data_1QNK
# 
_entry.id   1QNK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QNK         
PDBE  EBI-4297     
WWPDB D_1290004297 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QNK 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Qian, Y.Q.'   1 ? 
'Johanson, K.' 2 ? 
'McDevitt, P.' 3 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8.
;
'J. Mol. Biol.' 294 1065 1072 1999 JMOBAK UK 0022-2836 0070 ? 10600366 10.1006/jmbi.1999.3333 
1       
;Characterization and Purification of a Stromal Cell Derived Hematopoietic Synergistic Factor Induced by a Novel Hematoregulatory Compound, Sk&F 107647
;
Blood           86  310A ?    1995 ?      US 0006-4971 ?    ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Qian, Y.Q.'     1 
primary 'Johanson, K.O.' 2 
primary 'McDevitt, P.'   3 
1       'King, A.'       4 
1       'Scott, R.'      5 
1       'Wu, D.'         6 
1       'Strickler, J.'  7 
1       'Mcnulty, D.'    8 
1       'Scott, M.'      9 
# 
_cell.entry_id           1QNK 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QNK 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'C-X-C motif chemokine 2' 
_entity.formula_weight             7553.010 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Residues 5-73' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Growth-regulated protein beta,Gro-beta,Macrophage inflammatory protein 2-alpha,MIP2-alpha' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN 
_entity_poly.pdbx_seq_one_letter_code_can   TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  THR n 
1 2  GLU n 
1 3  LEU n 
1 4  ARG n 
1 5  CYS n 
1 6  GLN n 
1 7  CYS n 
1 8  LEU n 
1 9  GLN n 
1 10 THR n 
1 11 LEU n 
1 12 GLN n 
1 13 GLY n 
1 14 ILE n 
1 15 HIS n 
1 16 LEU n 
1 17 LYS n 
1 18 ASN n 
1 19 ILE n 
1 20 GLN n 
1 21 SER n 
1 22 VAL n 
1 23 LYS n 
1 24 VAL n 
1 25 LYS n 
1 26 SER n 
1 27 PRO n 
1 28 GLY n 
1 29 PRO n 
1 30 HIS n 
1 31 CYS n 
1 32 ALA n 
1 33 GLN n 
1 34 THR n 
1 35 GLU n 
1 36 VAL n 
1 37 ILE n 
1 38 ALA n 
1 39 THR n 
1 40 LEU n 
1 41 LYS n 
1 42 ASN n 
1 43 GLY n 
1 44 GLN n 
1 45 LYS n 
1 46 ALA n 
1 47 CYS n 
1 48 LEU n 
1 49 ASN n 
1 50 PRO n 
1 51 ALA n 
1 52 SER n 
1 53 PRO n 
1 54 MET n 
1 55 VAL n 
1 56 LYS n 
1 57 LYS n 
1 58 ILE n 
1 59 ILE n 
1 60 GLU n 
1 61 LYS n 
1 62 MET n 
1 63 LEU n 
1 64 LYS n 
1 65 ASN n 
1 66 GLY n 
1 67 LYS n 
1 68 SER n 
1 69 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   69 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CXCL2, GRO2, GROB, MIP2A, SCYB2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    BLOOD 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               '(LW 14)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CXCL2_HUMAN 
_struct_ref.pdbx_db_accession          P19875 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN 
_struct_ref.pdbx_align_begin           39 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QNK A 1 ? 69 ? P19875 39 ? 107 ? 5 73 
2 1 1QNK B 1 ? 69 ? P19875 39 ? 107 ? 5 73 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            2D 
_pdbx_nmr_exptl.solution_id     1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            303 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     5.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         90%H2O/10%D2O 
_pdbx_nmr_sample_details.solvent_system   ? 
_pdbx_nmr_sample_details.label            ? 
_pdbx_nmr_sample_details.type             ? 
_pdbx_nmr_sample_details.details          ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             UNITYPLUS 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1QNK 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1QNK 
_pdbx_nmr_details.text       
;SEE JRNL ARTICLE FOR DETAILS THREE-DIMENSIONAL STRUCTURE IN AQUEOUS SOLUTION REPRESENTED BY 20 CONFORMERS DETERMINED BY NUCLEAR MAGNETIC RESONANCE, TORSION ANGLE DYNAMICS AND RESTRAINED ENERGY REFINEMENT. DATA WERE COLLECTED AT 30 DEGREES CELSIUS AND AT PH 5.5. THEY CONSIST OF 1878 UPPER LIMITS ON DISTANCES OBTAINED FROM NOE MEASUREMENTS AND 314 ANGLE CONSTRAINTS OBTAINED FROM NOE MEASUREMENTS AND COUPLING CONSTANT MEASUREMENTS. THERE INPUT DATA ARE ALSO AVAILABLE FROM THE PROTEIN DATA BANK. TORSION ANGLE DYNAMICS CALCULATIONS WERE PERFORMED WITH THE PROGRAM DYANA (P.GUNTERT, C.MUMENTHALER, K.WUTHRICH, J.MOL.BIOL. (1997) VOL. 273, 283-298).
;
# 
_pdbx_nmr_ensemble.entry_id                             1QNK 
_pdbx_nmr_ensemble.conformers_calculated_total_number   80 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'target function' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           'PROGRAM FOR NMR OR THEORETICAL MODELING MODELING' MODELING JONES,ZOU,COWAN,KJELDGAARD 1 
'structure solution' DYANA                                              ?        ?                          2 
# 
_exptl.entry_id          1QNK 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1QNK 
_struct.title                     'TRUNCATED HUMAN GROB[5-73], NMR, 20 STRUCTURES' 
_struct.pdbx_descriptor           'GROB[5-73]' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QNK 
_struct_keywords.pdbx_keywords   CHEMOKINE 
_struct_keywords.text            'CHEMOKINE, CHEMOKINE 15-O, HUMAN CHEMOKINE GROB[5-73], CXC CHEMOKINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 54 ? LYS A 64 ? MET A 58 LYS A 68 1 ? 11 
HELX_P HELX_P2 2 MET B 54 ? LYS B 64 ? MET B 58 LYS B 68 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 9  A CYS 35 1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 11 A CYS 51 1_555 ? ? ? ? ? ? ? 1.912 ? 
disulf3 disulf ? ? B CYS 5 SG ? ? ? 1_555 B CYS 31 SG ? ? B CYS 9  B CYS 35 1_555 ? ? ? ? ? ? ? 1.935 ? 
disulf4 disulf ? ? B CYS 7 SG ? ? ? 1_555 B CYS 47 SG ? ? B CYS 11 B CYS 51 1_555 ? ? ? ? ? ? ? 1.956 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
1 1 2 ? anti-parallel 
1 2 3 ? anti-parallel 
1 3 4 ? anti-parallel 
1 4 5 ? anti-parallel 
1 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1 1 LYS A 45 ? LEU A 48 ? LYS A 49 LEU A 52 
1 2 GLU A 35 ? LEU A 40 ? GLU A 39 LEU A 44 
1 3 SER A 21 ? LYS A 25 ? SER A 25 LYS A 29 
1 4 SER B 21 ? LYS B 25 ? SER B 25 LYS B 29 
1 5 GLU B 35 ? LEU B 40 ? GLU B 39 LEU B 44 
1 6 LYS B 45 ? LEU B 48 ? LYS B 49 LEU B 52 
# 
_database_PDB_matrix.entry_id          1QNK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QNK 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . THR A 1 1  ? -9.039  -15.666 -16.224 1.00 0.00 ? 5  THR A N    1  
ATOM 2     C CA   . THR A 1 1  ? -9.790  -16.810 -15.737 1.00 0.00 ? 5  THR A CA   1  
ATOM 3     C C    . THR A 1 1  ? -9.000  -17.543 -14.651 1.00 0.00 ? 5  THR A C    1  
ATOM 4     O O    . THR A 1 1  ? -9.520  -17.802 -13.567 1.00 0.00 ? 5  THR A O    1  
ATOM 5     C CB   . THR A 1 1  ? -10.137 -17.693 -16.937 1.00 0.00 ? 5  THR A CB   1  
ATOM 6     O OG1  . THR A 1 1  ? -11.117 -16.943 -17.649 1.00 0.00 ? 5  THR A OG1  1  
ATOM 7     C CG2  . THR A 1 1  ? -10.870 -18.973 -16.530 1.00 0.00 ? 5  THR A CG2  1  
ATOM 8     H H    . THR A 1 1  ? -9.000  -14.888 -15.597 1.00 0.00 ? 5  THR A H    1  
ATOM 9     H HA   . THR A 1 1  ? -10.708 -16.447 -15.275 1.00 0.00 ? 5  THR A HA   1  
ATOM 10    H HB   . THR A 1 1  ? -9.246  -17.925 -17.521 1.00 0.00 ? 5  THR A HB   1  
ATOM 11    H HG1  . THR A 1 1  ? -11.240 -17.323 -18.565 1.00 0.00 ? 5  THR A HG1  1  
ATOM 12    H HG21 . THR A 1 1  ? -10.366 -19.425 -15.676 1.00 0.00 ? 5  THR A HG21 1  
ATOM 13    H HG22 . THR A 1 1  ? -11.898 -18.732 -16.259 1.00 0.00 ? 5  THR A HG22 1  
ATOM 14    H HG23 . THR A 1 1  ? -10.870 -19.674 -17.365 1.00 0.00 ? 5  THR A HG23 1  
ATOM 15    N N    . GLU A 1 2  ? -7.755  -17.858 -14.980 1.00 0.00 ? 6  GLU A N    1  
ATOM 16    C CA   . GLU A 1 2  ? -6.888  -18.556 -14.047 1.00 0.00 ? 6  GLU A CA   1  
ATOM 17    C C    . GLU A 1 2  ? -5.711  -17.665 -13.647 1.00 0.00 ? 6  GLU A C    1  
ATOM 18    O O    . GLU A 1 2  ? -4.636  -17.748 -14.238 1.00 0.00 ? 6  GLU A O    1  
ATOM 19    C CB   . GLU A 1 2  ? -6.398  -19.879 -14.638 1.00 0.00 ? 6  GLU A CB   1  
ATOM 20    C CG   . GLU A 1 2  ? -5.968  -20.848 -13.535 1.00 0.00 ? 6  GLU A CG   1  
ATOM 21    C CD   . GLU A 1 2  ? -5.175  -22.022 -14.113 1.00 0.00 ? 6  GLU A CD   1  
ATOM 22    O OE1  . GLU A 1 2  ? -5.618  -22.546 -15.158 1.00 0.00 ? 6  GLU A OE1  1  
ATOM 23    O OE2  . GLU A 1 2  ? -4.144  -22.368 -13.498 1.00 0.00 ? 6  GLU A OE2  1  
ATOM 24    H H    . GLU A 1 2  ? -7.340  -17.644 -15.864 1.00 0.00 ? 6  GLU A H    1  
ATOM 25    H HA   . GLU A 1 2  ? -7.509  -18.763 -13.174 1.00 0.00 ? 6  GLU A HA   1  
ATOM 26    H HB2  . GLU A 1 2  ? -7.190  -20.331 -15.235 1.00 0.00 ? 6  GLU A HB2  1  
ATOM 27    H HB3  . GLU A 1 2  ? -5.560  -19.693 -15.310 1.00 0.00 ? 6  GLU A HB3  1  
ATOM 28    H HG2  . GLU A 1 2  ? -5.359  -20.320 -12.800 1.00 0.00 ? 6  GLU A HG2  1  
ATOM 29    H HG3  . GLU A 1 2  ? -6.848  -21.221 -13.011 1.00 0.00 ? 6  GLU A HG3  1  
ATOM 30    N N    . LEU A 1 3  ? -5.955  -16.831 -12.646 1.00 0.00 ? 7  LEU A N    1  
ATOM 31    C CA   . LEU A 1 3  ? -4.928  -15.925 -12.160 1.00 0.00 ? 7  LEU A CA   1  
ATOM 32    C C    . LEU A 1 3  ? -4.381  -16.446 -10.829 1.00 0.00 ? 7  LEU A C    1  
ATOM 33    O O    . LEU A 1 3  ? -4.964  -17.345 -10.224 1.00 0.00 ? 7  LEU A O    1  
ATOM 34    C CB   . LEU A 1 3  ? -5.467  -14.495 -12.085 1.00 0.00 ? 7  LEU A CB   1  
ATOM 35    C CG   . LEU A 1 3  ? -5.853  -13.853 -13.419 1.00 0.00 ? 7  LEU A CG   1  
ATOM 36    C CD1  . LEU A 1 3  ? -7.298  -14.191 -13.793 1.00 0.00 ? 7  LEU A CD1  1  
ATOM 37    C CD2  . LEU A 1 3  ? -5.605  -12.344 -13.393 1.00 0.00 ? 7  LEU A CD2  1  
ATOM 38    H H    . LEU A 1 3  ? -6.832  -16.770 -12.170 1.00 0.00 ? 7  LEU A H    1  
ATOM 39    H HA   . LEU A 1 3  ? -4.119  -15.926 -12.890 1.00 0.00 ? 7  LEU A HA   1  
ATOM 40    H HB2  . LEU A 1 3  ? -6.343  -14.492 -11.436 1.00 0.00 ? 7  LEU A HB2  1  
ATOM 41    H HB3  . LEU A 1 3  ? -4.714  -13.869 -11.607 1.00 0.00 ? 7  LEU A HB3  1  
ATOM 42    H HG   . LEU A 1 3  ? -5.214  -14.271 -14.197 1.00 0.00 ? 7  LEU A HG   1  
ATOM 43    H HD11 . LEU A 1 3  ? -7.969  -13.826 -13.015 1.00 0.00 ? 7  LEU A HD11 1  
ATOM 44    H HD12 . LEU A 1 3  ? -7.548  -13.715 -14.741 1.00 0.00 ? 7  LEU A HD12 1  
ATOM 45    H HD13 . LEU A 1 3  ? -7.405  -15.271 -13.888 1.00 0.00 ? 7  LEU A HD13 1  
ATOM 46    H HD21 . LEU A 1 3  ? -5.705  -11.977 -12.371 1.00 0.00 ? 7  LEU A HD21 1  
ATOM 47    H HD22 . LEU A 1 3  ? -4.600  -12.134 -13.758 1.00 0.00 ? 7  LEU A HD22 1  
ATOM 48    H HD23 . LEU A 1 3  ? -6.335  -11.845 -14.031 1.00 0.00 ? 7  LEU A HD23 1  
ATOM 49    N N    . ARG A 1 4  ? -3.268  -15.861 -10.413 1.00 0.00 ? 8  ARG A N    1  
ATOM 50    C CA   . ARG A 1 4  ? -2.637  -16.255 -9.165  1.00 0.00 ? 8  ARG A CA   1  
ATOM 51    C C    . ARG A 1 4  ? -2.217  -15.018 -8.369  1.00 0.00 ? 8  ARG A C    1  
ATOM 52    O O    . ARG A 1 4  ? -2.908  -14.001 -8.385  1.00 0.00 ? 8  ARG A O    1  
ATOM 53    C CB   . ARG A 1 4  ? -1.407  -17.129 -9.423  1.00 0.00 ? 8  ARG A CB   1  
ATOM 54    C CG   . ARG A 1 4  ? -1.657  -18.099 -10.579 1.00 0.00 ? 8  ARG A CG   1  
ATOM 55    C CD   . ARG A 1 4  ? -0.598  -19.203 -10.606 1.00 0.00 ? 8  ARG A CD   1  
ATOM 56    N NE   . ARG A 1 4  ? -1.103  -20.371 -11.363 1.00 0.00 ? 8  ARG A NE   1  
ATOM 57    C CZ   . ARG A 1 4  ? -0.401  -21.494 -11.568 1.00 0.00 ? 8  ARG A CZ   1  
ATOM 58    N NH1  . ARG A 1 4  ? 0.839   -21.608 -11.075 1.00 0.00 ? 8  ARG A NH1  1  
ATOM 59    N NH2  . ARG A 1 4  ? -0.940  -22.502 -12.267 1.00 0.00 ? 8  ARG A NH2  1  
ATOM 60    H H    . ARG A 1 4  ? -2.800  -15.131 -10.911 1.00 0.00 ? 8  ARG A H    1  
ATOM 61    H HA   . ARG A 1 4  ? -3.400  -16.823 -8.634  1.00 0.00 ? 8  ARG A HA   1  
ATOM 62    H HB2  . ARG A 1 4  ? -0.549  -16.498 -9.652  1.00 0.00 ? 8  ARG A HB2  1  
ATOM 63    H HB3  . ARG A 1 4  ? -1.160  -17.689 -8.521  1.00 0.00 ? 8  ARG A HB3  1  
ATOM 64    H HG2  . ARG A 1 4  ? -2.647  -18.543 -10.479 1.00 0.00 ? 8  ARG A HG2  1  
ATOM 65    H HG3  . ARG A 1 4  ? -1.645  -17.556 -11.524 1.00 0.00 ? 8  ARG A HG3  1  
ATOM 66    H HD2  . ARG A 1 4  ? 0.317   -18.830 -11.066 1.00 0.00 ? 8  ARG A HD2  1  
ATOM 67    H HD3  . ARG A 1 4  ? -0.344  -19.501 -9.589  1.00 0.00 ? 8  ARG A HD3  1  
ATOM 68    H HE   . ARG A 1 4  ? -2.026  -20.318 -11.745 1.00 0.00 ? 8  ARG A HE   1  
ATOM 69    H HH11 . ARG A 1 4  ? 1.241   -20.856 -10.554 1.00 0.00 ? 8  ARG A HH11 1  
ATOM 70    H HH12 . ARG A 1 4  ? 1.363   -22.446 -11.228 1.00 0.00 ? 8  ARG A HH12 1  
ATOM 71    H HH21 . ARG A 1 4  ? -1.866  -22.416 -12.636 1.00 0.00 ? 8  ARG A HH21 1  
ATOM 72    H HH22 . ARG A 1 4  ? -0.417  -23.340 -12.421 1.00 0.00 ? 8  ARG A HH22 1  
ATOM 73    N N    . CYS A 1 5  ? -1.085  -15.146 -7.691  1.00 0.00 ? 9  CYS A N    1  
ATOM 74    C CA   . CYS A 1 5  ? -0.565  -14.051 -6.890  1.00 0.00 ? 9  CYS A CA   1  
ATOM 75    C C    . CYS A 1 5  ? 0.425   -13.258 -7.746  1.00 0.00 ? 9  CYS A C    1  
ATOM 76    O O    . CYS A 1 5  ? 1.044   -13.807 -8.655  1.00 0.00 ? 9  CYS A O    1  
ATOM 77    C CB   . CYS A 1 5  ? 0.075   -14.552 -5.594  1.00 0.00 ? 9  CYS A CB   1  
ATOM 78    S SG   . CYS A 1 5  ? -1.112  -15.044 -4.292  1.00 0.00 ? 9  CYS A SG   1  
ATOM 79    H H    . CYS A 1 5  ? -0.529  -15.977 -7.684  1.00 0.00 ? 9  CYS A H    1  
ATOM 80    H HA   . CYS A 1 5  ? -1.419  -13.433 -6.613  1.00 0.00 ? 9  CYS A HA   1  
ATOM 81    H HB2  . CYS A 1 5  ? 0.712   -15.406 -5.827  1.00 0.00 ? 9  CYS A HB2  1  
ATOM 82    H HB3  . CYS A 1 5  ? 0.723   -13.770 -5.199  1.00 0.00 ? 9  CYS A HB3  1  
ATOM 83    N N    . GLN A 1 6  ? 0.543   -11.978 -7.424  1.00 0.00 ? 10 GLN A N    1  
ATOM 84    C CA   . GLN A 1 6  ? 1.447   -11.104 -8.152  1.00 0.00 ? 10 GLN A CA   1  
ATOM 85    C C    . GLN A 1 6  ? 2.822   -11.085 -7.481  1.00 0.00 ? 10 GLN A C    1  
ATOM 86    O O    . GLN A 1 6  ? 3.692   -10.304 -7.863  1.00 0.00 ? 10 GLN A O    1  
ATOM 87    C CB   . GLN A 1 6  ? 0.872   -9.690  -8.263  1.00 0.00 ? 10 GLN A CB   1  
ATOM 88    C CG   . GLN A 1 6  ? 1.405   -8.977  -9.508  1.00 0.00 ? 10 GLN A CG   1  
ATOM 89    C CD   . GLN A 1 6  ? 0.744   -7.609  -9.681  1.00 0.00 ? 10 GLN A CD   1  
ATOM 90    O OE1  . GLN A 1 6  ? 0.179   -7.290  -10.715 1.00 0.00 ? 10 GLN A OE1  1  
ATOM 91    N NE2  . GLN A 1 6  ? 0.845   -6.820  -8.615  1.00 0.00 ? 10 GLN A NE2  1  
ATOM 92    H H    . GLN A 1 6  ? 0.035   -11.538 -6.683  1.00 0.00 ? 10 GLN A H    1  
ATOM 93    H HA   . GLN A 1 6  ? 1.527   -11.536 -9.150  1.00 0.00 ? 10 GLN A HA   1  
ATOM 94    H HB2  . GLN A 1 6  ? -0.216  -9.739  -8.306  1.00 0.00 ? 10 GLN A HB2  1  
ATOM 95    H HB3  . GLN A 1 6  ? 1.130   -9.117  -7.373  1.00 0.00 ? 10 GLN A HB3  1  
ATOM 96    H HG2  . GLN A 1 6  ? 2.485   -8.856  -9.426  1.00 0.00 ? 10 GLN A HG2  1  
ATOM 97    H HG3  . GLN A 1 6  ? 1.219   -9.590  -10.390 1.00 0.00 ? 10 GLN A HG3  1  
ATOM 98    H HE21 . GLN A 1 6  ? 1.322   -7.143  -7.798  1.00 0.00 ? 10 GLN A HE21 1  
ATOM 99    H HE22 . GLN A 1 6  ? 0.444   -5.904  -8.631  1.00 0.00 ? 10 GLN A HE22 1  
ATOM 100   N N    . CYS A 1 7  ? 2.975   -11.954 -6.493  1.00 0.00 ? 11 CYS A N    1  
ATOM 101   C CA   . CYS A 1 7  ? 4.229   -12.047 -5.766  1.00 0.00 ? 11 CYS A CA   1  
ATOM 102   C C    . CYS A 1 7  ? 4.700   -13.502 -5.803  1.00 0.00 ? 11 CYS A C    1  
ATOM 103   O O    . CYS A 1 7  ? 4.046   -14.384 -5.248  1.00 0.00 ? 11 CYS A O    1  
ATOM 104   C CB   . CYS A 1 7  ? 4.092   -11.528 -4.333  1.00 0.00 ? 11 CYS A CB   1  
ATOM 105   S SG   . CYS A 1 7  ? 4.794   -9.862  -4.049  1.00 0.00 ? 11 CYS A SG   1  
ATOM 106   H H    . CYS A 1 7  ? 2.262   -12.586 -6.189  1.00 0.00 ? 11 CYS A H    1  
ATOM 107   H HA   . CYS A 1 7  ? 4.938   -11.398 -6.280  1.00 0.00 ? 11 CYS A HA   1  
ATOM 108   H HB2  . CYS A 1 7  ? 3.035   -11.512 -4.067  1.00 0.00 ? 11 CYS A HB2  1  
ATOM 109   H HB3  . CYS A 1 7  ? 4.579   -12.232 -3.658  1.00 0.00 ? 11 CYS A HB3  1  
ATOM 110   N N    . LEU A 1 8  ? 5.830   -13.709 -6.463  1.00 0.00 ? 12 LEU A N    1  
ATOM 111   C CA   . LEU A 1 8  ? 6.395   -15.042 -6.581  1.00 0.00 ? 12 LEU A CA   1  
ATOM 112   C C    . LEU A 1 8  ? 7.289   -15.320 -5.371  1.00 0.00 ? 12 LEU A C    1  
ATOM 113   O O    . LEU A 1 8  ? 7.490   -16.474 -4.995  1.00 0.00 ? 12 LEU A O    1  
ATOM 114   C CB   . LEU A 1 8  ? 7.110   -15.205 -7.924  1.00 0.00 ? 12 LEU A CB   1  
ATOM 115   C CG   . LEU A 1 8  ? 6.348   -14.707 -9.154  1.00 0.00 ? 12 LEU A CG   1  
ATOM 116   C CD1  . LEU A 1 8  ? 7.313   -14.239 -10.244 1.00 0.00 ? 12 LEU A CD1  1  
ATOM 117   C CD2  . LEU A 1 8  ? 5.377   -15.774 -9.666  1.00 0.00 ? 12 LEU A CD2  1  
ATOM 118   H H    . LEU A 1 8  ? 6.355   -12.986 -6.912  1.00 0.00 ? 12 LEU A H    1  
ATOM 119   H HA   . LEU A 1 8  ? 5.567   -15.750 -6.568  1.00 0.00 ? 12 LEU A HA   1  
ATOM 120   H HB2  . LEU A 1 8  ? 8.062   -14.676 -7.873  1.00 0.00 ? 12 LEU A HB2  1  
ATOM 121   H HB3  . LEU A 1 8  ? 7.339   -16.261 -8.065  1.00 0.00 ? 12 LEU A HB3  1  
ATOM 122   H HG   . LEU A 1 8  ? 5.751   -13.844 -8.860  1.00 0.00 ? 12 LEU A HG   1  
ATOM 123   H HD11 . LEU A 1 8  ? 8.117   -13.658 -9.793  1.00 0.00 ? 12 LEU A HD11 1  
ATOM 124   H HD12 . LEU A 1 8  ? 7.733   -15.106 -10.754 1.00 0.00 ? 12 LEU A HD12 1  
ATOM 125   H HD13 . LEU A 1 8  ? 6.776   -13.620 -10.963 1.00 0.00 ? 12 LEU A HD13 1  
ATOM 126   H HD21 . LEU A 1 8  ? 4.884   -16.252 -8.820  1.00 0.00 ? 12 LEU A HD21 1  
ATOM 127   H HD22 . LEU A 1 8  ? 4.629   -15.307 -10.306 1.00 0.00 ? 12 LEU A HD22 1  
ATOM 128   H HD23 . LEU A 1 8  ? 5.928   -16.522 -10.236 1.00 0.00 ? 12 LEU A HD23 1  
ATOM 129   N N    . GLN A 1 9  ? 7.803   -14.243 -4.794  1.00 0.00 ? 13 GLN A N    1  
ATOM 130   C CA   . GLN A 1 9  ? 8.671   -14.357 -3.635  1.00 0.00 ? 13 GLN A CA   1  
ATOM 131   C C    . GLN A 1 9  ? 8.272   -13.333 -2.570  1.00 0.00 ? 13 GLN A C    1  
ATOM 132   O O    . GLN A 1 9  ? 7.351   -12.544 -2.777  1.00 0.00 ? 13 GLN A O    1  
ATOM 133   C CB   . GLN A 1 9  ? 10.139  -14.192 -4.031  1.00 0.00 ? 13 GLN A CB   1  
ATOM 134   C CG   . GLN A 1 9  ? 11.048  -15.025 -3.125  1.00 0.00 ? 13 GLN A CG   1  
ATOM 135   C CD   . GLN A 1 9  ? 12.279  -15.519 -3.888  1.00 0.00 ? 13 GLN A CD   1  
ATOM 136   O OE1  . GLN A 1 9  ? 12.516  -15.166 -5.031  1.00 0.00 ? 13 GLN A OE1  1  
ATOM 137   N NE2  . GLN A 1 9  ? 13.046  -16.355 -3.194  1.00 0.00 ? 13 GLN A NE2  1  
ATOM 138   H H    . GLN A 1 9  ? 7.635   -13.308 -5.106  1.00 0.00 ? 13 GLN A H    1  
ATOM 139   H HA   . GLN A 1 9  ? 8.515   -15.366 -3.254  1.00 0.00 ? 13 GLN A HA   1  
ATOM 140   H HB2  . GLN A 1 9  ? 10.276  -14.497 -5.068  1.00 0.00 ? 13 GLN A HB2  1  
ATOM 141   H HB3  . GLN A 1 9  ? 10.421  -13.141 -3.967  1.00 0.00 ? 13 GLN A HB3  1  
ATOM 142   H HG2  . GLN A 1 9  ? 11.363  -14.426 -2.270  1.00 0.00 ? 13 GLN A HG2  1  
ATOM 143   H HG3  . GLN A 1 9  ? 10.494  -15.877 -2.731  1.00 0.00 ? 13 GLN A HG3  1  
ATOM 144   H HE21 . GLN A 1 9  ? 12.795  -16.605 -2.259  1.00 0.00 ? 13 GLN A HE21 1  
ATOM 145   H HE22 . GLN A 1 9  ? 13.874  -16.734 -3.607  1.00 0.00 ? 13 GLN A HE22 1  
ATOM 146   N N    . THR A 1 10 ? 8.984   -13.378 -1.454  1.00 0.00 ? 14 THR A N    1  
ATOM 147   C CA   . THR A 1 10 ? 8.716   -12.464 -0.357  1.00 0.00 ? 14 THR A CA   1  
ATOM 148   C C    . THR A 1 10 ? 9.943   -12.343 0.549   1.00 0.00 ? 14 THR A C    1  
ATOM 149   O O    . THR A 1 10 ? 10.813  -13.213 0.540   1.00 0.00 ? 14 THR A O    1  
ATOM 150   C CB   . THR A 1 10 ? 7.466   -12.958 0.375   1.00 0.00 ? 14 THR A CB   1  
ATOM 151   O OG1  . THR A 1 10 ? 7.664   -14.365 0.489   1.00 0.00 ? 14 THR A OG1  1  
ATOM 152   C CG2  . THR A 1 10 ? 6.200   -12.828 -0.474  1.00 0.00 ? 14 THR A CG2  1  
ATOM 153   H H    . THR A 1 10 ? 9.731   -14.023 -1.294  1.00 0.00 ? 14 THR A H    1  
ATOM 154   H HA   . THR A 1 10 ? 8.527   -11.475 -0.773  1.00 0.00 ? 14 THR A HA   1  
ATOM 155   H HB   . THR A 1 10 ? 7.348   -12.448 1.331   1.00 0.00 ? 14 THR A HB   1  
ATOM 156   H HG1  . THR A 1 10 ? 8.399   -14.555 1.140   1.00 0.00 ? 14 THR A HG1  1  
ATOM 157   H HG21 . THR A 1 10 ? 6.199   -11.861 -0.978  1.00 0.00 ? 14 THR A HG21 1  
ATOM 158   H HG22 . THR A 1 10 ? 6.177   -13.624 -1.218  1.00 0.00 ? 14 THR A HG22 1  
ATOM 159   H HG23 . THR A 1 10 ? 5.323   -12.904 0.168   1.00 0.00 ? 14 THR A HG23 1  
ATOM 160   N N    . LEU A 1 11 ? 9.973   -11.259 1.309   1.00 0.00 ? 15 LEU A N    1  
ATOM 161   C CA   . LEU A 1 11 ? 11.079  -11.013 2.219   1.00 0.00 ? 15 LEU A CA   1  
ATOM 162   C C    . LEU A 1 11 ? 10.540  -10.877 3.644   1.00 0.00 ? 15 LEU A C    1  
ATOM 163   O O    . LEU A 1 11 ? 9.546   -10.191 3.873   1.00 0.00 ? 15 LEU A O    1  
ATOM 164   C CB   . LEU A 1 11 ? 11.897  -9.807  1.753   1.00 0.00 ? 15 LEU A CB   1  
ATOM 165   C CG   . LEU A 1 11 ? 12.376  -9.841  0.301   1.00 0.00 ? 15 LEU A CG   1  
ATOM 166   C CD1  . LEU A 1 11 ? 12.242  -8.465  -0.354  1.00 0.00 ? 15 LEU A CD1  1  
ATOM 167   C CD2  . LEU A 1 11 ? 13.804  -10.383 0.207   1.00 0.00 ? 15 LEU A CD2  1  
ATOM 168   H H    . LEU A 1 11 ? 9.261   -10.556 1.310   1.00 0.00 ? 15 LEU A H    1  
ATOM 169   H HA   . LEU A 1 11 ? 11.735  -11.882 2.178   1.00 0.00 ? 15 LEU A HA   1  
ATOM 170   H HB2  . LEU A 1 11 ? 11.297  -8.908  1.896   1.00 0.00 ? 15 LEU A HB2  1  
ATOM 171   H HB3  . LEU A 1 11 ? 12.769  -9.713  2.401   1.00 0.00 ? 15 LEU A HB3  1  
ATOM 172   H HG   . LEU A 1 11 ? 11.735  -10.526 -0.254  1.00 0.00 ? 15 LEU A HG   1  
ATOM 173   H HD11 . LEU A 1 11 ? 11.772  -7.774  0.346   1.00 0.00 ? 15 LEU A HD11 1  
ATOM 174   H HD12 . LEU A 1 11 ? 13.230  -8.093  -0.624  1.00 0.00 ? 15 LEU A HD12 1  
ATOM 175   H HD13 . LEU A 1 11 ? 11.627  -8.548  -1.250  1.00 0.00 ? 15 LEU A HD13 1  
ATOM 176   H HD21 . LEU A 1 11 ? 13.959  -11.135 0.981   1.00 0.00 ? 15 LEU A HD21 1  
ATOM 177   H HD22 . LEU A 1 11 ? 13.958  -10.834 -0.774  1.00 0.00 ? 15 LEU A HD22 1  
ATOM 178   H HD23 . LEU A 1 11 ? 14.513  -9.567  0.347   1.00 0.00 ? 15 LEU A HD23 1  
ATOM 179   N N    . GLN A 1 12 ? 11.221  -11.543 4.566   1.00 0.00 ? 16 GLN A N    1  
ATOM 180   C CA   . GLN A 1 12 ? 10.823  -11.506 5.963   1.00 0.00 ? 16 GLN A CA   1  
ATOM 181   C C    . GLN A 1 12 ? 11.735  -10.561 6.749   1.00 0.00 ? 16 GLN A C    1  
ATOM 182   O O    . GLN A 1 12 ? 12.516  -11.004 7.590   1.00 0.00 ? 16 GLN A O    1  
ATOM 183   C CB   . GLN A 1 12 ? 10.831  -12.909 6.573   1.00 0.00 ? 16 GLN A CB   1  
ATOM 184   C CG   . GLN A 1 12 ? 10.761  -12.844 8.099   1.00 0.00 ? 16 GLN A CG   1  
ATOM 185   C CD   . GLN A 1 12 ? 9.663   -13.763 8.638   1.00 0.00 ? 16 GLN A CD   1  
ATOM 186   O OE1  . GLN A 1 12 ? 9.053   -14.533 7.915   1.00 0.00 ? 16 GLN A OE1  1  
ATOM 187   N NE2  . GLN A 1 12 ? 9.447   -13.640 9.945   1.00 0.00 ? 16 GLN A NE2  1  
ATOM 188   H H    . GLN A 1 12 ? 12.029  -12.100 4.371   1.00 0.00 ? 16 GLN A H    1  
ATOM 189   H HA   . GLN A 1 12 ? 9.803   -11.122 5.963   1.00 0.00 ? 16 GLN A HA   1  
ATOM 190   H HB2  . GLN A 1 12 ? 9.985   -13.480 6.190   1.00 0.00 ? 16 GLN A HB2  1  
ATOM 191   H HB3  . GLN A 1 12 ? 11.735  -13.437 6.269   1.00 0.00 ? 16 GLN A HB3  1  
ATOM 192   H HG2  . GLN A 1 12 ? 11.723  -13.132 8.524   1.00 0.00 ? 16 GLN A HG2  1  
ATOM 193   H HG3  . GLN A 1 12 ? 10.568  -11.818 8.415   1.00 0.00 ? 16 GLN A HG3  1  
ATOM 194   H HE21 . GLN A 1 12 ? 9.984   -12.989 10.481  1.00 0.00 ? 16 GLN A HE21 1  
ATOM 195   H HE22 . GLN A 1 12 ? 8.748   -14.200 10.390  1.00 0.00 ? 16 GLN A HE22 1  
ATOM 196   N N    . GLY A 1 13 ? 11.605  -9.278  6.447   1.00 0.00 ? 17 GLY A N    1  
ATOM 197   C CA   . GLY A 1 13 ? 12.407  -8.267  7.115   1.00 0.00 ? 17 GLY A CA   1  
ATOM 198   C C    . GLY A 1 13 ? 13.446  -7.673  6.161   1.00 0.00 ? 17 GLY A C    1  
ATOM 199   O O    . GLY A 1 13 ? 14.453  -8.311  5.859   1.00 0.00 ? 17 GLY A O    1  
ATOM 200   H H    . GLY A 1 13 ? 10.967  -8.926  5.761   1.00 0.00 ? 17 GLY A H    1  
ATOM 201   H HA2  . GLY A 1 13 ? 11.760  -7.475  7.493   1.00 0.00 ? 17 GLY A HA2  1  
ATOM 202   H HA3  . GLY A 1 13 ? 12.909  -8.707  7.977   1.00 0.00 ? 17 GLY A HA3  1  
ATOM 203   N N    . ILE A 1 14 ? 13.165  -6.458  5.714   1.00 0.00 ? 18 ILE A N    1  
ATOM 204   C CA   . ILE A 1 14 ? 14.062  -5.771  4.801   1.00 0.00 ? 18 ILE A CA   1  
ATOM 205   C C    . ILE A 1 14 ? 14.308  -4.348  5.309   1.00 0.00 ? 18 ILE A C    1  
ATOM 206   O O    . ILE A 1 14 ? 13.527  -3.824  6.101   1.00 0.00 ? 18 ILE A O    1  
ATOM 207   C CB   . ILE A 1 14 ? 13.519  -5.828  3.372   1.00 0.00 ? 18 ILE A CB   1  
ATOM 208   C CG1  . ILE A 1 14 ? 13.790  -7.193  2.737   1.00 0.00 ? 18 ILE A CG1  1  
ATOM 209   C CG2  . ILE A 1 14 ? 14.078  -4.682  2.526   1.00 0.00 ? 18 ILE A CG2  1  
ATOM 210   C CD1  . ILE A 1 14 ? 15.241  -7.299  2.262   1.00 0.00 ? 18 ILE A CD1  1  
ATOM 211   H H    . ILE A 1 14 ? 12.343  -5.946  5.965   1.00 0.00 ? 18 ILE A H    1  
ATOM 212   H HA   . ILE A 1 14 ? 15.010  -6.309  4.808   1.00 0.00 ? 18 ILE A HA   1  
ATOM 213   H HB   . ILE A 1 14 ? 12.438  -5.701  3.412   1.00 0.00 ? 18 ILE A HB   1  
ATOM 214   H HG12 . ILE A 1 14 ? 13.582  -7.982  3.459   1.00 0.00 ? 18 ILE A HG12 1  
ATOM 215   H HG13 . ILE A 1 14 ? 13.116  -7.347  1.894   1.00 0.00 ? 18 ILE A HG13 1  
ATOM 216   H HG21 . ILE A 1 14 ? 13.885  -3.733  3.028   1.00 0.00 ? 18 ILE A HG21 1  
ATOM 217   H HG22 . ILE A 1 14 ? 15.153  -4.814  2.400   1.00 0.00 ? 18 ILE A HG22 1  
ATOM 218   H HG23 . ILE A 1 14 ? 13.595  -4.681  1.549   1.00 0.00 ? 18 ILE A HG23 1  
ATOM 219   H HD11 . ILE A 1 14 ? 15.901  -6.859  3.009   1.00 0.00 ? 18 ILE A HD11 1  
ATOM 220   H HD12 . ILE A 1 14 ? 15.501  -8.348  2.119   1.00 0.00 ? 18 ILE A HD12 1  
ATOM 221   H HD13 . ILE A 1 14 ? 15.354  -6.765  1.318   1.00 0.00 ? 18 ILE A HD13 1  
ATOM 222   N N    . HIS A 1 15 ? 15.398  -3.764  4.832   1.00 0.00 ? 19 HIS A N    1  
ATOM 223   C CA   . HIS A 1 15 ? 15.756  -2.413  5.227   1.00 0.00 ? 19 HIS A CA   1  
ATOM 224   C C    . HIS A 1 15 ? 14.764  -1.420  4.620   1.00 0.00 ? 19 HIS A C    1  
ATOM 225   O O    . HIS A 1 15 ? 14.420  -1.521  3.443   1.00 0.00 ? 19 HIS A O    1  
ATOM 226   C CB   . HIS A 1 15 ? 17.207  -2.105  4.853   1.00 0.00 ? 19 HIS A CB   1  
ATOM 227   C CG   . HIS A 1 15 ? 17.992  -1.422  5.948   1.00 0.00 ? 19 HIS A CG   1  
ATOM 228   N ND1  . HIS A 1 15 ? 19.375  -1.442  6.004   1.00 0.00 ? 19 HIS A ND1  1  
ATOM 229   C CD2  . HIS A 1 15 ? 17.574  -0.698  7.026   1.00 0.00 ? 19 HIS A CD2  1  
ATOM 230   C CE1  . HIS A 1 15 ? 19.761  -0.760  7.072   1.00 0.00 ? 19 HIS A CE1  1  
ATOM 231   N NE2  . HIS A 1 15 ? 18.643  -0.300  7.704   1.00 0.00 ? 19 HIS A NE2  1  
ATOM 232   H H    . HIS A 1 15 ? 16.028  -4.198  4.188   1.00 0.00 ? 19 HIS A H    1  
ATOM 233   H HA   . HIS A 1 15 ? 15.678  -2.374  6.314   1.00 0.00 ? 19 HIS A HA   1  
ATOM 234   H HB2  . HIS A 1 15 ? 17.709  -3.035  4.587   1.00 0.00 ? 19 HIS A HB2  1  
ATOM 235   H HB3  . HIS A 1 15 ? 17.216  -1.472  3.965   1.00 0.00 ? 19 HIS A HB3  1  
ATOM 236   H HD1  . HIS A 1 15 ? 19.980  -1.895  5.349   1.00 0.00 ? 19 HIS A HD1  1  
ATOM 237   H HD2  . HIS A 1 15 ? 16.537  -0.484  7.286   1.00 0.00 ? 19 HIS A HD2  1  
ATOM 238   H HE1  . HIS A 1 15 ? 20.790  -0.595  7.390   1.00 0.00 ? 19 HIS A HE1  1  
ATOM 239   N N    . LEU A 1 16 ? 14.330  -0.483  5.451   1.00 0.00 ? 20 LEU A N    1  
ATOM 240   C CA   . LEU A 1 16 ? 13.384  0.528   5.011   1.00 0.00 ? 20 LEU A CA   1  
ATOM 241   C C    . LEU A 1 16 ? 14.145  1.682   4.355   1.00 0.00 ? 20 LEU A C    1  
ATOM 242   O O    . LEU A 1 16 ? 13.562  2.722   4.053   1.00 0.00 ? 20 LEU A O    1  
ATOM 243   C CB   . LEU A 1 16 ? 12.487  0.963   6.171   1.00 0.00 ? 20 LEU A CB   1  
ATOM 244   C CG   . LEU A 1 16 ? 11.844  2.345   6.040   1.00 0.00 ? 20 LEU A CG   1  
ATOM 245   C CD1  . LEU A 1 16 ? 11.068  2.467   4.727   1.00 0.00 ? 20 LEU A CD1  1  
ATOM 246   C CD2  . LEU A 1 16 ? 10.967  2.660   7.254   1.00 0.00 ? 20 LEU A CD2  1  
ATOM 247   H H    . LEU A 1 16 ? 14.615  -0.408  6.407   1.00 0.00 ? 20 LEU A H    1  
ATOM 248   H HA   . LEU A 1 16 ? 12.740  0.068   4.261   1.00 0.00 ? 20 LEU A HA   1  
ATOM 249   H HB2  . LEU A 1 16 ? 11.693  0.225   6.288   1.00 0.00 ? 20 LEU A HB2  1  
ATOM 250   H HB3  . LEU A 1 16 ? 13.077  0.945   7.087   1.00 0.00 ? 20 LEU A HB3  1  
ATOM 251   H HG   . LEU A 1 16 ? 12.638  3.091   6.014   1.00 0.00 ? 20 LEU A HG   1  
ATOM 252   H HD11 . LEU A 1 16 ? 11.193  1.553   4.145   1.00 0.00 ? 20 LEU A HD11 1  
ATOM 253   H HD12 . LEU A 1 16 ? 10.010  2.618   4.942   1.00 0.00 ? 20 LEU A HD12 1  
ATOM 254   H HD13 . LEU A 1 16 ? 11.448  3.315   4.157   1.00 0.00 ? 20 LEU A HD13 1  
ATOM 255   H HD21 . LEU A 1 16 ? 10.612  1.730   7.697   1.00 0.00 ? 20 LEU A HD21 1  
ATOM 256   H HD22 . LEU A 1 16 ? 11.552  3.213   7.990   1.00 0.00 ? 20 LEU A HD22 1  
ATOM 257   H HD23 . LEU A 1 16 ? 10.115  3.262   6.941   1.00 0.00 ? 20 LEU A HD23 1  
ATOM 258   N N    . LYS A 1 17 ? 15.435  1.460   4.155   1.00 0.00 ? 21 LYS A N    1  
ATOM 259   C CA   . LYS A 1 17 ? 16.282  2.468   3.540   1.00 0.00 ? 21 LYS A CA   1  
ATOM 260   C C    . LYS A 1 17 ? 16.296  2.262   2.024   1.00 0.00 ? 21 LYS A C    1  
ATOM 261   O O    . LYS A 1 17 ? 16.556  3.197   1.269   1.00 0.00 ? 21 LYS A O    1  
ATOM 262   C CB   . LYS A 1 17 ? 17.674  2.458   4.175   1.00 0.00 ? 21 LYS A CB   1  
ATOM 263   C CG   . LYS A 1 17 ? 18.734  2.937   3.181   1.00 0.00 ? 21 LYS A CG   1  
ATOM 264   C CD   . LYS A 1 17 ? 18.479  4.386   2.763   1.00 0.00 ? 21 LYS A CD   1  
ATOM 265   C CE   . LYS A 1 17 ? 18.798  4.595   1.281   1.00 0.00 ? 21 LYS A CE   1  
ATOM 266   N NZ   . LYS A 1 17 ? 17.778  5.459   0.648   1.00 0.00 ? 21 LYS A NZ   1  
ATOM 267   H H    . LYS A 1 17 ? 15.902  0.611   4.403   1.00 0.00 ? 21 LYS A H    1  
ATOM 268   H HA   . LYS A 1 17 ? 15.838  3.441   3.753   1.00 0.00 ? 21 LYS A HA   1  
ATOM 269   H HB2  . LYS A 1 17 ? 17.681  3.099   5.056   1.00 0.00 ? 21 LYS A HB2  1  
ATOM 270   H HB3  . LYS A 1 17 ? 17.916  1.450   4.513   1.00 0.00 ? 21 LYS A HB3  1  
ATOM 271   H HG2  . LYS A 1 17 ? 19.723  2.852   3.630   1.00 0.00 ? 21 LYS A HG2  1  
ATOM 272   H HG3  . LYS A 1 17 ? 18.727  2.294   2.300   1.00 0.00 ? 21 LYS A HG3  1  
ATOM 273   H HD2  . LYS A 1 17 ? 17.437  4.646   2.954   1.00 0.00 ? 21 LYS A HD2  1  
ATOM 274   H HD3  . LYS A 1 17 ? 19.090  5.056   3.368   1.00 0.00 ? 21 LYS A HD3  1  
ATOM 275   H HE2  . LYS A 1 17 ? 19.784  5.048   1.176   1.00 0.00 ? 21 LYS A HE2  1  
ATOM 276   H HE3  . LYS A 1 17 ? 18.834  3.631   0.772   1.00 0.00 ? 21 LYS A HE3  1  
ATOM 277   H HZ1  . LYS A 1 17 ? 16.925  5.404   1.168   1.00 0.00 ? 21 LYS A HZ1  1  
ATOM 278   H HZ2  . LYS A 1 17 ? 18.102  6.405   0.638   1.00 0.00 ? 21 LYS A HZ2  1  
ATOM 279   H HZ3  . LYS A 1 17 ? 17.617  5.152   -0.290  1.00 0.00 ? 21 LYS A HZ3  1  
ATOM 280   N N    . ASN A 1 18 ? 16.013  1.031   1.624   1.00 0.00 ? 22 ASN A N    1  
ATOM 281   C CA   . ASN A 1 18 ? 15.989  0.690   0.212   1.00 0.00 ? 22 ASN A CA   1  
ATOM 282   C C    . ASN A 1 18 ? 14.572  0.881   -0.331  1.00 0.00 ? 22 ASN A C    1  
ATOM 283   O O    . ASN A 1 18 ? 14.390  1.380   -1.441  1.00 0.00 ? 22 ASN A O    1  
ATOM 284   C CB   . ASN A 1 18 ? 16.387  -0.771  -0.008  1.00 0.00 ? 22 ASN A CB   1  
ATOM 285   C CG   . ASN A 1 18 ? 17.778  -0.872  -0.636  1.00 0.00 ? 22 ASN A CG   1  
ATOM 286   O OD1  . ASN A 1 18 ? 18.167  -0.079  -1.477  1.00 0.00 ? 22 ASN A OD1  1  
ATOM 287   N ND2  . ASN A 1 18 ? 18.504  -1.890  -0.182  1.00 0.00 ? 22 ASN A ND2  1  
ATOM 288   H H    . ASN A 1 18 ? 15.802  0.275   2.245   1.00 0.00 ? 22 ASN A H    1  
ATOM 289   H HA   . ASN A 1 18 ? 16.710  1.360   -0.257  1.00 0.00 ? 22 ASN A HA   1  
ATOM 290   H HB2  . ASN A 1 18 ? 16.374  -1.303  0.943   1.00 0.00 ? 22 ASN A HB2  1  
ATOM 291   H HB3  . ASN A 1 18 ? 15.656  -1.257  -0.655  1.00 0.00 ? 22 ASN A HB3  1  
ATOM 292   H HD21 . ASN A 1 18 ? 18.125  -2.505  0.509   1.00 0.00 ? 22 ASN A HD21 1  
ATOM 293   H HD22 . ASN A 1 18 ? 19.429  -2.040  -0.532  1.00 0.00 ? 22 ASN A HD22 1  
ATOM 294   N N    . ILE A 1 19 ? 13.603  0.474   0.476   1.00 0.00 ? 23 ILE A N    1  
ATOM 295   C CA   . ILE A 1 19 ? 12.207  0.595   0.090   1.00 0.00 ? 23 ILE A CA   1  
ATOM 296   C C    . ILE A 1 19 ? 11.866  2.071   -0.117  1.00 0.00 ? 23 ILE A C    1  
ATOM 297   O O    . ILE A 1 19 ? 12.117  2.899   0.757   1.00 0.00 ? 23 ILE A O    1  
ATOM 298   C CB   . ILE A 1 19 ? 11.307  -0.107  1.109   1.00 0.00 ? 23 ILE A CB   1  
ATOM 299   C CG1  . ILE A 1 19 ? 11.158  -1.593  0.777   1.00 0.00 ? 23 ILE A CG1  1  
ATOM 300   C CG2  . ILE A 1 19 ? 9.952   0.594   1.219   1.00 0.00 ? 23 ILE A CG2  1  
ATOM 301   C CD1  . ILE A 1 19 ? 11.443  -2.461  2.005   1.00 0.00 ? 23 ILE A CD1  1  
ATOM 302   H H    . ILE A 1 19 ? 13.759  0.069   1.377   1.00 0.00 ? 23 ILE A H    1  
ATOM 303   H HA   . ILE A 1 19 ? 12.085  0.075   -0.860  1.00 0.00 ? 23 ILE A HA   1  
ATOM 304   H HB   . ILE A 1 19 ? 11.784  -0.042  2.088   1.00 0.00 ? 23 ILE A HB   1  
ATOM 305   H HG12 . ILE A 1 19 ? 10.149  -1.789  0.415   1.00 0.00 ? 23 ILE A HG12 1  
ATOM 306   H HG13 . ILE A 1 19 ? 11.843  -1.860  -0.028  1.00 0.00 ? 23 ILE A HG13 1  
ATOM 307   H HG21 . ILE A 1 19 ? 9.591   0.845   0.222   1.00 0.00 ? 23 ILE A HG21 1  
ATOM 308   H HG22 . ILE A 1 19 ? 9.238   -0.069  1.707   1.00 0.00 ? 23 ILE A HG22 1  
ATOM 309   H HG23 . ILE A 1 19 ? 10.062  1.506   1.806   1.00 0.00 ? 23 ILE A HG23 1  
ATOM 310   H HD11 . ILE A 1 19 ? 10.919  -2.052  2.868   1.00 0.00 ? 23 ILE A HD11 1  
ATOM 311   H HD12 . ILE A 1 19 ? 11.099  -3.478  1.818   1.00 0.00 ? 23 ILE A HD12 1  
ATOM 312   H HD13 . ILE A 1 19 ? 12.515  -2.470  2.202   1.00 0.00 ? 23 ILE A HD13 1  
ATOM 313   N N    . GLN A 1 20 ? 11.299  2.357   -1.280  1.00 0.00 ? 24 GLN A N    1  
ATOM 314   C CA   . GLN A 1 20 ? 10.920  3.719   -1.614  1.00 0.00 ? 24 GLN A CA   1  
ATOM 315   C C    . GLN A 1 20 ? 9.398   3.837   -1.717  1.00 0.00 ? 24 GLN A C    1  
ATOM 316   O O    . GLN A 1 20 ? 8.851   4.936   -1.642  1.00 0.00 ? 24 GLN A O    1  
ATOM 317   C CB   . GLN A 1 20 ? 11.595  4.174   -2.910  1.00 0.00 ? 24 GLN A CB   1  
ATOM 318   C CG   . GLN A 1 20 ? 12.181  5.579   -2.759  1.00 0.00 ? 24 GLN A CG   1  
ATOM 319   C CD   . GLN A 1 20 ? 11.893  6.430   -3.997  1.00 0.00 ? 24 GLN A CD   1  
ATOM 320   O OE1  . GLN A 1 20 ? 12.785  6.854   -4.712  1.00 0.00 ? 24 GLN A OE1  1  
ATOM 321   N NE2  . GLN A 1 20 ? 10.599  6.655   -4.210  1.00 0.00 ? 24 GLN A NE2  1  
ATOM 322   H H    . GLN A 1 20 ? 11.098  1.678   -1.986  1.00 0.00 ? 24 GLN A H    1  
ATOM 323   H HA   . GLN A 1 20 ? 11.283  4.331   -0.788  1.00 0.00 ? 24 GLN A HA   1  
ATOM 324   H HB2  . GLN A 1 20 ? 12.385  3.473   -3.178  1.00 0.00 ? 24 GLN A HB2  1  
ATOM 325   H HB3  . GLN A 1 20 ? 10.870  4.164   -3.724  1.00 0.00 ? 24 GLN A HB3  1  
ATOM 326   H HG2  . GLN A 1 20 ? 11.759  6.060   -1.876  1.00 0.00 ? 24 GLN A HG2  1  
ATOM 327   H HG3  . GLN A 1 20 ? 13.258  5.513   -2.601  1.00 0.00 ? 24 GLN A HG3  1  
ATOM 328   H HE21 . GLN A 1 20 ? 9.917   6.277   -3.584  1.00 0.00 ? 24 GLN A HE21 1  
ATOM 329   H HE22 . GLN A 1 20 ? 10.309  7.201   -4.995  1.00 0.00 ? 24 GLN A HE22 1  
ATOM 330   N N    . SER A 1 21 ? 8.758   2.690   -1.888  1.00 0.00 ? 25 SER A N    1  
ATOM 331   C CA   . SER A 1 21 ? 7.310   2.651   -2.003  1.00 0.00 ? 25 SER A CA   1  
ATOM 332   C C    . SER A 1 21 ? 6.786   1.285   -1.554  1.00 0.00 ? 25 SER A C    1  
ATOM 333   O O    . SER A 1 21 ? 7.519   0.297   -1.580  1.00 0.00 ? 25 SER A O    1  
ATOM 334   C CB   . SER A 1 21 ? 6.863   2.946   -3.436  1.00 0.00 ? 25 SER A CB   1  
ATOM 335   O OG   . SER A 1 21 ? 7.936   3.424   -4.242  1.00 0.00 ? 25 SER A OG   1  
ATOM 336   H H    . SER A 1 21 ? 9.211   1.800   -1.949  1.00 0.00 ? 25 SER A H    1  
ATOM 337   H HA   . SER A 1 21 ? 6.947   3.436   -1.340  1.00 0.00 ? 25 SER A HA   1  
ATOM 338   H HB2  . SER A 1 21 ? 6.451   2.040   -3.881  1.00 0.00 ? 25 SER A HB2  1  
ATOM 339   H HB3  . SER A 1 21 ? 6.063   3.686   -3.421  1.00 0.00 ? 25 SER A HB3  1  
ATOM 340   H HG   . SER A 1 21 ? 8.333   4.245   -3.831  1.00 0.00 ? 25 SER A HG   1  
ATOM 341   N N    . VAL A 1 22 ? 5.523   1.273   -1.154  1.00 0.00 ? 26 VAL A N    1  
ATOM 342   C CA   . VAL A 1 22 ? 4.893   0.045   -0.701  1.00 0.00 ? 26 VAL A CA   1  
ATOM 343   C C    . VAL A 1 22 ? 3.575   -0.154  -1.451  1.00 0.00 ? 26 VAL A C    1  
ATOM 344   O O    . VAL A 1 22 ? 2.777   0.775   -1.569  1.00 0.00 ? 26 VAL A O    1  
ATOM 345   C CB   . VAL A 1 22 ? 4.718   0.077   0.819   1.00 0.00 ? 26 VAL A CB   1  
ATOM 346   C CG1  . VAL A 1 22 ? 3.733   -1.000  1.280   1.00 0.00 ? 26 VAL A CG1  1  
ATOM 347   C CG2  . VAL A 1 22 ? 6.064   -0.071  1.530   1.00 0.00 ? 26 VAL A CG2  1  
ATOM 348   H H    . VAL A 1 22 ? 4.935   2.081   -1.137  1.00 0.00 ? 26 VAL A H    1  
ATOM 349   H HA   . VAL A 1 22 ? 5.564   -0.779  -0.946  1.00 0.00 ? 26 VAL A HA   1  
ATOM 350   H HB   . VAL A 1 22 ? 4.302   1.048   1.088   1.00 0.00 ? 26 VAL A HB   1  
ATOM 351   H HG11 . VAL A 1 22 ? 2.828   -0.947  0.675   1.00 0.00 ? 26 VAL A HG11 1  
ATOM 352   H HG12 . VAL A 1 22 ? 4.190   -1.983  1.165   1.00 0.00 ? 26 VAL A HG12 1  
ATOM 353   H HG13 . VAL A 1 22 ? 3.480   -0.836  2.327   1.00 0.00 ? 26 VAL A HG13 1  
ATOM 354   H HG21 . VAL A 1 22 ? 6.853   0.348   0.905   1.00 0.00 ? 26 VAL A HG21 1  
ATOM 355   H HG22 . VAL A 1 22 ? 6.034   0.461   2.481   1.00 0.00 ? 26 VAL A HG22 1  
ATOM 356   H HG23 . VAL A 1 22 ? 6.266   -1.127  1.710   1.00 0.00 ? 26 VAL A HG23 1  
ATOM 357   N N    . LYS A 1 23 ? 3.386   -1.371  -1.939  1.00 0.00 ? 27 LYS A N    1  
ATOM 358   C CA   . LYS A 1 23 ? 2.178   -1.704  -2.675  1.00 0.00 ? 27 LYS A CA   1  
ATOM 359   C C    . LYS A 1 23 ? 1.516   -2.926  -2.034  1.00 0.00 ? 27 LYS A C    1  
ATOM 360   O O    . LYS A 1 23 ? 2.143   -3.975  -1.898  1.00 0.00 ? 27 LYS A O    1  
ATOM 361   C CB   . LYS A 1 23 ? 2.489   -1.882  -4.162  1.00 0.00 ? 27 LYS A CB   1  
ATOM 362   C CG   . LYS A 1 23 ? 1.224   -1.724  -5.009  1.00 0.00 ? 27 LYS A CG   1  
ATOM 363   C CD   . LYS A 1 23 ? 0.278   -2.909  -4.807  1.00 0.00 ? 27 LYS A CD   1  
ATOM 364   C CE   . LYS A 1 23 ? -0.121  -3.527  -6.149  1.00 0.00 ? 27 LYS A CE   1  
ATOM 365   N NZ   . LYS A 1 23 ? -1.512  -3.161  -6.495  1.00 0.00 ? 27 LYS A NZ   1  
ATOM 366   H H    . LYS A 1 23 ? 4.040   -2.121  -1.839  1.00 0.00 ? 27 LYS A H    1  
ATOM 367   H HA   . LYS A 1 23 ? 1.498   -0.856  -2.586  1.00 0.00 ? 27 LYS A HA   1  
ATOM 368   H HB2  . LYS A 1 23 ? 3.233   -1.148  -4.473  1.00 0.00 ? 27 LYS A HB2  1  
ATOM 369   H HB3  . LYS A 1 23 ? 2.923   -2.867  -4.331  1.00 0.00 ? 27 LYS A HB3  1  
ATOM 370   H HG2  . LYS A 1 23 ? 0.715   -0.798  -4.740  1.00 0.00 ? 27 LYS A HG2  1  
ATOM 371   H HG3  . LYS A 1 23 ? 1.494   -1.645  -6.062  1.00 0.00 ? 27 LYS A HG3  1  
ATOM 372   H HD2  . LYS A 1 23 ? 0.760   -3.663  -4.185  1.00 0.00 ? 27 LYS A HD2  1  
ATOM 373   H HD3  . LYS A 1 23 ? -0.615  -2.580  -4.275  1.00 0.00 ? 27 LYS A HD3  1  
ATOM 374   H HE2  . LYS A 1 23 ? 0.557   -3.183  -6.930  1.00 0.00 ? 27 LYS A HE2  1  
ATOM 375   H HE3  . LYS A 1 23 ? -0.025  -4.611  -6.100  1.00 0.00 ? 27 LYS A HE3  1  
ATOM 376   H HZ1  . LYS A 1 23 ? -2.122  -3.424  -5.748  1.00 0.00 ? 27 LYS A HZ1  1  
ATOM 377   H HZ2  . LYS A 1 23 ? -1.571  -2.173  -6.641  1.00 0.00 ? 27 LYS A HZ2  1  
ATOM 378   H HZ3  . LYS A 1 23 ? -1.784  -3.638  -7.331  1.00 0.00 ? 27 LYS A HZ3  1  
ATOM 379   N N    . VAL A 1 24 ? 0.259   -2.748  -1.657  1.00 0.00 ? 28 VAL A N    1  
ATOM 380   C CA   . VAL A 1 24 ? -0.495  -3.823  -1.034  1.00 0.00 ? 28 VAL A CA   1  
ATOM 381   C C    . VAL A 1 24 ? -1.669  -4.206  -1.937  1.00 0.00 ? 28 VAL A C    1  
ATOM 382   O O    . VAL A 1 24 ? -2.555  -3.391  -2.189  1.00 0.00 ? 28 VAL A O    1  
ATOM 383   C CB   . VAL A 1 24 ? -0.933  -3.408  0.372   1.00 0.00 ? 28 VAL A CB   1  
ATOM 384   C CG1  . VAL A 1 24 ? -2.030  -4.334  0.900   1.00 0.00 ? 28 VAL A CG1  1  
ATOM 385   C CG2  . VAL A 1 24 ? 0.260   -3.371  1.329   1.00 0.00 ? 28 VAL A CG2  1  
ATOM 386   H H    . VAL A 1 24 ? -0.243  -1.891  -1.771  1.00 0.00 ? 28 VAL A H    1  
ATOM 387   H HA   . VAL A 1 24 ? 0.171   -4.680  -0.941  1.00 0.00 ? 28 VAL A HA   1  
ATOM 388   H HB   . VAL A 1 24 ? -1.345  -2.401  0.311   1.00 0.00 ? 28 VAL A HB   1  
ATOM 389   H HG11 . VAL A 1 24 ? -2.161  -5.171  0.213   1.00 0.00 ? 28 VAL A HG11 1  
ATOM 390   H HG12 . VAL A 1 24 ? -1.746  -4.711  1.882   1.00 0.00 ? 28 VAL A HG12 1  
ATOM 391   H HG13 . VAL A 1 24 ? -2.966  -3.780  0.980   1.00 0.00 ? 28 VAL A HG13 1  
ATOM 392   H HG21 . VAL A 1 24 ? 1.068   -3.982  0.926   1.00 0.00 ? 28 VAL A HG21 1  
ATOM 393   H HG22 . VAL A 1 24 ? 0.604   -2.342  1.442   1.00 0.00 ? 28 VAL A HG22 1  
ATOM 394   H HG23 . VAL A 1 24 ? -0.041  -3.761  2.301   1.00 0.00 ? 28 VAL A HG23 1  
ATOM 395   N N    . LYS A 1 25 ? -1.638  -5.448  -2.399  1.00 0.00 ? 29 LYS A N    1  
ATOM 396   C CA   . LYS A 1 25 ? -2.688  -5.950  -3.268  1.00 0.00 ? 29 LYS A CA   1  
ATOM 397   C C    . LYS A 1 25 ? -3.314  -7.196  -2.638  1.00 0.00 ? 29 LYS A C    1  
ATOM 398   O O    . LYS A 1 25 ? -2.846  -8.311  -2.864  1.00 0.00 ? 29 LYS A O    1  
ATOM 399   C CB   . LYS A 1 25 ? -2.150  -6.179  -4.682  1.00 0.00 ? 29 LYS A CB   1  
ATOM 400   C CG   . LYS A 1 25 ? -3.291  -6.249  -5.699  1.00 0.00 ? 29 LYS A CG   1  
ATOM 401   C CD   . LYS A 1 25 ? -3.872  -7.662  -5.776  1.00 0.00 ? 29 LYS A CD   1  
ATOM 402   C CE   . LYS A 1 25 ? -4.241  -8.025  -7.215  1.00 0.00 ? 29 LYS A CE   1  
ATOM 403   N NZ   . LYS A 1 25 ? -3.820  -9.410  -7.525  1.00 0.00 ? 29 LYS A NZ   1  
ATOM 404   H H    . LYS A 1 25 ? -0.913  -6.105  -2.189  1.00 0.00 ? 29 LYS A H    1  
ATOM 405   H HA   . LYS A 1 25 ? -3.453  -5.176  -3.337  1.00 0.00 ? 29 LYS A HA   1  
ATOM 406   H HB2  . LYS A 1 25 ? -1.467  -5.374  -4.951  1.00 0.00 ? 29 LYS A HB2  1  
ATOM 407   H HB3  . LYS A 1 25 ? -1.576  -7.106  -4.710  1.00 0.00 ? 29 LYS A HB3  1  
ATOM 408   H HG2  . LYS A 1 25 ? -4.074  -5.544  -5.420  1.00 0.00 ? 29 LYS A HG2  1  
ATOM 409   H HG3  . LYS A 1 25 ? -2.926  -5.947  -6.681  1.00 0.00 ? 29 LYS A HG3  1  
ATOM 410   H HD2  . LYS A 1 25 ? -3.146  -8.378  -5.391  1.00 0.00 ? 29 LYS A HD2  1  
ATOM 411   H HD3  . LYS A 1 25 ? -4.755  -7.731  -5.141  1.00 0.00 ? 29 LYS A HD3  1  
ATOM 412   H HE2  . LYS A 1 25 ? -5.317  -7.926  -7.357  1.00 0.00 ? 29 LYS A HE2  1  
ATOM 413   H HE3  . LYS A 1 25 ? -3.763  -7.330  -7.906  1.00 0.00 ? 29 LYS A HE3  1  
ATOM 414   H HZ1  . LYS A 1 25 ? -3.231  -9.750  -6.792  1.00 0.00 ? 29 LYS A HZ1  1  
ATOM 415   H HZ2  . LYS A 1 25 ? -4.628  -9.994  -7.602  1.00 0.00 ? 29 LYS A HZ2  1  
ATOM 416   H HZ3  . LYS A 1 25 ? -3.318  -9.420  -8.389  1.00 0.00 ? 29 LYS A HZ3  1  
ATOM 417   N N    . SER A 1 26 ? -4.362  -6.964  -1.862  1.00 0.00 ? 30 SER A N    1  
ATOM 418   C CA   . SER A 1 26 ? -5.056  -8.054  -1.198  1.00 0.00 ? 30 SER A CA   1  
ATOM 419   C C    . SER A 1 26 ? -5.348  -9.175  -2.197  1.00 0.00 ? 30 SER A C    1  
ATOM 420   O O    . SER A 1 26 ? -5.107  -9.023  -3.394  1.00 0.00 ? 30 SER A O    1  
ATOM 421   C CB   . SER A 1 26 ? -6.355  -7.568  -0.552  1.00 0.00 ? 30 SER A CB   1  
ATOM 422   O OG   . SER A 1 26 ? -6.299  -7.627  0.871   1.00 0.00 ? 30 SER A OG   1  
ATOM 423   H H    . SER A 1 26 ? -4.736  -6.054  -1.684  1.00 0.00 ? 30 SER A H    1  
ATOM 424   H HA   . SER A 1 26 ? -4.373  -8.402  -0.422  1.00 0.00 ? 30 SER A HA   1  
ATOM 425   H HB2  . SER A 1 26 ? -6.553  -6.542  -0.864  1.00 0.00 ? 30 SER A HB2  1  
ATOM 426   H HB3  . SER A 1 26 ? -7.187  -8.176  -0.908  1.00 0.00 ? 30 SER A HB3  1  
ATOM 427   H HG   . SER A 1 26 ? -5.685  -8.362  1.158   1.00 0.00 ? 30 SER A HG   1  
ATOM 428   N N    . PRO A 1 27 ? -5.877  -10.305 -1.656  1.00 0.00 ? 31 PRO A N    1  
ATOM 429   C CA   . PRO A 1 27 ? -6.204  -11.451 -2.487  1.00 0.00 ? 31 PRO A CA   1  
ATOM 430   C C    . PRO A 1 27 ? -7.480  -11.198 -3.292  1.00 0.00 ? 31 PRO A C    1  
ATOM 431   O O    . PRO A 1 27 ? -8.156  -10.189 -3.091  1.00 0.00 ? 31 PRO A O    1  
ATOM 432   C CB   . PRO A 1 27 ? -6.334  -12.615 -1.519  1.00 0.00 ? 31 PRO A CB   1  
ATOM 433   C CG   . PRO A 1 27 ? -6.534  -11.995 -0.146  1.00 0.00 ? 31 PRO A CG   1  
ATOM 434   C CD   . PRO A 1 27 ? -6.176  -10.521 -0.243  1.00 0.00 ? 31 PRO A CD   1  
ATOM 435   H HA   . PRO A 1 27 ? -5.482  -11.608 -3.161  1.00 0.00 ? 31 PRO A HA   1  
ATOM 436   H HB2  . PRO A 1 27 ? -7.176  -13.253 -1.786  1.00 0.00 ? 31 PRO A HB2  1  
ATOM 437   H HB3  . PRO A 1 27 ? -5.442  -13.241 -1.539  1.00 0.00 ? 31 PRO A HB3  1  
ATOM 438   H HG2  . PRO A 1 27 ? -7.567  -12.116 0.181   1.00 0.00 ? 31 PRO A HG2  1  
ATOM 439   H HG3  . PRO A 1 27 ? -5.905  -12.492 0.593   1.00 0.00 ? 31 PRO A HG3  1  
ATOM 440   H HD2  . PRO A 1 27 ? -7.002  -9.890  0.087   1.00 0.00 ? 31 PRO A HD2  1  
ATOM 441   H HD3  . PRO A 1 27 ? -5.319  -10.279 0.385   1.00 0.00 ? 31 PRO A HD3  1  
ATOM 442   N N    . GLY A 1 28 ? -7.773  -12.131 -4.186  1.00 0.00 ? 32 GLY A N    1  
ATOM 443   C CA   . GLY A 1 28 ? -8.956  -12.021 -5.022  1.00 0.00 ? 32 GLY A CA   1  
ATOM 444   C C    . GLY A 1 28 ? -9.576  -13.397 -5.277  1.00 0.00 ? 32 GLY A C    1  
ATOM 445   O O    . GLY A 1 28 ? -9.316  -14.345 -4.539  1.00 0.00 ? 32 GLY A O    1  
ATOM 446   H H    . GLY A 1 28 ? -7.218  -12.948 -4.343  1.00 0.00 ? 32 GLY A H    1  
ATOM 447   H HA2  . GLY A 1 28 ? -9.687  -11.372 -4.541  1.00 0.00 ? 32 GLY A HA2  1  
ATOM 448   H HA3  . GLY A 1 28 ? -8.693  -11.555 -5.972  1.00 0.00 ? 32 GLY A HA3  1  
ATOM 449   N N    . PRO A 1 29 ? -10.406 -13.462 -6.353  1.00 0.00 ? 33 PRO A N    1  
ATOM 450   C CA   . PRO A 1 29 ? -11.065 -14.706 -6.715  1.00 0.00 ? 33 PRO A CA   1  
ATOM 451   C C    . PRO A 1 29 ? -10.082 -15.677 -7.370  1.00 0.00 ? 33 PRO A C    1  
ATOM 452   O O    . PRO A 1 29 ? -10.466 -16.771 -7.782  1.00 0.00 ? 33 PRO A O    1  
ATOM 453   C CB   . PRO A 1 29 ? -12.200 -14.295 -7.639  1.00 0.00 ? 33 PRO A CB   1  
ATOM 454   C CG   . PRO A 1 29 ? -11.853 -12.899 -8.130  1.00 0.00 ? 33 PRO A CG   1  
ATOM 455   C CD   . PRO A 1 29 ? -10.737 -12.359 -7.250  1.00 0.00 ? 33 PRO A CD   1  
ATOM 456   H HA   . PRO A 1 29 ? -11.404 -15.170 -5.896  1.00 0.00 ? 33 PRO A HA   1  
ATOM 457   H HB2  . PRO A 1 29 ? -12.295 -14.990 -8.473  1.00 0.00 ? 33 PRO A HB2  1  
ATOM 458   H HB3  . PRO A 1 29 ? -13.154 -14.297 -7.111  1.00 0.00 ? 33 PRO A HB3  1  
ATOM 459   H HG2  . PRO A 1 29 ? -11.536 -12.929 -9.172  1.00 0.00 ? 33 PRO A HG2  1  
ATOM 460   H HG3  . PRO A 1 29 ? -12.726 -12.249 -8.081  1.00 0.00 ? 33 PRO A HG3  1  
ATOM 461   H HD2  . PRO A 1 29 ? -9.874  -12.059 -7.844  1.00 0.00 ? 33 PRO A HD2  1  
ATOM 462   H HD3  . PRO A 1 29 ? -11.062 -11.480 -6.693  1.00 0.00 ? 33 PRO A HD3  1  
ATOM 463   N N    . HIS A 1 30 ? -8.833  -15.242 -7.448  1.00 0.00 ? 34 HIS A N    1  
ATOM 464   C CA   . HIS A 1 30 ? -7.792  -16.060 -8.046  1.00 0.00 ? 34 HIS A CA   1  
ATOM 465   C C    . HIS A 1 30 ? -6.806  -16.509 -6.965  1.00 0.00 ? 34 HIS A C    1  
ATOM 466   O O    . HIS A 1 30 ? -6.530  -17.699 -6.827  1.00 0.00 ? 34 HIS A O    1  
ATOM 467   C CB   . HIS A 1 30 ? -7.111  -15.316 -9.197  1.00 0.00 ? 34 HIS A CB   1  
ATOM 468   C CG   . HIS A 1 30 ? -7.049  -13.819 -9.010  1.00 0.00 ? 34 HIS A CG   1  
ATOM 469   N ND1  . HIS A 1 30 ? -8.176  -13.017 -9.008  1.00 0.00 ? 34 HIS A ND1  1  
ATOM 470   C CD2  . HIS A 1 30 ? -5.985  -12.989 -8.817  1.00 0.00 ? 34 HIS A CD2  1  
ATOM 471   C CE1  . HIS A 1 30 ? -7.796  -11.761 -8.822  1.00 0.00 ? 34 HIS A CE1  1  
ATOM 472   N NE2  . HIS A 1 30 ? -6.437  -11.746 -8.705  1.00 0.00 ? 34 HIS A NE2  1  
ATOM 473   H H    . HIS A 1 30 ? -8.529  -14.351 -7.111  1.00 0.00 ? 34 HIS A H    1  
ATOM 474   H HA   . HIS A 1 30 ? -8.284  -16.938 -8.463  1.00 0.00 ? 34 HIS A HA   1  
ATOM 475   H HB2  . HIS A 1 30 ? -6.098  -15.700 -9.315  1.00 0.00 ? 34 HIS A HB2  1  
ATOM 476   H HB3  . HIS A 1 30 ? -7.644  -15.534 -10.123 1.00 0.00 ? 34 HIS A HB3  1  
ATOM 477   H HD1  . HIS A 1 30 ? -9.118  -13.331 -9.126  1.00 0.00 ? 34 HIS A HD1  1  
ATOM 478   H HD2  . HIS A 1 30 ? -4.939  -13.294 -8.764  1.00 0.00 ? 34 HIS A HD2  1  
ATOM 479   H HE1  . HIS A 1 30 ? -8.453  -10.893 -8.772  1.00 0.00 ? 34 HIS A HE1  1  
ATOM 480   N N    . CYS A 1 31 ? -6.302  -15.531 -6.227  1.00 0.00 ? 35 CYS A N    1  
ATOM 481   C CA   . CYS A 1 31 ? -5.353  -15.810 -5.163  1.00 0.00 ? 35 CYS A CA   1  
ATOM 482   C C    . CYS A 1 31 ? -6.015  -15.467 -3.827  1.00 0.00 ? 35 CYS A C    1  
ATOM 483   O O    . CYS A 1 31 ? -6.482  -14.346 -3.631  1.00 0.00 ? 35 CYS A O    1  
ATOM 484   C CB   . CYS A 1 31 ? -4.041  -15.048 -5.361  1.00 0.00 ? 35 CYS A CB   1  
ATOM 485   S SG   . CYS A 1 31 ? -2.532  -16.080 -5.262  1.00 0.00 ? 35 CYS A SG   1  
ATOM 486   H H    . CYS A 1 31 ? -6.531  -14.565 -6.346  1.00 0.00 ? 35 CYS A H    1  
ATOM 487   H HA   . CYS A 1 31 ? -5.123  -16.874 -5.219  1.00 0.00 ? 35 CYS A HA   1  
ATOM 488   H HB2  . CYS A 1 31 ? -4.065  -14.558 -6.334  1.00 0.00 ? 35 CYS A HB2  1  
ATOM 489   H HB3  . CYS A 1 31 ? -3.976  -14.262 -4.609  1.00 0.00 ? 35 CYS A HB3  1  
ATOM 490   N N    . ALA A 1 32 ? -6.034  -16.454 -2.942  1.00 0.00 ? 36 ALA A N    1  
ATOM 491   C CA   . ALA A 1 32 ? -6.631  -16.271 -1.630  1.00 0.00 ? 36 ALA A CA   1  
ATOM 492   C C    . ALA A 1 32 ? -5.549  -15.842 -0.637  1.00 0.00 ? 36 ALA A C    1  
ATOM 493   O O    . ALA A 1 32 ? -5.690  -16.049 0.567   1.00 0.00 ? 36 ALA A O    1  
ATOM 494   C CB   . ALA A 1 32 ? -7.334  -17.562 -1.205  1.00 0.00 ? 36 ALA A CB   1  
ATOM 495   H H    . ALA A 1 32 ? -5.652  -17.362 -3.110  1.00 0.00 ? 36 ALA A H    1  
ATOM 496   H HA   . ALA A 1 32 ? -7.374  -15.477 -1.711  1.00 0.00 ? 36 ALA A HA   1  
ATOM 497   H HB1  . ALA A 1 32 ? -7.602  -18.138 -2.090  1.00 0.00 ? 36 ALA A HB1  1  
ATOM 498   H HB2  . ALA A 1 32 ? -6.665  -18.150 -0.577  1.00 0.00 ? 36 ALA A HB2  1  
ATOM 499   H HB3  . ALA A 1 32 ? -8.236  -17.316 -0.644  1.00 0.00 ? 36 ALA A HB3  1  
ATOM 500   N N    . GLN A 1 33 ? -4.494  -15.252 -1.180  1.00 0.00 ? 37 GLN A N    1  
ATOM 501   C CA   . GLN A 1 33 ? -3.389  -14.792 -0.357  1.00 0.00 ? 37 GLN A CA   1  
ATOM 502   C C    . GLN A 1 33 ? -2.985  -13.371 -0.755  1.00 0.00 ? 37 GLN A C    1  
ATOM 503   O O    . GLN A 1 33 ? -3.262  -12.933 -1.871  1.00 0.00 ? 37 GLN A O    1  
ATOM 504   C CB   . GLN A 1 33 ? -2.198  -15.747 -0.454  1.00 0.00 ? 37 GLN A CB   1  
ATOM 505   C CG   . GLN A 1 33 ? -2.654  -17.204 -0.346  1.00 0.00 ? 37 GLN A CG   1  
ATOM 506   C CD   . GLN A 1 33 ? -2.477  -17.933 -1.680  1.00 0.00 ? 37 GLN A CD   1  
ATOM 507   O OE1  . GLN A 1 33 ? -2.175  -17.343 -2.704  1.00 0.00 ? 37 GLN A OE1  1  
ATOM 508   N NE2  . GLN A 1 33 ? -2.682  -19.245 -1.610  1.00 0.00 ? 37 GLN A NE2  1  
ATOM 509   H H    . GLN A 1 33 ? -4.388  -15.087 -2.160  1.00 0.00 ? 37 GLN A H    1  
ATOM 510   H HA   . GLN A 1 33 ? -3.767  -14.796 0.666   1.00 0.00 ? 37 GLN A HA   1  
ATOM 511   H HB2  . GLN A 1 33 ? -1.680  -15.593 -1.400  1.00 0.00 ? 37 GLN A HB2  1  
ATOM 512   H HB3  . GLN A 1 33 ? -1.484  -15.526 0.340   1.00 0.00 ? 37 GLN A HB3  1  
ATOM 513   H HG2  . GLN A 1 33 ? -2.080  -17.712 0.429   1.00 0.00 ? 37 GLN A HG2  1  
ATOM 514   H HG3  . GLN A 1 33 ? -3.700  -17.240 -0.044  1.00 0.00 ? 37 GLN A HG3  1  
ATOM 515   H HE21 . GLN A 1 33 ? -2.928  -19.667 -0.738  1.00 0.00 ? 37 GLN A HE21 1  
ATOM 516   H HE22 . GLN A 1 33 ? -2.591  -19.810 -2.431  1.00 0.00 ? 37 GLN A HE22 1  
ATOM 517   N N    . THR A 1 34 ? -2.338  -12.689 0.179   1.00 0.00 ? 38 THR A N    1  
ATOM 518   C CA   . THR A 1 34 ? -1.894  -11.327 -0.062  1.00 0.00 ? 38 THR A CA   1  
ATOM 519   C C    . THR A 1 34 ? -0.566  -11.325 -0.822  1.00 0.00 ? 38 THR A C    1  
ATOM 520   O O    . THR A 1 34 ? 0.137   -12.334 -0.853  1.00 0.00 ? 38 THR A O    1  
ATOM 521   C CB   . THR A 1 34 ? -1.823  -10.608 1.287   1.00 0.00 ? 38 THR A CB   1  
ATOM 522   O OG1  . THR A 1 34 ? -3.073  -10.904 1.904   1.00 0.00 ? 38 THR A OG1  1  
ATOM 523   C CG2  . THR A 1 34 ? -1.832  -9.085  1.140   1.00 0.00 ? 38 THR A CG2  1  
ATOM 524   H H    . THR A 1 34 ? -2.117  -13.052 1.084   1.00 0.00 ? 38 THR A H    1  
ATOM 525   H HA   . THR A 1 34 ? -2.628  -10.833 -0.699  1.00 0.00 ? 38 THR A HA   1  
ATOM 526   H HB   . THR A 1 34 ? -0.957  -10.939 1.860   1.00 0.00 ? 38 THR A HB   1  
ATOM 527   H HG1  . THR A 1 34 ? -3.030  -10.696 2.881   1.00 0.00 ? 38 THR A HG1  1  
ATOM 528   H HG21 . THR A 1 34 ? -2.561  -8.797  0.382   1.00 0.00 ? 38 THR A HG21 1  
ATOM 529   H HG22 . THR A 1 34 ? -2.100  -8.629  2.093   1.00 0.00 ? 38 THR A HG22 1  
ATOM 530   H HG23 . THR A 1 34 ? -0.841  -8.743  0.840   1.00 0.00 ? 38 THR A HG23 1  
ATOM 531   N N    . GLU A 1 35 ? -0.263  -10.180 -1.415  1.00 0.00 ? 39 GLU A N    1  
ATOM 532   C CA   . GLU A 1 35 ? 0.969   -10.033 -2.173  1.00 0.00 ? 39 GLU A CA   1  
ATOM 533   C C    . GLU A 1 35 ? 1.502   -8.605  -2.047  1.00 0.00 ? 39 GLU A C    1  
ATOM 534   O O    . GLU A 1 35 ? 1.319   -7.788  -2.948  1.00 0.00 ? 39 GLU A O    1  
ATOM 535   C CB   . GLU A 1 35 ? 0.758   -10.413 -3.640  1.00 0.00 ? 39 GLU A CB   1  
ATOM 536   C CG   . GLU A 1 35 ? -0.636  -10.002 -4.118  1.00 0.00 ? 39 GLU A CG   1  
ATOM 537   C CD   . GLU A 1 35 ? -1.653  -11.118 -3.867  1.00 0.00 ? 39 GLU A CD   1  
ATOM 538   O OE1  . GLU A 1 35 ? -1.377  -12.249 -4.321  1.00 0.00 ? 39 GLU A OE1  1  
ATOM 539   O OE2  . GLU A 1 35 ? -2.682  -10.814 -3.226  1.00 0.00 ? 39 GLU A OE2  1  
ATOM 540   H H    . GLU A 1 35 ? -0.840  -9.364  -1.385  1.00 0.00 ? 39 GLU A H    1  
ATOM 541   H HA   . GLU A 1 35 ? 1.672   -10.733 -1.721  1.00 0.00 ? 39 GLU A HA   1  
ATOM 542   H HB2  . GLU A 1 35 ? 1.515   -9.928  -4.257  1.00 0.00 ? 39 GLU A HB2  1  
ATOM 543   H HB3  . GLU A 1 35 ? 0.886   -11.488 -3.764  1.00 0.00 ? 39 GLU A HB3  1  
ATOM 544   H HG2  . GLU A 1 35 ? -0.950  -9.096  -3.600  1.00 0.00 ? 39 GLU A HG2  1  
ATOM 545   H HG3  . GLU A 1 35 ? -0.605  -9.766  -5.182  1.00 0.00 ? 39 GLU A HG3  1  
ATOM 546   N N    . VAL A 1 36 ? 2.152   -8.347  -0.922  1.00 0.00 ? 40 VAL A N    1  
ATOM 547   C CA   . VAL A 1 36 ? 2.714   -7.032  -0.666  1.00 0.00 ? 40 VAL A CA   1  
ATOM 548   C C    . VAL A 1 36 ? 3.947   -6.828  -1.549  1.00 0.00 ? 40 VAL A C    1  
ATOM 549   O O    . VAL A 1 36 ? 4.897   -7.607  -1.484  1.00 0.00 ? 40 VAL A O    1  
ATOM 550   C CB   . VAL A 1 36 ? 3.014   -6.871  0.825   1.00 0.00 ? 40 VAL A CB   1  
ATOM 551   C CG1  . VAL A 1 36 ? 3.663   -5.516  1.111   1.00 0.00 ? 40 VAL A CG1  1  
ATOM 552   C CG2  . VAL A 1 36 ? 1.748   -7.061  1.663   1.00 0.00 ? 40 VAL A CG2  1  
ATOM 553   H H    . VAL A 1 36 ? 2.297   -9.017  -0.194  1.00 0.00 ? 40 VAL A H    1  
ATOM 554   H HA   . VAL A 1 36 ? 1.961   -6.294  -0.941  1.00 0.00 ? 40 VAL A HA   1  
ATOM 555   H HB   . VAL A 1 36 ? 3.723   -7.649  1.110   1.00 0.00 ? 40 VAL A HB   1  
ATOM 556   H HG11 . VAL A 1 36 ? 4.267   -5.214  0.256   1.00 0.00 ? 40 VAL A HG11 1  
ATOM 557   H HG12 . VAL A 1 36 ? 2.886   -4.771  1.288   1.00 0.00 ? 40 VAL A HG12 1  
ATOM 558   H HG13 . VAL A 1 36 ? 4.297   -5.596  1.994   1.00 0.00 ? 40 VAL A HG13 1  
ATOM 559   H HG21 . VAL A 1 36 ? 0.871   -6.962  1.023   1.00 0.00 ? 40 VAL A HG21 1  
ATOM 560   H HG22 . VAL A 1 36 ? 1.757   -8.052  2.116   1.00 0.00 ? 40 VAL A HG22 1  
ATOM 561   H HG23 . VAL A 1 36 ? 1.713   -6.304  2.446   1.00 0.00 ? 40 VAL A HG23 1  
ATOM 562   N N    . ILE A 1 37 ? 3.892   -5.778  -2.355  1.00 0.00 ? 41 ILE A N    1  
ATOM 563   C CA   . ILE A 1 37 ? 4.992   -5.462  -3.250  1.00 0.00 ? 41 ILE A CA   1  
ATOM 564   C C    . ILE A 1 37 ? 5.488   -4.044  -2.961  1.00 0.00 ? 41 ILE A C    1  
ATOM 565   O O    . ILE A 1 37 ? 4.747   -3.077  -3.129  1.00 0.00 ? 41 ILE A O    1  
ATOM 566   C CB   . ILE A 1 37 ? 4.579   -5.684  -4.706  1.00 0.00 ? 41 ILE A CB   1  
ATOM 567   C CG1  . ILE A 1 37 ? 3.782   -6.982  -4.859  1.00 0.00 ? 41 ILE A CG1  1  
ATOM 568   C CG2  . ILE A 1 37 ? 5.795   -5.646  -5.633  1.00 0.00 ? 41 ILE A CG2  1  
ATOM 569   C CD1  . ILE A 1 37 ? 2.390   -6.706  -5.430  1.00 0.00 ? 41 ILE A CD1  1  
ATOM 570   H H    . ILE A 1 37 ? 3.115   -5.150  -2.402  1.00 0.00 ? 41 ILE A H    1  
ATOM 571   H HA   . ILE A 1 37 ? 5.800   -6.162  -3.034  1.00 0.00 ? 41 ILE A HA   1  
ATOM 572   H HB   . ILE A 1 37 ? 3.922   -4.866  -5.003  1.00 0.00 ? 41 ILE A HB   1  
ATOM 573   H HG12 . ILE A 1 37 ? 4.319   -7.667  -5.514  1.00 0.00 ? 41 ILE A HG12 1  
ATOM 574   H HG13 . ILE A 1 37 ? 3.691   -7.472  -3.890  1.00 0.00 ? 41 ILE A HG13 1  
ATOM 575   H HG21 . ILE A 1 37 ? 6.599   -6.243  -5.202  1.00 0.00 ? 41 ILE A HG21 1  
ATOM 576   H HG22 . ILE A 1 37 ? 5.523   -6.053  -6.607  1.00 0.00 ? 41 ILE A HG22 1  
ATOM 577   H HG23 . ILE A 1 37 ? 6.131   -4.616  -5.751  1.00 0.00 ? 41 ILE A HG23 1  
ATOM 578   H HD11 . ILE A 1 37 ? 1.882   -5.968  -4.809  1.00 0.00 ? 41 ILE A HD11 1  
ATOM 579   H HD12 . ILE A 1 37 ? 2.483   -6.323  -6.446  1.00 0.00 ? 41 ILE A HD12 1  
ATOM 580   H HD13 . ILE A 1 37 ? 1.812   -7.631  -5.442  1.00 0.00 ? 41 ILE A HD13 1  
ATOM 581   N N    . ALA A 1 38 ? 6.739   -3.965  -2.530  1.00 0.00 ? 42 ALA A N    1  
ATOM 582   C CA   . ALA A 1 38 ? 7.343   -2.682  -2.216  1.00 0.00 ? 42 ALA A CA   1  
ATOM 583   C C    . ALA A 1 38 ? 8.368   -2.327  -3.295  1.00 0.00 ? 42 ALA A C    1  
ATOM 584   O O    . ALA A 1 38 ? 9.104   -3.194  -3.765  1.00 0.00 ? 42 ALA A O    1  
ATOM 585   C CB   . ALA A 1 38 ? 7.963   -2.738  -0.818  1.00 0.00 ? 42 ALA A CB   1  
ATOM 586   H H    . ALA A 1 38 ? 7.335   -4.757  -2.396  1.00 0.00 ? 42 ALA A H    1  
ATOM 587   H HA   . ALA A 1 38 ? 6.551   -1.933  -2.219  1.00 0.00 ? 42 ALA A HA   1  
ATOM 588   H HB1  . ALA A 1 38 ? 8.348   -1.753  -0.553  1.00 0.00 ? 42 ALA A HB1  1  
ATOM 589   H HB2  . ALA A 1 38 ? 7.204   -3.038  -0.096  1.00 0.00 ? 42 ALA A HB2  1  
ATOM 590   H HB3  . ALA A 1 38 ? 8.778   -3.461  -0.811  1.00 0.00 ? 42 ALA A HB3  1  
ATOM 591   N N    . THR A 1 39 ? 8.383   -1.053  -3.656  1.00 0.00 ? 43 THR A N    1  
ATOM 592   C CA   . THR A 1 39 ? 9.306   -0.573  -4.671  1.00 0.00 ? 43 THR A CA   1  
ATOM 593   C C    . THR A 1 39 ? 10.634  -0.162  -4.032  1.00 0.00 ? 43 THR A C    1  
ATOM 594   O O    . THR A 1 39 ? 10.651  0.428   -2.953  1.00 0.00 ? 43 THR A O    1  
ATOM 595   C CB   . THR A 1 39 ? 8.621   0.562   -5.434  1.00 0.00 ? 43 THR A CB   1  
ATOM 596   O OG1  . THR A 1 39 ? 7.611   -0.092  -6.198  1.00 0.00 ? 43 THR A OG1  1  
ATOM 597   C CG2  . THR A 1 39 ? 9.534   1.194   -6.487  1.00 0.00 ? 43 THR A CG2  1  
ATOM 598   H H    . THR A 1 39 ? 7.781   -0.355  -3.268  1.00 0.00 ? 43 THR A H    1  
ATOM 599   H HA   . THR A 1 39 ? 9.521   -1.394  -5.355  1.00 0.00 ? 43 THR A HA   1  
ATOM 600   H HB   . THR A 1 39 ? 8.238   1.317   -4.747  1.00 0.00 ? 43 THR A HB   1  
ATOM 601   H HG1  . THR A 1 39 ? 7.046   0.585   -6.669  1.00 0.00 ? 43 THR A HG1  1  
ATOM 602   H HG21 . THR A 1 39 ? 10.539  1.300   -6.080  1.00 0.00 ? 43 THR A HG21 1  
ATOM 603   H HG22 . THR A 1 39 ? 9.565   0.557   -7.370  1.00 0.00 ? 43 THR A HG22 1  
ATOM 604   H HG23 . THR A 1 39 ? 9.147   2.176   -6.761  1.00 0.00 ? 43 THR A HG23 1  
ATOM 605   N N    . LEU A 1 40 ? 11.714  -0.489  -4.726  1.00 0.00 ? 44 LEU A N    1  
ATOM 606   C CA   . LEU A 1 40 ? 13.043  -0.161  -4.241  1.00 0.00 ? 44 LEU A CA   1  
ATOM 607   C C    . LEU A 1 40 ? 13.420  1.246   -4.710  1.00 0.00 ? 44 LEU A C    1  
ATOM 608   O O    . LEU A 1 40 ? 12.928  1.714   -5.735  1.00 0.00 ? 44 LEU A O    1  
ATOM 609   C CB   . LEU A 1 40 ? 14.047  -1.238  -4.657  1.00 0.00 ? 44 LEU A CB   1  
ATOM 610   C CG   . LEU A 1 40 ? 14.968  -1.761  -3.553  1.00 0.00 ? 44 LEU A CG   1  
ATOM 611   C CD1  . LEU A 1 40 ? 15.593  -3.100  -3.948  1.00 0.00 ? 44 LEU A CD1  1  
ATOM 612   C CD2  . LEU A 1 40 ? 16.027  -0.720  -3.184  1.00 0.00 ? 44 LEU A CD2  1  
ATOM 613   H H    . LEU A 1 40 ? 11.691  -0.969  -5.603  1.00 0.00 ? 44 LEU A H    1  
ATOM 614   H HA   . LEU A 1 40 ? 13.003  -0.162  -3.151  1.00 0.00 ? 44 LEU A HA   1  
ATOM 615   H HB2  . LEU A 1 40 ? 13.494  -2.081  -5.071  1.00 0.00 ? 44 LEU A HB2  1  
ATOM 616   H HB3  . LEU A 1 40 ? 14.667  -0.838  -5.460  1.00 0.00 ? 44 LEU A HB3  1  
ATOM 617   H HG   . LEU A 1 40 ? 14.366  -1.937  -2.661  1.00 0.00 ? 44 LEU A HG   1  
ATOM 618   H HD11 . LEU A 1 40 ? 14.804  -3.816  -4.177  1.00 0.00 ? 44 LEU A HD11 1  
ATOM 619   H HD12 . LEU A 1 40 ? 16.224  -2.961  -4.826  1.00 0.00 ? 44 LEU A HD12 1  
ATOM 620   H HD13 . LEU A 1 40 ? 16.197  -3.476  -3.122  1.00 0.00 ? 44 LEU A HD13 1  
ATOM 621   H HD21 . LEU A 1 40 ? 16.180  -0.043  -4.025  1.00 0.00 ? 44 LEU A HD21 1  
ATOM 622   H HD22 . LEU A 1 40 ? 15.691  -0.152  -2.316  1.00 0.00 ? 44 LEU A HD22 1  
ATOM 623   H HD23 . LEU A 1 40 ? 16.964  -1.224  -2.948  1.00 0.00 ? 44 LEU A HD23 1  
ATOM 624   N N    . LYS A 1 41 ? 14.290  1.879   -3.937  1.00 0.00 ? 45 LYS A N    1  
ATOM 625   C CA   . LYS A 1 41 ? 14.739  3.223   -4.261  1.00 0.00 ? 45 LYS A CA   1  
ATOM 626   C C    . LYS A 1 41 ? 15.768  3.154   -5.392  1.00 0.00 ? 45 LYS A C    1  
ATOM 627   O O    . LYS A 1 41 ? 16.277  4.182   -5.836  1.00 0.00 ? 45 LYS A O    1  
ATOM 628   C CB   . LYS A 1 41 ? 15.250  3.934   -3.007  1.00 0.00 ? 45 LYS A CB   1  
ATOM 629   C CG   . LYS A 1 41 ? 15.542  5.409   -3.293  1.00 0.00 ? 45 LYS A CG   1  
ATOM 630   C CD   . LYS A 1 41 ? 17.033  5.633   -3.552  1.00 0.00 ? 45 LYS A CD   1  
ATOM 631   C CE   . LYS A 1 41 ? 17.572  6.778   -2.692  1.00 0.00 ? 45 LYS A CE   1  
ATOM 632   N NZ   . LYS A 1 41 ? 18.147  7.841   -3.547  1.00 0.00 ? 45 LYS A NZ   1  
ATOM 633   H H    . LYS A 1 41 ? 14.686  1.491   -3.105  1.00 0.00 ? 45 LYS A H    1  
ATOM 634   H HA   . LYS A 1 41 ? 13.872  3.780   -4.617  1.00 0.00 ? 45 LYS A HA   1  
ATOM 635   H HB2  . LYS A 1 41 ? 14.510  3.854   -2.211  1.00 0.00 ? 45 LYS A HB2  1  
ATOM 636   H HB3  . LYS A 1 41 ? 16.156  3.443   -2.650  1.00 0.00 ? 45 LYS A HB3  1  
ATOM 637   H HG2  . LYS A 1 41 ? 14.965  5.736   -4.158  1.00 0.00 ? 45 LYS A HG2  1  
ATOM 638   H HG3  . LYS A 1 41 ? 15.220  6.017   -2.448  1.00 0.00 ? 45 LYS A HG3  1  
ATOM 639   H HD2  . LYS A 1 41 ? 17.585  4.719   -3.334  1.00 0.00 ? 45 LYS A HD2  1  
ATOM 640   H HD3  . LYS A 1 41 ? 17.193  5.858   -4.606  1.00 0.00 ? 45 LYS A HD3  1  
ATOM 641   H HE2  . LYS A 1 41 ? 16.770  7.190   -2.080  1.00 0.00 ? 45 LYS A HE2  1  
ATOM 642   H HE3  . LYS A 1 41 ? 18.333  6.401   -2.010  1.00 0.00 ? 45 LYS A HE3  1  
ATOM 643   H HZ1  . LYS A 1 41 ? 18.821  7.441   -4.169  1.00 0.00 ? 45 LYS A HZ1  1  
ATOM 644   H HZ2  . LYS A 1 41 ? 17.418  8.272   -4.079  1.00 0.00 ? 45 LYS A HZ2  1  
ATOM 645   H HZ3  . LYS A 1 41 ? 18.591  8.528   -2.972  1.00 0.00 ? 45 LYS A HZ3  1  
ATOM 646   N N    . ASN A 1 42 ? 16.043  1.932   -5.824  1.00 0.00 ? 46 ASN A N    1  
ATOM 647   C CA   . ASN A 1 42 ? 17.002  1.715   -6.894  1.00 0.00 ? 46 ASN A CA   1  
ATOM 648   C C    . ASN A 1 42 ? 16.252  1.401   -8.190  1.00 0.00 ? 46 ASN A C    1  
ATOM 649   O O    . ASN A 1 42 ? 16.856  1.328   -9.259  1.00 0.00 ? 46 ASN A O    1  
ATOM 650   C CB   . ASN A 1 42 ? 17.920  0.532   -6.580  1.00 0.00 ? 46 ASN A CB   1  
ATOM 651   C CG   . ASN A 1 42 ? 18.178  -0.309  -7.832  1.00 0.00 ? 46 ASN A CG   1  
ATOM 652   O OD1  . ASN A 1 42 ? 18.785  0.133   -8.794  1.00 0.00 ? 46 ASN A OD1  1  
ATOM 653   N ND2  . ASN A 1 42 ? 17.685  -1.542  -7.767  1.00 0.00 ? 46 ASN A ND2  1  
ATOM 654   H H    . ASN A 1 42 ? 15.624  1.101   -5.457  1.00 0.00 ? 46 ASN A H    1  
ATOM 655   H HA   . ASN A 1 42 ? 17.574  2.641   -6.958  1.00 0.00 ? 46 ASN A HA   1  
ATOM 656   H HB2  . ASN A 1 42 ? 18.866  0.897   -6.181  1.00 0.00 ? 46 ASN A HB2  1  
ATOM 657   H HB3  . ASN A 1 42 ? 17.466  -0.089  -5.808  1.00 0.00 ? 46 ASN A HB3  1  
ATOM 658   H HD21 . ASN A 1 42 ? 17.197  -1.843  -6.947  1.00 0.00 ? 46 ASN A HD21 1  
ATOM 659   H HD22 . ASN A 1 42 ? 17.803  -2.169  -8.537  1.00 0.00 ? 46 ASN A HD22 1  
ATOM 660   N N    . GLY A 1 43 ? 14.946  1.223   -8.052  1.00 0.00 ? 47 GLY A N    1  
ATOM 661   C CA   . GLY A 1 43 ? 14.107  0.918   -9.198  1.00 0.00 ? 47 GLY A CA   1  
ATOM 662   C C    . GLY A 1 43 ? 13.637  -0.537  -9.162  1.00 0.00 ? 47 GLY A C    1  
ATOM 663   O O    . GLY A 1 43 ? 12.842  -0.958  -10.001 1.00 0.00 ? 47 GLY A O    1  
ATOM 664   H H    . GLY A 1 43 ? 14.463  1.284   -7.179  1.00 0.00 ? 47 GLY A H    1  
ATOM 665   H HA2  . GLY A 1 43 ? 13.243  1.583   -9.208  1.00 0.00 ? 47 GLY A HA2  1  
ATOM 666   H HA3  . GLY A 1 43 ? 14.661  1.103   -10.118 1.00 0.00 ? 47 GLY A HA3  1  
ATOM 667   N N    . GLN A 1 44 ? 14.148  -1.267  -8.181  1.00 0.00 ? 48 GLN A N    1  
ATOM 668   C CA   . GLN A 1 44 ? 13.791  -2.666  -8.025  1.00 0.00 ? 48 GLN A CA   1  
ATOM 669   C C    . GLN A 1 44 ? 12.542  -2.801  -7.152  1.00 0.00 ? 48 GLN A C    1  
ATOM 670   O O    . GLN A 1 44 ? 11.907  -1.803  -6.812  1.00 0.00 ? 48 GLN A O    1  
ATOM 671   C CB   . GLN A 1 44 ? 14.956  -3.468  -7.441  1.00 0.00 ? 48 GLN A CB   1  
ATOM 672   C CG   . GLN A 1 44 ? 15.834  -4.048  -8.552  1.00 0.00 ? 48 GLN A CG   1  
ATOM 673   C CD   . GLN A 1 44 ? 16.934  -4.940  -7.973  1.00 0.00 ? 48 GLN A CD   1  
ATOM 674   O OE1  . GLN A 1 44 ? 16.852  -5.424  -6.856  1.00 0.00 ? 48 GLN A OE1  1  
ATOM 675   N NE2  . GLN A 1 44 ? 17.964  -5.129  -8.792  1.00 0.00 ? 48 GLN A NE2  1  
ATOM 676   H H    . GLN A 1 44 ? 14.795  -0.917  -7.503  1.00 0.00 ? 48 GLN A H    1  
ATOM 677   H HA   . GLN A 1 44 ? 13.579  -3.025  -9.032  1.00 0.00 ? 48 GLN A HA   1  
ATOM 678   H HB2  . GLN A 1 44 ? 15.557  -2.826  -6.796  1.00 0.00 ? 48 GLN A HB2  1  
ATOM 679   H HB3  . GLN A 1 44 ? 14.571  -4.275  -6.818  1.00 0.00 ? 48 GLN A HB3  1  
ATOM 680   H HG2  . GLN A 1 44 ? 15.218  -4.625  -9.243  1.00 0.00 ? 48 GLN A HG2  1  
ATOM 681   H HG3  . GLN A 1 44 ? 16.282  -3.237  -9.127  1.00 0.00 ? 48 GLN A HG3  1  
ATOM 682   H HE21 . GLN A 1 44 ? 17.969  -4.703  -9.697  1.00 0.00 ? 48 GLN A HE21 1  
ATOM 683   H HE22 . GLN A 1 44 ? 18.734  -5.698  -8.504  1.00 0.00 ? 48 GLN A HE22 1  
ATOM 684   N N    . LYS A 1 45 ? 12.225  -4.042  -6.815  1.00 0.00 ? 49 LYS A N    1  
ATOM 685   C CA   . LYS A 1 45 ? 11.063  -4.320  -5.988  1.00 0.00 ? 49 LYS A CA   1  
ATOM 686   C C    . LYS A 1 45 ? 11.368  -5.504  -5.068  1.00 0.00 ? 49 LYS A C    1  
ATOM 687   O O    . LYS A 1 45 ? 12.085  -6.426  -5.454  1.00 0.00 ? 49 LYS A O    1  
ATOM 688   C CB   . LYS A 1 45 ? 9.822   -4.522  -6.859  1.00 0.00 ? 49 LYS A CB   1  
ATOM 689   C CG   . LYS A 1 45 ? 9.604   -3.326  -7.790  1.00 0.00 ? 49 LYS A CG   1  
ATOM 690   C CD   . LYS A 1 45 ? 8.402   -3.557  -8.707  1.00 0.00 ? 49 LYS A CD   1  
ATOM 691   C CE   . LYS A 1 45 ? 7.348   -2.465  -8.514  1.00 0.00 ? 49 LYS A CE   1  
ATOM 692   N NZ   . LYS A 1 45 ? 6.064   -2.870  -9.128  1.00 0.00 ? 49 LYS A NZ   1  
ATOM 693   H H    . LYS A 1 45 ? 12.746  -4.848  -7.095  1.00 0.00 ? 49 LYS A H    1  
ATOM 694   H HA   . LYS A 1 45 ? 10.884  -3.440  -5.370  1.00 0.00 ? 49 LYS A HA   1  
ATOM 695   H HB2  . LYS A 1 45 ? 9.931   -5.431  -7.450  1.00 0.00 ? 49 LYS A HB2  1  
ATOM 696   H HB3  . LYS A 1 45 ? 8.946   -4.657  -6.225  1.00 0.00 ? 49 LYS A HB3  1  
ATOM 697   H HG2  . LYS A 1 45 ? 9.447   -2.424  -7.198  1.00 0.00 ? 49 LYS A HG2  1  
ATOM 698   H HG3  . LYS A 1 45 ? 10.499  -3.161  -8.391  1.00 0.00 ? 49 LYS A HG3  1  
ATOM 699   H HD2  . LYS A 1 45 ? 8.730   -3.570  -9.746  1.00 0.00 ? 49 LYS A HD2  1  
ATOM 700   H HD3  . LYS A 1 45 ? 7.963   -4.532  -8.499  1.00 0.00 ? 49 LYS A HD3  1  
ATOM 701   H HE2  . LYS A 1 45 ? 7.204   -2.274  -7.450  1.00 0.00 ? 49 LYS A HE2  1  
ATOM 702   H HE3  . LYS A 1 45 ? 7.694   -1.533  -8.961  1.00 0.00 ? 49 LYS A HE3  1  
ATOM 703   H HZ1  . LYS A 1 45 ? 6.220   -3.143  -10.078 1.00 0.00 ? 49 LYS A HZ1  1  
ATOM 704   H HZ2  . LYS A 1 45 ? 5.678   -3.640  -8.619  1.00 0.00 ? 49 LYS A HZ2  1  
ATOM 705   H HZ3  . LYS A 1 45 ? 5.425   -2.101  -9.104  1.00 0.00 ? 49 LYS A HZ3  1  
ATOM 706   N N    . ALA A 1 46 ? 10.808  -5.440  -3.869  1.00 0.00 ? 50 ALA A N    1  
ATOM 707   C CA   . ALA A 1 46 ? 11.011  -6.496  -2.891  1.00 0.00 ? 50 ALA A CA   1  
ATOM 708   C C    . ALA A 1 46 ? 9.661   -6.900  -2.296  1.00 0.00 ? 50 ALA A C    1  
ATOM 709   O O    . ALA A 1 46 ? 9.040   -6.124  -1.572  1.00 0.00 ? 50 ALA A O    1  
ATOM 710   C CB   . ALA A 1 46 ? 11.999  -6.020  -1.824  1.00 0.00 ? 50 ALA A CB   1  
ATOM 711   H H    . ALA A 1 46 ? 10.226  -4.687  -3.563  1.00 0.00 ? 50 ALA A H    1  
ATOM 712   H HA   . ALA A 1 46 ? 11.441  -7.352  -3.411  1.00 0.00 ? 50 ALA A HA   1  
ATOM 713   H HB1  . ALA A 1 46 ? 12.215  -4.962  -1.975  1.00 0.00 ? 50 ALA A HB1  1  
ATOM 714   H HB2  . ALA A 1 46 ? 11.564  -6.165  -0.836  1.00 0.00 ? 50 ALA A HB2  1  
ATOM 715   H HB3  . ALA A 1 46 ? 12.922  -6.594  -1.903  1.00 0.00 ? 50 ALA A HB3  1  
ATOM 716   N N    . CYS A 1 47 ? 9.246   -8.115  -2.625  1.00 0.00 ? 51 CYS A N    1  
ATOM 717   C CA   . CYS A 1 47 ? 7.980   -8.632  -2.132  1.00 0.00 ? 51 CYS A CA   1  
ATOM 718   C C    . CYS A 1 47 ? 8.122   -8.899  -0.632  1.00 0.00 ? 51 CYS A C    1  
ATOM 719   O O    . CYS A 1 47 ? 9.137   -9.430  -0.186  1.00 0.00 ? 51 CYS A O    1  
ATOM 720   C CB   . CYS A 1 47 ? 7.545   -9.884  -2.896  1.00 0.00 ? 51 CYS A CB   1  
ATOM 721   S SG   . CYS A 1 47 ? 6.638   -9.558  -4.451  1.00 0.00 ? 51 CYS A SG   1  
ATOM 722   H H    . CYS A 1 47 ? 9.757   -8.740  -3.215  1.00 0.00 ? 51 CYS A H    1  
ATOM 723   H HA   . CYS A 1 47 ? 7.233   -7.861  -2.320  1.00 0.00 ? 51 CYS A HA   1  
ATOM 724   H HB2  . CYS A 1 47 ? 8.430   -10.479 -3.126  1.00 0.00 ? 51 CYS A HB2  1  
ATOM 725   H HB3  . CYS A 1 47 ? 6.915   -10.490 -2.244  1.00 0.00 ? 51 CYS A HB3  1  
ATOM 726   N N    . LEU A 1 48 ? 7.088   -8.518  0.104   1.00 0.00 ? 52 LEU A N    1  
ATOM 727   C CA   . LEU A 1 48 ? 7.085   -8.709  1.544   1.00 0.00 ? 52 LEU A CA   1  
ATOM 728   C C    . LEU A 1 48 ? 6.160   -9.876  1.897   1.00 0.00 ? 52 LEU A C    1  
ATOM 729   O O    . LEU A 1 48 ? 5.346   -10.297 1.077   1.00 0.00 ? 52 LEU A O    1  
ATOM 730   C CB   . LEU A 1 48 ? 6.727   -7.404  2.257   1.00 0.00 ? 52 LEU A CB   1  
ATOM 731   C CG   . LEU A 1 48 ? 7.706   -6.244  2.065   1.00 0.00 ? 52 LEU A CG   1  
ATOM 732   C CD1  . LEU A 1 48 ? 7.073   -4.916  2.484   1.00 0.00 ? 52 LEU A CD1  1  
ATOM 733   C CD2  . LEU A 1 48 ? 9.021   -6.509  2.801   1.00 0.00 ? 52 LEU A CD2  1  
ATOM 734   H H    . LEU A 1 48 ? 6.266   -8.086  -0.267  1.00 0.00 ? 52 LEU A H    1  
ATOM 735   H HA   . LEU A 1 48 ? 8.100   -8.971  1.842   1.00 0.00 ? 52 LEU A HA   1  
ATOM 736   H HB2  . LEU A 1 48 ? 5.743   -7.083  1.914   1.00 0.00 ? 52 LEU A HB2  1  
ATOM 737   H HB3  . LEU A 1 48 ? 6.641   -7.607  3.325   1.00 0.00 ? 52 LEU A HB3  1  
ATOM 738   H HG   . LEU A 1 48 ? 7.941   -6.168  1.003   1.00 0.00 ? 52 LEU A HG   1  
ATOM 739   H HD11 . LEU A 1 48 ? 6.761   -4.975  3.526   1.00 0.00 ? 52 LEU A HD11 1  
ATOM 740   H HD12 . LEU A 1 48 ? 7.801   -4.113  2.367   1.00 0.00 ? 52 LEU A HD12 1  
ATOM 741   H HD13 . LEU A 1 48 ? 6.205   -4.713  1.856   1.00 0.00 ? 52 LEU A HD13 1  
ATOM 742   H HD21 . LEU A 1 48 ? 9.028   -7.533  3.176   1.00 0.00 ? 52 LEU A HD21 1  
ATOM 743   H HD22 . LEU A 1 48 ? 9.856   -6.368  2.115   1.00 0.00 ? 52 LEU A HD22 1  
ATOM 744   H HD23 . LEU A 1 48 ? 9.116   -5.815  3.636   1.00 0.00 ? 52 LEU A HD23 1  
ATOM 745   N N    . ASN A 1 49 ? 6.317   -10.365 3.118   1.00 0.00 ? 53 ASN A N    1  
ATOM 746   C CA   . ASN A 1 49 ? 5.506   -11.475 3.590   1.00 0.00 ? 53 ASN A CA   1  
ATOM 747   C C    . ASN A 1 49 ? 4.342   -10.933 4.423   1.00 0.00 ? 53 ASN A C    1  
ATOM 748   O O    . ASN A 1 49 ? 4.546   -10.431 5.527   1.00 0.00 ? 53 ASN A O    1  
ATOM 749   C CB   . ASN A 1 49 ? 6.323   -12.417 4.476   1.00 0.00 ? 53 ASN A CB   1  
ATOM 750   C CG   . ASN A 1 49 ? 5.804   -13.853 4.375   1.00 0.00 ? 53 ASN A CG   1  
ATOM 751   O OD1  . ASN A 1 49 ? 5.419   -14.328 3.320   1.00 0.00 ? 53 ASN A OD1  1  
ATOM 752   N ND2  . ASN A 1 49 ? 5.815   -14.514 5.529   1.00 0.00 ? 53 ASN A ND2  1  
ATOM 753   H H    . ASN A 1 49 ? 6.981   -10.016 3.779   1.00 0.00 ? 53 ASN A H    1  
ATOM 754   H HA   . ASN A 1 49 ? 5.170   -11.987 2.688   1.00 0.00 ? 53 ASN A HA   1  
ATOM 755   H HB2  . ASN A 1 49 ? 7.371   -12.383 4.178   1.00 0.00 ? 53 ASN A HB2  1  
ATOM 756   H HB3  . ASN A 1 49 ? 6.275   -12.081 5.512   1.00 0.00 ? 53 ASN A HB3  1  
ATOM 757   H HD21 . ASN A 1 49 ? 6.144   -14.065 6.360   1.00 0.00 ? 53 ASN A HD21 1  
ATOM 758   H HD22 . ASN A 1 49 ? 5.495   -15.460 5.566   1.00 0.00 ? 53 ASN A HD22 1  
ATOM 759   N N    . PRO A 1 50 ? 3.116   -11.057 3.847   1.00 0.00 ? 54 PRO A N    1  
ATOM 760   C CA   . PRO A 1 50 ? 1.920   -10.586 4.524   1.00 0.00 ? 54 PRO A CA   1  
ATOM 761   C C    . PRO A 1 50 ? 1.522   -11.534 5.657   1.00 0.00 ? 54 PRO A C    1  
ATOM 762   O O    . PRO A 1 50 ? 0.361   -11.925 5.765   1.00 0.00 ? 54 PRO A O    1  
ATOM 763   C CB   . PRO A 1 50 ? 0.865   -10.486 3.435   1.00 0.00 ? 54 PRO A CB   1  
ATOM 764   C CG   . PRO A 1 50 ? 1.371   -11.342 2.285   1.00 0.00 ? 54 PRO A CG   1  
ATOM 765   C CD   . PRO A 1 50 ? 2.838   -11.647 2.541   1.00 0.00 ? 54 PRO A CD   1  
ATOM 766   H HA   . PRO A 1 50 ? 2.092   -9.700  4.956   1.00 0.00 ? 54 PRO A HA   1  
ATOM 767   H HB2  . PRO A 1 50 ? -0.101  -10.843 3.793   1.00 0.00 ? 54 PRO A HB2  1  
ATOM 768   H HB3  . PRO A 1 50 ? 0.725   -9.452  3.120   1.00 0.00 ? 54 PRO A HB3  1  
ATOM 769   H HG2  . PRO A 1 50 ? 0.795   -12.265 2.214   1.00 0.00 ? 54 PRO A HG2  1  
ATOM 770   H HG3  . PRO A 1 50 ? 1.250   -10.817 1.337   1.00 0.00 ? 54 PRO A HG3  1  
ATOM 771   H HD2  . PRO A 1 50 ? 3.024   -12.721 2.543   1.00 0.00 ? 54 PRO A HD2  1  
ATOM 772   H HD3  . PRO A 1 50 ? 3.473   -11.215 1.768   1.00 0.00 ? 54 PRO A HD3  1  
ATOM 773   N N    . ALA A 1 51 ? 2.508   -11.876 6.473   1.00 0.00 ? 55 ALA A N    1  
ATOM 774   C CA   . ALA A 1 51 ? 2.276   -12.771 7.594   1.00 0.00 ? 55 ALA A CA   1  
ATOM 775   C C    . ALA A 1 51 ? 3.455   -12.684 8.564   1.00 0.00 ? 55 ALA A C    1  
ATOM 776   O O    . ALA A 1 51 ? 3.773   -13.655 9.250   1.00 0.00 ? 55 ALA A O    1  
ATOM 777   C CB   . ALA A 1 51 ? 2.051   -14.193 7.075   1.00 0.00 ? 55 ALA A CB   1  
ATOM 778   H H    . ALA A 1 51 ? 3.450   -11.554 6.378   1.00 0.00 ? 55 ALA A H    1  
ATOM 779   H HA   . ALA A 1 51 ? 1.372   -12.437 8.103   1.00 0.00 ? 55 ALA A HA   1  
ATOM 780   H HB1  . ALA A 1 51 ? 1.627   -14.150 6.071   1.00 0.00 ? 55 ALA A HB1  1  
ATOM 781   H HB2  . ALA A 1 51 ? 1.364   -14.718 7.738   1.00 0.00 ? 55 ALA A HB2  1  
ATOM 782   H HB3  . ALA A 1 51 ? 3.003   -14.723 7.044   1.00 0.00 ? 55 ALA A HB3  1  
ATOM 783   N N    . SER A 1 52 ? 4.073   -11.512 8.591   1.00 0.00 ? 56 SER A N    1  
ATOM 784   C CA   . SER A 1 52 ? 5.211   -11.286 9.466   1.00 0.00 ? 56 SER A CA   1  
ATOM 785   C C    . SER A 1 52 ? 4.965   -10.051 10.335  1.00 0.00 ? 56 SER A C    1  
ATOM 786   O O    . SER A 1 52 ? 4.312   -9.103  9.902   1.00 0.00 ? 56 SER A O    1  
ATOM 787   C CB   . SER A 1 52 ? 6.501   -11.120 8.660   1.00 0.00 ? 56 SER A CB   1  
ATOM 788   O OG   . SER A 1 52 ? 7.574   -10.639 9.464   1.00 0.00 ? 56 SER A OG   1  
ATOM 789   H H    . SER A 1 52 ? 3.808   -10.728 8.030   1.00 0.00 ? 56 SER A H    1  
ATOM 790   H HA   . SER A 1 52 ? 5.282   -12.181 10.084  1.00 0.00 ? 56 SER A HA   1  
ATOM 791   H HB2  . SER A 1 52 ? 6.779   -12.078 8.219   1.00 0.00 ? 56 SER A HB2  1  
ATOM 792   H HB3  . SER A 1 52 ? 6.327   -10.429 7.836   1.00 0.00 ? 56 SER A HB3  1  
ATOM 793   H HG   . SER A 1 52 ? 8.445   -10.987 9.116   1.00 0.00 ? 56 SER A HG   1  
ATOM 794   N N    . PRO A 1 53 ? 5.516   -10.104 11.577  1.00 0.00 ? 57 PRO A N    1  
ATOM 795   C CA   . PRO A 1 53 ? 5.363   -9.001  12.511  1.00 0.00 ? 57 PRO A CA   1  
ATOM 796   C C    . PRO A 1 53 ? 6.264   -7.826  12.124  1.00 0.00 ? 57 PRO A C    1  
ATOM 797   O O    . PRO A 1 53 ? 6.070   -6.708  12.599  1.00 0.00 ? 57 PRO A O    1  
ATOM 798   C CB   . PRO A 1 53 ? 5.703   -9.587  13.872  1.00 0.00 ? 57 PRO A CB   1  
ATOM 799   C CG   . PRO A 1 53 ? 6.479   -10.864 13.593  1.00 0.00 ? 57 PRO A CG   1  
ATOM 800   C CD   . PRO A 1 53 ? 6.295   -11.210 12.124  1.00 0.00 ? 57 PRO A CD   1  
ATOM 801   H HA   . PRO A 1 53 ? 4.427   -8.649  12.483  1.00 0.00 ? 57 PRO A HA   1  
ATOM 802   H HB2  . PRO A 1 53 ? 6.298   -8.889  14.460  1.00 0.00 ? 57 PRO A HB2  1  
ATOM 803   H HB3  . PRO A 1 53 ? 4.799   -9.797  14.444  1.00 0.00 ? 57 PRO A HB3  1  
ATOM 804   H HG2  . PRO A 1 53 ? 7.536   -10.727 13.823  1.00 0.00 ? 57 PRO A HG2  1  
ATOM 805   H HG3  . PRO A 1 53 ? 6.118   -11.676 14.225  1.00 0.00 ? 57 PRO A HG3  1  
ATOM 806   H HD2  . PRO A 1 53 ? 7.255   -11.308 11.617  1.00 0.00 ? 57 PRO A HD2  1  
ATOM 807   H HD3  . PRO A 1 53 ? 5.774   -12.160 12.004  1.00 0.00 ? 57 PRO A HD3  1  
ATOM 808   N N    . MET A 1 54 ? 7.229   -8.120  11.266  1.00 0.00 ? 58 MET A N    1  
ATOM 809   C CA   . MET A 1 54 ? 8.161   -7.102  10.810  1.00 0.00 ? 58 MET A CA   1  
ATOM 810   C C    . MET A 1 54 ? 7.682   -6.467  9.503   1.00 0.00 ? 58 MET A C    1  
ATOM 811   O O    . MET A 1 54 ? 8.029   -5.327  9.199   1.00 0.00 ? 58 MET A O    1  
ATOM 812   C CB   . MET A 1 54 ? 9.540   -7.730  10.598  1.00 0.00 ? 58 MET A CB   1  
ATOM 813   C CG   . MET A 1 54 ? 10.645  -6.679  10.721  1.00 0.00 ? 58 MET A CG   1  
ATOM 814   S SD   . MET A 1 54 ? 10.657  -5.997  12.371  1.00 0.00 ? 58 MET A SD   1  
ATOM 815   C CE   . MET A 1 54 ? 10.561  -7.500  13.329  1.00 0.00 ? 58 MET A CE   1  
ATOM 816   H H    . MET A 1 54 ? 7.380   -9.032  10.885  1.00 0.00 ? 58 MET A H    1  
ATOM 817   H HA   . MET A 1 54 ? 8.184   -6.351  11.600  1.00 0.00 ? 58 MET A HA   1  
ATOM 818   H HB2  . MET A 1 54 ? 9.700   -8.520  11.331  1.00 0.00 ? 58 MET A HB2  1  
ATOM 819   H HB3  . MET A 1 54 ? 9.584   -8.195  9.613   1.00 0.00 ? 58 MET A HB3  1  
ATOM 820   H HG2  . MET A 1 54 ? 11.612  -7.129  10.498  1.00 0.00 ? 58 MET A HG2  1  
ATOM 821   H HG3  . MET A 1 54 ? 10.487  -5.885  9.992   1.00 0.00 ? 58 MET A HG3  1  
ATOM 822   H HE1  . MET A 1 54 ? 11.249  -8.238  12.916  1.00 0.00 ? 58 MET A HE1  1  
ATOM 823   H HE2  . MET A 1 54 ? 10.832  -7.289  14.363  1.00 0.00 ? 58 MET A HE2  1  
ATOM 824   H HE3  . MET A 1 54 ? 9.544   -7.890  13.291  1.00 0.00 ? 58 MET A HE3  1  
ATOM 825   N N    . VAL A 1 55 ? 6.891   -7.233  8.765   1.00 0.00 ? 59 VAL A N    1  
ATOM 826   C CA   . VAL A 1 55 ? 6.361   -6.759  7.498   1.00 0.00 ? 59 VAL A CA   1  
ATOM 827   C C    . VAL A 1 55 ? 5.296   -5.693  7.762   1.00 0.00 ? 59 VAL A C    1  
ATOM 828   O O    . VAL A 1 55 ? 4.913   -4.955  6.855   1.00 0.00 ? 59 VAL A O    1  
ATOM 829   C CB   . VAL A 1 55 ? 5.836   -7.939  6.677   1.00 0.00 ? 59 VAL A CB   1  
ATOM 830   C CG1  . VAL A 1 55 ? 4.831   -7.469  5.624   1.00 0.00 ? 59 VAL A CG1  1  
ATOM 831   C CG2  . VAL A 1 55 ? 6.987   -8.711  6.030   1.00 0.00 ? 59 VAL A CG2  1  
ATOM 832   H H    . VAL A 1 55 ? 6.613   -8.159  9.020   1.00 0.00 ? 59 VAL A H    1  
ATOM 833   H HA   . VAL A 1 55 ? 7.184   -6.304  6.947   1.00 0.00 ? 59 VAL A HA   1  
ATOM 834   H HB   . VAL A 1 55 ? 5.319   -8.616  7.356   1.00 0.00 ? 59 VAL A HB   1  
ATOM 835   H HG11 . VAL A 1 55 ? 5.274   -6.670  5.029   1.00 0.00 ? 59 VAL A HG11 1  
ATOM 836   H HG12 . VAL A 1 55 ? 4.569   -8.304  4.973   1.00 0.00 ? 59 VAL A HG12 1  
ATOM 837   H HG13 . VAL A 1 55 ? 3.933   -7.099  6.119   1.00 0.00 ? 59 VAL A HG13 1  
ATOM 838   H HG21 . VAL A 1 55 ? 7.772   -8.880  6.767   1.00 0.00 ? 59 VAL A HG21 1  
ATOM 839   H HG22 . VAL A 1 55 ? 6.621   -9.670  5.663   1.00 0.00 ? 59 VAL A HG22 1  
ATOM 840   H HG23 . VAL A 1 55 ? 7.390   -8.134  5.197   1.00 0.00 ? 59 VAL A HG23 1  
ATOM 841   N N    . LYS A 1 56 ? 4.847   -5.647  9.008   1.00 0.00 ? 60 LYS A N    1  
ATOM 842   C CA   . LYS A 1 56 ? 3.833   -4.684  9.402   1.00 0.00 ? 60 LYS A CA   1  
ATOM 843   C C    . LYS A 1 56 ? 4.507   -3.490  10.082  1.00 0.00 ? 60 LYS A C    1  
ATOM 844   O O    . LYS A 1 56 ? 3.831   -2.584  10.567  1.00 0.00 ? 60 LYS A O    1  
ATOM 845   C CB   . LYS A 1 56 ? 2.761   -5.356  10.262  1.00 0.00 ? 60 LYS A CB   1  
ATOM 846   C CG   . LYS A 1 56 ? 2.325   -6.689  9.651   1.00 0.00 ? 60 LYS A CG   1  
ATOM 847   C CD   . LYS A 1 56 ? 1.481   -6.466  8.394   1.00 0.00 ? 60 LYS A CD   1  
ATOM 848   C CE   . LYS A 1 56 ? 0.045   -6.082  8.759   1.00 0.00 ? 60 LYS A CE   1  
ATOM 849   N NZ   . LYS A 1 56 ? -0.094  -4.611  8.837   1.00 0.00 ? 60 LYS A NZ   1  
ATOM 850   H H    . LYS A 1 56 ? 5.164   -6.251  9.739   1.00 0.00 ? 60 LYS A H    1  
ATOM 851   H HA   . LYS A 1 56 ? 3.344   -4.333  8.494   1.00 0.00 ? 60 LYS A HA   1  
ATOM 852   H HB2  . LYS A 1 56 ? 3.147   -5.522  11.268  1.00 0.00 ? 60 LYS A HB2  1  
ATOM 853   H HB3  . LYS A 1 56 ? 1.899   -4.696  10.358  1.00 0.00 ? 60 LYS A HB3  1  
ATOM 854   H HG2  . LYS A 1 56 ? 3.203   -7.284  9.403   1.00 0.00 ? 60 LYS A HG2  1  
ATOM 855   H HG3  . LYS A 1 56 ? 1.751   -7.258  10.383  1.00 0.00 ? 60 LYS A HG3  1  
ATOM 856   H HD2  . LYS A 1 56 ? 1.928   -5.679  7.787   1.00 0.00 ? 60 LYS A HD2  1  
ATOM 857   H HD3  . LYS A 1 56 ? 1.477   -7.372  7.789   1.00 0.00 ? 60 LYS A HD3  1  
ATOM 858   H HE2  . LYS A 1 56 ? -0.644  -6.480  8.014   1.00 0.00 ? 60 LYS A HE2  1  
ATOM 859   H HE3  . LYS A 1 56 ? -0.226  -6.531  9.715   1.00 0.00 ? 60 LYS A HE3  1  
ATOM 860   H HZ1  . LYS A 1 56 ? 0.636   -4.178  8.308   1.00 0.00 ? 60 LYS A HZ1  1  
ATOM 861   H HZ2  . LYS A 1 56 ? -0.982  -4.340  8.465   1.00 0.00 ? 60 LYS A HZ2  1  
ATOM 862   H HZ3  . LYS A 1 56 ? -0.030  -4.321  9.792   1.00 0.00 ? 60 LYS A HZ3  1  
ATOM 863   N N    . LYS A 1 57 ? 5.832   -3.528  10.096  1.00 0.00 ? 61 LYS A N    1  
ATOM 864   C CA   . LYS A 1 57 ? 6.604   -2.460  10.708  1.00 0.00 ? 61 LYS A CA   1  
ATOM 865   C C    . LYS A 1 57 ? 7.455   -1.774  9.637   1.00 0.00 ? 61 LYS A C    1  
ATOM 866   O O    . LYS A 1 57 ? 7.969   -0.678  9.856   1.00 0.00 ? 61 LYS A O    1  
ATOM 867   C CB   . LYS A 1 57 ? 7.417   -2.996  11.888  1.00 0.00 ? 61 LYS A CB   1  
ATOM 868   C CG   . LYS A 1 57 ? 6.498   -3.463  13.019  1.00 0.00 ? 61 LYS A CG   1  
ATOM 869   C CD   . LYS A 1 57 ? 6.949   -2.891  14.364  1.00 0.00 ? 61 LYS A CD   1  
ATOM 870   C CE   . LYS A 1 57 ? 6.047   -3.380  15.499  1.00 0.00 ? 61 LYS A CE   1  
ATOM 871   N NZ   . LYS A 1 57 ? 4.734   -2.698  15.447  1.00 0.00 ? 61 LYS A NZ   1  
ATOM 872   H H    . LYS A 1 57 ? 6.374   -4.268  9.699   1.00 0.00 ? 61 LYS A H    1  
ATOM 873   H HA   . LYS A 1 57 ? 5.898   -1.733  11.106  1.00 0.00 ? 61 LYS A HA   1  
ATOM 874   H HB2  . LYS A 1 57 ? 8.043   -3.825  11.558  1.00 0.00 ? 61 LYS A HB2  1  
ATOM 875   H HB3  . LYS A 1 57 ? 8.086   -2.218  12.256  1.00 0.00 ? 61 LYS A HB3  1  
ATOM 876   H HG2  . LYS A 1 57 ? 5.474   -3.152  12.812  1.00 0.00 ? 61 LYS A HG2  1  
ATOM 877   H HG3  . LYS A 1 57 ? 6.497   -4.552  13.065  1.00 0.00 ? 61 LYS A HG3  1  
ATOM 878   H HD2  . LYS A 1 57 ? 7.980   -3.186  14.562  1.00 0.00 ? 61 LYS A HD2  1  
ATOM 879   H HD3  . LYS A 1 57 ? 6.932   -1.802  14.324  1.00 0.00 ? 61 LYS A HD3  1  
ATOM 880   H HE2  . LYS A 1 57 ? 5.906   -4.458  15.421  1.00 0.00 ? 61 LYS A HE2  1  
ATOM 881   H HE3  . LYS A 1 57 ? 6.525   -3.190  16.459  1.00 0.00 ? 61 LYS A HE3  1  
ATOM 882   H HZ1  . LYS A 1 57 ? 4.674   -2.153  14.611  1.00 0.00 ? 61 LYS A HZ1  1  
ATOM 883   H HZ2  . LYS A 1 57 ? 4.003   -3.381  15.453  1.00 0.00 ? 61 LYS A HZ2  1  
ATOM 884   H HZ3  . LYS A 1 57 ? 4.638   -2.100  16.243  1.00 0.00 ? 61 LYS A HZ3  1  
ATOM 885   N N    . ILE A 1 58 ? 7.577   -2.447  8.502   1.00 0.00 ? 62 ILE A N    1  
ATOM 886   C CA   . ILE A 1 58 ? 8.357   -1.915  7.397   1.00 0.00 ? 62 ILE A CA   1  
ATOM 887   C C    . ILE A 1 58 ? 7.430   -1.164  6.440   1.00 0.00 ? 62 ILE A C    1  
ATOM 888   O O    . ILE A 1 58 ? 7.890   -0.379  5.613   1.00 0.00 ? 62 ILE A O    1  
ATOM 889   C CB   . ILE A 1 58 ? 9.162   -3.029  6.725   1.00 0.00 ? 62 ILE A CB   1  
ATOM 890   C CG1  . ILE A 1 58 ? 10.033  -3.767  7.744   1.00 0.00 ? 62 ILE A CG1  1  
ATOM 891   C CG2  . ILE A 1 58 ? 9.985   -2.482  5.557   1.00 0.00 ? 62 ILE A CG2  1  
ATOM 892   C CD1  . ILE A 1 58 ? 10.243  -5.225  7.331   1.00 0.00 ? 62 ILE A CD1  1  
ATOM 893   H H    . ILE A 1 58 ? 7.156   -3.338  8.332   1.00 0.00 ? 62 ILE A H    1  
ATOM 894   H HA   . ILE A 1 58 ? 9.072   -1.206  7.813   1.00 0.00 ? 62 ILE A HA   1  
ATOM 895   H HB   . ILE A 1 58 ? 8.462   -3.756  6.313   1.00 0.00 ? 62 ILE A HB   1  
ATOM 896   H HG12 . ILE A 1 58 ? 10.998  -3.268  7.833   1.00 0.00 ? 62 ILE A HG12 1  
ATOM 897   H HG13 . ILE A 1 58 ? 9.562   -3.728  8.726   1.00 0.00 ? 62 ILE A HG13 1  
ATOM 898   H HG21 . ILE A 1 58 ? 10.477  -1.558  5.860   1.00 0.00 ? 62 ILE A HG21 1  
ATOM 899   H HG22 . ILE A 1 58 ? 10.738  -3.216  5.268   1.00 0.00 ? 62 ILE A HG22 1  
ATOM 900   H HG23 . ILE A 1 58 ? 9.328   -2.284  4.711   1.00 0.00 ? 62 ILE A HG23 1  
ATOM 901   H HD11 . ILE A 1 58 ? 10.545  -5.267  6.285   1.00 0.00 ? 62 ILE A HD11 1  
ATOM 902   H HD12 . ILE A 1 58 ? 11.022  -5.670  7.952   1.00 0.00 ? 62 ILE A HD12 1  
ATOM 903   H HD13 . ILE A 1 58 ? 9.314   -5.778  7.464   1.00 0.00 ? 62 ILE A HD13 1  
ATOM 904   N N    . ILE A 1 59 ? 6.140   -1.431  6.584   1.00 0.00 ? 63 ILE A N    1  
ATOM 905   C CA   . ILE A 1 59 ? 5.144   -0.789  5.743   1.00 0.00 ? 63 ILE A CA   1  
ATOM 906   C C    . ILE A 1 59 ? 4.613   0.459   6.450   1.00 0.00 ? 63 ILE A C    1  
ATOM 907   O O    . ILE A 1 59 ? 4.664   1.558   5.898   1.00 0.00 ? 63 ILE A O    1  
ATOM 908   C CB   . ILE A 1 59 ? 4.051   -1.786  5.352   1.00 0.00 ? 63 ILE A CB   1  
ATOM 909   C CG1  . ILE A 1 59 ? 4.549   -2.751  4.273   1.00 0.00 ? 63 ILE A CG1  1  
ATOM 910   C CG2  . ILE A 1 59 ? 2.774   -1.060  4.925   1.00 0.00 ? 63 ILE A CG2  1  
ATOM 911   C CD1  . ILE A 1 59 ? 3.814   -4.090  4.354   1.00 0.00 ? 63 ILE A CD1  1  
ATOM 912   H H    . ILE A 1 59 ? 5.774   -2.071  7.260   1.00 0.00 ? 63 ILE A H    1  
ATOM 913   H HA   . ILE A 1 59 ? 5.643   -0.481  4.824   1.00 0.00 ? 63 ILE A HA   1  
ATOM 914   H HB   . ILE A 1 59 ? 3.804   -2.384  6.229   1.00 0.00 ? 63 ILE A HB   1  
ATOM 915   H HG12 . ILE A 1 59 ? 4.400   -2.309  3.288   1.00 0.00 ? 63 ILE A HG12 1  
ATOM 916   H HG13 . ILE A 1 59 ? 5.620   -2.912  4.392   1.00 0.00 ? 63 ILE A HG13 1  
ATOM 917   H HG21 . ILE A 1 59 ? 3.019   -0.296  4.188   1.00 0.00 ? 63 ILE A HG21 1  
ATOM 918   H HG22 . ILE A 1 59 ? 2.077   -1.776  4.489   1.00 0.00 ? 63 ILE A HG22 1  
ATOM 919   H HG23 . ILE A 1 59 ? 2.315   -0.591  5.795   1.00 0.00 ? 63 ILE A HG23 1  
ATOM 920   H HD11 . ILE A 1 59 ? 3.039   -4.034  5.118   1.00 0.00 ? 63 ILE A HD11 1  
ATOM 921   H HD12 . ILE A 1 59 ? 3.357   -4.312  3.389   1.00 0.00 ? 63 ILE A HD12 1  
ATOM 922   H HD13 . ILE A 1 59 ? 4.521   -4.878  4.611   1.00 0.00 ? 63 ILE A HD13 1  
ATOM 923   N N    . GLU A 1 60 ? 4.116   0.249   7.660   1.00 0.00 ? 64 GLU A N    1  
ATOM 924   C CA   . GLU A 1 60 ? 3.576   1.344   8.447   1.00 0.00 ? 64 GLU A CA   1  
ATOM 925   C C    . GLU A 1 60 ? 4.596   2.480   8.546   1.00 0.00 ? 64 GLU A C    1  
ATOM 926   O O    . GLU A 1 60 ? 4.227   3.653   8.540   1.00 0.00 ? 64 GLU A O    1  
ATOM 927   C CB   . GLU A 1 60 ? 3.154   0.864   9.837   1.00 0.00 ? 64 GLU A CB   1  
ATOM 928   C CG   . GLU A 1 60 ? 1.974   -0.107  9.747   1.00 0.00 ? 64 GLU A CG   1  
ATOM 929   C CD   . GLU A 1 60 ? 1.855   -0.944  11.022  1.00 0.00 ? 64 GLU A CD   1  
ATOM 930   O OE1  . GLU A 1 60 ? 2.348   -0.464  12.065  1.00 0.00 ? 64 GLU A OE1  1  
ATOM 931   O OE2  . GLU A 1 60 ? 1.273   -2.046  10.924  1.00 0.00 ? 64 GLU A OE2  1  
ATOM 932   H H    . GLU A 1 60 ? 4.078   -0.648  8.101   1.00 0.00 ? 64 GLU A H    1  
ATOM 933   H HA   . GLU A 1 60 ? 2.694   1.685   7.904   1.00 0.00 ? 64 GLU A HA   1  
ATOM 934   H HB2  . GLU A 1 60 ? 3.995   0.374   10.328  1.00 0.00 ? 64 GLU A HB2  1  
ATOM 935   H HB3  . GLU A 1 60 ? 2.879   1.719   10.454  1.00 0.00 ? 64 GLU A HB3  1  
ATOM 936   H HG2  . GLU A 1 60 ? 1.052   0.451   9.587   1.00 0.00 ? 64 GLU A HG2  1  
ATOM 937   H HG3  . GLU A 1 60 ? 2.104   -0.763  8.887   1.00 0.00 ? 64 GLU A HG3  1  
ATOM 938   N N    . LYS A 1 61 ? 5.860   2.092   8.636   1.00 0.00 ? 65 LYS A N    1  
ATOM 939   C CA   . LYS A 1 61 ? 6.936   3.063   8.736   1.00 0.00 ? 65 LYS A CA   1  
ATOM 940   C C    . LYS A 1 61 ? 7.095   3.782   7.394   1.00 0.00 ? 65 LYS A C    1  
ATOM 941   O O    . LYS A 1 61 ? 7.341   4.986   7.357   1.00 0.00 ? 65 LYS A O    1  
ATOM 942   C CB   . LYS A 1 61 ? 8.219   2.392   9.230   1.00 0.00 ? 65 LYS A CB   1  
ATOM 943   C CG   . LYS A 1 61 ? 8.391   2.582   10.738  1.00 0.00 ? 65 LYS A CG   1  
ATOM 944   C CD   . LYS A 1 61 ? 9.869   2.723   11.108  1.00 0.00 ? 65 LYS A CD   1  
ATOM 945   C CE   . LYS A 1 61 ? 10.499  1.355   11.380  1.00 0.00 ? 65 LYS A CE   1  
ATOM 946   N NZ   . LYS A 1 61 ? 11.935  1.365   11.021  1.00 0.00 ? 65 LYS A NZ   1  
ATOM 947   H H    . LYS A 1 61 ? 6.152   1.135   8.640   1.00 0.00 ? 65 LYS A H    1  
ATOM 948   H HA   . LYS A 1 61 ? 6.645   3.796   9.488   1.00 0.00 ? 65 LYS A HA   1  
ATOM 949   H HB2  . LYS A 1 61 ? 8.192   1.328   8.994   1.00 0.00 ? 65 LYS A HB2  1  
ATOM 950   H HB3  . LYS A 1 61 ? 9.078   2.812   8.706   1.00 0.00 ? 65 LYS A HB3  1  
ATOM 951   H HG2  . LYS A 1 61 ? 7.846   3.468   11.061  1.00 0.00 ? 65 LYS A HG2  1  
ATOM 952   H HG3  . LYS A 1 61 ? 7.960   1.732   11.267  1.00 0.00 ? 65 LYS A HG3  1  
ATOM 953   H HD2  . LYS A 1 61 ? 10.405  3.219   10.298  1.00 0.00 ? 65 LYS A HD2  1  
ATOM 954   H HD3  . LYS A 1 61 ? 9.969   3.355   11.990  1.00 0.00 ? 65 LYS A HD3  1  
ATOM 955   H HE2  . LYS A 1 61 ? 10.383  1.098   12.432  1.00 0.00 ? 65 LYS A HE2  1  
ATOM 956   H HE3  . LYS A 1 61 ? 9.980   0.588   10.805  1.00 0.00 ? 65 LYS A HE3  1  
ATOM 957   H HZ1  . LYS A 1 61 ? 12.205  2.290   10.751  1.00 0.00 ? 65 LYS A HZ1  1  
ATOM 958   H HZ2  . LYS A 1 61 ? 12.478  1.077   11.810  1.00 0.00 ? 65 LYS A HZ2  1  
ATOM 959   H HZ3  . LYS A 1 61 ? 12.093  0.736   10.260  1.00 0.00 ? 65 LYS A HZ3  1  
ATOM 960   N N    . MET A 1 62 ? 6.947   3.012   6.326   1.00 0.00 ? 66 MET A N    1  
ATOM 961   C CA   . MET A 1 62 ? 7.071   3.560   4.986   1.00 0.00 ? 66 MET A CA   1  
ATOM 962   C C    . MET A 1 62 ? 6.109   4.732   4.782   1.00 0.00 ? 66 MET A C    1  
ATOM 963   O O    . MET A 1 62 ? 6.454   5.716   4.128   1.00 0.00 ? 66 MET A O    1  
ATOM 964   C CB   . MET A 1 62 ? 6.771   2.468   3.957   1.00 0.00 ? 66 MET A CB   1  
ATOM 965   C CG   . MET A 1 62 ? 7.983   2.213   3.059   1.00 0.00 ? 66 MET A CG   1  
ATOM 966   S SD   . MET A 1 62 ? 8.556   3.750   2.355   1.00 0.00 ? 66 MET A SD   1  
ATOM 967   C CE   . MET A 1 62 ? 7.310   4.000   1.101   1.00 0.00 ? 66 MET A CE   1  
ATOM 968   H H    . MET A 1 62 ? 6.747   2.033   6.365   1.00 0.00 ? 66 MET A H    1  
ATOM 969   H HA   . MET A 1 62 ? 8.101   3.909   4.906   1.00 0.00 ? 66 MET A HA   1  
ATOM 970   H HB2  . MET A 1 62 ? 6.494   1.547   4.470   1.00 0.00 ? 66 MET A HB2  1  
ATOM 971   H HB3  . MET A 1 62 ? 5.917   2.763   3.347   1.00 0.00 ? 66 MET A HB3  1  
ATOM 972   H HG2  . MET A 1 62 ? 8.783   1.748   3.636   1.00 0.00 ? 66 MET A HG2  1  
ATOM 973   H HG3  . MET A 1 62 ? 7.717   1.517   2.264   1.00 0.00 ? 66 MET A HG3  1  
ATOM 974   H HE1  . MET A 1 62 ? 6.834   3.048   0.867   1.00 0.00 ? 66 MET A HE1  1  
ATOM 975   H HE2  . MET A 1 62 ? 6.559   4.700   1.469   1.00 0.00 ? 66 MET A HE2  1  
ATOM 976   H HE3  . MET A 1 62 ? 7.775   4.405   0.203   1.00 0.00 ? 66 MET A HE3  1  
ATOM 977   N N    . LEU A 1 63 ? 4.922   4.588   5.353   1.00 0.00 ? 67 LEU A N    1  
ATOM 978   C CA   . LEU A 1 63 ? 3.908   5.623   5.241   1.00 0.00 ? 67 LEU A CA   1  
ATOM 979   C C    . LEU A 1 63 ? 4.366   6.865   6.009   1.00 0.00 ? 67 LEU A C    1  
ATOM 980   O O    . LEU A 1 63 ? 3.828   7.953   5.813   1.00 0.00 ? 67 LEU A O    1  
ATOM 981   C CB   . LEU A 1 63 ? 2.547   5.089   5.691   1.00 0.00 ? 67 LEU A CB   1  
ATOM 982   C CG   . LEU A 1 63 ? 1.801   4.216   4.680   1.00 0.00 ? 67 LEU A CG   1  
ATOM 983   C CD1  . LEU A 1 63 ? 2.676   3.053   4.209   1.00 0.00 ? 67 LEU A CD1  1  
ATOM 984   C CD2  . LEU A 1 63 ? 0.465   3.735   5.250   1.00 0.00 ? 67 LEU A CD2  1  
ATOM 985   H H    . LEU A 1 63 ? 4.650   3.785   5.882   1.00 0.00 ? 67 LEU A H    1  
ATOM 986   H HA   . LEU A 1 63 ? 3.820   5.882   4.186   1.00 0.00 ? 67 LEU A HA   1  
ATOM 987   H HB2  . LEU A 1 63 ? 2.689   4.511   6.605   1.00 0.00 ? 67 LEU A HB2  1  
ATOM 988   H HB3  . LEU A 1 63 ? 1.912   5.938   5.946   1.00 0.00 ? 67 LEU A HB3  1  
ATOM 989   H HG   . LEU A 1 63 ? 1.576   4.824   3.803   1.00 0.00 ? 67 LEU A HG   1  
ATOM 990   H HD11 . LEU A 1 63 ? 3.636   3.436   3.864   1.00 0.00 ? 67 LEU A HD11 1  
ATOM 991   H HD12 . LEU A 1 63 ? 2.837   2.361   5.037   1.00 0.00 ? 67 LEU A HD12 1  
ATOM 992   H HD13 . LEU A 1 63 ? 2.178   2.531   3.392   1.00 0.00 ? 67 LEU A HD13 1  
ATOM 993   H HD21 . LEU A 1 63 ? 0.067   4.489   5.929   1.00 0.00 ? 67 LEU A HD21 1  
ATOM 994   H HD22 . LEU A 1 63 ? -0.240  3.571   4.435   1.00 0.00 ? 67 LEU A HD22 1  
ATOM 995   H HD23 . LEU A 1 63 ? 0.617   2.802   5.792   1.00 0.00 ? 67 LEU A HD23 1  
ATOM 996   N N    . LYS A 1 64 ? 5.354   6.659   6.868   1.00 0.00 ? 68 LYS A N    1  
ATOM 997   C CA   . LYS A 1 64 ? 5.890   7.749   7.666   1.00 0.00 ? 68 LYS A CA   1  
ATOM 998   C C    . LYS A 1 64 ? 7.195   8.241   7.038   1.00 0.00 ? 68 LYS A C    1  
ATOM 999   O O    . LYS A 1 64 ? 7.551   9.411   7.173   1.00 0.00 ? 68 LYS A O    1  
ATOM 1000  C CB   . LYS A 1 64 ? 6.034   7.321   9.128   1.00 0.00 ? 68 LYS A CB   1  
ATOM 1001  C CG   . LYS A 1 64 ? 4.727   7.537   9.894   1.00 0.00 ? 68 LYS A CG   1  
ATOM 1002  C CD   . LYS A 1 64 ? 3.615   6.643   9.344   1.00 0.00 ? 68 LYS A CD   1  
ATOM 1003  C CE   . LYS A 1 64 ? 2.274   6.965   10.007  1.00 0.00 ? 68 LYS A CE   1  
ATOM 1004  N NZ   . LYS A 1 64 ? 1.316   5.855   9.805   1.00 0.00 ? 68 LYS A NZ   1  
ATOM 1005  H H    . LYS A 1 64 ? 5.785   5.771   7.022   1.00 0.00 ? 68 LYS A H    1  
ATOM 1006  H HA   . LYS A 1 64 ? 5.165   8.562   7.638   1.00 0.00 ? 68 LYS A HA   1  
ATOM 1007  H HB2  . LYS A 1 64 ? 6.319   6.270   9.178   1.00 0.00 ? 68 LYS A HB2  1  
ATOM 1008  H HB3  . LYS A 1 64 ? 6.835   7.890   9.600   1.00 0.00 ? 68 LYS A HB3  1  
ATOM 1009  H HG2  . LYS A 1 64 ? 4.882   7.323   10.951  1.00 0.00 ? 68 LYS A HG2  1  
ATOM 1010  H HG3  . LYS A 1 64 ? 4.428   8.583   9.821   1.00 0.00 ? 68 LYS A HG3  1  
ATOM 1011  H HD2  . LYS A 1 64 ? 3.533   6.779   8.265   1.00 0.00 ? 68 LYS A HD2  1  
ATOM 1012  H HD3  . LYS A 1 64 ? 3.867   5.596   9.515   1.00 0.00 ? 68 LYS A HD3  1  
ATOM 1013  H HE2  . LYS A 1 64 ? 2.421   7.137   11.073  1.00 0.00 ? 68 LYS A HE2  1  
ATOM 1014  H HE3  . LYS A 1 64 ? 1.866   7.885   9.588   1.00 0.00 ? 68 LYS A HE3  1  
ATOM 1015  H HZ1  . LYS A 1 64 ? 1.673   5.228   9.112   1.00 0.00 ? 68 LYS A HZ1  1  
ATOM 1016  H HZ2  . LYS A 1 64 ? 1.190   5.362   10.666  1.00 0.00 ? 68 LYS A HZ2  1  
ATOM 1017  H HZ3  . LYS A 1 64 ? 0.438   6.223   9.501   1.00 0.00 ? 68 LYS A HZ3  1  
ATOM 1018  N N    . ASN A 1 65 ? 7.874   7.324   6.364   1.00 0.00 ? 69 ASN A N    1  
ATOM 1019  C CA   . ASN A 1 65 ? 9.132   7.650   5.715   1.00 0.00 ? 69 ASN A CA   1  
ATOM 1020  C C    . ASN A 1 65 ? 10.148  8.087   6.772   1.00 0.00 ? 69 ASN A C    1  
ATOM 1021  O O    . ASN A 1 65 ? 11.023  7.312   7.155   1.00 0.00 ? 69 ASN A O    1  
ATOM 1022  C CB   . ASN A 1 65 ? 8.957   8.801   4.723   1.00 0.00 ? 69 ASN A CB   1  
ATOM 1023  C CG   . ASN A 1 65 ? 10.312  9.296   4.212   1.00 0.00 ? 69 ASN A CG   1  
ATOM 1024  O OD1  . ASN A 1 65 ? 11.131  8.540   3.715   1.00 0.00 ? 69 ASN A OD1  1  
ATOM 1025  N ND2  . ASN A 1 65 ? 10.502  10.604  4.362   1.00 0.00 ? 69 ASN A ND2  1  
ATOM 1026  H H    . ASN A 1 65 ? 7.577   6.374   6.259   1.00 0.00 ? 69 ASN A H    1  
ATOM 1027  H HA   . ASN A 1 65 ? 9.433   6.738   5.199   1.00 0.00 ? 69 ASN A HA   1  
ATOM 1028  H HB2  . ASN A 1 65 ? 8.346   8.472   3.882   1.00 0.00 ? 69 ASN A HB2  1  
ATOM 1029  H HB3  . ASN A 1 65 ? 8.423   9.622   5.202   1.00 0.00 ? 69 ASN A HB3  1  
ATOM 1030  H HD21 . ASN A 1 65 ? 9.789   11.168  4.779   1.00 0.00 ? 69 ASN A HD21 1  
ATOM 1031  H HD22 . ASN A 1 65 ? 11.358  11.023  4.059   1.00 0.00 ? 69 ASN A HD22 1  
ATOM 1032  N N    . GLY A 1 66 ? 9.998   9.328   7.214   1.00 0.00 ? 70 GLY A N    1  
ATOM 1033  C CA   . GLY A 1 66 ? 10.892  9.877   8.219   1.00 0.00 ? 70 GLY A CA   1  
ATOM 1034  C C    . GLY A 1 66 ? 12.053  10.631  7.567   1.00 0.00 ? 70 GLY A C    1  
ATOM 1035  O O    . GLY A 1 66 ? 11.876  11.746  7.077   1.00 0.00 ? 70 GLY A O    1  
ATOM 1036  H H    . GLY A 1 66 ? 9.283   9.951   6.897   1.00 0.00 ? 70 GLY A H    1  
ATOM 1037  H HA2  . GLY A 1 66 ? 10.338  10.550  8.874   1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1038  H HA3  . GLY A 1 66 ? 11.281  9.073   8.843   1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1039  N N    . LYS A 1 67 ? 13.214  9.993   7.582   1.00 0.00 ? 71 LYS A N    1  
ATOM 1040  C CA   . LYS A 1 67 ? 14.403  10.590  6.998   1.00 0.00 ? 71 LYS A CA   1  
ATOM 1041  C C    . LYS A 1 67 ? 14.265  10.606  5.475   1.00 0.00 ? 71 LYS A C    1  
ATOM 1042  O O    . LYS A 1 67 ? 13.202  10.293  4.941   1.00 0.00 ? 71 LYS A O    1  
ATOM 1043  C CB   . LYS A 1 67 ? 15.660  9.872   7.494   1.00 0.00 ? 71 LYS A CB   1  
ATOM 1044  C CG   . LYS A 1 67 ? 16.125  10.443  8.835   1.00 0.00 ? 71 LYS A CG   1  
ATOM 1045  C CD   . LYS A 1 67 ? 17.604  10.831  8.784   1.00 0.00 ? 71 LYS A CD   1  
ATOM 1046  C CE   . LYS A 1 67 ? 18.121  11.205  10.174  1.00 0.00 ? 71 LYS A CE   1  
ATOM 1047  N NZ   . LYS A 1 67 ? 19.600  11.164  10.205  1.00 0.00 ? 71 LYS A NZ   1  
ATOM 1048  H H    . LYS A 1 67 ? 13.348  9.087   7.982   1.00 0.00 ? 71 LYS A H    1  
ATOM 1049  H HA   . LYS A 1 67 ? 14.459  11.619  7.352   1.00 0.00 ? 71 LYS A HA   1  
ATOM 1050  H HB2  . LYS A 1 67 ? 15.459  8.806   7.599   1.00 0.00 ? 71 LYS A HB2  1  
ATOM 1051  H HB3  . LYS A 1 67 ? 16.456  9.974   6.756   1.00 0.00 ? 71 LYS A HB3  1  
ATOM 1052  H HG2  . LYS A 1 67 ? 15.524  11.317  9.090   1.00 0.00 ? 71 LYS A HG2  1  
ATOM 1053  H HG3  . LYS A 1 67 ? 15.965  9.707   9.623   1.00 0.00 ? 71 LYS A HG3  1  
ATOM 1054  H HD2  . LYS A 1 67 ? 18.187  10.001  8.386   1.00 0.00 ? 71 LYS A HD2  1  
ATOM 1055  H HD3  . LYS A 1 67 ? 17.740  11.672  8.103   1.00 0.00 ? 71 LYS A HD3  1  
ATOM 1056  H HE2  . LYS A 1 67 ? 17.774  12.203  10.442  1.00 0.00 ? 71 LYS A HE2  1  
ATOM 1057  H HE3  . LYS A 1 67 ? 17.716  10.517  10.917  1.00 0.00 ? 71 LYS A HE3  1  
ATOM 1058  H HZ1  . LYS A 1 67 ? 19.917  10.288  9.841   1.00 0.00 ? 71 LYS A HZ1  1  
ATOM 1059  H HZ2  . LYS A 1 67 ? 19.966  11.909  9.648   1.00 0.00 ? 71 LYS A HZ2  1  
ATOM 1060  H HZ3  . LYS A 1 67 ? 19.917  11.267  11.148  1.00 0.00 ? 71 LYS A HZ3  1  
ATOM 1061  N N    . SER A 1 68 ? 15.355  10.975  4.818   1.00 0.00 ? 72 SER A N    1  
ATOM 1062  C CA   . SER A 1 68 ? 15.368  11.037  3.366   1.00 0.00 ? 72 SER A CA   1  
ATOM 1063  C C    . SER A 1 68 ? 16.762  11.431  2.872   1.00 0.00 ? 72 SER A C    1  
ATOM 1064  O O    . SER A 1 68 ? 17.045  12.612  2.680   1.00 0.00 ? 72 SER A O    1  
ATOM 1065  C CB   . SER A 1 68 ? 14.322  12.026  2.847   1.00 0.00 ? 72 SER A CB   1  
ATOM 1066  O OG   . SER A 1 68 ? 13.686  11.556  1.661   1.00 0.00 ? 72 SER A OG   1  
ATOM 1067  H H    . SER A 1 68 ? 16.215  11.229  5.260   1.00 0.00 ? 72 SER A H    1  
ATOM 1068  H HA   . SER A 1 68 ? 15.114  10.031  3.032   1.00 0.00 ? 72 SER A HA   1  
ATOM 1069  H HB2  . SER A 1 68 ? 13.571  12.196  3.618   1.00 0.00 ? 72 SER A HB2  1  
ATOM 1070  H HB3  . SER A 1 68 ? 14.798  12.986  2.647   1.00 0.00 ? 72 SER A HB3  1  
ATOM 1071  H HG   . SER A 1 68 ? 12.878  12.111  1.464   1.00 0.00 ? 72 SER A HG   1  
ATOM 1072  N N    . ASN A 1 69 ? 17.595  10.419  2.681   1.00 0.00 ? 73 ASN A N    1  
ATOM 1073  C CA   . ASN A 1 69 ? 18.952  10.644  2.213   1.00 0.00 ? 73 ASN A CA   1  
ATOM 1074  C C    . ASN A 1 69 ? 18.910  11.205  0.791   1.00 0.00 ? 73 ASN A C    1  
ATOM 1075  O O    . ASN A 1 69 ? 17.864  11.187  0.143   1.00 0.00 ? 73 ASN A O    1  
ATOM 1076  C CB   . ASN A 1 69 ? 19.749  9.338   2.183   1.00 0.00 ? 73 ASN A CB   1  
ATOM 1077  C CG   . ASN A 1 69 ? 21.113  9.544   1.523   1.00 0.00 ? 73 ASN A CG   1  
ATOM 1078  O OD1  . ASN A 1 69 ? 21.227  9.764   0.328   1.00 0.00 ? 73 ASN A OD1  1  
ATOM 1079  N ND2  . ASN A 1 69 ? 22.140  9.460   2.364   1.00 0.00 ? 73 ASN A ND2  1  
ATOM 1080  H H    . ASN A 1 69 ? 17.357  9.461   2.840   1.00 0.00 ? 73 ASN A H    1  
ATOM 1081  H HA   . ASN A 1 69 ? 19.388  11.345  2.925   1.00 0.00 ? 73 ASN A HA   1  
ATOM 1082  H HB2  . ASN A 1 69 ? 19.884  8.967   3.199   1.00 0.00 ? 73 ASN A HB2  1  
ATOM 1083  H HB3  . ASN A 1 69 ? 19.188  8.579   1.639   1.00 0.00 ? 73 ASN A HB3  1  
ATOM 1084  H HD21 . ASN A 1 69 ? 21.977  9.277   3.334   1.00 0.00 ? 73 ASN A HD21 1  
ATOM 1085  H HD22 . ASN A 1 69 ? 23.074  9.580   2.028   1.00 0.00 ? 73 ASN A HD22 1  
ATOM 1086  N N    . THR B 1 1  ? 14.275  15.269  -13.335 1.00 0.00 ? 5  THR B N    1  
ATOM 1087  C CA   . THR B 1 1  ? 14.887  16.444  -12.739 1.00 0.00 ? 5  THR B CA   1  
ATOM 1088  C C    . THR B 1 1  ? 13.863  17.211  -11.900 1.00 0.00 ? 5  THR B C    1  
ATOM 1089  O O    . THR B 1 1  ? 14.077  17.444  -10.712 1.00 0.00 ? 5  THR B O    1  
ATOM 1090  C CB   . THR B 1 1  ? 15.500  17.280  -13.864 1.00 0.00 ? 5  THR B CB   1  
ATOM 1091  O OG1  . THR B 1 1  ? 16.591  16.489  -14.329 1.00 0.00 ? 5  THR B OG1  1  
ATOM 1092  C CG2  . THR B 1 1  ? 16.161  18.560  -13.348 1.00 0.00 ? 5  THR B CG2  1  
ATOM 1093  H H    . THR B 1 1  ? 13.482  15.454  -13.916 1.00 0.00 ? 5  THR B H    1  
ATOM 1094  H HA   . THR B 1 1  ? 15.673  16.114  -12.060 1.00 0.00 ? 5  THR B HA   1  
ATOM 1095  H HB   . THR B 1 1  ? 14.758  17.506  -14.630 1.00 0.00 ? 5  THR B HB   1  
ATOM 1096  H HG1  . THR B 1 1  ? 17.313  16.462  -13.638 1.00 0.00 ? 5  THR B HG1  1  
ATOM 1097  H HG21 . THR B 1 1  ? 16.002  18.644  -12.273 1.00 0.00 ? 5  THR B HG21 1  
ATOM 1098  H HG22 . THR B 1 1  ? 17.231  18.525  -13.555 1.00 0.00 ? 5  THR B HG22 1  
ATOM 1099  H HG23 . THR B 1 1  ? 15.723  19.423  -13.849 1.00 0.00 ? 5  THR B HG23 1  
ATOM 1100  N N    . GLU B 1 2  ? 12.771  17.583  -12.553 1.00 0.00 ? 6  GLU B N    1  
ATOM 1101  C CA   . GLU B 1 2  ? 11.713  18.319  -11.882 1.00 0.00 ? 6  GLU B CA   1  
ATOM 1102  C C    . GLU B 1 2  ? 10.448  17.463  -11.788 1.00 0.00 ? 6  GLU B C    1  
ATOM 1103  O O    . GLU B 1 2  ? 9.550   17.582  -12.620 1.00 0.00 ? 6  GLU B O    1  
ATOM 1104  C CB   . GLU B 1 2  ? 11.427  19.642  -12.597 1.00 0.00 ? 6  GLU B CB   1  
ATOM 1105  C CG   . GLU B 1 2  ? 10.747  20.638  -11.655 1.00 0.00 ? 6  GLU B CG   1  
ATOM 1106  C CD   . GLU B 1 2  ? 11.106  22.078  -12.028 1.00 0.00 ? 6  GLU B CD   1  
ATOM 1107  O OE1  . GLU B 1 2  ? 12.285  22.440  -11.825 1.00 0.00 ? 6  GLU B OE1  1  
ATOM 1108  O OE2  . GLU B 1 2  ? 10.193  22.784  -12.509 1.00 0.00 ? 6  GLU B OE2  1  
ATOM 1109  H H    . GLU B 1 2  ? 12.604  17.389  -13.520 1.00 0.00 ? 6  GLU B H    1  
ATOM 1110  H HA   . GLU B 1 2  ? 12.094  18.528  -10.883 1.00 0.00 ? 6  GLU B HA   1  
ATOM 1111  H HB2  . GLU B 1 2  ? 12.360  20.066  -12.969 1.00 0.00 ? 6  GLU B HB2  1  
ATOM 1112  H HB3  . GLU B 1 2  ? 10.791  19.461  -13.463 1.00 0.00 ? 6  GLU B HB3  1  
ATOM 1113  H HG2  . GLU B 1 2  ? 9.666   20.505  -11.700 1.00 0.00 ? 6  GLU B HG2  1  
ATOM 1114  H HG3  . GLU B 1 2  ? 11.051  20.438  -10.628 1.00 0.00 ? 6  GLU B HG3  1  
ATOM 1115  N N    . LEU B 1 3  ? 10.418  16.620  -10.766 1.00 0.00 ? 7  LEU B N    1  
ATOM 1116  C CA   . LEU B 1 3  ? 9.278   15.744  -10.552 1.00 0.00 ? 7  LEU B CA   1  
ATOM 1117  C C    . LEU B 1 3  ? 8.444   16.277  -9.385  1.00 0.00 ? 7  LEU B C    1  
ATOM 1118  O O    . LEU B 1 3  ? 8.896   17.143  -8.638  1.00 0.00 ? 7  LEU B O    1  
ATOM 1119  C CB   . LEU B 1 3  ? 9.741   14.298  -10.367 1.00 0.00 ? 7  LEU B CB   1  
ATOM 1120  C CG   . LEU B 1 3  ? 10.467  13.668  -11.558 1.00 0.00 ? 7  LEU B CG   1  
ATOM 1121  C CD1  . LEU B 1 3  ? 11.971  13.939  -11.489 1.00 0.00 ? 7  LEU B CD1  1  
ATOM 1122  C CD2  . LEU B 1 3  ? 10.158  12.173  -11.661 1.00 0.00 ? 7  LEU B CD2  1  
ATOM 1123  H H    . LEU B 1 3  ? 11.153  16.530  -10.093 1.00 0.00 ? 7  LEU B H    1  
ATOM 1124  H HA   . LEU B 1 3  ? 8.669   15.775  -11.455 1.00 0.00 ? 7  LEU B HA   1  
ATOM 1125  H HB2  . LEU B 1 3  ? 10.402  14.256  -9.501  1.00 0.00 ? 7  LEU B HB2  1  
ATOM 1126  H HB3  . LEU B 1 3  ? 8.870   13.686  -10.132 1.00 0.00 ? 7  LEU B HB3  1  
ATOM 1127  H HG   . LEU B 1 3  ? 10.097  14.137  -12.470 1.00 0.00 ? 7  LEU B HG   1  
ATOM 1128  H HD11 . LEU B 1 3  ? 12.371  13.536  -10.558 1.00 0.00 ? 7  LEU B HD11 1  
ATOM 1129  H HD12 . LEU B 1 3  ? 12.466  13.460  -12.334 1.00 0.00 ? 7  LEU B HD12 1  
ATOM 1130  H HD13 . LEU B 1 3  ? 12.149  15.014  -11.525 1.00 0.00 ? 7  LEU B HD13 1  
ATOM 1131  H HD21 . LEU B 1 3  ? 9.998   11.766  -10.662 1.00 0.00 ? 7  LEU B HD21 1  
ATOM 1132  H HD22 . LEU B 1 3  ? 9.258   12.029  -12.260 1.00 0.00 ? 7  LEU B HD22 1  
ATOM 1133  H HD23 . LEU B 1 3  ? 10.995  11.661  -12.133 1.00 0.00 ? 7  LEU B HD23 1  
ATOM 1134  N N    . ARG B 1 4  ? 7.240   15.737  -9.266  1.00 0.00 ? 8  ARG B N    1  
ATOM 1135  C CA   . ARG B 1 4  ? 6.338   16.147  -8.203  1.00 0.00 ? 8  ARG B CA   1  
ATOM 1136  C C    . ARG B 1 4  ? 5.705   14.921  -7.541  1.00 0.00 ? 8  ARG B C    1  
ATOM 1137  O O    . ARG B 1 4  ? 6.345   13.877  -7.420  1.00 0.00 ? 8  ARG B O    1  
ATOM 1138  C CB   . ARG B 1 4  ? 5.231   17.056  -8.740  1.00 0.00 ? 8  ARG B CB   1  
ATOM 1139  C CG   . ARG B 1 4  ? 5.793   18.078  -9.730  1.00 0.00 ? 8  ARG B CG   1  
ATOM 1140  C CD   . ARG B 1 4  ? 4.732   19.111  -10.113 1.00 0.00 ? 8  ARG B CD   1  
ATOM 1141  N NE   . ARG B 1 4  ? 5.302   20.095  -11.060 1.00 0.00 ? 8  ARG B NE   1  
ATOM 1142  C CZ   . ARG B 1 4  ? 6.010   21.171  -10.690 1.00 0.00 ? 8  ARG B CZ   1  
ATOM 1143  N NH1  . ARG B 1 4  ? 6.239   21.408  -9.391  1.00 0.00 ? 8  ARG B NH1  1  
ATOM 1144  N NH2  . ARG B 1 4  ? 6.489   22.010  -11.619 1.00 0.00 ? 8  ARG B NH2  1  
ATOM 1145  H H    . ARG B 1 4  ? 6.879   15.033  -9.878  1.00 0.00 ? 8  ARG B H    1  
ATOM 1146  H HA   . ARG B 1 4  ? 6.967   16.692  -7.498  1.00 0.00 ? 8  ARG B HA   1  
ATOM 1147  H HB2  . ARG B 1 4  ? 4.466   16.453  -9.228  1.00 0.00 ? 8  ARG B HB2  1  
ATOM 1148  H HB3  . ARG B 1 4  ? 4.748   17.575  -7.912  1.00 0.00 ? 8  ARG B HB3  1  
ATOM 1149  H HG2  . ARG B 1 4  ? 6.654   18.581  -9.290  1.00 0.00 ? 8  ARG B HG2  1  
ATOM 1150  H HG3  . ARG B 1 4  ? 6.146   17.566  -10.625 1.00 0.00 ? 8  ARG B HG3  1  
ATOM 1151  H HD2  . ARG B 1 4  ? 3.874   18.614  -10.565 1.00 0.00 ? 8  ARG B HD2  1  
ATOM 1152  H HD3  . ARG B 1 4  ? 4.370   19.621  -9.220  1.00 0.00 ? 8  ARG B HD3  1  
ATOM 1153  H HE   . ARG B 1 4  ? 5.150   19.948  -12.037 1.00 0.00 ? 8  ARG B HE   1  
ATOM 1154  H HH11 . ARG B 1 4  ? 5.882   20.782  -8.698  1.00 0.00 ? 8  ARG B HH11 1  
ATOM 1155  H HH12 . ARG B 1 4  ? 6.767   22.211  -9.115  1.00 0.00 ? 8  ARG B HH12 1  
ATOM 1156  H HH21 . ARG B 1 4  ? 6.318   21.833  -12.588 1.00 0.00 ? 8  ARG B HH21 1  
ATOM 1157  H HH22 . ARG B 1 4  ? 7.017   22.813  -11.343 1.00 0.00 ? 8  ARG B HH22 1  
ATOM 1158  N N    . CYS B 1 5  ? 4.457   15.088  -7.129  1.00 0.00 ? 9  CYS B N    1  
ATOM 1159  C CA   . CYS B 1 5  ? 3.731   14.008  -6.483  1.00 0.00 ? 9  CYS B CA   1  
ATOM 1160  C C    . CYS B 1 5  ? 2.975   13.227  -7.559  1.00 0.00 ? 9  CYS B C    1  
ATOM 1161  O O    . CYS B 1 5  ? 2.682   13.760  -8.628  1.00 0.00 ? 9  CYS B O    1  
ATOM 1162  C CB   . CYS B 1 5  ? 2.794   14.530  -5.391  1.00 0.00 ? 9  CYS B CB   1  
ATOM 1163  S SG   . CYS B 1 5  ? 3.614   15.509  -4.080  1.00 0.00 ? 9  CYS B SG   1  
ATOM 1164  H H    . CYS B 1 5  ? 3.945   15.941  -7.231  1.00 0.00 ? 9  CYS B H    1  
ATOM 1165  H HA   . CYS B 1 5  ? 4.476   13.377  -5.997  1.00 0.00 ? 9  CYS B HA   1  
ATOM 1166  H HB2  . CYS B 1 5  ? 2.024   15.146  -5.857  1.00 0.00 ? 9  CYS B HB2  1  
ATOM 1167  H HB3  . CYS B 1 5  ? 2.289   13.682  -4.930  1.00 0.00 ? 9  CYS B HB3  1  
ATOM 1168  N N    . GLN B 1 6  ? 2.679   11.976  -7.238  1.00 0.00 ? 10 GLN B N    1  
ATOM 1169  C CA   . GLN B 1 6  ? 1.962   11.115  -8.164  1.00 0.00 ? 10 GLN B CA   1  
ATOM 1170  C C    . GLN B 1 6  ? 0.455   11.347  -8.045  1.00 0.00 ? 10 GLN B C    1  
ATOM 1171  O O    . GLN B 1 6  ? -0.326  10.784  -8.811  1.00 0.00 ? 10 GLN B O    1  
ATOM 1172  C CB   . GLN B 1 6  ? 2.311   9.644   -7.928  1.00 0.00 ? 10 GLN B CB   1  
ATOM 1173  C CG   . GLN B 1 6  ? 2.385   8.879   -9.251  1.00 0.00 ? 10 GLN B CG   1  
ATOM 1174  C CD   . GLN B 1 6  ? 1.339   7.764   -9.299  1.00 0.00 ? 10 GLN B CD   1  
ATOM 1175  O OE1  . GLN B 1 6  ? 0.200   7.962   -9.688  1.00 0.00 ? 10 GLN B OE1  1  
ATOM 1176  N NE2  . GLN B 1 6  ? 1.788   6.583   -8.883  1.00 0.00 ? 10 GLN B NE2  1  
ATOM 1177  H H    . GLN B 1 6  ? 2.921   11.550  -6.366  1.00 0.00 ? 10 GLN B H    1  
ATOM 1178  H HA   . GLN B 1 6  ? 2.304   11.409  -9.156  1.00 0.00 ? 10 GLN B HA   1  
ATOM 1179  H HB2  . GLN B 1 6  ? 3.266   9.572   -7.408  1.00 0.00 ? 10 GLN B HB2  1  
ATOM 1180  H HB3  . GLN B 1 6  ? 1.561   9.188   -7.282  1.00 0.00 ? 10 GLN B HB3  1  
ATOM 1181  H HG2  . GLN B 1 6  ? 2.227   9.567   -10.082 1.00 0.00 ? 10 GLN B HG2  1  
ATOM 1182  H HG3  . GLN B 1 6  ? 3.381   8.454   -9.374  1.00 0.00 ? 10 GLN B HG3  1  
ATOM 1183  H HE21 . GLN B 1 6  ? 2.735   6.488   -8.576  1.00 0.00 ? 10 GLN B HE21 1  
ATOM 1184  H HE22 . GLN B 1 6  ? 1.178   5.790   -8.876  1.00 0.00 ? 10 GLN B HE22 1  
ATOM 1185  N N    . CYS B 1 7  ? 0.090   12.177  -7.078  1.00 0.00 ? 11 CYS B N    1  
ATOM 1186  C CA   . CYS B 1 7  ? -1.310  12.490  -6.849  1.00 0.00 ? 11 CYS B CA   1  
ATOM 1187  C C    . CYS B 1 7  ? -1.409  13.951  -6.406  1.00 0.00 ? 11 CYS B C    1  
ATOM 1188  O O    . CYS B 1 7  ? -0.739  14.364  -5.461  1.00 0.00 ? 11 CYS B O    1  
ATOM 1189  C CB   . CYS B 1 7  ? -1.942  11.540  -5.829  1.00 0.00 ? 11 CYS B CB   1  
ATOM 1190  S SG   . CYS B 1 7  ? -3.304  10.507  -6.483  1.00 0.00 ? 11 CYS B SG   1  
ATOM 1191  H H    . CYS B 1 7  ? 0.731   12.630  -6.459  1.00 0.00 ? 11 CYS B H    1  
ATOM 1192  H HA   . CYS B 1 7  ? -1.825  12.337  -7.797  1.00 0.00 ? 11 CYS B HA   1  
ATOM 1193  H HB2  . CYS B 1 7  ? -1.166  10.885  -5.433  1.00 0.00 ? 11 CYS B HB2  1  
ATOM 1194  H HB3  . CYS B 1 7  ? -2.320  12.128  -4.992  1.00 0.00 ? 11 CYS B HB3  1  
ATOM 1195  N N    . LEU B 1 8  ? -2.251  14.693  -7.110  1.00 0.00 ? 12 LEU B N    1  
ATOM 1196  C CA   . LEU B 1 8  ? -2.447  16.099  -6.801  1.00 0.00 ? 12 LEU B CA   1  
ATOM 1197  C C    . LEU B 1 8  ? -3.542  16.237  -5.742  1.00 0.00 ? 12 LEU B C    1  
ATOM 1198  O O    . LEU B 1 8  ? -3.614  17.249  -5.046  1.00 0.00 ? 12 LEU B O    1  
ATOM 1199  C CB   . LEU B 1 8  ? -2.724  16.895  -8.079  1.00 0.00 ? 12 LEU B CB   1  
ATOM 1200  C CG   . LEU B 1 8  ? -1.813  16.588  -9.270  1.00 0.00 ? 12 LEU B CG   1  
ATOM 1201  C CD1  . LEU B 1 8  ? -2.522  16.887  -10.593 1.00 0.00 ? 12 LEU B CD1  1  
ATOM 1202  C CD2  . LEU B 1 8  ? -0.484  17.335  -9.150  1.00 0.00 ? 12 LEU B CD2  1  
ATOM 1203  H H    . LEU B 1 8  ? -2.793  14.349  -7.877  1.00 0.00 ? 12 LEU B H    1  
ATOM 1204  H HA   . LEU B 1 8  ? -1.513  16.475  -6.384  1.00 0.00 ? 12 LEU B HA   1  
ATOM 1205  H HB2  . LEU B 1 8  ? -3.756  16.714  -8.380  1.00 0.00 ? 12 LEU B HB2  1  
ATOM 1206  H HB3  . LEU B 1 8  ? -2.640  17.957  -7.847  1.00 0.00 ? 12 LEU B HB3  1  
ATOM 1207  H HG   . LEU B 1 8  ? -1.586  15.522  -9.261  1.00 0.00 ? 12 LEU B HG   1  
ATOM 1208  H HD11 . LEU B 1 8  ? -3.148  17.772  -10.477 1.00 0.00 ? 12 LEU B HD11 1  
ATOM 1209  H HD12 . LEU B 1 8  ? -1.779  17.066  -11.370 1.00 0.00 ? 12 LEU B HD12 1  
ATOM 1210  H HD13 . LEU B 1 8  ? -3.143  16.037  -10.872 1.00 0.00 ? 12 LEU B HD13 1  
ATOM 1211  H HD21 . LEU B 1 8  ? -0.334  17.648  -8.117  1.00 0.00 ? 12 LEU B HD21 1  
ATOM 1212  H HD22 . LEU B 1 8  ? 0.331   16.677  -9.453  1.00 0.00 ? 12 LEU B HD22 1  
ATOM 1213  H HD23 . LEU B 1 8  ? -0.501  18.213  -9.797  1.00 0.00 ? 12 LEU B HD23 1  
ATOM 1214  N N    . GLN B 1 9  ? -4.369  15.205  -5.653  1.00 0.00 ? 13 GLN B N    1  
ATOM 1215  C CA   . GLN B 1 9  ? -5.457  15.198  -4.691  1.00 0.00 ? 13 GLN B CA   1  
ATOM 1216  C C    . GLN B 1 9  ? -5.519  13.850  -3.970  1.00 0.00 ? 13 GLN B C    1  
ATOM 1217  O O    . GLN B 1 9  ? -4.850  12.898  -4.368  1.00 0.00 ? 13 GLN B O    1  
ATOM 1218  C CB   . GLN B 1 9  ? -6.790  15.520  -5.368  1.00 0.00 ? 13 GLN B CB   1  
ATOM 1219  C CG   . GLN B 1 9  ? -7.716  16.286  -4.421  1.00 0.00 ? 13 GLN B CG   1  
ATOM 1220  C CD   . GLN B 1 9  ? -7.969  17.706  -4.931  1.00 0.00 ? 13 GLN B CD   1  
ATOM 1221  O OE1  . GLN B 1 9  ? -7.288  18.208  -5.810  1.00 0.00 ? 13 GLN B OE1  1  
ATOM 1222  N NE2  . GLN B 1 9  ? -8.984  18.323  -4.332  1.00 0.00 ? 13 GLN B NE2  1  
ATOM 1223  H H    . GLN B 1 9  ? -4.303  14.386  -6.223  1.00 0.00 ? 13 GLN B H    1  
ATOM 1224  H HA   . GLN B 1 9  ? -5.218  15.988  -3.978  1.00 0.00 ? 13 GLN B HA   1  
ATOM 1225  H HB2  . GLN B 1 9  ? -6.612  16.112  -6.266  1.00 0.00 ? 13 GLN B HB2  1  
ATOM 1226  H HB3  . GLN B 1 9  ? -7.273  14.596  -5.686  1.00 0.00 ? 13 GLN B HB3  1  
ATOM 1227  H HG2  . GLN B 1 9  ? -8.663  15.756  -4.325  1.00 0.00 ? 13 GLN B HG2  1  
ATOM 1228  H HG3  . GLN B 1 9  ? -7.271  16.327  -3.427  1.00 0.00 ? 13 GLN B HG3  1  
ATOM 1229  H HE21 . GLN B 1 9  ? -9.502  17.854  -3.617  1.00 0.00 ? 13 GLN B HE21 1  
ATOM 1230  H HE22 . GLN B 1 9  ? -9.228  19.256  -4.597  1.00 0.00 ? 13 GLN B HE22 1  
ATOM 1231  N N    . THR B 1 10 ? -6.329  13.812  -2.922  1.00 0.00 ? 14 THR B N    1  
ATOM 1232  C CA   . THR B 1 10 ? -6.488  12.597  -2.142  1.00 0.00 ? 14 THR B CA   1  
ATOM 1233  C C    . THR B 1 10 ? -7.895  12.526  -1.544  1.00 0.00 ? 14 THR B C    1  
ATOM 1234  O O    . THR B 1 10 ? -8.616  13.523  -1.525  1.00 0.00 ? 14 THR B O    1  
ATOM 1235  C CB   . THR B 1 10 ? -5.378  12.562  -1.090  1.00 0.00 ? 14 THR B CB   1  
ATOM 1236  O OG1  . THR B 1 10 ? -5.251  13.919  -0.674  1.00 0.00 ? 14 THR B OG1  1  
ATOM 1237  C CG2  . THR B 1 10 ? -4.012  12.226  -1.691  1.00 0.00 ? 14 THR B CG2  1  
ATOM 1238  H H    . THR B 1 10 ? -6.870  14.591  -2.605  1.00 0.00 ? 14 THR B H    1  
ATOM 1239  H HA   . THR B 1 10 ? -6.382  11.743  -2.811  1.00 0.00 ? 14 THR B HA   1  
ATOM 1240  H HB   . THR B 1 10 ? -5.628  11.873  -0.283  1.00 0.00 ? 14 THR B HB   1  
ATOM 1241  H HG1  . THR B 1 10 ? -4.857  14.467  -1.412  1.00 0.00 ? 14 THR B HG1  1  
ATOM 1242  H HG21 . THR B 1 10 ? -3.776  12.941  -2.480  1.00 0.00 ? 14 THR B HG21 1  
ATOM 1243  H HG22 . THR B 1 10 ? -3.250  12.280  -0.913  1.00 0.00 ? 14 THR B HG22 1  
ATOM 1244  H HG23 . THR B 1 10 ? -4.035  11.219  -2.107  1.00 0.00 ? 14 THR B HG23 1  
ATOM 1245  N N    . LEU B 1 11 ? -8.243  11.339  -1.070  1.00 0.00 ? 15 LEU B N    1  
ATOM 1246  C CA   . LEU B 1 11 ? -9.550  11.126  -0.474  1.00 0.00 ? 15 LEU B CA   1  
ATOM 1247  C C    . LEU B 1 11 ? -9.434  11.228  1.049   1.00 0.00 ? 15 LEU B C    1  
ATOM 1248  O O    . LEU B 1 11 ? -8.341  11.116  1.600   1.00 0.00 ? 15 LEU B O    1  
ATOM 1249  C CB   . LEU B 1 11 ? -10.150 9.804   -0.957  1.00 0.00 ? 15 LEU B CB   1  
ATOM 1250  C CG   . LEU B 1 11 ? -10.506 9.732   -2.443  1.00 0.00 ? 15 LEU B CG   1  
ATOM 1251  C CD1  . LEU B 1 11 ? -10.535 8.282   -2.930  1.00 0.00 ? 15 LEU B CD1  1  
ATOM 1252  C CD2  . LEU B 1 11 ? -11.821 10.459  -2.728  1.00 0.00 ? 15 LEU B CD2  1  
ATOM 1253  H H    . LEU B 1 11 ? -7.650  10.534  -1.090  1.00 0.00 ? 15 LEU B H    1  
ATOM 1254  H HA   . LEU B 1 11 ? -10.204 11.924  -0.825  1.00 0.00 ? 15 LEU B HA   1  
ATOM 1255  H HB2  . LEU B 1 11 ? -9.445  9.004   -0.733  1.00 0.00 ? 15 LEU B HB2  1  
ATOM 1256  H HB3  . LEU B 1 11 ? -11.052 9.604   -0.378  1.00 0.00 ? 15 LEU B HB3  1  
ATOM 1257  H HG   . LEU B 1 11 ? -9.726  10.245  -3.006  1.00 0.00 ? 15 LEU B HG   1  
ATOM 1258  H HD11 . LEU B 1 11 ? -10.630 7.613   -2.075  1.00 0.00 ? 15 LEU B HD11 1  
ATOM 1259  H HD12 . LEU B 1 11 ? -11.385 8.140   -3.598  1.00 0.00 ? 15 LEU B HD12 1  
ATOM 1260  H HD13 . LEU B 1 11 ? -9.612  8.059   -3.465  1.00 0.00 ? 15 LEU B HD13 1  
ATOM 1261  H HD21 . LEU B 1 11 ? -12.227 10.855  -1.797  1.00 0.00 ? 15 LEU B HD21 1  
ATOM 1262  H HD22 . LEU B 1 11 ? -11.640 11.279  -3.423  1.00 0.00 ? 15 LEU B HD22 1  
ATOM 1263  H HD23 . LEU B 1 11 ? -12.534 9.762   -3.167  1.00 0.00 ? 15 LEU B HD23 1  
ATOM 1264  N N    . GLN B 1 12 ? -10.577 11.441  1.684   1.00 0.00 ? 16 GLN B N    1  
ATOM 1265  C CA   . GLN B 1 12 ? -10.617 11.560  3.132   1.00 0.00 ? 16 GLN B CA   1  
ATOM 1266  C C    . GLN B 1 12 ? -10.916 10.202  3.768   1.00 0.00 ? 16 GLN B C    1  
ATOM 1267  O O    . GLN B 1 12 ? -10.773 10.034  4.978   1.00 0.00 ? 16 GLN B O    1  
ATOM 1268  C CB   . GLN B 1 12 ? -11.644 12.608  3.567   1.00 0.00 ? 16 GLN B CB   1  
ATOM 1269  C CG   . GLN B 1 12 ? -12.054 12.400  5.027   1.00 0.00 ? 16 GLN B CG   1  
ATOM 1270  C CD   . GLN B 1 12 ? -12.736 13.649  5.588   1.00 0.00 ? 16 GLN B CD   1  
ATOM 1271  O OE1  . GLN B 1 12 ? -13.946 13.798  5.549   1.00 0.00 ? 16 GLN B OE1  1  
ATOM 1272  N NE2  . GLN B 1 12 ? -11.894 14.536  6.111   1.00 0.00 ? 16 GLN B NE2  1  
ATOM 1273  H H    . GLN B 1 12 ? -11.462 11.532  1.228   1.00 0.00 ? 16 GLN B H    1  
ATOM 1274  H HA   . GLN B 1 12 ? -9.621  11.895  3.423   1.00 0.00 ? 16 GLN B HA   1  
ATOM 1275  H HB2  . GLN B 1 12 ? -11.226 13.606  3.442   1.00 0.00 ? 16 GLN B HB2  1  
ATOM 1276  H HB3  . GLN B 1 12 ? -12.524 12.548  2.927   1.00 0.00 ? 16 GLN B HB3  1  
ATOM 1277  H HG2  . GLN B 1 12 ? -12.730 11.548  5.101   1.00 0.00 ? 16 GLN B HG2  1  
ATOM 1278  H HG3  . GLN B 1 12 ? -11.175 12.161  5.625   1.00 0.00 ? 16 GLN B HG3  1  
ATOM 1279  H HE21 . GLN B 1 12 ? -10.911 14.353  6.111   1.00 0.00 ? 16 GLN B HE21 1  
ATOM 1280  H HE22 . GLN B 1 12 ? -12.244 15.387  6.503   1.00 0.00 ? 16 GLN B HE22 1  
ATOM 1281  N N    . GLY B 1 13 ? -11.326 9.266   2.924   1.00 0.00 ? 17 GLY B N    1  
ATOM 1282  C CA   . GLY B 1 13 ? -11.646 7.927   3.389   1.00 0.00 ? 17 GLY B CA   1  
ATOM 1283  C C    . GLY B 1 13 ? -12.929 7.412   2.736   1.00 0.00 ? 17 GLY B C    1  
ATOM 1284  O O    . GLY B 1 13 ? -14.030 7.736   3.180   1.00 0.00 ? 17 GLY B O    1  
ATOM 1285  H H    . GLY B 1 13 ? -11.439 9.410   1.942   1.00 0.00 ? 17 GLY B H    1  
ATOM 1286  H HA2  . GLY B 1 13 ? -10.821 7.252   3.161   1.00 0.00 ? 17 GLY B HA2  1  
ATOM 1287  H HA3  . GLY B 1 13 ? -11.762 7.933   4.473   1.00 0.00 ? 17 GLY B HA3  1  
ATOM 1288  N N    . ILE B 1 14 ? -12.746 6.618   1.691   1.00 0.00 ? 18 ILE B N    1  
ATOM 1289  C CA   . ILE B 1 14 ? -13.876 6.054   0.972   1.00 0.00 ? 18 ILE B CA   1  
ATOM 1290  C C    . ILE B 1 14 ? -14.093 4.609   1.423   1.00 0.00 ? 18 ILE B C    1  
ATOM 1291  O O    . ILE B 1 14 ? -13.207 4.002   2.023   1.00 0.00 ? 18 ILE B O    1  
ATOM 1292  C CB   . ILE B 1 14 ? -13.679 6.205   -0.538  1.00 0.00 ? 18 ILE B CB   1  
ATOM 1293  C CG1  . ILE B 1 14 ? -14.118 7.592   -1.013  1.00 0.00 ? 18 ILE B CG1  1  
ATOM 1294  C CG2  . ILE B 1 14 ? -14.394 5.086   -1.298  1.00 0.00 ? 18 ILE B CG2  1  
ATOM 1295  C CD1  . ILE B 1 14 ? -14.299 7.619   -2.532  1.00 0.00 ? 18 ILE B CD1  1  
ATOM 1296  H H    . ILE B 1 14 ? -11.848 6.359   1.336   1.00 0.00 ? 18 ILE B H    1  
ATOM 1297  H HA   . ILE B 1 14 ? -14.758 6.636   1.241   1.00 0.00 ? 18 ILE B HA   1  
ATOM 1298  H HB   . ILE B 1 14 ? -12.615 6.112   -0.754  1.00 0.00 ? 18 ILE B HB   1  
ATOM 1299  H HG12 . ILE B 1 14 ? -15.053 7.867   -0.526  1.00 0.00 ? 18 ILE B HG12 1  
ATOM 1300  H HG13 . ILE B 1 14 ? -13.375 8.333   -0.718  1.00 0.00 ? 18 ILE B HG13 1  
ATOM 1301  H HG21 . ILE B 1 14 ? -14.062 4.119   -0.919  1.00 0.00 ? 18 ILE B HG21 1  
ATOM 1302  H HG22 . ILE B 1 14 ? -15.471 5.181   -1.157  1.00 0.00 ? 18 ILE B HG22 1  
ATOM 1303  H HG23 . ILE B 1 14 ? -14.158 5.160   -2.360  1.00 0.00 ? 18 ILE B HG23 1  
ATOM 1304  H HD11 . ILE B 1 14 ? -13.486 7.068   -3.004  1.00 0.00 ? 18 ILE B HD11 1  
ATOM 1305  H HD12 . ILE B 1 14 ? -15.251 7.157   -2.792  1.00 0.00 ? 18 ILE B HD12 1  
ATOM 1306  H HD13 . ILE B 1 14 ? -14.289 8.652   -2.880  1.00 0.00 ? 18 ILE B HD13 1  
ATOM 1307  N N    . HIS B 1 15 ? -15.276 4.098   1.117   1.00 0.00 ? 19 HIS B N    1  
ATOM 1308  C CA   . HIS B 1 15 ? -15.621 2.735   1.483   1.00 0.00 ? 19 HIS B CA   1  
ATOM 1309  C C    . HIS B 1 15 ? -14.524 1.782   1.004   1.00 0.00 ? 19 HIS B C    1  
ATOM 1310  O O    . HIS B 1 15 ? -14.053 1.890   -0.127  1.00 0.00 ? 19 HIS B O    1  
ATOM 1311  C CB   . HIS B 1 15 ? -17.005 2.361   0.949   1.00 0.00 ? 19 HIS B CB   1  
ATOM 1312  C CG   . HIS B 1 15 ? -17.861 1.604   1.936   1.00 0.00 ? 19 HIS B CG   1  
ATOM 1313  N ND1  . HIS B 1 15 ? -19.220 1.415   1.758   1.00 0.00 ? 19 HIS B ND1  1  
ATOM 1314  C CD2  . HIS B 1 15 ? -17.537 0.992   3.110   1.00 0.00 ? 19 HIS B CD2  1  
ATOM 1315  C CE1  . HIS B 1 15 ? -19.683 0.719   2.786   1.00 0.00 ? 19 HIS B CE1  1  
ATOM 1316  N NE2  . HIS B 1 15 ? -18.638 0.458   3.623   1.00 0.00 ? 19 HIS B NE2  1  
ATOM 1317  H H    . HIS B 1 15 ? -15.992 4.598   0.629   1.00 0.00 ? 19 HIS B H    1  
ATOM 1318  H HA   . HIS B 1 15 ? -15.666 2.705   2.572   1.00 0.00 ? 19 HIS B HA   1  
ATOM 1319  H HB2  . HIS B 1 15 ? -17.527 3.272   0.654   1.00 0.00 ? 19 HIS B HB2  1  
ATOM 1320  H HB3  . HIS B 1 15 ? -16.885 1.757   0.049   1.00 0.00 ? 19 HIS B HB3  1  
ATOM 1321  H HD1  . HIS B 1 15 ? -19.761 1.746   0.985   1.00 0.00 ? 19 HIS B HD1  1  
ATOM 1322  H HD2  . HIS B 1 15 ? -16.541 0.948   3.553   1.00 0.00 ? 19 HIS B HD2  1  
ATOM 1323  H HE1  . HIS B 1 15 ? -20.717 0.409   2.936   1.00 0.00 ? 19 HIS B HE1  1  
ATOM 1324  N N    . LEU B 1 16 ? -14.149 0.870   1.889   1.00 0.00 ? 20 LEU B N    1  
ATOM 1325  C CA   . LEU B 1 16 ? -13.116 -0.101  1.571   1.00 0.00 ? 20 LEU B CA   1  
ATOM 1326  C C    . LEU B 1 16 ? -13.742 -1.278  0.820   1.00 0.00 ? 20 LEU B C    1  
ATOM 1327  O O    . LEU B 1 16 ? -13.078 -2.282  0.567   1.00 0.00 ? 20 LEU B O    1  
ATOM 1328  C CB   . LEU B 1 16 ? -12.358 -0.512  2.835   1.00 0.00 ? 20 LEU B CB   1  
ATOM 1329  C CG   . LEU B 1 16 ? -11.128 -1.396  2.623   1.00 0.00 ? 20 LEU B CG   1  
ATOM 1330  C CD1  . LEU B 1 16 ? -10.095 -0.695  1.738   1.00 0.00 ? 20 LEU B CD1  1  
ATOM 1331  C CD2  . LEU B 1 16 ? -10.531 -1.836  3.961   1.00 0.00 ? 20 LEU B CD2  1  
ATOM 1332  H H    . LEU B 1 16 ? -14.537 0.788   2.807   1.00 0.00 ? 20 LEU B H    1  
ATOM 1333  H HA   . LEU B 1 16 ? -12.400 0.388   0.910   1.00 0.00 ? 20 LEU B HA   1  
ATOM 1334  H HB2  . LEU B 1 16 ? -12.045 0.393   3.357   1.00 0.00 ? 20 LEU B HB2  1  
ATOM 1335  H HB3  . LEU B 1 16 ? -13.049 -1.037  3.494   1.00 0.00 ? 20 LEU B HB3  1  
ATOM 1336  H HG   . LEU B 1 16 ? -11.442 -2.298  2.098   1.00 0.00 ? 20 LEU B HG   1  
ATOM 1337  H HD11 . LEU B 1 16 ? -10.481 0.276   1.428   1.00 0.00 ? 20 LEU B HD11 1  
ATOM 1338  H HD12 . LEU B 1 16 ? -9.170  -0.556  2.298   1.00 0.00 ? 20 LEU B HD12 1  
ATOM 1339  H HD13 . LEU B 1 16 ? -9.898  -1.305  0.856   1.00 0.00 ? 20 LEU B HD13 1  
ATOM 1340  H HD21 . LEU B 1 16 ? -10.668 -1.045  4.698   1.00 0.00 ? 20 LEU B HD21 1  
ATOM 1341  H HD22 . LEU B 1 16 ? -11.033 -2.741  4.302   1.00 0.00 ? 20 LEU B HD22 1  
ATOM 1342  H HD23 . LEU B 1 16 ? -9.467  -2.036  3.836   1.00 0.00 ? 20 LEU B HD23 1  
ATOM 1343  N N    . LYS B 1 17 ? -15.014 -1.116  0.485   1.00 0.00 ? 21 LYS B N    1  
ATOM 1344  C CA   . LYS B 1 17 ? -15.737 -2.152  -0.232  1.00 0.00 ? 21 LYS B CA   1  
ATOM 1345  C C    . LYS B 1 17 ? -15.409 -2.059  -1.723  1.00 0.00 ? 21 LYS B C    1  
ATOM 1346  O O    . LYS B 1 17 ? -15.609 -3.018  -2.467  1.00 0.00 ? 21 LYS B O    1  
ATOM 1347  C CB   . LYS B 1 17 ? -17.234 -2.071  0.075   1.00 0.00 ? 21 LYS B CB   1  
ATOM 1348  C CG   . LYS B 1 17 ? -18.062 -2.626  -1.085  1.00 0.00 ? 21 LYS B CG   1  
ATOM 1349  C CD   . LYS B 1 17 ? -17.826 -4.128  -1.259  1.00 0.00 ? 21 LYS B CD   1  
ATOM 1350  C CE   . LYS B 1 17 ? -18.625 -4.931  -0.231  1.00 0.00 ? 21 LYS B CE   1  
ATOM 1351  N NZ   . LYS B 1 17 ? -18.512 -6.381  -0.505  1.00 0.00 ? 21 LYS B NZ   1  
ATOM 1352  H H    . LYS B 1 17 ? -15.547 -0.296  0.695   1.00 0.00 ? 21 LYS B H    1  
ATOM 1353  H HA   . LYS B 1 17 ? -15.384 -3.114  0.141   1.00 0.00 ? 21 LYS B HA   1  
ATOM 1354  H HB2  . LYS B 1 17 ? -17.454 -2.630  0.984   1.00 0.00 ? 21 LYS B HB2  1  
ATOM 1355  H HB3  . LYS B 1 17 ? -17.514 -1.034  0.264   1.00 0.00 ? 21 LYS B HB3  1  
ATOM 1356  H HG2  . LYS B 1 17 ? -19.121 -2.440  -0.903  1.00 0.00 ? 21 LYS B HG2  1  
ATOM 1357  H HG3  . LYS B 1 17 ? -17.801 -2.104  -2.006  1.00 0.00 ? 21 LYS B HG3  1  
ATOM 1358  H HD2  . LYS B 1 17 ? -18.113 -4.431  -2.266  1.00 0.00 ? 21 LYS B HD2  1  
ATOM 1359  H HD3  . LYS B 1 17 ? -16.763 -4.347  -1.150  1.00 0.00 ? 21 LYS B HD3  1  
ATOM 1360  H HE2  . LYS B 1 17 ? -18.259 -4.715  0.773   1.00 0.00 ? 21 LYS B HE2  1  
ATOM 1361  H HE3  . LYS B 1 17 ? -19.672 -4.630  -0.260  1.00 0.00 ? 21 LYS B HE3  1  
ATOM 1362  H HZ1  . LYS B 1 17 ? -17.831 -6.533  -1.221  1.00 0.00 ? 21 LYS B HZ1  1  
ATOM 1363  H HZ2  . LYS B 1 17 ? -18.231 -6.857  0.329   1.00 0.00 ? 21 LYS B HZ2  1  
ATOM 1364  H HZ3  . LYS B 1 17 ? -19.398 -6.733  -0.807  1.00 0.00 ? 21 LYS B HZ3  1  
ATOM 1365  N N    . ASN B 1 18 ? -14.910 -0.896  -2.115  1.00 0.00 ? 22 ASN B N    1  
ATOM 1366  C CA   . ASN B 1 18 ? -14.553 -0.665  -3.504  1.00 0.00 ? 22 ASN B CA   1  
ATOM 1367  C C    . ASN B 1 18 ? -13.049 -0.884  -3.682  1.00 0.00 ? 22 ASN B C    1  
ATOM 1368  O O    . ASN B 1 18 ? -12.616 -1.468  -4.675  1.00 0.00 ? 22 ASN B O    1  
ATOM 1369  C CB   . ASN B 1 18 ? -14.875 0.770   -3.925  1.00 0.00 ? 22 ASN B CB   1  
ATOM 1370  C CG   . ASN B 1 18 ? -16.199 0.834   -4.689  1.00 0.00 ? 22 ASN B CG   1  
ATOM 1371  O OD1  . ASN B 1 18 ? -16.415 0.138   -5.667  1.00 0.00 ? 22 ASN B OD1  1  
ATOM 1372  N ND2  . ASN B 1 18 ? -17.070 1.706   -4.189  1.00 0.00 ? 22 ASN B ND2  1  
ATOM 1373  H H    . ASN B 1 18 ? -14.751 -0.121  -1.503  1.00 0.00 ? 22 ASN B H    1  
ATOM 1374  H HA   . ASN B 1 18 ? -15.148 -1.377  -4.076  1.00 0.00 ? 22 ASN B HA   1  
ATOM 1375  H HB2  . ASN B 1 18 ? -14.928 1.408   -3.043  1.00 0.00 ? 22 ASN B HB2  1  
ATOM 1376  H HB3  . ASN B 1 18 ? -14.071 1.159   -4.550  1.00 0.00 ? 22 ASN B HB3  1  
ATOM 1377  H HD21 . ASN B 1 18 ? -16.830 2.246   -3.382  1.00 0.00 ? 22 ASN B HD21 1  
ATOM 1378  H HD22 . ASN B 1 18 ? -17.965 1.820   -4.619  1.00 0.00 ? 22 ASN B HD22 1  
ATOM 1379  N N    . ILE B 1 19 ? -12.294 -0.403  -2.706  1.00 0.00 ? 23 ILE B N    1  
ATOM 1380  C CA   . ILE B 1 19 ? -10.847 -0.539  -2.742  1.00 0.00 ? 23 ILE B CA   1  
ATOM 1381  C C    . ILE B 1 19 ? -10.481 -2.022  -2.837  1.00 0.00 ? 23 ILE B C    1  
ATOM 1382  O O    . ILE B 1 19 ? -10.960 -2.835  -2.049  1.00 0.00 ? 23 ILE B O    1  
ATOM 1383  C CB   . ILE B 1 19 ? -10.212 0.176   -1.548  1.00 0.00 ? 23 ILE B CB   1  
ATOM 1384  C CG1  . ILE B 1 19 ? -10.038 1.669   -1.832  1.00 0.00 ? 23 ILE B CG1  1  
ATOM 1385  C CG2  . ILE B 1 19 ? -8.893  -0.489  -1.149  1.00 0.00 ? 23 ILE B CG2  1  
ATOM 1386  C CD1  . ILE B 1 19 ? -10.465 2.510   -0.627  1.00 0.00 ? 23 ILE B CD1  1  
ATOM 1387  H H    . ILE B 1 19 ? -12.653 0.071   -1.902  1.00 0.00 ? 23 ILE B H    1  
ATOM 1388  H HA   . ILE B 1 19 ? -10.495 -0.038  -3.643  1.00 0.00 ? 23 ILE B HA   1  
ATOM 1389  H HB   . ILE B 1 19 ? -10.887 0.086   -0.697  1.00 0.00 ? 23 ILE B HB   1  
ATOM 1390  H HG12 . ILE B 1 19 ? -8.996  1.878   -2.075  1.00 0.00 ? 23 ILE B HG12 1  
ATOM 1391  H HG13 . ILE B 1 19 ? -10.630 1.948   -2.703  1.00 0.00 ? 23 ILE B HG13 1  
ATOM 1392  H HG21 . ILE B 1 19 ? -9.061  -1.551  -0.968  1.00 0.00 ? 23 ILE B HG21 1  
ATOM 1393  H HG22 . ILE B 1 19 ? -8.167  -0.369  -1.954  1.00 0.00 ? 23 ILE B HG22 1  
ATOM 1394  H HG23 . ILE B 1 19 ? -8.510  -0.022  -0.242  1.00 0.00 ? 23 ILE B HG23 1  
ATOM 1395  H HD11 . ILE B 1 19 ? -11.282 2.010   -0.107  1.00 0.00 ? 23 ILE B HD11 1  
ATOM 1396  H HD12 . ILE B 1 19 ? -9.620  2.628   0.051   1.00 0.00 ? 23 ILE B HD12 1  
ATOM 1397  H HD13 . ILE B 1 19 ? -10.798 3.490   -0.968  1.00 0.00 ? 23 ILE B HD13 1  
ATOM 1398  N N    . GLN B 1 20 ? -9.634  -2.328  -3.810  1.00 0.00 ? 24 GLN B N    1  
ATOM 1399  C CA   . GLN B 1 20 ? -9.198  -3.698  -4.018  1.00 0.00 ? 24 GLN B CA   1  
ATOM 1400  C C    . GLN B 1 20 ? -7.704  -3.831  -3.720  1.00 0.00 ? 24 GLN B C    1  
ATOM 1401  O O    . GLN B 1 20 ? -7.212  -4.930  -3.471  1.00 0.00 ? 24 GLN B O    1  
ATOM 1402  C CB   . GLN B 1 20 ? -9.517  -4.165  -5.440  1.00 0.00 ? 24 GLN B CB   1  
ATOM 1403  C CG   . GLN B 1 20 ? -10.110 -5.575  -5.435  1.00 0.00 ? 24 GLN B CG   1  
ATOM 1404  C CD   . GLN B 1 20 ? -9.011  -6.631  -5.300  1.00 0.00 ? 24 GLN B CD   1  
ATOM 1405  O OE1  . GLN B 1 20 ? -8.990  -7.429  -4.378  1.00 0.00 ? 24 GLN B OE1  1  
ATOM 1406  N NE2  . GLN B 1 20 ? -8.101  -6.591  -6.270  1.00 0.00 ? 24 GLN B NE2  1  
ATOM 1407  H H    . GLN B 1 20 ? -9.249  -1.660  -4.447  1.00 0.00 ? 24 GLN B H    1  
ATOM 1408  H HA   . GLN B 1 20 ? -9.772  -4.296  -3.310  1.00 0.00 ? 24 GLN B HA   1  
ATOM 1409  H HB2  . GLN B 1 20 ? -10.219 -3.473  -5.905  1.00 0.00 ? 24 GLN B HB2  1  
ATOM 1410  H HB3  . GLN B 1 20 ? -8.609  -4.150  -6.044  1.00 0.00 ? 24 GLN B HB3  1  
ATOM 1411  H HG2  . GLN B 1 20 ? -10.816 -5.673  -4.610  1.00 0.00 ? 24 GLN B HG2  1  
ATOM 1412  H HG3  . GLN B 1 20 ? -10.669 -5.742  -6.355  1.00 0.00 ? 24 GLN B HG3  1  
ATOM 1413  H HE21 . GLN B 1 20 ? -8.176  -5.911  -6.998  1.00 0.00 ? 24 GLN B HE21 1  
ATOM 1414  H HE22 . GLN B 1 20 ? -7.342  -7.242  -6.270  1.00 0.00 ? 24 GLN B HE22 1  
ATOM 1415  N N    . SER B 1 21 ? -7.023  -2.694  -3.754  1.00 0.00 ? 25 SER B N    1  
ATOM 1416  C CA   . SER B 1 21 ? -5.594  -2.670  -3.490  1.00 0.00 ? 25 SER B CA   1  
ATOM 1417  C C    . SER B 1 21 ? -5.178  -1.284  -2.993  1.00 0.00 ? 25 SER B C    1  
ATOM 1418  O O    . SER B 1 21 ? -5.836  -0.290  -3.292  1.00 0.00 ? 25 SER B O    1  
ATOM 1419  C CB   . SER B 1 21 ? -4.797  -3.047  -4.740  1.00 0.00 ? 25 SER B CB   1  
ATOM 1420  O OG   . SER B 1 21 ? -5.562  -3.842  -5.642  1.00 0.00 ? 25 SER B OG   1  
ATOM 1421  H H    . SER B 1 21 ? -7.431  -1.804  -3.957  1.00 0.00 ? 25 SER B H    1  
ATOM 1422  H HA   . SER B 1 21 ? -5.431  -3.419  -2.716  1.00 0.00 ? 25 SER B HA   1  
ATOM 1423  H HB2  . SER B 1 21 ? -4.467  -2.140  -5.247  1.00 0.00 ? 25 SER B HB2  1  
ATOM 1424  H HB3  . SER B 1 21 ? -3.900  -3.592  -4.447  1.00 0.00 ? 25 SER B HB3  1  
ATOM 1425  H HG   . SER B 1 21 ? -5.141  -3.831  -6.549  1.00 0.00 ? 25 SER B HG   1  
ATOM 1426  N N    . VAL B 1 22 ? -4.086  -1.264  -2.242  1.00 0.00 ? 26 VAL B N    1  
ATOM 1427  C CA   . VAL B 1 22 ? -3.574  -0.016  -1.700  1.00 0.00 ? 26 VAL B CA   1  
ATOM 1428  C C    . VAL B 1 22 ? -2.087  0.108   -2.035  1.00 0.00 ? 26 VAL B C    1  
ATOM 1429  O O    . VAL B 1 22 ? -1.321  -0.834  -1.835  1.00 0.00 ? 26 VAL B O    1  
ATOM 1430  C CB   . VAL B 1 22 ? -3.857  0.057   -0.198  1.00 0.00 ? 26 VAL B CB   1  
ATOM 1431  C CG1  . VAL B 1 22 ? -3.034  1.166   0.461   1.00 0.00 ? 26 VAL B CG1  1  
ATOM 1432  C CG2  . VAL B 1 22 ? -5.351  0.248   0.071   1.00 0.00 ? 26 VAL B CG2  1  
ATOM 1433  H H    . VAL B 1 22 ? -3.556  -2.077  -2.003  1.00 0.00 ? 26 VAL B H    1  
ATOM 1434  H HA   . VAL B 1 22 ? -4.112  0.798   -2.184  1.00 0.00 ? 26 VAL B HA   1  
ATOM 1435  H HB   . VAL B 1 22 ? -3.555  -0.892  0.246   1.00 0.00 ? 26 VAL B HB   1  
ATOM 1436  H HG11 . VAL B 1 22 ? -2.435  1.672   -0.296  1.00 0.00 ? 26 VAL B HG11 1  
ATOM 1437  H HG12 . VAL B 1 22 ? -3.705  1.884   0.933   1.00 0.00 ? 26 VAL B HG12 1  
ATOM 1438  H HG13 . VAL B 1 22 ? -2.378  0.733   1.215   1.00 0.00 ? 26 VAL B HG13 1  
ATOM 1439  H HG21 . VAL B 1 22 ? -5.923  -0.426  -0.566  1.00 0.00 ? 26 VAL B HG21 1  
ATOM 1440  H HG22 . VAL B 1 22 ? -5.563  0.028   1.117   1.00 0.00 ? 26 VAL B HG22 1  
ATOM 1441  H HG23 . VAL B 1 22 ? -5.630  1.279   -0.148  1.00 0.00 ? 26 VAL B HG23 1  
ATOM 1442  N N    . LYS B 1 23 ? -1.722  1.277   -2.541  1.00 0.00 ? 27 LYS B N    1  
ATOM 1443  C CA   . LYS B 1 23 ? -0.340  1.537   -2.906  1.00 0.00 ? 27 LYS B CA   1  
ATOM 1444  C C    . LYS B 1 23 ? 0.131   2.821   -2.221  1.00 0.00 ? 27 LYS B C    1  
ATOM 1445  O O    . LYS B 1 23 ? -0.509  3.864   -2.343  1.00 0.00 ? 27 LYS B O    1  
ATOM 1446  C CB   . LYS B 1 23 ? -0.183  1.557   -4.427  1.00 0.00 ? 27 LYS B CB   1  
ATOM 1447  C CG   . LYS B 1 23 ? 1.294   1.558   -4.826  1.00 0.00 ? 27 LYS B CG   1  
ATOM 1448  C CD   . LYS B 1 23 ? 1.948   2.904   -4.504  1.00 0.00 ? 27 LYS B CD   1  
ATOM 1449  C CE   . LYS B 1 23 ? 2.734   3.433   -5.705  1.00 0.00 ? 27 LYS B CE   1  
ATOM 1450  N NZ   . LYS B 1 23 ? 2.067   4.623   -6.278  1.00 0.00 ? 27 LYS B NZ   1  
ATOM 1451  H H    . LYS B 1 23 ? -2.352  2.038   -2.701  1.00 0.00 ? 27 LYS B H    1  
ATOM 1452  H HA   . LYS B 1 23 ? 0.258   0.706   -2.531  1.00 0.00 ? 27 LYS B HA   1  
ATOM 1453  H HB2  . LYS B 1 23 ? -0.679  0.688   -4.860  1.00 0.00 ? 27 LYS B HB2  1  
ATOM 1454  H HB3  . LYS B 1 23 ? -0.674  2.440   -4.836  1.00 0.00 ? 27 LYS B HB3  1  
ATOM 1455  H HG2  . LYS B 1 23 ? 1.818   0.760   -4.299  1.00 0.00 ? 27 LYS B HG2  1  
ATOM 1456  H HG3  . LYS B 1 23 ? 1.387   1.350   -5.892  1.00 0.00 ? 27 LYS B HG3  1  
ATOM 1457  H HD2  . LYS B 1 23 ? 1.182   3.625   -4.220  1.00 0.00 ? 27 LYS B HD2  1  
ATOM 1458  H HD3  . LYS B 1 23 ? 2.615   2.793   -3.649  1.00 0.00 ? 27 LYS B HD3  1  
ATOM 1459  H HE2  . LYS B 1 23 ? 3.749   3.689   -5.399  1.00 0.00 ? 27 LYS B HE2  1  
ATOM 1460  H HE3  . LYS B 1 23 ? 2.818   2.655   -6.464  1.00 0.00 ? 27 LYS B HE3  1  
ATOM 1461  H HZ1  . LYS B 1 23 ? 1.168   4.736   -5.856  1.00 0.00 ? 27 LYS B HZ1  1  
ATOM 1462  H HZ2  . LYS B 1 23 ? 2.623   5.435   -6.100  1.00 0.00 ? 27 LYS B HZ2  1  
ATOM 1463  H HZ3  . LYS B 1 23 ? 1.959   4.502   -7.265  1.00 0.00 ? 27 LYS B HZ3  1  
ATOM 1464  N N    . VAL B 1 24 ? 1.248   2.704   -1.517  1.00 0.00 ? 28 VAL B N    1  
ATOM 1465  C CA   . VAL B 1 24 ? 1.812   3.843   -0.814  1.00 0.00 ? 28 VAL B CA   1  
ATOM 1466  C C    . VAL B 1 24 ? 3.147   4.224   -1.457  1.00 0.00 ? 28 VAL B C    1  
ATOM 1467  O O    . VAL B 1 24 ? 4.043   3.390   -1.577  1.00 0.00 ? 28 VAL B O    1  
ATOM 1468  C CB   . VAL B 1 24 ? 1.936   3.527   0.678   1.00 0.00 ? 28 VAL B CB   1  
ATOM 1469  C CG1  . VAL B 1 24 ? 3.118   4.274   1.300   1.00 0.00 ? 28 VAL B CG1  1  
ATOM 1470  C CG2  . VAL B 1 24 ? 0.635   3.847   1.417   1.00 0.00 ? 28 VAL B CG2  1  
ATOM 1471  H H    . VAL B 1 24 ? 1.762   1.852   -1.424  1.00 0.00 ? 28 VAL B H    1  
ATOM 1472  H HA   . VAL B 1 24 ? 1.118   4.676   -0.926  1.00 0.00 ? 28 VAL B HA   1  
ATOM 1473  H HB   . VAL B 1 24 ? 2.124   2.458   0.780   1.00 0.00 ? 28 VAL B HB   1  
ATOM 1474  H HG11 . VAL B 1 24 ? 3.299   5.194   0.745   1.00 0.00 ? 28 VAL B HG11 1  
ATOM 1475  H HG12 . VAL B 1 24 ? 2.889   4.515   2.338   1.00 0.00 ? 28 VAL B HG12 1  
ATOM 1476  H HG13 . VAL B 1 24 ? 4.007   3.645   1.261   1.00 0.00 ? 28 VAL B HG13 1  
ATOM 1477  H HG21 . VAL B 1 24 ? -0.198  3.820   0.714   1.00 0.00 ? 28 VAL B HG21 1  
ATOM 1478  H HG22 . VAL B 1 24 ? 0.472   3.109   2.202   1.00 0.00 ? 28 VAL B HG22 1  
ATOM 1479  H HG23 . VAL B 1 24 ? 0.704   4.841   1.860   1.00 0.00 ? 28 VAL B HG23 1  
ATOM 1480  N N    . LYS B 1 25 ? 3.237   5.484   -1.855  1.00 0.00 ? 29 LYS B N    1  
ATOM 1481  C CA   . LYS B 1 25 ? 4.447   5.986   -2.483  1.00 0.00 ? 29 LYS B CA   1  
ATOM 1482  C C    . LYS B 1 25 ? 4.960   7.196   -1.698  1.00 0.00 ? 29 LYS B C    1  
ATOM 1483  O O    . LYS B 1 25 ? 4.644   8.336   -2.033  1.00 0.00 ? 29 LYS B O    1  
ATOM 1484  C CB   . LYS B 1 25 ? 4.202   6.274   -3.965  1.00 0.00 ? 29 LYS B CB   1  
ATOM 1485  C CG   . LYS B 1 25 ? 5.522   6.355   -4.734  1.00 0.00 ? 29 LYS B CG   1  
ATOM 1486  C CD   . LYS B 1 25 ? 6.143   7.749   -4.612  1.00 0.00 ? 29 LYS B CD   1  
ATOM 1487  C CE   . LYS B 1 25 ? 6.477   8.323   -5.990  1.00 0.00 ? 29 LYS B CE   1  
ATOM 1488  N NZ   . LYS B 1 25 ? 7.602   7.581   -6.602  1.00 0.00 ? 29 LYS B NZ   1  
ATOM 1489  H H    . LYS B 1 25 ? 2.504   6.157   -1.754  1.00 0.00 ? 29 LYS B H    1  
ATOM 1490  H HA   . LYS B 1 25 ? 5.196   5.196   -2.428  1.00 0.00 ? 29 LYS B HA   1  
ATOM 1491  H HB2  . LYS B 1 25 ? 3.576   5.491   -4.393  1.00 0.00 ? 29 LYS B HB2  1  
ATOM 1492  H HB3  . LYS B 1 25 ? 3.656   7.211   -4.072  1.00 0.00 ? 29 LYS B HB3  1  
ATOM 1493  H HG2  . LYS B 1 25 ? 6.217   5.609   -4.350  1.00 0.00 ? 29 LYS B HG2  1  
ATOM 1494  H HG3  . LYS B 1 25 ? 5.351   6.121   -5.785  1.00 0.00 ? 29 LYS B HG3  1  
ATOM 1495  H HD2  . LYS B 1 25 ? 5.452   8.414   -4.094  1.00 0.00 ? 29 LYS B HD2  1  
ATOM 1496  H HD3  . LYS B 1 25 ? 7.048   7.696   -4.007  1.00 0.00 ? 29 LYS B HD3  1  
ATOM 1497  H HE2  . LYS B 1 25 ? 5.602   8.265   -6.637  1.00 0.00 ? 29 LYS B HE2  1  
ATOM 1498  H HE3  . LYS B 1 25 ? 6.736   9.378   -5.898  1.00 0.00 ? 29 LYS B HE3  1  
ATOM 1499  H HZ1  . LYS B 1 25 ? 7.986   6.946   -5.931  1.00 0.00 ? 29 LYS B HZ1  1  
ATOM 1500  H HZ2  . LYS B 1 25 ? 7.273   7.069   -7.395  1.00 0.00 ? 29 LYS B HZ2  1  
ATOM 1501  H HZ3  . LYS B 1 25 ? 8.309   8.227   -6.892  1.00 0.00 ? 29 LYS B HZ3  1  
ATOM 1502  N N    . SER B 1 26 ? 5.744   6.905   -0.671  1.00 0.00 ? 30 SER B N    1  
ATOM 1503  C CA   . SER B 1 26 ? 6.304   7.954   0.164   1.00 0.00 ? 30 SER B CA   1  
ATOM 1504  C C    . SER B 1 26 ? 6.891   9.063   -0.712  1.00 0.00 ? 30 SER B C    1  
ATOM 1505  O O    . SER B 1 26 ? 6.951   8.927   -1.933  1.00 0.00 ? 30 SER B O    1  
ATOM 1506  C CB   . SER B 1 26 ? 7.375   7.398   1.104   1.00 0.00 ? 30 SER B CB   1  
ATOM 1507  O OG   . SER B 1 26 ? 6.967   7.452   2.469   1.00 0.00 ? 30 SER B OG   1  
ATOM 1508  H H    . SER B 1 26 ? 5.997   5.974   -0.406  1.00 0.00 ? 30 SER B H    1  
ATOM 1509  H HA   . SER B 1 26 ? 5.467   8.333   0.751   1.00 0.00 ? 30 SER B HA   1  
ATOM 1510  H HB2  . SER B 1 26 ? 7.595   6.365   0.833   1.00 0.00 ? 30 SER B HB2  1  
ATOM 1511  H HB3  . SER B 1 26 ? 8.297   7.964   0.979   1.00 0.00 ? 30 SER B HB3  1  
ATOM 1512  H HG   . SER B 1 26 ? 5.969   7.450   2.528   1.00 0.00 ? 30 SER B HG   1  
ATOM 1513  N N    . PRO B 1 27 ? 7.320   10.163  -0.037  1.00 0.00 ? 31 PRO B N    1  
ATOM 1514  C CA   . PRO B 1 27 ? 7.900   11.293  -0.741  1.00 0.00 ? 31 PRO B CA   1  
ATOM 1515  C C    . PRO B 1 27 ? 9.324   10.979  -1.204  1.00 0.00 ? 31 PRO B C    1  
ATOM 1516  O O    . PRO B 1 27 ? 9.839   9.892   -0.946  1.00 0.00 ? 31 PRO B O    1  
ATOM 1517  C CB   . PRO B 1 27 ? 7.838   12.446  0.247   1.00 0.00 ? 31 PRO B CB   1  
ATOM 1518  C CG   . PRO B 1 27 ? 7.656   11.812  1.617   1.00 0.00 ? 31 PRO B CG   1  
ATOM 1519  C CD   . PRO B 1 27 ? 7.264   10.358  1.408   1.00 0.00 ? 31 PRO B CD   1  
ATOM 1520  H HA   . PRO B 1 27 ? 7.380   11.489  -1.573  1.00 0.00 ? 31 PRO B HA   1  
ATOM 1521  H HB2  . PRO B 1 27 ? 8.750   13.042  0.211   1.00 0.00 ? 31 PRO B HB2  1  
ATOM 1522  H HB3  . PRO B 1 27 ? 7.010   13.116  0.014   1.00 0.00 ? 31 PRO B HB3  1  
ATOM 1523  H HG2  . PRO B 1 27 ? 8.578   11.880  2.194   1.00 0.00 ? 31 PRO B HG2  1  
ATOM 1524  H HG3  . PRO B 1 27 ? 6.886   12.337  2.182   1.00 0.00 ? 31 PRO B HG3  1  
ATOM 1525  H HD2  . PRO B 1 27 ? 7.949   9.685   1.925   1.00 0.00 ? 31 PRO B HD2  1  
ATOM 1526  H HD3  . PRO B 1 27 ? 6.266   10.157  1.797   1.00 0.00 ? 31 PRO B HD3  1  
ATOM 1527  N N    . GLY B 1 28 ? 9.920   11.950  -1.880  1.00 0.00 ? 32 GLY B N    1  
ATOM 1528  C CA   . GLY B 1 28 ? 11.275  11.791  -2.382  1.00 0.00 ? 32 GLY B CA   1  
ATOM 1529  C C    . GLY B 1 28 ? 11.974  13.146  -2.512  1.00 0.00 ? 32 GLY B C    1  
ATOM 1530  O O    . GLY B 1 28 ? 11.590  14.112  -1.855  1.00 0.00 ? 32 GLY B O    1  
ATOM 1531  H H    . GLY B 1 28 ? 9.494   12.831  -2.086  1.00 0.00 ? 32 GLY B H    1  
ATOM 1532  H HA2  . GLY B 1 28 ? 11.842  11.148  -1.709  1.00 0.00 ? 32 GLY B HA2  1  
ATOM 1533  H HA3  . GLY B 1 28 ? 11.251  11.295  -3.352  1.00 0.00 ? 32 GLY B HA3  1  
ATOM 1534  N N    . PRO B 1 29 ? 13.016  13.173  -3.386  1.00 0.00 ? 33 PRO B N    1  
ATOM 1535  C CA   . PRO B 1 29 ? 13.772  14.393  -3.610  1.00 0.00 ? 33 PRO B CA   1  
ATOM 1536  C C    . PRO B 1 29 ? 12.980  15.380  -4.470  1.00 0.00 ? 33 PRO B C    1  
ATOM 1537  O O    . PRO B 1 29 ? 13.464  16.467  -4.780  1.00 0.00 ? 33 PRO B O    1  
ATOM 1538  C CB   . PRO B 1 29 ? 15.066  13.939  -4.267  1.00 0.00 ? 33 PRO B CB   1  
ATOM 1539  C CG   . PRO B 1 29 ? 14.791  12.545  -4.808  1.00 0.00 ? 33 PRO B CG   1  
ATOM 1540  C CD   . PRO B 1 29 ? 13.499  12.048  -4.181  1.00 0.00 ? 33 PRO B CD   1  
ATOM 1541  H HA   . PRO B 1 29 ? 13.942  14.861  -2.743  1.00 0.00 ? 33 PRO B HA   1  
ATOM 1542  H HB2  . PRO B 1 29 ? 15.356  14.618  -5.068  1.00 0.00 ? 33 PRO B HB2  1  
ATOM 1543  H HB3  . PRO B 1 29 ? 15.885  13.925  -3.548  1.00 0.00 ? 33 PRO B HB3  1  
ATOM 1544  H HG2  . PRO B 1 29 ? 14.705  12.567  -5.894  1.00 0.00 ? 33 PRO B HG2  1  
ATOM 1545  H HG3  . PRO B 1 29 ? 15.615  11.873  -4.567  1.00 0.00 ? 33 PRO B HG3  1  
ATOM 1546  H HD2  . PRO B 1 29 ? 12.774  11.761  -4.943  1.00 0.00 ? 33 PRO B HD2  1  
ATOM 1547  H HD3  . PRO B 1 29 ? 13.672  11.169  -3.559  1.00 0.00 ? 33 PRO B HD3  1  
ATOM 1548  N N    . HIS B 1 30 ? 11.774  14.965  -4.831  1.00 0.00 ? 34 HIS B N    1  
ATOM 1549  C CA   . HIS B 1 30 ? 10.909  15.799  -5.648  1.00 0.00 ? 34 HIS B CA   1  
ATOM 1550  C C    . HIS B 1 30 ? 9.650   16.161  -4.859  1.00 0.00 ? 34 HIS B C    1  
ATOM 1551  O O    . HIS B 1 30 ? 9.358   17.339  -4.656  1.00 0.00 ? 34 HIS B O    1  
ATOM 1552  C CB   . HIS B 1 30 ? 10.597  15.114  -6.981  1.00 0.00 ? 34 HIS B CB   1  
ATOM 1553  C CG   . HIS B 1 30 ? 10.482  13.612  -6.888  1.00 0.00 ? 34 HIS B CG   1  
ATOM 1554  N ND1  . HIS B 1 30 ? 11.555  12.795  -6.578  1.00 0.00 ? 34 HIS B ND1  1  
ATOM 1555  C CD2  . HIS B 1 30 ? 9.409   12.788  -7.065  1.00 0.00 ? 34 HIS B CD2  1  
ATOM 1556  C CE1  . HIS B 1 30 ? 11.137  11.538  -6.574  1.00 0.00 ? 34 HIS B CE1  1  
ATOM 1557  N NE2  . HIS B 1 30 ? 9.807   11.536  -6.876  1.00 0.00 ? 34 HIS B NE2  1  
ATOM 1558  H H    . HIS B 1 30 ? 11.387  14.079  -4.574  1.00 0.00 ? 34 HIS B H    1  
ATOM 1559  H HA   . HIS B 1 30 ? 11.467  16.710  -5.865  1.00 0.00 ? 34 HIS B HA   1  
ATOM 1560  H HB2  . HIS B 1 30 ? 9.664   15.517  -7.374  1.00 0.00 ? 34 HIS B HB2  1  
ATOM 1561  H HB3  . HIS B 1 30 ? 11.379  15.365  -7.698  1.00 0.00 ? 34 HIS B HB3  1  
ATOM 1562  H HD1  . HIS B 1 30 ? 12.488  13.102  -6.391  1.00 0.00 ? 34 HIS B HD1  1  
ATOM 1563  H HD2  . HIS B 1 30 ? 8.398   13.104  -7.319  1.00 0.00 ? 34 HIS B HD2  1  
ATOM 1564  H HE1  . HIS B 1 30 ? 11.748  10.660  -6.365  1.00 0.00 ? 34 HIS B HE1  1  
ATOM 1565  N N    . CYS B 1 31 ? 8.938   15.128  -4.435  1.00 0.00 ? 35 CYS B N    1  
ATOM 1566  C CA   . CYS B 1 31 ? 7.716   15.323  -3.673  1.00 0.00 ? 35 CYS B CA   1  
ATOM 1567  C C    . CYS B 1 31 ? 8.027   15.074  -2.195  1.00 0.00 ? 35 CYS B C    1  
ATOM 1568  O O    . CYS B 1 31 ? 8.356   13.954  -1.807  1.00 0.00 ? 35 CYS B O    1  
ATOM 1569  C CB   . CYS B 1 31 ? 6.585   14.425  -4.177  1.00 0.00 ? 35 CYS B CB   1  
ATOM 1570  S SG   . CYS B 1 31 ? 5.035   14.526  -3.208  1.00 0.00 ? 35 CYS B SG   1  
ATOM 1571  H H    . CYS B 1 31 ? 9.182   14.173  -4.605  1.00 0.00 ? 35 CYS B H    1  
ATOM 1572  H HA   . CYS B 1 31 ? 7.408   16.356  -3.835  1.00 0.00 ? 35 CYS B HA   1  
ATOM 1573  H HB2  . CYS B 1 31 ? 6.367   14.685  -5.213  1.00 0.00 ? 35 CYS B HB2  1  
ATOM 1574  H HB3  . CYS B 1 31 ? 6.932   13.391  -4.174  1.00 0.00 ? 35 CYS B HB3  1  
ATOM 1575  N N    . ALA B 1 32 ? 7.913   16.137  -1.412  1.00 0.00 ? 36 ALA B N    1  
ATOM 1576  C CA   . ALA B 1 32 ? 8.178   16.047  0.014   1.00 0.00 ? 36 ALA B CA   1  
ATOM 1577  C C    . ALA B 1 32 ? 6.876   15.730  0.751   1.00 0.00 ? 36 ALA B C    1  
ATOM 1578  O O    . ALA B 1 32 ? 6.738   16.034  1.935   1.00 0.00 ? 36 ALA B O    1  
ATOM 1579  C CB   . ALA B 1 32 ? 8.818   17.350  0.496   1.00 0.00 ? 36 ALA B CB   1  
ATOM 1580  H H    . ALA B 1 32 ? 7.645   17.044  -1.736  1.00 0.00 ? 36 ALA B H    1  
ATOM 1581  H HA   . ALA B 1 32 ? 8.883   15.231  0.170   1.00 0.00 ? 36 ALA B HA   1  
ATOM 1582  H HB1  . ALA B 1 32 ? 9.506   17.721  -0.264  1.00 0.00 ? 36 ALA B HB1  1  
ATOM 1583  H HB2  . ALA B 1 32 ? 9.364   17.166  1.422   1.00 0.00 ? 36 ALA B HB2  1  
ATOM 1584  H HB3  . ALA B 1 32 ? 8.041   18.093  0.675   1.00 0.00 ? 36 ALA B HB3  1  
ATOM 1585  N N    . GLN B 1 33 ? 5.953   15.121  0.021   1.00 0.00 ? 37 GLN B N    1  
ATOM 1586  C CA   . GLN B 1 33 ? 4.666   14.759  0.591   1.00 0.00 ? 37 GLN B CA   1  
ATOM 1587  C C    . GLN B 1 33 ? 4.298   13.326  0.200   1.00 0.00 ? 37 GLN B C    1  
ATOM 1588  O O    . GLN B 1 33 ? 4.770   12.814  -0.814  1.00 0.00 ? 37 GLN B O    1  
ATOM 1589  C CB   . GLN B 1 33 ? 3.578   15.742  0.157   1.00 0.00 ? 37 GLN B CB   1  
ATOM 1590  C CG   . GLN B 1 33 ? 4.099   17.181  0.179   1.00 0.00 ? 37 GLN B CG   1  
ATOM 1591  C CD   . GLN B 1 33 ? 4.187   17.711  1.612   1.00 0.00 ? 37 GLN B CD   1  
ATOM 1592  O OE1  . GLN B 1 33 ? 3.219   17.731  2.354   1.00 0.00 ? 37 GLN B OE1  1  
ATOM 1593  N NE2  . GLN B 1 33 ? 5.398   18.137  1.958   1.00 0.00 ? 37 GLN B NE2  1  
ATOM 1594  H H    . GLN B 1 33 ? 6.073   14.877  -0.942  1.00 0.00 ? 37 GLN B H    1  
ATOM 1595  H HA   . GLN B 1 33 ? 4.799   14.825  1.671   1.00 0.00 ? 37 GLN B HA   1  
ATOM 1596  H HB2  . GLN B 1 33 ? 3.234   15.491  -0.846  1.00 0.00 ? 37 GLN B HB2  1  
ATOM 1597  H HB3  . GLN B 1 33 ? 2.717   15.654  0.820   1.00 0.00 ? 37 GLN B HB3  1  
ATOM 1598  H HG2  . GLN B 1 33 ? 5.082   17.222  -0.289  1.00 0.00 ? 37 GLN B HG2  1  
ATOM 1599  H HG3  . GLN B 1 33 ? 3.439   17.819  -0.409  1.00 0.00 ? 37 GLN B HG3  1  
ATOM 1600  H HE21 . GLN B 1 33 ? 6.150   18.092  1.300   1.00 0.00 ? 37 GLN B HE21 1  
ATOM 1601  H HE22 . GLN B 1 33 ? 5.557   18.502  2.875   1.00 0.00 ? 37 GLN B HE22 1  
ATOM 1602  N N    . THR B 1 34 ? 3.457   12.719  1.025   1.00 0.00 ? 38 THR B N    1  
ATOM 1603  C CA   . THR B 1 34 ? 3.020   11.356  0.779   1.00 0.00 ? 38 THR B CA   1  
ATOM 1604  C C    . THR B 1 34 ? 1.869   11.339  -0.230  1.00 0.00 ? 38 THR B C    1  
ATOM 1605  O O    . THR B 1 34 ? 1.160   12.332  -0.385  1.00 0.00 ? 38 THR B O    1  
ATOM 1606  C CB   . THR B 1 34 ? 2.656   10.725  2.125   1.00 0.00 ? 38 THR B CB   1  
ATOM 1607  O OG1  . THR B 1 34 ? 3.669   11.194  3.012   1.00 0.00 ? 38 THR B OG1  1  
ATOM 1608  C CG2  . THR B 1 34 ? 2.834   9.206   2.126   1.00 0.00 ? 38 THR B CG2  1  
ATOM 1609  H H    . THR B 1 34 ? 3.078   13.143  1.848   1.00 0.00 ? 38 THR B H    1  
ATOM 1610  H HA   . THR B 1 34 ? 3.846   10.805  0.330   1.00 0.00 ? 38 THR B HA   1  
ATOM 1611  H HB   . THR B 1 34 ? 1.645   11.000  2.423   1.00 0.00 ? 38 THR B HB   1  
ATOM 1612  H HG1  . THR B 1 34 ? 3.281   11.852  3.657   1.00 0.00 ? 38 THR B HG1  1  
ATOM 1613  H HG21 . THR B 1 34 ? 3.853   8.958   1.832   1.00 0.00 ? 38 THR B HG21 1  
ATOM 1614  H HG22 . THR B 1 34 ? 2.641   8.818   3.127   1.00 0.00 ? 38 THR B HG22 1  
ATOM 1615  H HG23 . THR B 1 34 ? 2.133   8.757   1.422   1.00 0.00 ? 38 THR B HG23 1  
ATOM 1616  N N    . GLU B 1 35 ? 1.720   10.200  -0.890  1.00 0.00 ? 39 GLU B N    1  
ATOM 1617  C CA   . GLU B 1 35 ? 0.669   10.041  -1.880  1.00 0.00 ? 39 GLU B CA   1  
ATOM 1618  C C    . GLU B 1 35 ? 0.215   8.581   -1.942  1.00 0.00 ? 39 GLU B C    1  
ATOM 1619  O O    . GLU B 1 35 ? 0.834   7.763   -2.622  1.00 0.00 ? 39 GLU B O    1  
ATOM 1620  C CB   . GLU B 1 35 ? 1.130   10.531  -3.254  1.00 0.00 ? 39 GLU B CB   1  
ATOM 1621  C CG   . GLU B 1 35 ? 2.616   10.239  -3.469  1.00 0.00 ? 39 GLU B CG   1  
ATOM 1622  C CD   . GLU B 1 35 ? 3.477   11.422  -3.019  1.00 0.00 ? 39 GLU B CD   1  
ATOM 1623  O OE1  . GLU B 1 35 ? 2.955   12.556  -3.071  1.00 0.00 ? 39 GLU B OE1  1  
ATOM 1624  O OE2  . GLU B 1 35 ? 4.638   11.164  -2.633  1.00 0.00 ? 39 GLU B OE2  1  
ATOM 1625  H H    . GLU B 1 35 ? 2.302   9.397   -0.758  1.00 0.00 ? 39 GLU B H    1  
ATOM 1626  H HA   . GLU B 1 35 ? -0.152  10.668  -1.533  1.00 0.00 ? 39 GLU B HA   1  
ATOM 1627  H HB2  . GLU B 1 35 ? 0.544   10.044  -4.033  1.00 0.00 ? 39 GLU B HB2  1  
ATOM 1628  H HB3  . GLU B 1 35 ? 0.949   11.602  -3.341  1.00 0.00 ? 39 GLU B HB3  1  
ATOM 1629  H HG2  . GLU B 1 35 ? 2.900   9.346   -2.913  1.00 0.00 ? 39 GLU B HG2  1  
ATOM 1630  H HG3  . GLU B 1 35 ? 2.801   10.031  -4.523  1.00 0.00 ? 39 GLU B HG3  1  
ATOM 1631  N N    . VAL B 1 36 ? -0.861  8.297   -1.223  1.00 0.00 ? 40 VAL B N    1  
ATOM 1632  C CA   . VAL B 1 36 ? -1.404  6.950   -1.188  1.00 0.00 ? 40 VAL B CA   1  
ATOM 1633  C C    . VAL B 1 36 ? -2.362  6.761   -2.366  1.00 0.00 ? 40 VAL B C    1  
ATOM 1634  O O    . VAL B 1 36 ? -3.277  7.560   -2.562  1.00 0.00 ? 40 VAL B O    1  
ATOM 1635  C CB   . VAL B 1 36 ? -2.064  6.687   0.167   1.00 0.00 ? 40 VAL B CB   1  
ATOM 1636  C CG1  . VAL B 1 36 ? -2.647  5.274   0.227   1.00 0.00 ? 40 VAL B CG1  1  
ATOM 1637  C CG2  . VAL B 1 36 ? -1.077  6.922   1.312   1.00 0.00 ? 40 VAL B CG2  1  
ATOM 1638  H H    . VAL B 1 36 ? -1.358  8.968   -0.673  1.00 0.00 ? 40 VAL B H    1  
ATOM 1639  H HA   . VAL B 1 36 ? -0.571  6.256   -1.299  1.00 0.00 ? 40 VAL B HA   1  
ATOM 1640  H HB   . VAL B 1 36 ? -2.886  7.394   0.283   1.00 0.00 ? 40 VAL B HB   1  
ATOM 1641  H HG11 . VAL B 1 36 ? -1.889  4.554   -0.080  1.00 0.00 ? 40 VAL B HG11 1  
ATOM 1642  H HG12 . VAL B 1 36 ? -2.964  5.055   1.247   1.00 0.00 ? 40 VAL B HG12 1  
ATOM 1643  H HG13 . VAL B 1 36 ? -3.505  5.206   -0.442  1.00 0.00 ? 40 VAL B HG13 1  
ATOM 1644  H HG21 . VAL B 1 36 ? -0.071  6.658   0.985   1.00 0.00 ? 40 VAL B HG21 1  
ATOM 1645  H HG22 . VAL B 1 36 ? -1.101  7.973   1.602   1.00 0.00 ? 40 VAL B HG22 1  
ATOM 1646  H HG23 . VAL B 1 36 ? -1.356  6.303   2.165   1.00 0.00 ? 40 VAL B HG23 1  
ATOM 1647  N N    . ILE B 1 37 ? -2.120  5.698   -3.120  1.00 0.00 ? 41 ILE B N    1  
ATOM 1648  C CA   . ILE B 1 37 ? -2.949  5.394   -4.273  1.00 0.00 ? 41 ILE B CA   1  
ATOM 1649  C C    . ILE B 1 37 ? -3.484  3.965   -4.149  1.00 0.00 ? 41 ILE B C    1  
ATOM 1650  O O    . ILE B 1 37 ? -2.712  3.008   -4.142  1.00 0.00 ? 41 ILE B O    1  
ATOM 1651  C CB   . ILE B 1 37 ? -2.179  5.651   -5.570  1.00 0.00 ? 41 ILE B CB   1  
ATOM 1652  C CG1  . ILE B 1 37 ? -1.511  7.027   -5.547  1.00 0.00 ? 41 ILE B CG1  1  
ATOM 1653  C CG2  . ILE B 1 37 ? -3.085  5.473   -6.790  1.00 0.00 ? 41 ILE B CG2  1  
ATOM 1654  C CD1  . ILE B 1 37 ? 0.010   6.900   -5.655  1.00 0.00 ? 41 ILE B CD1  1  
ATOM 1655  H H    . ILE B 1 37 ? -1.374  5.053   -2.954  1.00 0.00 ? 41 ILE B H    1  
ATOM 1656  H HA   . ILE B 1 37 ? -3.794  6.082   -4.259  1.00 0.00 ? 41 ILE B HA   1  
ATOM 1657  H HB   . ILE B 1 37 ? -1.385  4.908   -5.649  1.00 0.00 ? 41 ILE B HB   1  
ATOM 1658  H HG12 . ILE B 1 37 ? -1.888  7.632   -6.372  1.00 0.00 ? 41 ILE B HG12 1  
ATOM 1659  H HG13 . ILE B 1 37 ? -1.772  7.547   -4.625  1.00 0.00 ? 41 ILE B HG13 1  
ATOM 1660  H HG21 . ILE B 1 37 ? -4.084  5.187   -6.462  1.00 0.00 ? 41 ILE B HG21 1  
ATOM 1661  H HG22 . ILE B 1 37 ? -3.139  6.412   -7.342  1.00 0.00 ? 41 ILE B HG22 1  
ATOM 1662  H HG23 . ILE B 1 37 ? -2.678  4.695   -7.435  1.00 0.00 ? 41 ILE B HG23 1  
ATOM 1663  H HD11 . ILE B 1 37 ? 0.383   6.295   -4.829  1.00 0.00 ? 41 ILE B HD11 1  
ATOM 1664  H HD12 . ILE B 1 37 ? 0.269   6.424   -6.601  1.00 0.00 ? 41 ILE B HD12 1  
ATOM 1665  H HD13 . ILE B 1 37 ? 0.461   7.891   -5.612  1.00 0.00 ? 41 ILE B HD13 1  
ATOM 1666  N N    . ALA B 1 38 ? -4.802  3.867   -4.053  1.00 0.00 ? 42 ALA B N    1  
ATOM 1667  C CA   . ALA B 1 38 ? -5.449  2.572   -3.929  1.00 0.00 ? 42 ALA B CA   1  
ATOM 1668  C C    . ALA B 1 38 ? -6.158  2.234   -5.241  1.00 0.00 ? 42 ALA B C    1  
ATOM 1669  O O    . ALA B 1 38 ? -6.682  3.120   -5.914  1.00 0.00 ? 42 ALA B O    1  
ATOM 1670  C CB   . ALA B 1 38 ? -6.407  2.592   -2.736  1.00 0.00 ? 42 ALA B CB   1  
ATOM 1671  H H    . ALA B 1 38 ? -5.423  4.651   -4.059  1.00 0.00 ? 42 ALA B H    1  
ATOM 1672  H HA   . ALA B 1 38 ? -4.672  1.830   -3.743  1.00 0.00 ? 42 ALA B HA   1  
ATOM 1673  H HB1  . ALA B 1 38 ? -7.288  3.183   -2.987  1.00 0.00 ? 42 ALA B HB1  1  
ATOM 1674  H HB2  . ALA B 1 38 ? -6.709  1.573   -2.496  1.00 0.00 ? 42 ALA B HB2  1  
ATOM 1675  H HB3  . ALA B 1 38 ? -5.906  3.035   -1.875  1.00 0.00 ? 42 ALA B HB3  1  
ATOM 1676  N N    . THR B 1 39 ? -6.153  0.949   -5.565  1.00 0.00 ? 43 THR B N    1  
ATOM 1677  C CA   . THR B 1 39 ? -6.790  0.483   -6.785  1.00 0.00 ? 43 THR B CA   1  
ATOM 1678  C C    . THR B 1 39 ? -8.225  0.035   -6.500  1.00 0.00 ? 43 THR B C    1  
ATOM 1679  O O    . THR B 1 39 ? -8.470  -0.712  -5.554  1.00 0.00 ? 43 THR B O    1  
ATOM 1680  C CB   . THR B 1 39 ? -5.916  -0.623  -7.382  1.00 0.00 ? 43 THR B CB   1  
ATOM 1681  O OG1  . THR B 1 39 ? -4.753  0.062   -7.838  1.00 0.00 ? 43 THR B OG1  1  
ATOM 1682  C CG2  . THR B 1 39 ? -6.518  -1.223  -8.654  1.00 0.00 ? 43 THR B CG2  1  
ATOM 1683  H H    . THR B 1 39 ? -5.725  0.234   -5.012  1.00 0.00 ? 43 THR B H    1  
ATOM 1684  H HA   . THR B 1 39 ? -6.848  1.317   -7.484  1.00 0.00 ? 43 THR B HA   1  
ATOM 1685  H HB   . THR B 1 39 ? -5.713  -1.399  -6.644  1.00 0.00 ? 43 THR B HB   1  
ATOM 1686  H HG1  . THR B 1 39 ? -3.944  -0.509  -7.699  1.00 0.00 ? 43 THR B HG1  1  
ATOM 1687  H HG21 . THR B 1 39 ? -7.383  -0.634  -8.959  1.00 0.00 ? 43 THR B HG21 1  
ATOM 1688  H HG22 . THR B 1 39 ? -5.772  -1.213  -9.448  1.00 0.00 ? 43 THR B HG22 1  
ATOM 1689  H HG23 . THR B 1 39 ? -6.829  -2.250  -8.460  1.00 0.00 ? 43 THR B HG23 1  
ATOM 1690  N N    . LEU B 1 40 ? -9.136  0.512   -7.336  1.00 0.00 ? 44 LEU B N    1  
ATOM 1691  C CA   . LEU B 1 40 ? -10.540 0.170   -7.186  1.00 0.00 ? 44 LEU B CA   1  
ATOM 1692  C C    . LEU B 1 40 ? -10.783 -1.231  -7.749  1.00 0.00 ? 44 LEU B C    1  
ATOM 1693  O O    . LEU B 1 40 ? -10.089 -1.664  -8.667  1.00 0.00 ? 44 LEU B O    1  
ATOM 1694  C CB   . LEU B 1 40 ? -11.424 1.248   -7.817  1.00 0.00 ? 44 LEU B CB   1  
ATOM 1695  C CG   . LEU B 1 40 ? -12.587 1.750   -6.958  1.00 0.00 ? 44 LEU B CG   1  
ATOM 1696  C CD1  . LEU B 1 40 ? -13.096 3.103   -7.460  1.00 0.00 ? 44 LEU B CD1  1  
ATOM 1697  C CD2  . LEU B 1 40 ? -13.705 0.708   -6.887  1.00 0.00 ? 44 LEU B CD2  1  
ATOM 1698  H H    . LEU B 1 40 ? -8.928  1.119   -8.103  1.00 0.00 ? 44 LEU B H    1  
ATOM 1699  H HA   . LEU B 1 40 ? -10.761 0.157   -6.118  1.00 0.00 ? 44 LEU B HA   1  
ATOM 1700  H HB2  . LEU B 1 40 ? -10.796 2.100   -8.075  1.00 0.00 ? 44 LEU B HB2  1  
ATOM 1701  H HB3  . LEU B 1 40 ? -11.830 0.857   -8.750  1.00 0.00 ? 44 LEU B HB3  1  
ATOM 1702  H HG   . LEU B 1 40 ? -12.222 1.900   -5.942  1.00 0.00 ? 44 LEU B HG   1  
ATOM 1703  H HD11 . LEU B 1 40 ? -12.408 3.494   -8.210  1.00 0.00 ? 44 LEU B HD11 1  
ATOM 1704  H HD12 . LEU B 1 40 ? -14.084 2.978   -7.902  1.00 0.00 ? 44 LEU B HD12 1  
ATOM 1705  H HD13 . LEU B 1 40 ? -13.157 3.800   -6.624  1.00 0.00 ? 44 LEU B HD13 1  
ATOM 1706  H HD21 . LEU B 1 40 ? -13.771 0.179   -7.838  1.00 0.00 ? 44 LEU B HD21 1  
ATOM 1707  H HD22 . LEU B 1 40 ? -13.488 -0.004  -6.090  1.00 0.00 ? 44 LEU B HD22 1  
ATOM 1708  H HD23 . LEU B 1 40 ? -14.653 1.205   -6.681  1.00 0.00 ? 44 LEU B HD23 1  
ATOM 1709  N N    . LYS B 1 41 ? -11.771 -1.902  -7.174  1.00 0.00 ? 45 LYS B N    1  
ATOM 1710  C CA   . LYS B 1 41 ? -12.114 -3.246  -7.608  1.00 0.00 ? 45 LYS B CA   1  
ATOM 1711  C C    . LYS B 1 41 ? -12.852 -3.173  -8.946  1.00 0.00 ? 45 LYS B C    1  
ATOM 1712  O O    . LYS B 1 41 ? -13.176 -4.202  -9.537  1.00 0.00 ? 45 LYS B O    1  
ATOM 1713  C CB   . LYS B 1 41 ? -12.895 -3.978  -6.514  1.00 0.00 ? 45 LYS B CB   1  
ATOM 1714  C CG   . LYS B 1 41 ? -13.072 -5.457  -6.864  1.00 0.00 ? 45 LYS B CG   1  
ATOM 1715  C CD   . LYS B 1 41 ? -14.434 -5.707  -7.516  1.00 0.00 ? 45 LYS B CD   1  
ATOM 1716  C CE   . LYS B 1 41 ? -15.301 -6.617  -6.643  1.00 0.00 ? 45 LYS B CE   1  
ATOM 1717  N NZ   . LYS B 1 41 ? -16.644 -6.783  -7.242  1.00 0.00 ? 45 LYS B NZ   1  
ATOM 1718  H H    . LYS B 1 41 ? -12.331 -1.543  -6.428  1.00 0.00 ? 45 LYS B H    1  
ATOM 1719  H HA   . LYS B 1 41 ? -11.181 -3.789  -7.756  1.00 0.00 ? 45 LYS B HA   1  
ATOM 1720  H HB2  . LYS B 1 41 ? -12.370 -3.887  -5.563  1.00 0.00 ? 45 LYS B HB2  1  
ATOM 1721  H HB3  . LYS B 1 41 ? -13.871 -3.512  -6.385  1.00 0.00 ? 45 LYS B HB3  1  
ATOM 1722  H HG2  . LYS B 1 41 ? -12.278 -5.772  -7.541  1.00 0.00 ? 45 LYS B HG2  1  
ATOM 1723  H HG3  . LYS B 1 41 ? -12.980 -6.062  -5.962  1.00 0.00 ? 45 LYS B HG3  1  
ATOM 1724  H HD2  . LYS B 1 41 ? -14.944 -4.757  -7.675  1.00 0.00 ? 45 LYS B HD2  1  
ATOM 1725  H HD3  . LYS B 1 41 ? -14.295 -6.162  -8.496  1.00 0.00 ? 45 LYS B HD3  1  
ATOM 1726  H HE2  . LYS B 1 41 ? -14.822 -7.590  -6.535  1.00 0.00 ? 45 LYS B HE2  1  
ATOM 1727  H HE3  . LYS B 1 41 ? -15.392 -6.193  -5.643  1.00 0.00 ? 45 LYS B HE3  1  
ATOM 1728  H HZ1  . LYS B 1 41 ? -16.698 -6.257  -8.091  1.00 0.00 ? 45 LYS B HZ1  1  
ATOM 1729  H HZ2  . LYS B 1 41 ? -16.804 -7.750  -7.438  1.00 0.00 ? 45 LYS B HZ2  1  
ATOM 1730  H HZ3  . LYS B 1 41 ? -17.338 -6.454  -6.601  1.00 0.00 ? 45 LYS B HZ3  1  
ATOM 1731  N N    . ASN B 1 42 ? -13.095 -1.947  -9.385  1.00 0.00 ? 46 ASN B N    1  
ATOM 1732  C CA   . ASN B 1 42 ? -13.789 -1.726  -10.643 1.00 0.00 ? 46 ASN B CA   1  
ATOM 1733  C C    . ASN B 1 42 ? -12.765 -1.420  -11.738 1.00 0.00 ? 46 ASN B C    1  
ATOM 1734  O O    . ASN B 1 42 ? -13.112 -1.356  -12.916 1.00 0.00 ? 46 ASN B O    1  
ATOM 1735  C CB   . ASN B 1 42 ? -14.745 -0.536  -10.543 1.00 0.00 ? 46 ASN B CB   1  
ATOM 1736  C CG   . ASN B 1 42 ? -14.715 0.300   -11.824 1.00 0.00 ? 46 ASN B CG   1  
ATOM 1737  O OD1  . ASN B 1 42 ? -15.108 -0.140  -12.892 1.00 0.00 ? 46 ASN B OD1  1  
ATOM 1738  N ND2  . ASN B 1 42 ? -14.229 1.527   -11.658 1.00 0.00 ? 46 ASN B ND2  1  
ATOM 1739  H H    . ASN B 1 42 ? -12.828 -1.115  -8.898  1.00 0.00 ? 46 ASN B H    1  
ATOM 1740  H HA   . ASN B 1 42 ? -14.339 -2.648  -10.832 1.00 0.00 ? 46 ASN B HA   1  
ATOM 1741  H HB2  . ASN B 1 42 ? -15.759 -0.894  -10.361 1.00 0.00 ? 46 ASN B HB2  1  
ATOM 1742  H HB3  . ASN B 1 42 ? -14.469 0.086   -9.692  1.00 0.00 ? 46 ASN B HB3  1  
ATOM 1743  H HD21 . ASN B 1 42 ? -13.923 1.825   -10.754 1.00 0.00 ? 46 ASN B HD21 1  
ATOM 1744  H HD22 . ASN B 1 42 ? -14.168 2.150   -12.437 1.00 0.00 ? 46 ASN B HD22 1  
ATOM 1745  N N    . GLY B 1 43 ? -11.525 -1.238  -11.309 1.00 0.00 ? 47 GLY B N    1  
ATOM 1746  C CA   . GLY B 1 43 ? -10.448 -0.940  -12.239 1.00 0.00 ? 47 GLY B CA   1  
ATOM 1747  C C    . GLY B 1 43 ? -9.985  0.511   -12.094 1.00 0.00 ? 47 GLY B C    1  
ATOM 1748  O O    . GLY B 1 43 ? -8.997  0.915   -12.705 1.00 0.00 ? 47 GLY B O    1  
ATOM 1749  H H    . GLY B 1 43 ? -11.251 -1.292  -10.349 1.00 0.00 ? 47 GLY B H    1  
ATOM 1750  H HA2  . GLY B 1 43 ? -9.610  -1.613  -12.058 1.00 0.00 ? 47 GLY B HA2  1  
ATOM 1751  H HA3  . GLY B 1 43 ? -10.785 -1.118  -13.260 1.00 0.00 ? 47 GLY B HA3  1  
ATOM 1752  N N    . GLN B 1 44 ? -10.720 1.255   -11.280 1.00 0.00 ? 48 GLN B N    1  
ATOM 1753  C CA   . GLN B 1 44 ? -10.397 2.652   -11.047 1.00 0.00 ? 48 GLN B CA   1  
ATOM 1754  C C    . GLN B 1 44 ? -9.372  2.779   -9.919  1.00 0.00 ? 48 GLN B C    1  
ATOM 1755  O O    . GLN B 1 44 ? -8.840  1.777   -9.443  1.00 0.00 ? 48 GLN B O    1  
ATOM 1756  C CB   . GLN B 1 44 ? -11.657 3.462   -10.736 1.00 0.00 ? 48 GLN B CB   1  
ATOM 1757  C CG   . GLN B 1 44 ? -12.311 3.975   -12.021 1.00 0.00 ? 48 GLN B CG   1  
ATOM 1758  C CD   . GLN B 1 44 ? -13.671 4.612   -11.728 1.00 0.00 ? 48 GLN B CD   1  
ATOM 1759  O OE1  . GLN B 1 44 ? -14.278 4.392   -10.693 1.00 0.00 ? 48 GLN B OE1  1  
ATOM 1760  N NE2  . GLN B 1 44 ? -14.113 5.411   -12.695 1.00 0.00 ? 48 GLN B NE2  1  
ATOM 1761  H H    . GLN B 1 44 ? -11.522 0.918   -10.787 1.00 0.00 ? 48 GLN B H    1  
ATOM 1762  H HA   . GLN B 1 44 ? -9.965  3.009   -11.982 1.00 0.00 ? 48 GLN B HA   1  
ATOM 1763  H HB2  . GLN B 1 44 ? -12.366 2.842   -10.186 1.00 0.00 ? 48 GLN B HB2  1  
ATOM 1764  H HB3  . GLN B 1 44 ? -11.404 4.304   -10.092 1.00 0.00 ? 48 GLN B HB3  1  
ATOM 1765  H HG2  . GLN B 1 44 ? -11.658 4.706   -12.498 1.00 0.00 ? 48 GLN B HG2  1  
ATOM 1766  H HG3  . GLN B 1 44 ? -12.435 3.152   -12.724 1.00 0.00 ? 48 GLN B HG3  1  
ATOM 1767  H HE21 . GLN B 1 44 ? -13.565 5.549   -13.520 1.00 0.00 ? 48 GLN B HE21 1  
ATOM 1768  H HE22 . GLN B 1 44 ? -14.994 5.874   -12.596 1.00 0.00 ? 48 GLN B HE22 1  
ATOM 1769  N N    . LYS B 1 45 ? -9.125  4.019   -9.523  1.00 0.00 ? 49 LYS B N    1  
ATOM 1770  C CA   . LYS B 1 45 ? -8.173  4.290   -8.460  1.00 0.00 ? 49 LYS B CA   1  
ATOM 1771  C C    . LYS B 1 45 ? -8.668  5.474   -7.627  1.00 0.00 ? 49 LYS B C    1  
ATOM 1772  O O    . LYS B 1 45 ? -9.264  6.407   -8.162  1.00 0.00 ? 49 LYS B O    1  
ATOM 1773  C CB   . LYS B 1 45 ? -6.769  4.486   -9.035  1.00 0.00 ? 49 LYS B CB   1  
ATOM 1774  C CG   . LYS B 1 45 ? -6.347  3.281   -9.877  1.00 0.00 ? 49 LYS B CG   1  
ATOM 1775  C CD   . LYS B 1 45 ? -5.002  3.533   -10.561 1.00 0.00 ? 49 LYS B CD   1  
ATOM 1776  C CE   . LYS B 1 45 ? -3.875  2.783   -9.847  1.00 0.00 ? 49 LYS B CE   1  
ATOM 1777  N NZ   . LYS B 1 45 ? -2.558  3.191   -10.387 1.00 0.00 ? 49 LYS B NZ   1  
ATOM 1778  H H    . LYS B 1 45 ? -9.562  4.829   -9.915  1.00 0.00 ? 49 LYS B H    1  
ATOM 1779  H HA   . LYS B 1 45 ? -8.138  3.408   -7.820  1.00 0.00 ? 49 LYS B HA   1  
ATOM 1780  H HB2  . LYS B 1 45 ? -6.745  5.388   -9.647  1.00 0.00 ? 49 LYS B HB2  1  
ATOM 1781  H HB3  . LYS B 1 45 ? -6.056  4.635   -8.223  1.00 0.00 ? 49 LYS B HB3  1  
ATOM 1782  H HG2  . LYS B 1 45 ? -6.277  2.397   -9.243  1.00 0.00 ? 49 LYS B HG2  1  
ATOM 1783  H HG3  . LYS B 1 45 ? -7.108  3.074   -10.629 1.00 0.00 ? 49 LYS B HG3  1  
ATOM 1784  H HD2  . LYS B 1 45 ? -5.053  3.214   -11.602 1.00 0.00 ? 49 LYS B HD2  1  
ATOM 1785  H HD3  . LYS B 1 45 ? -4.787  4.601   -10.565 1.00 0.00 ? 49 LYS B HD3  1  
ATOM 1786  H HE2  . LYS B 1 45 ? -3.915  2.987   -8.777  1.00 0.00 ? 49 LYS B HE2  1  
ATOM 1787  H HE3  . LYS B 1 45 ? -4.009  1.709   -9.972  1.00 0.00 ? 49 LYS B HE3  1  
ATOM 1788  H HZ1  . LYS B 1 45 ? -2.638  4.091   -10.816 1.00 0.00 ? 49 LYS B HZ1  1  
ATOM 1789  H HZ2  . LYS B 1 45 ? -1.892  3.234   -9.642  1.00 0.00 ? 49 LYS B HZ2  1  
ATOM 1790  H HZ3  . LYS B 1 45 ? -2.255  2.523   -11.067 1.00 0.00 ? 49 LYS B HZ3  1  
ATOM 1791  N N    . ALA B 1 46 ? -8.402  5.397   -6.331  1.00 0.00 ? 50 ALA B N    1  
ATOM 1792  C CA   . ALA B 1 46 ? -8.813  6.451   -5.419  1.00 0.00 ? 50 ALA B CA   1  
ATOM 1793  C C    . ALA B 1 46 ? -7.666  6.760   -4.454  1.00 0.00 ? 50 ALA B C    1  
ATOM 1794  O O    . ALA B 1 46 ? -7.285  5.913   -3.646  1.00 0.00 ? 50 ALA B O    1  
ATOM 1795  C CB   . ALA B 1 46 ? -10.090 6.027   -4.691  1.00 0.00 ? 50 ALA B CB   1  
ATOM 1796  H H    . ALA B 1 46 ? -7.916  4.634   -5.904  1.00 0.00 ? 50 ALA B H    1  
ATOM 1797  H HA   . ALA B 1 46 ? -9.025  7.340   -6.013  1.00 0.00 ? 50 ALA B HA   1  
ATOM 1798  H HB1  . ALA B 1 46 ? -10.894 6.721   -4.935  1.00 0.00 ? 50 ALA B HB1  1  
ATOM 1799  H HB2  . ALA B 1 46 ? -9.915  6.037   -3.615  1.00 0.00 ? 50 ALA B HB2  1  
ATOM 1800  H HB3  . ALA B 1 46 ? -10.370 5.022   -5.005  1.00 0.00 ? 50 ALA B HB3  1  
ATOM 1801  N N    . CYS B 1 47 ? -7.149  7.974   -4.568  1.00 0.00 ? 51 CYS B N    1  
ATOM 1802  C CA   . CYS B 1 47 ? -6.055  8.405   -3.716  1.00 0.00 ? 51 CYS B CA   1  
ATOM 1803  C C    . CYS B 1 47 ? -6.617  8.698   -2.323  1.00 0.00 ? 51 CYS B C    1  
ATOM 1804  O O    . CYS B 1 47 ? -7.727  9.211   -2.193  1.00 0.00 ? 51 CYS B O    1  
ATOM 1805  C CB   . CYS B 1 47 ? -5.323  9.614   -4.302  1.00 0.00 ? 51 CYS B CB   1  
ATOM 1806  S SG   . CYS B 1 47 ? -3.694  9.239   -5.045  1.00 0.00 ? 51 CYS B SG   1  
ATOM 1807  H H    . CYS B 1 47 ? -7.465  8.656   -5.227  1.00 0.00 ? 51 CYS B H    1  
ATOM 1808  H HA   . CYS B 1 47 ? -5.342  7.580   -3.680  1.00 0.00 ? 51 CYS B HA   1  
ATOM 1809  H HB2  . CYS B 1 47 ? -5.957  10.071  -5.061  1.00 0.00 ? 51 CYS B HB2  1  
ATOM 1810  H HB3  . CYS B 1 47 ? -5.185  10.355  -3.514  1.00 0.00 ? 51 CYS B HB3  1  
ATOM 1811  N N    . LEU B 1 48 ? -5.824  8.359   -1.317  1.00 0.00 ? 52 LEU B N    1  
ATOM 1812  C CA   . LEU B 1 48 ? -6.229  8.579   0.061   1.00 0.00 ? 52 LEU B CA   1  
ATOM 1813  C C    . LEU B 1 48 ? -5.351  9.669   0.678   1.00 0.00 ? 52 LEU B C    1  
ATOM 1814  O O    . LEU B 1 48 ? -4.312  10.023  0.122   1.00 0.00 ? 52 LEU B O    1  
ATOM 1815  C CB   . LEU B 1 48 ? -6.214  7.263   0.841   1.00 0.00 ? 52 LEU B CB   1  
ATOM 1816  C CG   . LEU B 1 48 ? -7.093  6.142   0.282   1.00 0.00 ? 52 LEU B CG   1  
ATOM 1817  C CD1  . LEU B 1 48 ? -6.660  4.781   0.830   1.00 0.00 ? 52 LEU B CD1  1  
ATOM 1818  C CD2  . LEU B 1 48 ? -8.573  6.422   0.546   1.00 0.00 ? 52 LEU B CD2  1  
ATOM 1819  H H    . LEU B 1 48 ? -4.923  7.942   -1.431  1.00 0.00 ? 52 LEU B H    1  
ATOM 1820  H HA   . LEU B 1 48 ? -7.260  8.933   0.047   1.00 0.00 ? 52 LEU B HA   1  
ATOM 1821  H HB2  . LEU B 1 48 ? -5.186  6.903   0.888   1.00 0.00 ? 52 LEU B HB2  1  
ATOM 1822  H HB3  . LEU B 1 48 ? -6.527  7.466   1.865   1.00 0.00 ? 52 LEU B HB3  1  
ATOM 1823  H HG   . LEU B 1 48 ? -6.959  6.110   -0.800  1.00 0.00 ? 52 LEU B HG   1  
ATOM 1824  H HD11 . LEU B 1 48 ? -5.839  4.917   1.534   1.00 0.00 ? 52 LEU B HD11 1  
ATOM 1825  H HD12 . LEU B 1 48 ? -7.501  4.311   1.340   1.00 0.00 ? 52 LEU B HD12 1  
ATOM 1826  H HD13 . LEU B 1 48 ? -6.333  4.145   0.008   1.00 0.00 ? 52 LEU B HD13 1  
ATOM 1827  H HD21 . LEU B 1 48 ? -8.679  6.958   1.490   1.00 0.00 ? 52 LEU B HD21 1  
ATOM 1828  H HD22 . LEU B 1 48 ? -8.978  7.030   -0.264  1.00 0.00 ? 52 LEU B HD22 1  
ATOM 1829  H HD23 . LEU B 1 48 ? -9.118  5.479   0.600   1.00 0.00 ? 52 LEU B HD23 1  
ATOM 1830  N N    . ASN B 1 49 ? -5.800  10.171  1.819   1.00 0.00 ? 53 ASN B N    1  
ATOM 1831  C CA   . ASN B 1 49 ? -5.068  11.214  2.518   1.00 0.00 ? 53 ASN B CA   1  
ATOM 1832  C C    . ASN B 1 49 ? -4.220  10.583  3.624   1.00 0.00 ? 53 ASN B C    1  
ATOM 1833  O O    . ASN B 1 49 ? -4.755  9.970   4.548   1.00 0.00 ? 53 ASN B O    1  
ATOM 1834  C CB   . ASN B 1 49 ? -6.023  12.217  3.168   1.00 0.00 ? 53 ASN B CB   1  
ATOM 1835  C CG   . ASN B 1 49 ? -5.291  13.507  3.543   1.00 0.00 ? 53 ASN B CG   1  
ATOM 1836  O OD1  . ASN B 1 49 ? -4.518  14.058  2.777   1.00 0.00 ? 53 ASN B OD1  1  
ATOM 1837  N ND2  . ASN B 1 49 ? -5.578  13.957  4.761   1.00 0.00 ? 53 ASN B ND2  1  
ATOM 1838  H H    . ASN B 1 49 ? -6.646  9.878   2.265   1.00 0.00 ? 53 ASN B H    1  
ATOM 1839  H HA   . ASN B 1 49 ? -4.461  11.699  1.753   1.00 0.00 ? 53 ASN B HA   1  
ATOM 1840  H HB2  . ASN B 1 49 ? -6.840  12.443  2.483   1.00 0.00 ? 53 ASN B HB2  1  
ATOM 1841  H HB3  . ASN B 1 49 ? -6.468  11.775  4.060   1.00 0.00 ? 53 ASN B HB3  1  
ATOM 1842  H HD21 . ASN B 1 49 ? -6.222  13.457  5.341   1.00 0.00 ? 53 ASN B HD21 1  
ATOM 1843  H HD22 . ASN B 1 49 ? -5.149  14.795  5.099   1.00 0.00 ? 53 ASN B HD22 1  
ATOM 1844  N N    . PRO B 1 50 ? -2.878  10.757  3.491   1.00 0.00 ? 54 PRO B N    1  
ATOM 1845  C CA   . PRO B 1 50 ? -1.951  10.212  4.468   1.00 0.00 ? 54 PRO B CA   1  
ATOM 1846  C C    . PRO B 1 50 ? -1.966  11.036  5.757   1.00 0.00 ? 54 PRO B C    1  
ATOM 1847  O O    . PRO B 1 50 ? -1.219  10.747  6.691   1.00 0.00 ? 54 PRO B O    1  
ATOM 1848  C CB   . PRO B 1 50 ? -0.599  10.218  3.774   1.00 0.00 ? 54 PRO B CB   1  
ATOM 1849  C CG   . PRO B 1 50 ? -0.731  11.190  2.613   1.00 0.00 ? 54 PRO B CG   1  
ATOM 1850  C CD   . PRO B 1 50 ? -2.210  11.476  2.410   1.00 0.00 ? 54 PRO B CD   1  
ATOM 1851  H HA   . PRO B 1 50 ? -2.229  9.288   4.731   1.00 0.00 ? 54 PRO B HA   1  
ATOM 1852  H HB2  . PRO B 1 50 ? 0.190   10.530  4.458   1.00 0.00 ? 54 PRO B HB2  1  
ATOM 1853  H HB3  . PRO B 1 50 ? -0.337  9.220   3.420   1.00 0.00 ? 54 PRO B HB3  1  
ATOM 1854  H HG2  . PRO B 1 50 ? -0.189  12.112  2.824   1.00 0.00 ? 54 PRO B HG2  1  
ATOM 1855  H HG3  . PRO B 1 50 ? -0.297  10.765  1.708   1.00 0.00 ? 54 PRO B HG3  1  
ATOM 1856  H HD2  . PRO B 1 50 ? -2.416  12.546  2.459   1.00 0.00 ? 54 PRO B HD2  1  
ATOM 1857  H HD3  . PRO B 1 50 ? -2.550  11.130  1.434   1.00 0.00 ? 54 PRO B HD3  1  
ATOM 1858  N N    . ALA B 1 51 ? -2.823  12.046  5.766   1.00 0.00 ? 55 ALA B N    1  
ATOM 1859  C CA   . ALA B 1 51 ? -2.944  12.914  6.925   1.00 0.00 ? 55 ALA B CA   1  
ATOM 1860  C C    . ALA B 1 51 ? -4.308  12.692  7.583   1.00 0.00 ? 55 ALA B C    1  
ATOM 1861  O O    . ALA B 1 51 ? -4.800  13.556  8.307   1.00 0.00 ? 55 ALA B O    1  
ATOM 1862  C CB   . ALA B 1 51 ? -2.733  14.368  6.499   1.00 0.00 ? 55 ALA B CB   1  
ATOM 1863  H H    . ALA B 1 51 ? -3.427  12.274  5.002   1.00 0.00 ? 55 ALA B H    1  
ATOM 1864  H HA   . ALA B 1 51 ? -2.161  12.637  7.630   1.00 0.00 ? 55 ALA B HA   1  
ATOM 1865  H HB1  . ALA B 1 51 ? -3.287  15.027  7.167   1.00 0.00 ? 55 ALA B HB1  1  
ATOM 1866  H HB2  . ALA B 1 51 ? -3.089  14.502  5.477   1.00 0.00 ? 55 ALA B HB2  1  
ATOM 1867  H HB3  . ALA B 1 51 ? -1.671  14.610  6.548   1.00 0.00 ? 55 ALA B HB3  1  
ATOM 1868  N N    . SER B 1 52 ? -4.880  11.529  7.307   1.00 0.00 ? 56 SER B N    1  
ATOM 1869  C CA   . SER B 1 52 ? -6.177  11.183  7.863   1.00 0.00 ? 56 SER B CA   1  
ATOM 1870  C C    . SER B 1 52 ? -6.058  9.924   8.724   1.00 0.00 ? 56 SER B C    1  
ATOM 1871  O O    . SER B 1 52 ? -5.340  8.991   8.370   1.00 0.00 ? 56 SER B O    1  
ATOM 1872  C CB   . SER B 1 52 ? -7.212  10.972  6.756   1.00 0.00 ? 56 SER B CB   1  
ATOM 1873  O OG   . SER B 1 52 ? -8.344  10.238  7.216   1.00 0.00 ? 56 SER B OG   1  
ATOM 1874  H H    . SER B 1 52 ? -4.473  10.832  6.717   1.00 0.00 ? 56 SER B H    1  
ATOM 1875  H HA   . SER B 1 52 ? -6.467  12.038  8.473   1.00 0.00 ? 56 SER B HA   1  
ATOM 1876  H HB2  . SER B 1 52 ? -7.538  11.940  6.375   1.00 0.00 ? 56 SER B HB2  1  
ATOM 1877  H HB3  . SER B 1 52 ? -6.750  10.442  5.923   1.00 0.00 ? 56 SER B HB3  1  
ATOM 1878  H HG   . SER B 1 52 ? -9.084  10.295  6.545   1.00 0.00 ? 56 SER B HG   1  
ATOM 1879  N N    . PRO B 1 53 ? -6.792  9.940   9.869   1.00 0.00 ? 57 PRO B N    1  
ATOM 1880  C CA   . PRO B 1 53 ? -6.775  8.811   10.784  1.00 0.00 ? 57 PRO B CA   1  
ATOM 1881  C C    . PRO B 1 53 ? -7.598  7.646   10.232  1.00 0.00 ? 57 PRO B C    1  
ATOM 1882  O O    . PRO B 1 53 ? -7.554  6.540   10.770  1.00 0.00 ? 57 PRO B O    1  
ATOM 1883  C CB   . PRO B 1 53 ? -7.323  9.358   12.093  1.00 0.00 ? 57 PRO B CB   1  
ATOM 1884  C CG   . PRO B 1 53 ? -8.057  10.640  11.734  1.00 0.00 ? 57 PRO B CG   1  
ATOM 1885  C CD   . PRO B 1 53 ? -7.654  11.028  10.321  1.00 0.00 ? 57 PRO B CD   1  
ATOM 1886  H HA   . PRO B 1 53 ? -5.844  8.463   10.889  1.00 0.00 ? 57 PRO B HA   1  
ATOM 1887  H HB2  . PRO B 1 53 ? -7.996  8.641   12.564  1.00 0.00 ? 57 PRO B HB2  1  
ATOM 1888  H HB3  . PRO B 1 53 ? -6.519  9.553   12.802  1.00 0.00 ? 57 PRO B HB3  1  
ATOM 1889  H HG2  . PRO B 1 53 ? -9.135  10.493  11.797  1.00 0.00 ? 57 PRO B HG2  1  
ATOM 1890  H HG3  . PRO B 1 53 ? -7.803  11.434  12.436  1.00 0.00 ? 57 PRO B HG3  1  
ATOM 1891  H HD2  . PRO B 1 53 ? -8.525  11.137  9.676   1.00 0.00 ? 57 PRO B HD2  1  
ATOM 1892  H HD3  . PRO B 1 53 ? -7.127  11.982  10.308  1.00 0.00 ? 57 PRO B HD3  1  
ATOM 1893  N N    . MET B 1 54 ? -8.329  7.932   9.165   1.00 0.00 ? 58 MET B N    1  
ATOM 1894  C CA   . MET B 1 54 ? -9.160  6.921   8.533   1.00 0.00 ? 58 MET B CA   1  
ATOM 1895  C C    . MET B 1 54 ? -8.388  6.182   7.439   1.00 0.00 ? 58 MET B C    1  
ATOM 1896  O O    . MET B 1 54 ? -8.827  5.136   6.963   1.00 0.00 ? 58 MET B O    1  
ATOM 1897  C CB   . MET B 1 54 ? -10.398 7.584   7.926   1.00 0.00 ? 58 MET B CB   1  
ATOM 1898  C CG   . MET B 1 54 ? -11.577 6.610   7.885   1.00 0.00 ? 58 MET B CG   1  
ATOM 1899  S SD   . MET B 1 54 ? -12.880 7.182   8.964   1.00 0.00 ? 58 MET B SD   1  
ATOM 1900  C CE   . MET B 1 54 ? -12.000 7.224   10.516  1.00 0.00 ? 58 MET B CE   1  
ATOM 1901  H H    . MET B 1 54 ? -8.358  8.834   8.733   1.00 0.00 ? 58 MET B H    1  
ATOM 1902  H HA   . MET B 1 54 ? -9.431  6.227   9.329   1.00 0.00 ? 58 MET B HA   1  
ATOM 1903  H HB2  . MET B 1 54 ? -10.668 8.463   8.512   1.00 0.00 ? 58 MET B HB2  1  
ATOM 1904  H HB3  . MET B 1 54 ? -10.172 7.930   6.918   1.00 0.00 ? 58 MET B HB3  1  
ATOM 1905  H HG2  . MET B 1 54 ? -11.951 6.522   6.865   1.00 0.00 ? 58 MET B HG2  1  
ATOM 1906  H HG3  . MET B 1 54 ? -11.250 5.617   8.192   1.00 0.00 ? 58 MET B HG3  1  
ATOM 1907  H HE1  . MET B 1 54 ? -11.043 6.714   10.406  1.00 0.00 ? 58 MET B HE1  1  
ATOM 1908  H HE2  . MET B 1 54 ? -11.829 8.260   10.809  1.00 0.00 ? 58 MET B HE2  1  
ATOM 1909  H HE3  . MET B 1 54 ? -12.592 6.723   11.283  1.00 0.00 ? 58 MET B HE3  1  
ATOM 1910  N N    . VAL B 1 55 ? -7.251  6.754   7.071   1.00 0.00 ? 59 VAL B N    1  
ATOM 1911  C CA   . VAL B 1 55 ? -6.414  6.162   6.041   1.00 0.00 ? 59 VAL B CA   1  
ATOM 1912  C C    . VAL B 1 55 ? -5.568  5.046   6.657   1.00 0.00 ? 59 VAL B C    1  
ATOM 1913  O O    . VAL B 1 55 ? -5.030  4.203   5.941   1.00 0.00 ? 59 VAL B O    1  
ATOM 1914  C CB   . VAL B 1 55 ? -5.573  7.246   5.364   1.00 0.00 ? 59 VAL B CB   1  
ATOM 1915  C CG1  . VAL B 1 55 ? -4.283  6.658   4.787   1.00 0.00 ? 59 VAL B CG1  1  
ATOM 1916  C CG2  . VAL B 1 55 ? -6.378  7.969   4.283   1.00 0.00 ? 59 VAL B CG2  1  
ATOM 1917  H H    . VAL B 1 55 ? -6.901  7.605   7.463   1.00 0.00 ? 59 VAL B H    1  
ATOM 1918  H HA   . VAL B 1 55 ? -7.074  5.729   5.290   1.00 0.00 ? 59 VAL B HA   1  
ATOM 1919  H HB   . VAL B 1 55 ? -5.297  7.979   6.123   1.00 0.00 ? 59 VAL B HB   1  
ATOM 1920  H HG11 . VAL B 1 55 ? -4.519  5.770   4.201   1.00 0.00 ? 59 VAL B HG11 1  
ATOM 1921  H HG12 . VAL B 1 55 ? -3.801  7.398   4.148   1.00 0.00 ? 59 VAL B HG12 1  
ATOM 1922  H HG13 . VAL B 1 55 ? -3.611  6.388   5.601   1.00 0.00 ? 59 VAL B HG13 1  
ATOM 1923  H HG21 . VAL B 1 55 ? -7.123  7.290   3.869   1.00 0.00 ? 59 VAL B HG21 1  
ATOM 1924  H HG22 . VAL B 1 55 ? -6.877  8.834   4.719   1.00 0.00 ? 59 VAL B HG22 1  
ATOM 1925  H HG23 . VAL B 1 55 ? -5.706  8.299   3.490   1.00 0.00 ? 59 VAL B HG23 1  
ATOM 1926  N N    . LYS B 1 56 ? -5.477  5.077   7.979   1.00 0.00 ? 60 LYS B N    1  
ATOM 1927  C CA   . LYS B 1 56 ? -4.705  4.078   8.699   1.00 0.00 ? 60 LYS B CA   1  
ATOM 1928  C C    . LYS B 1 56 ? -5.631  2.939   9.131   1.00 0.00 ? 60 LYS B C    1  
ATOM 1929  O O    . LYS B 1 56 ? -5.200  2.009   9.811   1.00 0.00 ? 60 LYS B O    1  
ATOM 1930  C CB   . LYS B 1 56 ? -3.942  4.723   9.857   1.00 0.00 ? 60 LYS B CB   1  
ATOM 1931  C CG   . LYS B 1 56 ? -2.975  5.794   9.348   1.00 0.00 ? 60 LYS B CG   1  
ATOM 1932  C CD   . LYS B 1 56 ? -3.736  6.986   8.763   1.00 0.00 ? 60 LYS B CD   1  
ATOM 1933  C CE   . LYS B 1 56 ? -2.910  8.269   8.870   1.00 0.00 ? 60 LYS B CE   1  
ATOM 1934  N NZ   . LYS B 1 56 ? -3.211  8.976   10.135  1.00 0.00 ? 60 LYS B NZ   1  
ATOM 1935  H H    . LYS B 1 56 ? -5.917  5.766   8.554   1.00 0.00 ? 60 LYS B H    1  
ATOM 1936  H HA   . LYS B 1 56 ? -3.963  3.677   8.008   1.00 0.00 ? 60 LYS B HA   1  
ATOM 1937  H HB2  . LYS B 1 56 ? -4.647  5.169   10.559  1.00 0.00 ? 60 LYS B HB2  1  
ATOM 1938  H HB3  . LYS B 1 56 ? -3.389  3.959   10.404  1.00 0.00 ? 60 LYS B HB3  1  
ATOM 1939  H HG2  . LYS B 1 56 ? -2.337  6.131   10.165  1.00 0.00 ? 60 LYS B HG2  1  
ATOM 1940  H HG3  . LYS B 1 56 ? -2.321  5.367   8.588   1.00 0.00 ? 60 LYS B HG3  1  
ATOM 1941  H HD2  . LYS B 1 56 ? -3.977  6.791   7.718   1.00 0.00 ? 60 LYS B HD2  1  
ATOM 1942  H HD3  . LYS B 1 56 ? -4.681  7.113   9.290   1.00 0.00 ? 60 LYS B HD3  1  
ATOM 1943  H HE2  . LYS B 1 56 ? -1.847  8.030   8.824   1.00 0.00 ? 60 LYS B HE2  1  
ATOM 1944  H HE3  . LYS B 1 56 ? -3.126  8.920   8.023   1.00 0.00 ? 60 LYS B HE3  1  
ATOM 1945  H HZ1  . LYS B 1 56 ? -3.018  8.372   10.908  1.00 0.00 ? 60 LYS B HZ1  1  
ATOM 1946  H HZ2  . LYS B 1 56 ? -2.642  9.795   10.203  1.00 0.00 ? 60 LYS B HZ2  1  
ATOM 1947  H HZ3  . LYS B 1 56 ? -4.176  9.238   10.149  1.00 0.00 ? 60 LYS B HZ3  1  
ATOM 1948  N N    . LYS B 1 57 ? -6.885  3.049   8.717   1.00 0.00 ? 61 LYS B N    1  
ATOM 1949  C CA   . LYS B 1 57 ? -7.875  2.040   9.053   1.00 0.00 ? 61 LYS B CA   1  
ATOM 1950  C C    . LYS B 1 57 ? -8.386  1.386   7.768   1.00 0.00 ? 61 LYS B C    1  
ATOM 1951  O O    . LYS B 1 57 ? -8.998  0.319   7.810   1.00 0.00 ? 61 LYS B O    1  
ATOM 1952  C CB   . LYS B 1 57 ? -8.982  2.643   9.919   1.00 0.00 ? 61 LYS B CB   1  
ATOM 1953  C CG   . LYS B 1 57 ? -10.074 3.274   9.053   1.00 0.00 ? 61 LYS B CG   1  
ATOM 1954  C CD   . LYS B 1 57 ? -11.306 2.369   8.978   1.00 0.00 ? 61 LYS B CD   1  
ATOM 1955  C CE   . LYS B 1 57 ? -12.572 3.133   9.370   1.00 0.00 ? 61 LYS B CE   1  
ATOM 1956  N NZ   . LYS B 1 57 ? -12.648 3.291   10.839  1.00 0.00 ? 61 LYS B NZ   1  
ATOM 1957  H H    . LYS B 1 57 ? -7.227  3.809   8.164   1.00 0.00 ? 61 LYS B H    1  
ATOM 1958  H HA   . LYS B 1 57 ? -7.375  1.279   9.652   1.00 0.00 ? 61 LYS B HA   1  
ATOM 1959  H HB2  . LYS B 1 57 ? -9.417  1.869   10.552  1.00 0.00 ? 61 LYS B HB2  1  
ATOM 1960  H HB3  . LYS B 1 57 ? -8.560  3.396   10.584  1.00 0.00 ? 61 LYS B HB3  1  
ATOM 1961  H HG2  . LYS B 1 57 ? -10.355 4.243   9.464   1.00 0.00 ? 61 LYS B HG2  1  
ATOM 1962  H HG3  . LYS B 1 57 ? -9.688  3.453   8.049   1.00 0.00 ? 61 LYS B HG3  1  
ATOM 1963  H HD2  . LYS B 1 57 ? -11.412 1.977   7.966   1.00 0.00 ? 61 LYS B HD2  1  
ATOM 1964  H HD3  . LYS B 1 57 ? -11.174 1.513   9.640   1.00 0.00 ? 61 LYS B HD3  1  
ATOM 1965  H HE2  . LYS B 1 57 ? -12.575 4.113   8.892   1.00 0.00 ? 61 LYS B HE2  1  
ATOM 1966  H HE3  . LYS B 1 57 ? -13.452 2.600   9.009   1.00 0.00 ? 61 LYS B HE3  1  
ATOM 1967  H HZ1  . LYS B 1 57 ? -12.399 2.429   11.280  1.00 0.00 ? 61 LYS B HZ1  1  
ATOM 1968  H HZ2  . LYS B 1 57 ? -12.016 4.009   11.131  1.00 0.00 ? 61 LYS B HZ2  1  
ATOM 1969  H HZ3  . LYS B 1 57 ? -13.580 3.542   11.100  1.00 0.00 ? 61 LYS B HZ3  1  
ATOM 1970  N N    . ILE B 1 58 ? -8.117  2.053   6.655   1.00 0.00 ? 62 ILE B N    1  
ATOM 1971  C CA   . ILE B 1 58 ? -8.543  1.550   5.360   1.00 0.00 ? 62 ILE B CA   1  
ATOM 1972  C C    . ILE B 1 58 ? -7.443  0.661   4.776   1.00 0.00 ? 62 ILE B C    1  
ATOM 1973  O O    . ILE B 1 58 ? -7.691  -0.114  3.853   1.00 0.00 ? 62 ILE B O    1  
ATOM 1974  C CB   . ILE B 1 58 ? -8.950  2.706   4.444   1.00 0.00 ? 62 ILE B CB   1  
ATOM 1975  C CG1  . ILE B 1 58 ? -10.115 3.496   5.043   1.00 0.00 ? 62 ILE B CG1  1  
ATOM 1976  C CG2  . ILE B 1 58 ? -9.263  2.204   3.033   1.00 0.00 ? 62 ILE B CG2  1  
ATOM 1977  C CD1  . ILE B 1 58 ? -10.053 4.967   4.626   1.00 0.00 ? 62 ILE B CD1  1  
ATOM 1978  H H    . ILE B 1 58 ? -7.620  2.920   6.629   1.00 0.00 ? 62 ILE B H    1  
ATOM 1979  H HA   . ILE B 1 58 ? -9.431  0.940   5.522   1.00 0.00 ? 62 ILE B HA   1  
ATOM 1980  H HB   . ILE B 1 58 ? -8.106  3.390   4.362   1.00 0.00 ? 62 ILE B HB   1  
ATOM 1981  H HG12 . ILE B 1 58 ? -11.060 3.062   4.716   1.00 0.00 ? 62 ILE B HG12 1  
ATOM 1982  H HG13 . ILE B 1 58 ? -10.089 3.421   6.130   1.00 0.00 ? 62 ILE B HG13 1  
ATOM 1983  H HG21 . ILE B 1 58 ? -9.937  1.349   3.093   1.00 0.00 ? 62 ILE B HG21 1  
ATOM 1984  H HG22 . ILE B 1 58 ? -9.738  3.001   2.461   1.00 0.00 ? 62 ILE B HG22 1  
ATOM 1985  H HG23 . ILE B 1 58 ? -8.339  1.904   2.540   1.00 0.00 ? 62 ILE B HG23 1  
ATOM 1986  H HD11 . ILE B 1 58 ? -9.022  5.318   4.685   1.00 0.00 ? 62 ILE B HD11 1  
ATOM 1987  H HD12 . ILE B 1 58 ? -10.413 5.070   3.602   1.00 0.00 ? 62 ILE B HD12 1  
ATOM 1988  H HD13 . ILE B 1 58 ? -10.678 5.561   5.292   1.00 0.00 ? 62 ILE B HD13 1  
ATOM 1989  N N    . ILE B 1 59 ? -6.252  0.802   5.338   1.00 0.00 ? 63 ILE B N    1  
ATOM 1990  C CA   . ILE B 1 59 ? -5.113  0.022   4.885   1.00 0.00 ? 63 ILE B CA   1  
ATOM 1991  C C    . ILE B 1 59 ? -4.997  -1.245  5.736   1.00 0.00 ? 63 ILE B C    1  
ATOM 1992  O O    . ILE B 1 59 ? -5.042  -2.356  5.210   1.00 0.00 ? 63 ILE B O    1  
ATOM 1993  C CB   . ILE B 1 59 ? -3.845  0.877   4.880   1.00 0.00 ? 63 ILE B CB   1  
ATOM 1994  C CG1  . ILE B 1 59 ? -3.836  1.838   3.689   1.00 0.00 ? 63 ILE B CG1  1  
ATOM 1995  C CG2  . ILE B 1 59 ? -2.592  0.000   4.919   1.00 0.00 ? 63 ILE B CG2  1  
ATOM 1996  C CD1  . ILE B 1 59 ? -3.021  3.094   4.004   1.00 0.00 ? 63 ILE B CD1  1  
ATOM 1997  H H    . ILE B 1 59 ? -6.059  1.435   6.088   1.00 0.00 ? 63 ILE B H    1  
ATOM 1998  H HA   . ILE B 1 59 ? -5.308  -0.272  3.854   1.00 0.00 ? 63 ILE B HA   1  
ATOM 1999  H HB   . ILE B 1 59 ? -3.840  1.486   5.785   1.00 0.00 ? 63 ILE B HB   1  
ATOM 2000  H HG12 . ILE B 1 59 ? -3.416  1.337   2.817   1.00 0.00 ? 63 ILE B HG12 1  
ATOM 2001  H HG13 . ILE B 1 59 ? -4.858  2.117   3.435   1.00 0.00 ? 63 ILE B HG13 1  
ATOM 2002  H HG21 . ILE B 1 59 ? -2.657  -0.761  4.141   1.00 0.00 ? 63 ILE B HG21 1  
ATOM 2003  H HG22 . ILE B 1 59 ? -1.710  0.618   4.749   1.00 0.00 ? 63 ILE B HG22 1  
ATOM 2004  H HG23 . ILE B 1 59 ? -2.515  -0.482  5.894   1.00 0.00 ? 63 ILE B HG23 1  
ATOM 2005  H HD11 . ILE B 1 59 ? -3.058  3.292   5.076   1.00 0.00 ? 63 ILE B HD11 1  
ATOM 2006  H HD12 . ILE B 1 59 ? -1.986  2.943   3.698   1.00 0.00 ? 63 ILE B HD12 1  
ATOM 2007  H HD13 . ILE B 1 59 ? -3.439  3.943   3.463   1.00 0.00 ? 63 ILE B HD13 1  
ATOM 2008  N N    . GLU B 1 60 ? -4.851  -1.034  7.036   1.00 0.00 ? 64 GLU B N    1  
ATOM 2009  C CA   . GLU B 1 60 ? -4.729  -2.145  7.964   1.00 0.00 ? 64 GLU B CA   1  
ATOM 2010  C C    . GLU B 1 60 ? -5.853  -3.157  7.733   1.00 0.00 ? 64 GLU B C    1  
ATOM 2011  O O    . GLU B 1 60 ? -5.655  -4.359  7.899   1.00 0.00 ? 64 GLU B O    1  
ATOM 2012  C CB   . GLU B 1 60 ? -4.725  -1.651  9.413   1.00 0.00 ? 64 GLU B CB   1  
ATOM 2013  C CG   . GLU B 1 60 ? -3.476  -0.816  9.703   1.00 0.00 ? 64 GLU B CG   1  
ATOM 2014  C CD   . GLU B 1 60 ? -3.705  0.114   10.896  1.00 0.00 ? 64 GLU B CD   1  
ATOM 2015  O OE1  . GLU B 1 60 ? -4.619  -0.195  11.690  1.00 0.00 ? 64 GLU B OE1  1  
ATOM 2016  O OE2  . GLU B 1 60 ? -2.960  1.114   10.988  1.00 0.00 ? 64 GLU B OE2  1  
ATOM 2017  H H    . GLU B 1 60 ? -4.816  -0.127  7.455   1.00 0.00 ? 64 GLU B H    1  
ATOM 2018  H HA   . GLU B 1 60 ? -3.766  -2.605  7.741   1.00 0.00 ? 64 GLU B HA   1  
ATOM 2019  H HB2  . GLU B 1 60 ? -5.617  -1.055  9.600   1.00 0.00 ? 64 GLU B HB2  1  
ATOM 2020  H HB3  . GLU B 1 60 ? -4.762  -2.504  10.091  1.00 0.00 ? 64 GLU B HB3  1  
ATOM 2021  H HG2  . GLU B 1 60 ? -2.633  -1.475  9.908   1.00 0.00 ? 64 GLU B HG2  1  
ATOM 2022  H HG3  . GLU B 1 60 ? -3.215  -0.228  8.824   1.00 0.00 ? 64 GLU B HG3  1  
ATOM 2023  N N    . LYS B 1 61 ? -7.009  -2.632  7.354   1.00 0.00 ? 65 LYS B N    1  
ATOM 2024  C CA   . LYS B 1 61 ? -8.166  -3.474  7.099   1.00 0.00 ? 65 LYS B CA   1  
ATOM 2025  C C    . LYS B 1 61 ? -7.971  -4.211  5.772   1.00 0.00 ? 65 LYS B C    1  
ATOM 2026  O O    . LYS B 1 61 ? -8.351  -5.374  5.643   1.00 0.00 ? 65 LYS B O    1  
ATOM 2027  C CB   . LYS B 1 61 ? -9.453  -2.650  7.162   1.00 0.00 ? 65 LYS B CB   1  
ATOM 2028  C CG   . LYS B 1 61 ? -9.920  -2.470  8.608   1.00 0.00 ? 65 LYS B CG   1  
ATOM 2029  C CD   . LYS B 1 61 ? -11.424 -2.200  8.669   1.00 0.00 ? 65 LYS B CD   1  
ATOM 2030  C CE   . LYS B 1 61 ? -12.156 -3.334  9.389   1.00 0.00 ? 65 LYS B CE   1  
ATOM 2031  N NZ   . LYS B 1 61 ? -13.227 -2.792  10.256  1.00 0.00 ? 65 LYS B NZ   1  
ATOM 2032  H H    . LYS B 1 61 ? -7.162  -1.652  7.222   1.00 0.00 ? 65 LYS B H    1  
ATOM 2033  H HA   . LYS B 1 61 ? -8.216  -4.211  7.900   1.00 0.00 ? 65 LYS B HA   1  
ATOM 2034  H HB2  . LYS B 1 61 ? -9.288  -1.673  6.706   1.00 0.00 ? 65 LYS B HB2  1  
ATOM 2035  H HB3  . LYS B 1 61 ? -10.234 -3.143  6.582   1.00 0.00 ? 65 LYS B HB3  1  
ATOM 2036  H HG2  . LYS B 1 61 ? -9.684  -3.365  9.183   1.00 0.00 ? 65 LYS B HG2  1  
ATOM 2037  H HG3  . LYS B 1 61 ? -9.379  -1.643  9.068   1.00 0.00 ? 65 LYS B HG3  1  
ATOM 2038  H HD2  . LYS B 1 61 ? -11.607 -1.258  9.186   1.00 0.00 ? 65 LYS B HD2  1  
ATOM 2039  H HD3  . LYS B 1 61 ? -11.819 -2.091  7.659   1.00 0.00 ? 65 LYS B HD3  1  
ATOM 2040  H HE2  . LYS B 1 61 ? -12.584 -4.020  8.658   1.00 0.00 ? 65 LYS B HE2  1  
ATOM 2041  H HE3  . LYS B 1 61 ? -11.450 -3.908  9.989   1.00 0.00 ? 65 LYS B HE3  1  
ATOM 2042  H HZ1  . LYS B 1 61 ? -13.649 -2.003  9.810   1.00 0.00 ? 65 LYS B HZ1  1  
ATOM 2043  H HZ2  . LYS B 1 61 ? -13.919 -3.497  10.411  1.00 0.00 ? 65 LYS B HZ2  1  
ATOM 2044  H HZ3  . LYS B 1 61 ? -12.836 -2.510  11.132  1.00 0.00 ? 65 LYS B HZ3  1  
ATOM 2045  N N    . MET B 1 62 ? -7.380  -3.504  4.820   1.00 0.00 ? 66 MET B N    1  
ATOM 2046  C CA   . MET B 1 62 ? -7.131  -4.076  3.508   1.00 0.00 ? 66 MET B CA   1  
ATOM 2047  C C    . MET B 1 62 ? -6.232  -5.310  3.610   1.00 0.00 ? 66 MET B C    1  
ATOM 2048  O O    . MET B 1 62 ? -6.478  -6.318  2.950   1.00 0.00 ? 66 MET B O    1  
ATOM 2049  C CB   . MET B 1 62 ? -6.463  -3.030  2.613   1.00 0.00 ? 66 MET B CB   1  
ATOM 2050  C CG   . MET B 1 62 ? -7.376  -2.643  1.448   1.00 0.00 ? 66 MET B CG   1  
ATOM 2051  S SD   . MET B 1 62 ? -7.601  -4.039  0.358   1.00 0.00 ? 66 MET B SD   1  
ATOM 2052  C CE   . MET B 1 62 ? -5.899  -4.392  -0.048  1.00 0.00 ? 66 MET B CE   1  
ATOM 2053  H H    . MET B 1 62 ? -7.074  -2.559  4.934   1.00 0.00 ? 66 MET B H    1  
ATOM 2054  H HA   . MET B 1 62 ? -8.110  -4.362  3.123   1.00 0.00 ? 66 MET B HA   1  
ATOM 2055  H HB2  . MET B 1 62 ? -6.222  -2.145  3.201   1.00 0.00 ? 66 MET B HB2  1  
ATOM 2056  H HB3  . MET B 1 62 ? -5.523  -3.423  2.228   1.00 0.00 ? 66 MET B HB3  1  
ATOM 2057  H HG2  . MET B 1 62 ? -8.342  -2.308  1.827   1.00 0.00 ? 66 MET B HG2  1  
ATOM 2058  H HG3  . MET B 1 62 ? -6.943  -1.808  0.898   1.00 0.00 ? 66 MET B HG3  1  
ATOM 2059  H HE1  . MET B 1 62 ? -5.271  -3.554  0.256   1.00 0.00 ? 66 MET B HE1  1  
ATOM 2060  H HE2  . MET B 1 62 ? -5.580  -5.293  0.476   1.00 0.00 ? 66 MET B HE2  1  
ATOM 2061  H HE3  . MET B 1 62 ? -5.806  -4.544  -1.123  1.00 0.00 ? 66 MET B HE3  1  
ATOM 2062  N N    . LEU B 1 63 ? -5.208  -5.189  4.443   1.00 0.00 ? 67 LEU B N    1  
ATOM 2063  C CA   . LEU B 1 63 ? -4.271  -6.282  4.640   1.00 0.00 ? 67 LEU B CA   1  
ATOM 2064  C C    . LEU B 1 63 ? -4.985  -7.442  5.336   1.00 0.00 ? 67 LEU B C    1  
ATOM 2065  O O    . LEU B 1 63 ? -4.485  -8.566  5.350   1.00 0.00 ? 67 LEU B O    1  
ATOM 2066  C CB   . LEU B 1 63 ? -3.025  -5.793  5.382   1.00 0.00 ? 67 LEU B CB   1  
ATOM 2067  C CG   . LEU B 1 63 ? -1.991  -5.048  4.537   1.00 0.00 ? 67 LEU B CG   1  
ATOM 2068  C CD1  . LEU B 1 63 ? -2.596  -3.788  3.914   1.00 0.00 ? 67 LEU B CD1  1  
ATOM 2069  C CD2  . LEU B 1 63 ? -0.736  -4.736  5.355   1.00 0.00 ? 67 LEU B CD2  1  
ATOM 2070  H H    . LEU B 1 63 ? -5.015  -4.366  4.976   1.00 0.00 ? 67 LEU B H    1  
ATOM 2071  H HA   . LEU B 1 63 ? -3.948  -6.617  3.654   1.00 0.00 ? 67 LEU B HA   1  
ATOM 2072  H HB2  . LEU B 1 63 ? -3.344  -5.137  6.192   1.00 0.00 ? 67 LEU B HB2  1  
ATOM 2073  H HB3  . LEU B 1 63 ? -2.539  -6.653  5.841   1.00 0.00 ? 67 LEU B HB3  1  
ATOM 2074  H HG   . LEU B 1 63 ? -1.687  -5.698  3.716   1.00 0.00 ? 67 LEU B HG   1  
ATOM 2075  H HD11 . LEU B 1 63 ? -3.120  -3.219  4.682   1.00 0.00 ? 67 LEU B HD11 1  
ATOM 2076  H HD12 . LEU B 1 63 ? -1.801  -3.176  3.487   1.00 0.00 ? 67 LEU B HD12 1  
ATOM 2077  H HD13 . LEU B 1 63 ? -3.297  -4.072  3.130   1.00 0.00 ? 67 LEU B HD13 1  
ATOM 2078  H HD21 . LEU B 1 63 ? -0.371  -5.651  5.823   1.00 0.00 ? 67 LEU B HD21 1  
ATOM 2079  H HD22 . LEU B 1 63 ? 0.035   -4.331  4.699   1.00 0.00 ? 67 LEU B HD22 1  
ATOM 2080  H HD23 . LEU B 1 63 ? -0.977  -4.005  6.126   1.00 0.00 ? 67 LEU B HD23 1  
ATOM 2081  N N    . LYS B 1 64 ? -6.145  -7.130  5.897   1.00 0.00 ? 68 LYS B N    1  
ATOM 2082  C CA   . LYS B 1 64 ? -6.933  -8.132  6.593   1.00 0.00 ? 68 LYS B CA   1  
ATOM 2083  C C    . LYS B 1 64 ? -8.080  -8.591  5.690   1.00 0.00 ? 68 LYS B C    1  
ATOM 2084  O O    . LYS B 1 64 ? -8.567  -9.712  5.820   1.00 0.00 ? 68 LYS B O    1  
ATOM 2085  C CB   . LYS B 1 64 ? -7.395  -7.602  7.952   1.00 0.00 ? 68 LYS B CB   1  
ATOM 2086  C CG   . LYS B 1 64 ? -6.372  -7.925  9.043   1.00 0.00 ? 68 LYS B CG   1  
ATOM 2087  C CD   . LYS B 1 64 ? -6.886  -7.498  10.420  1.00 0.00 ? 68 LYS B CD   1  
ATOM 2088  C CE   . LYS B 1 64 ? -7.635  -8.642  11.104  1.00 0.00 ? 68 LYS B CE   1  
ATOM 2089  N NZ   . LYS B 1 64 ? -8.080  -8.235  12.456  1.00 0.00 ? 68 LYS B NZ   1  
ATOM 2090  H H    . LYS B 1 64 ? -6.545  -6.214  5.881   1.00 0.00 ? 68 LYS B H    1  
ATOM 2091  H HA   . LYS B 1 64 ? -6.282  -8.985  6.785   1.00 0.00 ? 68 LYS B HA   1  
ATOM 2092  H HB2  . LYS B 1 64 ? -7.543  -6.523  7.895   1.00 0.00 ? 68 LYS B HB2  1  
ATOM 2093  H HB3  . LYS B 1 64 ? -8.358  -8.042  8.210   1.00 0.00 ? 68 LYS B HB3  1  
ATOM 2094  H HG2  . LYS B 1 64 ? -6.163  -8.994  9.045   1.00 0.00 ? 68 LYS B HG2  1  
ATOM 2095  H HG3  . LYS B 1 64 ? -5.433  -7.416  8.828   1.00 0.00 ? 68 LYS B HG3  1  
ATOM 2096  H HD2  . LYS B 1 64 ? -6.048  -7.183  11.042  1.00 0.00 ? 68 LYS B HD2  1  
ATOM 2097  H HD3  . LYS B 1 64 ? -7.546  -6.637  10.314  1.00 0.00 ? 68 LYS B HD3  1  
ATOM 2098  H HE2  . LYS B 1 64 ? -8.497  -8.931  10.503  1.00 0.00 ? 68 LYS B HE2  1  
ATOM 2099  H HE3  . LYS B 1 64 ? -6.989  -9.517  11.176  1.00 0.00 ? 68 LYS B HE3  1  
ATOM 2100  H HZ1  . LYS B 1 64 ? -8.551  -7.355  12.401  1.00 0.00 ? 68 LYS B HZ1  1  
ATOM 2101  H HZ2  . LYS B 1 64 ? -8.705  -8.925  12.823  1.00 0.00 ? 68 LYS B HZ2  1  
ATOM 2102  H HZ3  . LYS B 1 64 ? -7.285  -8.151  13.057  1.00 0.00 ? 68 LYS B HZ3  1  
ATOM 2103  N N    . ASN B 1 65 ? -8.478  -7.699  4.794   1.00 0.00 ? 69 ASN B N    1  
ATOM 2104  C CA   . ASN B 1 65 ? -9.558  -7.998  3.869   1.00 0.00 ? 69 ASN B CA   1  
ATOM 2105  C C    . ASN B 1 65 ? -10.841 -8.263  4.659   1.00 0.00 ? 69 ASN B C    1  
ATOM 2106  O O    . ASN B 1 65 ? -11.709 -7.396  4.750   1.00 0.00 ? 69 ASN B O    1  
ATOM 2107  C CB   . ASN B 1 65 ? -9.245  -9.247  3.042   1.00 0.00 ? 69 ASN B CB   1  
ATOM 2108  C CG   . ASN B 1 65 ? -10.467 -9.691  2.236   1.00 0.00 ? 69 ASN B CG   1  
ATOM 2109  O OD1  . ASN B 1 65 ? -11.517 -10.005 2.773   1.00 0.00 ? 69 ASN B OD1  1  
ATOM 2110  N ND2  . ASN B 1 65 ? -10.274 -9.699  0.920   1.00 0.00 ? 69 ASN B ND2  1  
ATOM 2111  H H    . ASN B 1 65 ? -8.076  -6.789  4.694   1.00 0.00 ? 69 ASN B H    1  
ATOM 2112  H HA   . ASN B 1 65 ? -9.637  -7.121  3.228   1.00 0.00 ? 69 ASN B HA   1  
ATOM 2113  H HB2  . ASN B 1 65 ? -8.415  -9.042  2.367   1.00 0.00 ? 69 ASN B HB2  1  
ATOM 2114  H HB3  . ASN B 1 65 ? -8.927  -10.054 3.702   1.00 0.00 ? 69 ASN B HB3  1  
ATOM 2115  H HD21 . ASN B 1 65 ? -9.387  -9.430  0.544   1.00 0.00 ? 69 ASN B HD21 1  
ATOM 2116  H HD22 . ASN B 1 65 ? -11.014 -9.975  0.308   1.00 0.00 ? 69 ASN B HD22 1  
ATOM 2117  N N    . GLY B 1 66 ? -10.921 -9.466  5.211   1.00 0.00 ? 70 GLY B N    1  
ATOM 2118  C CA   . GLY B 1 66 ? -12.083 -9.856  5.990   1.00 0.00 ? 70 GLY B CA   1  
ATOM 2119  C C    . GLY B 1 66 ? -11.715 -10.917 7.030   1.00 0.00 ? 70 GLY B C    1  
ATOM 2120  O O    . GLY B 1 66 ? -10.962 -11.844 6.736   1.00 0.00 ? 70 GLY B O    1  
ATOM 2121  H H    . GLY B 1 66 ? -10.210 -10.165 5.132   1.00 0.00 ? 70 GLY B H    1  
ATOM 2122  H HA2  . GLY B 1 66 ? -12.501 -8.982  6.489   1.00 0.00 ? 70 GLY B HA2  1  
ATOM 2123  H HA3  . GLY B 1 66 ? -12.856 -10.244 5.327   1.00 0.00 ? 70 GLY B HA3  1  
ATOM 2124  N N    . LYS B 1 67 ? -12.264 -10.745 8.223   1.00 0.00 ? 71 LYS B N    1  
ATOM 2125  C CA   . LYS B 1 67 ? -12.003 -11.676 9.308   1.00 0.00 ? 71 LYS B CA   1  
ATOM 2126  C C    . LYS B 1 67 ? -13.321 -12.310 9.758   1.00 0.00 ? 71 LYS B C    1  
ATOM 2127  O O    . LYS B 1 67 ? -13.478 -13.529 9.705   1.00 0.00 ? 71 LYS B O    1  
ATOM 2128  C CB   . LYS B 1 67 ? -11.237 -10.983 10.436  1.00 0.00 ? 71 LYS B CB   1  
ATOM 2129  C CG   . LYS B 1 67 ? -10.168 -11.908 11.022  1.00 0.00 ? 71 LYS B CG   1  
ATOM 2130  C CD   . LYS B 1 67 ? -10.569 -12.395 12.416  1.00 0.00 ? 71 LYS B CD   1  
ATOM 2131  C CE   . LYS B 1 67 ? -10.006 -13.791 12.692  1.00 0.00 ? 71 LYS B CE   1  
ATOM 2132  N NZ   . LYS B 1 67 ? -8.785  -13.701 13.524  1.00 0.00 ? 71 LYS B NZ   1  
ATOM 2133  H H    . LYS B 1 67 ? -12.876 -9.988  8.454   1.00 0.00 ? 71 LYS B H    1  
ATOM 2134  H HA   . LYS B 1 67 ? -11.358 -12.462 8.915   1.00 0.00 ? 71 LYS B HA   1  
ATOM 2135  H HB2  . LYS B 1 67 ? -10.769 -10.074 10.059  1.00 0.00 ? 71 LYS B HB2  1  
ATOM 2136  H HB3  . LYS B 1 67 ? -11.931 -10.681 11.220  1.00 0.00 ? 71 LYS B HB3  1  
ATOM 2137  H HG2  . LYS B 1 67 ? -10.022 -12.764 10.362  1.00 0.00 ? 71 LYS B HG2  1  
ATOM 2138  H HG3  . LYS B 1 67 ? -9.216  -11.381 11.077  1.00 0.00 ? 71 LYS B HG3  1  
ATOM 2139  H HD2  . LYS B 1 67 ? -10.204 -11.696 13.168  1.00 0.00 ? 71 LYS B HD2  1  
ATOM 2140  H HD3  . LYS B 1 67 ? -11.656 -12.414 12.500  1.00 0.00 ? 71 LYS B HD3  1  
ATOM 2141  H HE2  . LYS B 1 67 ? -10.755 -14.398 13.200  1.00 0.00 ? 71 LYS B HE2  1  
ATOM 2142  H HE3  . LYS B 1 67 ? -9.776  -14.289 11.751  1.00 0.00 ? 71 LYS B HE3  1  
ATOM 2143  H HZ1  . LYS B 1 67 ? -8.363  -12.803 13.402  1.00 0.00 ? 71 LYS B HZ1  1  
ATOM 2144  H HZ2  . LYS B 1 67 ? -9.027  -13.828 14.486  1.00 0.00 ? 71 LYS B HZ2  1  
ATOM 2145  H HZ3  . LYS B 1 67 ? -8.140  -14.413 13.246  1.00 0.00 ? 71 LYS B HZ3  1  
ATOM 2146  N N    . SER B 1 68 ? -14.235 -11.454 10.192  1.00 0.00 ? 72 SER B N    1  
ATOM 2147  C CA   . SER B 1 68 ? -15.534 -11.915 10.651  1.00 0.00 ? 72 SER B CA   1  
ATOM 2148  C C    . SER B 1 68 ? -16.465 -10.721 10.872  1.00 0.00 ? 72 SER B C    1  
ATOM 2149  O O    . SER B 1 68 ? -16.539 -10.183 11.976  1.00 0.00 ? 72 SER B O    1  
ATOM 2150  C CB   . SER B 1 68 ? -15.405 -12.732 11.938  1.00 0.00 ? 72 SER B CB   1  
ATOM 2151  O OG   . SER B 1 68 ? -14.939 -11.942 13.028  1.00 0.00 ? 72 SER B OG   1  
ATOM 2152  H H    . SER B 1 68 ? -14.099 -10.464 10.232  1.00 0.00 ? 72 SER B H    1  
ATOM 2153  H HA   . SER B 1 68 ? -15.913 -12.552 9.853   1.00 0.00 ? 72 SER B HA   1  
ATOM 2154  H HB2  . SER B 1 68 ? -16.373 -13.165 12.191  1.00 0.00 ? 72 SER B HB2  1  
ATOM 2155  H HB3  . SER B 1 68 ? -14.718 -13.562 11.773  1.00 0.00 ? 72 SER B HB3  1  
ATOM 2156  H HG   . SER B 1 68 ? -13.955 -12.070 13.148  1.00 0.00 ? 72 SER B HG   1  
ATOM 2157  N N    . ASN B 1 69 ? -17.151 -10.341 9.805   1.00 0.00 ? 73 ASN B N    1  
ATOM 2158  C CA   . ASN B 1 69 ? -18.074 -9.220  9.868   1.00 0.00 ? 73 ASN B CA   1  
ATOM 2159  C C    . ASN B 1 69 ? -17.422 -8.071  10.639  1.00 0.00 ? 73 ASN B C    1  
ATOM 2160  O O    . ASN B 1 69 ? -16.650 -7.298  10.073  1.00 0.00 ? 73 ASN B O    1  
ATOM 2161  C CB   . ASN B 1 69 ? -19.362 -9.608  10.597  1.00 0.00 ? 73 ASN B CB   1  
ATOM 2162  C CG   . ASN B 1 69 ? -20.291 -8.402  10.750  1.00 0.00 ? 73 ASN B CG   1  
ATOM 2163  O OD1  . ASN B 1 69 ? -20.149 -7.389  10.084  1.00 0.00 ? 73 ASN B OD1  1  
ATOM 2164  N ND2  . ASN B 1 69 ? -21.246 -8.566  11.661  1.00 0.00 ? 73 ASN B ND2  1  
ATOM 2165  H H    . ASN B 1 69 ? -17.085 -10.784 8.910   1.00 0.00 ? 73 ASN B H    1  
ATOM 2166  H HA   . ASN B 1 69 ? -18.282 -8.961  8.830   1.00 0.00 ? 73 ASN B HA   1  
ATOM 2167  H HB2  . ASN B 1 69 ? -19.873 -10.398 10.046  1.00 0.00 ? 73 ASN B HB2  1  
ATOM 2168  H HB3  . ASN B 1 69 ? -19.120 -10.012 11.581  1.00 0.00 ? 73 ASN B HB3  1  
ATOM 2169  H HD21 . ASN B 1 69 ? -21.306 -9.422  12.173  1.00 0.00 ? 73 ASN B HD21 1  
ATOM 2170  H HD22 . ASN B 1 69 ? -21.903 -7.832  11.833  1.00 0.00 ? 73 ASN B HD22 1  
ATOM 2171  N N    . THR A 1 1  ? -9.605  -15.807 -16.729 1.00 0.00 ? 5  THR A N    2  
ATOM 2172  C CA   . THR A 1 1  ? -10.473 -16.534 -15.818 1.00 0.00 ? 5  THR A CA   2  
ATOM 2173  C C    . THR A 1 1  ? -9.643  -17.284 -14.775 1.00 0.00 ? 5  THR A C    2  
ATOM 2174  O O    . THR A 1 1  ? -10.137 -17.599 -13.694 1.00 0.00 ? 5  THR A O    2  
ATOM 2175  C CB   . THR A 1 1  ? -11.372 -17.448 -16.652 1.00 0.00 ? 5  THR A CB   2  
ATOM 2176  O OG1  . THR A 1 1  ? -11.954 -18.329 -15.695 1.00 0.00 ? 5  THR A OG1  2  
ATOM 2177  C CG2  . THR A 1 1  ? -10.574 -18.373 -17.573 1.00 0.00 ? 5  THR A CG2  2  
ATOM 2178  H H    . THR A 1 1  ? -9.506  -14.831 -16.531 1.00 0.00 ? 5  THR A H    2  
ATOM 2179  H HA   . THR A 1 1  ? -11.087 -15.812 -15.280 1.00 0.00 ? 5  THR A HA   2  
ATOM 2180  H HB   . THR A 1 1  ? -12.100 -16.868 -17.219 1.00 0.00 ? 5  THR A HB   2  
ATOM 2181  H HG1  . THR A 1 1  ? -12.933 -18.429 -15.872 1.00 0.00 ? 5  THR A HG1  2  
ATOM 2182  H HG21 . THR A 1 1  ? -9.783  -17.805 -18.062 1.00 0.00 ? 5  THR A HG21 2  
ATOM 2183  H HG22 . THR A 1 1  ? -10.133 -19.179 -16.986 1.00 0.00 ? 5  THR A HG22 2  
ATOM 2184  H HG23 . THR A 1 1  ? -11.238 -18.795 -18.328 1.00 0.00 ? 5  THR A HG23 2  
ATOM 2185  N N    . GLU A 1 2  ? -8.396  -17.549 -15.137 1.00 0.00 ? 6  GLU A N    2  
ATOM 2186  C CA   . GLU A 1 2  ? -7.493  -18.256 -14.245 1.00 0.00 ? 6  GLU A CA   2  
ATOM 2187  C C    . GLU A 1 2  ? -6.359  -17.332 -13.795 1.00 0.00 ? 6  GLU A C    2  
ATOM 2188  O O    . GLU A 1 2  ? -5.281  -17.332 -14.387 1.00 0.00 ? 6  GLU A O    2  
ATOM 2189  C CB   . GLU A 1 2  ? -6.940  -19.517 -14.913 1.00 0.00 ? 6  GLU A CB   2  
ATOM 2190  C CG   . GLU A 1 2  ? -6.470  -20.530 -13.867 1.00 0.00 ? 6  GLU A CG   2  
ATOM 2191  C CD   . GLU A 1 2  ? -7.661  -21.231 -13.209 1.00 0.00 ? 6  GLU A CD   2  
ATOM 2192  O OE1  . GLU A 1 2  ? -8.198  -22.160 -13.850 1.00 0.00 ? 6  GLU A OE1  2  
ATOM 2193  O OE2  . GLU A 1 2  ? -8.008  -20.821 -12.080 1.00 0.00 ? 6  GLU A OE2  2  
ATOM 2194  H H    . GLU A 1 2  ? -8.002  -17.289 -16.018 1.00 0.00 ? 6  GLU A H    2  
ATOM 2195  H HA   . GLU A 1 2  ? -8.099  -18.544 -13.386 1.00 0.00 ? 6  GLU A HA   2  
ATOM 2196  H HB2  . GLU A 1 2  ? -7.708  -19.967 -15.541 1.00 0.00 ? 6  GLU A HB2  2  
ATOM 2197  H HB3  . GLU A 1 2  ? -6.108  -19.252 -15.566 1.00 0.00 ? 6  GLU A HB3  2  
ATOM 2198  H HG2  . GLU A 1 2  ? -5.823  -21.270 -14.337 1.00 0.00 ? 6  GLU A HG2  2  
ATOM 2199  H HG3  . GLU A 1 2  ? -5.876  -20.024 -13.106 1.00 0.00 ? 6  GLU A HG3  2  
ATOM 2200  N N    . LEU A 1 3  ? -6.642  -16.567 -12.751 1.00 0.00 ? 7  LEU A N    2  
ATOM 2201  C CA   . LEU A 1 3  ? -5.660  -15.640 -12.214 1.00 0.00 ? 7  LEU A CA   2  
ATOM 2202  C C    . LEU A 1 3  ? -5.103  -16.197 -10.903 1.00 0.00 ? 7  LEU A C    2  
ATOM 2203  O O    . LEU A 1 3  ? -5.705  -17.080 -10.293 1.00 0.00 ? 7  LEU A O    2  
ATOM 2204  C CB   . LEU A 1 3  ? -6.262  -14.240 -12.081 1.00 0.00 ? 7  LEU A CB   2  
ATOM 2205  C CG   . LEU A 1 3  ? -6.828  -13.628 -13.364 1.00 0.00 ? 7  LEU A CG   2  
ATOM 2206  C CD1  . LEU A 1 3  ? -8.318  -13.944 -13.511 1.00 0.00 ? 7  LEU A CD1  2  
ATOM 2207  C CD2  . LEU A 1 3  ? -6.553  -12.124 -13.422 1.00 0.00 ? 7  LEU A CD2  2  
ATOM 2208  H H    . LEU A 1 3  ? -7.522  -16.573 -12.275 1.00 0.00 ? 7  LEU A H    2  
ATOM 2209  H HA   . LEU A 1 3  ? -4.846  -15.573 -12.935 1.00 0.00 ? 7  LEU A HA   2  
ATOM 2210  H HB2  . LEU A 1 3  ? -7.059  -14.277 -11.337 1.00 0.00 ? 7  LEU A HB2  2  
ATOM 2211  H HB3  . LEU A 1 3  ? -5.494  -13.571 -11.691 1.00 0.00 ? 7  LEU A HB3  2  
ATOM 2212  H HG   . LEU A 1 3  ? -6.318  -14.082 -14.213 1.00 0.00 ? 7  LEU A HG   2  
ATOM 2213  H HD11 . LEU A 1 3  ? -8.764  -14.059 -12.523 1.00 0.00 ? 7  LEU A HD11 2  
ATOM 2214  H HD12 . LEU A 1 3  ? -8.812  -13.129 -14.040 1.00 0.00 ? 7  LEU A HD12 2  
ATOM 2215  H HD13 . LEU A 1 3  ? -8.439  -14.869 -14.074 1.00 0.00 ? 7  LEU A HD13 2  
ATOM 2216  H HD21 . LEU A 1 3  ? -6.066  -11.808 -12.499 1.00 0.00 ? 7  LEU A HD21 2  
ATOM 2217  H HD22 . LEU A 1 3  ? -5.903  -11.906 -14.269 1.00 0.00 ? 7  LEU A HD22 2  
ATOM 2218  H HD23 . LEU A 1 3  ? -7.494  -11.587 -13.538 1.00 0.00 ? 7  LEU A HD23 2  
ATOM 2219  N N    . ARG A 1 4  ? -3.958  -15.659 -10.508 1.00 0.00 ? 8  ARG A N    2  
ATOM 2220  C CA   . ARG A 1 4  ? -3.312  -16.092 -9.280  1.00 0.00 ? 8  ARG A CA   2  
ATOM 2221  C C    . ARG A 1 4  ? -2.833  -14.880 -8.477  1.00 0.00 ? 8  ARG A C    2  
ATOM 2222  O O    . ARG A 1 4  ? -3.484  -13.836 -8.475  1.00 0.00 ? 8  ARG A O    2  
ATOM 2223  C CB   . ARG A 1 4  ? -2.120  -17.003 -9.576  1.00 0.00 ? 8  ARG A CB   2  
ATOM 2224  C CG   . ARG A 1 4  ? -2.450  -17.992 -10.696 1.00 0.00 ? 8  ARG A CG   2  
ATOM 2225  C CD   . ARG A 1 4  ? -1.778  -19.344 -10.448 1.00 0.00 ? 8  ARG A CD   2  
ATOM 2226  N NE   . ARG A 1 4  ? -2.399  -20.382 -11.302 1.00 0.00 ? 8  ARG A NE   2  
ATOM 2227  C CZ   . ARG A 1 4  ? -2.272  -21.699 -11.095 1.00 0.00 ? 8  ARG A CZ   2  
ATOM 2228  N NH1  . ARG A 1 4  ? -1.547  -22.149 -10.062 1.00 0.00 ? 8  ARG A NH1  2  
ATOM 2229  N NH2  . ARG A 1 4  ? -2.871  -22.568 -11.921 1.00 0.00 ? 8  ARG A NH2  2  
ATOM 2230  H H    . ARG A 1 4  ? -3.475  -14.942 -11.009 1.00 0.00 ? 8  ARG A H    2  
ATOM 2231  H HA   . ARG A 1 4  ? -4.083  -16.641 -8.739  1.00 0.00 ? 8  ARG A HA   2  
ATOM 2232  H HB2  . ARG A 1 4  ? -1.259  -16.399 -9.863  1.00 0.00 ? 8  ARG A HB2  2  
ATOM 2233  H HB3  . ARG A 1 4  ? -1.841  -17.548 -8.675  1.00 0.00 ? 8  ARG A HB3  2  
ATOM 2234  H HG2  . ARG A 1 4  ? -3.530  -18.125 -10.761 1.00 0.00 ? 8  ARG A HG2  2  
ATOM 2235  H HG3  . ARG A 1 4  ? -2.121  -17.588 -11.653 1.00 0.00 ? 8  ARG A HG3  2  
ATOM 2236  H HD2  . ARG A 1 4  ? -0.712  -19.274 -10.664 1.00 0.00 ? 8  ARG A HD2  2  
ATOM 2237  H HD3  . ARG A 1 4  ? -1.874  -19.621 -9.398  1.00 0.00 ? 8  ARG A HD3  2  
ATOM 2238  H HE   . ARG A 1 4  ? -2.947  -20.080 -12.082 1.00 0.00 ? 8  ARG A HE   2  
ATOM 2239  H HH11 . ARG A 1 4  ? -1.100  -21.501 -9.445  1.00 0.00 ? 8  ARG A HH11 2  
ATOM 2240  H HH12 . ARG A 1 4  ? -1.452  -23.132 -9.907  1.00 0.00 ? 8  ARG A HH12 2  
ATOM 2241  H HH21 . ARG A 1 4  ? -3.413  -22.233 -12.692 1.00 0.00 ? 8  ARG A HH21 2  
ATOM 2242  H HH22 . ARG A 1 4  ? -2.776  -23.552 -11.767 1.00 0.00 ? 8  ARG A HH22 2  
ATOM 2243  N N    . CYS A 1 5  ? -1.700  -15.060 -7.815  1.00 0.00 ? 9  CYS A N    2  
ATOM 2244  C CA   . CYS A 1 5  ? -1.126  -13.995 -7.011  1.00 0.00 ? 9  CYS A CA   2  
ATOM 2245  C C    . CYS A 1 5  ? -0.150  -13.205 -7.885  1.00 0.00 ? 9  CYS A C    2  
ATOM 2246  O O    . CYS A 1 5  ? 0.485   -13.766 -8.776  1.00 0.00 ? 9  CYS A O    2  
ATOM 2247  C CB   . CYS A 1 5  ? -0.451  -14.540 -5.750  1.00 0.00 ? 9  CYS A CB   2  
ATOM 2248  S SG   . CYS A 1 5  ? -1.505  -15.627 -4.723  1.00 0.00 ? 9  CYS A SG   2  
ATOM 2249  H H    . CYS A 1 5  ? -1.177  -15.913 -7.823  1.00 0.00 ? 9  CYS A H    2  
ATOM 2250  H HA   . CYS A 1 5  ? -1.955  -13.365 -6.688  1.00 0.00 ? 9  CYS A HA   2  
ATOM 2251  H HB2  . CYS A 1 5  ? 0.441   -15.093 -6.043  1.00 0.00 ? 9  CYS A HB2  2  
ATOM 2252  H HB3  . CYS A 1 5  ? -0.118  -13.699 -5.141  1.00 0.00 ? 9  CYS A HB3  2  
ATOM 2253  N N    . GLN A 1 6  ? -0.061  -11.914 -7.599  1.00 0.00 ? 10 GLN A N    2  
ATOM 2254  C CA   . GLN A 1 6  ? 0.826   -11.041 -8.348  1.00 0.00 ? 10 GLN A CA   2  
ATOM 2255  C C    . GLN A 1 6  ? 2.279   -11.272 -7.926  1.00 0.00 ? 10 GLN A C    2  
ATOM 2256  O O    . GLN A 1 6  ? 3.197   -10.700 -8.510  1.00 0.00 ? 10 GLN A O    2  
ATOM 2257  C CB   . GLN A 1 6  ? 0.430   -9.574  -8.171  1.00 0.00 ? 10 GLN A CB   2  
ATOM 2258  C CG   . GLN A 1 6  ? 1.391   -8.652  -8.924  1.00 0.00 ? 10 GLN A CG   2  
ATOM 2259  C CD   . GLN A 1 6  ? 0.662   -7.415  -9.454  1.00 0.00 ? 10 GLN A CD   2  
ATOM 2260  O OE1  . GLN A 1 6  ? 0.473   -7.237  -10.646 1.00 0.00 ? 10 GLN A OE1  2  
ATOM 2261  N NE2  . GLN A 1 6  ? 0.264   -6.574  -8.504  1.00 0.00 ? 10 GLN A NE2  2  
ATOM 2262  H H    . GLN A 1 6  ? -0.581  -11.465 -6.872  1.00 0.00 ? 10 GLN A H    2  
ATOM 2263  H HA   . GLN A 1 6  ? 0.695   -11.323 -9.393  1.00 0.00 ? 10 GLN A HA   2  
ATOM 2264  H HB2  . GLN A 1 6  ? -0.586  -9.421  -8.534  1.00 0.00 ? 10 GLN A HB2  2  
ATOM 2265  H HB3  . GLN A 1 6  ? 0.431   -9.319  -7.111  1.00 0.00 ? 10 GLN A HB3  2  
ATOM 2266  H HG2  . GLN A 1 6  ? 2.201   -8.345  -8.262  1.00 0.00 ? 10 GLN A HG2  2  
ATOM 2267  H HG3  . GLN A 1 6  ? 1.845   -9.194  -9.754  1.00 0.00 ? 10 GLN A HG3  2  
ATOM 2268  H HE21 . GLN A 1 6  ? 0.450   -6.780  -7.543  1.00 0.00 ? 10 GLN A HE21 2  
ATOM 2269  H HE22 . GLN A 1 6  ? -0.222  -5.735  -8.751  1.00 0.00 ? 10 GLN A HE22 2  
ATOM 2270  N N    . CYS A 1 7  ? 2.441   -12.111 -6.914  1.00 0.00 ? 11 CYS A N    2  
ATOM 2271  C CA   . CYS A 1 7  ? 3.766   -12.425 -6.406  1.00 0.00 ? 11 CYS A CA   2  
ATOM 2272  C C    . CYS A 1 7  ? 3.786   -13.898 -5.994  1.00 0.00 ? 11 CYS A C    2  
ATOM 2273  O O    . CYS A 1 7  ? 2.861   -14.376 -5.338  1.00 0.00 ? 11 CYS A O    2  
ATOM 2274  C CB   . CYS A 1 7  ? 4.162   -11.503 -5.251  1.00 0.00 ? 11 CYS A CB   2  
ATOM 2275  S SG   . CYS A 1 7  ? 5.673   -10.514 -5.542  1.00 0.00 ? 11 CYS A SG   2  
ATOM 2276  H H    . CYS A 1 7  ? 1.688   -12.573 -6.444  1.00 0.00 ? 11 CYS A H    2  
ATOM 2277  H HA   . CYS A 1 7  ? 4.465   -12.242 -7.222  1.00 0.00 ? 11 CYS A HA   2  
ATOM 2278  H HB2  . CYS A 1 7  ? 3.334   -10.824 -5.046  1.00 0.00 ? 11 CYS A HB2  2  
ATOM 2279  H HB3  . CYS A 1 7  ? 4.307   -12.108 -4.356  1.00 0.00 ? 11 CYS A HB3  2  
ATOM 2280  N N    . LEU A 1 8  ? 4.851   -14.577 -6.395  1.00 0.00 ? 12 LEU A N    2  
ATOM 2281  C CA   . LEU A 1 8  ? 5.004   -15.986 -6.075  1.00 0.00 ? 12 LEU A CA   2  
ATOM 2282  C C    . LEU A 1 8  ? 5.994   -16.138 -4.918  1.00 0.00 ? 12 LEU A C    2  
ATOM 2283  O O    . LEU A 1 8  ? 6.073   -17.198 -4.299  1.00 0.00 ? 12 LEU A O    2  
ATOM 2284  C CB   . LEU A 1 8  ? 5.391   -16.780 -7.324  1.00 0.00 ? 12 LEU A CB   2  
ATOM 2285  C CG   . LEU A 1 8  ? 4.656   -16.404 -8.612  1.00 0.00 ? 12 LEU A CG   2  
ATOM 2286  C CD1  . LEU A 1 8  ? 5.529   -16.673 -9.840  1.00 0.00 ? 12 LEU A CD1  2  
ATOM 2287  C CD2  . LEU A 1 8  ? 3.306   -17.118 -8.701  1.00 0.00 ? 12 LEU A CD2  2  
ATOM 2288  H H    . LEU A 1 8  ? 5.599   -14.181 -6.927  1.00 0.00 ? 12 LEU A H    2  
ATOM 2289  H HA   . LEU A 1 8  ? 4.031   -16.354 -5.748  1.00 0.00 ? 12 LEU A HA   2  
ATOM 2290  H HB2  . LEU A 1 8  ? 6.462   -16.657 -7.491  1.00 0.00 ? 12 LEU A HB2  2  
ATOM 2291  H HB3  . LEU A 1 8  ? 5.219   -17.838 -7.126  1.00 0.00 ? 12 LEU A HB3  2  
ATOM 2292  H HG   . LEU A 1 8  ? 4.453   -15.334 -8.590  1.00 0.00 ? 12 LEU A HG   2  
ATOM 2293  H HD11 . LEU A 1 8  ? 6.543   -16.912 -9.519  1.00 0.00 ? 12 LEU A HD11 2  
ATOM 2294  H HD12 . LEU A 1 8  ? 5.118   -17.513 -10.401 1.00 0.00 ? 12 LEU A HD12 2  
ATOM 2295  H HD13 . LEU A 1 8  ? 5.547   -15.787 -10.474 1.00 0.00 ? 12 LEU A HD13 2  
ATOM 2296  H HD21 . LEU A 1 8  ? 2.905   -17.264 -7.698  1.00 0.00 ? 12 LEU A HD21 2  
ATOM 2297  H HD22 . LEU A 1 8  ? 2.613   -16.513 -9.286  1.00 0.00 ? 12 LEU A HD22 2  
ATOM 2298  H HD23 . LEU A 1 8  ? 3.439   -18.087 -9.184  1.00 0.00 ? 12 LEU A HD23 2  
ATOM 2299  N N    . GLN A 1 9  ? 6.724   -15.062 -4.661  1.00 0.00 ? 13 GLN A N    2  
ATOM 2300  C CA   . GLN A 1 9  ? 7.705   -15.062 -3.590  1.00 0.00 ? 13 GLN A CA   2  
ATOM 2301  C C    . GLN A 1 9  ? 7.600   -13.772 -2.774  1.00 0.00 ? 13 GLN A C    2  
ATOM 2302  O O    . GLN A 1 9  ? 6.949   -12.818 -3.196  1.00 0.00 ? 13 GLN A O    2  
ATOM 2303  C CB   . GLN A 1 9  ? 9.120   -15.248 -4.142  1.00 0.00 ? 13 GLN A CB   2  
ATOM 2304  C CG   . GLN A 1 9  ? 10.101  -15.611 -3.026  1.00 0.00 ? 13 GLN A CG   2  
ATOM 2305  C CD   . GLN A 1 9  ? 11.245  -16.475 -3.561  1.00 0.00 ? 13 GLN A CD   2  
ATOM 2306  O OE1  . GLN A 1 9  ? 12.129  -16.014 -4.265  1.00 0.00 ? 13 GLN A OE1  2  
ATOM 2307  N NE2  . GLN A 1 9  ? 11.179  -17.751 -3.190  1.00 0.00 ? 13 GLN A NE2  2  
ATOM 2308  H H    . GLN A 1 9  ? 6.653   -14.204 -5.169  1.00 0.00 ? 13 GLN A H    2  
ATOM 2309  H HA   . GLN A 1 9  ? 7.451   -15.917 -2.964  1.00 0.00 ? 13 GLN A HA   2  
ATOM 2310  H HB2  . GLN A 1 9  ? 9.118   -16.032 -4.900  1.00 0.00 ? 13 GLN A HB2  2  
ATOM 2311  H HB3  . GLN A 1 9  ? 9.446   -14.331 -4.634  1.00 0.00 ? 13 GLN A HB3  2  
ATOM 2312  H HG2  . GLN A 1 9  ? 10.505  -14.702 -2.581  1.00 0.00 ? 13 GLN A HG2  2  
ATOM 2313  H HG3  . GLN A 1 9  ? 9.576   -16.147 -2.235  1.00 0.00 ? 13 GLN A HG3  2  
ATOM 2314  H HE21 . GLN A 1 9  ? 10.426  -18.065 -2.612  1.00 0.00 ? 13 GLN A HE21 2  
ATOM 2315  H HE22 . GLN A 1 9  ? 11.882  -18.396 -3.490  1.00 0.00 ? 13 GLN A HE22 2  
ATOM 2316  N N    . THR A 1 10 ? 8.252   -13.785 -1.620  1.00 0.00 ? 14 THR A N    2  
ATOM 2317  C CA   . THR A 1 10 ? 8.240   -12.628 -0.741  1.00 0.00 ? 14 THR A CA   2  
ATOM 2318  C C    . THR A 1 10 ? 9.517   -12.583 0.099   1.00 0.00 ? 14 THR A C    2  
ATOM 2319  O O    . THR A 1 10 ? 10.239  -13.575 0.191   1.00 0.00 ? 14 THR A O    2  
ATOM 2320  C CB   . THR A 1 10 ? 6.962   -12.684 0.098   1.00 0.00 ? 14 THR A CB   2  
ATOM 2321  O OG1  . THR A 1 10 ? 6.857   -14.053 0.480   1.00 0.00 ? 14 THR A OG1  2  
ATOM 2322  C CG2  . THR A 1 10 ? 5.703   -12.433 -0.735  1.00 0.00 ? 14 THR A CG2  2  
ATOM 2323  H H    . THR A 1 10 ? 8.779   -14.565 -1.284  1.00 0.00 ? 14 THR A H    2  
ATOM 2324  H HA   . THR A 1 10 ? 8.231   -11.729 -1.357  1.00 0.00 ? 14 THR A HA   2  
ATOM 2325  H HB   . THR A 1 10 ? 7.017   -11.993 0.939   1.00 0.00 ? 14 THR A HB   2  
ATOM 2326  H HG1  . THR A 1 10 ? 7.030   -14.643 -0.310  1.00 0.00 ? 14 THR A HG1  2  
ATOM 2327  H HG21 . THR A 1 10 ? 5.768   -11.452 -1.205  1.00 0.00 ? 14 THR A HG21 2  
ATOM 2328  H HG22 . THR A 1 10 ? 5.617   -13.200 -1.505  1.00 0.00 ? 14 THR A HG22 2  
ATOM 2329  H HG23 . THR A 1 10 ? 4.826   -12.468 -0.088  1.00 0.00 ? 14 THR A HG23 2  
ATOM 2330  N N    . LEU A 1 11 ? 9.758   -11.423 0.692   1.00 0.00 ? 15 LEU A N    2  
ATOM 2331  C CA   . LEU A 1 11 ? 10.935  -11.237 1.522   1.00 0.00 ? 15 LEU A CA   2  
ATOM 2332  C C    . LEU A 1 11 ? 10.568  -11.491 2.985   1.00 0.00 ? 15 LEU A C    2  
ATOM 2333  O O    . LEU A 1 11 ? 9.421   -11.808 3.295   1.00 0.00 ? 15 LEU A O    2  
ATOM 2334  C CB   . LEU A 1 11 ? 11.553  -9.859  1.274   1.00 0.00 ? 15 LEU A CB   2  
ATOM 2335  C CG   . LEU A 1 11 ? 12.127  -9.623  -0.125  1.00 0.00 ? 15 LEU A CG   2  
ATOM 2336  C CD1  . LEU A 1 11 ? 11.744  -8.237  -0.648  1.00 0.00 ? 15 LEU A CD1  2  
ATOM 2337  C CD2  . LEU A 1 11 ? 13.640  -9.844  -0.141  1.00 0.00 ? 15 LEU A CD2  2  
ATOM 2338  H H    . LEU A 1 11 ? 9.165   -10.621 0.612   1.00 0.00 ? 15 LEU A H    2  
ATOM 2339  H HA   . LEU A 1 11 ? 11.672  -11.980 1.216   1.00 0.00 ? 15 LEU A HA   2  
ATOM 2340  H HB2  . LEU A 1 11 ? 10.793  -9.102  1.466   1.00 0.00 ? 15 LEU A HB2  2  
ATOM 2341  H HB3  . LEU A 1 11 ? 12.349  -9.703  2.002   1.00 0.00 ? 15 LEU A HB3  2  
ATOM 2342  H HG   . LEU A 1 11 ? 11.687  -10.355 -0.802  1.00 0.00 ? 15 LEU A HG   2  
ATOM 2343  H HD11 . LEU A 1 11 ? 11.253  -7.673  0.145   1.00 0.00 ? 15 LEU A HD11 2  
ATOM 2344  H HD12 . LEU A 1 11 ? 12.642  -7.709  -0.968  1.00 0.00 ? 15 LEU A HD12 2  
ATOM 2345  H HD13 . LEU A 1 11 ? 11.064  -8.343  -1.493  1.00 0.00 ? 15 LEU A HD13 2  
ATOM 2346  H HD21 . LEU A 1 11 ? 14.049  -9.630  0.846   1.00 0.00 ? 15 LEU A HD21 2  
ATOM 2347  H HD22 . LEU A 1 11 ? 13.854  -10.880 -0.406  1.00 0.00 ? 15 LEU A HD22 2  
ATOM 2348  H HD23 . LEU A 1 11 ? 14.097  -9.180  -0.875  1.00 0.00 ? 15 LEU A HD23 2  
ATOM 2349  N N    . GLN A 1 12 ? 11.564  -11.343 3.847   1.00 0.00 ? 16 GLN A N    2  
ATOM 2350  C CA   . GLN A 1 12 ? 11.360  -11.553 5.270   1.00 0.00 ? 16 GLN A CA   2  
ATOM 2351  C C    . GLN A 1 12 ? 11.531  -10.237 6.030   1.00 0.00 ? 16 GLN A C    2  
ATOM 2352  O O    . GLN A 1 12 ? 11.120  -10.125 7.184   1.00 0.00 ? 16 GLN A O    2  
ATOM 2353  C CB   . GLN A 1 12 ? 12.311  -12.625 5.808   1.00 0.00 ? 16 GLN A CB   2  
ATOM 2354  C CG   . GLN A 1 12 ? 12.320  -12.632 7.338   1.00 0.00 ? 16 GLN A CG   2  
ATOM 2355  C CD   . GLN A 1 12 ? 13.565  -11.929 7.882   1.00 0.00 ? 16 GLN A CD   2  
ATOM 2356  O OE1  . GLN A 1 12 ? 14.648  -12.488 7.942   1.00 0.00 ? 16 GLN A OE1  2  
ATOM 2357  N NE2  . GLN A 1 12 ? 13.352  -10.676 8.274   1.00 0.00 ? 16 GLN A NE2  2  
ATOM 2358  H H    . GLN A 1 12 ? 12.495  -11.085 3.586   1.00 0.00 ? 16 GLN A H    2  
ATOM 2359  H HA   . GLN A 1 12 ? 10.334  -11.906 5.366   1.00 0.00 ? 16 GLN A HA   2  
ATOM 2360  H HB2  . GLN A 1 12 ? 12.008  -13.604 5.438   1.00 0.00 ? 16 GLN A HB2  2  
ATOM 2361  H HB3  . GLN A 1 12 ? 13.319  -12.442 5.435   1.00 0.00 ? 16 GLN A HB3  2  
ATOM 2362  H HG2  . GLN A 1 12 ? 11.425  -12.136 7.712   1.00 0.00 ? 16 GLN A HG2  2  
ATOM 2363  H HG3  . GLN A 1 12 ? 12.290  -13.659 7.700   1.00 0.00 ? 16 GLN A HG3  2  
ATOM 2364  H HE21 . GLN A 1 12 ? 12.438  -10.277 8.197   1.00 0.00 ? 16 GLN A HE21 2  
ATOM 2365  H HE22 . GLN A 1 12 ? 14.105  -10.133 8.645   1.00 0.00 ? 16 GLN A HE22 2  
ATOM 2366  N N    . GLY A 1 13 ? 12.139  -9.274  5.353   1.00 0.00 ? 17 GLY A N    2  
ATOM 2367  C CA   . GLY A 1 13 ? 12.369  -7.969  5.951   1.00 0.00 ? 17 GLY A CA   2  
ATOM 2368  C C    . GLY A 1 13 ? 13.528  -7.247  5.260   1.00 0.00 ? 17 GLY A C    2  
ATOM 2369  O O    . GLY A 1 13 ? 14.693  -7.528  5.537   1.00 0.00 ? 17 GLY A O    2  
ATOM 2370  H H    . GLY A 1 13 ? 12.470  -9.373  4.415   1.00 0.00 ? 17 GLY A H    2  
ATOM 2371  H HA2  . GLY A 1 13 ? 11.464  -7.367  5.877   1.00 0.00 ? 17 GLY A HA2  2  
ATOM 2372  H HA3  . GLY A 1 13 ? 12.589  -8.085  7.012   1.00 0.00 ? 17 GLY A HA3  2  
ATOM 2373  N N    . ILE A 1 14 ? 13.167  -6.330  4.375   1.00 0.00 ? 18 ILE A N    2  
ATOM 2374  C CA   . ILE A 1 14 ? 14.162  -5.565  3.642   1.00 0.00 ? 18 ILE A CA   2  
ATOM 2375  C C    . ILE A 1 14 ? 14.388  -4.225  4.346   1.00 0.00 ? 18 ILE A C    2  
ATOM 2376  O O    . ILE A 1 14 ? 13.563  -3.795  5.151   1.00 0.00 ? 18 ILE A O    2  
ATOM 2377  C CB   . ILE A 1 14 ? 13.757  -5.427  2.173   1.00 0.00 ? 18 ILE A CB   2  
ATOM 2378  C CG1  . ILE A 1 14 ? 14.075  -6.705  1.395   1.00 0.00 ? 18 ILE A CG1  2  
ATOM 2379  C CG2  . ILE A 1 14 ? 14.404  -4.194  1.539   1.00 0.00 ? 18 ILE A CG2  2  
ATOM 2380  C CD1  . ILE A 1 14 ? 15.560  -7.057  1.501   1.00 0.00 ? 18 ILE A CD1  2  
ATOM 2381  H H    . ILE A 1 14 ? 12.217  -6.107  4.155   1.00 0.00 ? 18 ILE A H    2  
ATOM 2382  H HA   . ILE A 1 14 ? 15.093  -6.130  3.668   1.00 0.00 ? 18 ILE A HA   2  
ATOM 2383  H HB   . ILE A 1 14 ? 12.677  -5.282  2.128   1.00 0.00 ? 18 ILE A HB   2  
ATOM 2384  H HG12 . ILE A 1 14 ? 13.473  -7.529  1.780   1.00 0.00 ? 18 ILE A HG12 2  
ATOM 2385  H HG13 . ILE A 1 14 ? 13.802  -6.574  0.347   1.00 0.00 ? 18 ILE A HG13 2  
ATOM 2386  H HG21 . ILE A 1 14 ? 14.118  -3.304  2.101   1.00 0.00 ? 18 ILE A HG21 2  
ATOM 2387  H HG22 . ILE A 1 14 ? 15.489  -4.302  1.559   1.00 0.00 ? 18 ILE A HG22 2  
ATOM 2388  H HG23 . ILE A 1 14 ? 14.067  -4.096  0.508   1.00 0.00 ? 18 ILE A HG23 2  
ATOM 2389  H HD11 . ILE A 1 14 ? 16.109  -6.200  1.892   1.00 0.00 ? 18 ILE A HD11 2  
ATOM 2390  H HD12 . ILE A 1 14 ? 15.685  -7.906  2.174   1.00 0.00 ? 18 ILE A HD12 2  
ATOM 2391  H HD13 . ILE A 1 14 ? 15.943  -7.316  0.514   1.00 0.00 ? 18 ILE A HD13 2  
ATOM 2392  N N    . HIS A 1 15 ? 15.510  -3.602  4.017   1.00 0.00 ? 19 HIS A N    2  
ATOM 2393  C CA   . HIS A 1 15 ? 15.856  -2.320  4.607   1.00 0.00 ? 19 HIS A CA   2  
ATOM 2394  C C    . HIS A 1 15 ? 14.903  -1.242  4.086   1.00 0.00 ? 19 HIS A C    2  
ATOM 2395  O O    . HIS A 1 15 ? 14.570  -1.222  2.902   1.00 0.00 ? 19 HIS A O    2  
ATOM 2396  C CB   . HIS A 1 15 ? 17.327  -1.984  4.354   1.00 0.00 ? 19 HIS A CB   2  
ATOM 2397  C CG   . HIS A 1 15 ? 18.052  -1.452  5.567   1.00 0.00 ? 19 HIS A CG   2  
ATOM 2398  N ND1  . HIS A 1 15 ? 19.264  -0.789  5.485   1.00 0.00 ? 19 HIS A ND1  2  
ATOM 2399  C CD2  . HIS A 1 15 ? 17.724  -1.491  6.891   1.00 0.00 ? 19 HIS A CD2  2  
ATOM 2400  C CE1  . HIS A 1 15 ? 19.640  -0.450  6.709   1.00 0.00 ? 19 HIS A CE1  2  
ATOM 2401  N NE2  . HIS A 1 15 ? 18.684  -0.887  7.579   1.00 0.00 ? 19 HIS A NE2  2  
ATOM 2402  H H    . HIS A 1 15 ? 16.176  -3.959  3.361   1.00 0.00 ? 19 HIS A H    2  
ATOM 2403  H HA   . HIS A 1 15 ? 15.719  -2.425  5.684   1.00 0.00 ? 19 HIS A HA   2  
ATOM 2404  H HB2  . HIS A 1 15 ? 17.838  -2.880  4.002   1.00 0.00 ? 19 HIS A HB2  2  
ATOM 2405  H HB3  . HIS A 1 15 ? 17.388  -1.246  3.554   1.00 0.00 ? 19 HIS A HB3  2  
ATOM 2406  H HD1  . HIS A 1 15 ? 19.771  -0.599  4.644   1.00 0.00 ? 19 HIS A HD1  2  
ATOM 2407  H HD2  . HIS A 1 15 ? 16.826  -1.943  7.311   1.00 0.00 ? 19 HIS A HD2  2  
ATOM 2408  H HE1  . HIS A 1 15 ? 20.552  0.084   6.975   1.00 0.00 ? 19 HIS A HE1  2  
ATOM 2409  N N    . LEU A 1 16 ? 14.491  -0.372  4.997   1.00 0.00 ? 20 LEU A N    2  
ATOM 2410  C CA   . LEU A 1 16 ? 13.584  0.707   4.644   1.00 0.00 ? 20 LEU A CA   2  
ATOM 2411  C C    . LEU A 1 16 ? 14.364  1.809   3.924   1.00 0.00 ? 20 LEU A C    2  
ATOM 2412  O O    . LEU A 1 16 ? 13.789  2.820   3.523   1.00 0.00 ? 20 LEU A O    2  
ATOM 2413  C CB   . LEU A 1 16 ? 12.827  1.196   5.880   1.00 0.00 ? 20 LEU A CB   2  
ATOM 2414  C CG   . LEU A 1 16 ? 12.104  2.537   5.738   1.00 0.00 ? 20 LEU A CG   2  
ATOM 2415  C CD1  . LEU A 1 16 ? 11.202  2.545   4.502   1.00 0.00 ? 20 LEU A CD1  2  
ATOM 2416  C CD2  . LEU A 1 16 ? 11.333  2.883   7.013   1.00 0.00 ? 20 LEU A CD2  2  
ATOM 2417  H H    . LEU A 1 16 ? 14.767  -0.395  5.958   1.00 0.00 ? 20 LEU A H    2  
ATOM 2418  H HA   . LEU A 1 16 ? 12.845  0.299   3.954   1.00 0.00 ? 20 LEU A HA   2  
ATOM 2419  H HB2  . LEU A 1 16 ? 12.093  0.438   6.156   1.00 0.00 ? 20 LEU A HB2  2  
ATOM 2420  H HB3  . LEU A 1 16 ? 13.533  1.272   6.707   1.00 0.00 ? 20 LEU A HB3  2  
ATOM 2421  H HG   . LEU A 1 16 ? 12.854  3.315   5.594   1.00 0.00 ? 20 LEU A HG   2  
ATOM 2422  H HD11 . LEU A 1 16 ? 11.118  1.532   4.107   1.00 0.00 ? 20 LEU A HD11 2  
ATOM 2423  H HD12 . LEU A 1 16 ? 10.213  2.912   4.776   1.00 0.00 ? 20 LEU A HD12 2  
ATOM 2424  H HD13 . LEU A 1 16 ? 11.633  3.197   3.742   1.00 0.00 ? 20 LEU A HD13 2  
ATOM 2425  H HD21 . LEU A 1 16 ? 11.827  2.427   7.871   1.00 0.00 ? 20 LEU A HD21 2  
ATOM 2426  H HD22 . LEU A 1 16 ? 11.308  3.965   7.140   1.00 0.00 ? 20 LEU A HD22 2  
ATOM 2427  H HD23 . LEU A 1 16 ? 10.314  2.503   6.935   1.00 0.00 ? 20 LEU A HD23 2  
ATOM 2428  N N    . LYS A 1 17 ? 15.660  1.577   3.783   1.00 0.00 ? 21 LYS A N    2  
ATOM 2429  C CA   . LYS A 1 17 ? 16.525  2.537   3.119   1.00 0.00 ? 21 LYS A CA   2  
ATOM 2430  C C    . LYS A 1 17 ? 16.485  2.294   1.609   1.00 0.00 ? 21 LYS A C    2  
ATOM 2431  O O    . LYS A 1 17 ? 16.949  3.126   0.830   1.00 0.00 ? 21 LYS A O    2  
ATOM 2432  C CB   . LYS A 1 17 ? 17.934  2.490   3.712   1.00 0.00 ? 21 LYS A CB   2  
ATOM 2433  C CG   . LYS A 1 17 ? 17.900  2.709   5.226   1.00 0.00 ? 21 LYS A CG   2  
ATOM 2434  C CD   . LYS A 1 17 ? 19.030  3.639   5.672   1.00 0.00 ? 21 LYS A CD   2  
ATOM 2435  C CE   . LYS A 1 17 ? 18.926  3.952   7.166   1.00 0.00 ? 21 LYS A CE   2  
ATOM 2436  N NZ   . LYS A 1 17 ? 19.478  5.294   7.454   1.00 0.00 ? 21 LYS A NZ   2  
ATOM 2437  H H    . LYS A 1 17 ? 16.120  0.752   4.113   1.00 0.00 ? 21 LYS A H    2  
ATOM 2438  H HA   . LYS A 1 17 ? 16.124  3.531   3.320   1.00 0.00 ? 21 LYS A HA   2  
ATOM 2439  H HB2  . LYS A 1 17 ? 18.394  1.527   3.491   1.00 0.00 ? 21 LYS A HB2  2  
ATOM 2440  H HB3  . LYS A 1 17 ? 18.555  3.254   3.245   1.00 0.00 ? 21 LYS A HB3  2  
ATOM 2441  H HG2  . LYS A 1 17 ? 16.939  3.136   5.513   1.00 0.00 ? 21 LYS A HG2  2  
ATOM 2442  H HG3  . LYS A 1 17 ? 17.988  1.751   5.738   1.00 0.00 ? 21 LYS A HG3  2  
ATOM 2443  H HD2  . LYS A 1 17 ? 19.993  3.173   5.460   1.00 0.00 ? 21 LYS A HD2  2  
ATOM 2444  H HD3  . LYS A 1 17 ? 18.991  4.565   5.099   1.00 0.00 ? 21 LYS A HD3  2  
ATOM 2445  H HE2  . LYS A 1 17 ? 17.884  3.905   7.481   1.00 0.00 ? 21 LYS A HE2  2  
ATOM 2446  H HE3  . LYS A 1 17 ? 19.467  3.199   7.739   1.00 0.00 ? 21 LYS A HE3  2  
ATOM 2447  H HZ1  . LYS A 1 17 ? 19.010  5.975   6.890   1.00 0.00 ? 21 LYS A HZ1  2  
ATOM 2448  H HZ2  . LYS A 1 17 ? 19.341  5.511   8.420   1.00 0.00 ? 21 LYS A HZ2  2  
ATOM 2449  H HZ3  . LYS A 1 17 ? 20.456  5.304   7.245   1.00 0.00 ? 21 LYS A HZ3  2  
ATOM 2450  N N    . ASN A 1 18 ? 15.925  1.151   1.241   1.00 0.00 ? 22 ASN A N    2  
ATOM 2451  C CA   . ASN A 1 18 ? 15.819  0.788   -0.162  1.00 0.00 ? 22 ASN A CA   2  
ATOM 2452  C C    . ASN A 1 18 ? 14.374  0.983   -0.627  1.00 0.00 ? 22 ASN A C    2  
ATOM 2453  O O    . ASN A 1 18 ? 14.131  1.557   -1.687  1.00 0.00 ? 22 ASN A O    2  
ATOM 2454  C CB   . ASN A 1 18 ? 16.192  -0.679  -0.382  1.00 0.00 ? 22 ASN A CB   2  
ATOM 2455  C CG   . ASN A 1 18 ? 17.516  -0.801  -1.138  1.00 0.00 ? 22 ASN A CG   2  
ATOM 2456  O OD1  . ASN A 1 18 ? 17.800  -0.064  -2.067  1.00 0.00 ? 22 ASN A OD1  2  
ATOM 2457  N ND2  . ASN A 1 18 ? 18.308  -1.771  -0.689  1.00 0.00 ? 22 ASN A ND2  2  
ATOM 2458  H H    . ASN A 1 18 ? 15.550  0.480   1.880   1.00 0.00 ? 22 ASN A H    2  
ATOM 2459  H HA   . ASN A 1 18 ? 16.516  1.445   -0.682  1.00 0.00 ? 22 ASN A HA   2  
ATOM 2460  H HB2  . ASN A 1 18 ? 16.270  -1.186  0.580   1.00 0.00 ? 22 ASN A HB2  2  
ATOM 2461  H HB3  . ASN A 1 18 ? 15.402  -1.180  -0.942  1.00 0.00 ? 22 ASN A HB3  2  
ATOM 2462  H HD21 . ASN A 1 18 ? 18.015  -2.341  0.078   1.00 0.00 ? 22 ASN A HD21 2  
ATOM 2463  H HD22 . ASN A 1 18 ? 19.197  -1.930  -1.119  1.00 0.00 ? 22 ASN A HD22 2  
ATOM 2464  N N    . ILE A 1 19 ? 13.453  0.494   0.190   1.00 0.00 ? 23 ILE A N    2  
ATOM 2465  C CA   . ILE A 1 19 ? 12.038  0.607   -0.124  1.00 0.00 ? 23 ILE A CA   2  
ATOM 2466  C C    . ILE A 1 19 ? 11.666  2.085   -0.255  1.00 0.00 ? 23 ILE A C    2  
ATOM 2467  O O    . ILE A 1 19 ? 12.019  2.896   0.600   1.00 0.00 ? 23 ILE A O    2  
ATOM 2468  C CB   . ILE A 1 19 ? 11.199  -0.149  0.908   1.00 0.00 ? 23 ILE A CB   2  
ATOM 2469  C CG1  . ILE A 1 19 ? 11.066  -1.626  0.530   1.00 0.00 ? 23 ILE A CG1  2  
ATOM 2470  C CG2  . ILE A 1 19 ? 9.835   0.518   1.100   1.00 0.00 ? 23 ILE A CG2  2  
ATOM 2471  C CD1  . ILE A 1 19 ? 11.468  -2.529  1.699   1.00 0.00 ? 23 ILE A CD1  2  
ATOM 2472  H H    . ILE A 1 19 ? 13.659  0.028   1.051   1.00 0.00 ? 23 ILE A H    2  
ATOM 2473  H HA   . ILE A 1 19 ? 11.878  0.123   -1.087  1.00 0.00 ? 23 ILE A HA   2  
ATOM 2474  H HB   . ILE A 1 19 ? 11.716  -0.107  1.866   1.00 0.00 ? 23 ILE A HB   2  
ATOM 2475  H HG12 . ILE A 1 19 ? 10.037  -1.839  0.239   1.00 0.00 ? 23 ILE A HG12 2  
ATOM 2476  H HG13 . ILE A 1 19 ? 11.694  -1.842  -0.334  1.00 0.00 ? 23 ILE A HG13 2  
ATOM 2477  H HG21 . ILE A 1 19 ? 9.334   0.604   0.137   1.00 0.00 ? 23 ILE A HG21 2  
ATOM 2478  H HG22 . ILE A 1 19 ? 9.227   -0.086  1.774   1.00 0.00 ? 23 ILE A HG22 2  
ATOM 2479  H HG23 . ILE A 1 19 ? 9.974   1.511   1.528   1.00 0.00 ? 23 ILE A HG23 2  
ATOM 2480  H HD11 . ILE A 1 19 ? 12.352  -2.119  2.187   1.00 0.00 ? 23 ILE A HD11 2  
ATOM 2481  H HD12 . ILE A 1 19 ? 10.648  -2.582  2.415   1.00 0.00 ? 23 ILE A HD12 2  
ATOM 2482  H HD13 . ILE A 1 19 ? 11.690  -3.529  1.325   1.00 0.00 ? 23 ILE A HD13 2  
ATOM 2483  N N    . GLN A 1 20 ? 10.958  2.390   -1.333  1.00 0.00 ? 24 GLN A N    2  
ATOM 2484  C CA   . GLN A 1 20 ? 10.534  3.757   -1.587  1.00 0.00 ? 24 GLN A CA   2  
ATOM 2485  C C    . GLN A 1 20 ? 9.010   3.862   -1.511  1.00 0.00 ? 24 GLN A C    2  
ATOM 2486  O O    . GLN A 1 20 ? 8.464   4.961   -1.422  1.00 0.00 ? 24 GLN A O    2  
ATOM 2487  C CB   . GLN A 1 20 ? 11.051  4.248   -2.941  1.00 0.00 ? 24 GLN A CB   2  
ATOM 2488  C CG   . GLN A 1 20 ? 11.436  5.728   -2.876  1.00 0.00 ? 24 GLN A CG   2  
ATOM 2489  C CD   . GLN A 1 20 ? 10.465  6.582   -3.694  1.00 0.00 ? 24 GLN A CD   2  
ATOM 2490  O OE1  . GLN A 1 20 ? 10.756  7.015   -4.797  1.00 0.00 ? 24 GLN A OE1  2  
ATOM 2491  N NE2  . GLN A 1 20 ? 9.299   6.800   -3.093  1.00 0.00 ? 24 GLN A NE2  2  
ATOM 2492  H H    . GLN A 1 20 ? 10.675  1.724   -2.023  1.00 0.00 ? 24 GLN A H    2  
ATOM 2493  H HA   . GLN A 1 20 ? 10.986  4.353   -0.794  1.00 0.00 ? 24 GLN A HA   2  
ATOM 2494  H HB2  . GLN A 1 20 ? 11.917  3.656   -3.240  1.00 0.00 ? 24 GLN A HB2  2  
ATOM 2495  H HB3  . GLN A 1 20 ? 10.285  4.100   -3.702  1.00 0.00 ? 24 GLN A HB3  2  
ATOM 2496  H HG2  . GLN A 1 20 ? 11.436  6.062   -1.839  1.00 0.00 ? 24 GLN A HG2  2  
ATOM 2497  H HG3  . GLN A 1 20 ? 12.450  5.860   -3.254  1.00 0.00 ? 24 GLN A HG3  2  
ATOM 2498  H HE21 . GLN A 1 20 ? 9.123   6.415   -2.187  1.00 0.00 ? 24 GLN A HE21 2  
ATOM 2499  H HE22 . GLN A 1 20 ? 8.597   7.348   -3.548  1.00 0.00 ? 24 GLN A HE22 2  
ATOM 2500  N N    . SER A 1 21 ? 8.366   2.705   -1.549  1.00 0.00 ? 25 SER A N    2  
ATOM 2501  C CA   . SER A 1 21 ? 6.915   2.654   -1.486  1.00 0.00 ? 25 SER A CA   2  
ATOM 2502  C C    . SER A 1 21 ? 6.458   1.249   -1.089  1.00 0.00 ? 25 SER A C    2  
ATOM 2503  O O    . SER A 1 21 ? 7.220   0.290   -1.198  1.00 0.00 ? 25 SER A O    2  
ATOM 2504  C CB   . SER A 1 21 ? 6.291   3.056   -2.824  1.00 0.00 ? 25 SER A CB   2  
ATOM 2505  O OG   . SER A 1 21 ? 7.176   3.852   -3.608  1.00 0.00 ? 25 SER A OG   2  
ATOM 2506  H H    . SER A 1 21 ? 8.817   1.816   -1.622  1.00 0.00 ? 25 SER A H    2  
ATOM 2507  H HA   . SER A 1 21 ? 6.633   3.378   -0.722  1.00 0.00 ? 25 SER A HA   2  
ATOM 2508  H HB2  . SER A 1 21 ? 6.018   2.160   -3.381  1.00 0.00 ? 25 SER A HB2  2  
ATOM 2509  H HB3  . SER A 1 21 ? 5.370   3.610   -2.642  1.00 0.00 ? 25 SER A HB3  2  
ATOM 2510  H HG   . SER A 1 21 ? 6.910   3.810   -4.571  1.00 0.00 ? 25 SER A HG   2  
ATOM 2511  N N    . VAL A 1 22 ? 5.215   1.171   -0.635  1.00 0.00 ? 26 VAL A N    2  
ATOM 2512  C CA   . VAL A 1 22 ? 4.648   -0.101  -0.221  1.00 0.00 ? 26 VAL A CA   2  
ATOM 2513  C C    . VAL A 1 22 ? 3.306   -0.309  -0.926  1.00 0.00 ? 26 VAL A C    2  
ATOM 2514  O O    . VAL A 1 22 ? 2.550   0.641   -1.123  1.00 0.00 ? 26 VAL A O    2  
ATOM 2515  C CB   . VAL A 1 22 ? 4.536   -0.152  1.304   1.00 0.00 ? 26 VAL A CB   2  
ATOM 2516  C CG1  . VAL A 1 22 ? 3.767   -1.395  1.756   1.00 0.00 ? 26 VAL A CG1  2  
ATOM 2517  C CG2  . VAL A 1 22 ? 5.918   -0.094  1.958   1.00 0.00 ? 26 VAL A CG2  2  
ATOM 2518  H H    . VAL A 1 22 ? 4.602   1.956   -0.549  1.00 0.00 ? 26 VAL A H    2  
ATOM 2519  H HA   . VAL A 1 22 ? 5.335   -0.886  -0.535  1.00 0.00 ? 26 VAL A HA   2  
ATOM 2520  H HB   . VAL A 1 22 ? 3.975   0.725   1.628   1.00 0.00 ? 26 VAL A HB   2  
ATOM 2521  H HG11 . VAL A 1 22 ? 3.016   -1.649  1.008   1.00 0.00 ? 26 VAL A HG11 2  
ATOM 2522  H HG12 . VAL A 1 22 ? 4.460   -2.228  1.873   1.00 0.00 ? 26 VAL A HG12 2  
ATOM 2523  H HG13 . VAL A 1 22 ? 3.278   -1.193  2.709   1.00 0.00 ? 26 VAL A HG13 2  
ATOM 2524  H HG21 . VAL A 1 22 ? 6.638   0.315   1.249   1.00 0.00 ? 26 VAL A HG21 2  
ATOM 2525  H HG22 . VAL A 1 22 ? 5.876   0.544   2.841   1.00 0.00 ? 26 VAL A HG22 2  
ATOM 2526  H HG23 . VAL A 1 22 ? 6.225   -1.098  2.249   1.00 0.00 ? 26 VAL A HG23 2  
ATOM 2527  N N    . LYS A 1 23 ? 3.052   -1.558  -1.287  1.00 0.00 ? 27 LYS A N    2  
ATOM 2528  C CA   . LYS A 1 23 ? 1.814   -1.904  -1.966  1.00 0.00 ? 27 LYS A CA   2  
ATOM 2529  C C    . LYS A 1 23 ? 1.296   -3.238  -1.425  1.00 0.00 ? 27 LYS A C    2  
ATOM 2530  O O    . LYS A 1 23 ? 2.023   -4.230  -1.411  1.00 0.00 ? 27 LYS A O    2  
ATOM 2531  C CB   . LYS A 1 23 ? 2.014   -1.891  -3.483  1.00 0.00 ? 27 LYS A CB   2  
ATOM 2532  C CG   . LYS A 1 23 ? 0.710   -1.547  -4.205  1.00 0.00 ? 27 LYS A CG   2  
ATOM 2533  C CD   . LYS A 1 23 ? -0.285  -2.706  -4.121  1.00 0.00 ? 27 LYS A CD   2  
ATOM 2534  C CE   . LYS A 1 23 ? -0.667  -3.203  -5.517  1.00 0.00 ? 27 LYS A CE   2  
ATOM 2535  N NZ   . LYS A 1 23 ? -1.332  -2.128  -6.286  1.00 0.00 ? 27 LYS A NZ   2  
ATOM 2536  H H    . LYS A 1 23 ? 3.672   -2.325  -1.123  1.00 0.00 ? 27 LYS A H    2  
ATOM 2537  H HA   . LYS A 1 23 ? 1.085   -1.129  -1.731  1.00 0.00 ? 27 LYS A HA   2  
ATOM 2538  H HB2  . LYS A 1 23 ? 2.783   -1.165  -3.747  1.00 0.00 ? 27 LYS A HB2  2  
ATOM 2539  H HB3  . LYS A 1 23 ? 2.372   -2.866  -3.815  1.00 0.00 ? 27 LYS A HB3  2  
ATOM 2540  H HG2  . LYS A 1 23 ? 0.270   -0.653  -3.763  1.00 0.00 ? 27 LYS A HG2  2  
ATOM 2541  H HG3  . LYS A 1 23 ? 0.918   -1.317  -5.250  1.00 0.00 ? 27 LYS A HG3  2  
ATOM 2542  H HD2  . LYS A 1 23 ? 0.151   -3.524  -3.547  1.00 0.00 ? 27 LYS A HD2  2  
ATOM 2543  H HD3  . LYS A 1 23 ? -1.180  -2.384  -3.588  1.00 0.00 ? 27 LYS A HD3  2  
ATOM 2544  H HE2  . LYS A 1 23 ? 0.224   -3.539  -6.047  1.00 0.00 ? 27 LYS A HE2  2  
ATOM 2545  H HE3  . LYS A 1 23 ? -1.332  -4.063  -5.434  1.00 0.00 ? 27 LYS A HE3  2  
ATOM 2546  H HZ1  . LYS A 1 23 ? -1.960  -1.630  -5.688  1.00 0.00 ? 27 LYS A HZ1  2  
ATOM 2547  H HZ2  . LYS A 1 23 ? -0.642  -1.498  -6.643  1.00 0.00 ? 27 LYS A HZ2  2  
ATOM 2548  H HZ3  . LYS A 1 23 ? -1.843  -2.528  -7.046  1.00 0.00 ? 27 LYS A HZ3  2  
ATOM 2549  N N    . VAL A 1 24 ? 0.044   -3.218  -0.994  1.00 0.00 ? 28 VAL A N    2  
ATOM 2550  C CA   . VAL A 1 24 ? -0.580  -4.414  -0.453  1.00 0.00 ? 28 VAL A CA   2  
ATOM 2551  C C    . VAL A 1 24 ? -1.745  -4.829  -1.355  1.00 0.00 ? 28 VAL A C    2  
ATOM 2552  O O    . VAL A 1 24 ? -2.829  -4.252  -1.279  1.00 0.00 ? 28 VAL A O    2  
ATOM 2553  C CB   . VAL A 1 24 ? -1.003  -4.174  0.997   1.00 0.00 ? 28 VAL A CB   2  
ATOM 2554  C CG1  . VAL A 1 24 ? -1.854  -5.333  1.520   1.00 0.00 ? 28 VAL A CG1  2  
ATOM 2555  C CG2  . VAL A 1 24 ? 0.215   -3.940  1.893   1.00 0.00 ? 28 VAL A CG2  2  
ATOM 2556  H H    . VAL A 1 24 ? -0.540  -2.407  -1.009  1.00 0.00 ? 28 VAL A H    2  
ATOM 2557  H HA   . VAL A 1 24 ? 0.168   -5.207  -0.459  1.00 0.00 ? 28 VAL A HA   2  
ATOM 2558  H HB   . VAL A 1 24 ? -1.615  -3.272  1.023   1.00 0.00 ? 28 VAL A HB   2  
ATOM 2559  H HG11 . VAL A 1 24 ? -2.186  -5.946  0.682   1.00 0.00 ? 28 VAL A HG11 2  
ATOM 2560  H HG12 . VAL A 1 24 ? -1.260  -5.941  2.202   1.00 0.00 ? 28 VAL A HG12 2  
ATOM 2561  H HG13 . VAL A 1 24 ? -2.722  -4.938  2.048   1.00 0.00 ? 28 VAL A HG13 2  
ATOM 2562  H HG21 . VAL A 1 24 ? 1.078   -3.691  1.274   1.00 0.00 ? 28 VAL A HG21 2  
ATOM 2563  H HG22 . VAL A 1 24 ? 0.010   -3.118  2.578   1.00 0.00 ? 28 VAL A HG22 2  
ATOM 2564  H HG23 . VAL A 1 24 ? 0.426   -4.845  2.463   1.00 0.00 ? 28 VAL A HG23 2  
ATOM 2565  N N    . LYS A 1 25 ? -1.481  -5.824  -2.188  1.00 0.00 ? 29 LYS A N    2  
ATOM 2566  C CA   . LYS A 1 25 ? -2.494  -6.323  -3.103  1.00 0.00 ? 29 LYS A CA   2  
ATOM 2567  C C    . LYS A 1 25 ? -3.228  -7.497  -2.454  1.00 0.00 ? 29 LYS A C    2  
ATOM 2568  O O    . LYS A 1 25 ? -2.903  -8.656  -2.711  1.00 0.00 ? 29 LYS A O    2  
ATOM 2569  C CB   . LYS A 1 25 ? -1.871  -6.660  -4.459  1.00 0.00 ? 29 LYS A CB   2  
ATOM 2570  C CG   . LYS A 1 25 ? -2.930  -6.665  -5.563  1.00 0.00 ? 29 LYS A CG   2  
ATOM 2571  C CD   . LYS A 1 25 ? -3.707  -7.983  -5.573  1.00 0.00 ? 29 LYS A CD   2  
ATOM 2572  C CE   . LYS A 1 25 ? -3.808  -8.549  -6.991  1.00 0.00 ? 29 LYS A CE   2  
ATOM 2573  N NZ   . LYS A 1 25 ? -5.138  -9.160  -7.211  1.00 0.00 ? 29 LYS A NZ   2  
ATOM 2574  H H    . LYS A 1 25 ? -0.597  -6.288  -2.243  1.00 0.00 ? 29 LYS A H    2  
ATOM 2575  H HA   . LYS A 1 25 ? -3.209  -5.517  -3.269  1.00 0.00 ? 29 LYS A HA   2  
ATOM 2576  H HB2  . LYS A 1 25 ? -1.094  -5.934  -4.698  1.00 0.00 ? 29 LYS A HB2  2  
ATOM 2577  H HB3  . LYS A 1 25 ? -1.389  -7.637  -4.409  1.00 0.00 ? 29 LYS A HB3  2  
ATOM 2578  H HG2  . LYS A 1 25 ? -3.619  -5.834  -5.414  1.00 0.00 ? 29 LYS A HG2  2  
ATOM 2579  H HG3  . LYS A 1 25 ? -2.452  -6.513  -6.531  1.00 0.00 ? 29 LYS A HG3  2  
ATOM 2580  H HD2  . LYS A 1 25 ? -3.212  -8.706  -4.923  1.00 0.00 ? 29 LYS A HD2  2  
ATOM 2581  H HD3  . LYS A 1 25 ? -4.706  -7.824  -5.169  1.00 0.00 ? 29 LYS A HD3  2  
ATOM 2582  H HE2  . LYS A 1 25 ? -3.641  -7.755  -7.718  1.00 0.00 ? 29 LYS A HE2  2  
ATOM 2583  H HE3  . LYS A 1 25 ? -3.029  -9.295  -7.148  1.00 0.00 ? 29 LYS A HE3  2  
ATOM 2584  H HZ1  . LYS A 1 25 ? -5.555  -9.379  -6.328  1.00 0.00 ? 29 LYS A HZ1  2  
ATOM 2585  H HZ2  . LYS A 1 25 ? -5.723  -8.517  -7.705  1.00 0.00 ? 29 LYS A HZ2  2  
ATOM 2586  H HZ3  . LYS A 1 25 ? -5.036  -9.997  -7.748  1.00 0.00 ? 29 LYS A HZ3  2  
ATOM 2587  N N    . SER A 1 26 ? -4.205  -7.158  -1.625  1.00 0.00 ? 30 SER A N    2  
ATOM 2588  C CA   . SER A 1 26 ? -4.988  -8.170  -0.937  1.00 0.00 ? 30 SER A CA   2  
ATOM 2589  C C    . SER A 1 26 ? -5.395  -9.273  -1.917  1.00 0.00 ? 30 SER A C    2  
ATOM 2590  O O    . SER A 1 26 ? -5.206  -9.135  -3.125  1.00 0.00 ? 30 SER A O    2  
ATOM 2591  C CB   . SER A 1 26 ? -6.228  -7.557  -0.283  1.00 0.00 ? 30 SER A CB   2  
ATOM 2592  O OG   . SER A 1 26 ? -6.099  -7.475  1.133   1.00 0.00 ? 30 SER A OG   2  
ATOM 2593  H H    . SER A 1 26 ? -4.463  -6.214  -1.422  1.00 0.00 ? 30 SER A H    2  
ATOM 2594  H HA   . SER A 1 26 ? -4.330  -8.569  -0.165  1.00 0.00 ? 30 SER A HA   2  
ATOM 2595  H HB2  . SER A 1 26 ? -6.397  -6.560  -0.691  1.00 0.00 ? 30 SER A HB2  2  
ATOM 2596  H HB3  . SER A 1 26 ? -7.104  -8.156  -0.534  1.00 0.00 ? 30 SER A HB3  2  
ATOM 2597  H HG   . SER A 1 26 ? -5.530  -8.225  1.469   1.00 0.00 ? 30 SER A HG   2  
ATOM 2598  N N    . PRO A 1 27 ? -5.960  -10.370 -1.346  1.00 0.00 ? 31 PRO A N    2  
ATOM 2599  C CA   . PRO A 1 27 ? -6.395  -11.495 -2.155  1.00 0.00 ? 31 PRO A CA   2  
ATOM 2600  C C    . PRO A 1 27 ? -7.694  -11.168 -2.896  1.00 0.00 ? 31 PRO A C    2  
ATOM 2601  O O    . PRO A 1 27 ? -8.245  -10.080 -2.740  1.00 0.00 ? 31 PRO A O    2  
ATOM 2602  C CB   . PRO A 1 27 ? -6.543  -12.649 -1.178  1.00 0.00 ? 31 PRO A CB   2  
ATOM 2603  C CG   . PRO A 1 27 ? -6.637  -12.018 0.202   1.00 0.00 ? 31 PRO A CG   2  
ATOM 2604  C CD   . PRO A 1 27 ? -6.200  -10.567 0.081   1.00 0.00 ? 31 PRO A CD   2  
ATOM 2605  H HA   . PRO A 1 27 ? -5.719  -11.694 -2.865  1.00 0.00 ? 31 PRO A HA   2  
ATOM 2606  H HB2  . PRO A 1 27 ? -7.434  -13.237 -1.399  1.00 0.00 ? 31 PRO A HB2  2  
ATOM 2607  H HB3  . PRO A 1 27 ? -5.691  -13.326 -1.240  1.00 0.00 ? 31 PRO A HB3  2  
ATOM 2608  H HG2  . PRO A 1 27 ? -7.657  -12.079 0.581   1.00 0.00 ? 31 PRO A HG2  2  
ATOM 2609  H HG3  . PRO A 1 27 ? -6.002  -12.550 0.910   1.00 0.00 ? 31 PRO A HG3  2  
ATOM 2610  H HD2  . PRO A 1 27 ? -6.969  -9.889  0.451   1.00 0.00 ? 31 PRO A HD2  2  
ATOM 2611  H HD3  . PRO A 1 27 ? -5.299  -10.375 0.664   1.00 0.00 ? 31 PRO A HD3  2  
ATOM 2612  N N    . GLY A 1 28 ? -8.146  -12.131 -3.686  1.00 0.00 ? 32 GLY A N    2  
ATOM 2613  C CA   . GLY A 1 28 ? -9.369  -11.960 -4.450  1.00 0.00 ? 32 GLY A CA   2  
ATOM 2614  C C    . GLY A 1 28 ? -10.021 -13.311 -4.752  1.00 0.00 ? 32 GLY A C    2  
ATOM 2615  O O    . GLY A 1 28 ? -9.774  -14.293 -4.054  1.00 0.00 ? 32 GLY A O    2  
ATOM 2616  H H    . GLY A 1 28 ? -7.692  -13.014 -3.807  1.00 0.00 ? 32 GLY A H    2  
ATOM 2617  H HA2  . GLY A 1 28 ? -10.065 -11.332 -3.894  1.00 0.00 ? 32 GLY A HA2  2  
ATOM 2618  H HA3  . GLY A 1 28 ? -9.149  -11.442 -5.384  1.00 0.00 ? 32 GLY A HA3  2  
ATOM 2619  N N    . PRO A 1 29 ? -10.864 -13.317 -5.820  1.00 0.00 ? 33 PRO A N    2  
ATOM 2620  C CA   . PRO A 1 29 ? -11.553 -14.531 -6.222  1.00 0.00 ? 33 PRO A CA   2  
ATOM 2621  C C    . PRO A 1 29 ? -10.598 -15.497 -6.926  1.00 0.00 ? 33 PRO A C    2  
ATOM 2622  O O    . PRO A 1 29 ? -11.006 -16.573 -7.360  1.00 0.00 ? 33 PRO A O    2  
ATOM 2623  C CB   . PRO A 1 29 ? -12.688 -14.061 -7.117  1.00 0.00 ? 33 PRO A CB   2  
ATOM 2624  C CG   . PRO A 1 29 ? -12.316 -12.654 -7.557  1.00 0.00 ? 33 PRO A CG   2  
ATOM 2625  C CD   . PRO A 1 29 ? -11.180 -12.173 -6.669  1.00 0.00 ? 33 PRO A CD   2  
ATOM 2626  H HA   . PRO A 1 29 ? -11.893 -15.020 -5.418  1.00 0.00 ? 33 PRO A HA   2  
ATOM 2627  H HB2  . PRO A 1 29 ? -12.807 -14.720 -7.976  1.00 0.00 ? 33 PRO A HB2  2  
ATOM 2628  H HB3  . PRO A 1 29 ? -13.636 -14.064 -6.579  1.00 0.00 ? 33 PRO A HB3  2  
ATOM 2629  H HG2  . PRO A 1 29 ? -12.011 -12.650 -8.603  1.00 0.00 ? 33 PRO A HG2  2  
ATOM 2630  H HG3  . PRO A 1 29 ? -13.175 -11.988 -7.473  1.00 0.00 ? 33 PRO A HG3  2  
ATOM 2631  H HD2  . PRO A 1 29 ? -10.317 -11.868 -7.261  1.00 0.00 ? 33 PRO A HD2  2  
ATOM 2632  H HD3  . PRO A 1 29 ? -11.480 -11.310 -6.075  1.00 0.00 ? 33 PRO A HD3  2  
ATOM 2633  N N    . HIS A 1 30 ? -9.344  -15.078 -7.016  1.00 0.00 ? 34 HIS A N    2  
ATOM 2634  C CA   . HIS A 1 30 ? -8.328  -15.892 -7.660  1.00 0.00 ? 34 HIS A CA   2  
ATOM 2635  C C    . HIS A 1 30 ? -7.248  -16.264 -6.642  1.00 0.00 ? 34 HIS A C    2  
ATOM 2636  O O    . HIS A 1 30 ? -6.972  -17.444 -6.428  1.00 0.00 ? 34 HIS A O    2  
ATOM 2637  C CB   . HIS A 1 30 ? -7.762  -15.182 -8.892  1.00 0.00 ? 34 HIS A CB   2  
ATOM 2638  C CG   . HIS A 1 30 ? -7.665  -13.682 -8.745  1.00 0.00 ? 34 HIS A CG   2  
ATOM 2639  N ND1  . HIS A 1 30 ? -8.776  -12.870 -8.596  1.00 0.00 ? 34 HIS A ND1  2  
ATOM 2640  C CD2  . HIS A 1 30 ? -6.579  -12.857 -8.726  1.00 0.00 ? 34 HIS A CD2  2  
ATOM 2641  C CE1  . HIS A 1 30 ? -8.365  -11.615 -8.493  1.00 0.00 ? 34 HIS A CE1  2  
ATOM 2642  N NE2  . HIS A 1 30 ? -7.004  -11.608 -8.574  1.00 0.00 ? 34 HIS A NE2  2  
ATOM 2643  H H    . HIS A 1 30 ? -9.021  -14.201 -6.660  1.00 0.00 ? 34 HIS A H    2  
ATOM 2644  H HA   . HIS A 1 30 ? -8.824  -16.801 -8.000  1.00 0.00 ? 34 HIS A HA   2  
ATOM 2645  H HB2  . HIS A 1 30 ? -6.770  -15.581 -9.105  1.00 0.00 ? 34 HIS A HB2  2  
ATOM 2646  H HB3  . HIS A 1 30 ? -8.390  -15.413 -9.752  1.00 0.00 ? 34 HIS A HB3  2  
ATOM 2647  H HD1  . HIS A 1 30 ? -9.727  -13.179 -8.570  1.00 0.00 ? 34 HIS A HD1  2  
ATOM 2648  H HD2  . HIS A 1 30 ? -5.539  -13.170 -8.819  1.00 0.00 ? 34 HIS A HD2  2  
ATOM 2649  H HE1  . HIS A 1 30 ? -9.004  -10.740 -8.366  1.00 0.00 ? 34 HIS A HE1  2  
ATOM 2650  N N    . CYS A 1 31 ? -6.667  -15.237 -6.042  1.00 0.00 ? 35 CYS A N    2  
ATOM 2651  C CA   . CYS A 1 31 ? -5.623  -15.441 -5.051  1.00 0.00 ? 35 CYS A CA   2  
ATOM 2652  C C    . CYS A 1 31 ? -6.229  -15.226 -3.663  1.00 0.00 ? 35 CYS A C    2  
ATOM 2653  O O    . CYS A 1 31 ? -6.681  -14.127 -3.342  1.00 0.00 ? 35 CYS A O    2  
ATOM 2654  C CB   . CYS A 1 31 ? -4.422  -14.526 -5.298  1.00 0.00 ? 35 CYS A CB   2  
ATOM 2655  S SG   . CYS A 1 31 ? -3.083  -14.667 -4.059  1.00 0.00 ? 35 CYS A SG   2  
ATOM 2656  H H    . CYS A 1 31 ? -6.897  -14.280 -6.221  1.00 0.00 ? 35 CYS A H    2  
ATOM 2657  H HA   . CYS A 1 31 ? -5.278  -16.468 -5.168  1.00 0.00 ? 35 CYS A HA   2  
ATOM 2658  H HB2  . CYS A 1 31 ? -4.011  -14.746 -6.283  1.00 0.00 ? 35 CYS A HB2  2  
ATOM 2659  H HB3  . CYS A 1 31 ? -4.769  -13.493 -5.320  1.00 0.00 ? 35 CYS A HB3  2  
ATOM 2660  N N    . ALA A 1 32 ? -6.220  -16.292 -2.876  1.00 0.00 ? 36 ALA A N    2  
ATOM 2661  C CA   . ALA A 1 32 ? -6.764  -16.233 -1.530  1.00 0.00 ? 36 ALA A CA   2  
ATOM 2662  C C    . ALA A 1 32 ? -5.638  -15.920 -0.543  1.00 0.00 ? 36 ALA A C    2  
ATOM 2663  O O    . ALA A 1 32 ? -5.735  -16.246 0.639   1.00 0.00 ? 36 ALA A O    2  
ATOM 2664  C CB   . ALA A 1 32 ? -7.472  -17.550 -1.208  1.00 0.00 ? 36 ALA A CB   2  
ATOM 2665  H H    . ALA A 1 32 ? -5.851  -17.181 -3.145  1.00 0.00 ? 36 ALA A H    2  
ATOM 2666  H HA   . ALA A 1 32 ? -7.495  -15.425 -1.502  1.00 0.00 ? 36 ALA A HA   2  
ATOM 2667  H HB1  . ALA A 1 32 ? -7.182  -18.307 -1.937  1.00 0.00 ? 36 ALA A HB1  2  
ATOM 2668  H HB2  . ALA A 1 32 ? -7.187  -17.881 -0.209  1.00 0.00 ? 36 ALA A HB2  2  
ATOM 2669  H HB3  . ALA A 1 32 ? -8.551  -17.402 -1.247  1.00 0.00 ? 36 ALA A HB3  2  
ATOM 2670  N N    . GLN A 1 33 ? -4.595  -15.291 -1.065  1.00 0.00 ? 37 GLN A N    2  
ATOM 2671  C CA   . GLN A 1 33 ? -3.451  -14.930 -0.245  1.00 0.00 ? 37 GLN A CA   2  
ATOM 2672  C C    . GLN A 1 33 ? -2.980  -13.514 -0.584  1.00 0.00 ? 37 GLN A C    2  
ATOM 2673  O O    . GLN A 1 33 ? -3.168  -13.046 -1.705  1.00 0.00 ? 37 GLN A O    2  
ATOM 2674  C CB   . GLN A 1 33 ? -2.315  -15.940 -0.413  1.00 0.00 ? 37 GLN A CB   2  
ATOM 2675  C CG   . GLN A 1 33 ? -2.862  -17.360 -0.570  1.00 0.00 ? 37 GLN A CG   2  
ATOM 2676  C CD   . GLN A 1 33 ? -3.421  -17.882 0.756   1.00 0.00 ? 37 GLN A CD   2  
ATOM 2677  O OE1  . GLN A 1 33 ? -3.089  -17.407 1.829   1.00 0.00 ? 37 GLN A OE1  2  
ATOM 2678  N NE2  . GLN A 1 33 ? -4.285  -18.884 0.622   1.00 0.00 ? 37 GLN A NE2  2  
ATOM 2679  H H    . GLN A 1 33 ? -4.524  -15.029 -2.028  1.00 0.00 ? 37 GLN A H    2  
ATOM 2680  H HA   . GLN A 1 33 ? -3.810  -14.964 0.784   1.00 0.00 ? 37 GLN A HA   2  
ATOM 2681  H HB2  . GLN A 1 33 ? -1.717  -15.679 -1.286  1.00 0.00 ? 37 GLN A HB2  2  
ATOM 2682  H HB3  . GLN A 1 33 ? -1.652  -15.896 0.452   1.00 0.00 ? 37 GLN A HB3  2  
ATOM 2683  H HG2  . GLN A 1 33 ? -3.646  -17.370 -1.327  1.00 0.00 ? 37 GLN A HG2  2  
ATOM 2684  H HG3  . GLN A 1 33 ? -2.071  -18.023 -0.921  1.00 0.00 ? 37 GLN A HG3  2  
ATOM 2685  H HE21 . GLN A 1 33 ? -4.515  -19.228 -0.289  1.00 0.00 ? 37 GLN A HE21 2  
ATOM 2686  H HE22 . GLN A 1 33 ? -4.705  -19.293 1.432   1.00 0.00 ? 37 GLN A HE22 2  
ATOM 2687  N N    . THR A 1 34 ? -2.378  -12.872 0.406   1.00 0.00 ? 38 THR A N    2  
ATOM 2688  C CA   . THR A 1 34 ? -1.879  -11.519 0.227   1.00 0.00 ? 38 THR A CA   2  
ATOM 2689  C C    . THR A 1 34 ? -0.550  -11.537 -0.531  1.00 0.00 ? 38 THR A C    2  
ATOM 2690  O O    . THR A 1 34 ? 0.082   -12.585 -0.658  1.00 0.00 ? 38 THR A O    2  
ATOM 2691  C CB   . THR A 1 34 ? -1.783  -10.864 1.606   1.00 0.00 ? 38 THR A CB   2  
ATOM 2692  O OG1  . THR A 1 34 ? -3.062  -11.096 2.191   1.00 0.00 ? 38 THR A OG1  2  
ATOM 2693  C CG2  . THR A 1 34 ? -1.682  -9.340  1.525   1.00 0.00 ? 38 THR A CG2  2  
ATOM 2694  H H    . THR A 1 34 ? -2.229  -13.260 1.316   1.00 0.00 ? 38 THR A H    2  
ATOM 2695  H HA   . THR A 1 34 ? -2.591  -10.969 -0.388  1.00 0.00 ? 38 THR A HA   2  
ATOM 2696  H HB   . THR A 1 34 ? -0.953  -11.279 2.178   1.00 0.00 ? 38 THR A HB   2  
ATOM 2697  H HG1  . THR A 1 34 ? -3.068  -11.979 2.661   1.00 0.00 ? 38 THR A HG1  2  
ATOM 2698  H HG21 . THR A 1 34 ? -2.180  -8.990  0.620   1.00 0.00 ? 38 THR A HG21 2  
ATOM 2699  H HG22 . THR A 1 34 ? -2.162  -8.896  2.397   1.00 0.00 ? 38 THR A HG22 2  
ATOM 2700  H HG23 . THR A 1 34 ? -0.633  -9.046  1.499   1.00 0.00 ? 38 THR A HG23 2  
ATOM 2701  N N    . GLU A 1 35 ? -0.165  -10.365 -1.014  1.00 0.00 ? 39 GLU A N    2  
ATOM 2702  C CA   . GLU A 1 35 ? 1.077   -10.233 -1.756  1.00 0.00 ? 39 GLU A CA   2  
ATOM 2703  C C    . GLU A 1 35 ? 1.588   -8.792  -1.683  1.00 0.00 ? 39 GLU A C    2  
ATOM 2704  O O    . GLU A 1 35 ? 1.354   -8.000  -2.593  1.00 0.00 ? 39 GLU A O    2  
ATOM 2705  C CB   . GLU A 1 35 ? 0.898   -10.678 -3.209  1.00 0.00 ? 39 GLU A CB   2  
ATOM 2706  C CG   . GLU A 1 35 ? -0.494  -10.312 -3.727  1.00 0.00 ? 39 GLU A CG   2  
ATOM 2707  C CD   . GLU A 1 35 ? -1.380  -11.554 -3.842  1.00 0.00 ? 39 GLU A CD   2  
ATOM 2708  O OE1  . GLU A 1 35 ? -1.203  -12.458 -2.997  1.00 0.00 ? 39 GLU A OE1  2  
ATOM 2709  O OE2  . GLU A 1 35 ? -2.214  -11.572 -4.773  1.00 0.00 ? 39 GLU A OE2  2  
ATOM 2710  H H    . GLU A 1 35 ? -0.685  -9.518  -0.906  1.00 0.00 ? 39 GLU A H    2  
ATOM 2711  H HA   . GLU A 1 35 ? 1.782   -10.901 -1.262  1.00 0.00 ? 39 GLU A HA   2  
ATOM 2712  H HB2  . GLU A 1 35 ? 1.658   -10.207 -3.833  1.00 0.00 ? 39 GLU A HB2  2  
ATOM 2713  H HB3  . GLU A 1 35 ? 1.047   -11.755 -3.284  1.00 0.00 ? 39 GLU A HB3  2  
ATOM 2714  H HG2  . GLU A 1 35 ? -0.959  -9.591  -3.054  1.00 0.00 ? 39 GLU A HG2  2  
ATOM 2715  H HG3  . GLU A 1 35 ? -0.409  -9.830  -4.701  1.00 0.00 ? 39 GLU A HG3  2  
ATOM 2716  N N    . VAL A 1 36 ? 2.277   -8.497  -0.590  1.00 0.00 ? 40 VAL A N    2  
ATOM 2717  C CA   . VAL A 1 36 ? 2.824   -7.167  -0.386  1.00 0.00 ? 40 VAL A CA   2  
ATOM 2718  C C    . VAL A 1 36 ? 3.941   -6.918  -1.401  1.00 0.00 ? 40 VAL A C    2  
ATOM 2719  O O    . VAL A 1 36 ? 4.858   -7.727  -1.532  1.00 0.00 ? 40 VAL A O    2  
ATOM 2720  C CB   . VAL A 1 36 ? 3.286   -7.007  1.064   1.00 0.00 ? 40 VAL A CB   2  
ATOM 2721  C CG1  . VAL A 1 36 ? 3.870   -5.613  1.303   1.00 0.00 ? 40 VAL A CG1  2  
ATOM 2722  C CG2  . VAL A 1 36 ? 2.144   -7.299  2.039   1.00 0.00 ? 40 VAL A CG2  2  
ATOM 2723  H H    . VAL A 1 36 ? 2.464   -9.148  0.146   1.00 0.00 ? 40 VAL A H    2  
ATOM 2724  H HA   . VAL A 1 36 ? 2.021   -6.451  -0.565  1.00 0.00 ? 40 VAL A HA   2  
ATOM 2725  H HB   . VAL A 1 36 ? 4.076   -7.737  1.245   1.00 0.00 ? 40 VAL A HB   2  
ATOM 2726  H HG11 . VAL A 1 36 ? 3.148   -4.859  0.990   1.00 0.00 ? 40 VAL A HG11 2  
ATOM 2727  H HG12 . VAL A 1 36 ? 4.090   -5.489  2.363   1.00 0.00 ? 40 VAL A HG12 2  
ATOM 2728  H HG13 . VAL A 1 36 ? 4.787   -5.499  0.726   1.00 0.00 ? 40 VAL A HG13 2  
ATOM 2729  H HG21 . VAL A 1 36 ? 1.206   -6.939  1.617   1.00 0.00 ? 40 VAL A HG21 2  
ATOM 2730  H HG22 . VAL A 1 36 ? 2.077   -8.373  2.210   1.00 0.00 ? 40 VAL A HG22 2  
ATOM 2731  H HG23 . VAL A 1 36 ? 2.336   -6.792  2.985   1.00 0.00 ? 40 VAL A HG23 2  
ATOM 2732  N N    . ILE A 1 37 ? 3.828   -5.794  -2.094  1.00 0.00 ? 41 ILE A N    2  
ATOM 2733  C CA   . ILE A 1 37 ? 4.817   -5.428  -3.093  1.00 0.00 ? 41 ILE A CA   2  
ATOM 2734  C C    . ILE A 1 37 ? 5.291   -3.996  -2.836  1.00 0.00 ? 41 ILE A C    2  
ATOM 2735  O O    . ILE A 1 37 ? 4.549   -3.042  -3.066  1.00 0.00 ? 41 ILE A O    2  
ATOM 2736  C CB   . ILE A 1 37 ? 4.262   -5.648  -4.502  1.00 0.00 ? 41 ILE A CB   2  
ATOM 2737  C CG1  . ILE A 1 37 ? 3.645   -7.042  -4.637  1.00 0.00 ? 41 ILE A CG1  2  
ATOM 2738  C CG2  . ILE A 1 37 ? 5.337   -5.392  -5.561  1.00 0.00 ? 41 ILE A CG2  2  
ATOM 2739  C CD1  . ILE A 1 37 ? 2.168   -6.952  -5.027  1.00 0.00 ? 41 ILE A CD1  2  
ATOM 2740  H H    . ILE A 1 37 ? 3.079   -5.141  -1.982  1.00 0.00 ? 41 ILE A H    2  
ATOM 2741  H HA   . ILE A 1 37 ? 5.667   -6.100  -2.973  1.00 0.00 ? 41 ILE A HA   2  
ATOM 2742  H HB   . ILE A 1 37 ? 3.464   -4.925  -4.672  1.00 0.00 ? 41 ILE A HB   2  
ATOM 2743  H HG12 . ILE A 1 37 ? 4.189   -7.613  -5.389  1.00 0.00 ? 41 ILE A HG12 2  
ATOM 2744  H HG13 . ILE A 1 37 ? 3.744   -7.580  -3.695  1.00 0.00 ? 41 ILE A HG13 2  
ATOM 2745  H HG21 . ILE A 1 37 ? 6.173   -6.072  -5.402  1.00 0.00 ? 41 ILE A HG21 2  
ATOM 2746  H HG22 . ILE A 1 37 ? 4.916   -5.559  -6.553  1.00 0.00 ? 41 ILE A HG22 2  
ATOM 2747  H HG23 . ILE A 1 37 ? 5.685   -4.362  -5.483  1.00 0.00 ? 41 ILE A HG23 2  
ATOM 2748  H HD11 . ILE A 1 37 ? 1.693   -6.145  -4.469  1.00 0.00 ? 41 ILE A HD11 2  
ATOM 2749  H HD12 . ILE A 1 37 ? 2.086   -6.752  -6.095  1.00 0.00 ? 41 ILE A HD12 2  
ATOM 2750  H HD13 . ILE A 1 37 ? 1.673   -7.895  -4.795  1.00 0.00 ? 41 ILE A HD13 2  
ATOM 2751  N N    . ALA A 1 38 ? 6.523   -3.891  -2.361  1.00 0.00 ? 42 ALA A N    2  
ATOM 2752  C CA   . ALA A 1 38 ? 7.105   -2.592  -2.070  1.00 0.00 ? 42 ALA A CA   2  
ATOM 2753  C C    . ALA A 1 38 ? 8.000   -2.165  -3.235  1.00 0.00 ? 42 ALA A C    2  
ATOM 2754  O O    . ALA A 1 38 ? 8.703   -2.991  -3.817  1.00 0.00 ? 42 ALA A O    2  
ATOM 2755  C CB   . ALA A 1 38 ? 7.865   -2.658  -0.744  1.00 0.00 ? 42 ALA A CB   2  
ATOM 2756  H H    . ALA A 1 38 ? 7.120   -4.672  -2.177  1.00 0.00 ? 42 ALA A H    2  
ATOM 2757  H HA   . ALA A 1 38 ? 6.287   -1.877  -1.970  1.00 0.00 ? 42 ALA A HA   2  
ATOM 2758  H HB1  . ALA A 1 38 ? 8.132   -1.650  -0.427  1.00 0.00 ? 42 ALA A HB1  2  
ATOM 2759  H HB2  . ALA A 1 38 ? 7.234   -3.123  0.014   1.00 0.00 ? 42 ALA A HB2  2  
ATOM 2760  H HB3  . ALA A 1 38 ? 8.772   -3.249  -0.875  1.00 0.00 ? 42 ALA A HB3  2  
ATOM 2761  N N    . THR A 1 39 ? 7.946   -0.877  -3.541  1.00 0.00 ? 43 THR A N    2  
ATOM 2762  C CA   . THR A 1 39 ? 8.743   -0.332  -4.626  1.00 0.00 ? 43 THR A CA   2  
ATOM 2763  C C    . THR A 1 39 ? 10.120  0.095   -4.114  1.00 0.00 ? 43 THR A C    2  
ATOM 2764  O O    . THR A 1 39 ? 10.229  0.704   -3.050  1.00 0.00 ? 43 THR A O    2  
ATOM 2765  C CB   . THR A 1 39 ? 7.952   0.811   -5.266  1.00 0.00 ? 43 THR A CB   2  
ATOM 2766  O OG1  . THR A 1 39 ? 6.899   0.154   -5.967  1.00 0.00 ? 43 THR A OG1  2  
ATOM 2767  C CG2  . THR A 1 39 ? 8.741   1.527   -6.364  1.00 0.00 ? 43 THR A CG2  2  
ATOM 2768  H H    . THR A 1 39 ? 7.371   -0.213  -3.063  1.00 0.00 ? 43 THR A H    2  
ATOM 2769  H HA   . THR A 1 39 ? 8.906   -1.119  -5.362  1.00 0.00 ? 43 THR A HA   2  
ATOM 2770  H HB   . THR A 1 39 ? 7.608   1.517   -4.510  1.00 0.00 ? 43 THR A HB   2  
ATOM 2771  H HG1  . THR A 1 39 ? 6.272   0.830   -6.354  1.00 0.00 ? 43 THR A HG1  2  
ATOM 2772  H HG21 . THR A 1 39 ? 9.228   0.788   -7.002  1.00 0.00 ? 43 THR A HG21 2  
ATOM 2773  H HG22 . THR A 1 39 ? 8.062   2.133   -6.963  1.00 0.00 ? 43 THR A HG22 2  
ATOM 2774  H HG23 . THR A 1 39 ? 9.496   2.168   -5.910  1.00 0.00 ? 43 THR A HG23 2  
ATOM 2775  N N    . LEU A 1 40 ? 11.137  -0.241  -4.894  1.00 0.00 ? 44 LEU A N    2  
ATOM 2776  C CA   . LEU A 1 40 ? 12.502  0.100   -4.532  1.00 0.00 ? 44 LEU A CA   2  
ATOM 2777  C C    . LEU A 1 40 ? 12.797  1.537   -4.967  1.00 0.00 ? 44 LEU A C    2  
ATOM 2778  O O    . LEU A 1 40 ? 12.237  2.019   -5.951  1.00 0.00 ? 44 LEU A O    2  
ATOM 2779  C CB   . LEU A 1 40 ? 13.480  -0.928  -5.104  1.00 0.00 ? 44 LEU A CB   2  
ATOM 2780  C CG   . LEU A 1 40 ? 14.520  -1.480  -4.127  1.00 0.00 ? 44 LEU A CG   2  
ATOM 2781  C CD1  . LEU A 1 40 ? 15.128  -2.783  -4.650  1.00 0.00 ? 44 LEU A CD1  2  
ATOM 2782  C CD2  . LEU A 1 40 ? 15.591  -0.432  -3.816  1.00 0.00 ? 44 LEU A CD2  2  
ATOM 2783  H H    . LEU A 1 40 ? 11.039  -0.736  -5.757  1.00 0.00 ? 44 LEU A H    2  
ATOM 2784  H HA   . LEU A 1 40 ? 12.576  0.046   -3.446  1.00 0.00 ? 44 LEU A HA   2  
ATOM 2785  H HB2  . LEU A 1 40 ? 12.906  -1.764  -5.502  1.00 0.00 ? 44 LEU A HB2  2  
ATOM 2786  H HB3  . LEU A 1 40 ? 14.005  -0.473  -5.943  1.00 0.00 ? 44 LEU A HB3  2  
ATOM 2787  H HG   . LEU A 1 40 ? 14.017  -1.713  -3.188  1.00 0.00 ? 44 LEU A HG   2  
ATOM 2788  H HD11 . LEU A 1 40 ? 14.330  -3.492  -4.871  1.00 0.00 ? 44 LEU A HD11 2  
ATOM 2789  H HD12 . LEU A 1 40 ? 15.695  -2.580  -5.558  1.00 0.00 ? 44 LEU A HD12 2  
ATOM 2790  H HD13 . LEU A 1 40 ? 15.790  -3.205  -3.894  1.00 0.00 ? 44 LEU A HD13 2  
ATOM 2791  H HD21 . LEU A 1 40 ? 15.301  0.524   -4.251  1.00 0.00 ? 44 LEU A HD21 2  
ATOM 2792  H HD22 . LEU A 1 40 ? 15.693  -0.325  -2.736  1.00 0.00 ? 44 LEU A HD22 2  
ATOM 2793  H HD23 . LEU A 1 40 ? 16.544  -0.750  -4.241  1.00 0.00 ? 44 LEU A HD23 2  
ATOM 2794  N N    . LYS A 1 41 ? 13.674  2.182   -4.212  1.00 0.00 ? 45 LYS A N    2  
ATOM 2795  C CA   . LYS A 1 41 ? 14.049  3.554   -4.507  1.00 0.00 ? 45 LYS A CA   2  
ATOM 2796  C C    . LYS A 1 41 ? 14.964  3.576   -5.733  1.00 0.00 ? 45 LYS A C    2  
ATOM 2797  O O    . LYS A 1 41 ? 15.356  4.644   -6.201  1.00 0.00 ? 45 LYS A O    2  
ATOM 2798  C CB   . LYS A 1 41 ? 14.660  4.220   -3.272  1.00 0.00 ? 45 LYS A CB   2  
ATOM 2799  C CG   . LYS A 1 41 ? 15.600  5.359   -3.672  1.00 0.00 ? 45 LYS A CG   2  
ATOM 2800  C CD   . LYS A 1 41 ? 14.839  6.466   -4.405  1.00 0.00 ? 45 LYS A CD   2  
ATOM 2801  C CE   . LYS A 1 41 ? 14.602  7.668   -3.489  1.00 0.00 ? 45 LYS A CE   2  
ATOM 2802  N NZ   . LYS A 1 41 ? 15.345  8.850   -3.981  1.00 0.00 ? 45 LYS A NZ   2  
ATOM 2803  H H    . LYS A 1 41 ? 14.124  1.783   -3.413  1.00 0.00 ? 45 LYS A H    2  
ATOM 2804  H HA   . LYS A 1 41 ? 13.136  4.098   -4.748  1.00 0.00 ? 45 LYS A HA   2  
ATOM 2805  H HB2  . LYS A 1 41 ? 13.867  4.606   -2.632  1.00 0.00 ? 45 LYS A HB2  2  
ATOM 2806  H HB3  . LYS A 1 41 ? 15.208  3.480   -2.689  1.00 0.00 ? 45 LYS A HB3  2  
ATOM 2807  H HG2  . LYS A 1 41 ? 16.079  5.770   -2.783  1.00 0.00 ? 45 LYS A HG2  2  
ATOM 2808  H HG3  . LYS A 1 41 ? 16.393  4.973   -4.312  1.00 0.00 ? 45 LYS A HG3  2  
ATOM 2809  H HD2  . LYS A 1 41 ? 15.403  6.780   -5.284  1.00 0.00 ? 45 LYS A HD2  2  
ATOM 2810  H HD3  . LYS A 1 41 ? 13.883  6.081   -4.761  1.00 0.00 ? 45 LYS A HD3  2  
ATOM 2811  H HE2  . LYS A 1 41 ? 13.537  7.894   -3.443  1.00 0.00 ? 45 LYS A HE2  2  
ATOM 2812  H HE3  . LYS A 1 41 ? 14.921  7.428   -2.474  1.00 0.00 ? 45 LYS A HE3  2  
ATOM 2813  H HZ1  . LYS A 1 41 ? 15.556  8.731   -4.951  1.00 0.00 ? 45 LYS A HZ1  2  
ATOM 2814  H HZ2  . LYS A 1 41 ? 14.786  9.670   -3.859  1.00 0.00 ? 45 LYS A HZ2  2  
ATOM 2815  H HZ3  . LYS A 1 41 ? 16.196  8.947   -3.465  1.00 0.00 ? 45 LYS A HZ3  2  
ATOM 2816  N N    . ASN A 1 42 ? 15.277  2.384   -6.219  1.00 0.00 ? 46 ASN A N    2  
ATOM 2817  C CA   . ASN A 1 42 ? 16.138  2.252   -7.382  1.00 0.00 ? 46 ASN A CA   2  
ATOM 2818  C C    . ASN A 1 42 ? 15.278  2.003   -8.623  1.00 0.00 ? 46 ASN A C    2  
ATOM 2819  O O    . ASN A 1 42 ? 15.778  2.035   -9.746  1.00 0.00 ? 46 ASN A O    2  
ATOM 2820  C CB   . ASN A 1 42 ? 17.097  1.070   -7.227  1.00 0.00 ? 46 ASN A CB   2  
ATOM 2821  C CG   . ASN A 1 42 ? 17.264  0.321   -8.550  1.00 0.00 ? 46 ASN A CG   2  
ATOM 2822  O OD1  . ASN A 1 42 ? 17.757  0.849   -9.534  1.00 0.00 ? 46 ASN A OD1  2  
ATOM 2823  N ND2  . ASN A 1 42 ? 16.826  -0.934  -8.520  1.00 0.00 ? 46 ASN A ND2  2  
ATOM 2824  H H    . ASN A 1 42 ? 14.954  1.520   -5.833  1.00 0.00 ? 46 ASN A H    2  
ATOM 2825  H HA   . ASN A 1 42 ? 16.689  3.191   -7.438  1.00 0.00 ? 46 ASN A HA   2  
ATOM 2826  H HB2  . ASN A 1 42 ? 18.068  1.428   -6.882  1.00 0.00 ? 46 ASN A HB2  2  
ATOM 2827  H HB3  . ASN A 1 42 ? 16.720  0.389   -6.464  1.00 0.00 ? 46 ASN A HB3  2  
ATOM 2828  H HD21 . ASN A 1 42 ? 16.432  -1.306  -7.680  1.00 0.00 ? 46 ASN A HD21 2  
ATOM 2829  H HD22 . ASN A 1 42 ? 16.892  -1.507  -9.338  1.00 0.00 ? 46 ASN A HD22 2  
ATOM 2830  N N    . GLY A 1 43 ? 13.999  1.760   -8.378  1.00 0.00 ? 47 GLY A N    2  
ATOM 2831  C CA   . GLY A 1 43 ? 13.065  1.505   -9.461  1.00 0.00 ? 47 GLY A CA   2  
ATOM 2832  C C    . GLY A 1 43 ? 12.606  0.046   -9.458  1.00 0.00 ? 47 GLY A C    2  
ATOM 2833  O O    . GLY A 1 43 ? 11.694  -0.324  -10.196 1.00 0.00 ? 47 GLY A O    2  
ATOM 2834  H H    . GLY A 1 43 ? 13.600  1.735   -7.461  1.00 0.00 ? 47 GLY A H    2  
ATOM 2835  H HA2  . GLY A 1 43 ? 12.200  2.162   -9.363  1.00 0.00 ? 47 GLY A HA2  2  
ATOM 2836  H HA3  . GLY A 1 43 ? 13.536  1.740   -10.416 1.00 0.00 ? 47 GLY A HA3  2  
ATOM 2837  N N    . GLN A 1 44 ? 13.259  -0.745  -8.619  1.00 0.00 ? 48 GLN A N    2  
ATOM 2838  C CA   . GLN A 1 44 ? 12.929  -2.156  -8.509  1.00 0.00 ? 48 GLN A CA   2  
ATOM 2839  C C    . GLN A 1 44 ? 11.774  -2.356  -7.527  1.00 0.00 ? 48 GLN A C    2  
ATOM 2840  O O    . GLN A 1 44 ? 11.153  -1.390  -7.087  1.00 0.00 ? 48 GLN A O    2  
ATOM 2841  C CB   . GLN A 1 44 ? 14.153  -2.974  -8.092  1.00 0.00 ? 48 GLN A CB   2  
ATOM 2842  C CG   . GLN A 1 44 ? 14.882  -3.533  -9.315  1.00 0.00 ? 48 GLN A CG   2  
ATOM 2843  C CD   . GLN A 1 44 ? 15.819  -4.676  -8.919  1.00 0.00 ? 48 GLN A CD   2  
ATOM 2844  O OE1  . GLN A 1 44 ? 16.173  -4.852  -7.765  1.00 0.00 ? 48 GLN A OE1  2  
ATOM 2845  N NE2  . GLN A 1 44 ? 16.201  -5.440  -9.939  1.00 0.00 ? 48 GLN A NE2  2  
ATOM 2846  H H    . GLN A 1 44 ? 13.999  -0.436  -8.022  1.00 0.00 ? 48 GLN A H    2  
ATOM 2847  H HA   . GLN A 1 44 ? 12.621  -2.459  -9.510  1.00 0.00 ? 48 GLN A HA   2  
ATOM 2848  H HB2  . GLN A 1 44 ? 14.833  -2.348  -7.513  1.00 0.00 ? 48 GLN A HB2  2  
ATOM 2849  H HB3  . GLN A 1 44 ? 13.843  -3.793  -7.442  1.00 0.00 ? 48 GLN A HB3  2  
ATOM 2850  H HG2  . GLN A 1 44 ? 14.155  -3.891  -10.044 1.00 0.00 ? 48 GLN A HG2  2  
ATOM 2851  H HG3  . GLN A 1 44 ? 15.453  -2.740  -9.797  1.00 0.00 ? 48 GLN A HG3  2  
ATOM 2852  H HE21 . GLN A 1 44 ? 15.875  -5.241  -10.862 1.00 0.00 ? 48 GLN A HE21 2  
ATOM 2853  H HE22 . GLN A 1 44 ? 16.815  -6.214  -9.781  1.00 0.00 ? 48 GLN A HE22 2  
ATOM 2854  N N    . LYS A 1 45 ? 11.520  -3.618  -7.210  1.00 0.00 ? 49 LYS A N    2  
ATOM 2855  C CA   . LYS A 1 45 ? 10.451  -3.957  -6.287  1.00 0.00 ? 49 LYS A CA   2  
ATOM 2856  C C    . LYS A 1 45 ? 10.867  -5.172  -5.455  1.00 0.00 ? 49 LYS A C    2  
ATOM 2857  O O    . LYS A 1 45 ? 11.558  -6.061  -5.951  1.00 0.00 ? 49 LYS A O    2  
ATOM 2858  C CB   . LYS A 1 45 ? 9.134   -4.152  -7.042  1.00 0.00 ? 49 LYS A CB   2  
ATOM 2859  C CG   . LYS A 1 45 ? 8.801   -2.922  -7.889  1.00 0.00 ? 49 LYS A CG   2  
ATOM 2860  C CD   . LYS A 1 45 ? 7.497   -3.126  -8.664  1.00 0.00 ? 49 LYS A CD   2  
ATOM 2861  C CE   . LYS A 1 45 ? 7.416   -2.177  -9.861  1.00 0.00 ? 49 LYS A CE   2  
ATOM 2862  N NZ   . LYS A 1 45 ? 6.009   -1.807  -10.134 1.00 0.00 ? 49 LYS A NZ   2  
ATOM 2863  H H    . LYS A 1 45 ? 12.030  -4.398  -7.572  1.00 0.00 ? 49 LYS A H    2  
ATOM 2864  H HA   . LYS A 1 45 ? 10.316  -3.109  -5.617  1.00 0.00 ? 49 LYS A HA   2  
ATOM 2865  H HB2  . LYS A 1 45 ? 9.203   -5.031  -7.683  1.00 0.00 ? 49 LYS A HB2  2  
ATOM 2866  H HB3  . LYS A 1 45 ? 8.328   -4.338  -6.332  1.00 0.00 ? 49 LYS A HB3  2  
ATOM 2867  H HG2  . LYS A 1 45 ? 8.712   -2.046  -7.246  1.00 0.00 ? 49 LYS A HG2  2  
ATOM 2868  H HG3  . LYS A 1 45 ? 9.615   -2.724  -8.586  1.00 0.00 ? 49 LYS A HG3  2  
ATOM 2869  H HD2  . LYS A 1 45 ? 7.433   -4.158  -9.008  1.00 0.00 ? 49 LYS A HD2  2  
ATOM 2870  H HD3  . LYS A 1 45 ? 6.647   -2.958  -8.003  1.00 0.00 ? 49 LYS A HD3  2  
ATOM 2871  H HE2  . LYS A 1 45 ? 8.002   -1.280  -9.661  1.00 0.00 ? 49 LYS A HE2  2  
ATOM 2872  H HE3  . LYS A 1 45 ? 7.851   -2.653  -10.740 1.00 0.00 ? 49 LYS A HE3  2  
ATOM 2873  H HZ1  . LYS A 1 45 ? 5.400   -2.475  -9.707  1.00 0.00 ? 49 LYS A HZ1  2  
ATOM 2874  H HZ2  . LYS A 1 45 ? 5.824   -0.899  -9.759  1.00 0.00 ? 49 LYS A HZ2  2  
ATOM 2875  H HZ3  . LYS A 1 45 ? 5.853   -1.798  -11.122 1.00 0.00 ? 49 LYS A HZ3  2  
ATOM 2876  N N    . ALA A 1 46 ? 10.431  -5.170  -4.204  1.00 0.00 ? 50 ALA A N    2  
ATOM 2877  C CA   . ALA A 1 46 ? 10.750  -6.260  -3.298  1.00 0.00 ? 50 ALA A CA   2  
ATOM 2878  C C    . ALA A 1 46 ? 9.481   -6.692  -2.560  1.00 0.00 ? 50 ALA A C    2  
ATOM 2879  O O    . ALA A 1 46 ? 8.952   -5.944  -1.739  1.00 0.00 ? 50 ALA A O    2  
ATOM 2880  C CB   . ALA A 1 46 ? 11.860  -5.821  -2.342  1.00 0.00 ? 50 ALA A CB   2  
ATOM 2881  H H    . ALA A 1 46 ? 9.870   -4.442  -3.809  1.00 0.00 ? 50 ALA A H    2  
ATOM 2882  H HA   . ALA A 1 46 ? 11.113  -7.095  -3.898  1.00 0.00 ? 50 ALA A HA   2  
ATOM 2883  H HB1  . ALA A 1 46 ? 12.114  -4.779  -2.534  1.00 0.00 ? 50 ALA A HB1  2  
ATOM 2884  H HB2  . ALA A 1 46 ? 11.518  -5.929  -1.313  1.00 0.00 ? 50 ALA A HB2  2  
ATOM 2885  H HB3  . ALA A 1 46 ? 12.741  -6.444  -2.499  1.00 0.00 ? 50 ALA A HB3  2  
ATOM 2886  N N    . CYS A 1 47 ? 9.030   -7.896  -2.878  1.00 0.00 ? 51 CYS A N    2  
ATOM 2887  C CA   . CYS A 1 47 ? 7.834   -8.436  -2.255  1.00 0.00 ? 51 CYS A CA   2  
ATOM 2888  C C    . CYS A 1 47 ? 8.166   -8.790  -0.804  1.00 0.00 ? 51 CYS A C    2  
ATOM 2889  O O    . CYS A 1 47 ? 9.239   -9.321  -0.521  1.00 0.00 ? 51 CYS A O    2  
ATOM 2890  C CB   . CYS A 1 47 ? 7.288   -9.640  -3.026  1.00 0.00 ? 51 CYS A CB   2  
ATOM 2891  S SG   . CYS A 1 47 ? 5.785   -9.302  -4.013  1.00 0.00 ? 51 CYS A SG   2  
ATOM 2892  H H    . CYS A 1 47 ? 9.466   -8.498  -3.547  1.00 0.00 ? 51 CYS A H    2  
ATOM 2893  H HA   . CYS A 1 47 ? 7.077   -7.652  -2.299  1.00 0.00 ? 51 CYS A HA   2  
ATOM 2894  H HB2  . CYS A 1 47 ? 8.068   -10.010 -3.692  1.00 0.00 ? 51 CYS A HB2  2  
ATOM 2895  H HB3  . CYS A 1 47 ? 7.068   -10.438 -2.317  1.00 0.00 ? 51 CYS A HB3  2  
ATOM 2896  N N    . LEU A 1 48 ? 7.225   -8.482  0.077   1.00 0.00 ? 52 LEU A N    2  
ATOM 2897  C CA   . LEU A 1 48 ? 7.404   -8.761  1.491   1.00 0.00 ? 52 LEU A CA   2  
ATOM 2898  C C    . LEU A 1 48 ? 6.417   -9.847  1.922   1.00 0.00 ? 52 LEU A C    2  
ATOM 2899  O O    . LEU A 1 48 ? 5.418   -10.086 1.245   1.00 0.00 ? 52 LEU A O    2  
ATOM 2900  C CB   . LEU A 1 48 ? 7.296   -7.472  2.310   1.00 0.00 ? 52 LEU A CB   2  
ATOM 2901  C CG   . LEU A 1 48 ? 8.245   -6.341  1.907   1.00 0.00 ? 52 LEU A CG   2  
ATOM 2902  C CD1  . LEU A 1 48 ? 7.702   -4.984  2.359   1.00 0.00 ? 52 LEU A CD1  2  
ATOM 2903  C CD2  . LEU A 1 48 ? 9.658   -6.597  2.434   1.00 0.00 ? 52 LEU A CD2  2  
ATOM 2904  H H    . LEU A 1 48 ? 6.355   -8.050  -0.162  1.00 0.00 ? 52 LEU A H    2  
ATOM 2905  H HA   . LEU A 1 48 ? 8.417   -9.142  1.623   1.00 0.00 ? 52 LEU A HA   2  
ATOM 2906  H HB2  . LEU A 1 48 ? 6.273   -7.104  2.238   1.00 0.00 ? 52 LEU A HB2  2  
ATOM 2907  H HB3  . LEU A 1 48 ? 7.475   -7.715  3.357   1.00 0.00 ? 52 LEU A HB3  2  
ATOM 2908  H HG   . LEU A 1 48 ? 8.306   -6.317  0.819   1.00 0.00 ? 52 LEU A HG   2  
ATOM 2909  H HD11 . LEU A 1 48 ? 7.347   -5.058  3.387   1.00 0.00 ? 52 LEU A HD11 2  
ATOM 2910  H HD12 . LEU A 1 48 ? 8.494   -4.238  2.301   1.00 0.00 ? 52 LEU A HD12 2  
ATOM 2911  H HD13 . LEU A 1 48 ? 6.877   -4.688  1.711   1.00 0.00 ? 52 LEU A HD13 2  
ATOM 2912  H HD21 . LEU A 1 48 ? 9.841   -7.671  2.478   1.00 0.00 ? 52 LEU A HD21 2  
ATOM 2913  H HD22 . LEU A 1 48 ? 10.384  -6.131  1.768   1.00 0.00 ? 52 LEU A HD22 2  
ATOM 2914  H HD23 . LEU A 1 48 ? 9.756   -6.171  3.433   1.00 0.00 ? 52 LEU A HD23 2  
ATOM 2915  N N    . ASN A 1 49 ? 6.730   -10.476 3.045   1.00 0.00 ? 53 ASN A N    2  
ATOM 2916  C CA   . ASN A 1 49 ? 5.883   -11.531 3.573   1.00 0.00 ? 53 ASN A CA   2  
ATOM 2917  C C    . ASN A 1 49 ? 4.924   -10.939 4.608   1.00 0.00 ? 53 ASN A C    2  
ATOM 2918  O O    . ASN A 1 49 ? 5.358   -10.401 5.625   1.00 0.00 ? 53 ASN A O    2  
ATOM 2919  C CB   . ASN A 1 49 ? 6.716   -12.612 4.265   1.00 0.00 ? 53 ASN A CB   2  
ATOM 2920  C CG   . ASN A 1 49 ? 5.862   -13.839 4.590   1.00 0.00 ? 53 ASN A CG   2  
ATOM 2921  O OD1  . ASN A 1 49 ? 4.905   -14.161 3.905   1.00 0.00 ? 53 ASN A OD1  2  
ATOM 2922  N ND2  . ASN A 1 49 ? 6.259   -14.504 5.671   1.00 0.00 ? 53 ASN A ND2  2  
ATOM 2923  H H    . ASN A 1 49 ? 7.545   -10.275 3.589   1.00 0.00 ? 53 ASN A H    2  
ATOM 2924  H HA   . ASN A 1 49 ? 5.362   -11.941 2.708   1.00 0.00 ? 53 ASN A HA   2  
ATOM 2925  H HB2  . ASN A 1 49 ? 7.547   -12.903 3.622   1.00 0.00 ? 53 ASN A HB2  2  
ATOM 2926  H HB3  . ASN A 1 49 ? 7.148   -12.212 5.182   1.00 0.00 ? 53 ASN A HB3  2  
ATOM 2927  H HD21 . ASN A 1 49 ? 7.052   -14.186 6.190   1.00 0.00 ? 53 ASN A HD21 2  
ATOM 2928  H HD22 . ASN A 1 49 ? 5.763   -15.321 5.966   1.00 0.00 ? 53 ASN A HD22 2  
ATOM 2929  N N    . PRO A 1 50 ? 3.604   -11.062 4.305   1.00 0.00 ? 54 PRO A N    2  
ATOM 2930  C CA   . PRO A 1 50 ? 2.580   -10.545 5.197   1.00 0.00 ? 54 PRO A CA   2  
ATOM 2931  C C    . PRO A 1 50 ? 2.417   -11.445 6.424   1.00 0.00 ? 54 PRO A C    2  
ATOM 2932  O O    . PRO A 1 50 ? 1.601   -11.164 7.300   1.00 0.00 ? 54 PRO A O    2  
ATOM 2933  C CB   . PRO A 1 50 ? 1.322   -10.466 4.348   1.00 0.00 ? 54 PRO A CB   2  
ATOM 2934  C CG   . PRO A 1 50 ? 1.568   -11.372 3.152   1.00 0.00 ? 54 PRO A CG   2  
ATOM 2935  C CD   . PRO A 1 50 ? 3.053   -11.694 3.110   1.00 0.00 ? 54 PRO A CD   2  
ATOM 2936  H HA   . PRO A 1 50 ? 2.847   -9.648  5.549   1.00 0.00 ? 54 PRO A HA   2  
ATOM 2937  H HB2  . PRO A 1 50 ? 0.449   -10.793 4.912   1.00 0.00 ? 54 PRO A HB2  2  
ATOM 2938  H HB3  . PRO A 1 50 ? 1.130   -9.442  4.029   1.00 0.00 ? 54 PRO A HB3  2  
ATOM 2939  H HG2  . PRO A 1 50 ? 0.982   -12.287 3.239   1.00 0.00 ? 54 PRO A HG2  2  
ATOM 2940  H HG3  . PRO A 1 50 ? 1.258   -10.880 2.230   1.00 0.00 ? 54 PRO A HG3  2  
ATOM 2941  H HD2  . PRO A 1 50 ? 3.226   -12.770 3.115   1.00 0.00 ? 54 PRO A HD2  2  
ATOM 2942  H HD3  . PRO A 1 50 ? 3.518   -11.302 2.205   1.00 0.00 ? 54 PRO A HD3  2  
ATOM 2943  N N    . ALA A 1 51 ? 3.208   -12.508 6.448   1.00 0.00 ? 55 ALA A N    2  
ATOM 2944  C CA   . ALA A 1 51 ? 3.162   -13.450 7.554   1.00 0.00 ? 55 ALA A CA   2  
ATOM 2945  C C    . ALA A 1 51 ? 4.380   -13.233 8.454   1.00 0.00 ? 55 ALA A C    2  
ATOM 2946  O O    . ALA A 1 51 ? 4.693   -14.075 9.294   1.00 0.00 ? 55 ALA A O    2  
ATOM 2947  C CB   . ALA A 1 51 ? 3.089   -14.876 7.006   1.00 0.00 ? 55 ALA A CB   2  
ATOM 2948  H H    . ALA A 1 51 ? 3.870   -12.729 5.732   1.00 0.00 ? 55 ALA A H    2  
ATOM 2949  H HA   . ALA A 1 51 ? 2.257   -13.246 8.126   1.00 0.00 ? 55 ALA A HA   2  
ATOM 2950  H HB1  . ALA A 1 51 ? 2.655   -14.860 6.006   1.00 0.00 ? 55 ALA A HB1  2  
ATOM 2951  H HB2  . ALA A 1 51 ? 2.466   -15.486 7.661   1.00 0.00 ? 55 ALA A HB2  2  
ATOM 2952  H HB3  . ALA A 1 51 ? 4.092   -15.300 6.960   1.00 0.00 ? 55 ALA A HB3  2  
ATOM 2953  N N    . SER A 1 52 ? 5.033   -12.099 8.248   1.00 0.00 ? 56 SER A N    2  
ATOM 2954  C CA   . SER A 1 52 ? 6.210   -11.760 9.031   1.00 0.00 ? 56 SER A CA   2  
ATOM 2955  C C    . SER A 1 52 ? 5.932   -10.522 9.885   1.00 0.00 ? 56 SER A C    2  
ATOM 2956  O O    . SER A 1 52 ? 5.204   -9.624  9.465   1.00 0.00 ? 56 SER A O    2  
ATOM 2957  C CB   . SER A 1 52 ? 7.422   -11.521 8.128   1.00 0.00 ? 56 SER A CB   2  
ATOM 2958  O OG   . SER A 1 52 ? 8.514   -10.947 8.842   1.00 0.00 ? 56 SER A OG   2  
ATOM 2959  H H    . SER A 1 52 ? 4.772   -11.419 7.563   1.00 0.00 ? 56 SER A H    2  
ATOM 2960  H HA   . SER A 1 52 ? 6.395   -12.628 9.664   1.00 0.00 ? 56 SER A HA   2  
ATOM 2961  H HB2  . SER A 1 52 ? 7.736   -12.466 7.685   1.00 0.00 ? 56 SER A HB2  2  
ATOM 2962  H HB3  . SER A 1 52 ? 7.138   -10.862 7.308   1.00 0.00 ? 56 SER A HB3  2  
ATOM 2963  H HG   . SER A 1 52 ? 8.588   -9.973  8.628   1.00 0.00 ? 56 SER A HG   2  
ATOM 2964  N N    . PRO A 1 53 ? 6.541   -10.513 11.101  1.00 0.00 ? 57 PRO A N    2  
ATOM 2965  C CA   . PRO A 1 53 ? 6.367   -9.400  12.018  1.00 0.00 ? 57 PRO A CA   2  
ATOM 2966  C C    . PRO A 1 53 ? 7.177   -8.184  11.565  1.00 0.00 ? 57 PRO A C    2  
ATOM 2967  O O    . PRO A 1 53 ? 6.696   -7.054  11.631  1.00 0.00 ? 57 PRO A O    2  
ATOM 2968  C CB   . PRO A 1 53 ? 6.804   -9.934  13.373  1.00 0.00 ? 57 PRO A CB   2  
ATOM 2969  C CG   . PRO A 1 53 ? 7.641   -11.169 13.083  1.00 0.00 ? 57 PRO A CG   2  
ATOM 2970  C CD   . PRO A 1 53 ? 7.410   -11.560 11.633  1.00 0.00 ? 57 PRO A CD   2  
ATOM 2971  H HA   . PRO A 1 53 ? 5.411   -9.104  12.027  1.00 0.00 ? 57 PRO A HA   2  
ATOM 2972  H HB2  . PRO A 1 53 ? 7.383   -9.188  13.918  1.00 0.00 ? 57 PRO A HB2  2  
ATOM 2973  H HB3  . PRO A 1 53 ? 5.942   -10.182 13.991  1.00 0.00 ? 57 PRO A HB3  2  
ATOM 2974  H HG2  . PRO A 1 53 ? 8.697   -10.965 13.260  1.00 0.00 ? 57 PRO A HG2  2  
ATOM 2975  H HG3  . PRO A 1 53 ? 7.359   -11.986 13.748  1.00 0.00 ? 57 PRO A HG3  2  
ATOM 2976  H HD2  . PRO A 1 53 ? 8.349   -11.612 11.082  1.00 0.00 ? 57 PRO A HD2  2  
ATOM 2977  H HD3  . PRO A 1 53 ? 6.941   -12.540 11.556  1.00 0.00 ? 57 PRO A HD3  2  
ATOM 2978  N N    . MET A 1 54 ? 8.393   -8.457  11.114  1.00 0.00 ? 58 MET A N    2  
ATOM 2979  C CA   . MET A 1 54 ? 9.274   -7.400  10.650  1.00 0.00 ? 58 MET A CA   2  
ATOM 2980  C C    . MET A 1 54 ? 8.667   -6.666  9.452   1.00 0.00 ? 58 MET A C    2  
ATOM 2981  O O    . MET A 1 54 ? 9.003   -5.512  9.191   1.00 0.00 ? 58 MET A O    2  
ATOM 2982  C CB   . MET A 1 54 ? 10.624  -7.998  10.251  1.00 0.00 ? 58 MET A CB   2  
ATOM 2983  C CG   . MET A 1 54 ? 11.780  -7.152  10.790  1.00 0.00 ? 58 MET A CG   2  
ATOM 2984  S SD   . MET A 1 54 ? 12.478  -7.924  12.240  1.00 0.00 ? 58 MET A SD   2  
ATOM 2985  C CE   . MET A 1 54 ? 11.489  -7.153  13.509  1.00 0.00 ? 58 MET A CE   2  
ATOM 2986  H H    . MET A 1 54 ? 8.776   -9.380  11.064  1.00 0.00 ? 58 MET A H    2  
ATOM 2987  H HA   . MET A 1 54 ? 9.377   -6.714  11.491  1.00 0.00 ? 58 MET A HA   2  
ATOM 2988  H HB2  . MET A 1 54 ? 10.703  -9.015  10.637  1.00 0.00 ? 58 MET A HB2  2  
ATOM 2989  H HB3  . MET A 1 54 ? 10.691  -8.063  9.165   1.00 0.00 ? 58 MET A HB3  2  
ATOM 2990  H HG2  . MET A 1 54 ? 12.546  -7.038  10.023  1.00 0.00 ? 58 MET A HG2  2  
ATOM 2991  H HG3  . MET A 1 54 ? 11.425  -6.151  11.036  1.00 0.00 ? 58 MET A HG3  2  
ATOM 2992  H HE1  . MET A 1 54 ? 11.491  -6.072  13.364  1.00 0.00 ? 58 MET A HE1  2  
ATOM 2993  H HE2  . MET A 1 54 ? 10.466  -7.525  13.450  1.00 0.00 ? 58 MET A HE2  2  
ATOM 2994  H HE3  . MET A 1 54 ? 11.905  -7.389  14.488  1.00 0.00 ? 58 MET A HE3  2  
ATOM 2995  N N    . VAL A 1 55 ? 7.784   -7.366  8.756   1.00 0.00 ? 59 VAL A N    2  
ATOM 2996  C CA   . VAL A 1 55 ? 7.127   -6.796  7.592   1.00 0.00 ? 59 VAL A CA   2  
ATOM 2997  C C    . VAL A 1 55 ? 6.041   -5.821  8.051   1.00 0.00 ? 59 VAL A C    2  
ATOM 2998  O O    . VAL A 1 55 ? 5.386   -5.183  7.229   1.00 0.00 ? 59 VAL A O    2  
ATOM 2999  C CB   . VAL A 1 55 ? 6.588   -7.913  6.696   1.00 0.00 ? 59 VAL A CB   2  
ATOM 3000  C CG1  . VAL A 1 55 ? 5.534   -7.376  5.725   1.00 0.00 ? 59 VAL A CG1  2  
ATOM 3001  C CG2  . VAL A 1 55 ? 7.724   -8.608  5.943   1.00 0.00 ? 59 VAL A CG2  2  
ATOM 3002  H H    . VAL A 1 55 ? 7.516   -8.305  8.975   1.00 0.00 ? 59 VAL A H    2  
ATOM 3003  H HA   . VAL A 1 55 ? 7.878   -6.244  7.028   1.00 0.00 ? 59 VAL A HA   2  
ATOM 3004  H HB   . VAL A 1 55 ? 6.108   -8.653  7.336   1.00 0.00 ? 59 VAL A HB   2  
ATOM 3005  H HG11 . VAL A 1 55 ? 5.818   -6.376  5.397   1.00 0.00 ? 59 VAL A HG11 2  
ATOM 3006  H HG12 . VAL A 1 55 ? 5.467   -8.037  4.860   1.00 0.00 ? 59 VAL A HG12 2  
ATOM 3007  H HG13 . VAL A 1 55 ? 4.567   -7.334  6.226   1.00 0.00 ? 59 VAL A HG13 2  
ATOM 3008  H HG21 . VAL A 1 55 ? 8.256   -7.878  5.334   1.00 0.00 ? 59 VAL A HG21 2  
ATOM 3009  H HG22 . VAL A 1 55 ? 8.413   -9.056  6.658   1.00 0.00 ? 59 VAL A HG22 2  
ATOM 3010  H HG23 . VAL A 1 55 ? 7.311   -9.385  5.300   1.00 0.00 ? 59 VAL A HG23 2  
ATOM 3011  N N    . LYS A 1 56 ? 5.883   -5.737  9.364   1.00 0.00 ? 60 LYS A N    2  
ATOM 3012  C CA   . LYS A 1 56 ? 4.887   -4.851  9.943   1.00 0.00 ? 60 LYS A CA   2  
ATOM 3013  C C    . LYS A 1 56 ? 5.585   -3.628  10.541  1.00 0.00 ? 60 LYS A C    2  
ATOM 3014  O O    . LYS A 1 56 ? 4.937   -2.768  11.136  1.00 0.00 ? 60 LYS A O    2  
ATOM 3015  C CB   . LYS A 1 56 ? 4.011   -5.609  10.943  1.00 0.00 ? 60 LYS A CB   2  
ATOM 3016  C CG   . LYS A 1 56 ? 3.495   -6.917  10.339  1.00 0.00 ? 60 LYS A CG   2  
ATOM 3017  C CD   . LYS A 1 56 ? 2.461   -6.645  9.245   1.00 0.00 ? 60 LYS A CD   2  
ATOM 3018  C CE   . LYS A 1 56 ? 1.128   -6.198  9.849   1.00 0.00 ? 60 LYS A CE   2  
ATOM 3019  N NZ   . LYS A 1 56 ? 1.017   -4.723  9.827   1.00 0.00 ? 60 LYS A NZ   2  
ATOM 3020  H H    . LYS A 1 56 ? 6.419   -6.260  10.027  1.00 0.00 ? 60 LYS A H    2  
ATOM 3021  H HA   . LYS A 1 56 ? 4.237   -4.517  9.134   1.00 0.00 ? 60 LYS A HA   2  
ATOM 3022  H HB2  . LYS A 1 56 ? 4.584   -5.822  11.845  1.00 0.00 ? 60 LYS A HB2  2  
ATOM 3023  H HB3  . LYS A 1 56 ? 3.169   -4.985  11.241  1.00 0.00 ? 60 LYS A HB3  2  
ATOM 3024  H HG2  . LYS A 1 56 ? 4.329   -7.483  9.923   1.00 0.00 ? 60 LYS A HG2  2  
ATOM 3025  H HG3  . LYS A 1 56 ? 3.050   -7.532  11.120  1.00 0.00 ? 60 LYS A HG3  2  
ATOM 3026  H HD2  . LYS A 1 56 ? 2.834   -5.874  8.570   1.00 0.00 ? 60 LYS A HD2  2  
ATOM 3027  H HD3  . LYS A 1 56 ? 2.311   -7.545  8.649   1.00 0.00 ? 60 LYS A HD3  2  
ATOM 3028  H HE2  . LYS A 1 56 ? 0.303   -6.640  9.291   1.00 0.00 ? 60 LYS A HE2  2  
ATOM 3029  H HE3  . LYS A 1 56 ? 1.048   -6.559  10.875  1.00 0.00 ? 60 LYS A HE3  2  
ATOM 3030  H HZ1  . LYS A 1 56 ? 1.809   -4.336  9.353   1.00 0.00 ? 60 LYS A HZ1  2  
ATOM 3031  H HZ2  . LYS A 1 56 ? 0.180   -4.459  9.348   1.00 0.00 ? 60 LYS A HZ2  2  
ATOM 3032  H HZ3  . LYS A 1 56 ? 0.988   -4.376  10.764  1.00 0.00 ? 60 LYS A HZ3  2  
ATOM 3033  N N    . LYS A 1 57 ? 6.897   -3.588  10.361  1.00 0.00 ? 61 LYS A N    2  
ATOM 3034  C CA   . LYS A 1 57 ? 7.690   -2.485  10.875  1.00 0.00 ? 61 LYS A CA   2  
ATOM 3035  C C    . LYS A 1 57 ? 8.379   -1.771  9.710   1.00 0.00 ? 61 LYS A C    2  
ATOM 3036  O O    . LYS A 1 57 ? 8.857   -0.648  9.861   1.00 0.00 ? 61 LYS A O    2  
ATOM 3037  C CB   . LYS A 1 57 ? 8.657   -2.976  11.954  1.00 0.00 ? 61 LYS A CB   2  
ATOM 3038  C CG   . LYS A 1 57 ? 9.931   -3.549  11.329  1.00 0.00 ? 61 LYS A CG   2  
ATOM 3039  C CD   . LYS A 1 57 ? 11.095  -2.565  11.458  1.00 0.00 ? 61 LYS A CD   2  
ATOM 3040  C CE   . LYS A 1 57 ? 12.433  -3.261  11.197  1.00 0.00 ? 61 LYS A CE   2  
ATOM 3041  N NZ   . LYS A 1 57 ? 13.557  -2.329  11.438  1.00 0.00 ? 61 LYS A NZ   2  
ATOM 3042  H H    . LYS A 1 57 ? 7.416   -4.291  9.875   1.00 0.00 ? 61 LYS A H    2  
ATOM 3043  H HA   . LYS A 1 57 ? 7.004   -1.784  11.352  1.00 0.00 ? 61 LYS A HA   2  
ATOM 3044  H HB2  . LYS A 1 57 ? 8.913   -2.153  12.621  1.00 0.00 ? 61 LYS A HB2  2  
ATOM 3045  H HB3  . LYS A 1 57 ? 8.171   -3.739  12.562  1.00 0.00 ? 61 LYS A HB3  2  
ATOM 3046  H HG2  . LYS A 1 57 ? 10.188  -4.489  11.816  1.00 0.00 ? 61 LYS A HG2  2  
ATOM 3047  H HG3  . LYS A 1 57 ? 9.755   -3.773  10.277  1.00 0.00 ? 61 LYS A HG3  2  
ATOM 3048  H HD2  . LYS A 1 57 ? 10.964  -1.745  10.752  1.00 0.00 ? 61 LYS A HD2  2  
ATOM 3049  H HD3  . LYS A 1 57 ? 11.097  -2.128  12.457  1.00 0.00 ? 61 LYS A HD3  2  
ATOM 3050  H HE2  . LYS A 1 57 ? 12.529  -4.132  11.846  1.00 0.00 ? 61 LYS A HE2  2  
ATOM 3051  H HE3  . LYS A 1 57 ? 12.466  -3.624  10.170  1.00 0.00 ? 61 LYS A HE3  2  
ATOM 3052  H HZ1  . LYS A 1 57 ? 13.202  -1.402  11.559  1.00 0.00 ? 61 LYS A HZ1  2  
ATOM 3053  H HZ2  . LYS A 1 57 ? 14.050  -2.607  12.262  1.00 0.00 ? 61 LYS A HZ2  2  
ATOM 3054  H HZ3  . LYS A 1 57 ? 14.179  -2.348  10.655  1.00 0.00 ? 61 LYS A HZ3  2  
ATOM 3055  N N    . ILE A 1 58 ? 8.410   -2.454  8.575   1.00 0.00 ? 62 ILE A N    2  
ATOM 3056  C CA   . ILE A 1 58 ? 9.033   -1.900  7.385   1.00 0.00 ? 62 ILE A CA   2  
ATOM 3057  C C    . ILE A 1 58 ? 7.986   -1.128  6.579   1.00 0.00 ? 62 ILE A C    2  
ATOM 3058  O O    . ILE A 1 58 ? 8.332   -0.328  5.711   1.00 0.00 ? 62 ILE A O    2  
ATOM 3059  C CB   . ILE A 1 58 ? 9.735   -2.999  6.586   1.00 0.00 ? 62 ILE A CB   2  
ATOM 3060  C CG1  . ILE A 1 58 ? 10.827  -3.671  7.422   1.00 0.00 ? 62 ILE A CG1  2  
ATOM 3061  C CG2  . ILE A 1 58 ? 10.279  -2.454  5.264   1.00 0.00 ? 62 ILE A CG2  2  
ATOM 3062  C CD1  . ILE A 1 58 ? 11.015  -5.132  7.006   1.00 0.00 ? 62 ILE A CD1  2  
ATOM 3063  H H    . ILE A 1 58 ? 8.019   -3.367  8.461   1.00 0.00 ? 62 ILE A H    2  
ATOM 3064  H HA   . ILE A 1 58 ? 9.801   -1.200  7.714   1.00 0.00 ? 62 ILE A HA   2  
ATOM 3065  H HB   . ILE A 1 58 ? 9.000   -3.766  6.340   1.00 0.00 ? 62 ILE A HB   2  
ATOM 3066  H HG12 . ILE A 1 58 ? 11.766  -3.131  7.302   1.00 0.00 ? 62 ILE A HG12 2  
ATOM 3067  H HG13 . ILE A 1 58 ? 10.563  -3.622  8.478   1.00 0.00 ? 62 ILE A HG13 2  
ATOM 3068  H HG21 . ILE A 1 58 ? 10.610  -1.425  5.404   1.00 0.00 ? 62 ILE A HG21 2  
ATOM 3069  H HG22 . ILE A 1 58 ? 11.121  -3.065  4.938   1.00 0.00 ? 62 ILE A HG22 2  
ATOM 3070  H HG23 . ILE A 1 58 ? 9.495   -2.485  4.508   1.00 0.00 ? 62 ILE A HG23 2  
ATOM 3071  H HD11 . ILE A 1 58 ? 10.357  -5.358  6.166   1.00 0.00 ? 62 ILE A HD11 2  
ATOM 3072  H HD12 . ILE A 1 58 ? 12.051  -5.294  6.709   1.00 0.00 ? 62 ILE A HD12 2  
ATOM 3073  H HD13 . ILE A 1 58 ? 10.770  -5.783  7.845   1.00 0.00 ? 62 ILE A HD13 2  
ATOM 3074  N N    . ILE A 1 59 ? 6.727   -1.395  6.895   1.00 0.00 ? 63 ILE A N    2  
ATOM 3075  C CA   . ILE A 1 59 ? 5.628   -0.735  6.211   1.00 0.00 ? 63 ILE A CA   2  
ATOM 3076  C C    . ILE A 1 59 ? 5.210   0.504   7.004   1.00 0.00 ? 63 ILE A C    2  
ATOM 3077  O O    . ILE A 1 59 ? 5.218   1.616   6.477   1.00 0.00 ? 63 ILE A O    2  
ATOM 3078  C CB   . ILE A 1 59 ? 4.484   -1.720  5.961   1.00 0.00 ? 63 ILE A CB   2  
ATOM 3079  C CG1  . ILE A 1 59 ? 4.824   -2.674  4.814   1.00 0.00 ? 63 ILE A CG1  2  
ATOM 3080  C CG2  . ILE A 1 59 ? 3.167   -0.981  5.721   1.00 0.00 ? 63 ILE A CG2  2  
ATOM 3081  C CD1  . ILE A 1 59 ? 4.100   -4.012  4.981   1.00 0.00 ? 63 ILE A CD1  2  
ATOM 3082  H H    . ILE A 1 59 ? 6.454   -2.047  7.602   1.00 0.00 ? 63 ILE A H    2  
ATOM 3083  H HA   . ILE A 1 59 ? 5.995   -0.414  5.236   1.00 0.00 ? 63 ILE A HA   2  
ATOM 3084  H HB   . ILE A 1 59 ? 4.354   -2.327  6.857   1.00 0.00 ? 63 ILE A HB   2  
ATOM 3085  H HG12 . ILE A 1 59 ? 4.542   -2.221  3.863   1.00 0.00 ? 63 ILE A HG12 2  
ATOM 3086  H HG13 . ILE A 1 59 ? 5.900   -2.841  4.781   1.00 0.00 ? 63 ILE A HG13 2  
ATOM 3087  H HG21 . ILE A 1 59 ? 3.376   0.041   5.405   1.00 0.00 ? 63 ILE A HG21 2  
ATOM 3088  H HG22 . ILE A 1 59 ? 2.599   -1.492  4.943   1.00 0.00 ? 63 ILE A HG22 2  
ATOM 3089  H HG23 . ILE A 1 59 ? 2.586   -0.965  6.643   1.00 0.00 ? 63 ILE A HG23 2  
ATOM 3090  H HD11 . ILE A 1 59 ? 3.830   -4.151  6.028   1.00 0.00 ? 63 ILE A HD11 2  
ATOM 3091  H HD12 . ILE A 1 59 ? 3.197   -4.016  4.370   1.00 0.00 ? 63 ILE A HD12 2  
ATOM 3092  H HD13 . ILE A 1 59 ? 4.756   -4.822  4.665   1.00 0.00 ? 63 ILE A HD13 2  
ATOM 3093  N N    . GLU A 1 60 ? 4.854   0.272   8.259   1.00 0.00 ? 64 GLU A N    2  
ATOM 3094  C CA   . GLU A 1 60 ? 4.433   1.356   9.131   1.00 0.00 ? 64 GLU A CA   2  
ATOM 3095  C C    . GLU A 1 60 ? 5.485   2.466   9.143   1.00 0.00 ? 64 GLU A C    2  
ATOM 3096  O O    . GLU A 1 60 ? 5.149   3.643   9.265   1.00 0.00 ? 64 GLU A O    2  
ATOM 3097  C CB   . GLU A 1 60 ? 4.158   0.846   10.547  1.00 0.00 ? 64 GLU A CB   2  
ATOM 3098  C CG   . GLU A 1 60 ? 2.967   -0.115  10.562  1.00 0.00 ? 64 GLU A CG   2  
ATOM 3099  C CD   . GLU A 1 60 ? 3.003   -1.014  11.799  1.00 0.00 ? 64 GLU A CD   2  
ATOM 3100  O OE1  . GLU A 1 60 ? 3.989   -0.895  12.558  1.00 0.00 ? 64 GLU A OE1  2  
ATOM 3101  O OE2  . GLU A 1 60 ? 2.045   -1.802  11.956  1.00 0.00 ? 64 GLU A OE2  2  
ATOM 3102  H H    . GLU A 1 60 ? 4.850   -0.635  8.681   1.00 0.00 ? 64 GLU A H    2  
ATOM 3103  H HA   . GLU A 1 60 ? 3.504   1.731   8.699   1.00 0.00 ? 64 GLU A HA   2  
ATOM 3104  H HB2  . GLU A 1 60 ? 5.042   0.340   10.933  1.00 0.00 ? 64 GLU A HB2  2  
ATOM 3105  H HB3  . GLU A 1 60 ? 3.958   1.688   11.208  1.00 0.00 ? 64 GLU A HB3  2  
ATOM 3106  H HG2  . GLU A 1 60 ? 2.037   0.454   10.548  1.00 0.00 ? 64 GLU A HG2  2  
ATOM 3107  H HG3  . GLU A 1 60 ? 2.978   -0.728  9.661   1.00 0.00 ? 64 GLU A HG3  2  
ATOM 3108  N N    . LYS A 1 61 ? 6.737   2.053   9.015   1.00 0.00 ? 65 LYS A N    2  
ATOM 3109  C CA   . LYS A 1 61 ? 7.841   2.998   9.009   1.00 0.00 ? 65 LYS A CA   2  
ATOM 3110  C C    . LYS A 1 61 ? 7.864   3.740   7.672   1.00 0.00 ? 65 LYS A C    2  
ATOM 3111  O O    . LYS A 1 61 ? 8.188   4.926   7.622   1.00 0.00 ? 65 LYS A O    2  
ATOM 3112  C CB   . LYS A 1 61 ? 9.155   2.288   9.342   1.00 0.00 ? 65 LYS A CB   2  
ATOM 3113  C CG   . LYS A 1 61 ? 9.277   2.036   10.846  1.00 0.00 ? 65 LYS A CG   2  
ATOM 3114  C CD   . LYS A 1 61 ? 10.731  1.772   11.242  1.00 0.00 ? 65 LYS A CD   2  
ATOM 3115  C CE   . LYS A 1 61 ? 11.158  2.680   12.397  1.00 0.00 ? 65 LYS A CE   2  
ATOM 3116  N NZ   . LYS A 1 61 ? 10.561  2.216   13.670  1.00 0.00 ? 65 LYS A NZ   2  
ATOM 3117  H H    . LYS A 1 61 ? 7.002   1.093   8.916   1.00 0.00 ? 65 LYS A H    2  
ATOM 3118  H HA   . LYS A 1 61 ? 7.655   3.721   9.803   1.00 0.00 ? 65 LYS A HA   2  
ATOM 3119  H HB2  . LYS A 1 61 ? 9.208   1.341   8.805   1.00 0.00 ? 65 LYS A HB2  2  
ATOM 3120  H HB3  . LYS A 1 61 ? 9.996   2.894   9.002   1.00 0.00 ? 65 LYS A HB3  2  
ATOM 3121  H HG2  . LYS A 1 61 ? 8.898   2.898   11.395  1.00 0.00 ? 65 LYS A HG2  2  
ATOM 3122  H HG3  . LYS A 1 61 ? 8.659   1.183   11.127  1.00 0.00 ? 65 LYS A HG3  2  
ATOM 3123  H HD2  . LYS A 1 61 ? 10.848  0.728   11.534  1.00 0.00 ? 65 LYS A HD2  2  
ATOM 3124  H HD3  . LYS A 1 61 ? 11.381  1.938   10.384  1.00 0.00 ? 65 LYS A HD3  2  
ATOM 3125  H HE2  . LYS A 1 61 ? 12.245  2.686   12.479  1.00 0.00 ? 65 LYS A HE2  2  
ATOM 3126  H HE3  . LYS A 1 61 ? 10.848  3.705   12.195  1.00 0.00 ? 65 LYS A HE3  2  
ATOM 3127  H HZ1  . LYS A 1 61 ? 10.730  1.237   13.779  1.00 0.00 ? 65 LYS A HZ1  2  
ATOM 3128  H HZ2  . LYS A 1 61 ? 10.975  2.713   14.432  1.00 0.00 ? 65 LYS A HZ2  2  
ATOM 3129  H HZ3  . LYS A 1 61 ? 9.576   2.386   13.657  1.00 0.00 ? 65 LYS A HZ3  2  
ATOM 3130  N N    . MET A 1 62 ? 7.517   3.012   6.621   1.00 0.00 ? 66 MET A N    2  
ATOM 3131  C CA   . MET A 1 62 ? 7.495   3.587   5.287   1.00 0.00 ? 66 MET A CA   2  
ATOM 3132  C C    . MET A 1 62 ? 6.554   4.792   5.225   1.00 0.00 ? 66 MET A C    2  
ATOM 3133  O O    . MET A 1 62 ? 6.843   5.775   4.544   1.00 0.00 ? 66 MET A O    2  
ATOM 3134  C CB   . MET A 1 62 ? 7.035   2.528   4.282   1.00 0.00 ? 66 MET A CB   2  
ATOM 3135  C CG   . MET A 1 62 ? 8.110   2.273   3.224   1.00 0.00 ? 66 MET A CG   2  
ATOM 3136  S SD   . MET A 1 62 ? 8.602   3.814   2.469   1.00 0.00 ? 66 MET A SD   2  
ATOM 3137  C CE   . MET A 1 62 ? 7.113   4.206   1.566   1.00 0.00 ? 66 MET A CE   2  
ATOM 3138  H H    . MET A 1 62 ? 7.256   2.048   6.670   1.00 0.00 ? 66 MET A H    2  
ATOM 3139  H HA   . MET A 1 62 ? 8.518   3.905   5.088   1.00 0.00 ? 66 MET A HA   2  
ATOM 3140  H HB2  . MET A 1 62 ? 6.807   1.600   4.806   1.00 0.00 ? 66 MET A HB2  2  
ATOM 3141  H HB3  . MET A 1 62 ? 6.115   2.856   3.799   1.00 0.00 ? 66 MET A HB3  2  
ATOM 3142  H HG2  . MET A 1 62 ? 8.974   1.790   3.681   1.00 0.00 ? 66 MET A HG2  2  
ATOM 3143  H HG3  . MET A 1 62 ? 7.730   1.591   2.464   1.00 0.00 ? 66 MET A HG3  2  
ATOM 3144  H HE1  . MET A 1 62 ? 6.578   3.286   1.332   1.00 0.00 ? 66 MET A HE1  2  
ATOM 3145  H HE2  . MET A 1 62 ? 6.479   4.850   2.174   1.00 0.00 ? 66 MET A HE2  2  
ATOM 3146  H HE3  . MET A 1 62 ? 7.374   4.720   0.642   1.00 0.00 ? 66 MET A HE3  2  
ATOM 3147  N N    . LEU A 1 63 ? 5.448   4.676   5.945   1.00 0.00 ? 67 LEU A N    2  
ATOM 3148  C CA   . LEU A 1 63 ? 4.463   5.744   5.981   1.00 0.00 ? 67 LEU A CA   2  
ATOM 3149  C C    . LEU A 1 63 ? 5.035   6.934   6.754   1.00 0.00 ? 67 LEU A C    2  
ATOM 3150  O O    . LEU A 1 63 ? 4.505   8.041   6.678   1.00 0.00 ? 67 LEU A O    2  
ATOM 3151  C CB   . LEU A 1 63 ? 3.134   5.229   6.538   1.00 0.00 ? 67 LEU A CB   2  
ATOM 3152  C CG   . LEU A 1 63 ? 2.288   4.386   5.582   1.00 0.00 ? 67 LEU A CG   2  
ATOM 3153  C CD1  . LEU A 1 63 ? 3.088   3.198   5.044   1.00 0.00 ? 67 LEU A CD1  2  
ATOM 3154  C CD2  . LEU A 1 63 ? 0.985   3.943   6.250   1.00 0.00 ? 67 LEU A CD2  2  
ATOM 3155  H H    . LEU A 1 63 ? 5.221   3.873   6.496   1.00 0.00 ? 67 LEU A H    2  
ATOM 3156  H HA   . LEU A 1 63 ? 4.282   6.056   4.952   1.00 0.00 ? 67 LEU A HA   2  
ATOM 3157  H HB2  . LEU A 1 63 ? 3.342   4.635   7.428   1.00 0.00 ? 67 LEU A HB2  2  
ATOM 3158  H HB3  . LEU A 1 63 ? 2.541   6.086   6.858   1.00 0.00 ? 67 LEU A HB3  2  
ATOM 3159  H HG   . LEU A 1 63 ? 2.017   5.006   4.728   1.00 0.00 ? 67 LEU A HG   2  
ATOM 3160  H HD11 . LEU A 1 63 ? 4.010   3.559   4.586   1.00 0.00 ? 67 LEU A HD11 2  
ATOM 3161  H HD12 . LEU A 1 63 ? 3.330   2.522   5.863   1.00 0.00 ? 67 LEU A HD12 2  
ATOM 3162  H HD13 . LEU A 1 63 ? 2.495   2.669   4.298   1.00 0.00 ? 67 LEU A HD13 2  
ATOM 3163  H HD21 . LEU A 1 63 ? 1.184   3.657   7.283   1.00 0.00 ? 67 LEU A HD21 2  
ATOM 3164  H HD22 . LEU A 1 63 ? 0.270   4.766   6.233   1.00 0.00 ? 67 LEU A HD22 2  
ATOM 3165  H HD23 . LEU A 1 63 ? 0.571   3.091   5.711   1.00 0.00 ? 67 LEU A HD23 2  
ATOM 3166  N N    . LYS A 1 64 ? 6.109   6.664   7.482   1.00 0.00 ? 68 LYS A N    2  
ATOM 3167  C CA   . LYS A 1 64 ? 6.758   7.699   8.269   1.00 0.00 ? 68 LYS A CA   2  
ATOM 3168  C C    . LYS A 1 64 ? 8.024   8.165   7.546   1.00 0.00 ? 68 LYS A C    2  
ATOM 3169  O O    . LYS A 1 64 ? 8.441   9.312   7.695   1.00 0.00 ? 68 LYS A O    2  
ATOM 3170  C CB   . LYS A 1 64 ? 7.010   7.208   9.696   1.00 0.00 ? 68 LYS A CB   2  
ATOM 3171  C CG   . LYS A 1 64 ? 6.292   8.093   10.716  1.00 0.00 ? 68 LYS A CG   2  
ATOM 3172  C CD   . LYS A 1 64 ? 7.187   8.375   11.924  1.00 0.00 ? 68 LYS A CD   2  
ATOM 3173  C CE   . LYS A 1 64 ? 7.114   7.232   12.939  1.00 0.00 ? 68 LYS A CE   2  
ATOM 3174  N NZ   . LYS A 1 64 ? 8.419   7.052   13.612  1.00 0.00 ? 68 LYS A NZ   2  
ATOM 3175  H H    . LYS A 1 64 ? 6.533   5.761   7.539   1.00 0.00 ? 68 LYS A H    2  
ATOM 3176  H HA   . LYS A 1 64 ? 6.068   8.540   8.335   1.00 0.00 ? 68 LYS A HA   2  
ATOM 3177  H HB2  . LYS A 1 64 ? 6.666   6.178   9.797   1.00 0.00 ? 68 LYS A HB2  2  
ATOM 3178  H HB3  . LYS A 1 64 ? 8.081   7.206   9.900   1.00 0.00 ? 68 LYS A HB3  2  
ATOM 3179  H HG2  . LYS A 1 64 ? 6.003   9.034   10.246  1.00 0.00 ? 68 LYS A HG2  2  
ATOM 3180  H HG3  . LYS A 1 64 ? 5.374   7.606   11.044  1.00 0.00 ? 68 LYS A HG3  2  
ATOM 3181  H HD2  . LYS A 1 64 ? 8.218   8.508   11.595  1.00 0.00 ? 68 LYS A HD2  2  
ATOM 3182  H HD3  . LYS A 1 64 ? 6.881   9.308   12.399  1.00 0.00 ? 68 LYS A HD3  2  
ATOM 3183  H HE2  . LYS A 1 64 ? 6.342   7.445   13.680  1.00 0.00 ? 68 LYS A HE2  2  
ATOM 3184  H HE3  . LYS A 1 64 ? 6.827   6.309   12.436  1.00 0.00 ? 68 LYS A HE3  2  
ATOM 3185  H HZ1  . LYS A 1 64 ? 9.152   7.082   12.932  1.00 0.00 ? 68 LYS A HZ1  2  
ATOM 3186  H HZ2  . LYS A 1 64 ? 8.554   7.784   14.280  1.00 0.00 ? 68 LYS A HZ2  2  
ATOM 3187  H HZ3  . LYS A 1 64 ? 8.434   6.168   14.079  1.00 0.00 ? 68 LYS A HZ3  2  
ATOM 3188  N N    . ASN A 1 65 ? 8.599   7.250   6.779   1.00 0.00 ? 69 ASN A N    2  
ATOM 3189  C CA   . ASN A 1 65 ? 9.808   7.553   6.033   1.00 0.00 ? 69 ASN A CA   2  
ATOM 3190  C C    . ASN A 1 65 ? 10.929  7.914   7.010   1.00 0.00 ? 69 ASN A C    2  
ATOM 3191  O O    . ASN A 1 65 ? 11.796  7.090   7.297   1.00 0.00 ? 69 ASN A O    2  
ATOM 3192  C CB   . ASN A 1 65 ? 9.595   8.745   5.098   1.00 0.00 ? 69 ASN A CB   2  
ATOM 3193  C CG   . ASN A 1 65 ? 10.919  9.205   4.485   1.00 0.00 ? 69 ASN A CG   2  
ATOM 3194  O OD1  . ASN A 1 65 ? 11.876  9.519   5.174   1.00 0.00 ? 69 ASN A OD1  2  
ATOM 3195  N ND2  . ASN A 1 65 ? 10.921  9.228   3.155   1.00 0.00 ? 69 ASN A ND2  2  
ATOM 3196  H H    . ASN A 1 65 ? 8.253   6.319   6.664   1.00 0.00 ? 69 ASN A H    2  
ATOM 3197  H HA   . ASN A 1 65 ? 10.027  6.650   5.463   1.00 0.00 ? 69 ASN A HA   2  
ATOM 3198  H HB2  . ASN A 1 65 ? 8.899   8.470   4.305   1.00 0.00 ? 69 ASN A HB2  2  
ATOM 3199  H HB3  . ASN A 1 65 ? 9.140   9.568   5.649   1.00 0.00 ? 69 ASN A HB3  2  
ATOM 3200  H HD21 . ASN A 1 65 ? 10.101  8.959   2.650   1.00 0.00 ? 69 ASN A HD21 2  
ATOM 3201  H HD22 . ASN A 1 65 ? 11.741  9.516   2.661   1.00 0.00 ? 69 ASN A HD22 2  
ATOM 3202  N N    . GLY A 1 66 ? 10.874  9.145   7.495   1.00 0.00 ? 70 GLY A N    2  
ATOM 3203  C CA   . GLY A 1 66 ? 11.873  9.625   8.435   1.00 0.00 ? 70 GLY A CA   2  
ATOM 3204  C C    . GLY A 1 66 ? 12.330  11.040  8.074   1.00 0.00 ? 70 GLY A C    2  
ATOM 3205  O O    . GLY A 1 66 ? 11.544  11.984  8.134   1.00 0.00 ? 70 GLY A O    2  
ATOM 3206  H H    . GLY A 1 66 ? 10.165  9.809   7.257   1.00 0.00 ? 70 GLY A H    2  
ATOM 3207  H HA2  . GLY A 1 66 ? 11.462  9.618   9.444   1.00 0.00 ? 70 GLY A HA2  2  
ATOM 3208  H HA3  . GLY A 1 66 ? 12.730  8.951   8.435   1.00 0.00 ? 70 GLY A HA3  2  
ATOM 3209  N N    . LYS A 1 67 ? 13.599  11.142  7.707   1.00 0.00 ? 71 LYS A N    2  
ATOM 3210  C CA   . LYS A 1 67 ? 14.170  12.426  7.336   1.00 0.00 ? 71 LYS A CA   2  
ATOM 3211  C C    . LYS A 1 67 ? 13.759  12.767  5.903   1.00 0.00 ? 71 LYS A C    2  
ATOM 3212  O O    . LYS A 1 67 ? 12.919  13.638  5.685   1.00 0.00 ? 71 LYS A O    2  
ATOM 3213  C CB   . LYS A 1 67 ? 15.684  12.423  7.558   1.00 0.00 ? 71 LYS A CB   2  
ATOM 3214  C CG   . LYS A 1 67 ? 16.193  13.828  7.886   1.00 0.00 ? 71 LYS A CG   2  
ATOM 3215  C CD   . LYS A 1 67 ? 17.327  14.234  6.942   1.00 0.00 ? 71 LYS A CD   2  
ATOM 3216  C CE   . LYS A 1 67 ? 17.631  15.729  7.062   1.00 0.00 ? 71 LYS A CE   2  
ATOM 3217  N NZ   . LYS A 1 67 ? 18.765  15.954  7.986   1.00 0.00 ? 71 LYS A NZ   2  
ATOM 3218  H H    . LYS A 1 67 ? 14.232  10.369  7.660   1.00 0.00 ? 71 LYS A H    2  
ATOM 3219  H HA   . LYS A 1 67 ? 13.748  13.176  8.005   1.00 0.00 ? 71 LYS A HA   2  
ATOM 3220  H HB2  . LYS A 1 67 ? 15.935  11.742  8.372   1.00 0.00 ? 71 LYS A HB2  2  
ATOM 3221  H HB3  . LYS A 1 67 ? 16.185  12.050  6.665   1.00 0.00 ? 71 LYS A HB3  2  
ATOM 3222  H HG2  . LYS A 1 67 ? 15.374  14.543  7.806   1.00 0.00 ? 71 LYS A HG2  2  
ATOM 3223  H HG3  . LYS A 1 67 ? 16.544  13.860  8.917   1.00 0.00 ? 71 LYS A HG3  2  
ATOM 3224  H HD2  . LYS A 1 67 ? 18.222  13.658  7.174   1.00 0.00 ? 71 LYS A HD2  2  
ATOM 3225  H HD3  . LYS A 1 67 ? 17.052  13.997  5.914   1.00 0.00 ? 71 LYS A HD3  2  
ATOM 3226  H HE2  . LYS A 1 67 ? 17.867  16.139  6.080   1.00 0.00 ? 71 LYS A HE2  2  
ATOM 3227  H HE3  . LYS A 1 67 ? 16.749  16.258  7.425   1.00 0.00 ? 71 LYS A HE3  2  
ATOM 3228  H HZ1  . LYS A 1 67 ? 18.622  15.428  8.824   1.00 0.00 ? 71 LYS A HZ1  2  
ATOM 3229  H HZ2  . LYS A 1 67 ? 19.615  15.659  7.548   1.00 0.00 ? 71 LYS A HZ2  2  
ATOM 3230  H HZ3  . LYS A 1 67 ? 18.826  16.927  8.209   1.00 0.00 ? 71 LYS A HZ3  2  
ATOM 3231  N N    . SER A 1 68 ? 14.372  12.063  4.962   1.00 0.00 ? 72 SER A N    2  
ATOM 3232  C CA   . SER A 1 68 ? 14.080  12.281  3.555   1.00 0.00 ? 72 SER A CA   2  
ATOM 3233  C C    . SER A 1 68 ? 14.732  11.184  2.710   1.00 0.00 ? 72 SER A C    2  
ATOM 3234  O O    . SER A 1 68 ? 15.673  11.448  1.964   1.00 0.00 ? 72 SER A O    2  
ATOM 3235  C CB   . SER A 1 68 ? 14.562  13.659  3.100   1.00 0.00 ? 72 SER A CB   2  
ATOM 3236  O OG   . SER A 1 68 ? 15.980  13.781  3.177   1.00 0.00 ? 72 SER A OG   2  
ATOM 3237  H H    . SER A 1 68 ? 15.054  11.356  5.148   1.00 0.00 ? 72 SER A H    2  
ATOM 3238  H HA   . SER A 1 68 ? 12.994  12.231  3.475   1.00 0.00 ? 72 SER A HA   2  
ATOM 3239  H HB2  . SER A 1 68 ? 14.239  13.836  2.074   1.00 0.00 ? 72 SER A HB2  2  
ATOM 3240  H HB3  . SER A 1 68 ? 14.098  14.428  3.717   1.00 0.00 ? 72 SER A HB3  2  
ATOM 3241  H HG   . SER A 1 68 ? 16.299  14.480  2.537   1.00 0.00 ? 72 SER A HG   2  
ATOM 3242  N N    . ASN A 1 69 ? 14.204  9.978   2.855   1.00 0.00 ? 73 ASN A N    2  
ATOM 3243  C CA   . ASN A 1 69 ? 14.723  8.840   2.115   1.00 0.00 ? 73 ASN A CA   2  
ATOM 3244  C C    . ASN A 1 69 ? 14.764  9.184   0.624   1.00 0.00 ? 73 ASN A C    2  
ATOM 3245  O O    . ASN A 1 69 ? 15.782  9.658   0.121   1.00 0.00 ? 73 ASN A O    2  
ATOM 3246  C CB   . ASN A 1 69 ? 13.827  7.612   2.292   1.00 0.00 ? 73 ASN A CB   2  
ATOM 3247  C CG   . ASN A 1 69 ? 14.658  6.373   2.632   1.00 0.00 ? 73 ASN A CG   2  
ATOM 3248  O OD1  . ASN A 1 69 ? 15.869  6.347   2.491   1.00 0.00 ? 73 ASN A OD1  2  
ATOM 3249  N ND2  . ASN A 1 69 ? 13.940  5.349   3.085   1.00 0.00 ? 73 ASN A ND2  2  
ATOM 3250  H H    . ASN A 1 69 ? 13.439  9.772   3.464   1.00 0.00 ? 73 ASN A H    2  
ATOM 3251  H HA   . ASN A 1 69 ? 15.715  8.657   2.528   1.00 0.00 ? 73 ASN A HA   2  
ATOM 3252  H HB2  . ASN A 1 69 ? 13.103  7.798   3.085   1.00 0.00 ? 73 ASN A HB2  2  
ATOM 3253  H HB3  . ASN A 1 69 ? 13.261  7.436   1.378   1.00 0.00 ? 73 ASN A HB3  2  
ATOM 3254  H HD21 . ASN A 1 69 ? 12.948  5.436   3.177   1.00 0.00 ? 73 ASN A HD21 2  
ATOM 3255  H HD22 . ASN A 1 69 ? 14.392  4.493   3.335   1.00 0.00 ? 73 ASN A HD22 2  
ATOM 3256  N N    . THR B 1 1  ? 15.708  14.651  -11.437 1.00 0.00 ? 5  THR B N    2  
ATOM 3257  C CA   . THR B 1 1  ? 16.222  15.884  -10.865 1.00 0.00 ? 5  THR B CA   2  
ATOM 3258  C C    . THR B 1 1  ? 15.078  16.723  -10.290 1.00 0.00 ? 5  THR B C    2  
ATOM 3259  O O    . THR B 1 1  ? 15.086  17.062  -9.108  1.00 0.00 ? 5  THR B O    2  
ATOM 3260  C CB   . THR B 1 1  ? 17.022  16.610  -11.948 1.00 0.00 ? 5  THR B CB   2  
ATOM 3261  O OG1  . THR B 1 1  ? 18.155  15.772  -12.163 1.00 0.00 ? 5  THR B OG1  2  
ATOM 3262  C CG2  . THR B 1 1  ? 17.622  17.926  -11.450 1.00 0.00 ? 5  THR B CG2  2  
ATOM 3263  H H    . THR B 1 1  ? 15.807  13.843  -10.857 1.00 0.00 ? 5  THR B H    2  
ATOM 3264  H HA   . THR B 1 1  ? 16.880  15.630  -10.035 1.00 0.00 ? 5  THR B HA   2  
ATOM 3265  H HB   . THR B 1 1  ? 16.415  16.771  -12.839 1.00 0.00 ? 5  THR B HB   2  
ATOM 3266  H HG1  . THR B 1 1  ? 18.670  16.090  -12.958 1.00 0.00 ? 5  THR B HG1  2  
ATOM 3267  H HG21 . THR B 1 1  ? 16.921  18.410  -10.769 1.00 0.00 ? 5  THR B HG21 2  
ATOM 3268  H HG22 . THR B 1 1  ? 18.557  17.725  -10.926 1.00 0.00 ? 5  THR B HG22 2  
ATOM 3269  H HG23 . THR B 1 1  ? 17.816  18.582  -12.299 1.00 0.00 ? 5  THR B HG23 2  
ATOM 3270  N N    . GLU B 1 2  ? 14.122  17.032  -11.154 1.00 0.00 ? 6  GLU B N    2  
ATOM 3271  C CA   . GLU B 1 2  ? 12.974  17.825  -10.747 1.00 0.00 ? 6  GLU B CA   2  
ATOM 3272  C C    . GLU B 1 2  ? 11.695  16.991  -10.838 1.00 0.00 ? 6  GLU B C    2  
ATOM 3273  O O    . GLU B 1 2  ? 10.984  17.044  -11.840 1.00 0.00 ? 6  GLU B O    2  
ATOM 3274  C CB   . GLU B 1 2  ? 12.860  19.097  -11.589 1.00 0.00 ? 6  GLU B CB   2  
ATOM 3275  C CG   . GLU B 1 2  ? 12.042  20.165  -10.861 1.00 0.00 ? 6  GLU B CG   2  
ATOM 3276  C CD   . GLU B 1 2  ? 12.457  21.570  -11.303 1.00 0.00 ? 6  GLU B CD   2  
ATOM 3277  O OE1  . GLU B 1 2  ? 12.257  21.871  -12.499 1.00 0.00 ? 6  GLU B OE1  2  
ATOM 3278  O OE2  . GLU B 1 2  ? 12.964  22.311  -10.434 1.00 0.00 ? 6  GLU B OE2  2  
ATOM 3279  H H    . GLU B 1 2  ? 14.123  16.752  -12.114 1.00 0.00 ? 6  GLU B H    2  
ATOM 3280  H HA   . GLU B 1 2  ? 13.164  18.099  -9.710  1.00 0.00 ? 6  GLU B HA   2  
ATOM 3281  H HB2  . GLU B 1 2  ? 13.855  19.483  -11.809 1.00 0.00 ? 6  GLU B HB2  2  
ATOM 3282  H HB3  . GLU B 1 2  ? 12.391  18.864  -12.545 1.00 0.00 ? 6  GLU B HB3  2  
ATOM 3283  H HG2  . GLU B 1 2  ? 10.981  20.016  -11.062 1.00 0.00 ? 6  GLU B HG2  2  
ATOM 3284  H HG3  . GLU B 1 2  ? 12.180  20.063  -9.785  1.00 0.00 ? 6  GLU B HG3  2  
ATOM 3285  N N    . LEU B 1 3  ? 11.440  16.239  -9.777  1.00 0.00 ? 7  LEU B N    2  
ATOM 3286  C CA   . LEU B 1 3  ? 10.259  15.394  -9.724  1.00 0.00 ? 7  LEU B CA   2  
ATOM 3287  C C    . LEU B 1 3  ? 9.233   16.019  -8.776  1.00 0.00 ? 7  LEU B C    2  
ATOM 3288  O O    . LEU B 1 3  ? 9.545   16.964  -8.052  1.00 0.00 ? 7  LEU B O    2  
ATOM 3289  C CB   . LEU B 1 3  ? 10.642  13.960  -9.356  1.00 0.00 ? 7  LEU B CB   2  
ATOM 3290  C CG   . LEU B 1 3  ? 11.510  13.215  -10.372 1.00 0.00 ? 7  LEU B CG   2  
ATOM 3291  C CD1  . LEU B 1 3  ? 12.996  13.465  -10.111 1.00 0.00 ? 7  LEU B CD1  2  
ATOM 3292  C CD2  . LEU B 1 3  ? 11.174  11.723  -10.391 1.00 0.00 ? 7  LEU B CD2  2  
ATOM 3293  H H    . LEU B 1 3  ? 12.024  16.201  -8.965  1.00 0.00 ? 7  LEU B H    2  
ATOM 3294  H HA   . LEU B 1 3  ? 9.832   15.367  -10.726 1.00 0.00 ? 7  LEU B HA   2  
ATOM 3295  H HB2  . LEU B 1 3  ? 11.170  13.979  -8.402  1.00 0.00 ? 7  LEU B HB2  2  
ATOM 3296  H HB3  . LEU B 1 3  ? 9.726   13.388  -9.202  1.00 0.00 ? 7  LEU B HB3  2  
ATOM 3297  H HG   . LEU B 1 3  ? 11.287  13.608  -11.365 1.00 0.00 ? 7  LEU B HG   2  
ATOM 3298  H HD11 . LEU B 1 3  ? 13.184  14.539  -10.074 1.00 0.00 ? 7  LEU B HD11 2  
ATOM 3299  H HD12 . LEU B 1 3  ? 13.279  13.014  -9.160  1.00 0.00 ? 7  LEU B HD12 2  
ATOM 3300  H HD13 . LEU B 1 3  ? 13.586  13.021  -10.914 1.00 0.00 ? 7  LEU B HD13 2  
ATOM 3301  H HD21 . LEU B 1 3  ? 10.703  11.444  -9.449  1.00 0.00 ? 7  LEU B HD21 2  
ATOM 3302  H HD22 . LEU B 1 3  ? 10.491  11.514  -11.215 1.00 0.00 ? 7  LEU B HD22 2  
ATOM 3303  H HD23 . LEU B 1 3  ? 12.090  11.146  -10.525 1.00 0.00 ? 7  LEU B HD23 2  
ATOM 3304  N N    . ARG B 1 4  ? 8.029   15.467  -8.811  1.00 0.00 ? 8  ARG B N    2  
ATOM 3305  C CA   . ARG B 1 4  ? 6.955   15.958  -7.964  1.00 0.00 ? 8  ARG B CA   2  
ATOM 3306  C C    . ARG B 1 4  ? 6.198   14.788  -7.334  1.00 0.00 ? 8  ARG B C    2  
ATOM 3307  O O    . ARG B 1 4  ? 6.796   13.766  -7.000  1.00 0.00 ? 8  ARG B O    2  
ATOM 3308  C CB   . ARG B 1 4  ? 5.975   16.820  -8.763  1.00 0.00 ? 8  ARG B CB   2  
ATOM 3309  C CG   . ARG B 1 4  ? 6.719   17.751  -9.722  1.00 0.00 ? 8  ARG B CG   2  
ATOM 3310  C CD   . ARG B 1 4  ? 6.054   19.128  -9.776  1.00 0.00 ? 8  ARG B CD   2  
ATOM 3311  N NE   . ARG B 1 4  ? 6.730   19.977  -10.783 1.00 0.00 ? 8  ARG B NE   2  
ATOM 3312  C CZ   . ARG B 1 4  ? 6.171   21.053  -11.354 1.00 0.00 ? 8  ARG B CZ   2  
ATOM 3313  N NH1  . ARG B 1 4  ? 4.925   21.417  -11.023 1.00 0.00 ? 8  ARG B NH1  2  
ATOM 3314  N NH2  . ARG B 1 4  ? 6.860   21.764  -12.258 1.00 0.00 ? 8  ARG B NH2  2  
ATOM 3315  H H    . ARG B 1 4  ? 7.783   14.699  -9.403  1.00 0.00 ? 8  ARG B H    2  
ATOM 3316  H HA   . ARG B 1 4  ? 7.453   16.559  -7.203  1.00 0.00 ? 8  ARG B HA   2  
ATOM 3317  H HB2  . ARG B 1 4  ? 5.296   16.179  -9.325  1.00 0.00 ? 8  ARG B HB2  2  
ATOM 3318  H HB3  . ARG B 1 4  ? 5.364   17.410  -8.079  1.00 0.00 ? 8  ARG B HB3  2  
ATOM 3319  H HG2  . ARG B 1 4  ? 7.756   17.856  -9.402  1.00 0.00 ? 8  ARG B HG2  2  
ATOM 3320  H HG3  . ARG B 1 4  ? 6.737   17.312  -10.720 1.00 0.00 ? 8  ARG B HG3  2  
ATOM 3321  H HD2  . ARG B 1 4  ? 4.999   19.021  -10.028 1.00 0.00 ? 8  ARG B HD2  2  
ATOM 3322  H HD3  . ARG B 1 4  ? 6.101   19.603  -8.796  1.00 0.00 ? 8  ARG B HD3  2  
ATOM 3323  H HE   . ARG B 1 4  ? 7.661   19.733  -11.052 1.00 0.00 ? 8  ARG B HE   2  
ATOM 3324  H HH11 . ARG B 1 4  ? 4.412   20.886  -10.349 1.00 0.00 ? 8  ARG B HH11 2  
ATOM 3325  H HH12 . ARG B 1 4  ? 4.509   22.220  -11.450 1.00 0.00 ? 8  ARG B HH12 2  
ATOM 3326  H HH21 . ARG B 1 4  ? 7.790   21.493  -12.505 1.00 0.00 ? 8  ARG B HH21 2  
ATOM 3327  H HH22 . ARG B 1 4  ? 6.443   22.567  -12.685 1.00 0.00 ? 8  ARG B HH22 2  
ATOM 3328  N N    . CYS B 1 5  ? 4.895   14.976  -7.191  1.00 0.00 ? 9  CYS B N    2  
ATOM 3329  C CA   . CYS B 1 5  ? 4.050   13.948  -6.607  1.00 0.00 ? 9  CYS B CA   2  
ATOM 3330  C C    . CYS B 1 5  ? 3.383   13.171  -7.744  1.00 0.00 ? 9  CYS B C    2  
ATOM 3331  O O    . CYS B 1 5  ? 3.457   13.575  -8.903  1.00 0.00 ? 9  CYS B O    2  
ATOM 3332  C CB   . CYS B 1 5  ? 3.021   14.542  -5.642  1.00 0.00 ? 9  CYS B CB   2  
ATOM 3333  S SG   . CYS B 1 5  ? 3.689   15.019  -4.007  1.00 0.00 ? 9  CYS B SG   2  
ATOM 3334  H H    . CYS B 1 5  ? 4.417   15.810  -7.466  1.00 0.00 ? 9  CYS B H    2  
ATOM 3335  H HA   . CYS B 1 5  ? 4.704   13.299  -6.025  1.00 0.00 ? 9  CYS B HA   2  
ATOM 3336  H HB2  . CYS B 1 5  ? 2.574   15.421  -6.106  1.00 0.00 ? 9  CYS B HB2  2  
ATOM 3337  H HB3  . CYS B 1 5  ? 2.221   13.817  -5.495  1.00 0.00 ? 9  CYS B HB3  2  
ATOM 3338  N N    . GLN B 1 6  ? 2.748   12.069  -7.372  1.00 0.00 ? 10 GLN B N    2  
ATOM 3339  C CA   . GLN B 1 6  ? 2.069   11.231  -8.346  1.00 0.00 ? 10 GLN B CA   2  
ATOM 3340  C C    . GLN B 1 6  ? 0.561   11.483  -8.303  1.00 0.00 ? 10 GLN B C    2  
ATOM 3341  O O    . GLN B 1 6  ? -0.186  10.943  -9.118  1.00 0.00 ? 10 GLN B O    2  
ATOM 3342  C CB   . GLN B 1 6  ? 2.385   9.752   -8.112  1.00 0.00 ? 10 GLN B CB   2  
ATOM 3343  C CG   . GLN B 1 6  ? 1.637   8.868   -9.111  1.00 0.00 ? 10 GLN B CG   2  
ATOM 3344  C CD   . GLN B 1 6  ? 2.211   7.449   -9.124  1.00 0.00 ? 10 GLN B CD   2  
ATOM 3345  O OE1  . GLN B 1 6  ? 2.545   6.897   -10.159 1.00 0.00 ? 10 GLN B OE1  2  
ATOM 3346  N NE2  . GLN B 1 6  ? 2.306   6.893   -7.920  1.00 0.00 ? 10 GLN B NE2  2  
ATOM 3347  H H    . GLN B 1 6  ? 2.693   11.747  -6.426  1.00 0.00 ? 10 GLN B H    2  
ATOM 3348  H HA   . GLN B 1 6  ? 2.468   11.533  -9.315  1.00 0.00 ? 10 GLN B HA   2  
ATOM 3349  H HB2  . GLN B 1 6  ? 3.458   9.587   -8.207  1.00 0.00 ? 10 GLN B HB2  2  
ATOM 3350  H HB3  . GLN B 1 6  ? 2.108   9.474   -7.095  1.00 0.00 ? 10 GLN B HB3  2  
ATOM 3351  H HG2  . GLN B 1 6  ? 0.579   8.833   -8.850  1.00 0.00 ? 10 GLN B HG2  2  
ATOM 3352  H HG3  . GLN B 1 6  ? 1.705   9.301   -10.109 1.00 0.00 ? 10 GLN B HG3  2  
ATOM 3353  H HE21 . GLN B 1 6  ? 2.013   7.401   -7.110  1.00 0.00 ? 10 GLN B HE21 2  
ATOM 3354  H HE22 . GLN B 1 6  ? 2.670   5.966   -7.825  1.00 0.00 ? 10 GLN B HE22 2  
ATOM 3355  N N    . CYS B 1 7  ? 0.157   12.304  -7.344  1.00 0.00 ? 11 CYS B N    2  
ATOM 3356  C CA   . CYS B 1 7  ? -1.249  12.634  -7.184  1.00 0.00 ? 11 CYS B CA   2  
ATOM 3357  C C    . CYS B 1 7  ? -1.351  14.091  -6.729  1.00 0.00 ? 11 CYS B C    2  
ATOM 3358  O O    . CYS B 1 7  ? -0.606  14.525  -5.851  1.00 0.00 ? 11 CYS B O    2  
ATOM 3359  C CB   . CYS B 1 7  ? -1.947  11.681  -6.211  1.00 0.00 ? 11 CYS B CB   2  
ATOM 3360  S SG   . CYS B 1 7  ? -3.453  10.879  -6.871  1.00 0.00 ? 11 CYS B SG   2  
ATOM 3361  H H    . CYS B 1 7  ? 0.771   12.739  -6.685  1.00 0.00 ? 11 CYS B H    2  
ATOM 3362  H HA   . CYS B 1 7  ? -1.715  12.500  -8.161  1.00 0.00 ? 11 CYS B HA   2  
ATOM 3363  H HB2  . CYS B 1 7  ? -1.240  10.906  -5.914  1.00 0.00 ? 11 CYS B HB2  2  
ATOM 3364  H HB3  . CYS B 1 7  ? -2.211  12.234  -5.310  1.00 0.00 ? 11 CYS B HB3  2  
ATOM 3365  N N    . LEU B 1 8  ? -2.280  14.806  -7.346  1.00 0.00 ? 12 LEU B N    2  
ATOM 3366  C CA   . LEU B 1 8  ? -2.490  16.206  -7.014  1.00 0.00 ? 12 LEU B CA   2  
ATOM 3367  C C    . LEU B 1 8  ? -3.696  16.329  -6.081  1.00 0.00 ? 12 LEU B C    2  
ATOM 3368  O O    . LEU B 1 8  ? -3.887  17.362  -5.441  1.00 0.00 ? 12 LEU B O    2  
ATOM 3369  C CB   . LEU B 1 8  ? -2.609  17.046  -8.288  1.00 0.00 ? 12 LEU B CB   2  
ATOM 3370  C CG   . LEU B 1 8  ? -1.614  16.718  -9.403  1.00 0.00 ? 12 LEU B CG   2  
ATOM 3371  C CD1  . LEU B 1 8  ? -2.215  17.016  -10.778 1.00 0.00 ? 12 LEU B CD1  2  
ATOM 3372  C CD2  . LEU B 1 8  ? -0.287  17.448  -9.186  1.00 0.00 ? 12 LEU B CD2  2  
ATOM 3373  H H    . LEU B 1 8  ? -2.882  14.446  -8.058  1.00 0.00 ? 12 LEU B H    2  
ATOM 3374  H HA   . LEU B 1 8  ? -1.604  16.551  -6.482  1.00 0.00 ? 12 LEU B HA   2  
ATOM 3375  H HB2  . LEU B 1 8  ? -3.618  16.930  -8.683  1.00 0.00 ? 12 LEU B HB2  2  
ATOM 3376  H HB3  . LEU B 1 8  ? -2.490  18.095  -8.019  1.00 0.00 ? 12 LEU B HB3  2  
ATOM 3377  H HG   . LEU B 1 8  ? -1.403  15.649  -9.369  1.00 0.00 ? 12 LEU B HG   2  
ATOM 3378  H HD11 . LEU B 1 8  ? -3.205  17.455  -10.655 1.00 0.00 ? 12 LEU B HD11 2  
ATOM 3379  H HD12 . LEU B 1 8  ? -1.571  17.714  -11.312 1.00 0.00 ? 12 LEU B HD12 2  
ATOM 3380  H HD13 . LEU B 1 8  ? -2.297  16.090  -11.347 1.00 0.00 ? 12 LEU B HD13 2  
ATOM 3381  H HD21 . LEU B 1 8  ? -0.122  17.591  -8.119  1.00 0.00 ? 12 LEU B HD21 2  
ATOM 3382  H HD22 . LEU B 1 8  ? 0.526   16.855  -9.604  1.00 0.00 ? 12 LEU B HD22 2  
ATOM 3383  H HD23 . LEU B 1 8  ? -0.322  18.418  -9.682  1.00 0.00 ? 12 LEU B HD23 2  
ATOM 3384  N N    . GLN B 1 9  ? -4.479  15.261  -6.034  1.00 0.00 ? 13 GLN B N    2  
ATOM 3385  C CA   . GLN B 1 9  ? -5.661  15.237  -5.189  1.00 0.00 ? 13 GLN B CA   2  
ATOM 3386  C C    . GLN B 1 9  ? -5.749  13.908  -4.436  1.00 0.00 ? 13 GLN B C    2  
ATOM 3387  O O    . GLN B 1 9  ? -5.010  12.971  -4.735  1.00 0.00 ? 13 GLN B O    2  
ATOM 3388  C CB   . GLN B 1 9  ? -6.927  15.485  -6.012  1.00 0.00 ? 13 GLN B CB   2  
ATOM 3389  C CG   . GLN B 1 9  ? -8.000  16.180  -5.170  1.00 0.00 ? 13 GLN B CG   2  
ATOM 3390  C CD   . GLN B 1 9  ? -8.402  17.519  -5.791  1.00 0.00 ? 13 GLN B CD   2  
ATOM 3391  O OE1  . GLN B 1 9  ? -7.839  17.971  -6.775  1.00 0.00 ? 13 GLN B OE1  2  
ATOM 3392  N NE2  . GLN B 1 9  ? -9.404  18.128  -5.162  1.00 0.00 ? 13 GLN B NE2  2  
ATOM 3393  H H    . GLN B 1 9  ? -4.317  14.425  -6.557  1.00 0.00 ? 13 GLN B H    2  
ATOM 3394  H HA   . GLN B 1 9  ? -5.529  16.056  -4.482  1.00 0.00 ? 13 GLN B HA   2  
ATOM 3395  H HB2  . GLN B 1 9  ? -6.687  16.099  -6.879  1.00 0.00 ? 13 GLN B HB2  2  
ATOM 3396  H HB3  . GLN B 1 9  ? -7.312  14.538  -6.388  1.00 0.00 ? 13 GLN B HB3  2  
ATOM 3397  H HG2  . GLN B 1 9  ? -8.876  15.536  -5.088  1.00 0.00 ? 13 GLN B HG2  2  
ATOM 3398  H HG3  . GLN B 1 9  ? -7.627  16.341  -4.159  1.00 0.00 ? 13 GLN B HG3  2  
ATOM 3399  H HE21 . GLN B 1 9  ? -9.822  17.703  -4.360  1.00 0.00 ? 13 GLN B HE21 2  
ATOM 3400  H HE22 . GLN B 1 9  ? -9.739  19.010  -5.493  1.00 0.00 ? 13 GLN B HE22 2  
ATOM 3401  N N    . THR B 1 10 ? -6.658  13.869  -3.473  1.00 0.00 ? 14 THR B N    2  
ATOM 3402  C CA   . THR B 1 10 ? -6.851  12.671  -2.674  1.00 0.00 ? 14 THR B CA   2  
ATOM 3403  C C    . THR B 1 10 ? -8.288  12.603  -2.154  1.00 0.00 ? 14 THR B C    2  
ATOM 3404  O O    . THR B 1 10 ? -9.015  13.594  -2.196  1.00 0.00 ? 14 THR B O    2  
ATOM 3405  C CB   . THR B 1 10 ? -5.802  12.670  -1.561  1.00 0.00 ? 14 THR B CB   2  
ATOM 3406  O OG1  . THR B 1 10 ? -5.623  14.050  -1.251  1.00 0.00 ? 14 THR B OG1  2  
ATOM 3407  C CG2  . THR B 1 10 ? -4.426  12.217  -2.054  1.00 0.00 ? 14 THR B CG2  2  
ATOM 3408  H H    . THR B 1 10 ? -7.255  14.636  -3.236  1.00 0.00 ? 14 THR B H    2  
ATOM 3409  H HA   . THR B 1 10 ? -6.702  11.803  -3.316  1.00 0.00 ? 14 THR B HA   2  
ATOM 3410  H HB   . THR B 1 10 ? -6.131  12.066  -0.716  1.00 0.00 ? 14 THR B HB   2  
ATOM 3411  H HG1  . THR B 1 10 ? -6.309  14.343  -0.587  1.00 0.00 ? 14 THR B HG1  2  
ATOM 3412  H HG21 . THR B 1 10 ? -4.512  11.237  -2.522  1.00 0.00 ? 14 THR B HG21 2  
ATOM 3413  H HG22 . THR B 1 10 ? -4.046  12.935  -2.781  1.00 0.00 ? 14 THR B HG22 2  
ATOM 3414  H HG23 . THR B 1 10 ? -3.739  12.158  -1.209  1.00 0.00 ? 14 THR B HG23 2  
ATOM 3415  N N    . LEU B 1 11 ? -8.655  11.423  -1.677  1.00 0.00 ? 15 LEU B N    2  
ATOM 3416  C CA   . LEU B 1 11 ? -9.993  11.212  -1.149  1.00 0.00 ? 15 LEU B CA   2  
ATOM 3417  C C    . LEU B 1 11 ? -9.936  11.192  0.380   1.00 0.00 ? 15 LEU B C    2  
ATOM 3418  O O    . LEU B 1 11 ? -8.861  11.064  0.963   1.00 0.00 ? 15 LEU B O    2  
ATOM 3419  C CB   . LEU B 1 11 ? -10.617 9.955   -1.758  1.00 0.00 ? 15 LEU B CB   2  
ATOM 3420  C CG   . LEU B 1 11 ? -10.920 10.015  -3.257  1.00 0.00 ? 15 LEU B CG   2  
ATOM 3421  C CD1  . LEU B 1 11 ? -11.419 8.663   -3.770  1.00 0.00 ? 15 LEU B CD1  2  
ATOM 3422  C CD2  . LEU B 1 11 ? -11.901 11.146  -3.573  1.00 0.00 ? 15 LEU B CD2  2  
ATOM 3423  H H    . LEU B 1 11 ? -8.058  10.621  -1.646  1.00 0.00 ? 15 LEU B H    2  
ATOM 3424  H HA   . LEU B 1 11 ? -10.604 12.059  -1.461  1.00 0.00 ? 15 LEU B HA   2  
ATOM 3425  H HB2  . LEU B 1 11 ? -9.946  9.115   -1.577  1.00 0.00 ? 15 LEU B HB2  2  
ATOM 3426  H HB3  . LEU B 1 11 ? -11.545 9.741   -1.228  1.00 0.00 ? 15 LEU B HB3  2  
ATOM 3427  H HG   . LEU B 1 11 ? -9.992  10.237  -3.784  1.00 0.00 ? 15 LEU B HG   2  
ATOM 3428  H HD11 . LEU B 1 11 ? -10.952 7.862   -3.197  1.00 0.00 ? 15 LEU B HD11 2  
ATOM 3429  H HD12 . LEU B 1 11 ? -12.502 8.608   -3.655  1.00 0.00 ? 15 LEU B HD12 2  
ATOM 3430  H HD13 . LEU B 1 11 ? -11.160 8.556   -4.823  1.00 0.00 ? 15 LEU B HD13 2  
ATOM 3431  H HD21 . LEU B 1 11 ? -12.331 11.524  -2.645  1.00 0.00 ? 15 LEU B HD21 2  
ATOM 3432  H HD22 . LEU B 1 11 ? -11.374 11.951  -4.084  1.00 0.00 ? 15 LEU B HD22 2  
ATOM 3433  H HD23 . LEU B 1 11 ? -12.697 10.767  -4.215  1.00 0.00 ? 15 LEU B HD23 2  
ATOM 3434  N N    . GLN B 1 12 ? -11.108 11.319  0.985   1.00 0.00 ? 16 GLN B N    2  
ATOM 3435  C CA   . GLN B 1 12 ? -11.205 11.317  2.435   1.00 0.00 ? 16 GLN B CA   2  
ATOM 3436  C C    . GLN B 1 12 ? -11.267 9.881   2.961   1.00 0.00 ? 16 GLN B C    2  
ATOM 3437  O O    . GLN B 1 12 ? -11.111 9.648   4.158   1.00 0.00 ? 16 GLN B O    2  
ATOM 3438  C CB   . GLN B 1 12 ? -12.416 12.125  2.904   1.00 0.00 ? 16 GLN B CB   2  
ATOM 3439  C CG   . GLN B 1 12 ? -12.823 11.729  4.325   1.00 0.00 ? 16 GLN B CG   2  
ATOM 3440  C CD   . GLN B 1 12 ? -11.696 12.018  5.319   1.00 0.00 ? 16 GLN B CD   2  
ATOM 3441  O OE1  . GLN B 1 12 ? -10.552 12.235  4.954   1.00 0.00 ? 16 GLN B OE1  2  
ATOM 3442  N NE2  . GLN B 1 12 ? -12.082 12.008  6.592   1.00 0.00 ? 16 GLN B NE2  2  
ATOM 3443  H H    . GLN B 1 12 ? -11.978 11.422  0.503   1.00 0.00 ? 16 GLN B H    2  
ATOM 3444  H HA   . GLN B 1 12 ? -10.294 11.801  2.787   1.00 0.00 ? 16 GLN B HA   2  
ATOM 3445  H HB2  . GLN B 1 12 ? -12.182 13.189  2.873   1.00 0.00 ? 16 GLN B HB2  2  
ATOM 3446  H HB3  . GLN B 1 12 ? -13.252 11.963  2.224   1.00 0.00 ? 16 GLN B HB3  2  
ATOM 3447  H HG2  . GLN B 1 12 ? -13.719 12.276  4.617   1.00 0.00 ? 16 GLN B HG2  2  
ATOM 3448  H HG3  . GLN B 1 12 ? -13.074 10.668  4.353   1.00 0.00 ? 16 GLN B HG3  2  
ATOM 3449  H HE21 . GLN B 1 12 ? -13.036 11.822  6.823   1.00 0.00 ? 16 GLN B HE21 2  
ATOM 3450  H HE22 . GLN B 1 12 ? -11.417 12.186  7.317   1.00 0.00 ? 16 GLN B HE22 2  
ATOM 3451  N N    . GLY B 1 13 ? -11.494 8.957   2.039   1.00 0.00 ? 17 GLY B N    2  
ATOM 3452  C CA   . GLY B 1 13 ? -11.578 7.550   2.395   1.00 0.00 ? 17 GLY B CA   2  
ATOM 3453  C C    . GLY B 1 13 ? -12.693 6.853   1.613   1.00 0.00 ? 17 GLY B C    2  
ATOM 3454  O O    . GLY B 1 13 ? -13.865 6.955   1.971   1.00 0.00 ? 17 GLY B O    2  
ATOM 3455  H H    . GLY B 1 13 ? -11.619 9.155   1.067   1.00 0.00 ? 17 GLY B H    2  
ATOM 3456  H HA2  . GLY B 1 13 ? -10.625 7.062   2.190   1.00 0.00 ? 17 GLY B HA2  2  
ATOM 3457  H HA3  . GLY B 1 13 ? -11.763 7.453   3.464   1.00 0.00 ? 17 GLY B HA3  2  
ATOM 3458  N N    . ILE B 1 14 ? -12.288 6.159   0.559   1.00 0.00 ? 18 ILE B N    2  
ATOM 3459  C CA   . ILE B 1 14 ? -13.239 5.445   -0.276  1.00 0.00 ? 18 ILE B CA   2  
ATOM 3460  C C    . ILE B 1 14 ? -13.633 4.136   0.411   1.00 0.00 ? 18 ILE B C    2  
ATOM 3461  O O    . ILE B 1 14 ? -12.869 3.596   1.210   1.00 0.00 ? 18 ILE B O    2  
ATOM 3462  C CB   . ILE B 1 14 ? -12.675 5.253   -1.686  1.00 0.00 ? 18 ILE B CB   2  
ATOM 3463  C CG1  . ILE B 1 14 ? -12.915 6.495   -2.546  1.00 0.00 ? 18 ILE B CG1  2  
ATOM 3464  C CG2  . ILE B 1 14 ? -13.240 3.988   -2.335  1.00 0.00 ? 18 ILE B CG2  2  
ATOM 3465  C CD1  . ILE B 1 14 ? -14.403 6.670   -2.853  1.00 0.00 ? 18 ILE B CD1  2  
ATOM 3466  H H    . ILE B 1 14 ? -11.333 6.081   0.274   1.00 0.00 ? 18 ILE B H    2  
ATOM 3467  H HA   . ILE B 1 14 ? -14.128 6.069   -0.367  1.00 0.00 ? 18 ILE B HA   2  
ATOM 3468  H HB   . ILE B 1 14 ? -11.596 5.120   -1.607  1.00 0.00 ? 18 ILE B HB   2  
ATOM 3469  H HG12 . ILE B 1 14 ? -12.540 7.378   -2.029  1.00 0.00 ? 18 ILE B HG12 2  
ATOM 3470  H HG13 . ILE B 1 14 ? -12.355 6.411   -3.478  1.00 0.00 ? 18 ILE B HG13 2  
ATOM 3471  H HG21 . ILE B 1 14 ? -14.312 3.932   -2.148  1.00 0.00 ? 18 ILE B HG21 2  
ATOM 3472  H HG22 . ILE B 1 14 ? -13.059 4.020   -3.410  1.00 0.00 ? 18 ILE B HG22 2  
ATOM 3473  H HG23 . ILE B 1 14 ? -12.750 3.112   -1.910  1.00 0.00 ? 18 ILE B HG23 2  
ATOM 3474  H HD11 . ILE B 1 14 ? -14.873 5.691   -2.945  1.00 0.00 ? 18 ILE B HD11 2  
ATOM 3475  H HD12 . ILE B 1 14 ? -14.878 7.227   -2.045  1.00 0.00 ? 18 ILE B HD12 2  
ATOM 3476  H HD13 . ILE B 1 14 ? -14.520 7.218   -3.788  1.00 0.00 ? 18 ILE B HD13 2  
ATOM 3477  N N    . HIS B 1 15 ? -14.825 3.665   0.077   1.00 0.00 ? 19 HIS B N    2  
ATOM 3478  C CA   . HIS B 1 15 ? -15.330 2.430   0.652   1.00 0.00 ? 19 HIS B CA   2  
ATOM 3479  C C    . HIS B 1 15 ? -14.261 1.341   0.549   1.00 0.00 ? 19 HIS B C    2  
ATOM 3480  O O    . HIS B 1 15 ? -13.586 1.223   -0.472  1.00 0.00 ? 19 HIS B O    2  
ATOM 3481  C CB   . HIS B 1 15 ? -16.653 2.026   -0.003  1.00 0.00 ? 19 HIS B CB   2  
ATOM 3482  C CG   . HIS B 1 15 ? -17.677 1.485   0.964   1.00 0.00 ? 19 HIS B CG   2  
ATOM 3483  N ND1  . HIS B 1 15 ? -18.951 2.013   1.082   1.00 0.00 ? 19 HIS B ND1  2  
ATOM 3484  C CD2  . HIS B 1 15 ? -17.604 0.456   1.857   1.00 0.00 ? 19 HIS B CD2  2  
ATOM 3485  C CE1  . HIS B 1 15 ? -19.605 1.327   2.007   1.00 0.00 ? 19 HIS B CE1  2  
ATOM 3486  N NE2  . HIS B 1 15 ? -18.769 0.363   2.487   1.00 0.00 ? 19 HIS B NE2  2  
ATOM 3487  H H    . HIS B 1 15 ? -15.441 4.111   -0.574  1.00 0.00 ? 19 HIS B H    2  
ATOM 3488  H HA   . HIS B 1 15 ? -15.530 2.634   1.704   1.00 0.00 ? 19 HIS B HA   2  
ATOM 3489  H HB2  . HIS B 1 15 ? -17.073 2.893   -0.514  1.00 0.00 ? 19 HIS B HB2  2  
ATOM 3490  H HB3  . HIS B 1 15 ? -16.454 1.273   -0.765  1.00 0.00 ? 19 HIS B HB3  2  
ATOM 3491  H HD1  . HIS B 1 15 ? -19.315 2.783   0.557   1.00 0.00 ? 19 HIS B HD1  2  
ATOM 3492  H HD2  . HIS B 1 15 ? -16.735 -0.181  2.025   1.00 0.00 ? 19 HIS B HD2  2  
ATOM 3493  H HE1  . HIS B 1 15 ? -20.632 1.502   2.328   1.00 0.00 ? 19 HIS B HE1  2  
ATOM 3494  N N    . LEU B 1 16 ? -14.140 0.572   1.621   1.00 0.00 ? 20 LEU B N    2  
ATOM 3495  C CA   . LEU B 1 16 ? -13.164 -0.503  1.665   1.00 0.00 ? 20 LEU B CA   2  
ATOM 3496  C C    . LEU B 1 16 ? -13.745 -1.741  0.978   1.00 0.00 ? 20 LEU B C    2  
ATOM 3497  O O    . LEU B 1 16 ? -13.131 -2.807  0.989   1.00 0.00 ? 20 LEU B O    2  
ATOM 3498  C CB   . LEU B 1 16 ? -12.708 -0.755  3.103   1.00 0.00 ? 20 LEU B CB   2  
ATOM 3499  C CG   . LEU B 1 16 ? -11.732 -1.916  3.304   1.00 0.00 ? 20 LEU B CG   2  
ATOM 3500  C CD1  . LEU B 1 16 ? -10.485 -1.741  2.434   1.00 0.00 ? 20 LEU B CD1  2  
ATOM 3501  C CD2  . LEU B 1 16 ? -11.379 -2.087  4.783   1.00 0.00 ? 20 LEU B CD2  2  
ATOM 3502  H H    . LEU B 1 16 ? -14.693 0.674   2.448   1.00 0.00 ? 20 LEU B H    2  
ATOM 3503  H HA   . LEU B 1 16 ? -12.290 -0.175  1.102   1.00 0.00 ? 20 LEU B HA   2  
ATOM 3504  H HB2  . LEU B 1 16 ? -12.241 0.155   3.480   1.00 0.00 ? 20 LEU B HB2  2  
ATOM 3505  H HB3  . LEU B 1 16 ? -13.590 -0.939  3.716   1.00 0.00 ? 20 LEU B HB3  2  
ATOM 3506  H HG   . LEU B 1 16 ? -12.222 -2.835  2.982   1.00 0.00 ? 20 LEU B HG   2  
ATOM 3507  H HD11 . LEU B 1 16 ? -10.563 -0.810  1.871   1.00 0.00 ? 20 LEU B HD11 2  
ATOM 3508  H HD12 . LEU B 1 16 ? -9.600  -1.709  3.069   1.00 0.00 ? 20 LEU B HD12 2  
ATOM 3509  H HD13 . LEU B 1 16 ? -10.405 -2.579  1.741   1.00 0.00 ? 20 LEU B HD13 2  
ATOM 3510  H HD21 . LEU B 1 16 ? -12.294 -2.109  5.374   1.00 0.00 ? 20 LEU B HD21 2  
ATOM 3511  H HD22 . LEU B 1 16 ? -10.834 -3.021  4.921   1.00 0.00 ? 20 LEU B HD22 2  
ATOM 3512  H HD23 . LEU B 1 16 ? -10.757 -1.252  5.107   1.00 0.00 ? 20 LEU B HD23 2  
ATOM 3513  N N    . LYS B 1 17 ? -14.921 -1.559  0.397   1.00 0.00 ? 21 LYS B N    2  
ATOM 3514  C CA   . LYS B 1 17 ? -15.592 -2.648  -0.293  1.00 0.00 ? 21 LYS B CA   2  
ATOM 3515  C C    . LYS B 1 17 ? -15.185 -2.638  -1.768  1.00 0.00 ? 21 LYS B C    2  
ATOM 3516  O O    . LYS B 1 17 ? -15.267 -3.662  -2.445  1.00 0.00 ? 21 LYS B O    2  
ATOM 3517  C CB   . LYS B 1 17 ? -17.104 -2.572  -0.072  1.00 0.00 ? 21 LYS B CB   2  
ATOM 3518  C CG   . LYS B 1 17 ? -17.466 -2.931  1.370   1.00 0.00 ? 21 LYS B CG   2  
ATOM 3519  C CD   . LYS B 1 17 ? -18.490 -4.067  1.412   1.00 0.00 ? 21 LYS B CD   2  
ATOM 3520  C CE   . LYS B 1 17 ? -19.875 -3.542  1.798   1.00 0.00 ? 21 LYS B CE   2  
ATOM 3521  N NZ   . LYS B 1 17 ? -20.135 -3.775  3.236   1.00 0.00 ? 21 LYS B NZ   2  
ATOM 3522  H H    . LYS B 1 17 ? -15.414 -0.689  0.392   1.00 0.00 ? 21 LYS B H    2  
ATOM 3523  H HA   . LYS B 1 17 ? -15.247 -3.580  0.154   1.00 0.00 ? 21 LYS B HA   2  
ATOM 3524  H HB2  . LYS B 1 17 ? -17.459 -1.567  -0.300  1.00 0.00 ? 21 LYS B HB2  2  
ATOM 3525  H HB3  . LYS B 1 17 ? -17.610 -3.251  -0.758  1.00 0.00 ? 21 LYS B HB3  2  
ATOM 3526  H HG2  . LYS B 1 17 ? -16.567 -3.227  1.911   1.00 0.00 ? 21 LYS B HG2  2  
ATOM 3527  H HG3  . LYS B 1 17 ? -17.869 -2.054  1.877   1.00 0.00 ? 21 LYS B HG3  2  
ATOM 3528  H HD2  . LYS B 1 17 ? -18.540 -4.553  0.438   1.00 0.00 ? 21 LYS B HD2  2  
ATOM 3529  H HD3  . LYS B 1 17 ? -18.171 -4.823  2.130   1.00 0.00 ? 21 LYS B HD3  2  
ATOM 3530  H HE2  . LYS B 1 17 ? -19.941 -2.477  1.577   1.00 0.00 ? 21 LYS B HE2  2  
ATOM 3531  H HE3  . LYS B 1 17 ? -20.638 -4.039  1.199   1.00 0.00 ? 21 LYS B HE3  2  
ATOM 3532  H HZ1  . LYS B 1 17 ? -19.267 -3.802  3.732   1.00 0.00 ? 21 LYS B HZ1  2  
ATOM 3533  H HZ2  . LYS B 1 17 ? -20.702 -3.033  3.596   1.00 0.00 ? 21 LYS B HZ2  2  
ATOM 3534  H HZ3  . LYS B 1 17 ? -20.612 -4.646  3.352   1.00 0.00 ? 21 LYS B HZ3  2  
ATOM 3535  N N    . ASN B 1 18 ? -14.755 -1.470  -2.223  1.00 0.00 ? 22 ASN B N    2  
ATOM 3536  C CA   . ASN B 1 18 ? -14.335 -1.314  -3.605  1.00 0.00 ? 22 ASN B CA   2  
ATOM 3537  C C    . ASN B 1 18 ? -12.821 -1.512  -3.699  1.00 0.00 ? 22 ASN B C    2  
ATOM 3538  O O    . ASN B 1 18 ? -12.341 -2.269  -4.542  1.00 0.00 ? 22 ASN B O    2  
ATOM 3539  C CB   . ASN B 1 18 ? -14.662 0.087   -4.125  1.00 0.00 ? 22 ASN B CB   2  
ATOM 3540  C CG   . ASN B 1 18 ? -15.860 0.053   -5.077  1.00 0.00 ? 22 ASN B CG   2  
ATOM 3541  O OD1  . ASN B 1 18 ? -16.003 -0.832  -5.905  1.00 0.00 ? 22 ASN B OD1  2  
ATOM 3542  N ND2  . ASN B 1 18 ? -16.709 1.063   -4.915  1.00 0.00 ? 22 ASN B ND2  2  
ATOM 3543  H H    . ASN B 1 18 ? -14.692 -0.642  -1.666  1.00 0.00 ? 22 ASN B H    2  
ATOM 3544  H HA   . ASN B 1 18 ? -14.890 -2.071  -4.160  1.00 0.00 ? 22 ASN B HA   2  
ATOM 3545  H HB2  . ASN B 1 18 ? -14.879 0.749   -3.287  1.00 0.00 ? 22 ASN B HB2  2  
ATOM 3546  H HB3  . ASN B 1 18 ? -13.795 0.499   -4.641  1.00 0.00 ? 22 ASN B HB3  2  
ATOM 3547  H HD21 . ASN B 1 18 ? -16.533 1.757   -4.216  1.00 0.00 ? 22 ASN B HD21 2  
ATOM 3548  H HD22 . ASN B 1 18 ? -17.524 1.129   -5.490  1.00 0.00 ? 22 ASN B HD22 2  
ATOM 3549  N N    . ILE B 1 19 ? -12.110 -0.818  -2.823  1.00 0.00 ? 23 ILE B N    2  
ATOM 3550  C CA   . ILE B 1 19 ? -10.660 -0.907  -2.796  1.00 0.00 ? 23 ILE B CA   2  
ATOM 3551  C C    . ILE B 1 19 ? -10.244 -2.379  -2.848  1.00 0.00 ? 23 ILE B C    2  
ATOM 3552  O O    . ILE B 1 19 ? -10.730 -3.193  -2.065  1.00 0.00 ? 23 ILE B O    2  
ATOM 3553  C CB   . ILE B 1 19 ? -10.099 -0.151  -1.591  1.00 0.00 ? 23 ILE B CB   2  
ATOM 3554  C CG1  . ILE B 1 19 ? -9.895  1.329   -1.918  1.00 0.00 ? 23 ILE B CG1  2  
ATOM 3555  C CG2  . ILE B 1 19 ? -8.814  -0.808  -1.082  1.00 0.00 ? 23 ILE B CG2  2  
ATOM 3556  C CD1  . ILE B 1 19 ? -10.529 2.220   -0.847  1.00 0.00 ? 23 ILE B CD1  2  
ATOM 3557  H H    . ILE B 1 19 ? -12.508 -0.204  -2.141  1.00 0.00 ? 23 ILE B H    2  
ATOM 3558  H HA   . ILE B 1 19 ? -10.286 -0.410  -3.691  1.00 0.00 ? 23 ILE B HA   2  
ATOM 3559  H HB   . ILE B 1 19 ? -10.829 -0.205  -0.783  1.00 0.00 ? 23 ILE B HB   2  
ATOM 3560  H HG12 . ILE B 1 19 ? -8.829  1.546   -1.992  1.00 0.00 ? 23 ILE B HG12 2  
ATOM 3561  H HG13 . ILE B 1 19 ? -10.334 1.554   -2.890  1.00 0.00 ? 23 ILE B HG13 2  
ATOM 3562  H HG21 . ILE B 1 19 ? -9.010  -1.853  -0.842  1.00 0.00 ? 23 ILE B HG21 2  
ATOM 3563  H HG22 . ILE B 1 19 ? -8.046  -0.750  -1.853  1.00 0.00 ? 23 ILE B HG22 2  
ATOM 3564  H HG23 . ILE B 1 19 ? -8.470  -0.288  -0.187  1.00 0.00 ? 23 ILE B HG23 2  
ATOM 3565  H HD11 . ILE B 1 19 ? -11.455 1.764   -0.497  1.00 0.00 ? 23 ILE B HD11 2  
ATOM 3566  H HD12 . ILE B 1 19 ? -9.839  2.329   -0.011  1.00 0.00 ? 23 ILE B HD12 2  
ATOM 3567  H HD13 . ILE B 1 19 ? -10.744 3.201   -1.272  1.00 0.00 ? 23 ILE B HD13 2  
ATOM 3568  N N    . GLN B 1 20 ? -9.348  -2.674  -3.779  1.00 0.00 ? 24 GLN B N    2  
ATOM 3569  C CA   . GLN B 1 20 ? -8.860  -4.033  -3.943  1.00 0.00 ? 24 GLN B CA   2  
ATOM 3570  C C    . GLN B 1 20 ? -7.382  -4.117  -3.559  1.00 0.00 ? 24 GLN B C    2  
ATOM 3571  O O    . GLN B 1 20 ? -6.893  -5.181  -3.183  1.00 0.00 ? 24 GLN B O    2  
ATOM 3572  C CB   . GLN B 1 20 ? -9.084  -4.527  -5.374  1.00 0.00 ? 24 GLN B CB   2  
ATOM 3573  C CG   . GLN B 1 20 ? -9.590  -5.970  -5.383  1.00 0.00 ? 24 GLN B CG   2  
ATOM 3574  C CD   . GLN B 1 20 ? -8.847  -6.805  -6.428  1.00 0.00 ? 24 GLN B CD   2  
ATOM 3575  O OE1  . GLN B 1 20 ? -9.436  -7.440  -7.287  1.00 0.00 ? 24 GLN B OE1  2  
ATOM 3576  N NE2  . GLN B 1 20 ? -7.523  -6.770  -6.306  1.00 0.00 ? 24 GLN B NE2  2  
ATOM 3577  H H    . GLN B 1 20 ? -8.958  -2.006  -4.412  1.00 0.00 ? 24 GLN B H    2  
ATOM 3578  H HA   . GLN B 1 20 ? -9.455  -4.639  -3.259  1.00 0.00 ? 24 GLN B HA   2  
ATOM 3579  H HB2  . GLN B 1 20 ? -9.804  -3.881  -5.877  1.00 0.00 ? 24 GLN B HB2  2  
ATOM 3580  H HB3  . GLN B 1 20 ? -8.151  -4.461  -5.935  1.00 0.00 ? 24 GLN B HB3  2  
ATOM 3581  H HG2  . GLN B 1 20 ? -9.457  -6.413  -4.396  1.00 0.00 ? 24 GLN B HG2  2  
ATOM 3582  H HG3  . GLN B 1 20 ? -10.659 -5.983  -5.596  1.00 0.00 ? 24 GLN B HG3  2  
ATOM 3583  H HE21 . GLN B 1 20 ? -7.102  -6.228  -5.579  1.00 0.00 ? 24 GLN B HE21 2  
ATOM 3584  H HE22 . GLN B 1 20 ? -6.948  -7.284  -6.943  1.00 0.00 ? 24 GLN B HE22 2  
ATOM 3585  N N    . SER B 1 21 ? -6.710  -2.979  -3.666  1.00 0.00 ? 25 SER B N    2  
ATOM 3586  C CA   . SER B 1 21 ? -5.297  -2.911  -3.334  1.00 0.00 ? 25 SER B CA   2  
ATOM 3587  C C    . SER B 1 21 ? -4.962  -1.535  -2.756  1.00 0.00 ? 25 SER B C    2  
ATOM 3588  O O    . SER B 1 21 ? -5.702  -0.574  -2.961  1.00 0.00 ? 25 SER B O    2  
ATOM 3589  C CB   . SER B 1 21 ? -4.429  -3.197  -4.561  1.00 0.00 ? 25 SER B CB   2  
ATOM 3590  O OG   . SER B 1 21 ? -5.180  -3.777  -5.623  1.00 0.00 ? 25 SER B OG   2  
ATOM 3591  H H    . SER B 1 21 ? -7.115  -2.118  -3.972  1.00 0.00 ? 25 SER B H    2  
ATOM 3592  H HA   . SER B 1 21 ? -5.138  -3.689  -2.588  1.00 0.00 ? 25 SER B HA   2  
ATOM 3593  H HB2  . SER B 1 21 ? -3.971  -2.269  -4.905  1.00 0.00 ? 25 SER B HB2  2  
ATOM 3594  H HB3  . SER B 1 21 ? -3.617  -3.868  -4.282  1.00 0.00 ? 25 SER B HB3  2  
ATOM 3595  H HG   . SER B 1 21 ? -5.343  -4.746  -5.438  1.00 0.00 ? 25 SER B HG   2  
ATOM 3596  N N    . VAL B 1 22 ? -3.846  -1.483  -2.044  1.00 0.00 ? 26 VAL B N    2  
ATOM 3597  C CA   . VAL B 1 22 ? -3.403  -0.241  -1.434  1.00 0.00 ? 26 VAL B CA   2  
ATOM 3598  C C    . VAL B 1 22 ? -1.954  0.034   -1.841  1.00 0.00 ? 26 VAL B C    2  
ATOM 3599  O O    . VAL B 1 22 ? -1.109  -0.858  -1.783  1.00 0.00 ? 26 VAL B O    2  
ATOM 3600  C CB   . VAL B 1 22 ? -3.597  -0.304  0.082   1.00 0.00 ? 26 VAL B CB   2  
ATOM 3601  C CG1  . VAL B 1 22 ? -2.804  0.801   0.783   1.00 0.00 ? 26 VAL B CG1  2  
ATOM 3602  C CG2  . VAL B 1 22 ? -5.080  -0.231  0.449   1.00 0.00 ? 26 VAL B CG2  2  
ATOM 3603  H H    . VAL B 1 22 ? -3.249  -2.269  -1.881  1.00 0.00 ? 26 VAL B H    2  
ATOM 3604  H HA   . VAL B 1 22 ? -4.034  0.559   -1.822  1.00 0.00 ? 26 VAL B HA   2  
ATOM 3605  H HB   . VAL B 1 22 ? -3.213  -1.263  0.430   1.00 0.00 ? 26 VAL B HB   2  
ATOM 3606  H HG11 . VAL B 1 22 ? -1.765  0.766   0.455   1.00 0.00 ? 26 VAL B HG11 2  
ATOM 3607  H HG12 . VAL B 1 22 ? -3.232  1.771   0.530   1.00 0.00 ? 26 VAL B HG12 2  
ATOM 3608  H HG13 . VAL B 1 22 ? -2.850  0.653   1.862   1.00 0.00 ? 26 VAL B HG13 2  
ATOM 3609  H HG21 . VAL B 1 22 ? -5.682  -0.537  -0.406  1.00 0.00 ? 26 VAL B HG21 2  
ATOM 3610  H HG22 . VAL B 1 22 ? -5.280  -0.896  1.290   1.00 0.00 ? 26 VAL B HG22 2  
ATOM 3611  H HG23 . VAL B 1 22 ? -5.336  0.792   0.726   1.00 0.00 ? 26 VAL B HG23 2  
ATOM 3612  N N    . LYS B 1 23 ? -1.711  1.273   -2.243  1.00 0.00 ? 27 LYS B N    2  
ATOM 3613  C CA   . LYS B 1 23 ? -0.379  1.677   -2.660  1.00 0.00 ? 27 LYS B CA   2  
ATOM 3614  C C    . LYS B 1 23 ? 0.041   2.921   -1.874  1.00 0.00 ? 27 LYS B C    2  
ATOM 3615  O O    . LYS B 1 23 ? -0.624  3.953   -1.938  1.00 0.00 ? 27 LYS B O    2  
ATOM 3616  C CB   . LYS B 1 23 ? -0.325  1.861   -4.178  1.00 0.00 ? 27 LYS B CB   2  
ATOM 3617  C CG   . LYS B 1 23 ? 1.061   2.333   -4.623  1.00 0.00 ? 27 LYS B CG   2  
ATOM 3618  C CD   . LYS B 1 23 ? 2.164   1.580   -3.877  1.00 0.00 ? 27 LYS B CD   2  
ATOM 3619  C CE   . LYS B 1 23 ? 3.436   1.492   -4.722  1.00 0.00 ? 27 LYS B CE   2  
ATOM 3620  N NZ   . LYS B 1 23 ? 3.841   2.836   -5.191  1.00 0.00 ? 27 LYS B NZ   2  
ATOM 3621  H H    . LYS B 1 23 ? -2.404  1.993   -2.287  1.00 0.00 ? 27 LYS B H    2  
ATOM 3622  H HA   . LYS B 1 23 ? 0.302   0.863   -2.409  1.00 0.00 ? 27 LYS B HA   2  
ATOM 3623  H HB2  . LYS B 1 23 ? -0.568  0.920   -4.671  1.00 0.00 ? 27 LYS B HB2  2  
ATOM 3624  H HB3  . LYS B 1 23 ? -1.077  2.586   -4.487  1.00 0.00 ? 27 LYS B HB3  2  
ATOM 3625  H HG2  . LYS B 1 23 ? 1.173   2.180   -5.697  1.00 0.00 ? 27 LYS B HG2  2  
ATOM 3626  H HG3  . LYS B 1 23 ? 1.160   3.403   -4.442  1.00 0.00 ? 27 LYS B HG3  2  
ATOM 3627  H HD2  . LYS B 1 23 ? 2.382   2.085   -2.936  1.00 0.00 ? 27 LYS B HD2  2  
ATOM 3628  H HD3  . LYS B 1 23 ? 1.819   0.577   -3.627  1.00 0.00 ? 27 LYS B HD3  2  
ATOM 3629  H HE2  . LYS B 1 23 ? 4.240   1.048   -4.135  1.00 0.00 ? 27 LYS B HE2  2  
ATOM 3630  H HE3  . LYS B 1 23 ? 3.267   0.838   -5.578  1.00 0.00 ? 27 LYS B HE3  2  
ATOM 3631  H HZ1  . LYS B 1 23 ? 3.048   3.307   -5.579  1.00 0.00 ? 27 LYS B HZ1  2  
ATOM 3632  H HZ2  . LYS B 1 23 ? 4.198   3.364   -4.420  1.00 0.00 ? 27 LYS B HZ2  2  
ATOM 3633  H HZ3  . LYS B 1 23 ? 4.550   2.746   -5.890  1.00 0.00 ? 27 LYS B HZ3  2  
ATOM 3634  N N    . VAL B 1 24 ? 1.143   2.781   -1.151  1.00 0.00 ? 28 VAL B N    2  
ATOM 3635  C CA   . VAL B 1 24 ? 1.659   3.880   -0.354  1.00 0.00 ? 28 VAL B CA   2  
ATOM 3636  C C    . VAL B 1 24 ? 3.005   4.331   -0.926  1.00 0.00 ? 28 VAL B C    2  
ATOM 3637  O O    . VAL B 1 24 ? 3.959   3.556   -0.961  1.00 0.00 ? 28 VAL B O    2  
ATOM 3638  C CB   . VAL B 1 24 ? 1.744   3.466   1.117   1.00 0.00 ? 28 VAL B CB   2  
ATOM 3639  C CG1  . VAL B 1 24 ? 2.649   4.416   1.903   1.00 0.00 ? 28 VAL B CG1  2  
ATOM 3640  C CG2  . VAL B 1 24 ? 0.351   3.390   1.745   1.00 0.00 ? 28 VAL B CG2  2  
ATOM 3641  H H    . VAL B 1 24 ? 1.678   1.937   -1.105  1.00 0.00 ? 28 VAL B H    2  
ATOM 3642  H HA   . VAL B 1 24 ? 0.951   4.705   -0.432  1.00 0.00 ? 28 VAL B HA   2  
ATOM 3643  H HB   . VAL B 1 24 ? 2.186   2.470   1.159   1.00 0.00 ? 28 VAL B HB   2  
ATOM 3644  H HG11 . VAL B 1 24 ? 2.368   5.447   1.688   1.00 0.00 ? 28 VAL B HG11 2  
ATOM 3645  H HG12 . VAL B 1 24 ? 2.538   4.224   2.970   1.00 0.00 ? 28 VAL B HG12 2  
ATOM 3646  H HG13 . VAL B 1 24 ? 3.687   4.255   1.610   1.00 0.00 ? 28 VAL B HG13 2  
ATOM 3647  H HG21 . VAL B 1 24 ? -0.320  4.073   1.226   1.00 0.00 ? 28 VAL B HG21 2  
ATOM 3648  H HG22 . VAL B 1 24 ? -0.030  2.372   1.662   1.00 0.00 ? 28 VAL B HG22 2  
ATOM 3649  H HG23 . VAL B 1 24 ? 0.412   3.670   2.797   1.00 0.00 ? 28 VAL B HG23 2  
ATOM 3650  N N    . LYS B 1 25 ? 3.037   5.583   -1.360  1.00 0.00 ? 29 LYS B N    2  
ATOM 3651  C CA   . LYS B 1 25 ? 4.250   6.146   -1.929  1.00 0.00 ? 29 LYS B CA   2  
ATOM 3652  C C    . LYS B 1 25 ? 4.675   7.364   -1.107  1.00 0.00 ? 29 LYS B C    2  
ATOM 3653  O O    . LYS B 1 25 ? 4.252   8.485   -1.387  1.00 0.00 ? 29 LYS B O    2  
ATOM 3654  C CB   . LYS B 1 25 ? 4.055   6.446   -3.417  1.00 0.00 ? 29 LYS B CB   2  
ATOM 3655  C CG   . LYS B 1 25 ? 5.399   6.667   -4.113  1.00 0.00 ? 29 LYS B CG   2  
ATOM 3656  C CD   . LYS B 1 25 ? 5.858   8.120   -3.970  1.00 0.00 ? 29 LYS B CD   2  
ATOM 3657  C CE   . LYS B 1 25 ? 6.160   8.736   -5.337  1.00 0.00 ? 29 LYS B CE   2  
ATOM 3658  N NZ   . LYS B 1 25 ? 5.866   10.187  -5.328  1.00 0.00 ? 29 LYS B NZ   2  
ATOM 3659  H H    . LYS B 1 25 ? 2.256   6.206   -1.328  1.00 0.00 ? 29 LYS B H    2  
ATOM 3660  H HA   . LYS B 1 25 ? 5.029   5.388   -1.853  1.00 0.00 ? 29 LYS B HA   2  
ATOM 3661  H HB2  . LYS B 1 25 ? 3.527   5.619   -3.893  1.00 0.00 ? 29 LYS B HB2  2  
ATOM 3662  H HB3  . LYS B 1 25 ? 3.430   7.331   -3.534  1.00 0.00 ? 29 LYS B HB3  2  
ATOM 3663  H HG2  . LYS B 1 25 ? 6.148   6.002   -3.684  1.00 0.00 ? 29 LYS B HG2  2  
ATOM 3664  H HG3  . LYS B 1 25 ? 5.313   6.411   -5.169  1.00 0.00 ? 29 LYS B HG3  2  
ATOM 3665  H HD2  . LYS B 1 25 ? 5.085   8.701   -3.467  1.00 0.00 ? 29 LYS B HD2  2  
ATOM 3666  H HD3  . LYS B 1 25 ? 6.748   8.164   -3.342  1.00 0.00 ? 29 LYS B HD3  2  
ATOM 3667  H HE2  . LYS B 1 25 ? 7.207   8.573   -5.593  1.00 0.00 ? 29 LYS B HE2  2  
ATOM 3668  H HE3  . LYS B 1 25 ? 5.563   8.244   -6.105  1.00 0.00 ? 29 LYS B HE3  2  
ATOM 3669  H HZ1  . LYS B 1 25 ? 6.425   10.636  -4.630  1.00 0.00 ? 29 LYS B HZ1  2  
ATOM 3670  H HZ2  . LYS B 1 25 ? 6.078   10.576  -6.224  1.00 0.00 ? 29 LYS B HZ2  2  
ATOM 3671  H HZ3  . LYS B 1 25 ? 4.898   10.330  -5.122  1.00 0.00 ? 29 LYS B HZ3  2  
ATOM 3672  N N    . SER B 1 26 ? 5.507   7.104   -0.110  1.00 0.00 ? 30 SER B N    2  
ATOM 3673  C CA   . SER B 1 26 ? 5.995   8.165   0.755   1.00 0.00 ? 30 SER B CA   2  
ATOM 3674  C C    . SER B 1 26 ? 6.671   9.253   -0.082  1.00 0.00 ? 30 SER B C    2  
ATOM 3675  O O    . SER B 1 26 ? 6.883   9.077   -1.281  1.00 0.00 ? 30 SER B O    2  
ATOM 3676  C CB   . SER B 1 26 ? 6.968   7.619   1.801   1.00 0.00 ? 30 SER B CB   2  
ATOM 3677  O OG   . SER B 1 26 ? 6.407   7.633   3.111   1.00 0.00 ? 30 SER B OG   2  
ATOM 3678  H H    . SER B 1 26 ? 5.847   6.189   0.111   1.00 0.00 ? 30 SER B H    2  
ATOM 3679  H HA   . SER B 1 26 ? 5.110   8.560   1.254   1.00 0.00 ? 30 SER B HA   2  
ATOM 3680  H HB2  . SER B 1 26 ? 7.250   6.600   1.538   1.00 0.00 ? 30 SER B HB2  2  
ATOM 3681  H HB3  . SER B 1 26 ? 7.881   8.214   1.793   1.00 0.00 ? 30 SER B HB3  2  
ATOM 3682  H HG   . SER B 1 26 ? 6.919   8.261   3.697   1.00 0.00 ? 30 SER B HG   2  
ATOM 3683  N N    . PRO B 1 27 ? 6.998   10.383  0.600   1.00 0.00 ? 31 PRO B N    2  
ATOM 3684  C CA   . PRO B 1 27 ? 7.646   11.499  -0.068  1.00 0.00 ? 31 PRO B CA   2  
ATOM 3685  C C    . PRO B 1 27 ? 9.120   11.195  -0.340  1.00 0.00 ? 31 PRO B C    2  
ATOM 3686  O O    . PRO B 1 27 ? 9.651   10.196  0.142   1.00 0.00 ? 31 PRO B O    2  
ATOM 3687  C CB   . PRO B 1 27 ? 7.446   12.684  0.863   1.00 0.00 ? 31 PRO B CB   2  
ATOM 3688  C CG   . PRO B 1 27 ? 7.106   12.093  2.222   1.00 0.00 ? 31 PRO B CG   2  
ATOM 3689  C CD   . PRO B 1 27 ? 6.762   10.627  2.020   1.00 0.00 ? 31 PRO B CD   2  
ATOM 3690  H HA   . PRO B 1 27 ? 7.229   11.657  -0.963  1.00 0.00 ? 31 PRO B HA   2  
ATOM 3691  H HB2  . PRO B 1 27 ? 8.348   13.294  0.918   1.00 0.00 ? 31 PRO B HB2  2  
ATOM 3692  H HB3  . PRO B 1 27 ? 6.645   13.331  0.506   1.00 0.00 ? 31 PRO B HB3  2  
ATOM 3693  H HG2  . PRO B 1 27 ? 7.948   12.198  2.906   1.00 0.00 ? 31 PRO B HG2  2  
ATOM 3694  H HG3  . PRO B 1 27 ? 6.265   12.624  2.669   1.00 0.00 ? 31 PRO B HG3  2  
ATOM 3695  H HD2  . PRO B 1 27 ? 7.387   9.984   2.641   1.00 0.00 ? 31 PRO B HD2  2  
ATOM 3696  H HD3  . PRO B 1 27 ? 5.726   10.421  2.290   1.00 0.00 ? 31 PRO B HD3  2  
ATOM 3697  N N    . GLY B 1 28 ? 9.740   12.075  -1.113  1.00 0.00 ? 32 GLY B N    2  
ATOM 3698  C CA   . GLY B 1 28 ? 11.143  11.913  -1.456  1.00 0.00 ? 32 GLY B CA   2  
ATOM 3699  C C    . GLY B 1 28 ? 11.850  13.267  -1.525  1.00 0.00 ? 32 GLY B C    2  
ATOM 3700  O O    . GLY B 1 28 ? 11.362  14.255  -0.978  1.00 0.00 ? 32 GLY B O    2  
ATOM 3701  H H    . GLY B 1 28 ? 9.301   12.885  -1.502  1.00 0.00 ? 32 GLY B H    2  
ATOM 3702  H HA2  . GLY B 1 28 ? 11.631  11.280  -0.714  1.00 0.00 ? 32 GLY B HA2  2  
ATOM 3703  H HA3  . GLY B 1 28 ? 11.230  11.404  -2.416  1.00 0.00 ? 32 GLY B HA3  2  
ATOM 3704  N N    . PRO B 1 29 ? 13.019  13.270  -2.220  1.00 0.00 ? 33 PRO B N    2  
ATOM 3705  C CA   . PRO B 1 29 ? 13.799  14.487  -2.367  1.00 0.00 ? 33 PRO B CA   2  
ATOM 3706  C C    . PRO B 1 29 ? 13.154  15.433  -3.382  1.00 0.00 ? 33 PRO B C    2  
ATOM 3707  O O    . PRO B 1 29 ? 13.686  16.505  -3.663  1.00 0.00 ? 33 PRO B O    2  
ATOM 3708  C CB   . PRO B 1 29 ? 15.183  14.020  -2.787  1.00 0.00 ? 33 PRO B CB   2  
ATOM 3709  C CG   . PRO B 1 29 ? 15.003  12.603  -3.309  1.00 0.00 ? 33 PRO B CG   2  
ATOM 3710  C CD   . PRO B 1 29 ? 13.628  12.119  -2.880  1.00 0.00 ? 33 PRO B CD   2  
ATOM 3711  H HA   . PRO B 1 29 ? 13.825  14.990  -1.503  1.00 0.00 ? 33 PRO B HA   2  
ATOM 3712  H HB2  . PRO B 1 29 ? 15.598  14.670  -3.558  1.00 0.00 ? 33 PRO B HB2  2  
ATOM 3713  H HB3  . PRO B 1 29 ? 15.875  14.041  -1.946  1.00 0.00 ? 33 PRO B HB3  2  
ATOM 3714  H HG2  . PRO B 1 29 ? 15.094  12.582  -4.395  1.00 0.00 ? 33 PRO B HG2  2  
ATOM 3715  H HG3  . PRO B 1 29 ? 15.779  11.949  -2.912  1.00 0.00 ? 33 PRO B HG3  2  
ATOM 3716  H HD2  . PRO B 1 29 ? 13.037  11.797  -3.737  1.00 0.00 ? 33 PRO B HD2  2  
ATOM 3717  H HD3  . PRO B 1 29 ? 13.701  11.267  -2.204  1.00 0.00 ? 33 PRO B HD3  2  
ATOM 3718  N N    . HIS B 1 30 ? 12.015  15.000  -3.905  1.00 0.00 ? 34 HIS B N    2  
ATOM 3719  C CA   . HIS B 1 30 ? 11.292  15.794  -4.883  1.00 0.00 ? 34 HIS B CA   2  
ATOM 3720  C C    . HIS B 1 30 ? 9.988   16.305  -4.266  1.00 0.00 ? 34 HIS B C    2  
ATOM 3721  O O    . HIS B 1 30 ? 9.716   17.504  -4.286  1.00 0.00 ? 34 HIS B O    2  
ATOM 3722  C CB   . HIS B 1 30 ? 11.066  14.998  -6.170  1.00 0.00 ? 34 HIS B CB   2  
ATOM 3723  C CG   . HIS B 1 30 ? 10.903  13.512  -5.952  1.00 0.00 ? 34 HIS B CG   2  
ATOM 3724  N ND1  . HIS B 1 30 ? 11.934  12.702  -5.511  1.00 0.00 ? 34 HIS B ND1  2  
ATOM 3725  C CD2  . HIS B 1 30 ? 9.819   12.701  -6.119  1.00 0.00 ? 34 HIS B CD2  2  
ATOM 3726  C CE1  . HIS B 1 30 ? 11.481  11.460  -5.421  1.00 0.00 ? 34 HIS B CE1  2  
ATOM 3727  N NE2  . HIS B 1 30 ? 10.170  11.462  -5.799  1.00 0.00 ? 34 HIS B NE2  2  
ATOM 3728  H H    . HIS B 1 30 ? 11.589  14.126  -3.671  1.00 0.00 ? 34 HIS B H    2  
ATOM 3729  H HA   . HIS B 1 30 ? 11.927  16.646  -5.126  1.00 0.00 ? 34 HIS B HA   2  
ATOM 3730  H HB2  . HIS B 1 30 ? 10.177  15.381  -6.671  1.00 0.00 ? 34 HIS B HB2  2  
ATOM 3731  H HB3  . HIS B 1 30 ? 11.908  15.166  -6.841  1.00 0.00 ? 34 HIS B HB3  2  
ATOM 3732  H HD1  . HIS B 1 30 ? 12.864  13.002  -5.297  1.00 0.00 ? 34 HIS B HD1  2  
ATOM 3733  H HD2  . HIS B 1 30 ? 8.833   13.017  -6.459  1.00 0.00 ? 34 HIS B HD2  2  
ATOM 3734  H HE1  . HIS B 1 30 ? 12.054  10.590  -5.100  1.00 0.00 ? 34 HIS B HE1  2  
ATOM 3735  N N    . CYS B 1 31 ? 9.217   15.369  -3.732  1.00 0.00 ? 35 CYS B N    2  
ATOM 3736  C CA   . CYS B 1 31 ? 7.949   15.710  -3.110  1.00 0.00 ? 35 CYS B CA   2  
ATOM 3737  C C    . CYS B 1 31 ? 8.050   15.404  -1.614  1.00 0.00 ? 35 CYS B C    2  
ATOM 3738  O O    . CYS B 1 31 ? 8.341   14.274  -1.226  1.00 0.00 ? 35 CYS B O    2  
ATOM 3739  C CB   . CYS B 1 31 ? 6.781   14.970  -3.766  1.00 0.00 ? 35 CYS B CB   2  
ATOM 3740  S SG   . CYS B 1 31 ? 5.454   16.051  -4.412  1.00 0.00 ? 35 CYS B SG   2  
ATOM 3741  H H    . CYS B 1 31 ? 9.446   14.396  -3.720  1.00 0.00 ? 35 CYS B H    2  
ATOM 3742  H HA   . CYS B 1 31 ? 7.794   16.775  -3.278  1.00 0.00 ? 35 CYS B HA   2  
ATOM 3743  H HB2  . CYS B 1 31 ? 7.167   14.363  -4.585  1.00 0.00 ? 35 CYS B HB2  2  
ATOM 3744  H HB3  . CYS B 1 31 ? 6.348   14.284  -3.037  1.00 0.00 ? 35 CYS B HB3  2  
ATOM 3745  N N    . ALA B 1 32 ? 7.803   16.432  -0.815  1.00 0.00 ? 36 ALA B N    2  
ATOM 3746  C CA   . ALA B 1 32 ? 7.863   16.288  0.629   1.00 0.00 ? 36 ALA B CA   2  
ATOM 3747  C C    . ALA B 1 32 ? 6.467   15.959  1.163   1.00 0.00 ? 36 ALA B C    2  
ATOM 3748  O O    . ALA B 1 32 ? 6.165   16.224  2.325   1.00 0.00 ? 36 ALA B O    2  
ATOM 3749  C CB   . ALA B 1 32 ? 8.437   17.565  1.247   1.00 0.00 ? 36 ALA B CB   2  
ATOM 3750  H H    . ALA B 1 32 ? 7.567   17.348  -1.139  1.00 0.00 ? 36 ALA B H    2  
ATOM 3751  H HA   . ALA B 1 32 ? 8.533   15.458  0.853   1.00 0.00 ? 36 ALA B HA   2  
ATOM 3752  H HB1  . ALA B 1 32 ? 9.521   17.477  1.319   1.00 0.00 ? 36 ALA B HB1  2  
ATOM 3753  H HB2  . ALA B 1 32 ? 8.182   18.418  0.619   1.00 0.00 ? 36 ALA B HB2  2  
ATOM 3754  H HB3  . ALA B 1 32 ? 8.017   17.708  2.242   1.00 0.00 ? 36 ALA B HB3  2  
ATOM 3755  N N    . GLN B 1 33 ? 5.653   15.387  0.287   1.00 0.00 ? 37 GLN B N    2  
ATOM 3756  C CA   . GLN B 1 33 ? 4.297   15.019  0.656   1.00 0.00 ? 37 GLN B CA   2  
ATOM 3757  C C    . GLN B 1 33 ? 4.044   13.543  0.345   1.00 0.00 ? 37 GLN B C    2  
ATOM 3758  O O    . GLN B 1 33 ? 4.672   12.977  -0.549  1.00 0.00 ? 37 GLN B O    2  
ATOM 3759  C CB   . GLN B 1 33 ? 3.276   15.912  -0.052  1.00 0.00 ? 37 GLN B CB   2  
ATOM 3760  C CG   . GLN B 1 33 ? 3.802   17.341  -0.195  1.00 0.00 ? 37 GLN B CG   2  
ATOM 3761  C CD   . GLN B 1 33 ? 3.875   18.038  1.166   1.00 0.00 ? 37 GLN B CD   2  
ATOM 3762  O OE1  . GLN B 1 33 ? 3.288   17.606  2.145   1.00 0.00 ? 37 GLN B OE1  2  
ATOM 3763  N NE2  . GLN B 1 33 ? 4.625   19.136  1.172   1.00 0.00 ? 37 GLN B NE2  2  
ATOM 3764  H H    . GLN B 1 33 ? 5.907   15.175  -0.656  1.00 0.00 ? 37 GLN B H    2  
ATOM 3765  H HA   . GLN B 1 33 ? 4.233   15.187  1.731   1.00 0.00 ? 37 GLN B HA   2  
ATOM 3766  H HB2  . GLN B 1 33 ? 3.051   15.503  -1.037  1.00 0.00 ? 37 GLN B HB2  2  
ATOM 3767  H HB3  . GLN B 1 33 ? 2.342   15.919  0.510   1.00 0.00 ? 37 GLN B HB3  2  
ATOM 3768  H HG2  . GLN B 1 33 ? 4.792   17.324  -0.652  1.00 0.00 ? 37 GLN B HG2  2  
ATOM 3769  H HG3  . GLN B 1 33 ? 3.153   17.907  -0.863  1.00 0.00 ? 37 GLN B HG3  2  
ATOM 3770  H HE21 . GLN B 1 33 ? 5.079   19.436  0.334   1.00 0.00 ? 37 GLN B HE21 2  
ATOM 3771  H HE22 . GLN B 1 33 ? 4.734   19.662  2.016   1.00 0.00 ? 37 GLN B HE22 2  
ATOM 3772  N N    . THR B 1 34 ? 3.123   12.961  1.099   1.00 0.00 ? 38 THR B N    2  
ATOM 3773  C CA   . THR B 1 34 ? 2.779   11.562  0.915   1.00 0.00 ? 38 THR B CA   2  
ATOM 3774  C C    . THR B 1 34 ? 1.798   11.402  -0.248  1.00 0.00 ? 38 THR B C    2  
ATOM 3775  O O    . THR B 1 34 ? 1.113   12.353  -0.622  1.00 0.00 ? 38 THR B O    2  
ATOM 3776  C CB   . THR B 1 34 ? 2.239   11.029  2.243   1.00 0.00 ? 38 THR B CB   2  
ATOM 3777  O OG1  . THR B 1 34 ? 3.155   11.525  3.215   1.00 0.00 ? 38 THR B OG1  2  
ATOM 3778  C CG2  . THR B 1 34 ? 2.361   9.508   2.357   1.00 0.00 ? 38 THR B CG2  2  
ATOM 3779  H H    . THR B 1 34 ? 2.617   13.429  1.824   1.00 0.00 ? 38 THR B H    2  
ATOM 3780  H HA   . THR B 1 34 ? 3.685   11.018  0.646   1.00 0.00 ? 38 THR B HA   2  
ATOM 3781  H HB   . THR B 1 34 ? 1.209   11.349  2.401   1.00 0.00 ? 38 THR B HB   2  
ATOM 3782  H HG1  . THR B 1 34 ? 2.771   11.421  4.132   1.00 0.00 ? 38 THR B HG1  2  
ATOM 3783  H HG21 . THR B 1 34 ? 3.308   9.186   1.924   1.00 0.00 ? 38 THR B HG21 2  
ATOM 3784  H HG22 . THR B 1 34 ? 2.326   9.218   3.408   1.00 0.00 ? 38 THR B HG22 2  
ATOM 3785  H HG23 . THR B 1 34 ? 1.538   9.036   1.822   1.00 0.00 ? 38 THR B HG23 2  
ATOM 3786  N N    . GLU B 1 35 ? 1.762   10.193  -0.788  1.00 0.00 ? 39 GLU B N    2  
ATOM 3787  C CA   . GLU B 1 35 ? 0.876   9.896   -1.901  1.00 0.00 ? 39 GLU B CA   2  
ATOM 3788  C C    . GLU B 1 35 ? 0.230   8.522   -1.714  1.00 0.00 ? 39 GLU B C    2  
ATOM 3789  O O    . GLU B 1 35 ? 0.683   7.535   -2.291  1.00 0.00 ? 39 GLU B O    2  
ATOM 3790  C CB   . GLU B 1 35 ? 1.624   9.973   -3.233  1.00 0.00 ? 39 GLU B CB   2  
ATOM 3791  C CG   . GLU B 1 35 ? 1.562   11.386  -3.816  1.00 0.00 ? 39 GLU B CG   2  
ATOM 3792  C CD   . GLU B 1 35 ? 2.856   12.153  -3.535  1.00 0.00 ? 39 GLU B CD   2  
ATOM 3793  O OE1  . GLU B 1 35 ? 2.909   12.806  -2.470  1.00 0.00 ? 39 GLU B OE1  2  
ATOM 3794  O OE2  . GLU B 1 35 ? 3.763   12.069  -4.391  1.00 0.00 ? 39 GLU B OE2  2  
ATOM 3795  H H    . GLU B 1 35 ? 2.322   9.425   -0.478  1.00 0.00 ? 39 GLU B H    2  
ATOM 3796  H HA   . GLU B 1 35 ? 0.110   10.672  -1.876  1.00 0.00 ? 39 GLU B HA   2  
ATOM 3797  H HB2  . GLU B 1 35 ? 2.664   9.681   -3.087  1.00 0.00 ? 39 GLU B HB2  2  
ATOM 3798  H HB3  . GLU B 1 35 ? 1.191   9.265   -3.940  1.00 0.00 ? 39 GLU B HB3  2  
ATOM 3799  H HG2  . GLU B 1 35 ? 1.394   11.333  -4.892  1.00 0.00 ? 39 GLU B HG2  2  
ATOM 3800  H HG3  . GLU B 1 35 ? 0.716   11.924  -3.388  1.00 0.00 ? 39 GLU B HG3  2  
ATOM 3801  N N    . VAL B 1 36 ? -0.820  8.503   -0.905  1.00 0.00 ? 40 VAL B N    2  
ATOM 3802  C CA   . VAL B 1 36 ? -1.533  7.266   -0.634  1.00 0.00 ? 40 VAL B CA   2  
ATOM 3803  C C    . VAL B 1 36 ? -2.478  6.962   -1.798  1.00 0.00 ? 40 VAL B C    2  
ATOM 3804  O O    . VAL B 1 36 ? -3.315  7.789   -2.156  1.00 0.00 ? 40 VAL B O    2  
ATOM 3805  C CB   . VAL B 1 36 ? -2.254  7.361   0.712   1.00 0.00 ? 40 VAL B CB   2  
ATOM 3806  C CG1  . VAL B 1 36 ? -2.990  6.059   1.033   1.00 0.00 ? 40 VAL B CG1  2  
ATOM 3807  C CG2  . VAL B 1 36 ? -1.279  7.731   1.831   1.00 0.00 ? 40 VAL B CG2  2  
ATOM 3808  H H    . VAL B 1 36 ? -1.182  9.310   -0.439  1.00 0.00 ? 40 VAL B H    2  
ATOM 3809  H HA   . VAL B 1 36 ? -0.793  6.468   -0.565  1.00 0.00 ? 40 VAL B HA   2  
ATOM 3810  H HB   . VAL B 1 36 ? -2.997  8.156   0.639   1.00 0.00 ? 40 VAL B HB   2  
ATOM 3811  H HG11 . VAL B 1 36 ? -3.460  5.674   0.128   1.00 0.00 ? 40 VAL B HG11 2  
ATOM 3812  H HG12 . VAL B 1 36 ? -2.279  5.325   1.414   1.00 0.00 ? 40 VAL B HG12 2  
ATOM 3813  H HG13 . VAL B 1 36 ? -3.754  6.250   1.787   1.00 0.00 ? 40 VAL B HG13 2  
ATOM 3814  H HG21 . VAL B 1 36 ? -0.644  8.554   1.503   1.00 0.00 ? 40 VAL B HG21 2  
ATOM 3815  H HG22 . VAL B 1 36 ? -1.839  8.036   2.716   1.00 0.00 ? 40 VAL B HG22 2  
ATOM 3816  H HG23 . VAL B 1 36 ? -0.659  6.868   2.073   1.00 0.00 ? 40 VAL B HG23 2  
ATOM 3817  N N    . ILE B 1 37 ? -2.312  5.772   -2.358  1.00 0.00 ? 41 ILE B N    2  
ATOM 3818  C CA   . ILE B 1 37 ? -3.140  5.349   -3.475  1.00 0.00 ? 41 ILE B CA   2  
ATOM 3819  C C    . ILE B 1 37 ? -3.778  3.997   -3.147  1.00 0.00 ? 41 ILE B C    2  
ATOM 3820  O O    . ILE B 1 37 ? -3.227  3.219   -2.370  1.00 0.00 ? 41 ILE B O    2  
ATOM 3821  C CB   . ILE B 1 37 ? -2.329  5.348   -4.772  1.00 0.00 ? 41 ILE B CB   2  
ATOM 3822  C CG1  . ILE B 1 37 ? -1.169  6.343   -4.695  1.00 0.00 ? 41 ILE B CG1  2  
ATOM 3823  C CG2  . ILE B 1 37 ? -3.229  5.611   -5.981  1.00 0.00 ? 41 ILE B CG2  2  
ATOM 3824  C CD1  . ILE B 1 37 ? -1.682  7.768   -4.477  1.00 0.00 ? 41 ILE B CD1  2  
ATOM 3825  H H    . ILE B 1 37 ? -1.629  5.105   -2.062  1.00 0.00 ? 41 ILE B H    2  
ATOM 3826  H HA   . ILE B 1 37 ? -3.934  6.087   -3.591  1.00 0.00 ? 41 ILE B HA   2  
ATOM 3827  H HB   . ILE B 1 37 ? -1.895  4.357   -4.904  1.00 0.00 ? 41 ILE B HB   2  
ATOM 3828  H HG12 . ILE B 1 37 ? -0.501  6.064   -3.880  1.00 0.00 ? 41 ILE B HG12 2  
ATOM 3829  H HG13 . ILE B 1 37 ? -0.586  6.299   -5.615  1.00 0.00 ? 41 ILE B HG13 2  
ATOM 3830  H HG21 . ILE B 1 37 ? -4.129  6.135   -5.658  1.00 0.00 ? 41 ILE B HG21 2  
ATOM 3831  H HG22 . ILE B 1 37 ? -2.694  6.222   -6.707  1.00 0.00 ? 41 ILE B HG22 2  
ATOM 3832  H HG23 . ILE B 1 37 ? -3.507  4.662   -6.440  1.00 0.00 ? 41 ILE B HG23 2  
ATOM 3833  H HD11 . ILE B 1 37 ? -2.753  7.742   -4.276  1.00 0.00 ? 41 ILE B HD11 2  
ATOM 3834  H HD12 . ILE B 1 37 ? -1.164  8.215   -3.629  1.00 0.00 ? 41 ILE B HD12 2  
ATOM 3835  H HD13 . ILE B 1 37 ? -1.494  8.362   -5.372  1.00 0.00 ? 41 ILE B HD13 2  
ATOM 3836  N N    . ALA B 1 38 ? -4.930  3.760   -3.757  1.00 0.00 ? 42 ALA B N    2  
ATOM 3837  C CA   . ALA B 1 38 ? -5.648  2.515   -3.540  1.00 0.00 ? 42 ALA B CA   2  
ATOM 3838  C C    . ALA B 1 38 ? -6.271  2.055   -4.859  1.00 0.00 ? 42 ALA B C    2  
ATOM 3839  O O    . ALA B 1 38 ? -6.946  2.830   -5.535  1.00 0.00 ? 42 ALA B O    2  
ATOM 3840  C CB   . ALA B 1 38 ? -6.693  2.714   -2.440  1.00 0.00 ? 42 ALA B CB   2  
ATOM 3841  H H    . ALA B 1 38 ? -5.370  4.398   -4.388  1.00 0.00 ? 42 ALA B H    2  
ATOM 3842  H HA   . ALA B 1 38 ? -4.927  1.769   -3.208  1.00 0.00 ? 42 ALA B HA   2  
ATOM 3843  H HB1  . ALA B 1 38 ? -7.657  2.949   -2.892  1.00 0.00 ? 42 ALA B HB1  2  
ATOM 3844  H HB2  . ALA B 1 38 ? -6.780  1.801   -1.852  1.00 0.00 ? 42 ALA B HB2  2  
ATOM 3845  H HB3  . ALA B 1 38 ? -6.386  3.535   -1.792  1.00 0.00 ? 42 ALA B HB3  2  
ATOM 3846  N N    . THR B 1 39 ? -6.023  0.795   -5.186  1.00 0.00 ? 43 THR B N    2  
ATOM 3847  C CA   . THR B 1 39 ? -6.551  0.222   -6.412  1.00 0.00 ? 43 THR B CA   2  
ATOM 3848  C C    . THR B 1 39 ? -8.003  -0.216  -6.214  1.00 0.00 ? 43 THR B C    2  
ATOM 3849  O O    . THR B 1 39 ? -8.354  -0.763  -5.170  1.00 0.00 ? 43 THR B O    2  
ATOM 3850  C CB   . THR B 1 39 ? -5.625  -0.920  -6.838  1.00 0.00 ? 43 THR B CB   2  
ATOM 3851  O OG1  . THR B 1 39 ? -4.421  -0.264  -7.225  1.00 0.00 ? 43 THR B OG1  2  
ATOM 3852  C CG2  . THR B 1 39 ? -6.100  -1.613  -8.117  1.00 0.00 ? 43 THR B CG2  2  
ATOM 3853  H H    . THR B 1 39 ? -5.473  0.171   -4.631  1.00 0.00 ? 43 THR B H    2  
ATOM 3854  H HA   . THR B 1 39 ? -6.552  0.995   -7.181  1.00 0.00 ? 43 THR B HA   2  
ATOM 3855  H HB   . THR B 1 39 ? -5.498  -1.639  -6.029  1.00 0.00 ? 43 THR B HB   2  
ATOM 3856  H HG1  . THR B 1 39 ? -3.644  -0.656  -6.732  1.00 0.00 ? 43 THR B HG1  2  
ATOM 3857  H HG21 . THR B 1 39 ? -6.907  -1.034  -8.566  1.00 0.00 ? 43 THR B HG21 2  
ATOM 3858  H HG22 . THR B 1 39 ? -5.270  -1.686  -8.820  1.00 0.00 ? 43 THR B HG22 2  
ATOM 3859  H HG23 . THR B 1 39 ? -6.461  -2.613  -7.875  1.00 0.00 ? 43 THR B HG23 2  
ATOM 3860  N N    . LEU B 1 40 ? -8.810  0.043   -7.233  1.00 0.00 ? 44 LEU B N    2  
ATOM 3861  C CA   . LEU B 1 40 ? -10.217 -0.318  -7.184  1.00 0.00 ? 44 LEU B CA   2  
ATOM 3862  C C    . LEU B 1 40 ? -10.390 -1.751  -7.692  1.00 0.00 ? 44 LEU B C    2  
ATOM 3863  O O    . LEU B 1 40 ? -9.620  -2.213  -8.532  1.00 0.00 ? 44 LEU B O    2  
ATOM 3864  C CB   . LEU B 1 40 ? -11.060 0.710   -7.943  1.00 0.00 ? 44 LEU B CB   2  
ATOM 3865  C CG   . LEU B 1 40 ? -12.294 1.238   -7.209  1.00 0.00 ? 44 LEU B CG   2  
ATOM 3866  C CD1  . LEU B 1 40 ? -12.803 2.529   -7.853  1.00 0.00 ? 44 LEU B CD1  2  
ATOM 3867  C CD2  . LEU B 1 40 ? -13.384 0.168   -7.129  1.00 0.00 ? 44 LEU B CD2  2  
ATOM 3868  H H    . LEU B 1 40 ? -8.517  0.488   -8.079  1.00 0.00 ? 44 LEU B H    2  
ATOM 3869  H HA   . LEU B 1 40 ? -10.527 -0.281  -6.140  1.00 0.00 ? 44 LEU B HA   2  
ATOM 3870  H HB2  . LEU B 1 40 ? -10.422 1.556   -8.198  1.00 0.00 ? 44 LEU B HB2  2  
ATOM 3871  H HB3  . LEU B 1 40 ? -11.384 0.261   -8.882  1.00 0.00 ? 44 LEU B HB3  2  
ATOM 3872  H HG   . LEU B 1 40 ? -12.005 1.481   -6.186  1.00 0.00 ? 44 LEU B HG   2  
ATOM 3873  H HD11 . LEU B 1 40 ? -12.112 2.843   -8.635  1.00 0.00 ? 44 LEU B HD11 2  
ATOM 3874  H HD12 . LEU B 1 40 ? -13.788 2.354   -8.288  1.00 0.00 ? 44 LEU B HD12 2  
ATOM 3875  H HD13 . LEU B 1 40 ? -12.874 3.310   -7.096  1.00 0.00 ? 44 LEU B HD13 2  
ATOM 3876  H HD21 . LEU B 1 40 ? -13.378 -0.426  -8.043  1.00 0.00 ? 44 LEU B HD21 2  
ATOM 3877  H HD22 . LEU B 1 40 ? -13.195 -0.480  -6.273  1.00 0.00 ? 44 LEU B HD22 2  
ATOM 3878  H HD23 . LEU B 1 40 ? -14.356 0.648   -7.014  1.00 0.00 ? 44 LEU B HD23 2  
ATOM 3879  N N    . LYS B 1 41 ? -11.406 -2.414  -7.160  1.00 0.00 ? 45 LYS B N    2  
ATOM 3880  C CA   . LYS B 1 41 ? -11.690 -3.785  -7.548  1.00 0.00 ? 45 LYS B CA   2  
ATOM 3881  C C    . LYS B 1 41 ? -12.301 -3.797  -8.951  1.00 0.00 ? 45 LYS B C    2  
ATOM 3882  O O    . LYS B 1 41 ? -12.538 -4.862  -9.520  1.00 0.00 ? 45 LYS B O    2  
ATOM 3883  C CB   . LYS B 1 41 ? -12.560 -4.472  -6.493  1.00 0.00 ? 45 LYS B CB   2  
ATOM 3884  C CG   . LYS B 1 41 ? -12.730 -5.959  -6.806  1.00 0.00 ? 45 LYS B CG   2  
ATOM 3885  C CD   . LYS B 1 41 ? -14.044 -6.216  -7.548  1.00 0.00 ? 45 LYS B CD   2  
ATOM 3886  C CE   . LYS B 1 41 ? -14.861 -7.307  -6.853  1.00 0.00 ? 45 LYS B CE   2  
ATOM 3887  N NZ   . LYS B 1 41 ? -15.549 -6.760  -5.662  1.00 0.00 ? 45 LYS B NZ   2  
ATOM 3888  H H    . LYS B 1 41 ? -12.028 -2.031  -6.477  1.00 0.00 ? 45 LYS B H    2  
ATOM 3889  H HA   . LYS B 1 41 ? -10.740 -4.319  -7.580  1.00 0.00 ? 45 LYS B HA   2  
ATOM 3890  H HB2  . LYS B 1 41 ? -12.106 -4.353  -5.509  1.00 0.00 ? 45 LYS B HB2  2  
ATOM 3891  H HB3  . LYS B 1 41 ? -13.537 -3.990  -6.452  1.00 0.00 ? 45 LYS B HB3  2  
ATOM 3892  H HG2  . LYS B 1 41 ? -11.893 -6.305  -7.413  1.00 0.00 ? 45 LYS B HG2  2  
ATOM 3893  H HG3  . LYS B 1 41 ? -12.712 -6.534  -5.881  1.00 0.00 ? 45 LYS B HG3  2  
ATOM 3894  H HD2  . LYS B 1 41 ? -14.625 -5.295  -7.595  1.00 0.00 ? 45 LYS B HD2  2  
ATOM 3895  H HD3  . LYS B 1 41 ? -13.834 -6.513  -8.575  1.00 0.00 ? 45 LYS B HD3  2  
ATOM 3896  H HE2  . LYS B 1 41 ? -15.594 -7.719  -7.547  1.00 0.00 ? 45 LYS B HE2  2  
ATOM 3897  H HE3  . LYS B 1 41 ? -14.207 -8.127  -6.557  1.00 0.00 ? 45 LYS B HE3  2  
ATOM 3898  H HZ1  . LYS B 1 41 ? -16.106 -5.974  -5.931  1.00 0.00 ? 45 LYS B HZ1  2  
ATOM 3899  H HZ2  . LYS B 1 41 ? -16.137 -7.464  -5.264  1.00 0.00 ? 45 LYS B HZ2  2  
ATOM 3900  H HZ3  . LYS B 1 41 ? -14.870 -6.472  -4.987  1.00 0.00 ? 45 LYS B HZ3  2  
ATOM 3901  N N    . ASN B 1 42 ? -12.539 -2.601  -9.468  1.00 0.00 ? 46 ASN B N    2  
ATOM 3902  C CA   . ASN B 1 42 ? -13.118 -2.460  -10.793 1.00 0.00 ? 46 ASN B CA   2  
ATOM 3903  C C    . ASN B 1 42 ? -12.003 -2.192  -11.806 1.00 0.00 ? 46 ASN B C    2  
ATOM 3904  O O    . ASN B 1 42 ? -12.243 -2.191  -13.013 1.00 0.00 ? 46 ASN B O    2  
ATOM 3905  C CB   . ASN B 1 42 ? -14.096 -1.285  -10.845 1.00 0.00 ? 46 ASN B CB   2  
ATOM 3906  C CG   . ASN B 1 42 ? -13.971 -0.525  -12.167 1.00 0.00 ? 46 ASN B CG   2  
ATOM 3907  O OD1  . ASN B 1 42 ? -14.251 -1.039  -13.238 1.00 0.00 ? 46 ASN B OD1  2  
ATOM 3908  N ND2  . ASN B 1 42 ? -13.534 0.724   -12.034 1.00 0.00 ? 46 ASN B ND2  2  
ATOM 3909  H H    . ASN B 1 42 ? -12.344 -1.739  -8.999  1.00 0.00 ? 46 ASN B H    2  
ATOM 3910  H HA   . ASN B 1 42 ? -13.635 -3.401  -10.981 1.00 0.00 ? 46 ASN B HA   2  
ATOM 3911  H HB2  . ASN B 1 42 ? -15.117 -1.650  -10.728 1.00 0.00 ? 46 ASN B HB2  2  
ATOM 3912  H HB3  . ASN B 1 42 ? -13.902 -0.608  -10.013 1.00 0.00 ? 46 ASN B HB3  2  
ATOM 3913  H HD21 . ASN B 1 42 ? -13.322 1.085   -11.126 1.00 0.00 ? 46 ASN B HD21 2  
ATOM 3914  H HD22 . ASN B 1 42 ? -13.419 1.303   -12.841 1.00 0.00 ? 46 ASN B HD22 2  
ATOM 3915  N N    . GLY B 1 43 ? -10.808 -1.972  -11.279 1.00 0.00 ? 47 GLY B N    2  
ATOM 3916  C CA   . GLY B 1 43 ? -9.656  -1.704  -12.122 1.00 0.00 ? 47 GLY B CA   2  
ATOM 3917  C C    . GLY B 1 43 ? -9.246  -0.232  -12.038 1.00 0.00 ? 47 GLY B C    2  
ATOM 3918  O O    . GLY B 1 43 ? -8.225  0.165   -12.599 1.00 0.00 ? 47 GLY B O    2  
ATOM 3919  H H    . GLY B 1 43 ? -10.622 -1.974  -10.296 1.00 0.00 ? 47 GLY B H    2  
ATOM 3920  H HA2  . GLY B 1 43 ? -8.822  -2.335  -11.815 1.00 0.00 ? 47 GLY B HA2  2  
ATOM 3921  H HA3  . GLY B 1 43 ? -9.888  -1.962  -13.155 1.00 0.00 ? 47 GLY B HA3  2  
ATOM 3922  N N    . GLN B 1 44 ? -10.063 0.538   -11.334 1.00 0.00 ? 48 GLN B N    2  
ATOM 3923  C CA   . GLN B 1 44 ? -9.798  1.957   -11.169 1.00 0.00 ? 48 GLN B CA   2  
ATOM 3924  C C    . GLN B 1 44 ? -8.884  2.190   -9.965  1.00 0.00 ? 48 GLN B C    2  
ATOM 3925  O O    . GLN B 1 44 ? -8.377  1.239   -9.372  1.00 0.00 ? 48 GLN B O    2  
ATOM 3926  C CB   . GLN B 1 44 ? -11.102 2.745   -11.029 1.00 0.00 ? 48 GLN B CB   2  
ATOM 3927  C CG   . GLN B 1 44 ? -11.644 3.156   -12.400 1.00 0.00 ? 48 GLN B CG   2  
ATOM 3928  C CD   . GLN B 1 44 ? -13.008 3.837   -12.268 1.00 0.00 ? 48 GLN B CD   2  
ATOM 3929  O OE1  . GLN B 1 44 ? -13.267 4.591   -11.344 1.00 0.00 ? 48 GLN B OE1  2  
ATOM 3930  N NE2  . GLN B 1 44 ? -13.862 3.531   -13.240 1.00 0.00 ? 48 GLN B NE2  2  
ATOM 3931  H H    . GLN B 1 44 ? -10.891 0.207   -10.881 1.00 0.00 ? 48 GLN B H    2  
ATOM 3932  H HA   . GLN B 1 44 ? -9.291  2.265   -12.084 1.00 0.00 ? 48 GLN B HA   2  
ATOM 3933  H HB2  . GLN B 1 44 ? -11.843 2.140   -10.507 1.00 0.00 ? 48 GLN B HB2  2  
ATOM 3934  H HB3  . GLN B 1 44 ? -10.930 3.633   -10.421 1.00 0.00 ? 48 GLN B HB3  2  
ATOM 3935  H HG2  . GLN B 1 44 ? -10.941 3.832   -12.885 1.00 0.00 ? 48 GLN B HG2  2  
ATOM 3936  H HG3  . GLN B 1 44 ? -11.733 2.276   -13.038 1.00 0.00 ? 48 GLN B HG3  2  
ATOM 3937  H HE21 . GLN B 1 44 ? -13.586 2.904   -13.969 1.00 0.00 ? 48 GLN B HE21 2  
ATOM 3938  H HE22 . GLN B 1 44 ? -14.780 3.927   -13.242 1.00 0.00 ? 48 GLN B HE22 2  
ATOM 3939  N N    . LYS B 1 45 ? -8.700  3.462   -9.639  1.00 0.00 ? 49 LYS B N    2  
ATOM 3940  C CA   . LYS B 1 45 ? -7.856  3.832   -8.516  1.00 0.00 ? 49 LYS B CA   2  
ATOM 3941  C C    . LYS B 1 45 ? -8.451  5.057   -7.819  1.00 0.00 ? 49 LYS B C    2  
ATOM 3942  O O    . LYS B 1 45 ? -9.022  5.930   -8.470  1.00 0.00 ? 49 LYS B O    2  
ATOM 3943  C CB   . LYS B 1 45 ? -6.410  4.028   -8.975  1.00 0.00 ? 49 LYS B CB   2  
ATOM 3944  C CG   . LYS B 1 45 ? -5.890  2.782   -9.696  1.00 0.00 ? 49 LYS B CG   2  
ATOM 3945  C CD   . LYS B 1 45 ? -6.273  2.807   -11.177 1.00 0.00 ? 49 LYS B CD   2  
ATOM 3946  C CE   . LYS B 1 45 ? -5.039  2.639   -12.066 1.00 0.00 ? 49 LYS B CE   2  
ATOM 3947  N NZ   . LYS B 1 45 ? -4.254  3.894   -12.104 1.00 0.00 ? 49 LYS B NZ   2  
ATOM 3948  H H    . LYS B 1 45 ? -9.116  4.229   -10.127 1.00 0.00 ? 49 LYS B H    2  
ATOM 3949  H HA   . LYS B 1 45 ? -7.862  2.998   -7.814  1.00 0.00 ? 49 LYS B HA   2  
ATOM 3950  H HB2  . LYS B 1 45 ? -6.348  4.889   -9.639  1.00 0.00 ? 49 LYS B HB2  2  
ATOM 3951  H HB3  . LYS B 1 45 ? -5.777  4.244   -8.114  1.00 0.00 ? 49 LYS B HB3  2  
ATOM 3952  H HG2  . LYS B 1 45 ? -4.806  2.727   -9.598  1.00 0.00 ? 49 LYS B HG2  2  
ATOM 3953  H HG3  . LYS B 1 45 ? -6.299  1.888   -9.225  1.00 0.00 ? 49 LYS B HG3  2  
ATOM 3954  H HD2  . LYS B 1 45 ? -6.986  2.008   -11.385 1.00 0.00 ? 49 LYS B HD2  2  
ATOM 3955  H HD3  . LYS B 1 45 ? -6.770  3.747   -11.413 1.00 0.00 ? 49 LYS B HD3  2  
ATOM 3956  H HE2  . LYS B 1 45 ? -4.418  1.827   -11.687 1.00 0.00 ? 49 LYS B HE2  2  
ATOM 3957  H HE3  . LYS B 1 45 ? -5.344  2.363   -13.075 1.00 0.00 ? 49 LYS B HE3  2  
ATOM 3958  H HZ1  . LYS B 1 45 ? -4.823  4.652   -11.785 1.00 0.00 ? 49 LYS B HZ1  2  
ATOM 3959  H HZ2  . LYS B 1 45 ? -3.453  3.805   -11.512 1.00 0.00 ? 49 LYS B HZ2  2  
ATOM 3960  H HZ3  . LYS B 1 45 ? -3.957  4.073   -13.043 1.00 0.00 ? 49 LYS B HZ3  2  
ATOM 3961  N N    . ALA B 1 46 ? -8.296  5.083   -6.503  1.00 0.00 ? 50 ALA B N    2  
ATOM 3962  C CA   . ALA B 1 46 ? -8.811  6.186   -5.710  1.00 0.00 ? 50 ALA B CA   2  
ATOM 3963  C C    . ALA B 1 46 ? -7.718  6.679   -4.760  1.00 0.00 ? 50 ALA B C    2  
ATOM 3964  O O    . ALA B 1 46 ? -7.334  5.971   -3.830  1.00 0.00 ? 50 ALA B O    2  
ATOM 3965  C CB   . ALA B 1 46 ? -10.071 5.737   -4.968  1.00 0.00 ? 50 ALA B CB   2  
ATOM 3966  H H    . ALA B 1 46 ? -7.830  4.369   -5.981  1.00 0.00 ? 50 ALA B H    2  
ATOM 3967  H HA   . ALA B 1 46 ? -9.076  6.992   -6.395  1.00 0.00 ? 50 ALA B HA   2  
ATOM 3968  H HB1  . ALA B 1 46 ? -10.602 4.998   -5.567  1.00 0.00 ? 50 ALA B HB1  2  
ATOM 3969  H HB2  . ALA B 1 46 ? -9.791  5.296   -4.011  1.00 0.00 ? 50 ALA B HB2  2  
ATOM 3970  H HB3  . ALA B 1 46 ? -10.717 6.598   -4.795  1.00 0.00 ? 50 ALA B HB3  2  
ATOM 3971  N N    . CYS B 1 47 ? -7.248  7.889   -5.026  1.00 0.00 ? 51 CYS B N    2  
ATOM 3972  C CA   . CYS B 1 47 ? -6.208  8.485   -4.205  1.00 0.00 ? 51 CYS B CA   2  
ATOM 3973  C C    . CYS B 1 47 ? -6.802  8.805   -2.832  1.00 0.00 ? 51 CYS B C    2  
ATOM 3974  O O    . CYS B 1 47 ? -7.916  9.318   -2.739  1.00 0.00 ? 51 CYS B O    2  
ATOM 3975  C CB   . CYS B 1 47 ? -5.604  9.724   -4.869  1.00 0.00 ? 51 CYS B CB   2  
ATOM 3976  S SG   . CYS B 1 47 ? -4.032  9.429   -5.759  1.00 0.00 ? 51 CYS B SG   2  
ATOM 3977  H H    . CYS B 1 47 ? -7.567  8.458   -5.784  1.00 0.00 ? 51 CYS B H    2  
ATOM 3978  H HA   . CYS B 1 47 ? -5.414  7.743   -4.120  1.00 0.00 ? 51 CYS B HA   2  
ATOM 3979  H HB2  . CYS B 1 47 ? -6.331  10.134  -5.570  1.00 0.00 ? 51 CYS B HB2  2  
ATOM 3980  H HB3  . CYS B 1 47 ? -5.436  10.483  -4.105  1.00 0.00 ? 51 CYS B HB3  2  
ATOM 3981  N N    . LEU B 1 48 ? -6.032  8.490   -1.801  1.00 0.00 ? 52 LEU B N    2  
ATOM 3982  C CA   . LEU B 1 48 ? -6.469  8.737   -0.438  1.00 0.00 ? 52 LEU B CA   2  
ATOM 3983  C C    . LEU B 1 48 ? -5.619  9.856   0.170   1.00 0.00 ? 52 LEU B C    2  
ATOM 3984  O O    . LEU B 1 48 ? -4.515  10.127  -0.300  1.00 0.00 ? 52 LEU B O    2  
ATOM 3985  C CB   . LEU B 1 48 ? -6.451  7.441   0.375   1.00 0.00 ? 52 LEU B CB   2  
ATOM 3986  C CG   . LEU B 1 48 ? -7.333  6.307   -0.152  1.00 0.00 ? 52 LEU B CG   2  
ATOM 3987  C CD1  . LEU B 1 48 ? -6.897  4.960   0.425   1.00 0.00 ? 52 LEU B CD1  2  
ATOM 3988  C CD2  . LEU B 1 48 ? -8.812  6.594   0.115   1.00 0.00 ? 52 LEU B CD2  2  
ATOM 3989  H H    . LEU B 1 48 ? -5.127  8.073   -1.886  1.00 0.00 ? 52 LEU B H    2  
ATOM 3990  H HA   . LEU B 1 48 ? -7.504  9.076   -0.483  1.00 0.00 ? 52 LEU B HA   2  
ATOM 3991  H HB2  . LEU B 1 48 ? -5.423  7.081   0.425   1.00 0.00 ? 52 LEU B HB2  2  
ATOM 3992  H HB3  . LEU B 1 48 ? -6.759  7.671   1.395   1.00 0.00 ? 52 LEU B HB3  2  
ATOM 3993  H HG   . LEU B 1 48 ? -7.207  6.250   -1.233  1.00 0.00 ? 52 LEU B HG   2  
ATOM 3994  H HD11 . LEU B 1 48 ? -6.653  5.079   1.481   1.00 0.00 ? 52 LEU B HD11 2  
ATOM 3995  H HD12 . LEU B 1 48 ? -7.708  4.239   0.319   1.00 0.00 ? 52 LEU B HD12 2  
ATOM 3996  H HD13 . LEU B 1 48 ? -6.019  4.601   -0.112  1.00 0.00 ? 52 LEU B HD13 2  
ATOM 3997  H HD21 . LEU B 1 48 ? -8.933  6.958   1.135   1.00 0.00 ? 52 LEU B HD21 2  
ATOM 3998  H HD22 . LEU B 1 48 ? -9.168  7.350   -0.585  1.00 0.00 ? 52 LEU B HD22 2  
ATOM 3999  H HD23 . LEU B 1 48 ? -9.389  5.678   -0.015  1.00 0.00 ? 52 LEU B HD23 2  
ATOM 4000  N N    . ASN B 1 49 ? -6.167  10.475  1.206   1.00 0.00 ? 53 ASN B N    2  
ATOM 4001  C CA   . ASN B 1 49 ? -5.473  11.557  1.882   1.00 0.00 ? 53 ASN B CA   2  
ATOM 4002  C C    . ASN B 1 49 ? -4.677  10.990  3.060   1.00 0.00 ? 53 ASN B C    2  
ATOM 4003  O O    . ASN B 1 49 ? -5.249  10.392  3.970   1.00 0.00 ? 53 ASN B O    2  
ATOM 4004  C CB   . ASN B 1 49 ? -6.462  12.586  2.433   1.00 0.00 ? 53 ASN B CB   2  
ATOM 4005  C CG   . ASN B 1 49 ? -5.736  13.851  2.896   1.00 0.00 ? 53 ASN B CG   2  
ATOM 4006  O OD1  . ASN B 1 49 ? -4.769  14.297  2.301   1.00 0.00 ? 53 ASN B OD1  2  
ATOM 4007  N ND2  . ASN B 1 49 ? -6.255  14.402  3.990   1.00 0.00 ? 53 ASN B ND2  2  
ATOM 4008  H H    . ASN B 1 49 ? -7.065  10.248  1.582   1.00 0.00 ? 53 ASN B H    2  
ATOM 4009  H HA   . ASN B 1 49 ? -4.832  12.005  1.123   1.00 0.00 ? 53 ASN B HA   2  
ATOM 4010  H HB2  . ASN B 1 49 ? -7.191  12.842  1.664   1.00 0.00 ? 53 ASN B HB2  2  
ATOM 4011  H HB3  . ASN B 1 49 ? -7.016  12.154  3.266   1.00 0.00 ? 53 ASN B HB3  2  
ATOM 4012  H HD21 . ASN B 1 49 ? -7.051  13.986  4.430   1.00 0.00 ? 53 ASN B HD21 2  
ATOM 4013  H HD22 . ASN B 1 49 ? -5.850  15.233  4.371   1.00 0.00 ? 53 ASN B HD22 2  
ATOM 4014  N N    . PRO B 1 50 ? -3.335  11.203  3.002   1.00 0.00 ? 54 PRO B N    2  
ATOM 4015  C CA   . PRO B 1 50 ? -2.455  10.720  4.053   1.00 0.00 ? 54 PRO B CA   2  
ATOM 4016  C C    . PRO B 1 50 ? -2.574  11.585  5.309   1.00 0.00 ? 54 PRO B C    2  
ATOM 4017  O O    . PRO B 1 50 ? -1.900  11.333  6.307   1.00 0.00 ? 54 PRO B O    2  
ATOM 4018  C CB   . PRO B 1 50 ? -1.063  10.746  3.443   1.00 0.00 ? 54 PRO B CB   2  
ATOM 4019  C CG   . PRO B 1 50 ? -1.151  11.675  2.243   1.00 0.00 ? 54 PRO B CG   2  
ATOM 4020  C CD   . PRO B 1 50 ? -2.623  11.907  1.940   1.00 0.00 ? 54 PRO B CD   2  
ATOM 4021  H HA   . PRO B 1 50 ? -2.720  9.797   4.331   1.00 0.00 ? 54 PRO B HA   2  
ATOM 4022  H HB2  . PRO B 1 50 ? -0.328  11.107  4.162   1.00 0.00 ? 54 PRO B HB2  2  
ATOM 4023  H HB3  . PRO B 1 50 ? -0.750  9.747   3.141   1.00 0.00 ? 54 PRO B HB3  2  
ATOM 4024  H HG2  . PRO B 1 50 ? -0.651  12.621  2.454   1.00 0.00 ? 54 PRO B HG2  2  
ATOM 4025  H HG3  . PRO B 1 50 ? -0.649  11.235  1.381   1.00 0.00 ? 54 PRO B HG3  2  
ATOM 4026  H HD2  . PRO B 1 50 ? -2.864  12.970  1.939   1.00 0.00 ? 54 PRO B HD2  2  
ATOM 4027  H HD3  . PRO B 1 50 ? -2.891  11.518  0.958   1.00 0.00 ? 54 PRO B HD3  2  
ATOM 4028  N N    . ALA B 1 51 ? -3.436  12.588  5.219   1.00 0.00 ? 55 ALA B N    2  
ATOM 4029  C CA   . ALA B 1 51 ? -3.651  13.492  6.336   1.00 0.00 ? 55 ALA B CA   2  
ATOM 4030  C C    . ALA B 1 51 ? -5.005  13.185  6.980   1.00 0.00 ? 55 ALA B C    2  
ATOM 4031  O O    . ALA B 1 51 ? -5.522  13.986  7.757   1.00 0.00 ? 55 ALA B O    2  
ATOM 4032  C CB   . ALA B 1 51 ? -3.551  14.938  5.848   1.00 0.00 ? 55 ALA B CB   2  
ATOM 4033  H H    . ALA B 1 51 ? -3.980  12.786  4.404   1.00 0.00 ? 55 ALA B H    2  
ATOM 4034  H HA   . ALA B 1 51 ? -2.862  13.312  7.066   1.00 0.00 ? 55 ALA B HA   2  
ATOM 4035  H HB1  . ALA B 1 51 ? -4.548  15.378  5.808   1.00 0.00 ? 55 ALA B HB1  2  
ATOM 4036  H HB2  . ALA B 1 51 ? -3.106  14.957  4.854   1.00 0.00 ? 55 ALA B HB2  2  
ATOM 4037  H HB3  . ALA B 1 51 ? -2.929  15.511  6.536   1.00 0.00 ? 55 ALA B HB3  2  
ATOM 4038  N N    . SER B 1 52 ? -5.540  12.024  6.633   1.00 0.00 ? 56 SER B N    2  
ATOM 4039  C CA   . SER B 1 52 ? -6.824  11.603  7.168   1.00 0.00 ? 56 SER B CA   2  
ATOM 4040  C C    . SER B 1 52 ? -6.642  10.365  8.049   1.00 0.00 ? 56 SER B C    2  
ATOM 4041  O O    . SER B 1 52 ? -5.806  9.511   7.761   1.00 0.00 ? 56 SER B O    2  
ATOM 4042  C CB   . SER B 1 52 ? -7.820  11.312  6.043   1.00 0.00 ? 56 SER B CB   2  
ATOM 4043  O OG   . SER B 1 52 ? -9.018  10.716  6.533   1.00 0.00 ? 56 SER B OG   2  
ATOM 4044  H H    . SER B 1 52 ? -5.113  11.379  6.000   1.00 0.00 ? 56 SER B H    2  
ATOM 4045  H HA   . SER B 1 52 ? -7.181  12.445  7.760   1.00 0.00 ? 56 SER B HA   2  
ATOM 4046  H HB2  . SER B 1 52 ? -8.062  12.239  5.525   1.00 0.00 ? 56 SER B HB2  2  
ATOM 4047  H HB3  . SER B 1 52 ? -7.358  10.649  5.312   1.00 0.00 ? 56 SER B HB3  2  
ATOM 4048  H HG   . SER B 1 52 ? -9.604  10.447  5.768   1.00 0.00 ? 56 SER B HG   2  
ATOM 4049  N N    . PRO B 1 53 ? -7.461  10.307  9.134   1.00 0.00 ? 57 PRO B N    2  
ATOM 4050  C CA   . PRO B 1 53 ? -7.399  9.189   10.059  1.00 0.00 ? 57 PRO B CA   2  
ATOM 4051  C C    . PRO B 1 53 ? -8.051  7.942   9.457   1.00 0.00 ? 57 PRO B C    2  
ATOM 4052  O O    . PRO B 1 53 ? -7.501  6.845   9.546   1.00 0.00 ? 57 PRO B O    2  
ATOM 4053  C CB   . PRO B 1 53 ? -8.101  9.678   11.315  1.00 0.00 ? 57 PRO B CB   2  
ATOM 4054  C CG   . PRO B 1 53 ? -8.934  10.876  10.887  1.00 0.00 ? 57 PRO B CG   2  
ATOM 4055  C CD   . PRO B 1 53 ? -8.464  11.301  9.506   1.00 0.00 ? 57 PRO B CD   2  
ATOM 4056  H HA   . PRO B 1 53 ? -6.448  8.940   10.239  1.00 0.00 ? 57 PRO B HA   2  
ATOM 4057  H HB2  . PRO B 1 53 ? -8.731  8.896   11.740  1.00 0.00 ? 57 PRO B HB2  2  
ATOM 4058  H HB3  . PRO B 1 53 ? -7.380  9.958   12.082  1.00 0.00 ? 57 PRO B HB3  2  
ATOM 4059  H HG2  . PRO B 1 53 ? -9.993  10.617  10.868  1.00 0.00 ? 57 PRO B HG2  2  
ATOM 4060  H HG3  . PRO B 1 53 ? -8.819  11.694  11.598  1.00 0.00 ? 57 PRO B HG3  2  
ATOM 4061  H HD2  . PRO B 1 53 ? -9.289  11.316  8.794   1.00 0.00 ? 57 PRO B HD2  2  
ATOM 4062  H HD3  . PRO B 1 53 ? -8.040  12.304  9.523   1.00 0.00 ? 57 PRO B HD3  2  
ATOM 4063  N N    . MET B 1 54 ? -9.213  8.152   8.857   1.00 0.00 ? 58 MET B N    2  
ATOM 4064  C CA   . MET B 1 54 ? -9.945  7.059   8.241   1.00 0.00 ? 58 MET B CA   2  
ATOM 4065  C C    . MET B 1 54 ? -9.109  6.384   7.152   1.00 0.00 ? 58 MET B C    2  
ATOM 4066  O O    . MET B 1 54 ? -9.299  5.204   6.859   1.00 0.00 ? 58 MET B O    2  
ATOM 4067  C CB   . MET B 1 54 ? -11.243 7.593   7.631   1.00 0.00 ? 58 MET B CB   2  
ATOM 4068  C CG   . MET B 1 54 ? -12.152 6.446   7.184   1.00 0.00 ? 58 MET B CG   2  
ATOM 4069  S SD   . MET B 1 54 ? -12.645 5.472   8.596   1.00 0.00 ? 58 MET B SD   2  
ATOM 4070  C CE   . MET B 1 54 ? -13.261 6.764   9.663   1.00 0.00 ? 58 MET B CE   2  
ATOM 4071  H H    . MET B 1 54 ? -9.654  9.047   8.789   1.00 0.00 ? 58 MET B H    2  
ATOM 4072  H HA   . MET B 1 54 ? -10.147 6.351   9.045   1.00 0.00 ? 58 MET B HA   2  
ATOM 4073  H HB2  . MET B 1 54 ? -11.764 8.212   8.361   1.00 0.00 ? 58 MET B HB2  2  
ATOM 4074  H HB3  . MET B 1 54 ? -11.012 8.232   6.778   1.00 0.00 ? 58 MET B HB3  2  
ATOM 4075  H HG2  . MET B 1 54 ? -13.033 6.844   6.681   1.00 0.00 ? 58 MET B HG2  2  
ATOM 4076  H HG3  . MET B 1 54 ? -11.630 5.817   6.463   1.00 0.00 ? 58 MET B HG3  2  
ATOM 4077  H HE1  . MET B 1 54 ? -13.879 7.450   9.084   1.00 0.00 ? 58 MET B HE1  2  
ATOM 4078  H HE2  . MET B 1 54 ? -13.858 6.322   10.461  1.00 0.00 ? 58 MET B HE2  2  
ATOM 4079  H HE3  . MET B 1 54 ? -12.422 7.308   10.097  1.00 0.00 ? 58 MET B HE3  2  
ATOM 4080  N N    . VAL B 1 55 ? -8.201  7.161   6.581   1.00 0.00 ? 59 VAL B N    2  
ATOM 4081  C CA   . VAL B 1 55 ? -7.334  6.654   5.531   1.00 0.00 ? 59 VAL B CA   2  
ATOM 4082  C C    . VAL B 1 55 ? -6.340  5.659   6.132   1.00 0.00 ? 59 VAL B C    2  
ATOM 4083  O O    . VAL B 1 55 ? -5.712  4.888   5.407   1.00 0.00 ? 59 VAL B O    2  
ATOM 4084  C CB   . VAL B 1 55 ? -6.653  7.817   4.807   1.00 0.00 ? 59 VAL B CB   2  
ATOM 4085  C CG1  . VAL B 1 55 ? -5.336  7.369   4.169   1.00 0.00 ? 59 VAL B CG1  2  
ATOM 4086  C CG2  . VAL B 1 55 ? -7.585  8.435   3.763   1.00 0.00 ? 59 VAL B CG2  2  
ATOM 4087  H H    . VAL B 1 55 ? -8.052  8.120   6.824   1.00 0.00 ? 59 VAL B H    2  
ATOM 4088  H HA   . VAL B 1 55 ? -7.963  6.130   4.810   1.00 0.00 ? 59 VAL B HA   2  
ATOM 4089  H HB   . VAL B 1 55 ? -6.423  8.584   5.546   1.00 0.00 ? 59 VAL B HB   2  
ATOM 4090  H HG11 . VAL B 1 55 ? -5.520  6.518   3.514   1.00 0.00 ? 59 VAL B HG11 2  
ATOM 4091  H HG12 . VAL B 1 55 ? -4.915  8.191   3.589   1.00 0.00 ? 59 VAL B HG12 2  
ATOM 4092  H HG13 . VAL B 1 55 ? -4.634  7.080   4.951   1.00 0.00 ? 59 VAL B HG13 2  
ATOM 4093  H HG21 . VAL B 1 55 ? -7.914  7.663   3.067   1.00 0.00 ? 59 VAL B HG21 2  
ATOM 4094  H HG22 . VAL B 1 55 ? -8.452  8.868   4.261   1.00 0.00 ? 59 VAL B HG22 2  
ATOM 4095  H HG23 . VAL B 1 55 ? -7.053  9.214   3.216   1.00 0.00 ? 59 VAL B HG23 2  
ATOM 4096  N N    . LYS B 1 56 ? -6.228  5.707   7.451   1.00 0.00 ? 60 LYS B N    2  
ATOM 4097  C CA   . LYS B 1 56 ? -5.321  4.820   8.159   1.00 0.00 ? 60 LYS B CA   2  
ATOM 4098  C C    . LYS B 1 56 ? -6.101  3.614   8.686   1.00 0.00 ? 60 LYS B C    2  
ATOM 4099  O O    . LYS B 1 56 ? -5.545  2.765   9.381   1.00 0.00 ? 60 LYS B O    2  
ATOM 4100  C CB   . LYS B 1 56 ? -4.562  5.584   9.245   1.00 0.00 ? 60 LYS B CB   2  
ATOM 4101  C CG   . LYS B 1 56 ? -4.101  6.950   8.735   1.00 0.00 ? 60 LYS B CG   2  
ATOM 4102  C CD   . LYS B 1 56 ? -3.003  6.800   7.680   1.00 0.00 ? 60 LYS B CD   2  
ATOM 4103  C CE   . LYS B 1 56 ? -1.632  6.628   8.336   1.00 0.00 ? 60 LYS B CE   2  
ATOM 4104  N NZ   . LYS B 1 56 ? -1.357  5.197   8.594   1.00 0.00 ? 60 LYS B NZ   2  
ATOM 4105  H H    . LYS B 1 56 ? -6.743  6.337   8.034   1.00 0.00 ? 60 LYS B H    2  
ATOM 4106  H HA   . LYS B 1 56 ? -4.583  4.466   7.439   1.00 0.00 ? 60 LYS B HA   2  
ATOM 4107  H HB2  . LYS B 1 56 ? -5.202  5.715   10.118  1.00 0.00 ? 60 LYS B HB2  2  
ATOM 4108  H HB3  . LYS B 1 56 ? -3.699  5.002   9.569   1.00 0.00 ? 60 LYS B HB3  2  
ATOM 4109  H HG2  . LYS B 1 56 ? -4.948  7.488   8.309   1.00 0.00 ? 60 LYS B HG2  2  
ATOM 4110  H HG3  . LYS B 1 56 ? -3.731  7.548   9.568   1.00 0.00 ? 60 LYS B HG3  2  
ATOM 4111  H HD2  . LYS B 1 56 ? -3.218  5.939   7.047   1.00 0.00 ? 60 LYS B HD2  2  
ATOM 4112  H HD3  . LYS B 1 56 ? -2.993  7.676   7.032   1.00 0.00 ? 60 LYS B HD3  2  
ATOM 4113  H HE2  . LYS B 1 56 ? -0.858  7.042   7.690   1.00 0.00 ? 60 LYS B HE2  2  
ATOM 4114  H HE3  . LYS B 1 56 ? -1.598  7.185   9.272   1.00 0.00 ? 60 LYS B HE3  2  
ATOM 4115  H HZ1  . LYS B 1 56 ? -1.949  4.634   8.017   1.00 0.00 ? 60 LYS B HZ1  2  
ATOM 4116  H HZ2  . LYS B 1 56 ? -0.399  4.998   8.383   1.00 0.00 ? 60 LYS B HZ2  2  
ATOM 4117  H HZ3  . LYS B 1 56 ? -1.536  4.991   9.556   1.00 0.00 ? 60 LYS B HZ3  2  
ATOM 4118  N N    . LYS B 1 57 ? -7.378  3.577   8.335   1.00 0.00 ? 61 LYS B N    2  
ATOM 4119  C CA   . LYS B 1 57 ? -8.241  2.489   8.764   1.00 0.00 ? 61 LYS B CA   2  
ATOM 4120  C C    . LYS B 1 57 ? -8.727  1.715   7.537   1.00 0.00 ? 61 LYS B C    2  
ATOM 4121  O O    . LYS B 1 57 ? -9.220  0.595   7.660   1.00 0.00 ? 61 LYS B O    2  
ATOM 4122  C CB   . LYS B 1 57 ? -9.374  3.019   9.645   1.00 0.00 ? 61 LYS B CB   2  
ATOM 4123  C CG   . LYS B 1 57 ? -8.820  3.733   10.879  1.00 0.00 ? 61 LYS B CG   2  
ATOM 4124  C CD   . LYS B 1 57 ? -9.624  3.369   12.129  1.00 0.00 ? 61 LYS B CD   2  
ATOM 4125  C CE   . LYS B 1 57 ? -9.078  4.092   13.362  1.00 0.00 ? 61 LYS B CE   2  
ATOM 4126  N NZ   . LYS B 1 57 ? -9.973  3.886   14.523  1.00 0.00 ? 61 LYS B NZ   2  
ATOM 4127  H H    . LYS B 1 57 ? -7.823  4.271   7.769   1.00 0.00 ? 61 LYS B H    2  
ATOM 4128  H HA   . LYS B 1 57 ? -7.641  1.819   9.379   1.00 0.00 ? 61 LYS B HA   2  
ATOM 4129  H HB2  . LYS B 1 57 ? -9.995  3.707   9.071   1.00 0.00 ? 61 LYS B HB2  2  
ATOM 4130  H HB3  . LYS B 1 57 ? -10.015 2.194   9.954   1.00 0.00 ? 61 LYS B HB3  2  
ATOM 4131  H HG2  . LYS B 1 57 ? -7.775  3.460   11.023  1.00 0.00 ? 61 LYS B HG2  2  
ATOM 4132  H HG3  . LYS B 1 57 ? -8.850  4.811   10.724  1.00 0.00 ? 61 LYS B HG3  2  
ATOM 4133  H HD2  . LYS B 1 57 ? -10.671 3.634   11.982  1.00 0.00 ? 61 LYS B HD2  2  
ATOM 4134  H HD3  . LYS B 1 57 ? -9.587  2.292   12.289  1.00 0.00 ? 61 LYS B HD3  2  
ATOM 4135  H HE2  . LYS B 1 57 ? -8.079  3.723   13.595  1.00 0.00 ? 61 LYS B HE2  2  
ATOM 4136  H HE3  . LYS B 1 57 ? -8.983  5.158   13.154  1.00 0.00 ? 61 LYS B HE3  2  
ATOM 4137  H HZ1  . LYS B 1 57 ? -10.778 3.368   14.235  1.00 0.00 ? 61 LYS B HZ1  2  
ATOM 4138  H HZ2  . LYS B 1 57 ? -9.486  3.377   15.233  1.00 0.00 ? 61 LYS B HZ2  2  
ATOM 4139  H HZ3  . LYS B 1 57 ? -10.258 4.773   14.885  1.00 0.00 ? 61 LYS B HZ3  2  
ATOM 4140  N N    . ILE B 1 58 ? -8.570  2.342   6.380   1.00 0.00 ? 62 ILE B N    2  
ATOM 4141  C CA   . ILE B 1 58 ? -8.987  1.726   5.132   1.00 0.00 ? 62 ILE B CA   2  
ATOM 4142  C C    . ILE B 1 58 ? -7.799  0.986   4.512   1.00 0.00 ? 62 ILE B C    2  
ATOM 4143  O O    . ILE B 1 58 ? -7.978  0.149   3.629   1.00 0.00 ? 62 ILE B O    2  
ATOM 4144  C CB   . ILE B 1 58 ? -9.615  2.768   4.204   1.00 0.00 ? 62 ILE B CB   2  
ATOM 4145  C CG1  . ILE B 1 58 ? -10.767 3.497   4.898   1.00 0.00 ? 62 ILE B CG1  2  
ATOM 4146  C CG2  . ILE B 1 58 ? -10.051 2.133   2.882   1.00 0.00 ? 62 ILE B CG2  2  
ATOM 4147  C CD1  . ILE B 1 58 ? -10.923 4.918   4.355   1.00 0.00 ? 62 ILE B CD1  2  
ATOM 4148  H H    . ILE B 1 58 ? -8.168  3.253   6.289   1.00 0.00 ? 62 ILE B H    2  
ATOM 4149  H HA   . ILE B 1 58 ? -9.762  0.998   5.370   1.00 0.00 ? 62 ILE B HA   2  
ATOM 4150  H HB   . ILE B 1 58 ? -8.857  3.515   3.967   1.00 0.00 ? 62 ILE B HB   2  
ATOM 4151  H HG12 . ILE B 1 58 ? -11.694 2.943   4.749   1.00 0.00 ? 62 ILE B HG12 2  
ATOM 4152  H HG13 . ILE B 1 58 ? -10.586 3.532   5.972   1.00 0.00 ? 62 ILE B HG13 2  
ATOM 4153  H HG21 . ILE B 1 58 ? -9.947  1.050   2.948   1.00 0.00 ? 62 ILE B HG21 2  
ATOM 4154  H HG22 . ILE B 1 58 ? -11.092 2.386   2.683   1.00 0.00 ? 62 ILE B HG22 2  
ATOM 4155  H HG23 . ILE B 1 58 ? -9.424  2.509   2.074   1.00 0.00 ? 62 ILE B HG23 2  
ATOM 4156  H HD11 . ILE B 1 58 ? -10.659 4.934   3.297   1.00 0.00 ? 62 ILE B HD11 2  
ATOM 4157  H HD12 . ILE B 1 58 ? -11.957 5.242   4.476   1.00 0.00 ? 62 ILE B HD12 2  
ATOM 4158  H HD13 . ILE B 1 58 ? -10.265 5.591   4.904   1.00 0.00 ? 62 ILE B HD13 2  
ATOM 4159  N N    . ILE B 1 59 ? -6.614  1.322   5.000   1.00 0.00 ? 63 ILE B N    2  
ATOM 4160  C CA   . ILE B 1 59 ? -5.398  0.700   4.505   1.00 0.00 ? 63 ILE B CA   2  
ATOM 4161  C C    . ILE B 1 59 ? -5.044  -0.496  5.392   1.00 0.00 ? 63 ILE B C    2  
ATOM 4162  O O    . ILE B 1 59 ? -4.894  -1.614  4.902   1.00 0.00 ? 63 ILE B O    2  
ATOM 4163  C CB   . ILE B 1 59 ? -4.276  1.733   4.391   1.00 0.00 ? 63 ILE B CB   2  
ATOM 4164  C CG1  . ILE B 1 59 ? -4.490  2.643   3.179   1.00 0.00 ? 63 ILE B CG1  2  
ATOM 4165  C CG2  . ILE B 1 59 ? -2.905  1.054   4.362   1.00 0.00 ? 63 ILE B CG2  2  
ATOM 4166  C CD1  . ILE B 1 59 ? -3.867  4.021   3.411   1.00 0.00 ? 63 ILE B CD1  2  
ATOM 4167  H H    . ILE B 1 59 ? -6.478  2.004   5.719   1.00 0.00 ? 63 ILE B H    2  
ATOM 4168  H HA   . ILE B 1 59 ? -5.604  0.334   3.499   1.00 0.00 ? 63 ILE B HA   2  
ATOM 4169  H HB   . ILE B 1 59 ? -4.303  2.367   5.277   1.00 0.00 ? 63 ILE B HB   2  
ATOM 4170  H HG12 . ILE B 1 59 ? -4.049  2.185   2.294   1.00 0.00 ? 63 ILE B HG12 2  
ATOM 4171  H HG13 . ILE B 1 59 ? -5.557  2.751   2.985   1.00 0.00 ? 63 ILE B HG13 2  
ATOM 4172  H HG21 . ILE B 1 59 ? -3.006  0.050   3.951   1.00 0.00 ? 63 ILE B HG21 2  
ATOM 4173  H HG22 . ILE B 1 59 ? -2.225  1.635   3.739   1.00 0.00 ? 63 ILE B HG22 2  
ATOM 4174  H HG23 . ILE B 1 59 ? -2.508  0.994   5.375   1.00 0.00 ? 63 ILE B HG23 2  
ATOM 4175  H HD11 . ILE B 1 59 ? -3.803  4.215   4.482   1.00 0.00 ? 63 ILE B HD11 2  
ATOM 4176  H HD12 . ILE B 1 59 ? -2.868  4.046   2.977   1.00 0.00 ? 63 ILE B HD12 2  
ATOM 4177  H HD13 . ILE B 1 59 ? -4.487  4.784   2.940   1.00 0.00 ? 63 ILE B HD13 2  
ATOM 4178  N N    . GLU B 1 60 ? -4.922  -0.219  6.682   1.00 0.00 ? 64 GLU B N    2  
ATOM 4179  C CA   . GLU B 1 60 ? -4.588  -1.258  7.642   1.00 0.00 ? 64 GLU B CA   2  
ATOM 4180  C C    . GLU B 1 60 ? -5.557  -2.435  7.508   1.00 0.00 ? 64 GLU B C    2  
ATOM 4181  O O    . GLU B 1 60 ? -5.163  -3.589  7.670   1.00 0.00 ? 64 GLU B O    2  
ATOM 4182  C CB   . GLU B 1 60 ? -4.590  -0.707  9.069   1.00 0.00 ? 64 GLU B CB   2  
ATOM 4183  C CG   . GLU B 1 60 ? -3.460  0.306   9.267   1.00 0.00 ? 64 GLU B CG   2  
ATOM 4184  C CD   . GLU B 1 60 ? -3.748  1.224   10.457  1.00 0.00 ? 64 GLU B CD   2  
ATOM 4185  O OE1  . GLU B 1 60 ? -4.708  0.912   11.195  1.00 0.00 ? 64 GLU B OE1  2  
ATOM 4186  O OE2  . GLU B 1 60 ? -3.002  2.216   10.602  1.00 0.00 ? 64 GLU B OE2  2  
ATOM 4187  H H    . GLU B 1 60 ? -5.045  0.693   7.073   1.00 0.00 ? 64 GLU B H    2  
ATOM 4188  H HA   . GLU B 1 60 ? -3.579  -1.578  7.384   1.00 0.00 ? 64 GLU B HA   2  
ATOM 4189  H HB2  . GLU B 1 60 ? -5.549  -0.233  9.279   1.00 0.00 ? 64 GLU B HB2  2  
ATOM 4190  H HB3  . GLU B 1 60 ? -4.477  -1.526  9.780   1.00 0.00 ? 64 GLU B HB3  2  
ATOM 4191  H HG2  . GLU B 1 60 ? -2.519  -0.220  9.428   1.00 0.00 ? 64 GLU B HG2  2  
ATOM 4192  H HG3  . GLU B 1 60 ? -3.341  0.904   8.363   1.00 0.00 ? 64 GLU B HG3  2  
ATOM 4193  N N    . LYS B 1 61 ? -6.805  -2.102  7.213   1.00 0.00 ? 65 LYS B N    2  
ATOM 4194  C CA   . LYS B 1 61 ? -7.833  -3.117  7.055   1.00 0.00 ? 65 LYS B CA   2  
ATOM 4195  C C    . LYS B 1 61 ? -7.584  -3.891  5.759   1.00 0.00 ? 65 LYS B C    2  
ATOM 4196  O O    . LYS B 1 61 ? -7.807  -5.100  5.701   1.00 0.00 ? 65 LYS B O    2  
ATOM 4197  C CB   . LYS B 1 61 ? -9.225  -2.488  7.139   1.00 0.00 ? 65 LYS B CB   2  
ATOM 4198  C CG   . LYS B 1 61 ? -9.600  -2.176  8.589   1.00 0.00 ? 65 LYS B CG   2  
ATOM 4199  C CD   . LYS B 1 61 ? -10.486 -3.277  9.175   1.00 0.00 ? 65 LYS B CD   2  
ATOM 4200  C CE   . LYS B 1 61 ? -10.110 -3.568  10.629  1.00 0.00 ? 65 LYS B CE   2  
ATOM 4201  N NZ   . LYS B 1 61 ? -11.073 -4.516  11.234  1.00 0.00 ? 65 LYS B NZ   2  
ATOM 4202  H H    . LYS B 1 61 ? -7.117  -1.161  7.083   1.00 0.00 ? 65 LYS B H    2  
ATOM 4203  H HA   . LYS B 1 61 ? -7.741  -3.808  7.893   1.00 0.00 ? 65 LYS B HA   2  
ATOM 4204  H HB2  . LYS B 1 61 ? -9.250  -1.572  6.548   1.00 0.00 ? 65 LYS B HB2  2  
ATOM 4205  H HB3  . LYS B 1 61 ? -9.961  -3.166  6.706   1.00 0.00 ? 65 LYS B HB3  2  
ATOM 4206  H HG2  . LYS B 1 61 ? -8.695  -2.075  9.188   1.00 0.00 ? 65 LYS B HG2  2  
ATOM 4207  H HG3  . LYS B 1 61 ? -10.122 -1.220  8.636   1.00 0.00 ? 65 LYS B HG3  2  
ATOM 4208  H HD2  . LYS B 1 61 ? -11.532 -2.975  9.119   1.00 0.00 ? 65 LYS B HD2  2  
ATOM 4209  H HD3  . LYS B 1 61 ? -10.385 -4.185  8.581   1.00 0.00 ? 65 LYS B HD3  2  
ATOM 4210  H HE2  . LYS B 1 61 ? -9.103  -3.984  10.674  1.00 0.00 ? 65 LYS B HE2  2  
ATOM 4211  H HE3  . LYS B 1 61 ? -10.097 -2.640  11.200  1.00 0.00 ? 65 LYS B HE3  2  
ATOM 4212  H HZ1  . LYS B 1 61 ? -11.116 -5.346  10.679  1.00 0.00 ? 65 LYS B HZ1  2  
ATOM 4213  H HZ2  . LYS B 1 61 ? -10.774 -4.748  12.159  1.00 0.00 ? 65 LYS B HZ2  2  
ATOM 4214  H HZ3  . LYS B 1 61 ? -11.978 -4.092  11.272  1.00 0.00 ? 65 LYS B HZ3  2  
ATOM 4215  N N    . MET B 1 62 ? -7.126  -3.163  4.751   1.00 0.00 ? 66 MET B N    2  
ATOM 4216  C CA   . MET B 1 62 ? -6.845  -3.766  3.460   1.00 0.00 ? 66 MET B CA   2  
ATOM 4217  C C    . MET B 1 62 ? -5.787  -4.864  3.586   1.00 0.00 ? 66 MET B C    2  
ATOM 4218  O O    . MET B 1 62 ? -5.883  -5.902  2.932   1.00 0.00 ? 66 MET B O    2  
ATOM 4219  C CB   . MET B 1 62 ? -6.352  -2.691  2.490   1.00 0.00 ? 66 MET B CB   2  
ATOM 4220  C CG   . MET B 1 62 ? -7.306  -2.543  1.303   1.00 0.00 ? 66 MET B CG   2  
ATOM 4221  S SD   . MET B 1 62 ? -7.447  -4.096  0.436   1.00 0.00 ? 66 MET B SD   2  
ATOM 4222  C CE   . MET B 1 62 ? -5.726  -4.408  0.078   1.00 0.00 ? 66 MET B CE   2  
ATOM 4223  H H    . MET B 1 62 ? -6.948  -2.181  4.807   1.00 0.00 ? 66 MET B H    2  
ATOM 4224  H HA   . MET B 1 62 ? -7.789  -4.198  3.127   1.00 0.00 ? 66 MET B HA   2  
ATOM 4225  H HB2  . MET B 1 62 ? -6.264  -1.738  3.012   1.00 0.00 ? 66 MET B HB2  2  
ATOM 4226  H HB3  . MET B 1 62 ? -5.356  -2.949  2.131   1.00 0.00 ? 66 MET B HB3  2  
ATOM 4227  H HG2  . MET B 1 62 ? -8.287  -2.221  1.653   1.00 0.00 ? 66 MET B HG2  2  
ATOM 4228  H HG3  . MET B 1 62 ? -6.940  -1.770  0.626   1.00 0.00 ? 66 MET B HG3  2  
ATOM 4229  H HE1  . MET B 1 62 ? -5.152  -3.495  0.230   1.00 0.00 ? 66 MET B HE1  2  
ATOM 4230  H HE2  . MET B 1 62 ? -5.352  -5.188  0.742   1.00 0.00 ? 66 MET B HE2  2  
ATOM 4231  H HE3  . MET B 1 62 ? -5.624  -4.733  -0.958  1.00 0.00 ? 66 MET B HE3  2  
ATOM 4232  N N    . LEU B 1 63 ? -4.802  -4.598  4.431   1.00 0.00 ? 67 LEU B N    2  
ATOM 4233  C CA   . LEU B 1 63 ? -3.727  -5.551  4.651   1.00 0.00 ? 67 LEU B CA   2  
ATOM 4234  C C    . LEU B 1 63 ? -4.275  -6.767  5.399   1.00 0.00 ? 67 LEU B C    2  
ATOM 4235  O O    . LEU B 1 63 ? -3.631  -7.814  5.445   1.00 0.00 ? 67 LEU B O    2  
ATOM 4236  C CB   . LEU B 1 63 ? -2.548  -4.875  5.355   1.00 0.00 ? 67 LEU B CB   2  
ATOM 4237  C CG   . LEU B 1 63 ? -1.646  -4.010  4.472   1.00 0.00 ? 67 LEU B CG   2  
ATOM 4238  C CD1  . LEU B 1 63 ? -2.458  -2.937  3.744   1.00 0.00 ? 67 LEU B CD1  2  
ATOM 4239  C CD2  . LEU B 1 63 ? -0.499  -3.407  5.285   1.00 0.00 ? 67 LEU B CD2  2  
ATOM 4240  H H    . LEU B 1 63 ? -4.731  -3.752  4.958   1.00 0.00 ? 67 LEU B H    2  
ATOM 4241  H HA   . LEU B 1 63 ? -3.374  -5.877  3.672   1.00 0.00 ? 67 LEU B HA   2  
ATOM 4242  H HB2  . LEU B 1 63 ? -2.939  -4.254  6.160   1.00 0.00 ? 67 LEU B HB2  2  
ATOM 4243  H HB3  . LEU B 1 63 ? -1.935  -5.649  5.818   1.00 0.00 ? 67 LEU B HB3  2  
ATOM 4244  H HG   . LEU B 1 63 ? -1.200  -4.648  3.709   1.00 0.00 ? 67 LEU B HG   2  
ATOM 4245  H HD11 . LEU B 1 63 ? -3.283  -3.406  3.207   1.00 0.00 ? 67 LEU B HD11 2  
ATOM 4246  H HD12 . LEU B 1 63 ? -2.855  -2.227  4.470   1.00 0.00 ? 67 LEU B HD12 2  
ATOM 4247  H HD13 . LEU B 1 63 ? -1.816  -2.412  3.037   1.00 0.00 ? 67 LEU B HD13 2  
ATOM 4248  H HD21 . LEU B 1 63 ? -0.621  -3.670  6.336   1.00 0.00 ? 67 LEU B HD21 2  
ATOM 4249  H HD22 . LEU B 1 63 ? 0.450   -3.800  4.920   1.00 0.00 ? 67 LEU B HD22 2  
ATOM 4250  H HD23 . LEU B 1 63 ? -0.508  -2.322  5.178   1.00 0.00 ? 67 LEU B HD23 2  
ATOM 4251  N N    . LYS B 1 64 ? -5.458  -6.589  5.967   1.00 0.00 ? 68 LYS B N    2  
ATOM 4252  C CA   . LYS B 1 64 ? -6.100  -7.659  6.712   1.00 0.00 ? 68 LYS B CA   2  
ATOM 4253  C C    . LYS B 1 64 ? -7.213  -8.272  5.859   1.00 0.00 ? 68 LYS B C    2  
ATOM 4254  O O    . LYS B 1 64 ? -7.597  -9.422  6.065   1.00 0.00 ? 68 LYS B O    2  
ATOM 4255  C CB   . LYS B 1 64 ? -6.577  -7.153  8.074   1.00 0.00 ? 68 LYS B CB   2  
ATOM 4256  C CG   . LYS B 1 64 ? -5.771  -7.789  9.209   1.00 0.00 ? 68 LYS B CG   2  
ATOM 4257  C CD   . LYS B 1 64 ? -6.640  -7.991  10.452  1.00 0.00 ? 68 LYS B CD   2  
ATOM 4258  C CE   . LYS B 1 64 ? -5.889  -8.789  11.520  1.00 0.00 ? 68 LYS B CE   2  
ATOM 4259  N NZ   . LYS B 1 64 ? -5.729  -7.983  12.751  1.00 0.00 ? 68 LYS B NZ   2  
ATOM 4260  H H    . LYS B 1 64 ? -5.975  -5.734  5.926   1.00 0.00 ? 68 LYS B H    2  
ATOM 4261  H HA   . LYS B 1 64 ? -5.347  -8.425  6.898   1.00 0.00 ? 68 LYS B HA   2  
ATOM 4262  H HB2  . LYS B 1 64 ? -6.481  -6.068  8.118   1.00 0.00 ? 68 LYS B HB2  2  
ATOM 4263  H HB3  . LYS B 1 64 ? -7.635  -7.383  8.202   1.00 0.00 ? 68 LYS B HB3  2  
ATOM 4264  H HG2  . LYS B 1 64 ? -5.369  -8.747  8.881   1.00 0.00 ? 68 LYS B HG2  2  
ATOM 4265  H HG3  . LYS B 1 64 ? -4.920  -7.154  9.455   1.00 0.00 ? 68 LYS B HG3  2  
ATOM 4266  H HD2  . LYS B 1 64 ? -6.934  -7.023  10.856  1.00 0.00 ? 68 LYS B HD2  2  
ATOM 4267  H HD3  . LYS B 1 64 ? -7.556  -8.515  10.178  1.00 0.00 ? 68 LYS B HD3  2  
ATOM 4268  H HE2  . LYS B 1 64 ? -6.434  -9.706  11.747  1.00 0.00 ? 68 LYS B HE2  2  
ATOM 4269  H HE3  . LYS B 1 64 ? -4.911  -9.085  11.142  1.00 0.00 ? 68 LYS B HE3  2  
ATOM 4270  H HZ1  . LYS B 1 64 ? -5.287  -7.115  12.526  1.00 0.00 ? 68 LYS B HZ1  2  
ATOM 4271  H HZ2  . LYS B 1 64 ? -6.627  -7.806  13.153  1.00 0.00 ? 68 LYS B HZ2  2  
ATOM 4272  H HZ3  . LYS B 1 64 ? -5.163  -8.485  13.406  1.00 0.00 ? 68 LYS B HZ3  2  
ATOM 4273  N N    . ASN B 1 65 ? -7.699  -7.476  4.918   1.00 0.00 ? 69 ASN B N    2  
ATOM 4274  C CA   . ASN B 1 65 ? -8.761  -7.925  4.033   1.00 0.00 ? 69 ASN B CA   2  
ATOM 4275  C C    . ASN B 1 65 ? -10.008 -8.244  4.860   1.00 0.00 ? 69 ASN B C    2  
ATOM 4276  O O    . ASN B 1 65 ? -10.950 -7.455  4.898   1.00 0.00 ? 69 ASN B O    2  
ATOM 4277  C CB   . ASN B 1 65 ? -8.352  -9.195  3.284   1.00 0.00 ? 69 ASN B CB   2  
ATOM 4278  C CG   . ASN B 1 65 ? -9.538  -9.785  2.519   1.00 0.00 ? 69 ASN B CG   2  
ATOM 4279  O OD1  . ASN B 1 65 ? -10.513 -9.115  2.219   1.00 0.00 ? 69 ASN B OD1  2  
ATOM 4280  N ND2  . ASN B 1 65 ? -9.402  -11.074 2.220   1.00 0.00 ? 69 ASN B ND2  2  
ATOM 4281  H H    . ASN B 1 65 ? -7.382  -6.541  4.756   1.00 0.00 ? 69 ASN B H    2  
ATOM 4282  H HA   . ASN B 1 65 ? -8.921  -7.101  3.337   1.00 0.00 ? 69 ASN B HA   2  
ATOM 4283  H HB2  . ASN B 1 65 ? -7.544  -8.967  2.589   1.00 0.00 ? 69 ASN B HB2  2  
ATOM 4284  H HB3  . ASN B 1 65 ? -7.968  -9.930  3.990   1.00 0.00 ? 69 ASN B HB3  2  
ATOM 4285  H HD21 . ASN B 1 65 ? -8.576  -11.566 2.496   1.00 0.00 ? 69 ASN B HD21 2  
ATOM 4286  H HD22 . ASN B 1 65 ? -10.125 -11.551 1.721   1.00 0.00 ? 69 ASN B HD22 2  
ATOM 4287  N N    . GLY B 1 66 ? -9.973  -9.403  5.501   1.00 0.00 ? 70 GLY B N    2  
ATOM 4288  C CA   . GLY B 1 66 ? -11.088 -9.836  6.325   1.00 0.00 ? 70 GLY B CA   2  
ATOM 4289  C C    . GLY B 1 66 ? -11.581 -11.220 5.897   1.00 0.00 ? 70 GLY B C    2  
ATOM 4290  O O    . GLY B 1 66 ? -11.154 -11.744 4.869   1.00 0.00 ? 70 GLY B O    2  
ATOM 4291  H H    . GLY B 1 66 ? -9.202  -10.039 5.464   1.00 0.00 ? 70 GLY B H    2  
ATOM 4292  H HA2  . GLY B 1 66 ? -10.784 -9.863  7.371   1.00 0.00 ? 70 GLY B HA2  2  
ATOM 4293  H HA3  . GLY B 1 66 ? -11.903 -9.116  6.248   1.00 0.00 ? 70 GLY B HA3  2  
ATOM 4294  N N    . LYS B 1 67 ? -12.473 -11.772 6.706   1.00 0.00 ? 71 LYS B N    2  
ATOM 4295  C CA   . LYS B 1 67 ? -13.029 -13.084 6.424   1.00 0.00 ? 71 LYS B CA   2  
ATOM 4296  C C    . LYS B 1 67 ? -14.177 -12.943 5.423   1.00 0.00 ? 71 LYS B C    2  
ATOM 4297  O O    . LYS B 1 67 ? -14.070 -13.391 4.282   1.00 0.00 ? 71 LYS B O    2  
ATOM 4298  C CB   . LYS B 1 67 ? -13.429 -13.788 7.722   1.00 0.00 ? 71 LYS B CB   2  
ATOM 4299  C CG   . LYS B 1 67 ? -12.256 -14.583 8.299   1.00 0.00 ? 71 LYS B CG   2  
ATOM 4300  C CD   . LYS B 1 67 ? -12.363 -14.694 9.821   1.00 0.00 ? 71 LYS B CD   2  
ATOM 4301  C CE   . LYS B 1 67 ? -13.360 -15.783 10.222  1.00 0.00 ? 71 LYS B CE   2  
ATOM 4302  N NZ   . LYS B 1 67 ? -13.778 -15.610 11.631  1.00 0.00 ? 71 LYS B NZ   2  
ATOM 4303  H H    . LYS B 1 67 ? -12.815 -11.338 7.540   1.00 0.00 ? 71 LYS B H    2  
ATOM 4304  H HA   . LYS B 1 67 ? -12.241 -13.681 5.964   1.00 0.00 ? 71 LYS B HA   2  
ATOM 4305  H HB2  . LYS B 1 67 ? -13.766 -13.050 8.451   1.00 0.00 ? 71 LYS B HB2  2  
ATOM 4306  H HB3  . LYS B 1 67 ? -14.269 -14.456 7.535   1.00 0.00 ? 71 LYS B HB3  2  
ATOM 4307  H HG2  . LYS B 1 67 ? -12.237 -15.580 7.858   1.00 0.00 ? 71 LYS B HG2  2  
ATOM 4308  H HG3  . LYS B 1 67 ? -11.317 -14.099 8.031   1.00 0.00 ? 71 LYS B HG3  2  
ATOM 4309  H HD2  . LYS B 1 67 ? -11.384 -14.920 10.243  1.00 0.00 ? 71 LYS B HD2  2  
ATOM 4310  H HD3  . LYS B 1 67 ? -12.678 -13.737 10.238  1.00 0.00 ? 71 LYS B HD3  2  
ATOM 4311  H HE2  . LYS B 1 67 ? -14.233 -15.743 9.570   1.00 0.00 ? 71 LYS B HE2  2  
ATOM 4312  H HE3  . LYS B 1 67 ? -12.908 -16.766 10.089  1.00 0.00 ? 71 LYS B HE3  2  
ATOM 4313  H HZ1  . LYS B 1 67 ? -14.168 -14.697 11.753  1.00 0.00 ? 71 LYS B HZ1  2  
ATOM 4314  H HZ2  . LYS B 1 67 ? -14.464 -16.300 11.862  1.00 0.00 ? 71 LYS B HZ2  2  
ATOM 4315  H HZ3  . LYS B 1 67 ? -12.984 -15.716 12.230  1.00 0.00 ? 71 LYS B HZ3  2  
ATOM 4316  N N    . SER B 1 68 ? -15.250 -12.318 5.885   1.00 0.00 ? 72 SER B N    2  
ATOM 4317  C CA   . SER B 1 68 ? -16.417 -12.112 5.045   1.00 0.00 ? 72 SER B CA   2  
ATOM 4318  C C    . SER B 1 68 ? -17.463 -11.285 5.795   1.00 0.00 ? 72 SER B C    2  
ATOM 4319  O O    . SER B 1 68 ? -17.830 -10.196 5.356   1.00 0.00 ? 72 SER B O    2  
ATOM 4320  C CB   . SER B 1 68 ? -17.017 -13.447 4.598   1.00 0.00 ? 72 SER B CB   2  
ATOM 4321  O OG   . SER B 1 68 ? -17.284 -14.308 5.702   1.00 0.00 ? 72 SER B OG   2  
ATOM 4322  H H    . SER B 1 68 ? -15.329 -11.957 6.815   1.00 0.00 ? 72 SER B H    2  
ATOM 4323  H HA   . SER B 1 68 ? -16.052 -11.568 4.173   1.00 0.00 ? 72 SER B HA   2  
ATOM 4324  H HB2  . SER B 1 68 ? -17.941 -13.263 4.049   1.00 0.00 ? 72 SER B HB2  2  
ATOM 4325  H HB3  . SER B 1 68 ? -16.330 -13.941 3.911   1.00 0.00 ? 72 SER B HB3  2  
ATOM 4326  H HG   . SER B 1 68 ? -16.493 -14.336 6.313   1.00 0.00 ? 72 SER B HG   2  
ATOM 4327  N N    . ASN B 1 69 ? -17.913 -11.833 6.914   1.00 0.00 ? 73 ASN B N    2  
ATOM 4328  C CA   . ASN B 1 69 ? -18.909 -11.159 7.729   1.00 0.00 ? 73 ASN B CA   2  
ATOM 4329  C C    . ASN B 1 69 ? -19.272 -12.047 8.921   1.00 0.00 ? 73 ASN B C    2  
ATOM 4330  O O    . ASN B 1 69 ? -18.913 -13.223 8.956   1.00 0.00 ? 73 ASN B O    2  
ATOM 4331  C CB   . ASN B 1 69 ? -20.187 -10.894 6.931   1.00 0.00 ? 73 ASN B CB   2  
ATOM 4332  C CG   . ASN B 1 69 ? -20.381 -9.396  6.688   1.00 0.00 ? 73 ASN B CG   2  
ATOM 4333  O OD1  . ASN B 1 69 ? -20.531 -8.606  7.606   1.00 0.00 ? 73 ASN B OD1  2  
ATOM 4334  N ND2  . ASN B 1 69 ? -20.372 -9.050  5.404   1.00 0.00 ? 73 ASN B ND2  2  
ATOM 4335  H H    . ASN B 1 69 ? -17.609 -12.719 7.264   1.00 0.00 ? 73 ASN B H    2  
ATOM 4336  H HA   . ASN B 1 69 ? -18.444 -10.222 8.034   1.00 0.00 ? 73 ASN B HA   2  
ATOM 4337  H HB2  . ASN B 1 69 ? -20.138 -11.417 5.976   1.00 0.00 ? 73 ASN B HB2  2  
ATOM 4338  H HB3  . ASN B 1 69 ? -21.046 -11.293 7.469   1.00 0.00 ? 73 ASN B HB3  2  
ATOM 4339  H HD21 . ASN B 1 69 ? -20.244 -9.748  4.699   1.00 0.00 ? 73 ASN B HD21 2  
ATOM 4340  H HD22 . ASN B 1 69 ? -20.491 -8.092  5.143   1.00 0.00 ? 73 ASN B HD22 2  
ATOM 4341  N N    . THR A 1 1  ? -11.736 -17.483 -16.036 1.00 0.00 ? 5  THR A N    3  
ATOM 4342  C CA   . THR A 1 1  ? -11.320 -16.590 -14.968 1.00 0.00 ? 5  THR A CA   3  
ATOM 4343  C C    . THR A 1 1  ? -10.459 -17.341 -13.950 1.00 0.00 ? 5  THR A C    3  
ATOM 4344  O O    . THR A 1 1  ? -10.878 -17.554 -12.814 1.00 0.00 ? 5  THR A O    3  
ATOM 4345  C CB   . THR A 1 1  ? -12.577 -15.966 -14.357 1.00 0.00 ? 5  THR A CB   3  
ATOM 4346  O OG1  . THR A 1 1  ? -13.250 -15.382 -15.469 1.00 0.00 ? 5  THR A OG1  3  
ATOM 4347  C CG2  . THR A 1 1  ? -12.258 -14.777 -13.449 1.00 0.00 ? 5  THR A CG2  3  
ATOM 4348  H H    . THR A 1 1  ? -11.167 -18.297 -16.152 1.00 0.00 ? 5  THR A H    3  
ATOM 4349  H HA   . THR A 1 1  ? -10.697 -15.806 -15.398 1.00 0.00 ? 5  THR A HA   3  
ATOM 4350  H HB   . THR A 1 1  ? -13.165 -16.715 -13.826 1.00 0.00 ? 5  THR A HB   3  
ATOM 4351  H HG1  . THR A 1 1  ? -12.742 -14.585 -15.796 1.00 0.00 ? 5  THR A HG1  3  
ATOM 4352  H HG21 . THR A 1 1  ? -11.423 -15.032 -12.795 1.00 0.00 ? 5  THR A HG21 3  
ATOM 4353  H HG22 . THR A 1 1  ? -11.990 -13.914 -14.059 1.00 0.00 ? 5  THR A HG22 3  
ATOM 4354  H HG23 . THR A 1 1  ? -13.132 -14.536 -12.844 1.00 0.00 ? 5  THR A HG23 3  
ATOM 4355  N N    . GLU A 1 2  ? -9.270  -17.721 -14.395 1.00 0.00 ? 6  GLU A N    3  
ATOM 4356  C CA   . GLU A 1 2  ? -8.346  -18.443 -13.537 1.00 0.00 ? 6  GLU A CA   3  
ATOM 4357  C C    . GLU A 1 2  ? -7.095  -17.602 -13.278 1.00 0.00 ? 6  GLU A C    3  
ATOM 4358  O O    . GLU A 1 2  ? -6.091  -17.745 -13.974 1.00 0.00 ? 6  GLU A O    3  
ATOM 4359  C CB   . GLU A 1 2  ? -7.979  -19.798 -14.145 1.00 0.00 ? 6  GLU A CB   3  
ATOM 4360  C CG   . GLU A 1 2  ? -7.492  -20.769 -13.068 1.00 0.00 ? 6  GLU A CG   3  
ATOM 4361  C CD   . GLU A 1 2  ? -8.672  -21.429 -12.350 1.00 0.00 ? 6  GLU A CD   3  
ATOM 4362  O OE1  . GLU A 1 2  ? -9.489  -22.055 -13.060 1.00 0.00 ? 6  GLU A OE1  3  
ATOM 4363  O OE2  . GLU A 1 2  ? -8.730  -21.292 -11.109 1.00 0.00 ? 6  GLU A OE2  3  
ATOM 4364  H H    . GLU A 1 2  ? -8.937  -17.543 -15.321 1.00 0.00 ? 6  GLU A H    3  
ATOM 4365  H HA   . GLU A 1 2  ? -8.884  -18.605 -12.603 1.00 0.00 ? 6  GLU A HA   3  
ATOM 4366  H HB2  . GLU A 1 2  ? -8.846  -20.220 -14.654 1.00 0.00 ? 6  GLU A HB2  3  
ATOM 4367  H HB3  . GLU A 1 2  ? -7.202  -19.665 -14.898 1.00 0.00 ? 6  GLU A HB3  3  
ATOM 4368  H HG2  . GLU A 1 2  ? -6.863  -21.535 -13.521 1.00 0.00 ? 6  GLU A HG2  3  
ATOM 4369  H HG3  . GLU A 1 2  ? -6.875  -20.236 -12.345 1.00 0.00 ? 6  GLU A HG3  3  
ATOM 4370  N N    . LEU A 1 3  ? -7.196  -16.743 -12.274 1.00 0.00 ? 7  LEU A N    3  
ATOM 4371  C CA   . LEU A 1 3  ? -6.085  -15.879 -11.913 1.00 0.00 ? 7  LEU A CA   3  
ATOM 4372  C C    . LEU A 1 3  ? -5.428  -16.406 -10.636 1.00 0.00 ? 7  LEU A C    3  
ATOM 4373  O O    . LEU A 1 3  ? -5.978  -17.278 -9.965  1.00 0.00 ? 7  LEU A O    3  
ATOM 4374  C CB   . LEU A 1 3  ? -6.549  -14.425 -11.811 1.00 0.00 ? 7  LEU A CB   3  
ATOM 4375  C CG   . LEU A 1 3  ? -7.029  -13.781 -13.113 1.00 0.00 ? 7  LEU A CG   3  
ATOM 4376  C CD1  . LEU A 1 3  ? -8.522  -14.037 -13.333 1.00 0.00 ? 7  LEU A CD1  3  
ATOM 4377  C CD2  . LEU A 1 3  ? -6.693  -12.289 -13.143 1.00 0.00 ? 7  LEU A CD2  3  
ATOM 4378  H H    . LEU A 1 3  ? -8.016  -16.633 -11.712 1.00 0.00 ? 7  LEU A H    3  
ATOM 4379  H HA   . LEU A 1 3  ? -5.357  -15.929 -12.723 1.00 0.00 ? 7  LEU A HA   3  
ATOM 4380  H HB2  . LEU A 1 3  ? -7.358  -14.373 -11.083 1.00 0.00 ? 7  LEU A HB2  3  
ATOM 4381  H HB3  . LEU A 1 3  ? -5.726  -13.829 -11.416 1.00 0.00 ? 7  LEU A HB3  3  
ATOM 4382  H HG   . LEU A 1 3  ? -6.497  -14.248 -13.942 1.00 0.00 ? 7  LEU A HG   3  
ATOM 4383  H HD11 . LEU A 1 3  ? -8.870  -14.787 -12.623 1.00 0.00 ? 7  LEU A HD11 3  
ATOM 4384  H HD12 . LEU A 1 3  ? -9.075  -13.110 -13.183 1.00 0.00 ? 7  LEU A HD12 3  
ATOM 4385  H HD13 . LEU A 1 3  ? -8.683  -14.396 -14.349 1.00 0.00 ? 7  LEU A HD13 3  
ATOM 4386  H HD21 . LEU A 1 3  ? -6.163  -12.017 -12.230 1.00 0.00 ? 7  LEU A HD21 3  
ATOM 4387  H HD22 . LEU A 1 3  ? -6.062  -12.076 -14.006 1.00 0.00 ? 7  LEU A HD22 3  
ATOM 4388  H HD23 . LEU A 1 3  ? -7.614  -11.710 -13.215 1.00 0.00 ? 7  LEU A HD23 3  
ATOM 4389  N N    . ARG A 1 4  ? -4.260  -15.856 -10.339 1.00 0.00 ? 8  ARG A N    3  
ATOM 4390  C CA   . ARG A 1 4  ? -3.522  -16.259 -9.154  1.00 0.00 ? 8  ARG A CA   3  
ATOM 4391  C C    . ARG A 1 4  ? -2.976  -15.031 -8.425  1.00 0.00 ? 8  ARG A C    3  
ATOM 4392  O O    . ARG A 1 4  ? -3.631  -13.990 -8.378  1.00 0.00 ? 8  ARG A O    3  
ATOM 4393  C CB   . ARG A 1 4  ? -2.360  -17.186 -9.519  1.00 0.00 ? 8  ARG A CB   3  
ATOM 4394  C CG   . ARG A 1 4  ? -2.776  -18.189 -10.596 1.00 0.00 ? 8  ARG A CG   3  
ATOM 4395  C CD   . ARG A 1 4  ? -2.143  -19.559 -10.343 1.00 0.00 ? 8  ARG A CD   3  
ATOM 4396  N NE   . ARG A 1 4  ? -2.154  -20.360 -11.588 1.00 0.00 ? 8  ARG A NE   3  
ATOM 4397  C CZ   . ARG A 1 4  ? -3.200  -21.087 -12.004 1.00 0.00 ? 8  ARG A CZ   3  
ATOM 4398  N NH1  . ARG A 1 4  ? -4.325  -21.119 -11.277 1.00 0.00 ? 8  ARG A NH1  3  
ATOM 4399  N NH2  . ARG A 1 4  ? -3.120  -21.782 -13.146 1.00 0.00 ? 8  ARG A NH2  3  
ATOM 4400  H H    . ARG A 1 4  ? -3.819  -15.147 -10.890 1.00 0.00 ? 8  ARG A H    3  
ATOM 4401  H HA   . ARG A 1 4  ? -4.249  -16.790 -8.540  1.00 0.00 ? 8  ARG A HA   3  
ATOM 4402  H HB2  . ARG A 1 4  ? -1.516  -16.594 -9.874  1.00 0.00 ? 8  ARG A HB2  3  
ATOM 4403  H HB3  . ARG A 1 4  ? -2.023  -17.719 -8.630  1.00 0.00 ? 8  ARG A HB3  3  
ATOM 4404  H HG2  . ARG A 1 4  ? -3.861  -18.284 -10.611 1.00 0.00 ? 8  ARG A HG2  3  
ATOM 4405  H HG3  . ARG A 1 4  ? -2.474  -17.821 -11.577 1.00 0.00 ? 8  ARG A HG3  3  
ATOM 4406  H HD2  . ARG A 1 4  ? -1.119  -19.436 -9.989  1.00 0.00 ? 8  ARG A HD2  3  
ATOM 4407  H HD3  . ARG A 1 4  ? -2.690  -20.083 -9.559  1.00 0.00 ? 8  ARG A HD3  3  
ATOM 4408  H HE   . ARG A 1 4  ? -1.329  -20.358 -12.153 1.00 0.00 ? 8  ARG A HE   3  
ATOM 4409  H HH11 . ARG A 1 4  ? -4.385  -20.600 -10.425 1.00 0.00 ? 8  ARG A HH11 3  
ATOM 4410  H HH12 . ARG A 1 4  ? -5.105  -21.661 -11.588 1.00 0.00 ? 8  ARG A HH12 3  
ATOM 4411  H HH21 . ARG A 1 4  ? -2.280  -21.758 -13.689 1.00 0.00 ? 8  ARG A HH21 3  
ATOM 4412  H HH22 . ARG A 1 4  ? -3.900  -22.325 -13.457 1.00 0.00 ? 8  ARG A HH22 3  
ATOM 4413  N N    . CYS A 1 5  ? -1.782  -15.191 -7.873  1.00 0.00 ? 9  CYS A N    3  
ATOM 4414  C CA   . CYS A 1 5  ? -1.140  -14.108 -7.148  1.00 0.00 ? 9  CYS A CA   3  
ATOM 4415  C C    . CYS A 1 5  ? -0.168  -13.404 -8.097  1.00 0.00 ? 9  CYS A C    3  
ATOM 4416  O O    . CYS A 1 5  ? 0.218   -13.963 -9.122  1.00 0.00 ? 9  CYS A O    3  
ATOM 4417  C CB   . CYS A 1 5  ? -0.441  -14.610 -5.883  1.00 0.00 ? 9  CYS A CB   3  
ATOM 4418  S SG   . CYS A 1 5  ? -1.550  -14.901 -4.457  1.00 0.00 ? 9  CYS A SG   3  
ATOM 4419  H H    . CYS A 1 5  ? -1.256  -16.041 -7.916  1.00 0.00 ? 9  CYS A H    3  
ATOM 4420  H HA   . CYS A 1 5  ? -1.933  -13.429 -6.833  1.00 0.00 ? 9  CYS A HA   3  
ATOM 4421  H HB2  . CYS A 1 5  ? 0.079   -15.539 -6.117  1.00 0.00 ? 9  CYS A HB2  3  
ATOM 4422  H HB3  . CYS A 1 5  ? 0.318   -13.884 -5.592  1.00 0.00 ? 9  CYS A HB3  3  
ATOM 4423  N N    . GLN A 1 6  ? 0.200   -12.188 -7.720  1.00 0.00 ? 10 GLN A N    3  
ATOM 4424  C CA   . GLN A 1 6  ? 1.120   -11.402 -8.525  1.00 0.00 ? 10 GLN A CA   3  
ATOM 4425  C C    . GLN A 1 6  ? 2.562   -11.647 -8.074  1.00 0.00 ? 10 GLN A C    3  
ATOM 4426  O O    . GLN A 1 6  ? 3.500   -11.115 -8.666  1.00 0.00 ? 10 GLN A O    3  
ATOM 4427  C CB   . GLN A 1 6  ? 0.771   -9.914  -8.461  1.00 0.00 ? 10 GLN A CB   3  
ATOM 4428  C CG   . GLN A 1 6  ? 1.734   -9.088  -9.315  1.00 0.00 ? 10 GLN A CG   3  
ATOM 4429  C CD   . GLN A 1 6  ? 1.058   -7.815  -9.829  1.00 0.00 ? 10 GLN A CD   3  
ATOM 4430  O OE1  . GLN A 1 6  ? 0.715   -7.691  -10.993 1.00 0.00 ? 10 GLN A OE1  3  
ATOM 4431  N NE2  . GLN A 1 6  ? 0.885   -6.881  -8.899  1.00 0.00 ? 10 GLN A NE2  3  
ATOM 4432  H H    . GLN A 1 6  ? -0.118  -11.741 -6.884  1.00 0.00 ? 10 GLN A H    3  
ATOM 4433  H HA   . GLN A 1 6  ? 0.987   -11.757 -9.547  1.00 0.00 ? 10 GLN A HA   3  
ATOM 4434  H HB2  . GLN A 1 6  ? -0.251  -9.762  -8.808  1.00 0.00 ? 10 GLN A HB2  3  
ATOM 4435  H HB3  . GLN A 1 6  ? 0.810   -9.572  -7.427  1.00 0.00 ? 10 GLN A HB3  3  
ATOM 4436  H HG2  . GLN A 1 6  ? 2.613   -8.824  -8.727  1.00 0.00 ? 10 GLN A HG2  3  
ATOM 4437  H HG3  . GLN A 1 6  ? 2.082   -9.685  -10.158 1.00 0.00 ? 10 GLN A HG3  3  
ATOM 4438  H HE21 . GLN A 1 6  ? 1.190   -7.047  -7.961  1.00 0.00 ? 10 GLN A HE21 3  
ATOM 4439  H HE22 . GLN A 1 6  ? 0.451   -6.012  -9.137  1.00 0.00 ? 10 GLN A HE22 3  
ATOM 4440  N N    . CYS A 1 7  ? 2.693   -12.451 -7.029  1.00 0.00 ? 11 CYS A N    3  
ATOM 4441  C CA   . CYS A 1 7  ? 4.004   -12.773 -6.492  1.00 0.00 ? 11 CYS A CA   3  
ATOM 4442  C C    . CYS A 1 7  ? 3.989   -14.230 -6.027  1.00 0.00 ? 11 CYS A C    3  
ATOM 4443  O O    . CYS A 1 7  ? 3.060   -14.658 -5.344  1.00 0.00 ? 11 CYS A O    3  
ATOM 4444  C CB   . CYS A 1 7  ? 4.403   -11.818 -5.364  1.00 0.00 ? 11 CYS A CB   3  
ATOM 4445  S SG   . CYS A 1 7  ? 5.964   -10.907 -5.646  1.00 0.00 ? 11 CYS A SG   3  
ATOM 4446  H H    . CYS A 1 7  ? 1.925   -12.880 -6.553  1.00 0.00 ? 11 CYS A H    3  
ATOM 4447  H HA   . CYS A 1 7  ? 4.718   -12.632 -7.303  1.00 0.00 ? 11 CYS A HA   3  
ATOM 4448  H HB2  . CYS A 1 7  ? 3.599   -11.097 -5.216  1.00 0.00 ? 11 CYS A HB2  3  
ATOM 4449  H HB3  . CYS A 1 7  ? 4.493   -12.389 -4.440  1.00 0.00 ? 11 CYS A HB3  3  
ATOM 4450  N N    . LEU A 1 8  ? 5.029   -14.953 -6.417  1.00 0.00 ? 12 LEU A N    3  
ATOM 4451  C CA   . LEU A 1 8  ? 5.147   -16.354 -6.050  1.00 0.00 ? 12 LEU A CA   3  
ATOM 4452  C C    . LEU A 1 8  ? 6.096   -16.485 -4.857  1.00 0.00 ? 12 LEU A C    3  
ATOM 4453  O O    . LEU A 1 8  ? 6.130   -17.523 -4.198  1.00 0.00 ? 12 LEU A O    3  
ATOM 4454  C CB   . LEU A 1 8  ? 5.561   -17.193 -7.260  1.00 0.00 ? 12 LEU A CB   3  
ATOM 4455  C CG   . LEU A 1 8  ? 4.862   -16.857 -8.579  1.00 0.00 ? 12 LEU A CG   3  
ATOM 4456  C CD1  . LEU A 1 8  ? 5.743   -17.224 -9.775  1.00 0.00 ? 12 LEU A CD1  3  
ATOM 4457  C CD2  . LEU A 1 8  ? 3.486   -17.523 -8.655  1.00 0.00 ? 12 LEU A CD2  3  
ATOM 4458  H H    . LEU A 1 8  ? 5.780   -14.597 -6.974  1.00 0.00 ? 12 LEU A H    3  
ATOM 4459  H HA   . LEU A 1 8  ? 4.158   -16.696 -5.744  1.00 0.00 ? 12 LEU A HA   3  
ATOM 4460  H HB2  . LEU A 1 8  ? 6.636   -17.082 -7.403  1.00 0.00 ? 12 LEU A HB2  3  
ATOM 4461  H HB3  . LEU A 1 8  ? 5.377   -18.242 -7.031  1.00 0.00 ? 12 LEU A HB3  3  
ATOM 4462  H HG   . LEU A 1 8  ? 4.701   -15.780 -8.617  1.00 0.00 ? 12 LEU A HG   3  
ATOM 4463  H HD11 . LEU A 1 8  ? 6.764   -17.398 -9.435  1.00 0.00 ? 12 LEU A HD11 3  
ATOM 4464  H HD12 . LEU A 1 8  ? 5.358   -18.129 -10.246 1.00 0.00 ? 12 LEU A HD12 3  
ATOM 4465  H HD13 . LEU A 1 8  ? 5.734   -16.407 -10.497 1.00 0.00 ? 12 LEU A HD13 3  
ATOM 4466  H HD21 . LEU A 1 8  ? 3.298   -18.074 -7.734  1.00 0.00 ? 12 LEU A HD21 3  
ATOM 4467  H HD22 . LEU A 1 8  ? 2.720   -16.759 -8.785  1.00 0.00 ? 12 LEU A HD22 3  
ATOM 4468  H HD23 . LEU A 1 8  ? 3.461   -18.210 -9.501  1.00 0.00 ? 12 LEU A HD23 3  
ATOM 4469  N N    . GLN A 1 9  ? 6.843   -15.418 -4.615  1.00 0.00 ? 13 GLN A N    3  
ATOM 4470  C CA   . GLN A 1 9  ? 7.790   -15.401 -3.514  1.00 0.00 ? 13 GLN A CA   3  
ATOM 4471  C C    . GLN A 1 9  ? 7.680   -14.086 -2.739  1.00 0.00 ? 13 GLN A C    3  
ATOM 4472  O O    . GLN A 1 9  ? 7.011   -13.154 -3.184  1.00 0.00 ? 13 GLN A O    3  
ATOM 4473  C CB   . GLN A 1 9  ? 9.218   -15.625 -4.014  1.00 0.00 ? 13 GLN A CB   3  
ATOM 4474  C CG   . GLN A 1 9  ? 10.044  -16.402 -2.987  1.00 0.00 ? 13 GLN A CG   3  
ATOM 4475  C CD   . GLN A 1 9  ? 10.366  -17.809 -3.494  1.00 0.00 ? 13 GLN A CD   3  
ATOM 4476  O OE1  . GLN A 1 9  ? 10.327  -18.094 -4.679  1.00 0.00 ? 13 GLN A OE1  3  
ATOM 4477  N NE2  . GLN A 1 9  ? 10.686  -18.670 -2.532  1.00 0.00 ? 13 GLN A NE2  3  
ATOM 4478  H H    . GLN A 1 9  ? 6.809   -14.578 -5.156  1.00 0.00 ? 13 GLN A H    3  
ATOM 4479  H HA   . GLN A 1 9  ? 7.502   -16.234 -2.871  1.00 0.00 ? 13 GLN A HA   3  
ATOM 4480  H HB2  . GLN A 1 9  ? 9.195   -16.172 -4.957  1.00 0.00 ? 13 GLN A HB2  3  
ATOM 4481  H HB3  . GLN A 1 9  ? 9.692   -14.664 -4.215  1.00 0.00 ? 13 GLN A HB3  3  
ATOM 4482  H HG2  . GLN A 1 9  ? 10.970  -15.866 -2.779  1.00 0.00 ? 13 GLN A HG2  3  
ATOM 4483  H HG3  . GLN A 1 9  ? 9.495   -16.467 -2.048  1.00 0.00 ? 13 GLN A HG3  3  
ATOM 4484  H HE21 . GLN A 1 9  ? 10.699  -18.372 -1.578  1.00 0.00 ? 13 GLN A HE21 3  
ATOM 4485  H HE22 . GLN A 1 9  ? 10.913  -19.616 -2.763  1.00 0.00 ? 13 GLN A HE22 3  
ATOM 4486  N N    . THR A 1 10 ? 8.347   -14.052 -1.595  1.00 0.00 ? 14 THR A N    3  
ATOM 4487  C CA   . THR A 1 10 ? 8.333   -12.867 -0.755  1.00 0.00 ? 14 THR A CA   3  
ATOM 4488  C C    . THR A 1 10 ? 9.601   -12.802 0.098   1.00 0.00 ? 14 THR A C    3  
ATOM 4489  O O    . THR A 1 10 ? 10.321  -13.792 0.223   1.00 0.00 ? 14 THR A O    3  
ATOM 4490  C CB   . THR A 1 10 ? 7.045   -12.888 0.071   1.00 0.00 ? 14 THR A CB   3  
ATOM 4491  O OG1  . THR A 1 10 ? 6.864   -14.263 0.396   1.00 0.00 ? 14 THR A OG1  3  
ATOM 4492  C CG2  . THR A 1 10 ? 5.810   -12.536 -0.761  1.00 0.00 ? 14 THR A CG2  3  
ATOM 4493  H H    . THR A 1 10 ? 8.889   -14.815 -1.241  1.00 0.00 ? 14 THR A H    3  
ATOM 4494  H HA   . THR A 1 10 ? 8.337   -11.988 -1.401  1.00 0.00 ? 14 THR A HA   3  
ATOM 4495  H HB   . THR A 1 10 ? 7.129   -12.235 0.939   1.00 0.00 ? 14 THR A HB   3  
ATOM 4496  H HG1  . THR A 1 10 ? 6.761   -14.802 -0.440  1.00 0.00 ? 14 THR A HG1  3  
ATOM 4497  H HG21 . THR A 1 10 ? 5.978   -11.592 -1.279  1.00 0.00 ? 14 THR A HG21 3  
ATOM 4498  H HG22 . THR A 1 10 ? 5.628   -13.324 -1.492  1.00 0.00 ? 14 THR A HG22 3  
ATOM 4499  H HG23 . THR A 1 10 ? 4.945   -12.442 -0.105  1.00 0.00 ? 14 THR A HG23 3  
ATOM 4500  N N    . LEU A 1 11 ? 9.837   -11.628 0.664   1.00 0.00 ? 15 LEU A N    3  
ATOM 4501  C CA   . LEU A 1 11 ? 11.005  -11.421 1.502   1.00 0.00 ? 15 LEU A CA   3  
ATOM 4502  C C    . LEU A 1 11 ? 10.579  -11.409 2.971   1.00 0.00 ? 15 LEU A C    3  
ATOM 4503  O O    . LEU A 1 11 ? 9.388   -11.460 3.276   1.00 0.00 ? 15 LEU A O    3  
ATOM 4504  C CB   . LEU A 1 11 ? 11.759  -10.162 1.070   1.00 0.00 ? 15 LEU A CB   3  
ATOM 4505  C CG   . LEU A 1 11 ? 12.206  -10.116 -0.393  1.00 0.00 ? 15 LEU A CG   3  
ATOM 4506  C CD1  . LEU A 1 11 ? 12.121  -8.693  -0.948  1.00 0.00 ? 15 LEU A CD1  3  
ATOM 4507  C CD2  . LEU A 1 11 ? 13.606  -10.713 -0.557  1.00 0.00 ? 15 LEU A CD2  3  
ATOM 4508  H H    . LEU A 1 11 ? 9.246   -10.828 0.557   1.00 0.00 ? 15 LEU A H    3  
ATOM 4509  H HA   . LEU A 1 11 ? 11.674  -12.267 1.344   1.00 0.00 ? 15 LEU A HA   3  
ATOM 4510  H HB2  . LEU A 1 11 ? 11.122  -9.298  1.261   1.00 0.00 ? 15 LEU A HB2  3  
ATOM 4511  H HB3  . LEU A 1 11 ? 12.640  -10.055 1.702   1.00 0.00 ? 15 LEU A HB3  3  
ATOM 4512  H HG   . LEU A 1 11 ? 11.523  -10.732 -0.978  1.00 0.00 ? 15 LEU A HG   3  
ATOM 4513  H HD11 . LEU A 1 11 ? 11.887  -8.001  -0.140  1.00 0.00 ? 15 LEU A HD11 3  
ATOM 4514  H HD12 . LEU A 1 11 ? 13.077  -8.420  -1.396  1.00 0.00 ? 15 LEU A HD12 3  
ATOM 4515  H HD13 . LEU A 1 11 ? 11.338  -8.645  -1.706  1.00 0.00 ? 15 LEU A HD13 3  
ATOM 4516  H HD21 . LEU A 1 11 ? 13.916  -11.173 0.381   1.00 0.00 ? 15 LEU A HD21 3  
ATOM 4517  H HD22 . LEU A 1 11 ? 13.589  -11.467 -1.344  1.00 0.00 ? 15 LEU A HD22 3  
ATOM 4518  H HD23 . LEU A 1 11 ? 14.308  -9.923  -0.824  1.00 0.00 ? 15 LEU A HD23 3  
ATOM 4519  N N    . GLN A 1 12 ? 11.574  -11.341 3.843   1.00 0.00 ? 16 GLN A N    3  
ATOM 4520  C CA   . GLN A 1 12 ? 11.317  -11.321 5.273   1.00 0.00 ? 16 GLN A CA   3  
ATOM 4521  C C    . GLN A 1 12 ? 11.327  -9.882  5.794   1.00 0.00 ? 16 GLN A C    3  
ATOM 4522  O O    . GLN A 1 12 ? 10.870  -9.618  6.905   1.00 0.00 ? 16 GLN A O    3  
ATOM 4523  C CB   . GLN A 1 12 ? 12.332  -12.184 6.025   1.00 0.00 ? 16 GLN A CB   3  
ATOM 4524  C CG   . GLN A 1 12 ? 12.396  -11.792 7.502   1.00 0.00 ? 16 GLN A CG   3  
ATOM 4525  C CD   . GLN A 1 12 ? 11.033  -11.964 8.175   1.00 0.00 ? 16 GLN A CD   3  
ATOM 4526  O OE1  . GLN A 1 12 ? 10.112  -12.549 7.629   1.00 0.00 ? 16 GLN A OE1  3  
ATOM 4527  N NE2  . GLN A 1 12 ? 10.956  -11.423 9.387   1.00 0.00 ? 16 GLN A NE2  3  
ATOM 4528  H H    . GLN A 1 12 ? 12.540  -11.299 3.587   1.00 0.00 ? 16 GLN A H    3  
ATOM 4529  H HA   . GLN A 1 12 ? 10.322  -11.751 5.394   1.00 0.00 ? 16 GLN A HA   3  
ATOM 4530  H HB2  . GLN A 1 12 ? 12.058  -13.235 5.935   1.00 0.00 ? 16 GLN A HB2  3  
ATOM 4531  H HB3  . GLN A 1 12 ? 13.317  -12.071 5.572   1.00 0.00 ? 16 GLN A HB3  3  
ATOM 4532  H HG2  . GLN A 1 12 ? 13.138  -12.407 8.013   1.00 0.00 ? 16 GLN A HG2  3  
ATOM 4533  H HG3  . GLN A 1 12 ? 12.723  -10.757 7.594   1.00 0.00 ? 16 GLN A HG3  3  
ATOM 4534  H HE21 . GLN A 1 12 ? 11.749  -10.956 9.778   1.00 0.00 ? 16 GLN A HE21 3  
ATOM 4535  H HE22 . GLN A 1 12 ? 10.104  -11.483 9.908   1.00 0.00 ? 16 GLN A HE22 3  
ATOM 4536  N N    . GLY A 1 13 ? 11.852  -8.991  4.967   1.00 0.00 ? 17 GLY A N    3  
ATOM 4537  C CA   . GLY A 1 13 ? 11.927  -7.586  5.330   1.00 0.00 ? 17 GLY A CA   3  
ATOM 4538  C C    . GLY A 1 13 ? 13.334  -7.033  5.093   1.00 0.00 ? 17 GLY A C    3  
ATOM 4539  O O    . GLY A 1 13 ? 14.243  -7.279  5.884   1.00 0.00 ? 17 GLY A O    3  
ATOM 4540  H H    . GLY A 1 13 ? 12.221  -9.214  4.064   1.00 0.00 ? 17 GLY A H    3  
ATOM 4541  H HA2  . GLY A 1 13 ? 11.205  -7.016  4.746   1.00 0.00 ? 17 GLY A HA2  3  
ATOM 4542  H HA3  . GLY A 1 13 ? 11.657  -7.463  6.379   1.00 0.00 ? 17 GLY A HA3  3  
ATOM 4543  N N    . ILE A 1 14 ? 13.469  -6.297  4.000   1.00 0.00 ? 18 ILE A N    3  
ATOM 4544  C CA   . ILE A 1 14 ? 14.750  -5.707  3.648   1.00 0.00 ? 18 ILE A CA   3  
ATOM 4545  C C    . ILE A 1 14 ? 14.805  -4.269  4.169   1.00 0.00 ? 18 ILE A C    3  
ATOM 4546  O O    . ILE A 1 14 ? 13.775  -3.690  4.511   1.00 0.00 ? 18 ILE A O    3  
ATOM 4547  C CB   . ILE A 1 14 ? 15.000  -5.826  2.143   1.00 0.00 ? 18 ILE A CB   3  
ATOM 4548  C CG1  . ILE A 1 14 ? 15.185  -7.288  1.732   1.00 0.00 ? 18 ILE A CG1  3  
ATOM 4549  C CG2  . ILE A 1 14 ? 16.181  -4.954  1.713   1.00 0.00 ? 18 ILE A CG2  3  
ATOM 4550  C CD1  . ILE A 1 14 ? 13.835  -7.991  1.581   1.00 0.00 ? 18 ILE A CD1  3  
ATOM 4551  H H    . ILE A 1 14 ? 12.725  -6.102  3.361   1.00 0.00 ? 18 ILE A H    3  
ATOM 4552  H HA   . ILE A 1 14 ? 15.525  -6.286  4.150   1.00 0.00 ? 18 ILE A HA   3  
ATOM 4553  H HB   . ILE A 1 14 ? 14.118  -5.454  1.621   1.00 0.00 ? 18 ILE A HB   3  
ATOM 4554  H HG12 . ILE A 1 14 ? 15.733  -7.337  0.791   1.00 0.00 ? 18 ILE A HG12 3  
ATOM 4555  H HG13 . ILE A 1 14 ? 15.788  -7.805  2.479   1.00 0.00 ? 18 ILE A HG13 3  
ATOM 4556  H HG21 . ILE A 1 14 ? 17.067  -5.238  2.281   1.00 0.00 ? 18 ILE A HG21 3  
ATOM 4557  H HG22 . ILE A 1 14 ? 16.370  -5.098  0.649   1.00 0.00 ? 18 ILE A HG22 3  
ATOM 4558  H HG23 . ILE A 1 14 ? 15.948  -3.907  1.903   1.00 0.00 ? 18 ILE A HG23 3  
ATOM 4559  H HD11 . ILE A 1 14 ? 13.076  -7.262  1.297   1.00 0.00 ? 18 ILE A HD11 3  
ATOM 4560  H HD12 . ILE A 1 14 ? 13.909  -8.758  0.810   1.00 0.00 ? 18 ILE A HD12 3  
ATOM 4561  H HD13 . ILE A 1 14 ? 13.558  -8.453  2.528   1.00 0.00 ? 18 ILE A HD13 3  
ATOM 4562  N N    . HIS A 1 15 ? 16.017  -3.736  4.213   1.00 0.00 ? 19 HIS A N    3  
ATOM 4563  C CA   . HIS A 1 15 ? 16.219  -2.377  4.687   1.00 0.00 ? 19 HIS A CA   3  
ATOM 4564  C C    . HIS A 1 15 ? 15.153  -1.459  4.084   1.00 0.00 ? 19 HIS A C    3  
ATOM 4565  O O    . HIS A 1 15 ? 14.845  -1.556  2.897   1.00 0.00 ? 19 HIS A O    3  
ATOM 4566  C CB   . HIS A 1 15 ? 17.644  -1.905  4.391   1.00 0.00 ? 19 HIS A CB   3  
ATOM 4567  C CG   . HIS A 1 15 ? 18.248  -1.054  5.482   1.00 0.00 ? 19 HIS A CG   3  
ATOM 4568  N ND1  . HIS A 1 15 ? 19.536  -1.243  5.954   1.00 0.00 ? 19 HIS A ND1  3  
ATOM 4569  C CD2  . HIS A 1 15 ? 17.729  -0.009  6.188   1.00 0.00 ? 19 HIS A CD2  3  
ATOM 4570  C CE1  . HIS A 1 15 ? 19.770  -0.347  6.901   1.00 0.00 ? 19 HIS A CE1  3  
ATOM 4571  N NE2  . HIS A 1 15 ? 18.649  0.416   7.045   1.00 0.00 ? 19 HIS A NE2  3  
ATOM 4572  H H    . HIS A 1 15 ? 16.849  -4.214  3.934   1.00 0.00 ? 19 HIS A H    3  
ATOM 4573  H HA   . HIS A 1 15 ? 16.095  -2.401  5.770   1.00 0.00 ? 19 HIS A HA   3  
ATOM 4574  H HB2  . HIS A 1 15 ? 18.278  -2.777  4.230   1.00 0.00 ? 19 HIS A HB2  3  
ATOM 4575  H HB3  . HIS A 1 15 ? 17.641  -1.337  3.461   1.00 0.00 ? 19 HIS A HB3  3  
ATOM 4576  H HD1  . HIS A 1 15 ? 20.180  -1.938  5.634   1.00 0.00 ? 19 HIS A HD1  3  
ATOM 4577  H HD2  . HIS A 1 15 ? 16.729  0.406   6.068   1.00 0.00 ? 19 HIS A HD2  3  
ATOM 4578  H HE1  . HIS A 1 15 ? 20.696  -0.239  7.466   1.00 0.00 ? 19 HIS A HE1  3  
ATOM 4579  N N    . LEU A 1 16 ? 14.620  -0.590  4.930   1.00 0.00 ? 20 LEU A N    3  
ATOM 4580  C CA   . LEU A 1 16 ? 13.595  0.344   4.496   1.00 0.00 ? 20 LEU A CA   3  
ATOM 4581  C C    . LEU A 1 16 ? 14.262  1.608   3.948   1.00 0.00 ? 20 LEU A C    3  
ATOM 4582  O O    . LEU A 1 16 ? 13.599  2.622   3.738   1.00 0.00 ? 20 LEU A O    3  
ATOM 4583  C CB   . LEU A 1 16 ? 12.602  0.614   5.628   1.00 0.00 ? 20 LEU A CB   3  
ATOM 4584  C CG   . LEU A 1 16 ? 11.224  1.127   5.204   1.00 0.00 ? 20 LEU A CG   3  
ATOM 4585  C CD1  . LEU A 1 16 ? 11.270  2.622   4.883   1.00 0.00 ? 20 LEU A CD1  3  
ATOM 4586  C CD2  . LEU A 1 16 ? 10.670  0.308   4.036   1.00 0.00 ? 20 LEU A CD2  3  
ATOM 4587  H H    . LEU A 1 16 ? 14.876  -0.518  5.894   1.00 0.00 ? 20 LEU A H    3  
ATOM 4588  H HA   . LEU A 1 16 ? 13.040  -0.132  3.687   1.00 0.00 ? 20 LEU A HA   3  
ATOM 4589  H HB2  . LEU A 1 16 ? 12.467  -0.308  6.194   1.00 0.00 ? 20 LEU A HB2  3  
ATOM 4590  H HB3  . LEU A 1 16 ? 13.045  1.343   6.307   1.00 0.00 ? 20 LEU A HB3  3  
ATOM 4591  H HG   . LEU A 1 16 ? 10.539  0.998   6.041   1.00 0.00 ? 20 LEU A HG   3  
ATOM 4592  H HD11 . LEU A 1 16 ? 12.143  3.069   5.361   1.00 0.00 ? 20 LEU A HD11 3  
ATOM 4593  H HD12 . LEU A 1 16 ? 11.335  2.761   3.804   1.00 0.00 ? 20 LEU A HD12 3  
ATOM 4594  H HD13 . LEU A 1 16 ? 10.366  3.102   5.258   1.00 0.00 ? 20 LEU A HD13 3  
ATOM 4595  H HD21 . LEU A 1 16 ? 11.192  -0.648  3.983   1.00 0.00 ? 20 LEU A HD21 3  
ATOM 4596  H HD22 . LEU A 1 16 ? 9.605   0.132   4.189   1.00 0.00 ? 20 LEU A HD22 3  
ATOM 4597  H HD23 . LEU A 1 16 ? 10.819  0.855   3.105   1.00 0.00 ? 20 LEU A HD23 3  
ATOM 4598  N N    . LYS A 1 17 ? 15.565  1.504   3.733   1.00 0.00 ? 21 LYS A N    3  
ATOM 4599  C CA   . LYS A 1 17 ? 16.329  2.626   3.214   1.00 0.00 ? 21 LYS A CA   3  
ATOM 4600  C C    . LYS A 1 17 ? 16.336  2.569   1.685   1.00 0.00 ? 21 LYS A C    3  
ATOM 4601  O O    . LYS A 1 17 ? 16.551  3.583   1.023   1.00 0.00 ? 21 LYS A O    3  
ATOM 4602  C CB   . LYS A 1 17 ? 17.727  2.656   3.834   1.00 0.00 ? 21 LYS A CB   3  
ATOM 4603  C CG   . LYS A 1 17 ? 18.620  1.573   3.225   1.00 0.00 ? 21 LYS A CG   3  
ATOM 4604  C CD   . LYS A 1 17 ? 20.068  1.729   3.694   1.00 0.00 ? 21 LYS A CD   3  
ATOM 4605  C CE   . LYS A 1 17 ? 20.861  0.441   3.465   1.00 0.00 ? 21 LYS A CE   3  
ATOM 4606  N NZ   . LYS A 1 17 ? 22.195  0.745   2.903   1.00 0.00 ? 21 LYS A NZ   3  
ATOM 4607  H H    . LYS A 1 17 ? 16.097  0.676   3.907   1.00 0.00 ? 21 LYS A H    3  
ATOM 4608  H HA   . LYS A 1 17 ? 15.820  3.539   3.523   1.00 0.00 ? 21 LYS A HA   3  
ATOM 4609  H HB2  . LYS A 1 17 ? 18.178  3.635   3.678   1.00 0.00 ? 21 LYS A HB2  3  
ATOM 4610  H HB3  . LYS A 1 17 ? 17.654  2.508   4.912   1.00 0.00 ? 21 LYS A HB3  3  
ATOM 4611  H HG2  . LYS A 1 17 ? 18.248  0.588   3.506   1.00 0.00 ? 21 LYS A HG2  3  
ATOM 4612  H HG3  . LYS A 1 17 ? 18.578  1.632   2.137   1.00 0.00 ? 21 LYS A HG3  3  
ATOM 4613  H HD2  . LYS A 1 17 ? 20.542  2.551   3.157   1.00 0.00 ? 21 LYS A HD2  3  
ATOM 4614  H HD3  . LYS A 1 17 ? 20.086  1.988   4.752   1.00 0.00 ? 21 LYS A HD3  3  
ATOM 4615  H HE2  . LYS A 1 17 ? 20.970  -0.098  4.406   1.00 0.00 ? 21 LYS A HE2  3  
ATOM 4616  H HE3  . LYS A 1 17 ? 20.314  -0.213  2.785   1.00 0.00 ? 21 LYS A HE3  3  
ATOM 4617  H HZ1  . LYS A 1 17 ? 22.100  1.404   2.157   1.00 0.00 ? 21 LYS A HZ1  3  
ATOM 4618  H HZ2  . LYS A 1 17 ? 22.777  1.133   3.618   1.00 0.00 ? 21 LYS A HZ2  3  
ATOM 4619  H HZ3  . LYS A 1 17 ? 22.610  -0.095  2.555   1.00 0.00 ? 21 LYS A HZ3  3  
ATOM 4620  N N    . ASN A 1 18 ? 16.098  1.372   1.168   1.00 0.00 ? 22 ASN A N    3  
ATOM 4621  C CA   . ASN A 1 18 ? 16.074  1.169   -0.270  1.00 0.00 ? 22 ASN A CA   3  
ATOM 4622  C C    . ASN A 1 18 ? 14.632  1.272   -0.772  1.00 0.00 ? 22 ASN A C    3  
ATOM 4623  O O    . ASN A 1 18 ? 14.379  1.843   -1.832  1.00 0.00 ? 22 ASN A O    3  
ATOM 4624  C CB   . ASN A 1 18 ? 16.605  -0.217  -0.640  1.00 0.00 ? 22 ASN A CB   3  
ATOM 4625  C CG   . ASN A 1 18 ? 18.056  -0.139  -1.117  1.00 0.00 ? 22 ASN A CG   3  
ATOM 4626  O OD1  . ASN A 1 18 ? 18.398  0.593   -2.031  1.00 0.00 ? 22 ASN A OD1  3  
ATOM 4627  N ND2  . ASN A 1 18 ? 18.889  -0.933  -0.450  1.00 0.00 ? 22 ASN A ND2  3  
ATOM 4628  H H    . ASN A 1 18 ? 15.924  0.552   1.714   1.00 0.00 ? 22 ASN A H    3  
ATOM 4629  H HA   . ASN A 1 18 ? 16.715  1.950   -0.680  1.00 0.00 ? 22 ASN A HA   3  
ATOM 4630  H HB2  . ASN A 1 18 ? 16.537  -0.879  0.224   1.00 0.00 ? 22 ASN A HB2  3  
ATOM 4631  H HB3  . ASN A 1 18 ? 15.984  -0.652  -1.423  1.00 0.00 ? 22 ASN A HB3  3  
ATOM 4632  H HD21 . ASN A 1 18 ? 18.544  -1.510  0.290   1.00 0.00 ? 22 ASN A HD21 3  
ATOM 4633  H HD22 . ASN A 1 18 ? 19.860  -0.953  -0.688  1.00 0.00 ? 22 ASN A HD22 3  
ATOM 4634  N N    . ILE A 1 19 ? 13.725  0.712   0.014   1.00 0.00 ? 23 ILE A N    3  
ATOM 4635  C CA   . ILE A 1 19 ? 12.315  0.734   -0.337  1.00 0.00 ? 23 ILE A CA   3  
ATOM 4636  C C    . ILE A 1 19 ? 11.872  2.181   -0.562  1.00 0.00 ? 23 ILE A C    3  
ATOM 4637  O O    . ILE A 1 19 ? 12.190  3.062   0.236   1.00 0.00 ? 23 ILE A O    3  
ATOM 4638  C CB   . ILE A 1 19 ? 11.489  -0.006  0.717   1.00 0.00 ? 23 ILE A CB   3  
ATOM 4639  C CG1  . ILE A 1 19 ? 11.440  -1.506  0.422   1.00 0.00 ? 23 ILE A CG1  3  
ATOM 4640  C CG2  . ILE A 1 19 ? 10.089  0.600   0.841   1.00 0.00 ? 23 ILE A CG2  3  
ATOM 4641  C CD1  . ILE A 1 19 ? 11.679  -2.323  1.693   1.00 0.00 ? 23 ILE A CD1  3  
ATOM 4642  H H    . ILE A 1 19 ? 13.939  0.250   0.875   1.00 0.00 ? 23 ILE A H    3  
ATOM 4643  H HA   . ILE A 1 19 ? 12.203  0.189   -1.275  1.00 0.00 ? 23 ILE A HA   3  
ATOM 4644  H HB   . ILE A 1 19 ? 11.979  0.117   1.683   1.00 0.00 ? 23 ILE A HB   3  
ATOM 4645  H HG12 . ILE A 1 19 ? 10.470  -1.765  -0.004  1.00 0.00 ? 23 ILE A HG12 3  
ATOM 4646  H HG13 . ILE A 1 19 ? 12.193  -1.759  -0.324  1.00 0.00 ? 23 ILE A HG13 3  
ATOM 4647  H HG21 . ILE A 1 19 ? 9.582   0.543   -0.122  1.00 0.00 ? 23 ILE A HG21 3  
ATOM 4648  H HG22 . ILE A 1 19 ? 9.518   0.045   1.585   1.00 0.00 ? 23 ILE A HG22 3  
ATOM 4649  H HG23 . ILE A 1 19 ? 10.170  1.642   1.148   1.00 0.00 ? 23 ILE A HG23 3  
ATOM 4650  H HD11 . ILE A 1 19 ? 12.342  -1.772  2.360   1.00 0.00 ? 23 ILE A HD11 3  
ATOM 4651  H HD12 . ILE A 1 19 ? 10.728  -2.503  2.194   1.00 0.00 ? 23 ILE A HD12 3  
ATOM 4652  H HD13 . ILE A 1 19 ? 12.138  -3.277  1.431   1.00 0.00 ? 23 ILE A HD13 3  
ATOM 4653  N N    . GLN A 1 20 ? 11.145  2.381   -1.651  1.00 0.00 ? 24 GLN A N    3  
ATOM 4654  C CA   . GLN A 1 20 ? 10.655  3.707   -1.990  1.00 0.00 ? 24 GLN A CA   3  
ATOM 4655  C C    . GLN A 1 20 ? 9.134   3.766   -1.834  1.00 0.00 ? 24 GLN A C    3  
ATOM 4656  O O    . GLN A 1 20 ? 8.567   4.842   -1.645  1.00 0.00 ? 24 GLN A O    3  
ATOM 4657  C CB   . GLN A 1 20 ? 11.077  4.101   -3.407  1.00 0.00 ? 24 GLN A CB   3  
ATOM 4658  C CG   . GLN A 1 20 ? 11.438  5.586   -3.478  1.00 0.00 ? 24 GLN A CG   3  
ATOM 4659  C CD   . GLN A 1 20 ? 10.205  6.462   -3.245  1.00 0.00 ? 24 GLN A CD   3  
ATOM 4660  O OE1  . GLN A 1 20 ? 10.178  7.324   -2.381  1.00 0.00 ? 24 GLN A OE1  3  
ATOM 4661  N NE2  . GLN A 1 20 ? 9.189   6.195   -4.061  1.00 0.00 ? 24 GLN A NE2  3  
ATOM 4662  H H    . GLN A 1 20 ? 10.890  1.659   -2.294  1.00 0.00 ? 24 GLN A H    3  
ATOM 4663  H HA   . GLN A 1 20 ? 11.127  4.382   -1.276  1.00 0.00 ? 24 GLN A HA   3  
ATOM 4664  H HB2  . GLN A 1 20 ? 11.932  3.500   -3.716  1.00 0.00 ? 24 GLN A HB2  3  
ATOM 4665  H HB3  . GLN A 1 20 ? 10.267  3.886   -4.104  1.00 0.00 ? 24 GLN A HB3  3  
ATOM 4666  H HG2  . GLN A 1 20 ? 12.198  5.815   -2.731  1.00 0.00 ? 24 GLN A HG2  3  
ATOM 4667  H HG3  . GLN A 1 20 ? 11.870  5.813   -4.452  1.00 0.00 ? 24 GLN A HG3  3  
ATOM 4668  H HE21 . GLN A 1 20 ? 9.277   5.474   -4.748  1.00 0.00 ? 24 GLN A HE21 3  
ATOM 4669  H HE22 . GLN A 1 20 ? 8.338   6.714   -3.986  1.00 0.00 ? 24 GLN A HE22 3  
ATOM 4670  N N    . SER A 1 21 ? 8.516   2.597   -1.919  1.00 0.00 ? 25 SER A N    3  
ATOM 4671  C CA   . SER A 1 21 ? 7.072   2.503   -1.790  1.00 0.00 ? 25 SER A CA   3  
ATOM 4672  C C    . SER A 1 21 ? 6.672   1.074   -1.418  1.00 0.00 ? 25 SER A C    3  
ATOM 4673  O O    . SER A 1 21 ? 7.451   0.140   -1.600  1.00 0.00 ? 25 SER A O    3  
ATOM 4674  C CB   . SER A 1 21 ? 6.374   2.930   -3.083  1.00 0.00 ? 25 SER A CB   3  
ATOM 4675  O OG   . SER A 1 21 ? 7.224   3.715   -3.915  1.00 0.00 ? 25 SER A OG   3  
ATOM 4676  H H    . SER A 1 21 ? 8.984   1.727   -2.073  1.00 0.00 ? 25 SER A H    3  
ATOM 4677  H HA   . SER A 1 21 ? 6.808   3.195   -0.990  1.00 0.00 ? 25 SER A HA   3  
ATOM 4678  H HB2  . SER A 1 21 ? 6.050   2.044   -3.630  1.00 0.00 ? 25 SER A HB2  3  
ATOM 4679  H HB3  . SER A 1 21 ? 5.477   3.500   -2.840  1.00 0.00 ? 25 SER A HB3  3  
ATOM 4680  H HG   . SER A 1 21 ? 7.487   3.192   -4.726  1.00 0.00 ? 25 SER A HG   3  
ATOM 4681  N N    . VAL A 1 22 ? 5.458   0.949   -0.902  1.00 0.00 ? 26 VAL A N    3  
ATOM 4682  C CA   . VAL A 1 22 ? 4.945   -0.350  -0.502  1.00 0.00 ? 26 VAL A CA   3  
ATOM 4683  C C    . VAL A 1 22 ? 3.540   -0.539  -1.079  1.00 0.00 ? 26 VAL A C    3  
ATOM 4684  O O    . VAL A 1 22 ? 2.719   0.376   -1.035  1.00 0.00 ? 26 VAL A O    3  
ATOM 4685  C CB   . VAL A 1 22 ? 4.988   -0.484  1.021   1.00 0.00 ? 26 VAL A CB   3  
ATOM 4686  C CG1  . VAL A 1 22 ? 4.165   -1.685  1.490   1.00 0.00 ? 26 VAL A CG1  3  
ATOM 4687  C CG2  . VAL A 1 22 ? 6.431   -0.579  1.522   1.00 0.00 ? 26 VAL A CG2  3  
ATOM 4688  H H    . VAL A 1 22 ? 4.830   1.714   -0.757  1.00 0.00 ? 26 VAL A H    3  
ATOM 4689  H HA   . VAL A 1 22 ? 5.603   -1.109  -0.927  1.00 0.00 ? 26 VAL A HA   3  
ATOM 4690  H HB   . VAL A 1 22 ? 4.544   0.414   1.449   1.00 0.00 ? 26 VAL A HB   3  
ATOM 4691  H HG11 . VAL A 1 22 ? 3.755   -2.205  0.624   1.00 0.00 ? 26 VAL A HG11 3  
ATOM 4692  H HG12 . VAL A 1 22 ? 4.803   -2.366  2.054   1.00 0.00 ? 26 VAL A HG12 3  
ATOM 4693  H HG13 . VAL A 1 22 ? 3.350   -1.341  2.126   1.00 0.00 ? 26 VAL A HG13 3  
ATOM 4694  H HG21 . VAL A 1 22 ? 7.064   0.087   0.936   1.00 0.00 ? 26 VAL A HG21 3  
ATOM 4695  H HG22 . VAL A 1 22 ? 6.471   -0.287  2.572   1.00 0.00 ? 26 VAL A HG22 3  
ATOM 4696  H HG23 . VAL A 1 22 ? 6.786   -1.604  1.416   1.00 0.00 ? 26 VAL A HG23 3  
ATOM 4697  N N    . LYS A 1 23 ? 3.307   -1.732  -1.607  1.00 0.00 ? 27 LYS A N    3  
ATOM 4698  C CA   . LYS A 1 23 ? 2.016   -2.052  -2.191  1.00 0.00 ? 27 LYS A CA   3  
ATOM 4699  C C    . LYS A 1 23 ? 1.512   -3.375  -1.611  1.00 0.00 ? 27 LYS A C    3  
ATOM 4700  O O    . LYS A 1 23 ? 2.217   -4.382  -1.648  1.00 0.00 ? 27 LYS A O    3  
ATOM 4701  C CB   . LYS A 1 23 ? 2.103   -2.044  -3.719  1.00 0.00 ? 27 LYS A CB   3  
ATOM 4702  C CG   . LYS A 1 23 ? 0.769   -1.628  -4.342  1.00 0.00 ? 27 LYS A CG   3  
ATOM 4703  C CD   . LYS A 1 23 ? -0.264  -2.751  -4.226  1.00 0.00 ? 27 LYS A CD   3  
ATOM 4704  C CE   . LYS A 1 23 ? -0.668  -3.269  -5.608  1.00 0.00 ? 27 LYS A CE   3  
ATOM 4705  N NZ   . LYS A 1 23 ? -1.333  -2.201  -6.388  1.00 0.00 ? 27 LYS A NZ   3  
ATOM 4706  H H    . LYS A 1 23 ? 3.980   -2.470  -1.639  1.00 0.00 ? 27 LYS A H    3  
ATOM 4707  H HA   . LYS A 1 23 ? 1.322   -1.262  -1.904  1.00 0.00 ? 27 LYS A HA   3  
ATOM 4708  H HB2  . LYS A 1 23 ? 2.887   -1.359  -4.039  1.00 0.00 ? 27 LYS A HB2  3  
ATOM 4709  H HB3  . LYS A 1 23 ? 2.381   -3.036  -4.076  1.00 0.00 ? 27 LYS A HB3  3  
ATOM 4710  H HG2  . LYS A 1 23 ? 0.395   -0.733  -3.845  1.00 0.00 ? 27 LYS A HG2  3  
ATOM 4711  H HG3  . LYS A 1 23 ? 0.917   -1.372  -5.391  1.00 0.00 ? 27 LYS A HG3  3  
ATOM 4712  H HD2  . LYS A 1 23 ? 0.146   -3.568  -3.633  1.00 0.00 ? 27 LYS A HD2  3  
ATOM 4713  H HD3  . LYS A 1 23 ? -1.146  -2.386  -3.699  1.00 0.00 ? 27 LYS A HD3  3  
ATOM 4714  H HE2  . LYS A 1 23 ? 0.214   -3.621  -6.143  1.00 0.00 ? 27 LYS A HE2  3  
ATOM 4715  H HE3  . LYS A 1 23 ? -1.338  -4.122  -5.502  1.00 0.00 ? 27 LYS A HE3  3  
ATOM 4716  H HZ1  . LYS A 1 23 ? -1.359  -1.360  -5.847  1.00 0.00 ? 27 LYS A HZ1  3  
ATOM 4717  H HZ2  . LYS A 1 23 ? -0.824  -2.039  -7.233  1.00 0.00 ? 27 LYS A HZ2  3  
ATOM 4718  H HZ3  . LYS A 1 23 ? -2.267  -2.483  -6.610  1.00 0.00 ? 27 LYS A HZ3  3  
ATOM 4719  N N    . VAL A 1 24 ? 0.296   -3.330  -1.088  1.00 0.00 ? 28 VAL A N    3  
ATOM 4720  C CA   . VAL A 1 24 ? -0.311  -4.512  -0.500  1.00 0.00 ? 28 VAL A CA   3  
ATOM 4721  C C    . VAL A 1 24 ? -1.530  -4.921  -1.330  1.00 0.00 ? 28 VAL A C    3  
ATOM 4722  O O    . VAL A 1 24 ? -2.623  -4.391  -1.136  1.00 0.00 ? 28 VAL A O    3  
ATOM 4723  C CB   . VAL A 1 24 ? -0.648  -4.252  0.969   1.00 0.00 ? 28 VAL A CB   3  
ATOM 4724  C CG1  . VAL A 1 24 ? -1.501  -5.384  1.545   1.00 0.00 ? 28 VAL A CG1  3  
ATOM 4725  C CG2  . VAL A 1 24 ? 0.623   -4.049  1.796   1.00 0.00 ? 28 VAL A CG2  3  
ATOM 4726  H H    . VAL A 1 24 ? -0.272  -2.506  -1.062  1.00 0.00 ? 28 VAL A H    3  
ATOM 4727  H HA   . VAL A 1 24 ? 0.426   -5.314  -0.541  1.00 0.00 ? 28 VAL A HA   3  
ATOM 4728  H HB   . VAL A 1 24 ? -1.232  -3.333  1.022   1.00 0.00 ? 28 VAL A HB   3  
ATOM 4729  H HG11 . VAL A 1 24 ? -1.803  -6.056  0.741   1.00 0.00 ? 28 VAL A HG11 3  
ATOM 4730  H HG12 . VAL A 1 24 ? -0.921  -5.938  2.283   1.00 0.00 ? 28 VAL A HG12 3  
ATOM 4731  H HG13 . VAL A 1 24 ? -2.388  -4.965  2.020   1.00 0.00 ? 28 VAL A HG13 3  
ATOM 4732  H HG21 . VAL A 1 24 ? 1.494   -4.301  1.190   1.00 0.00 ? 28 VAL A HG21 3  
ATOM 4733  H HG22 . VAL A 1 24 ? 0.689   -3.008  2.112   1.00 0.00 ? 28 VAL A HG22 3  
ATOM 4734  H HG23 . VAL A 1 24 ? 0.593   -4.695  2.674   1.00 0.00 ? 28 VAL A HG23 3  
ATOM 4735  N N    . LYS A 1 25 ? -1.301  -5.859  -2.237  1.00 0.00 ? 29 LYS A N    3  
ATOM 4736  C CA   . LYS A 1 25 ? -2.367  -6.345  -3.097  1.00 0.00 ? 29 LYS A CA   3  
ATOM 4737  C C    . LYS A 1 25 ? -3.081  -7.510  -2.408  1.00 0.00 ? 29 LYS A C    3  
ATOM 4738  O O    . LYS A 1 25 ? -2.742  -8.671  -2.634  1.00 0.00 ? 29 LYS A O    3  
ATOM 4739  C CB   . LYS A 1 25 ? -1.821  -6.691  -4.483  1.00 0.00 ? 29 LYS A CB   3  
ATOM 4740  C CG   . LYS A 1 25 ? -2.928  -6.638  -5.538  1.00 0.00 ? 29 LYS A CG   3  
ATOM 4741  C CD   . LYS A 1 25 ? -3.717  -7.948  -5.571  1.00 0.00 ? 29 LYS A CD   3  
ATOM 4742  C CE   . LYS A 1 25 ? -3.660  -8.587  -6.960  1.00 0.00 ? 29 LYS A CE   3  
ATOM 4743  N NZ   . LYS A 1 25 ? -4.855  -8.216  -7.751  1.00 0.00 ? 29 LYS A NZ   3  
ATOM 4744  H H    . LYS A 1 25 ? -0.409  -6.285  -2.388  1.00 0.00 ? 29 LYS A H    3  
ATOM 4745  H HA   . LYS A 1 25 ? -3.080  -5.530  -3.225  1.00 0.00 ? 29 LYS A HA   3  
ATOM 4746  H HB2  . LYS A 1 25 ? -1.026  -5.995  -4.750  1.00 0.00 ? 29 LYS A HB2  3  
ATOM 4747  H HB3  . LYS A 1 25 ? -1.378  -7.687  -4.465  1.00 0.00 ? 29 LYS A HB3  3  
ATOM 4748  H HG2  . LYS A 1 25 ? -3.602  -5.809  -5.321  1.00 0.00 ? 29 LYS A HG2  3  
ATOM 4749  H HG3  . LYS A 1 25 ? -2.492  -6.446  -6.518  1.00 0.00 ? 29 LYS A HG3  3  
ATOM 4750  H HD2  . LYS A 1 25 ? -3.312  -8.639  -4.832  1.00 0.00 ? 29 LYS A HD2  3  
ATOM 4751  H HD3  . LYS A 1 25 ? -4.755  -7.759  -5.296  1.00 0.00 ? 29 LYS A HD3  3  
ATOM 4752  H HE2  . LYS A 1 25 ? -2.758  -8.263  -7.479  1.00 0.00 ? 29 LYS A HE2  3  
ATOM 4753  H HE3  . LYS A 1 25 ? -3.601  -9.671  -6.866  1.00 0.00 ? 29 LYS A HE3  3  
ATOM 4754  H HZ1  . LYS A 1 25 ? -5.090  -7.261  -7.571  1.00 0.00 ? 29 LYS A HZ1  3  
ATOM 4755  H HZ2  . LYS A 1 25 ? -4.660  -8.333  -8.725  1.00 0.00 ? 29 LYS A HZ2  3  
ATOM 4756  H HZ3  . LYS A 1 25 ? -5.622  -8.803  -7.492  1.00 0.00 ? 29 LYS A HZ3  3  
ATOM 4757  N N    . SER A 1 26 ? -4.056  -7.160  -1.583  1.00 0.00 ? 30 SER A N    3  
ATOM 4758  C CA   . SER A 1 26 ? -4.820  -8.162  -0.860  1.00 0.00 ? 30 SER A CA   3  
ATOM 4759  C C    . SER A 1 26 ? -5.258  -9.275  -1.814  1.00 0.00 ? 30 SER A C    3  
ATOM 4760  O O    . SER A 1 26 ? -5.098  -9.156  -3.028  1.00 0.00 ? 30 SER A O    3  
ATOM 4761  C CB   . SER A 1 26 ? -6.039  -7.538  -0.177  1.00 0.00 ? 30 SER A CB   3  
ATOM 4762  O OG   . SER A 1 26 ? -5.923  -7.556  1.243   1.00 0.00 ? 30 SER A OG   3  
ATOM 4763  H H    . SER A 1 26 ? -4.325  -6.214  -1.405  1.00 0.00 ? 30 SER A H    3  
ATOM 4764  H HA   . SER A 1 26 ? -4.141  -8.553  -0.103  1.00 0.00 ? 30 SER A HA   3  
ATOM 4765  H HB2  . SER A 1 26 ? -6.159  -6.510  -0.518  1.00 0.00 ? 30 SER A HB2  3  
ATOM 4766  H HB3  . SER A 1 26 ? -6.938  -8.080  -0.474  1.00 0.00 ? 30 SER A HB3  3  
ATOM 4767  H HG   . SER A 1 26 ? -6.694  -7.072  1.656   1.00 0.00 ? 30 SER A HG   3  
ATOM 4768  N N    . PRO A 1 27 ? -5.817  -10.360 -1.214  1.00 0.00 ? 31 PRO A N    3  
ATOM 4769  C CA   . PRO A 1 27 ? -6.279  -11.493 -1.997  1.00 0.00 ? 31 PRO A CA   3  
ATOM 4770  C C    . PRO A 1 27 ? -7.593  -11.168 -2.710  1.00 0.00 ? 31 PRO A C    3  
ATOM 4771  O O    . PRO A 1 27 ? -8.194  -10.122 -2.466  1.00 0.00 ? 31 PRO A O    3  
ATOM 4772  C CB   . PRO A 1 27 ? -6.411  -12.633 -1.000  1.00 0.00 ? 31 PRO A CB   3  
ATOM 4773  C CG   . PRO A 1 27 ? -6.467  -11.982 0.372   1.00 0.00 ? 31 PRO A CG   3  
ATOM 4774  C CD   . PRO A 1 27 ? -6.023  -10.536 0.220   1.00 0.00 ? 31 PRO A CD   3  
ATOM 4775  H HA   . PRO A 1 27 ? -5.622  -11.707 -2.720  1.00 0.00 ? 31 PRO A HA   3  
ATOM 4776  H HB2  . PRO A 1 27 ? -7.311  -13.218 -1.192  1.00 0.00 ? 31 PRO A HB2  3  
ATOM 4777  H HB3  . PRO A 1 27 ? -5.565  -13.316 -1.074  1.00 0.00 ? 31 PRO A HB3  3  
ATOM 4778  H HG2  . PRO A 1 27 ? -7.478  -12.030 0.777   1.00 0.00 ? 31 PRO A HG2  3  
ATOM 4779  H HG3  . PRO A 1 27 ? -5.818  -12.509 1.071   1.00 0.00 ? 31 PRO A HG3  3  
ATOM 4780  H HD2  . PRO A 1 27 ? -6.779  -9.848  0.599   1.00 0.00 ? 31 PRO A HD2  3  
ATOM 4781  H HD3  . PRO A 1 27 ? -5.107  -10.342 0.779   1.00 0.00 ? 31 PRO A HD3  3  
ATOM 4782  N N    . GLY A 1 28 ? -8.001  -12.082 -3.578  1.00 0.00 ? 32 GLY A N    3  
ATOM 4783  C CA   . GLY A 1 28 ? -9.233  -11.906 -4.328  1.00 0.00 ? 32 GLY A CA   3  
ATOM 4784  C C    . GLY A 1 28 ? -9.937  -13.246 -4.549  1.00 0.00 ? 32 GLY A C    3  
ATOM 4785  O O    . GLY A 1 28 ? -9.656  -14.221 -3.854  1.00 0.00 ? 32 GLY A O    3  
ATOM 4786  H H    . GLY A 1 28 ? -7.507  -12.930 -3.771  1.00 0.00 ? 32 GLY A H    3  
ATOM 4787  H HA2  . GLY A 1 28 ? -9.895  -11.226 -3.791  1.00 0.00 ? 32 GLY A HA2  3  
ATOM 4788  H HA3  . GLY A 1 28 ? -9.014  -11.443 -5.290  1.00 0.00 ? 32 GLY A HA3  3  
ATOM 4789  N N    . PRO A 1 29 ? -10.864 -13.251 -5.545  1.00 0.00 ? 33 PRO A N    3  
ATOM 4790  C CA   . PRO A 1 29 ? -11.611 -14.455 -5.866  1.00 0.00 ? 33 PRO A CA   3  
ATOM 4791  C C    . PRO A 1 29 ? -10.737 -15.456 -6.626  1.00 0.00 ? 33 PRO A C    3  
ATOM 4792  O O    . PRO A 1 29 ? -11.205 -16.527 -7.009  1.00 0.00 ? 33 PRO A O    3  
ATOM 4793  C CB   . PRO A 1 29 ? -12.804 -13.974 -6.675  1.00 0.00 ? 33 PRO A CB   3  
ATOM 4794  C CG   . PRO A 1 29 ? -12.438 -12.585 -7.172  1.00 0.00 ? 33 PRO A CG   3  
ATOM 4795  C CD   . PRO A 1 29 ? -11.223 -12.115 -6.388  1.00 0.00 ? 33 PRO A CD   3  
ATOM 4796  H HA   . PRO A 1 29 ? -11.894 -14.921 -5.028  1.00 0.00 ? 33 PRO A HA   3  
ATOM 4797  H HB2  . PRO A 1 29 ? -13.007 -14.646 -7.509  1.00 0.00 ? 33 PRO A HB2  3  
ATOM 4798  H HB3  . PRO A 1 29 ? -13.705 -13.945 -6.062  1.00 0.00 ? 33 PRO A HB3  3  
ATOM 4799  H HG2  . PRO A 1 29 ? -12.219 -12.606 -8.239  1.00 0.00 ? 33 PRO A HG2  3  
ATOM 4800  H HG3  . PRO A 1 29 ? -13.272 -11.897 -7.031  1.00 0.00 ? 33 PRO A HG3  3  
ATOM 4801  H HD2  . PRO A 1 29 ? -10.404 -11.841 -7.054  1.00 0.00 ? 33 PRO A HD2  3  
ATOM 4802  H HD3  . PRO A 1 29 ? -11.454 -11.234 -5.789  1.00 0.00 ? 33 PRO A HD3  3  
ATOM 4803  N N    . HIS A 1 30 ? -9.485  -15.070 -6.821  1.00 0.00 ? 34 HIS A N    3  
ATOM 4804  C CA   . HIS A 1 30 ? -8.542  -15.920 -7.528  1.00 0.00 ? 34 HIS A CA   3  
ATOM 4805  C C    . HIS A 1 30 ? -7.457  -16.399 -6.562  1.00 0.00 ? 34 HIS A C    3  
ATOM 4806  O O    . HIS A 1 30 ? -7.184  -17.595 -6.471  1.00 0.00 ? 34 HIS A O    3  
ATOM 4807  C CB   . HIS A 1 30 ? -7.971  -15.199 -8.751  1.00 0.00 ? 34 HIS A CB   3  
ATOM 4808  C CG   . HIS A 1 30 ? -7.834  -13.705 -8.574  1.00 0.00 ? 34 HIS A CG   3  
ATOM 4809  N ND1  . HIS A 1 30 ? -8.924  -12.862 -8.448  1.00 0.00 ? 34 HIS A ND1  3  
ATOM 4810  C CD2  . HIS A 1 30 ? -6.725  -12.914 -8.501  1.00 0.00 ? 34 HIS A CD2  3  
ATOM 4811  C CE1  . HIS A 1 30 ? -8.480  -11.622 -8.308  1.00 0.00 ? 34 HIS A CE1  3  
ATOM 4812  N NE2  . HIS A 1 30 ? -7.117  -11.656 -8.342  1.00 0.00 ? 34 HIS A NE2  3  
ATOM 4813  H H    . HIS A 1 30 ? -9.113  -14.197 -6.506  1.00 0.00 ? 34 HIS A H    3  
ATOM 4814  H HA   . HIS A 1 30 ? -9.105  -16.783 -7.885  1.00 0.00 ? 34 HIS A HA   3  
ATOM 4815  H HB2  . HIS A 1 30 ? -6.992  -15.618 -8.983  1.00 0.00 ? 34 HIS A HB2  3  
ATOM 4816  H HB3  . HIS A 1 30 ? -8.614  -15.395 -9.609  1.00 0.00 ? 34 HIS A HB3  3  
ATOM 4817  H HD1  . HIS A 1 30 ? -9.884  -13.141 -8.461  1.00 0.00 ? 34 HIS A HD1  3  
ATOM 4818  H HD2  . HIS A 1 30 ? -5.692  -13.258 -8.564  1.00 0.00 ? 34 HIS A HD2  3  
ATOM 4819  H HE1  . HIS A 1 30 ? -9.095  -10.730 -8.187  1.00 0.00 ? 34 HIS A HE1  3  
ATOM 4820  N N    . CYS A 1 31 ? -6.867  -15.440 -5.863  1.00 0.00 ? 35 CYS A N    3  
ATOM 4821  C CA   . CYS A 1 31 ? -5.818  -15.748 -4.906  1.00 0.00 ? 35 CYS A CA   3  
ATOM 4822  C C    . CYS A 1 31 ? -6.333  -15.415 -3.504  1.00 0.00 ? 35 CYS A C    3  
ATOM 4823  O O    . CYS A 1 31 ? -6.784  -14.298 -3.254  1.00 0.00 ? 35 CYS A O    3  
ATOM 4824  C CB   . CYS A 1 31 ? -4.521  -15.003 -5.229  1.00 0.00 ? 35 CYS A CB   3  
ATOM 4825  S SG   . CYS A 1 31 ? -3.025  -16.055 -5.283  1.00 0.00 ? 35 CYS A SG   3  
ATOM 4826  H H    . CYS A 1 31 ? -7.095  -14.469 -5.942  1.00 0.00 ? 35 CYS A H    3  
ATOM 4827  H HA   . CYS A 1 31 ? -5.613  -16.814 -5.000  1.00 0.00 ? 35 CYS A HA   3  
ATOM 4828  H HB2  . CYS A 1 31 ? -4.634  -14.507 -6.193  1.00 0.00 ? 35 CYS A HB2  3  
ATOM 4829  H HB3  . CYS A 1 31 ? -4.372  -14.222 -4.484  1.00 0.00 ? 35 CYS A HB3  3  
ATOM 4830  N N    . ALA A 1 32 ? -6.249  -16.404 -2.627  1.00 0.00 ? 36 ALA A N    3  
ATOM 4831  C CA   . ALA A 1 32 ? -6.701  -16.231 -1.257  1.00 0.00 ? 36 ALA A CA   3  
ATOM 4832  C C    . ALA A 1 32 ? -5.506  -15.874 -0.372  1.00 0.00 ? 36 ALA A C    3  
ATOM 4833  O O    . ALA A 1 32 ? -5.533  -16.105 0.836   1.00 0.00 ? 36 ALA A O    3  
ATOM 4834  C CB   . ALA A 1 32 ? -7.415  -17.501 -0.790  1.00 0.00 ? 36 ALA A CB   3  
ATOM 4835  H H    . ALA A 1 32 ? -5.882  -17.310 -2.839  1.00 0.00 ? 36 ALA A H    3  
ATOM 4836  H HA   . ALA A 1 32 ? -7.412  -15.404 -1.245  1.00 0.00 ? 36 ALA A HA   3  
ATOM 4837  H HB1  . ALA A 1 32 ? -7.030  -18.358 -1.342  1.00 0.00 ? 36 ALA A HB1  3  
ATOM 4838  H HB2  . ALA A 1 32 ? -7.239  -17.645 0.276   1.00 0.00 ? 36 ALA A HB2  3  
ATOM 4839  H HB3  . ALA A 1 32 ? -8.486  -17.403 -0.971  1.00 0.00 ? 36 ALA A HB3  3  
ATOM 4840  N N    . GLN A 1 33 ? -4.485  -15.318 -1.007  1.00 0.00 ? 37 GLN A N    3  
ATOM 4841  C CA   . GLN A 1 33 ? -3.281  -14.928 -0.292  1.00 0.00 ? 37 GLN A CA   3  
ATOM 4842  C C    . GLN A 1 33 ? -2.899  -13.488 -0.643  1.00 0.00 ? 37 GLN A C    3  
ATOM 4843  O O    . GLN A 1 33 ? -3.271  -12.984 -1.701  1.00 0.00 ? 37 GLN A O    3  
ATOM 4844  C CB   . GLN A 1 33 ? -2.130  -15.890 -0.590  1.00 0.00 ? 37 GLN A CB   3  
ATOM 4845  C CG   . GLN A 1 33 ? -2.621  -17.338 -0.627  1.00 0.00 ? 37 GLN A CG   3  
ATOM 4846  C CD   . GLN A 1 33 ? -2.823  -17.885 0.788   1.00 0.00 ? 37 GLN A CD   3  
ATOM 4847  O OE1  . GLN A 1 33 ? -1.962  -17.788 1.647   1.00 0.00 ? 37 GLN A OE1  3  
ATOM 4848  N NE2  . GLN A 1 33 ? -4.005  -18.464 0.981   1.00 0.00 ? 37 GLN A NE2  3  
ATOM 4849  H H    . GLN A 1 33 ? -4.470  -15.134 -1.990  1.00 0.00 ? 37 GLN A H    3  
ATOM 4850  H HA   . GLN A 1 33 ? -3.538  -14.995 0.766   1.00 0.00 ? 37 GLN A HA   3  
ATOM 4851  H HB2  . GLN A 1 33 ? -1.674  -15.632 -1.546  1.00 0.00 ? 37 GLN A HB2  3  
ATOM 4852  H HB3  . GLN A 1 33 ? -1.356  -15.783 0.170   1.00 0.00 ? 37 GLN A HB3  3  
ATOM 4853  H HG2  . GLN A 1 33 ? -3.559  -17.394 -1.179  1.00 0.00 ? 37 GLN A HG2  3  
ATOM 4854  H HG3  . GLN A 1 33 ? -1.899  -17.957 -1.160  1.00 0.00 ? 37 GLN A HG3  3  
ATOM 4855  H HE21 . GLN A 1 33 ? -4.667  -18.510 0.232   1.00 0.00 ? 37 GLN A HE21 3  
ATOM 4856  H HE22 . GLN A 1 33 ? -4.231  -18.852 1.874   1.00 0.00 ? 37 GLN A HE22 3  
ATOM 4857  N N    . THR A 1 34 ? -2.160  -12.868 0.266   1.00 0.00 ? 38 THR A N    3  
ATOM 4858  C CA   . THR A 1 34 ? -1.723  -11.497 0.066   1.00 0.00 ? 38 THR A CA   3  
ATOM 4859  C C    . THR A 1 34 ? -0.460  -11.461 -0.796  1.00 0.00 ? 38 THR A C    3  
ATOM 4860  O O    . THR A 1 34 ? 0.221   -12.473 -0.949  1.00 0.00 ? 38 THR A O    3  
ATOM 4861  C CB   . THR A 1 34 ? -1.539  -10.854 1.441   1.00 0.00 ? 38 THR A CB   3  
ATOM 4862  O OG1  . THR A 1 34 ? -2.744  -11.165 2.135   1.00 0.00 ? 38 THR A OG1  3  
ATOM 4863  C CG2  . THR A 1 34 ? -1.531  -9.325  1.377   1.00 0.00 ? 38 THR A CG2  3  
ATOM 4864  H H    . THR A 1 34 ? -1.862  -13.286 1.124   1.00 0.00 ? 38 THR A H    3  
ATOM 4865  H HA   . THR A 1 34 ? -2.500  -10.965 -0.484  1.00 0.00 ? 38 THR A HA   3  
ATOM 4866  H HB   . THR A 1 34 ? -0.638  -11.228 1.928   1.00 0.00 ? 38 THR A HB   3  
ATOM 4867  H HG1  . THR A 1 34 ? -2.720  -12.112 2.455   1.00 0.00 ? 38 THR A HG1  3  
ATOM 4868  H HG21 . THR A 1 34 ? -2.465  -8.975  0.938   1.00 0.00 ? 38 THR A HG21 3  
ATOM 4869  H HG22 . THR A 1 34 ? -1.427  -8.919  2.383   1.00 0.00 ? 38 THR A HG22 3  
ATOM 4870  H HG23 . THR A 1 34 ? -0.694  -8.992  0.763   1.00 0.00 ? 38 THR A HG23 3  
ATOM 4871  N N    . GLU A 1 35 ? -0.185  -10.283 -1.337  1.00 0.00 ? 39 GLU A N    3  
ATOM 4872  C CA   . GLU A 1 35 ? 0.985   -10.101 -2.180  1.00 0.00 ? 39 GLU A CA   3  
ATOM 4873  C C    . GLU A 1 35 ? 1.575   -8.704  -1.975  1.00 0.00 ? 39 GLU A C    3  
ATOM 4874  O O    . GLU A 1 35 ? 1.342   -7.804  -2.780  1.00 0.00 ? 39 GLU A O    3  
ATOM 4875  C CB   . GLU A 1 35 ? 0.643   -10.341 -3.652  1.00 0.00 ? 39 GLU A CB   3  
ATOM 4876  C CG   . GLU A 1 35 ? 0.325   -11.816 -3.908  1.00 0.00 ? 39 GLU A CG   3  
ATOM 4877  C CD   . GLU A 1 35 ? 1.440   -12.717 -3.374  1.00 0.00 ? 39 GLU A CD   3  
ATOM 4878  O OE1  . GLU A 1 35 ? 2.592   -12.233 -3.336  1.00 0.00 ? 39 GLU A OE1  3  
ATOM 4879  O OE2  . GLU A 1 35 ? 1.115   -13.870 -3.017  1.00 0.00 ? 39 GLU A OE2  3  
ATOM 4880  H H    . GLU A 1 35 ? -0.744  -9.464  -1.208  1.00 0.00 ? 39 GLU A H    3  
ATOM 4881  H HA   . GLU A 1 35 ? 1.699   -10.856 -1.852  1.00 0.00 ? 39 GLU A HA   3  
ATOM 4882  H HB2  . GLU A 1 35 ? -0.212  -9.727  -3.935  1.00 0.00 ? 39 GLU A HB2  3  
ATOM 4883  H HB3  . GLU A 1 35 ? 1.479   -10.032 -4.279  1.00 0.00 ? 39 GLU A HB3  3  
ATOM 4884  H HG2  . GLU A 1 35 ? -0.619  -12.076 -3.429  1.00 0.00 ? 39 GLU A HG2  3  
ATOM 4885  H HG3  . GLU A 1 35 ? 0.197   -11.983 -4.977  1.00 0.00 ? 39 GLU A HG3  3  
ATOM 4886  N N    . VAL A 1 36 ? 2.328   -8.568  -0.894  1.00 0.00 ? 40 VAL A N    3  
ATOM 4887  C CA   . VAL A 1 36 ? 2.954   -7.296  -0.572  1.00 0.00 ? 40 VAL A CA   3  
ATOM 4888  C C    . VAL A 1 36 ? 4.119   -7.049  -1.532  1.00 0.00 ? 40 VAL A C    3  
ATOM 4889  O O    . VAL A 1 36 ? 5.108   -7.782  -1.516  1.00 0.00 ? 40 VAL A O    3  
ATOM 4890  C CB   . VAL A 1 36 ? 3.376   -7.277  0.898   1.00 0.00 ? 40 VAL A CB   3  
ATOM 4891  C CG1  . VAL A 1 36 ? 4.264   -6.068  1.198   1.00 0.00 ? 40 VAL A CG1  3  
ATOM 4892  C CG2  . VAL A 1 36 ? 2.155   -7.303  1.819   1.00 0.00 ? 40 VAL A CG2  3  
ATOM 4893  H H    . VAL A 1 36 ? 2.513   -9.306  -0.244  1.00 0.00 ? 40 VAL A H    3  
ATOM 4894  H HA   . VAL A 1 36 ? 2.207   -6.516  -0.719  1.00 0.00 ? 40 VAL A HA   3  
ATOM 4895  H HB   . VAL A 1 36 ? 3.959   -8.178  1.091   1.00 0.00 ? 40 VAL A HB   3  
ATOM 4896  H HG11 . VAL A 1 36 ? 5.124   -6.074  0.527   1.00 0.00 ? 40 VAL A HG11 3  
ATOM 4897  H HG12 . VAL A 1 36 ? 3.693   -5.152  1.048   1.00 0.00 ? 40 VAL A HG12 3  
ATOM 4898  H HG13 . VAL A 1 36 ? 4.608   -6.117  2.231   1.00 0.00 ? 40 VAL A HG13 3  
ATOM 4899  H HG21 . VAL A 1 36 ? 1.350   -7.860  1.340   1.00 0.00 ? 40 VAL A HG21 3  
ATOM 4900  H HG22 . VAL A 1 36 ? 2.420   -7.784  2.761   1.00 0.00 ? 40 VAL A HG22 3  
ATOM 4901  H HG23 . VAL A 1 36 ? 1.825   -6.282  2.013   1.00 0.00 ? 40 VAL A HG23 3  
ATOM 4902  N N    . ILE A 1 37 ? 3.965   -6.016  -2.346  1.00 0.00 ? 41 ILE A N    3  
ATOM 4903  C CA   . ILE A 1 37 ? 4.992   -5.663  -3.312  1.00 0.00 ? 41 ILE A CA   3  
ATOM 4904  C C    . ILE A 1 37 ? 5.444   -4.222  -3.065  1.00 0.00 ? 41 ILE A C    3  
ATOM 4905  O O    . ILE A 1 37 ? 4.652   -3.290  -3.189  1.00 0.00 ? 41 ILE A O    3  
ATOM 4906  C CB   . ILE A 1 37 ? 4.498   -5.917  -4.737  1.00 0.00 ? 41 ILE A CB   3  
ATOM 4907  C CG1  . ILE A 1 37 ? 3.952   -7.339  -4.882  1.00 0.00 ? 41 ILE A CG1  3  
ATOM 4908  C CG2  . ILE A 1 37 ? 5.596   -5.618  -5.760  1.00 0.00 ? 41 ILE A CG2  3  
ATOM 4909  C CD1  . ILE A 1 37 ? 2.504   -7.322  -5.378  1.00 0.00 ? 41 ILE A CD1  3  
ATOM 4910  H H    . ILE A 1 37 ? 3.158   -5.425  -2.354  1.00 0.00 ? 41 ILE A H    3  
ATOM 4911  H HA   . ILE A 1 37 ? 5.841   -6.325  -3.142  1.00 0.00 ? 41 ILE A HA   3  
ATOM 4912  H HB   . ILE A 1 37 ? 3.674   -5.233  -4.940  1.00 0.00 ? 41 ILE A HB   3  
ATOM 4913  H HG12 . ILE A 1 37 ? 4.572   -7.901  -5.580  1.00 0.00 ? 41 ILE A HG12 3  
ATOM 4914  H HG13 . ILE A 1 37 ? 4.005   -7.853  -3.923  1.00 0.00 ? 41 ILE A HG13 3  
ATOM 4915  H HG21 . ILE A 1 37 ? 6.158   -4.739  -5.443  1.00 0.00 ? 41 ILE A HG21 3  
ATOM 4916  H HG22 . ILE A 1 37 ? 6.269   -6.473  -5.831  1.00 0.00 ? 41 ILE A HG22 3  
ATOM 4917  H HG23 . ILE A 1 37 ? 5.144   -5.429  -6.733  1.00 0.00 ? 41 ILE A HG23 3  
ATOM 4918  H HD11 . ILE A 1 37 ? 2.013   -6.413  -5.032  1.00 0.00 ? 41 ILE A HD11 3  
ATOM 4919  H HD12 . ILE A 1 37 ? 2.493   -7.350  -6.468  1.00 0.00 ? 41 ILE A HD12 3  
ATOM 4920  H HD13 . ILE A 1 37 ? 1.976   -8.192  -4.987  1.00 0.00 ? 41 ILE A HD13 3  
ATOM 4921  N N    . ALA A 1 38 ? 6.716   -4.085  -2.721  1.00 0.00 ? 42 ALA A N    3  
ATOM 4922  C CA   . ALA A 1 38 ? 7.283   -2.774  -2.456  1.00 0.00 ? 42 ALA A CA   3  
ATOM 4923  C C    . ALA A 1 38 ? 8.226   -2.391  -3.599  1.00 0.00 ? 42 ALA A C    3  
ATOM 4924  O O    . ALA A 1 38 ? 8.919   -3.244  -4.149  1.00 0.00 ? 42 ALA A O    3  
ATOM 4925  C CB   . ALA A 1 38 ? 7.988   -2.787  -1.098  1.00 0.00 ? 42 ALA A CB   3  
ATOM 4926  H H    . ALA A 1 38 ? 7.354   -4.849  -2.622  1.00 0.00 ? 42 ALA A H    3  
ATOM 4927  H HA   . ALA A 1 38 ? 6.462   -2.059  -2.418  1.00 0.00 ? 42 ALA A HA   3  
ATOM 4928  H HB1  . ALA A 1 38 ? 9.066   -2.857  -1.249  1.00 0.00 ? 42 ALA A HB1  3  
ATOM 4929  H HB2  . ALA A 1 38 ? 7.756   -1.868  -0.559  1.00 0.00 ? 42 ALA A HB2  3  
ATOM 4930  H HB3  . ALA A 1 38 ? 7.646   -3.645  -0.519  1.00 0.00 ? 42 ALA A HB3  3  
ATOM 4931  N N    . THR A 1 39 ? 8.220   -1.106  -3.922  1.00 0.00 ? 43 THR A N    3  
ATOM 4932  C CA   . THR A 1 39 ? 9.066   -0.599  -4.989  1.00 0.00 ? 43 THR A CA   3  
ATOM 4933  C C    . THR A 1 39 ? 10.408  -0.127  -4.427  1.00 0.00 ? 43 THR A C    3  
ATOM 4934  O O    . THR A 1 39 ? 10.458  0.485   -3.361  1.00 0.00 ? 43 THR A O    3  
ATOM 4935  C CB   . THR A 1 39 ? 8.294   0.500   -5.722  1.00 0.00 ? 43 THR A CB   3  
ATOM 4936  O OG1  . THR A 1 39 ? 7.274   -0.203  -6.426  1.00 0.00 ? 43 THR A OG1  3  
ATOM 4937  C CG2  . THR A 1 39 ? 9.122   1.160   -6.827  1.00 0.00 ? 43 THR A CG2  3  
ATOM 4938  H H    . THR A 1 39 ? 7.653   -0.418  -3.469  1.00 0.00 ? 43 THR A H    3  
ATOM 4939  H HA   . THR A 1 39 ? 9.277   -1.416  -5.678  1.00 0.00 ? 43 THR A HA   3  
ATOM 4940  H HB   . THR A 1 39 ? 7.917   1.245   -5.022  1.00 0.00 ? 43 THR A HB   3  
ATOM 4941  H HG1  . THR A 1 39 ? 6.721   0.439   -6.957  1.00 0.00 ? 43 THR A HG1  3  
ATOM 4942  H HG21 . THR A 1 39 ? 9.551   0.390   -7.468  1.00 0.00 ? 43 THR A HG21 3  
ATOM 4943  H HG22 . THR A 1 39 ? 8.482   1.812   -7.421  1.00 0.00 ? 43 THR A HG22 3  
ATOM 4944  H HG23 . THR A 1 39 ? 9.923   1.747   -6.379  1.00 0.00 ? 43 THR A HG23 3  
ATOM 4945  N N    . LEU A 1 40 ? 11.463  -0.428  -5.169  1.00 0.00 ? 44 LEU A N    3  
ATOM 4946  C CA   . LEU A 1 40 ? 12.803  -0.043  -4.758  1.00 0.00 ? 44 LEU A CA   3  
ATOM 4947  C C    . LEU A 1 40 ? 13.103  1.367   -5.273  1.00 0.00 ? 44 LEU A C    3  
ATOM 4948  O O    . LEU A 1 40 ? 12.582  1.777   -6.309  1.00 0.00 ? 44 LEU A O    3  
ATOM 4949  C CB   . LEU A 1 40 ? 13.823  -1.091  -5.205  1.00 0.00 ? 44 LEU A CB   3  
ATOM 4950  C CG   . LEU A 1 40 ? 14.820  -1.554  -4.140  1.00 0.00 ? 44 LEU A CG   3  
ATOM 4951  C CD1  . LEU A 1 40 ? 15.458  -2.888  -4.530  1.00 0.00 ? 44 LEU A CD1  3  
ATOM 4952  C CD2  . LEU A 1 40 ? 15.869  -0.475  -3.866  1.00 0.00 ? 44 LEU A CD2  3  
ATOM 4953  H H    . LEU A 1 40 ? 11.414  -0.926  -6.035  1.00 0.00 ? 44 LEU A H    3  
ATOM 4954  H HA   . LEU A 1 40 ? 12.817  -0.023  -3.669  1.00 0.00 ? 44 LEU A HA   3  
ATOM 4955  H HB2  . LEU A 1 40 ? 13.282  -1.964  -5.571  1.00 0.00 ? 44 LEU A HB2  3  
ATOM 4956  H HB3  . LEU A 1 40 ? 14.384  -0.687  -6.048  1.00 0.00 ? 44 LEU A HB3  3  
ATOM 4957  H HG   . LEU A 1 40 ? 14.275  -1.717  -3.210  1.00 0.00 ? 44 LEU A HG   3  
ATOM 4958  H HD11 . LEU A 1 40 ? 14.677  -3.605  -4.782  1.00 0.00 ? 44 LEU A HD11 3  
ATOM 4959  H HD12 . LEU A 1 40 ? 16.109  -2.742  -5.392  1.00 0.00 ? 44 LEU A HD12 3  
ATOM 4960  H HD13 . LEU A 1 40 ? 16.044  -3.269  -3.693  1.00 0.00 ? 44 LEU A HD13 3  
ATOM 4961  H HD21 . LEU A 1 40 ? 16.104  0.048   -4.793  1.00 0.00 ? 44 LEU A HD21 3  
ATOM 4962  H HD22 . LEU A 1 40 ? 15.478  0.236   -3.138  1.00 0.00 ? 44 LEU A HD22 3  
ATOM 4963  H HD23 . LEU A 1 40 ? 16.773  -0.939  -3.471  1.00 0.00 ? 44 LEU A HD23 3  
ATOM 4964  N N    . LYS A 1 41 ? 13.943  2.068   -4.526  1.00 0.00 ? 45 LYS A N    3  
ATOM 4965  C CA   . LYS A 1 41 ? 14.319  3.423   -4.894  1.00 0.00 ? 45 LYS A CA   3  
ATOM 4966  C C    . LYS A 1 41 ? 15.292  3.375   -6.074  1.00 0.00 ? 45 LYS A C    3  
ATOM 4967  O O    . LYS A 1 41 ? 15.687  4.414   -6.600  1.00 0.00 ? 45 LYS A O    3  
ATOM 4968  C CB   . LYS A 1 41 ? 14.863  4.176   -3.679  1.00 0.00 ? 45 LYS A CB   3  
ATOM 4969  C CG   . LYS A 1 41 ? 14.909  5.683   -3.943  1.00 0.00 ? 45 LYS A CG   3  
ATOM 4970  C CD   . LYS A 1 41 ? 16.334  6.139   -4.265  1.00 0.00 ? 45 LYS A CD   3  
ATOM 4971  C CE   . LYS A 1 41 ? 16.823  7.170   -3.246  1.00 0.00 ? 45 LYS A CE   3  
ATOM 4972  N NZ   . LYS A 1 41 ? 17.510  8.289   -3.930  1.00 0.00 ? 45 LYS A NZ   3  
ATOM 4973  H H    . LYS A 1 41 ? 14.362  1.727   -3.685  1.00 0.00 ? 45 LYS A H    3  
ATOM 4974  H HA   . LYS A 1 41 ? 13.413  3.938   -5.214  1.00 0.00 ? 45 LYS A HA   3  
ATOM 4975  H HB2  . LYS A 1 41 ? 14.236  3.975   -2.810  1.00 0.00 ? 45 LYS A HB2  3  
ATOM 4976  H HB3  . LYS A 1 41 ? 15.863  3.815   -3.439  1.00 0.00 ? 45 LYS A HB3  3  
ATOM 4977  H HG2  . LYS A 1 41 ? 14.248  5.930   -4.773  1.00 0.00 ? 45 LYS A HG2  3  
ATOM 4978  H HG3  . LYS A 1 41 ? 14.540  6.220   -3.070  1.00 0.00 ? 45 LYS A HG3  3  
ATOM 4979  H HD2  . LYS A 1 41 ? 17.003  5.279   -4.268  1.00 0.00 ? 45 LYS A HD2  3  
ATOM 4980  H HD3  . LYS A 1 41 ? 16.364  6.569   -5.267  1.00 0.00 ? 45 LYS A HD3  3  
ATOM 4981  H HE2  . LYS A 1 41 ? 15.979  7.551   -2.671  1.00 0.00 ? 45 LYS A HE2  3  
ATOM 4982  H HE3  . LYS A 1 41 ? 17.503  6.696   -2.538  1.00 0.00 ? 45 LYS A HE3  3  
ATOM 4983  H HZ1  . LYS A 1 41 ? 17.653  8.055   -4.891  1.00 0.00 ? 45 LYS A HZ1  3  
ATOM 4984  H HZ2  . LYS A 1 41 ? 16.947  9.113   -3.868  1.00 0.00 ? 45 LYS A HZ2  3  
ATOM 4985  H HZ3  . LYS A 1 41 ? 18.394  8.455   -3.492  1.00 0.00 ? 45 LYS A HZ3  3  
ATOM 4986  N N    . ASN A 1 42 ? 15.650  2.157   -6.455  1.00 0.00 ? 46 ASN A N    3  
ATOM 4987  C CA   . ASN A 1 42 ? 16.569  1.960   -7.563  1.00 0.00 ? 46 ASN A CA   3  
ATOM 4988  C C    . ASN A 1 42 ? 15.775  1.608   -8.822  1.00 0.00 ? 46 ASN A C    3  
ATOM 4989  O O    . ASN A 1 42 ? 16.336  1.535   -9.914  1.00 0.00 ? 46 ASN A O    3  
ATOM 4990  C CB   . ASN A 1 42 ? 17.537  0.810   -7.277  1.00 0.00 ? 46 ASN A CB   3  
ATOM 4991  C CG   . ASN A 1 42 ? 17.777  -0.030  -8.534  1.00 0.00 ? 46 ASN A CG   3  
ATOM 4992  O OD1  . ASN A 1 42 ? 18.348  0.420   -9.513  1.00 0.00 ? 46 ASN A OD1  3  
ATOM 4993  N ND2  . ASN A 1 42 ? 17.309  -1.272  -8.451  1.00 0.00 ? 46 ASN A ND2  3  
ATOM 4994  H H    . ASN A 1 42 ? 15.324  1.317   -6.022  1.00 0.00 ? 46 ASN A H    3  
ATOM 4995  H HA   . ASN A 1 42 ? 17.108  2.903   -7.659  1.00 0.00 ? 46 ASN A HA   3  
ATOM 4996  H HB2  . ASN A 1 42 ? 18.485  1.209   -6.916  1.00 0.00 ? 46 ASN A HB2  3  
ATOM 4997  H HB3  . ASN A 1 42 ? 17.135  0.179   -6.485  1.00 0.00 ? 46 ASN A HB3  3  
ATOM 4998  H HD21 . ASN A 1 42 ? 16.849  -1.579  -7.618  1.00 0.00 ? 46 ASN A HD21 3  
ATOM 4999  H HD22 . ASN A 1 42 ? 17.417  -1.899  -9.222  1.00 0.00 ? 46 ASN A HD22 3  
ATOM 5000  N N    . GLY A 1 43 ? 14.481  1.398   -8.628  1.00 0.00 ? 47 GLY A N    3  
ATOM 5001  C CA   . GLY A 1 43 ? 13.604  1.055   -9.734  1.00 0.00 ? 47 GLY A CA   3  
ATOM 5002  C C    . GLY A 1 43 ? 13.197  -0.419  -9.675  1.00 0.00 ? 47 GLY A C    3  
ATOM 5003  O O    . GLY A 1 43 ? 12.379  -0.873  -10.474 1.00 0.00 ? 47 GLY A O    3  
ATOM 5004  H H    . GLY A 1 43 ? 14.033  1.459   -7.736  1.00 0.00 ? 47 GLY A H    3  
ATOM 5005  H HA2  . GLY A 1 43 ? 12.714  1.683   -9.706  1.00 0.00 ? 47 GLY A HA2  3  
ATOM 5006  H HA3  . GLY A 1 43 ? 14.108  1.259   -10.679 1.00 0.00 ? 47 GLY A HA3  3  
ATOM 5007  N N    . GLN A 1 44 ? 13.786  -1.124  -8.721  1.00 0.00 ? 48 GLN A N    3  
ATOM 5008  C CA   . GLN A 1 44 ? 13.495  -2.537  -8.547  1.00 0.00 ? 48 GLN A CA   3  
ATOM 5009  C C    . GLN A 1 44 ? 12.282  -2.720  -7.633  1.00 0.00 ? 48 GLN A C    3  
ATOM 5010  O O    . GLN A 1 44 ? 11.621  -1.748  -7.270  1.00 0.00 ? 48 GLN A O    3  
ATOM 5011  C CB   . GLN A 1 44 ? 14.712  -3.284  -7.998  1.00 0.00 ? 48 GLN A CB   3  
ATOM 5012  C CG   . GLN A 1 44 ? 15.646  -3.718  -9.130  1.00 0.00 ? 48 GLN A CG   3  
ATOM 5013  C CD   . GLN A 1 44 ? 16.972  -4.243  -8.576  1.00 0.00 ? 48 GLN A CD   3  
ATOM 5014  O OE1  . GLN A 1 44 ? 17.109  -4.540  -7.401  1.00 0.00 ? 48 GLN A OE1  3  
ATOM 5015  N NE2  . GLN A 1 44 ? 17.937  -4.341  -9.486  1.00 0.00 ? 48 GLN A NE2  3  
ATOM 5016  H H    . GLN A 1 44 ? 14.450  -0.747  -8.075  1.00 0.00 ? 48 GLN A H    3  
ATOM 5017  H HA   . GLN A 1 44 ? 13.267  -2.911  -9.545  1.00 0.00 ? 48 GLN A HA   3  
ATOM 5018  H HB2  . GLN A 1 44 ? 15.253  -2.644  -7.301  1.00 0.00 ? 48 GLN A HB2  3  
ATOM 5019  H HB3  . GLN A 1 44 ? 14.384  -4.159  -7.437  1.00 0.00 ? 48 GLN A HB3  3  
ATOM 5020  H HG2  . GLN A 1 44 ? 15.164  -4.492  -9.727  1.00 0.00 ? 48 GLN A HG2  3  
ATOM 5021  H HG3  . GLN A 1 44 ? 15.834  -2.874  -9.794  1.00 0.00 ? 48 GLN A HG3  3  
ATOM 5022  H HE21 . GLN A 1 44 ? 17.759  -4.080  -10.435 1.00 0.00 ? 48 GLN A HE21 3  
ATOM 5023  H HE22 . GLN A 1 44 ? 18.842  -4.675  -9.221  1.00 0.00 ? 48 GLN A HE22 3  
ATOM 5024  N N    . LYS A 1 45 ? 12.025  -3.973  -7.288  1.00 0.00 ? 49 LYS A N    3  
ATOM 5025  C CA   . LYS A 1 45 ? 10.902  -4.297  -6.424  1.00 0.00 ? 49 LYS A CA   3  
ATOM 5026  C C    . LYS A 1 45 ? 11.275  -5.484  -5.534  1.00 0.00 ? 49 LYS A C    3  
ATOM 5027  O O    . LYS A 1 45 ? 12.007  -6.377  -5.958  1.00 0.00 ? 49 LYS A O    3  
ATOM 5028  C CB   . LYS A 1 45 ? 9.636   -4.523  -7.252  1.00 0.00 ? 49 LYS A CB   3  
ATOM 5029  C CG   . LYS A 1 45 ? 9.345   -3.318  -8.149  1.00 0.00 ? 49 LYS A CG   3  
ATOM 5030  C CD   . LYS A 1 45 ? 8.029   -3.504  -8.908  1.00 0.00 ? 49 LYS A CD   3  
ATOM 5031  C CE   . LYS A 1 45 ? 8.131   -2.945  -10.328 1.00 0.00 ? 49 LYS A CE   3  
ATOM 5032  N NZ   . LYS A 1 45 ? 7.043   -3.480  -11.176 1.00 0.00 ? 49 LYS A NZ   3  
ATOM 5033  H H    . LYS A 1 45 ? 12.567  -4.758  -7.588  1.00 0.00 ? 49 LYS A H    3  
ATOM 5034  H HA   . LYS A 1 45 ? 10.720  -3.431  -5.787  1.00 0.00 ? 49 LYS A HA   3  
ATOM 5035  H HB2  . LYS A 1 45 ? 9.752   -5.417  -7.865  1.00 0.00 ? 49 LYS A HB2  3  
ATOM 5036  H HB3  . LYS A 1 45 ? 8.789   -4.700  -6.589  1.00 0.00 ? 49 LYS A HB3  3  
ATOM 5037  H HG2  . LYS A 1 45 ? 9.294   -2.413  -7.544  1.00 0.00 ? 49 LYS A HG2  3  
ATOM 5038  H HG3  . LYS A 1 45 ? 10.161  -3.182  -8.858  1.00 0.00 ? 49 LYS A HG3  3  
ATOM 5039  H HD2  . LYS A 1 45 ? 7.775   -4.564  -8.948  1.00 0.00 ? 49 LYS A HD2  3  
ATOM 5040  H HD3  . LYS A 1 45 ? 7.223   -3.003  -8.373  1.00 0.00 ? 49 LYS A HD3  3  
ATOM 5041  H HE2  . LYS A 1 45 ? 8.078   -1.856  -10.302 1.00 0.00 ? 49 LYS A HE2  3  
ATOM 5042  H HE3  . LYS A 1 45 ? 9.098   -3.205  -10.760 1.00 0.00 ? 49 LYS A HE3  3  
ATOM 5043  H HZ1  . LYS A 1 45 ? 6.167   -3.361  -10.709 1.00 0.00 ? 49 LYS A HZ1  3  
ATOM 5044  H HZ2  . LYS A 1 45 ? 7.026   -2.989  -12.047 1.00 0.00 ? 49 LYS A HZ2  3  
ATOM 5045  H HZ3  . LYS A 1 45 ? 7.201   -4.453  -11.346 1.00 0.00 ? 49 LYS A HZ3  3  
ATOM 5046  N N    . ALA A 1 46 ? 10.754  -5.455  -4.316  1.00 0.00 ? 50 ALA A N    3  
ATOM 5047  C CA   . ALA A 1 46 ? 11.023  -6.518  -3.362  1.00 0.00 ? 50 ALA A CA   3  
ATOM 5048  C C    . ALA A 1 46 ? 9.716   -6.927  -2.679  1.00 0.00 ? 50 ALA A C    3  
ATOM 5049  O O    . ALA A 1 46 ? 9.129   -6.144  -1.934  1.00 0.00 ? 50 ALA A O    3  
ATOM 5050  C CB   . ALA A 1 46 ? 12.082  -6.050  -2.361  1.00 0.00 ? 50 ALA A CB   3  
ATOM 5051  H H    . ALA A 1 46 ? 10.159  -4.725  -3.979  1.00 0.00 ? 50 ALA A H    3  
ATOM 5052  H HA   . ALA A 1 46 ? 11.416  -7.370  -3.916  1.00 0.00 ? 50 ALA A HA   3  
ATOM 5053  H HB1  . ALA A 1 46 ? 12.164  -4.964  -2.400  1.00 0.00 ? 50 ALA A HB1  3  
ATOM 5054  H HB2  . ALA A 1 46 ? 11.792  -6.356  -1.356  1.00 0.00 ? 50 ALA A HB2  3  
ATOM 5055  H HB3  . ALA A 1 46 ? 13.043  -6.497  -2.614  1.00 0.00 ? 50 ALA A HB3  3  
ATOM 5056  N N    . CYS A 1 47 ? 9.299   -8.153  -2.957  1.00 0.00 ? 51 CYS A N    3  
ATOM 5057  C CA   . CYS A 1 47 ? 8.073   -8.676  -2.379  1.00 0.00 ? 51 CYS A CA   3  
ATOM 5058  C C    . CYS A 1 47 ? 8.336   -9.001  -0.908  1.00 0.00 ? 51 CYS A C    3  
ATOM 5059  O O    . CYS A 1 47 ? 9.387   -9.539  -0.565  1.00 0.00 ? 51 CYS A O    3  
ATOM 5060  C CB   . CYS A 1 47 ? 7.558   -9.894  -3.150  1.00 0.00 ? 51 CYS A CB   3  
ATOM 5061  S SG   . CYS A 1 47 ? 6.135   -9.561  -4.251  1.00 0.00 ? 51 CYS A SG   3  
ATOM 5062  H H    . CYS A 1 47 ? 9.783   -8.784  -3.564  1.00 0.00 ? 51 CYS A H    3  
ATOM 5063  H HA   . CYS A 1 47 ? 7.322   -7.891  -2.475  1.00 0.00 ? 51 CYS A HA   3  
ATOM 5064  H HB2  . CYS A 1 47 ? 8.375   -10.300 -3.747  1.00 0.00 ? 51 CYS A HB2  3  
ATOM 5065  H HB3  . CYS A 1 47 ? 7.274   -10.665 -2.434  1.00 0.00 ? 51 CYS A HB3  3  
ATOM 5066  N N    . LEU A 1 48 ? 7.362   -8.661  -0.076  1.00 0.00 ? 52 LEU A N    3  
ATOM 5067  C CA   . LEU A 1 48 ? 7.475   -8.909  1.351   1.00 0.00 ? 52 LEU A CA   3  
ATOM 5068  C C    . LEU A 1 48 ? 6.506   -10.025 1.748   1.00 0.00 ? 52 LEU A C    3  
ATOM 5069  O O    . LEU A 1 48 ? 5.610   -10.376 0.981   1.00 0.00 ? 52 LEU A O    3  
ATOM 5070  C CB   . LEU A 1 48 ? 7.275   -7.613  2.138   1.00 0.00 ? 52 LEU A CB   3  
ATOM 5071  C CG   . LEU A 1 48 ? 8.273   -6.490  1.846   1.00 0.00 ? 52 LEU A CG   3  
ATOM 5072  C CD1  . LEU A 1 48 ? 7.734   -5.140  2.324   1.00 0.00 ? 52 LEU A CD1  3  
ATOM 5073  C CD2  . LEU A 1 48 ? 9.644   -6.805  2.447   1.00 0.00 ? 52 LEU A CD2  3  
ATOM 5074  H H    . LEU A 1 48 ? 6.509   -8.223  -0.363  1.00 0.00 ? 52 LEU A H    3  
ATOM 5075  H HA   . LEU A 1 48 ? 8.492   -9.250  1.543   1.00 0.00 ? 52 LEU A HA   3  
ATOM 5076  H HB2  . LEU A 1 48 ? 6.270   -7.240  1.938   1.00 0.00 ? 52 LEU A HB2  3  
ATOM 5077  H HB3  . LEU A 1 48 ? 7.322   -7.846  3.202   1.00 0.00 ? 52 LEU A HB3  3  
ATOM 5078  H HG   . LEU A 1 48 ? 8.403   -6.421  0.766   1.00 0.00 ? 52 LEU A HG   3  
ATOM 5079  H HD11 . LEU A 1 48 ? 6.645   -5.150  2.286   1.00 0.00 ? 52 LEU A HD11 3  
ATOM 5080  H HD12 . LEU A 1 48 ? 8.061   -4.960  3.348   1.00 0.00 ? 52 LEU A HD12 3  
ATOM 5081  H HD13 . LEU A 1 48 ? 8.113   -4.349  1.677   1.00 0.00 ? 52 LEU A HD13 3  
ATOM 5082  H HD21 . LEU A 1 48 ? 9.882   -7.855  2.277   1.00 0.00 ? 52 LEU A HD21 3  
ATOM 5083  H HD22 . LEU A 1 48 ? 10.400  -6.180  1.974   1.00 0.00 ? 52 LEU A HD22 3  
ATOM 5084  H HD23 . LEU A 1 48 ? 9.625   -6.606  3.518   1.00 0.00 ? 52 LEU A HD23 3  
ATOM 5085  N N    . ASN A 1 49 ? 6.719   -10.552 2.944   1.00 0.00 ? 53 ASN A N    3  
ATOM 5086  C CA   . ASN A 1 49 ? 5.876   -11.621 3.452   1.00 0.00 ? 53 ASN A CA   3  
ATOM 5087  C C    . ASN A 1 49 ? 4.729   -11.018 4.265   1.00 0.00 ? 53 ASN A C    3  
ATOM 5088  O O    . ASN A 1 49 ? 4.951   -10.450 5.333   1.00 0.00 ? 53 ASN A O    3  
ATOM 5089  C CB   . ASN A 1 49 ? 6.666   -12.556 4.371   1.00 0.00 ? 53 ASN A CB   3  
ATOM 5090  C CG   . ASN A 1 49 ? 5.950   -13.898 4.533   1.00 0.00 ? 53 ASN A CG   3  
ATOM 5091  O OD1  . ASN A 1 49 ? 5.324   -14.411 3.621   1.00 0.00 ? 53 ASN A OD1  3  
ATOM 5092  N ND2  . ASN A 1 49 ? 6.079   -14.437 5.743   1.00 0.00 ? 53 ASN A ND2  3  
ATOM 5093  H H    . ASN A 1 49 ? 7.450   -10.261 3.562   1.00 0.00 ? 53 ASN A H    3  
ATOM 5094  H HA   . ASN A 1 49 ? 5.526   -12.155 2.569   1.00 0.00 ? 53 ASN A HA   3  
ATOM 5095  H HB2  . ASN A 1 49 ? 7.663   -12.718 3.962   1.00 0.00 ? 53 ASN A HB2  3  
ATOM 5096  H HB3  . ASN A 1 49 ? 6.795   -12.088 5.348   1.00 0.00 ? 53 ASN A HB3  3  
ATOM 5097  H HD21 . ASN A 1 49 ? 6.607   -13.964 6.447   1.00 0.00 ? 53 ASN A HD21 3  
ATOM 5098  H HD22 . ASN A 1 49 ? 5.647   -15.316 5.947   1.00 0.00 ? 53 ASN A HD22 3  
ATOM 5099  N N    . PRO A 1 50 ? 3.495   -11.165 3.713   1.00 0.00 ? 54 PRO A N    3  
ATOM 5100  C CA   . PRO A 1 50 ? 2.312   -10.641 4.374   1.00 0.00 ? 54 PRO A CA   3  
ATOM 5101  C C    . PRO A 1 50 ? 1.919   -11.513 5.568   1.00 0.00 ? 54 PRO A C    3  
ATOM 5102  O O    . PRO A 1 50 ? 0.755   -11.881 5.717   1.00 0.00 ? 54 PRO A O    3  
ATOM 5103  C CB   . PRO A 1 50 ? 1.243   -10.598 3.294   1.00 0.00 ? 54 PRO A CB   3  
ATOM 5104  C CG   . PRO A 1 50 ? 1.726   -11.528 2.193   1.00 0.00 ? 54 PRO A CG   3  
ATOM 5105  C CD   . PRO A 1 50 ? 3.193   -11.831 2.449   1.00 0.00 ? 54 PRO A CD   3  
ATOM 5106  H HA   . PRO A 1 50 ? 2.497   -9.732  4.749   1.00 0.00 ? 54 PRO A HA   3  
ATOM 5107  H HB2  . PRO A 1 50 ? 0.279   -10.923 3.685   1.00 0.00 ? 54 PRO A HB2  3  
ATOM 5108  H HB3  . PRO A 1 50 ? 1.109   -9.583  2.918   1.00 0.00 ? 54 PRO A HB3  3  
ATOM 5109  H HG2  . PRO A 1 50 ? 1.142   -12.447 2.186   1.00 0.00 ? 54 PRO A HG2  3  
ATOM 5110  H HG3  . PRO A 1 50 ? 1.598   -11.061 1.216   1.00 0.00 ? 54 PRO A HG3  3  
ATOM 5111  H HD2  . PRO A 1 50 ? 3.370   -12.905 2.515   1.00 0.00 ? 54 PRO A HD2  3  
ATOM 5112  H HD3  . PRO A 1 50 ? 3.823   -11.454 1.643   1.00 0.00 ? 54 PRO A HD3  3  
ATOM 5113  N N    . ALA A 1 51 ? 2.914   -11.820 6.389   1.00 0.00 ? 55 ALA A N    3  
ATOM 5114  C CA   . ALA A 1 51 ? 2.687   -12.642 7.565   1.00 0.00 ? 55 ALA A CA   3  
ATOM 5115  C C    . ALA A 1 51 ? 3.938   -12.621 8.445   1.00 0.00 ? 55 ALA A C    3  
ATOM 5116  O O    . ALA A 1 51 ? 4.253   -13.609 9.107   1.00 0.00 ? 55 ALA A O    3  
ATOM 5117  C CB   . ALA A 1 51 ? 2.303   -14.058 7.132   1.00 0.00 ? 55 ALA A CB   3  
ATOM 5118  H H    . ALA A 1 51 ? 3.858   -11.516 6.260   1.00 0.00 ? 55 ALA A H    3  
ATOM 5119  H HA   . ALA A 1 51 ? 1.856   -12.207 8.119   1.00 0.00 ? 55 ALA A HA   3  
ATOM 5120  H HB1  . ALA A 1 51 ? 2.863   -14.329 6.236   1.00 0.00 ? 55 ALA A HB1  3  
ATOM 5121  H HB2  . ALA A 1 51 ? 2.538   -14.759 7.932   1.00 0.00 ? 55 ALA A HB2  3  
ATOM 5122  H HB3  . ALA A 1 51 ? 1.235   -14.095 6.917   1.00 0.00 ? 55 ALA A HB3  3  
ATOM 5123  N N    . SER A 1 52 ? 4.619   -11.484 8.424   1.00 0.00 ? 56 SER A N    3  
ATOM 5124  C CA   . SER A 1 52 ? 5.829   -11.321 9.212   1.00 0.00 ? 56 SER A CA   3  
ATOM 5125  C C    . SER A 1 52 ? 5.674   -10.139 10.171  1.00 0.00 ? 56 SER A C    3  
ATOM 5126  O O    . SER A 1 52 ? 4.932   -9.199  9.888   1.00 0.00 ? 56 SER A O    3  
ATOM 5127  C CB   . SER A 1 52 ? 7.049   -11.119 8.312   1.00 0.00 ? 56 SER A CB   3  
ATOM 5128  O OG   . SER A 1 52 ? 8.023   -10.271 8.915   1.00 0.00 ? 56 SER A OG   3  
ATOM 5129  H H    . SER A 1 52 ? 4.356   -10.685 7.883   1.00 0.00 ? 56 SER A H    3  
ATOM 5130  H HA   . SER A 1 52 ? 5.938   -12.253 9.768   1.00 0.00 ? 56 SER A HA   3  
ATOM 5131  H HB2  . SER A 1 52 ? 7.500   -12.086 8.089   1.00 0.00 ? 56 SER A HB2  3  
ATOM 5132  H HB3  . SER A 1 52 ? 6.732   -10.689 7.362   1.00 0.00 ? 56 SER A HB3  3  
ATOM 5133  H HG   . SER A 1 52 ? 8.579   -9.832  8.209   1.00 0.00 ? 56 SER A HG   3  
ATOM 5134  N N    . PRO A 1 53 ? 6.405   -10.226 11.314  1.00 0.00 ? 57 PRO A N    3  
ATOM 5135  C CA   . PRO A 1 53 ? 6.356   -9.175  12.316  1.00 0.00 ? 57 PRO A CA   3  
ATOM 5136  C C    . PRO A 1 53 ? 7.149   -7.948  11.862  1.00 0.00 ? 57 PRO A C    3  
ATOM 5137  O O    . PRO A 1 53 ? 6.853   -6.826  12.272  1.00 0.00 ? 57 PRO A O    3  
ATOM 5138  C CB   . PRO A 1 53 ? 6.915   -9.809  13.579  1.00 0.00 ? 57 PRO A CB   3  
ATOM 5139  C CG   . PRO A 1 53 ? 7.683   -11.039 13.124  1.00 0.00 ? 57 PRO A CG   3  
ATOM 5140  C CD   . PRO A 1 53 ? 7.294   -11.324 11.682  1.00 0.00 ? 57 PRO A CD   3  
ATOM 5141  H HA   . PRO A 1 53 ? 5.415   -8.861  12.443  1.00 0.00 ? 57 PRO A HA   3  
ATOM 5142  H HB2  . PRO A 1 53 ? 7.567   -9.115  14.109  1.00 0.00 ? 57 PRO A HB2  3  
ATOM 5143  H HB3  . PRO A 1 53 ? 6.114   -10.081 14.267  1.00 0.00 ? 57 PRO A HB3  3  
ATOM 5144  H HG2  . PRO A 1 53 ? 8.757   -10.868 13.202  1.00 0.00 ? 57 PRO A HG2  3  
ATOM 5145  H HG3  . PRO A 1 53 ? 7.449   -11.892 13.759  1.00 0.00 ? 57 PRO A HG3  3  
ATOM 5146  H HD2  . PRO A 1 53 ? 8.170   -11.358 11.035  1.00 0.00 ? 57 PRO A HD2  3  
ATOM 5147  H HD3  . PRO A 1 53 ? 6.793   -12.287 11.591  1.00 0.00 ? 57 PRO A HD3  3  
ATOM 5148  N N    . MET A 1 54 ? 8.141   -8.201  11.021  1.00 0.00 ? 58 MET A N    3  
ATOM 5149  C CA   . MET A 1 54 ? 8.978   -7.131  10.507  1.00 0.00 ? 58 MET A CA   3  
ATOM 5150  C C    . MET A 1 54 ? 8.316   -6.442  9.312   1.00 0.00 ? 58 MET A C    3  
ATOM 5151  O O    . MET A 1 54 ? 8.690   -5.329  8.947   1.00 0.00 ? 58 MET A O    3  
ATOM 5152  C CB   . MET A 1 54 ? 10.332  -7.702  10.080  1.00 0.00 ? 58 MET A CB   3  
ATOM 5153  C CG   . MET A 1 54 ? 11.406  -6.613  10.064  1.00 0.00 ? 58 MET A CG   3  
ATOM 5154  S SD   . MET A 1 54 ? 12.538  -6.850  11.424  1.00 0.00 ? 58 MET A SD   3  
ATOM 5155  C CE   . MET A 1 54 ? 11.386  -6.851  12.789  1.00 0.00 ? 58 MET A CE   3  
ATOM 5156  H H    . MET A 1 54 ? 8.375   -9.116  10.692  1.00 0.00 ? 58 MET A H    3  
ATOM 5157  H HA   . MET A 1 54 ? 9.087   -6.424  11.329  1.00 0.00 ? 58 MET A HA   3  
ATOM 5158  H HB2  . MET A 1 54 ? 10.627  -8.498  10.765  1.00 0.00 ? 58 MET A HB2  3  
ATOM 5159  H HB3  . MET A 1 54 ? 10.247  -8.149  9.090   1.00 0.00 ? 58 MET A HB3  3  
ATOM 5160  H HG2  . MET A 1 54 ? 11.950  -6.640  9.120   1.00 0.00 ? 58 MET A HG2  3  
ATOM 5161  H HG3  . MET A 1 54 ? 10.940  -5.630  10.136  1.00 0.00 ? 58 MET A HG3  3  
ATOM 5162  H HE1  . MET A 1 54 ? 10.478  -7.379  12.497  1.00 0.00 ? 58 MET A HE1  3  
ATOM 5163  H HE2  . MET A 1 54 ? 11.838  -7.351  13.645  1.00 0.00 ? 58 MET A HE2  3  
ATOM 5164  H HE3  . MET A 1 54 ? 11.139  -5.824  13.056  1.00 0.00 ? 58 MET A HE3  3  
ATOM 5165  N N    . VAL A 1 55 ? 7.343   -7.133  8.736   1.00 0.00 ? 59 VAL A N    3  
ATOM 5166  C CA   . VAL A 1 55 ? 6.625   -6.602  7.590   1.00 0.00 ? 59 VAL A CA   3  
ATOM 5167  C C    . VAL A 1 55 ? 5.597   -5.575  8.069   1.00 0.00 ? 59 VAL A C    3  
ATOM 5168  O O    . VAL A 1 55 ? 4.998   -4.867  7.261   1.00 0.00 ? 59 VAL A O    3  
ATOM 5169  C CB   . VAL A 1 55 ? 5.999   -7.745  6.788   1.00 0.00 ? 59 VAL A CB   3  
ATOM 5170  C CG1  . VAL A 1 55 ? 4.789   -7.257  5.989   1.00 0.00 ? 59 VAL A CG1  3  
ATOM 5171  C CG2  . VAL A 1 55 ? 7.033   -8.402  5.871   1.00 0.00 ? 59 VAL A CG2  3  
ATOM 5172  H H    . VAL A 1 55 ? 7.045   -8.038  9.039   1.00 0.00 ? 59 VAL A H    3  
ATOM 5173  H HA   . VAL A 1 55 ? 7.351   -6.099  6.951   1.00 0.00 ? 59 VAL A HA   3  
ATOM 5174  H HB   . VAL A 1 55 ? 5.652   -8.499  7.495   1.00 0.00 ? 59 VAL A HB   3  
ATOM 5175  H HG11 . VAL A 1 55 ? 5.064   -6.367  5.422   1.00 0.00 ? 59 VAL A HG11 3  
ATOM 5176  H HG12 . VAL A 1 55 ? 4.467   -8.040  5.304   1.00 0.00 ? 59 VAL A HG12 3  
ATOM 5177  H HG13 . VAL A 1 55 ? 3.976   -7.015  6.674   1.00 0.00 ? 59 VAL A HG13 3  
ATOM 5178  H HG21 . VAL A 1 55 ? 7.718   -7.642  5.494   1.00 0.00 ? 59 VAL A HG21 3  
ATOM 5179  H HG22 . VAL A 1 55 ? 7.593   -9.150  6.432   1.00 0.00 ? 59 VAL A HG22 3  
ATOM 5180  H HG23 . VAL A 1 55 ? 6.525   -8.880  5.035   1.00 0.00 ? 59 VAL A HG23 3  
ATOM 5181  N N    . LYS A 1 56 ? 5.423   -5.527  9.382   1.00 0.00 ? 60 LYS A N    3  
ATOM 5182  C CA   . LYS A 1 56 ? 4.477   -4.599  9.978   1.00 0.00 ? 60 LYS A CA   3  
ATOM 5183  C C    . LYS A 1 56 ? 5.238   -3.405  10.557  1.00 0.00 ? 60 LYS A C    3  
ATOM 5184  O O    . LYS A 1 56 ? 4.638   -2.513  11.156  1.00 0.00 ? 60 LYS A O    3  
ATOM 5185  C CB   . LYS A 1 56 ? 3.592   -5.318  10.999  1.00 0.00 ? 60 LYS A CB   3  
ATOM 5186  C CG   . LYS A 1 56 ? 3.100   -6.658  10.450  1.00 0.00 ? 60 LYS A CG   3  
ATOM 5187  C CD   . LYS A 1 56 ? 2.006   -6.452  9.400   1.00 0.00 ? 60 LYS A CD   3  
ATOM 5188  C CE   . LYS A 1 56 ? 0.654   -6.182  10.062  1.00 0.00 ? 60 LYS A CE   3  
ATOM 5189  N NZ   . LYS A 1 56 ? -0.040  -7.454  10.362  1.00 0.00 ? 60 LYS A NZ   3  
ATOM 5190  H H    . LYS A 1 56 ? 5.914   -6.107  10.032  1.00 0.00 ? 60 LYS A H    3  
ATOM 5191  H HA   . LYS A 1 56 ? 3.825   -4.241  9.182   1.00 0.00 ? 60 LYS A HA   3  
ATOM 5192  H HB2  . LYS A 1 56 ? 4.152   -5.482  11.920  1.00 0.00 ? 60 LYS A HB2  3  
ATOM 5193  H HB3  . LYS A 1 56 ? 2.739   -4.689  11.252  1.00 0.00 ? 60 LYS A HB3  3  
ATOM 5194  H HG2  . LYS A 1 56 ? 3.935   -7.204  10.009  1.00 0.00 ? 60 LYS A HG2  3  
ATOM 5195  H HG3  . LYS A 1 56 ? 2.715   -7.270  11.266  1.00 0.00 ? 60 LYS A HG3  3  
ATOM 5196  H HD2  . LYS A 1 56 ? 2.272   -5.617  8.752   1.00 0.00 ? 60 LYS A HD2  3  
ATOM 5197  H HD3  . LYS A 1 56 ? 1.934   -7.336  8.766   1.00 0.00 ? 60 LYS A HD3  3  
ATOM 5198  H HE2  . LYS A 1 56 ? 0.800   -5.614  10.982  1.00 0.00 ? 60 LYS A HE2  3  
ATOM 5199  H HE3  . LYS A 1 56 ? 0.036   -5.570  9.405   1.00 0.00 ? 60 LYS A HE3  3  
ATOM 5200  H HZ1  . LYS A 1 56 ? 0.056   -8.077  9.586   1.00 0.00 ? 60 LYS A HZ1  3  
ATOM 5201  H HZ2  . LYS A 1 56 ? 0.364   -7.870  11.177  1.00 0.00 ? 60 LYS A HZ2  3  
ATOM 5202  H HZ3  . LYS A 1 56 ? -1.010  -7.274  10.527  1.00 0.00 ? 60 LYS A HZ3  3  
ATOM 5203  N N    . LYS A 1 57 ? 6.548   -3.425  10.359  1.00 0.00 ? 61 LYS A N    3  
ATOM 5204  C CA   . LYS A 1 57 ? 7.397   -2.355  10.853  1.00 0.00 ? 61 LYS A CA   3  
ATOM 5205  C C    . LYS A 1 57 ? 8.101   -1.682  9.674   1.00 0.00 ? 61 LYS A C    3  
ATOM 5206  O O    . LYS A 1 57 ? 8.650   -0.590  9.815   1.00 0.00 ? 61 LYS A O    3  
ATOM 5207  C CB   . LYS A 1 57 ? 8.356   -2.882  11.923  1.00 0.00 ? 61 LYS A CB   3  
ATOM 5208  C CG   . LYS A 1 57 ? 9.610   -3.484  11.285  1.00 0.00 ? 61 LYS A CG   3  
ATOM 5209  C CD   . LYS A 1 57 ? 10.786  -2.509  11.362  1.00 0.00 ? 61 LYS A CD   3  
ATOM 5210  C CE   . LYS A 1 57 ? 12.027  -3.191  11.940  1.00 0.00 ? 61 LYS A CE   3  
ATOM 5211  N NZ   . LYS A 1 57 ? 13.247  -2.727  11.241  1.00 0.00 ? 61 LYS A NZ   3  
ATOM 5212  H H    . LYS A 1 57 ? 7.028   -4.154  9.871   1.00 0.00 ? 61 LYS A H    3  
ATOM 5213  H HA   . LYS A 1 57 ? 6.750   -1.621  11.334  1.00 0.00 ? 61 LYS A HA   3  
ATOM 5214  H HB2  . LYS A 1 57 ? 8.638   -2.072  12.595  1.00 0.00 ? 61 LYS A HB2  3  
ATOM 5215  H HB3  . LYS A 1 57 ? 7.853   -3.637  12.527  1.00 0.00 ? 61 LYS A HB3  3  
ATOM 5216  H HG2  . LYS A 1 57 ? 9.870   -4.413  11.793  1.00 0.00 ? 61 LYS A HG2  3  
ATOM 5217  H HG3  . LYS A 1 57 ? 9.408   -3.735  10.244  1.00 0.00 ? 61 LYS A HG3  3  
ATOM 5218  H HD2  . LYS A 1 57 ? 11.009  -2.123  10.367  1.00 0.00 ? 61 LYS A HD2  3  
ATOM 5219  H HD3  . LYS A 1 57 ? 10.514  -1.654  11.982  1.00 0.00 ? 61 LYS A HD3  3  
ATOM 5220  H HE2  . LYS A 1 57 ? 12.107  -2.973  13.005  1.00 0.00 ? 61 LYS A HE2  3  
ATOM 5221  H HE3  . LYS A 1 57 ? 11.934  -4.272  11.842  1.00 0.00 ? 61 LYS A HE3  3  
ATOM 5222  H HZ1  . LYS A 1 57 ? 13.304  -1.730  11.297  1.00 0.00 ? 61 LYS A HZ1  3  
ATOM 5223  H HZ2  . LYS A 1 57 ? 14.053  -3.132  11.672  1.00 0.00 ? 61 LYS A HZ2  3  
ATOM 5224  H HZ3  . LYS A 1 57 ? 13.207  -3.005  10.281  1.00 0.00 ? 61 LYS A HZ3  3  
ATOM 5225  N N    . ILE A 1 58 ? 8.063   -2.361  8.537   1.00 0.00 ? 62 ILE A N    3  
ATOM 5226  C CA   . ILE A 1 58 ? 8.690   -1.842  7.334   1.00 0.00 ? 62 ILE A CA   3  
ATOM 5227  C C    . ILE A 1 58 ? 7.672   -1.011  6.550   1.00 0.00 ? 62 ILE A C    3  
ATOM 5228  O O    . ILE A 1 58 ? 8.045   -0.223  5.683   1.00 0.00 ? 62 ILE A O    3  
ATOM 5229  C CB   . ILE A 1 58 ? 9.312   -2.980  6.521   1.00 0.00 ? 62 ILE A CB   3  
ATOM 5230  C CG1  . ILE A 1 58 ? 10.324  -3.764  7.359   1.00 0.00 ? 62 ILE A CG1  3  
ATOM 5231  C CG2  . ILE A 1 58 ? 9.928   -2.453  5.223   1.00 0.00 ? 62 ILE A CG2  3  
ATOM 5232  C CD1  . ILE A 1 58 ? 10.353  -5.237  6.946   1.00 0.00 ? 62 ILE A CD1  3  
ATOM 5233  H H    . ILE A 1 58 ? 7.614   -3.248  8.431   1.00 0.00 ? 62 ILE A H    3  
ATOM 5234  H HA   . ILE A 1 58 ? 9.504   -1.187  7.646   1.00 0.00 ? 62 ILE A HA   3  
ATOM 5235  H HB   . ILE A 1 58 ? 8.519   -3.673  6.242   1.00 0.00 ? 62 ILE A HB   3  
ATOM 5236  H HG12 . ILE A 1 58 ? 11.316  -3.328  7.239   1.00 0.00 ? 62 ILE A HG12 3  
ATOM 5237  H HG13 . ILE A 1 58 ? 10.066  -3.683  8.415   1.00 0.00 ? 62 ILE A HG13 3  
ATOM 5238  H HG21 . ILE A 1 58 ? 9.220   -1.789  4.728   1.00 0.00 ? 62 ILE A HG21 3  
ATOM 5239  H HG22 . ILE A 1 58 ? 10.842  -1.904  5.452   1.00 0.00 ? 62 ILE A HG22 3  
ATOM 5240  H HG23 . ILE A 1 58 ? 10.162  -3.290  4.566   1.00 0.00 ? 62 ILE A HG23 3  
ATOM 5241  H HD11 . ILE A 1 58 ? 9.392   -5.512  6.513   1.00 0.00 ? 62 ILE A HD11 3  
ATOM 5242  H HD12 . ILE A 1 58 ? 11.142  -5.392  6.210   1.00 0.00 ? 62 ILE A HD12 3  
ATOM 5243  H HD13 . ILE A 1 58 ? 10.548  -5.855  7.822   1.00 0.00 ? 62 ILE A HD13 3  
ATOM 5244  N N    . ILE A 1 59 ? 6.406   -1.216  6.884   1.00 0.00 ? 63 ILE A N    3  
ATOM 5245  C CA   . ILE A 1 59 ? 5.332   -0.496  6.222   1.00 0.00 ? 63 ILE A CA   3  
ATOM 5246  C C    . ILE A 1 59 ? 4.985   0.753   7.035   1.00 0.00 ? 63 ILE A C    3  
ATOM 5247  O O    . ILE A 1 59 ? 5.043   1.869   6.521   1.00 0.00 ? 63 ILE A O    3  
ATOM 5248  C CB   . ILE A 1 59 ? 4.138   -1.421  5.977   1.00 0.00 ? 63 ILE A CB   3  
ATOM 5249  C CG1  . ILE A 1 59 ? 4.413   -2.374  4.812   1.00 0.00 ? 63 ILE A CG1  3  
ATOM 5250  C CG2  . ILE A 1 59 ? 2.854   -0.616  5.768   1.00 0.00 ? 63 ILE A CG2  3  
ATOM 5251  C CD1  . ILE A 1 59 ? 3.639   -3.683  4.980   1.00 0.00 ? 63 ILE A CD1  3  
ATOM 5252  H H    . ILE A 1 59 ? 6.112   -1.860  7.591   1.00 0.00 ? 63 ILE A H    3  
ATOM 5253  H HA   . ILE A 1 59 ? 5.702   -0.182  5.246   1.00 0.00 ? 63 ILE A HA   3  
ATOM 5254  H HB   . ILE A 1 59 ? 3.993   -2.034  6.867   1.00 0.00 ? 63 ILE A HB   3  
ATOM 5255  H HG12 . ILE A 1 59 ? 4.130   -1.898  3.873   1.00 0.00 ? 63 ILE A HG12 3  
ATOM 5256  H HG13 . ILE A 1 59 ? 5.481   -2.584  4.753   1.00 0.00 ? 63 ILE A HG13 3  
ATOM 5257  H HG21 . ILE A 1 59 ? 2.662   -0.003  6.649   1.00 0.00 ? 63 ILE A HG21 3  
ATOM 5258  H HG22 . ILE A 1 59 ? 2.967   0.028   4.896   1.00 0.00 ? 63 ILE A HG22 3  
ATOM 5259  H HG23 . ILE A 1 59 ? 2.019   -1.298  5.611   1.00 0.00 ? 63 ILE A HG23 3  
ATOM 5260  H HD11 . ILE A 1 59 ? 3.045   -3.639  5.892   1.00 0.00 ? 63 ILE A HD11 3  
ATOM 5261  H HD12 . ILE A 1 59 ? 2.981   -3.828  4.123   1.00 0.00 ? 63 ILE A HD12 3  
ATOM 5262  H HD13 . ILE A 1 59 ? 4.341   -4.515  5.043   1.00 0.00 ? 63 ILE A HD13 3  
ATOM 5263  N N    . GLU A 1 60 ? 4.632   0.523   8.291   1.00 0.00 ? 64 GLU A N    3  
ATOM 5264  C CA   . GLU A 1 60 ? 4.276   1.616   9.180   1.00 0.00 ? 64 GLU A CA   3  
ATOM 5265  C C    . GLU A 1 60 ? 5.384   2.670   9.196   1.00 0.00 ? 64 GLU A C    3  
ATOM 5266  O O    . GLU A 1 60 ? 5.117   3.854   9.395   1.00 0.00 ? 64 GLU A O    3  
ATOM 5267  C CB   . GLU A 1 60 ? 3.987   1.103   10.592  1.00 0.00 ? 64 GLU A CB   3  
ATOM 5268  C CG   . GLU A 1 60 ? 2.753   0.197   10.605  1.00 0.00 ? 64 GLU A CG   3  
ATOM 5269  C CD   . GLU A 1 60 ? 2.758   -0.719  11.830  1.00 0.00 ? 64 GLU A CD   3  
ATOM 5270  O OE1  . GLU A 1 60 ? 3.523   -0.407  12.769  1.00 0.00 ? 64 GLU A OE1  3  
ATOM 5271  O OE2  . GLU A 1 60 ? 1.997   -1.710  11.801  1.00 0.00 ? 64 GLU A OE2  3  
ATOM 5272  H H    . GLU A 1 60 ? 4.587   -0.387  8.702   1.00 0.00 ? 64 GLU A H    3  
ATOM 5273  H HA   . GLU A 1 60 ? 3.364   2.044   8.762   1.00 0.00 ? 64 GLU A HA   3  
ATOM 5274  H HB2  . GLU A 1 60 ? 4.850   0.553   10.967  1.00 0.00 ? 64 GLU A HB2  3  
ATOM 5275  H HB3  . GLU A 1 60 ? 3.830   1.946   11.265  1.00 0.00 ? 64 GLU A HB3  3  
ATOM 5276  H HG2  . GLU A 1 60 ? 1.850   0.807   10.605  1.00 0.00 ? 64 GLU A HG2  3  
ATOM 5277  H HG3  . GLU A 1 60 ? 2.731   -0.405  9.696   1.00 0.00 ? 64 GLU A HG3  3  
ATOM 5278  N N    . LYS A 1 61 ? 6.605   2.202   8.984   1.00 0.00 ? 65 LYS A N    3  
ATOM 5279  C CA   . LYS A 1 61 ? 7.756   3.089   8.972   1.00 0.00 ? 65 LYS A CA   3  
ATOM 5280  C C    . LYS A 1 61 ? 7.810   3.829   7.633   1.00 0.00 ? 65 LYS A C    3  
ATOM 5281  O O    . LYS A 1 61 ? 8.210   4.990   7.577   1.00 0.00 ? 65 LYS A O    3  
ATOM 5282  C CB   . LYS A 1 61 ? 9.034   2.314   9.298   1.00 0.00 ? 65 LYS A CB   3  
ATOM 5283  C CG   . LYS A 1 61 ? 9.060   1.894   10.769  1.00 0.00 ? 65 LYS A CG   3  
ATOM 5284  C CD   . LYS A 1 61 ? 9.328   3.096   11.678  1.00 0.00 ? 65 LYS A CD   3  
ATOM 5285  C CE   . LYS A 1 61 ? 8.097   3.429   12.523  1.00 0.00 ? 65 LYS A CE   3  
ATOM 5286  N NZ   . LYS A 1 61 ? 7.755   4.864   12.396  1.00 0.00 ? 65 LYS A NZ   3  
ATOM 5287  H H    . LYS A 1 61 ? 6.814   1.237   8.823   1.00 0.00 ? 65 LYS A H    3  
ATOM 5288  H HA   . LYS A 1 61 ? 7.612   3.822   9.766   1.00 0.00 ? 65 LYS A HA   3  
ATOM 5289  H HB2  . LYS A 1 61 ? 9.101   1.431   8.662   1.00 0.00 ? 65 LYS A HB2  3  
ATOM 5290  H HB3  . LYS A 1 61 ? 9.905   2.932   9.077   1.00 0.00 ? 65 LYS A HB3  3  
ATOM 5291  H HG2  . LYS A 1 61 ? 8.108   1.436   11.037  1.00 0.00 ? 65 LYS A HG2  3  
ATOM 5292  H HG3  . LYS A 1 61 ? 9.831   1.139   10.921  1.00 0.00 ? 65 LYS A HG3  3  
ATOM 5293  H HD2  . LYS A 1 61 ? 10.174  2.881   12.330  1.00 0.00 ? 65 LYS A HD2  3  
ATOM 5294  H HD3  . LYS A 1 61 ? 9.604   3.959   11.073  1.00 0.00 ? 65 LYS A HD3  3  
ATOM 5295  H HE2  . LYS A 1 61 ? 7.253   2.818   12.203  1.00 0.00 ? 65 LYS A HE2  3  
ATOM 5296  H HE3  . LYS A 1 61 ? 8.289   3.186   13.568  1.00 0.00 ? 65 LYS A HE3  3  
ATOM 5297  H HZ1  . LYS A 1 61 ? 8.595   5.404   12.343  1.00 0.00 ? 65 LYS A HZ1  3  
ATOM 5298  H HZ2  . LYS A 1 61 ? 7.215   5.005   11.566  1.00 0.00 ? 65 LYS A HZ2  3  
ATOM 5299  H HZ3  . LYS A 1 61 ? 7.223   5.151   13.192  1.00 0.00 ? 65 LYS A HZ3  3  
ATOM 5300  N N    . MET A 1 62 ? 7.400   3.125   6.588   1.00 0.00 ? 66 MET A N    3  
ATOM 5301  C CA   . MET A 1 62 ? 7.397   3.700   5.254   1.00 0.00 ? 66 MET A CA   3  
ATOM 5302  C C    . MET A 1 62 ? 6.460   4.908   5.179   1.00 0.00 ? 66 MET A C    3  
ATOM 5303  O O    . MET A 1 62 ? 6.743   5.874   4.473   1.00 0.00 ? 66 MET A O    3  
ATOM 5304  C CB   . MET A 1 62 ? 6.948   2.643   4.243   1.00 0.00 ? 66 MET A CB   3  
ATOM 5305  C CG   . MET A 1 62 ? 8.083   2.288   3.280   1.00 0.00 ? 66 MET A CG   3  
ATOM 5306  S SD   . MET A 1 62 ? 8.488   3.699   2.266   1.00 0.00 ? 66 MET A SD   3  
ATOM 5307  C CE   . MET A 1 62 ? 6.928   3.938   1.431   1.00 0.00 ? 66 MET A CE   3  
ATOM 5308  H H    . MET A 1 62 ? 7.076   2.181   6.642   1.00 0.00 ? 66 MET A H    3  
ATOM 5309  H HA   . MET A 1 62 ? 8.424   4.016   5.068   1.00 0.00 ? 66 MET A HA   3  
ATOM 5310  H HB2  . MET A 1 62 ? 6.619   1.747   4.770   1.00 0.00 ? 66 MET A HB2  3  
ATOM 5311  H HB3  . MET A 1 62 ? 6.092   3.014   3.680   1.00 0.00 ? 66 MET A HB3  3  
ATOM 5312  H HG2  . MET A 1 62 ? 8.961   1.970   3.842   1.00 0.00 ? 66 MET A HG2  3  
ATOM 5313  H HG3  . MET A 1 62 ? 7.787   1.449   2.650   1.00 0.00 ? 66 MET A HG3  3  
ATOM 5314  H HE1  . MET A 1 62 ? 6.483   2.968   1.207   1.00 0.00 ? 66 MET A HE1  3  
ATOM 5315  H HE2  . MET A 1 62 ? 6.255   4.506   2.073   1.00 0.00 ? 66 MET A HE2  3  
ATOM 5316  H HE3  . MET A 1 62 ? 7.092   4.485   0.502   1.00 0.00 ? 66 MET A HE3  3  
ATOM 5317  N N    . LEU A 1 63 ? 5.365   4.813   5.919   1.00 0.00 ? 67 LEU A N    3  
ATOM 5318  C CA   . LEU A 1 63 ? 4.385   5.886   5.946   1.00 0.00 ? 67 LEU A CA   3  
ATOM 5319  C C    . LEU A 1 63 ? 4.962   7.079   6.712   1.00 0.00 ? 67 LEU A C    3  
ATOM 5320  O O    . LEU A 1 63 ? 4.445   8.191   6.616   1.00 0.00 ? 67 LEU A O    3  
ATOM 5321  C CB   . LEU A 1 63 ? 3.054   5.382   6.506   1.00 0.00 ? 67 LEU A CB   3  
ATOM 5322  C CG   . LEU A 1 63 ? 2.179   4.583   5.537   1.00 0.00 ? 67 LEU A CG   3  
ATOM 5323  C CD1  . LEU A 1 63 ? 2.941   3.383   4.971   1.00 0.00 ? 67 LEU A CD1  3  
ATOM 5324  C CD2  . LEU A 1 63 ? 0.865   4.167   6.202   1.00 0.00 ? 67 LEU A CD2  3  
ATOM 5325  H H    . LEU A 1 63 ? 5.143   4.024   6.491   1.00 0.00 ? 67 LEU A H    3  
ATOM 5326  H HA   . LEU A 1 63 ? 4.207   6.191   4.915   1.00 0.00 ? 67 LEU A HA   3  
ATOM 5327  H HB2  . LEU A 1 63 ? 3.261   4.758   7.375   1.00 0.00 ? 67 LEU A HB2  3  
ATOM 5328  H HB3  . LEU A 1 63 ? 2.482   6.240   6.858   1.00 0.00 ? 67 LEU A HB3  3  
ATOM 5329  H HG   . LEU A 1 63 ? 1.923   5.228   4.696   1.00 0.00 ? 67 LEU A HG   3  
ATOM 5330  H HD11 . LEU A 1 63 ? 3.878   3.723   4.531   1.00 0.00 ? 67 LEU A HD11 3  
ATOM 5331  H HD12 . LEU A 1 63 ? 3.151   2.676   5.773   1.00 0.00 ? 67 LEU A HD12 3  
ATOM 5332  H HD13 . LEU A 1 63 ? 2.335   2.896   4.207   1.00 0.00 ? 67 LEU A HD13 3  
ATOM 5333  H HD21 . LEU A 1 63 ? 1.041   3.963   7.258   1.00 0.00 ? 67 LEU A HD21 3  
ATOM 5334  H HD22 . LEU A 1 63 ? 0.137   4.971   6.103   1.00 0.00 ? 67 LEU A HD22 3  
ATOM 5335  H HD23 . LEU A 1 63 ? 0.482   3.268   5.718   1.00 0.00 ? 67 LEU A HD23 3  
ATOM 5336  N N    . LYS A 1 64 ? 6.026   6.806   7.454   1.00 0.00 ? 68 LYS A N    3  
ATOM 5337  C CA   . LYS A 1 64 ? 6.678   7.843   8.235   1.00 0.00 ? 68 LYS A CA   3  
ATOM 5338  C C    . LYS A 1 64 ? 7.958   8.284   7.522   1.00 0.00 ? 68 LYS A C    3  
ATOM 5339  O O    . LYS A 1 64 ? 8.361   9.441   7.622   1.00 0.00 ? 68 LYS A O    3  
ATOM 5340  C CB   . LYS A 1 64 ? 6.907   7.367   9.671   1.00 0.00 ? 68 LYS A CB   3  
ATOM 5341  C CG   . LYS A 1 64 ? 7.974   8.215   10.366  1.00 0.00 ? 68 LYS A CG   3  
ATOM 5342  C CD   . LYS A 1 64 ? 7.525   8.616   11.773  1.00 0.00 ? 68 LYS A CD   3  
ATOM 5343  C CE   . LYS A 1 64 ? 8.666   8.455   12.779  1.00 0.00 ? 68 LYS A CE   3  
ATOM 5344  N NZ   . LYS A 1 64 ? 9.399   9.731   12.941  1.00 0.00 ? 68 LYS A NZ   3  
ATOM 5345  H H    . LYS A 1 64 ? 6.440   5.899   7.525   1.00 0.00 ? 68 LYS A H    3  
ATOM 5346  H HA   . LYS A 1 64 ? 5.998   8.693   8.282   1.00 0.00 ? 68 LYS A HA   3  
ATOM 5347  H HB2  . LYS A 1 64 ? 5.973   7.422   10.230  1.00 0.00 ? 68 LYS A HB2  3  
ATOM 5348  H HB3  . LYS A 1 64 ? 7.214   6.321   9.667   1.00 0.00 ? 68 LYS A HB3  3  
ATOM 5349  H HG2  . LYS A 1 64 ? 8.907   7.655   10.424  1.00 0.00 ? 68 LYS A HG2  3  
ATOM 5350  H HG3  . LYS A 1 64 ? 8.175   9.109   9.776   1.00 0.00 ? 68 LYS A HG3  3  
ATOM 5351  H HD2  . LYS A 1 64 ? 7.183   9.651   11.768  1.00 0.00 ? 68 LYS A HD2  3  
ATOM 5352  H HD3  . LYS A 1 64 ? 6.678   8.002   12.077  1.00 0.00 ? 68 LYS A HD3  3  
ATOM 5353  H HE2  . LYS A 1 64 ? 8.268   8.133   13.742  1.00 0.00 ? 68 LYS A HE2  3  
ATOM 5354  H HE3  . LYS A 1 64 ? 9.350   7.676   12.441  1.00 0.00 ? 68 LYS A HE3  3  
ATOM 5355  H HZ1  . LYS A 1 64 ? 8.778   10.496  12.771  1.00 0.00 ? 68 LYS A HZ1  3  
ATOM 5356  H HZ2  . LYS A 1 64 ? 9.758   9.793   13.872  1.00 0.00 ? 68 LYS A HZ2  3  
ATOM 5357  H HZ3  . LYS A 1 64 ? 10.156  9.765   12.288  1.00 0.00 ? 68 LYS A HZ3  3  
ATOM 5358  N N    . ASN A 1 65 ? 8.561   7.337   6.818   1.00 0.00 ? 69 ASN A N    3  
ATOM 5359  C CA   . ASN A 1 65 ? 9.787   7.613   6.088   1.00 0.00 ? 69 ASN A CA   3  
ATOM 5360  C C    . ASN A 1 65 ? 10.879  8.031   7.075   1.00 0.00 ? 69 ASN A C    3  
ATOM 5361  O O    . ASN A 1 65 ? 11.748  7.231   7.420   1.00 0.00 ? 69 ASN A O    3  
ATOM 5362  C CB   . ASN A 1 65 ? 9.589   8.756   5.091   1.00 0.00 ? 69 ASN A CB   3  
ATOM 5363  C CG   . ASN A 1 65 ? 10.925  9.198   4.490   1.00 0.00 ? 69 ASN A CG   3  
ATOM 5364  O OD1  . ASN A 1 65 ? 11.819  8.403   4.249   1.00 0.00 ? 69 ASN A OD1  3  
ATOM 5365  N ND2  . ASN A 1 65 ? 11.010  10.505  4.262   1.00 0.00 ? 69 ASN A ND2  3  
ATOM 5366  H H    . ASN A 1 65 ? 8.226   6.398   6.742   1.00 0.00 ? 69 ASN A H    3  
ATOM 5367  H HA   . ASN A 1 65 ? 10.026  6.685   5.569   1.00 0.00 ? 69 ASN A HA   3  
ATOM 5368  H HB2  . ASN A 1 65 ? 8.916   8.437   4.295   1.00 0.00 ? 69 ASN A HB2  3  
ATOM 5369  H HB3  . ASN A 1 65 ? 9.114   9.601   5.590   1.00 0.00 ? 69 ASN A HB3  3  
ATOM 5370  H HD21 . ASN A 1 65 ? 10.239  11.102  4.482   1.00 0.00 ? 69 ASN A HD21 3  
ATOM 5371  H HD22 . ASN A 1 65 ? 11.845  10.891  3.870   1.00 0.00 ? 69 ASN A HD22 3  
ATOM 5372  N N    . GLY A 1 66 ? 10.800  9.283   7.501   1.00 0.00 ? 70 GLY A N    3  
ATOM 5373  C CA   . GLY A 1 66 ? 11.772  9.816   8.441   1.00 0.00 ? 70 GLY A CA   3  
ATOM 5374  C C    . GLY A 1 66 ? 12.405  11.101  7.905   1.00 0.00 ? 70 GLY A C    3  
ATOM 5375  O O    . GLY A 1 66 ? 11.700  12.045  7.552   1.00 0.00 ? 70 GLY A O    3  
ATOM 5376  H H    . GLY A 1 66 ? 10.091  9.927   7.215   1.00 0.00 ? 70 GLY A H    3  
ATOM 5377  H HA2  . GLY A 1 66 ? 11.286  10.017  9.396   1.00 0.00 ? 70 GLY A HA2  3  
ATOM 5378  H HA3  . GLY A 1 66 ? 12.548  9.074   8.627   1.00 0.00 ? 70 GLY A HA3  3  
ATOM 5379  N N    . LYS A 1 67 ? 13.729  11.096  7.860   1.00 0.00 ? 71 LYS A N    3  
ATOM 5380  C CA   . LYS A 1 67 ? 14.466  12.250  7.372   1.00 0.00 ? 71 LYS A CA   3  
ATOM 5381  C C    . LYS A 1 67 ? 14.762  12.068  5.882   1.00 0.00 ? 71 LYS A C    3  
ATOM 5382  O O    . LYS A 1 67 ? 14.001  12.531  5.034   1.00 0.00 ? 71 LYS A O    3  
ATOM 5383  C CB   . LYS A 1 67 ? 15.716  12.486  8.223   1.00 0.00 ? 71 LYS A CB   3  
ATOM 5384  C CG   . LYS A 1 67 ? 15.460  13.553  9.289   1.00 0.00 ? 71 LYS A CG   3  
ATOM 5385  C CD   . LYS A 1 67 ? 16.750  13.906  10.032  1.00 0.00 ? 71 LYS A CD   3  
ATOM 5386  C CE   . LYS A 1 67 ? 17.543  14.973  9.276   1.00 0.00 ? 71 LYS A CE   3  
ATOM 5387  N NZ   . LYS A 1 67 ? 18.996  14.782  9.483   1.00 0.00 ? 71 LYS A NZ   3  
ATOM 5388  H H    . LYS A 1 67 ? 14.296  10.324  8.148   1.00 0.00 ? 71 LYS A H    3  
ATOM 5389  H HA   . LYS A 1 67 ? 13.824  13.122  7.493   1.00 0.00 ? 71 LYS A HA   3  
ATOM 5390  H HB2  . LYS A 1 67 ? 16.017  11.554  8.700   1.00 0.00 ? 71 LYS A HB2  3  
ATOM 5391  H HB3  . LYS A 1 67 ? 16.542  12.797  7.583   1.00 0.00 ? 71 LYS A HB3  3  
ATOM 5392  H HG2  . LYS A 1 67 ? 15.048  14.447  8.822   1.00 0.00 ? 71 LYS A HG2  3  
ATOM 5393  H HG3  . LYS A 1 67 ? 14.715  13.192  9.998   1.00 0.00 ? 71 LYS A HG3  3  
ATOM 5394  H HD2  . LYS A 1 67 ? 16.510  14.266  11.033  1.00 0.00 ? 71 LYS A HD2  3  
ATOM 5395  H HD3  . LYS A 1 67 ? 17.360  13.011  10.154  1.00 0.00 ? 71 LYS A HD3  3  
ATOM 5396  H HE2  . LYS A 1 67 ? 17.312  14.921  8.212   1.00 0.00 ? 71 LYS A HE2  3  
ATOM 5397  H HE3  . LYS A 1 67 ? 17.248  15.965  9.619   1.00 0.00 ? 71 LYS A HE3  3  
ATOM 5398  H HZ1  . LYS A 1 67 ? 19.177  13.826  9.715   1.00 0.00 ? 71 LYS A HZ1  3  
ATOM 5399  H HZ2  . LYS A 1 67 ? 19.487  15.021  8.645   1.00 0.00 ? 71 LYS A HZ2  3  
ATOM 5400  H HZ3  . LYS A 1 67 ? 19.307  15.371  10.230  1.00 0.00 ? 71 LYS A HZ3  3  
ATOM 5401  N N    . SER A 1 68 ? 15.869  11.394  5.609   1.00 0.00 ? 72 SER A N    3  
ATOM 5402  C CA   . SER A 1 68 ? 16.274  11.146  4.236   1.00 0.00 ? 72 SER A CA   3  
ATOM 5403  C C    . SER A 1 68 ? 16.953  12.389  3.658   1.00 0.00 ? 72 SER A C    3  
ATOM 5404  O O    . SER A 1 68 ? 16.294  13.391  3.387   1.00 0.00 ? 72 SER A O    3  
ATOM 5405  C CB   . SER A 1 68 ? 15.077  10.745  3.372   1.00 0.00 ? 72 SER A CB   3  
ATOM 5406  O OG   . SER A 1 68 ? 15.365  9.615   2.552   1.00 0.00 ? 72 SER A OG   3  
ATOM 5407  H H    . SER A 1 68 ? 16.482  11.021  6.305   1.00 0.00 ? 72 SER A H    3  
ATOM 5408  H HA   . SER A 1 68 ? 16.978  10.315  4.288   1.00 0.00 ? 72 SER A HA   3  
ATOM 5409  H HB2  . SER A 1 68 ? 14.226  10.519  4.014   1.00 0.00 ? 72 SER A HB2  3  
ATOM 5410  H HB3  . SER A 1 68 ? 14.787  11.585  2.742   1.00 0.00 ? 72 SER A HB3  3  
ATOM 5411  H HG   . SER A 1 68 ? 15.748  9.916   1.678   1.00 0.00 ? 72 SER A HG   3  
ATOM 5412  N N    . ASN A 1 69 ? 18.263  12.283  3.485   1.00 0.00 ? 73 ASN A N    3  
ATOM 5413  C CA   . ASN A 1 69 ? 19.038  13.386  2.944   1.00 0.00 ? 73 ASN A CA   3  
ATOM 5414  C C    . ASN A 1 69 ? 18.328  13.946  1.710   1.00 0.00 ? 73 ASN A C    3  
ATOM 5415  O O    . ASN A 1 69 ? 18.874  14.794  1.007   1.00 0.00 ? 73 ASN A O    3  
ATOM 5416  C CB   . ASN A 1 69 ? 20.432  12.922  2.518   1.00 0.00 ? 73 ASN A CB   3  
ATOM 5417  C CG   . ASN A 1 69 ? 21.516  13.824  3.113   1.00 0.00 ? 73 ASN A CG   3  
ATOM 5418  O OD1  . ASN A 1 69 ? 21.423  14.292  4.235   1.00 0.00 ? 73 ASN A OD1  3  
ATOM 5419  N ND2  . ASN A 1 69 ? 22.547  14.039  2.300   1.00 0.00 ? 73 ASN A ND2  3  
ATOM 5420  H H    . ASN A 1 69 ? 18.792  11.464  3.708   1.00 0.00 ? 73 ASN A H    3  
ATOM 5421  H HA   . ASN A 1 69 ? 19.105  14.113  3.753   1.00 0.00 ? 73 ASN A HA   3  
ATOM 5422  H HB2  . ASN A 1 69 ? 20.592  11.894  2.841   1.00 0.00 ? 73 ASN A HB2  3  
ATOM 5423  H HB3  . ASN A 1 69 ? 20.505  12.930  1.430   1.00 0.00 ? 73 ASN A HB3  3  
ATOM 5424  H HD21 . ASN A 1 69 ? 22.562  13.624  1.390   1.00 0.00 ? 73 ASN A HD21 3  
ATOM 5425  H HD22 . ASN A 1 69 ? 23.307  14.616  2.599   1.00 0.00 ? 73 ASN A HD22 3  
ATOM 5426  N N    . THR B 1 1  ? 15.271  15.635  -9.970  1.00 0.00 ? 5  THR B N    3  
ATOM 5427  C CA   . THR B 1 1  ? 15.270  16.662  -8.942  1.00 0.00 ? 5  THR B CA   3  
ATOM 5428  C C    . THR B 1 1  ? 13.978  17.480  -9.007  1.00 0.00 ? 5  THR B C    3  
ATOM 5429  O O    . THR B 1 1  ? 13.366  17.763  -7.978  1.00 0.00 ? 5  THR B O    3  
ATOM 5430  C CB   . THR B 1 1  ? 16.533  17.507  -9.116  1.00 0.00 ? 5  THR B CB   3  
ATOM 5431  O OG1  . THR B 1 1  ? 16.509  17.888  -10.489 1.00 0.00 ? 5  THR B OG1  3  
ATOM 5432  C CG2  . THR B 1 1  ? 17.814  16.680  -8.981  1.00 0.00 ? 5  THR B CG2  3  
ATOM 5433  H H    . THR B 1 1  ? 14.626  15.785  -10.719 1.00 0.00 ? 5  THR B H    3  
ATOM 5434  H HA   . THR B 1 1  ? 15.290  16.173  -7.968  1.00 0.00 ? 5  THR B HA   3  
ATOM 5435  H HB   . THR B 1 1  ? 16.538  18.348  -8.423  1.00 0.00 ? 5  THR B HB   3  
ATOM 5436  H HG1  . THR B 1 1  ? 17.358  18.360  -10.728 1.00 0.00 ? 5  THR B HG1  3  
ATOM 5437  H HG21 . THR B 1 1  ? 17.567  15.686  -8.607  1.00 0.00 ? 5  THR B HG21 3  
ATOM 5438  H HG22 . THR B 1 1  ? 18.294  16.592  -9.956  1.00 0.00 ? 5  THR B HG22 3  
ATOM 5439  H HG23 . THR B 1 1  ? 18.492  17.172  -8.285  1.00 0.00 ? 5  THR B HG23 3  
ATOM 5440  N N    . GLU B 1 2  ? 13.602  17.836  -10.226 1.00 0.00 ? 6  GLU B N    3  
ATOM 5441  C CA   . GLU B 1 2  ? 12.395  18.616  -10.439 1.00 0.00 ? 6  GLU B CA   3  
ATOM 5442  C C    . GLU B 1 2  ? 11.175  17.695  -10.519 1.00 0.00 ? 6  GLU B C    3  
ATOM 5443  O O    . GLU B 1 2  ? 10.444  17.713  -11.508 1.00 0.00 ? 6  GLU B O    3  
ATOM 5444  C CB   . GLU B 1 2  ? 12.514  19.479  -11.697 1.00 0.00 ? 6  GLU B CB   3  
ATOM 5445  C CG   . GLU B 1 2  ? 11.490  20.616  -11.680 1.00 0.00 ? 6  GLU B CG   3  
ATOM 5446  C CD   . GLU B 1 2  ? 11.189  21.104  -13.099 1.00 0.00 ? 6  GLU B CD   3  
ATOM 5447  O OE1  . GLU B 1 2  ? 12.168  21.418  -13.810 1.00 0.00 ? 6  GLU B OE1  3  
ATOM 5448  O OE2  . GLU B 1 2  ? 9.988   21.151  -13.441 1.00 0.00 ? 6  GLU B OE2  3  
ATOM 5449  H H    . GLU B 1 2  ? 14.106  17.602  -11.058 1.00 0.00 ? 6  GLU B H    3  
ATOM 5450  H HA   . GLU B 1 2  ? 12.311  19.265  -9.567  1.00 0.00 ? 6  GLU B HA   3  
ATOM 5451  H HB2  . GLU B 1 2  ? 13.520  19.892  -11.765 1.00 0.00 ? 6  GLU B HB2  3  
ATOM 5452  H HB3  . GLU B 1 2  ? 12.362  18.861  -12.582 1.00 0.00 ? 6  GLU B HB3  3  
ATOM 5453  H HG2  . GLU B 1 2  ? 10.569  20.274  -11.207 1.00 0.00 ? 6  GLU B HG2  3  
ATOM 5454  H HG3  . GLU B 1 2  ? 11.869  21.443  -11.080 1.00 0.00 ? 6  GLU B HG3  3  
ATOM 5455  N N    . LEU B 1 3  ? 10.995  16.912  -9.466  1.00 0.00 ? 7  LEU B N    3  
ATOM 5456  C CA   . LEU B 1 3  ? 9.877   15.986  -9.404  1.00 0.00 ? 7  LEU B CA   3  
ATOM 5457  C C    . LEU B 1 3  ? 8.818   16.534  -8.446  1.00 0.00 ? 7  LEU B C    3  
ATOM 5458  O O    . LEU B 1 3  ? 9.076   17.482  -7.706  1.00 0.00 ? 7  LEU B O    3  
ATOM 5459  C CB   . LEU B 1 3  ? 10.364  14.581  -9.044  1.00 0.00 ? 7  LEU B CB   3  
ATOM 5460  C CG   . LEU B 1 3  ? 11.323  13.928  -10.041 1.00 0.00 ? 7  LEU B CG   3  
ATOM 5461  C CD1  . LEU B 1 3  ? 12.664  13.604  -9.380  1.00 0.00 ? 7  LEU B CD1  3  
ATOM 5462  C CD2  . LEU B 1 3  ? 10.688  12.693  -10.684 1.00 0.00 ? 7  LEU B CD2  3  
ATOM 5463  H H    . LEU B 1 3  ? 11.595  16.904  -8.666  1.00 0.00 ? 7  LEU B H    3  
ATOM 5464  H HA   . LEU B 1 3  ? 9.443   15.931  -10.403 1.00 0.00 ? 7  LEU B HA   3  
ATOM 5465  H HB2  . LEU B 1 3  ? 10.856  14.627  -8.073  1.00 0.00 ? 7  LEU B HB2  3  
ATOM 5466  H HB3  . LEU B 1 3  ? 9.494   13.935  -8.930  1.00 0.00 ? 7  LEU B HB3  3  
ATOM 5467  H HG   . LEU B 1 3  ? 11.523  14.641  -10.841 1.00 0.00 ? 7  LEU B HG   3  
ATOM 5468  H HD11 . LEU B 1 3  ? 12.507  13.395  -8.321  1.00 0.00 ? 7  LEU B HD11 3  
ATOM 5469  H HD12 . LEU B 1 3  ? 13.105  12.731  -9.860  1.00 0.00 ? 7  LEU B HD12 3  
ATOM 5470  H HD13 . LEU B 1 3  ? 13.337  14.455  -9.486  1.00 0.00 ? 7  LEU B HD13 3  
ATOM 5471  H HD21 . LEU B 1 3  ? 9.609   12.722  -10.538 1.00 0.00 ? 7  LEU B HD21 3  
ATOM 5472  H HD22 . LEU B 1 3  ? 10.911  12.684  -11.751 1.00 0.00 ? 7  LEU B HD22 3  
ATOM 5473  H HD23 . LEU B 1 3  ? 11.094  11.793  -10.221 1.00 0.00 ? 7  LEU B HD23 3  
ATOM 5474  N N    . ARG B 1 4  ? 7.647   15.915  -8.491  1.00 0.00 ? 8  ARG B N    3  
ATOM 5475  C CA   . ARG B 1 4  ? 6.548   16.329  -7.635  1.00 0.00 ? 8  ARG B CA   3  
ATOM 5476  C C    . ARG B 1 4  ? 5.871   15.106  -7.013  1.00 0.00 ? 8  ARG B C    3  
ATOM 5477  O O    . ARG B 1 4  ? 6.536   14.128  -6.675  1.00 0.00 ? 8  ARG B O    3  
ATOM 5478  C CB   . ARG B 1 4  ? 5.511   17.132  -8.422  1.00 0.00 ? 8  ARG B CB   3  
ATOM 5479  C CG   . ARG B 1 4  ? 6.188   18.158  -9.333  1.00 0.00 ? 8  ARG B CG   3  
ATOM 5480  C CD   . ARG B 1 4  ? 5.222   18.658  -10.409 1.00 0.00 ? 8  ARG B CD   3  
ATOM 5481  N NE   . ARG B 1 4  ? 4.576   19.914  -9.966  1.00 0.00 ? 8  ARG B NE   3  
ATOM 5482  C CZ   . ARG B 1 4  ? 3.882   20.727  -10.773 1.00 0.00 ? 8  ARG B CZ   3  
ATOM 5483  N NH1  . ARG B 1 4  ? 3.739   20.422  -12.070 1.00 0.00 ? 8  ARG B NH1  3  
ATOM 5484  N NH2  . ARG B 1 4  ? 3.331   21.847  -10.284 1.00 0.00 ? 8  ARG B NH2  3  
ATOM 5485  H H    . ARG B 1 4  ? 7.445   15.144  -9.096  1.00 0.00 ? 8  ARG B H    3  
ATOM 5486  H HA   . ARG B 1 4  ? 7.010   16.953  -6.871  1.00 0.00 ? 8  ARG B HA   3  
ATOM 5487  H HB2  . ARG B 1 4  ? 4.899   16.457  -9.021  1.00 0.00 ? 8  ARG B HB2  3  
ATOM 5488  H HB3  . ARG B 1 4  ? 4.839   17.642  -7.731  1.00 0.00 ? 8  ARG B HB3  3  
ATOM 5489  H HG2  . ARG B 1 4  ? 6.543   19.000  -8.739  1.00 0.00 ? 8  ARG B HG2  3  
ATOM 5490  H HG3  . ARG B 1 4  ? 7.063   17.710  -9.805  1.00 0.00 ? 8  ARG B HG3  3  
ATOM 5491  H HD2  . ARG B 1 4  ? 5.759   18.825  -11.343 1.00 0.00 ? 8  ARG B HD2  3  
ATOM 5492  H HD3  . ARG B 1 4  ? 4.464   17.901  -10.609 1.00 0.00 ? 8  ARG B HD3  3  
ATOM 5493  H HE   . ARG B 1 4  ? 4.664   20.172  -9.004  1.00 0.00 ? 8  ARG B HE   3  
ATOM 5494  H HH11 . ARG B 1 4  ? 4.151   19.587  -12.436 1.00 0.00 ? 8  ARG B HH11 3  
ATOM 5495  H HH12 . ARG B 1 4  ? 3.221   21.029  -12.673 1.00 0.00 ? 8  ARG B HH12 3  
ATOM 5496  H HH21 . ARG B 1 4  ? 3.438   22.075  -9.316  1.00 0.00 ? 8  ARG B HH21 3  
ATOM 5497  H HH22 . ARG B 1 4  ? 2.813   22.454  -10.887 1.00 0.00 ? 8  ARG B HH22 3  
ATOM 5498  N N    . CYS B 1 5  ? 4.556   15.202  -6.879  1.00 0.00 ? 9  CYS B N    3  
ATOM 5499  C CA   . CYS B 1 5  ? 3.781   14.116  -6.303  1.00 0.00 ? 9  CYS B CA   3  
ATOM 5500  C C    . CYS B 1 5  ? 3.132   13.331  -7.444  1.00 0.00 ? 9  CYS B C    3  
ATOM 5501  O O    . CYS B 1 5  ? 2.852   13.887  -8.505  1.00 0.00 ? 9  CYS B O    3  
ATOM 5502  C CB   . CYS B 1 5  ? 2.744   14.630  -5.302  1.00 0.00 ? 9  CYS B CB   3  
ATOM 5503  S SG   . CYS B 1 5  ? 3.415   15.056  -3.653  1.00 0.00 ? 9  CYS B SG   3  
ATOM 5504  H H    . CYS B 1 5  ? 4.022   16.001  -7.157  1.00 0.00 ? 9  CYS B H    3  
ATOM 5505  H HA   . CYS B 1 5  ? 4.482   13.490  -5.751  1.00 0.00 ? 9  CYS B HA   3  
ATOM 5506  H HB2  . CYS B 1 5  ? 2.262   15.513  -5.721  1.00 0.00 ? 9  CYS B HB2  3  
ATOM 5507  H HB3  . CYS B 1 5  ? 1.971   13.872  -5.180  1.00 0.00 ? 9  CYS B HB3  3  
ATOM 5508  N N    . GLN B 1 6  ? 2.912   12.049  -7.188  1.00 0.00 ? 10 GLN B N    3  
ATOM 5509  C CA   . GLN B 1 6  ? 2.301   11.182  -8.180  1.00 0.00 ? 10 GLN B CA   3  
ATOM 5510  C C    . GLN B 1 6  ? 0.784   11.376  -8.193  1.00 0.00 ? 10 GLN B C    3  
ATOM 5511  O O    . GLN B 1 6  ? 0.085   10.782  -9.013  1.00 0.00 ? 10 GLN B O    3  
ATOM 5512  C CB   . GLN B 1 6  ? 2.665   9.717   -7.927  1.00 0.00 ? 10 GLN B CB   3  
ATOM 5513  C CG   . GLN B 1 6  ? 2.783   8.946   -9.242  1.00 0.00 ? 10 GLN B CG   3  
ATOM 5514  C CD   . GLN B 1 6  ? 1.682   7.890   -9.359  1.00 0.00 ? 10 GLN B CD   3  
ATOM 5515  O OE1  . GLN B 1 6  ? 0.705   8.050   -10.073 1.00 0.00 ? 10 GLN B OE1  3  
ATOM 5516  N NE2  . GLN B 1 6  ? 1.893   6.804   -8.620  1.00 0.00 ? 10 GLN B NE2  3  
ATOM 5517  H H    . GLN B 1 6  ? 3.143   11.605  -6.322  1.00 0.00 ? 10 GLN B H    3  
ATOM 5518  H HA   . GLN B 1 6  ? 2.722   11.494  -9.136  1.00 0.00 ? 10 GLN B HA   3  
ATOM 5519  H HB2  . GLN B 1 6  ? 3.608   9.662   -7.383  1.00 0.00 ? 10 GLN B HB2  3  
ATOM 5520  H HB3  . GLN B 1 6  ? 1.905   9.254   -7.296  1.00 0.00 ? 10 GLN B HB3  3  
ATOM 5521  H HG2  . GLN B 1 6  ? 2.717   9.639   -10.081 1.00 0.00 ? 10 GLN B HG2  3  
ATOM 5522  H HG3  . GLN B 1 6  ? 3.760   8.466   -9.300  1.00 0.00 ? 10 GLN B HG3  3  
ATOM 5523  H HE21 . GLN B 1 6  ? 2.716   6.736   -8.056  1.00 0.00 ? 10 GLN B HE21 3  
ATOM 5524  H HE22 . GLN B 1 6  ? 1.229   6.056   -8.629  1.00 0.00 ? 10 GLN B HE22 3  
ATOM 5525  N N    . CYS B 1 7  ? 0.318   12.210  -7.275  1.00 0.00 ? 11 CYS B N    3  
ATOM 5526  C CA   . CYS B 1 7  ? -1.104  12.489  -7.170  1.00 0.00 ? 11 CYS B CA   3  
ATOM 5527  C C    . CYS B 1 7  ? -1.278  13.966  -6.811  1.00 0.00 ? 11 CYS B C    3  
ATOM 5528  O O    . CYS B 1 7  ? -0.627  14.467  -5.895  1.00 0.00 ? 11 CYS B O    3  
ATOM 5529  C CB   . CYS B 1 7  ? -1.788  11.571  -6.155  1.00 0.00 ? 11 CYS B CB   3  
ATOM 5530  S SG   . CYS B 1 7  ? -3.174  10.583  -6.826  1.00 0.00 ? 11 CYS B SG   3  
ATOM 5531  H H    . CYS B 1 7  ? 0.893   12.689  -6.611  1.00 0.00 ? 11 CYS B H    3  
ATOM 5532  H HA   . CYS B 1 7  ? -1.538  12.274  -8.146  1.00 0.00 ? 11 CYS B HA   3  
ATOM 5533  H HB2  . CYS B 1 7  ? -1.043  10.892  -5.741  1.00 0.00 ? 11 CYS B HB2  3  
ATOM 5534  H HB3  . CYS B 1 7  ? -2.159  12.178  -5.329  1.00 0.00 ? 11 CYS B HB3  3  
ATOM 5535  N N    . LEU B 1 8  ? -2.159  14.622  -7.552  1.00 0.00 ? 12 LEU B N    3  
ATOM 5536  C CA   . LEU B 1 8  ? -2.427  16.032  -7.323  1.00 0.00 ? 12 LEU B CA   3  
ATOM 5537  C C    . LEU B 1 8  ? -3.629  16.173  -6.387  1.00 0.00 ? 12 LEU B C    3  
ATOM 5538  O O    . LEU B 1 8  ? -3.840  17.232  -5.797  1.00 0.00 ? 12 LEU B O    3  
ATOM 5539  C CB   . LEU B 1 8  ? -2.594  16.768  -8.654  1.00 0.00 ? 12 LEU B CB   3  
ATOM 5540  C CG   . LEU B 1 8  ? -1.600  16.397  -9.756  1.00 0.00 ? 12 LEU B CG   3  
ATOM 5541  C CD1  . LEU B 1 8  ? -2.223  16.580  -11.141 1.00 0.00 ? 12 LEU B CD1  3  
ATOM 5542  C CD2  . LEU B 1 8  ? -0.296  17.182  -9.605  1.00 0.00 ? 12 LEU B CD2  3  
ATOM 5543  H H    . LEU B 1 8  ? -2.685  14.208  -8.294  1.00 0.00 ? 12 LEU B H    3  
ATOM 5544  H HA   . LEU B 1 8  ? -1.552  16.455  -6.829  1.00 0.00 ? 12 LEU B HA   3  
ATOM 5545  H HB2  . LEU B 1 8  ? -3.603  16.584  -9.024  1.00 0.00 ? 12 LEU B HB2  3  
ATOM 5546  H HB3  . LEU B 1 8  ? -2.515  17.839  -8.466  1.00 0.00 ? 12 LEU B HB3  3  
ATOM 5547  H HG   . LEU B 1 8  ? -1.354  15.340  -9.651  1.00 0.00 ? 12 LEU B HG   3  
ATOM 5548  H HD11 . LEU B 1 8  ? -3.308  16.629  -11.048 1.00 0.00 ? 12 LEU B HD11 3  
ATOM 5549  H HD12 . LEU B 1 8  ? -1.855  17.505  -11.585 1.00 0.00 ? 12 LEU B HD12 3  
ATOM 5550  H HD13 . LEU B 1 8  ? -1.950  15.738  -11.777 1.00 0.00 ? 12 LEU B HD13 3  
ATOM 5551  H HD21 . LEU B 1 8  ? -0.519  18.197  -9.277  1.00 0.00 ? 12 LEU B HD21 3  
ATOM 5552  H HD22 . LEU B 1 8  ? 0.340   16.693  -8.867  1.00 0.00 ? 12 LEU B HD22 3  
ATOM 5553  H HD23 . LEU B 1 8  ? 0.221   17.215  -10.564 1.00 0.00 ? 12 LEU B HD23 3  
ATOM 5554  N N    . GLN B 1 9  ? -4.385  15.091  -6.279  1.00 0.00 ? 13 GLN B N    3  
ATOM 5555  C CA   . GLN B 1 9  ? -5.560  15.081  -5.425  1.00 0.00 ? 13 GLN B CA   3  
ATOM 5556  C C    . GLN B 1 9  ? -5.593  13.803  -4.583  1.00 0.00 ? 13 GLN B C    3  
ATOM 5557  O O    . GLN B 1 9  ? -4.801  12.889  -4.804  1.00 0.00 ? 13 GLN B O    3  
ATOM 5558  C CB   . GLN B 1 9  ? -6.840  15.226  -6.250  1.00 0.00 ? 13 GLN B CB   3  
ATOM 5559  C CG   . GLN B 1 9  ? -7.863  16.103  -5.526  1.00 0.00 ? 13 GLN B CG   3  
ATOM 5560  C CD   . GLN B 1 9  ? -9.283  15.568  -5.724  1.00 0.00 ? 13 GLN B CD   3  
ATOM 5561  O OE1  . GLN B 1 9  ? -9.552  14.757  -6.595  1.00 0.00 ? 13 GLN B OE1  3  
ATOM 5562  N NE2  . GLN B 1 9  ? -10.172 16.064  -4.869  1.00 0.00 ? 13 GLN B NE2  3  
ATOM 5563  H H    . GLN B 1 9  ? -4.206  14.233  -6.762  1.00 0.00 ? 13 GLN B H    3  
ATOM 5564  H HA   . GLN B 1 9  ? -5.454  15.949  -4.775  1.00 0.00 ? 13 GLN B HA   3  
ATOM 5565  H HB2  . GLN B 1 9  ? -6.603  15.663  -7.221  1.00 0.00 ? 13 GLN B HB2  3  
ATOM 5566  H HB3  . GLN B 1 9  ? -7.269  14.242  -6.440  1.00 0.00 ? 13 GLN B HB3  3  
ATOM 5567  H HG2  . GLN B 1 9  ? -7.629  16.139  -4.462  1.00 0.00 ? 13 GLN B HG2  3  
ATOM 5568  H HG3  . GLN B 1 9  ? -7.801  17.125  -5.900  1.00 0.00 ? 13 GLN B HG3  3  
ATOM 5569  H HE21 . GLN B 1 9  ? -9.885  16.726  -4.177  1.00 0.00 ? 13 GLN B HE21 3  
ATOM 5570  H HE22 . GLN B 1 9  ? -11.128 15.775  -4.918  1.00 0.00 ? 13 GLN B HE22 3  
ATOM 5571  N N    . THR B 1 10 ? -6.519  13.782  -3.635  1.00 0.00 ? 14 THR B N    3  
ATOM 5572  C CA   . THR B 1 10 ? -6.665  12.632  -2.758  1.00 0.00 ? 14 THR B CA   3  
ATOM 5573  C C    . THR B 1 10 ? -8.095  12.552  -2.218  1.00 0.00 ? 14 THR B C    3  
ATOM 5574  O O    . THR B 1 10 ? -8.852  13.517  -2.310  1.00 0.00 ? 14 THR B O    3  
ATOM 5575  C CB   . THR B 1 10 ? -5.606  12.736  -1.660  1.00 0.00 ? 14 THR B CB   3  
ATOM 5576  O OG1  . THR B 1 10 ? -5.525  14.132  -1.387  1.00 0.00 ? 14 THR B OG1  3  
ATOM 5577  C CG2  . THR B 1 10 ? -4.206  12.373  -2.160  1.00 0.00 ? 14 THR B CG2  3  
ATOM 5578  H H    . THR B 1 10 ? -7.159  14.530  -3.461  1.00 0.00 ? 14 THR B H    3  
ATOM 5579  H HA   . THR B 1 10 ? -6.494  11.729  -3.345  1.00 0.00 ? 14 THR B HA   3  
ATOM 5580  H HB   . THR B 1 10 ? -5.879  12.130  -0.796  1.00 0.00 ? 14 THR B HB   3  
ATOM 5581  H HG1  . THR B 1 10 ? -5.987  14.339  -0.524  1.00 0.00 ? 14 THR B HG1  3  
ATOM 5582  H HG21 . THR B 1 10 ? -4.242  11.412  -2.674  1.00 0.00 ? 14 THR B HG21 3  
ATOM 5583  H HG22 . THR B 1 10 ? -3.856  13.141  -2.850  1.00 0.00 ? 14 THR B HG22 3  
ATOM 5584  H HG23 . THR B 1 10 ? -3.523  12.307  -1.313  1.00 0.00 ? 14 THR B HG23 3  
ATOM 5585  N N    . LEU B 1 11 ? -8.421  11.392  -1.667  1.00 0.00 ? 15 LEU B N    3  
ATOM 5586  C CA   . LEU B 1 11 ? -9.746  11.174  -1.112  1.00 0.00 ? 15 LEU B CA   3  
ATOM 5587  C C    . LEU B 1 11 ? -9.702  11.390  0.402   1.00 0.00 ? 15 LEU B C    3  
ATOM 5588  O O    . LEU B 1 11 ? -8.637  11.638  0.967   1.00 0.00 ? 15 LEU B O    3  
ATOM 5589  C CB   . LEU B 1 11 ? -10.278 9.799   -1.521  1.00 0.00 ? 15 LEU B CB   3  
ATOM 5590  C CG   . LEU B 1 11 ? -10.399 9.547   -3.026  1.00 0.00 ? 15 LEU B CG   3  
ATOM 5591  C CD1  . LEU B 1 11 ? -10.028 8.104   -3.372  1.00 0.00 ? 15 LEU B CD1  3  
ATOM 5592  C CD2  . LEU B 1 11 ? -11.794 9.919   -3.534  1.00 0.00 ? 15 LEU B CD2  3  
ATOM 5593  H H    . LEU B 1 11 ? -7.799  10.612  -1.597  1.00 0.00 ? 15 LEU B H    3  
ATOM 5594  H HA   . LEU B 1 11 ? -10.410 11.920  -1.548  1.00 0.00 ? 15 LEU B HA   3  
ATOM 5595  H HB2  . LEU B 1 11 ? -9.625  9.037   -1.097  1.00 0.00 ? 15 LEU B HB2  3  
ATOM 5596  H HB3  . LEU B 1 11 ? -11.261 9.663   -1.070  1.00 0.00 ? 15 LEU B HB3  3  
ATOM 5597  H HG   . LEU B 1 11 ? -9.687  10.194  -3.539  1.00 0.00 ? 15 LEU B HG   3  
ATOM 5598  H HD11 . LEU B 1 11 ? -9.332  7.719   -2.627  1.00 0.00 ? 15 LEU B HD11 3  
ATOM 5599  H HD12 . LEU B 1 11 ? -10.929 7.489   -3.379  1.00 0.00 ? 15 LEU B HD12 3  
ATOM 5600  H HD13 . LEU B 1 11 ? -9.561  8.074   -4.356  1.00 0.00 ? 15 LEU B HD13 3  
ATOM 5601  H HD21 . LEU B 1 11 ? -12.340 10.440  -2.748  1.00 0.00 ? 15 LEU B HD21 3  
ATOM 5602  H HD22 . LEU B 1 11 ? -11.702 10.567  -4.405  1.00 0.00 ? 15 LEU B HD22 3  
ATOM 5603  H HD23 . LEU B 1 11 ? -12.333 9.013   -3.811  1.00 0.00 ? 15 LEU B HD23 3  
ATOM 5604  N N    . GLN B 1 12 ? -10.871 11.288  1.016   1.00 0.00 ? 16 GLN B N    3  
ATOM 5605  C CA   . GLN B 1 12 ? -10.980 11.470  2.454   1.00 0.00 ? 16 GLN B CA   3  
ATOM 5606  C C    . GLN B 1 12 ? -11.311 10.139  3.134   1.00 0.00 ? 16 GLN B C    3  
ATOM 5607  O O    . GLN B 1 12 ? -11.206 10.018  4.353   1.00 0.00 ? 16 GLN B O    3  
ATOM 5608  C CB   . GLN B 1 12 ? -12.024 12.534  2.795   1.00 0.00 ? 16 GLN B CB   3  
ATOM 5609  C CG   . GLN B 1 12 ? -12.496 12.395  4.244   1.00 0.00 ? 16 GLN B CG   3  
ATOM 5610  C CD   . GLN B 1 12 ? -11.330 12.570  5.219   1.00 0.00 ? 16 GLN B CD   3  
ATOM 5611  O OE1  . GLN B 1 12 ? -10.169 12.426  4.871   1.00 0.00 ? 16 GLN B OE1  3  
ATOM 5612  N NE2  . GLN B 1 12 ? -11.702 12.886  6.456   1.00 0.00 ? 16 GLN B NE2  3  
ATOM 5613  H H    . GLN B 1 12 ? -11.732 11.086  0.550   1.00 0.00 ? 16 GLN B H    3  
ATOM 5614  H HA   . GLN B 1 12 ? -9.998  11.816  2.777   1.00 0.00 ? 16 GLN B HA   3  
ATOM 5615  H HB2  . GLN B 1 12 ? -11.601 13.527  2.640   1.00 0.00 ? 16 GLN B HB2  3  
ATOM 5616  H HB3  . GLN B 1 12 ? -12.876 12.442  2.121   1.00 0.00 ? 16 GLN B HB3  3  
ATOM 5617  H HG2  . GLN B 1 12 ? -13.264 13.140  4.453   1.00 0.00 ? 16 GLN B HG2  3  
ATOM 5618  H HG3  . GLN B 1 12 ? -12.953 11.417  4.389   1.00 0.00 ? 16 GLN B HG3  3  
ATOM 5619  H HE21 . GLN B 1 12 ? -12.672 12.988  6.676   1.00 0.00 ? 16 GLN B HE21 3  
ATOM 5620  H HE22 . GLN B 1 12 ? -11.012 13.021  7.167   1.00 0.00 ? 16 GLN B HE22 3  
ATOM 5621  N N    . GLY B 1 13 ? -11.703 9.175   2.315   1.00 0.00 ? 17 GLY B N    3  
ATOM 5622  C CA   . GLY B 1 13 ? -12.050 7.858   2.821   1.00 0.00 ? 17 GLY B CA   3  
ATOM 5623  C C    . GLY B 1 13 ? -13.122 7.200   1.950   1.00 0.00 ? 17 GLY B C    3  
ATOM 5624  O O    . GLY B 1 13 ? -14.313 7.454   2.127   1.00 0.00 ? 17 GLY B O    3  
ATOM 5625  H H    . GLY B 1 13 ? -11.786 9.281   1.324   1.00 0.00 ? 17 GLY B H    3  
ATOM 5626  H HA2  . GLY B 1 13 ? -11.160 7.228   2.847   1.00 0.00 ? 17 GLY B HA2  3  
ATOM 5627  H HA3  . GLY B 1 13 ? -12.410 7.942   3.846   1.00 0.00 ? 17 GLY B HA3  3  
ATOM 5628  N N    . ILE B 1 14 ? -12.661 6.368   1.028   1.00 0.00 ? 18 ILE B N    3  
ATOM 5629  C CA   . ILE B 1 14 ? -13.566 5.671   0.129   1.00 0.00 ? 18 ILE B CA   3  
ATOM 5630  C C    . ILE B 1 14 ? -13.939 4.317   0.736   1.00 0.00 ? 18 ILE B C    3  
ATOM 5631  O O    . ILE B 1 14 ? -13.260 3.829   1.637   1.00 0.00 ? 18 ILE B O    3  
ATOM 5632  C CB   . ILE B 1 14 ? -12.958 5.572   -1.271  1.00 0.00 ? 18 ILE B CB   3  
ATOM 5633  C CG1  . ILE B 1 14 ? -13.216 6.849   -2.073  1.00 0.00 ? 18 ILE B CG1  3  
ATOM 5634  C CG2  . ILE B 1 14 ? -13.463 4.325   -2.001  1.00 0.00 ? 18 ILE B CG2  3  
ATOM 5635  C CD1  . ILE B 1 14 ? -14.716 7.111   -2.221  1.00 0.00 ? 18 ILE B CD1  3  
ATOM 5636  H H    . ILE B 1 14 ? -11.691 6.167   0.891   1.00 0.00 ? 18 ILE B H    3  
ATOM 5637  H HA   . ILE B 1 14 ? -14.471 6.273   0.045   1.00 0.00 ? 18 ILE B HA   3  
ATOM 5638  H HB   . ILE B 1 14 ? -11.878 5.469   -1.168  1.00 0.00 ? 18 ILE B HB   3  
ATOM 5639  H HG12 . ILE B 1 14 ? -12.742 7.696   -1.577  1.00 0.00 ? 18 ILE B HG12 3  
ATOM 5640  H HG13 . ILE B 1 14 ? -12.759 6.762   -3.059  1.00 0.00 ? 18 ILE B HG13 3  
ATOM 5641  H HG21 . ILE B 1 14 ? -13.235 3.440   -1.408  1.00 0.00 ? 18 ILE B HG21 3  
ATOM 5642  H HG22 . ILE B 1 14 ? -14.541 4.399   -2.143  1.00 0.00 ? 18 ILE B HG22 3  
ATOM 5643  H HG23 . ILE B 1 14 ? -12.973 4.248   -2.971  1.00 0.00 ? 18 ILE B HG23 3  
ATOM 5644  H HD11 . ILE B 1 14 ? -15.273 6.255   -1.838  1.00 0.00 ? 18 ILE B HD11 3  
ATOM 5645  H HD12 . ILE B 1 14 ? -14.986 8.003   -1.656  1.00 0.00 ? 18 ILE B HD12 3  
ATOM 5646  H HD13 . ILE B 1 14 ? -14.957 7.260   -3.273  1.00 0.00 ? 18 ILE B HD13 3  
ATOM 5647  N N    . HIS B 1 15 ? -15.017 3.749   0.216   1.00 0.00 ? 19 HIS B N    3  
ATOM 5648  C CA   . HIS B 1 15 ? -15.489 2.461   0.696   1.00 0.00 ? 19 HIS B CA   3  
ATOM 5649  C C    . HIS B 1 15 ? -14.386 1.414   0.522   1.00 0.00 ? 19 HIS B C    3  
ATOM 5650  O O    . HIS B 1 15 ? -13.716 1.378   -0.509  1.00 0.00 ? 19 HIS B O    3  
ATOM 5651  C CB   . HIS B 1 15 ? -16.794 2.067   0.002   1.00 0.00 ? 19 HIS B CB   3  
ATOM 5652  C CG   . HIS B 1 15 ? -17.853 1.539   0.939   1.00 0.00 ? 19 HIS B CG   3  
ATOM 5653  N ND1  . HIS B 1 15 ? -19.036 2.212   1.189   1.00 0.00 ? 19 HIS B ND1  3  
ATOM 5654  C CD2  . HIS B 1 15 ? -17.895 0.397   1.684   1.00 0.00 ? 19 HIS B CD2  3  
ATOM 5655  C CE1  . HIS B 1 15 ? -19.750 1.499   2.048   1.00 0.00 ? 19 HIS B CE1  3  
ATOM 5656  N NE2  . HIS B 1 15 ? -19.041 0.374   2.353   1.00 0.00 ? 19 HIS B NE2  3  
ATOM 5657  H H    . HIS B 1 15 ? -15.564 4.153   -0.517  1.00 0.00 ? 19 HIS B H    3  
ATOM 5658  H HA   . HIS B 1 15 ? -15.700 2.580   1.758   1.00 0.00 ? 19 HIS B HA   3  
ATOM 5659  H HB2  . HIS B 1 15 ? -17.190 2.936   -0.525  1.00 0.00 ? 19 HIS B HB2  3  
ATOM 5660  H HB3  . HIS B 1 15 ? -16.579 1.309   -0.751  1.00 0.00 ? 19 HIS B HB3  3  
ATOM 5661  H HD1  . HIS B 1 15 ? -19.307 3.089   0.790   1.00 0.00 ? 19 HIS B HD1  3  
ATOM 5662  H HD2  . HIS B 1 15 ? -17.119 -0.367  1.722   1.00 0.00 ? 19 HIS B HD2  3  
ATOM 5663  H HE1  . HIS B 1 15 ? -20.732 1.763   2.440   1.00 0.00 ? 19 HIS B HE1  3  
ATOM 5664  N N    . LEU B 1 16 ? -14.232 0.588   1.546   1.00 0.00 ? 20 LEU B N    3  
ATOM 5665  C CA   . LEU B 1 16 ? -13.223 -0.457  1.520   1.00 0.00 ? 20 LEU B CA   3  
ATOM 5666  C C    . LEU B 1 16 ? -13.801 -1.702  0.845   1.00 0.00 ? 20 LEU B C    3  
ATOM 5667  O O    . LEU B 1 16 ? -13.195 -2.772  0.885   1.00 0.00 ? 20 LEU B O    3  
ATOM 5668  C CB   . LEU B 1 16 ? -12.682 -0.715  2.928   1.00 0.00 ? 20 LEU B CB   3  
ATOM 5669  C CG   . LEU B 1 16 ? -11.561 -1.751  3.036   1.00 0.00 ? 20 LEU B CG   3  
ATOM 5670  C CD1  . LEU B 1 16 ? -10.366 -1.360  2.165   1.00 0.00 ? 20 LEU B CD1  3  
ATOM 5671  C CD2  . LEU B 1 16 ? -11.159 -1.972  4.496   1.00 0.00 ? 20 LEU B CD2  3  
ATOM 5672  H H    . LEU B 1 16 ? -14.781 0.624   2.381   1.00 0.00 ? 20 LEU B H    3  
ATOM 5673  H HA   . LEU B 1 16 ? -12.391 -0.092  0.917   1.00 0.00 ? 20 LEU B HA   3  
ATOM 5674  H HB2  . LEU B 1 16 ? -12.318 0.229   3.335   1.00 0.00 ? 20 LEU B HB2  3  
ATOM 5675  H HB3  . LEU B 1 16 ? -13.510 -1.036  3.560   1.00 0.00 ? 20 LEU B HB3  3  
ATOM 5676  H HG   . LEU B 1 16 ? -11.938 -2.702  2.659   1.00 0.00 ? 20 LEU B HG   3  
ATOM 5677  H HD11 . LEU B 1 16 ? -10.569 -0.406  1.678   1.00 0.00 ? 20 LEU B HD11 3  
ATOM 5678  H HD12 . LEU B 1 16 ? -9.477  -1.268  2.788   1.00 0.00 ? 20 LEU B HD12 3  
ATOM 5679  H HD13 . LEU B 1 16 ? -10.202 -2.127  1.408   1.00 0.00 ? 20 LEU B HD13 3  
ATOM 5680  H HD21 . LEU B 1 16 ? -12.020 -1.801  5.141   1.00 0.00 ? 20 LEU B HD21 3  
ATOM 5681  H HD22 . LEU B 1 16 ? -10.806 -2.996  4.624   1.00 0.00 ? 20 LEU B HD22 3  
ATOM 5682  H HD23 . LEU B 1 16 ? -10.362 -1.277  4.762   1.00 0.00 ? 20 LEU B HD23 3  
ATOM 5683  N N    . LYS B 1 17 ? -14.967 -1.522  0.242   1.00 0.00 ? 21 LYS B N    3  
ATOM 5684  C CA   . LYS B 1 17 ? -15.634 -2.618  -0.440  1.00 0.00 ? 21 LYS B CA   3  
ATOM 5685  C C    . LYS B 1 17 ? -15.234 -2.612  -1.917  1.00 0.00 ? 21 LYS B C    3  
ATOM 5686  O O    . LYS B 1 17 ? -15.482 -3.580  -2.635  1.00 0.00 ? 21 LYS B O    3  
ATOM 5687  C CB   . LYS B 1 17 ? -17.145 -2.550  -0.212  1.00 0.00 ? 21 LYS B CB   3  
ATOM 5688  C CG   . LYS B 1 17 ? -17.904 -3.208  -1.367  1.00 0.00 ? 21 LYS B CG   3  
ATOM 5689  C CD   . LYS B 1 17 ? -17.632 -4.713  -1.414  1.00 0.00 ? 21 LYS B CD   3  
ATOM 5690  C CE   . LYS B 1 17 ? -17.865 -5.268  -2.821  1.00 0.00 ? 21 LYS B CE   3  
ATOM 5691  N NZ   . LYS B 1 17 ? -16.789 -6.216  -3.188  1.00 0.00 ? 21 LYS B NZ   3  
ATOM 5692  H H    . LYS B 1 17 ? -15.453 -0.648  0.214   1.00 0.00 ? 21 LYS B H    3  
ATOM 5693  H HA   . LYS B 1 17 ? -15.281 -3.546  0.010   1.00 0.00 ? 21 LYS B HA   3  
ATOM 5694  H HB2  . LYS B 1 17 ? -17.398 -3.047  0.724   1.00 0.00 ? 21 LYS B HB2  3  
ATOM 5695  H HB3  . LYS B 1 17 ? -17.456 -1.510  -0.115  1.00 0.00 ? 21 LYS B HB3  3  
ATOM 5696  H HG2  . LYS B 1 17 ? -18.973 -3.031  -1.251  1.00 0.00 ? 21 LYS B HG2  3  
ATOM 5697  H HG3  . LYS B 1 17 ? -17.605 -2.751  -2.310  1.00 0.00 ? 21 LYS B HG3  3  
ATOM 5698  H HD2  . LYS B 1 17 ? -16.605 -4.911  -1.106  1.00 0.00 ? 21 LYS B HD2  3  
ATOM 5699  H HD3  . LYS B 1 17 ? -18.282 -5.226  -0.705  1.00 0.00 ? 21 LYS B HD3  3  
ATOM 5700  H HE2  . LYS B 1 17 ? -18.831 -5.771  -2.865  1.00 0.00 ? 21 LYS B HE2  3  
ATOM 5701  H HE3  . LYS B 1 17 ? -17.898 -4.450  -3.540  1.00 0.00 ? 21 LYS B HE3  3  
ATOM 5702  H HZ1  . LYS B 1 17 ? -15.900 -5.774  -3.068  1.00 0.00 ? 21 LYS B HZ1  3  
ATOM 5703  H HZ2  . LYS B 1 17 ? -16.842 -7.024  -2.601  1.00 0.00 ? 21 LYS B HZ2  3  
ATOM 5704  H HZ3  . LYS B 1 17 ? -16.898 -6.491  -4.143  1.00 0.00 ? 21 LYS B HZ3  3  
ATOM 5705  N N    . ASN B 1 18 ? -14.621 -1.511  -2.327  1.00 0.00 ? 22 ASN B N    3  
ATOM 5706  C CA   . ASN B 1 18 ? -14.185 -1.367  -3.706  1.00 0.00 ? 22 ASN B CA   3  
ATOM 5707  C C    . ASN B 1 18 ? -12.670 -1.568  -3.780  1.00 0.00 ? 22 ASN B C    3  
ATOM 5708  O O    . ASN B 1 18 ? -12.181 -2.329  -4.613  1.00 0.00 ? 22 ASN B O    3  
ATOM 5709  C CB   . ASN B 1 18 ? -14.503 0.030   -4.241  1.00 0.00 ? 22 ASN B CB   3  
ATOM 5710  C CG   . ASN B 1 18 ? -15.657 -0.017  -5.245  1.00 0.00 ? 22 ASN B CG   3  
ATOM 5711  O OD1  . ASN B 1 18 ? -15.669 -0.799  -6.181  1.00 0.00 ? 22 ASN B OD1  3  
ATOM 5712  N ND2  . ASN B 1 18 ? -16.625 0.862   -4.998  1.00 0.00 ? 22 ASN B ND2  3  
ATOM 5713  H H    . ASN B 1 18 ? -14.423 -0.729  -1.737  1.00 0.00 ? 22 ASN B H    3  
ATOM 5714  H HA   . ASN B 1 18 ? -14.734 -2.127  -4.261  1.00 0.00 ? 22 ASN B HA   3  
ATOM 5715  H HB2  . ASN B 1 18 ? -14.763 0.690   -3.414  1.00 0.00 ? 22 ASN B HB2  3  
ATOM 5716  H HB3  . ASN B 1 18 ? -13.618 0.451   -4.719  1.00 0.00 ? 22 ASN B HB3  3  
ATOM 5717  H HD21 . ASN B 1 18 ? -16.554 1.476   -4.212  1.00 0.00 ? 22 ASN B HD21 3  
ATOM 5718  H HD22 . ASN B 1 18 ? -17.423 0.908   -5.599  1.00 0.00 ? 22 ASN B HD22 3  
ATOM 5719  N N    . ILE B 1 19 ? -11.969 -0.871  -2.898  1.00 0.00 ? 23 ILE B N    3  
ATOM 5720  C CA   . ILE B 1 19 ? -10.519 -0.963  -2.853  1.00 0.00 ? 23 ILE B CA   3  
ATOM 5721  C C    . ILE B 1 19 ? -10.103 -2.433  -2.922  1.00 0.00 ? 23 ILE B C    3  
ATOM 5722  O O    . ILE B 1 19 ? -10.607 -3.261  -2.165  1.00 0.00 ? 23 ILE B O    3  
ATOM 5723  C CB   . ILE B 1 19 ? -9.973  -0.227  -1.627  1.00 0.00 ? 23 ILE B CB   3  
ATOM 5724  C CG1  . ILE B 1 19 ? -9.639  1.228   -1.965  1.00 0.00 ? 23 ILE B CG1  3  
ATOM 5725  C CG2  . ILE B 1 19 ? -8.774  -0.967  -1.032  1.00 0.00 ? 23 ILE B CG2  3  
ATOM 5726  C CD1  . ILE B 1 19 ? -10.262 2.185   -0.947  1.00 0.00 ? 23 ILE B CD1  3  
ATOM 5727  H H    . ILE B 1 19 ? -12.374 -0.253  -2.224  1.00 0.00 ? 23 ILE B H    3  
ATOM 5728  H HA   . ILE B 1 19 ? -10.132 -0.452  -3.734  1.00 0.00 ? 23 ILE B HA   3  
ATOM 5729  H HB   . ILE B 1 19 ? -10.752 -0.209  -0.865  1.00 0.00 ? 23 ILE B HB   3  
ATOM 5730  H HG12 . ILE B 1 19 ? -8.557  1.361   -1.980  1.00 0.00 ? 23 ILE B HG12 3  
ATOM 5731  H HG13 . ILE B 1 19 ? -10.003 1.466   -2.964  1.00 0.00 ? 23 ILE B HG13 3  
ATOM 5732  H HG21 . ILE B 1 19 ? -9.074  -1.978  -0.753  1.00 0.00 ? 23 ILE B HG21 3  
ATOM 5733  H HG22 . ILE B 1 19 ? -7.974  -1.017  -1.770  1.00 0.00 ? 23 ILE B HG22 3  
ATOM 5734  H HG23 . ILE B 1 19 ? -8.421  -0.436  -0.148  1.00 0.00 ? 23 ILE B HG23 3  
ATOM 5735  H HD11 . ILE B 1 19 ? -11.181 1.749   -0.555  1.00 0.00 ? 23 ILE B HD11 3  
ATOM 5736  H HD12 . ILE B 1 19 ? -9.562  2.352   -0.129  1.00 0.00 ? 23 ILE B HD12 3  
ATOM 5737  H HD13 . ILE B 1 19 ? -10.488 3.134   -1.432  1.00 0.00 ? 23 ILE B HD13 3  
ATOM 5738  N N    . GLN B 1 20 ? -9.188  -2.714  -3.838  1.00 0.00 ? 24 GLN B N    3  
ATOM 5739  C CA   . GLN B 1 20 ? -8.699  -4.070  -4.017  1.00 0.00 ? 24 GLN B CA   3  
ATOM 5740  C C    . GLN B 1 20 ? -7.220  -4.156  -3.634  1.00 0.00 ? 24 GLN B C    3  
ATOM 5741  O O    . GLN B 1 20 ? -6.731  -5.224  -3.270  1.00 0.00 ? 24 GLN B O    3  
ATOM 5742  C CB   . GLN B 1 20 ? -8.922  -4.549  -5.453  1.00 0.00 ? 24 GLN B CB   3  
ATOM 5743  C CG   . GLN B 1 20 ? -9.378  -6.009  -5.479  1.00 0.00 ? 24 GLN B CG   3  
ATOM 5744  C CD   . GLN B 1 20 ? -8.193  -6.957  -5.281  1.00 0.00 ? 24 GLN B CD   3  
ATOM 5745  O OE1  . GLN B 1 20 ? -8.075  -7.644  -4.279  1.00 0.00 ? 24 GLN B OE1  3  
ATOM 5746  N NE2  . GLN B 1 20 ? -7.325  -6.956  -6.289  1.00 0.00 ? 24 GLN B NE2  3  
ATOM 5747  H H    . GLN B 1 20 ? -8.783  -2.035  -4.451  1.00 0.00 ? 24 GLN B H    3  
ATOM 5748  H HA   . GLN B 1 20 ? -9.293  -4.684  -3.340  1.00 0.00 ? 24 GLN B HA   3  
ATOM 5749  H HB2  . GLN B 1 20 ? -9.670  -3.922  -5.937  1.00 0.00 ? 24 GLN B HB2  3  
ATOM 5750  H HB3  . GLN B 1 20 ? -7.999  -4.442  -6.023  1.00 0.00 ? 24 GLN B HB3  3  
ATOM 5751  H HG2  . GLN B 1 20 ? -10.117 -6.177  -4.697  1.00 0.00 ? 24 GLN B HG2  3  
ATOM 5752  H HG3  . GLN B 1 20 ? -9.865  -6.225  -6.430  1.00 0.00 ? 24 GLN B HG3  3  
ATOM 5753  H HE21 . GLN B 1 20 ? -7.481  -6.368  -7.082  1.00 0.00 ? 24 GLN B HE21 3  
ATOM 5754  H HE22 . GLN B 1 20 ? -6.516  -7.543  -6.252  1.00 0.00 ? 24 GLN B HE22 3  
ATOM 5755  N N    . SER B 1 21 ? -6.550  -3.017  -3.729  1.00 0.00 ? 25 SER B N    3  
ATOM 5756  C CA   . SER B 1 21 ? -5.137  -2.950  -3.396  1.00 0.00 ? 25 SER B CA   3  
ATOM 5757  C C    . SER B 1 21 ? -4.802  -1.576  -2.812  1.00 0.00 ? 25 SER B C    3  
ATOM 5758  O O    . SER B 1 21 ? -5.571  -0.628  -2.964  1.00 0.00 ? 25 SER B O    3  
ATOM 5759  C CB   . SER B 1 21 ? -4.269  -3.231  -4.624  1.00 0.00 ? 25 SER B CB   3  
ATOM 5760  O OG   . SER B 1 21 ? -5.033  -3.740  -5.714  1.00 0.00 ? 25 SER B OG   3  
ATOM 5761  H H    . SER B 1 21 ? -6.956  -2.153  -4.025  1.00 0.00 ? 25 SER B H    3  
ATOM 5762  H HA   . SER B 1 21 ? -4.978  -3.731  -2.653  1.00 0.00 ? 25 SER B HA   3  
ATOM 5763  H HB2  . SER B 1 21 ? -3.766  -2.314  -4.931  1.00 0.00 ? 25 SER B HB2  3  
ATOM 5764  H HB3  . SER B 1 21 ? -3.491  -3.948  -4.361  1.00 0.00 ? 25 SER B HB3  3  
ATOM 5765  H HG   . SER B 1 21 ? -5.391  -4.646  -5.487  1.00 0.00 ? 25 SER B HG   3  
ATOM 5766  N N    . VAL B 1 22 ? -3.652  -1.512  -2.156  1.00 0.00 ? 26 VAL B N    3  
ATOM 5767  C CA   . VAL B 1 22 ? -3.205  -0.270  -1.549  1.00 0.00 ? 26 VAL B CA   3  
ATOM 5768  C C    . VAL B 1 22 ? -1.747  -0.014  -1.936  1.00 0.00 ? 26 VAL B C    3  
ATOM 5769  O O    . VAL B 1 22 ? -0.910  -0.909  -1.841  1.00 0.00 ? 26 VAL B O    3  
ATOM 5770  C CB   . VAL B 1 22 ? -3.422  -0.320  -0.035  1.00 0.00 ? 26 VAL B CB   3  
ATOM 5771  C CG1  . VAL B 1 22 ? -2.624  0.778   0.670   1.00 0.00 ? 26 VAL B CG1  3  
ATOM 5772  C CG2  . VAL B 1 22 ? -4.910  -0.224  0.309   1.00 0.00 ? 26 VAL B CG2  3  
ATOM 5773  H H    . VAL B 1 22 ? -3.032  -2.288  -2.037  1.00 0.00 ? 26 VAL B H    3  
ATOM 5774  H HA   . VAL B 1 22 ? -3.822  0.533   -1.952  1.00 0.00 ? 26 VAL B HA   3  
ATOM 5775  H HB   . VAL B 1 22 ? -3.057  -1.282  0.324   1.00 0.00 ? 26 VAL B HB   3  
ATOM 5776  H HG11 . VAL B 1 22 ? -2.574  1.659   0.029   1.00 0.00 ? 26 VAL B HG11 3  
ATOM 5777  H HG12 . VAL B 1 22 ? -3.115  1.039   1.608   1.00 0.00 ? 26 VAL B HG12 3  
ATOM 5778  H HG13 . VAL B 1 22 ? -1.615  0.420   0.875   1.00 0.00 ? 26 VAL B HG13 3  
ATOM 5779  H HG21 . VAL B 1 22 ? -5.500  -0.619  -0.518  1.00 0.00 ? 26 VAL B HG21 3  
ATOM 5780  H HG22 . VAL B 1 22 ? -5.113  -0.803  1.210   1.00 0.00 ? 26 VAL B HG22 3  
ATOM 5781  H HG23 . VAL B 1 22 ? -5.177  0.819   0.480   1.00 0.00 ? 26 VAL B HG23 3  
ATOM 5782  N N    . LYS B 1 23 ? -1.489  1.213   -2.363  1.00 0.00 ? 27 LYS B N    3  
ATOM 5783  C CA   . LYS B 1 23 ? -0.147  1.599   -2.765  1.00 0.00 ? 27 LYS B CA   3  
ATOM 5784  C C    . LYS B 1 23 ? 0.279   2.840   -1.979  1.00 0.00 ? 27 LYS B C    3  
ATOM 5785  O O    . LYS B 1 23 ? -0.370  3.882   -2.058  1.00 0.00 ? 27 LYS B O    3  
ATOM 5786  C CB   . LYS B 1 23 ? -0.072  1.776   -4.283  1.00 0.00 ? 27 LYS B CB   3  
ATOM 5787  C CG   . LYS B 1 23 ? 1.339   2.176   -4.719  1.00 0.00 ? 27 LYS B CG   3  
ATOM 5788  C CD   . LYS B 1 23 ? 2.397   1.385   -3.946  1.00 0.00 ? 27 LYS B CD   3  
ATOM 5789  C CE   . LYS B 1 23 ? 3.696   1.279   -4.748  1.00 0.00 ? 27 LYS B CE   3  
ATOM 5790  N NZ   . LYS B 1 23 ? 4.082   2.602   -5.288  1.00 0.00 ? 27 LYS B NZ   3  
ATOM 5791  H H    . LYS B 1 23 ? -2.176  1.936   -2.438  1.00 0.00 ? 27 LYS B H    3  
ATOM 5792  H HA   . LYS B 1 23 ? 0.521   0.778   -2.503  1.00 0.00 ? 27 LYS B HA   3  
ATOM 5793  H HB2  . LYS B 1 23 ? -0.359  0.847   -4.776  1.00 0.00 ? 27 LYS B HB2  3  
ATOM 5794  H HB3  . LYS B 1 23 ? -0.784  2.538   -4.599  1.00 0.00 ? 27 LYS B HB3  3  
ATOM 5795  H HG2  . LYS B 1 23 ? 1.457   1.999   -5.788  1.00 0.00 ? 27 LYS B HG2  3  
ATOM 5796  H HG3  . LYS B 1 23 ? 1.486   3.243   -4.554  1.00 0.00 ? 27 LYS B HG3  3  
ATOM 5797  H HD2  . LYS B 1 23 ? 2.594   1.871   -2.991  1.00 0.00 ? 27 LYS B HD2  3  
ATOM 5798  H HD3  . LYS B 1 23 ? 2.020   0.387   -3.724  1.00 0.00 ? 27 LYS B HD3  3  
ATOM 5799  H HE2  . LYS B 1 23 ? 4.492   0.893   -4.112  1.00 0.00 ? 27 LYS B HE2  3  
ATOM 5800  H HE3  . LYS B 1 23 ? 3.569   0.569   -5.565  1.00 0.00 ? 27 LYS B HE3  3  
ATOM 5801  H HZ1  . LYS B 1 23 ? 4.106   3.271   -4.545  1.00 0.00 ? 27 LYS B HZ1  3  
ATOM 5802  H HZ2  . LYS B 1 23 ? 4.987   2.539   -5.709  1.00 0.00 ? 27 LYS B HZ2  3  
ATOM 5803  H HZ3  . LYS B 1 23 ? 3.414   2.890   -5.974  1.00 0.00 ? 27 LYS B HZ3  3  
ATOM 5804  N N    . VAL B 1 24 ? 1.368   2.688   -1.239  1.00 0.00 ? 28 VAL B N    3  
ATOM 5805  C CA   . VAL B 1 24 ? 1.888   3.784   -0.440  1.00 0.00 ? 28 VAL B CA   3  
ATOM 5806  C C    . VAL B 1 24 ? 3.223   4.249   -1.026  1.00 0.00 ? 28 VAL B C    3  
ATOM 5807  O O    . VAL B 1 24 ? 4.194   3.495   -1.043  1.00 0.00 ? 28 VAL B O    3  
ATOM 5808  C CB   . VAL B 1 24 ? 1.995   3.358   1.026   1.00 0.00 ? 28 VAL B CB   3  
ATOM 5809  C CG1  . VAL B 1 24 ? 3.445   3.043   1.401   1.00 0.00 ? 28 VAL B CG1  3  
ATOM 5810  C CG2  . VAL B 1 24 ? 1.410   4.426   1.952   1.00 0.00 ? 28 VAL B CG2  3  
ATOM 5811  H H    . VAL B 1 24 ? 1.890   1.838   -1.181  1.00 0.00 ? 28 VAL B H    3  
ATOM 5812  H HA   . VAL B 1 24 ? 1.173   4.605   -0.501  1.00 0.00 ? 28 VAL B HA   3  
ATOM 5813  H HB   . VAL B 1 24 ? 1.411   2.447   1.154   1.00 0.00 ? 28 VAL B HB   3  
ATOM 5814  H HG11 . VAL B 1 24 ? 4.072   3.908   1.185   1.00 0.00 ? 28 VAL B HG11 3  
ATOM 5815  H HG12 . VAL B 1 24 ? 3.503   2.808   2.463   1.00 0.00 ? 28 VAL B HG12 3  
ATOM 5816  H HG13 . VAL B 1 24 ? 3.792   2.188   0.820   1.00 0.00 ? 28 VAL B HG13 3  
ATOM 5817  H HG21 . VAL B 1 24 ? 1.378   5.382   1.429   1.00 0.00 ? 28 VAL B HG21 3  
ATOM 5818  H HG22 . VAL B 1 24 ? 0.400   4.138   2.246   1.00 0.00 ? 28 VAL B HG22 3  
ATOM 5819  H HG23 . VAL B 1 24 ? 2.034   4.519   2.841   1.00 0.00 ? 28 VAL B HG23 3  
ATOM 5820  N N    . LYS B 1 25 ? 3.228   5.489   -1.493  1.00 0.00 ? 29 LYS B N    3  
ATOM 5821  C CA   . LYS B 1 25 ? 4.427   6.063   -2.079  1.00 0.00 ? 29 LYS B CA   3  
ATOM 5822  C C    . LYS B 1 25 ? 4.891   7.245   -1.225  1.00 0.00 ? 29 LYS B C    3  
ATOM 5823  O O    . LYS B 1 25 ? 4.520   8.388   -1.487  1.00 0.00 ? 29 LYS B O    3  
ATOM 5824  C CB   . LYS B 1 25 ? 4.187   6.422   -3.547  1.00 0.00 ? 29 LYS B CB   3  
ATOM 5825  C CG   . LYS B 1 25 ? 5.512   6.581   -4.296  1.00 0.00 ? 29 LYS B CG   3  
ATOM 5826  C CD   . LYS B 1 25 ? 6.098   7.978   -4.083  1.00 0.00 ? 29 LYS B CD   3  
ATOM 5827  C CE   . LYS B 1 25 ? 6.701   8.523   -5.379  1.00 0.00 ? 29 LYS B CE   3  
ATOM 5828  N NZ   . LYS B 1 25 ? 7.224   9.892   -5.172  1.00 0.00 ? 29 LYS B NZ   3  
ATOM 5829  H H    . LYS B 1 25 ? 2.433   6.097   -1.475  1.00 0.00 ? 29 LYS B H    3  
ATOM 5830  H HA   . LYS B 1 25 ? 5.201   5.296   -2.057  1.00 0.00 ? 29 LYS B HA   3  
ATOM 5831  H HB2  . LYS B 1 25 ? 3.587   5.646   -4.022  1.00 0.00 ? 29 LYS B HB2  3  
ATOM 5832  H HB3  . LYS B 1 25 ? 3.616   7.349   -3.610  1.00 0.00 ? 29 LYS B HB3  3  
ATOM 5833  H HG2  . LYS B 1 25 ? 6.221   5.828   -3.951  1.00 0.00 ? 29 LYS B HG2  3  
ATOM 5834  H HG3  . LYS B 1 25 ? 5.354   6.407   -5.360  1.00 0.00 ? 29 LYS B HG3  3  
ATOM 5835  H HD2  . LYS B 1 25 ? 5.320   8.653   -3.727  1.00 0.00 ? 29 LYS B HD2  3  
ATOM 5836  H HD3  . LYS B 1 25 ? 6.865   7.940   -3.309  1.00 0.00 ? 29 LYS B HD3  3  
ATOM 5837  H HE2  . LYS B 1 25 ? 7.503   7.868   -5.718  1.00 0.00 ? 29 LYS B HE2  3  
ATOM 5838  H HE3  . LYS B 1 25 ? 5.943   8.532   -6.163  1.00 0.00 ? 29 LYS B HE3  3  
ATOM 5839  H HZ1  . LYS B 1 25 ? 6.816   10.283  -4.347  1.00 0.00 ? 29 LYS B HZ1  3  
ATOM 5840  H HZ2  . LYS B 1 25 ? 8.218   9.856   -5.067  1.00 0.00 ? 29 LYS B HZ2  3  
ATOM 5841  H HZ3  . LYS B 1 25 ? 6.992   10.460  -5.961  1.00 0.00 ? 29 LYS B HZ3  3  
ATOM 5842  N N    . SER B 1 26 ? 5.695   6.928   -0.221  1.00 0.00 ? 30 SER B N    3  
ATOM 5843  C CA   . SER B 1 26 ? 6.214   7.950   0.674   1.00 0.00 ? 30 SER B CA   3  
ATOM 5844  C C    . SER B 1 26 ? 6.792   9.111   -0.138  1.00 0.00 ? 30 SER B C    3  
ATOM 5845  O O    . SER B 1 26 ? 6.982   8.994   -1.347  1.00 0.00 ? 30 SER B O    3  
ATOM 5846  C CB   . SER B 1 26 ? 7.278   7.374   1.609   1.00 0.00 ? 30 SER B CB   3  
ATOM 5847  O OG   . SER B 1 26 ? 8.598   7.608   1.125   1.00 0.00 ? 30 SER B OG   3  
ATOM 5848  H H    . SER B 1 26 ? 5.992   5.996   -0.014  1.00 0.00 ? 30 SER B H    3  
ATOM 5849  H HA   . SER B 1 26 ? 5.357   8.282   1.260   1.00 0.00 ? 30 SER B HA   3  
ATOM 5850  H HB2  . SER B 1 26 ? 7.171   7.819   2.598   1.00 0.00 ? 30 SER B HB2  3  
ATOM 5851  H HB3  . SER B 1 26 ? 7.119   6.301   1.724   1.00 0.00 ? 30 SER B HB3  3  
ATOM 5852  H HG   . SER B 1 26 ? 9.181   6.820   1.326   1.00 0.00 ? 30 SER B HG   3  
ATOM 5853  N N    . PRO B 1 27 ? 7.064   10.234  0.579   1.00 0.00 ? 31 PRO B N    3  
ATOM 5854  C CA   . PRO B 1 27 ? 7.617   11.415  -0.061  1.00 0.00 ? 31 PRO B CA   3  
ATOM 5855  C C    . PRO B 1 27 ? 9.100   11.220  -0.383  1.00 0.00 ? 31 PRO B C    3  
ATOM 5856  O O    . PRO B 1 27 ? 9.679   10.184  -0.060  1.00 0.00 ? 31 PRO B O    3  
ATOM 5857  C CB   . PRO B 1 27 ? 7.367   12.548  0.921   1.00 0.00 ? 31 PRO B CB   3  
ATOM 5858  C CG   . PRO B 1 27 ? 7.105   11.886  2.263   1.00 0.00 ? 31 PRO B CG   3  
ATOM 5859  C CD   . PRO B 1 27 ? 6.853   10.408  2.013   1.00 0.00 ? 31 PRO B CD   3  
ATOM 5860  H HA   . PRO B 1 27 ? 7.166   11.578  -0.938  1.00 0.00 ? 31 PRO B HA   3  
ATOM 5861  H HB2  . PRO B 1 27 ? 8.228   13.215  0.975   1.00 0.00 ? 31 PRO B HB2  3  
ATOM 5862  H HB3  . PRO B 1 27 ? 6.515   13.153  0.610   1.00 0.00 ? 31 PRO B HB3  3  
ATOM 5863  H HG2  . PRO B 1 27 ? 7.958   12.021  2.929   1.00 0.00 ? 31 PRO B HG2  3  
ATOM 5864  H HG3  . PRO B 1 27 ? 6.244   12.343  2.752   1.00 0.00 ? 31 PRO B HG3  3  
ATOM 5865  H HD2  . PRO B 1 27 ? 7.536   9.787   2.593   1.00 0.00 ? 31 PRO B HD2  3  
ATOM 5866  H HD3  . PRO B 1 27 ? 5.841   10.125  2.302   1.00 0.00 ? 31 PRO B HD3  3  
ATOM 5867  N N    . GLY B 1 28 ? 9.673   12.233  -1.017  1.00 0.00 ? 32 GLY B N    3  
ATOM 5868  C CA   . GLY B 1 28 ? 11.078  12.186  -1.387  1.00 0.00 ? 32 GLY B CA   3  
ATOM 5869  C C    . GLY B 1 28 ? 11.696  13.585  -1.371  1.00 0.00 ? 32 GLY B C    3  
ATOM 5870  O O    . GLY B 1 28 ? 11.155  14.500  -0.751  1.00 0.00 ? 32 GLY B O    3  
ATOM 5871  H H    . GLY B 1 28 ? 9.196   13.072  -1.277  1.00 0.00 ? 32 GLY B H    3  
ATOM 5872  H HA2  . GLY B 1 28 ? 11.618  11.537  -0.697  1.00 0.00 ? 32 GLY B HA2  3  
ATOM 5873  H HA3  . GLY B 1 28 ? 11.181  11.750  -2.381  1.00 0.00 ? 32 GLY B HA3  3  
ATOM 5874  N N    . PRO B 1 29 ? 12.852  13.711  -2.077  1.00 0.00 ? 33 PRO B N    3  
ATOM 5875  C CA   . PRO B 1 29 ? 13.549  14.984  -2.149  1.00 0.00 ? 33 PRO B CA   3  
ATOM 5876  C C    . PRO B 1 29 ? 12.828  15.952  -3.089  1.00 0.00 ? 33 PRO B C    3  
ATOM 5877  O O    . PRO B 1 29 ? 13.289  17.072  -3.305  1.00 0.00 ? 33 PRO B O    3  
ATOM 5878  C CB   . PRO B 1 29 ? 14.953  14.636  -2.617  1.00 0.00 ? 33 PRO B CB   3  
ATOM 5879  C CG   . PRO B 1 29 ? 14.856  13.250  -3.233  1.00 0.00 ? 33 PRO B CG   3  
ATOM 5880  C CD   . PRO B 1 29 ? 13.521  12.650  -2.823  1.00 0.00 ? 33 PRO B CD   3  
ATOM 5881  H HA   . PRO B 1 29 ? 13.556  15.427  -1.253  1.00 0.00 ? 33 PRO B HA   3  
ATOM 5882  H HB2  . PRO B 1 29 ? 15.313  15.363  -3.345  1.00 0.00 ? 33 PRO B HB2  3  
ATOM 5883  H HB3  . PRO B 1 29 ? 15.656  14.645  -1.784  1.00 0.00 ? 33 PRO B HB3  3  
ATOM 5884  H HG2  . PRO B 1 29 ? 14.931  13.309  -4.319  1.00 0.00 ? 33 PRO B HG2  3  
ATOM 5885  H HG3  . PRO B 1 29 ? 15.679  12.622  -2.891  1.00 0.00 ? 33 PRO B HG3  3  
ATOM 5886  H HD2  . PRO B 1 29 ? 12.938  12.349  -3.693  1.00 0.00 ? 33 PRO B HD2  3  
ATOM 5887  H HD3  . PRO B 1 29 ? 13.660  11.760  -2.208  1.00 0.00 ? 33 PRO B HD3  3  
ATOM 5888  N N    . HIS B 1 30 ? 11.710  15.485  -3.624  1.00 0.00 ? 34 HIS B N    3  
ATOM 5889  C CA   . HIS B 1 30 ? 10.920  16.295  -4.536  1.00 0.00 ? 34 HIS B CA   3  
ATOM 5890  C C    . HIS B 1 30 ? 9.599   16.680  -3.868  1.00 0.00 ? 34 HIS B C    3  
ATOM 5891  O O    . HIS B 1 30 ? 9.245   17.857  -3.816  1.00 0.00 ? 34 HIS B O    3  
ATOM 5892  C CB   . HIS B 1 30 ? 10.722  15.574  -5.870  1.00 0.00 ? 34 HIS B CB   3  
ATOM 5893  C CG   . HIS B 1 30 ? 10.651  14.071  -5.752  1.00 0.00 ? 34 HIS B CG   3  
ATOM 5894  N ND1  . HIS B 1 30 ? 11.733  13.297  -5.367  1.00 0.00 ? 34 HIS B ND1  3  
ATOM 5895  C CD2  . HIS B 1 30 ? 9.618   13.207  -5.970  1.00 0.00 ? 34 HIS B CD2  3  
ATOM 5896  C CE1  . HIS B 1 30 ? 11.356  12.027  -5.359  1.00 0.00 ? 34 HIS B CE1  3  
ATOM 5897  N NE2  . HIS B 1 30 ? 10.045  11.973  -5.733  1.00 0.00 ? 34 HIS B NE2  3  
ATOM 5898  H H    . HIS B 1 30 ? 11.342  14.572  -3.443  1.00 0.00 ? 34 HIS B H    3  
ATOM 5899  H HA   . HIS B 1 30 ? 11.497  17.200  -4.729  1.00 0.00 ? 34 HIS B HA   3  
ATOM 5900  H HB2  . HIS B 1 30 ? 9.804   15.936  -6.334  1.00 0.00 ? 34 HIS B HB2  3  
ATOM 5901  H HB3  . HIS B 1 30 ? 11.542  15.837  -6.539  1.00 0.00 ? 34 HIS B HB3  3  
ATOM 5902  H HD1  . HIS B 1 30 ? 12.643  13.639  -5.136  1.00 0.00 ? 34 HIS B HD1  3  
ATOM 5903  H HD2  . HIS B 1 30 ? 8.612   13.484  -6.285  1.00 0.00 ? 34 HIS B HD2  3  
ATOM 5904  H HE1  . HIS B 1 30 ? 11.983  11.174  -5.098  1.00 0.00 ? 34 HIS B HE1  3  
ATOM 5905  N N    . CYS B 1 31 ? 8.905   15.665  -3.373  1.00 0.00 ? 35 CYS B N    3  
ATOM 5906  C CA   . CYS B 1 31 ? 7.631   15.882  -2.710  1.00 0.00 ? 35 CYS B CA   3  
ATOM 5907  C C    . CYS B 1 31 ? 7.783   15.496  -1.238  1.00 0.00 ? 35 CYS B C    3  
ATOM 5908  O O    . CYS B 1 31 ? 8.156   14.367  -0.924  1.00 0.00 ? 35 CYS B O    3  
ATOM 5909  C CB   . CYS B 1 31 ? 6.500   15.107  -3.390  1.00 0.00 ? 35 CYS B CB   3  
ATOM 5910  S SG   . CYS B 1 31 ? 5.138   16.144  -4.036  1.00 0.00 ? 35 CYS B SG   3  
ATOM 5911  H H    . CYS B 1 31 ? 9.200   14.711  -3.419  1.00 0.00 ? 35 CYS B H    3  
ATOM 5912  H HA   . CYS B 1 31 ? 7.402   16.944  -2.810  1.00 0.00 ? 35 CYS B HA   3  
ATOM 5913  H HB2  . CYS B 1 31 ? 6.920   14.528  -4.213  1.00 0.00 ? 35 CYS B HB2  3  
ATOM 5914  H HB3  . CYS B 1 31 ? 6.088   14.394  -2.676  1.00 0.00 ? 35 CYS B HB3  3  
ATOM 5915  N N    . ALA B 1 32 ? 7.486   16.456  -0.373  1.00 0.00 ? 36 ALA B N    3  
ATOM 5916  C CA   . ALA B 1 32 ? 7.585   16.230  1.058   1.00 0.00 ? 36 ALA B CA   3  
ATOM 5917  C C    . ALA B 1 32 ? 6.230   15.762  1.592   1.00 0.00 ? 36 ALA B C    3  
ATOM 5918  O O    . ALA B 1 32 ? 5.930   15.932  2.772   1.00 0.00 ? 36 ALA B O    3  
ATOM 5919  C CB   . ALA B 1 32 ? 8.071   17.509  1.744   1.00 0.00 ? 36 ALA B CB   3  
ATOM 5920  H H    . ALA B 1 32 ? 7.183   17.372  -0.637  1.00 0.00 ? 36 ALA B H    3  
ATOM 5921  H HA   . ALA B 1 32 ? 8.322   15.443  1.220   1.00 0.00 ? 36 ALA B HA   3  
ATOM 5922  H HB1  . ALA B 1 32 ? 9.120   17.398  2.018   1.00 0.00 ? 36 ALA B HB1  3  
ATOM 5923  H HB2  . ALA B 1 32 ? 7.960   18.352  1.062   1.00 0.00 ? 36 ALA B HB2  3  
ATOM 5924  H HB3  . ALA B 1 32 ? 7.478   17.687  2.642   1.00 0.00 ? 36 ALA B HB3  3  
ATOM 5925  N N    . GLN B 1 33 ? 5.446   15.180  0.695   1.00 0.00 ? 37 GLN B N    3  
ATOM 5926  C CA   . GLN B 1 33 ? 4.130   14.686  1.061   1.00 0.00 ? 37 GLN B CA   3  
ATOM 5927  C C    . GLN B 1 33 ? 3.954   13.242  0.586   1.00 0.00 ? 37 GLN B C    3  
ATOM 5928  O O    . GLN B 1 33 ? 4.553   12.834  -0.409  1.00 0.00 ? 37 GLN B O    3  
ATOM 5929  C CB   . GLN B 1 33 ? 3.029   15.586  0.495   1.00 0.00 ? 37 GLN B CB   3  
ATOM 5930  C CG   . GLN B 1 33 ? 3.482   17.047  0.457   1.00 0.00 ? 37 GLN B CG   3  
ATOM 5931  C CD   . GLN B 1 33 ? 3.647   17.607  1.871   1.00 0.00 ? 37 GLN B CD   3  
ATOM 5932  O OE1  . GLN B 1 33 ? 2.767   17.514  2.710   1.00 0.00 ? 37 GLN B OE1  3  
ATOM 5933  N NE2  . GLN B 1 33 ? 4.822   18.193  2.087   1.00 0.00 ? 37 GLN B NE2  3  
ATOM 5934  H H    . GLN B 1 33 ? 5.697   15.045  -0.263  1.00 0.00 ? 37 GLN B H    3  
ATOM 5935  H HA   . GLN B 1 33 ? 4.098   14.724  2.149   1.00 0.00 ? 37 GLN B HA   3  
ATOM 5936  H HB2  . GLN B 1 33 ? 2.766   15.257  -0.510  1.00 0.00 ? 37 GLN B HB2  3  
ATOM 5937  H HB3  . GLN B 1 33 ? 2.131   15.496  1.106   1.00 0.00 ? 37 GLN B HB3  3  
ATOM 5938  H HG2  . GLN B 1 33 ? 4.427   17.125  -0.082  1.00 0.00 ? 37 GLN B HG2  3  
ATOM 5939  H HG3  . GLN B 1 33 ? 2.753   17.643  -0.091  1.00 0.00 ? 37 GLN B HG3  3  
ATOM 5940  H HE21 . GLN B 1 33 ? 5.501   18.236  1.355   1.00 0.00 ? 37 GLN B HE21 3  
ATOM 5941  H HE22 . GLN B 1 33 ? 5.025   18.590  2.982   1.00 0.00 ? 37 GLN B HE22 3  
ATOM 5942  N N    . THR B 1 34 ? 3.131   12.507  1.320   1.00 0.00 ? 38 THR B N    3  
ATOM 5943  C CA   . THR B 1 34 ? 2.870   11.117  0.986   1.00 0.00 ? 38 THR B CA   3  
ATOM 5944  C C    . THR B 1 34 ? 1.927   11.025  -0.215  1.00 0.00 ? 38 THR B C    3  
ATOM 5945  O O    . THR B 1 34 ? 1.268   12.002  -0.568  1.00 0.00 ? 38 THR B O    3  
ATOM 5946  C CB   . THR B 1 34 ? 2.328   10.424  2.238   1.00 0.00 ? 38 THR B CB   3  
ATOM 5947  O OG1  . THR B 1 34 ? 3.289   10.727  3.246   1.00 0.00 ? 38 THR B OG1  3  
ATOM 5948  C CG2  . THR B 1 34 ? 2.371   8.899   2.128   1.00 0.00 ? 38 THR B CG2  3  
ATOM 5949  H H    . THR B 1 34 ? 2.648   12.846  2.127   1.00 0.00 ? 38 THR B H    3  
ATOM 5950  H HA   . THR B 1 34 ? 3.810   10.652  0.691   1.00 0.00 ? 38 THR B HA   3  
ATOM 5951  H HB   . THR B 1 34 ? 1.320   10.770  2.469   1.00 0.00 ? 38 THR B HB   3  
ATOM 5952  H HG1  . THR B 1 34 ? 2.946   11.457  3.837   1.00 0.00 ? 38 THR B HG1  3  
ATOM 5953  H HG21 . THR B 1 34 ? 3.372   8.584   1.831   1.00 0.00 ? 38 THR B HG21 3  
ATOM 5954  H HG22 . THR B 1 34 ? 2.124   8.458   3.094   1.00 0.00 ? 38 THR B HG22 3  
ATOM 5955  H HG23 . THR B 1 34 ? 1.649   8.568   1.382   1.00 0.00 ? 38 THR B HG23 3  
ATOM 5956  N N    . GLU B 1 35 ? 1.892   9.842   -0.811  1.00 0.00 ? 39 GLU B N    3  
ATOM 5957  C CA   . GLU B 1 35 ? 1.041   9.610   -1.965  1.00 0.00 ? 39 GLU B CA   3  
ATOM 5958  C C    . GLU B 1 35 ? 0.397   8.225   -1.880  1.00 0.00 ? 39 GLU B C    3  
ATOM 5959  O O    . GLU B 1 35 ? 0.895   7.267   -2.470  1.00 0.00 ? 39 GLU B O    3  
ATOM 5960  C CB   . GLU B 1 35 ? 1.828   9.770   -3.268  1.00 0.00 ? 39 GLU B CB   3  
ATOM 5961  C CG   . GLU B 1 35 ? 1.836   11.228  -3.728  1.00 0.00 ? 39 GLU B CG   3  
ATOM 5962  C CD   . GLU B 1 35 ? 3.266   11.762  -3.833  1.00 0.00 ? 39 GLU B CD   3  
ATOM 5963  O OE1  . GLU B 1 35 ? 3.871   11.556  -4.907  1.00 0.00 ? 39 GLU B OE1  3  
ATOM 5964  O OE2  . GLU B 1 35 ? 3.721   12.364  -2.837  1.00 0.00 ? 39 GLU B OE2  3  
ATOM 5965  H H    . GLU B 1 35 ? 2.431   9.053   -0.517  1.00 0.00 ? 39 GLU B H    3  
ATOM 5966  H HA   . GLU B 1 35 ? 0.271   10.380  -1.917  1.00 0.00 ? 39 GLU B HA   3  
ATOM 5967  H HB2  . GLU B 1 35 ? 2.851   9.424   -3.123  1.00 0.00 ? 39 GLU B HB2  3  
ATOM 5968  H HB3  . GLU B 1 35 ? 1.386   9.142   -4.042  1.00 0.00 ? 39 GLU B HB3  3  
ATOM 5969  H HG2  . GLU B 1 35 ? 1.341   11.311  -4.696  1.00 0.00 ? 39 GLU B HG2  3  
ATOM 5970  H HG3  . GLU B 1 35 ? 1.267   11.838  -3.026  1.00 0.00 ? 39 GLU B HG3  3  
ATOM 5971  N N    . VAL B 1 36 ? -0.701  8.162   -1.140  1.00 0.00 ? 40 VAL B N    3  
ATOM 5972  C CA   . VAL B 1 36 ? -1.418  6.910   -0.970  1.00 0.00 ? 40 VAL B CA   3  
ATOM 5973  C C    . VAL B 1 36 ? -2.313  6.670   -2.188  1.00 0.00 ? 40 VAL B C    3  
ATOM 5974  O O    . VAL B 1 36 ? -3.168  7.495   -2.506  1.00 0.00 ? 40 VAL B O    3  
ATOM 5975  C CB   . VAL B 1 36 ? -2.194  6.927   0.348   1.00 0.00 ? 40 VAL B CB   3  
ATOM 5976  C CG1  . VAL B 1 36 ? -3.024  5.652   0.512   1.00 0.00 ? 40 VAL B CG1  3  
ATOM 5977  C CG2  . VAL B 1 36 ? -1.252  7.124   1.537   1.00 0.00 ? 40 VAL B CG2  3  
ATOM 5978  H H    . VAL B 1 36 ? -1.099  8.946   -0.663  1.00 0.00 ? 40 VAL B H    3  
ATOM 5979  H HA   . VAL B 1 36 ? -0.678  6.112   -0.916  1.00 0.00 ? 40 VAL B HA   3  
ATOM 5980  H HB   . VAL B 1 36 ? -2.881  7.773   0.322   1.00 0.00 ? 40 VAL B HB   3  
ATOM 5981  H HG11 . VAL B 1 36 ? -3.509  5.409   -0.434  1.00 0.00 ? 40 VAL B HG11 3  
ATOM 5982  H HG12 . VAL B 1 36 ? -2.373  4.829   0.808   1.00 0.00 ? 40 VAL B HG12 3  
ATOM 5983  H HG13 . VAL B 1 36 ? -3.783  5.808   1.279   1.00 0.00 ? 40 VAL B HG13 3  
ATOM 5984  H HG21 . VAL B 1 36 ? -0.700  8.055   1.413   1.00 0.00 ? 40 VAL B HG21 3  
ATOM 5985  H HG22 . VAL B 1 36 ? -1.833  7.166   2.459   1.00 0.00 ? 40 VAL B HG22 3  
ATOM 5986  H HG23 . VAL B 1 36 ? -0.551  6.290   1.588   1.00 0.00 ? 40 VAL B HG23 3  
ATOM 5987  N N    . ILE B 1 37 ? -2.085  5.537   -2.835  1.00 0.00 ? 41 ILE B N    3  
ATOM 5988  C CA   . ILE B 1 37 ? -2.860  5.178   -4.011  1.00 0.00 ? 41 ILE B CA   3  
ATOM 5989  C C    . ILE B 1 37 ? -3.482  3.796   -3.804  1.00 0.00 ? 41 ILE B C    3  
ATOM 5990  O O    . ILE B 1 37 ? -2.772  2.792   -3.764  1.00 0.00 ? 41 ILE B O    3  
ATOM 5991  C CB   . ILE B 1 37 ? -2.001  5.284   -5.272  1.00 0.00 ? 41 ILE B CB   3  
ATOM 5992  C CG1  . ILE B 1 37 ? -1.190  6.581   -5.276  1.00 0.00 ? 41 ILE B CG1  3  
ATOM 5993  C CG2  . ILE B 1 37 ? -2.856  5.138   -6.532  1.00 0.00 ? 41 ILE B CG2  3  
ATOM 5994  C CD1  . ILE B 1 37 ? 0.307   6.292   -5.406  1.00 0.00 ? 41 ILE B CD1  3  
ATOM 5995  H H    . ILE B 1 37 ? -1.388  4.871   -2.570  1.00 0.00 ? 41 ILE B H    3  
ATOM 5996  H HA   . ILE B 1 37 ? -3.664  5.908   -4.107  1.00 0.00 ? 41 ILE B HA   3  
ATOM 5997  H HB   . ILE B 1 37 ? -1.288  4.459   -5.270  1.00 0.00 ? 41 ILE B HB   3  
ATOM 5998  H HG12 . ILE B 1 37 ? -1.514  7.214   -6.102  1.00 0.00 ? 41 ILE B HG12 3  
ATOM 5999  H HG13 . ILE B 1 37 ? -1.379  7.135   -4.357  1.00 0.00 ? 41 ILE B HG13 3  
ATOM 6000  H HG21 . ILE B 1 37 ? -3.615  5.920   -6.549  1.00 0.00 ? 41 ILE B HG21 3  
ATOM 6001  H HG22 . ILE B 1 37 ? -2.221  5.229   -7.414  1.00 0.00 ? 41 ILE B HG22 3  
ATOM 6002  H HG23 . ILE B 1 37 ? -3.340  4.161   -6.532  1.00 0.00 ? 41 ILE B HG23 3  
ATOM 6003  H HD11 . ILE B 1 37 ? 0.452   5.379   -5.984  1.00 0.00 ? 41 ILE B HD11 3  
ATOM 6004  H HD12 . ILE B 1 37 ? 0.795   7.124   -5.913  1.00 0.00 ? 41 ILE B HD12 3  
ATOM 6005  H HD13 . ILE B 1 37 ? 0.740   6.167   -4.413  1.00 0.00 ? 41 ILE B HD13 3  
ATOM 6006  N N    . ALA B 1 38 ? -4.801  3.788   -3.679  1.00 0.00 ? 42 ALA B N    3  
ATOM 6007  C CA   . ALA B 1 38 ? -5.526  2.545   -3.478  1.00 0.00 ? 42 ALA B CA   3  
ATOM 6008  C C    . ALA B 1 38 ? -6.137  2.095   -4.806  1.00 0.00 ? 42 ALA B C    3  
ATOM 6009  O O    . ALA B 1 38 ? -6.796  2.879   -5.488  1.00 0.00 ? 42 ALA B O    3  
ATOM 6010  C CB   . ALA B 1 38 ? -6.581  2.740   -2.387  1.00 0.00 ? 42 ALA B CB   3  
ATOM 6011  H H    . ALA B 1 38 ? -5.371  4.609   -3.713  1.00 0.00 ? 42 ALA B H    3  
ATOM 6012  H HA   . ALA B 1 38 ? -4.811  1.794   -3.143  1.00 0.00 ? 42 ALA B HA   3  
ATOM 6013  H HB1  . ALA B 1 38 ? -7.561  2.866   -2.848  1.00 0.00 ? 42 ALA B HB1  3  
ATOM 6014  H HB2  . ALA B 1 38 ? -6.596  1.867   -1.735  1.00 0.00 ? 42 ALA B HB2  3  
ATOM 6015  H HB3  . ALA B 1 38 ? -6.339  3.627   -1.801  1.00 0.00 ? 42 ALA B HB3  3  
ATOM 6016  N N    . THR B 1 39 ? -5.898  0.834   -5.134  1.00 0.00 ? 43 THR B N    3  
ATOM 6017  C CA   . THR B 1 39 ? -6.416  0.270   -6.369  1.00 0.00 ? 43 THR B CA   3  
ATOM 6018  C C    . THR B 1 39 ? -7.873  -0.161  -6.188  1.00 0.00 ? 43 THR B C    3  
ATOM 6019  O O    . THR B 1 39 ? -8.256  -0.632  -5.119  1.00 0.00 ? 43 THR B O    3  
ATOM 6020  C CB   . THR B 1 39 ? -5.492  -0.874  -6.791  1.00 0.00 ? 43 THR B CB   3  
ATOM 6021  O OG1  . THR B 1 39 ? -4.295  -0.219  -7.202  1.00 0.00 ? 43 THR B OG1  3  
ATOM 6022  C CG2  . THR B 1 39 ? -5.981  -1.585  -8.055  1.00 0.00 ? 43 THR B CG2  3  
ATOM 6023  H H    . THR B 1 39 ? -5.361  0.203   -4.574  1.00 0.00 ? 43 THR B H    3  
ATOM 6024  H HA   . THR B 1 39 ? -6.405  1.048   -7.133  1.00 0.00 ? 43 THR B HA   3  
ATOM 6025  H HB   . THR B 1 39 ? -5.352  -1.582  -5.975  1.00 0.00 ? 43 THR B HB   3  
ATOM 6026  H HG1  . THR B 1 39 ? -4.490  0.411   -7.953  1.00 0.00 ? 43 THR B HG1  3  
ATOM 6027  H HG21 . THR B 1 39 ? -6.297  -0.844  -8.789  1.00 0.00 ? 43 THR B HG21 3  
ATOM 6028  H HG22 . THR B 1 39 ? -5.171  -2.185  -8.470  1.00 0.00 ? 43 THR B HG22 3  
ATOM 6029  H HG23 . THR B 1 39 ? -6.822  -2.232  -7.806  1.00 0.00 ? 43 THR B HG23 3  
ATOM 6030  N N    . LEU B 1 40 ? -8.645  0.017   -7.250  1.00 0.00 ? 44 LEU B N    3  
ATOM 6031  C CA   . LEU B 1 40 ? -10.052 -0.347  -7.222  1.00 0.00 ? 44 LEU B CA   3  
ATOM 6032  C C    . LEU B 1 40 ? -10.215 -1.773  -7.752  1.00 0.00 ? 44 LEU B C    3  
ATOM 6033  O O    . LEU B 1 40 ? -9.435  -2.220  -8.592  1.00 0.00 ? 44 LEU B O    3  
ATOM 6034  C CB   . LEU B 1 40 ? -10.889 0.689   -7.974  1.00 0.00 ? 44 LEU B CB   3  
ATOM 6035  C CG   . LEU B 1 40 ? -12.134 1.201   -7.247  1.00 0.00 ? 44 LEU B CG   3  
ATOM 6036  C CD1  . LEU B 1 40 ? -12.649 2.493   -7.885  1.00 0.00 ? 44 LEU B CD1  3  
ATOM 6037  C CD2  . LEU B 1 40 ? -13.217 0.121   -7.187  1.00 0.00 ? 44 LEU B CD2  3  
ATOM 6038  H H    . LEU B 1 40 ? -8.326  0.401   -8.116  1.00 0.00 ? 44 LEU B H    3  
ATOM 6039  H HA   . LEU B 1 40 ? -10.374 -0.327  -6.180  1.00 0.00 ? 44 LEU B HA   3  
ATOM 6040  H HB2  . LEU B 1 40 ? -10.252 1.542   -8.207  1.00 0.00 ? 44 LEU B HB2  3  
ATOM 6041  H HB3  . LEU B 1 40 ? -11.200 0.255   -8.924  1.00 0.00 ? 44 LEU B HB3  3  
ATOM 6042  H HG   . LEU B 1 40 ? -11.858 1.436   -6.220  1.00 0.00 ? 44 LEU B HG   3  
ATOM 6043  H HD11 . LEU B 1 40 ? -11.808 3.062   -8.282  1.00 0.00 ? 44 LEU B HD11 3  
ATOM 6044  H HD12 . LEU B 1 40 ? -13.338 2.250   -8.693  1.00 0.00 ? 44 LEU B HD12 3  
ATOM 6045  H HD13 . LEU B 1 40 ? -13.166 3.088   -7.132  1.00 0.00 ? 44 LEU B HD13 3  
ATOM 6046  H HD21 . LEU B 1 40 ? -13.206 -0.456  -8.112  1.00 0.00 ? 44 LEU B HD21 3  
ATOM 6047  H HD22 . LEU B 1 40 ? -13.023 -0.541  -6.343  1.00 0.00 ? 44 LEU B HD22 3  
ATOM 6048  H HD23 . LEU B 1 40 ? -14.192 0.591   -7.064  1.00 0.00 ? 44 LEU B HD23 3  
ATOM 6049  N N    . LYS B 1 41 ? -11.235 -2.447  -7.241  1.00 0.00 ? 45 LYS B N    3  
ATOM 6050  C CA   . LYS B 1 41 ? -11.511 -3.813  -7.653  1.00 0.00 ? 45 LYS B CA   3  
ATOM 6051  C C    . LYS B 1 41 ? -12.104 -3.806  -9.063  1.00 0.00 ? 45 LYS B C    3  
ATOM 6052  O O    . LYS B 1 41 ? -12.334 -4.863  -9.649  1.00 0.00 ? 45 LYS B O    3  
ATOM 6053  C CB   . LYS B 1 41 ? -12.391 -4.517  -6.619  1.00 0.00 ? 45 LYS B CB   3  
ATOM 6054  C CG   . LYS B 1 41 ? -13.209 -5.637  -7.266  1.00 0.00 ? 45 LYS B CG   3  
ATOM 6055  C CD   . LYS B 1 41 ? -12.296 -6.726  -7.832  1.00 0.00 ? 45 LYS B CD   3  
ATOM 6056  C CE   . LYS B 1 41 ? -12.391 -8.007  -7.001  1.00 0.00 ? 45 LYS B CE   3  
ATOM 6057  N NZ   . LYS B 1 41 ? -12.002 -7.744  -5.597  1.00 0.00 ? 45 LYS B NZ   3  
ATOM 6058  H H    . LYS B 1 41 ? -11.864 -2.077  -6.558  1.00 0.00 ? 45 LYS B H    3  
ATOM 6059  H HA   . LYS B 1 41 ? -10.559 -4.344  -7.681  1.00 0.00 ? 45 LYS B HA   3  
ATOM 6060  H HB2  . LYS B 1 41 ? -11.768 -4.930  -5.825  1.00 0.00 ? 45 LYS B HB2  3  
ATOM 6061  H HB3  . LYS B 1 41 ? -13.062 -3.794  -6.154  1.00 0.00 ? 45 LYS B HB3  3  
ATOM 6062  H HG2  . LYS B 1 41 ? -13.885 -6.070  -6.529  1.00 0.00 ? 45 LYS B HG2  3  
ATOM 6063  H HG3  . LYS B 1 41 ? -13.828 -5.225  -8.063  1.00 0.00 ? 45 LYS B HG3  3  
ATOM 6064  H HD2  . LYS B 1 41 ? -12.573 -6.937  -8.865  1.00 0.00 ? 45 LYS B HD2  3  
ATOM 6065  H HD3  . LYS B 1 41 ? -11.265 -6.372  -7.844  1.00 0.00 ? 45 LYS B HD3  3  
ATOM 6066  H HE2  . LYS B 1 41 ? -13.408 -8.396  -7.036  1.00 0.00 ? 45 LYS B HE2  3  
ATOM 6067  H HE3  . LYS B 1 41 ? -11.742 -8.773  -7.427  1.00 0.00 ? 45 LYS B HE3  3  
ATOM 6068  H HZ1  . LYS B 1 41 ? -12.395 -6.874  -5.300  1.00 0.00 ? 45 LYS B HZ1  3  
ATOM 6069  H HZ2  . LYS B 1 41 ? -12.343 -8.481  -5.013  1.00 0.00 ? 45 LYS B HZ2  3  
ATOM 6070  H HZ3  . LYS B 1 41 ? -11.005 -7.700  -5.530  1.00 0.00 ? 45 LYS B HZ3  3  
ATOM 6071  N N    . ASN B 1 42 ? -12.335 -2.603  -9.567  1.00 0.00 ? 46 ASN B N    3  
ATOM 6072  C CA   . ASN B 1 42 ? -12.897 -2.444  -10.898 1.00 0.00 ? 46 ASN B CA   3  
ATOM 6073  C C    . ASN B 1 42 ? -11.769 -2.169  -11.894 1.00 0.00 ? 46 ASN B C    3  
ATOM 6074  O O    . ASN B 1 42 ? -11.987 -2.188  -13.104 1.00 0.00 ? 46 ASN B O    3  
ATOM 6075  C CB   . ASN B 1 42 ? -13.870 -1.264  -10.947 1.00 0.00 ? 46 ASN B CB   3  
ATOM 6076  C CG   . ASN B 1 42 ? -13.725 -0.489  -12.258 1.00 0.00 ? 46 ASN B CG   3  
ATOM 6077  O OD1  . ASN B 1 42 ? -13.954 -1.001  -13.341 1.00 0.00 ? 46 ASN B OD1  3  
ATOM 6078  N ND2  . ASN B 1 42 ? -13.332 0.772   -12.100 1.00 0.00 ? 46 ASN B ND2  3  
ATOM 6079  H H    . ASN B 1 42 ? -12.145 -1.748  -9.084  1.00 0.00 ? 46 ASN B H    3  
ATOM 6080  H HA   . ASN B 1 42 ? -13.416 -3.380  -11.103 1.00 0.00 ? 46 ASN B HA   3  
ATOM 6081  H HB2  . ASN B 1 42 ? -14.893 -1.627  -10.847 1.00 0.00 ? 46 ASN B HB2  3  
ATOM 6082  H HB3  . ASN B 1 42 ? -13.683 -0.599  -10.104 1.00 0.00 ? 46 ASN B HB3  3  
ATOM 6083  H HD21 . ASN B 1 42 ? -13.161 1.131   -11.183 1.00 0.00 ? 46 ASN B HD21 3  
ATOM 6084  H HD22 . ASN B 1 42 ? -13.208 1.361   -12.899 1.00 0.00 ? 46 ASN B HD22 3  
ATOM 6085  N N    . GLY B 1 43 ? -10.588 -1.920  -11.347 1.00 0.00 ? 47 GLY B N    3  
ATOM 6086  C CA   . GLY B 1 43 ? -9.425  -1.641  -12.173 1.00 0.00 ? 47 GLY B CA   3  
ATOM 6087  C C    . GLY B 1 43 ? -8.989  -0.181  -12.031 1.00 0.00 ? 47 GLY B C    3  
ATOM 6088  O O    . GLY B 1 43 ? -7.901  0.190   -12.468 1.00 0.00 ? 47 GLY B O    3  
ATOM 6089  H H    . GLY B 1 43 ? -10.419 -1.906  -10.362 1.00 0.00 ? 47 GLY B H    3  
ATOM 6090  H HA2  . GLY B 1 43 ? -8.605  -2.299  -11.886 1.00 0.00 ? 47 GLY B HA2  3  
ATOM 6091  H HA3  . GLY B 1 43 ? -9.656  -1.856  -13.217 1.00 0.00 ? 47 GLY B HA3  3  
ATOM 6092  N N    . GLN B 1 44 ? -9.861  0.607   -11.420 1.00 0.00 ? 48 GLN B N    3  
ATOM 6093  C CA   . GLN B 1 44 ? -9.580  2.017   -11.215 1.00 0.00 ? 48 GLN B CA   3  
ATOM 6094  C C    . GLN B 1 44 ? -8.715  2.211   -9.968  1.00 0.00 ? 48 GLN B C    3  
ATOM 6095  O O    . GLN B 1 44 ? -8.284  1.238   -9.350  1.00 0.00 ? 48 GLN B O    3  
ATOM 6096  C CB   . GLN B 1 44 ? -10.875 2.826   -11.115 1.00 0.00 ? 48 GLN B CB   3  
ATOM 6097  C CG   . GLN B 1 44 ? -11.307 3.342   -12.489 1.00 0.00 ? 48 GLN B CG   3  
ATOM 6098  C CD   . GLN B 1 44 ? -12.416 4.388   -12.357 1.00 0.00 ? 48 GLN B CD   3  
ATOM 6099  O OE1  . GLN B 1 44 ? -13.441 4.169   -11.732 1.00 0.00 ? 48 GLN B OE1  3  
ATOM 6100  N NE2  . GLN B 1 44 ? -12.155 5.534   -12.980 1.00 0.00 ? 48 GLN B NE2  3  
ATOM 6101  H H    . GLN B 1 44 ? -10.744 0.296   -11.068 1.00 0.00 ? 48 GLN B H    3  
ATOM 6102  H HA   . GLN B 1 44 ? -9.029  2.334   -12.101 1.00 0.00 ? 48 GLN B HA   3  
ATOM 6103  H HB2  . GLN B 1 44 ? -11.664 2.204   -10.691 1.00 0.00 ? 48 GLN B HB2  3  
ATOM 6104  H HB3  . GLN B 1 44 ? -10.731 3.666   -10.435 1.00 0.00 ? 48 GLN B HB3  3  
ATOM 6105  H HG2  . GLN B 1 44 ? -10.451 3.777   -13.004 1.00 0.00 ? 48 GLN B HG2  3  
ATOM 6106  H HG3  . GLN B 1 44 ? -11.657 2.510   -13.100 1.00 0.00 ? 48 GLN B HG3  3  
ATOM 6107  H HE21 . GLN B 1 44 ? -11.294 5.649   -13.476 1.00 0.00 ? 48 GLN B HE21 3  
ATOM 6108  H HE22 . GLN B 1 44 ? -12.820 6.281   -12.952 1.00 0.00 ? 48 GLN B HE22 3  
ATOM 6109  N N    . LYS B 1 45 ? -8.485  3.472   -9.636  1.00 0.00 ? 49 LYS B N    3  
ATOM 6110  C CA   . LYS B 1 45 ? -7.679  3.806   -8.474  1.00 0.00 ? 49 LYS B CA   3  
ATOM 6111  C C    . LYS B 1 45 ? -8.254  5.053   -7.800  1.00 0.00 ? 49 LYS B C    3  
ATOM 6112  O O    . LYS B 1 45 ? -8.773  5.943   -8.472  1.00 0.00 ? 49 LYS B O    3  
ATOM 6113  C CB   . LYS B 1 45 ? -6.206  3.942   -8.865  1.00 0.00 ? 49 LYS B CB   3  
ATOM 6114  C CG   . LYS B 1 45 ? -5.696  2.664   -9.533  1.00 0.00 ? 49 LYS B CG   3  
ATOM 6115  C CD   . LYS B 1 45 ? -5.907  2.715   -11.048 1.00 0.00 ? 49 LYS B CD   3  
ATOM 6116  C CE   . LYS B 1 45 ? -4.663  2.227   -11.792 1.00 0.00 ? 49 LYS B CE   3  
ATOM 6117  N NZ   . LYS B 1 45 ? -4.062  3.329   -12.576 1.00 0.00 ? 49 LYS B NZ   3  
ATOM 6118  H H    . LYS B 1 45 ? -8.839  4.258   -10.144 1.00 0.00 ? 49 LYS B H    3  
ATOM 6119  H HA   . LYS B 1 45 ? -7.751  2.972   -7.776  1.00 0.00 ? 49 LYS B HA   3  
ATOM 6120  H HB2  . LYS B 1 45 ? -6.082  4.786   -9.543  1.00 0.00 ? 49 LYS B HB2  3  
ATOM 6121  H HB3  . LYS B 1 45 ? -5.609  4.156   -7.978  1.00 0.00 ? 49 LYS B HB3  3  
ATOM 6122  H HG2  . LYS B 1 45 ? -4.636  2.533   -9.315  1.00 0.00 ? 49 LYS B HG2  3  
ATOM 6123  H HG3  . LYS B 1 45 ? -6.215  1.800   -9.119  1.00 0.00 ? 49 LYS B HG3  3  
ATOM 6124  H HD2  . LYS B 1 45 ? -6.764  2.099   -11.320 1.00 0.00 ? 49 LYS B HD2  3  
ATOM 6125  H HD3  . LYS B 1 45 ? -6.140  3.736   -11.352 1.00 0.00 ? 49 LYS B HD3  3  
ATOM 6126  H HE2  . LYS B 1 45 ? -3.935  1.839   -11.080 1.00 0.00 ? 49 LYS B HE2  3  
ATOM 6127  H HE3  . LYS B 1 45 ? -4.929  1.404   -12.456 1.00 0.00 ? 49 LYS B HE3  3  
ATOM 6128  H HZ1  . LYS B 1 45 ? -4.788  3.910   -12.946 1.00 0.00 ? 49 LYS B HZ1  3  
ATOM 6129  H HZ2  . LYS B 1 45 ? -3.468  3.874   -11.984 1.00 0.00 ? 49 LYS B HZ2  3  
ATOM 6130  H HZ3  . LYS B 1 45 ? -3.524  2.948   -13.328 1.00 0.00 ? 49 LYS B HZ3  3  
ATOM 6131  N N    . ALA B 1 46 ? -8.143  5.078   -6.480  1.00 0.00 ? 50 ALA B N    3  
ATOM 6132  C CA   . ALA B 1 46 ? -8.645  6.202   -5.708  1.00 0.00 ? 50 ALA B CA   3  
ATOM 6133  C C    . ALA B 1 46 ? -7.572  6.654   -4.715  1.00 0.00 ? 50 ALA B C    3  
ATOM 6134  O O    . ALA B 1 46 ? -7.276  5.948   -3.752  1.00 0.00 ? 50 ALA B O    3  
ATOM 6135  C CB   . ALA B 1 46 ? -9.950  5.803   -5.015  1.00 0.00 ? 50 ALA B CB   3  
ATOM 6136  H H    . ALA B 1 46 ? -7.719  4.351   -5.941  1.00 0.00 ? 50 ALA B H    3  
ATOM 6137  H HA   . ALA B 1 46 ? -8.852  7.016   -6.402  1.00 0.00 ? 50 ALA B HA   3  
ATOM 6138  H HB1  . ALA B 1 46 ? -10.728 6.525   -5.261  1.00 0.00 ? 50 ALA B HB1  3  
ATOM 6139  H HB2  . ALA B 1 46 ? -9.797  5.787   -3.936  1.00 0.00 ? 50 ALA B HB2  3  
ATOM 6140  H HB3  . ALA B 1 46 ? -10.253 4.812   -5.354  1.00 0.00 ? 50 ALA B HB3  3  
ATOM 6141  N N    . CYS B 1 47 ? -7.019  7.827   -4.984  1.00 0.00 ? 51 CYS B N    3  
ATOM 6142  C CA   . CYS B 1 47 ? -5.985  8.381   -4.127  1.00 0.00 ? 51 CYS B CA   3  
ATOM 6143  C C    . CYS B 1 47 ? -6.617  8.732   -2.778  1.00 0.00 ? 51 CYS B C    3  
ATOM 6144  O O    . CYS B 1 47 ? -7.725  9.263   -2.726  1.00 0.00 ? 51 CYS B O    3  
ATOM 6145  C CB   . CYS B 1 47 ? -5.305  9.592   -4.770  1.00 0.00 ? 51 CYS B CB   3  
ATOM 6146  S SG   . CYS B 1 47 ? -3.643  9.261   -5.460  1.00 0.00 ? 51 CYS B SG   3  
ATOM 6147  H H    . CYS B 1 47 ? -7.266  8.395   -5.770  1.00 0.00 ? 51 CYS B H    3  
ATOM 6148  H HA   . CYS B 1 47 ? -5.227  7.607   -4.010  1.00 0.00 ? 51 CYS B HA   3  
ATOM 6149  H HB2  . CYS B 1 47 ? -5.946  9.970   -5.567  1.00 0.00 ? 51 CYS B HB2  3  
ATOM 6150  H HB3  . CYS B 1 47 ? -5.223  10.383  -4.025  1.00 0.00 ? 51 CYS B HB3  3  
ATOM 6151  N N    . LEU B 1 48 ? -5.884  8.419   -1.719  1.00 0.00 ? 52 LEU B N    3  
ATOM 6152  C CA   . LEU B 1 48 ? -6.359  8.694   -0.373  1.00 0.00 ? 52 LEU B CA   3  
ATOM 6153  C C    . LEU B 1 48 ? -5.513  9.810   0.243   1.00 0.00 ? 52 LEU B C    3  
ATOM 6154  O O    . LEU B 1 48 ? -4.444  10.138  -0.269  1.00 0.00 ? 52 LEU B O    3  
ATOM 6155  C CB   . LEU B 1 48 ? -6.384  7.411   0.459   1.00 0.00 ? 52 LEU B CB   3  
ATOM 6156  C CG   . LEU B 1 48 ? -7.262  6.279   -0.080  1.00 0.00 ? 52 LEU B CG   3  
ATOM 6157  C CD1  . LEU B 1 48 ? -6.876  4.939   0.549   1.00 0.00 ? 52 LEU B CD1  3  
ATOM 6158  C CD2  . LEU B 1 48 ? -8.746  6.597   0.114   1.00 0.00 ? 52 LEU B CD2  3  
ATOM 6159  H H    . LEU B 1 48 ? -4.984  7.987   -1.769  1.00 0.00 ? 52 LEU B H    3  
ATOM 6160  H HA   . LEU B 1 48 ? -7.388  9.046   -0.455  1.00 0.00 ? 52 LEU B HA   3  
ATOM 6161  H HB2  . LEU B 1 48 ? -5.363  7.040   0.550   1.00 0.00 ? 52 LEU B HB2  3  
ATOM 6162  H HB3  . LEU B 1 48 ? -6.723  7.660   1.465   1.00 0.00 ? 52 LEU B HB3  3  
ATOM 6163  H HG   . LEU B 1 48 ? -7.089  6.194   -1.152  1.00 0.00 ? 52 LEU B HG   3  
ATOM 6164  H HD11 . LEU B 1 48 ? -5.799  4.795   0.464   1.00 0.00 ? 52 LEU B HD11 3  
ATOM 6165  H HD12 . LEU B 1 48 ? -7.162  4.936   1.601   1.00 0.00 ? 52 LEU B HD12 3  
ATOM 6166  H HD13 . LEU B 1 48 ? -7.393  4.132   0.030   1.00 0.00 ? 52 LEU B HD13 3  
ATOM 6167  H HD21 . LEU B 1 48 ? -8.867  7.662   0.316   1.00 0.00 ? 52 LEU B HD21 3  
ATOM 6168  H HD22 . LEU B 1 48 ? -9.296  6.334   -0.790  1.00 0.00 ? 52 LEU B HD22 3  
ATOM 6169  H HD23 . LEU B 1 48 ? -9.134  6.022   0.955   1.00 0.00 ? 52 LEU B HD23 3  
ATOM 6170  N N    . ASN B 1 49 ? -6.024  10.363  1.334   1.00 0.00 ? 53 ASN B N    3  
ATOM 6171  C CA   . ASN B 1 49 ? -5.328  11.435  2.026   1.00 0.00 ? 53 ASN B CA   3  
ATOM 6172  C C    . ASN B 1 49 ? -4.604  10.863  3.246   1.00 0.00 ? 53 ASN B C    3  
ATOM 6173  O O    . ASN B 1 49 ? -5.240  10.353  4.167   1.00 0.00 ? 53 ASN B O    3  
ATOM 6174  C CB   . ASN B 1 49 ? -6.309  12.502  2.515   1.00 0.00 ? 53 ASN B CB   3  
ATOM 6175  C CG   . ASN B 1 49 ? -5.569  13.660  3.188   1.00 0.00 ? 53 ASN B CG   3  
ATOM 6176  O OD1  . ASN B 1 49 ? -4.452  14.003  2.838   1.00 0.00 ? 53 ASN B OD1  3  
ATOM 6177  N ND2  . ASN B 1 49 ? -6.253  14.241  4.170   1.00 0.00 ? 53 ASN B ND2  3  
ATOM 6178  H H    . ASN B 1 49 ? -6.894  10.090  1.744   1.00 0.00 ? 53 ASN B H    3  
ATOM 6179  H HA   . ASN B 1 49 ? -4.641  11.852  1.290   1.00 0.00 ? 53 ASN B HA   3  
ATOM 6180  H HB2  . ASN B 1 49 ? -6.893  12.877  1.675   1.00 0.00 ? 53 ASN B HB2  3  
ATOM 6181  H HB3  . ASN B 1 49 ? -7.013  12.058  3.219   1.00 0.00 ? 53 ASN B HB3  3  
ATOM 6182  H HD21 . ASN B 1 49 ? -7.166  13.911  4.407   1.00 0.00 ? 53 ASN B HD21 3  
ATOM 6183  H HD22 . ASN B 1 49 ? -5.853  15.009  4.671   1.00 0.00 ? 53 ASN B HD22 3  
ATOM 6184  N N    . PRO B 1 50 ? -3.249  10.971  3.213   1.00 0.00 ? 54 PRO B N    3  
ATOM 6185  C CA   . PRO B 1 50 ? -2.431  10.470  4.305   1.00 0.00 ? 54 PRO B CA   3  
ATOM 6186  C C    . PRO B 1 50 ? -2.509  11.399  5.518   1.00 0.00 ? 54 PRO B C    3  
ATOM 6187  O O    . PRO B 1 50 ? -1.867  11.149  6.537   1.00 0.00 ? 54 PRO B O    3  
ATOM 6188  C CB   . PRO B 1 50 ? -1.028  10.362  3.728   1.00 0.00 ? 54 PRO B CB   3  
ATOM 6189  C CG   . PRO B 1 50 ? -1.019  11.239  2.487   1.00 0.00 ? 54 PRO B CG   3  
ATOM 6190  C CD   . PRO B 1 50 ? -2.461  11.569  2.138   1.00 0.00 ? 54 PRO B CD   3  
ATOM 6191  H HA   . PRO B 1 50 ? -2.773  9.584   4.616   1.00 0.00 ? 54 PRO B HA   3  
ATOM 6192  H HB2  . PRO B 1 50 ? -0.283  10.698  4.449   1.00 0.00 ? 54 PRO B HB2  3  
ATOM 6193  H HB3  . PRO B 1 50 ? -0.787  9.329   3.479   1.00 0.00 ? 54 PRO B HB3  3  
ATOM 6194  H HG2  . PRO B 1 50 ? -0.452  12.153  2.669   1.00 0.00 ? 54 PRO B HG2  3  
ATOM 6195  H HG3  . PRO B 1 50 ? -0.534  10.723  1.658   1.00 0.00 ? 54 PRO B HG3  3  
ATOM 6196  H HD2  . PRO B 1 50 ? -2.620  12.646  2.084   1.00 0.00 ? 54 PRO B HD2  3  
ATOM 6197  H HD3  . PRO B 1 50 ? -2.738  11.157  1.168   1.00 0.00 ? 54 PRO B HD3  3  
ATOM 6198  N N    . ALA B 1 51 ? -3.301  12.450  5.368   1.00 0.00 ? 55 ALA B N    3  
ATOM 6199  C CA   . ALA B 1 51 ? -3.471  13.417  6.439   1.00 0.00 ? 55 ALA B CA   3  
ATOM 6200  C C    . ALA B 1 51 ? -4.820  13.183  7.123   1.00 0.00 ? 55 ALA B C    3  
ATOM 6201  O O    . ALA B 1 51 ? -5.212  13.941  8.008   1.00 0.00 ? 55 ALA B O    3  
ATOM 6202  C CB   . ALA B 1 51 ? -3.343  14.833  5.874   1.00 0.00 ? 55 ALA B CB   3  
ATOM 6203  H H    . ALA B 1 51 ? -3.819  12.646  4.536   1.00 0.00 ? 55 ALA B H    3  
ATOM 6204  H HA   . ALA B 1 51 ? -2.673  13.254  7.164   1.00 0.00 ? 55 ALA B HA   3  
ATOM 6205  H HB1  . ALA B 1 51 ? -3.997  15.506  6.428   1.00 0.00 ? 55 ALA B HB1  3  
ATOM 6206  H HB2  . ALA B 1 51 ? -3.629  14.832  4.823   1.00 0.00 ? 55 ALA B HB2  3  
ATOM 6207  H HB3  . ALA B 1 51 ? -2.310  15.170  5.970   1.00 0.00 ? 55 ALA B HB3  3  
ATOM 6208  N N    . SER B 1 52 ? -5.493  12.128  6.686   1.00 0.00 ? 56 SER B N    3  
ATOM 6209  C CA   . SER B 1 52 ? -6.790  11.784  7.244   1.00 0.00 ? 56 SER B CA   3  
ATOM 6210  C C    . SER B 1 52 ? -6.679  10.505  8.076   1.00 0.00 ? 56 SER B C    3  
ATOM 6211  O O    . SER B 1 52 ? -5.873  9.628   7.767   1.00 0.00 ? 56 SER B O    3  
ATOM 6212  C CB   . SER B 1 52 ? -7.836  11.611  6.141   1.00 0.00 ? 56 SER B CB   3  
ATOM 6213  O OG   . SER B 1 52 ? -9.063  11.092  6.646   1.00 0.00 ? 56 SER B OG   3  
ATOM 6214  H H    . SER B 1 52 ? -5.168  11.516  5.965   1.00 0.00 ? 56 SER B H    3  
ATOM 6215  H HA   . SER B 1 52 ? -7.065  12.628  7.876   1.00 0.00 ? 56 SER B HA   3  
ATOM 6216  H HB2  . SER B 1 52 ? -8.020  12.573  5.662   1.00 0.00 ? 56 SER B HB2  3  
ATOM 6217  H HB3  . SER B 1 52 ? -7.447  10.942  5.374   1.00 0.00 ? 56 SER B HB3  3  
ATOM 6218  H HG   . SER B 1 52 ? -9.430  10.407  6.016   1.00 0.00 ? 56 SER B HG   3  
ATOM 6219  N N    . PRO B 1 53 ? -7.521  10.437  9.141   1.00 0.00 ? 57 PRO B N    3  
ATOM 6220  C CA   . PRO B 1 53 ? -7.525  9.279   10.019  1.00 0.00 ? 57 PRO B CA   3  
ATOM 6221  C C    . PRO B 1 53 ? -8.216  8.088   9.353   1.00 0.00 ? 57 PRO B C    3  
ATOM 6222  O O    . PRO B 1 53 ? -7.713  6.966   9.403   1.00 0.00 ? 57 PRO B O    3  
ATOM 6223  C CB   . PRO B 1 53 ? -8.231  9.745   11.282  1.00 0.00 ? 57 PRO B CB   3  
ATOM 6224  C CG   . PRO B 1 53 ? -9.004  10.994  10.890  1.00 0.00 ? 57 PRO B CG   3  
ATOM 6225  C CD   . PRO B 1 53 ? -8.488  11.456  9.537   1.00 0.00 ? 57 PRO B CD   3  
ATOM 6226  H HA   . PRO B 1 53 ? -6.588  8.982   10.206  1.00 0.00 ? 57 PRO B HA   3  
ATOM 6227  H HB2  . PRO B 1 53 ? -8.901  8.974   11.662  1.00 0.00 ? 57 PRO B HB2  3  
ATOM 6228  H HB3  . PRO B 1 53 ? -7.513  9.962   12.073  1.00 0.00 ? 57 PRO B HB3  3  
ATOM 6229  H HG2  . PRO B 1 53 ? -10.072 10.782  10.840  1.00 0.00 ? 57 PRO B HG2  3  
ATOM 6230  H HG3  . PRO B 1 53 ? -8.869  11.777  11.637  1.00 0.00 ? 57 PRO B HG3  3  
ATOM 6231  H HD2  . PRO B 1 53 ? -9.298  11.537  8.811   1.00 0.00 ? 57 PRO B HD2  3  
ATOM 6232  H HD3  . PRO B 1 53 ? -8.022  12.439  9.605   1.00 0.00 ? 57 PRO B HD3  3  
ATOM 6233  N N    . MET B 1 54 ? -9.358  8.372   8.744   1.00 0.00 ? 58 MET B N    3  
ATOM 6234  C CA   . MET B 1 54 ? -10.123 7.338   8.068   1.00 0.00 ? 58 MET B CA   3  
ATOM 6235  C C    . MET B 1 54 ? -9.292  6.669   6.971   1.00 0.00 ? 58 MET B C    3  
ATOM 6236  O O    . MET B 1 54 ? -9.598  5.555   6.549   1.00 0.00 ? 58 MET B O    3  
ATOM 6237  C CB   . MET B 1 54 ? -11.381 7.953   7.453   1.00 0.00 ? 58 MET B CB   3  
ATOM 6238  C CG   . MET B 1 54 ? -12.564 6.987   7.541   1.00 0.00 ? 58 MET B CG   3  
ATOM 6239  S SD   . MET B 1 54 ? -13.720 7.549   8.781   1.00 0.00 ? 58 MET B SD   3  
ATOM 6240  C CE   . MET B 1 54 ? -12.999 6.807   10.235  1.00 0.00 ? 58 MET B CE   3  
ATOM 6241  H H    . MET B 1 54 ? -9.760  9.287   8.708   1.00 0.00 ? 58 MET B H    3  
ATOM 6242  H HA   . MET B 1 54 ? -10.374 6.609   8.839   1.00 0.00 ? 58 MET B HA   3  
ATOM 6243  H HB2  . MET B 1 54 ? -11.626 8.882   7.969   1.00 0.00 ? 58 MET B HB2  3  
ATOM 6244  H HB3  . MET B 1 54 ? -11.193 8.208   6.410   1.00 0.00 ? 58 MET B HB3  3  
ATOM 6245  H HG2  . MET B 1 54 ? -13.061 6.918   6.574   1.00 0.00 ? 58 MET B HG2  3  
ATOM 6246  H HG3  . MET B 1 54 ? -12.210 5.987   7.790   1.00 0.00 ? 58 MET B HG3  3  
ATOM 6247  H HE1  . MET B 1 54 ? -11.920 6.725   10.105  1.00 0.00 ? 58 MET B HE1  3  
ATOM 6248  H HE2  . MET B 1 54 ? -13.213 7.429   11.105  1.00 0.00 ? 58 MET B HE2  3  
ATOM 6249  H HE3  . MET B 1 54 ? -13.424 5.814   10.385  1.00 0.00 ? 58 MET B HE3  3  
ATOM 6250  N N    . VAL B 1 55 ? -8.258  7.377   6.542   1.00 0.00 ? 59 VAL B N    3  
ATOM 6251  C CA   . VAL B 1 55 ? -7.381  6.866   5.502   1.00 0.00 ? 59 VAL B CA   3  
ATOM 6252  C C    . VAL B 1 55 ? -6.345  5.931   6.129   1.00 0.00 ? 59 VAL B C    3  
ATOM 6253  O O    . VAL B 1 55 ? -5.537  5.331   5.422   1.00 0.00 ? 59 VAL B O    3  
ATOM 6254  C CB   . VAL B 1 55 ? -6.749  8.028   4.733   1.00 0.00 ? 59 VAL B CB   3  
ATOM 6255  C CG1  . VAL B 1 55 ? -5.566  7.548   3.890   1.00 0.00 ? 59 VAL B CG1  3  
ATOM 6256  C CG2  . VAL B 1 55 ? -7.788  8.740   3.865   1.00 0.00 ? 59 VAL B CG2  3  
ATOM 6257  H H    . VAL B 1 55 ? -8.017  8.283   6.891   1.00 0.00 ? 59 VAL B H    3  
ATOM 6258  H HA   . VAL B 1 55 ? -7.994  6.294   4.806   1.00 0.00 ? 59 VAL B HA   3  
ATOM 6259  H HB   . VAL B 1 55 ? -6.372  8.746   5.461   1.00 0.00 ? 59 VAL B HB   3  
ATOM 6260  H HG11 . VAL B 1 55 ? -5.868  6.684   3.298   1.00 0.00 ? 59 VAL B HG11 3  
ATOM 6261  H HG12 . VAL B 1 55 ? -5.245  8.350   3.224   1.00 0.00 ? 59 VAL B HG12 3  
ATOM 6262  H HG13 . VAL B 1 55 ? -4.742  7.269   4.546   1.00 0.00 ? 59 VAL B HG13 3  
ATOM 6263  H HG21 . VAL B 1 55 ? -8.722  8.835   4.419   1.00 0.00 ? 59 VAL B HG21 3  
ATOM 6264  H HG22 . VAL B 1 55 ? -7.422  9.732   3.599   1.00 0.00 ? 59 VAL B HG22 3  
ATOM 6265  H HG23 . VAL B 1 55 ? -7.962  8.161   2.958   1.00 0.00 ? 59 VAL B HG23 3  
ATOM 6266  N N    . LYS B 1 56 ? -6.403  5.836   7.450   1.00 0.00 ? 60 LYS B N    3  
ATOM 6267  C CA   . LYS B 1 56 ? -5.480  4.984   8.180   1.00 0.00 ? 60 LYS B CA   3  
ATOM 6268  C C    . LYS B 1 56 ? -6.227  3.750   8.691   1.00 0.00 ? 60 LYS B C    3  
ATOM 6269  O O    . LYS B 1 56 ? -5.653  2.920   9.394   1.00 0.00 ? 60 LYS B O    3  
ATOM 6270  C CB   . LYS B 1 56 ? -4.776  5.777   9.283   1.00 0.00 ? 60 LYS B CB   3  
ATOM 6271  C CG   . LYS B 1 56 ? -4.330  7.149   8.772   1.00 0.00 ? 60 LYS B CG   3  
ATOM 6272  C CD   . LYS B 1 56 ? -3.091  7.026   7.881   1.00 0.00 ? 60 LYS B CD   3  
ATOM 6273  C CE   . LYS B 1 56 ? -1.859  6.649   8.706   1.00 0.00 ? 60 LYS B CE   3  
ATOM 6274  N NZ   . LYS B 1 56 ? -0.986  7.829   8.902   1.00 0.00 ? 60 LYS B NZ   3  
ATOM 6275  H H    . LYS B 1 56 ? -7.063  6.327   8.017   1.00 0.00 ? 60 LYS B H    3  
ATOM 6276  H HA   . LYS B 1 56 ? -4.712  4.657   7.478   1.00 0.00 ? 60 LYS B HA   3  
ATOM 6277  H HB2  . LYS B 1 56 ? -5.448  5.902   10.131  1.00 0.00 ? 60 LYS B HB2  3  
ATOM 6278  H HB3  . LYS B 1 56 ? -3.911  5.219   9.641   1.00 0.00 ? 60 LYS B HB3  3  
ATOM 6279  H HG2  . LYS B 1 56 ? -5.141  7.613   8.211   1.00 0.00 ? 60 LYS B HG2  3  
ATOM 6280  H HG3  . LYS B 1 56 ? -4.111  7.802   9.617   1.00 0.00 ? 60 LYS B HG3  3  
ATOM 6281  H HD2  . LYS B 1 56 ? -3.265  6.271   7.114   1.00 0.00 ? 60 LYS B HD2  3  
ATOM 6282  H HD3  . LYS B 1 56 ? -2.914  7.970   7.366   1.00 0.00 ? 60 LYS B HD3  3  
ATOM 6283  H HE2  . LYS B 1 56 ? -2.168  6.253   9.673   1.00 0.00 ? 60 LYS B HE2  3  
ATOM 6284  H HE3  . LYS B 1 56 ? -1.303  5.859   8.200   1.00 0.00 ? 60 LYS B HE3  3  
ATOM 6285  H HZ1  . LYS B 1 56 ? -1.266  8.558   8.277   1.00 0.00 ? 60 LYS B HZ1  3  
ATOM 6286  H HZ2  . LYS B 1 56 ? -1.067  8.149   9.846   1.00 0.00 ? 60 LYS B HZ2  3  
ATOM 6287  H HZ3  . LYS B 1 56 ? -0.037  7.576   8.715   1.00 0.00 ? 60 LYS B HZ3  3  
ATOM 6288  N N    . LYS B 1 57 ? -7.495  3.669   8.317   1.00 0.00 ? 61 LYS B N    3  
ATOM 6289  C CA   . LYS B 1 57 ? -8.327  2.551   8.729   1.00 0.00 ? 61 LYS B CA   3  
ATOM 6290  C C    . LYS B 1 57 ? -8.797  1.787   7.490   1.00 0.00 ? 61 LYS B C    3  
ATOM 6291  O O    . LYS B 1 57 ? -9.265  0.654   7.595   1.00 0.00 ? 61 LYS B O    3  
ATOM 6292  C CB   . LYS B 1 57 ? -9.470  3.034   9.624   1.00 0.00 ? 61 LYS B CB   3  
ATOM 6293  C CG   . LYS B 1 57 ? -10.624 3.589   8.787   1.00 0.00 ? 61 LYS B CG   3  
ATOM 6294  C CD   . LYS B 1 57 ? -11.736 2.550   8.629   1.00 0.00 ? 61 LYS B CD   3  
ATOM 6295  C CE   . LYS B 1 57 ? -13.059 3.216   8.246   1.00 0.00 ? 61 LYS B CE   3  
ATOM 6296  N NZ   . LYS B 1 57 ? -13.943 2.253   7.553   1.00 0.00 ? 61 LYS B NZ   3  
ATOM 6297  H H    . LYS B 1 57 ? -7.954  4.349   7.745   1.00 0.00 ? 61 LYS B H    3  
ATOM 6298  H HA   . LYS B 1 57 ? -7.706  1.886   9.330   1.00 0.00 ? 61 LYS B HA   3  
ATOM 6299  H HB2  . LYS B 1 57 ? -9.827  2.210   10.241  1.00 0.00 ? 61 LYS B HB2  3  
ATOM 6300  H HB3  . LYS B 1 57 ? -9.104  3.804   10.303  1.00 0.00 ? 61 LYS B HB3  3  
ATOM 6301  H HG2  . LYS B 1 57 ? -11.024 4.485   9.262   1.00 0.00 ? 61 LYS B HG2  3  
ATOM 6302  H HG3  . LYS B 1 57 ? -10.256 3.886   7.805   1.00 0.00 ? 61 LYS B HG3  3  
ATOM 6303  H HD2  . LYS B 1 57 ? -11.455 1.825   7.865   1.00 0.00 ? 61 LYS B HD2  3  
ATOM 6304  H HD3  . LYS B 1 57 ? -11.859 1.999   9.561   1.00 0.00 ? 61 LYS B HD3  3  
ATOM 6305  H HE2  . LYS B 1 57 ? -13.554 3.596   9.140   1.00 0.00 ? 61 LYS B HE2  3  
ATOM 6306  H HE3  . LYS B 1 57 ? -12.867 4.073   7.599   1.00 0.00 ? 61 LYS B HE3  3  
ATOM 6307  H HZ1  . LYS B 1 57 ? -13.982 1.401   8.075   1.00 0.00 ? 61 LYS B HZ1  3  
ATOM 6308  H HZ2  . LYS B 1 57 ? -14.862 2.639   7.476   1.00 0.00 ? 61 LYS B HZ2  3  
ATOM 6309  H HZ3  . LYS B 1 57 ? -13.582 2.067   6.639   1.00 0.00 ? 61 LYS B HZ3  3  
ATOM 6310  N N    . ILE B 1 58 ? -8.655  2.437   6.344   1.00 0.00 ? 62 ILE B N    3  
ATOM 6311  C CA   . ILE B 1 58 ? -9.060  1.833   5.086   1.00 0.00 ? 62 ILE B CA   3  
ATOM 6312  C C    . ILE B 1 58 ? -7.862  1.112   4.463   1.00 0.00 ? 62 ILE B C    3  
ATOM 6313  O O    . ILE B 1 58 ? -8.029  0.280   3.573   1.00 0.00 ? 62 ILE B O    3  
ATOM 6314  C CB   . ILE B 1 58 ? -9.692  2.881   4.167   1.00 0.00 ? 62 ILE B CB   3  
ATOM 6315  C CG1  . ILE B 1 58 ? -10.890 3.552   4.844   1.00 0.00 ? 62 ILE B CG1  3  
ATOM 6316  C CG2  . ILE B 1 58 ? -10.066 2.271   2.815   1.00 0.00 ? 62 ILE B CG2  3  
ATOM 6317  C CD1  . ILE B 1 58 ? -11.051 4.996   4.366   1.00 0.00 ? 62 ILE B CD1  3  
ATOM 6318  H H    . ILE B 1 58 ? -8.274  3.358   6.267   1.00 0.00 ? 62 ILE B H    3  
ATOM 6319  H HA   . ILE B 1 58 ? -9.829  1.095   5.310   1.00 0.00 ? 62 ILE B HA   3  
ATOM 6320  H HB   . ILE B 1 58 ? -8.953  3.659   3.977   1.00 0.00 ? 62 ILE B HB   3  
ATOM 6321  H HG12 . ILE B 1 58 ? -11.797 2.989   4.625   1.00 0.00 ? 62 ILE B HG12 3  
ATOM 6322  H HG13 . ILE B 1 58 ? -10.757 3.535   5.925   1.00 0.00 ? 62 ILE B HG13 3  
ATOM 6323  H HG21 . ILE B 1 58 ? -10.274 1.208   2.941   1.00 0.00 ? 62 ILE B HG21 3  
ATOM 6324  H HG22 . ILE B 1 58 ? -10.951 2.771   2.423   1.00 0.00 ? 62 ILE B HG22 3  
ATOM 6325  H HG23 . ILE B 1 58 ? -9.237  2.398   2.118   1.00 0.00 ? 62 ILE B HG23 3  
ATOM 6326  H HD11 . ILE B 1 58 ? -10.100 5.357   3.973   1.00 0.00 ? 62 ILE B HD11 3  
ATOM 6327  H HD12 . ILE B 1 58 ? -11.807 5.038   3.582   1.00 0.00 ? 62 ILE B HD12 3  
ATOM 6328  H HD13 . ILE B 1 58 ? -11.360 5.623   5.203   1.00 0.00 ? 62 ILE B HD13 3  
ATOM 6329  N N    . ILE B 1 59 ? -6.682  1.458   4.956   1.00 0.00 ? 63 ILE B N    3  
ATOM 6330  C CA   . ILE B 1 59 ? -5.458  0.854   4.459   1.00 0.00 ? 63 ILE B CA   3  
ATOM 6331  C C    . ILE B 1 59 ? -5.093  -0.345  5.337   1.00 0.00 ? 63 ILE B C    3  
ATOM 6332  O O    . ILE B 1 59 ? -4.929  -1.457  4.838   1.00 0.00 ? 63 ILE B O    3  
ATOM 6333  C CB   . ILE B 1 59 ? -4.347  1.902   4.356   1.00 0.00 ? 63 ILE B CB   3  
ATOM 6334  C CG1  . ILE B 1 59 ? -4.631  2.892   3.225   1.00 0.00 ? 63 ILE B CG1  3  
ATOM 6335  C CG2  . ILE B 1 59 ? -2.978  1.236   4.205   1.00 0.00 ? 63 ILE B CG2  3  
ATOM 6336  C CD1  . ILE B 1 59 ? -3.896  4.214   3.456   1.00 0.00 ? 63 ILE B CD1  3  
ATOM 6337  H H    . ILE B 1 59 ? -6.556  2.136   5.680   1.00 0.00 ? 63 ILE B H    3  
ATOM 6338  H HA   . ILE B 1 59 ? -5.657  0.495   3.449   1.00 0.00 ? 63 ILE B HA   3  
ATOM 6339  H HB   . ILE B 1 59 ? -4.327  2.471   5.285   1.00 0.00 ? 63 ILE B HB   3  
ATOM 6340  H HG12 . ILE B 1 59 ? -4.322  2.461   2.273   1.00 0.00 ? 63 ILE B HG12 3  
ATOM 6341  H HG13 . ILE B 1 59 ? -5.704  3.076   3.158   1.00 0.00 ? 63 ILE B HG13 3  
ATOM 6342  H HG21 . ILE B 1 59 ? -3.106  0.227   3.812   1.00 0.00 ? 63 ILE B HG21 3  
ATOM 6343  H HG22 . ILE B 1 59 ? -2.365  1.819   3.518   1.00 0.00 ? 63 ILE B HG22 3  
ATOM 6344  H HG23 . ILE B 1 59 ? -2.488  1.188   5.177   1.00 0.00 ? 63 ILE B HG23 3  
ATOM 6345  H HD11 . ILE B 1 59 ? -3.645  4.310   4.512   1.00 0.00 ? 63 ILE B HD11 3  
ATOM 6346  H HD12 . ILE B 1 59 ? -2.981  4.229   2.863   1.00 0.00 ? 63 ILE B HD12 3  
ATOM 6347  H HD13 . ILE B 1 59 ? -4.536  5.043   3.157   1.00 0.00 ? 63 ILE B HD13 3  
ATOM 6348  N N    . GLU B 1 60 ? -4.975  -0.077  6.629   1.00 0.00 ? 64 GLU B N    3  
ATOM 6349  C CA   . GLU B 1 60 ? -4.632  -1.120  7.581   1.00 0.00 ? 64 GLU B CA   3  
ATOM 6350  C C    . GLU B 1 60 ? -5.603  -2.295  7.453   1.00 0.00 ? 64 GLU B C    3  
ATOM 6351  O O    . GLU B 1 60 ? -5.210  -3.450  7.614   1.00 0.00 ? 64 GLU B O    3  
ATOM 6352  C CB   . GLU B 1 60 ? -4.617  -0.574  9.011   1.00 0.00 ? 64 GLU B CB   3  
ATOM 6353  C CG   . GLU B 1 60 ? -3.507  0.462   9.190   1.00 0.00 ? 64 GLU B CG   3  
ATOM 6354  C CD   . GLU B 1 60 ? -3.801  1.381   10.378  1.00 0.00 ? 64 GLU B CD   3  
ATOM 6355  O OE1  . GLU B 1 60 ? -4.574  0.943   11.256  1.00 0.00 ? 64 GLU B OE1  3  
ATOM 6356  O OE2  . GLU B 1 60 ? -3.246  2.501   10.380  1.00 0.00 ? 64 GLU B OE2  3  
ATOM 6357  H H    . GLU B 1 60 ? -5.109  0.831   7.027   1.00 0.00 ? 64 GLU B H    3  
ATOM 6358  H HA   . GLU B 1 60 ? -3.626  -1.440  7.311   1.00 0.00 ? 64 GLU B HA   3  
ATOM 6359  H HB2  . GLU B 1 60 ? -5.582  -0.123  9.241   1.00 0.00 ? 64 GLU B HB2  3  
ATOM 6360  H HB3  . GLU B 1 60 ? -4.472  -1.393  9.715   1.00 0.00 ? 64 GLU B HB3  3  
ATOM 6361  H HG2  . GLU B 1 60 ? -2.554  -0.043  9.345   1.00 0.00 ? 64 GLU B HG2  3  
ATOM 6362  H HG3  . GLU B 1 60 ? -3.409  1.056   8.281   1.00 0.00 ? 64 GLU B HG3  3  
ATOM 6363  N N    . LYS B 1 61 ? -6.853  -1.961  7.166   1.00 0.00 ? 65 LYS B N    3  
ATOM 6364  C CA   . LYS B 1 61 ? -7.883  -2.975  7.014   1.00 0.00 ? 65 LYS B CA   3  
ATOM 6365  C C    . LYS B 1 61 ? -7.639  -3.754  5.720   1.00 0.00 ? 65 LYS B C    3  
ATOM 6366  O O    . LYS B 1 61 ? -7.880  -4.959  5.662   1.00 0.00 ? 65 LYS B O    3  
ATOM 6367  C CB   . LYS B 1 61 ? -9.273  -2.342  7.099   1.00 0.00 ? 65 LYS B CB   3  
ATOM 6368  C CG   . LYS B 1 61 ? -9.719  -2.190  8.554   1.00 0.00 ? 65 LYS B CG   3  
ATOM 6369  C CD   . LYS B 1 61 ? -11.183 -2.600  8.725   1.00 0.00 ? 65 LYS B CD   3  
ATOM 6370  C CE   . LYS B 1 61 ? -12.065 -1.382  9.006   1.00 0.00 ? 65 LYS B CE   3  
ATOM 6371  N NZ   . LYS B 1 61 ? -12.622 -0.843  7.744   1.00 0.00 ? 65 LYS B NZ   3  
ATOM 6372  H H    . LYS B 1 61 ? -7.164  -1.020  7.037   1.00 0.00 ? 65 LYS B H    3  
ATOM 6373  H HA   . LYS B 1 61 ? -7.790  -3.663  7.855   1.00 0.00 ? 65 LYS B HA   3  
ATOM 6374  H HB2  . LYS B 1 61 ? -9.263  -1.366  6.614   1.00 0.00 ? 65 LYS B HB2  3  
ATOM 6375  H HB3  . LYS B 1 61 ? -9.991  -2.959  6.557   1.00 0.00 ? 65 LYS B HB3  3  
ATOM 6376  H HG2  . LYS B 1 61 ? -9.089  -2.804  9.197   1.00 0.00 ? 65 LYS B HG2  3  
ATOM 6377  H HG3  . LYS B 1 61 ? -9.588  -1.156  8.873   1.00 0.00 ? 65 LYS B HG3  3  
ATOM 6378  H HD2  . LYS B 1 61 ? -11.531 -3.105  7.823   1.00 0.00 ? 65 LYS B HD2  3  
ATOM 6379  H HD3  . LYS B 1 61 ? -11.272 -3.314  9.544   1.00 0.00 ? 65 LYS B HD3  3  
ATOM 6380  H HE2  . LYS B 1 61 ? -12.876 -1.659  9.679   1.00 0.00 ? 65 LYS B HE2  3  
ATOM 6381  H HE3  . LYS B 1 61 ? -11.481 -0.612  9.510   1.00 0.00 ? 65 LYS B HE3  3  
ATOM 6382  H HZ1  . LYS B 1 61 ? -12.618 -1.559  7.046   1.00 0.00 ? 65 LYS B HZ1  3  
ATOM 6383  H HZ2  . LYS B 1 61 ? -13.560 -0.533  7.900   1.00 0.00 ? 65 LYS B HZ2  3  
ATOM 6384  H HZ3  . LYS B 1 61 ? -12.063 -0.074  7.435   1.00 0.00 ? 65 LYS B HZ3  3  
ATOM 6385  N N    . MET B 1 62 ? -7.164  -3.035  4.714   1.00 0.00 ? 66 MET B N    3  
ATOM 6386  C CA   . MET B 1 62 ? -6.885  -3.644  3.425   1.00 0.00 ? 66 MET B CA   3  
ATOM 6387  C C    . MET B 1 62 ? -5.880  -4.789  3.565   1.00 0.00 ? 66 MET B C    3  
ATOM 6388  O O    . MET B 1 62 ? -6.002  -5.812  2.894   1.00 0.00 ? 66 MET B O    3  
ATOM 6389  C CB   . MET B 1 62 ? -6.324  -2.587  2.471   1.00 0.00 ? 66 MET B CB   3  
ATOM 6390  C CG   . MET B 1 62 ? -7.207  -2.446  1.229   1.00 0.00 ? 66 MET B CG   3  
ATOM 6391  S SD   . MET B 1 62 ? -7.294  -4.004  0.362   1.00 0.00 ? 66 MET B SD   3  
ATOM 6392  C CE   . MET B 1 62 ? -5.562  -4.260  0.012   1.00 0.00 ? 66 MET B CE   3  
ATOM 6393  H H    . MET B 1 62 ? -6.970  -2.055  4.770   1.00 0.00 ? 66 MET B H    3  
ATOM 6394  H HA   . MET B 1 62 ? -7.841  -4.031  3.071   1.00 0.00 ? 66 MET B HA   3  
ATOM 6395  H HB2  . MET B 1 62 ? -6.257  -1.628  2.985   1.00 0.00 ? 66 MET B HB2  3  
ATOM 6396  H HB3  . MET B 1 62 ? -5.312  -2.860  2.174   1.00 0.00 ? 66 MET B HB3  3  
ATOM 6397  H HG2  . MET B 1 62 ? -8.207  -2.125  1.518   1.00 0.00 ? 66 MET B HG2  3  
ATOM 6398  H HG3  . MET B 1 62 ? -6.803  -1.676  0.572   1.00 0.00 ? 66 MET B HG3  3  
ATOM 6399  H HE1  . MET B 1 62 ? -5.038  -3.306  0.052   1.00 0.00 ? 66 MET B HE1  3  
ATOM 6400  H HE2  . MET B 1 62 ? -5.139  -4.939  0.752   1.00 0.00 ? 66 MET B HE2  3  
ATOM 6401  H HE3  . MET B 1 62 ? -5.453  -4.693  -0.982  1.00 0.00 ? 66 MET B HE3  3  
ATOM 6402  N N    . LEU B 1 63 ? -4.910  -4.578  4.443   1.00 0.00 ? 67 LEU B N    3  
ATOM 6403  C CA   . LEU B 1 63 ? -3.885  -5.580  4.680   1.00 0.00 ? 67 LEU B CA   3  
ATOM 6404  C C    . LEU B 1 63 ? -4.507  -6.781  5.395   1.00 0.00 ? 67 LEU B C    3  
ATOM 6405  O O    . LEU B 1 63 ? -3.908  -7.854  5.451   1.00 0.00 ? 67 LEU B O    3  
ATOM 6406  C CB   . LEU B 1 63 ? -2.699  -4.967  5.427   1.00 0.00 ? 67 LEU B CB   3  
ATOM 6407  C CG   . LEU B 1 63 ? -1.749  -4.110  4.588   1.00 0.00 ? 67 LEU B CG   3  
ATOM 6408  C CD1  . LEU B 1 63 ? -2.512  -3.011  3.846   1.00 0.00 ? 67 LEU B CD1  3  
ATOM 6409  C CD2  . LEU B 1 63 ? -0.619  -3.541  5.449   1.00 0.00 ? 67 LEU B CD2  3  
ATOM 6410  H H    . LEU B 1 63 ? -4.818  -3.743  4.986   1.00 0.00 ? 67 LEU B H    3  
ATOM 6411  H HA   . LEU B 1 63 ? -3.518  -5.909  3.708   1.00 0.00 ? 67 LEU B HA   3  
ATOM 6412  H HB2  . LEU B 1 63 ? -3.085  -4.355  6.242   1.00 0.00 ? 67 LEU B HB2  3  
ATOM 6413  H HB3  . LEU B 1 63 ? -2.123  -5.774  5.880   1.00 0.00 ? 67 LEU B HB3  3  
ATOM 6414  H HG   . LEU B 1 63 ? -1.289  -4.748  3.834   1.00 0.00 ? 67 LEU B HG   3  
ATOM 6415  H HD11 . LEU B 1 63 ? -3.308  -3.460  3.251   1.00 0.00 ? 67 LEU B HD11 3  
ATOM 6416  H HD12 . LEU B 1 63 ? -2.945  -2.318  4.567   1.00 0.00 ? 67 LEU B HD12 3  
ATOM 6417  H HD13 . LEU B 1 63 ? -1.828  -2.473  3.190   1.00 0.00 ? 67 LEU B HD13 3  
ATOM 6418  H HD21 . LEU B 1 63 ? -0.108  -4.356  5.962   1.00 0.00 ? 67 LEU B HD21 3  
ATOM 6419  H HD22 . LEU B 1 63 ? 0.090   -3.011  4.813   1.00 0.00 ? 67 LEU B HD22 3  
ATOM 6420  H HD23 . LEU B 1 63 ? -1.034  -2.852  6.184   1.00 0.00 ? 67 LEU B HD23 3  
ATOM 6421  N N    . LYS B 1 64 ? -5.701  -6.560  5.925   1.00 0.00 ? 68 LYS B N    3  
ATOM 6422  C CA   . LYS B 1 64 ? -6.412  -7.611  6.635   1.00 0.00 ? 68 LYS B CA   3  
ATOM 6423  C C    . LYS B 1 64 ? -7.524  -8.162  5.740   1.00 0.00 ? 68 LYS B C    3  
ATOM 6424  O O    . LYS B 1 64 ? -7.927  -9.315  5.885   1.00 0.00 ? 68 LYS B O    3  
ATOM 6425  C CB   . LYS B 1 64 ? -6.907  -7.102  7.990   1.00 0.00 ? 68 LYS B CB   3  
ATOM 6426  C CG   . LYS B 1 64 ? -7.990  -8.022  8.558   1.00 0.00 ? 68 LYS B CG   3  
ATOM 6427  C CD   . LYS B 1 64 ? -7.799  -8.228  10.062  1.00 0.00 ? 68 LYS B CD   3  
ATOM 6428  C CE   . LYS B 1 64 ? -6.806  -9.358  10.339  1.00 0.00 ? 68 LYS B CE   3  
ATOM 6429  N NZ   . LYS B 1 64 ? -6.649  -9.565  11.796  1.00 0.00 ? 68 LYS B NZ   3  
ATOM 6430  H H    . LYS B 1 64 ? -6.182  -5.685  5.876   1.00 0.00 ? 68 LYS B H    3  
ATOM 6431  H HA   . LYS B 1 64 ? -5.698  -8.411  6.832   1.00 0.00 ? 68 LYS B HA   3  
ATOM 6432  H HB2  . LYS B 1 64 ? -6.072  -7.042  8.688   1.00 0.00 ? 68 LYS B HB2  3  
ATOM 6433  H HB3  . LYS B 1 64 ? -7.303  -6.092  7.880   1.00 0.00 ? 68 LYS B HB3  3  
ATOM 6434  H HG2  . LYS B 1 64 ? -8.973  -7.592  8.368   1.00 0.00 ? 68 LYS B HG2  3  
ATOM 6435  H HG3  . LYS B 1 64 ? -7.958  -8.985  8.048   1.00 0.00 ? 68 LYS B HG3  3  
ATOM 6436  H HD2  . LYS B 1 64 ? -7.441  -7.304  10.517  1.00 0.00 ? 68 LYS B HD2  3  
ATOM 6437  H HD3  . LYS B 1 64 ? -8.758  -8.460  10.525  1.00 0.00 ? 68 LYS B HD3  3  
ATOM 6438  H HE2  . LYS B 1 64 ? -7.153  -10.279 9.870   1.00 0.00 ? 68 LYS B HE2  3  
ATOM 6439  H HE3  . LYS B 1 64 ? -5.840  -9.118  9.894   1.00 0.00 ? 68 LYS B HE3  3  
ATOM 6440  H HZ1  . LYS B 1 64 ? -6.516  -8.682  12.246  1.00 0.00 ? 68 LYS B HZ1  3  
ATOM 6441  H HZ2  . LYS B 1 64 ? -7.471  -10.004 12.161  1.00 0.00 ? 68 LYS B HZ2  3  
ATOM 6442  H HZ3  . LYS B 1 64 ? -5.856  -10.150 11.967  1.00 0.00 ? 68 LYS B HZ3  3  
ATOM 6443  N N    . ASN B 1 65 ? -7.989  -7.312  4.837   1.00 0.00 ? 69 ASN B N    3  
ATOM 6444  C CA   . ASN B 1 65 ? -9.047  -7.700  3.919   1.00 0.00 ? 69 ASN B CA   3  
ATOM 6445  C C    . ASN B 1 65 ? -10.310 -8.033  4.715   1.00 0.00 ? 69 ASN B C    3  
ATOM 6446  O O    . ASN B 1 65 ? -11.240 -7.230  4.775   1.00 0.00 ? 69 ASN B O    3  
ATOM 6447  C CB   . ASN B 1 65 ? -8.653  -8.942  3.117   1.00 0.00 ? 69 ASN B CB   3  
ATOM 6448  C CG   . ASN B 1 65 ? -9.835  -9.464  2.299   1.00 0.00 ? 69 ASN B CG   3  
ATOM 6449  O OD1  . ASN B 1 65 ? -10.816 -9.962  2.825   1.00 0.00 ? 69 ASN B OD1  3  
ATOM 6450  N ND2  . ASN B 1 65 ? -9.688  -9.322  0.984   1.00 0.00 ? 69 ASN B ND2  3  
ATOM 6451  H H    . ASN B 1 65 ? -7.655  -6.376  4.726   1.00 0.00 ? 69 ASN B H    3  
ATOM 6452  H HA   . ASN B 1 65 ? -9.183  -6.842  3.260   1.00 0.00 ? 69 ASN B HA   3  
ATOM 6453  H HB2  . ASN B 1 65 ? -7.823  -8.701  2.452   1.00 0.00 ? 69 ASN B HB2  3  
ATOM 6454  H HB3  . ASN B 1 65 ? -8.302  -9.721  3.794   1.00 0.00 ? 69 ASN B HB3  3  
ATOM 6455  H HD21 . ASN B 1 65 ? -8.857  -8.904  0.616   1.00 0.00 ? 69 ASN B HD21 3  
ATOM 6456  H HD22 . ASN B 1 65 ? -10.408 -9.634  0.364   1.00 0.00 ? 69 ASN B HD22 3  
ATOM 6457  N N    . GLY B 1 66 ? -10.302 -9.218  5.308   1.00 0.00 ? 70 GLY B N    3  
ATOM 6458  C CA   . GLY B 1 66 ? -11.436 -9.667  6.098   1.00 0.00 ? 70 GLY B CA   3  
ATOM 6459  C C    . GLY B 1 66 ? -10.981 -10.194 7.460   1.00 0.00 ? 70 GLY B C    3  
ATOM 6460  O O    . GLY B 1 66 ? -9.983  -10.908 7.551   1.00 0.00 ? 70 GLY B O    3  
ATOM 6461  H H    . GLY B 1 66 ? -9.542  -9.865  5.254   1.00 0.00 ? 70 GLY B H    3  
ATOM 6462  H HA2  . GLY B 1 66 ? -12.135 -8.842  6.238   1.00 0.00 ? 70 GLY B HA2  3  
ATOM 6463  H HA3  . GLY B 1 66 ? -11.971 -10.450 5.561   1.00 0.00 ? 70 GLY B HA3  3  
ATOM 6464  N N    . LYS B 1 67 ? -11.733 -9.821  8.485   1.00 0.00 ? 71 LYS B N    3  
ATOM 6465  C CA   . LYS B 1 67 ? -11.419 -10.248 9.838   1.00 0.00 ? 71 LYS B CA   3  
ATOM 6466  C C    . LYS B 1 67 ? -11.669 -11.752 9.965   1.00 0.00 ? 71 LYS B C    3  
ATOM 6467  O O    . LYS B 1 67 ? -11.956 -12.423 8.975   1.00 0.00 ? 71 LYS B O    3  
ATOM 6468  C CB   . LYS B 1 67 ? -12.192 -9.408  10.857  1.00 0.00 ? 71 LYS B CB   3  
ATOM 6469  C CG   . LYS B 1 67 ? -11.449 -8.108  11.173  1.00 0.00 ? 71 LYS B CG   3  
ATOM 6470  C CD   . LYS B 1 67 ? -12.379 -7.093  11.839  1.00 0.00 ? 71 LYS B CD   3  
ATOM 6471  C CE   . LYS B 1 67 ? -11.609 -6.200  12.814  1.00 0.00 ? 71 LYS B CE   3  
ATOM 6472  N NZ   . LYS B 1 67 ? -12.221 -6.254  14.160  1.00 0.00 ? 71 LYS B NZ   3  
ATOM 6473  H H    . LYS B 1 67 ? -12.543 -9.240  8.402   1.00 0.00 ? 71 LYS B H    3  
ATOM 6474  H HA   . LYS B 1 67 ? -10.359 -10.058 10.002  1.00 0.00 ? 71 LYS B HA   3  
ATOM 6475  H HB2  . LYS B 1 67 ? -13.184 -9.178  10.468  1.00 0.00 ? 71 LYS B HB2  3  
ATOM 6476  H HB3  . LYS B 1 67 ? -12.335 -9.982  11.773  1.00 0.00 ? 71 LYS B HB3  3  
ATOM 6477  H HG2  . LYS B 1 67 ? -10.604 -8.319  11.830  1.00 0.00 ? 71 LYS B HG2  3  
ATOM 6478  H HG3  . LYS B 1 67 ? -11.041 -7.686  10.255  1.00 0.00 ? 71 LYS B HG3  3  
ATOM 6479  H HD2  . LYS B 1 67 ? -12.857 -6.477  11.077  1.00 0.00 ? 71 LYS B HD2  3  
ATOM 6480  H HD3  . LYS B 1 67 ? -13.174 -7.616  12.370  1.00 0.00 ? 71 LYS B HD3  3  
ATOM 6481  H HE2  . LYS B 1 67 ? -10.569 -6.523  12.868  1.00 0.00 ? 71 LYS B HE2  3  
ATOM 6482  H HE3  . LYS B 1 67 ? -11.605 -5.172  12.450  1.00 0.00 ? 71 LYS B HE3  3  
ATOM 6483  H HZ1  . LYS B 1 67 ? -13.191 -6.479  14.076  1.00 0.00 ? 71 LYS B HZ1  3  
ATOM 6484  H HZ2  . LYS B 1 67 ? -11.762 -6.954  14.708  1.00 0.00 ? 71 LYS B HZ2  3  
ATOM 6485  H HZ3  . LYS B 1 67 ? -12.123 -5.364  14.607  1.00 0.00 ? 71 LYS B HZ3  3  
ATOM 6486  N N    . SER B 1 68 ? -11.550 -12.238 11.192  1.00 0.00 ? 72 SER B N    3  
ATOM 6487  C CA   . SER B 1 68 ? -11.759 -13.650 11.461  1.00 0.00 ? 72 SER B CA   3  
ATOM 6488  C C    . SER B 1 68 ? -10.500 -14.443 11.104  1.00 0.00 ? 72 SER B C    3  
ATOM 6489  O O    . SER B 1 68 ? -9.984  -15.199 11.925  1.00 0.00 ? 72 SER B O    3  
ATOM 6490  C CB   . SER B 1 68 ? -12.963 -14.187 10.684  1.00 0.00 ? 72 SER B CB   3  
ATOM 6491  O OG   . SER B 1 68 ? -13.842 -14.940 11.515  1.00 0.00 ? 72 SER B OG   3  
ATOM 6492  H H    . SER B 1 68 ? -11.316 -11.685 11.992  1.00 0.00 ? 72 SER B H    3  
ATOM 6493  H HA   . SER B 1 68 ? -11.960 -13.713 12.530  1.00 0.00 ? 72 SER B HA   3  
ATOM 6494  H HB2  . SER B 1 68 ? -13.508 -13.354 10.240  1.00 0.00 ? 72 SER B HB2  3  
ATOM 6495  H HB3  . SER B 1 68 ? -12.614 -14.813 9.863   1.00 0.00 ? 72 SER B HB3  3  
ATOM 6496  H HG   . SER B 1 68 ? -13.369 -15.216 12.352  1.00 0.00 ? 72 SER B HG   3  
ATOM 6497  N N    . ASN B 1 69 ? -10.042 -14.243 9.877   1.00 0.00 ? 73 ASN B N    3  
ATOM 6498  C CA   . ASN B 1 69 ? -8.853  -14.929 9.400   1.00 0.00 ? 73 ASN B CA   3  
ATOM 6499  C C    . ASN B 1 69 ? -8.453  -14.362 8.037   1.00 0.00 ? 73 ASN B C    3  
ATOM 6500  O O    . ASN B 1 69 ? -9.280  -13.780 7.336   1.00 0.00 ? 73 ASN B O    3  
ATOM 6501  C CB   . ASN B 1 69 ? -9.113  -16.428 9.231   1.00 0.00 ? 73 ASN B CB   3  
ATOM 6502  C CG   . ASN B 1 69 ? -10.567 -16.690 8.833   1.00 0.00 ? 73 ASN B CG   3  
ATOM 6503  O OD1  . ASN B 1 69 ? -11.119 -16.060 7.946   1.00 0.00 ? 73 ASN B OD1  3  
ATOM 6504  N ND2  . ASN B 1 69 ? -11.155 -17.654 9.537   1.00 0.00 ? 73 ASN B ND2  3  
ATOM 6505  H H    . ASN B 1 69 ? -10.467 -13.626 9.214   1.00 0.00 ? 73 ASN B H    3  
ATOM 6506  H HA   . ASN B 1 69 ? -8.095  -14.753 10.164  1.00 0.00 ? 73 ASN B HA   3  
ATOM 6507  H HB2  . ASN B 1 69 ? -8.446  -16.833 8.471   1.00 0.00 ? 73 ASN B HB2  3  
ATOM 6508  H HB3  . ASN B 1 69 ? -8.888  -16.947 10.163  1.00 0.00 ? 73 ASN B HB3  3  
ATOM 6509  H HD21 . ASN B 1 69 ? -10.645 -18.132 10.252  1.00 0.00 ? 73 ASN B HD21 3  
ATOM 6510  H HD22 . ASN B 1 69 ? -12.106 -17.899 9.351   1.00 0.00 ? 73 ASN B HD22 3  
ATOM 6511  N N    . THR A 1 1  ? -11.072 -17.699 -15.944 1.00 0.00 ? 5  THR A N    4  
ATOM 6512  C CA   . THR A 1 1  ? -10.102 -16.791 -15.354 1.00 0.00 ? 5  THR A CA   4  
ATOM 6513  C C    . THR A 1 1  ? -9.128  -17.559 -14.458 1.00 0.00 ? 5  THR A C    4  
ATOM 6514  O O    . THR A 1 1  ? -9.509  -18.043 -13.394 1.00 0.00 ? 5  THR A O    4  
ATOM 6515  C CB   . THR A 1 1  ? -10.870 -15.693 -14.615 1.00 0.00 ? 5  THR A CB   4  
ATOM 6516  O OG1  . THR A 1 1  ? -11.666 -16.403 -13.669 1.00 0.00 ? 5  THR A OG1  4  
ATOM 6517  C CG2  . THR A 1 1  ? -11.894 -14.991 -15.510 1.00 0.00 ? 5  THR A CG2  4  
ATOM 6518  H H    . THR A 1 1  ? -11.530 -18.307 -15.295 1.00 0.00 ? 5  THR A H    4  
ATOM 6519  H HA   . THR A 1 1  ? -9.515  -16.346 -16.157 1.00 0.00 ? 5  THR A HA   4  
ATOM 6520  H HB   . THR A 1 1  ? -10.186 -14.973 -14.167 1.00 0.00 ? 5  THR A HB   4  
ATOM 6521  H HG1  . THR A 1 1  ? -12.354 -16.952 -14.144 1.00 0.00 ? 5  THR A HG1  4  
ATOM 6522  H HG21 . THR A 1 1  ? -12.123 -15.625 -16.367 1.00 0.00 ? 5  THR A HG21 4  
ATOM 6523  H HG22 . THR A 1 1  ? -12.805 -14.805 -14.942 1.00 0.00 ? 5  THR A HG22 4  
ATOM 6524  H HG23 . THR A 1 1  ? -11.482 -14.044 -15.858 1.00 0.00 ? 5  THR A HG23 4  
ATOM 6525  N N    . GLU A 1 2  ? -7.890  -17.647 -14.923 1.00 0.00 ? 6  GLU A N    4  
ATOM 6526  C CA   . GLU A 1 2  ? -6.859  -18.348 -14.177 1.00 0.00 ? 6  GLU A CA   4  
ATOM 6527  C C    . GLU A 1 2  ? -5.772  -17.370 -13.727 1.00 0.00 ? 6  GLU A C    4  
ATOM 6528  O O    . GLU A 1 2  ? -4.698  -17.312 -14.324 1.00 0.00 ? 6  GLU A O    4  
ATOM 6529  C CB   . GLU A 1 2  ? -6.263  -19.487 -15.005 1.00 0.00 ? 6  GLU A CB   4  
ATOM 6530  C CG   . GLU A 1 2  ? -5.616  -20.540 -14.103 1.00 0.00 ? 6  GLU A CG   4  
ATOM 6531  C CD   . GLU A 1 2  ? -4.331  -21.085 -14.730 1.00 0.00 ? 6  GLU A CD   4  
ATOM 6532  O OE1  . GLU A 1 2  ? -3.339  -20.324 -14.744 1.00 0.00 ? 6  GLU A OE1  4  
ATOM 6533  O OE2  . GLU A 1 2  ? -4.369  -22.250 -15.182 1.00 0.00 ? 6  GLU A OE2  4  
ATOM 6534  H H    . GLU A 1 2  ? -7.589  -17.250 -15.790 1.00 0.00 ? 6  GLU A H    4  
ATOM 6535  H HA   . GLU A 1 2  ? -7.364  -18.765 -13.306 1.00 0.00 ? 6  GLU A HA   4  
ATOM 6536  H HB2  . GLU A 1 2  ? -7.043  -19.950 -15.609 1.00 0.00 ? 6  GLU A HB2  4  
ATOM 6537  H HB3  . GLU A 1 2  ? -5.519  -19.089 -15.696 1.00 0.00 ? 6  GLU A HB3  4  
ATOM 6538  H HG2  . GLU A 1 2  ? -5.393  -20.103 -13.130 1.00 0.00 ? 6  GLU A HG2  4  
ATOM 6539  H HG3  . GLU A 1 2  ? -6.316  -21.358 -13.933 1.00 0.00 ? 6  GLU A HG3  4  
ATOM 6540  N N    . LEU A 1 3  ? -6.088  -16.625 -12.677 1.00 0.00 ? 7  LEU A N    4  
ATOM 6541  C CA   . LEU A 1 3  ? -5.152  -15.653 -12.141 1.00 0.00 ? 7  LEU A CA   4  
ATOM 6542  C C    . LEU A 1 3  ? -4.549  -16.194 -10.842 1.00 0.00 ? 7  LEU A C    4  
ATOM 6543  O O    . LEU A 1 3  ? -5.093  -17.118 -10.239 1.00 0.00 ? 7  LEU A O    4  
ATOM 6544  C CB   . LEU A 1 3  ? -5.827  -14.289 -11.983 1.00 0.00 ? 7  LEU A CB   4  
ATOM 6545  C CG   . LEU A 1 3  ? -6.491  -13.720 -13.239 1.00 0.00 ? 7  LEU A CG   4  
ATOM 6546  C CD1  . LEU A 1 3  ? -7.951  -14.167 -13.337 1.00 0.00 ? 7  LEU A CD1  4  
ATOM 6547  C CD2  . LEU A 1 3  ? -6.353  -12.198 -13.291 1.00 0.00 ? 7  LEU A CD2  4  
ATOM 6548  H H    . LEU A 1 3  ? -6.964  -16.679 -12.197 1.00 0.00 ? 7  LEU A H    4  
ATOM 6549  H HA   . LEU A 1 3  ? -4.350  -15.533 -12.870 1.00 0.00 ? 7  LEU A HA   4  
ATOM 6550  H HB2  . LEU A 1 3  ? -6.582  -14.367 -11.201 1.00 0.00 ? 7  LEU A HB2  4  
ATOM 6551  H HB3  . LEU A 1 3  ? -5.081  -13.574 -11.636 1.00 0.00 ? 7  LEU A HB3  4  
ATOM 6552  H HG   . LEU A 1 3  ? -5.973  -14.121 -14.111 1.00 0.00 ? 7  LEU A HG   4  
ATOM 6553  H HD11 . LEU A 1 3  ? -7.999  -15.256 -13.335 1.00 0.00 ? 7  LEU A HD11 4  
ATOM 6554  H HD12 . LEU A 1 3  ? -8.508  -13.778 -12.484 1.00 0.00 ? 7  LEU A HD12 4  
ATOM 6555  H HD13 . LEU A 1 3  ? -8.387  -13.785 -14.260 1.00 0.00 ? 7  LEU A HD13 4  
ATOM 6556  H HD21 . LEU A 1 3  ? -5.821  -11.851 -12.405 1.00 0.00 ? 7  LEU A HD21 4  
ATOM 6557  H HD22 . LEU A 1 3  ? -5.795  -11.914 -14.184 1.00 0.00 ? 7  LEU A HD22 4  
ATOM 6558  H HD23 . LEU A 1 3  ? -7.343  -11.744 -13.322 1.00 0.00 ? 7  LEU A HD23 4  
ATOM 6559  N N    . ARG A 1 4  ? -3.434  -15.595 -10.450 1.00 0.00 ? 8  ARG A N    4  
ATOM 6560  C CA   . ARG A 1 4  ? -2.752  -16.006 -9.235  1.00 0.00 ? 8  ARG A CA   4  
ATOM 6561  C C    . ARG A 1 4  ? -2.324  -14.779 -8.426  1.00 0.00 ? 8  ARG A C    4  
ATOM 6562  O O    . ARG A 1 4  ? -3.041  -13.780 -8.382  1.00 0.00 ? 8  ARG A O    4  
ATOM 6563  C CB   . ARG A 1 4  ? -1.518  -16.852 -9.555  1.00 0.00 ? 8  ARG A CB   4  
ATOM 6564  C CG   . ARG A 1 4  ? -1.819  -17.862 -10.664 1.00 0.00 ? 8  ARG A CG   4  
ATOM 6565  C CD   . ARG A 1 4  ? -1.065  -19.174 -10.431 1.00 0.00 ? 8  ARG A CD   4  
ATOM 6566  N NE   . ARG A 1 4  ? -0.109  -19.411 -11.535 1.00 0.00 ? 8  ARG A NE   4  
ATOM 6567  C CZ   . ARG A 1 4  ? 0.853   -20.344 -11.508 1.00 0.00 ? 8  ARG A CZ   4  
ATOM 6568  N NH1  . ARG A 1 4  ? 0.992   -21.132 -10.433 1.00 0.00 ? 8  ARG A NH1  4  
ATOM 6569  N NH2  . ARG A 1 4  ? 1.676   -20.488 -12.556 1.00 0.00 ? 8  ARG A NH2  4  
ATOM 6570  H H    . ARG A 1 4  ? -2.998  -14.845 -10.947 1.00 0.00 ? 8  ARG A H    4  
ATOM 6571  H HA   . ARG A 1 4  ? -3.486  -16.599 -8.690  1.00 0.00 ? 8  ARG A HA   4  
ATOM 6572  H HB2  . ARG A 1 4  ? -0.697  -16.204 -9.861  1.00 0.00 ? 8  ARG A HB2  4  
ATOM 6573  H HB3  . ARG A 1 4  ? -1.191  -17.379 -8.658  1.00 0.00 ? 8  ARG A HB3  4  
ATOM 6574  H HG2  . ARG A 1 4  ? -2.891  -18.057 -10.703 1.00 0.00 ? 8  ARG A HG2  4  
ATOM 6575  H HG3  . ARG A 1 4  ? -1.535  -17.443 -11.629 1.00 0.00 ? 8  ARG A HG3  4  
ATOM 6576  H HD2  . ARG A 1 4  ? -0.534  -19.133 -9.480  1.00 0.00 ? 8  ARG A HD2  4  
ATOM 6577  H HD3  . ARG A 1 4  ? -1.771  -20.002 -10.366 1.00 0.00 ? 8  ARG A HD3  4  
ATOM 6578  H HE   . ARG A 1 4  ? -0.185  -18.839 -12.352 1.00 0.00 ? 8  ARG A HE   4  
ATOM 6579  H HH11 . ARG A 1 4  ? 0.378   -21.025 -9.652  1.00 0.00 ? 8  ARG A HH11 4  
ATOM 6580  H HH12 . ARG A 1 4  ? 1.709   -21.829 -10.413 1.00 0.00 ? 8  ARG A HH12 4  
ATOM 6581  H HH21 . ARG A 1 4  ? 1.572   -19.900 -13.358 1.00 0.00 ? 8  ARG A HH21 4  
ATOM 6582  H HH22 . ARG A 1 4  ? 2.393   -21.184 -12.536 1.00 0.00 ? 8  ARG A HH22 4  
ATOM 6583  N N    . CYS A 1 5  ? -1.159  -14.895 -7.807  1.00 0.00 ? 9  CYS A N    4  
ATOM 6584  C CA   . CYS A 1 5  ? -0.628  -13.809 -7.002  1.00 0.00 ? 9  CYS A CA   4  
ATOM 6585  C C    . CYS A 1 5  ? 0.315   -12.980 -7.876  1.00 0.00 ? 9  CYS A C    4  
ATOM 6586  O O    . CYS A 1 5  ? 0.877   -13.489 -8.845  1.00 0.00 ? 9  CYS A O    4  
ATOM 6587  C CB   . CYS A 1 5  ? 0.069   -14.326 -5.741  1.00 0.00 ? 9  CYS A CB   4  
ATOM 6588  S SG   . CYS A 1 5  ? -1.060  -14.831 -4.393  1.00 0.00 ? 9  CYS A SG   4  
ATOM 6589  H H    . CYS A 1 5  ? -0.583  -15.711 -7.848  1.00 0.00 ? 9  CYS A H    4  
ATOM 6590  H HA   . CYS A 1 5  ? -1.481  -13.212 -6.679  1.00 0.00 ? 9  CYS A HA   4  
ATOM 6591  H HB2  . CYS A 1 5  ? 0.692   -15.178 -6.012  1.00 0.00 ? 9  CYS A HB2  4  
ATOM 6592  H HB3  . CYS A 1 5  ? 0.735   -13.549 -5.367  1.00 0.00 ? 9  CYS A HB3  4  
ATOM 6593  N N    . GLN A 1 6  ? 0.461   -11.717 -7.502  1.00 0.00 ? 10 GLN A N    4  
ATOM 6594  C CA   . GLN A 1 6  ? 1.327   -10.813 -8.240  1.00 0.00 ? 10 GLN A CA   4  
ATOM 6595  C C    . GLN A 1 6  ? 2.727   -10.799 -7.624  1.00 0.00 ? 10 GLN A C    4  
ATOM 6596  O O    . GLN A 1 6  ? 3.583   -10.017 -8.037  1.00 0.00 ? 10 GLN A O    4  
ATOM 6597  C CB   . GLN A 1 6  ? 0.734   -9.404  -8.288  1.00 0.00 ? 10 GLN A CB   4  
ATOM 6598  C CG   . GLN A 1 6  ? 1.027   -8.731  -9.631  1.00 0.00 ? 10 GLN A CG   4  
ATOM 6599  C CD   . GLN A 1 6  ? 1.915   -7.499  -9.444  1.00 0.00 ? 10 GLN A CD   4  
ATOM 6600  O OE1  . GLN A 1 6  ? 3.034   -7.429  -9.925  1.00 0.00 ? 10 GLN A OE1  4  
ATOM 6601  N NE2  . GLN A 1 6  ? 1.355   -6.533  -8.721  1.00 0.00 ? 10 GLN A NE2  4  
ATOM 6602  H H    . GLN A 1 6  ? 0.001   -11.311 -6.712  1.00 0.00 ? 10 GLN A H    4  
ATOM 6603  H HA   . GLN A 1 6  ? 1.372   -11.217 -9.251  1.00 0.00 ? 10 GLN A HA   4  
ATOM 6604  H HB2  . GLN A 1 6  ? -0.343  -9.453  -8.129  1.00 0.00 ? 10 GLN A HB2  4  
ATOM 6605  H HB3  . GLN A 1 6  ? 1.148   -8.803  -7.478  1.00 0.00 ? 10 GLN A HB3  4  
ATOM 6606  H HG2  . GLN A 1 6  ? 1.519   -9.440  -10.297 1.00 0.00 ? 10 GLN A HG2  4  
ATOM 6607  H HG3  . GLN A 1 6  ? 0.092   -8.441  -10.108 1.00 0.00 ? 10 GLN A HG3  4  
ATOM 6608  H HE21 . GLN A 1 6  ? 0.433   -6.654  -8.354  1.00 0.00 ? 10 GLN A HE21 4  
ATOM 6609  H HE22 . GLN A 1 6  ? 1.857   -5.687  -8.543  1.00 0.00 ? 10 GLN A HE22 4  
ATOM 6610  N N    . CYS A 1 7  ? 2.918   -11.672 -6.646  1.00 0.00 ? 11 CYS A N    4  
ATOM 6611  C CA   . CYS A 1 7  ? 4.200   -11.769 -5.969  1.00 0.00 ? 11 CYS A CA   4  
ATOM 6612  C C    . CYS A 1 7  ? 4.695   -13.212 -6.082  1.00 0.00 ? 11 CYS A C    4  
ATOM 6613  O O    . CYS A 1 7  ? 4.084   -14.126 -5.530  1.00 0.00 ? 11 CYS A O    4  
ATOM 6614  C CB   . CYS A 1 7  ? 4.107   -11.310 -4.512  1.00 0.00 ? 11 CYS A CB   4  
ATOM 6615  S SG   . CYS A 1 7  ? 4.793   -9.645  -4.186  1.00 0.00 ? 11 CYS A SG   4  
ATOM 6616  H H    . CYS A 1 7  ? 2.217   -12.304 -6.316  1.00 0.00 ? 11 CYS A H    4  
ATOM 6617  H HA   . CYS A 1 7  ? 4.877   -11.086 -6.481  1.00 0.00 ? 11 CYS A HA   4  
ATOM 6618  H HB2  . CYS A 1 7  ? 3.060   -11.321 -4.208  1.00 0.00 ? 11 CYS A HB2  4  
ATOM 6619  H HB3  . CYS A 1 7  ? 4.629   -12.032 -3.884  1.00 0.00 ? 11 CYS A HB3  4  
ATOM 6620  N N    . LEU A 1 8  ? 5.796   -13.372 -6.800  1.00 0.00 ? 12 LEU A N    4  
ATOM 6621  C CA   . LEU A 1 8  ? 6.380   -14.688 -6.993  1.00 0.00 ? 12 LEU A CA   4  
ATOM 6622  C C    . LEU A 1 8  ? 7.330   -14.995 -5.833  1.00 0.00 ? 12 LEU A C    4  
ATOM 6623  O O    . LEU A 1 8  ? 7.568   -16.158 -5.512  1.00 0.00 ? 12 LEU A O    4  
ATOM 6624  C CB   . LEU A 1 8  ? 7.039   -14.786 -8.370  1.00 0.00 ? 12 LEU A CB   4  
ATOM 6625  C CG   . LEU A 1 8  ? 6.217   -14.257 -9.547  1.00 0.00 ? 12 LEU A CG   4  
ATOM 6626  C CD1  . LEU A 1 8  ? 7.125   -13.824 -10.699 1.00 0.00 ? 12 LEU A CD1  4  
ATOM 6627  C CD2  . LEU A 1 8  ? 5.174   -15.284 -9.993  1.00 0.00 ? 12 LEU A CD2  4  
ATOM 6628  H H    . LEU A 1 8  ? 6.287   -12.623 -7.246  1.00 0.00 ? 12 LEU A H    4  
ATOM 6629  H HA   . LEU A 1 8  ? 5.566   -15.413 -6.973  1.00 0.00 ? 12 LEU A HA   4  
ATOM 6630  H HB2  . LEU A 1 8  ? 7.983   -14.242 -8.338  1.00 0.00 ? 12 LEU A HB2  4  
ATOM 6631  H HB3  . LEU A 1 8  ? 7.281   -15.831 -8.562  1.00 0.00 ? 12 LEU A HB3  4  
ATOM 6632  H HG   . LEU A 1 8  ? 5.675   -13.372 -9.214  1.00 0.00 ? 12 LEU A HG   4  
ATOM 6633  H HD11 . LEU A 1 8  ? 8.156   -13.771 -10.350 1.00 0.00 ? 12 LEU A HD11 4  
ATOM 6634  H HD12 . LEU A 1 8  ? 7.053   -14.548 -11.510 1.00 0.00 ? 12 LEU A HD12 4  
ATOM 6635  H HD13 . LEU A 1 8  ? 6.812   -12.843 -11.059 1.00 0.00 ? 12 LEU A HD13 4  
ATOM 6636  H HD21 . LEU A 1 8  ? 4.880   -15.896 -9.140  1.00 0.00 ? 12 LEU A HD21 4  
ATOM 6637  H HD22 . LEU A 1 8  ? 4.300   -14.766 -10.388 1.00 0.00 ? 12 LEU A HD22 4  
ATOM 6638  H HD23 . LEU A 1 8  ? 5.601   -15.921 -10.768 1.00 0.00 ? 12 LEU A HD23 4  
ATOM 6639  N N    . GLN A 1 9  ? 7.847   -13.931 -5.237  1.00 0.00 ? 13 GLN A N    4  
ATOM 6640  C CA   . GLN A 1 9  ? 8.765   -14.071 -4.120  1.00 0.00 ? 13 GLN A CA   4  
ATOM 6641  C C    . GLN A 1 9  ? 8.402   -13.087 -3.006  1.00 0.00 ? 13 GLN A C    4  
ATOM 6642  O O    . GLN A 1 9  ? 7.464   -12.303 -3.147  1.00 0.00 ? 13 GLN A O    4  
ATOM 6643  C CB   . GLN A 1 9  ? 10.214  -13.877 -4.573  1.00 0.00 ? 13 GLN A CB   4  
ATOM 6644  C CG   . GLN A 1 9  ? 11.164  -14.764 -3.767  1.00 0.00 ? 13 GLN A CG   4  
ATOM 6645  C CD   . GLN A 1 9  ? 11.931  -15.720 -4.683  1.00 0.00 ? 13 GLN A CD   4  
ATOM 6646  O OE1  . GLN A 1 9  ? 12.008  -15.539 -5.888  1.00 0.00 ? 13 GLN A OE1  4  
ATOM 6647  N NE2  . GLN A 1 9  ? 12.494  -16.744 -4.048  1.00 0.00 ? 13 GLN A NE2  4  
ATOM 6648  H H    . GLN A 1 9  ? 7.648   -12.988 -5.504  1.00 0.00 ? 13 GLN A H    4  
ATOM 6649  H HA   . GLN A 1 9  ? 8.636   -15.094 -3.765  1.00 0.00 ? 13 GLN A HA   4  
ATOM 6650  H HB2  . GLN A 1 9  ? 10.301  -14.112 -5.633  1.00 0.00 ? 13 GLN A HB2  4  
ATOM 6651  H HB3  . GLN A 1 9  ? 10.498  -12.831 -4.454  1.00 0.00 ? 13 GLN A HB3  4  
ATOM 6652  H HG2  . GLN A 1 9  ? 11.868  -14.142 -3.214  1.00 0.00 ? 13 GLN A HG2  4  
ATOM 6653  H HG3  . GLN A 1 9  ? 10.598  -15.336 -3.032  1.00 0.00 ? 13 GLN A HG3  4  
ATOM 6654  H HE21 . GLN A 1 9  ? 12.393  -16.834 -3.057  1.00 0.00 ? 13 GLN A HE21 4  
ATOM 6655  H HE22 . GLN A 1 9  ? 13.017  -17.424 -4.561  1.00 0.00 ? 13 GLN A HE22 4  
ATOM 6656  N N    . THR A 1 10 ? 9.164   -13.158 -1.924  1.00 0.00 ? 14 THR A N    4  
ATOM 6657  C CA   . THR A 1 10 ? 8.933   -12.283 -0.788  1.00 0.00 ? 14 THR A CA   4  
ATOM 6658  C C    . THR A 1 10 ? 10.197  -12.176 0.068   1.00 0.00 ? 14 THR A C    4  
ATOM 6659  O O    . THR A 1 10 ? 11.081  -13.028 -0.015  1.00 0.00 ? 14 THR A O    4  
ATOM 6660  C CB   . THR A 1 10 ? 7.722   -12.815 -0.019  1.00 0.00 ? 14 THR A CB   4  
ATOM 6661  O OG1  . THR A 1 10 ? 7.942   -14.222 0.045   1.00 0.00 ? 14 THR A OG1  4  
ATOM 6662  C CG2  . THR A 1 10 ? 6.420   -12.676 -0.809  1.00 0.00 ? 14 THR A CG2  4  
ATOM 6663  H H    . THR A 1 10 ? 9.924   -13.799 -1.818  1.00 0.00 ? 14 THR A H    4  
ATOM 6664  H HA   . THR A 1 10 ? 8.716   -11.283 -1.163  1.00 0.00 ? 14 THR A HA   4  
ATOM 6665  H HB   . THR A 1 10 ? 7.639   -12.335 0.956   1.00 0.00 ? 14 THR A HB   4  
ATOM 6666  H HG1  . THR A 1 10 ? 8.751   -14.417 0.599   1.00 0.00 ? 14 THR A HG1  4  
ATOM 6667  H HG21 . THR A 1 10 ? 6.376   -11.688 -1.267  1.00 0.00 ? 14 THR A HG21 4  
ATOM 6668  H HG22 . THR A 1 10 ? 6.384   -13.439 -1.587  1.00 0.00 ? 14 THR A HG22 4  
ATOM 6669  H HG23 . THR A 1 10 ? 5.571   -12.803 -0.137  1.00 0.00 ? 14 THR A HG23 4  
ATOM 6670  N N    . LEU A 1 11 ? 10.243  -11.123 0.870   1.00 0.00 ? 15 LEU A N    4  
ATOM 6671  C CA   . LEU A 1 11 ? 11.384  -10.894 1.740   1.00 0.00 ? 15 LEU A CA   4  
ATOM 6672  C C    . LEU A 1 11 ? 10.923  -10.927 3.198   1.00 0.00 ? 15 LEU A C    4  
ATOM 6673  O O    . LEU A 1 11 ? 9.857   -10.410 3.528   1.00 0.00 ? 15 LEU A O    4  
ATOM 6674  C CB   . LEU A 1 11 ? 12.103  -9.600  1.351   1.00 0.00 ? 15 LEU A CB   4  
ATOM 6675  C CG   . LEU A 1 11 ? 12.446  -9.443  -0.132  1.00 0.00 ? 15 LEU A CG   4  
ATOM 6676  C CD1  . LEU A 1 11 ? 12.048  -8.057  -0.642  1.00 0.00 ? 15 LEU A CD1  4  
ATOM 6677  C CD2  . LEU A 1 11 ? 13.924  -9.746  -0.387  1.00 0.00 ? 15 LEU A CD2  4  
ATOM 6678  H H    . LEU A 1 11 ? 9.520   -10.435 0.931   1.00 0.00 ? 15 LEU A H    4  
ATOM 6679  H HA   . LEU A 1 11 ? 12.086  -11.713 1.581   1.00 0.00 ? 15 LEU A HA   4  
ATOM 6680  H HB2  . LEU A 1 11 ? 11.480  -8.758  1.651   1.00 0.00 ? 15 LEU A HB2  4  
ATOM 6681  H HB3  . LEU A 1 11 ? 13.027  -9.534  1.926   1.00 0.00 ? 15 LEU A HB3  4  
ATOM 6682  H HG   . LEU A 1 11 ? 11.866  -10.173 -0.696  1.00 0.00 ? 15 LEU A HG   4  
ATOM 6683  H HD11 . LEU A 1 11 ? 11.181  -7.700  -0.087  1.00 0.00 ? 15 LEU A HD11 4  
ATOM 6684  H HD12 . LEU A 1 11 ? 12.879  -7.366  -0.502  1.00 0.00 ? 15 LEU A HD12 4  
ATOM 6685  H HD13 . LEU A 1 11 ? 11.801  -8.117  -1.702  1.00 0.00 ? 15 LEU A HD13 4  
ATOM 6686  H HD21 . LEU A 1 11 ? 14.540  -9.121  0.260   1.00 0.00 ? 15 LEU A HD21 4  
ATOM 6687  H HD22 . LEU A 1 11 ? 14.122  -10.796 -0.174  1.00 0.00 ? 15 LEU A HD22 4  
ATOM 6688  H HD23 . LEU A 1 11 ? 14.163  -9.535  -1.430  1.00 0.00 ? 15 LEU A HD23 4  
ATOM 6689  N N    . GLN A 1 12 ? 11.749  -11.540 4.033   1.00 0.00 ? 16 GLN A N    4  
ATOM 6690  C CA   . GLN A 1 12 ? 11.440  -11.647 5.449   1.00 0.00 ? 16 GLN A CA   4  
ATOM 6691  C C    . GLN A 1 12 ? 12.187  -10.571 6.238   1.00 0.00 ? 16 GLN A C    4  
ATOM 6692  O O    . GLN A 1 12 ? 13.073  -10.881 7.033   1.00 0.00 ? 16 GLN A O    4  
ATOM 6693  C CB   . GLN A 1 12 ? 11.770  -13.044 5.978   1.00 0.00 ? 16 GLN A CB   4  
ATOM 6694  C CG   . GLN A 1 12 ? 11.787  -13.061 7.508   1.00 0.00 ? 16 GLN A CG   4  
ATOM 6695  C CD   . GLN A 1 12 ? 11.115  -14.324 8.050   1.00 0.00 ? 16 GLN A CD   4  
ATOM 6696  O OE1  . GLN A 1 12 ? 11.737  -15.172 8.668   1.00 0.00 ? 16 GLN A OE1  4  
ATOM 6697  N NE2  . GLN A 1 12 ? 9.814   -14.401 7.784   1.00 0.00 ? 16 GLN A NE2  4  
ATOM 6698  H H    . GLN A 1 12 ? 12.615  -11.958 3.757   1.00 0.00 ? 16 GLN A H    4  
ATOM 6699  H HA   . GLN A 1 12 ? 10.365  -11.482 5.523   1.00 0.00 ? 16 GLN A HA   4  
ATOM 6700  H HB2  . GLN A 1 12 ? 11.034  -13.760 5.611   1.00 0.00 ? 16 GLN A HB2  4  
ATOM 6701  H HB3  . GLN A 1 12 ? 12.741  -13.361 5.596   1.00 0.00 ? 16 GLN A HB3  4  
ATOM 6702  H HG2  . GLN A 1 12 ? 12.816  -13.011 7.864   1.00 0.00 ? 16 GLN A HG2  4  
ATOM 6703  H HG3  . GLN A 1 12 ? 11.274  -12.179 7.890   1.00 0.00 ? 16 GLN A HG3  4  
ATOM 6704  H HE21 . GLN A 1 12 ? 9.365   -13.670 7.271   1.00 0.00 ? 16 GLN A HE21 4  
ATOM 6705  H HE22 . GLN A 1 12 ? 9.286   -15.191 8.097   1.00 0.00 ? 16 GLN A HE22 4  
ATOM 6706  N N    . GLY A 1 13 ? 11.802  -9.327  5.992   1.00 0.00 ? 17 GLY A N    4  
ATOM 6707  C CA   . GLY A 1 13 ? 12.424  -8.203  6.670   1.00 0.00 ? 17 GLY A CA   4  
ATOM 6708  C C    . GLY A 1 13 ? 13.574  -7.630  5.840   1.00 0.00 ? 17 GLY A C    4  
ATOM 6709  O O    . GLY A 1 13 ? 14.684  -8.161  5.860   1.00 0.00 ? 17 GLY A O    4  
ATOM 6710  H H    . GLY A 1 13 ? 11.080  -9.083  5.344   1.00 0.00 ? 17 GLY A H    4  
ATOM 6711  H HA2  . GLY A 1 13 ? 11.680  -7.427  6.853   1.00 0.00 ? 17 GLY A HA2  4  
ATOM 6712  H HA3  . GLY A 1 13 ? 12.797  -8.522  7.643   1.00 0.00 ? 17 GLY A HA3  4  
ATOM 6713  N N    . ILE A 1 14 ? 13.270  -6.554  5.129   1.00 0.00 ? 18 ILE A N    4  
ATOM 6714  C CA   . ILE A 1 14 ? 14.264  -5.903  4.294   1.00 0.00 ? 18 ILE A CA   4  
ATOM 6715  C C    . ILE A 1 14 ? 14.473  -4.467  4.780   1.00 0.00 ? 18 ILE A C    4  
ATOM 6716  O O    . ILE A 1 14 ? 13.584  -3.882  5.397   1.00 0.00 ? 18 ILE A O    4  
ATOM 6717  C CB   . ILE A 1 14 ? 13.872  -6.001  2.818   1.00 0.00 ? 18 ILE A CB   4  
ATOM 6718  C CG1  . ILE A 1 14 ? 14.318  -7.336  2.220   1.00 0.00 ? 18 ILE A CG1  4  
ATOM 6719  C CG2  . ILE A 1 14 ? 14.412  -4.808  2.027   1.00 0.00 ? 18 ILE A CG2  4  
ATOM 6720  C CD1  . ILE A 1 14 ? 15.802  -7.301  1.848   1.00 0.00 ? 18 ILE A CD1  4  
ATOM 6721  H H    . ILE A 1 14 ? 12.365  -6.128  5.119   1.00 0.00 ? 18 ILE A H    4  
ATOM 6722  H HA   . ILE A 1 14 ? 15.200  -6.448  4.415   1.00 0.00 ? 18 ILE A HA   4  
ATOM 6723  H HB   . ILE A 1 14 ? 12.784  -5.966  2.751   1.00 0.00 ? 18 ILE A HB   4  
ATOM 6724  H HG12 . ILE A 1 14 ? 14.138  -8.138  2.935   1.00 0.00 ? 18 ILE A HG12 4  
ATOM 6725  H HG13 . ILE A 1 14 ? 13.723  -7.559  1.334   1.00 0.00 ? 18 ILE A HG13 4  
ATOM 6726  H HG21 . ILE A 1 14 ? 15.476  -4.690  2.229   1.00 0.00 ? 18 ILE A HG21 4  
ATOM 6727  H HG22 . ILE A 1 14 ? 14.262  -4.982  0.961   1.00 0.00 ? 18 ILE A HG22 4  
ATOM 6728  H HG23 . ILE A 1 14 ? 13.882  -3.904  2.325   1.00 0.00 ? 18 ILE A HG23 4  
ATOM 6729  H HD11 . ILE A 1 14 ? 16.395  -7.098  2.739   1.00 0.00 ? 18 ILE A HD11 4  
ATOM 6730  H HD12 . ILE A 1 14 ? 16.094  -8.264  1.429   1.00 0.00 ? 18 ILE A HD12 4  
ATOM 6731  H HD13 . ILE A 1 14 ? 15.973  -6.518  1.110   1.00 0.00 ? 18 ILE A HD13 4  
ATOM 6732  N N    . HIS A 1 15 ? 15.653  -3.942  4.485   1.00 0.00 ? 19 HIS A N    4  
ATOM 6733  C CA   . HIS A 1 15 ? 15.989  -2.586  4.885   1.00 0.00 ? 19 HIS A CA   4  
ATOM 6734  C C    . HIS A 1 15 ? 14.984  -1.607  4.275   1.00 0.00 ? 19 HIS A C    4  
ATOM 6735  O O    . HIS A 1 15 ? 14.680  -1.684  3.086   1.00 0.00 ? 19 HIS A O    4  
ATOM 6736  C CB   . HIS A 1 15 ? 17.437  -2.255  4.518   1.00 0.00 ? 19 HIS A CB   4  
ATOM 6737  C CG   . HIS A 1 15 ? 18.207  -1.565  5.618   1.00 0.00 ? 19 HIS A CG   4  
ATOM 6738  N ND1  . HIS A 1 15 ? 19.558  -1.775  5.833   1.00 0.00 ? 19 HIS A ND1  4  
ATOM 6739  C CD2  . HIS A 1 15 ? 17.802  -0.667  6.562   1.00 0.00 ? 19 HIS A CD2  4  
ATOM 6740  C CE1  . HIS A 1 15 ? 19.939  -1.032  6.862   1.00 0.00 ? 19 HIS A CE1  4  
ATOM 6741  N NE2  . HIS A 1 15 ? 18.849  -0.347  7.313   1.00 0.00 ? 19 HIS A NE2  4  
ATOM 6742  H H    . HIS A 1 15 ? 16.370  -4.425  3.983   1.00 0.00 ? 19 HIS A H    4  
ATOM 6743  H HA   . HIS A 1 15 ? 15.905  -2.550  5.971   1.00 0.00 ? 19 HIS A HA   4  
ATOM 6744  H HB2  . HIS A 1 15 ? 17.953  -3.177  4.250   1.00 0.00 ? 19 HIS A HB2  4  
ATOM 6745  H HB3  . HIS A 1 15 ? 17.440  -1.619  3.632   1.00 0.00 ? 19 HIS A HB3  4  
ATOM 6746  H HD1  . HIS A 1 15 ? 20.147  -2.383  5.301   1.00 0.00 ? 19 HIS A HD1  4  
ATOM 6747  H HD2  . HIS A 1 15 ? 16.791  -0.279  6.679   1.00 0.00 ? 19 HIS A HD2  4  
ATOM 6748  H HE1  . HIS A 1 15 ? 20.946  -0.979  7.276   1.00 0.00 ? 19 HIS A HE1  4  
ATOM 6749  N N    . LEU A 1 16 ? 14.497  -0.708  5.117   1.00 0.00 ? 20 LEU A N    4  
ATOM 6750  C CA   . LEU A 1 16 ? 13.532  0.286   4.676   1.00 0.00 ? 20 LEU A CA   4  
ATOM 6751  C C    . LEU A 1 16 ? 14.276  1.498   4.114   1.00 0.00 ? 20 LEU A C    4  
ATOM 6752  O O    . LEU A 1 16 ? 13.682  2.555   3.908   1.00 0.00 ? 20 LEU A O    4  
ATOM 6753  C CB   . LEU A 1 16 ? 12.562  0.630   5.808   1.00 0.00 ? 20 LEU A CB   4  
ATOM 6754  C CG   . LEU A 1 16 ? 11.646  1.831   5.564   1.00 0.00 ? 20 LEU A CG   4  
ATOM 6755  C CD1  . LEU A 1 16 ? 11.032  1.777   4.164   1.00 0.00 ? 20 LEU A CD1  4  
ATOM 6756  C CD2  . LEU A 1 16 ? 10.578  1.937   6.655   1.00 0.00 ? 20 LEU A CD2  4  
ATOM 6757  H H    . LEU A 1 16 ? 14.750  -0.651  6.083   1.00 0.00 ? 20 LEU A H    4  
ATOM 6758  H HA   . LEU A 1 16 ? 12.945  -0.162  3.875   1.00 0.00 ? 20 LEU A HA   4  
ATOM 6759  H HB2  . LEU A 1 16 ? 11.940  -0.242  6.005   1.00 0.00 ? 20 LEU A HB2  4  
ATOM 6760  H HB3  . LEU A 1 16 ? 13.142  0.819   6.712   1.00 0.00 ? 20 LEU A HB3  4  
ATOM 6761  H HG   . LEU A 1 16 ? 12.250  2.738   5.616   1.00 0.00 ? 20 LEU A HG   4  
ATOM 6762  H HD11 . LEU A 1 16 ? 11.805  1.523   3.438   1.00 0.00 ? 20 LEU A HD11 4  
ATOM 6763  H HD12 . LEU A 1 16 ? 10.248  1.020   4.141   1.00 0.00 ? 20 LEU A HD12 4  
ATOM 6764  H HD13 . LEU A 1 16 ? 10.607  2.749   3.916   1.00 0.00 ? 20 LEU A HD13 4  
ATOM 6765  H HD21 . LEU A 1 16 ? 11.036  1.765   7.629   1.00 0.00 ? 20 LEU A HD21 4  
ATOM 6766  H HD22 . LEU A 1 16 ? 10.134  2.932   6.633   1.00 0.00 ? 20 LEU A HD22 4  
ATOM 6767  H HD23 . LEU A 1 16 ? 9.805   1.189   6.480   1.00 0.00 ? 20 LEU A HD23 4  
ATOM 6768  N N    . LYS A 1 17 ? 15.566  1.305   3.881   1.00 0.00 ? 21 LYS A N    4  
ATOM 6769  C CA   . LYS A 1 17 ? 16.398  2.369   3.346   1.00 0.00 ? 21 LYS A CA   4  
ATOM 6770  C C    . LYS A 1 17 ? 16.378  2.307   1.817   1.00 0.00 ? 21 LYS A C    4  
ATOM 6771  O O    . LYS A 1 17 ? 16.737  3.275   1.148   1.00 0.00 ? 21 LYS A O    4  
ATOM 6772  C CB   . LYS A 1 17 ? 17.804  2.304   3.946   1.00 0.00 ? 21 LYS A CB   4  
ATOM 6773  C CG   . LYS A 1 17 ? 18.837  2.903   2.989   1.00 0.00 ? 21 LYS A CG   4  
ATOM 6774  C CD   . LYS A 1 17 ? 18.666  4.419   2.877   1.00 0.00 ? 21 LYS A CD   4  
ATOM 6775  C CE   . LYS A 1 17 ? 20.003  5.137   3.071   1.00 0.00 ? 21 LYS A CE   4  
ATOM 6776  N NZ   . LYS A 1 17 ? 20.459  5.014   4.473   1.00 0.00 ? 21 LYS A NZ   4  
ATOM 6777  H H    . LYS A 1 17 ? 16.042  0.442   4.051   1.00 0.00 ? 21 LYS A H    4  
ATOM 6778  H HA   . LYS A 1 17 ? 15.958  3.316   3.659   1.00 0.00 ? 21 LYS A HA   4  
ATOM 6779  H HB2  . LYS A 1 17 ? 17.825  2.842   4.893   1.00 0.00 ? 21 LYS A HB2  4  
ATOM 6780  H HB3  . LYS A 1 17 ? 18.062  1.267   4.163   1.00 0.00 ? 21 LYS A HB3  4  
ATOM 6781  H HG2  . LYS A 1 17 ? 19.842  2.671   3.341   1.00 0.00 ? 21 LYS A HG2  4  
ATOM 6782  H HG3  . LYS A 1 17 ? 18.732  2.448   2.004   1.00 0.00 ? 21 LYS A HG3  4  
ATOM 6783  H HD2  . LYS A 1 17 ? 18.252  4.671   1.901   1.00 0.00 ? 21 LYS A HD2  4  
ATOM 6784  H HD3  . LYS A 1 17 ? 17.952  4.764   3.625   1.00 0.00 ? 21 LYS A HD3  4  
ATOM 6785  H HE2  . LYS A 1 17 ? 20.751  4.712   2.401   1.00 0.00 ? 21 LYS A HE2  4  
ATOM 6786  H HE3  . LYS A 1 17 ? 19.900  6.189   2.806   1.00 0.00 ? 21 LYS A HE3  4  
ATOM 6787  H HZ1  . LYS A 1 17 ? 19.745  5.352   5.087   1.00 0.00 ? 21 LYS A HZ1  4  
ATOM 6788  H HZ2  . LYS A 1 17 ? 20.649  4.055   4.680   1.00 0.00 ? 21 LYS A HZ2  4  
ATOM 6789  H HZ3  . LYS A 1 17 ? 21.291  5.554   4.602   1.00 0.00 ? 21 LYS A HZ3  4  
ATOM 6790  N N    . ASN A 1 18 ? 15.955  1.159   1.309   1.00 0.00 ? 22 ASN A N    4  
ATOM 6791  C CA   . ASN A 1 18 ? 15.883  0.958   -0.128  1.00 0.00 ? 22 ASN A CA   4  
ATOM 6792  C C    . ASN A 1 18 ? 14.444  1.178   -0.598  1.00 0.00 ? 22 ASN A C    4  
ATOM 6793  O O    . ASN A 1 18 ? 14.215  1.767   -1.654  1.00 0.00 ? 22 ASN A O    4  
ATOM 6794  C CB   . ASN A 1 18 ? 16.292  -0.467  -0.506  1.00 0.00 ? 22 ASN A CB   4  
ATOM 6795  C CG   . ASN A 1 18 ? 17.741  -0.511  -0.995  1.00 0.00 ? 22 ASN A CG   4  
ATOM 6796  O OD1  . ASN A 1 18 ? 18.207  0.356   -1.715  1.00 0.00 ? 22 ASN A OD1  4  
ATOM 6797  N ND2  . ASN A 1 18 ? 18.426  -1.567  -0.563  1.00 0.00 ? 22 ASN A ND2  4  
ATOM 6798  H H    . ASN A 1 18 ? 15.665  0.377   1.860   1.00 0.00 ? 22 ASN A H    4  
ATOM 6799  H HA   . ASN A 1 18 ? 16.577  1.683   -0.554  1.00 0.00 ? 22 ASN A HA   4  
ATOM 6800  H HB2  . ASN A 1 18 ? 16.175  -1.124  0.357   1.00 0.00 ? 22 ASN A HB2  4  
ATOM 6801  H HB3  . ASN A 1 18 ? 15.630  -0.845  -1.285  1.00 0.00 ? 22 ASN A HB3  4  
ATOM 6802  H HD21 . ASN A 1 18 ? 17.984  -2.242  0.027   1.00 0.00 ? 22 ASN A HD21 4  
ATOM 6803  H HD22 . ASN A 1 18 ? 19.383  -1.685  -0.829  1.00 0.00 ? 22 ASN A HD22 4  
ATOM 6804  N N    . ILE A 1 19 ? 13.511  0.692   0.207   1.00 0.00 ? 23 ILE A N    4  
ATOM 6805  C CA   . ILE A 1 19 ? 12.101  0.827   -0.113  1.00 0.00 ? 23 ILE A CA   4  
ATOM 6806  C C    . ILE A 1 19 ? 11.760  2.310   -0.277  1.00 0.00 ? 23 ILE A C    4  
ATOM 6807  O O    . ILE A 1 19 ? 12.084  3.124   0.586   1.00 0.00 ? 23 ILE A O    4  
ATOM 6808  C CB   . ILE A 1 19 ? 11.243  0.111   0.931   1.00 0.00 ? 23 ILE A CB   4  
ATOM 6809  C CG1  . ILE A 1 19 ? 10.998  -1.346  0.534   1.00 0.00 ? 23 ILE A CG1  4  
ATOM 6810  C CG2  . ILE A 1 19 ? 9.934   0.865   1.177   1.00 0.00 ? 23 ILE A CG2  4  
ATOM 6811  C CD1  . ILE A 1 19 ? 11.289  -2.290  1.702   1.00 0.00 ? 23 ILE A CD1  4  
ATOM 6812  H H    . ILE A 1 19 ? 13.706  0.213   1.064   1.00 0.00 ? 23 ILE A H    4  
ATOM 6813  H HA   . ILE A 1 19 ? 11.933  0.327   -1.067  1.00 0.00 ? 23 ILE A HA   4  
ATOM 6814  H HB   . ILE A 1 19 ? 11.790  0.100   1.874   1.00 0.00 ? 23 ILE A HB   4  
ATOM 6815  H HG12 . ILE A 1 19 ? 9.964   -1.470  0.210   1.00 0.00 ? 23 ILE A HG12 4  
ATOM 6816  H HG13 . ILE A 1 19 ? 11.631  -1.607  -0.315  1.00 0.00 ? 23 ILE A HG13 4  
ATOM 6817  H HG21 . ILE A 1 19 ? 9.523   1.199   0.225   1.00 0.00 ? 23 ILE A HG21 4  
ATOM 6818  H HG22 . ILE A 1 19 ? 9.221   0.204   1.669   1.00 0.00 ? 23 ILE A HG22 4  
ATOM 6819  H HG23 . ILE A 1 19 ? 10.127  1.729   1.812   1.00 0.00 ? 23 ILE A HG23 4  
ATOM 6820  H HD11 . ILE A 1 19 ? 12.068  -1.860  2.331   1.00 0.00 ? 23 ILE A HD11 4  
ATOM 6821  H HD12 . ILE A 1 19 ? 10.383  -2.429  2.291   1.00 0.00 ? 23 ILE A HD12 4  
ATOM 6822  H HD13 . ILE A 1 19 ? 11.623  -3.253  1.317   1.00 0.00 ? 23 ILE A HD13 4  
ATOM 6823  N N    . GLN A 1 20 ? 11.110  2.615   -1.390  1.00 0.00 ? 24 GLN A N    4  
ATOM 6824  C CA   . GLN A 1 20 ? 10.722  3.986   -1.678  1.00 0.00 ? 24 GLN A CA   4  
ATOM 6825  C C    . GLN A 1 20 ? 9.197   4.113   -1.696  1.00 0.00 ? 24 GLN A C    4  
ATOM 6826  O O    . GLN A 1 20 ? 8.658   5.193   -1.463  1.00 0.00 ? 24 GLN A O    4  
ATOM 6827  C CB   . GLN A 1 20 ? 11.327  4.461   -3.001  1.00 0.00 ? 24 GLN A CB   4  
ATOM 6828  C CG   . GLN A 1 20 ? 11.697  5.944   -2.932  1.00 0.00 ? 24 GLN A CG   4  
ATOM 6829  C CD   . GLN A 1 20 ? 10.980  6.739   -4.026  1.00 0.00 ? 24 GLN A CD   4  
ATOM 6830  O OE1  . GLN A 1 20 ? 11.578  7.212   -4.979  1.00 0.00 ? 24 GLN A OE1  4  
ATOM 6831  N NE2  . GLN A 1 20 ? 9.669   6.859   -3.836  1.00 0.00 ? 24 GLN A NE2  4  
ATOM 6832  H H    . GLN A 1 20 ? 10.850  1.947   -2.087  1.00 0.00 ? 24 GLN A H    4  
ATOM 6833  H HA   . GLN A 1 20 ? 11.133  4.581   -0.863  1.00 0.00 ? 24 GLN A HA   4  
ATOM 6834  H HB2  . GLN A 1 20 ? 12.214  3.871   -3.231  1.00 0.00 ? 24 GLN A HB2  4  
ATOM 6835  H HB3  . GLN A 1 20 ? 10.616  4.297   -3.810  1.00 0.00 ? 24 GLN A HB3  4  
ATOM 6836  H HG2  . GLN A 1 20 ? 11.432  6.344   -1.954  1.00 0.00 ? 24 GLN A HG2  4  
ATOM 6837  H HG3  . GLN A 1 20 ? 12.776  6.059   -3.042  1.00 0.00 ? 24 GLN A HG3  4  
ATOM 6838  H HE21 . GLN A 1 20 ? 9.241   6.446   -3.032  1.00 0.00 ? 24 GLN A HE21 4  
ATOM 6839  H HE22 . GLN A 1 20 ? 9.112   7.362   -4.497  1.00 0.00 ? 24 GLN A HE22 4  
ATOM 6840  N N    . SER A 1 21 ? 8.545   2.994   -1.976  1.00 0.00 ? 25 SER A N    4  
ATOM 6841  C CA   . SER A 1 21 ? 7.093   2.966   -2.028  1.00 0.00 ? 25 SER A CA   4  
ATOM 6842  C C    . SER A 1 21 ? 6.577   1.623   -1.508  1.00 0.00 ? 25 SER A C    4  
ATOM 6843  O O    . SER A 1 21 ? 7.339   0.666   -1.386  1.00 0.00 ? 25 SER A O    4  
ATOM 6844  C CB   . SER A 1 21 ? 6.588   3.214   -3.451  1.00 0.00 ? 25 SER A CB   4  
ATOM 6845  O OG   . SER A 1 21 ? 7.621   3.691   -4.309  1.00 0.00 ? 25 SER A OG   4  
ATOM 6846  H H    . SER A 1 21 ? 8.992   2.119   -2.166  1.00 0.00 ? 25 SER A H    4  
ATOM 6847  H HA   . SER A 1 21 ? 6.766   3.779   -1.380  1.00 0.00 ? 25 SER A HA   4  
ATOM 6848  H HB2  . SER A 1 21 ? 6.178   2.289   -3.856  1.00 0.00 ? 25 SER A HB2  4  
ATOM 6849  H HB3  . SER A 1 21 ? 5.775   3.939   -3.425  1.00 0.00 ? 25 SER A HB3  4  
ATOM 6850  H HG   . SER A 1 21 ? 8.516   3.437   -3.941  1.00 0.00 ? 25 SER A HG   4  
ATOM 6851  N N    . VAL A 1 22 ? 5.285   1.596   -1.215  1.00 0.00 ? 26 VAL A N    4  
ATOM 6852  C CA   . VAL A 1 22 ? 4.657   0.386   -0.711  1.00 0.00 ? 26 VAL A CA   4  
ATOM 6853  C C    . VAL A 1 22 ? 3.376   0.114   -1.501  1.00 0.00 ? 26 VAL A C    4  
ATOM 6854  O O    . VAL A 1 22 ? 2.585   1.026   -1.741  1.00 0.00 ? 26 VAL A O    4  
ATOM 6855  C CB   . VAL A 1 22 ? 4.416   0.510   0.795   1.00 0.00 ? 26 VAL A CB   4  
ATOM 6856  C CG1  . VAL A 1 22 ? 3.438   -0.560  1.284   1.00 0.00 ? 26 VAL A CG1  4  
ATOM 6857  C CG2  . VAL A 1 22 ? 5.735   0.442   1.569   1.00 0.00 ? 26 VAL A CG2  4  
ATOM 6858  H H    . VAL A 1 22 ? 4.672   2.379   -1.317  1.00 0.00 ? 26 VAL A H    4  
ATOM 6859  H HA   . VAL A 1 22 ? 5.352   -0.438  -0.875  1.00 0.00 ? 26 VAL A HA   4  
ATOM 6860  H HB   . VAL A 1 22 ? 3.968   1.486   0.983   1.00 0.00 ? 26 VAL A HB   4  
ATOM 6861  H HG11 . VAL A 1 22 ? 2.507   -0.485  0.721   1.00 0.00 ? 26 VAL A HG11 4  
ATOM 6862  H HG12 . VAL A 1 22 ? 3.875   -1.547  1.135   1.00 0.00 ? 26 VAL A HG12 4  
ATOM 6863  H HG13 . VAL A 1 22 ? 3.234   -0.409  2.344   1.00 0.00 ? 26 VAL A HG13 4  
ATOM 6864  H HG21 . VAL A 1 22 ? 6.528   0.896   0.975   1.00 0.00 ? 26 VAL A HG21 4  
ATOM 6865  H HG22 . VAL A 1 22 ? 5.632   0.982   2.510   1.00 0.00 ? 26 VAL A HG22 4  
ATOM 6866  H HG23 . VAL A 1 22 ? 5.983   -0.599  1.772   1.00 0.00 ? 26 VAL A HG23 4  
ATOM 6867  N N    . LYS A 1 23 ? 3.210   -1.143  -1.883  1.00 0.00 ? 27 LYS A N    4  
ATOM 6868  C CA   . LYS A 1 23 ? 2.037   -1.546  -2.641  1.00 0.00 ? 27 LYS A CA   4  
ATOM 6869  C C    . LYS A 1 23 ? 1.429   -2.797  -2.004  1.00 0.00 ? 27 LYS A C    4  
ATOM 6870  O O    . LYS A 1 23 ? 2.092   -3.827  -1.892  1.00 0.00 ? 27 LYS A O    4  
ATOM 6871  C CB   . LYS A 1 23 ? 2.389   -1.719  -4.120  1.00 0.00 ? 27 LYS A CB   4  
ATOM 6872  C CG   . LYS A 1 23 ? 1.198   -2.271  -4.906  1.00 0.00 ? 27 LYS A CG   4  
ATOM 6873  C CD   . LYS A 1 23 ? -0.060  -1.439  -4.651  1.00 0.00 ? 27 LYS A CD   4  
ATOM 6874  C CE   . LYS A 1 23 ? -1.265  -2.025  -5.391  1.00 0.00 ? 27 LYS A CE   4  
ATOM 6875  N NZ   . LYS A 1 23 ? -2.020  -0.955  -6.080  1.00 0.00 ? 27 LYS A NZ   4  
ATOM 6876  H H    . LYS A 1 23 ? 3.858   -1.878  -1.684  1.00 0.00 ? 27 LYS A H    4  
ATOM 6877  H HA   . LYS A 1 23 ? 1.311   -0.737  -2.575  1.00 0.00 ? 27 LYS A HA   4  
ATOM 6878  H HB2  . LYS A 1 23 ? 2.694   -0.760  -4.540  1.00 0.00 ? 27 LYS A HB2  4  
ATOM 6879  H HB3  . LYS A 1 23 ? 3.239   -2.394  -4.219  1.00 0.00 ? 27 LYS A HB3  4  
ATOM 6880  H HG2  . LYS A 1 23 ? 1.429   -2.270  -5.972  1.00 0.00 ? 27 LYS A HG2  4  
ATOM 6881  H HG3  . LYS A 1 23 ? 1.017   -3.307  -4.620  1.00 0.00 ? 27 LYS A HG3  4  
ATOM 6882  H HD2  . LYS A 1 23 ? -0.267  -1.405  -3.581  1.00 0.00 ? 27 LYS A HD2  4  
ATOM 6883  H HD3  . LYS A 1 23 ? 0.106   -0.412  -4.976  1.00 0.00 ? 27 LYS A HD3  4  
ATOM 6884  H HE2  . LYS A 1 23 ? -0.928  -2.766  -6.116  1.00 0.00 ? 27 LYS A HE2  4  
ATOM 6885  H HE3  . LYS A 1 23 ? -1.916  -2.542  -4.686  1.00 0.00 ? 27 LYS A HE3  4  
ATOM 6886  H HZ1  . LYS A 1 23 ? -2.328  -0.280  -5.410  1.00 0.00 ? 27 LYS A HZ1  4  
ATOM 6887  H HZ2  . LYS A 1 23 ? -1.429  -0.511  -6.754  1.00 0.00 ? 27 LYS A HZ2  4  
ATOM 6888  H HZ3  . LYS A 1 23 ? -2.813  -1.352  -6.543  1.00 0.00 ? 27 LYS A HZ3  4  
ATOM 6889  N N    . VAL A 1 24 ? 0.173   -2.667  -1.603  1.00 0.00 ? 28 VAL A N    4  
ATOM 6890  C CA   . VAL A 1 24 ? -0.533  -3.773  -0.980  1.00 0.00 ? 28 VAL A CA   4  
ATOM 6891  C C    . VAL A 1 24 ? -1.663  -4.236  -1.902  1.00 0.00 ? 28 VAL A C    4  
ATOM 6892  O O    . VAL A 1 24 ? -2.544  -3.452  -2.252  1.00 0.00 ? 28 VAL A O    4  
ATOM 6893  C CB   . VAL A 1 24 ? -1.025  -3.364  0.410   1.00 0.00 ? 28 VAL A CB   4  
ATOM 6894  C CG1  . VAL A 1 24 ? -2.280  -4.147  0.799   1.00 0.00 ? 28 VAL A CG1  4  
ATOM 6895  C CG2  . VAL A 1 24 ? 0.078   -3.541  1.455   1.00 0.00 ? 28 VAL A CG2  4  
ATOM 6896  H H    . VAL A 1 24 ? -0.360  -1.826  -1.698  1.00 0.00 ? 28 VAL A H    4  
ATOM 6897  H HA   . VAL A 1 24 ? 0.178   -4.591  -0.860  1.00 0.00 ? 28 VAL A HA   4  
ATOM 6898  H HB   . VAL A 1 24 ? -1.287  -2.307  0.375   1.00 0.00 ? 28 VAL A HB   4  
ATOM 6899  H HG11 . VAL A 1 24 ? -2.306  -5.089  0.251   1.00 0.00 ? 28 VAL A HG11 4  
ATOM 6900  H HG12 . VAL A 1 24 ? -2.265  -4.350  1.870   1.00 0.00 ? 28 VAL A HG12 4  
ATOM 6901  H HG13 . VAL A 1 24 ? -3.165  -3.560  0.553   1.00 0.00 ? 28 VAL A HG13 4  
ATOM 6902  H HG21 . VAL A 1 24 ? 0.431   -4.572  1.440   1.00 0.00 ? 28 VAL A HG21 4  
ATOM 6903  H HG22 . VAL A 1 24 ? 0.906   -2.869  1.227   1.00 0.00 ? 28 VAL A HG22 4  
ATOM 6904  H HG23 . VAL A 1 24 ? -0.318  -3.307  2.444   1.00 0.00 ? 28 VAL A HG23 4  
ATOM 6905  N N    . LYS A 1 25 ? -1.601  -5.507  -2.270  1.00 0.00 ? 29 LYS A N    4  
ATOM 6906  C CA   . LYS A 1 25 ? -2.608  -6.083  -3.144  1.00 0.00 ? 29 LYS A CA   4  
ATOM 6907  C C    . LYS A 1 25 ? -3.230  -7.305  -2.464  1.00 0.00 ? 29 LYS A C    4  
ATOM 6908  O O    . LYS A 1 25 ? -2.779  -8.431  -2.669  1.00 0.00 ? 29 LYS A O    4  
ATOM 6909  C CB   . LYS A 1 25 ? -2.014  -6.383  -4.522  1.00 0.00 ? 29 LYS A CB   4  
ATOM 6910  C CG   . LYS A 1 25 ? -3.080  -6.280  -5.614  1.00 0.00 ? 29 LYS A CG   4  
ATOM 6911  C CD   . LYS A 1 25 ? -3.923  -7.555  -5.679  1.00 0.00 ? 29 LYS A CD   4  
ATOM 6912  C CE   . LYS A 1 25 ? -4.482  -7.771  -7.087  1.00 0.00 ? 29 LYS A CE   4  
ATOM 6913  N NZ   . LYS A 1 25 ? -5.015  -9.144  -7.228  1.00 0.00 ? 29 LYS A NZ   4  
ATOM 6914  H H    . LYS A 1 25 ? -0.881  -6.138  -1.981  1.00 0.00 ? 29 LYS A H    4  
ATOM 6915  H HA   . LYS A 1 25 ? -3.386  -5.333  -3.286  1.00 0.00 ? 29 LYS A HA   4  
ATOM 6916  H HB2  . LYS A 1 25 ? -1.204  -5.685  -4.733  1.00 0.00 ? 29 LYS A HB2  4  
ATOM 6917  H HB3  . LYS A 1 25 ? -1.580  -7.383  -4.525  1.00 0.00 ? 29 LYS A HB3  4  
ATOM 6918  H HG2  . LYS A 1 25 ? -3.725  -5.423  -5.417  1.00 0.00 ? 29 LYS A HG2  4  
ATOM 6919  H HG3  . LYS A 1 25 ? -2.603  -6.105  -6.578  1.00 0.00 ? 29 LYS A HG3  4  
ATOM 6920  H HD2  . LYS A 1 25 ? -3.315  -8.412  -5.390  1.00 0.00 ? 29 LYS A HD2  4  
ATOM 6921  H HD3  . LYS A 1 25 ? -4.744  -7.490  -4.965  1.00 0.00 ? 29 LYS A HD3  4  
ATOM 6922  H HE2  . LYS A 1 25 ? -5.271  -7.046  -7.287  1.00 0.00 ? 29 LYS A HE2  4  
ATOM 6923  H HE3  . LYS A 1 25 ? -3.698  -7.601  -7.826  1.00 0.00 ? 29 LYS A HE3  4  
ATOM 6924  H HZ1  . LYS A 1 25 ? -4.729  -9.695  -6.444  1.00 0.00 ? 29 LYS A HZ1  4  
ATOM 6925  H HZ2  . LYS A 1 25 ? -6.014  -9.112  -7.266  1.00 0.00 ? 29 LYS A HZ2  4  
ATOM 6926  H HZ3  . LYS A 1 25 ? -4.663  -9.554  -8.070  1.00 0.00 ? 29 LYS A HZ3  4  
ATOM 6927  N N    . SER A 1 26 ? -4.255  -7.040  -1.668  1.00 0.00 ? 30 SER A N    4  
ATOM 6928  C CA   . SER A 1 26 ? -4.944  -8.104  -0.956  1.00 0.00 ? 30 SER A CA   4  
ATOM 6929  C C    . SER A 1 26 ? -5.271  -9.249  -1.916  1.00 0.00 ? 30 SER A C    4  
ATOM 6930  O O    . SER A 1 26 ? -5.009  -9.155  -3.114  1.00 0.00 ? 30 SER A O    4  
ATOM 6931  C CB   . SER A 1 26 ? -6.221  -7.586  -0.292  1.00 0.00 ? 30 SER A CB   4  
ATOM 6932  O OG   . SER A 1 26 ? -7.391  -7.993  -0.997  1.00 0.00 ? 30 SER A OG   4  
ATOM 6933  H H    . SER A 1 26 ? -4.616  -6.122  -1.506  1.00 0.00 ? 30 SER A H    4  
ATOM 6934  H HA   . SER A 1 26 ? -4.245  -8.436  -0.188  1.00 0.00 ? 30 SER A HA   4  
ATOM 6935  H HB2  . SER A 1 26 ? -6.270  -7.951  0.734   1.00 0.00 ? 30 SER A HB2  4  
ATOM 6936  H HB3  . SER A 1 26 ? -6.188  -6.497  -0.242  1.00 0.00 ? 30 SER A HB3  4  
ATOM 6937  H HG   . SER A 1 26 ? -7.526  -7.412  -1.800  1.00 0.00 ? 30 SER A HG   4  
ATOM 6938  N N    . PRO A 1 27 ? -5.854  -10.334 -1.338  1.00 0.00 ? 31 PRO A N    4  
ATOM 6939  C CA   . PRO A 1 27 ? -6.220  -11.497 -2.129  1.00 0.00 ? 31 PRO A CA   4  
ATOM 6940  C C    . PRO A 1 27 ? -7.475  -11.221 -2.961  1.00 0.00 ? 31 PRO A C    4  
ATOM 6941  O O    . PRO A 1 27 ? -8.088  -10.163 -2.834  1.00 0.00 ? 31 PRO A O    4  
ATOM 6942  C CB   . PRO A 1 27 ? -6.412  -12.616 -1.119  1.00 0.00 ? 31 PRO A CB   4  
ATOM 6943  C CG   . PRO A 1 27 ? -6.602  -11.934 0.227   1.00 0.00 ? 31 PRO A CG   4  
ATOM 6944  C CD   . PRO A 1 27 ? -6.180  -10.482 0.077   1.00 0.00 ? 31 PRO A CD   4  
ATOM 6945  H HA   . PRO A 1 27 ? -5.498  -11.710 -2.787  1.00 0.00 ? 31 PRO A HA   4  
ATOM 6946  H HB2  . PRO A 1 27 ? -7.277  -13.227 -1.372  1.00 0.00 ? 31 PRO A HB2  4  
ATOM 6947  H HB3  . PRO A 1 27 ? -5.547  -13.279 -1.102  1.00 0.00 ? 31 PRO A HB3  4  
ATOM 6948  H HG2  . PRO A 1 27 ? -7.642  -11.999 0.544   1.00 0.00 ? 31 PRO A HG2  4  
ATOM 6949  H HG3  . PRO A 1 27 ? -6.004  -12.428 0.993   1.00 0.00 ? 31 PRO A HG3  4  
ATOM 6950  H HD2  . PRO A 1 27 ? -6.981  -9.804  0.372   1.00 0.00 ? 31 PRO A HD2  4  
ATOM 6951  H HD3  . PRO A 1 27 ? -5.321  -10.252 0.707   1.00 0.00 ? 31 PRO A HD3  4  
ATOM 6952  N N    . GLY A 1 28 ? -7.818  -12.192 -3.794  1.00 0.00 ? 32 GLY A N    4  
ATOM 6953  C CA   . GLY A 1 28 ? -8.988  -12.068 -4.647  1.00 0.00 ? 32 GLY A CA   4  
ATOM 6954  C C    . GLY A 1 28 ? -9.601  -13.439 -4.940  1.00 0.00 ? 32 GLY A C    4  
ATOM 6955  O O    . GLY A 1 28 ? -9.315  -14.412 -4.245  1.00 0.00 ? 32 GLY A O    4  
ATOM 6956  H H    . GLY A 1 28 ? -7.314  -13.050 -3.892  1.00 0.00 ? 32 GLY A H    4  
ATOM 6957  H HA2  . GLY A 1 28 ? -9.729  -11.430 -4.164  1.00 0.00 ? 32 GLY A HA2  4  
ATOM 6958  H HA3  . GLY A 1 28 ? -8.711  -11.582 -5.582  1.00 0.00 ? 32 GLY A HA3  4  
ATOM 6959  N N    . PRO A 1 29 ? -10.455 -13.472 -5.998  1.00 0.00 ? 33 PRO A N    4  
ATOM 6960  C CA   . PRO A 1 29 ? -11.111 -14.707 -6.392  1.00 0.00 ? 33 PRO A CA   4  
ATOM 6961  C C    . PRO A 1 29 ? -10.134 -15.643 -7.107  1.00 0.00 ? 33 PRO A C    4  
ATOM 6962  O O    . PRO A 1 29 ? -10.511 -16.735 -7.530  1.00 0.00 ? 33 PRO A O    4  
ATOM 6963  C CB   . PRO A 1 29 ? -12.270 -14.273 -7.274  1.00 0.00 ? 33 PRO A CB   4  
ATOM 6964  C CG   . PRO A 1 29 ? -11.947 -12.856 -7.719  1.00 0.00 ? 33 PRO A CG   4  
ATOM 6965  C CD   . PRO A 1 29 ? -10.817 -12.339 -6.845  1.00 0.00 ? 33 PRO A CD   4  
ATOM 6966  H HA   . PRO A 1 29 ? -11.426 -15.206 -5.585  1.00 0.00 ? 33 PRO A HA   4  
ATOM 6967  H HB2  . PRO A 1 29 ? -12.378 -14.937 -8.132  1.00 0.00 ? 33 PRO A HB2  4  
ATOM 6968  H HB3  . PRO A 1 29 ? -13.211 -14.306 -6.726  1.00 0.00 ? 33 PRO A HB3  4  
ATOM 6969  H HG2  . PRO A 1 29 ? -11.654 -12.843 -8.769  1.00 0.00 ? 33 PRO A HG2  4  
ATOM 6970  H HG3  . PRO A 1 29 ? -12.826 -12.217 -7.626  1.00 0.00 ? 33 PRO A HG3  4  
ATOM 6971  H HD2  . PRO A 1 29 ? -9.971  -12.008 -7.446  1.00 0.00 ? 33 PRO A HD2  4  
ATOM 6972  H HD3  . PRO A 1 29 ? -11.137 -11.485 -6.248  1.00 0.00 ? 33 PRO A HD3  4  
ATOM 6973  N N    . HIS A 1 30 ? -8.897  -15.182 -7.219  1.00 0.00 ? 34 HIS A N    4  
ATOM 6974  C CA   . HIS A 1 30 ? -7.863  -15.964 -7.875  1.00 0.00 ? 34 HIS A CA   4  
ATOM 6975  C C    . HIS A 1 30 ? -6.815  -16.395 -6.846  1.00 0.00 ? 34 HIS A C    4  
ATOM 6976  O O    . HIS A 1 30 ? -6.456  -17.569 -6.775  1.00 0.00 ? 34 HIS A O    4  
ATOM 6977  C CB   . HIS A 1 30 ? -7.258  -15.190 -9.048  1.00 0.00 ? 34 HIS A CB   4  
ATOM 6978  C CG   . HIS A 1 30 ? -7.211  -13.695 -8.839  1.00 0.00 ? 34 HIS A CG   4  
ATOM 6979  N ND1  . HIS A 1 30 ? -8.350  -12.916 -8.740  1.00 0.00 ? 34 HIS A ND1  4  
ATOM 6980  C CD2  . HIS A 1 30 ? -6.150  -12.847 -8.709  1.00 0.00 ? 34 HIS A CD2  4  
ATOM 6981  C CE1  . HIS A 1 30 ? -7.980  -11.656 -8.561  1.00 0.00 ? 34 HIS A CE1  4  
ATOM 6982  N NE2  . HIS A 1 30 ? -6.616  -11.616 -8.543  1.00 0.00 ? 34 HIS A NE2  4  
ATOM 6983  H H    . HIS A 1 30 ? -8.598  -14.293 -6.872  1.00 0.00 ? 34 HIS A H    4  
ATOM 6984  H HA   . HIS A 1 30 ? -8.350  -16.852 -8.278  1.00 0.00 ? 34 HIS A HA   4  
ATOM 6985  H HB2  . HIS A 1 30 ? -6.247  -15.554 -9.227  1.00 0.00 ? 34 HIS A HB2  4  
ATOM 6986  H HB3  . HIS A 1 30 ? -7.837  -15.403 -9.947  1.00 0.00 ? 34 HIS A HB3  4  
ATOM 6987  H HD1  . HIS A 1 30 ? -9.292  -13.246 -8.796  1.00 0.00 ? 34 HIS A HD1  4  
ATOM 6988  H HD2  . HIS A 1 30 ? -5.099  -13.132 -8.738  1.00 0.00 ? 34 HIS A HD2  4  
ATOM 6989  H HE1  . HIS A 1 30 ? -8.648  -10.802 -8.448  1.00 0.00 ? 34 HIS A HE1  4  
ATOM 6990  N N    . CYS A 1 31 ? -6.355  -15.421 -6.074  1.00 0.00 ? 35 CYS A N    4  
ATOM 6991  C CA   . CYS A 1 31 ? -5.356  -15.685 -5.053  1.00 0.00 ? 35 CYS A CA   4  
ATOM 6992  C C    . CYS A 1 31 ? -5.958  -15.336 -3.690  1.00 0.00 ? 35 CYS A C    4  
ATOM 6993  O O    . CYS A 1 31 ? -6.353  -14.195 -3.456  1.00 0.00 ? 35 CYS A O    4  
ATOM 6994  C CB   . CYS A 1 31 ? -4.060  -14.916 -5.317  1.00 0.00 ? 35 CYS A CB   4  
ATOM 6995  S SG   . CYS A 1 31 ? -2.542  -15.938 -5.293  1.00 0.00 ? 35 CYS A SG   4  
ATOM 6996  H H    . CYS A 1 31 ? -6.653  -14.469 -6.138  1.00 0.00 ? 35 CYS A H    4  
ATOM 6997  H HA   . CYS A 1 31 ? -5.121  -16.748 -5.112  1.00 0.00 ? 35 CYS A HA   4  
ATOM 6998  H HB2  . CYS A 1 31 ? -4.136  -14.427 -6.288  1.00 0.00 ? 35 CYS A HB2  4  
ATOM 6999  H HB3  . CYS A 1 31 ? -3.962  -14.128 -4.570  1.00 0.00 ? 35 CYS A HB3  4  
ATOM 7000  N N    . ALA A 1 32 ? -6.010  -16.341 -2.828  1.00 0.00 ? 36 ALA A N    4  
ATOM 7001  C CA   . ALA A 1 32 ? -6.558  -16.154 -1.495  1.00 0.00 ? 36 ALA A CA   4  
ATOM 7002  C C    . ALA A 1 32 ? -5.428  -15.786 -0.531  1.00 0.00 ? 36 ALA A C    4  
ATOM 7003  O O    . ALA A 1 32 ? -5.540  -16.005 0.675   1.00 0.00 ? 36 ALA A O    4  
ATOM 7004  C CB   . ALA A 1 32 ? -7.300  -17.422 -1.066  1.00 0.00 ? 36 ALA A CB   4  
ATOM 7005  H H    . ALA A 1 32 ? -5.687  -17.266 -3.026  1.00 0.00 ? 36 ALA A H    4  
ATOM 7006  H HA   . ALA A 1 32 ? -7.269  -15.330 -1.540  1.00 0.00 ? 36 ALA A HA   4  
ATOM 7007  H HB1  . ALA A 1 32 ? -7.464  -18.059 -1.935  1.00 0.00 ? 36 ALA A HB1  4  
ATOM 7008  H HB2  . ALA A 1 32 ? -6.705  -17.960 -0.328  1.00 0.00 ? 36 ALA A HB2  4  
ATOM 7009  H HB3  . ALA A 1 32 ? -8.261  -17.150 -0.629  1.00 0.00 ? 36 ALA A HB3  4  
ATOM 7010  N N    . GLN A 1 33 ? -4.366  -15.234 -1.098  1.00 0.00 ? 37 GLN A N    4  
ATOM 7011  C CA   . GLN A 1 33 ? -3.217  -14.833 -0.304  1.00 0.00 ? 37 GLN A CA   4  
ATOM 7012  C C    . GLN A 1 33 ? -2.875  -13.366 -0.567  1.00 0.00 ? 37 GLN A C    4  
ATOM 7013  O O    . GLN A 1 33 ? -3.277  -12.804 -1.585  1.00 0.00 ? 37 GLN A O    4  
ATOM 7014  C CB   . GLN A 1 33 ? -2.014  -15.736 -0.586  1.00 0.00 ? 37 GLN A CB   4  
ATOM 7015  C CG   . GLN A 1 33 ? -2.411  -17.212 -0.531  1.00 0.00 ? 37 GLN A CG   4  
ATOM 7016  C CD   . GLN A 1 33 ? -2.178  -17.792 0.865   1.00 0.00 ? 37 GLN A CD   4  
ATOM 7017  O OE1  . GLN A 1 33 ? -1.189  -17.513 1.524   1.00 0.00 ? 37 GLN A OE1  4  
ATOM 7018  N NE2  . GLN A 1 33 ? -3.139  -18.612 1.279   1.00 0.00 ? 37 GLN A NE2  4  
ATOM 7019  H H    . GLN A 1 33 ? -4.283  -15.059 -2.079  1.00 0.00 ? 37 GLN A H    4  
ATOM 7020  H HA   . GLN A 1 33 ? -3.524  -14.961 0.735   1.00 0.00 ? 37 GLN A HA   4  
ATOM 7021  H HB2  . GLN A 1 33 ? -1.602  -15.502 -1.568  1.00 0.00 ? 37 GLN A HB2  4  
ATOM 7022  H HB3  . GLN A 1 33 ? -1.229  -15.540 0.144   1.00 0.00 ? 37 GLN A HB3  4  
ATOM 7023  H HG2  . GLN A 1 33 ? -3.462  -17.320 -0.803  1.00 0.00 ? 37 GLN A HG2  4  
ATOM 7024  H HG3  . GLN A 1 33 ? -1.833  -17.775 -1.264  1.00 0.00 ? 37 GLN A HG3  4  
ATOM 7025  H HE21 . GLN A 1 33 ? -3.925  -18.799 0.688   1.00 0.00 ? 37 GLN A HE21 4  
ATOM 7026  H HE22 . GLN A 1 33 ? -3.077  -19.042 2.179   1.00 0.00 ? 37 GLN A HE22 4  
ATOM 7027  N N    . THR A 1 34 ? -2.136  -12.786 0.368   1.00 0.00 ? 38 THR A N    4  
ATOM 7028  C CA   . THR A 1 34 ? -1.736  -11.394 0.249   1.00 0.00 ? 38 THR A CA   4  
ATOM 7029  C C    . THR A 1 34 ? -0.594  -11.252 -0.760  1.00 0.00 ? 38 THR A C    4  
ATOM 7030  O O    . THR A 1 34 ? 0.074   -12.231 -1.088  1.00 0.00 ? 38 THR A O    4  
ATOM 7031  C CB   . THR A 1 34 ? -1.379  -10.884 1.647   1.00 0.00 ? 38 THR A CB   4  
ATOM 7032  O OG1  . THR A 1 34 ? -2.525  -11.195 2.433   1.00 0.00 ? 38 THR A OG1  4  
ATOM 7033  C CG2  . THR A 1 34 ? -1.288  -9.358  1.708   1.00 0.00 ? 38 THR A CG2  4  
ATOM 7034  H H    . THR A 1 34 ? -1.813  -13.250 1.193   1.00 0.00 ? 38 THR A H    4  
ATOM 7035  H HA   . THR A 1 34 ? -2.580  -10.826 -0.141  1.00 0.00 ? 38 THR A HA   4  
ATOM 7036  H HB   . THR A 1 34 ? -0.458  -11.344 2.005   1.00 0.00 ? 38 THR A HB   4  
ATOM 7037  H HG1  . THR A 1 34 ? -3.353  -10.872 1.975   1.00 0.00 ? 38 THR A HG1  4  
ATOM 7038  H HG21 . THR A 1 34 ? -0.520  -9.012  1.016   1.00 0.00 ? 38 THR A HG21 4  
ATOM 7039  H HG22 . THR A 1 34 ? -2.249  -8.926  1.430   1.00 0.00 ? 38 THR A HG22 4  
ATOM 7040  H HG23 . THR A 1 34 ? -1.030  -9.050  2.721   1.00 0.00 ? 38 THR A HG23 4  
ATOM 7041  N N    . GLU A 1 35 ? -0.407  -10.025 -1.223  1.00 0.00 ? 39 GLU A N    4  
ATOM 7042  C CA   . GLU A 1 35 ? 0.642   -9.742  -2.188  1.00 0.00 ? 39 GLU A CA   4  
ATOM 7043  C C    . GLU A 1 35 ? 1.239   -8.356  -1.932  1.00 0.00 ? 39 GLU A C    4  
ATOM 7044  O O    . GLU A 1 35 ? 0.918   -7.399  -2.634  1.00 0.00 ? 39 GLU A O    4  
ATOM 7045  C CB   . GLU A 1 35 ? 0.116   -9.856  -3.620  1.00 0.00 ? 39 GLU A CB   4  
ATOM 7046  C CG   . GLU A 1 35 ? 0.025   -11.320 -4.056  1.00 0.00 ? 39 GLU A CG   4  
ATOM 7047  C CD   . GLU A 1 35 ? -1.408  -11.688 -4.447  1.00 0.00 ? 39 GLU A CD   4  
ATOM 7048  O OE1  . GLU A 1 35 ? -1.797  -11.328 -5.578  1.00 0.00 ? 39 GLU A OE1  4  
ATOM 7049  O OE2  . GLU A 1 35 ? -2.081  -12.321 -3.605  1.00 0.00 ? 39 GLU A OE2  4  
ATOM 7050  H H    . GLU A 1 35 ? -0.955  -9.234  -0.951  1.00 0.00 ? 39 GLU A H    4  
ATOM 7051  H HA   . GLU A 1 35 ? 1.401   -10.507 -2.024  1.00 0.00 ? 39 GLU A HA   4  
ATOM 7052  H HB2  . GLU A 1 35 ? -0.868  -9.391  -3.687  1.00 0.00 ? 39 GLU A HB2  4  
ATOM 7053  H HB3  . GLU A 1 35 ? 0.773   -9.311  -4.297  1.00 0.00 ? 39 GLU A HB3  4  
ATOM 7054  H HG2  . GLU A 1 35 ? 0.692   -11.493 -4.900  1.00 0.00 ? 39 GLU A HG2  4  
ATOM 7055  H HG3  . GLU A 1 35 ? 0.362   -11.966 -3.245  1.00 0.00 ? 39 GLU A HG3  4  
ATOM 7056  N N    . VAL A 1 36 ? 2.097   -8.294  -0.924  1.00 0.00 ? 40 VAL A N    4  
ATOM 7057  C CA   . VAL A 1 36 ? 2.742   -7.041  -0.567  1.00 0.00 ? 40 VAL A CA   4  
ATOM 7058  C C    . VAL A 1 36 ? 3.921   -6.792  -1.510  1.00 0.00 ? 40 VAL A C    4  
ATOM 7059  O O    . VAL A 1 36 ? 4.810   -7.633  -1.633  1.00 0.00 ? 40 VAL A O    4  
ATOM 7060  C CB   . VAL A 1 36 ? 3.150   -7.065  0.907   1.00 0.00 ? 40 VAL A CB   4  
ATOM 7061  C CG1  . VAL A 1 36 ? 3.825   -5.753  1.310   1.00 0.00 ? 40 VAL A CG1  4  
ATOM 7062  C CG2  . VAL A 1 36 ? 1.947   -7.360  1.805   1.00 0.00 ? 40 VAL A CG2  4  
ATOM 7063  H H    . VAL A 1 36 ? 2.353   -9.077  -0.358  1.00 0.00 ? 40 VAL A H    4  
ATOM 7064  H HA   . VAL A 1 36 ? 2.010   -6.245  -0.702  1.00 0.00 ? 40 VAL A HA   4  
ATOM 7065  H HB   . VAL A 1 36 ? 3.873   -7.869  1.042   1.00 0.00 ? 40 VAL A HB   4  
ATOM 7066  H HG11 . VAL A 1 36 ? 4.657   -5.550  0.635   1.00 0.00 ? 40 VAL A HG11 4  
ATOM 7067  H HG12 . VAL A 1 36 ? 3.103   -4.939  1.251   1.00 0.00 ? 40 VAL A HG12 4  
ATOM 7068  H HG13 . VAL A 1 36 ? 4.198   -5.834  2.331   1.00 0.00 ? 40 VAL A HG13 4  
ATOM 7069  H HG21 . VAL A 1 36 ? 1.523   -8.329  1.538   1.00 0.00 ? 40 VAL A HG21 4  
ATOM 7070  H HG22 . VAL A 1 36 ? 2.266   -7.378  2.847   1.00 0.00 ? 40 VAL A HG22 4  
ATOM 7071  H HG23 . VAL A 1 36 ? 1.193   -6.585  1.669   1.00 0.00 ? 40 VAL A HG23 4  
ATOM 7072  N N    . ILE A 1 37 ? 3.890   -5.633  -2.151  1.00 0.00 ? 41 ILE A N    4  
ATOM 7073  C CA   . ILE A 1 37 ? 4.945   -5.263  -3.079  1.00 0.00 ? 41 ILE A CA   4  
ATOM 7074  C C    . ILE A 1 37 ? 5.476   -3.876  -2.713  1.00 0.00 ? 41 ILE A C    4  
ATOM 7075  O O    . ILE A 1 37 ? 4.730   -2.898  -2.727  1.00 0.00 ? 41 ILE A O    4  
ATOM 7076  C CB   . ILE A 1 37 ? 4.450   -5.371  -4.523  1.00 0.00 ? 41 ILE A CB   4  
ATOM 7077  C CG1  . ILE A 1 37 ? 3.773   -6.721  -4.771  1.00 0.00 ? 41 ILE A CG1  4  
ATOM 7078  C CG2  . ILE A 1 37 ? 5.587   -5.109  -5.513  1.00 0.00 ? 41 ILE A CG2  4  
ATOM 7079  C CD1  . ILE A 1 37 ? 2.348   -6.531  -5.294  1.00 0.00 ? 41 ILE A CD1  4  
ATOM 7080  H H    . ILE A 1 37 ? 3.163   -4.955  -2.045  1.00 0.00 ? 41 ILE A H    4  
ATOM 7081  H HA   . ILE A 1 37 ? 5.753   -5.985  -2.960  1.00 0.00 ? 41 ILE A HA   4  
ATOM 7082  H HB   . ILE A 1 37 ? 3.698   -4.599  -4.685  1.00 0.00 ? 41 ILE A HB   4  
ATOM 7083  H HG12 . ILE A 1 37 ? 4.355   -7.296  -5.491  1.00 0.00 ? 41 ILE A HG12 4  
ATOM 7084  H HG13 . ILE A 1 37 ? 3.752   -7.296  -3.846  1.00 0.00 ? 41 ILE A HG13 4  
ATOM 7085  H HG21 . ILE A 1 37 ? 6.166   -4.247  -5.182  1.00 0.00 ? 41 ILE A HG21 4  
ATOM 7086  H HG22 . ILE A 1 37 ? 6.235   -5.985  -5.561  1.00 0.00 ? 41 ILE A HG22 4  
ATOM 7087  H HG23 . ILE A 1 37 ? 5.171   -4.910  -6.500  1.00 0.00 ? 41 ILE A HG23 4  
ATOM 7088  H HD11 . ILE A 1 37 ? 2.326   -5.694  -5.992  1.00 0.00 ? 41 ILE A HD11 4  
ATOM 7089  H HD12 . ILE A 1 37 ? 2.025   -7.439  -5.804  1.00 0.00 ? 41 ILE A HD12 4  
ATOM 7090  H HD13 . ILE A 1 37 ? 1.679   -6.325  -4.459  1.00 0.00 ? 41 ILE A HD13 4  
ATOM 7091  N N    . ALA A 1 38 ? 6.761   -3.835  -2.394  1.00 0.00 ? 42 ALA A N    4  
ATOM 7092  C CA   . ALA A 1 38 ? 7.401   -2.583  -2.025  1.00 0.00 ? 42 ALA A CA   4  
ATOM 7093  C C    . ALA A 1 38 ? 8.344   -2.147  -3.149  1.00 0.00 ? 42 ALA A C    4  
ATOM 7094  O O    . ALA A 1 38 ? 9.131   -2.949  -3.650  1.00 0.00 ? 42 ALA A O    4  
ATOM 7095  C CB   . ALA A 1 38 ? 8.126   -2.755  -0.689  1.00 0.00 ? 42 ALA A CB   4  
ATOM 7096  H H    . ALA A 1 38 ? 7.361   -4.635  -2.386  1.00 0.00 ? 42 ALA A H    4  
ATOM 7097  H HA   . ALA A 1 38 ? 6.619   -1.833  -1.906  1.00 0.00 ? 42 ALA A HA   4  
ATOM 7098  H HB1  . ALA A 1 38 ? 9.182   -2.959  -0.872  1.00 0.00 ? 42 ALA A HB1  4  
ATOM 7099  H HB2  . ALA A 1 38 ? 7.686   -3.588  -0.141  1.00 0.00 ? 42 ALA A HB2  4  
ATOM 7100  H HB3  . ALA A 1 38 ? 8.029   -1.842  -0.103  1.00 0.00 ? 42 ALA A HB3  4  
ATOM 7101  N N    . THR A 1 39 ? 8.234   -0.877  -3.511  1.00 0.00 ? 43 THR A N    4  
ATOM 7102  C CA   . THR A 1 39 ? 9.066   -0.325  -4.565  1.00 0.00 ? 43 THR A CA   4  
ATOM 7103  C C    . THR A 1 39 ? 10.433  0.080   -4.009  1.00 0.00 ? 43 THR A C    4  
ATOM 7104  O O    . THR A 1 39 ? 10.535  0.525   -2.867  1.00 0.00 ? 43 THR A O    4  
ATOM 7105  C CB   . THR A 1 39 ? 8.305   0.835   -5.210  1.00 0.00 ? 43 THR A CB   4  
ATOM 7106  O OG1  . THR A 1 39 ? 7.260   0.201   -5.942  1.00 0.00 ? 43 THR A OG1  4  
ATOM 7107  C CG2  . THR A 1 39 ? 9.129   1.552   -6.282  1.00 0.00 ? 43 THR A CG2  4  
ATOM 7108  H H    . THR A 1 39 ? 7.591   -0.232  -3.098  1.00 0.00 ? 43 THR A H    4  
ATOM 7109  H HA   . THR A 1 39 ? 9.241   -1.103  -5.308  1.00 0.00 ? 43 THR A HA   4  
ATOM 7110  H HB   . THR A 1 39 ? 7.954   1.538   -4.455  1.00 0.00 ? 43 THR A HB   4  
ATOM 7111  H HG1  . THR A 1 39 ? 6.760   -0.429  -5.348  1.00 0.00 ? 43 THR A HG1  4  
ATOM 7112  H HG21 . THR A 1 39 ? 10.190  1.432   -6.066  1.00 0.00 ? 43 THR A HG21 4  
ATOM 7113  H HG22 . THR A 1 39 ? 8.906   1.123   -7.259  1.00 0.00 ? 43 THR A HG22 4  
ATOM 7114  H HG23 . THR A 1 39 ? 8.877   2.613   -6.285  1.00 0.00 ? 43 THR A HG23 4  
ATOM 7115  N N    . LEU A 1 40 ? 11.449  -0.089  -4.842  1.00 0.00 ? 44 LEU A N    4  
ATOM 7116  C CA   . LEU A 1 40 ? 12.805  0.253   -4.448  1.00 0.00 ? 44 LEU A CA   4  
ATOM 7117  C C    . LEU A 1 40 ? 13.119  1.680   -4.901  1.00 0.00 ? 44 LEU A C    4  
ATOM 7118  O O    . LEU A 1 40 ? 12.576  2.151   -5.899  1.00 0.00 ? 44 LEU A O    4  
ATOM 7119  C CB   . LEU A 1 40 ? 13.795  -0.790  -4.972  1.00 0.00 ? 44 LEU A CB   4  
ATOM 7120  C CG   . LEU A 1 40 ? 14.805  -1.326  -3.955  1.00 0.00 ? 44 LEU A CG   4  
ATOM 7121  C CD1  . LEU A 1 40 ? 15.455  -2.617  -4.457  1.00 0.00 ? 44 LEU A CD1  4  
ATOM 7122  C CD2  . LEU A 1 40 ? 15.844  -0.261  -3.602  1.00 0.00 ? 44 LEU A CD2  4  
ATOM 7123  H H    . LEU A 1 40 ? 11.357  -0.452  -5.770  1.00 0.00 ? 44 LEU A H    4  
ATOM 7124  H HA   . LEU A 1 40 ? 12.847  0.219   -3.359  1.00 0.00 ? 44 LEU A HA   4  
ATOM 7125  H HB2  . LEU A 1 40 ? 13.228  -1.632  -5.370  1.00 0.00 ? 44 LEU A HB2  4  
ATOM 7126  H HB3  . LEU A 1 40 ? 14.345  -0.354  -5.806  1.00 0.00 ? 44 LEU A HB3  4  
ATOM 7127  H HG   . LEU A 1 40 ? 14.270  -1.571  -3.038  1.00 0.00 ? 44 LEU A HG   4  
ATOM 7128  H HD11 . LEU A 1 40 ? 14.685  -3.369  -4.629  1.00 0.00 ? 44 LEU A HD11 4  
ATOM 7129  H HD12 . LEU A 1 40 ? 15.983  -2.419  -5.390  1.00 0.00 ? 44 LEU A HD12 4  
ATOM 7130  H HD13 . LEU A 1 40 ? 16.160  -2.983  -3.710  1.00 0.00 ? 44 LEU A HD13 4  
ATOM 7131  H HD21 . LEU A 1 40 ? 16.072  0.333   -4.487  1.00 0.00 ? 44 LEU A HD21 4  
ATOM 7132  H HD22 . LEU A 1 40 ? 15.448  0.388   -2.821  1.00 0.00 ? 44 LEU A HD22 4  
ATOM 7133  H HD23 . LEU A 1 40 ? 16.754  -0.745  -3.245  1.00 0.00 ? 44 LEU A HD23 4  
ATOM 7134  N N    . LYS A 1 41 ? 13.994  2.328   -4.146  1.00 0.00 ? 45 LYS A N    4  
ATOM 7135  C CA   . LYS A 1 41 ? 14.386  3.692   -4.457  1.00 0.00 ? 45 LYS A CA   4  
ATOM 7136  C C    . LYS A 1 41 ? 15.316  3.685   -5.672  1.00 0.00 ? 45 LYS A C    4  
ATOM 7137  O O    . LYS A 1 41 ? 15.703  4.743   -6.168  1.00 0.00 ? 45 LYS A O    4  
ATOM 7138  C CB   . LYS A 1 41 ? 14.988  4.370   -3.226  1.00 0.00 ? 45 LYS A CB   4  
ATOM 7139  C CG   . LYS A 1 41 ? 15.925  5.511   -3.631  1.00 0.00 ? 45 LYS A CG   4  
ATOM 7140  C CD   . LYS A 1 41 ? 15.163  6.606   -4.379  1.00 0.00 ? 45 LYS A CD   4  
ATOM 7141  C CE   . LYS A 1 41 ? 15.115  7.898   -3.560  1.00 0.00 ? 45 LYS A CE   4  
ATOM 7142  N NZ   . LYS A 1 41 ? 16.401  8.624   -3.661  1.00 0.00 ? 45 LYS A NZ   4  
ATOM 7143  H H    . LYS A 1 41 ? 14.430  1.937   -3.336  1.00 0.00 ? 45 LYS A H    4  
ATOM 7144  H HA   . LYS A 1 41 ? 13.481  4.241   -4.718  1.00 0.00 ? 45 LYS A HA   4  
ATOM 7145  H HB2  . LYS A 1 41 ? 14.190  4.758   -2.592  1.00 0.00 ? 45 LYS A HB2  4  
ATOM 7146  H HB3  . LYS A 1 41 ? 15.536  3.638   -2.634  1.00 0.00 ? 45 LYS A HB3  4  
ATOM 7147  H HG2  . LYS A 1 41 ? 16.396  5.932   -2.743  1.00 0.00 ? 45 LYS A HG2  4  
ATOM 7148  H HG3  . LYS A 1 41 ? 16.724  5.122   -4.262  1.00 0.00 ? 45 LYS A HG3  4  
ATOM 7149  H HD2  . LYS A 1 41 ? 15.644  6.798   -5.339  1.00 0.00 ? 45 LYS A HD2  4  
ATOM 7150  H HD3  . LYS A 1 41 ? 14.149  6.268   -4.592  1.00 0.00 ? 45 LYS A HD3  4  
ATOM 7151  H HE2  . LYS A 1 41 ? 14.304  8.532   -3.917  1.00 0.00 ? 45 LYS A HE2  4  
ATOM 7152  H HE3  . LYS A 1 41 ? 14.902  7.666   -2.516  1.00 0.00 ? 45 LYS A HE3  4  
ATOM 7153  H HZ1  . LYS A 1 41 ? 17.157  7.981   -3.537  1.00 0.00 ? 45 LYS A HZ1  4  
ATOM 7154  H HZ2  . LYS A 1 41 ? 16.472  9.052   -4.561  1.00 0.00 ? 45 LYS A HZ2  4  
ATOM 7155  H HZ3  . LYS A 1 41 ? 16.442  9.328   -2.952  1.00 0.00 ? 45 LYS A HZ3  4  
ATOM 7156  N N    . ASN A 1 42 ? 15.647  2.482   -6.118  1.00 0.00 ? 46 ASN A N    4  
ATOM 7157  C CA   . ASN A 1 42 ? 16.524  2.324   -7.265  1.00 0.00 ? 46 ASN A CA   4  
ATOM 7158  C C    . ASN A 1 42 ? 15.681  2.057   -8.513  1.00 0.00 ? 46 ASN A C    4  
ATOM 7159  O O    . ASN A 1 42 ? 16.199  2.058   -9.629  1.00 0.00 ? 46 ASN A O    4  
ATOM 7160  C CB   . ASN A 1 42 ? 17.474  1.140   -7.074  1.00 0.00 ? 46 ASN A CB   4  
ATOM 7161  C CG   . ASN A 1 42 ? 17.660  0.369   -8.383  1.00 0.00 ? 46 ASN A CG   4  
ATOM 7162  O OD1  . ASN A 1 42 ? 18.188  0.873   -9.360  1.00 0.00 ? 46 ASN A OD1  4  
ATOM 7163  N ND2  . ASN A 1 42 ? 17.197  -0.877  -8.346  1.00 0.00 ? 46 ASN A ND2  4  
ATOM 7164  H H    . ASN A 1 42 ? 15.328  1.627   -5.709  1.00 0.00 ? 46 ASN A H    4  
ATOM 7165  H HA   . ASN A 1 42 ? 17.081  3.259   -7.331  1.00 0.00 ? 46 ASN A HA   4  
ATOM 7166  H HB2  . ASN A 1 42 ? 18.440  1.498   -6.718  1.00 0.00 ? 46 ASN A HB2  4  
ATOM 7167  H HB3  . ASN A 1 42 ? 17.080  0.473   -6.307  1.00 0.00 ? 46 ASN A HB3  4  
ATOM 7168  H HD21 . ASN A 1 42 ? 16.773  -1.229  -7.512  1.00 0.00 ? 46 ASN A HD21 4  
ATOM 7169  H HD22 . ASN A 1 42 ? 17.272  -1.462  -9.154  1.00 0.00 ? 46 ASN A HD22 4  
ATOM 7170  N N    . GLY A 1 43 ? 14.395  1.836   -8.283  1.00 0.00 ? 47 GLY A N    4  
ATOM 7171  C CA   . GLY A 1 43 ? 13.475  1.567   -9.375  1.00 0.00 ? 47 GLY A CA   4  
ATOM 7172  C C    . GLY A 1 43 ? 13.009  0.110   -9.354  1.00 0.00 ? 47 GLY A C    4  
ATOM 7173  O O    . GLY A 1 43 ? 12.070  -0.255  -10.060 1.00 0.00 ? 47 GLY A O    4  
ATOM 7174  H H    . GLY A 1 43 ? 13.981  1.837   -7.373  1.00 0.00 ? 47 GLY A H    4  
ATOM 7175  H HA2  . GLY A 1 43 ? 12.612  2.230   -9.300  1.00 0.00 ? 47 GLY A HA2  4  
ATOM 7176  H HA3  . GLY A 1 43 ? 13.961  1.784   -10.327 1.00 0.00 ? 47 GLY A HA3  4  
ATOM 7177  N N    . GLN A 1 44 ? 13.687  -0.683  -8.538  1.00 0.00 ? 48 GLN A N    4  
ATOM 7178  C CA   . GLN A 1 44 ? 13.354  -2.092  -8.416  1.00 0.00 ? 48 GLN A CA   4  
ATOM 7179  C C    . GLN A 1 44 ? 12.186  -2.279  -7.445  1.00 0.00 ? 48 GLN A C    4  
ATOM 7180  O O    . GLN A 1 44 ? 11.586  -1.305  -6.995  1.00 0.00 ? 48 GLN A O    4  
ATOM 7181  C CB   . GLN A 1 44 ? 14.571  -2.906  -7.973  1.00 0.00 ? 48 GLN A CB   4  
ATOM 7182  C CG   . GLN A 1 44 ? 15.397  -3.358  -9.180  1.00 0.00 ? 48 GLN A CG   4  
ATOM 7183  C CD   . GLN A 1 44 ? 16.606  -4.185  -8.738  1.00 0.00 ? 48 GLN A CD   4  
ATOM 7184  O OE1  . GLN A 1 44 ? 17.439  -3.748  -7.962  1.00 0.00 ? 48 GLN A OE1  4  
ATOM 7185  N NE2  . GLN A 1 44 ? 16.655  -5.401  -9.274  1.00 0.00 ? 48 GLN A NE2  4  
ATOM 7186  H H    . GLN A 1 44 ? 14.449  -0.378  -7.967  1.00 0.00 ? 48 GLN A H    4  
ATOM 7187  H HA   . GLN A 1 44 ? 13.058  -2.407  -9.416  1.00 0.00 ? 48 GLN A HA   4  
ATOM 7188  H HB2  . GLN A 1 44 ? 15.192  -2.307  -7.307  1.00 0.00 ? 48 GLN A HB2  4  
ATOM 7189  H HB3  . GLN A 1 44 ? 14.244  -3.777  -7.405  1.00 0.00 ? 48 GLN A HB3  4  
ATOM 7190  H HG2  . GLN A 1 44 ? 14.773  -3.949  -9.850  1.00 0.00 ? 48 GLN A HG2  4  
ATOM 7191  H HG3  . GLN A 1 44 ? 15.733  -2.487  -9.742  1.00 0.00 ? 48 GLN A HG3  4  
ATOM 7192  H HE21 . GLN A 1 44 ? 15.938  -5.699  -9.904  1.00 0.00 ? 48 GLN A HE21 4  
ATOM 7193  H HE22 . GLN A 1 44 ? 17.408  -6.018  -9.046  1.00 0.00 ? 48 GLN A HE22 4  
ATOM 7194  N N    . LYS A 1 45 ? 11.900  -3.539  -7.151  1.00 0.00 ? 49 LYS A N    4  
ATOM 7195  C CA   . LYS A 1 45 ? 10.815  -3.867  -6.242  1.00 0.00 ? 49 LYS A CA   4  
ATOM 7196  C C    . LYS A 1 45 ? 11.199  -5.098  -5.418  1.00 0.00 ? 49 LYS A C    4  
ATOM 7197  O O    . LYS A 1 45 ? 11.879  -5.994  -5.915  1.00 0.00 ? 49 LYS A O    4  
ATOM 7198  C CB   . LYS A 1 45 ? 9.502   -4.027  -7.010  1.00 0.00 ? 49 LYS A CB   4  
ATOM 7199  C CG   . LYS A 1 45 ? 9.201   -2.783  -7.847  1.00 0.00 ? 49 LYS A CG   4  
ATOM 7200  C CD   . LYS A 1 45 ? 7.735   -2.758  -8.286  1.00 0.00 ? 49 LYS A CD   4  
ATOM 7201  C CE   . LYS A 1 45 ? 7.519   -1.755  -9.421  1.00 0.00 ? 49 LYS A CE   4  
ATOM 7202  N NZ   . LYS A 1 45 ? 6.088   -1.395  -9.529  1.00 0.00 ? 49 LYS A NZ   4  
ATOM 7203  H H    . LYS A 1 45 ? 12.393  -4.326  -7.521  1.00 0.00 ? 49 LYS A H    4  
ATOM 7204  H HA   . LYS A 1 45 ? 10.690  -3.023  -5.564  1.00 0.00 ? 49 LYS A HA   4  
ATOM 7205  H HB2  . LYS A 1 45 ? 9.560   -4.901  -7.659  1.00 0.00 ? 49 LYS A HB2  4  
ATOM 7206  H HB3  . LYS A 1 45 ? 8.686   -4.205  -6.310  1.00 0.00 ? 49 LYS A HB3  4  
ATOM 7207  H HG2  . LYS A 1 45 ? 9.425   -1.887  -7.268  1.00 0.00 ? 49 LYS A HG2  4  
ATOM 7208  H HG3  . LYS A 1 45 ? 9.847   -2.765  -8.725  1.00 0.00 ? 49 LYS A HG3  4  
ATOM 7209  H HD2  . LYS A 1 45 ? 7.433   -3.753  -8.613  1.00 0.00 ? 49 LYS A HD2  4  
ATOM 7210  H HD3  . LYS A 1 45 ? 7.102   -2.495  -7.438  1.00 0.00 ? 49 LYS A HD3  4  
ATOM 7211  H HE2  . LYS A 1 45 ? 8.113   -0.859  -9.240  1.00 0.00 ? 49 LYS A HE2  4  
ATOM 7212  H HE3  . LYS A 1 45 ? 7.865   -2.182  -10.362 1.00 0.00 ? 49 LYS A HE3  4  
ATOM 7213  H HZ1  . LYS A 1 45 ? 5.545   -2.008  -8.955  1.00 0.00 ? 49 LYS A HZ1  4  
ATOM 7214  H HZ2  . LYS A 1 45 ? 5.957   -0.451  -9.226  1.00 0.00 ? 49 LYS A HZ2  4  
ATOM 7215  H HZ3  . LYS A 1 45 ? 5.793   -1.483  -10.481 1.00 0.00 ? 49 LYS A HZ3  4  
ATOM 7216  N N    . ALA A 1 46 ? 10.748  -5.101  -4.172  1.00 0.00 ? 50 ALA A N    4  
ATOM 7217  C CA   . ALA A 1 46 ? 11.037  -6.207  -3.275  1.00 0.00 ? 50 ALA A CA   4  
ATOM 7218  C C    . ALA A 1 46 ? 9.742   -6.659  -2.597  1.00 0.00 ? 50 ALA A C    4  
ATOM 7219  O O    . ALA A 1 46 ? 9.187   -5.941  -1.767  1.00 0.00 ? 50 ALA A O    4  
ATOM 7220  C CB   . ALA A 1 46 ? 12.105  -5.780  -2.265  1.00 0.00 ? 50 ALA A CB   4  
ATOM 7221  H H    . ALA A 1 46 ? 10.197  -4.368  -3.775  1.00 0.00 ? 50 ALA A H    4  
ATOM 7222  H HA   . ALA A 1 46 ? 11.429  -7.027  -3.875  1.00 0.00 ? 50 ALA A HA   4  
ATOM 7223  H HB1  . ALA A 1 46 ? 12.461  -4.780  -2.514  1.00 0.00 ? 50 ALA A HB1  4  
ATOM 7224  H HB2  . ALA A 1 46 ? 11.676  -5.774  -1.263  1.00 0.00 ? 50 ALA A HB2  4  
ATOM 7225  H HB3  . ALA A 1 46 ? 12.938  -6.482  -2.299  1.00 0.00 ? 50 ALA A HB3  4  
ATOM 7226  N N    . CYS A 1 47 ? 9.298   -7.849  -2.976  1.00 0.00 ? 51 CYS A N    4  
ATOM 7227  C CA   . CYS A 1 47 ? 8.078   -8.406  -2.416  1.00 0.00 ? 51 CYS A CA   4  
ATOM 7228  C C    . CYS A 1 47 ? 8.327   -8.716  -0.938  1.00 0.00 ? 51 CYS A C    4  
ATOM 7229  O O    . CYS A 1 47 ? 9.401   -9.190  -0.572  1.00 0.00 ? 51 CYS A O    4  
ATOM 7230  C CB   . CYS A 1 47 ? 7.614   -9.642  -3.188  1.00 0.00 ? 51 CYS A CB   4  
ATOM 7231  S SG   . CYS A 1 47 ? 6.602   -9.286  -4.670  1.00 0.00 ? 51 CYS A SG   4  
ATOM 7232  H H    . CYS A 1 47 ? 9.755   -8.427  -3.652  1.00 0.00 ? 51 CYS A H    4  
ATOM 7233  H HA   . CYS A 1 47 ? 7.306   -7.644  -2.527  1.00 0.00 ? 51 CYS A HA   4  
ATOM 7234  H HB2  . CYS A 1 47 ? 8.491   -10.213 -3.493  1.00 0.00 ? 51 CYS A HB2  4  
ATOM 7235  H HB3  . CYS A 1 47 ? 7.038   -10.278 -2.516  1.00 0.00 ? 51 CYS A HB3  4  
ATOM 7236  N N    . LEU A 1 48 ? 7.316   -8.434  -0.130  1.00 0.00 ? 52 LEU A N    4  
ATOM 7237  C CA   . LEU A 1 48 ? 7.411   -8.677  1.300   1.00 0.00 ? 52 LEU A CA   4  
ATOM 7238  C C    . LEU A 1 48 ? 6.605   -9.928  1.655   1.00 0.00 ? 52 LEU A C    4  
ATOM 7239  O O    . LEU A 1 48 ? 5.806   -10.405 0.851   1.00 0.00 ? 52 LEU A O    4  
ATOM 7240  C CB   . LEU A 1 48 ? 6.991   -7.432  2.084   1.00 0.00 ? 52 LEU A CB   4  
ATOM 7241  C CG   . LEU A 1 48 ? 7.868   -6.193  1.894   1.00 0.00 ? 52 LEU A CG   4  
ATOM 7242  C CD1  . LEU A 1 48 ? 7.157   -4.935  2.398   1.00 0.00 ? 52 LEU A CD1  4  
ATOM 7243  C CD2  . LEU A 1 48 ? 9.235   -6.382  2.556   1.00 0.00 ? 52 LEU A CD2  4  
ATOM 7244  H H    . LEU A 1 48 ? 6.445   -8.048  -0.436  1.00 0.00 ? 52 LEU A H    4  
ATOM 7245  H HA   . LEU A 1 48 ? 8.460   -8.865  1.530   1.00 0.00 ? 52 LEU A HA   4  
ATOM 7246  H HB2  . LEU A 1 48 ? 5.970   -7.176  1.802   1.00 0.00 ? 52 LEU A HB2  4  
ATOM 7247  H HB3  . LEU A 1 48 ? 6.976   -7.683  3.144   1.00 0.00 ? 52 LEU A HB3  4  
ATOM 7248  H HG   . LEU A 1 48 ? 8.044   -6.058  0.827   1.00 0.00 ? 52 LEU A HG   4  
ATOM 7249  H HD11 . LEU A 1 48 ? 6.144   -4.906  1.997   1.00 0.00 ? 52 LEU A HD11 4  
ATOM 7250  H HD12 . LEU A 1 48 ? 7.116   -4.953  3.487   1.00 0.00 ? 52 LEU A HD12 4  
ATOM 7251  H HD13 . LEU A 1 48 ? 7.704   -4.052  2.069   1.00 0.00 ? 52 LEU A HD13 4  
ATOM 7252  H HD21 . LEU A 1 48 ? 9.367   -7.430  2.824   1.00 0.00 ? 52 LEU A HD21 4  
ATOM 7253  H HD22 . LEU A 1 48 ? 10.020  -6.084  1.861   1.00 0.00 ? 52 LEU A HD22 4  
ATOM 7254  H HD23 . LEU A 1 48 ? 9.292   -5.767  3.454   1.00 0.00 ? 52 LEU A HD23 4  
ATOM 7255  N N    . ASN A 1 49 ? 6.842   -10.424 2.860   1.00 0.00 ? 53 ASN A N    4  
ATOM 7256  C CA   . ASN A 1 49 ? 6.149   -11.610 3.332   1.00 0.00 ? 53 ASN A CA   4  
ATOM 7257  C C    . ASN A 1 49 ? 4.982   -11.191 4.229   1.00 0.00 ? 53 ASN A C    4  
ATOM 7258  O O    . ASN A 1 49 ? 5.192   -10.721 5.346   1.00 0.00 ? 53 ASN A O    4  
ATOM 7259  C CB   . ASN A 1 49 ? 7.080   -12.503 4.154   1.00 0.00 ? 53 ASN A CB   4  
ATOM 7260  C CG   . ASN A 1 49 ? 6.707   -13.978 3.995   1.00 0.00 ? 53 ASN A CG   4  
ATOM 7261  O OD1  . ASN A 1 49 ? 6.538   -14.488 2.900   1.00 0.00 ? 53 ASN A OD1  4  
ATOM 7262  N ND2  . ASN A 1 49 ? 6.588   -14.633 5.147   1.00 0.00 ? 53 ASN A ND2  4  
ATOM 7263  H H    . ASN A 1 49 ? 7.494   -10.030 3.509   1.00 0.00 ? 53 ASN A H    4  
ATOM 7264  H HA   . ASN A 1 49 ? 5.817   -12.125 2.430   1.00 0.00 ? 53 ASN A HA   4  
ATOM 7265  H HB2  . ASN A 1 49 ? 8.111   -12.349 3.836   1.00 0.00 ? 53 ASN A HB2  4  
ATOM 7266  H HB3  . ASN A 1 49 ? 7.025   -12.221 5.206   1.00 0.00 ? 53 ASN A HB3  4  
ATOM 7267  H HD21 . ASN A 1 49 ? 6.740   -14.155 6.012   1.00 0.00 ? 53 ASN A HD21 4  
ATOM 7268  H HD22 . ASN A 1 49 ? 6.347   -15.603 5.148   1.00 0.00 ? 53 ASN A HD22 4  
ATOM 7269  N N    . PRO A 1 50 ? 3.747   -11.381 3.692   1.00 0.00 ? 54 PRO A N    4  
ATOM 7270  C CA   . PRO A 1 50 ? 2.547   -11.028 4.432   1.00 0.00 ? 54 PRO A CA   4  
ATOM 7271  C C    . PRO A 1 50 ? 2.263   -12.049 5.536   1.00 0.00 ? 54 PRO A C    4  
ATOM 7272  O O    . PRO A 1 50 ? 1.127   -12.492 5.698   1.00 0.00 ? 54 PRO A O    4  
ATOM 7273  C CB   . PRO A 1 50 ? 1.446   -10.961 3.387   1.00 0.00 ? 54 PRO A CB   4  
ATOM 7274  C CG   . PRO A 1 50 ? 1.967   -11.729 2.183   1.00 0.00 ? 54 PRO A CG   4  
ATOM 7275  C CD   . PRO A 1 50 ? 3.461   -11.935 2.372   1.00 0.00 ? 54 PRO A CD   4  
ATOM 7276  H HA   . PRO A 1 50 ? 2.671   -10.151 4.896   1.00 0.00 ? 54 PRO A HA   4  
ATOM 7277  H HB2  . PRO A 1 50 ? 0.523   -11.403 3.763   1.00 0.00 ? 54 PRO A HB2  4  
ATOM 7278  H HB3  . PRO A 1 50 ? 1.220   -9.928  3.123   1.00 0.00 ? 54 PRO A HB3  4  
ATOM 7279  H HG2  . PRO A 1 50 ? 1.458   -12.688 2.092   1.00 0.00 ? 54 PRO A HG2  4  
ATOM 7280  H HG3  . PRO A 1 50 ? 1.772   -11.176 1.264   1.00 0.00 ? 54 PRO A HG3  4  
ATOM 7281  H HD2  . PRO A 1 50 ? 3.725   -12.992 2.321   1.00 0.00 ? 54 PRO A HD2  4  
ATOM 7282  H HD3  . PRO A 1 50 ? 4.033   -11.426 1.597   1.00 0.00 ? 54 PRO A HD3  4  
ATOM 7283  N N    . ALA A 1 51 ? 3.314   -12.392 6.265   1.00 0.00 ? 55 ALA A N    4  
ATOM 7284  C CA   . ALA A 1 51 ? 3.192   -13.352 7.349   1.00 0.00 ? 55 ALA A CA   4  
ATOM 7285  C C    . ALA A 1 51 ? 4.362   -13.173 8.318   1.00 0.00 ? 55 ALA A C    4  
ATOM 7286  O O    . ALA A 1 51 ? 4.747   -14.112 9.014   1.00 0.00 ? 55 ALA A O    4  
ATOM 7287  C CB   . ALA A 1 51 ? 3.125   -14.768 6.772   1.00 0.00 ? 55 ALA A CB   4  
ATOM 7288  H H    . ALA A 1 51 ? 4.235   -12.027 6.126   1.00 0.00 ? 55 ALA A H    4  
ATOM 7289  H HA   . ALA A 1 51 ? 2.260   -13.143 7.874   1.00 0.00 ? 55 ALA A HA   4  
ATOM 7290  H HB1  . ALA A 1 51 ? 3.975   -15.347 7.131   1.00 0.00 ? 55 ALA A HB1  4  
ATOM 7291  H HB2  . ALA A 1 51 ? 2.198   -15.246 7.089   1.00 0.00 ? 55 ALA A HB2  4  
ATOM 7292  H HB3  . ALA A 1 51 ? 3.154   -14.718 5.683   1.00 0.00 ? 55 ALA A HB3  4  
ATOM 7293  N N    . SER A 1 52 ? 4.896   -11.960 8.333   1.00 0.00 ? 56 SER A N    4  
ATOM 7294  C CA   . SER A 1 52 ? 6.015   -11.646 9.205   1.00 0.00 ? 56 SER A CA   4  
ATOM 7295  C C    . SER A 1 52 ? 5.709   -10.383 10.014  1.00 0.00 ? 56 SER A C    4  
ATOM 7296  O O    . SER A 1 52 ? 5.054   -9.468  9.518   1.00 0.00 ? 56 SER A O    4  
ATOM 7297  C CB   . SER A 1 52 ? 7.305   -11.463 8.403   1.00 0.00 ? 56 SER A CB   4  
ATOM 7298  O OG   . SER A 1 52 ? 8.419   -11.174 9.243   1.00 0.00 ? 56 SER A OG   4  
ATOM 7299  H H    . SER A 1 52 ? 4.578   -11.202 7.764   1.00 0.00 ? 56 SER A H    4  
ATOM 7300  H HA   . SER A 1 52 ? 6.117   -12.507 9.866   1.00 0.00 ? 56 SER A HA   4  
ATOM 7301  H HB2  . SER A 1 52 ? 7.507   -12.369 7.831   1.00 0.00 ? 56 SER A HB2  4  
ATOM 7302  H HB3  . SER A 1 52 ? 7.173   -10.655 7.684   1.00 0.00 ? 56 SER A HB3  4  
ATOM 7303  H HG   . SER A 1 52 ? 9.163   -11.816 9.057   1.00 0.00 ? 56 SER A HG   4  
ATOM 7304  N N    . PRO A 1 53 ? 6.210   -10.374 11.278  1.00 0.00 ? 57 PRO A N    4  
ATOM 7305  C CA   . PRO A 1 53 ? 5.998   -9.239  12.160  1.00 0.00 ? 57 PRO A CA   4  
ATOM 7306  C C    . PRO A 1 53 ? 6.889   -8.061  11.761  1.00 0.00 ? 57 PRO A C    4  
ATOM 7307  O O    . PRO A 1 53 ? 6.863   -7.013  12.405  1.00 0.00 ? 57 PRO A O    4  
ATOM 7308  C CB   . PRO A 1 53 ? 6.295   -9.764  13.555  1.00 0.00 ? 57 PRO A CB   4  
ATOM 7309  C CG   . PRO A 1 53 ? 7.108   -11.033 13.358  1.00 0.00 ? 57 PRO A CG   4  
ATOM 7310  C CD   . PRO A 1 53 ? 6.990   -11.441 11.899  1.00 0.00 ? 57 PRO A CD   4  
ATOM 7311  H HA   . PRO A 1 53 ? 5.057   -8.910  12.080  1.00 0.00 ? 57 PRO A HA   4  
ATOM 7312  H HB2  . PRO A 1 53 ? 6.852   -9.030  14.138  1.00 0.00 ? 57 PRO A HB2  4  
ATOM 7313  H HB3  . PRO A 1 53 ? 5.374   -9.971  14.099  1.00 0.00 ? 57 PRO A HB3  4  
ATOM 7314  H HG2  . PRO A 1 53 ? 8.152   -10.863 13.624  1.00 0.00 ? 57 PRO A HG2  4  
ATOM 7315  H HG3  . PRO A 1 53 ? 6.740   -11.827 14.008  1.00 0.00 ? 57 PRO A HG3  4  
ATOM 7316  H HD2  . PRO A 1 53 ? 7.971   -11.537 11.434  1.00 0.00 ? 57 PRO A HD2  4  
ATOM 7317  H HD3  . PRO A 1 53 ? 6.494   -12.406 11.796  1.00 0.00 ? 57 PRO A HD3  4  
ATOM 7318  N N    . MET A 1 54 ? 7.655   -8.272  10.701  1.00 0.00 ? 58 MET A N    4  
ATOM 7319  C CA   . MET A 1 54 ? 8.552   -7.240  10.209  1.00 0.00 ? 58 MET A CA   4  
ATOM 7320  C C    . MET A 1 54 ? 7.964   -6.542  8.982   1.00 0.00 ? 58 MET A C    4  
ATOM 7321  O O    . MET A 1 54 ? 8.416   -5.464  8.600   1.00 0.00 ? 58 MET A O    4  
ATOM 7322  C CB   . MET A 1 54 ? 9.899   -7.867  9.844   1.00 0.00 ? 58 MET A CB   4  
ATOM 7323  C CG   . MET A 1 54 ? 11.058  -6.968  10.279  1.00 0.00 ? 58 MET A CG   4  
ATOM 7324  S SD   . MET A 1 54 ? 11.028  -6.748  12.051  1.00 0.00 ? 58 MET A SD   4  
ATOM 7325  C CE   . MET A 1 54 ? 10.714  -8.428  12.566  1.00 0.00 ? 58 MET A CE   4  
ATOM 7326  H H    . MET A 1 54 ? 7.670   -9.127  10.183  1.00 0.00 ? 58 MET A H    4  
ATOM 7327  H HA   . MET A 1 54 ? 8.655   -6.527  11.027  1.00 0.00 ? 58 MET A HA   4  
ATOM 7328  H HB2  . MET A 1 54 ? 9.992   -8.842  10.321  1.00 0.00 ? 58 MET A HB2  4  
ATOM 7329  H HB3  . MET A 1 54 ? 9.948   -8.032  8.768   1.00 0.00 ? 58 MET A HB3  4  
ATOM 7330  H HG2  . MET A 1 54 ? 12.007  -7.410  9.976   1.00 0.00 ? 58 MET A HG2  4  
ATOM 7331  H HG3  . MET A 1 54 ? 10.985  -6.000  9.783   1.00 0.00 ? 58 MET A HG3  4  
ATOM 7332  H HE1  . MET A 1 54 ? 11.245  -9.115  11.908  1.00 0.00 ? 58 MET A HE1  4  
ATOM 7333  H HE2  . MET A 1 54 ? 11.061  -8.565  13.590  1.00 0.00 ? 58 MET A HE2  4  
ATOM 7334  H HE3  . MET A 1 54 ? 9.644   -8.629  12.515  1.00 0.00 ? 58 MET A HE3  4  
ATOM 7335  N N    . VAL A 1 55 ? 6.964   -7.186  8.397   1.00 0.00 ? 59 VAL A N    4  
ATOM 7336  C CA   . VAL A 1 55 ? 6.309   -6.640  7.220   1.00 0.00 ? 59 VAL A CA   4  
ATOM 7337  C C    . VAL A 1 55 ? 5.302   -5.572  7.651   1.00 0.00 ? 59 VAL A C    4  
ATOM 7338  O O    . VAL A 1 55 ? 4.913   -4.721  6.853   1.00 0.00 ? 59 VAL A O    4  
ATOM 7339  C CB   . VAL A 1 55 ? 5.673   -7.768  6.405   1.00 0.00 ? 59 VAL A CB   4  
ATOM 7340  C CG1  . VAL A 1 55 ? 4.520   -7.242  5.548   1.00 0.00 ? 59 VAL A CG1  4  
ATOM 7341  C CG2  . VAL A 1 55 ? 6.719   -8.476  5.541   1.00 0.00 ? 59 VAL A CG2  4  
ATOM 7342  H H    . VAL A 1 55 ? 6.602   -8.062  8.713   1.00 0.00 ? 59 VAL A H    4  
ATOM 7343  H HA   . VAL A 1 55 ? 7.077   -6.170  6.605   1.00 0.00 ? 59 VAL A HA   4  
ATOM 7344  H HB   . VAL A 1 55 ? 5.266   -8.498  7.104   1.00 0.00 ? 59 VAL A HB   4  
ATOM 7345  H HG11 . VAL A 1 55 ? 3.776   -6.771  6.191   1.00 0.00 ? 59 VAL A HG11 4  
ATOM 7346  H HG12 . VAL A 1 55 ? 4.900   -6.510  4.836   1.00 0.00 ? 59 VAL A HG12 4  
ATOM 7347  H HG13 . VAL A 1 55 ? 4.061   -8.070  5.008   1.00 0.00 ? 59 VAL A HG13 4  
ATOM 7348  H HG21 . VAL A 1 55 ? 7.477   -7.759  5.226   1.00 0.00 ? 59 VAL A HG21 4  
ATOM 7349  H HG22 . VAL A 1 55 ? 7.189   -9.272  6.119   1.00 0.00 ? 59 VAL A HG22 4  
ATOM 7350  H HG23 . VAL A 1 55 ? 6.235   -8.903  4.663   1.00 0.00 ? 59 VAL A HG23 4  
ATOM 7351  N N    . LYS A 1 56 ? 4.907   -5.653  8.914   1.00 0.00 ? 60 LYS A N    4  
ATOM 7352  C CA   . LYS A 1 56 ? 3.952   -4.704  9.461   1.00 0.00 ? 60 LYS A CA   4  
ATOM 7353  C C    . LYS A 1 56 ? 4.707   -3.566  10.150  1.00 0.00 ? 60 LYS A C    4  
ATOM 7354  O O    . LYS A 1 56 ? 4.095   -2.682  10.748  1.00 0.00 ? 60 LYS A O    4  
ATOM 7355  C CB   . LYS A 1 56 ? 2.949   -5.417  10.371  1.00 0.00 ? 60 LYS A CB   4  
ATOM 7356  C CG   . LYS A 1 56 ? 2.224   -6.535  9.618   1.00 0.00 ? 60 LYS A CG   4  
ATOM 7357  C CD   . LYS A 1 56 ? 3.122   -7.764  9.464   1.00 0.00 ? 60 LYS A CD   4  
ATOM 7358  C CE   . LYS A 1 56 ? 2.300   -9.053  9.515   1.00 0.00 ? 60 LYS A CE   4  
ATOM 7359  N NZ   . LYS A 1 56 ? 1.740   -9.365  8.181   1.00 0.00 ? 60 LYS A NZ   4  
ATOM 7360  H H    . LYS A 1 56 ? 5.227   -6.348  9.557   1.00 0.00 ? 60 LYS A H    4  
ATOM 7361  H HA   . LYS A 1 56 ? 3.389   -4.288  8.625   1.00 0.00 ? 60 LYS A HA   4  
ATOM 7362  H HB2  . LYS A 1 56 ? 3.468   -5.833  11.235  1.00 0.00 ? 60 LYS A HB2  4  
ATOM 7363  H HB3  . LYS A 1 56 ? 2.223   -4.699  10.751  1.00 0.00 ? 60 LYS A HB3  4  
ATOM 7364  H HG2  . LYS A 1 56 ? 1.316   -6.809  10.154  1.00 0.00 ? 60 LYS A HG2  4  
ATOM 7365  H HG3  . LYS A 1 56 ? 1.919   -6.177  8.635   1.00 0.00 ? 60 LYS A HG3  4  
ATOM 7366  H HD2  . LYS A 1 56 ? 3.660   -7.709  8.517   1.00 0.00 ? 60 LYS A HD2  4  
ATOM 7367  H HD3  . LYS A 1 56 ? 3.871   -7.774  10.255  1.00 0.00 ? 60 LYS A HD3  4  
ATOM 7368  H HE2  . LYS A 1 56 ? 2.927   -9.878  9.855   1.00 0.00 ? 60 LYS A HE2  4  
ATOM 7369  H HE3  . LYS A 1 56 ? 1.493   -8.948  10.240  1.00 0.00 ? 60 LYS A HE3  4  
ATOM 7370  H HZ1  . LYS A 1 56 ? 2.485   -9.459  7.521   1.00 0.00 ? 60 LYS A HZ1  4  
ATOM 7371  H HZ2  . LYS A 1 56 ? 1.226   -10.221 8.228   1.00 0.00 ? 60 LYS A HZ2  4  
ATOM 7372  H HZ3  . LYS A 1 56 ? 1.131   -8.625  7.895   1.00 0.00 ? 60 LYS A HZ3  4  
ATOM 7373  N N    . LYS A 1 57 ? 6.027   -3.626  10.045  1.00 0.00 ? 61 LYS A N    4  
ATOM 7374  C CA   . LYS A 1 57 ? 6.872   -2.612  10.652  1.00 0.00 ? 61 LYS A CA   4  
ATOM 7375  C C    . LYS A 1 57 ? 7.648   -1.879  9.555   1.00 0.00 ? 61 LYS A C    4  
ATOM 7376  O O    . LYS A 1 57 ? 8.195   -0.802  9.791   1.00 0.00 ? 61 LYS A O    4  
ATOM 7377  C CB   . LYS A 1 57 ? 7.766   -3.232  11.727  1.00 0.00 ? 61 LYS A CB   4  
ATOM 7378  C CG   . LYS A 1 57 ? 9.066   -3.765  11.120  1.00 0.00 ? 61 LYS A CG   4  
ATOM 7379  C CD   . LYS A 1 57 ? 10.216  -2.778  11.334  1.00 0.00 ? 61 LYS A CD   4  
ATOM 7380  C CE   . LYS A 1 57 ? 11.469  -3.225  10.579  1.00 0.00 ? 61 LYS A CE   4  
ATOM 7381  N NZ   . LYS A 1 57 ? 12.102  -2.074  9.898   1.00 0.00 ? 61 LYS A NZ   4  
ATOM 7382  H H    . LYS A 1 57 ? 6.517   -4.349  9.558   1.00 0.00 ? 61 LYS A H    4  
ATOM 7383  H HA   . LYS A 1 57 ? 6.218   -1.896  11.150  1.00 0.00 ? 61 LYS A HA   4  
ATOM 7384  H HB2  . LYS A 1 57 ? 7.995   -2.488  12.489  1.00 0.00 ? 61 LYS A HB2  4  
ATOM 7385  H HB3  . LYS A 1 57 ? 7.234   -4.043  12.224  1.00 0.00 ? 61 LYS A HB3  4  
ATOM 7386  H HG2  . LYS A 1 57 ? 9.316   -4.724  11.572  1.00 0.00 ? 61 LYS A HG2  4  
ATOM 7387  H HG3  . LYS A 1 57 ? 8.927   -3.941  10.053  1.00 0.00 ? 61 LYS A HG3  4  
ATOM 7388  H HD2  . LYS A 1 57 ? 9.917   -1.787  10.994  1.00 0.00 ? 61 LYS A HD2  4  
ATOM 7389  H HD3  . LYS A 1 57 ? 10.437  -2.698  12.398  1.00 0.00 ? 61 LYS A HD3  4  
ATOM 7390  H HE2  . LYS A 1 57 ? 12.177  -3.679  11.273  1.00 0.00 ? 61 LYS A HE2  4  
ATOM 7391  H HE3  . LYS A 1 57 ? 11.207  -3.989  9.847   1.00 0.00 ? 61 LYS A HE3  4  
ATOM 7392  H HZ1  . LYS A 1 57 ? 12.322  -1.368  10.572  1.00 0.00 ? 61 LYS A HZ1  4  
ATOM 7393  H HZ2  . LYS A 1 57 ? 12.941  -2.375  9.444   1.00 0.00 ? 61 LYS A HZ2  4  
ATOM 7394  H HZ3  . LYS A 1 57 ? 11.471  -1.700  9.218   1.00 0.00 ? 61 LYS A HZ3  4  
ATOM 7395  N N    . ILE A 1 58 ? 7.671   -2.491  8.380   1.00 0.00 ? 62 ILE A N    4  
ATOM 7396  C CA   . ILE A 1 58 ? 8.370   -1.909  7.247   1.00 0.00 ? 62 ILE A CA   4  
ATOM 7397  C C    . ILE A 1 58 ? 7.400   -1.037  6.448   1.00 0.00 ? 62 ILE A C    4  
ATOM 7398  O O    . ILE A 1 58 ? 7.824   -0.204  5.648   1.00 0.00 ? 62 ILE A O    4  
ATOM 7399  C CB   . ILE A 1 58 ? 9.042   -3.003  6.414   1.00 0.00 ? 62 ILE A CB   4  
ATOM 7400  C CG1  . ILE A 1 58 ? 10.072  -3.770  7.246   1.00 0.00 ? 62 ILE A CG1  4  
ATOM 7401  C CG2  . ILE A 1 58 ? 9.654   -2.422  5.138   1.00 0.00 ? 62 ILE A CG2  4  
ATOM 7402  C CD1  . ILE A 1 58 ? 10.206  -5.214  6.758   1.00 0.00 ? 62 ILE A CD1  4  
ATOM 7403  H H    . ILE A 1 58 ? 7.223   -3.366  8.197   1.00 0.00 ? 62 ILE A H    4  
ATOM 7404  H HA   . ILE A 1 58 ? 9.161   -1.273  7.643   1.00 0.00 ? 62 ILE A HA   4  
ATOM 7405  H HB   . ILE A 1 58 ? 8.279   -3.718  6.109   1.00 0.00 ? 62 ILE A HB   4  
ATOM 7406  H HG12 . ILE A 1 58 ? 11.039  -3.271  7.185   1.00 0.00 ? 62 ILE A HG12 4  
ATOM 7407  H HG13 . ILE A 1 58 ? 9.776   -3.763  8.295   1.00 0.00 ? 62 ILE A HG13 4  
ATOM 7408  H HG21 . ILE A 1 58 ? 9.793   -1.347  5.258   1.00 0.00 ? 62 ILE A HG21 4  
ATOM 7409  H HG22 . ILE A 1 58 ? 10.618  -2.894  4.950   1.00 0.00 ? 62 ILE A HG22 4  
ATOM 7410  H HG23 . ILE A 1 58 ? 8.987   -2.610  4.297   1.00 0.00 ? 62 ILE A HG23 4  
ATOM 7411  H HD11 . ILE A 1 58 ? 9.216   -5.620  6.549   1.00 0.00 ? 62 ILE A HD11 4  
ATOM 7412  H HD12 . ILE A 1 58 ? 10.807  -5.236  5.849   1.00 0.00 ? 62 ILE A HD12 4  
ATOM 7413  H HD13 . ILE A 1 58 ? 10.690  -5.814  7.528   1.00 0.00 ? 62 ILE A HD13 4  
ATOM 7414  N N    . ILE A 1 59 ? 6.117   -1.257  6.692   1.00 0.00 ? 63 ILE A N    4  
ATOM 7415  C CA   . ILE A 1 59 ? 5.083   -0.501  6.006   1.00 0.00 ? 63 ILE A CA   4  
ATOM 7416  C C    . ILE A 1 59 ? 4.708   0.721   6.846   1.00 0.00 ? 63 ILE A C    4  
ATOM 7417  O O    . ILE A 1 59 ? 4.825   1.855   6.385   1.00 0.00 ? 63 ILE A O    4  
ATOM 7418  C CB   . ILE A 1 59 ? 3.895   -1.403  5.667   1.00 0.00 ? 63 ILE A CB   4  
ATOM 7419  C CG1  . ILE A 1 59 ? 4.221   -2.319  4.486   1.00 0.00 ? 63 ILE A CG1  4  
ATOM 7420  C CG2  . ILE A 1 59 ? 2.632   -0.576  5.420   1.00 0.00 ? 63 ILE A CG2  4  
ATOM 7421  C CD1  . ILE A 1 59 ? 3.402   -3.610  4.550   1.00 0.00 ? 63 ILE A CD1  4  
ATOM 7422  H H    . ILE A 1 59 ? 5.780   -1.936  7.345   1.00 0.00 ? 63 ILE A H    4  
ATOM 7423  H HA   . ILE A 1 59 ? 5.504   -0.155  5.062   1.00 0.00 ? 63 ILE A HA   4  
ATOM 7424  H HB   . ILE A 1 59 ? 3.697   -2.044  6.526   1.00 0.00 ? 63 ILE A HB   4  
ATOM 7425  H HG12 . ILE A 1 59 ? 4.014   -1.799  3.550   1.00 0.00 ? 63 ILE A HG12 4  
ATOM 7426  H HG13 . ILE A 1 59 ? 5.284   -2.559  4.489   1.00 0.00 ? 63 ILE A HG13 4  
ATOM 7427  H HG21 . ILE A 1 59 ? 2.908   0.397   5.014   1.00 0.00 ? 63 ILE A HG21 4  
ATOM 7428  H HG22 . ILE A 1 59 ? 1.989   -1.098  4.710   1.00 0.00 ? 63 ILE A HG22 4  
ATOM 7429  H HG23 . ILE A 1 59 ? 2.098   -0.439  6.360   1.00 0.00 ? 63 ILE A HG23 4  
ATOM 7430  H HD11 . ILE A 1 59 ? 2.989   -3.728  5.552   1.00 0.00 ? 63 ILE A HD11 4  
ATOM 7431  H HD12 . ILE A 1 59 ? 2.589   -3.561  3.826   1.00 0.00 ? 63 ILE A HD12 4  
ATOM 7432  H HD13 . ILE A 1 59 ? 4.044   -4.460  4.319   1.00 0.00 ? 63 ILE A HD13 4  
ATOM 7433  N N    . GLU A 1 60 ? 4.264   0.448   8.064   1.00 0.00 ? 64 GLU A N    4  
ATOM 7434  C CA   . GLU A 1 60 ? 3.871   1.512   8.973   1.00 0.00 ? 64 GLU A CA   4  
ATOM 7435  C C    . GLU A 1 60 ? 4.949   2.596   9.020   1.00 0.00 ? 64 GLU A C    4  
ATOM 7436  O O    . GLU A 1 60 ? 4.639   3.781   9.131   1.00 0.00 ? 64 GLU A O    4  
ATOM 7437  C CB   . GLU A 1 60 ? 3.587   0.960   10.372  1.00 0.00 ? 64 GLU A CB   4  
ATOM 7438  C CG   . GLU A 1 60 ? 2.343   0.070   10.368  1.00 0.00 ? 64 GLU A CG   4  
ATOM 7439  C CD   . GLU A 1 60 ? 2.351   -0.889  11.560  1.00 0.00 ? 64 GLU A CD   4  
ATOM 7440  O OE1  . GLU A 1 60 ? 2.908   -0.490  12.606  1.00 0.00 ? 64 GLU A OE1  4  
ATOM 7441  O OE2  . GLU A 1 60 ? 1.801   -2.000  11.399  1.00 0.00 ? 64 GLU A OE2  4  
ATOM 7442  H H    . GLU A 1 60 ? 4.172   -0.477  8.432   1.00 0.00 ? 64 GLU A H    4  
ATOM 7443  H HA   . GLU A 1 60 ? 2.951   1.922   8.557   1.00 0.00 ? 64 GLU A HA   4  
ATOM 7444  H HB2  . GLU A 1 60 ? 4.446   0.389   10.723  1.00 0.00 ? 64 GLU A HB2  4  
ATOM 7445  H HB3  . GLU A 1 60 ? 3.446   1.785   11.070  1.00 0.00 ? 64 GLU A HB3  4  
ATOM 7446  H HG2  . GLU A 1 60 ? 1.447   0.690   10.402  1.00 0.00 ? 64 GLU A HG2  4  
ATOM 7447  H HG3  . GLU A 1 60 ? 2.301   -0.499  9.439   1.00 0.00 ? 64 GLU A HG3  4  
ATOM 7448  N N    . LYS A 1 61 ? 6.195   2.152   8.932   1.00 0.00 ? 65 LYS A N    4  
ATOM 7449  C CA   . LYS A 1 61 ? 7.321   3.070   8.963   1.00 0.00 ? 65 LYS A CA   4  
ATOM 7450  C C    . LYS A 1 61 ? 7.374   3.849   7.647   1.00 0.00 ? 65 LYS A C    4  
ATOM 7451  O O    . LYS A 1 61 ? 7.686   5.039   7.639   1.00 0.00 ? 65 LYS A O    4  
ATOM 7452  C CB   . LYS A 1 61 ? 8.614   2.320   9.286   1.00 0.00 ? 65 LYS A CB   4  
ATOM 7453  C CG   . LYS A 1 61 ? 9.025   2.538   10.744  1.00 0.00 ? 65 LYS A CG   4  
ATOM 7454  C CD   . LYS A 1 61 ? 10.204  3.509   10.842  1.00 0.00 ? 65 LYS A CD   4  
ATOM 7455  C CE   . LYS A 1 61 ? 10.721  3.601   12.279  1.00 0.00 ? 65 LYS A CE   4  
ATOM 7456  N NZ   . LYS A 1 61 ? 11.972  4.389   12.330  1.00 0.00 ? 65 LYS A NZ   4  
ATOM 7457  H H    . LYS A 1 61 ? 6.439   1.186   8.842   1.00 0.00 ? 65 LYS A H    4  
ATOM 7458  H HA   . LYS A 1 61 ? 7.145   3.775   9.775   1.00 0.00 ? 65 LYS A HA   4  
ATOM 7459  H HB2  . LYS A 1 61 ? 8.479   1.255   9.099   1.00 0.00 ? 65 LYS A HB2  4  
ATOM 7460  H HB3  . LYS A 1 61 ? 9.411   2.660   8.625   1.00 0.00 ? 65 LYS A HB3  4  
ATOM 7461  H HG2  . LYS A 1 61 ? 8.179   2.929   11.309  1.00 0.00 ? 65 LYS A HG2  4  
ATOM 7462  H HG3  . LYS A 1 61 ? 9.297   1.584   11.196  1.00 0.00 ? 65 LYS A HG3  4  
ATOM 7463  H HD2  . LYS A 1 61 ? 11.007  3.180   10.182  1.00 0.00 ? 65 LYS A HD2  4  
ATOM 7464  H HD3  . LYS A 1 61 ? 9.895   4.497   10.499  1.00 0.00 ? 65 LYS A HD3  4  
ATOM 7465  H HE2  . LYS A 1 61 ? 9.966   4.064   12.914  1.00 0.00 ? 65 LYS A HE2  4  
ATOM 7466  H HE3  . LYS A 1 61 ? 10.898  2.600   12.672  1.00 0.00 ? 65 LYS A HE3  4  
ATOM 7467  H HZ1  . LYS A 1 61 ? 12.637  4.002   11.690  1.00 0.00 ? 65 LYS A HZ1  4  
ATOM 7468  H HZ2  . LYS A 1 61 ? 11.780  5.337   12.077  1.00 0.00 ? 65 LYS A HZ2  4  
ATOM 7469  H HZ3  . LYS A 1 61 ? 12.347  4.361   13.257  1.00 0.00 ? 65 LYS A HZ3  4  
ATOM 7470  N N    . MET A 1 62 ? 7.064   3.147   6.568   1.00 0.00 ? 66 MET A N    4  
ATOM 7471  C CA   . MET A 1 62 ? 7.072   3.758   5.249   1.00 0.00 ? 66 MET A CA   4  
ATOM 7472  C C    . MET A 1 62 ? 6.128   4.961   5.197   1.00 0.00 ? 66 MET A C    4  
ATOM 7473  O O    . MET A 1 62 ? 6.448   5.979   4.585   1.00 0.00 ? 66 MET A O    4  
ATOM 7474  C CB   . MET A 1 62 ? 6.643   2.726   4.205   1.00 0.00 ? 66 MET A CB   4  
ATOM 7475  C CG   . MET A 1 62 ? 7.787   2.415   3.238   1.00 0.00 ? 66 MET A CG   4  
ATOM 7476  S SD   . MET A 1 62 ? 8.055   3.800   2.144   1.00 0.00 ? 66 MET A SD   4  
ATOM 7477  C CE   . MET A 1 62 ? 6.392   4.048   1.545   1.00 0.00 ? 66 MET A CE   4  
ATOM 7478  H H    . MET A 1 62 ? 6.811   2.179   6.583   1.00 0.00 ? 66 MET A H    4  
ATOM 7479  H HA   . MET A 1 62 ? 8.099   4.085   5.085   1.00 0.00 ? 66 MET A HA   4  
ATOM 7480  H HB2  . MET A 1 62 ? 6.324   1.810   4.703   1.00 0.00 ? 66 MET A HB2  4  
ATOM 7481  H HB3  . MET A 1 62 ? 5.784   3.101   3.649   1.00 0.00 ? 66 MET A HB3  4  
ATOM 7482  H HG2  . MET A 1 62 ? 8.698   2.201   3.797   1.00 0.00 ? 66 MET A HG2  4  
ATOM 7483  H HG3  . MET A 1 62 ? 7.552   1.523   2.658   1.00 0.00 ? 66 MET A HG3  4  
ATOM 7484  H HE1  . MET A 1 62 ? 5.832   3.116   1.631   1.00 0.00 ? 66 MET A HE1  4  
ATOM 7485  H HE2  . MET A 1 62 ? 5.904   4.821   2.138   1.00 0.00 ? 66 MET A HE2  4  
ATOM 7486  H HE3  . MET A 1 62 ? 6.425   4.357   0.500   1.00 0.00 ? 66 MET A HE3  4  
ATOM 7487  N N    . LEU A 1 63 ? 4.984   4.804   5.847   1.00 0.00 ? 67 LEU A N    4  
ATOM 7488  C CA   . LEU A 1 63 ? 3.992   5.864   5.882   1.00 0.00 ? 67 LEU A CA   4  
ATOM 7489  C C    . LEU A 1 63 ? 4.532   7.036   6.705   1.00 0.00 ? 67 LEU A C    4  
ATOM 7490  O O    . LEU A 1 63 ? 4.000   8.143   6.640   1.00 0.00 ? 67 LEU A O    4  
ATOM 7491  C CB   . LEU A 1 63 ? 2.650   5.327   6.384   1.00 0.00 ? 67 LEU A CB   4  
ATOM 7492  C CG   . LEU A 1 63 ? 1.846   4.492   5.385   1.00 0.00 ? 67 LEU A CG   4  
ATOM 7493  C CD1  . LEU A 1 63 ? 2.703   3.374   4.789   1.00 0.00 ? 67 LEU A CD1  4  
ATOM 7494  C CD2  . LEU A 1 63 ? 0.566   3.953   6.026   1.00 0.00 ? 67 LEU A CD2  4  
ATOM 7495  H H    . LEU A 1 63 ? 4.732   3.973   6.342   1.00 0.00 ? 67 LEU A H    4  
ATOM 7496  H HA   . LEU A 1 63 ? 3.840   6.204   4.857   1.00 0.00 ? 67 LEU A HA   4  
ATOM 7497  H HB2  . LEU A 1 63 ? 2.834   4.719   7.270   1.00 0.00 ? 67 LEU A HB2  4  
ATOM 7498  H HB3  . LEU A 1 63 ? 2.037   6.171   6.698   1.00 0.00 ? 67 LEU A HB3  4  
ATOM 7499  H HG   . LEU A 1 63 ? 1.546   5.141   4.562   1.00 0.00 ? 67 LEU A HG   4  
ATOM 7500  H HD11 . LEU A 1 63 ? 3.600   3.802   4.342   1.00 0.00 ? 67 LEU A HD11 4  
ATOM 7501  H HD12 . LEU A 1 63 ? 2.988   2.675   5.576   1.00 0.00 ? 67 LEU A HD12 4  
ATOM 7502  H HD13 . LEU A 1 63 ? 2.133   2.846   4.025   1.00 0.00 ? 67 LEU A HD13 4  
ATOM 7503  H HD21 . LEU A 1 63 ? 0.061   4.758   6.562   1.00 0.00 ? 67 LEU A HD21 4  
ATOM 7504  H HD22 . LEU A 1 63 ? -0.093  3.564   5.250   1.00 0.00 ? 67 LEU A HD22 4  
ATOM 7505  H HD23 . LEU A 1 63 ? 0.817   3.154   6.723   1.00 0.00 ? 67 LEU A HD23 4  
ATOM 7506  N N    . LYS A 1 64 ? 5.582   6.751   7.461   1.00 0.00 ? 68 LYS A N    4  
ATOM 7507  C CA   . LYS A 1 64 ? 6.200   7.767   8.296   1.00 0.00 ? 68 LYS A CA   4  
ATOM 7508  C C    . LYS A 1 64 ? 7.481   8.265   7.623   1.00 0.00 ? 68 LYS A C    4  
ATOM 7509  O O    . LYS A 1 64 ? 7.867   9.420   7.793   1.00 0.00 ? 68 LYS A O    4  
ATOM 7510  C CB   . LYS A 1 64 ? 6.417   7.236   9.714   1.00 0.00 ? 68 LYS A CB   4  
ATOM 7511  C CG   . LYS A 1 64 ? 7.469   8.064   10.455  1.00 0.00 ? 68 LYS A CG   4  
ATOM 7512  C CD   . LYS A 1 64 ? 7.024   8.357   11.890  1.00 0.00 ? 68 LYS A CD   4  
ATOM 7513  C CE   . LYS A 1 64 ? 6.889   9.863   12.125  1.00 0.00 ? 68 LYS A CE   4  
ATOM 7514  N NZ   . LYS A 1 64 ? 7.245   10.204  13.520  1.00 0.00 ? 68 LYS A NZ   4  
ATOM 7515  H H    . LYS A 1 64 ? 6.009   5.848   7.508   1.00 0.00 ? 68 LYS A H    4  
ATOM 7516  H HA   . LYS A 1 64 ? 5.501   8.601   8.367   1.00 0.00 ? 68 LYS A HA   4  
ATOM 7517  H HB2  . LYS A 1 64 ? 5.476   7.260   10.264  1.00 0.00 ? 68 LYS A HB2  4  
ATOM 7518  H HB3  . LYS A 1 64 ? 6.734   6.194   9.671   1.00 0.00 ? 68 LYS A HB3  4  
ATOM 7519  H HG2  . LYS A 1 64 ? 8.417   7.528   10.467  1.00 0.00 ? 68 LYS A HG2  4  
ATOM 7520  H HG3  . LYS A 1 64 ? 7.639   9.001   9.925   1.00 0.00 ? 68 LYS A HG3  4  
ATOM 7521  H HD2  . LYS A 1 64 ? 6.071   7.868   12.086  1.00 0.00 ? 68 LYS A HD2  4  
ATOM 7522  H HD3  . LYS A 1 64 ? 7.747   7.940   12.590  1.00 0.00 ? 68 LYS A HD3  4  
ATOM 7523  H HE2  . LYS A 1 64 ? 7.536   10.405  11.435  1.00 0.00 ? 68 LYS A HE2  4  
ATOM 7524  H HE3  . LYS A 1 64 ? 5.866   10.179  11.917  1.00 0.00 ? 68 LYS A HE3  4  
ATOM 7525  H HZ1  . LYS A 1 64 ? 7.986   9.608   13.830  1.00 0.00 ? 68 LYS A HZ1  4  
ATOM 7526  H HZ2  . LYS A 1 64 ? 7.543   11.158  13.564  1.00 0.00 ? 68 LYS A HZ2  4  
ATOM 7527  H HZ3  . LYS A 1 64 ? 6.447   10.077  14.109  1.00 0.00 ? 68 LYS A HZ3  4  
ATOM 7528  N N    . ASN A 1 65 ? 8.104   7.368   6.873   1.00 0.00 ? 69 ASN A N    4  
ATOM 7529  C CA   . ASN A 1 65 ? 9.334   7.701   6.174   1.00 0.00 ? 69 ASN A CA   4  
ATOM 7530  C C    . ASN A 1 65 ? 10.410  8.076   7.194   1.00 0.00 ? 69 ASN A C    4  
ATOM 7531  O O    . ASN A 1 65 ? 11.287  7.270   7.501   1.00 0.00 ? 69 ASN A O    4  
ATOM 7532  C CB   . ASN A 1 65 ? 9.130   8.897   5.241   1.00 0.00 ? 69 ASN A CB   4  
ATOM 7533  C CG   . ASN A 1 65 ? 10.466  9.391   4.684   1.00 0.00 ? 69 ASN A CG   4  
ATOM 7534  O OD1  . ASN A 1 65 ? 11.220  10.092  5.338   1.00 0.00 ? 69 ASN A OD1  4  
ATOM 7535  N ND2  . ASN A 1 65 ? 10.716  8.989   3.441   1.00 0.00 ? 69 ASN A ND2  4  
ATOM 7536  H H    . ASN A 1 65 ? 7.784   6.430   6.740   1.00 0.00 ? 69 ASN A H    4  
ATOM 7537  H HA   . ASN A 1 65 ? 9.591   6.808   5.605   1.00 0.00 ? 69 ASN A HA   4  
ATOM 7538  H HB2  . ASN A 1 65 ? 8.471   8.614   4.420   1.00 0.00 ? 69 ASN A HB2  4  
ATOM 7539  H HB3  . ASN A 1 65 ? 8.636   9.704   5.782   1.00 0.00 ? 69 ASN A HB3  4  
ATOM 7540  H HD21 . ASN A 1 65 ? 10.055  8.414   2.959   1.00 0.00 ? 69 ASN A HD21 4  
ATOM 7541  H HD22 . ASN A 1 65 ? 11.566  9.260   2.989   1.00 0.00 ? 69 ASN A HD22 4  
ATOM 7542  N N    . GLY A 1 66 ? 10.308  9.299   7.692   1.00 0.00 ? 70 GLY A N    4  
ATOM 7543  C CA   . GLY A 1 66 ? 11.263  9.791   8.671   1.00 0.00 ? 70 GLY A CA   4  
ATOM 7544  C C    . GLY A 1 66 ? 11.433  11.307  8.559   1.00 0.00 ? 70 GLY A C    4  
ATOM 7545  O O    . GLY A 1 66 ? 10.462  12.054  8.670   1.00 0.00 ? 70 GLY A O    4  
ATOM 7546  H H    . GLY A 1 66 ? 9.592   9.949   7.437   1.00 0.00 ? 70 GLY A H    4  
ATOM 7547  H HA2  . GLY A 1 66 ? 10.924  9.533   9.675   1.00 0.00 ? 70 GLY A HA2  4  
ATOM 7548  H HA3  . GLY A 1 66 ? 12.225  9.301   8.524   1.00 0.00 ? 70 GLY A HA3  4  
ATOM 7549  N N    . LYS A 1 67 ? 12.674  11.716  8.340   1.00 0.00 ? 71 LYS A N    4  
ATOM 7550  C CA   . LYS A 1 67 ? 12.983  13.130  8.211   1.00 0.00 ? 71 LYS A CA   4  
ATOM 7551  C C    . LYS A 1 67 ? 12.362  13.668  6.920   1.00 0.00 ? 71 LYS A C    4  
ATOM 7552  O O    . LYS A 1 67 ? 11.532  14.576  6.958   1.00 0.00 ? 71 LYS A O    4  
ATOM 7553  C CB   . LYS A 1 67 ? 14.493  13.359  8.308   1.00 0.00 ? 71 LYS A CB   4  
ATOM 7554  C CG   . LYS A 1 67 ? 14.882  13.866  9.698   1.00 0.00 ? 71 LYS A CG   4  
ATOM 7555  C CD   . LYS A 1 67 ? 15.324  12.712  10.599  1.00 0.00 ? 71 LYS A CD   4  
ATOM 7556  C CE   . LYS A 1 67 ? 15.579  13.197  12.028  1.00 0.00 ? 71 LYS A CE   4  
ATOM 7557  N NZ   . LYS A 1 67 ? 14.716  12.469  12.985  1.00 0.00 ? 71 LYS A NZ   4  
ATOM 7558  H H    . LYS A 1 67 ? 13.458  11.102  8.251   1.00 0.00 ? 71 LYS A H    4  
ATOM 7559  H HA   . LYS A 1 67 ? 12.524  13.644  9.055   1.00 0.00 ? 71 LYS A HA   4  
ATOM 7560  H HB2  . LYS A 1 67 ? 15.020  12.429  8.096   1.00 0.00 ? 71 LYS A HB2  4  
ATOM 7561  H HB3  . LYS A 1 67 ? 14.805  14.081  7.553   1.00 0.00 ? 71 LYS A HB3  4  
ATOM 7562  H HG2  . LYS A 1 67 ? 15.689  14.594  9.611   1.00 0.00 ? 71 LYS A HG2  4  
ATOM 7563  H HG3  . LYS A 1 67 ? 14.035  14.382  10.151  1.00 0.00 ? 71 LYS A HG3  4  
ATOM 7564  H HD2  . LYS A 1 67 ? 14.558  11.937  10.607  1.00 0.00 ? 71 LYS A HD2  4  
ATOM 7565  H HD3  . LYS A 1 67 ? 16.231  12.259  10.198  1.00 0.00 ? 71 LYS A HD3  4  
ATOM 7566  H HE2  . LYS A 1 67 ? 16.627  13.048  12.287  1.00 0.00 ? 71 LYS A HE2  4  
ATOM 7567  H HE3  . LYS A 1 67 ? 15.384  14.268  12.094  1.00 0.00 ? 71 LYS A HE3  4  
ATOM 7568  H HZ1  . LYS A 1 67 ? 14.786  11.486  12.815  1.00 0.00 ? 71 LYS A HZ1  4  
ATOM 7569  H HZ2  . LYS A 1 67 ? 15.013  12.668  13.919  1.00 0.00 ? 71 LYS A HZ2  4  
ATOM 7570  H HZ3  . LYS A 1 67 ? 13.767  12.762  12.867  1.00 0.00 ? 71 LYS A HZ3  4  
ATOM 7571  N N    . SER A 1 68 ? 12.788  13.086  5.809   1.00 0.00 ? 72 SER A N    4  
ATOM 7572  C CA   . SER A 1 68 ? 12.284  13.496  4.509   1.00 0.00 ? 72 SER A CA   4  
ATOM 7573  C C    . SER A 1 68 ? 12.858  12.592  3.416   1.00 0.00 ? 72 SER A C    4  
ATOM 7574  O O    . SER A 1 68 ? 12.110  11.977  2.658   1.00 0.00 ? 72 SER A O    4  
ATOM 7575  C CB   . SER A 1 68 ? 12.626  14.959  4.222   1.00 0.00 ? 72 SER A CB   4  
ATOM 7576  O OG   . SER A 1 68 ? 11.498  15.687  3.744   1.00 0.00 ? 72 SER A OG   4  
ATOM 7577  H H    . SER A 1 68 ? 13.463  12.349  5.787   1.00 0.00 ? 72 SER A H    4  
ATOM 7578  H HA   . SER A 1 68 ? 11.201  13.382  4.570   1.00 0.00 ? 72 SER A HA   4  
ATOM 7579  H HB2  . SER A 1 68 ? 13.002  15.429  5.131   1.00 0.00 ? 72 SER A HB2  4  
ATOM 7580  H HB3  . SER A 1 68 ? 13.427  15.006  3.484   1.00 0.00 ? 72 SER A HB3  4  
ATOM 7581  H HG   . SER A 1 68 ? 10.654  15.272  4.084   1.00 0.00 ? 72 SER A HG   4  
ATOM 7582  N N    . ASN A 1 69 ? 14.181  12.541  3.370   1.00 0.00 ? 73 ASN A N    4  
ATOM 7583  C CA   . ASN A 1 69 ? 14.864  11.722  2.383   1.00 0.00 ? 73 ASN A CA   4  
ATOM 7584  C C    . ASN A 1 69 ? 14.289  12.017  0.996   1.00 0.00 ? 73 ASN A C    4  
ATOM 7585  O O    . ASN A 1 69 ? 14.959  12.614  0.156   1.00 0.00 ? 73 ASN A O    4  
ATOM 7586  C CB   . ASN A 1 69 ? 14.667  10.233  2.670   1.00 0.00 ? 73 ASN A CB   4  
ATOM 7587  C CG   . ASN A 1 69 ? 15.359  9.373   1.610   1.00 0.00 ? 73 ASN A CG   4  
ATOM 7588  O OD1  . ASN A 1 69 ? 16.425  9.696   1.112   1.00 0.00 ? 73 ASN A OD1  4  
ATOM 7589  N ND2  . ASN A 1 69 ? 14.696  8.265   1.295   1.00 0.00 ? 73 ASN A ND2  4  
ATOM 7590  H H    . ASN A 1 69 ? 14.782  13.044  3.991   1.00 0.00 ? 73 ASN A H    4  
ATOM 7591  H HA   . ASN A 1 69 ? 15.917  11.995  2.464   1.00 0.00 ? 73 ASN A HA   4  
ATOM 7592  H HB2  . ASN A 1 69 ? 15.066  9.993   3.656   1.00 0.00 ? 73 ASN A HB2  4  
ATOM 7593  H HB3  . ASN A 1 69 ? 13.602  10.001  2.693   1.00 0.00 ? 73 ASN A HB3  4  
ATOM 7594  H HD21 . ASN A 1 69 ? 13.825  8.059   1.742   1.00 0.00 ? 73 ASN A HD21 4  
ATOM 7595  H HD22 . ASN A 1 69 ? 15.068  7.637   0.611   1.00 0.00 ? 73 ASN A HD22 4  
ATOM 7596  N N    . THR B 1 1  ? 15.159  13.115  -11.031 1.00 0.00 ? 5  THR B N    4  
ATOM 7597  C CA   . THR B 1 1  ? 15.424  14.248  -10.161 1.00 0.00 ? 5  THR B CA   4  
ATOM 7598  C C    . THR B 1 1  ? 14.260  15.240  -10.209 1.00 0.00 ? 5  THR B C    4  
ATOM 7599  O O    . THR B 1 1  ? 13.783  15.694  -9.170  1.00 0.00 ? 5  THR B O    4  
ATOM 7600  C CB   . THR B 1 1  ? 16.762  14.862  -10.577 1.00 0.00 ? 5  THR B CB   4  
ATOM 7601  O OG1  . THR B 1 1  ? 16.611  15.113  -11.971 1.00 0.00 ? 5  THR B OG1  4  
ATOM 7602  C CG2  . THR B 1 1  ? 17.915  13.858  -10.502 1.00 0.00 ? 5  THR B CG2  4  
ATOM 7603  H H    . THR B 1 1  ? 15.115  12.229  -10.569 1.00 0.00 ? 5  THR B H    4  
ATOM 7604  H HA   . THR B 1 1  ? 15.492  13.885  -9.135  1.00 0.00 ? 5  THR B HA   4  
ATOM 7605  H HB   . THR B 1 1  ? 16.982  15.752  -9.987  1.00 0.00 ? 5  THR B HB   4  
ATOM 7606  H HG1  . THR B 1 1  ? 17.072  15.965  -12.217 1.00 0.00 ? 5  THR B HG1  4  
ATOM 7607  H HG21 . THR B 1 1  ? 17.620  12.929  -10.990 1.00 0.00 ? 5  THR B HG21 4  
ATOM 7608  H HG22 . THR B 1 1  ? 18.789  14.271  -11.005 1.00 0.00 ? 5  THR B HG22 4  
ATOM 7609  H HG23 . THR B 1 1  ? 18.156  13.659  -9.458  1.00 0.00 ? 5  THR B HG23 4  
ATOM 7610  N N    . GLU B 1 2  ? 13.836  15.547  -11.426 1.00 0.00 ? 6  GLU B N    4  
ATOM 7611  C CA   . GLU B 1 2  ? 12.736  16.477  -11.623 1.00 0.00 ? 6  GLU B CA   4  
ATOM 7612  C C    . GLU B 1 2  ? 11.399  15.736  -11.571 1.00 0.00 ? 6  GLU B C    4  
ATOM 7613  O O    . GLU B 1 2  ? 10.601  15.822  -12.503 1.00 0.00 ? 6  GLU B O    4  
ATOM 7614  C CB   . GLU B 1 2  ? 12.891  17.237  -12.942 1.00 0.00 ? 6  GLU B CB   4  
ATOM 7615  C CG   . GLU B 1 2  ? 12.040  18.509  -12.944 1.00 0.00 ? 6  GLU B CG   4  
ATOM 7616  C CD   . GLU B 1 2  ? 12.880  19.730  -13.324 1.00 0.00 ? 6  GLU B CD   4  
ATOM 7617  O OE1  . GLU B 1 2  ? 13.761  20.087  -12.512 1.00 0.00 ? 6  GLU B OE1  4  
ATOM 7618  O OE2  . GLU B 1 2  ? 12.623  20.279  -14.417 1.00 0.00 ? 6  GLU B OE2  4  
ATOM 7619  H H    . GLU B 1 2  ? 14.229  15.174  -12.266 1.00 0.00 ? 6  GLU B H    4  
ATOM 7620  H HA   . GLU B 1 2  ? 12.801  17.182  -10.794 1.00 0.00 ? 6  GLU B HA   4  
ATOM 7621  H HB2  . GLU B 1 2  ? 13.939  17.496  -13.095 1.00 0.00 ? 6  GLU B HB2  4  
ATOM 7622  H HB3  . GLU B 1 2  ? 12.596  16.596  -13.772 1.00 0.00 ? 6  GLU B HB3  4  
ATOM 7623  H HG2  . GLU B 1 2  ? 11.216  18.397  -13.649 1.00 0.00 ? 6  GLU B HG2  4  
ATOM 7624  H HG3  . GLU B 1 2  ? 11.600  18.658  -11.959 1.00 0.00 ? 6  GLU B HG3  4  
ATOM 7625  N N    . LEU B 1 3  ? 11.195  15.025  -10.471 1.00 0.00 ? 7  LEU B N    4  
ATOM 7626  C CA   . LEU B 1 3  ? 9.967   14.270  -10.286 1.00 0.00 ? 7  LEU B CA   4  
ATOM 7627  C C    . LEU B 1 3  ? 9.069   15.002  -9.287  1.00 0.00 ? 7  LEU B C    4  
ATOM 7628  O O    . LEU B 1 3  ? 9.512   15.932  -8.613  1.00 0.00 ? 7  LEU B O    4  
ATOM 7629  C CB   . LEU B 1 3  ? 10.282  12.827  -9.887  1.00 0.00 ? 7  LEU B CB   4  
ATOM 7630  C CG   . LEU B 1 3  ? 11.009  11.984  -10.937 1.00 0.00 ? 7  LEU B CG   4  
ATOM 7631  C CD1  . LEU B 1 3  ? 12.522  12.015  -10.713 1.00 0.00 ? 7  LEU B CD1  4  
ATOM 7632  C CD2  . LEU B 1 3  ? 10.463  10.555  -10.967 1.00 0.00 ? 7  LEU B CD2  4  
ATOM 7633  H H    . LEU B 1 3  ? 11.849  14.961  -9.718  1.00 0.00 ? 7  LEU B H    4  
ATOM 7634  H HA   . LEU B 1 3  ? 9.457   14.235  -11.248 1.00 0.00 ? 7  LEU B HA   4  
ATOM 7635  H HB2  . LEU B 1 3  ? 10.887  12.845  -8.981  1.00 0.00 ? 7  LEU B HB2  4  
ATOM 7636  H HB3  . LEU B 1 3  ? 9.346   12.329  -9.635  1.00 0.00 ? 7  LEU B HB3  4  
ATOM 7637  H HG   . LEU B 1 3  ? 10.819  12.422  -11.917 1.00 0.00 ? 7  LEU B HG   4  
ATOM 7638  H HD11 . LEU B 1 3  ? 12.767  12.801  -9.999  1.00 0.00 ? 7  LEU B HD11 4  
ATOM 7639  H HD12 . LEU B 1 3  ? 12.851  11.052  -10.322 1.00 0.00 ? 7  LEU B HD12 4  
ATOM 7640  H HD13 . LEU B 1 3  ? 13.025  12.214  -11.659 1.00 0.00 ? 7  LEU B HD13 4  
ATOM 7641  H HD21 . LEU B 1 3  ? 9.410   10.563  -10.686 1.00 0.00 ? 7  LEU B HD21 4  
ATOM 7642  H HD22 . LEU B 1 3  ? 10.567  10.148  -11.973 1.00 0.00 ? 7  LEU B HD22 4  
ATOM 7643  H HD23 . LEU B 1 3  ? 11.022  9.938   -10.265 1.00 0.00 ? 7  LEU B HD23 4  
ATOM 7644  N N    . ARG B 1 4  ? 7.823   14.556  -9.222  1.00 0.00 ? 8  ARG B N    4  
ATOM 7645  C CA   . ARG B 1 4  ? 6.859   15.157  -8.316  1.00 0.00 ? 8  ARG B CA   4  
ATOM 7646  C C    . ARG B 1 4  ? 6.059   14.071  -7.595  1.00 0.00 ? 8  ARG B C    4  
ATOM 7647  O O    . ARG B 1 4  ? 6.602   13.024  -7.245  1.00 0.00 ? 8  ARG B O    4  
ATOM 7648  C CB   . ARG B 1 4  ? 5.895   16.076  -9.069  1.00 0.00 ? 8  ARG B CB   4  
ATOM 7649  C CG   . ARG B 1 4  ? 6.643   16.940  -10.087 1.00 0.00 ? 8  ARG B CG   4  
ATOM 7650  C CD   . ARG B 1 4  ? 6.040   18.344  -10.163 1.00 0.00 ? 8  ARG B CD   4  
ATOM 7651  N NE   . ARG B 1 4  ? 6.874   19.296  -9.395  1.00 0.00 ? 8  ARG B NE   4  
ATOM 7652  C CZ   . ARG B 1 4  ? 6.505   20.549  -9.100  1.00 0.00 ? 8  ARG B CZ   4  
ATOM 7653  N NH1  . ARG B 1 4  ? 5.314   21.011  -9.505  1.00 0.00 ? 8  ARG B NH1  4  
ATOM 7654  N NH2  . ARG B 1 4  ? 7.327   21.342  -8.399  1.00 0.00 ? 8  ARG B NH2  4  
ATOM 7655  H H    . ARG B 1 4  ? 7.471   13.800  -9.773  1.00 0.00 ? 8  ARG B H    4  
ATOM 7656  H HA   . ARG B 1 4  ? 7.460   15.734  -7.613  1.00 0.00 ? 8  ARG B HA   4  
ATOM 7657  H HB2  . ARG B 1 4  ? 5.140   15.478  -9.579  1.00 0.00 ? 8  ARG B HB2  4  
ATOM 7658  H HB3  . ARG B 1 4  ? 5.369   16.716  -8.361  1.00 0.00 ? 8  ARG B HB3  4  
ATOM 7659  H HG2  . ARG B 1 4  ? 7.695   17.007  -9.809  1.00 0.00 ? 8  ARG B HG2  4  
ATOM 7660  H HG3  . ARG B 1 4  ? 6.602   16.469  -11.069 1.00 0.00 ? 8  ARG B HG3  4  
ATOM 7661  H HD2  . ARG B 1 4  ? 5.972   18.664  -11.202 1.00 0.00 ? 8  ARG B HD2  4  
ATOM 7662  H HD3  . ARG B 1 4  ? 5.025   18.335  -9.765  1.00 0.00 ? 8  ARG B HD3  4  
ATOM 7663  H HE   . ARG B 1 4  ? 7.770   18.983  -9.078  1.00 0.00 ? 8  ARG B HE   4  
ATOM 7664  H HH11 . ARG B 1 4  ? 4.701   20.419  -10.029 1.00 0.00 ? 8  ARG B HH11 4  
ATOM 7665  H HH12 . ARG B 1 4  ? 5.039   21.946  -9.285  1.00 0.00 ? 8  ARG B HH12 4  
ATOM 7666  H HH21 . ARG B 1 4  ? 8.216   20.998  -8.096  1.00 0.00 ? 8  ARG B HH21 4  
ATOM 7667  H HH22 . ARG B 1 4  ? 7.052   22.278  -8.178  1.00 0.00 ? 8  ARG B HH22 4  
ATOM 7668  N N    . CYS B 1 5  ? 4.781   14.357  -7.395  1.00 0.00 ? 9  CYS B N    4  
ATOM 7669  C CA   . CYS B 1 5  ? 3.900   13.417  -6.722  1.00 0.00 ? 9  CYS B CA   4  
ATOM 7670  C C    . CYS B 1 5  ? 3.056   12.706  -7.781  1.00 0.00 ? 9  CYS B C    4  
ATOM 7671  O O    . CYS B 1 5  ? 2.697   13.302  -8.796  1.00 0.00 ? 9  CYS B O    4  
ATOM 7672  C CB   . CYS B 1 5  ? 3.032   14.109  -5.670  1.00 0.00 ? 9  CYS B CB   4  
ATOM 7673  S SG   . CYS B 1 5  ? 3.920   14.615  -4.152  1.00 0.00 ? 9  CYS B SG   4  
ATOM 7674  H H    . CYS B 1 5  ? 4.347   15.210  -7.682  1.00 0.00 ? 9  CYS B H    4  
ATOM 7675  H HA   . CYS B 1 5  ? 4.541   12.708  -6.198  1.00 0.00 ? 9  CYS B HA   4  
ATOM 7676  H HB2  . CYS B 1 5  ? 2.577   14.992  -6.119  1.00 0.00 ? 9  CYS B HB2  4  
ATOM 7677  H HB3  . CYS B 1 5  ? 2.218   13.439  -5.392  1.00 0.00 ? 9  CYS B HB3  4  
ATOM 7678  N N    . GLN B 1 6  ? 2.764   11.443  -7.510  1.00 0.00 ? 10 GLN B N    4  
ATOM 7679  C CA   . GLN B 1 6  ? 1.969   10.645  -8.427  1.00 0.00 ? 10 GLN B CA   4  
ATOM 7680  C C    . GLN B 1 6  ? 0.480   10.943  -8.237  1.00 0.00 ? 10 GLN B C    4  
ATOM 7681  O O    . GLN B 1 6  ? -0.362  10.399  -8.951  1.00 0.00 ? 10 GLN B O    4  
ATOM 7682  C CB   . GLN B 1 6  ? 2.256   9.153   -8.247  1.00 0.00 ? 10 GLN B CB   4  
ATOM 7683  C CG   . GLN B 1 6  ? 1.920   8.372   -9.519  1.00 0.00 ? 10 GLN B CG   4  
ATOM 7684  C CD   . GLN B 1 6  ? 1.224   7.051   -9.185  1.00 0.00 ? 10 GLN B CD   4  
ATOM 7685  O OE1  . GLN B 1 6  ? 0.061   6.840   -9.484  1.00 0.00 ? 10 GLN B OE1  4  
ATOM 7686  N NE2  . GLN B 1 6  ? 1.999   6.177   -8.549  1.00 0.00 ? 10 GLN B NE2  4  
ATOM 7687  H H    . GLN B 1 6  ? 3.060   10.966  -6.682  1.00 0.00 ? 10 GLN B H    4  
ATOM 7688  H HA   . GLN B 1 6  ? 2.283   10.951  -9.425  1.00 0.00 ? 10 GLN B HA   4  
ATOM 7689  H HB2  . GLN B 1 6  ? 3.306   9.009   -7.994  1.00 0.00 ? 10 GLN B HB2  4  
ATOM 7690  H HB3  . GLN B 1 6  ? 1.671   8.764   -7.413  1.00 0.00 ? 10 GLN B HB3  4  
ATOM 7691  H HG2  . GLN B 1 6  ? 1.277   8.974   -10.161 1.00 0.00 ? 10 GLN B HG2  4  
ATOM 7692  H HG3  . GLN B 1 6  ? 2.834   8.174   -10.080 1.00 0.00 ? 10 GLN B HG3  4  
ATOM 7693  H HE21 . GLN B 1 6  ? 2.947   6.414   -8.333  1.00 0.00 ? 10 GLN B HE21 4  
ATOM 7694  H HE22 . GLN B 1 6  ? 1.635   5.284   -8.287  1.00 0.00 ? 10 GLN B HE22 4  
ATOM 7695  N N    . CYS B 1 7  ? 0.201   11.807  -7.272  1.00 0.00 ? 11 CYS B N    4  
ATOM 7696  C CA   . CYS B 1 7  ? -1.171  12.184  -6.979  1.00 0.00 ? 11 CYS B CA   4  
ATOM 7697  C C    . CYS B 1 7  ? -1.186  13.656  -6.560  1.00 0.00 ? 11 CYS B C    4  
ATOM 7698  O O    . CYS B 1 7  ? -0.329  14.095  -5.795  1.00 0.00 ? 11 CYS B O    4  
ATOM 7699  C CB   . CYS B 1 7  ? -1.791  11.280  -5.912  1.00 0.00 ? 11 CYS B CB   4  
ATOM 7700  S SG   . CYS B 1 7  ? -3.235  10.306  -6.474  1.00 0.00 ? 11 CYS B SG   4  
ATOM 7701  H H    . CYS B 1 7  ? 0.892   12.245  -6.696  1.00 0.00 ? 11 CYS B H    4  
ATOM 7702  H HA   . CYS B 1 7  ? -1.739  12.038  -7.898  1.00 0.00 ? 11 CYS B HA   4  
ATOM 7703  H HB2  . CYS B 1 7  ? -1.027  10.594  -5.548  1.00 0.00 ? 11 CYS B HB2  4  
ATOM 7704  H HB3  . CYS B 1 7  ? -2.094  11.897  -5.065  1.00 0.00 ? 11 CYS B HB3  4  
ATOM 7705  N N    . LEU B 1 8  ? -2.168  14.376  -7.081  1.00 0.00 ? 12 LEU B N    4  
ATOM 7706  C CA   . LEU B 1 8  ? -2.306  15.789  -6.770  1.00 0.00 ? 12 LEU B CA   4  
ATOM 7707  C C    . LEU B 1 8  ? -3.484  15.984  -5.813  1.00 0.00 ? 12 LEU B C    4  
ATOM 7708  O O    . LEU B 1 8  ? -3.621  17.042  -5.200  1.00 0.00 ? 12 LEU B O    4  
ATOM 7709  C CB   . LEU B 1 8  ? -2.415  16.612  -8.055  1.00 0.00 ? 12 LEU B CB   4  
ATOM 7710  C CG   . LEU B 1 8  ? -1.461  16.220  -9.186  1.00 0.00 ? 12 LEU B CG   4  
ATOM 7711  C CD1  . LEU B 1 8  ? -2.057  16.568  -10.551 1.00 0.00 ? 12 LEU B CD1  4  
ATOM 7712  C CD2  . LEU B 1 8  ? -0.082  16.852  -8.984  1.00 0.00 ? 12 LEU B CD2  4  
ATOM 7713  H H    . LEU B 1 8  ? -2.861  14.011  -7.703  1.00 0.00 ? 12 LEU B H    4  
ATOM 7714  H HA   . LEU B 1 8  ? -1.393  16.102  -6.263  1.00 0.00 ? 12 LEU B HA   4  
ATOM 7715  H HB2  . LEU B 1 8  ? -3.437  16.536  -8.427  1.00 0.00 ? 12 LEU B HB2  4  
ATOM 7716  H HB3  . LEU B 1 8  ? -2.243  17.659  -7.808  1.00 0.00 ? 12 LEU B HB3  4  
ATOM 7717  H HG   . LEU B 1 8  ? -1.326  15.139  -9.160  1.00 0.00 ? 12 LEU B HG   4  
ATOM 7718  H HD11 . LEU B 1 8  ? -3.119  16.323  -10.558 1.00 0.00 ? 12 LEU B HD11 4  
ATOM 7719  H HD12 . LEU B 1 8  ? -1.929  17.634  -10.743 1.00 0.00 ? 12 LEU B HD12 4  
ATOM 7720  H HD13 . LEU B 1 8  ? -1.547  15.996  -11.327 1.00 0.00 ? 12 LEU B HD13 4  
ATOM 7721  H HD21 . LEU B 1 8  ? -0.116  17.532  -8.133  1.00 0.00 ? 12 LEU B HD21 4  
ATOM 7722  H HD22 . LEU B 1 8  ? 0.652   16.069  -8.795  1.00 0.00 ? 12 LEU B HD22 4  
ATOM 7723  H HD23 . LEU B 1 8  ? 0.198   17.406  -9.880  1.00 0.00 ? 12 LEU B HD23 4  
ATOM 7724  N N    . GLN B 1 9  ? -4.304  14.948  -5.716  1.00 0.00 ? 13 GLN B N    4  
ATOM 7725  C CA   . GLN B 1 9  ? -5.465  14.993  -4.844  1.00 0.00 ? 13 GLN B CA   4  
ATOM 7726  C C    . GLN B 1 9  ? -5.579  13.693  -4.045  1.00 0.00 ? 13 GLN B C    4  
ATOM 7727  O O    . GLN B 1 9  ? -4.892  12.716  -4.340  1.00 0.00 ? 13 GLN B O    4  
ATOM 7728  C CB   . GLN B 1 9  ? -6.742  15.257  -5.645  1.00 0.00 ? 13 GLN B CB   4  
ATOM 7729  C CG   . GLN B 1 9  ? -7.887  15.684  -4.724  1.00 0.00 ? 13 GLN B CG   4  
ATOM 7730  C CD   . GLN B 1 9  ? -8.809  16.685  -5.424  1.00 0.00 ? 13 GLN B CD   4  
ATOM 7731  O OE1  . GLN B 1 9  ? -9.760  16.326  -6.099  1.00 0.00 ? 13 GLN B OE1  4  
ATOM 7732  N NE2  . GLN B 1 9  ? -8.475  17.957  -5.227  1.00 0.00 ? 13 GLN B NE2  4  
ATOM 7733  H H    . GLN B 1 9  ? -4.185  14.092  -6.218  1.00 0.00 ? 13 GLN B H    4  
ATOM 7734  H HA   . GLN B 1 9  ? -5.288  15.829  -4.167  1.00 0.00 ? 13 GLN B HA   4  
ATOM 7735  H HB2  . GLN B 1 9  ? -6.556  16.036  -6.385  1.00 0.00 ? 13 GLN B HB2  4  
ATOM 7736  H HB3  . GLN B 1 9  ? -7.026  14.359  -6.192  1.00 0.00 ? 13 GLN B HB3  4  
ATOM 7737  H HG2  . GLN B 1 9  ? -8.460  14.808  -4.421  1.00 0.00 ? 13 GLN B HG2  4  
ATOM 7738  H HG3  . GLN B 1 9  ? -7.482  16.131  -3.816  1.00 0.00 ? 13 GLN B HG3  4  
ATOM 7739  H HE21 . GLN B 1 9  ? -7.682  18.184  -4.662  1.00 0.00 ? 13 GLN B HE21 4  
ATOM 7740  H HE22 . GLN B 1 9  ? -9.018  18.687  -5.643  1.00 0.00 ? 13 GLN B HE22 4  
ATOM 7741  N N    . THR B 1 10 ? -6.452  13.723  -3.048  1.00 0.00 ? 14 THR B N    4  
ATOM 7742  C CA   . THR B 1 10 ? -6.664  12.559  -2.205  1.00 0.00 ? 14 THR B CA   4  
ATOM 7743  C C    . THR B 1 10 ? -8.083  12.567  -1.633  1.00 0.00 ? 14 THR B C    4  
ATOM 7744  O O    . THR B 1 10 ? -8.761  13.593  -1.657  1.00 0.00 ? 14 THR B O    4  
ATOM 7745  C CB   . THR B 1 10 ? -5.576  12.550  -1.129  1.00 0.00 ? 14 THR B CB   4  
ATOM 7746  O OG1  . THR B 1 10 ? -5.539  13.895  -0.661  1.00 0.00 ? 14 THR B OG1  4  
ATOM 7747  C CG2  . THR B 1 10 ? -4.180  12.318  -1.711  1.00 0.00 ? 14 THR B CG2  4  
ATOM 7748  H H    . THR B 1 10 ? -7.007  14.521  -2.815  1.00 0.00 ? 14 THR B H    4  
ATOM 7749  H HA   . THR B 1 10 ? -6.573  11.665  -2.822  1.00 0.00 ? 14 THR B HA   4  
ATOM 7750  H HB   . THR B 1 10 ? -5.801  11.817  -0.354  1.00 0.00 ? 14 THR B HB   4  
ATOM 7751  H HG1  . THR B 1 10 ? -6.458  14.195  -0.407  1.00 0.00 ? 14 THR B HG1  4  
ATOM 7752  H HG21 . THR B 1 10 ? -4.161  11.368  -2.244  1.00 0.00 ? 14 THR B HG21 4  
ATOM 7753  H HG22 . THR B 1 10 ? -3.935  13.127  -2.399  1.00 0.00 ? 14 THR B HG22 4  
ATOM 7754  H HG23 . THR B 1 10 ? -3.449  12.295  -0.902  1.00 0.00 ? 14 THR B HG23 4  
ATOM 7755  N N    . LEU B 1 11 ? -8.492  11.410  -1.133  1.00 0.00 ? 15 LEU B N    4  
ATOM 7756  C CA   . LEU B 1 11 ? -9.818  11.270  -0.556  1.00 0.00 ? 15 LEU B CA   4  
ATOM 7757  C C    . LEU B 1 11 ? -9.734  11.468  0.959   1.00 0.00 ? 15 LEU B C    4  
ATOM 7758  O O    . LEU B 1 11 ? -8.663  11.750  1.493   1.00 0.00 ? 15 LEU B O    4  
ATOM 7759  C CB   . LEU B 1 11 ? -10.444 9.937   -0.968  1.00 0.00 ? 15 LEU B CB   4  
ATOM 7760  C CG   . LEU B 1 11 ? -10.837 9.808   -2.442  1.00 0.00 ? 15 LEU B CG   4  
ATOM 7761  C CD1  . LEU B 1 11 ? -10.735 8.355   -2.911  1.00 0.00 ? 15 LEU B CD1  4  
ATOM 7762  C CD2  . LEU B 1 11 ? -12.228 10.394  -2.691  1.00 0.00 ? 15 LEU B CD2  4  
ATOM 7763  H H    . LEU B 1 11 ? -7.935  10.580  -1.117  1.00 0.00 ? 15 LEU B H    4  
ATOM 7764  H HA   . LEU B 1 11 ? -10.441 12.062  -0.973  1.00 0.00 ? 15 LEU B HA   4  
ATOM 7765  H HB2  . LEU B 1 11 ? -9.741  9.139   -0.729  1.00 0.00 ? 15 LEU B HB2  4  
ATOM 7766  H HB3  . LEU B 1 11 ? -11.333 9.772   -0.360  1.00 0.00 ? 15 LEU B HB3  4  
ATOM 7767  H HG   . LEU B 1 11 ? -10.132 10.388  -3.036  1.00 0.00 ? 15 LEU B HG   4  
ATOM 7768  H HD11 . LEU B 1 11 ? -10.696 7.695   -2.044  1.00 0.00 ? 15 LEU B HD11 4  
ATOM 7769  H HD12 . LEU B 1 11 ? -11.606 8.107   -3.518  1.00 0.00 ? 15 LEU B HD12 4  
ATOM 7770  H HD13 . LEU B 1 11 ? -9.830  8.228   -3.505  1.00 0.00 ? 15 LEU B HD13 4  
ATOM 7771  H HD21 . LEU B 1 11 ? -12.261 11.420  -2.325  1.00 0.00 ? 15 LEU B HD21 4  
ATOM 7772  H HD22 . LEU B 1 11 ? -12.441 10.383  -3.760  1.00 0.00 ? 15 LEU B HD22 4  
ATOM 7773  H HD23 . LEU B 1 11 ? -12.974 9.797   -2.167  1.00 0.00 ? 15 LEU B HD23 4  
ATOM 7774  N N    . GLN B 1 12 ? -10.878 11.311  1.608   1.00 0.00 ? 16 GLN B N    4  
ATOM 7775  C CA   . GLN B 1 12 ? -10.948 11.469  3.051   1.00 0.00 ? 16 GLN B CA   4  
ATOM 7776  C C    . GLN B 1 12 ? -11.249 10.125  3.718   1.00 0.00 ? 16 GLN B C    4  
ATOM 7777  O O    . GLN B 1 12 ? -11.104 9.984   4.931   1.00 0.00 ? 16 GLN B O    4  
ATOM 7778  C CB   . GLN B 1 12 ? -11.991 12.519  3.438   1.00 0.00 ? 16 GLN B CB   4  
ATOM 7779  C CG   . GLN B 1 12 ? -12.392 12.378  4.908   1.00 0.00 ? 16 GLN B CG   4  
ATOM 7780  C CD   . GLN B 1 12 ? -13.015 13.673  5.434   1.00 0.00 ? 16 GLN B CD   4  
ATOM 7781  O OE1  . GLN B 1 12 ? -14.184 13.955  5.232   1.00 0.00 ? 16 GLN B OE1  4  
ATOM 7782  N NE2  . GLN B 1 12 ? -12.171 14.441  6.117   1.00 0.00 ? 16 GLN B NE2  4  
ATOM 7783  H H    . GLN B 1 12 ? -11.745 11.081  1.166   1.00 0.00 ? 16 GLN B H    4  
ATOM 7784  H HA   . GLN B 1 12 ? -9.960  11.818  3.352   1.00 0.00 ? 16 GLN B HA   4  
ATOM 7785  H HB2  . GLN B 1 12 ? -11.590 13.517  3.262   1.00 0.00 ? 16 GLN B HB2  4  
ATOM 7786  H HB3  . GLN B 1 12 ? -12.872 12.413  2.806   1.00 0.00 ? 16 GLN B HB3  4  
ATOM 7787  H HG2  . GLN B 1 12 ? -13.102 11.558  5.018   1.00 0.00 ? 16 GLN B HG2  4  
ATOM 7788  H HG3  . GLN B 1 12 ? -11.516 12.123  5.505   1.00 0.00 ? 16 GLN B HG3  4  
ATOM 7789  H HE21 . GLN B 1 12 ? -11.223 14.150  6.246   1.00 0.00 ? 16 GLN B HE21 4  
ATOM 7790  H HE22 . GLN B 1 12 ? -12.484 15.309  6.501   1.00 0.00 ? 16 GLN B HE22 4  
ATOM 7791  N N    . GLY B 1 13 ? -11.663 9.172   2.896   1.00 0.00 ? 17 GLY B N    4  
ATOM 7792  C CA   . GLY B 1 13 ? -11.986 7.845   3.391   1.00 0.00 ? 17 GLY B CA   4  
ATOM 7793  C C    . GLY B 1 13 ? -13.059 7.183   2.524   1.00 0.00 ? 17 GLY B C    4  
ATOM 7794  O O    . GLY B 1 13 ? -14.244 7.488   2.656   1.00 0.00 ? 17 GLY B O    4  
ATOM 7795  H H    . GLY B 1 13 ? -11.779 9.295   1.910   1.00 0.00 ? 17 GLY B H    4  
ATOM 7796  H HA2  . GLY B 1 13 ? -11.088 7.227   3.398   1.00 0.00 ? 17 GLY B HA2  4  
ATOM 7797  H HA3  . GLY B 1 13 ? -12.335 7.912   4.421   1.00 0.00 ? 17 GLY B HA3  4  
ATOM 7798  N N    . ILE B 1 14 ? -12.607 6.288   1.658   1.00 0.00 ? 18 ILE B N    4  
ATOM 7799  C CA   . ILE B 1 14 ? -13.514 5.581   0.770   1.00 0.00 ? 18 ILE B CA   4  
ATOM 7800  C C    . ILE B 1 14 ? -13.840 4.211   1.369   1.00 0.00 ? 18 ILE B C    4  
ATOM 7801  O O    . ILE B 1 14 ? -13.098 3.703   2.208   1.00 0.00 ? 18 ILE B O    4  
ATOM 7802  C CB   . ILE B 1 14 ? -12.934 5.511   -0.644  1.00 0.00 ? 18 ILE B CB   4  
ATOM 7803  C CG1  . ILE B 1 14 ? -13.260 6.781   -1.433  1.00 0.00 ? 18 ILE B CG1  4  
ATOM 7804  C CG2  . ILE B 1 14 ? -13.405 4.249   -1.369  1.00 0.00 ? 18 ILE B CG2  4  
ATOM 7805  C CD1  . ILE B 1 14 ? -14.707 6.760   -1.931  1.00 0.00 ? 18 ILE B CD1  4  
ATOM 7806  H H    . ILE B 1 14 ? -11.642 6.046   1.557   1.00 0.00 ? 18 ILE B H    4  
ATOM 7807  H HA   . ILE B 1 14 ? -14.434 6.161   0.713   1.00 0.00 ? 18 ILE B HA   4  
ATOM 7808  H HB   . ILE B 1 14 ? -11.848 5.451   -0.566  1.00 0.00 ? 18 ILE B HB   4  
ATOM 7809  H HG12 . ILE B 1 14 ? -13.101 7.656   -0.803  1.00 0.00 ? 18 ILE B HG12 4  
ATOM 7810  H HG13 . ILE B 1 14 ? -12.581 6.871   -2.281  1.00 0.00 ? 18 ILE B HG13 4  
ATOM 7811  H HG21 . ILE B 1 14 ? -14.495 4.231   -1.396  1.00 0.00 ? 18 ILE B HG21 4  
ATOM 7812  H HG22 . ILE B 1 14 ? -13.016 4.248   -2.387  1.00 0.00 ? 18 ILE B HG22 4  
ATOM 7813  H HG23 . ILE B 1 14 ? -13.041 3.369   -0.839  1.00 0.00 ? 18 ILE B HG23 4  
ATOM 7814  H HD11 . ILE B 1 14 ? -14.857 5.892   -2.574  1.00 0.00 ? 18 ILE B HD11 4  
ATOM 7815  H HD12 . ILE B 1 14 ? -15.384 6.703   -1.079  1.00 0.00 ? 18 ILE B HD12 4  
ATOM 7816  H HD13 . ILE B 1 14 ? -14.910 7.670   -2.496  1.00 0.00 ? 18 ILE B HD13 4  
ATOM 7817  N N    . HIS B 1 15 ? -14.952 3.652   0.913   1.00 0.00 ? 19 HIS B N    4  
ATOM 7818  C CA   . HIS B 1 15 ? -15.386 2.351   1.393   1.00 0.00 ? 19 HIS B CA   4  
ATOM 7819  C C    . HIS B 1 15 ? -14.333 1.297   1.043   1.00 0.00 ? 19 HIS B C    4  
ATOM 7820  O O    . HIS B 1 15 ? -13.684 1.385   0.002   1.00 0.00 ? 19 HIS B O    4  
ATOM 7821  C CB   . HIS B 1 15 ? -16.774 2.006   0.849   1.00 0.00 ? 19 HIS B CB   4  
ATOM 7822  C CG   . HIS B 1 15 ? -17.703 1.400   1.873   1.00 0.00 ? 19 HIS B CG   4  
ATOM 7823  N ND1  . HIS B 1 15 ? -18.857 2.029   2.304   1.00 0.00 ? 19 HIS B ND1  4  
ATOM 7824  C CD2  . HIS B 1 15 ? -17.635 0.216   2.547   1.00 0.00 ? 19 HIS B CD2  4  
ATOM 7825  C CE1  . HIS B 1 15 ? -19.450 1.250   3.197   1.00 0.00 ? 19 HIS B CE1  4  
ATOM 7826  N NE2  . HIS B 1 15 ? -18.691 0.127   3.346   1.00 0.00 ? 19 HIS B NE2  4  
ATOM 7827  H H    . HIS B 1 15 ? -15.550 4.072   0.230   1.00 0.00 ? 19 HIS B H    4  
ATOM 7828  H HA   . HIS B 1 15 ? -15.464 2.428   2.478   1.00 0.00 ? 19 HIS B HA   4  
ATOM 7829  H HB2  . HIS B 1 15 ? -17.231 2.912   0.449   1.00 0.00 ? 19 HIS B HB2  4  
ATOM 7830  H HB3  . HIS B 1 15 ? -16.664 1.311   0.016   1.00 0.00 ? 19 HIS B HB3  4  
ATOM 7831  H HD1  . HIS B 1 15 ? -19.188 2.921   1.994   1.00 0.00 ? 19 HIS B HD1  4  
ATOM 7832  H HD2  . HIS B 1 15 ? -16.848 -0.531  2.445   1.00 0.00 ? 19 HIS B HD2  4  
ATOM 7833  H HE1  . HIS B 1 15 ? -20.381 1.469   3.720   1.00 0.00 ? 19 HIS B HE1  4  
ATOM 7834  N N    . LEU B 1 16 ? -14.197 0.325   1.933   1.00 0.00 ? 20 LEU B N    4  
ATOM 7835  C CA   . LEU B 1 16 ? -13.234 -0.745  1.731   1.00 0.00 ? 20 LEU B CA   4  
ATOM 7836  C C    . LEU B 1 16 ? -13.869 -1.841  0.873   1.00 0.00 ? 20 LEU B C    4  
ATOM 7837  O O    . LEU B 1 16 ? -13.284 -2.908  0.690   1.00 0.00 ? 20 LEU B O    4  
ATOM 7838  C CB   . LEU B 1 16 ? -12.702 -1.246  3.075   1.00 0.00 ? 20 LEU B CB   4  
ATOM 7839  C CG   . LEU B 1 16 ? -11.964 -2.586  3.045   1.00 0.00 ? 20 LEU B CG   4  
ATOM 7840  C CD1  . LEU B 1 16 ? -10.852 -2.577  1.994   1.00 0.00 ? 20 LEU B CD1  4  
ATOM 7841  C CD2  . LEU B 1 16 ? -11.436 -2.952  4.434   1.00 0.00 ? 20 LEU B CD2  4  
ATOM 7842  H H    . LEU B 1 16 ? -14.729 0.261   2.777   1.00 0.00 ? 20 LEU B H    4  
ATOM 7843  H HA   . LEU B 1 16 ? -12.389 -0.325  1.186   1.00 0.00 ? 20 LEU B HA   4  
ATOM 7844  H HB2  . LEU B 1 16 ? -12.028 -0.492  3.480   1.00 0.00 ? 20 LEU B HB2  4  
ATOM 7845  H HB3  . LEU B 1 16 ? -13.540 -1.331  3.766   1.00 0.00 ? 20 LEU B HB3  4  
ATOM 7846  H HG   . LEU B 1 16 ? -12.674 -3.361  2.756   1.00 0.00 ? 20 LEU B HG   4  
ATOM 7847  H HD11 . LEU B 1 16 ? -10.670 -1.553  1.667   1.00 0.00 ? 20 LEU B HD11 4  
ATOM 7848  H HD12 . LEU B 1 16 ? -9.940  -2.988  2.426   1.00 0.00 ? 20 LEU B HD12 4  
ATOM 7849  H HD13 . LEU B 1 16 ? -11.155 -3.183  1.140   1.00 0.00 ? 20 LEU B HD13 4  
ATOM 7850  H HD21 . LEU B 1 16 ? -11.235 -2.041  4.998   1.00 0.00 ? 20 LEU B HD21 4  
ATOM 7851  H HD22 . LEU B 1 16 ? -12.181 -3.549  4.960   1.00 0.00 ? 20 LEU B HD22 4  
ATOM 7852  H HD23 . LEU B 1 16 ? -10.515 -3.527  4.333   1.00 0.00 ? 20 LEU B HD23 4  
ATOM 7853  N N    . LYS B 1 17 ? -15.057 -1.540  0.369   1.00 0.00 ? 21 LYS B N    4  
ATOM 7854  C CA   . LYS B 1 17 ? -15.777 -2.487  -0.466  1.00 0.00 ? 21 LYS B CA   4  
ATOM 7855  C C    . LYS B 1 17 ? -15.369 -2.286  -1.927  1.00 0.00 ? 21 LYS B C    4  
ATOM 7856  O O    . LYS B 1 17 ? -15.535 -3.184  -2.751  1.00 0.00 ? 21 LYS B O    4  
ATOM 7857  C CB   . LYS B 1 17 ? -17.284 -2.373  -0.227  1.00 0.00 ? 21 LYS B CB   4  
ATOM 7858  C CG   . LYS B 1 17 ? -17.871 -1.183  -0.988  1.00 0.00 ? 21 LYS B CG   4  
ATOM 7859  C CD   . LYS B 1 17 ? -19.108 -0.633  -0.274  1.00 0.00 ? 21 LYS B CD   4  
ATOM 7860  C CE   . LYS B 1 17 ? -20.340 -0.706  -1.178  1.00 0.00 ? 21 LYS B CE   4  
ATOM 7861  N NZ   . LYS B 1 17 ? -21.567 -0.408  -0.406  1.00 0.00 ? 21 LYS B NZ   4  
ATOM 7862  H H    . LYS B 1 17 ? -15.525 -0.670  0.522   1.00 0.00 ? 21 LYS B H    4  
ATOM 7863  H HA   . LYS B 1 17 ? -15.476 -3.488  -0.158  1.00 0.00 ? 21 LYS B HA   4  
ATOM 7864  H HB2  . LYS B 1 17 ? -17.777 -3.292  -0.546  1.00 0.00 ? 21 LYS B HB2  4  
ATOM 7865  H HB3  . LYS B 1 17 ? -17.479 -2.261  0.839   1.00 0.00 ? 21 LYS B HB3  4  
ATOM 7866  H HG2  . LYS B 1 17 ? -17.120 -0.398  -1.078  1.00 0.00 ? 21 LYS B HG2  4  
ATOM 7867  H HG3  . LYS B 1 17 ? -18.137 -1.488  -2.000  1.00 0.00 ? 21 LYS B HG3  4  
ATOM 7868  H HD2  . LYS B 1 17 ? -19.288 -1.200  0.639   1.00 0.00 ? 21 LYS B HD2  4  
ATOM 7869  H HD3  . LYS B 1 17 ? -18.931 0.401   0.022   1.00 0.00 ? 21 LYS B HD3  4  
ATOM 7870  H HE2  . LYS B 1 17 ? -20.239 0.003   -1.999  1.00 0.00 ? 21 LYS B HE2  4  
ATOM 7871  H HE3  . LYS B 1 17 ? -20.415 -1.699  -1.621  1.00 0.00 ? 21 LYS B HE3  4  
ATOM 7872  H HZ1  . LYS B 1 17 ? -21.358 -0.424  0.572   1.00 0.00 ? 21 LYS B HZ1  4  
ATOM 7873  H HZ2  . LYS B 1 17 ? -21.908 0.498   -0.659  1.00 0.00 ? 21 LYS B HZ2  4  
ATOM 7874  H HZ3  . LYS B 1 17 ? -22.265 -1.095  -0.609  1.00 0.00 ? 21 LYS B HZ3  4  
ATOM 7875  N N    . ASN B 1 18 ? -14.843 -1.101  -2.203  1.00 0.00 ? 22 ASN B N    4  
ATOM 7876  C CA   . ASN B 1 18 ? -14.410 -0.771  -3.550  1.00 0.00 ? 22 ASN B CA   4  
ATOM 7877  C C    . ASN B 1 18 ? -12.898 -0.979  -3.661  1.00 0.00 ? 22 ASN B C    4  
ATOM 7878  O O    . ASN B 1 18 ? -12.424 -1.631  -4.590  1.00 0.00 ? 22 ASN B O    4  
ATOM 7879  C CB   . ASN B 1 18 ? -14.711 0.692   -3.882  1.00 0.00 ? 22 ASN B CB   4  
ATOM 7880  C CG   . ASN B 1 18 ? -16.040 0.822   -4.629  1.00 0.00 ? 22 ASN B CG   4  
ATOM 7881  O OD1  . ASN B 1 18 ? -16.239 0.263   -5.695  1.00 0.00 ? 22 ASN B OD1  4  
ATOM 7882  N ND2  . ASN B 1 18 ? -16.934 1.590   -4.013  1.00 0.00 ? 22 ASN B ND2  4  
ATOM 7883  H H    . ASN B 1 18 ? -14.711 -0.376  -1.527  1.00 0.00 ? 22 ASN B H    4  
ATOM 7884  H HA   . ASN B 1 18 ? -14.971 -1.438  -4.203  1.00 0.00 ? 22 ASN B HA   4  
ATOM 7885  H HB2  . ASN B 1 18 ? -14.747 1.277   -2.963  1.00 0.00 ? 22 ASN B HB2  4  
ATOM 7886  H HB3  . ASN B 1 18 ? -13.906 1.104   -4.490  1.00 0.00 ? 22 ASN B HB3  4  
ATOM 7887  H HD21 . ASN B 1 18 ? -16.706 2.020   -3.139  1.00 0.00 ? 22 ASN B HD21 4  
ATOM 7888  H HD22 . ASN B 1 18 ? -17.834 1.736   -4.423  1.00 0.00 ? 22 ASN B HD22 4  
ATOM 7889  N N    . ILE B 1 19 ? -12.183 -0.413  -2.700  1.00 0.00 ? 23 ILE B N    4  
ATOM 7890  C CA   . ILE B 1 19 ? -10.735 -0.528  -2.677  1.00 0.00 ? 23 ILE B CA   4  
ATOM 7891  C C    . ILE B 1 19 ? -10.345 -2.007  -2.704  1.00 0.00 ? 23 ILE B C    4  
ATOM 7892  O O    . ILE B 1 19 ? -10.841 -2.798  -1.903  1.00 0.00 ? 23 ILE B O    4  
ATOM 7893  C CB   . ILE B 1 19 ? -10.154 0.240   -1.488  1.00 0.00 ? 23 ILE B CB   4  
ATOM 7894  C CG1  . ILE B 1 19 ? -9.966  1.719   -1.830  1.00 0.00 ? 23 ILE B CG1  4  
ATOM 7895  C CG2  . ILE B 1 19 ? -8.856  -0.406  -1.000  1.00 0.00 ? 23 ILE B CG2  4  
ATOM 7896  C CD1  . ILE B 1 19 ? -10.613 2.613   -0.770  1.00 0.00 ? 23 ILE B CD1  4  
ATOM 7897  H H    . ILE B 1 19 ? -12.576 0.116   -1.947  1.00 0.00 ? 23 ILE B H    4  
ATOM 7898  H HA   . ILE B 1 19 ? -10.355 -0.055  -3.583  1.00 0.00 ? 23 ILE B HA   4  
ATOM 7899  H HB   . ILE B 1 19 ? -10.868 0.187   -0.666  1.00 0.00 ? 23 ILE B HB   4  
ATOM 7900  H HG12 . ILE B 1 19 ? -8.902  1.946   -1.902  1.00 0.00 ? 23 ILE B HG12 4  
ATOM 7901  H HG13 . ILE B 1 19 ? -10.404 1.929   -2.805  1.00 0.00 ? 23 ILE B HG13 4  
ATOM 7902  H HG21 . ILE B 1 19 ? -8.280  -0.757  -1.856  1.00 0.00 ? 23 ILE B HG21 4  
ATOM 7903  H HG22 . ILE B 1 19 ? -8.271  0.328   -0.445  1.00 0.00 ? 23 ILE B HG22 4  
ATOM 7904  H HG23 . ILE B 1 19 ? -9.091  -1.249  -0.350  1.00 0.00 ? 23 ILE B HG23 4  
ATOM 7905  H HD11 . ILE B 1 19 ? -11.474 2.102   -0.341  1.00 0.00 ? 23 ILE B HD11 4  
ATOM 7906  H HD12 . ILE B 1 19 ? -9.889  2.828   0.015   1.00 0.00 ? 23 ILE B HD12 4  
ATOM 7907  H HD13 . ILE B 1 19 ? -10.936 3.547   -1.231  1.00 0.00 ? 23 ILE B HD13 4  
ATOM 7908  N N    . GLN B 1 20 ? -9.459  -2.337  -3.633  1.00 0.00 ? 24 GLN B N    4  
ATOM 7909  C CA   . GLN B 1 20 ? -8.997  -3.707  -3.774  1.00 0.00 ? 24 GLN B CA   4  
ATOM 7910  C C    . GLN B 1 20 ? -7.511  -3.804  -3.426  1.00 0.00 ? 24 GLN B C    4  
ATOM 7911  O O    . GLN B 1 20 ? -7.002  -4.892  -3.158  1.00 0.00 ? 24 GLN B O    4  
ATOM 7912  C CB   . GLN B 1 20 ? -9.265  -4.233  -5.186  1.00 0.00 ? 24 GLN B CB   4  
ATOM 7913  C CG   . GLN B 1 20 ? -9.799  -5.666  -5.144  1.00 0.00 ? 24 GLN B CG   4  
ATOM 7914  C CD   . GLN B 1 20 ? -8.692  -6.653  -4.766  1.00 0.00 ? 24 GLN B CD   4  
ATOM 7915  O OE1  . GLN B 1 20 ? -8.804  -7.420  -3.824  1.00 0.00 ? 24 GLN B OE1  4  
ATOM 7916  N NE2  . GLN B 1 20 ? -7.621  -6.591  -5.551  1.00 0.00 ? 24 GLN B NE2  4  
ATOM 7917  H H    . GLN B 1 20 ? -9.061  -1.687  -4.281  1.00 0.00 ? 24 GLN B H    4  
ATOM 7918  H HA   . GLN B 1 20 ? -9.583  -4.285  -3.060  1.00 0.00 ? 24 GLN B HA   4  
ATOM 7919  H HB2  . GLN B 1 20 ? -9.986  -3.587  -5.688  1.00 0.00 ? 24 GLN B HB2  4  
ATOM 7920  H HB3  . GLN B 1 20 ? -8.346  -4.201  -5.771  1.00 0.00 ? 24 GLN B HB3  4  
ATOM 7921  H HG2  . GLN B 1 20 ? -10.614 -5.734  -4.423  1.00 0.00 ? 24 GLN B HG2  4  
ATOM 7922  H HG3  . GLN B 1 20 ? -10.212 -5.933  -6.117  1.00 0.00 ? 24 GLN B HG3  4  
ATOM 7923  H HE21 . GLN B 1 20 ? -7.593  -5.938  -6.308  1.00 0.00 ? 24 GLN B HE21 4  
ATOM 7924  H HE22 . GLN B 1 20 ? -6.843  -7.197  -5.384  1.00 0.00 ? 24 GLN B HE22 4  
ATOM 7925  N N    . SER B 1 21 ? -6.856  -2.653  -3.440  1.00 0.00 ? 25 SER B N    4  
ATOM 7926  C CA   . SER B 1 21 ? -5.438  -2.595  -3.129  1.00 0.00 ? 25 SER B CA   4  
ATOM 7927  C C    . SER B 1 21 ? -5.082  -1.219  -2.561  1.00 0.00 ? 25 SER B C    4  
ATOM 7928  O O    . SER B 1 21 ? -5.809  -0.249  -2.774  1.00 0.00 ? 25 SER B O    4  
ATOM 7929  C CB   . SER B 1 21 ? -4.589  -2.893  -4.367  1.00 0.00 ? 25 SER B CB   4  
ATOM 7930  O OG   . SER B 1 21 ? -5.353  -3.506  -5.402  1.00 0.00 ? 25 SER B OG   4  
ATOM 7931  H H    . SER B 1 21 ? -7.277  -1.772  -3.659  1.00 0.00 ? 25 SER B H    4  
ATOM 7932  H HA   . SER B 1 21 ? -5.274  -3.371  -2.382  1.00 0.00 ? 25 SER B HA   4  
ATOM 7933  H HB2  . SER B 1 21 ? -4.152  -1.966  -4.739  1.00 0.00 ? 25 SER B HB2  4  
ATOM 7934  H HB3  . SER B 1 21 ? -3.762  -3.547  -4.091  1.00 0.00 ? 25 SER B HB3  4  
ATOM 7935  H HG   . SER B 1 21 ? -5.608  -4.435  -5.135  1.00 0.00 ? 25 SER B HG   4  
ATOM 7936  N N    . VAL B 1 22 ? -3.965  -1.178  -1.850  1.00 0.00 ? 26 VAL B N    4  
ATOM 7937  C CA   . VAL B 1 22 ? -3.505  0.062   -1.250  1.00 0.00 ? 26 VAL B CA   4  
ATOM 7938  C C    . VAL B 1 22 ? -2.039  0.291   -1.622  1.00 0.00 ? 26 VAL B C    4  
ATOM 7939  O O    . VAL B 1 22 ? -1.219  -0.621  -1.519  1.00 0.00 ? 26 VAL B O    4  
ATOM 7940  C CB   . VAL B 1 22 ? -3.740  0.032   0.262   1.00 0.00 ? 26 VAL B CB   4  
ATOM 7941  C CG1  . VAL B 1 22 ? -2.938  1.129   0.964   1.00 0.00 ? 26 VAL B CG1  4  
ATOM 7942  C CG2  . VAL B 1 22 ? -5.231  0.149   0.587   1.00 0.00 ? 26 VAL B CG2  4  
ATOM 7943  H H    . VAL B 1 22 ? -3.380  -1.972  -1.682  1.00 0.00 ? 26 VAL B H    4  
ATOM 7944  H HA   . VAL B 1 22 ? -4.103  0.872   -1.668  1.00 0.00 ? 26 VAL B HA   4  
ATOM 7945  H HB   . VAL B 1 22 ? -3.391  -0.931  0.636   1.00 0.00 ? 26 VAL B HB   4  
ATOM 7946  H HG11 . VAL B 1 22 ? -1.902  1.093   0.627   1.00 0.00 ? 26 VAL B HG11 4  
ATOM 7947  H HG12 . VAL B 1 22 ? -3.365  2.102   0.723   1.00 0.00 ? 26 VAL B HG12 4  
ATOM 7948  H HG13 . VAL B 1 22 ? -2.975  0.972   2.042   1.00 0.00 ? 26 VAL B HG13 4  
ATOM 7949  H HG21 . VAL B 1 22 ? -5.817  -0.152  -0.281  1.00 0.00 ? 26 VAL B HG21 4  
ATOM 7950  H HG22 . VAL B 1 22 ? -5.471  -0.500  1.430   1.00 0.00 ? 26 VAL B HG22 4  
ATOM 7951  H HG23 . VAL B 1 22 ? -5.467  1.181   0.845   1.00 0.00 ? 26 VAL B HG23 4  
ATOM 7952  N N    . LYS B 1 23 ? -1.752  1.513   -2.046  1.00 0.00 ? 27 LYS B N    4  
ATOM 7953  C CA   . LYS B 1 23 ? -0.399  1.872   -2.434  1.00 0.00 ? 27 LYS B CA   4  
ATOM 7954  C C    . LYS B 1 23 ? -0.008  3.184   -1.750  1.00 0.00 ? 27 LYS B C    4  
ATOM 7955  O O    . LYS B 1 23 ? -0.713  4.185   -1.871  1.00 0.00 ? 27 LYS B O    4  
ATOM 7956  C CB   . LYS B 1 23 ? -0.271  1.912   -3.958  1.00 0.00 ? 27 LYS B CB   4  
ATOM 7957  C CG   . LYS B 1 23 ? 1.170   1.640   -4.395  1.00 0.00 ? 27 LYS B CG   4  
ATOM 7958  C CD   . LYS B 1 23 ? 2.073   2.835   -4.081  1.00 0.00 ? 27 LYS B CD   4  
ATOM 7959  C CE   . LYS B 1 23 ? 2.792   3.325   -5.339  1.00 0.00 ? 27 LYS B CE   4  
ATOM 7960  N NZ   . LYS B 1 23 ? 2.080   4.482   -5.926  1.00 0.00 ? 27 LYS B NZ   4  
ATOM 7961  H H    . LYS B 1 23 ? -2.425  2.249   -2.127  1.00 0.00 ? 27 LYS B H    4  
ATOM 7962  H HA   . LYS B 1 23 ? 0.264   1.085   -2.075  1.00 0.00 ? 27 LYS B HA   4  
ATOM 7963  H HB2  . LYS B 1 23 ? -0.935  1.170   -4.402  1.00 0.00 ? 27 LYS B HB2  4  
ATOM 7964  H HB3  . LYS B 1 23 ? -0.590  2.886   -4.329  1.00 0.00 ? 27 LYS B HB3  4  
ATOM 7965  H HG2  . LYS B 1 23 ? 1.546   0.752   -3.887  1.00 0.00 ? 27 LYS B HG2  4  
ATOM 7966  H HG3  . LYS B 1 23 ? 1.197   1.431   -5.464  1.00 0.00 ? 27 LYS B HG3  4  
ATOM 7967  H HD2  . LYS B 1 23 ? 1.476   3.645   -3.660  1.00 0.00 ? 27 LYS B HD2  4  
ATOM 7968  H HD3  . LYS B 1 23 ? 2.806   2.553   -3.325  1.00 0.00 ? 27 LYS B HD3  4  
ATOM 7969  H HE2  . LYS B 1 23 ? 3.816   3.606   -5.094  1.00 0.00 ? 27 LYS B HE2  4  
ATOM 7970  H HE3  . LYS B 1 23 ? 2.850   2.517   -6.069  1.00 0.00 ? 27 LYS B HE3  4  
ATOM 7971  H HZ1  . LYS B 1 23 ? 1.995   5.204   -5.240  1.00 0.00 ? 27 LYS B HZ1  4  
ATOM 7972  H HZ2  . LYS B 1 23 ? 2.594   4.826   -6.711  1.00 0.00 ? 27 LYS B HZ2  4  
ATOM 7973  H HZ3  . LYS B 1 23 ? 1.169   4.197   -6.224  1.00 0.00 ? 27 LYS B HZ3  4  
ATOM 7974  N N    . VAL B 1 24 ? 1.113   3.136   -1.047  1.00 0.00 ? 28 VAL B N    4  
ATOM 7975  C CA   . VAL B 1 24 ? 1.606   4.308   -0.343  1.00 0.00 ? 28 VAL B CA   4  
ATOM 7976  C C    . VAL B 1 24 ? 2.978   4.693   -0.901  1.00 0.00 ? 28 VAL B C    4  
ATOM 7977  O O    . VAL B 1 24 ? 3.978   4.041   -0.604  1.00 0.00 ? 28 VAL B O    4  
ATOM 7978  C CB   . VAL B 1 24 ? 1.626   4.044   1.164   1.00 0.00 ? 28 VAL B CB   4  
ATOM 7979  C CG1  . VAL B 1 24 ? 2.410   5.132   1.901   1.00 0.00 ? 28 VAL B CG1  4  
ATOM 7980  C CG2  . VAL B 1 24 ? 0.205   3.923   1.718   1.00 0.00 ? 28 VAL B CG2  4  
ATOM 7981  H H    . VAL B 1 24 ? 1.680   2.318   -0.953  1.00 0.00 ? 28 VAL B H    4  
ATOM 7982  H HA   . VAL B 1 24 ? 0.908   5.124   -0.534  1.00 0.00 ? 28 VAL B HA   4  
ATOM 7983  H HB   . VAL B 1 24 ? 2.133   3.094   1.331   1.00 0.00 ? 28 VAL B HB   4  
ATOM 7984  H HG11 . VAL B 1 24 ? 3.349   5.319   1.379   1.00 0.00 ? 28 VAL B HG11 4  
ATOM 7985  H HG12 . VAL B 1 24 ? 1.822   6.049   1.930   1.00 0.00 ? 28 VAL B HG12 4  
ATOM 7986  H HG13 . VAL B 1 24 ? 2.620   4.802   2.918   1.00 0.00 ? 28 VAL B HG13 4  
ATOM 7987  H HG21 . VAL B 1 24 ? -0.446  4.633   1.208   1.00 0.00 ? 28 VAL B HG21 4  
ATOM 7988  H HG22 . VAL B 1 24 ? -0.164  2.910   1.554   1.00 0.00 ? 28 VAL B HG22 4  
ATOM 7989  H HG23 . VAL B 1 24 ? 0.212   4.139   2.786   1.00 0.00 ? 28 VAL B HG23 4  
ATOM 7990  N N    . LYS B 1 25 ? 2.981   5.751   -1.699  1.00 0.00 ? 29 LYS B N    4  
ATOM 7991  C CA   . LYS B 1 25 ? 4.214   6.231   -2.300  1.00 0.00 ? 29 LYS B CA   4  
ATOM 7992  C C    . LYS B 1 25 ? 4.773   7.380   -1.460  1.00 0.00 ? 29 LYS B C    4  
ATOM 7993  O O    . LYS B 1 25 ? 4.487   8.546   -1.728  1.00 0.00 ? 29 LYS B O    4  
ATOM 7994  C CB   . LYS B 1 25 ? 3.986   6.596   -3.768  1.00 0.00 ? 29 LYS B CB   4  
ATOM 7995  C CG   . LYS B 1 25 ? 5.183   7.363   -4.334  1.00 0.00 ? 29 LYS B CG   4  
ATOM 7996  C CD   . LYS B 1 25 ? 6.333   6.412   -4.672  1.00 0.00 ? 29 LYS B CD   4  
ATOM 7997  C CE   . LYS B 1 25 ? 6.005   5.572   -5.908  1.00 0.00 ? 29 LYS B CE   4  
ATOM 7998  N NZ   . LYS B 1 25 ? 6.876   5.956   -7.042  1.00 0.00 ? 29 LYS B NZ   4  
ATOM 7999  H H    . LYS B 1 25 ? 2.163   6.276   -1.935  1.00 0.00 ? 29 LYS B H    4  
ATOM 8000  H HA   . LYS B 1 25 ? 4.929   5.408   -2.280  1.00 0.00 ? 29 LYS B HA   4  
ATOM 8001  H HB2  . LYS B 1 25 ? 3.821   5.691   -4.352  1.00 0.00 ? 29 LYS B HB2  4  
ATOM 8002  H HB3  . LYS B 1 25 ? 3.085   7.202   -3.861  1.00 0.00 ? 29 LYS B HB3  4  
ATOM 8003  H HG2  . LYS B 1 25 ? 4.881   7.907   -5.230  1.00 0.00 ? 29 LYS B HG2  4  
ATOM 8004  H HG3  . LYS B 1 25 ? 5.520   8.104   -3.610  1.00 0.00 ? 29 LYS B HG3  4  
ATOM 8005  H HD2  . LYS B 1 25 ? 7.244   6.985   -4.849  1.00 0.00 ? 29 LYS B HD2  4  
ATOM 8006  H HD3  . LYS B 1 25 ? 6.529   5.756   -3.824  1.00 0.00 ? 29 LYS B HD3  4  
ATOM 8007  H HE2  . LYS B 1 25 ? 6.138   4.514   -5.682  1.00 0.00 ? 29 LYS B HE2  4  
ATOM 8008  H HE3  . LYS B 1 25 ? 4.959   5.711   -6.182  1.00 0.00 ? 29 LYS B HE3  4  
ATOM 8009  H HZ1  . LYS B 1 25 ? 7.299   6.842   -6.852  1.00 0.00 ? 29 LYS B HZ1  4  
ATOM 8010  H HZ2  . LYS B 1 25 ? 7.588   5.265   -7.164  1.00 0.00 ? 29 LYS B HZ2  4  
ATOM 8011  H HZ3  . LYS B 1 25 ? 6.328   6.021   -7.876  1.00 0.00 ? 29 LYS B HZ3  4  
ATOM 8012  N N    . SER B 1 26 ? 5.560   7.011   -0.460  1.00 0.00 ? 30 SER B N    4  
ATOM 8013  C CA   . SER B 1 26 ? 6.162   7.997   0.422   1.00 0.00 ? 30 SER B CA   4  
ATOM 8014  C C    . SER B 1 26 ? 6.901   9.053   -0.402  1.00 0.00 ? 30 SER B C    4  
ATOM 8015  O O    . SER B 1 26 ? 7.091   8.886   -1.606  1.00 0.00 ? 30 SER B O    4  
ATOM 8016  C CB   . SER B 1 26 ? 7.117   7.336   1.417   1.00 0.00 ? 30 SER B CB   4  
ATOM 8017  O OG   . SER B 1 26 ? 6.685   7.505   2.764   1.00 0.00 ? 30 SER B OG   4  
ATOM 8018  H H    . SER B 1 26 ? 5.787   6.061   -0.248  1.00 0.00 ? 30 SER B H    4  
ATOM 8019  H HA   . SER B 1 26 ? 5.329   8.448   0.962   1.00 0.00 ? 30 SER B HA   4  
ATOM 8020  H HB2  . SER B 1 26 ? 7.195   6.272   1.192   1.00 0.00 ? 30 SER B HB2  4  
ATOM 8021  H HB3  . SER B 1 26 ? 8.114   7.761   1.300   1.00 0.00 ? 30 SER B HB3  4  
ATOM 8022  H HG   . SER B 1 26 ? 7.394   7.186   3.393   1.00 0.00 ? 30 SER B HG   4  
ATOM 8023  N N    . PRO B 1 27 ? 7.309   10.146  0.298   1.00 0.00 ? 31 PRO B N    4  
ATOM 8024  C CA   . PRO B 1 27 ? 8.024   11.229  -0.356  1.00 0.00 ? 31 PRO B CA   4  
ATOM 8025  C C    . PRO B 1 27 ? 9.472   10.833  -0.648  1.00 0.00 ? 31 PRO B C    4  
ATOM 8026  O O    . PRO B 1 27 ? 9.952   9.814   -0.155  1.00 0.00 ? 31 PRO B O    4  
ATOM 8027  C CB   . PRO B 1 27 ? 7.911   12.407  0.598   1.00 0.00 ? 31 PRO B CB   4  
ATOM 8028  C CG   . PRO B 1 27 ? 7.544   11.815  1.949   1.00 0.00 ? 31 PRO B CG   4  
ATOM 8029  C CD   . PRO B 1 27 ? 7.102   10.378  1.724   1.00 0.00 ? 31 PRO B CD   4  
ATOM 8030  H HA   . PRO B 1 27 ? 7.611   11.431  -1.244  1.00 0.00 ? 31 PRO B HA   4  
ATOM 8031  H HB2  . PRO B 1 27 ? 8.852   12.955  0.655   1.00 0.00 ? 31 PRO B HB2  4  
ATOM 8032  H HB3  . PRO B 1 27 ? 7.151   13.112  0.261   1.00 0.00 ? 31 PRO B HB3  4  
ATOM 8033  H HG2  . PRO B 1 27 ? 8.397   11.850  2.627   1.00 0.00 ? 31 PRO B HG2  4  
ATOM 8034  H HG3  . PRO B 1 27 ? 6.744   12.392  2.414   1.00 0.00 ? 31 PRO B HG3  4  
ATOM 8035  H HD2  . PRO B 1 27 ? 7.687   9.685   2.327   1.00 0.00 ? 31 PRO B HD2  4  
ATOM 8036  H HD3  . PRO B 1 27 ? 6.057   10.237  2.000   1.00 0.00 ? 31 PRO B HD3  4  
ATOM 8037  N N    . GLY B 1 28 ? 10.128  11.660  -1.450  1.00 0.00 ? 32 GLY B N    4  
ATOM 8038  C CA   . GLY B 1 28 ? 11.512  11.408  -1.814  1.00 0.00 ? 32 GLY B CA   4  
ATOM 8039  C C    . GLY B 1 28 ? 12.248  12.717  -2.109  1.00 0.00 ? 32 GLY B C    4  
ATOM 8040  O O    . GLY B 1 28 ? 11.844  13.780  -1.639  1.00 0.00 ? 32 GLY B O    4  
ATOM 8041  H H    . GLY B 1 28 ? 9.730   12.487  -1.847  1.00 0.00 ? 32 GLY B H    4  
ATOM 8042  H HA2  . GLY B 1 28 ? 12.014  10.879  -1.004  1.00 0.00 ? 32 GLY B HA2  4  
ATOM 8043  H HA3  . GLY B 1 28 ? 11.549  10.760  -2.690  1.00 0.00 ? 32 GLY B HA3  4  
ATOM 8044  N N    . PRO B 1 29 ? 13.343  12.593  -2.905  1.00 0.00 ? 33 PRO B N    4  
ATOM 8045  C CA   . PRO B 1 29 ? 14.139  13.754  -3.268  1.00 0.00 ? 33 PRO B CA   4  
ATOM 8046  C C    . PRO B 1 29 ? 13.424  14.601  -4.323  1.00 0.00 ? 33 PRO B C    4  
ATOM 8047  O O    . PRO B 1 29 ? 13.967  15.598  -4.796  1.00 0.00 ? 33 PRO B O    4  
ATOM 8048  C CB   . PRO B 1 29 ? 15.461  13.186  -3.759  1.00 0.00 ? 33 PRO B CB   4  
ATOM 8049  C CG   . PRO B 1 29 ? 15.191  11.727  -4.090  1.00 0.00 ? 33 PRO B CG   4  
ATOM 8050  C CD   . PRO B 1 29 ? 13.851  11.351  -3.480  1.00 0.00 ? 33 PRO B CD   4  
ATOM 8051  H HA   . PRO B 1 29 ? 14.263  14.351  -2.476  1.00 0.00 ? 33 PRO B HA   4  
ATOM 8052  H HB2  . PRO B 1 29 ? 15.817  13.726  -4.636  1.00 0.00 ? 33 PRO B HB2  4  
ATOM 8053  H HB3  . PRO B 1 29 ? 16.233  13.276  -2.994  1.00 0.00 ? 33 PRO B HB3  4  
ATOM 8054  H HG2  . PRO B 1 29 ? 15.175  11.578  -5.170  1.00 0.00 ? 33 PRO B HG2  4  
ATOM 8055  H HG3  . PRO B 1 29 ? 15.983  11.093  -3.693  1.00 0.00 ? 33 PRO B HG3  4  
ATOM 8056  H HD2  . PRO B 1 29 ? 13.170  10.955  -4.233  1.00 0.00 ? 33 PRO B HD2  4  
ATOM 8057  H HD3  . PRO B 1 29 ? 13.965  10.580  -2.718  1.00 0.00 ? 33 PRO B HD3  4  
ATOM 8058  N N    . HIS B 1 30 ? 12.217  14.172  -4.662  1.00 0.00 ? 34 HIS B N    4  
ATOM 8059  C CA   . HIS B 1 30 ? 11.423  14.878  -5.652  1.00 0.00 ? 34 HIS B CA   4  
ATOM 8060  C C    . HIS B 1 30 ? 10.192  15.490  -4.981  1.00 0.00 ? 34 HIS B C    4  
ATOM 8061  O O    . HIS B 1 30 ? 9.948   16.690  -5.099  1.00 0.00 ? 34 HIS B O    4  
ATOM 8062  C CB   . HIS B 1 30 ? 11.064  13.956  -6.820  1.00 0.00 ? 34 HIS B CB   4  
ATOM 8063  C CG   . HIS B 1 30 ? 10.890  12.508  -6.428  1.00 0.00 ? 34 HIS B CG   4  
ATOM 8064  N ND1  . HIS B 1 30 ? 11.930  11.730  -5.951  1.00 0.00 ? 34 HIS B ND1  4  
ATOM 8065  C CD2  . HIS B 1 30 ? 9.786   11.707  -6.446  1.00 0.00 ? 34 HIS B CD2  4  
ATOM 8066  C CE1  . HIS B 1 30 ? 11.462  10.517  -5.697  1.00 0.00 ? 34 HIS B CE1  4  
ATOM 8067  N NE2  . HIS B 1 30 ? 10.134  10.504  -6.005  1.00 0.00 ? 34 HIS B NE2  4  
ATOM 8068  H H    . HIS B 1 30 ? 11.783  13.359  -4.273  1.00 0.00 ? 34 HIS B H    4  
ATOM 8069  H HA   . HIS B 1 30 ? 12.050  15.680  -6.042  1.00 0.00 ? 34 HIS B HA   4  
ATOM 8070  H HB2  . HIS B 1 30 ? 10.142  14.311  -7.280  1.00 0.00 ? 34 HIS B HB2  4  
ATOM 8071  H HB3  . HIS B 1 30 ? 11.845  14.025  -7.577  1.00 0.00 ? 34 HIS B HB3  4  
ATOM 8072  H HD1  . HIS B 1 30 ? 12.874  12.032  -5.819  1.00 0.00 ? 34 HIS B HD1  4  
ATOM 8073  H HD2  . HIS B 1 30 ? 8.788   12.004  -6.768  1.00 0.00 ? 34 HIS B HD2  4  
ATOM 8074  H HE1  . HIS B 1 30 ? 12.038  9.676   -5.311  1.00 0.00 ? 34 HIS B HE1  4  
ATOM 8075  N N    . CYS B 1 31 ? 9.448   14.638  -4.291  1.00 0.00 ? 35 CYS B N    4  
ATOM 8076  C CA   . CYS B 1 31 ? 8.249   15.080  -3.600  1.00 0.00 ? 35 CYS B CA   4  
ATOM 8077  C C    . CYS B 1 31 ? 8.454   14.871  -2.098  1.00 0.00 ? 35 CYS B C    4  
ATOM 8078  O O    . CYS B 1 31 ? 8.818   13.779  -1.664  1.00 0.00 ? 35 CYS B O    4  
ATOM 8079  C CB   . CYS B 1 31 ? 7.002   14.355  -4.112  1.00 0.00 ? 35 CYS B CB   4  
ATOM 8080  S SG   . CYS B 1 31 ? 5.670   15.454  -4.716  1.00 0.00 ? 35 CYS B SG   4  
ATOM 8081  H H    . CYS B 1 31 ? 9.654   13.663  -4.199  1.00 0.00 ? 35 CYS B H    4  
ATOM 8082  H HA   . CYS B 1 31 ? 8.127   16.138  -3.830  1.00 0.00 ? 35 CYS B HA   4  
ATOM 8083  H HB2  . CYS B 1 31 ? 7.295   13.684  -4.919  1.00 0.00 ? 35 CYS B HB2  4  
ATOM 8084  H HB3  . CYS B 1 31 ? 6.605   13.734  -3.309  1.00 0.00 ? 35 CYS B HB3  4  
ATOM 8085  N N    . ALA B 1 32 ? 8.212   15.935  -1.347  1.00 0.00 ? 36 ALA B N    4  
ATOM 8086  C CA   . ALA B 1 32 ? 8.366   15.882  0.097   1.00 0.00 ? 36 ALA B CA   4  
ATOM 8087  C C    . ALA B 1 32 ? 7.001   15.637  0.743   1.00 0.00 ? 36 ALA B C    4  
ATOM 8088  O O    . ALA B 1 32 ? 6.794   15.964  1.910   1.00 0.00 ? 36 ALA B O    4  
ATOM 8089  C CB   . ALA B 1 32 ? 9.020   17.175  0.589   1.00 0.00 ? 36 ALA B CB   4  
ATOM 8090  H H    . ALA B 1 32 ? 7.917   16.819  -1.708  1.00 0.00 ? 36 ALA B H    4  
ATOM 8091  H HA   . ALA B 1 32 ? 9.025   15.045  0.330   1.00 0.00 ? 36 ALA B HA   4  
ATOM 8092  H HB1  . ALA B 1 32 ? 9.831   17.451  -0.085  1.00 0.00 ? 36 ALA B HB1  4  
ATOM 8093  H HB2  . ALA B 1 32 ? 9.417   17.022  1.593   1.00 0.00 ? 36 ALA B HB2  4  
ATOM 8094  H HB3  . ALA B 1 32 ? 8.277   17.972  0.609   1.00 0.00 ? 36 ALA B HB3  4  
ATOM 8095  N N    . GLN B 1 33 ? 6.104   15.062  -0.046  1.00 0.00 ? 37 GLN B N    4  
ATOM 8096  C CA   . GLN B 1 33 ? 4.764   14.769  0.434   1.00 0.00 ? 37 GLN B CA   4  
ATOM 8097  C C    . GLN B 1 33 ? 4.382   13.327  0.095   1.00 0.00 ? 37 GLN B C    4  
ATOM 8098  O O    . GLN B 1 33 ? 4.954   12.727  -0.814  1.00 0.00 ? 37 GLN B O    4  
ATOM 8099  C CB   . GLN B 1 33 ? 3.747   15.756  -0.142  1.00 0.00 ? 37 GLN B CB   4  
ATOM 8100  C CG   . GLN B 1 33 ? 4.249   17.196  -0.018  1.00 0.00 ? 37 GLN B CG   4  
ATOM 8101  C CD   . GLN B 1 33 ? 4.057   17.959  -1.331  1.00 0.00 ? 37 GLN B CD   4  
ATOM 8102  O OE1  . GLN B 1 33 ? 3.023   17.888  -1.974  1.00 0.00 ? 37 GLN B OE1  4  
ATOM 8103  N NE2  . GLN B 1 33 ? 5.109   18.689  -1.691  1.00 0.00 ? 37 GLN B NE2  4  
ATOM 8104  H H    . GLN B 1 33 ? 6.280   14.799  -0.994  1.00 0.00 ? 37 GLN B H    4  
ATOM 8105  H HA   . GLN B 1 33 ? 4.810   14.895  1.516   1.00 0.00 ? 37 GLN B HA   4  
ATOM 8106  H HB2  . GLN B 1 33 ? 3.561   15.521  -1.190  1.00 0.00 ? 37 GLN B HB2  4  
ATOM 8107  H HB3  . GLN B 1 33 ? 2.797   15.653  0.382   1.00 0.00 ? 37 GLN B HB3  4  
ATOM 8108  H HG2  . GLN B 1 33 ? 3.714   17.705  0.783   1.00 0.00 ? 37 GLN B HG2  4  
ATOM 8109  H HG3  . GLN B 1 33 ? 5.305   17.195  0.254   1.00 0.00 ? 37 GLN B HG3  4  
ATOM 8110  H HE21 . GLN B 1 33 ? 5.928   18.704  -1.118  1.00 0.00 ? 37 GLN B HE21 4  
ATOM 8111  H HE22 . GLN B 1 33 ? 5.080   19.224  -2.535  1.00 0.00 ? 37 GLN B HE22 4  
ATOM 8112  N N    . THR B 1 34 ? 3.417   12.813  0.843   1.00 0.00 ? 38 THR B N    4  
ATOM 8113  C CA   . THR B 1 34 ? 2.952   11.453  0.632   1.00 0.00 ? 38 THR B CA   4  
ATOM 8114  C C    . THR B 1 34 ? 1.807   11.431  -0.383  1.00 0.00 ? 38 THR B C    4  
ATOM 8115  O O    . THR B 1 34 ? 1.192   12.462  -0.652  1.00 0.00 ? 38 THR B O    4  
ATOM 8116  C CB   . THR B 1 34 ? 2.567   10.869  1.993   1.00 0.00 ? 38 THR B CB   4  
ATOM 8117  O OG1  . THR B 1 34 ? 3.707   11.116  2.812   1.00 0.00 ? 38 THR B OG1  4  
ATOM 8118  C CG2  . THR B 1 34 ? 2.452   9.343   1.965   1.00 0.00 ? 38 THR B CG2  4  
ATOM 8119  H H    . THR B 1 34 ? 2.956   13.308  1.580   1.00 0.00 ? 38 THR B H    4  
ATOM 8120  H HA   . THR B 1 34 ? 3.769   10.872  0.205   1.00 0.00 ? 38 THR B HA   4  
ATOM 8121  H HB   . THR B 1 34 ? 1.648   11.321  2.365   1.00 0.00 ? 38 THR B HB   4  
ATOM 8122  H HG1  . THR B 1 34 ? 3.461   11.025  3.777   1.00 0.00 ? 38 THR B HG1  4  
ATOM 8123  H HG21 . THR B 1 34 ? 3.152   8.940   1.232   1.00 0.00 ? 38 THR B HG21 4  
ATOM 8124  H HG22 . THR B 1 34 ? 2.688   8.942   2.950   1.00 0.00 ? 38 THR B HG22 4  
ATOM 8125  H HG23 . THR B 1 34 ? 1.436   9.060   1.691   1.00 0.00 ? 38 THR B HG23 4  
ATOM 8126  N N    . GLU B 1 35 ? 1.557   10.246  -0.919  1.00 0.00 ? 39 GLU B N    4  
ATOM 8127  C CA   . GLU B 1 35 ? 0.497   10.077  -1.899  1.00 0.00 ? 39 GLU B CA   4  
ATOM 8128  C C    . GLU B 1 35 ? 0.001   8.630   -1.900  1.00 0.00 ? 39 GLU B C    4  
ATOM 8129  O O    . GLU B 1 35 ? 0.583   7.770   -2.560  1.00 0.00 ? 39 GLU B O    4  
ATOM 8130  C CB   . GLU B 1 35 ? 0.968   10.496  -3.293  1.00 0.00 ? 39 GLU B CB   4  
ATOM 8131  C CG   . GLU B 1 35 ? 2.449   10.167  -3.494  1.00 0.00 ? 39 GLU B CG   4  
ATOM 8132  C CD   . GLU B 1 35 ? 3.304   11.434  -3.444  1.00 0.00 ? 39 GLU B CD   4  
ATOM 8133  O OE1  . GLU B 1 35 ? 3.020   12.276  -2.565  1.00 0.00 ? 39 GLU B OE1  4  
ATOM 8134  O OE2  . GLU B 1 35 ? 4.222   11.533  -4.287  1.00 0.00 ? 39 GLU B OE2  4  
ATOM 8135  H H    . GLU B 1 35 ? 2.061   9.413   -0.695  1.00 0.00 ? 39 GLU B H    4  
ATOM 8136  H HA   . GLU B 1 35 ? -0.304  10.743  -1.578  1.00 0.00 ? 39 GLU B HA   4  
ATOM 8137  H HB2  . GLU B 1 35 ? 0.372   9.986   -4.051  1.00 0.00 ? 39 GLU B HB2  4  
ATOM 8138  H HB3  . GLU B 1 35 ? 0.808   11.566  -3.429  1.00 0.00 ? 39 GLU B HB3  4  
ATOM 8139  H HG2  . GLU B 1 35 ? 2.778   9.471   -2.722  1.00 0.00 ? 39 GLU B HG2  4  
ATOM 8140  H HG3  . GLU B 1 35 ? 2.587   9.668   -4.453  1.00 0.00 ? 39 GLU B HG3  4  
ATOM 8141  N N    . VAL B 1 36 ? -1.070  8.404   -1.153  1.00 0.00 ? 40 VAL B N    4  
ATOM 8142  C CA   . VAL B 1 36 ? -1.651  7.076   -1.059  1.00 0.00 ? 40 VAL B CA   4  
ATOM 8143  C C    . VAL B 1 36 ? -2.555  6.833   -2.269  1.00 0.00 ? 40 VAL B C    4  
ATOM 8144  O O    . VAL B 1 36 ? -3.490  7.595   -2.513  1.00 0.00 ? 40 VAL B O    4  
ATOM 8145  C CB   . VAL B 1 36 ? -2.383  6.918   0.275   1.00 0.00 ? 40 VAL B CB   4  
ATOM 8146  C CG1  . VAL B 1 36 ? -3.069  5.553   0.366   1.00 0.00 ? 40 VAL B CG1  4  
ATOM 8147  C CG2  . VAL B 1 36 ? -1.429  7.131   1.452   1.00 0.00 ? 40 VAL B CG2  4  
ATOM 8148  H H    . VAL B 1 36 ? -1.538  9.109   -0.619  1.00 0.00 ? 40 VAL B H    4  
ATOM 8149  H HA   . VAL B 1 36 ? -0.833  6.357   -1.083  1.00 0.00 ? 40 VAL B HA   4  
ATOM 8150  H HB   . VAL B 1 36 ? -3.155  7.685   0.327   1.00 0.00 ? 40 VAL B HB   4  
ATOM 8151  H HG11 . VAL B 1 36 ? -2.336  4.766   0.190   1.00 0.00 ? 40 VAL B HG11 4  
ATOM 8152  H HG12 . VAL B 1 36 ? -3.504  5.431   1.358   1.00 0.00 ? 40 VAL B HG12 4  
ATOM 8153  H HG13 . VAL B 1 36 ? -3.856  5.492   -0.386  1.00 0.00 ? 40 VAL B HG13 4  
ATOM 8154  H HG21 . VAL B 1 36 ? -0.452  6.715   1.208   1.00 0.00 ? 40 VAL B HG21 4  
ATOM 8155  H HG22 . VAL B 1 36 ? -1.330  8.199   1.651   1.00 0.00 ? 40 VAL B HG22 4  
ATOM 8156  H HG23 . VAL B 1 36 ? -1.826  6.633   2.337   1.00 0.00 ? 40 VAL B HG23 4  
ATOM 8157  N N    . ILE B 1 37 ? -2.246  5.769   -2.995  1.00 0.00 ? 41 ILE B N    4  
ATOM 8158  C CA   . ILE B 1 37 ? -3.019  5.416   -4.174  1.00 0.00 ? 41 ILE B CA   4  
ATOM 8159  C C    . ILE B 1 37 ? -3.547  3.988   -4.024  1.00 0.00 ? 41 ILE B C    4  
ATOM 8160  O O    . ILE B 1 37 ? -2.784  3.027   -4.120  1.00 0.00 ? 41 ILE B O    4  
ATOM 8161  C CB   . ILE B 1 37 ? -2.192  5.636   -5.442  1.00 0.00 ? 41 ILE B CB   4  
ATOM 8162  C CG1  . ILE B 1 37 ? -1.509  7.005   -5.421  1.00 0.00 ? 41 ILE B CG1  4  
ATOM 8163  C CG2  . ILE B 1 37 ? -3.048  5.442   -6.695  1.00 0.00 ? 41 ILE B CG2  4  
ATOM 8164  C CD1  . ILE B 1 37 ? 0.009   6.862   -5.558  1.00 0.00 ? 41 ILE B CD1  4  
ATOM 8165  H H    . ILE B 1 37 ? -1.484  5.154   -2.790  1.00 0.00 ? 41 ILE B H    4  
ATOM 8166  H HA   . ILE B 1 37 ? -3.869  6.096   -4.222  1.00 0.00 ? 41 ILE B HA   4  
ATOM 8167  H HB   . ILE B 1 37 ? -1.404  4.883   -5.471  1.00 0.00 ? 41 ILE B HB   4  
ATOM 8168  H HG12 . ILE B 1 37 ? -1.894  7.620   -6.234  1.00 0.00 ? 41 ILE B HG12 4  
ATOM 8169  H HG13 . ILE B 1 37 ? -1.747  7.520   -4.491  1.00 0.00 ? 41 ILE B HG13 4  
ATOM 8170  H HG21 . ILE B 1 37 ? -4.020  5.037   -6.412  1.00 0.00 ? 41 ILE B HG21 4  
ATOM 8171  H HG22 . ILE B 1 37 ? -3.186  6.401   -7.194  1.00 0.00 ? 41 ILE B HG22 4  
ATOM 8172  H HG23 . ILE B 1 37 ? -2.549  4.749   -7.373  1.00 0.00 ? 41 ILE B HG23 4  
ATOM 8173  H HD11 . ILE B 1 37 ? 0.392   6.257   -4.736  1.00 0.00 ? 41 ILE B HD11 4  
ATOM 8174  H HD12 . ILE B 1 37 ? 0.244   6.379   -6.506  1.00 0.00 ? 41 ILE B HD12 4  
ATOM 8175  H HD13 . ILE B 1 37 ? 0.470   7.849   -5.528  1.00 0.00 ? 41 ILE B HD13 4  
ATOM 8176  N N    . ALA B 1 38 ? -4.847  3.893   -3.790  1.00 0.00 ? 42 ALA B N    4  
ATOM 8177  C CA   . ALA B 1 38 ? -5.486  2.599   -3.626  1.00 0.00 ? 42 ALA B CA   4  
ATOM 8178  C C    . ALA B 1 38 ? -6.160  2.197   -4.939  1.00 0.00 ? 42 ALA B C    4  
ATOM 8179  O O    . ALA B 1 38 ? -6.778  3.028   -5.603  1.00 0.00 ? 42 ALA B O    4  
ATOM 8180  C CB   . ALA B 1 38 ? -6.474  2.661   -2.459  1.00 0.00 ? 42 ALA B CB   4  
ATOM 8181  H H    . ALA B 1 38 ? -5.460  4.680   -3.714  1.00 0.00 ? 42 ALA B H    4  
ATOM 8182  H HA   . ALA B 1 38 ? -4.708  1.873   -3.389  1.00 0.00 ? 42 ALA B HA   4  
ATOM 8183  H HB1  . ALA B 1 38 ? -7.269  3.368   -2.693  1.00 0.00 ? 42 ALA B HB1  4  
ATOM 8184  H HB2  . ALA B 1 38 ? -6.903  1.673   -2.293  1.00 0.00 ? 42 ALA B HB2  4  
ATOM 8185  H HB3  . ALA B 1 38 ? -5.952  2.986   -1.559  1.00 0.00 ? 42 ALA B HB3  4  
ATOM 8186  N N    . THR B 1 39 ? -6.019  0.923   -5.275  1.00 0.00 ? 43 THR B N    4  
ATOM 8187  C CA   . THR B 1 39 ? -6.607  0.401   -6.497  1.00 0.00 ? 43 THR B CA   4  
ATOM 8188  C C    . THR B 1 39 ? -8.053  -0.031  -6.250  1.00 0.00 ? 43 THR B C    4  
ATOM 8189  O O    . THR B 1 39 ? -8.350  -0.676  -5.246  1.00 0.00 ? 43 THR B O    4  
ATOM 8190  C CB   . THR B 1 39 ? -5.712  -0.731  -7.005  1.00 0.00 ? 43 THR B CB   4  
ATOM 8191  O OG1  . THR B 1 39 ? -4.538  -0.067  -7.465  1.00 0.00 ? 43 THR B OG1  4  
ATOM 8192  C CG2  . THR B 1 39 ? -6.275  -1.403  -8.260  1.00 0.00 ? 43 THR B CG2  4  
ATOM 8193  H H    . THR B 1 39 ? -5.515  0.254   -4.729  1.00 0.00 ? 43 THR B H    4  
ATOM 8194  H HA   . THR B 1 39 ? -6.634  1.203   -7.235  1.00 0.00 ? 43 THR B HA   4  
ATOM 8195  H HB   . THR B 1 39 ? -5.528  -1.464  -6.220  1.00 0.00 ? 43 THR B HB   4  
ATOM 8196  H HG1  . THR B 1 39 ? -3.998  0.251   -6.686  1.00 0.00 ? 43 THR B HG1  4  
ATOM 8197  H HG21 . THR B 1 39 ? -7.288  -1.752  -8.061  1.00 0.00 ? 43 THR B HG21 4  
ATOM 8198  H HG22 . THR B 1 39 ? -6.292  -0.686  -9.080  1.00 0.00 ? 43 THR B HG22 4  
ATOM 8199  H HG23 . THR B 1 39 ? -5.645  -2.250  -8.531  1.00 0.00 ? 43 THR B HG23 4  
ATOM 8200  N N    . LEU B 1 40 ? -8.916  0.342   -7.185  1.00 0.00 ? 44 LEU B N    4  
ATOM 8201  C CA   . LEU B 1 40 ? -10.325 0.000   -7.081  1.00 0.00 ? 44 LEU B CA   4  
ATOM 8202  C C    . LEU B 1 40 ? -10.540 -1.421  -7.605  1.00 0.00 ? 44 LEU B C    4  
ATOM 8203  O O    . LEU B 1 40 ? -9.808  -1.882  -8.479  1.00 0.00 ? 44 LEU B O    4  
ATOM 8204  C CB   . LEU B 1 40 ? -11.184 1.052   -7.786  1.00 0.00 ? 44 LEU B CB   4  
ATOM 8205  C CG   . LEU B 1 40 ? -12.386 1.575   -6.997  1.00 0.00 ? 44 LEU B CG   4  
ATOM 8206  C CD1  . LEU B 1 40 ? -12.893 2.895   -7.582  1.00 0.00 ? 44 LEU B CD1  4  
ATOM 8207  C CD2  . LEU B 1 40 ? -13.491 0.520   -6.919  1.00 0.00 ? 44 LEU B CD2  4  
ATOM 8208  H H    . LEU B 1 40 ? -8.667  0.866   -7.999  1.00 0.00 ? 44 LEU B H    4  
ATOM 8209  H HA   . LEU B 1 40 ? -10.590 0.023   -6.025  1.00 0.00 ? 44 LEU B HA   4  
ATOM 8210  H HB2  . LEU B 1 40 ? -10.547 1.899   -8.044  1.00 0.00 ? 44 LEU B HB2  4  
ATOM 8211  H HB3  . LEU B 1 40 ? -11.546 0.628   -8.723  1.00 0.00 ? 44 LEU B HB3  4  
ATOM 8212  H HG   . LEU B 1 40 ? -12.062 1.778   -5.976  1.00 0.00 ? 44 LEU B HG   4  
ATOM 8213  H HD11 . LEU B 1 40 ? -12.156 3.290   -8.280  1.00 0.00 ? 44 LEU B HD11 4  
ATOM 8214  H HD12 . LEU B 1 40 ? -13.834 2.723   -8.105  1.00 0.00 ? 44 LEU B HD12 4  
ATOM 8215  H HD13 . LEU B 1 40 ? -13.051 3.612   -6.776  1.00 0.00 ? 44 LEU B HD13 4  
ATOM 8216  H HD21 . LEU B 1 40 ? -13.526 -0.040  -7.854  1.00 0.00 ? 44 LEU B HD21 4  
ATOM 8217  H HD22 . LEU B 1 40 ? -13.284 -0.162  -6.095  1.00 0.00 ? 44 LEU B HD22 4  
ATOM 8218  H HD23 . LEU B 1 40 ? -14.450 1.010   -6.753  1.00 0.00 ? 44 LEU B HD23 4  
ATOM 8219  N N    . LYS B 1 41 ? -11.548 -2.076  -7.048  1.00 0.00 ? 45 LYS B N    4  
ATOM 8220  C CA   . LYS B 1 41 ? -11.869 -3.436  -7.447  1.00 0.00 ? 45 LYS B CA   4  
ATOM 8221  C C    . LYS B 1 41 ? -12.549 -3.413  -8.818  1.00 0.00 ? 45 LYS B C    4  
ATOM 8222  O O    . LYS B 1 41 ? -12.852 -4.463  -9.382  1.00 0.00 ? 45 LYS B O    4  
ATOM 8223  C CB   . LYS B 1 41 ? -12.695 -4.132  -6.363  1.00 0.00 ? 45 LYS B CB   4  
ATOM 8224  C CG   . LYS B 1 41 ? -12.726 -5.645  -6.586  1.00 0.00 ? 45 LYS B CG   4  
ATOM 8225  C CD   . LYS B 1 41 ? -14.034 -6.074  -7.256  1.00 0.00 ? 45 LYS B CD   4  
ATOM 8226  C CE   . LYS B 1 41 ? -14.623 -7.307  -6.568  1.00 0.00 ? 45 LYS B CE   4  
ATOM 8227  N NZ   . LYS B 1 41 ? -13.932 -8.534  -7.023  1.00 0.00 ? 45 LYS B NZ   4  
ATOM 8228  H H    . LYS B 1 41 ? -12.139 -1.694  -6.337  1.00 0.00 ? 45 LYS B H    4  
ATOM 8229  H HA   . LYS B 1 41 ? -10.930 -3.980  -7.537  1.00 0.00 ? 45 LYS B HA   4  
ATOM 8230  H HB2  . LYS B 1 41 ? -12.272 -3.914  -5.382  1.00 0.00 ? 45 LYS B HB2  4  
ATOM 8231  H HB3  . LYS B 1 41 ? -13.711 -3.739  -6.366  1.00 0.00 ? 45 LYS B HB3  4  
ATOM 8232  H HG2  . LYS B 1 41 ? -11.881 -5.943  -7.206  1.00 0.00 ? 45 LYS B HG2  4  
ATOM 8233  H HG3  . LYS B 1 41 ? -12.617 -6.159  -5.631  1.00 0.00 ? 45 LYS B HG3  4  
ATOM 8234  H HD2  . LYS B 1 41 ? -14.751 -5.254  -7.218  1.00 0.00 ? 45 LYS B HD2  4  
ATOM 8235  H HD3  . LYS B 1 41 ? -13.853 -6.291  -8.308  1.00 0.00 ? 45 LYS B HD3  4  
ATOM 8236  H HE2  . LYS B 1 41 ? -14.528 -7.208  -5.487  1.00 0.00 ? 45 LYS B HE2  4  
ATOM 8237  H HE3  . LYS B 1 41 ? -15.688 -7.379  -6.789  1.00 0.00 ? 45 LYS B HE3  4  
ATOM 8238  H HZ1  . LYS B 1 41 ? -12.945 -8.373  -7.041  1.00 0.00 ? 45 LYS B HZ1  4  
ATOM 8239  H HZ2  . LYS B 1 41 ? -14.136 -9.284  -6.394  1.00 0.00 ? 45 LYS B HZ2  4  
ATOM 8240  H HZ3  . LYS B 1 41 ? -14.247 -8.774  -7.941  1.00 0.00 ? 45 LYS B HZ3  4  
ATOM 8241  N N    . ASN B 1 42 ? -12.769 -2.204  -9.314  1.00 0.00 ? 46 ASN B N    4  
ATOM 8242  C CA   . ASN B 1 42 ? -13.407 -2.030  -10.608 1.00 0.00 ? 46 ASN B CA   4  
ATOM 8243  C C    . ASN B 1 42 ? -12.338 -1.746  -11.665 1.00 0.00 ? 46 ASN B C    4  
ATOM 8244  O O    . ASN B 1 42 ? -12.634 -1.714  -12.858 1.00 0.00 ? 46 ASN B O    4  
ATOM 8245  C CB   . ASN B 1 42 ? -14.379 -0.849  -10.588 1.00 0.00 ? 46 ASN B CB   4  
ATOM 8246  C CG   . ASN B 1 42 ? -14.305 -0.057  -11.895 1.00 0.00 ? 46 ASN B CG   4  
ATOM 8247  O OD1  . ASN B 1 42 ? -14.655 -0.534  -12.962 1.00 0.00 ? 46 ASN B OD1  4  
ATOM 8248  N ND2  . ASN B 1 42 ? -13.831 1.178   -11.753 1.00 0.00 ? 46 ASN B ND2  4  
ATOM 8249  H H    . ASN B 1 42 ? -12.519 -1.355  -8.848  1.00 0.00 ? 46 ASN B H    4  
ATOM 8250  H HA   . ASN B 1 42 ? -13.938 -2.964  -10.792 1.00 0.00 ? 46 ASN B HA   4  
ATOM 8251  H HB2  . ASN B 1 42 ? -15.395 -1.212  -10.436 1.00 0.00 ? 46 ASN B HB2  4  
ATOM 8252  H HB3  . ASN B 1 42 ? -14.145 -0.195  -9.748  1.00 0.00 ? 46 ASN B HB3  4  
ATOM 8253  H HD21 . ASN B 1 42 ? -13.561 1.509   -10.849 1.00 0.00 ? 46 ASN B HD21 4  
ATOM 8254  H HD22 . ASN B 1 42 ? -13.744 1.775   -12.551 1.00 0.00 ? 46 ASN B HD22 4  
ATOM 8255  N N    . GLY B 1 43 ? -11.118 -1.546  -11.188 1.00 0.00 ? 47 GLY B N    4  
ATOM 8256  C CA   . GLY B 1 43 ? -10.004 -1.266  -12.077 1.00 0.00 ? 47 GLY B CA   4  
ATOM 8257  C C    . GLY B 1 43 ? -9.551  0.190   -11.947 1.00 0.00 ? 47 GLY B C    4  
ATOM 8258  O O    . GLY B 1 43 ? -8.511  0.571   -12.481 1.00 0.00 ? 47 GLY B O    4  
ATOM 8259  H H    . GLY B 1 43 ? -10.886 -1.574  -10.216 1.00 0.00 ? 47 GLY B H    4  
ATOM 8260  H HA2  . GLY B 1 43 ? -9.172  -1.931  -11.845 1.00 0.00 ? 47 GLY B HA2  4  
ATOM 8261  H HA3  . GLY B 1 43 ? -10.296 -1.468  -13.107 1.00 0.00 ? 47 GLY B HA3  4  
ATOM 8262  N N    . GLN B 1 44 ? -10.356 0.964   -11.233 1.00 0.00 ? 48 GLN B N    4  
ATOM 8263  C CA   . GLN B 1 44 ? -10.051 2.370   -11.026 1.00 0.00 ? 48 GLN B CA   4  
ATOM 8264  C C    . GLN B 1 44 ? -9.087  2.536   -9.849  1.00 0.00 ? 48 GLN B C    4  
ATOM 8265  O O    . GLN B 1 44 ? -8.578  1.552   -9.315  1.00 0.00 ? 48 GLN B O    4  
ATOM 8266  C CB   . GLN B 1 44 ? -11.329 3.181   -10.806 1.00 0.00 ? 48 GLN B CB   4  
ATOM 8267  C CG   . GLN B 1 44 ? -11.929 3.632   -12.140 1.00 0.00 ? 48 GLN B CG   4  
ATOM 8268  C CD   . GLN B 1 44 ? -13.329 4.216   -11.943 1.00 0.00 ? 48 GLN B CD   4  
ATOM 8269  O OE1  . GLN B 1 44 ? -13.916 4.141   -10.876 1.00 0.00 ? 48 GLN B OE1  4  
ATOM 8270  N NE2  . GLN B 1 44 ? -13.828 4.802   -13.028 1.00 0.00 ? 48 GLN B NE2  4  
ATOM 8271  H H    . GLN B 1 44 ? -11.200 0.647   -10.802 1.00 0.00 ? 48 GLN B H    4  
ATOM 8272  H HA   . GLN B 1 44 ? -9.571  2.701   -11.946 1.00 0.00 ? 48 GLN B HA   4  
ATOM 8273  H HB2  . GLN B 1 44 ? -12.057 2.580   -10.261 1.00 0.00 ? 48 GLN B HB2  4  
ATOM 8274  H HB3  . GLN B 1 44 ? -11.110 4.053   -10.189 1.00 0.00 ? 48 GLN B HB3  4  
ATOM 8275  H HG2  . GLN B 1 44 ? -11.281 4.378   -12.601 1.00 0.00 ? 48 GLN B HG2  4  
ATOM 8276  H HG3  . GLN B 1 44 ? -11.977 2.785   -12.825 1.00 0.00 ? 48 GLN B HG3  4  
ATOM 8277  H HE21 . GLN B 1 44 ? -13.294 4.829   -13.872 1.00 0.00 ? 48 GLN B HE21 4  
ATOM 8278  H HE22 . GLN B 1 44 ? -14.739 5.214   -12.999 1.00 0.00 ? 48 GLN B HE22 4  
ATOM 8279  N N    . LYS B 1 45 ? -8.866  3.789   -9.479  1.00 0.00 ? 49 LYS B N    4  
ATOM 8280  C CA   . LYS B 1 45 ? -7.973  4.097   -8.375  1.00 0.00 ? 49 LYS B CA   4  
ATOM 8281  C C    . LYS B 1 45 ? -8.516  5.303   -7.606  1.00 0.00 ? 49 LYS B C    4  
ATOM 8282  O O    . LYS B 1 45 ? -9.090  6.215   -8.199  1.00 0.00 ? 49 LYS B O    4  
ATOM 8283  C CB   . LYS B 1 45 ? -6.541  4.284   -8.881  1.00 0.00 ? 49 LYS B CB   4  
ATOM 8284  C CG   . LYS B 1 45 ? -6.077  3.064   -9.678  1.00 0.00 ? 49 LYS B CG   4  
ATOM 8285  C CD   . LYS B 1 45 ? -4.634  3.236   -10.154 1.00 0.00 ? 49 LYS B CD   4  
ATOM 8286  C CE   . LYS B 1 45 ? -4.261  2.160   -11.176 1.00 0.00 ? 49 LYS B CE   4  
ATOM 8287  N NZ   . LYS B 1 45 ? -2.858  1.728   -10.985 1.00 0.00 ? 49 LYS B NZ   4  
ATOM 8288  H H    . LYS B 1 45 ? -9.285  4.584   -9.918  1.00 0.00 ? 49 LYS B H    4  
ATOM 8289  H HA   . LYS B 1 45 ? -7.969  3.235   -7.708  1.00 0.00 ? 49 LYS B HA   4  
ATOM 8290  H HB2  . LYS B 1 45 ? -6.486  5.175   -9.507  1.00 0.00 ? 49 LYS B HB2  4  
ATOM 8291  H HB3  . LYS B 1 45 ? -5.872  4.448   -8.036  1.00 0.00 ? 49 LYS B HB3  4  
ATOM 8292  H HG2  . LYS B 1 45 ? -6.155  2.170   -9.059  1.00 0.00 ? 49 LYS B HG2  4  
ATOM 8293  H HG3  . LYS B 1 45 ? -6.732  2.915   -10.536 1.00 0.00 ? 49 LYS B HG3  4  
ATOM 8294  H HD2  . LYS B 1 45 ? -4.510  4.224   -10.600 1.00 0.00 ? 49 LYS B HD2  4  
ATOM 8295  H HD3  . LYS B 1 45 ? -3.956  3.184   -9.302  1.00 0.00 ? 49 LYS B HD3  4  
ATOM 8296  H HE2  . LYS B 1 45 ? -4.928  1.305   -11.071 1.00 0.00 ? 49 LYS B HE2  4  
ATOM 8297  H HE3  . LYS B 1 45 ? -4.394  2.547   -12.186 1.00 0.00 ? 49 LYS B HE3  4  
ATOM 8298  H HZ1  . LYS B 1 45 ? -2.340  2.463   -10.548 1.00 0.00 ? 49 LYS B HZ1  4  
ATOM 8299  H HZ2  . LYS B 1 45 ? -2.836  0.914   -10.405 1.00 0.00 ? 49 LYS B HZ2  4  
ATOM 8300  H HZ3  . LYS B 1 45 ? -2.451  1.515   -11.873 1.00 0.00 ? 49 LYS B HZ3  4  
ATOM 8301  N N    . ALA B 1 46 ? -8.316  5.268   -6.297  1.00 0.00 ? 50 ALA B N    4  
ATOM 8302  C CA   . ALA B 1 46 ? -8.779  6.347   -5.440  1.00 0.00 ? 50 ALA B CA   4  
ATOM 8303  C C    . ALA B 1 46 ? -7.680  6.703   -4.436  1.00 0.00 ? 50 ALA B C    4  
ATOM 8304  O O    . ALA B 1 46 ? -7.335  5.894   -3.576  1.00 0.00 ? 50 ALA B O    4  
ATOM 8305  C CB   . ALA B 1 46 ? -10.082 5.932   -4.755  1.00 0.00 ? 50 ALA B CB   4  
ATOM 8306  H H    . ALA B 1 46 ? -7.848  4.523   -5.822  1.00 0.00 ? 50 ALA B H    4  
ATOM 8307  H HA   . ALA B 1 46 ? -8.975  7.213   -6.073  1.00 0.00 ? 50 ALA B HA   4  
ATOM 8308  H HB1  . ALA B 1 46 ? -10.537 5.109   -5.307  1.00 0.00 ? 50 ALA B HB1  4  
ATOM 8309  H HB2  . ALA B 1 46 ? -9.871  5.613   -3.735  1.00 0.00 ? 50 ALA B HB2  4  
ATOM 8310  H HB3  . ALA B 1 46 ? -10.768 6.779   -4.736  1.00 0.00 ? 50 ALA B HB3  4  
ATOM 8311  N N    . CYS B 1 47 ? -7.161  7.913   -4.579  1.00 0.00 ? 51 CYS B N    4  
ATOM 8312  C CA   . CYS B 1 47 ? -6.109  8.386   -3.695  1.00 0.00 ? 51 CYS B CA   4  
ATOM 8313  C C    . CYS B 1 47 ? -6.736  8.730   -2.343  1.00 0.00 ? 51 CYS B C    4  
ATOM 8314  O O    . CYS B 1 47 ? -7.820  9.308   -2.286  1.00 0.00 ? 51 CYS B O    4  
ATOM 8315  C CB   . CYS B 1 47 ? -5.358  9.576   -4.296  1.00 0.00 ? 51 CYS B CB   4  
ATOM 8316  S SG   . CYS B 1 47 ? -3.692  9.184   -4.943  1.00 0.00 ? 51 CYS B SG   4  
ATOM 8317  H H    . CYS B 1 47 ? -7.448  8.565   -5.281  1.00 0.00 ? 51 CYS B H    4  
ATOM 8318  H HA   . CYS B 1 47 ? -5.395  7.568   -3.594  1.00 0.00 ? 51 CYS B HA   4  
ATOM 8319  H HB2  . CYS B 1 47 ? -5.957  9.995   -5.104  1.00 0.00 ? 51 CYS B HB2  4  
ATOM 8320  H HB3  . CYS B 1 47 ? -5.264  10.350  -3.534  1.00 0.00 ? 51 CYS B HB3  4  
ATOM 8321  N N    . LEU B 1 48 ? -6.027  8.360   -1.286  1.00 0.00 ? 52 LEU B N    4  
ATOM 8322  C CA   . LEU B 1 48 ? -6.500  8.623   0.062   1.00 0.00 ? 52 LEU B CA   4  
ATOM 8323  C C    . LEU B 1 48 ? -5.594  9.664   0.722   1.00 0.00 ? 52 LEU B C    4  
ATOM 8324  O O    . LEU B 1 48 ? -4.470  9.887   0.275   1.00 0.00 ? 52 LEU B O    4  
ATOM 8325  C CB   . LEU B 1 48 ? -6.615  7.318   0.853   1.00 0.00 ? 52 LEU B CB   4  
ATOM 8326  C CG   . LEU B 1 48 ? -7.537  6.252   0.258   1.00 0.00 ? 52 LEU B CG   4  
ATOM 8327  C CD1  . LEU B 1 48 ? -7.222  4.870   0.835   1.00 0.00 ? 52 LEU B CD1  4  
ATOM 8328  C CD2  . LEU B 1 48 ? -9.008  6.631   0.447   1.00 0.00 ? 52 LEU B CD2  4  
ATOM 8329  H H    . LEU B 1 48 ? -5.146  7.890   -1.341  1.00 0.00 ? 52 LEU B H    4  
ATOM 8330  H HA   . LEU B 1 48 ? -7.504  9.040   -0.019  1.00 0.00 ? 52 LEU B HA   4  
ATOM 8331  H HB2  . LEU B 1 48 ? -5.618  6.890   0.957   1.00 0.00 ? 52 LEU B HB2  4  
ATOM 8332  H HB3  . LEU B 1 48 ? -6.967  7.555   1.857   1.00 0.00 ? 52 LEU B HB3  4  
ATOM 8333  H HG   . LEU B 1 48 ? -7.354  6.202   -0.816  1.00 0.00 ? 52 LEU B HG   4  
ATOM 8334  H HD11 . LEU B 1 48 ? -6.159  4.807   1.067   1.00 0.00 ? 52 LEU B HD11 4  
ATOM 8335  H HD12 . LEU B 1 48 ? -7.802  4.716   1.745   1.00 0.00 ? 52 LEU B HD12 4  
ATOM 8336  H HD13 . LEU B 1 48 ? -7.481  4.104   0.105   1.00 0.00 ? 52 LEU B HD13 4  
ATOM 8337  H HD21 . LEU B 1 48 ? -9.076  7.668   0.775   1.00 0.00 ? 52 LEU B HD21 4  
ATOM 8338  H HD22 . LEU B 1 48 ? -9.538  6.512   -0.498  1.00 0.00 ? 52 LEU B HD22 4  
ATOM 8339  H HD23 . LEU B 1 48 ? -9.456  5.982   1.200   1.00 0.00 ? 52 LEU B HD23 4  
ATOM 8340  N N    . ASN B 1 49 ? -6.118  10.274  1.776   1.00 0.00 ? 53 ASN B N    4  
ATOM 8341  C CA   . ASN B 1 49 ? -5.370  11.287  2.502   1.00 0.00 ? 53 ASN B CA   4  
ATOM 8342  C C    . ASN B 1 49 ? -4.681  10.640  3.705   1.00 0.00 ? 53 ASN B C    4  
ATOM 8343  O O    . ASN B 1 49 ? -5.345  10.106  4.592   1.00 0.00 ? 53 ASN B O    4  
ATOM 8344  C CB   . ASN B 1 49 ? -6.297  12.387  3.022   1.00 0.00 ? 53 ASN B CB   4  
ATOM 8345  C CG   . ASN B 1 49 ? -5.499  13.493  3.716   1.00 0.00 ? 53 ASN B CG   4  
ATOM 8346  O OD1  . ASN B 1 49 ? -4.337  13.730  3.427   1.00 0.00 ? 53 ASN B OD1  4  
ATOM 8347  N ND2  . ASN B 1 49 ? -6.185  14.155  4.643   1.00 0.00 ? 53 ASN B ND2  4  
ATOM 8348  H H    . ASN B 1 49 ? -7.033  10.087  2.133   1.00 0.00 ? 53 ASN B H    4  
ATOM 8349  H HA   . ASN B 1 49 ? -4.660  11.690  1.781   1.00 0.00 ? 53 ASN B HA   4  
ATOM 8350  H HB2  . ASN B 1 49 ? -6.867  12.809  2.195   1.00 0.00 ? 53 ASN B HB2  4  
ATOM 8351  H HB3  . ASN B 1 49 ? -7.017  11.961  3.721   1.00 0.00 ? 53 ASN B HB3  4  
ATOM 8352  H HD21 . ASN B 1 49 ? -7.136  13.911  4.831   1.00 0.00 ? 53 ASN B HD21 4  
ATOM 8353  H HD22 . ASN B 1 49 ? -5.749  14.897  5.153   1.00 0.00 ? 53 ASN B HD22 4  
ATOM 8354  N N    . PRO B 1 50 ? -3.323  10.713  3.697   1.00 0.00 ? 54 PRO B N    4  
ATOM 8355  C CA   . PRO B 1 50 ? -2.536  10.142  4.777   1.00 0.00 ? 54 PRO B CA   4  
ATOM 8356  C C    . PRO B 1 50 ? -2.610  11.015  6.031   1.00 0.00 ? 54 PRO B C    4  
ATOM 8357  O O    . PRO B 1 50 ? -1.999  10.698  7.050   1.00 0.00 ? 54 PRO B O    4  
ATOM 8358  C CB   . PRO B 1 50 ? -1.128  10.023  4.217   1.00 0.00 ? 54 PRO B CB   4  
ATOM 8359  C CG   . PRO B 1 50 ? -1.076  10.956  3.018   1.00 0.00 ? 54 PRO B CG   4  
ATOM 8360  C CD   . PRO B 1 50 ? -2.503  11.339  2.663   1.00 0.00 ? 54 PRO B CD   4  
ATOM 8361  H HA   . PRO B 1 50 ? -2.906  9.251   5.042   1.00 0.00 ? 54 PRO B HA   4  
ATOM 8362  H HB2  . PRO B 1 50 ? -0.386  10.306  4.964   1.00 0.00 ? 54 PRO B HB2  4  
ATOM 8363  H HB3  . PRO B 1 50 ? -0.910  8.996   3.924   1.00 0.00 ? 54 PRO B HB3  4  
ATOM 8364  H HG2  . PRO B 1 50 ? -0.489  11.844  3.250   1.00 0.00 ? 54 PRO B HG2  4  
ATOM 8365  H HG3  . PRO B 1 50 ? -0.591  10.465  2.174   1.00 0.00 ? 54 PRO B HG3  4  
ATOM 8366  H HD2  . PRO B 1 50 ? -2.633  12.421  2.657   1.00 0.00 ? 54 PRO B HD2  4  
ATOM 8367  H HD3  . PRO B 1 50 ? -2.775  10.979  1.671   1.00 0.00 ? 54 PRO B HD3  4  
ATOM 8368  N N    . ALA B 1 51 ? -3.363  12.099  5.914   1.00 0.00 ? 55 ALA B N    4  
ATOM 8369  C CA   . ALA B 1 51 ? -3.525  13.021  7.026   1.00 0.00 ? 55 ALA B CA   4  
ATOM 8370  C C    . ALA B 1 51 ? -4.894  12.799  7.672   1.00 0.00 ? 55 ALA B C    4  
ATOM 8371  O O    . ALA B 1 51 ? -5.258  13.495  8.619   1.00 0.00 ? 55 ALA B O    4  
ATOM 8372  C CB   . ALA B 1 51 ? -3.340  14.457  6.530   1.00 0.00 ? 55 ALA B CB   4  
ATOM 8373  H H    . ALA B 1 51 ? -3.857  12.350  5.082   1.00 0.00 ? 55 ALA B H    4  
ATOM 8374  H HA   . ALA B 1 51 ? -2.747  12.799  7.757   1.00 0.00 ? 55 ALA B HA   4  
ATOM 8375  H HB1  . ALA B 1 51 ? -4.202  15.056  6.823   1.00 0.00 ? 55 ALA B HB1  4  
ATOM 8376  H HB2  . ALA B 1 51 ? -3.250  14.457  5.444   1.00 0.00 ? 55 ALA B HB2  4  
ATOM 8377  H HB3  . ALA B 1 51 ? -2.437  14.880  6.970   1.00 0.00 ? 55 ALA B HB3  4  
ATOM 8378  N N    . SER B 1 52 ? -5.616  11.827  7.135   1.00 0.00 ? 56 SER B N    4  
ATOM 8379  C CA   . SER B 1 52 ? -6.937  11.504  7.647   1.00 0.00 ? 56 SER B CA   4  
ATOM 8380  C C    . SER B 1 52 ? -6.857  10.287  8.571   1.00 0.00 ? 56 SER B C    4  
ATOM 8381  O O    . SER B 1 52 ? -6.084  9.363   8.321   1.00 0.00 ? 56 SER B O    4  
ATOM 8382  C CB   . SER B 1 52 ? -7.921  11.241  6.506   1.00 0.00 ? 56 SER B CB   4  
ATOM 8383  O OG   . SER B 1 52 ? -9.138  10.665  6.973   1.00 0.00 ? 56 SER B OG   4  
ATOM 8384  H H    . SER B 1 52 ? -5.312  11.265  6.365   1.00 0.00 ? 56 SER B H    4  
ATOM 8385  H HA   . SER B 1 52 ? -7.253  12.386  8.204   1.00 0.00 ? 56 SER B HA   4  
ATOM 8386  H HB2  . SER B 1 52 ? -8.137  12.177  5.991   1.00 0.00 ? 56 SER B HB2  4  
ATOM 8387  H HB3  . SER B 1 52 ? -7.461  10.575  5.776   1.00 0.00 ? 56 SER B HB3  4  
ATOM 8388  H HG   . SER B 1 52 ? -9.607  10.200  6.221   1.00 0.00 ? 56 SER B HG   4  
ATOM 8389  N N    . PRO B 1 53 ? -7.689  10.326  9.646   1.00 0.00 ? 57 PRO B N    4  
ATOM 8390  C CA   . PRO B 1 53 ? -7.719  9.237   10.608  1.00 0.00 ? 57 PRO B CA   4  
ATOM 8391  C C    . PRO B 1 53 ? -8.456  8.023   10.038  1.00 0.00 ? 57 PRO B C    4  
ATOM 8392  O O    . PRO B 1 53 ? -8.154  6.885   10.395  1.00 0.00 ? 57 PRO B O    4  
ATOM 8393  C CB   . PRO B 1 53 ? -8.396  9.818   11.839  1.00 0.00 ? 57 PRO B CB   4  
ATOM 8394  C CG   . PRO B 1 53 ? -9.132  11.060  11.362  1.00 0.00 ? 57 PRO B CG   4  
ATOM 8395  C CD   . PRO B 1 53 ? -8.618  11.403  9.974   1.00 0.00 ? 57 PRO B CD   4  
ATOM 8396  H HA   . PRO B 1 53 ? -6.791  8.924   10.808  1.00 0.00 ? 57 PRO B HA   4  
ATOM 8397  H HB2  . PRO B 1 53 ? -9.086  9.100   12.281  1.00 0.00 ? 57 PRO B HB2  4  
ATOM 8398  H HB3  . PRO B 1 53 ? -7.662  10.069  12.605  1.00 0.00 ? 57 PRO B HB3  4  
ATOM 8399  H HG2  . PRO B 1 53 ? -10.207 10.880  11.338  1.00 0.00 ? 57 PRO B HG2  4  
ATOM 8400  H HG3  . PRO B 1 53 ? -8.964  11.890  12.048  1.00 0.00 ? 57 PRO B HG3  4  
ATOM 8401  H HD2  . PRO B 1 53 ? -9.433  11.456  9.251   1.00 0.00 ? 57 PRO B HD2  4  
ATOM 8402  H HD3  . PRO B 1 53 ? -8.120  12.372  9.964   1.00 0.00 ? 57 PRO B HD3  4  
ATOM 8403  N N    . MET B 1 54 ? -9.409  8.306   9.162   1.00 0.00 ? 58 MET B N    4  
ATOM 8404  C CA   . MET B 1 54 ? -10.191 7.252   8.540   1.00 0.00 ? 58 MET B CA   4  
ATOM 8405  C C    . MET B 1 54 ? -9.401  6.571   7.420   1.00 0.00 ? 58 MET B C    4  
ATOM 8406  O O    . MET B 1 54 ? -9.711  5.446   7.032   1.00 0.00 ? 58 MET B O    4  
ATOM 8407  C CB   . MET B 1 54 ? -11.482 7.842   7.969   1.00 0.00 ? 58 MET B CB   4  
ATOM 8408  C CG   . MET B 1 54 ? -12.649 6.866   8.127   1.00 0.00 ? 58 MET B CG   4  
ATOM 8409  S SD   . MET B 1 54 ? -13.902 7.578   9.180   1.00 0.00 ? 58 MET B SD   4  
ATOM 8410  C CE   . MET B 1 54 ? -12.916 7.966   10.617  1.00 0.00 ? 58 MET B CE   4  
ATOM 8411  H H    . MET B 1 54 ? -9.648  9.234   8.877   1.00 0.00 ? 58 MET B H    4  
ATOM 8412  H HA   . MET B 1 54 ? -10.400 6.535   9.334   1.00 0.00 ? 58 MET B HA   4  
ATOM 8413  H HB2  . MET B 1 54 ? -11.714 8.778   8.477   1.00 0.00 ? 58 MET B HB2  4  
ATOM 8414  H HB3  . MET B 1 54 ? -11.342 8.079   6.914   1.00 0.00 ? 58 MET B HB3  4  
ATOM 8415  H HG2  . MET B 1 54 ? -13.073 6.631   7.151   1.00 0.00 ? 58 MET B HG2  4  
ATOM 8416  H HG3  . MET B 1 54 ? -12.293 5.928   8.554   1.00 0.00 ? 58 MET B HG3  4  
ATOM 8417  H HE1  . MET B 1 54 ? -11.859 7.865   10.370  1.00 0.00 ? 58 MET B HE1  4  
ATOM 8418  H HE2  . MET B 1 54 ? -13.120 8.990   10.931  1.00 0.00 ? 58 MET B HE2  4  
ATOM 8419  H HE3  . MET B 1 54 ? -13.168 7.280   11.426  1.00 0.00 ? 58 MET B HE3  4  
ATOM 8420  N N    . VAL B 1 55 ? -8.396  7.283   6.931   1.00 0.00 ? 59 VAL B N    4  
ATOM 8421  C CA   . VAL B 1 55 ? -7.560  6.762   5.864   1.00 0.00 ? 59 VAL B CA   4  
ATOM 8422  C C    . VAL B 1 55 ? -6.547  5.777   6.450   1.00 0.00 ? 59 VAL B C    4  
ATOM 8423  O O    . VAL B 1 55 ? -5.796  5.140   5.712   1.00 0.00 ? 59 VAL B O    4  
ATOM 8424  C CB   . VAL B 1 55 ? -6.901  7.916   5.104   1.00 0.00 ? 59 VAL B CB   4  
ATOM 8425  C CG1  . VAL B 1 55 ? -5.773  7.407   4.205   1.00 0.00 ? 59 VAL B CG1  4  
ATOM 8426  C CG2  . VAL B 1 55 ? -7.935  8.702   4.296   1.00 0.00 ? 59 VAL B CG2  4  
ATOM 8427  H H    . VAL B 1 55 ? -8.151  8.198   7.252   1.00 0.00 ? 59 VAL B H    4  
ATOM 8428  H HA   . VAL B 1 55 ? -8.208  6.228   5.169   1.00 0.00 ? 59 VAL B HA   4  
ATOM 8429  H HB   . VAL B 1 55 ? -6.464  8.593   5.838   1.00 0.00 ? 59 VAL B HB   4  
ATOM 8430  H HG11 . VAL B 1 55 ? -6.114  6.529   3.655   1.00 0.00 ? 59 VAL B HG11 4  
ATOM 8431  H HG12 . VAL B 1 55 ? -5.489  8.189   3.500   1.00 0.00 ? 59 VAL B HG12 4  
ATOM 8432  H HG13 . VAL B 1 55 ? -4.912  7.139   4.817   1.00 0.00 ? 59 VAL B HG13 4  
ATOM 8433  H HG21 . VAL B 1 55 ? -8.810  8.895   4.917   1.00 0.00 ? 59 VAL B HG21 4  
ATOM 8434  H HG22 . VAL B 1 55 ? -7.501  9.648   3.974   1.00 0.00 ? 59 VAL B HG22 4  
ATOM 8435  H HG23 . VAL B 1 55 ? -8.231  8.121   3.422   1.00 0.00 ? 59 VAL B HG23 4  
ATOM 8436  N N    . LYS B 1 56 ? -6.558  5.681   7.771   1.00 0.00 ? 60 LYS B N    4  
ATOM 8437  C CA   . LYS B 1 56 ? -5.650  4.784   8.465   1.00 0.00 ? 60 LYS B CA   4  
ATOM 8438  C C    . LYS B 1 56 ? -6.415  3.537   8.912   1.00 0.00 ? 60 LYS B C    4  
ATOM 8439  O O    . LYS B 1 56 ? -5.853  2.663   9.572   1.00 0.00 ? 60 LYS B O    4  
ATOM 8440  C CB   . LYS B 1 56 ? -4.944  5.515   9.609   1.00 0.00 ? 60 LYS B CB   4  
ATOM 8441  C CG   . LYS B 1 56 ? -4.401  6.868   9.143   1.00 0.00 ? 60 LYS B CG   4  
ATOM 8442  C CD   . LYS B 1 56 ? -3.125  6.692   8.317   1.00 0.00 ? 60 LYS B CD   4  
ATOM 8443  C CE   . LYS B 1 56 ? -1.924  6.402   9.219   1.00 0.00 ? 60 LYS B CE   4  
ATOM 8444  N NZ   . LYS B 1 56 ? -1.484  4.998   9.062   1.00 0.00 ? 60 LYS B NZ   4  
ATOM 8445  H H    . LYS B 1 56 ? -7.172  6.203   8.364   1.00 0.00 ? 60 LYS B H    4  
ATOM 8446  H HA   . LYS B 1 56 ? -4.882  4.482   7.753   1.00 0.00 ? 60 LYS B HA   4  
ATOM 8447  H HB2  . LYS B 1 56 ? -5.639  5.664   10.435  1.00 0.00 ? 60 LYS B HB2  4  
ATOM 8448  H HB3  . LYS B 1 56 ? -4.126  4.902   9.987   1.00 0.00 ? 60 LYS B HB3  4  
ATOM 8449  H HG2  . LYS B 1 56 ? -5.156  7.381   8.547   1.00 0.00 ? 60 LYS B HG2  4  
ATOM 8450  H HG3  . LYS B 1 56 ? -4.195  7.499   10.007  1.00 0.00 ? 60 LYS B HG3  4  
ATOM 8451  H HD2  . LYS B 1 56 ? -3.257  5.875   7.607   1.00 0.00 ? 60 LYS B HD2  4  
ATOM 8452  H HD3  . LYS B 1 56 ? -2.938  7.593   7.734   1.00 0.00 ? 60 LYS B HD3  4  
ATOM 8453  H HE2  . LYS B 1 56 ? -1.104  7.076   8.971   1.00 0.00 ? 60 LYS B HE2  4  
ATOM 8454  H HE3  . LYS B 1 56 ? -2.189  6.592   10.260  1.00 0.00 ? 60 LYS B HE3  4  
ATOM 8455  H HZ1  . LYS B 1 56 ? -2.250  4.385   9.256   1.00 0.00 ? 60 LYS B HZ1  4  
ATOM 8456  H HZ2  . LYS B 1 56 ? -1.169  4.850   8.125   1.00 0.00 ? 60 LYS B HZ2  4  
ATOM 8457  H HZ3  . LYS B 1 56 ? -0.737  4.809   9.699   1.00 0.00 ? 60 LYS B HZ3  4  
ATOM 8458  N N    . LYS B 1 57 ? -7.684  3.492   8.534   1.00 0.00 ? 61 LYS B N    4  
ATOM 8459  C CA   . LYS B 1 57 ? -8.531  2.366   8.888   1.00 0.00 ? 61 LYS B CA   4  
ATOM 8460  C C    . LYS B 1 57 ? -9.004  1.669   7.611   1.00 0.00 ? 61 LYS B C    4  
ATOM 8461  O O    . LYS B 1 57 ? -9.484  0.537   7.658   1.00 0.00 ? 61 LYS B O    4  
ATOM 8462  C CB   . LYS B 1 57 ? -9.673  2.820   9.800   1.00 0.00 ? 61 LYS B CB   4  
ATOM 8463  C CG   . LYS B 1 57 ? -10.841 3.373   8.981   1.00 0.00 ? 61 LYS B CG   4  
ATOM 8464  C CD   . LYS B 1 57 ? -11.976 2.352   8.887   1.00 0.00 ? 61 LYS B CD   4  
ATOM 8465  C CE   . LYS B 1 57 ? -13.336 3.024   9.086   1.00 0.00 ? 61 LYS B CE   4  
ATOM 8466  N NZ   . LYS B 1 57 ? -14.273 2.106   9.772   1.00 0.00 ? 61 LYS B NZ   4  
ATOM 8467  H H    . LYS B 1 57 ? -8.133  4.207   7.997   1.00 0.00 ? 61 LYS B H    4  
ATOM 8468  H HA   . LYS B 1 57 ? -7.922  1.666   9.458   1.00 0.00 ? 61 LYS B HA   4  
ATOM 8469  H HB2  . LYS B 1 57 ? -10.014 1.982   10.407  1.00 0.00 ? 61 LYS B HB2  4  
ATOM 8470  H HB3  . LYS B 1 57 ? -9.311  3.585   10.487  1.00 0.00 ? 61 LYS B HB3  4  
ATOM 8471  H HG2  . LYS B 1 57 ? -11.210 4.290   9.441   1.00 0.00 ? 61 LYS B HG2  4  
ATOM 8472  H HG3  . LYS B 1 57 ? -10.498 3.634   7.980   1.00 0.00 ? 61 LYS B HG3  4  
ATOM 8473  H HD2  . LYS B 1 57 ? -11.949 1.861   7.914   1.00 0.00 ? 61 LYS B HD2  4  
ATOM 8474  H HD3  . LYS B 1 57 ? -11.836 1.576   9.639   1.00 0.00 ? 61 LYS B HD3  4  
ATOM 8475  H HE2  . LYS B 1 57 ? -13.216 3.935   9.672   1.00 0.00 ? 61 LYS B HE2  4  
ATOM 8476  H HE3  . LYS B 1 57 ? -13.748 3.318   8.121   1.00 0.00 ? 61 LYS B HE3  4  
ATOM 8477  H HZ1  . LYS B 1 57 ? -13.858 1.782   10.623  1.00 0.00 ? 61 LYS B HZ1  4  
ATOM 8478  H HZ2  . LYS B 1 57 ? -15.123 2.590   9.979   1.00 0.00 ? 61 LYS B HZ2  4  
ATOM 8479  H HZ3  . LYS B 1 57 ? -14.469 1.325   9.179   1.00 0.00 ? 61 LYS B HZ3  4  
ATOM 8480  N N    . ILE B 1 58 ? -8.853  2.374   6.499   1.00 0.00 ? 62 ILE B N    4  
ATOM 8481  C CA   . ILE B 1 58 ? -9.258  1.836   5.211   1.00 0.00 ? 62 ILE B CA   4  
ATOM 8482  C C    . ILE B 1 58 ? -8.070  1.121   4.564   1.00 0.00 ? 62 ILE B C    4  
ATOM 8483  O O    . ILE B 1 58 ? -8.245  0.340   3.630   1.00 0.00 ? 62 ILE B O    4  
ATOM 8484  C CB   . ILE B 1 58 ? -9.863  2.937   4.338   1.00 0.00 ? 62 ILE B CB   4  
ATOM 8485  C CG1  . ILE B 1 58 ? -11.095 3.552   5.005   1.00 0.00 ? 62 ILE B CG1  4  
ATOM 8486  C CG2  . ILE B 1 58 ? -10.173 2.415   2.933   1.00 0.00 ? 62 ILE B CG2  4  
ATOM 8487  C CD1  . ILE B 1 58 ? -11.247 5.026   4.623   1.00 0.00 ? 62 ILE B CD1  4  
ATOM 8488  H H    . ILE B 1 58 ? -8.461  3.293   6.469   1.00 0.00 ? 62 ILE B H    4  
ATOM 8489  H HA   . ILE B 1 58 ? -10.044 1.104   5.396   1.00 0.00 ? 62 ILE B HA   4  
ATOM 8490  H HB   . ILE B 1 58 ? -9.125  3.732   4.230   1.00 0.00 ? 62 ILE B HB   4  
ATOM 8491  H HG12 . ILE B 1 58 ? -11.987 3.002   4.708   1.00 0.00 ? 62 ILE B HG12 4  
ATOM 8492  H HG13 . ILE B 1 58 ? -11.010 3.461   6.088   1.00 0.00 ? 62 ILE B HG13 4  
ATOM 8493  H HG21 . ILE B 1 58 ? -10.267 1.330   2.962   1.00 0.00 ? 62 ILE B HG21 4  
ATOM 8494  H HG22 . ILE B 1 58 ? -11.108 2.852   2.581   1.00 0.00 ? 62 ILE B HG22 4  
ATOM 8495  H HG23 . ILE B 1 58 ? -9.365  2.692   2.256   1.00 0.00 ? 62 ILE B HG23 4  
ATOM 8496  H HD11 . ILE B 1 58 ? -10.358 5.575   4.932   1.00 0.00 ? 62 ILE B HD11 4  
ATOM 8497  H HD12 . ILE B 1 58 ? -11.370 5.111   3.543   1.00 0.00 ? 62 ILE B HD12 4  
ATOM 8498  H HD13 . ILE B 1 58 ? -12.123 5.442   5.122   1.00 0.00 ? 62 ILE B HD13 4  
ATOM 8499  N N    . ILE B 1 59 ? -6.889  1.413   5.087   1.00 0.00 ? 63 ILE B N    4  
ATOM 8500  C CA   . ILE B 1 59 ? -5.672  0.808   4.573   1.00 0.00 ? 63 ILE B CA   4  
ATOM 8501  C C    . ILE B 1 59 ? -5.340  -0.438  5.396   1.00 0.00 ? 63 ILE B C    4  
ATOM 8502  O O    . ILE B 1 59 ? -5.175  -1.525  4.844   1.00 0.00 ? 63 ILE B O    4  
ATOM 8503  C CB   . ILE B 1 59 ? -4.540  1.836   4.528   1.00 0.00 ? 63 ILE B CB   4  
ATOM 8504  C CG1  . ILE B 1 59 ? -4.736  2.818   3.371   1.00 0.00 ? 63 ILE B CG1  4  
ATOM 8505  C CG2  . ILE B 1 59 ? -3.175  1.146   4.469   1.00 0.00 ? 63 ILE B CG2  4  
ATOM 8506  C CD1  . ILE B 1 59 ? -4.084  4.167   3.681   1.00 0.00 ? 63 ILE B CD1  4  
ATOM 8507  H H    . ILE B 1 59 ? -6.755  2.050   5.847   1.00 0.00 ? 63 ILE B H    4  
ATOM 8508  H HA   . ILE B 1 59 ? -5.869  0.501   3.545   1.00 0.00 ? 63 ILE B HA   4  
ATOM 8509  H HB   . ILE B 1 59 ? -4.568  2.415   5.451   1.00 0.00 ? 63 ILE B HB   4  
ATOM 8510  H HG12 . ILE B 1 59 ? -4.305  2.403   2.460   1.00 0.00 ? 63 ILE B HG12 4  
ATOM 8511  H HG13 . ILE B 1 59 ? -5.800  2.958   3.185   1.00 0.00 ? 63 ILE B HG13 4  
ATOM 8512  H HG21 . ILE B 1 59 ? -3.285  0.163   4.012   1.00 0.00 ? 63 ILE B HG21 4  
ATOM 8513  H HG22 . ILE B 1 59 ? -2.489  1.749   3.875   1.00 0.00 ? 63 ILE B HG22 4  
ATOM 8514  H HG23 . ILE B 1 59 ? -2.781  1.035   5.479   1.00 0.00 ? 63 ILE B HG23 4  
ATOM 8515  H HD11 . ILE B 1 59 ? -3.716  4.166   4.707   1.00 0.00 ? 63 ILE B HD11 4  
ATOM 8516  H HD12 . ILE B 1 59 ? -3.252  4.334   2.997   1.00 0.00 ? 63 ILE B HD12 4  
ATOM 8517  H HD13 . ILE B 1 59 ? -4.819  4.962   3.559   1.00 0.00 ? 63 ILE B HD13 4  
ATOM 8518  N N    . GLU B 1 60 ? -5.251  -0.238  6.703   1.00 0.00 ? 64 GLU B N    4  
ATOM 8519  C CA   . GLU B 1 60 ? -4.941  -1.332  7.607   1.00 0.00 ? 64 GLU B CA   4  
ATOM 8520  C C    . GLU B 1 60 ? -5.953  -2.467  7.435   1.00 0.00 ? 64 GLU B C    4  
ATOM 8521  O O    . GLU B 1 60 ? -5.605  -3.639  7.567   1.00 0.00 ? 64 GLU B O    4  
ATOM 8522  C CB   . GLU B 1 60 ? -4.902  -0.849  9.059   1.00 0.00 ? 64 GLU B CB   4  
ATOM 8523  C CG   . GLU B 1 60 ? -3.752  0.137   9.277   1.00 0.00 ? 64 GLU B CG   4  
ATOM 8524  C CD   . GLU B 1 60 ? -3.994  0.993   10.522  1.00 0.00 ? 64 GLU B CD   4  
ATOM 8525  O OE1  . GLU B 1 60 ? -4.706  0.498   11.422  1.00 0.00 ? 64 GLU B OE1  4  
ATOM 8526  O OE2  . GLU B 1 60 ? -3.460  2.123   10.546  1.00 0.00 ? 64 GLU B OE2  4  
ATOM 8527  H H    . GLU B 1 60 ? -5.386  0.649   7.143   1.00 0.00 ? 64 GLU B H    4  
ATOM 8528  H HA   . GLU B 1 60 ? -3.948  -1.675  7.318   1.00 0.00 ? 64 GLU B HA   4  
ATOM 8529  H HB2  . GLU B 1 60 ? -5.848  -0.372  9.313   1.00 0.00 ? 64 GLU B HB2  4  
ATOM 8530  H HB3  . GLU B 1 60 ? -4.786  -1.702  9.727   1.00 0.00 ? 64 GLU B HB3  4  
ATOM 8531  H HG2  . GLU B 1 60 ? -2.815  -0.409  9.383   1.00 0.00 ? 64 GLU B HG2  4  
ATOM 8532  H HG3  . GLU B 1 60 ? -3.649  0.780   8.403   1.00 0.00 ? 64 GLU B HG3  4  
ATOM 8533  N N    . LYS B 1 61 ? -7.185  -2.078  7.141   1.00 0.00 ? 65 LYS B N    4  
ATOM 8534  C CA   . LYS B 1 61 ? -8.250  -3.048  6.949   1.00 0.00 ? 65 LYS B CA   4  
ATOM 8535  C C    . LYS B 1 61 ? -8.046  -3.765  5.613   1.00 0.00 ? 65 LYS B C    4  
ATOM 8536  O O    . LYS B 1 61 ? -8.362  -4.947  5.484   1.00 0.00 ? 65 LYS B O    4  
ATOM 8537  C CB   . LYS B 1 61 ? -9.618  -2.376  7.083   1.00 0.00 ? 65 LYS B CB   4  
ATOM 8538  C CG   . LYS B 1 61 ? -9.995  -2.187  8.553   1.00 0.00 ? 65 LYS B CG   4  
ATOM 8539  C CD   . LYS B 1 61 ? -10.615 -3.462  9.128   1.00 0.00 ? 65 LYS B CD   4  
ATOM 8540  C CE   . LYS B 1 61 ? -10.288 -3.608  10.616  1.00 0.00 ? 65 LYS B CE   4  
ATOM 8541  N NZ   . LYS B 1 61 ? -11.162 -2.731  11.427  1.00 0.00 ? 65 LYS B NZ   4  
ATOM 8542  H H    . LYS B 1 61 ? -7.460  -1.123  7.035   1.00 0.00 ? 65 LYS B H    4  
ATOM 8543  H HA   . LYS B 1 61 ? -8.172  -3.782  7.751   1.00 0.00 ? 65 LYS B HA   4  
ATOM 8544  H HB2  . LYS B 1 61 ? -9.603  -1.408  6.581   1.00 0.00 ? 65 LYS B HB2  4  
ATOM 8545  H HB3  . LYS B 1 61 ? -10.375 -2.981  6.584   1.00 0.00 ? 65 LYS B HB3  4  
ATOM 8546  H HG2  . LYS B 1 61 ? -9.108  -1.919  9.128   1.00 0.00 ? 65 LYS B HG2  4  
ATOM 8547  H HG3  . LYS B 1 61 ? -10.699 -1.361  8.649   1.00 0.00 ? 65 LYS B HG3  4  
ATOM 8548  H HD2  . LYS B 1 61 ? -11.696 -3.439  8.990   1.00 0.00 ? 65 LYS B HD2  4  
ATOM 8549  H HD3  . LYS B 1 61 ? -10.243 -4.330  8.583   1.00 0.00 ? 65 LYS B HD3  4  
ATOM 8550  H HE2  . LYS B 1 61 ? -10.419 -4.646  10.923  1.00 0.00 ? 65 LYS B HE2  4  
ATOM 8551  H HE3  . LYS B 1 61 ? -9.243  -3.353  10.791  1.00 0.00 ? 65 LYS B HE3  4  
ATOM 8552  H HZ1  . LYS B 1 61 ? -11.709 -2.154  10.821  1.00 0.00 ? 65 LYS B HZ1  4  
ATOM 8553  H HZ2  . LYS B 1 61 ? -11.769 -3.294  11.989  1.00 0.00 ? 65 LYS B HZ2  4  
ATOM 8554  H HZ3  . LYS B 1 61 ? -10.599 -2.155  12.019  1.00 0.00 ? 65 LYS B HZ3  4  
ATOM 8555  N N    . MET B 1 62 ? -7.517  -3.021  4.653   1.00 0.00 ? 66 MET B N    4  
ATOM 8556  C CA   . MET B 1 62 ? -7.267  -3.571  3.332   1.00 0.00 ? 66 MET B CA   4  
ATOM 8557  C C    . MET B 1 62 ? -6.314  -4.766  3.407   1.00 0.00 ? 66 MET B C    4  
ATOM 8558  O O    . MET B 1 62 ? -6.477  -5.741  2.675   1.00 0.00 ? 66 MET B O    4  
ATOM 8559  C CB   . MET B 1 62 ? -6.660  -2.490  2.435   1.00 0.00 ? 66 MET B CB   4  
ATOM 8560  C CG   . MET B 1 62 ? -7.533  -2.245  1.203   1.00 0.00 ? 66 MET B CG   4  
ATOM 8561  S SD   . MET B 1 62 ? -7.665  -3.743  0.240   1.00 0.00 ? 66 MET B SD   4  
ATOM 8562  C CE   . MET B 1 62 ? -5.935  -4.092  -0.028  1.00 0.00 ? 66 MET B CE   4  
ATOM 8563  H H    . MET B 1 62 ? -7.262  -2.061  4.766   1.00 0.00 ? 66 MET B H    4  
ATOM 8564  H HA   . MET B 1 62 ? -8.239  -3.895  2.960   1.00 0.00 ? 66 MET B HA   4  
ATOM 8565  H HB2  . MET B 1 62 ? -6.552  -1.563  2.999   1.00 0.00 ? 66 MET B HB2  4  
ATOM 8566  H HB3  . MET B 1 62 ? -5.660  -2.791  2.122   1.00 0.00 ? 66 MET B HB3  4  
ATOM 8567  H HG2  . MET B 1 62 ? -8.525  -1.913  1.510   1.00 0.00 ? 66 MET B HG2  4  
ATOM 8568  H HG3  . MET B 1 62 ? -7.104  -1.449  0.595   1.00 0.00 ? 66 MET B HG3  4  
ATOM 8569  H HE1  . MET B 1 62 ? -5.382  -3.155  -0.103  1.00 0.00 ? 66 MET B HE1  4  
ATOM 8570  H HE2  . MET B 1 62 ? -5.548  -4.675  0.808   1.00 0.00 ? 66 MET B HE2  4  
ATOM 8571  H HE3  . MET B 1 62 ? -5.817  -4.658  -0.951  1.00 0.00 ? 66 MET B HE3  4  
ATOM 8572  N N    . LEU B 1 63 ? -5.341  -4.651  4.298   1.00 0.00 ? 67 LEU B N    4  
ATOM 8573  C CA   . LEU B 1 63 ? -4.362  -5.710  4.479   1.00 0.00 ? 67 LEU B CA   4  
ATOM 8574  C C    . LEU B 1 63 ? -5.044  -6.926  5.110   1.00 0.00 ? 67 LEU B C    4  
ATOM 8575  O O    . LEU B 1 63 ? -4.493  -8.026  5.100   1.00 0.00 ? 67 LEU B O    4  
ATOM 8576  C CB   . LEU B 1 63 ? -3.159  -5.198  5.273   1.00 0.00 ? 67 LEU B CB   4  
ATOM 8577  C CG   . LEU B 1 63 ? -2.157  -4.343  4.495   1.00 0.00 ? 67 LEU B CG   4  
ATOM 8578  C CD1  . LEU B 1 63 ? -2.849  -3.145  3.842   1.00 0.00 ? 67 LEU B CD1  4  
ATOM 8579  C CD2  . LEU B 1 63 ? -0.992  -3.914  5.390   1.00 0.00 ? 67 LEU B CD2  4  
ATOM 8580  H H    . LEU B 1 63 ? -5.215  -3.855  4.890   1.00 0.00 ? 67 LEU B H    4  
ATOM 8581  H HA   . LEU B 1 63 ? -4.000  -5.992  3.490   1.00 0.00 ? 67 LEU B HA   4  
ATOM 8582  H HB2  . LEU B 1 63 ? -3.528  -4.614  6.117   1.00 0.00 ? 67 LEU B HB2  4  
ATOM 8583  H HB3  . LEU B 1 63 ? -2.630  -6.057  5.687   1.00 0.00 ? 67 LEU B HB3  4  
ATOM 8584  H HG   . LEU B 1 63 ? -1.740  -4.950  3.692   1.00 0.00 ? 67 LEU B HG   4  
ATOM 8585  H HD11 . LEU B 1 63 ? -3.682  -3.495  3.232   1.00 0.00 ? 67 LEU B HD11 4  
ATOM 8586  H HD12 . LEU B 1 63 ? -3.222  -2.474  4.617   1.00 0.00 ? 67 LEU B HD12 4  
ATOM 8587  H HD13 . LEU B 1 63 ? -2.136  -2.612  3.213   1.00 0.00 ? 67 LEU B HD13 4  
ATOM 8588  H HD21 . LEU B 1 63 ? -1.381  -3.498  6.319   1.00 0.00 ? 67 LEU B HD21 4  
ATOM 8589  H HD22 . LEU B 1 63 ? -0.367  -4.779  5.613   1.00 0.00 ? 67 LEU B HD22 4  
ATOM 8590  H HD23 . LEU B 1 63 ? -0.397  -3.160  4.875   1.00 0.00 ? 67 LEU B HD23 4  
ATOM 8591  N N    . LYS B 1 64 ? -6.232  -6.687  5.645   1.00 0.00 ? 68 LYS B N    4  
ATOM 8592  C CA   . LYS B 1 64 ? -6.995  -7.749  6.279   1.00 0.00 ? 68 LYS B CA   4  
ATOM 8593  C C    . LYS B 1 64 ? -8.119  -8.195  5.342   1.00 0.00 ? 68 LYS B C    4  
ATOM 8594  O O    . LYS B 1 64 ? -8.528  -9.354  5.365   1.00 0.00 ? 68 LYS B O    4  
ATOM 8595  C CB   . LYS B 1 64 ? -7.484  -7.306  7.659   1.00 0.00 ? 68 LYS B CB   4  
ATOM 8596  C CG   . LYS B 1 64 ? -8.639  -8.187  8.140   1.00 0.00 ? 68 LYS B CG   4  
ATOM 8597  C CD   . LYS B 1 64 ? -8.452  -8.585  9.605   1.00 0.00 ? 68 LYS B CD   4  
ATOM 8598  C CE   . LYS B 1 64 ? -7.861  -9.992  9.720   1.00 0.00 ? 68 LYS B CE   4  
ATOM 8599  N NZ   . LYS B 1 64 ? -8.938  -11.006 9.750   1.00 0.00 ? 68 LYS B NZ   4  
ATOM 8600  H H    . LYS B 1 64 ? -6.673  -5.790  5.649   1.00 0.00 ? 68 LYS B H    4  
ATOM 8601  H HA   . LYS B 1 64 ? -6.318  -8.590  6.432   1.00 0.00 ? 68 LYS B HA   4  
ATOM 8602  H HB2  . LYS B 1 64 ? -6.663  -7.355  8.374   1.00 0.00 ? 68 LYS B HB2  4  
ATOM 8603  H HB3  . LYS B 1 64 ? -7.808  -6.266  7.617   1.00 0.00 ? 68 LYS B HB3  4  
ATOM 8604  H HG2  . LYS B 1 64 ? -9.582  -7.653  8.022   1.00 0.00 ? 68 LYS B HG2  4  
ATOM 8605  H HG3  . LYS B 1 64 ? -8.701  -9.082  7.521   1.00 0.00 ? 68 LYS B HG3  4  
ATOM 8606  H HD2  . LYS B 1 64 ? -7.795  -7.869  10.099  1.00 0.00 ? 68 LYS B HD2  4  
ATOM 8607  H HD3  . LYS B 1 64 ? -9.411  -8.547  10.122  1.00 0.00 ? 68 LYS B HD3  4  
ATOM 8608  H HE2  . LYS B 1 64 ? -7.196  -10.183 8.877   1.00 0.00 ? 68 LYS B HE2  4  
ATOM 8609  H HE3  . LYS B 1 64 ? -7.257  -10.066 10.625  1.00 0.00 ? 68 LYS B HE3  4  
ATOM 8610  H HZ1  . LYS B 1 64 ? -9.645  -10.722 10.398  1.00 0.00 ? 68 LYS B HZ1  4  
ATOM 8611  H HZ2  . LYS B 1 64 ? -9.338  -11.094 8.838   1.00 0.00 ? 68 LYS B HZ2  4  
ATOM 8612  H HZ3  . LYS B 1 64 ? -8.559  -11.886 10.035  1.00 0.00 ? 68 LYS B HZ3  4  
ATOM 8613  N N    . ASN B 1 65 ? -8.585  -7.250  4.539   1.00 0.00 ? 69 ASN B N    4  
ATOM 8614  C CA   . ASN B 1 65 ? -9.654  -7.530  3.595   1.00 0.00 ? 69 ASN B CA   4  
ATOM 8615  C C    . ASN B 1 65 ? -10.909 -7.950  4.362   1.00 0.00 ? 69 ASN B C    4  
ATOM 8616  O O    . ASN B 1 65 ? -11.831 -7.153  4.535   1.00 0.00 ? 69 ASN B O    4  
ATOM 8617  C CB   . ASN B 1 65 ? -9.271  -8.674  2.653   1.00 0.00 ? 69 ASN B CB   4  
ATOM 8618  C CG   . ASN B 1 65 ? -10.473 -9.124  1.820   1.00 0.00 ? 69 ASN B CG   4  
ATOM 8619  O OD1  . ASN B 1 65 ? -11.556 -8.566  1.894   1.00 0.00 ? 69 ASN B OD1  4  
ATOM 8620  N ND2  . ASN B 1 65 ? -10.223 -10.161 1.027   1.00 0.00 ? 69 ASN B ND2  4  
ATOM 8621  H H    . ASN B 1 65 ? -8.247  -6.309  4.526   1.00 0.00 ? 69 ASN B H    4  
ATOM 8622  H HA   . ASN B 1 65 ? -9.795  -6.604  3.039   1.00 0.00 ? 69 ASN B HA   4  
ATOM 8623  H HB2  . ASN B 1 65 ? -8.466  -8.352  1.993   1.00 0.00 ? 69 ASN B HB2  4  
ATOM 8624  H HB3  . ASN B 1 65 ? -8.891  -9.515  3.233   1.00 0.00 ? 69 ASN B HB3  4  
ATOM 8625  H HD21 . ASN B 1 65 ? -9.312  -10.573 1.014   1.00 0.00 ? 69 ASN B HD21 4  
ATOM 8626  H HD22 . ASN B 1 65 ? -10.946 -10.529 0.442   1.00 0.00 ? 69 ASN B HD22 4  
ATOM 8627  N N    . GLY B 1 66 ? -10.905 -9.199  4.803   1.00 0.00 ? 70 GLY B N    4  
ATOM 8628  C CA   . GLY B 1 66 ? -12.032 -9.734  5.548   1.00 0.00 ? 70 GLY B CA   4  
ATOM 8629  C C    . GLY B 1 66 ? -12.455 -8.777  6.664   1.00 0.00 ? 70 GLY B C    4  
ATOM 8630  O O    . GLY B 1 66 ? -11.754 -7.809  6.955   1.00 0.00 ? 70 GLY B O    4  
ATOM 8631  H H    . GLY B 1 66 ? -10.152 -9.841  4.658   1.00 0.00 ? 70 GLY B H    4  
ATOM 8632  H HA2  . GLY B 1 66 ? -12.871 -9.905  4.873   1.00 0.00 ? 70 GLY B HA2  4  
ATOM 8633  H HA3  . GLY B 1 66 ? -11.765 -10.701 5.974   1.00 0.00 ? 70 GLY B HA3  4  
ATOM 8634  N N    . LYS B 1 67 ? -13.599 -9.081  7.259   1.00 0.00 ? 71 LYS B N    4  
ATOM 8635  C CA   . LYS B 1 67 ? -14.124 -8.260  8.337   1.00 0.00 ? 71 LYS B CA   4  
ATOM 8636  C C    . LYS B 1 67 ? -13.937 -8.992  9.667   1.00 0.00 ? 71 LYS B C    4  
ATOM 8637  O O    . LYS B 1 67 ? -13.147 -8.565  10.508  1.00 0.00 ? 71 LYS B O    4  
ATOM 8638  C CB   . LYS B 1 67 ? -15.574 -7.864  8.051   1.00 0.00 ? 71 LYS B CB   4  
ATOM 8639  C CG   . LYS B 1 67 ? -15.757 -6.348  8.141   1.00 0.00 ? 71 LYS B CG   4  
ATOM 8640  C CD   . LYS B 1 67 ? -17.150 -5.993  8.664   1.00 0.00 ? 71 LYS B CD   4  
ATOM 8641  C CE   . LYS B 1 67 ? -17.190 -4.556  9.187   1.00 0.00 ? 71 LYS B CE   4  
ATOM 8642  N NZ   . LYS B 1 67 ? -18.433 -4.318  9.954   1.00 0.00 ? 71 LYS B NZ   4  
ATOM 8643  H H    . LYS B 1 67 ? -14.163 -9.870  7.016   1.00 0.00 ? 71 LYS B H    4  
ATOM 8644  H HA   . LYS B 1 67 ? -13.538 -7.341  8.362   1.00 0.00 ? 71 LYS B HA   4  
ATOM 8645  H HB2  . LYS B 1 67 ? -15.862 -8.211  7.059   1.00 0.00 ? 71 LYS B HB2  4  
ATOM 8646  H HB3  . LYS B 1 67 ? -16.236 -8.357  8.764   1.00 0.00 ? 71 LYS B HB3  4  
ATOM 8647  H HG2  . LYS B 1 67 ? -14.998 -5.925  8.800   1.00 0.00 ? 71 LYS B HG2  4  
ATOM 8648  H HG3  . LYS B 1 67 ? -15.608 -5.901  7.158   1.00 0.00 ? 71 LYS B HG3  4  
ATOM 8649  H HD2  . LYS B 1 67 ? -17.883 -6.114  7.866   1.00 0.00 ? 71 LYS B HD2  4  
ATOM 8650  H HD3  . LYS B 1 67 ? -17.430 -6.682  9.461   1.00 0.00 ? 71 LYS B HD3  4  
ATOM 8651  H HE2  . LYS B 1 67 ? -16.323 -4.369  9.820   1.00 0.00 ? 71 LYS B HE2  4  
ATOM 8652  H HE3  . LYS B 1 67 ? -17.131 -3.857  8.352   1.00 0.00 ? 71 LYS B HE3  4  
ATOM 8653  H HZ1  . LYS B 1 67 ? -18.612 -5.101  10.549  1.00 0.00 ? 71 LYS B HZ1  4  
ATOM 8654  H HZ2  . LYS B 1 67 ? -18.328 -3.494  10.511  1.00 0.00 ? 71 LYS B HZ2  4  
ATOM 8655  H HZ3  . LYS B 1 67 ? -19.198 -4.198  9.321   1.00 0.00 ? 71 LYS B HZ3  4  
ATOM 8656  N N    . SER B 1 68 ? -14.676 -10.081 9.816   1.00 0.00 ? 72 SER B N    4  
ATOM 8657  C CA   . SER B 1 68 ? -14.601 -10.876 11.030  1.00 0.00 ? 72 SER B CA   4  
ATOM 8658  C C    . SER B 1 68 ? -15.552 -12.071 10.932  1.00 0.00 ? 72 SER B C    4  
ATOM 8659  O O    . SER B 1 68 ? -16.763 -11.919 11.087  1.00 0.00 ? 72 SER B O    4  
ATOM 8660  C CB   . SER B 1 68 ? -14.933 -10.033 12.262  1.00 0.00 ? 72 SER B CB   4  
ATOM 8661  O OG   . SER B 1 68 ? -13.988 -10.224 13.311  1.00 0.00 ? 72 SER B OG   4  
ATOM 8662  H H    . SER B 1 68 ? -15.316 -10.421 9.127   1.00 0.00 ? 72 SER B H    4  
ATOM 8663  H HA   . SER B 1 68 ? -13.566 -11.214 11.090  1.00 0.00 ? 72 SER B HA   4  
ATOM 8664  H HB2  . SER B 1 68 ? -14.958 -8.979  11.984  1.00 0.00 ? 72 SER B HB2  4  
ATOM 8665  H HB3  . SER B 1 68 ? -15.930 -10.291 12.620  1.00 0.00 ? 72 SER B HB3  4  
ATOM 8666  H HG   . SER B 1 68 ? -13.792 -11.199 13.422  1.00 0.00 ? 72 SER B HG   4  
ATOM 8667  N N    . ASN B 1 69 ? -14.967 -13.232 10.677  1.00 0.00 ? 73 ASN B N    4  
ATOM 8668  C CA   . ASN B 1 69 ? -15.747 -14.452 10.557  1.00 0.00 ? 73 ASN B CA   4  
ATOM 8669  C C    . ASN B 1 69 ? -16.627 -14.614 11.799  1.00 0.00 ? 73 ASN B C    4  
ATOM 8670  O O    . ASN B 1 69 ? -16.164 -14.419 12.922  1.00 0.00 ? 73 ASN B O    4  
ATOM 8671  C CB   . ASN B 1 69 ? -14.839 -15.679 10.458  1.00 0.00 ? 73 ASN B CB   4  
ATOM 8672  C CG   . ASN B 1 69 ? -15.555 -16.837 9.759   1.00 0.00 ? 73 ASN B CG   4  
ATOM 8673  O OD1  . ASN B 1 69 ? -15.935 -16.757 8.602   1.00 0.00 ? 73 ASN B OD1  4  
ATOM 8674  N ND2  . ASN B 1 69 ? -15.716 -17.913 10.523  1.00 0.00 ? 73 ASN B ND2  4  
ATOM 8675  H H    . ASN B 1 69 ? -13.982 -13.347 10.553  1.00 0.00 ? 73 ASN B H    4  
ATOM 8676  H HA   . ASN B 1 69 ? -16.331 -14.330 9.645   1.00 0.00 ? 73 ASN B HA   4  
ATOM 8677  H HB2  . ASN B 1 69 ? -13.933 -15.422 9.909   1.00 0.00 ? 73 ASN B HB2  4  
ATOM 8678  H HB3  . ASN B 1 69 ? -14.529 -15.989 11.457  1.00 0.00 ? 73 ASN B HB3  4  
ATOM 8679  H HD21 . ASN B 1 69 ? -15.380 -17.913 11.464  1.00 0.00 ? 73 ASN B HD21 4  
ATOM 8680  H HD22 . ASN B 1 69 ? -16.174 -18.723 10.155  1.00 0.00 ? 73 ASN B HD22 4  
ATOM 8681  N N    . THR A 1 1  ? -11.630 -17.853 -16.226 1.00 0.00 ? 5  THR A N    5  
ATOM 8682  C CA   . THR A 1 1  ? -10.965 -16.870 -15.387 1.00 0.00 ? 5  THR A CA   5  
ATOM 8683  C C    . THR A 1 1  ? -10.118 -17.564 -14.319 1.00 0.00 ? 5  THR A C    5  
ATOM 8684  O O    . THR A 1 1  ? -10.574 -17.766 -13.195 1.00 0.00 ? 5  THR A O    5  
ATOM 8685  C CB   . THR A 1 1  ? -12.036 -15.943 -14.807 1.00 0.00 ? 5  THR A CB   5  
ATOM 8686  O OG1  . THR A 1 1  ? -12.678 -15.392 -15.953 1.00 0.00 ? 5  THR A OG1  5  
ATOM 8687  C CG2  . THR A 1 1  ? -11.436 -14.729 -14.096 1.00 0.00 ? 5  THR A CG2  5  
ATOM 8688  H H    . THR A 1 1  ? -12.564 -17.618 -16.493 1.00 0.00 ? 5  THR A H    5  
ATOM 8689  H HA   . THR A 1 1  ? -10.283 -16.292 -16.011 1.00 0.00 ? 5  THR A HA   5  
ATOM 8690  H HB   . THR A 1 1  ? -12.706 -16.491 -14.144 1.00 0.00 ? 5  THR A HB   5  
ATOM 8691  H HG1  . THR A 1 1  ? -13.567 -15.013 -15.698 1.00 0.00 ? 5  THR A HG1  5  
ATOM 8692  H HG21 . THR A 1 1  ? -10.618 -14.325 -14.693 1.00 0.00 ? 5  THR A HG21 5  
ATOM 8693  H HG22 . THR A 1 1  ? -12.204 -13.966 -13.968 1.00 0.00 ? 5  THR A HG22 5  
ATOM 8694  H HG23 . THR A 1 1  ? -11.057 -15.030 -13.119 1.00 0.00 ? 5  THR A HG23 5  
ATOM 8695  N N    . GLU A 1 2  ? -8.900  -17.911 -14.709 1.00 0.00 ? 6  GLU A N    5  
ATOM 8696  C CA   . GLU A 1 2  ? -7.985  -18.579 -13.799 1.00 0.00 ? 6  GLU A CA   5  
ATOM 8697  C C    . GLU A 1 2  ? -6.782  -17.681 -13.503 1.00 0.00 ? 6  GLU A C    5  
ATOM 8698  O O    . GLU A 1 2  ? -5.741  -17.800 -14.148 1.00 0.00 ? 6  GLU A O    5  
ATOM 8699  C CB   . GLU A 1 2  ? -7.537  -19.928 -14.364 1.00 0.00 ? 6  GLU A CB   5  
ATOM 8700  C CG   . GLU A 1 2  ? -7.038  -20.850 -13.250 1.00 0.00 ? 6  GLU A CG   5  
ATOM 8701  C CD   . GLU A 1 2  ? -6.977  -22.303 -13.728 1.00 0.00 ? 6  GLU A CD   5  
ATOM 8702  O OE1  . GLU A 1 2  ? -5.915  -22.678 -14.269 1.00 0.00 ? 6  GLU A OE1  5  
ATOM 8703  O OE2  . GLU A 1 2  ? -7.994  -23.005 -13.540 1.00 0.00 ? 6  GLU A OE2  5  
ATOM 8704  H H    . GLU A 1 2  ? -8.537  -17.743 -15.626 1.00 0.00 ? 6  GLU A H    5  
ATOM 8705  H HA   . GLU A 1 2  ? -8.556  -18.746 -12.885 1.00 0.00 ? 6  GLU A HA   5  
ATOM 8706  H HB2  . GLU A 1 2  ? -8.368  -20.401 -14.888 1.00 0.00 ? 6  GLU A HB2  5  
ATOM 8707  H HB3  . GLU A 1 2  ? -6.745  -19.774 -15.097 1.00 0.00 ? 6  GLU A HB3  5  
ATOM 8708  H HG2  . GLU A 1 2  ? -6.049  -20.529 -12.923 1.00 0.00 ? 6  GLU A HG2  5  
ATOM 8709  H HG3  . GLU A 1 2  ? -7.699  -20.775 -12.387 1.00 0.00 ? 6  GLU A HG3  5  
ATOM 8710  N N    . LEU A 1 3  ? -6.964  -16.803 -12.528 1.00 0.00 ? 7  LEU A N    5  
ATOM 8711  C CA   . LEU A 1 3  ? -5.907  -15.886 -12.139 1.00 0.00 ? 7  LEU A CA   5  
ATOM 8712  C C    . LEU A 1 3  ? -5.291  -16.356 -10.819 1.00 0.00 ? 7  LEU A C    5  
ATOM 8713  O O    . LEU A 1 3  ? -5.851  -17.213 -10.139 1.00 0.00 ? 7  LEU A O    5  
ATOM 8714  C CB   . LEU A 1 3  ? -6.432  -14.450 -12.095 1.00 0.00 ? 7  LEU A CB   5  
ATOM 8715  C CG   . LEU A 1 3  ? -6.892  -13.863 -13.432 1.00 0.00 ? 7  LEU A CG   5  
ATOM 8716  C CD1  . LEU A 1 3  ? -8.357  -14.206 -13.705 1.00 0.00 ? 7  LEU A CD1  5  
ATOM 8717  C CD2  . LEU A 1 3  ? -6.635  -12.356 -13.486 1.00 0.00 ? 7  LEU A CD2  5  
ATOM 8718  H H    . LEU A 1 3  ? -7.814  -16.713 -12.009 1.00 0.00 ? 7  LEU A H    5  
ATOM 8719  H HA   . LEU A 1 3  ? -5.139  -15.926 -12.912 1.00 0.00 ? 7  LEU A HA   5  
ATOM 8720  H HB2  . LEU A 1 3  ? -7.268  -14.410 -11.397 1.00 0.00 ? 7  LEU A HB2  5  
ATOM 8721  H HB3  . LEU A 1 3  ? -5.648  -13.810 -11.690 1.00 0.00 ? 7  LEU A HB3  5  
ATOM 8722  H HG   . LEU A 1 3  ? -6.301  -14.319 -14.226 1.00 0.00 ? 7  LEU A HG   5  
ATOM 8723  H HD11 . LEU A 1 3  ? -8.967  -13.902 -12.854 1.00 0.00 ? 7  LEU A HD11 5  
ATOM 8724  H HD12 . LEU A 1 3  ? -8.693  -13.679 -14.599 1.00 0.00 ? 7  LEU A HD12 5  
ATOM 8725  H HD13 . LEU A 1 3  ? -8.457  -15.280 -13.858 1.00 0.00 ? 7  LEU A HD13 5  
ATOM 8726  H HD21 . LEU A 1 3  ? -6.391  -11.993 -12.487 1.00 0.00 ? 7  LEU A HD21 5  
ATOM 8727  H HD22 . LEU A 1 3  ? -5.803  -12.153 -14.160 1.00 0.00 ? 7  LEU A HD22 5  
ATOM 8728  H HD23 . LEU A 1 3  ? -7.529  -11.848 -13.849 1.00 0.00 ? 7  LEU A HD23 5  
ATOM 8729  N N    . ARG A 1 4  ? -4.145  -15.773 -10.497 1.00 0.00 ? 8  ARG A N    5  
ATOM 8730  C CA   . ARG A 1 4  ? -3.447  -16.121 -9.272  1.00 0.00 ? 8  ARG A CA   5  
ATOM 8731  C C    . ARG A 1 4  ? -2.936  -14.858 -8.575  1.00 0.00 ? 8  ARG A C    5  
ATOM 8732  O O    . ARG A 1 4  ? -3.589  -13.816 -8.613  1.00 0.00 ? 8  ARG A O    5  
ATOM 8733  C CB   . ARG A 1 4  ? -2.266  -17.051 -9.556  1.00 0.00 ? 8  ARG A CB   5  
ATOM 8734  C CG   . ARG A 1 4  ? -2.625  -18.080 -10.630 1.00 0.00 ? 8  ARG A CG   5  
ATOM 8735  C CD   . ARG A 1 4  ? -1.670  -19.275 -10.586 1.00 0.00 ? 8  ARG A CD   5  
ATOM 8736  N NE   . ARG A 1 4  ? -1.353  -19.720 -11.961 1.00 0.00 ? 8  ARG A NE   5  
ATOM 8737  C CZ   . ARG A 1 4  ? -0.267  -20.435 -12.287 1.00 0.00 ? 8  ARG A CZ   5  
ATOM 8738  N NH1  . ARG A 1 4  ? 0.611   -20.790 -11.339 1.00 0.00 ? 8  ARG A NH1  5  
ATOM 8739  N NH2  . ARG A 1 4  ? -0.060  -20.795 -13.561 1.00 0.00 ? 8  ARG A NH2  5  
ATOM 8740  H H    . ARG A 1 4  ? -3.696  -15.076 -11.057 1.00 0.00 ? 8  ARG A H    5  
ATOM 8741  H HA   . ARG A 1 4  ? -4.192  -16.631 -8.662  1.00 0.00 ? 8  ARG A HA   5  
ATOM 8742  H HB2  . ARG A 1 4  ? -1.406  -16.465 -9.880  1.00 0.00 ? 8  ARG A HB2  5  
ATOM 8743  H HB3  . ARG A 1 4  ? -1.974  -17.564 -8.639  1.00 0.00 ? 8  ARG A HB3  5  
ATOM 8744  H HG2  . ARG A 1 4  ? -3.649  -18.422 -10.484 1.00 0.00 ? 8  ARG A HG2  5  
ATOM 8745  H HG3  . ARG A 1 4  ? -2.582  -17.612 -11.614 1.00 0.00 ? 8  ARG A HG3  5  
ATOM 8746  H HD2  . ARG A 1 4  ? -0.754  -19.000 -10.063 1.00 0.00 ? 8  ARG A HD2  5  
ATOM 8747  H HD3  . ARG A 1 4  ? -2.124  -20.092 -10.025 1.00 0.00 ? 8  ARG A HD3  5  
ATOM 8748  H HE   . ARG A 1 4  ? -1.988  -19.472 -12.692 1.00 0.00 ? 8  ARG A HE   5  
ATOM 8749  H HH11 . ARG A 1 4  ? 0.457   -20.521 -10.389 1.00 0.00 ? 8  ARG A HH11 5  
ATOM 8750  H HH12 . ARG A 1 4  ? 1.422   -21.323 -11.583 1.00 0.00 ? 8  ARG A HH12 5  
ATOM 8751  H HH21 . ARG A 1 4  ? -0.716  -20.531 -14.268 1.00 0.00 ? 8  ARG A HH21 5  
ATOM 8752  H HH22 . ARG A 1 4  ? 0.750   -21.329 -13.804 1.00 0.00 ? 8  ARG A HH22 5  
ATOM 8753  N N    . CYS A 1 5  ? -1.773  -14.992 -7.955  1.00 0.00 ? 9  CYS A N    5  
ATOM 8754  C CA   . CYS A 1 5  ? -1.167  -13.875 -7.251  1.00 0.00 ? 9  CYS A CA   5  
ATOM 8755  C C    . CYS A 1 5  ? -0.140  -13.222 -8.178  1.00 0.00 ? 9  CYS A C    5  
ATOM 8756  O O    . CYS A 1 5  ? 0.193   -13.773 -9.227  1.00 0.00 ? 9  CYS A O    5  
ATOM 8757  C CB   . CYS A 1 5  ? -0.541  -14.314 -5.925  1.00 0.00 ? 9  CYS A CB   5  
ATOM 8758  S SG   . CYS A 1 5  ? -1.731  -14.549 -4.555  1.00 0.00 ? 9  CYS A SG   5  
ATOM 8759  H H    . CYS A 1 5  ? -1.248  -15.843 -7.928  1.00 0.00 ? 9  CYS A H    5  
ATOM 8760  H HA   . CYS A 1 5  ? -1.972  -13.179 -7.015  1.00 0.00 ? 9  CYS A HA   5  
ATOM 8761  H HB2  . CYS A 1 5  ? -0.003  -15.248 -6.085  1.00 0.00 ? 9  CYS A HB2  5  
ATOM 8762  H HB3  . CYS A 1 5  ? 0.196   -13.570 -5.624  1.00 0.00 ? 9  CYS A HB3  5  
ATOM 8763  N N    . GLN A 1 6  ? 0.334   -12.058 -7.759  1.00 0.00 ? 10 GLN A N    5  
ATOM 8764  C CA   . GLN A 1 6  ? 1.316   -11.325 -8.539  1.00 0.00 ? 10 GLN A CA   5  
ATOM 8765  C C    . GLN A 1 6  ? 2.713   -11.510 -7.943  1.00 0.00 ? 10 GLN A C    5  
ATOM 8766  O O    . GLN A 1 6  ? 3.693   -10.996 -8.479  1.00 0.00 ? 10 GLN A O    5  
ATOM 8767  C CB   . GLN A 1 6  ? 0.950   -9.842  -8.628  1.00 0.00 ? 10 GLN A CB   5  
ATOM 8768  C CG   . GLN A 1 6  ? 1.032   -9.342  -10.072 1.00 0.00 ? 10 GLN A CG   5  
ATOM 8769  C CD   . GLN A 1 6  ? 1.706   -7.970  -10.139 1.00 0.00 ? 10 GLN A CD   5  
ATOM 8770  O OE1  . GLN A 1 6  ? 2.518   -7.691  -11.006 1.00 0.00 ? 10 GLN A OE1  5  
ATOM 8771  N NE2  . GLN A 1 6  ? 1.326   -7.132  -9.179  1.00 0.00 ? 10 GLN A NE2  5  
ATOM 8772  H H    . GLN A 1 6  ? 0.057   -11.617 -6.905  1.00 0.00 ? 10 GLN A H    5  
ATOM 8773  H HA   . GLN A 1 6  ? 1.278   -11.762 -9.537  1.00 0.00 ? 10 GLN A HA   5  
ATOM 8774  H HB2  . GLN A 1 6  ? -0.059  -9.689  -8.244  1.00 0.00 ? 10 GLN A HB2  5  
ATOM 8775  H HB3  . GLN A 1 6  ? 1.622   -9.259  -7.999  1.00 0.00 ? 10 GLN A HB3  5  
ATOM 8776  H HG2  . GLN A 1 6  ? 1.592   -10.056 -10.676 1.00 0.00 ? 10 GLN A HG2  5  
ATOM 8777  H HG3  . GLN A 1 6  ? 0.030   -9.280  -10.497 1.00 0.00 ? 10 GLN A HG3  5  
ATOM 8778  H HE21 . GLN A 1 6  ? 0.654   -7.425  -8.498  1.00 0.00 ? 10 GLN A HE21 5  
ATOM 8779  H HE22 . GLN A 1 6  ? 1.710   -6.210  -9.138  1.00 0.00 ? 10 GLN A HE22 5  
ATOM 8780  N N    . CYS A 1 7  ? 2.759   -12.246 -6.842  1.00 0.00 ? 11 CYS A N    5  
ATOM 8781  C CA   . CYS A 1 7  ? 4.019   -12.505 -6.168  1.00 0.00 ? 11 CYS A CA   5  
ATOM 8782  C C    . CYS A 1 7  ? 3.984   -13.932 -5.617  1.00 0.00 ? 11 CYS A C    5  
ATOM 8783  O O    . CYS A 1 7  ? 3.128   -14.265 -4.799  1.00 0.00 ? 11 CYS A O    5  
ATOM 8784  C CB   . CYS A 1 7  ? 4.295   -11.476 -5.070  1.00 0.00 ? 11 CYS A CB   5  
ATOM 8785  S SG   . CYS A 1 7  ? 5.811   -10.480 -5.315  1.00 0.00 ? 11 CYS A SG   5  
ATOM 8786  H H    . CYS A 1 7  ? 1.956   -12.660 -6.413  1.00 0.00 ? 11 CYS A H    5  
ATOM 8787  H HA   . CYS A 1 7  ? 4.803   -12.399 -6.917  1.00 0.00 ? 11 CYS A HA   5  
ATOM 8788  H HB2  . CYS A 1 7  ? 3.442   -10.802 -5.000  1.00 0.00 ? 11 CYS A HB2  5  
ATOM 8789  H HB3  . CYS A 1 7  ? 4.370   -11.996 -4.115  1.00 0.00 ? 11 CYS A HB3  5  
ATOM 8790  N N    . LEU A 1 8  ? 4.926   -14.737 -6.087  1.00 0.00 ? 12 LEU A N    5  
ATOM 8791  C CA   . LEU A 1 8  ? 5.014   -16.120 -5.652  1.00 0.00 ? 12 LEU A CA   5  
ATOM 8792  C C    . LEU A 1 8  ? 6.009   -16.224 -4.494  1.00 0.00 ? 12 LEU A C    5  
ATOM 8793  O O    . LEU A 1 8  ? 6.046   -17.233 -3.791  1.00 0.00 ? 12 LEU A O    5  
ATOM 8794  C CB   . LEU A 1 8  ? 5.348   -17.034 -6.833  1.00 0.00 ? 12 LEU A CB   5  
ATOM 8795  C CG   . LEU A 1 8  ? 4.605   -16.740 -8.138  1.00 0.00 ? 12 LEU A CG   5  
ATOM 8796  C CD1  . LEU A 1 8  ? 5.438   -17.162 -9.350  1.00 0.00 ? 12 LEU A CD1  5  
ATOM 8797  C CD2  . LEU A 1 8  ? 3.221   -17.392 -8.140  1.00 0.00 ? 12 LEU A CD2  5  
ATOM 8798  H H    . LEU A 1 8  ? 5.619   -14.458 -6.752  1.00 0.00 ? 12 LEU A H    5  
ATOM 8799  H HA   . LEU A 1 8  ? 4.029   -16.411 -5.287  1.00 0.00 ? 12 LEU A HA   5  
ATOM 8800  H HB2  . LEU A 1 8  ? 6.419   -16.970 -7.025  1.00 0.00 ? 12 LEU A HB2  5  
ATOM 8801  H HB3  . LEU A 1 8  ? 5.137   -18.063 -6.542  1.00 0.00 ? 12 LEU A HB3  5  
ATOM 8802  H HG   . LEU A 1 8  ? 4.454   -15.663 -8.210  1.00 0.00 ? 12 LEU A HG   5  
ATOM 8803  H HD11 . LEU A 1 8  ? 6.491   -16.958 -9.155  1.00 0.00 ? 12 LEU A HD11 5  
ATOM 8804  H HD12 . LEU A 1 8  ? 5.302   -18.228 -9.531  1.00 0.00 ? 12 LEU A HD12 5  
ATOM 8805  H HD13 . LEU A 1 8  ? 5.116   -16.600 -10.226 1.00 0.00 ? 12 LEU A HD13 5  
ATOM 8806  H HD21 . LEU A 1 8  ? 3.203   -18.209 -7.418  1.00 0.00 ? 12 LEU A HD21 5  
ATOM 8807  H HD22 . LEU A 1 8  ? 2.470   -16.650 -7.867  1.00 0.00 ? 12 LEU A HD22 5  
ATOM 8808  H HD23 . LEU A 1 8  ? 3.003   -17.781 -9.135  1.00 0.00 ? 12 LEU A HD23 5  
ATOM 8809  N N    . GLN A 1 9  ? 6.792   -15.167 -4.332  1.00 0.00 ? 13 GLN A N    5  
ATOM 8810  C CA   . GLN A 1 9  ? 7.784   -15.126 -3.272  1.00 0.00 ? 13 GLN A CA   5  
ATOM 8811  C C    . GLN A 1 9  ? 7.627   -13.848 -2.446  1.00 0.00 ? 13 GLN A C    5  
ATOM 8812  O O    . GLN A 1 9  ? 6.835   -12.974 -2.794  1.00 0.00 ? 13 GLN A O    5  
ATOM 8813  C CB   . GLN A 1 9  ? 9.200   -15.241 -3.841  1.00 0.00 ? 13 GLN A CB   5  
ATOM 8814  C CG   . GLN A 1 9  ? 10.082  -16.115 -2.947  1.00 0.00 ? 13 GLN A CG   5  
ATOM 8815  C CD   . GLN A 1 9  ? 10.949  -17.056 -3.785  1.00 0.00 ? 13 GLN A CD   5  
ATOM 8816  O OE1  . GLN A 1 9  ? 10.585  -18.184 -4.075  1.00 0.00 ? 13 GLN A OE1  5  
ATOM 8817  N NE2  . GLN A 1 9  ? 12.114  -16.533 -4.155  1.00 0.00 ? 13 GLN A NE2  5  
ATOM 8818  H H    . GLN A 1 9  ? 6.755   -14.351 -4.908  1.00 0.00 ? 13 GLN A H    5  
ATOM 8819  H HA   . GLN A 1 9  ? 7.579   -15.997 -2.649  1.00 0.00 ? 13 GLN A HA   5  
ATOM 8820  H HB2  . GLN A 1 9  ? 9.159   -15.666 -4.844  1.00 0.00 ? 13 GLN A HB2  5  
ATOM 8821  H HB3  . GLN A 1 9  ? 9.640   -14.248 -3.934  1.00 0.00 ? 13 GLN A HB3  5  
ATOM 8822  H HG2  . GLN A 1 9  ? 10.718  -15.482 -2.328  1.00 0.00 ? 13 GLN A HG2  5  
ATOM 8823  H HG3  . GLN A 1 9  ? 9.456   -16.696 -2.270  1.00 0.00 ? 13 GLN A HG3  5  
ATOM 8824  H HE21 . GLN A 1 9  ? 12.353  -15.601 -3.882  1.00 0.00 ? 13 GLN A HE21 5  
ATOM 8825  H HE22 . GLN A 1 9  ? 12.752  -17.071 -4.705  1.00 0.00 ? 13 GLN A HE22 5  
ATOM 8826  N N    . THR A 1 10 ? 8.395   -13.779 -1.368  1.00 0.00 ? 14 THR A N    5  
ATOM 8827  C CA   . THR A 1 10 ? 8.351   -12.622 -0.491  1.00 0.00 ? 14 THR A CA   5  
ATOM 8828  C C    . THR A 1 10 ? 9.640   -12.525 0.328   1.00 0.00 ? 14 THR A C    5  
ATOM 8829  O O    . THR A 1 10 ? 10.413  -13.480 0.392   1.00 0.00 ? 14 THR A O    5  
ATOM 8830  C CB   . THR A 1 10 ? 7.091   -12.730 0.371   1.00 0.00 ? 14 THR A CB   5  
ATOM 8831  O OG1  . THR A 1 10 ? 7.075   -14.090 0.794   1.00 0.00 ? 14 THR A OG1  5  
ATOM 8832  C CG2  . THR A 1 10 ? 5.808   -12.580 -0.448  1.00 0.00 ? 14 THR A CG2  5  
ATOM 8833  H H    . THR A 1 10 ? 9.037   -14.495 -1.093  1.00 0.00 ? 14 THR A H    5  
ATOM 8834  H HA   . THR A 1 10 ? 8.295   -11.725 -1.107  1.00 0.00 ? 14 THR A HA   5  
ATOM 8835  H HB   . THR A 1 10 ? 7.117   -12.011 1.189   1.00 0.00 ? 14 THR A HB   5  
ATOM 8836  H HG1  . THR A 1 10 ? 7.747   -14.230 1.522   1.00 0.00 ? 14 THR A HG1  5  
ATOM 8837  H HG21 . THR A 1 10 ? 5.909   -11.736 -1.131  1.00 0.00 ? 14 THR A HG21 5  
ATOM 8838  H HG22 . THR A 1 10 ? 5.633   -13.491 -1.020  1.00 0.00 ? 14 THR A HG22 5  
ATOM 8839  H HG23 . THR A 1 10 ? 4.967   -12.405 0.223   1.00 0.00 ? 14 THR A HG23 5  
ATOM 8840  N N    . LEU A 1 11 ? 9.832   -11.362 0.933   1.00 0.00 ? 15 LEU A N    5  
ATOM 8841  C CA   . LEU A 1 11 ? 11.014  -11.127 1.745   1.00 0.00 ? 15 LEU A CA   5  
ATOM 8842  C C    . LEU A 1 11 ? 10.629  -11.174 3.225   1.00 0.00 ? 15 LEU A C    5  
ATOM 8843  O O    . LEU A 1 11 ? 9.469   -11.409 3.561   1.00 0.00 ? 15 LEU A O    5  
ATOM 8844  C CB   . LEU A 1 11 ? 11.700  -9.824  1.329   1.00 0.00 ? 15 LEU A CB   5  
ATOM 8845  C CG   . LEU A 1 11 ? 12.286  -9.796  -0.084  1.00 0.00 ? 15 LEU A CG   5  
ATOM 8846  C CD1  . LEU A 1 11 ? 12.330  -8.368  -0.631  1.00 0.00 ? 15 LEU A CD1  5  
ATOM 8847  C CD2  . LEU A 1 11 ? 13.662  -10.465 -0.120  1.00 0.00 ? 15 LEU A CD2  5  
ATOM 8848  H H    . LEU A 1 11 ? 9.199   -10.590 0.876   1.00 0.00 ? 15 LEU A H    5  
ATOM 8849  H HA   . LEU A 1 11 ? 11.715  -11.938 1.544   1.00 0.00 ? 15 LEU A HA   5  
ATOM 8850  H HB2  . LEU A 1 11 ? 10.977  -9.012  1.417   1.00 0.00 ? 15 LEU A HB2  5  
ATOM 8851  H HB3  . LEU A 1 11 ? 12.501  -9.616  2.038   1.00 0.00 ? 15 LEU A HB3  5  
ATOM 8852  H HG   . LEU A 1 11 ? 11.631  -10.371 -0.737  1.00 0.00 ? 15 LEU A HG   5  
ATOM 8853  H HD11 . LEU A 1 11 ? 12.070  -7.666  0.162   1.00 0.00 ? 15 LEU A HD11 5  
ATOM 8854  H HD12 . LEU A 1 11 ? 13.333  -8.148  -0.995  1.00 0.00 ? 15 LEU A HD12 5  
ATOM 8855  H HD13 . LEU A 1 11 ? 11.617  -8.270  -1.450  1.00 0.00 ? 15 LEU A HD13 5  
ATOM 8856  H HD21 . LEU A 1 11 ? 13.756  -11.147 0.726   1.00 0.00 ? 15 LEU A HD21 5  
ATOM 8857  H HD22 . LEU A 1 11 ? 13.770  -11.023 -1.050  1.00 0.00 ? 15 LEU A HD22 5  
ATOM 8858  H HD23 . LEU A 1 11 ? 14.438  -9.703  -0.060  1.00 0.00 ? 15 LEU A HD23 5  
ATOM 8859  N N    . GLN A 1 12 ? 11.624  -10.947 4.070   1.00 0.00 ? 16 GLN A N    5  
ATOM 8860  C CA   . GLN A 1 12 ? 11.403  -10.960 5.506   1.00 0.00 ? 16 GLN A CA   5  
ATOM 8861  C C    . GLN A 1 12 ? 11.039  -9.559  6.000   1.00 0.00 ? 16 GLN A C    5  
ATOM 8862  O O    . GLN A 1 12 ? 10.579  -9.395  7.130   1.00 0.00 ? 16 GLN A O    5  
ATOM 8863  C CB   . GLN A 1 12 ? 12.630  -11.500 6.244   1.00 0.00 ? 16 GLN A CB   5  
ATOM 8864  C CG   . GLN A 1 12 ? 12.631  -11.052 7.707   1.00 0.00 ? 16 GLN A CG   5  
ATOM 8865  C CD   . GLN A 1 12 ? 11.394  -11.573 8.441   1.00 0.00 ? 16 GLN A CD   5  
ATOM 8866  O OE1  . GLN A 1 12 ? 10.699  -12.466 7.983   1.00 0.00 ? 16 GLN A OE1  5  
ATOM 8867  N NE2  . GLN A 1 12 ? 11.158  -10.968 9.601   1.00 0.00 ? 16 GLN A NE2  5  
ATOM 8868  H H    . GLN A 1 12 ? 12.564  -10.756 3.788   1.00 0.00 ? 16 GLN A H    5  
ATOM 8869  H HA   . GLN A 1 12 ? 10.565  -11.638 5.664   1.00 0.00 ? 16 GLN A HA   5  
ATOM 8870  H HB2  . GLN A 1 12 ? 12.640  -12.589 6.193   1.00 0.00 ? 16 GLN A HB2  5  
ATOM 8871  H HB3  . GLN A 1 12 ? 13.538  -11.150 5.752   1.00 0.00 ? 16 GLN A HB3  5  
ATOM 8872  H HG2  . GLN A 1 12 ? 13.532  -11.416 8.202   1.00 0.00 ? 16 GLN A HG2  5  
ATOM 8873  H HG3  . GLN A 1 12 ? 12.657  -9.964  7.758   1.00 0.00 ? 16 GLN A HG3  5  
ATOM 8874  H HE21 . GLN A 1 12 ? 11.768  -10.242 9.919   1.00 0.00 ? 16 GLN A HE21 5  
ATOM 8875  H HE22 . GLN A 1 12 ? 10.371  -11.238 10.155  1.00 0.00 ? 16 GLN A HE22 5  
ATOM 8876  N N    . GLY A 1 13 ? 11.257  -8.584  5.130   1.00 0.00 ? 17 GLY A N    5  
ATOM 8877  C CA   . GLY A 1 13 ? 10.958  -7.202  5.465   1.00 0.00 ? 17 GLY A CA   5  
ATOM 8878  C C    . GLY A 1 13 ? 11.925  -6.246  4.763   1.00 0.00 ? 17 GLY A C    5  
ATOM 8879  O O    . GLY A 1 13 ? 11.554  -5.125  4.417   1.00 0.00 ? 17 GLY A O    5  
ATOM 8880  H H    . GLY A 1 13 ? 11.632  -8.725  4.214   1.00 0.00 ? 17 GLY A H    5  
ATOM 8881  H HA2  . GLY A 1 13 ? 9.934   -6.968  5.174   1.00 0.00 ? 17 GLY A HA2  5  
ATOM 8882  H HA3  . GLY A 1 13 ? 11.022  -7.062  6.544   1.00 0.00 ? 17 GLY A HA3  5  
ATOM 8883  N N    . ILE A 1 14 ? 13.145  -6.724  4.572   1.00 0.00 ? 18 ILE A N    5  
ATOM 8884  C CA   . ILE A 1 14 ? 14.168  -5.926  3.918   1.00 0.00 ? 18 ILE A CA   5  
ATOM 8885  C C    . ILE A 1 14 ? 14.329  -4.600  4.663   1.00 0.00 ? 18 ILE A C    5  
ATOM 8886  O O    . ILE A 1 14 ? 13.474  -4.227  5.466   1.00 0.00 ? 18 ILE A O    5  
ATOM 8887  C CB   . ILE A 1 14 ? 13.849  -5.761  2.431   1.00 0.00 ? 18 ILE A CB   5  
ATOM 8888  C CG1  . ILE A 1 14 ? 14.123  -7.057  1.664   1.00 0.00 ? 18 ILE A CG1  5  
ATOM 8889  C CG2  . ILE A 1 14 ? 14.606  -4.572  1.836   1.00 0.00 ? 18 ILE A CG2  5  
ATOM 8890  C CD1  . ILE A 1 14 ? 15.593  -7.466  1.786   1.00 0.00 ? 18 ILE A CD1  5  
ATOM 8891  H H    . ILE A 1 14 ? 13.439  -7.637  4.856   1.00 0.00 ? 18 ILE A H    5  
ATOM 8892  H HA   . ILE A 1 14 ? 15.106  -6.477  3.987   1.00 0.00 ? 18 ILE A HA   5  
ATOM 8893  H HB   . ILE A 1 14 ? 12.785  -5.548  2.331   1.00 0.00 ? 18 ILE A HB   5  
ATOM 8894  H HG12 . ILE A 1 14 ? 13.487  -7.853  2.050   1.00 0.00 ? 18 ILE A HG12 5  
ATOM 8895  H HG13 . ILE A 1 14 ? 13.865  -6.924  0.614   1.00 0.00 ? 18 ILE A HG13 5  
ATOM 8896  H HG21 . ILE A 1 14 ? 14.350  -3.667  2.386   1.00 0.00 ? 18 ILE A HG21 5  
ATOM 8897  H HG22 . ILE A 1 14 ? 15.679  -4.751  1.910   1.00 0.00 ? 18 ILE A HG22 5  
ATOM 8898  H HG23 . ILE A 1 14 ? 14.329  -4.452  0.789   1.00 0.00 ? 18 ILE A HG23 5  
ATOM 8899  H HD11 . ILE A 1 14 ? 16.156  -6.660  2.258   1.00 0.00 ? 18 ILE A HD11 5  
ATOM 8900  H HD12 . ILE A 1 14 ? 15.670  -8.367  2.394   1.00 0.00 ? 18 ILE A HD12 5  
ATOM 8901  H HD13 . ILE A 1 14 ? 15.999  -7.660  0.794   1.00 0.00 ? 18 ILE A HD13 5  
ATOM 8902  N N    . HIS A 1 15 ? 15.429  -3.923  4.371   1.00 0.00 ? 19 HIS A N    5  
ATOM 8903  C CA   . HIS A 1 15 ? 15.713  -2.646  5.003   1.00 0.00 ? 19 HIS A CA   5  
ATOM 8904  C C    . HIS A 1 15 ? 14.773  -1.576  4.444   1.00 0.00 ? 19 HIS A C    5  
ATOM 8905  O O    . HIS A 1 15 ? 14.477  -1.568  3.250   1.00 0.00 ? 19 HIS A O    5  
ATOM 8906  C CB   . HIS A 1 15 ? 17.190  -2.278  4.847   1.00 0.00 ? 19 HIS A CB   5  
ATOM 8907  C CG   . HIS A 1 15 ? 17.830  -1.759  6.112   1.00 0.00 ? 19 HIS A CG   5  
ATOM 8908  N ND1  . HIS A 1 15 ? 19.064  -2.197  6.562   1.00 0.00 ? 19 HIS A ND1  5  
ATOM 8909  C CD2  . HIS A 1 15 ? 17.397  -0.835  7.017   1.00 0.00 ? 19 HIS A CD2  5  
ATOM 8910  C CE1  . HIS A 1 15 ? 19.349  -1.559  7.688   1.00 0.00 ? 19 HIS A CE1  5  
ATOM 8911  N NE2  . HIS A 1 15 ? 18.315  -0.716  7.968   1.00 0.00 ? 19 HIS A NE2  5  
ATOM 8912  H H    . HIS A 1 15 ? 16.119  -4.233  3.717   1.00 0.00 ? 19 HIS A H    5  
ATOM 8913  H HA   . HIS A 1 15 ? 15.512  -2.772  6.067   1.00 0.00 ? 19 HIS A HA   5  
ATOM 8914  H HB2  . HIS A 1 15 ? 17.738  -3.156  4.508   1.00 0.00 ? 19 HIS A HB2  5  
ATOM 8915  H HB3  . HIS A 1 15 ? 17.285  -1.522  4.068   1.00 0.00 ? 19 HIS A HB3  5  
ATOM 8916  H HD1  . HIS A 1 15 ? 19.642  -2.879  6.113   1.00 0.00 ? 19 HIS A HD1  5  
ATOM 8917  H HD2  . HIS A 1 15 ? 16.456  -0.287  6.967   1.00 0.00 ? 19 HIS A HD2  5  
ATOM 8918  H HE1  . HIS A 1 15 ? 20.252  -1.686  8.285   1.00 0.00 ? 19 HIS A HE1  5  
ATOM 8919  N N    . LEU A 1 16 ? 14.329  -0.700  5.333   1.00 0.00 ? 20 LEU A N    5  
ATOM 8920  C CA   . LEU A 1 16 ? 13.429  0.372   4.943   1.00 0.00 ? 20 LEU A CA   5  
ATOM 8921  C C    . LEU A 1 16 ? 14.240  1.516   4.330   1.00 0.00 ? 20 LEU A C    5  
ATOM 8922  O O    . LEU A 1 16 ? 13.678  2.531   3.922   1.00 0.00 ? 20 LEU A O    5  
ATOM 8923  C CB   . LEU A 1 16 ? 12.560  0.800   6.127   1.00 0.00 ? 20 LEU A CB   5  
ATOM 8924  C CG   . LEU A 1 16 ? 11.465  1.823   5.820   1.00 0.00 ? 20 LEU A CG   5  
ATOM 8925  C CD1  . LEU A 1 16 ? 10.184  1.132   5.349   1.00 0.00 ? 20 LEU A CD1  5  
ATOM 8926  C CD2  . LEU A 1 16 ? 11.214  2.735   7.023   1.00 0.00 ? 20 LEU A CD2  5  
ATOM 8927  H H    . LEU A 1 16 ? 14.575  -0.714  6.302   1.00 0.00 ? 20 LEU A H    5  
ATOM 8928  H HA   . LEU A 1 16 ? 12.760  -0.025  4.179   1.00 0.00 ? 20 LEU A HA   5  
ATOM 8929  H HB2  . LEU A 1 16 ? 12.091  -0.090  6.548   1.00 0.00 ? 20 LEU A HB2  5  
ATOM 8930  H HB3  . LEU A 1 16 ? 13.210  1.212   6.899   1.00 0.00 ? 20 LEU A HB3  5  
ATOM 8931  H HG   . LEU A 1 16 ? 11.809  2.457   5.002   1.00 0.00 ? 20 LEU A HG   5  
ATOM 8932  H HD11 . LEU A 1 16 ? 10.062  0.189   5.883   1.00 0.00 ? 20 LEU A HD11 5  
ATOM 8933  H HD12 . LEU A 1 16 ? 9.328   1.776   5.548   1.00 0.00 ? 20 LEU A HD12 5  
ATOM 8934  H HD13 . LEU A 1 16 ? 10.250  0.936   4.278   1.00 0.00 ? 20 LEU A HD13 5  
ATOM 8935  H HD21 . LEU A 1 16 ? 12.155  3.183   7.342   1.00 0.00 ? 20 LEU A HD21 5  
ATOM 8936  H HD22 . LEU A 1 16 ? 10.514  3.522   6.743   1.00 0.00 ? 20 LEU A HD22 5  
ATOM 8937  H HD23 . LEU A 1 16 ? 10.795  2.150   7.842   1.00 0.00 ? 20 LEU A HD23 5  
ATOM 8938  N N    . LYS A 1 17 ? 15.548  1.313   4.285   1.00 0.00 ? 21 LYS A N    5  
ATOM 8939  C CA   . LYS A 1 17 ? 16.442  2.315   3.729   1.00 0.00 ? 21 LYS A CA   5  
ATOM 8940  C C    . LYS A 1 17 ? 16.555  2.109   2.217   1.00 0.00 ? 21 LYS A C    5  
ATOM 8941  O O    . LYS A 1 17 ? 17.136  2.936   1.516   1.00 0.00 ? 21 LYS A O    5  
ATOM 8942  C CB   . LYS A 1 17 ? 17.789  2.293   4.455   1.00 0.00 ? 21 LYS A CB   5  
ATOM 8943  C CG   . LYS A 1 17 ? 17.600  2.444   5.966   1.00 0.00 ? 21 LYS A CG   5  
ATOM 8944  C CD   . LYS A 1 17 ? 18.939  2.692   6.663   1.00 0.00 ? 21 LYS A CD   5  
ATOM 8945  C CE   . LYS A 1 17 ? 19.213  4.190   6.808   1.00 0.00 ? 21 LYS A CE   5  
ATOM 8946  N NZ   . LYS A 1 17 ? 20.459  4.418   7.573   1.00 0.00 ? 21 LYS A NZ   5  
ATOM 8947  H H    . LYS A 1 17 ? 15.998  0.484   4.619   1.00 0.00 ? 21 LYS A H    5  
ATOM 8948  H HA   . LYS A 1 17 ? 15.993  3.291   3.913   1.00 0.00 ? 21 LYS A HA   5  
ATOM 8949  H HB2  . LYS A 1 17 ? 18.307  1.358   4.241   1.00 0.00 ? 21 LYS A HB2  5  
ATOM 8950  H HB3  . LYS A 1 17 ? 18.420  3.099   4.081   1.00 0.00 ? 21 LYS A HB3  5  
ATOM 8951  H HG2  . LYS A 1 17 ? 16.921  3.271   6.170   1.00 0.00 ? 21 LYS A HG2  5  
ATOM 8952  H HG3  . LYS A 1 17 ? 17.137  1.544   6.370   1.00 0.00 ? 21 LYS A HG3  5  
ATOM 8953  H HD2  . LYS A 1 17 ? 18.933  2.223   7.647   1.00 0.00 ? 21 LYS A HD2  5  
ATOM 8954  H HD3  . LYS A 1 17 ? 19.742  2.225   6.093   1.00 0.00 ? 21 LYS A HD3  5  
ATOM 8955  H HE2  . LYS A 1 17 ? 19.296  4.647   5.822   1.00 0.00 ? 21 LYS A HE2  5  
ATOM 8956  H HE3  . LYS A 1 17 ? 18.376  4.671   7.314   1.00 0.00 ? 21 LYS A HE3  5  
ATOM 8957  H HZ1  . LYS A 1 17 ? 20.971  3.561   7.639   1.00 0.00 ? 21 LYS A HZ1  5  
ATOM 8958  H HZ2  . LYS A 1 17 ? 21.017  5.104   7.106   1.00 0.00 ? 21 LYS A HZ2  5  
ATOM 8959  H HZ3  . LYS A 1 17 ? 20.232  4.742   8.491   1.00 0.00 ? 21 LYS A HZ3  5  
ATOM 8960  N N    . ASN A 1 18 ? 15.990  1.002   1.759   1.00 0.00 ? 22 ASN A N    5  
ATOM 8961  C CA   . ASN A 1 18 ? 16.019  0.677   0.343   1.00 0.00 ? 22 ASN A CA   5  
ATOM 8962  C C    . ASN A 1 18 ? 14.619  0.858   -0.246  1.00 0.00 ? 22 ASN A C    5  
ATOM 8963  O O    . ASN A 1 18 ? 14.472  1.336   -1.370  1.00 0.00 ? 22 ASN A O    5  
ATOM 8964  C CB   . ASN A 1 18 ? 16.442  -0.777  0.120   1.00 0.00 ? 22 ASN A CB   5  
ATOM 8965  C CG   . ASN A 1 18 ? 17.820  -0.852  -0.538  1.00 0.00 ? 22 ASN A CG   5  
ATOM 8966  O OD1  . ASN A 1 18 ? 18.100  -0.199  -1.530  1.00 0.00 ? 22 ASN A OD1  5  
ATOM 8967  N ND2  . ASN A 1 18 ? 18.664  -1.683  0.067   1.00 0.00 ? 22 ASN A ND2  5  
ATOM 8968  H H    . ASN A 1 18 ? 15.519  0.334   2.336   1.00 0.00 ? 22 ASN A H    5  
ATOM 8969  H HA   . ASN A 1 18 ? 16.747  1.361   -0.092  1.00 0.00 ? 22 ASN A HA   5  
ATOM 8970  H HB2  . ASN A 1 18 ? 16.461  -1.304  1.074   1.00 0.00 ? 22 ASN A HB2  5  
ATOM 8971  H HB3  . ASN A 1 18 ? 15.707  -1.281  -0.507  1.00 0.00 ? 22 ASN A HB3  5  
ATOM 8972  H HD21 . ASN A 1 18 ? 18.371  -2.190  0.878   1.00 0.00 ? 22 ASN A HD21 5  
ATOM 8973  H HD22 . ASN A 1 18 ? 19.591  -1.802  -0.289  1.00 0.00 ? 22 ASN A HD22 5  
ATOM 8974  N N    . ILE A 1 19 ? 13.626  0.467   0.538   1.00 0.00 ? 23 ILE A N    5  
ATOM 8975  C CA   . ILE A 1 19 ? 12.243  0.580   0.108   1.00 0.00 ? 23 ILE A CA   5  
ATOM 8976  C C    . ILE A 1 19 ? 11.892  2.057   -0.085  1.00 0.00 ? 23 ILE A C    5  
ATOM 8977  O O    . ILE A 1 19 ? 12.185  2.885   0.776   1.00 0.00 ? 23 ILE A O    5  
ATOM 8978  C CB   . ILE A 1 19 ? 11.317  -0.149  1.083   1.00 0.00 ? 23 ILE A CB   5  
ATOM 8979  C CG1  . ILE A 1 19 ? 11.203  -1.633  0.726   1.00 0.00 ? 23 ILE A CG1  5  
ATOM 8980  C CG2  . ILE A 1 19 ? 9.947   0.530   1.151   1.00 0.00 ? 23 ILE A CG2  5  
ATOM 8981  C CD1  . ILE A 1 19 ? 11.387  -2.511  1.966   1.00 0.00 ? 23 ILE A CD1  5  
ATOM 8982  H H    . ILE A 1 19 ? 13.754  0.079   1.451   1.00 0.00 ? 23 ILE A H    5  
ATOM 8983  H HA   . ILE A 1 19 ? 12.158  0.076   -0.855  1.00 0.00 ? 23 ILE A HA   5  
ATOM 8984  H HB   . ILE A 1 19 ? 11.755  -0.090  2.079   1.00 0.00 ? 23 ILE A HB   5  
ATOM 8985  H HG12 . ILE A 1 19 ? 10.229  -1.829  0.278   1.00 0.00 ? 23 ILE A HG12 5  
ATOM 8986  H HG13 . ILE A 1 19 ? 11.955  -1.889  -0.020  1.00 0.00 ? 23 ILE A HG13 5  
ATOM 8987  H HG21 . ILE A 1 19 ? 9.725   0.995   0.191   1.00 0.00 ? 23 ILE A HG21 5  
ATOM 8988  H HG22 . ILE A 1 19 ? 9.184   -0.213  1.380   1.00 0.00 ? 23 ILE A HG22 5  
ATOM 8989  H HG23 . ILE A 1 19 ? 9.958   1.292   1.930   1.00 0.00 ? 23 ILE A HG23 5  
ATOM 8990  H HD11 . ILE A 1 19 ? 11.074  -1.958  2.852   1.00 0.00 ? 23 ILE A HD11 5  
ATOM 8991  H HD12 . ILE A 1 19 ? 10.781  -3.411  1.866   1.00 0.00 ? 23 ILE A HD12 5  
ATOM 8992  H HD13 . ILE A 1 19 ? 12.437  -2.788  2.062   1.00 0.00 ? 23 ILE A HD13 5  
ATOM 8993  N N    . GLN A 1 20 ? 11.271  2.341   -1.220  1.00 0.00 ? 24 GLN A N    5  
ATOM 8994  C CA   . GLN A 1 20 ? 10.878  3.704   -1.537  1.00 0.00 ? 24 GLN A CA   5  
ATOM 8995  C C    . GLN A 1 20 ? 9.353   3.818   -1.588  1.00 0.00 ? 24 GLN A C    5  
ATOM 8996  O O    . GLN A 1 20 ? 8.801   4.898   -1.382  1.00 0.00 ? 24 GLN A O    5  
ATOM 8997  C CB   . GLN A 1 20 ? 11.507  4.164   -2.854  1.00 0.00 ? 24 GLN A CB   5  
ATOM 8998  C CG   . GLN A 1 20 ? 12.082  5.575   -2.723  1.00 0.00 ? 24 GLN A CG   5  
ATOM 8999  C CD   . GLN A 1 20 ? 10.967  6.623   -2.705  1.00 0.00 ? 24 GLN A CD   5  
ATOM 9000  O OE1  . GLN A 1 20 ? 10.772  7.342   -1.739  1.00 0.00 ? 24 GLN A OE1  5  
ATOM 9001  N NE2  . GLN A 1 20 ? 10.247  6.667   -3.822  1.00 0.00 ? 24 GLN A NE2  5  
ATOM 9002  H H    . GLN A 1 20 ? 11.037  1.661   -1.915  1.00 0.00 ? 24 GLN A H    5  
ATOM 9003  H HA   . GLN A 1 20 ? 11.268  4.315   -0.723  1.00 0.00 ? 24 GLN A HA   5  
ATOM 9004  H HB2  . GLN A 1 20 ? 12.296  3.471   -3.146  1.00 0.00 ? 24 GLN A HB2  5  
ATOM 9005  H HB3  . GLN A 1 20 ? 10.757  4.144   -3.645  1.00 0.00 ? 24 GLN A HB3  5  
ATOM 9006  H HG2  . GLN A 1 20 ? 12.670  5.649   -1.809  1.00 0.00 ? 24 GLN A HG2  5  
ATOM 9007  H HG3  . GLN A 1 20 ? 12.759  5.774   -3.554  1.00 0.00 ? 24 GLN A HG3  5  
ATOM 9008  H HE21 . GLN A 1 20 ? 10.460  6.048   -4.578  1.00 0.00 ? 24 GLN A HE21 5  
ATOM 9009  H HE22 . GLN A 1 20 ? 9.494   7.320   -3.907  1.00 0.00 ? 24 GLN A HE22 5  
ATOM 9010  N N    . SER A 1 21 ? 8.716   2.690   -1.864  1.00 0.00 ? 25 SER A N    5  
ATOM 9011  C CA   . SER A 1 21 ? 7.266   2.649   -1.945  1.00 0.00 ? 25 SER A CA   5  
ATOM 9012  C C    . SER A 1 21 ? 6.754   1.282   -1.487  1.00 0.00 ? 25 SER A C    5  
ATOM 9013  O O    . SER A 1 21 ? 7.488   0.296   -1.524  1.00 0.00 ? 25 SER A O    5  
ATOM 9014  C CB   . SER A 1 21 ? 6.785   2.948   -3.366  1.00 0.00 ? 25 SER A CB   5  
ATOM 9015  O OG   . SER A 1 21 ? 7.819   3.501   -4.175  1.00 0.00 ? 25 SER A OG   5  
ATOM 9016  H H    . SER A 1 21 ? 9.173   1.816   -2.030  1.00 0.00 ? 25 SER A H    5  
ATOM 9017  H HA   . SER A 1 21 ? 6.918   3.433   -1.272  1.00 0.00 ? 25 SER A HA   5  
ATOM 9018  H HB2  . SER A 1 21 ? 6.418   2.029   -3.825  1.00 0.00 ? 25 SER A HB2  5  
ATOM 9019  H HB3  . SER A 1 21 ? 5.945   3.642   -3.326  1.00 0.00 ? 25 SER A HB3  5  
ATOM 9020  H HG   . SER A 1 21 ? 7.573   3.429   -5.141  1.00 0.00 ? 25 SER A HG   5  
ATOM 9021  N N    . VAL A 1 22 ? 5.498   1.267   -1.066  1.00 0.00 ? 26 VAL A N    5  
ATOM 9022  C CA   . VAL A 1 22 ? 4.879   0.037   -0.602  1.00 0.00 ? 26 VAL A CA   5  
ATOM 9023  C C    . VAL A 1 22 ? 3.561   -0.179  -1.347  1.00 0.00 ? 26 VAL A C    5  
ATOM 9024  O O    . VAL A 1 22 ? 2.780   0.756   -1.519  1.00 0.00 ? 26 VAL A O    5  
ATOM 9025  C CB   . VAL A 1 22 ? 4.707   0.079   0.918   1.00 0.00 ? 26 VAL A CB   5  
ATOM 9026  C CG1  . VAL A 1 22 ? 3.766   -1.030  1.394   1.00 0.00 ? 26 VAL A CG1  5  
ATOM 9027  C CG2  . VAL A 1 22 ? 6.060   -0.009  1.626   1.00 0.00 ? 26 VAL A CG2  5  
ATOM 9028  H H    . VAL A 1 22 ? 4.907   2.073   -1.039  1.00 0.00 ? 26 VAL A H    5  
ATOM 9029  H HA   . VAL A 1 22 ? 5.556   -0.783  -0.842  1.00 0.00 ? 26 VAL A HA   5  
ATOM 9030  H HB   . VAL A 1 22 ? 4.255   1.036   1.178   1.00 0.00 ? 26 VAL A HB   5  
ATOM 9031  H HG11 . VAL A 1 22 ? 2.970   -1.169  0.662   1.00 0.00 ? 26 VAL A HG11 5  
ATOM 9032  H HG12 . VAL A 1 22 ? 4.325   -1.959  1.504   1.00 0.00 ? 26 VAL A HG12 5  
ATOM 9033  H HG13 . VAL A 1 22 ? 3.332   -0.750  2.354   1.00 0.00 ? 26 VAL A HG13 5  
ATOM 9034  H HG21 . VAL A 1 22 ? 6.825   0.461   1.008   1.00 0.00 ? 26 VAL A HG21 5  
ATOM 9035  H HG22 . VAL A 1 22 ? 6.003   0.504   2.586   1.00 0.00 ? 26 VAL A HG22 5  
ATOM 9036  H HG23 . VAL A 1 22 ? 6.318   -1.056  1.789   1.00 0.00 ? 26 VAL A HG23 5  
ATOM 9037  N N    . LYS A 1 23 ? 3.352   -1.417  -1.770  1.00 0.00 ? 27 LYS A N    5  
ATOM 9038  C CA   . LYS A 1 23 ? 2.142   -1.767  -2.493  1.00 0.00 ? 27 LYS A CA   5  
ATOM 9039  C C    . LYS A 1 23 ? 1.547   -3.044  -1.895  1.00 0.00 ? 27 LYS A C    5  
ATOM 9040  O O    . LYS A 1 23 ? 2.230   -4.061  -1.790  1.00 0.00 ? 27 LYS A O    5  
ATOM 9041  C CB   . LYS A 1 23 ? 2.423   -1.864  -3.994  1.00 0.00 ? 27 LYS A CB   5  
ATOM 9042  C CG   . LYS A 1 23 ? 1.152   -1.613  -4.807  1.00 0.00 ? 27 LYS A CG   5  
ATOM 9043  C CD   . LYS A 1 23 ? 0.136   -2.738  -4.598  1.00 0.00 ? 27 LYS A CD   5  
ATOM 9044  C CE   . LYS A 1 23 ? -0.638  -3.024  -5.887  1.00 0.00 ? 27 LYS A CE   5  
ATOM 9045  N NZ   . LYS A 1 23 ? -0.091  -4.220  -6.566  1.00 0.00 ? 27 LYS A NZ   5  
ATOM 9046  H H    . LYS A 1 23 ? 3.992   -2.172  -1.626  1.00 0.00 ? 27 LYS A H    5  
ATOM 9047  H HA   . LYS A 1 23 ? 1.430   -0.955  -2.351  1.00 0.00 ? 27 LYS A HA   5  
ATOM 9048  H HB2  . LYS A 1 23 ? 3.187   -1.138  -4.272  1.00 0.00 ? 27 LYS A HB2  5  
ATOM 9049  H HB3  . LYS A 1 23 ? 2.821   -2.851  -4.230  1.00 0.00 ? 27 LYS A HB3  5  
ATOM 9050  H HG2  . LYS A 1 23 ? 0.710   -0.661  -4.514  1.00 0.00 ? 27 LYS A HG2  5  
ATOM 9051  H HG3  . LYS A 1 23 ? 1.402   -1.536  -5.865  1.00 0.00 ? 27 LYS A HG3  5  
ATOM 9052  H HD2  . LYS A 1 23 ? 0.651   -3.642  -4.271  1.00 0.00 ? 27 LYS A HD2  5  
ATOM 9053  H HD3  . LYS A 1 23 ? -0.559  -2.463  -3.806  1.00 0.00 ? 27 LYS A HD3  5  
ATOM 9054  H HE2  . LYS A 1 23 ? -1.692  -3.179  -5.658  1.00 0.00 ? 27 LYS A HE2  5  
ATOM 9055  H HE3  . LYS A 1 23 ? -0.580  -2.163  -6.552  1.00 0.00 ? 27 LYS A HE3  5  
ATOM 9056  H HZ1  . LYS A 1 23 ? 0.868   -4.341  -6.306  1.00 0.00 ? 27 LYS A HZ1  5  
ATOM 9057  H HZ2  . LYS A 1 23 ? -0.614  -5.027  -6.293  1.00 0.00 ? 27 LYS A HZ2  5  
ATOM 9058  H HZ3  . LYS A 1 23 ? -0.155  -4.100  -7.556  1.00 0.00 ? 27 LYS A HZ3  5  
ATOM 9059  N N    . VAL A 1 24 ? 0.280   -2.949  -1.519  1.00 0.00 ? 28 VAL A N    5  
ATOM 9060  C CA   . VAL A 1 24 ? -0.414  -4.083  -0.935  1.00 0.00 ? 28 VAL A CA   5  
ATOM 9061  C C    . VAL A 1 24 ? -1.522  -4.542  -1.885  1.00 0.00 ? 28 VAL A C    5  
ATOM 9062  O O    . VAL A 1 24 ? -2.373  -3.748  -2.282  1.00 0.00 ? 28 VAL A O    5  
ATOM 9063  C CB   . VAL A 1 24 ? -0.934  -3.718  0.457   1.00 0.00 ? 28 VAL A CB   5  
ATOM 9064  C CG1  . VAL A 1 24 ? -2.461  -3.616  0.463   1.00 0.00 ? 28 VAL A CG1  5  
ATOM 9065  C CG2  . VAL A 1 24 ? -0.447  -4.721  1.505   1.00 0.00 ? 28 VAL A CG2  5  
ATOM 9066  H H    . VAL A 1 24 ? -0.269  -2.117  -1.608  1.00 0.00 ? 28 VAL A H    5  
ATOM 9067  H HA   . VAL A 1 24 ? 0.310   -4.890  -0.823  1.00 0.00 ? 28 VAL A HA   5  
ATOM 9068  H HB   . VAL A 1 24 ? -0.532  -2.739  0.719   1.00 0.00 ? 28 VAL A HB   5  
ATOM 9069  H HG11 . VAL A 1 24 ? -2.782  -2.923  -0.314  1.00 0.00 ? 28 VAL A HG11 5  
ATOM 9070  H HG12 . VAL A 1 24 ? -2.891  -4.600  0.274   1.00 0.00 ? 28 VAL A HG12 5  
ATOM 9071  H HG13 . VAL A 1 24 ? -2.797  -3.254  1.435   1.00 0.00 ? 28 VAL A HG13 5  
ATOM 9072  H HG21 . VAL A 1 24 ? 0.445   -5.227  1.136   1.00 0.00 ? 28 VAL A HG21 5  
ATOM 9073  H HG22 . VAL A 1 24 ? -0.210  -4.195  2.430   1.00 0.00 ? 28 VAL A HG22 5  
ATOM 9074  H HG23 . VAL A 1 24 ? -1.229  -5.456  1.695   1.00 0.00 ? 28 VAL A HG23 5  
ATOM 9075  N N    . LYS A 1 25 ? -1.476  -5.823  -2.221  1.00 0.00 ? 29 LYS A N    5  
ATOM 9076  C CA   . LYS A 1 25 ? -2.465  -6.397  -3.117  1.00 0.00 ? 29 LYS A CA   5  
ATOM 9077  C C    . LYS A 1 25 ? -3.135  -7.591  -2.433  1.00 0.00 ? 29 LYS A C    5  
ATOM 9078  O O    . LYS A 1 25 ? -2.695  -8.728  -2.590  1.00 0.00 ? 29 LYS A O    5  
ATOM 9079  C CB   . LYS A 1 25 ? -1.831  -6.739  -4.467  1.00 0.00 ? 29 LYS A CB   5  
ATOM 9080  C CG   . LYS A 1 25 ? -2.851  -6.611  -5.600  1.00 0.00 ? 29 LYS A CG   5  
ATOM 9081  C CD   . LYS A 1 25 ? -3.656  -7.902  -5.762  1.00 0.00 ? 29 LYS A CD   5  
ATOM 9082  C CE   . LYS A 1 25 ? -3.550  -8.439  -7.190  1.00 0.00 ? 29 LYS A CE   5  
ATOM 9083  N NZ   . LYS A 1 25 ? -4.241  -9.743  -7.307  1.00 0.00 ? 29 LYS A NZ   5  
ATOM 9084  H H    . LYS A 1 25 ? -0.781  -6.463  -1.893  1.00 0.00 ? 29 LYS A H    5  
ATOM 9085  H HA   . LYS A 1 25 ? -3.222  -5.635  -3.301  1.00 0.00 ? 29 LYS A HA   5  
ATOM 9086  H HB2  . LYS A 1 25 ? -0.987  -6.076  -4.656  1.00 0.00 ? 29 LYS A HB2  5  
ATOM 9087  H HB3  . LYS A 1 25 ? -1.437  -7.755  -4.441  1.00 0.00 ? 29 LYS A HB3  5  
ATOM 9088  H HG2  . LYS A 1 25 ? -3.526  -5.780  -5.395  1.00 0.00 ? 29 LYS A HG2  5  
ATOM 9089  H HG3  . LYS A 1 25 ? -2.336  -6.380  -6.533  1.00 0.00 ? 29 LYS A HG3  5  
ATOM 9090  H HD2  . LYS A 1 25 ? -3.293  -8.652  -5.059  1.00 0.00 ? 29 LYS A HD2  5  
ATOM 9091  H HD3  . LYS A 1 25 ? -4.702  -7.716  -5.516  1.00 0.00 ? 29 LYS A HD3  5  
ATOM 9092  H HE2  . LYS A 1 25 ? -3.989  -7.725  -7.887  1.00 0.00 ? 29 LYS A HE2  5  
ATOM 9093  H HE3  . LYS A 1 25 ? -2.502  -8.551  -7.466  1.00 0.00 ? 29 LYS A HE3  5  
ATOM 9094  H HZ1  . LYS A 1 25 ? -4.072  -10.284 -6.483  1.00 0.00 ? 29 LYS A HZ1  5  
ATOM 9095  H HZ2  . LYS A 1 25 ? -5.224  -9.591  -7.409  1.00 0.00 ? 29 LYS A HZ2  5  
ATOM 9096  H HZ3  . LYS A 1 25 ? -3.895  -10.234 -8.106  1.00 0.00 ? 29 LYS A HZ3  5  
ATOM 9097  N N    . SER A 1 26 ? -4.189  -7.290  -1.688  1.00 0.00 ? 30 SER A N    5  
ATOM 9098  C CA   . SER A 1 26 ? -4.924  -8.323  -0.979  1.00 0.00 ? 30 SER A CA   5  
ATOM 9099  C C    . SER A 1 26 ? -5.354  -9.422  -1.954  1.00 0.00 ? 30 SER A C    5  
ATOM 9100  O O    . SER A 1 26 ? -5.151  -9.300  -3.161  1.00 0.00 ? 30 SER A O    5  
ATOM 9101  C CB   . SER A 1 26 ? -6.144  -7.740  -0.265  1.00 0.00 ? 30 SER A CB   5  
ATOM 9102  O OG   . SER A 1 26 ? -6.118  -7.999  1.136   1.00 0.00 ? 30 SER A OG   5  
ATOM 9103  H H    . SER A 1 26 ? -4.541  -6.362  -1.566  1.00 0.00 ? 30 SER A H    5  
ATOM 9104  H HA   . SER A 1 26 ? -4.226  -8.719  -0.241  1.00 0.00 ? 30 SER A HA   5  
ATOM 9105  H HB2  . SER A 1 26 ? -6.183  -6.663  -0.434  1.00 0.00 ? 30 SER A HB2  5  
ATOM 9106  H HB3  . SER A 1 26 ? -7.053  -8.162  -0.695  1.00 0.00 ? 30 SER A HB3  5  
ATOM 9107  H HG   . SER A 1 26 ? -5.173  -8.023  1.461   1.00 0.00 ? 30 SER A HG   5  
ATOM 9108  N N    . PRO A 1 27 ? -5.956  -10.497 -1.379  1.00 0.00 ? 31 PRO A N    5  
ATOM 9109  C CA   . PRO A 1 27 ? -6.417  -11.616 -2.183  1.00 0.00 ? 31 PRO A CA   5  
ATOM 9110  C C    . PRO A 1 27 ? -7.699  -11.258 -2.937  1.00 0.00 ? 31 PRO A C    5  
ATOM 9111  O O    . PRO A 1 27 ? -8.237  -10.165 -2.769  1.00 0.00 ? 31 PRO A O    5  
ATOM 9112  C CB   . PRO A 1 27 ? -6.606  -12.757 -1.198  1.00 0.00 ? 31 PRO A CB   5  
ATOM 9113  C CG   . PRO A 1 27 ? -6.693  -12.112 0.176   1.00 0.00 ? 31 PRO A CG   5  
ATOM 9114  C CD   . PRO A 1 27 ? -6.213  -10.676 0.047   1.00 0.00 ? 31 PRO A CD   5  
ATOM 9115  H HA   . PRO A 1 27 ? -5.741  -11.840 -2.885  1.00 0.00 ? 31 PRO A HA   5  
ATOM 9116  H HB2  . PRO A 1 27 ? -7.511  -13.321 -1.423  1.00 0.00 ? 31 PRO A HB2  5  
ATOM 9117  H HB3  . PRO A 1 27 ? -5.773  -13.459 -1.248  1.00 0.00 ? 31 PRO A HB3  5  
ATOM 9118  H HG2  . PRO A 1 27 ? -7.718  -12.141 0.547   1.00 0.00 ? 31 PRO A HG2  5  
ATOM 9119  H HG3  . PRO A 1 27 ? -6.079  -12.657 0.893   1.00 0.00 ? 31 PRO A HG3  5  
ATOM 9120  H HD2  . PRO A 1 27 ? -6.966  -9.973  0.405   1.00 0.00 ? 31 PRO A HD2  5  
ATOM 9121  H HD3  . PRO A 1 27 ? -5.312  -10.505 0.636   1.00 0.00 ? 31 PRO A HD3  5  
ATOM 9122  N N    . GLY A 1 28 ? -8.151  -12.200 -3.752  1.00 0.00 ? 32 GLY A N    5  
ATOM 9123  C CA   . GLY A 1 28 ? -9.360  -11.998 -4.532  1.00 0.00 ? 32 GLY A CA   5  
ATOM 9124  C C    . GLY A 1 28 ? -10.049 -13.330 -4.832  1.00 0.00 ? 32 GLY A C    5  
ATOM 9125  O O    . GLY A 1 28 ? -9.794  -14.330 -4.161  1.00 0.00 ? 32 GLY A O    5  
ATOM 9126  H H    . GLY A 1 28 ? -7.707  -13.086 -3.883  1.00 0.00 ? 32 GLY A H    5  
ATOM 9127  H HA2  . GLY A 1 28 ? -10.043 -11.345 -3.989  1.00 0.00 ? 32 GLY A HA2  5  
ATOM 9128  H HA3  . GLY A 1 28 ? -9.114  -11.493 -5.467  1.00 0.00 ? 32 GLY A HA3  5  
ATOM 9129  N N    . PRO A 1 29 ? -10.931 -13.302 -5.866  1.00 0.00 ? 33 PRO A N    5  
ATOM 9130  C CA   . PRO A 1 29 ? -11.659 -14.496 -6.262  1.00 0.00 ? 33 PRO A CA   5  
ATOM 9131  C C    . PRO A 1 29 ? -10.750 -15.466 -7.019  1.00 0.00 ? 33 PRO A C    5  
ATOM 9132  O O    . PRO A 1 29 ? -11.195 -16.526 -7.457  1.00 0.00 ? 33 PRO A O    5  
ATOM 9133  C CB   . PRO A 1 29 ? -12.818 -13.988 -7.104  1.00 0.00 ? 33 PRO A CB   5  
ATOM 9134  C CG   . PRO A 1 29 ? -12.437 -12.581 -7.534  1.00 0.00 ? 33 PRO A CG   5  
ATOM 9135  C CD   . PRO A 1 29 ? -11.259 -12.137 -6.683  1.00 0.00 ? 33 PRO A CD   5  
ATOM 9136  H HA   . PRO A 1 29 ? -11.977 -14.992 -5.455  1.00 0.00 ? 33 PRO A HA   5  
ATOM 9137  H HB2  . PRO A 1 29 ? -12.983 -14.630 -7.970  1.00 0.00 ? 33 PRO A HB2  5  
ATOM 9138  H HB3  . PRO A 1 29 ? -13.745 -13.984 -6.530  1.00 0.00 ? 33 PRO A HB3  5  
ATOM 9139  H HG2  . PRO A 1 29 ? -12.172 -12.563 -8.591  1.00 0.00 ? 33 PRO A HG2  5  
ATOM 9140  H HG3  . PRO A 1 29 ? -13.279 -11.901 -7.405  1.00 0.00 ? 33 PRO A HG3  5  
ATOM 9141  H HD2  . PRO A 1 29 ? -10.413 -11.837 -7.302  1.00 0.00 ? 33 PRO A HD2  5  
ATOM 9142  H HD3  . PRO A 1 29 ? -11.519 -11.279 -6.063  1.00 0.00 ? 33 PRO A HD3  5  
ATOM 9143  N N    . HIS A 1 30 ? -9.493  -15.068 -7.151  1.00 0.00 ? 34 HIS A N    5  
ATOM 9144  C CA   . HIS A 1 30 ? -8.517  -15.889 -7.848  1.00 0.00 ? 34 HIS A CA   5  
ATOM 9145  C C    . HIS A 1 30 ? -7.446  -16.361 -6.863  1.00 0.00 ? 34 HIS A C    5  
ATOM 9146  O O    . HIS A 1 30 ? -7.124  -17.547 -6.810  1.00 0.00 ? 34 HIS A O    5  
ATOM 9147  C CB   . HIS A 1 30 ? -7.932  -15.139 -9.046  1.00 0.00 ? 34 HIS A CB   5  
ATOM 9148  C CG   . HIS A 1 30 ? -7.805  -13.649 -8.835  1.00 0.00 ? 34 HIS A CG   5  
ATOM 9149  N ND1  . HIS A 1 30 ? -8.900  -12.819 -8.672  1.00 0.00 ? 34 HIS A ND1  5  
ATOM 9150  C CD2  . HIS A 1 30 ? -6.701  -12.851 -8.761  1.00 0.00 ? 34 HIS A CD2  5  
ATOM 9151  C CE1  . HIS A 1 30 ? -8.463  -11.578 -8.509  1.00 0.00 ? 34 HIS A CE1  5  
ATOM 9152  N NE2  . HIS A 1 30 ? -7.101  -11.600 -8.565  1.00 0.00 ? 34 HIS A NE2  5  
ATOM 9153  H H    . HIS A 1 30 ? -9.139  -14.204 -6.793  1.00 0.00 ? 34 HIS A H    5  
ATOM 9154  H HA   . HIS A 1 30 ? -9.055  -16.757 -8.230  1.00 0.00 ? 34 HIS A HA   5  
ATOM 9155  H HB2  . HIS A 1 30 ? -6.948  -15.549 -9.273  1.00 0.00 ? 34 HIS A HB2  5  
ATOM 9156  H HB3  . HIS A 1 30 ? -8.561  -15.320 -9.917  1.00 0.00 ? 34 HIS A HB3  5  
ATOM 9157  H HD1  . HIS A 1 30 ? -9.858  -13.106 -8.676  1.00 0.00 ? 34 HIS A HD1  5  
ATOM 9158  H HD2  . HIS A 1 30 ? -5.667  -13.183 -8.848  1.00 0.00 ? 34 HIS A HD2  5  
ATOM 9159  H HE1  . HIS A 1 30 ? -9.084  -10.695 -8.357  1.00 0.00 ? 34 HIS A HE1  5  
ATOM 9160  N N    . CYS A 1 31 ? -6.923  -15.407 -6.106  1.00 0.00 ? 35 CYS A N    5  
ATOM 9161  C CA   . CYS A 1 31 ? -5.895  -15.710 -5.125  1.00 0.00 ? 35 CYS A CA   5  
ATOM 9162  C C    . CYS A 1 31 ? -6.469  -15.450 -3.731  1.00 0.00 ? 35 CYS A C    5  
ATOM 9163  O O    . CYS A 1 31 ? -6.941  -14.350 -3.445  1.00 0.00 ? 35 CYS A O    5  
ATOM 9164  C CB   . CYS A 1 31 ? -4.619  -14.904 -5.376  1.00 0.00 ? 35 CYS A CB   5  
ATOM 9165  S SG   . CYS A 1 31 ? -3.066  -15.864 -5.244  1.00 0.00 ? 35 CYS A SG   5  
ATOM 9166  H H    . CYS A 1 31 ? -7.190  -14.445 -6.155  1.00 0.00 ? 35 CYS A H    5  
ATOM 9167  H HA   . CYS A 1 31 ? -5.643  -16.763 -5.250  1.00 0.00 ? 35 CYS A HA   5  
ATOM 9168  H HB2  . CYS A 1 31 ? -4.674  -14.464 -6.372  1.00 0.00 ? 35 CYS A HB2  5  
ATOM 9169  H HB3  . CYS A 1 31 ? -4.581  -14.079 -4.665  1.00 0.00 ? 35 CYS A HB3  5  
ATOM 9170  N N    . ALA A 1 32 ? -6.409  -16.479 -2.900  1.00 0.00 ? 36 ALA A N    5  
ATOM 9171  C CA   . ALA A 1 32 ? -6.917  -16.376 -1.542  1.00 0.00 ? 36 ALA A CA   5  
ATOM 9172  C C    . ALA A 1 32 ? -5.757  -16.084 -0.589  1.00 0.00 ? 36 ALA A C    5  
ATOM 9173  O O    . ALA A 1 32 ? -5.834  -16.390 0.600   1.00 0.00 ? 36 ALA A O    5  
ATOM 9174  C CB   . ALA A 1 32 ? -7.663  -17.661 -1.177  1.00 0.00 ? 36 ALA A CB   5  
ATOM 9175  H H    . ALA A 1 32 ? -6.024  -17.370 -3.140  1.00 0.00 ? 36 ALA A H    5  
ATOM 9176  H HA   . ALA A 1 32 ? -7.619  -15.543 -1.513  1.00 0.00 ? 36 ALA A HA   5  
ATOM 9177  H HB1  . ALA A 1 32 ? -6.947  -18.418 -0.855  1.00 0.00 ? 36 ALA A HB1  5  
ATOM 9178  H HB2  . ALA A 1 32 ? -8.209  -18.025 -2.047  1.00 0.00 ? 36 ALA A HB2  5  
ATOM 9179  H HB3  . ALA A 1 32 ? -8.364  -17.457 -0.367  1.00 0.00 ? 36 ALA A HB3  5  
ATOM 9180  N N    . GLN A 1 33 ? -4.710  -15.494 -1.146  1.00 0.00 ? 37 GLN A N    5  
ATOM 9181  C CA   . GLN A 1 33 ? -3.535  -15.157 -0.360  1.00 0.00 ? 37 GLN A CA   5  
ATOM 9182  C C    . GLN A 1 33 ? -3.161  -13.688 -0.568  1.00 0.00 ? 37 GLN A C    5  
ATOM 9183  O O    . GLN A 1 33 ? -3.596  -13.064 -1.534  1.00 0.00 ? 37 GLN A O    5  
ATOM 9184  C CB   . GLN A 1 33 ? -2.362  -16.076 -0.706  1.00 0.00 ? 37 GLN A CB   5  
ATOM 9185  C CG   . GLN A 1 33 ? -2.786  -17.546 -0.667  1.00 0.00 ? 37 GLN A CG   5  
ATOM 9186  C CD   . GLN A 1 33 ? -2.375  -18.200 0.654   1.00 0.00 ? 37 GLN A CD   5  
ATOM 9187  O OE1  . GLN A 1 33 ? -1.258  -18.061 1.125   1.00 0.00 ? 37 GLN A OE1  5  
ATOM 9188  N NE2  . GLN A 1 33 ? -3.338  -18.920 1.224   1.00 0.00 ? 37 GLN A NE2  5  
ATOM 9189  H H    . GLN A 1 33 ? -4.655  -15.248 -2.114  1.00 0.00 ? 37 GLN A H    5  
ATOM 9190  H HA   . GLN A 1 33 ? -3.824  -15.322 0.678   1.00 0.00 ? 37 GLN A HA   5  
ATOM 9191  H HB2  . GLN A 1 33 ? -1.982  -15.830 -1.697  1.00 0.00 ? 37 GLN A HB2  5  
ATOM 9192  H HB3  . GLN A 1 33 ? -1.546  -15.911 -0.002  1.00 0.00 ? 37 GLN A HB3  5  
ATOM 9193  H HG2  . GLN A 1 33 ? -3.866  -17.619 -0.793  1.00 0.00 ? 37 GLN A HG2  5  
ATOM 9194  H HG3  . GLN A 1 33 ? -2.331  -18.082 -1.499  1.00 0.00 ? 37 GLN A HG3  5  
ATOM 9195  H HE21 . GLN A 1 33 ? -4.233  -18.993 0.785   1.00 0.00 ? 37 GLN A HE21 5  
ATOM 9196  H HE22 . GLN A 1 33 ? -3.166  -19.387 2.091   1.00 0.00 ? 37 GLN A HE22 5  
ATOM 9197  N N    . THR A 1 34 ? -2.358  -13.179 0.355   1.00 0.00 ? 38 THR A N    5  
ATOM 9198  C CA   . THR A 1 34 ? -1.920  -11.795 0.285   1.00 0.00 ? 38 THR A CA   5  
ATOM 9199  C C    . THR A 1 34 ? -0.614  -11.688 -0.505  1.00 0.00 ? 38 THR A C    5  
ATOM 9200  O O    . THR A 1 34 ? -0.017  -12.702 -0.863  1.00 0.00 ? 38 THR A O    5  
ATOM 9201  C CB   . THR A 1 34 ? -1.811  -11.261 1.714   1.00 0.00 ? 38 THR A CB   5  
ATOM 9202  O OG1  . THR A 1 34 ? -3.065  -11.590 2.305   1.00 0.00 ? 38 THR A OG1  5  
ATOM 9203  C CG2  . THR A 1 34 ? -1.764  -9.732  1.766   1.00 0.00 ? 38 THR A CG2  5  
ATOM 9204  H H    . THR A 1 34 ? -2.009  -13.693 1.138   1.00 0.00 ? 38 THR A H    5  
ATOM 9205  H HA   . THR A 1 34 ? -2.672  -11.224 -0.260  1.00 0.00 ? 38 THR A HA   5  
ATOM 9206  H HB   . THR A 1 34 ? -0.952  -11.694 2.227   1.00 0.00 ? 38 THR A HB   5  
ATOM 9207  H HG1  . THR A 1 34 ? -3.809  -11.170 1.785   1.00 0.00 ? 38 THR A HG1  5  
ATOM 9208  H HG21 . THR A 1 34 ? -2.199  -9.324  0.854   1.00 0.00 ? 38 THR A HG21 5  
ATOM 9209  H HG22 . THR A 1 34 ? -2.332  -9.381  2.628   1.00 0.00 ? 38 THR A HG22 5  
ATOM 9210  H HG23 . THR A 1 34 ? -0.729  -9.403  1.854   1.00 0.00 ? 38 THR A HG23 5  
ATOM 9211  N N    . GLU A 1 35 ? -0.210  -10.451 -0.754  1.00 0.00 ? 39 GLU A N    5  
ATOM 9212  C CA   . GLU A 1 35 ? 1.014   -10.198 -1.495  1.00 0.00 ? 39 GLU A CA   5  
ATOM 9213  C C    . GLU A 1 35 ? 1.392   -8.719  -1.407  1.00 0.00 ? 39 GLU A C    5  
ATOM 9214  O O    . GLU A 1 35 ? 0.681   -7.860  -1.927  1.00 0.00 ? 39 GLU A O    5  
ATOM 9215  C CB   . GLU A 1 35 ? 0.873   -10.642 -2.953  1.00 0.00 ? 39 GLU A CB   5  
ATOM 9216  C CG   . GLU A 1 35 ? 0.218   -9.549  -3.798  1.00 0.00 ? 39 GLU A CG   5  
ATOM 9217  C CD   . GLU A 1 35 ? -0.303  -10.116 -5.121  1.00 0.00 ? 39 GLU A CD   5  
ATOM 9218  O OE1  . GLU A 1 35 ? -0.619  -11.325 -5.134  1.00 0.00 ? 39 GLU A OE1  5  
ATOM 9219  O OE2  . GLU A 1 35 ? -0.373  -9.327  -6.088  1.00 0.00 ? 39 GLU A OE2  5  
ATOM 9220  H H    . GLU A 1 35 ? -0.703  -9.632  -0.459  1.00 0.00 ? 39 GLU A H    5  
ATOM 9221  H HA   . GLU A 1 35 ? 1.777   -10.805 -1.009  1.00 0.00 ? 39 GLU A HA   5  
ATOM 9222  H HB2  . GLU A 1 35 ? 1.856   -10.882 -3.360  1.00 0.00 ? 39 GLU A HB2  5  
ATOM 9223  H HB3  . GLU A 1 35 ? 0.277   -11.553 -3.004  1.00 0.00 ? 39 GLU A HB3  5  
ATOM 9224  H HG2  . GLU A 1 35 ? -0.605  -9.099  -3.243  1.00 0.00 ? 39 GLU A HG2  5  
ATOM 9225  H HG3  . GLU A 1 35 ? 0.939   -8.756  -3.997  1.00 0.00 ? 39 GLU A HG3  5  
ATOM 9226  N N    . VAL A 1 36 ? 2.511   -8.465  -0.744  1.00 0.00 ? 40 VAL A N    5  
ATOM 9227  C CA   . VAL A 1 36 ? 2.992   -7.104  -0.581  1.00 0.00 ? 40 VAL A CA   5  
ATOM 9228  C C    . VAL A 1 36 ? 4.146   -6.855  -1.554  1.00 0.00 ? 40 VAL A C    5  
ATOM 9229  O O    . VAL A 1 36 ? 5.106   -7.624  -1.594  1.00 0.00 ? 40 VAL A O    5  
ATOM 9230  C CB   . VAL A 1 36 ? 3.378   -6.857  0.879   1.00 0.00 ? 40 VAL A CB   5  
ATOM 9231  C CG1  . VAL A 1 36 ? 3.871   -5.423  1.081   1.00 0.00 ? 40 VAL A CG1  5  
ATOM 9232  C CG2  . VAL A 1 36 ? 2.211   -7.173  1.816   1.00 0.00 ? 40 VAL A CG2  5  
ATOM 9233  H H    . VAL A 1 36 ? 3.084   -9.169  -0.324  1.00 0.00 ? 40 VAL A H    5  
ATOM 9234  H HA   . VAL A 1 36 ? 2.171   -6.433  -0.831  1.00 0.00 ? 40 VAL A HA   5  
ATOM 9235  H HB   . VAL A 1 36 ? 4.199   -7.531  1.127   1.00 0.00 ? 40 VAL A HB   5  
ATOM 9236  H HG11 . VAL A 1 36 ? 3.081   -4.725  0.804   1.00 0.00 ? 40 VAL A HG11 5  
ATOM 9237  H HG12 . VAL A 1 36 ? 4.137   -5.274  2.128   1.00 0.00 ? 40 VAL A HG12 5  
ATOM 9238  H HG13 . VAL A 1 36 ? 4.746   -5.248  0.455   1.00 0.00 ? 40 VAL A HG13 5  
ATOM 9239  H HG21 . VAL A 1 36 ? 1.369   -7.549  1.234   1.00 0.00 ? 40 VAL A HG21 5  
ATOM 9240  H HG22 . VAL A 1 36 ? 2.519   -7.929  2.539   1.00 0.00 ? 40 VAL A HG22 5  
ATOM 9241  H HG23 . VAL A 1 36 ? 1.912   -6.267  2.343   1.00 0.00 ? 40 VAL A HG23 5  
ATOM 9242  N N    . ILE A 1 37 ? 4.014   -5.779  -2.316  1.00 0.00 ? 41 ILE A N    5  
ATOM 9243  C CA   . ILE A 1 37 ? 5.033   -5.420  -3.287  1.00 0.00 ? 41 ILE A CA   5  
ATOM 9244  C C    . ILE A 1 37 ? 5.524   -3.999  -3.002  1.00 0.00 ? 41 ILE A C    5  
ATOM 9245  O O    . ILE A 1 37 ? 4.800   -3.031  -3.227  1.00 0.00 ? 41 ILE A O    5  
ATOM 9246  C CB   . ILE A 1 37 ? 4.509   -5.615  -4.711  1.00 0.00 ? 41 ILE A CB   5  
ATOM 9247  C CG1  . ILE A 1 37 ? 3.752   -6.938  -4.840  1.00 0.00 ? 41 ILE A CG1  5  
ATOM 9248  C CG2  . ILE A 1 37 ? 5.643   -5.502  -5.733  1.00 0.00 ? 41 ILE A CG2  5  
ATOM 9249  C CD1  . ILE A 1 37 ? 2.307   -6.702  -5.284  1.00 0.00 ? 41 ILE A CD1  5  
ATOM 9250  H H    . ILE A 1 37 ? 3.230   -5.160  -2.277  1.00 0.00 ? 41 ILE A H    5  
ATOM 9251  H HA   . ILE A 1 37 ? 5.868   -6.108  -3.154  1.00 0.00 ? 41 ILE A HA   5  
ATOM 9252  H HB   . ILE A 1 37 ? 3.801   -4.816  -4.927  1.00 0.00 ? 41 ILE A HB   5  
ATOM 9253  H HG12 . ILE A 1 37 ? 4.256   -7.582  -5.561  1.00 0.00 ? 41 ILE A HG12 5  
ATOM 9254  H HG13 . ILE A 1 37 ? 3.761   -7.462  -3.884  1.00 0.00 ? 41 ILE A HG13 5  
ATOM 9255  H HG21 . ILE A 1 37 ? 6.570   -5.864  -5.288  1.00 0.00 ? 41 ILE A HG21 5  
ATOM 9256  H HG22 . ILE A 1 37 ? 5.402   -6.101  -6.610  1.00 0.00 ? 41 ILE A HG22 5  
ATOM 9257  H HG23 . ILE A 1 37 ? 5.764   -4.459  -6.027  1.00 0.00 ? 41 ILE A HG23 5  
ATOM 9258  H HD11 . ILE A 1 37 ? 2.300   -6.101  -6.193  1.00 0.00 ? 41 ILE A HD11 5  
ATOM 9259  H HD12 . ILE A 1 37 ? 1.824   -7.660  -5.477  1.00 0.00 ? 41 ILE A HD12 5  
ATOM 9260  H HD13 . ILE A 1 37 ? 1.767   -6.175  -4.497  1.00 0.00 ? 41 ILE A HD13 5  
ATOM 9261  N N    . ALA A 1 38 ? 6.752   -3.919  -2.510  1.00 0.00 ? 42 ALA A N    5  
ATOM 9262  C CA   . ALA A 1 38 ? 7.349   -2.633  -2.192  1.00 0.00 ? 42 ALA A CA   5  
ATOM 9263  C C    . ALA A 1 38 ? 8.339   -2.249  -3.294  1.00 0.00 ? 42 ALA A C    5  
ATOM 9264  O O    . ALA A 1 38 ? 9.103   -3.088  -3.767  1.00 0.00 ? 42 ALA A O    5  
ATOM 9265  C CB   . ALA A 1 38 ? 8.009   -2.704  -0.814  1.00 0.00 ? 42 ALA A CB   5  
ATOM 9266  H H    . ALA A 1 38 ? 7.335   -4.712  -2.330  1.00 0.00 ? 42 ALA A H    5  
ATOM 9267  H HA   . ALA A 1 38 ? 6.548   -1.895  -2.160  1.00 0.00 ? 42 ALA A HA   5  
ATOM 9268  H HB1  . ALA A 1 38 ? 8.120   -1.696  -0.412  1.00 0.00 ? 42 ALA A HB1  5  
ATOM 9269  H HB2  . ALA A 1 38 ? 7.387   -3.296  -0.143  1.00 0.00 ? 42 ALA A HB2  5  
ATOM 9270  H HB3  . ALA A 1 38 ? 8.991   -3.169  -0.904  1.00 0.00 ? 42 ALA A HB3  5  
ATOM 9271  N N    . THR A 1 39 ? 8.292   -0.979  -3.669  1.00 0.00 ? 43 THR A N    5  
ATOM 9272  C CA   . THR A 1 39 ? 9.176   -0.472  -4.706  1.00 0.00 ? 43 THR A CA   5  
ATOM 9273  C C    . THR A 1 39 ? 10.513  -0.039  -4.103  1.00 0.00 ? 43 THR A C    5  
ATOM 9274  O O    . THR A 1 39 ? 10.545  0.615   -3.061  1.00 0.00 ? 43 THR A O    5  
ATOM 9275  C CB   . THR A 1 39 ? 8.446   0.654   -5.440  1.00 0.00 ? 43 THR A CB   5  
ATOM 9276  O OG1  . THR A 1 39 ? 7.421   -0.013  -6.171  1.00 0.00 ? 43 THR A OG1  5  
ATOM 9277  C CG2  . THR A 1 39 ? 9.311   1.306   -6.521  1.00 0.00 ? 43 THR A CG2  5  
ATOM 9278  H H    . THR A 1 39 ? 7.668   -0.302  -3.279  1.00 0.00 ? 43 THR A H    5  
ATOM 9279  H HA   . THR A 1 39 ? 9.387   -1.283  -5.403  1.00 0.00 ? 43 THR A HA   5  
ATOM 9280  H HB   . THR A 1 39 ? 8.074   1.400   -4.737  1.00 0.00 ? 43 THR A HB   5  
ATOM 9281  H HG1  . THR A 1 39 ? 6.915   0.644   -6.728  1.00 0.00 ? 43 THR A HG1  5  
ATOM 9282  H HG21 . THR A 1 39 ? 9.802   0.531   -7.109  1.00 0.00 ? 43 THR A HG21 5  
ATOM 9283  H HG22 . THR A 1 39 ? 8.683   1.914   -7.172  1.00 0.00 ? 43 THR A HG22 5  
ATOM 9284  H HG23 . THR A 1 39 ? 10.065  1.937   -6.051  1.00 0.00 ? 43 THR A HG23 5  
ATOM 9285  N N    . LEU A 1 40 ? 11.584  -0.420  -4.783  1.00 0.00 ? 44 LEU A N    5  
ATOM 9286  C CA   . LEU A 1 40 ? 12.921  -0.079  -4.327  1.00 0.00 ? 44 LEU A CA   5  
ATOM 9287  C C    . LEU A 1 40 ? 13.259  1.345   -4.772  1.00 0.00 ? 44 LEU A C    5  
ATOM 9288  O O    . LEU A 1 40 ? 12.783  1.804   -5.810  1.00 0.00 ? 44 LEU A O    5  
ATOM 9289  C CB   . LEU A 1 40 ? 13.931  -1.127  -4.798  1.00 0.00 ? 44 LEU A CB   5  
ATOM 9290  C CG   . LEU A 1 40 ? 14.892  -1.659  -3.732  1.00 0.00 ? 44 LEU A CG   5  
ATOM 9291  C CD1  . LEU A 1 40 ? 15.492  -3.001  -4.156  1.00 0.00 ? 44 LEU A CD1  5  
ATOM 9292  C CD2  . LEU A 1 40 ? 15.971  -0.626  -3.402  1.00 0.00 ? 44 LEU A CD2  5  
ATOM 9293  H H    . LEU A 1 40 ? 11.549  -0.952  -5.629  1.00 0.00 ? 44 LEU A H    5  
ATOM 9294  H HA   . LEU A 1 40 ? 12.911  -0.107  -3.237  1.00 0.00 ? 44 LEU A HA   5  
ATOM 9295  H HB2  . LEU A 1 40 ? 13.382  -1.970  -5.217  1.00 0.00 ? 44 LEU A HB2  5  
ATOM 9296  H HB3  . LEU A 1 40 ? 14.521  -0.696  -5.607  1.00 0.00 ? 44 LEU A HB3  5  
ATOM 9297  H HG   . LEU A 1 40 ? 14.324  -1.835  -2.818  1.00 0.00 ? 44 LEU A HG   5  
ATOM 9298  H HD11 . LEU A 1 40 ? 15.032  -3.326  -5.089  1.00 0.00 ? 44 LEU A HD11 5  
ATOM 9299  H HD12 . LEU A 1 40 ? 16.567  -2.888  -4.301  1.00 0.00 ? 44 LEU A HD12 5  
ATOM 9300  H HD13 . LEU A 1 40 ? 15.306  -3.743  -3.381  1.00 0.00 ? 44 LEU A HD13 5  
ATOM 9301  H HD21 . LEU A 1 40 ? 15.697  0.336   -3.834  1.00 0.00 ? 44 LEU A HD21 5  
ATOM 9302  H HD22 . LEU A 1 40 ? 16.061  -0.527  -2.321  1.00 0.00 ? 44 LEU A HD22 5  
ATOM 9303  H HD23 . LEU A 1 40 ? 16.925  -0.952  -3.818  1.00 0.00 ? 44 LEU A HD23 5  
ATOM 9304  N N    . LYS A 1 41 ? 14.078  2.005   -3.966  1.00 0.00 ? 45 LYS A N    5  
ATOM 9305  C CA   . LYS A 1 41 ? 14.485  3.367   -4.264  1.00 0.00 ? 45 LYS A CA   5  
ATOM 9306  C C    . LYS A 1 41 ? 15.502  3.352   -5.407  1.00 0.00 ? 45 LYS A C    5  
ATOM 9307  O O    . LYS A 1 41 ? 15.949  4.406   -5.859  1.00 0.00 ? 45 LYS A O    5  
ATOM 9308  C CB   . LYS A 1 41 ? 14.990  4.064   -2.999  1.00 0.00 ? 45 LYS A CB   5  
ATOM 9309  C CG   . LYS A 1 41 ? 15.265  5.546   -3.263  1.00 0.00 ? 45 LYS A CG   5  
ATOM 9310  C CD   . LYS A 1 41 ? 16.752  5.790   -3.525  1.00 0.00 ? 45 LYS A CD   5  
ATOM 9311  C CE   . LYS A 1 41 ? 17.311  6.847   -2.571  1.00 0.00 ? 45 LYS A CE   5  
ATOM 9312  N NZ   . LYS A 1 41 ? 17.948  7.946   -3.331  1.00 0.00 ? 45 LYS A NZ   5  
ATOM 9313  H H    . LYS A 1 41 ? 14.460  1.624   -3.124  1.00 0.00 ? 45 LYS A H    5  
ATOM 9314  H HA   . LYS A 1 41 ? 13.599  3.907   -4.598  1.00 0.00 ? 45 LYS A HA   5  
ATOM 9315  H HB2  . LYS A 1 41 ? 14.252  3.963   -2.204  1.00 0.00 ? 45 LYS A HB2  5  
ATOM 9316  H HB3  . LYS A 1 41 ? 15.902  3.578   -2.651  1.00 0.00 ? 45 LYS A HB3  5  
ATOM 9317  H HG2  . LYS A 1 41 ? 14.681  5.881   -4.120  1.00 0.00 ? 45 LYS A HG2  5  
ATOM 9318  H HG3  . LYS A 1 41 ? 14.941  6.137   -2.406  1.00 0.00 ? 45 LYS A HG3  5  
ATOM 9319  H HD2  . LYS A 1 41 ? 17.304  4.858   -3.405  1.00 0.00 ? 45 LYS A HD2  5  
ATOM 9320  H HD3  . LYS A 1 41 ? 16.895  6.114   -4.556  1.00 0.00 ? 45 LYS A HD3  5  
ATOM 9321  H HE2  . LYS A 1 41 ? 16.509  7.245   -1.949  1.00 0.00 ? 45 LYS A HE2  5  
ATOM 9322  H HE3  . LYS A 1 41 ? 18.039  6.391   -1.900  1.00 0.00 ? 45 LYS A HE3  5  
ATOM 9323  H HZ1  . LYS A 1 41 ? 17.313  8.283   -4.026  1.00 0.00 ? 45 LYS A HZ1  5  
ATOM 9324  H HZ2  . LYS A 1 41 ? 18.184  8.690   -2.706  1.00 0.00 ? 45 LYS A HZ2  5  
ATOM 9325  H HZ3  . LYS A 1 41 ? 18.778  7.607   -3.774  1.00 0.00 ? 45 LYS A HZ3  5  
ATOM 9326  N N    . ASN A 1 42 ? 15.839  2.147   -5.841  1.00 0.00 ? 46 ASN A N    5  
ATOM 9327  C CA   . ASN A 1 42 ? 16.796  1.981   -6.922  1.00 0.00 ? 46 ASN A CA   5  
ATOM 9328  C C    . ASN A 1 42 ? 16.043  1.707   -8.225  1.00 0.00 ? 46 ASN A C    5  
ATOM 9329  O O    . ASN A 1 42 ? 16.642  1.692   -9.300  1.00 0.00 ? 46 ASN A O    5  
ATOM 9330  C CB   . ASN A 1 42 ? 17.728  0.797   -6.656  1.00 0.00 ? 46 ASN A CB   5  
ATOM 9331  C CG   . ASN A 1 42 ? 17.996  0.011   -7.942  1.00 0.00 ? 46 ASN A CG   5  
ATOM 9332  O OD1  . ASN A 1 42 ? 18.607  0.497   -8.880  1.00 0.00 ? 46 ASN A OD1  5  
ATOM 9333  N ND2  . ASN A 1 42 ? 17.508  -1.225  -7.932  1.00 0.00 ? 46 ASN A ND2  5  
ATOM 9334  H H    . ASN A 1 42 ? 15.472  1.295   -5.467  1.00 0.00 ? 46 ASN A H    5  
ATOM 9335  H HA   . ASN A 1 42 ? 17.358  2.914   -6.952  1.00 0.00 ? 46 ASN A HA   5  
ATOM 9336  H HB2  . ASN A 1 42 ? 18.669  1.156   -6.241  1.00 0.00 ? 46 ASN A HB2  5  
ATOM 9337  H HB3  . ASN A 1 42 ? 17.281  0.139   -5.910  1.00 0.00 ? 46 ASN A HB3  5  
ATOM 9338  H HD21 . ASN A 1 42 ? 17.016  -1.563  -7.129  1.00 0.00 ? 46 ASN A HD21 5  
ATOM 9339  H HD22 . ASN A 1 42 ? 17.632  -1.818  -8.728  1.00 0.00 ? 46 ASN A HD22 5  
ATOM 9340  N N    . GLY A 1 43 ? 14.742  1.499   -8.088  1.00 0.00 ? 47 GLY A N    5  
ATOM 9341  C CA   . GLY A 1 43 ? 13.902  1.227   -9.241  1.00 0.00 ? 47 GLY A CA   5  
ATOM 9342  C C    . GLY A 1 43 ? 13.472  -0.241  -9.273  1.00 0.00 ? 47 GLY A C    5  
ATOM 9343  O O    . GLY A 1 43 ? 12.738  -0.658  -10.167 1.00 0.00 ? 47 GLY A O    5  
ATOM 9344  H H    . GLY A 1 43 ? 14.263  1.513   -7.210  1.00 0.00 ? 47 GLY A H    5  
ATOM 9345  H HA2  . GLY A 1 43 ? 13.020  1.867   -9.212  1.00 0.00 ? 47 GLY A HA2  5  
ATOM 9346  H HA3  . GLY A 1 43 ? 14.443  1.471   -10.156 1.00 0.00 ? 47 GLY A HA3  5  
ATOM 9347  N N    . GLN A 1 44 ? 13.949  -0.986  -8.286  1.00 0.00 ? 48 GLN A N    5  
ATOM 9348  C CA   . GLN A 1 44 ? 13.624  -2.398  -8.189  1.00 0.00 ? 48 GLN A CA   5  
ATOM 9349  C C    . GLN A 1 44 ? 12.379  -2.598  -7.324  1.00 0.00 ? 48 GLN A C    5  
ATOM 9350  O O    . GLN A 1 44 ? 11.719  -1.631  -6.946  1.00 0.00 ? 48 GLN A O    5  
ATOM 9351  C CB   . GLN A 1 44 ? 14.808  -3.197  -7.640  1.00 0.00 ? 48 GLN A CB   5  
ATOM 9352  C CG   . GLN A 1 44 ? 15.713  -3.685  -8.773  1.00 0.00 ? 48 GLN A CG   5  
ATOM 9353  C CD   . GLN A 1 44 ? 16.904  -4.472  -8.223  1.00 0.00 ? 48 GLN A CD   5  
ATOM 9354  O OE1  . GLN A 1 44 ? 17.191  -4.466  -7.037  1.00 0.00 ? 48 GLN A OE1  5  
ATOM 9355  N NE2  . GLN A 1 44 ? 17.579  -5.149  -9.148  1.00 0.00 ? 48 GLN A NE2  5  
ATOM 9356  H H    . GLN A 1 44 ? 14.547  -0.639  -7.562  1.00 0.00 ? 48 GLN A H    5  
ATOM 9357  H HA   . GLN A 1 44 ? 13.420  -2.719  -9.211  1.00 0.00 ? 48 GLN A HA   5  
ATOM 9358  H HB2  . GLN A 1 44 ? 15.382  -2.577  -6.952  1.00 0.00 ? 48 GLN A HB2  5  
ATOM 9359  H HB3  . GLN A 1 44 ? 14.442  -4.051  -7.070  1.00 0.00 ? 48 GLN A HB3  5  
ATOM 9360  H HG2  . GLN A 1 44 ? 15.141  -4.313  -9.456  1.00 0.00 ? 48 GLN A HG2  5  
ATOM 9361  H HG3  . GLN A 1 44 ? 16.072  -2.831  -9.349  1.00 0.00 ? 48 GLN A HG3  5  
ATOM 9362  H HE21 . GLN A 1 44 ? 17.290  -5.111  -10.105 1.00 0.00 ? 48 GLN A HE21 5  
ATOM 9363  H HE22 . GLN A 1 44 ? 18.375  -5.695  -8.887  1.00 0.00 ? 48 GLN A HE22 5  
ATOM 9364  N N    . LYS A 1 45 ? 12.095  -3.860  -7.034  1.00 0.00 ? 49 LYS A N    5  
ATOM 9365  C CA   . LYS A 1 45 ? 10.940  -4.199  -6.220  1.00 0.00 ? 49 LYS A CA   5  
ATOM 9366  C C    . LYS A 1 45 ? 11.281  -5.399  -5.333  1.00 0.00 ? 49 LYS A C    5  
ATOM 9367  O O    . LYS A 1 45 ? 12.022  -6.289  -5.746  1.00 0.00 ? 49 LYS A O    5  
ATOM 9368  C CB   . LYS A 1 45 ? 9.708   -4.416  -7.101  1.00 0.00 ? 49 LYS A CB   5  
ATOM 9369  C CG   . LYS A 1 45 ? 9.451   -3.199  -7.992  1.00 0.00 ? 49 LYS A CG   5  
ATOM 9370  C CD   . LYS A 1 45 ? 8.296   -3.464  -8.960  1.00 0.00 ? 49 LYS A CD   5  
ATOM 9371  C CE   . LYS A 1 45 ? 8.698   -3.130  -10.398 1.00 0.00 ? 49 LYS A CE   5  
ATOM 9372  N NZ   . LYS A 1 45 ? 7.526   -3.212  -11.297 1.00 0.00 ? 49 LYS A NZ   5  
ATOM 9373  H H    . LYS A 1 45 ? 12.636  -4.641  -7.345  1.00 0.00 ? 49 LYS A H    5  
ATOM 9374  H HA   . LYS A 1 45 ? 10.731  -3.344  -5.578  1.00 0.00 ? 49 LYS A HA   5  
ATOM 9375  H HB2  . LYS A 1 45 ? 9.850   -5.302  -7.720  1.00 0.00 ? 49 LYS A HB2  5  
ATOM 9376  H HB3  . LYS A 1 45 ? 8.836   -4.603  -6.474  1.00 0.00 ? 49 LYS A HB3  5  
ATOM 9377  H HG2  . LYS A 1 45 ? 9.220   -2.333  -7.373  1.00 0.00 ? 49 LYS A HG2  5  
ATOM 9378  H HG3  . LYS A 1 45 ? 10.353  -2.958  -8.554  1.00 0.00 ? 49 LYS A HG3  5  
ATOM 9379  H HD2  . LYS A 1 45 ? 7.995   -4.509  -8.897  1.00 0.00 ? 49 LYS A HD2  5  
ATOM 9380  H HD3  . LYS A 1 45 ? 7.431   -2.865  -8.673  1.00 0.00 ? 49 LYS A HD3  5  
ATOM 9381  H HE2  . LYS A 1 45 ? 9.126   -2.128  -10.439 1.00 0.00 ? 49 LYS A HE2  5  
ATOM 9382  H HE3  . LYS A 1 45 ? 9.472   -3.821  -10.735 1.00 0.00 ? 49 LYS A HE3  5  
ATOM 9383  H HZ1  . LYS A 1 45 ? 6.734   -3.542  -10.783 1.00 0.00 ? 49 LYS A HZ1  5  
ATOM 9384  H HZ2  . LYS A 1 45 ? 7.327   -2.306  -11.670 1.00 0.00 ? 49 LYS A HZ2  5  
ATOM 9385  H HZ3  . LYS A 1 45 ? 7.723   -3.845  -12.046 1.00 0.00 ? 49 LYS A HZ3  5  
ATOM 9386  N N    . ALA A 1 46 ? 10.724  -5.383  -4.132  1.00 0.00 ? 50 ALA A N    5  
ATOM 9387  C CA   . ALA A 1 46 ? 10.960  -6.459  -3.184  1.00 0.00 ? 50 ALA A CA   5  
ATOM 9388  C C    . ALA A 1 46 ? 9.656   -6.782  -2.450  1.00 0.00 ? 50 ALA A C    5  
ATOM 9389  O O    . ALA A 1 46 ? 9.111   -5.935  -1.744  1.00 0.00 ? 50 ALA A O    5  
ATOM 9390  C CB   . ALA A 1 46 ? 12.083  -6.058  -2.226  1.00 0.00 ? 50 ALA A CB   5  
ATOM 9391  H H    . ALA A 1 46 ? 10.122  -4.655  -3.803  1.00 0.00 ? 50 ALA A H    5  
ATOM 9392  H HA   . ALA A 1 46 ? 11.276  -7.336  -3.749  1.00 0.00 ? 50 ALA A HA   5  
ATOM 9393  H HB1  . ALA A 1 46 ? 12.399  -5.038  -2.443  1.00 0.00 ? 50 ALA A HB1  5  
ATOM 9394  H HB2  . ALA A 1 46 ? 11.723  -6.117  -1.199  1.00 0.00 ? 50 ALA A HB2  5  
ATOM 9395  H HB3  . ALA A 1 46 ? 12.928  -6.735  -2.354  1.00 0.00 ? 50 ALA A HB3  5  
ATOM 9396  N N    . CYS A 1 47 ? 9.194   -8.008  -2.643  1.00 0.00 ? 51 CYS A N    5  
ATOM 9397  C CA   . CYS A 1 47 ? 7.965   -8.453  -2.009  1.00 0.00 ? 51 CYS A CA   5  
ATOM 9398  C C    . CYS A 1 47 ? 8.265   -8.756  -0.540  1.00 0.00 ? 51 CYS A C    5  
ATOM 9399  O O    . CYS A 1 47 ? 9.357   -9.214  -0.207  1.00 0.00 ? 51 CYS A O    5  
ATOM 9400  C CB   . CYS A 1 47 ? 7.362   -9.661  -2.730  1.00 0.00 ? 51 CYS A CB   5  
ATOM 9401  S SG   . CYS A 1 47 ? 5.880   -9.292  -3.738  1.00 0.00 ? 51 CYS A SG   5  
ATOM 9402  H H    . CYS A 1 47 ? 9.643   -8.691  -3.220  1.00 0.00 ? 51 CYS A H    5  
ATOM 9403  H HA   . CYS A 1 47 ? 7.252   -7.633  -2.098  1.00 0.00 ? 51 CYS A HA   5  
ATOM 9404  H HB2  . CYS A 1 47 ? 8.123   -10.099 -3.375  1.00 0.00 ? 51 CYS A HB2  5  
ATOM 9405  H HB3  . CYS A 1 47 ? 7.100   -10.416 -1.988  1.00 0.00 ? 51 CYS A HB3  5  
ATOM 9406  N N    . LEU A 1 48 ? 7.276   -8.489  0.300   1.00 0.00 ? 52 LEU A N    5  
ATOM 9407  C CA   . LEU A 1 48 ? 7.420   -8.727  1.726   1.00 0.00 ? 52 LEU A CA   5  
ATOM 9408  C C    . LEU A 1 48 ? 6.492   -9.869  2.144   1.00 0.00 ? 52 LEU A C    5  
ATOM 9409  O O    . LEU A 1 48 ? 5.576   -10.231 1.408   1.00 0.00 ? 52 LEU A O    5  
ATOM 9410  C CB   . LEU A 1 48 ? 7.194   -7.433  2.511   1.00 0.00 ? 52 LEU A CB   5  
ATOM 9411  C CG   . LEU A 1 48 ? 8.081   -6.248  2.120   1.00 0.00 ? 52 LEU A CG   5  
ATOM 9412  C CD1  . LEU A 1 48 ? 7.448   -4.924  2.552   1.00 0.00 ? 52 LEU A CD1  5  
ATOM 9413  C CD2  . LEU A 1 48 ? 9.496   -6.415  2.677   1.00 0.00 ? 52 LEU A CD2  5  
ATOM 9414  H H    . LEU A 1 48 ? 6.390   -8.116  0.021   1.00 0.00 ? 52 LEU A H    5  
ATOM 9415  H HA   . LEU A 1 48 ? 8.450   -9.036  1.903   1.00 0.00 ? 52 LEU A HA   5  
ATOM 9416  H HB2  . LEU A 1 48 ? 6.152   -7.136  2.393   1.00 0.00 ? 52 LEU A HB2  5  
ATOM 9417  H HB3  . LEU A 1 48 ? 7.348   -7.642  3.570   1.00 0.00 ? 52 LEU A HB3  5  
ATOM 9418  H HG   . LEU A 1 48 ? 8.162   -6.227  1.034   1.00 0.00 ? 52 LEU A HG   5  
ATOM 9419  H HD11 . LEU A 1 48 ? 6.450   -4.841  2.121   1.00 0.00 ? 52 LEU A HD11 5  
ATOM 9420  H HD12 . LEU A 1 48 ? 7.377   -4.893  3.640   1.00 0.00 ? 52 LEU A HD12 5  
ATOM 9421  H HD13 . LEU A 1 48 ? 8.064   -4.096  2.204   1.00 0.00 ? 52 LEU A HD13 5  
ATOM 9422  H HD21 . LEU A 1 48 ? 9.626   -7.435  3.039   1.00 0.00 ? 52 LEU A HD21 5  
ATOM 9423  H HD22 . LEU A 1 48 ? 10.222  -6.215  1.889   1.00 0.00 ? 52 LEU A HD22 5  
ATOM 9424  H HD23 . LEU A 1 48 ? 9.648   -5.715  3.498   1.00 0.00 ? 52 LEU A HD23 5  
ATOM 9425  N N    . ASN A 1 49 ? 6.763   -10.407 3.325   1.00 0.00 ? 53 ASN A N    5  
ATOM 9426  C CA   . ASN A 1 49 ? 5.964   -11.501 3.850   1.00 0.00 ? 53 ASN A CA   5  
ATOM 9427  C C    . ASN A 1 49 ? 4.837   -10.934 4.717   1.00 0.00 ? 53 ASN A C    5  
ATOM 9428  O O    . ASN A 1 49 ? 5.095   -10.300 5.739   1.00 0.00 ? 53 ASN A O    5  
ATOM 9429  C CB   . ASN A 1 49 ? 6.809   -12.431 4.722   1.00 0.00 ? 53 ASN A CB   5  
ATOM 9430  C CG   . ASN A 1 49 ? 6.023   -13.686 5.107   1.00 0.00 ? 53 ASN A CG   5  
ATOM 9431  O OD1  . ASN A 1 49 ? 5.356   -14.306 4.295   1.00 0.00 ? 53 ASN A OD1  5  
ATOM 9432  N ND2  . ASN A 1 49 ? 6.137   -14.024 6.389   1.00 0.00 ? 53 ASN A ND2  5  
ATOM 9433  H H    . ASN A 1 49 ? 7.510   -10.107 3.918   1.00 0.00 ? 53 ASN A H    5  
ATOM 9434  H HA   . ASN A 1 49 ? 5.589   -12.029 2.973   1.00 0.00 ? 53 ASN A HA   5  
ATOM 9435  H HB2  . ASN A 1 49 ? 7.714   -12.715 4.186   1.00 0.00 ? 53 ASN A HB2  5  
ATOM 9436  H HB3  . ASN A 1 49 ? 7.124   -11.904 5.623   1.00 0.00 ? 53 ASN A HB3  5  
ATOM 9437  H HD21 . ASN A 1 49 ? 6.701   -13.471 7.003   1.00 0.00 ? 53 ASN A HD21 5  
ATOM 9438  H HD22 . ASN A 1 49 ? 5.660   -14.830 6.738   1.00 0.00 ? 53 ASN A HD22 5  
ATOM 9439  N N    . PRO A 1 50 ? 3.580   -11.189 4.265   1.00 0.00 ? 54 PRO A N    5  
ATOM 9440  C CA   . PRO A 1 50 ? 2.414   -10.712 4.988   1.00 0.00 ? 54 PRO A CA   5  
ATOM 9441  C C    . PRO A 1 50 ? 2.169   -11.547 6.246   1.00 0.00 ? 54 PRO A C    5  
ATOM 9442  O O    . PRO A 1 50 ? 1.237   -11.277 7.003   1.00 0.00 ? 54 PRO A O    5  
ATOM 9443  C CB   . PRO A 1 50 ? 1.271   -10.793 3.989   1.00 0.00 ? 54 PRO A CB   5  
ATOM 9444  C CG   . PRO A 1 50 ? 1.738   -11.743 2.898   1.00 0.00 ? 54 PRO A CG   5  
ATOM 9445  C CD   . PRO A 1 50 ? 3.237   -11.936 3.059   1.00 0.00 ? 54 PRO A CD   5  
ATOM 9446  H HA   . PRO A 1 50 ? 2.562   -9.775  5.306   1.00 0.00 ? 54 PRO A HA   5  
ATOM 9447  H HB2  . PRO A 1 50 ? 0.362   -11.161 4.464   1.00 0.00 ? 54 PRO A HB2  5  
ATOM 9448  H HB3  . PRO A 1 50 ? 1.041   -9.810  3.578   1.00 0.00 ? 54 PRO A HB3  5  
ATOM 9449  H HG2  . PRO A 1 50 ? 1.220   -12.699 2.977   1.00 0.00 ? 54 PRO A HG2  5  
ATOM 9450  H HG3  . PRO A 1 50 ? 1.509   -11.336 1.913   1.00 0.00 ? 54 PRO A HG3  5  
ATOM 9451  H HD2  . PRO A 1 50 ? 3.492   -12.991 3.160   1.00 0.00 ? 54 PRO A HD2  5  
ATOM 9452  H HD3  . PRO A 1 50 ? 3.780   -11.560 2.192   1.00 0.00 ? 54 PRO A HD3  5  
ATOM 9453  N N    . ALA A 1 51 ? 3.021   -12.545 6.431   1.00 0.00 ? 55 ALA A N    5  
ATOM 9454  C CA   . ALA A 1 51 ? 2.908   -13.421 7.584   1.00 0.00 ? 55 ALA A CA   5  
ATOM 9455  C C    . ALA A 1 51 ? 3.980   -13.047 8.610   1.00 0.00 ? 55 ALA A C    5  
ATOM 9456  O O    . ALA A 1 51 ? 4.285   -13.831 9.508   1.00 0.00 ? 55 ALA A O    5  
ATOM 9457  C CB   . ALA A 1 51 ? 3.018   -14.878 7.131   1.00 0.00 ? 55 ALA A CB   5  
ATOM 9458  H H    . ALA A 1 51 ? 3.776   -12.757 5.811   1.00 0.00 ? 55 ALA A H    5  
ATOM 9459  H HA   . ALA A 1 51 ? 1.924   -13.264 8.026   1.00 0.00 ? 55 ALA A HA   5  
ATOM 9460  H HB1  . ALA A 1 51 ? 3.338   -15.496 7.969   1.00 0.00 ? 55 ALA A HB1  5  
ATOM 9461  H HB2  . ALA A 1 51 ? 3.747   -14.954 6.324   1.00 0.00 ? 55 ALA A HB2  5  
ATOM 9462  H HB3  . ALA A 1 51 ? 2.046   -15.222 6.776   1.00 0.00 ? 55 ALA A HB3  5  
ATOM 9463  N N    . SER A 1 52 ? 4.523   -11.850 8.442   1.00 0.00 ? 56 SER A N    5  
ATOM 9464  C CA   . SER A 1 52 ? 5.554   -11.363 9.342   1.00 0.00 ? 56 SER A CA   5  
ATOM 9465  C C    . SER A 1 52 ? 5.081   -10.086 10.038  1.00 0.00 ? 56 SER A C    5  
ATOM 9466  O O    . SER A 1 52 ? 4.436   -9.240  9.420   1.00 0.00 ? 56 SER A O    5  
ATOM 9467  C CB   . SER A 1 52 ? 6.863   -11.105 8.592   1.00 0.00 ? 56 SER A CB   5  
ATOM 9468  O OG   . SER A 1 52 ? 7.771   -10.318 9.357   1.00 0.00 ? 56 SER A OG   5  
ATOM 9469  H H    . SER A 1 52 ? 4.269   -11.219 7.709   1.00 0.00 ? 56 SER A H    5  
ATOM 9470  H HA   . SER A 1 52 ? 5.704   -12.162 10.068  1.00 0.00 ? 56 SER A HA   5  
ATOM 9471  H HB2  . SER A 1 52 ? 7.331   -12.058 8.342   1.00 0.00 ? 56 SER A HB2  5  
ATOM 9472  H HB3  . SER A 1 52 ? 6.648   -10.599 7.651   1.00 0.00 ? 56 SER A HB3  5  
ATOM 9473  H HG   . SER A 1 52 ? 8.707   -10.638 9.213   1.00 0.00 ? 56 SER A HG   5  
ATOM 9474  N N    . PRO A 1 53 ? 5.429   -9.983  11.349  1.00 0.00 ? 57 PRO A N    5  
ATOM 9475  C CA   . PRO A 1 53 ? 5.046   -8.823  12.135  1.00 0.00 ? 57 PRO A CA   5  
ATOM 9476  C C    . PRO A 1 53 ? 5.906   -7.609  11.777  1.00 0.00 ? 57 PRO A C    5  
ATOM 9477  O O    . PRO A 1 53 ? 5.455   -6.470  11.885  1.00 0.00 ? 57 PRO A O    5  
ATOM 9478  C CB   . PRO A 1 53 ? 5.208   -9.258  13.583  1.00 0.00 ? 57 PRO A CB   5  
ATOM 9479  C CG   . PRO A 1 53 ? 6.113   -10.479 13.552  1.00 0.00 ? 57 PRO A CG   5  
ATOM 9480  C CD   . PRO A 1 53 ? 6.192   -10.965 12.114  1.00 0.00 ? 57 PRO A CD   5  
ATOM 9481  H HA   . PRO A 1 53 ? 4.103   -8.560  11.931  1.00 0.00 ? 57 PRO A HA   5  
ATOM 9482  H HB2  . PRO A 1 53 ? 5.647   -8.462  14.183  1.00 0.00 ? 57 PRO A HB2  5  
ATOM 9483  H HB3  . PRO A 1 53 ? 4.243   -9.498  14.029  1.00 0.00 ? 57 PRO A HB3  5  
ATOM 9484  H HG2  . PRO A 1 53 ? 7.105   -10.228 13.926  1.00 0.00 ? 57 PRO A HG2  5  
ATOM 9485  H HG3  . PRO A 1 53 ? 5.718   -11.263 14.198  1.00 0.00 ? 57 PRO A HG3  5  
ATOM 9486  H HD2  . PRO A 1 53 ? 7.225   -11.018 11.770  1.00 0.00 ? 57 PRO A HD2  5  
ATOM 9487  H HD3  . PRO A 1 53 ? 5.769   -11.964 12.009  1.00 0.00 ? 57 PRO A HD3  5  
ATOM 9488  N N    . MET A 1 54 ? 7.130   -7.895  11.357  1.00 0.00 ? 58 MET A N    5  
ATOM 9489  C CA   . MET A 1 54 ? 8.057   -6.841  10.981  1.00 0.00 ? 58 MET A CA   5  
ATOM 9490  C C    . MET A 1 54 ? 7.617   -6.160  9.683   1.00 0.00 ? 58 MET A C    5  
ATOM 9491  O O    . MET A 1 54 ? 8.030   -5.037  9.396   1.00 0.00 ? 58 MET A O    5  
ATOM 9492  C CB   . MET A 1 54 ? 9.456   -7.432  10.799  1.00 0.00 ? 58 MET A CB   5  
ATOM 9493  C CG   . MET A 1 54 ? 10.517  -6.331  10.765  1.00 0.00 ? 58 MET A CG   5  
ATOM 9494  S SD   . MET A 1 54 ? 11.504  -6.387  12.251  1.00 0.00 ? 58 MET A SD   5  
ATOM 9495  C CE   . MET A 1 54 ? 10.215  -6.293  13.482  1.00 0.00 ? 58 MET A CE   5  
ATOM 9496  H H    . MET A 1 54 ? 7.489   -8.824  11.272  1.00 0.00 ? 58 MET A H    5  
ATOM 9497  H HA   . MET A 1 54 ? 8.033   -6.124  11.802  1.00 0.00 ? 58 MET A HA   5  
ATOM 9498  H HB2  . MET A 1 54 ? 9.671   -8.124  11.613  1.00 0.00 ? 58 MET A HB2  5  
ATOM 9499  H HB3  . MET A 1 54 ? 9.494   -8.008  9.874   1.00 0.00 ? 58 MET A HB3  5  
ATOM 9500  H HG2  . MET A 1 54 ? 11.155  -6.456  9.890   1.00 0.00 ? 58 MET A HG2  5  
ATOM 9501  H HG3  . MET A 1 54 ? 10.038  -5.356  10.673  1.00 0.00 ? 58 MET A HG3  5  
ATOM 9502  H HE1  . MET A 1 54 ? 9.500   -5.520  13.202  1.00 0.00 ? 58 MET A HE1  5  
ATOM 9503  H HE2  . MET A 1 54 ? 9.704   -7.254  13.548  1.00 0.00 ? 58 MET A HE2  5  
ATOM 9504  H HE3  . MET A 1 54 ? 10.654  -6.048  14.450  1.00 0.00 ? 58 MET A HE3  5  
ATOM 9505  N N    . VAL A 1 55 ? 6.786   -6.869  8.934   1.00 0.00 ? 59 VAL A N    5  
ATOM 9506  C CA   . VAL A 1 55 ? 6.285   -6.347  7.673   1.00 0.00 ? 59 VAL A CA   5  
ATOM 9507  C C    . VAL A 1 55 ? 5.305   -5.205  7.952   1.00 0.00 ? 59 VAL A C    5  
ATOM 9508  O O    . VAL A 1 55 ? 5.013   -4.404  7.066   1.00 0.00 ? 59 VAL A O    5  
ATOM 9509  C CB   . VAL A 1 55 ? 5.667   -7.477  6.848   1.00 0.00 ? 59 VAL A CB   5  
ATOM 9510  C CG1  . VAL A 1 55 ? 4.520   -6.958  5.979   1.00 0.00 ? 59 VAL A CG1  5  
ATOM 9511  C CG2  . VAL A 1 55 ? 6.728   -8.176  5.994   1.00 0.00 ? 59 VAL A CG2  5  
ATOM 9512  H H    . VAL A 1 55 ? 6.455   -7.781  9.175   1.00 0.00 ? 59 VAL A H    5  
ATOM 9513  H HA   . VAL A 1 55 ? 7.137   -5.951  7.120   1.00 0.00 ? 59 VAL A HA   5  
ATOM 9514  H HB   . VAL A 1 55 ? 5.257   -8.212  7.540   1.00 0.00 ? 59 VAL A HB   5  
ATOM 9515  H HG11 . VAL A 1 55 ? 3.755   -6.512  6.616   1.00 0.00 ? 59 VAL A HG11 5  
ATOM 9516  H HG12 . VAL A 1 55 ? 4.900   -6.206  5.287   1.00 0.00 ? 59 VAL A HG12 5  
ATOM 9517  H HG13 . VAL A 1 55 ? 4.087   -7.785  5.416   1.00 0.00 ? 59 VAL A HG13 5  
ATOM 9518  H HG21 . VAL A 1 55 ? 7.514   -7.465  5.738   1.00 0.00 ? 59 VAL A HG21 5  
ATOM 9519  H HG22 . VAL A 1 55 ? 7.157   -9.006  6.556   1.00 0.00 ? 59 VAL A HG22 5  
ATOM 9520  H HG23 . VAL A 1 55 ? 6.268   -8.554  5.081   1.00 0.00 ? 59 VAL A HG23 5  
ATOM 9521  N N    . LYS A 1 56 ? 4.825   -5.168  9.186   1.00 0.00 ? 60 LYS A N    5  
ATOM 9522  C CA   . LYS A 1 56 ? 3.884   -4.138  9.592   1.00 0.00 ? 60 LYS A CA   5  
ATOM 9523  C C    . LYS A 1 56 ? 4.650   -2.977  10.230  1.00 0.00 ? 60 LYS A C    5  
ATOM 9524  O O    . LYS A 1 56 ? 4.045   -2.021  10.713  1.00 0.00 ? 60 LYS A O    5  
ATOM 9525  C CB   . LYS A 1 56 ? 2.800   -4.729  10.496  1.00 0.00 ? 60 LYS A CB   5  
ATOM 9526  C CG   . LYS A 1 56 ? 2.092   -5.899  9.809   1.00 0.00 ? 60 LYS A CG   5  
ATOM 9527  C CD   . LYS A 1 56 ? 2.924   -7.179  9.908   1.00 0.00 ? 60 LYS A CD   5  
ATOM 9528  C CE   . LYS A 1 56 ? 2.044   -8.379  10.264  1.00 0.00 ? 60 LYS A CE   5  
ATOM 9529  N NZ   . LYS A 1 56 ? 1.343   -8.881  9.062   1.00 0.00 ? 60 LYS A NZ   5  
ATOM 9530  H H    . LYS A 1 56 ? 5.068   -5.824  9.901   1.00 0.00 ? 60 LYS A H    5  
ATOM 9531  H HA   . LYS A 1 56 ? 3.390   -3.774  8.692   1.00 0.00 ? 60 LYS A HA   5  
ATOM 9532  H HB2  . LYS A 1 56 ? 3.245   -5.068  11.431  1.00 0.00 ? 60 LYS A HB2  5  
ATOM 9533  H HB3  . LYS A 1 56 ? 2.073   -3.958  10.750  1.00 0.00 ? 60 LYS A HB3  5  
ATOM 9534  H HG2  . LYS A 1 56 ? 1.116   -6.058  10.269  1.00 0.00 ? 60 LYS A HG2  5  
ATOM 9535  H HG3  . LYS A 1 56 ? 1.914   -5.657  8.761   1.00 0.00 ? 60 LYS A HG3  5  
ATOM 9536  H HD2  . LYS A 1 56 ? 3.430   -7.362  8.960   1.00 0.00 ? 60 LYS A HD2  5  
ATOM 9537  H HD3  . LYS A 1 56 ? 3.699   -7.054  10.664  1.00 0.00 ? 60 LYS A HD3  5  
ATOM 9538  H HE2  . LYS A 1 56 ? 2.657   -9.172  10.693  1.00 0.00 ? 60 LYS A HE2  5  
ATOM 9539  H HE3  . LYS A 1 56 ? 1.317   -8.091  11.024  1.00 0.00 ? 60 LYS A HE3  5  
ATOM 9540  H HZ1  . LYS A 1 56 ? 1.953   -8.826  8.272   1.00 0.00 ? 60 LYS A HZ1  5  
ATOM 9541  H HZ2  . LYS A 1 56 ? 1.071   -9.833  9.208   1.00 0.00 ? 60 LYS A HZ2  5  
ATOM 9542  H HZ3  . LYS A 1 56 ? 0.529   -8.325  8.894   1.00 0.00 ? 60 LYS A HZ3  5  
ATOM 9543  N N    . LYS A 1 57 ? 5.969   -3.098  10.209  1.00 0.00 ? 61 LYS A N    5  
ATOM 9544  C CA   . LYS A 1 57 ? 6.823   -2.070  10.779  1.00 0.00 ? 61 LYS A CA   5  
ATOM 9545  C C    . LYS A 1 57 ? 7.639   -1.415  9.663   1.00 0.00 ? 61 LYS A C    5  
ATOM 9546  O O    . LYS A 1 57 ? 8.196   -0.334  9.849   1.00 0.00 ? 61 LYS A O    5  
ATOM 9547  C CB   . LYS A 1 57 ? 7.679   -2.649  11.908  1.00 0.00 ? 61 LYS A CB   5  
ATOM 9548  C CG   . LYS A 1 57 ? 6.803   -3.134  13.065  1.00 0.00 ? 61 LYS A CG   5  
ATOM 9549  C CD   . LYS A 1 57 ? 7.308   -2.585  14.401  1.00 0.00 ? 61 LYS A CD   5  
ATOM 9550  C CE   . LYS A 1 57 ? 6.436   -3.073  15.559  1.00 0.00 ? 61 LYS A CE   5  
ATOM 9551  N NZ   . LYS A 1 57 ? 5.652   -1.952  16.126  1.00 0.00 ? 61 LYS A NZ   5  
ATOM 9552  H H    . LYS A 1 57 ? 6.453   -3.878  9.814   1.00 0.00 ? 61 LYS A H    5  
ATOM 9553  H HA   . LYS A 1 57 ? 6.174   -1.314  11.222  1.00 0.00 ? 61 LYS A HA   5  
ATOM 9554  H HB2  . LYS A 1 57 ? 8.277   -3.477  11.528  1.00 0.00 ? 61 LYS A HB2  5  
ATOM 9555  H HB3  . LYS A 1 57 ? 8.375   -1.891  12.266  1.00 0.00 ? 61 LYS A HB3  5  
ATOM 9556  H HG2  . LYS A 1 57 ? 5.773   -2.817  12.904  1.00 0.00 ? 61 LYS A HG2  5  
ATOM 9557  H HG3  . LYS A 1 57 ? 6.802   -4.223  13.093  1.00 0.00 ? 61 LYS A HG3  5  
ATOM 9558  H HD2  . LYS A 1 57 ? 8.340   -2.899  14.561  1.00 0.00 ? 61 LYS A HD2  5  
ATOM 9559  H HD3  . LYS A 1 57 ? 7.307   -1.495  14.375  1.00 0.00 ? 61 LYS A HD3  5  
ATOM 9560  H HE2  . LYS A 1 57 ? 5.762   -3.855  15.210  1.00 0.00 ? 61 LYS A HE2  5  
ATOM 9561  H HE3  . LYS A 1 57 ? 7.062   -3.515  16.334  1.00 0.00 ? 61 LYS A HE3  5  
ATOM 9562  H HZ1  . LYS A 1 57 ? 5.826   -1.122  15.596  1.00 0.00 ? 61 LYS A HZ1  5  
ATOM 9563  H HZ2  . LYS A 1 57 ? 4.678   -2.174  16.088  1.00 0.00 ? 61 LYS A HZ2  5  
ATOM 9564  H HZ3  . LYS A 1 57 ? 5.924   -1.803  17.077  1.00 0.00 ? 61 LYS A HZ3  5  
ATOM 9565  N N    . ILE A 1 58 ? 7.685   -2.097  8.528   1.00 0.00 ? 62 ILE A N    5  
ATOM 9566  C CA   . ILE A 1 58 ? 8.424   -1.595  7.382   1.00 0.00 ? 62 ILE A CA   5  
ATOM 9567  C C    . ILE A 1 58 ? 7.471   -0.829  6.462   1.00 0.00 ? 62 ILE A C    5  
ATOM 9568  O O    . ILE A 1 58 ? 7.911   -0.066  5.603   1.00 0.00 ? 62 ILE A O    5  
ATOM 9569  C CB   . ILE A 1 58 ? 9.169   -2.734  6.684   1.00 0.00 ? 62 ILE A CB   5  
ATOM 9570  C CG1  . ILE A 1 58 ? 10.067  -3.486  7.669   1.00 0.00 ? 62 ILE A CG1  5  
ATOM 9571  C CG2  . ILE A 1 58 ? 9.952   -2.218  5.475   1.00 0.00 ? 62 ILE A CG2  5  
ATOM 9572  C CD1  . ILE A 1 58 ? 10.213  -4.955  7.266   1.00 0.00 ? 62 ILE A CD1  5  
ATOM 9573  H H    . ILE A 1 58 ? 7.229   -2.975  8.385   1.00 0.00 ? 62 ILE A H    5  
ATOM 9574  H HA   . ILE A 1 58 ? 9.175   -0.900  7.757   1.00 0.00 ? 62 ILE A HA   5  
ATOM 9575  H HB   . ILE A 1 58 ? 8.433   -3.446  6.311   1.00 0.00 ? 62 ILE A HB   5  
ATOM 9576  H HG12 . ILE A 1 58 ? 11.049  -3.015  7.704   1.00 0.00 ? 62 ILE A HG12 5  
ATOM 9577  H HG13 . ILE A 1 58 ? 9.647   -3.420  8.673   1.00 0.00 ? 62 ILE A HG13 5  
ATOM 9578  H HG21 . ILE A 1 58 ? 9.306   -1.581  4.870   1.00 0.00 ? 62 ILE A HG21 5  
ATOM 9579  H HG22 . ILE A 1 58 ? 10.812  -1.642  5.817   1.00 0.00 ? 62 ILE A HG22 5  
ATOM 9580  H HG23 . ILE A 1 58 ? 10.294  -3.062  4.877   1.00 0.00 ? 62 ILE A HG23 5  
ATOM 9581  H HD11 . ILE A 1 58 ? 9.991   -5.064  6.205   1.00 0.00 ? 62 ILE A HD11 5  
ATOM 9582  H HD12 . ILE A 1 58 ? 11.234  -5.285  7.460   1.00 0.00 ? 62 ILE A HD12 5  
ATOM 9583  H HD13 . ILE A 1 58 ? 9.519   -5.562  7.847   1.00 0.00 ? 62 ILE A HD13 5  
ATOM 9584  N N    . ILE A 1 59 ? 6.183   -1.059  6.673   1.00 0.00 ? 63 ILE A N    5  
ATOM 9585  C CA   . ILE A 1 59 ? 5.164   -0.401  5.873   1.00 0.00 ? 63 ILE A CA   5  
ATOM 9586  C C    . ILE A 1 59 ? 4.701   0.870   6.590   1.00 0.00 ? 63 ILE A C    5  
ATOM 9587  O O    . ILE A 1 59 ? 4.746   1.959   6.021   1.00 0.00 ? 63 ILE A O    5  
ATOM 9588  C CB   . ILE A 1 59 ? 4.028   -1.372  5.548   1.00 0.00 ? 63 ILE A CB   5  
ATOM 9589  C CG1  . ILE A 1 59 ? 4.472   -2.408  4.513   1.00 0.00 ? 63 ILE A CG1  5  
ATOM 9590  C CG2  . ILE A 1 59 ? 2.773   -0.618  5.103   1.00 0.00 ? 63 ILE A CG2  5  
ATOM 9591  C CD1  . ILE A 1 59 ? 3.662   -3.699  4.648   1.00 0.00 ? 63 ILE A CD1  5  
ATOM 9592  H H    . ILE A 1 59 ? 5.834   -1.681  7.374   1.00 0.00 ? 63 ILE A H    5  
ATOM 9593  H HA   . ILE A 1 59 ? 5.625   -0.115  4.928   1.00 0.00 ? 63 ILE A HA   5  
ATOM 9594  H HB   . ILE A 1 59 ? 3.772   -1.915  6.457   1.00 0.00 ? 63 ILE A HB   5  
ATOM 9595  H HG12 . ILE A 1 59 ? 4.348   -2.000  3.509   1.00 0.00 ? 63 ILE A HG12 5  
ATOM 9596  H HG13 . ILE A 1 59 ? 5.532   -2.624  4.641   1.00 0.00 ? 63 ILE A HG13 5  
ATOM 9597  H HG21 . ILE A 1 59 ? 3.043   0.396   4.808   1.00 0.00 ? 63 ILE A HG21 5  
ATOM 9598  H HG22 . ILE A 1 59 ? 2.321   -1.134  4.256   1.00 0.00 ? 63 ILE A HG22 5  
ATOM 9599  H HG23 . ILE A 1 59 ? 2.061   -0.579  5.927   1.00 0.00 ? 63 ILE A HG23 5  
ATOM 9600  H HD11 . ILE A 1 59 ? 3.370   -3.837  5.689   1.00 0.00 ? 63 ILE A HD11 5  
ATOM 9601  H HD12 . ILE A 1 59 ? 2.770   -3.636  4.025   1.00 0.00 ? 63 ILE A HD12 5  
ATOM 9602  H HD13 . ILE A 1 59 ? 4.271   -4.544  4.326   1.00 0.00 ? 63 ILE A HD13 5  
ATOM 9603  N N    . GLU A 1 60 ? 4.268   0.687   7.829   1.00 0.00 ? 64 GLU A N    5  
ATOM 9604  C CA   . GLU A 1 60 ? 3.797   1.805   8.629   1.00 0.00 ? 64 GLU A CA   5  
ATOM 9605  C C    . GLU A 1 60 ? 4.853   2.912   8.667   1.00 0.00 ? 64 GLU A C    5  
ATOM 9606  O O    . GLU A 1 60 ? 4.516   4.095   8.668   1.00 0.00 ? 64 GLU A O    5  
ATOM 9607  C CB   . GLU A 1 60 ? 3.429   1.350   10.043  1.00 0.00 ? 64 GLU A CB   5  
ATOM 9608  C CG   . GLU A 1 60 ? 2.212   0.422   10.020  1.00 0.00 ? 64 GLU A CG   5  
ATOM 9609  C CD   . GLU A 1 60 ? 2.100   -0.367  11.326  1.00 0.00 ? 64 GLU A CD   5  
ATOM 9610  O OE1  . GLU A 1 60 ? 2.714   0.085   12.317  1.00 0.00 ? 64 GLU A OE1  5  
ATOM 9611  O OE2  . GLU A 1 60 ? 1.404   -1.405  11.304  1.00 0.00 ? 64 GLU A OE2  5  
ATOM 9612  H H    . GLU A 1 60 ? 4.235   -0.202  8.284   1.00 0.00 ? 64 GLU A H    5  
ATOM 9613  H HA   . GLU A 1 60 ? 2.901   2.165   8.125   1.00 0.00 ? 64 GLU A HA   5  
ATOM 9614  H HB2  . GLU A 1 60 ? 4.275   0.834   10.495  1.00 0.00 ? 64 GLU A HB2  5  
ATOM 9615  H HB3  . GLU A 1 60 ? 3.216   2.220   10.665  1.00 0.00 ? 64 GLU A HB3  5  
ATOM 9616  H HG2  . GLU A 1 60 ? 1.306   1.009   9.867   1.00 0.00 ? 64 GLU A HG2  5  
ATOM 9617  H HG3  . GLU A 1 60 ? 2.291   -0.267  9.180   1.00 0.00 ? 64 GLU A HG3  5  
ATOM 9618  N N    . LYS A 1 61 ? 6.108   2.488   8.698   1.00 0.00 ? 65 LYS A N    5  
ATOM 9619  C CA   . LYS A 1 61 ? 7.214   3.429   8.736   1.00 0.00 ? 65 LYS A CA   5  
ATOM 9620  C C    . LYS A 1 61 ? 7.367   4.087   7.363   1.00 0.00 ? 65 LYS A C    5  
ATOM 9621  O O    . LYS A 1 61 ? 7.757   5.249   7.267   1.00 0.00 ? 65 LYS A O    5  
ATOM 9622  C CB   . LYS A 1 61 ? 8.487   2.740   9.232   1.00 0.00 ? 65 LYS A CB   5  
ATOM 9623  C CG   . LYS A 1 61 ? 8.493   2.632   10.759  1.00 0.00 ? 65 LYS A CG   5  
ATOM 9624  C CD   . LYS A 1 61 ? 9.919   2.705   11.308  1.00 0.00 ? 65 LYS A CD   5  
ATOM 9625  C CE   . LYS A 1 61 ? 10.097  1.759   12.497  1.00 0.00 ? 65 LYS A CE   5  
ATOM 9626  N NZ   . LYS A 1 61 ? 10.169  2.523   13.762  1.00 0.00 ? 65 LYS A NZ   5  
ATOM 9627  H H    . LYS A 1 61 ? 6.373   1.524   8.697   1.00 0.00 ? 65 LYS A H    5  
ATOM 9628  H HA   . LYS A 1 61 ? 6.962   4.201   9.463   1.00 0.00 ? 65 LYS A HA   5  
ATOM 9629  H HB2  . LYS A 1 61 ? 8.561   1.745   8.794   1.00 0.00 ? 65 LYS A HB2  5  
ATOM 9630  H HB3  . LYS A 1 61 ? 9.361   3.300   8.900   1.00 0.00 ? 65 LYS A HB3  5  
ATOM 9631  H HG2  . LYS A 1 61 ? 7.893   3.436   11.185  1.00 0.00 ? 65 LYS A HG2  5  
ATOM 9632  H HG3  . LYS A 1 61 ? 8.029   1.694   11.062  1.00 0.00 ? 65 LYS A HG3  5  
ATOM 9633  H HD2  . LYS A 1 61 ? 10.629  2.446   10.522  1.00 0.00 ? 65 LYS A HD2  5  
ATOM 9634  H HD3  . LYS A 1 61 ? 10.142  3.727   11.615  1.00 0.00 ? 65 LYS A HD3  5  
ATOM 9635  H HE2  . LYS A 1 61 ? 9.266   1.055   12.537  1.00 0.00 ? 65 LYS A HE2  5  
ATOM 9636  H HE3  . LYS A 1 61 ? 11.006  1.171   12.368  1.00 0.00 ? 65 LYS A HE3  5  
ATOM 9637  H HZ1  . LYS A 1 61 ? 9.380   3.134   13.828  1.00 0.00 ? 65 LYS A HZ1  5  
ATOM 9638  H HZ2  . LYS A 1 61 ? 10.166  1.889   14.535  1.00 0.00 ? 65 LYS A HZ2  5  
ATOM 9639  H HZ3  . LYS A 1 61 ? 11.011  3.063   13.777  1.00 0.00 ? 65 LYS A HZ3  5  
ATOM 9640  N N    . MET A 1 62 ? 7.050   3.314   6.334   1.00 0.00 ? 66 MET A N    5  
ATOM 9641  C CA   . MET A 1 62 ? 7.147   3.807   4.970   1.00 0.00 ? 66 MET A CA   5  
ATOM 9642  C C    . MET A 1 62 ? 6.212   4.998   4.750   1.00 0.00 ? 66 MET A C    5  
ATOM 9643  O O    . MET A 1 62 ? 6.566   5.948   4.054   1.00 0.00 ? 66 MET A O    5  
ATOM 9644  C CB   . MET A 1 62 ? 6.783   2.686   3.995   1.00 0.00 ? 66 MET A CB   5  
ATOM 9645  C CG   . MET A 1 62 ? 7.955   2.368   3.063   1.00 0.00 ? 66 MET A CG   5  
ATOM 9646  S SD   . MET A 1 62 ? 8.231   3.730   1.944   1.00 0.00 ? 66 MET A SD   5  
ATOM 9647  C CE   . MET A 1 62 ? 6.558   4.023   1.393   1.00 0.00 ? 66 MET A CE   5  
ATOM 9648  H H    . MET A 1 62 ? 6.733   2.370   6.420   1.00 0.00 ? 66 MET A H    5  
ATOM 9649  H HA   . MET A 1 62 ? 8.183   4.121   4.846   1.00 0.00 ? 66 MET A HA   5  
ATOM 9650  H HB2  . MET A 1 62 ? 6.504   1.791   4.552   1.00 0.00 ? 66 MET A HB2  5  
ATOM 9651  H HB3  . MET A 1 62 ? 5.914   2.979   3.406   1.00 0.00 ? 66 MET A HB3  5  
ATOM 9652  H HG2  . MET A 1 62 ? 8.855   2.179   3.648   1.00 0.00 ? 66 MET A HG2  5  
ATOM 9653  H HG3  . MET A 1 62 ? 7.745   1.459   2.499   1.00 0.00 ? 66 MET A HG3  5  
ATOM 9654  H HE1  . MET A 1 62 ? 6.010   3.081   1.380   1.00 0.00 ? 66 MET A HE1  5  
ATOM 9655  H HE2  . MET A 1 62 ? 6.068   4.719   2.075   1.00 0.00 ? 66 MET A HE2  5  
ATOM 9656  H HE3  . MET A 1 62 ? 6.575   4.449   0.390   1.00 0.00 ? 66 MET A HE3  5  
ATOM 9657  N N    . LEU A 1 63 ? 5.038   4.908   5.358   1.00 0.00 ? 67 LEU A N    5  
ATOM 9658  C CA   . LEU A 1 63 ? 4.050   5.967   5.237   1.00 0.00 ? 67 LEU A CA   5  
ATOM 9659  C C    . LEU A 1 63 ? 4.546   7.208   5.982   1.00 0.00 ? 67 LEU A C    5  
ATOM 9660  O O    . LEU A 1 63 ? 4.024   8.305   5.784   1.00 0.00 ? 67 LEU A O    5  
ATOM 9661  C CB   . LEU A 1 63 ? 2.679   5.476   5.704   1.00 0.00 ? 67 LEU A CB   5  
ATOM 9662  C CG   . LEU A 1 63 ? 1.914   4.587   4.721   1.00 0.00 ? 67 LEU A CG   5  
ATOM 9663  C CD1  . LEU A 1 63 ? 2.746   3.366   4.323   1.00 0.00 ? 67 LEU A CD1  5  
ATOM 9664  C CD2  . LEU A 1 63 ? 0.549   4.191   5.287   1.00 0.00 ? 67 LEU A CD2  5  
ATOM 9665  H H    . LEU A 1 63 ? 4.759   4.132   5.923   1.00 0.00 ? 67 LEU A H    5  
ATOM 9666  H HA   . LEU A 1 63 ? 3.962   6.212   4.178   1.00 0.00 ? 67 LEU A HA   5  
ATOM 9667  H HB2  . LEU A 1 63 ? 2.810   4.924   6.635   1.00 0.00 ? 67 LEU A HB2  5  
ATOM 9668  H HB3  . LEU A 1 63 ? 2.062   6.345   5.932   1.00 0.00 ? 67 LEU A HB3  5  
ATOM 9669  H HG   . LEU A 1 63 ? 1.731   5.161   3.812   1.00 0.00 ? 67 LEU A HG   5  
ATOM 9670  H HD11 . LEU A 1 63 ? 3.722   3.693   3.963   1.00 0.00 ? 67 LEU A HD11 5  
ATOM 9671  H HD12 . LEU A 1 63 ? 2.878   2.719   5.190   1.00 0.00 ? 67 LEU A HD12 5  
ATOM 9672  H HD13 . LEU A 1 63 ? 2.232   2.817   3.534   1.00 0.00 ? 67 LEU A HD13 5  
ATOM 9673  H HD21 . LEU A 1 63 ? 0.066   5.068   5.717   1.00 0.00 ? 67 LEU A HD21 5  
ATOM 9674  H HD22 . LEU A 1 63 ? -0.073  3.789   4.488   1.00 0.00 ? 67 LEU A HD22 5  
ATOM 9675  H HD23 . LEU A 1 63 ? 0.682   3.434   6.060   1.00 0.00 ? 67 LEU A HD23 5  
ATOM 9676  N N    . LYS A 1 64 ? 5.546   6.994   6.823   1.00 0.00 ? 68 LYS A N    5  
ATOM 9677  C CA   . LYS A 1 64 ? 6.118   8.082   7.599   1.00 0.00 ? 68 LYS A CA   5  
ATOM 9678  C C    . LYS A 1 64 ? 7.445   8.509   6.970   1.00 0.00 ? 68 LYS A C    5  
ATOM 9679  O O    . LYS A 1 64 ? 7.831   9.674   7.056   1.00 0.00 ? 68 LYS A O    5  
ATOM 9680  C CB   . LYS A 1 64 ? 6.235   7.685   9.072   1.00 0.00 ? 68 LYS A CB   5  
ATOM 9681  C CG   . LYS A 1 64 ? 5.233   8.460   9.930   1.00 0.00 ? 68 LYS A CG   5  
ATOM 9682  C CD   . LYS A 1 64 ? 5.919   9.608   10.673  1.00 0.00 ? 68 LYS A CD   5  
ATOM 9683  C CE   . LYS A 1 64 ? 5.107   10.030  11.899  1.00 0.00 ? 68 LYS A CE   5  
ATOM 9684  N NZ   . LYS A 1 64 ? 5.277   11.477  12.160  1.00 0.00 ? 68 LYS A NZ   5  
ATOM 9685  H H    . LYS A 1 64 ? 5.965   6.099   6.978   1.00 0.00 ? 68 LYS A H    5  
ATOM 9686  H HA   . LYS A 1 64 ? 5.424   8.921   7.546   1.00 0.00 ? 68 LYS A HA   5  
ATOM 9687  H HB2  . LYS A 1 64 ? 6.060   6.615   9.180   1.00 0.00 ? 68 LYS A HB2  5  
ATOM 9688  H HB3  . LYS A 1 64 ? 7.248   7.879   9.425   1.00 0.00 ? 68 LYS A HB3  5  
ATOM 9689  H HG2  . LYS A 1 64 ? 4.437   8.855   9.298   1.00 0.00 ? 68 LYS A HG2  5  
ATOM 9690  H HG3  . LYS A 1 64 ? 4.765   7.786   10.648  1.00 0.00 ? 68 LYS A HG3  5  
ATOM 9691  H HD2  . LYS A 1 64 ? 6.918   9.300   10.982  1.00 0.00 ? 68 LYS A HD2  5  
ATOM 9692  H HD3  . LYS A 1 64 ? 6.040   10.459  10.003  1.00 0.00 ? 68 LYS A HD3  5  
ATOM 9693  H HE2  . LYS A 1 64 ? 4.053   9.805   11.740  1.00 0.00 ? 68 LYS A HE2  5  
ATOM 9694  H HE3  . LYS A 1 64 ? 5.428   9.458   12.770  1.00 0.00 ? 68 LYS A HE3  5  
ATOM 9695  H HZ1  . LYS A 1 64 ? 6.252   11.696  12.201  1.00 0.00 ? 68 LYS A HZ1  5  
ATOM 9696  H HZ2  . LYS A 1 64 ? 4.848   12.001  11.425  1.00 0.00 ? 68 LYS A HZ2  5  
ATOM 9697  H HZ3  . LYS A 1 64 ? 4.846   11.712  13.032  1.00 0.00 ? 68 LYS A HZ3  5  
ATOM 9698  N N    . ASN A 1 65 ? 8.108   7.543   6.351   1.00 0.00 ? 69 ASN A N    5  
ATOM 9699  C CA   . ASN A 1 65 ? 9.384   7.805   5.707   1.00 0.00 ? 69 ASN A CA   5  
ATOM 9700  C C    . ASN A 1 65 ? 10.393  8.275   6.757   1.00 0.00 ? 69 ASN A C    5  
ATOM 9701  O O    . ASN A 1 65 ? 11.234  7.498   7.207   1.00 0.00 ? 69 ASN A O    5  
ATOM 9702  C CB   . ASN A 1 65 ? 9.253   8.904   4.651   1.00 0.00 ? 69 ASN A CB   5  
ATOM 9703  C CG   . ASN A 1 65 ? 10.629  9.349   4.150   1.00 0.00 ? 69 ASN A CG   5  
ATOM 9704  O OD1  . ASN A 1 65 ? 11.352  8.609   3.504   1.00 0.00 ? 69 ASN A OD1  5  
ATOM 9705  N ND2  . ASN A 1 65 ? 10.948  10.596  4.482   1.00 0.00 ? 69 ASN A ND2  5  
ATOM 9706  H H    . ASN A 1 65 ? 7.787   6.598   6.285   1.00 0.00 ? 69 ASN A H    5  
ATOM 9707  H HA   . ASN A 1 65 ? 9.672   6.860   5.247   1.00 0.00 ? 69 ASN A HA   5  
ATOM 9708  H HB2  . ASN A 1 65 ? 8.657   8.540   3.814   1.00 0.00 ? 69 ASN A HB2  5  
ATOM 9709  H HB3  . ASN A 1 65 ? 8.722   9.757   5.073   1.00 0.00 ? 69 ASN A HB3  5  
ATOM 9710  H HD21 . ASN A 1 65 ? 10.308  11.151  5.014   1.00 0.00 ? 69 ASN A HD21 5  
ATOM 9711  H HD22 . ASN A 1 65 ? 11.827  10.980  4.200   1.00 0.00 ? 69 ASN A HD22 5  
ATOM 9712  N N    . GLY A 1 66 ? 10.276  9.545   7.117   1.00 0.00 ? 70 GLY A N    5  
ATOM 9713  C CA   . GLY A 1 66 ? 11.167  10.128  8.105   1.00 0.00 ? 70 GLY A CA   5  
ATOM 9714  C C    . GLY A 1 66 ? 12.623  10.057  7.640   1.00 0.00 ? 70 GLY A C    5  
ATOM 9715  O O    . GLY A 1 66 ? 13.244  8.997   7.695   1.00 0.00 ? 70 GLY A O    5  
ATOM 9716  H H    . GLY A 1 66 ? 9.589   10.170  6.746   1.00 0.00 ? 70 GLY A H    5  
ATOM 9717  H HA2  . GLY A 1 66 ? 10.889  11.167  8.283   1.00 0.00 ? 70 GLY A HA2  5  
ATOM 9718  H HA3  . GLY A 1 66 ? 11.058  9.602   9.053   1.00 0.00 ? 70 GLY A HA3  5  
ATOM 9719  N N    . LYS A 1 67 ? 13.124  11.199  7.193   1.00 0.00 ? 71 LYS A N    5  
ATOM 9720  C CA   . LYS A 1 67 ? 14.496  11.279  6.719   1.00 0.00 ? 71 LYS A CA   5  
ATOM 9721  C C    . LYS A 1 67 ? 14.999  12.716  6.869   1.00 0.00 ? 71 LYS A C    5  
ATOM 9722  O O    . LYS A 1 67 ? 15.875  12.989  7.688   1.00 0.00 ? 71 LYS A O    5  
ATOM 9723  C CB   . LYS A 1 67 ? 14.602  10.736  5.293   1.00 0.00 ? 71 LYS A CB   5  
ATOM 9724  C CG   . LYS A 1 67 ? 15.862  9.883   5.124   1.00 0.00 ? 71 LYS A CG   5  
ATOM 9725  C CD   . LYS A 1 67 ? 16.776  10.465  4.044   1.00 0.00 ? 71 LYS A CD   5  
ATOM 9726  C CE   . LYS A 1 67 ? 16.340  10.007  2.651   1.00 0.00 ? 71 LYS A CE   5  
ATOM 9727  N NZ   . LYS A 1 67 ? 16.560  11.084  1.659   1.00 0.00 ? 71 LYS A NZ   5  
ATOM 9728  H H    . LYS A 1 67 ? 12.612  12.057  7.152   1.00 0.00 ? 71 LYS A H    5  
ATOM 9729  H HA   . LYS A 1 67 ? 15.100  10.634  7.356   1.00 0.00 ? 71 LYS A HA   5  
ATOM 9730  H HB2  . LYS A 1 67 ? 13.721  10.139  5.060   1.00 0.00 ? 71 LYS A HB2  5  
ATOM 9731  H HB3  . LYS A 1 67 ? 14.622  11.564  4.585   1.00 0.00 ? 71 LYS A HB3  5  
ATOM 9732  H HG2  . LYS A 1 67 ? 16.399  9.830   6.071   1.00 0.00 ? 71 LYS A HG2  5  
ATOM 9733  H HG3  . LYS A 1 67 ? 15.582  8.864   4.858   1.00 0.00 ? 71 LYS A HG3  5  
ATOM 9734  H HD2  . LYS A 1 67 ? 16.759  11.554  4.095   1.00 0.00 ? 71 LYS A HD2  5  
ATOM 9735  H HD3  . LYS A 1 67 ? 17.805  10.154  4.228   1.00 0.00 ? 71 LYS A HD3  5  
ATOM 9736  H HE2  . LYS A 1 67 ? 16.901  9.118   2.362   1.00 0.00 ? 71 LYS A HE2  5  
ATOM 9737  H HE3  . LYS A 1 67 ? 15.287  9.728   2.667   1.00 0.00 ? 71 LYS A HE3  5  
ATOM 9738  H HZ1  . LYS A 1 67 ? 16.118  11.923  1.976   1.00 0.00 ? 71 LYS A HZ1  5  
ATOM 9739  H HZ2  . LYS A 1 67 ? 17.541  11.243  1.552   1.00 0.00 ? 71 LYS A HZ2  5  
ATOM 9740  H HZ3  . LYS A 1 67 ? 16.168  10.812  0.780   1.00 0.00 ? 71 LYS A HZ3  5  
ATOM 9741  N N    . SER A 1 68 ? 14.423  13.598  6.065   1.00 0.00 ? 72 SER A N    5  
ATOM 9742  C CA   . SER A 1 68 ? 14.802  15.000  6.097   1.00 0.00 ? 72 SER A CA   5  
ATOM 9743  C C    . SER A 1 68 ? 16.198  15.179  5.497   1.00 0.00 ? 72 SER A C    5  
ATOM 9744  O O    . SER A 1 68 ? 17.175  15.346  6.226   1.00 0.00 ? 72 SER A O    5  
ATOM 9745  C CB   . SER A 1 68 ? 14.764  15.548  7.526   1.00 0.00 ? 72 SER A CB   5  
ATOM 9746  O OG   . SER A 1 68 ? 14.422  16.931  7.558   1.00 0.00 ? 72 SER A OG   5  
ATOM 9747  H H    . SER A 1 68 ? 13.711  13.368  5.401   1.00 0.00 ? 72 SER A H    5  
ATOM 9748  H HA   . SER A 1 68 ? 14.056  15.515  5.492   1.00 0.00 ? 72 SER A HA   5  
ATOM 9749  H HB2  . SER A 1 68 ? 14.041  14.981  8.112   1.00 0.00 ? 72 SER A HB2  5  
ATOM 9750  H HB3  . SER A 1 68 ? 15.738  15.404  7.995   1.00 0.00 ? 72 SER A HB3  5  
ATOM 9751  H HG   . SER A 1 68 ? 13.654  17.107  6.942   1.00 0.00 ? 72 SER A HG   5  
ATOM 9752  N N    . ASN A 1 69 ? 16.248  15.138  4.174   1.00 0.00 ? 73 ASN A N    5  
ATOM 9753  C CA   . ASN A 1 69 ? 17.508  15.294  3.467   1.00 0.00 ? 73 ASN A CA   5  
ATOM 9754  C C    . ASN A 1 69 ? 18.057  16.700  3.716   1.00 0.00 ? 73 ASN A C    5  
ATOM 9755  O O    . ASN A 1 69 ? 17.408  17.518  4.366   1.00 0.00 ? 73 ASN A O    5  
ATOM 9756  C CB   . ASN A 1 69 ? 17.319  15.120  1.959   1.00 0.00 ? 73 ASN A CB   5  
ATOM 9757  C CG   . ASN A 1 69 ? 18.663  15.165  1.229   1.00 0.00 ? 73 ASN A CG   5  
ATOM 9758  O OD1  . ASN A 1 69 ? 19.709  15.394  1.814   1.00 0.00 ? 73 ASN A OD1  5  
ATOM 9759  N ND2  . ASN A 1 69 ? 18.576  14.935  -0.078  1.00 0.00 ? 73 ASN A ND2  5  
ATOM 9760  H H    . ASN A 1 69 ? 15.449  15.002  3.588   1.00 0.00 ? 73 ASN A H    5  
ATOM 9761  H HA   . ASN A 1 69 ? 18.158  14.515  3.867   1.00 0.00 ? 73 ASN A HA   5  
ATOM 9762  H HB2  . ASN A 1 69 ? 16.824  14.170  1.758   1.00 0.00 ? 73 ASN A HB2  5  
ATOM 9763  H HB3  . ASN A 1 69 ? 16.667  15.906  1.578   1.00 0.00 ? 73 ASN A HB3  5  
ATOM 9764  H HD21 . ASN A 1 69 ? 17.686  14.754  -0.496  1.00 0.00 ? 73 ASN A HD21 5  
ATOM 9765  H HD22 . ASN A 1 69 ? 19.401  14.944  -0.643  1.00 0.00 ? 73 ASN A HD22 5  
ATOM 9766  N N    . THR B 1 1  ? 15.945  17.017  -13.132 1.00 0.00 ? 5  THR B N    5  
ATOM 9767  C CA   . THR B 1 1  ? 15.451  16.327  -11.952 1.00 0.00 ? 5  THR B CA   5  
ATOM 9768  C C    . THR B 1 1  ? 14.387  17.171  -11.247 1.00 0.00 ? 5  THR B C    5  
ATOM 9769  O O    . THR B 1 1  ? 14.500  17.448  -10.054 1.00 0.00 ? 5  THR B O    5  
ATOM 9770  C CB   . THR B 1 1  ? 16.650  15.993  -11.062 1.00 0.00 ? 5  THR B CB   5  
ATOM 9771  O OG1  . THR B 1 1  ? 16.073  15.354  -9.927  1.00 0.00 ? 5  THR B OG1  5  
ATOM 9772  C CG2  . THR B 1 1  ? 17.318  17.244  -10.487 1.00 0.00 ? 5  THR B CG2  5  
ATOM 9773  H H    . THR B 1 1  ? 16.223  17.966  -12.981 1.00 0.00 ? 5  THR B H    5  
ATOM 9774  H HA   . THR B 1 1  ? 14.967  15.404  -12.272 1.00 0.00 ? 5  THR B HA   5  
ATOM 9775  H HB   . THR B 1 1  ? 17.373  15.377  -11.598 1.00 0.00 ? 5  THR B HB   5  
ATOM 9776  H HG1  . THR B 1 1  ? 16.784  15.139  -9.257  1.00 0.00 ? 5  THR B HG1  5  
ATOM 9777  H HG21 . THR B 1 1  ? 17.272  18.050  -11.219 1.00 0.00 ? 5  THR B HG21 5  
ATOM 9778  H HG22 . THR B 1 1  ? 16.799  17.548  -9.578  1.00 0.00 ? 5  THR B HG22 5  
ATOM 9779  H HG23 . THR B 1 1  ? 18.360  17.025  -10.254 1.00 0.00 ? 5  THR B HG23 5  
ATOM 9780  N N    . GLU B 1 2  ? 13.379  17.556  -12.015 1.00 0.00 ? 6  GLU B N    5  
ATOM 9781  C CA   . GLU B 1 2  ? 12.296  18.363  -11.479 1.00 0.00 ? 6  GLU B CA   5  
ATOM 9782  C C    . GLU B 1 2  ? 10.999  17.551  -11.437 1.00 0.00 ? 6  GLU B C    5  
ATOM 9783  O O    . GLU B 1 2  ? 10.178  17.640  -12.349 1.00 0.00 ? 6  GLU B O    5  
ATOM 9784  C CB   . GLU B 1 2  ? 12.113  19.646  -12.292 1.00 0.00 ? 6  GLU B CB   5  
ATOM 9785  C CG   . GLU B 1 2  ? 11.432  20.732  -11.457 1.00 0.00 ? 6  GLU B CG   5  
ATOM 9786  C CD   . GLU B 1 2  ? 12.359  21.232  -10.347 1.00 0.00 ? 6  GLU B CD   5  
ATOM 9787  O OE1  . GLU B 1 2  ? 13.455  21.719  -10.698 1.00 0.00 ? 6  GLU B OE1  5  
ATOM 9788  O OE2  . GLU B 1 2  ? 11.950  21.116  -9.171  1.00 0.00 ? 6  GLU B OE2  5  
ATOM 9789  H H    . GLU B 1 2  ? 13.294  17.326  -12.985 1.00 0.00 ? 6  GLU B H    5  
ATOM 9790  H HA   . GLU B 1 2  ? 12.602  18.623  -10.466 1.00 0.00 ? 6  GLU B HA   5  
ATOM 9791  H HB2  . GLU B 1 2  ? 13.084  20.003  -12.638 1.00 0.00 ? 6  GLU B HB2  5  
ATOM 9792  H HB3  . GLU B 1 2  ? 11.516  19.437  -13.180 1.00 0.00 ? 6  GLU B HB3  5  
ATOM 9793  H HG2  . GLU B 1 2  ? 11.147  21.565  -12.100 1.00 0.00 ? 6  GLU B HG2  5  
ATOM 9794  H HG3  . GLU B 1 2  ? 10.515  20.338  -11.020 1.00 0.00 ? 6  GLU B HG3  5  
ATOM 9795  N N    . LEU B 1 3  ? 10.856  16.778  -10.371 1.00 0.00 ? 7  LEU B N    5  
ATOM 9796  C CA   . LEU B 1 3  ? 9.674   15.952  -10.198 1.00 0.00 ? 7  LEU B CA   5  
ATOM 9797  C C    . LEU B 1 3  ? 8.786   16.559  -9.111  1.00 0.00 ? 7  LEU B C    5  
ATOM 9798  O O    . LEU B 1 3  ? 9.211   17.460  -8.389  1.00 0.00 ? 7  LEU B O    5  
ATOM 9799  C CB   . LEU B 1 3  ? 10.071  14.499  -9.928  1.00 0.00 ? 7  LEU B CB   5  
ATOM 9800  C CG   . LEU B 1 3  ? 10.795  13.778  -11.067 1.00 0.00 ? 7  LEU B CG   5  
ATOM 9801  C CD1  . LEU B 1 3  ? 12.305  14.012  -10.991 1.00 0.00 ? 7  LEU B CD1  5  
ATOM 9802  C CD2  . LEU B 1 3  ? 10.446  12.289  -11.083 1.00 0.00 ? 7  LEU B CD2  5  
ATOM 9803  H H    . LEU B 1 3  ? 11.529  16.712  -9.634  1.00 0.00 ? 7  LEU B H    5  
ATOM 9804  H HA   . LEU B 1 3  ? 9.125   15.966  -11.140 1.00 0.00 ? 7  LEU B HA   5  
ATOM 9805  H HB2  . LEU B 1 3  ? 10.710  14.476  -9.045  1.00 0.00 ? 7  LEU B HB2  5  
ATOM 9806  H HB3  . LEU B 1 3  ? 9.169   13.937  -9.683  1.00 0.00 ? 7  LEU B HB3  5  
ATOM 9807  H HG   . LEU B 1 3  ? 10.451  14.200  -12.011 1.00 0.00 ? 7  LEU B HG   5  
ATOM 9808  H HD11 . LEU B 1 3  ? 12.571  14.347  -9.988  1.00 0.00 ? 7  LEU B HD11 5  
ATOM 9809  H HD12 . LEU B 1 3  ? 12.828  13.082  -11.213 1.00 0.00 ? 7  LEU B HD12 5  
ATOM 9810  H HD13 . LEU B 1 3  ? 12.592  14.773  -11.717 1.00 0.00 ? 7  LEU B HD13 5  
ATOM 9811  H HD21 . LEU B 1 3  ? 10.074  11.992  -10.102 1.00 0.00 ? 7  LEU B HD21 5  
ATOM 9812  H HD22 . LEU B 1 3  ? 9.677   12.104  -11.833 1.00 0.00 ? 7  LEU B HD22 5  
ATOM 9813  H HD23 . LEU B 1 3  ? 11.336  11.709  -11.325 1.00 0.00 ? 7  LEU B HD23 5  
ATOM 9814  N N    . ARG B 1 4  ? 7.569   16.042  -9.028  1.00 0.00 ? 8  ARG B N    5  
ATOM 9815  C CA   . ARG B 1 4  ? 6.617   16.523  -8.040  1.00 0.00 ? 8  ARG B CA   5  
ATOM 9816  C C    . ARG B 1 4  ? 5.912   15.345  -7.366  1.00 0.00 ? 8  ARG B C    5  
ATOM 9817  O O    . ARG B 1 4  ? 6.516   14.294  -7.153  1.00 0.00 ? 8  ARG B O    5  
ATOM 9818  C CB   . ARG B 1 4  ? 5.571   17.435  -8.683  1.00 0.00 ? 8  ARG B CB   5  
ATOM 9819  C CG   . ARG B 1 4  ? 6.218   18.392  -9.685  1.00 0.00 ? 8  ARG B CG   5  
ATOM 9820  C CD   . ARG B 1 4  ? 5.617   19.795  -9.572  1.00 0.00 ? 8  ARG B CD   5  
ATOM 9821  N NE   . ARG B 1 4  ? 5.179   20.267  -10.905 1.00 0.00 ? 8  ARG B NE   5  
ATOM 9822  C CZ   . ARG B 1 4  ? 4.614   21.460  -11.130 1.00 0.00 ? 8  ARG B CZ   5  
ATOM 9823  N NH1  . ARG B 1 4  ? 4.414   22.310  -10.114 1.00 0.00 ? 8  ARG B NH1  5  
ATOM 9824  N NH2  . ARG B 1 4  ? 4.248   21.804  -12.373 1.00 0.00 ? 8  ARG B NH2  5  
ATOM 9825  H H    . ARG B 1 4  ? 7.231   15.310  -9.619  1.00 0.00 ? 8  ARG B H    5  
ATOM 9826  H HA   . ARG B 1 4  ? 7.218   17.083  -7.324  1.00 0.00 ? 8  ARG B HA   5  
ATOM 9827  H HB2  . ARG B 1 4  ? 4.816   16.831  -9.186  1.00 0.00 ? 8  ARG B HB2  5  
ATOM 9828  H HB3  . ARG B 1 4  ? 5.057   18.006  -7.909  1.00 0.00 ? 8  ARG B HB3  5  
ATOM 9829  H HG2  . ARG B 1 4  ? 7.293   18.438  -9.508  1.00 0.00 ? 8  ARG B HG2  5  
ATOM 9830  H HG3  . ARG B 1 4  ? 6.079   18.013  -10.698 1.00 0.00 ? 8  ARG B HG3  5  
ATOM 9831  H HD2  . ARG B 1 4  ? 4.771   19.782  -8.885  1.00 0.00 ? 8  ARG B HD2  5  
ATOM 9832  H HD3  . ARG B 1 4  ? 6.354   20.483  -9.158  1.00 0.00 ? 8  ARG B HD3  5  
ATOM 9833  H HE   . ARG B 1 4  ? 5.313   19.656  -11.686 1.00 0.00 ? 8  ARG B HE   5  
ATOM 9834  H HH11 . ARG B 1 4  ? 4.687   22.053  -9.187  1.00 0.00 ? 8  ARG B HH11 5  
ATOM 9835  H HH12 . ARG B 1 4  ? 3.992   23.201  -10.282 1.00 0.00 ? 8  ARG B HH12 5  
ATOM 9836  H HH21 . ARG B 1 4  ? 4.396   21.170  -13.131 1.00 0.00 ? 8  ARG B HH21 5  
ATOM 9837  H HH22 . ARG B 1 4  ? 3.826   22.695  -12.541 1.00 0.00 ? 8  ARG B HH22 5  
ATOM 9838  N N    . CYS B 1 5  ? 4.643   15.559  -7.048  1.00 0.00 ? 9  CYS B N    5  
ATOM 9839  C CA   . CYS B 1 5  ? 3.849   14.528  -6.402  1.00 0.00 ? 9  CYS B CA   5  
ATOM 9840  C C    . CYS B 1 5  ? 3.106   13.744  -7.486  1.00 0.00 ? 9  CYS B C    5  
ATOM 9841  O O    . CYS B 1 5  ? 2.727   14.304  -8.513  1.00 0.00 ? 9  CYS B O    5  
ATOM 9842  C CB   . CYS B 1 5  ? 2.891   15.118  -5.366  1.00 0.00 ? 9  CYS B CB   5  
ATOM 9843  S SG   . CYS B 1 5  ? 3.682   16.188  -4.111  1.00 0.00 ? 9  CYS B SG   5  
ATOM 9844  H H    . CYS B 1 5  ? 4.160   16.416  -7.225  1.00 0.00 ? 9  CYS B H    5  
ATOM 9845  H HA   . CYS B 1 5  ? 4.548   13.883  -5.868  1.00 0.00 ? 9  CYS B HA   5  
ATOM 9846  H HB2  . CYS B 1 5  ? 2.127   15.696  -5.887  1.00 0.00 ? 9  CYS B HB2  5  
ATOM 9847  H HB3  . CYS B 1 5  ? 2.380   14.300  -4.857  1.00 0.00 ? 9  CYS B HB3  5  
ATOM 9848  N N    . GLN B 1 6  ? 2.921   12.459  -7.220  1.00 0.00 ? 10 GLN B N    5  
ATOM 9849  C CA   . GLN B 1 6  ? 2.230   11.593  -8.160  1.00 0.00 ? 10 GLN B CA   5  
ATOM 9850  C C    . GLN B 1 6  ? 0.716   11.761  -8.022  1.00 0.00 ? 10 GLN B C    5  
ATOM 9851  O O    . GLN B 1 6  ? -0.049  11.184  -8.794  1.00 0.00 ? 10 GLN B O    5  
ATOM 9852  C CB   . GLN B 1 6  ? 2.640   10.132  -7.962  1.00 0.00 ? 10 GLN B CB   5  
ATOM 9853  C CG   . GLN B 1 6  ? 2.716   9.397   -9.302  1.00 0.00 ? 10 GLN B CG   5  
ATOM 9854  C CD   . GLN B 1 6  ? 1.723   8.233   -9.346  1.00 0.00 ? 10 GLN B CD   5  
ATOM 9855  O OE1  . GLN B 1 6  ? 0.710   8.273   -10.024 1.00 0.00 ? 10 GLN B OE1  5  
ATOM 9856  N NE2  . GLN B 1 6  ? 2.070   7.198   -8.587  1.00 0.00 ? 10 GLN B NE2  5  
ATOM 9857  H H    . GLN B 1 6  ? 3.233   12.011  -6.382  1.00 0.00 ? 10 GLN B H    5  
ATOM 9858  H HA   . GLN B 1 6  ? 2.551   11.923  -9.148  1.00 0.00 ? 10 GLN B HA   5  
ATOM 9859  H HB2  . GLN B 1 6  ? 3.608   10.086  -7.463  1.00 0.00 ? 10 GLN B HB2  5  
ATOM 9860  H HB3  . GLN B 1 6  ? 1.922   9.634   -7.310  1.00 0.00 ? 10 GLN B HB3  5  
ATOM 9861  H HG2  . GLN B 1 6  ? 2.503   10.092  -10.114 1.00 0.00 ? 10 GLN B HG2  5  
ATOM 9862  H HG3  . GLN B 1 6  ? 3.727   9.023   -9.459  1.00 0.00 ? 10 GLN B HG3  5  
ATOM 9863  H HE21 . GLN B 1 6  ? 2.916   7.229   -8.055  1.00 0.00 ? 10 GLN B HE21 5  
ATOM 9864  H HE22 . GLN B 1 6  ? 1.485   6.387   -8.549  1.00 0.00 ? 10 GLN B HE22 5  
ATOM 9865  N N    . CYS B 1 7  ? 0.328   12.553  -7.034  1.00 0.00 ? 11 CYS B N    5  
ATOM 9866  C CA   . CYS B 1 7  ? -1.082  12.804  -6.786  1.00 0.00 ? 11 CYS B CA   5  
ATOM 9867  C C    . CYS B 1 7  ? -1.236  14.253  -6.318  1.00 0.00 ? 11 CYS B C    5  
ATOM 9868  O O    . CYS B 1 7  ? -0.455  14.730  -5.497  1.00 0.00 ? 11 CYS B O    5  
ATOM 9869  C CB   . CYS B 1 7  ? -1.663  11.813  -5.775  1.00 0.00 ? 11 CYS B CB   5  
ATOM 9870  S SG   . CYS B 1 7  ? -3.065  10.815  -6.399  1.00 0.00 ? 11 CYS B SG   5  
ATOM 9871  H H    . CYS B 1 7  ? 0.956   13.018  -6.411  1.00 0.00 ? 11 CYS B H    5  
ATOM 9872  H HA   . CYS B 1 7  ? -1.600  12.645  -7.731  1.00 0.00 ? 11 CYS B HA   5  
ATOM 9873  H HB2  . CYS B 1 7  ? -0.871  11.139  -5.451  1.00 0.00 ? 11 CYS B HB2  5  
ATOM 9874  H HB3  . CYS B 1 7  ? -1.992  12.365  -4.894  1.00 0.00 ? 11 CYS B HB3  5  
ATOM 9875  N N    . LEU B 1 8  ? -2.250  14.911  -6.862  1.00 0.00 ? 12 LEU B N    5  
ATOM 9876  C CA   . LEU B 1 8  ? -2.517  16.296  -6.510  1.00 0.00 ? 12 LEU B CA   5  
ATOM 9877  C C    . LEU B 1 8  ? -3.720  16.355  -5.567  1.00 0.00 ? 12 LEU B C    5  
ATOM 9878  O O    . LEU B 1 8  ? -3.950  17.370  -4.912  1.00 0.00 ? 12 LEU B O    5  
ATOM 9879  C CB   . LEU B 1 8  ? -2.681  17.146  -7.772  1.00 0.00 ? 12 LEU B CB   5  
ATOM 9880  C CG   . LEU B 1 8  ? -1.675  16.883  -8.894  1.00 0.00 ? 12 LEU B CG   5  
ATOM 9881  C CD1  . LEU B 1 8  ? -2.279  17.215  -10.260 1.00 0.00 ? 12 LEU B CD1  5  
ATOM 9882  C CD2  . LEU B 1 8  ? -0.368  17.638  -8.646  1.00 0.00 ? 12 LEU B CD2  5  
ATOM 9883  H H    . LEU B 1 8  ? -2.880  14.515  -7.529  1.00 0.00 ? 12 LEU B H    5  
ATOM 9884  H HA   . LEU B 1 8  ? -1.643  16.672  -5.979  1.00 0.00 ? 12 LEU B HA   5  
ATOM 9885  H HB2  . LEU B 1 8  ? -3.685  16.986  -8.165  1.00 0.00 ? 12 LEU B HB2  5  
ATOM 9886  H HB3  . LEU B 1 8  ? -2.614  18.197  -7.489  1.00 0.00 ? 12 LEU B HB3  5  
ATOM 9887  H HG   . LEU B 1 8  ? -1.437  15.819  -8.897  1.00 0.00 ? 12 LEU B HG   5  
ATOM 9888  H HD11 . LEU B 1 8  ? -3.216  16.672  -10.385 1.00 0.00 ? 12 LEU B HD11 5  
ATOM 9889  H HD12 . LEU B 1 8  ? -2.469  18.286  -10.323 1.00 0.00 ? 12 LEU B HD12 5  
ATOM 9890  H HD13 . LEU B 1 8  ? -1.582  16.923  -11.046 1.00 0.00 ? 12 LEU B HD13 5  
ATOM 9891  H HD21 . LEU B 1 8  ? -0.518  18.376  -7.859  1.00 0.00 ? 12 LEU B HD21 5  
ATOM 9892  H HD22 . LEU B 1 8  ? 0.406   16.933  -8.341  1.00 0.00 ? 12 LEU B HD22 5  
ATOM 9893  H HD23 . LEU B 1 8  ? -0.060  18.141  -9.563  1.00 0.00 ? 12 LEU B HD23 5  
ATOM 9894  N N    . GLN B 1 9  ? -4.456  15.254  -5.529  1.00 0.00 ? 13 GLN B N    5  
ATOM 9895  C CA   . GLN B 1 9  ? -5.630  15.168  -4.677  1.00 0.00 ? 13 GLN B CA   5  
ATOM 9896  C C    . GLN B 1 9  ? -5.645  13.835  -3.926  1.00 0.00 ? 13 GLN B C    5  
ATOM 9897  O O    . GLN B 1 9  ? -4.820  12.961  -4.189  1.00 0.00 ? 13 GLN B O    5  
ATOM 9898  C CB   . GLN B 1 9  ? -6.913  15.354  -5.490  1.00 0.00 ? 13 GLN B CB   5  
ATOM 9899  C CG   . GLN B 1 9  ? -7.991  16.056  -4.661  1.00 0.00 ? 13 GLN B CG   5  
ATOM 9900  C CD   . GLN B 1 9  ? -8.672  17.161  -5.471  1.00 0.00 ? 13 GLN B CD   5  
ATOM 9901  O OE1  . GLN B 1 9  ? -8.067  18.150  -5.850  1.00 0.00 ? 13 GLN B OE1  5  
ATOM 9902  N NE2  . GLN B 1 9  ? -9.960  16.939  -5.713  1.00 0.00 ? 13 GLN B NE2  5  
ATOM 9903  H H    . GLN B 1 9  ? -4.263  14.433  -6.065  1.00 0.00 ? 13 GLN B H    5  
ATOM 9904  H HA   . GLN B 1 9  ? -5.534  15.991  -3.968  1.00 0.00 ? 13 GLN B HA   5  
ATOM 9905  H HB2  . GLN B 1 9  ? -6.699  15.939  -6.385  1.00 0.00 ? 13 GLN B HB2  5  
ATOM 9906  H HB3  . GLN B 1 9  ? -7.280  14.383  -5.824  1.00 0.00 ? 13 GLN B HB3  5  
ATOM 9907  H HG2  . GLN B 1 9  ? -8.734  15.328  -4.335  1.00 0.00 ? 13 GLN B HG2  5  
ATOM 9908  H HG3  . GLN B 1 9  ? -7.544  16.481  -3.762  1.00 0.00 ? 13 GLN B HG3  5  
ATOM 9909  H HE21 . GLN B 1 9  ? -10.397 16.105  -5.373  1.00 0.00 ? 13 GLN B HE21 5  
ATOM 9910  H HE22 . GLN B 1 9  ? -10.493 17.604  -6.235  1.00 0.00 ? 13 GLN B HE22 5  
ATOM 9911  N N    . THR B 1 10 ? -6.592  13.721  -3.007  1.00 0.00 ? 14 THR B N    5  
ATOM 9912  C CA   . THR B 1 10 ? -6.725  12.509  -2.216  1.00 0.00 ? 14 THR B CA   5  
ATOM 9913  C C    . THR B 1 10 ? -8.143  12.391  -1.655  1.00 0.00 ? 14 THR B C    5  
ATOM 9914  O O    . THR B 1 10 ? -8.904  13.358  -1.672  1.00 0.00 ? 14 THR B O    5  
ATOM 9915  C CB   . THR B 1 10 ? -5.643  12.528  -1.135  1.00 0.00 ? 14 THR B CB   5  
ATOM 9916  O OG1  . THR B 1 10 ? -5.717  13.845  -0.593  1.00 0.00 ? 14 THR B OG1  5  
ATOM 9917  C CG2  . THR B 1 10 ? -4.231  12.444  -1.717  1.00 0.00 ? 14 THR B CG2  5  
ATOM 9918  H H    . THR B 1 10 ? -7.259  14.436  -2.799  1.00 0.00 ? 14 THR B H    5  
ATOM 9919  H HA   . THR B 1 10 ? -6.568  11.652  -2.872  1.00 0.00 ? 14 THR B HA   5  
ATOM 9920  H HB   . THR B 1 10 ? -5.810  11.738  -0.403  1.00 0.00 ? 14 THR B HB   5  
ATOM 9921  H HG1  . THR B 1 10 ? -5.322  13.860  0.325   1.00 0.00 ? 14 THR B HG1  5  
ATOM 9922  H HG21 . THR B 1 10 ? -4.184  11.631  -2.441  1.00 0.00 ? 14 THR B HG21 5  
ATOM 9923  H HG22 . THR B 1 10 ? -3.985  13.385  -2.210  1.00 0.00 ? 14 THR B HG22 5  
ATOM 9924  H HG23 . THR B 1 10 ? -3.517  12.257  -0.915  1.00 0.00 ? 14 THR B HG23 5  
ATOM 9925  N N    . LEU B 1 11 ? -8.457  11.198  -1.171  1.00 0.00 ? 15 LEU B N    5  
ATOM 9926  C CA   . LEU B 1 11 ? -9.770  10.942  -0.605  1.00 0.00 ? 15 LEU B CA   5  
ATOM 9927  C C    . LEU B 1 11 ? -9.662  10.884  0.920   1.00 0.00 ? 15 LEU B C    5  
ATOM 9928  O O    . LEU B 1 11 ? -8.564  10.946  1.470   1.00 0.00 ? 15 LEU B O    5  
ATOM 9929  C CB   . LEU B 1 11 ? -10.385 9.686   -1.226  1.00 0.00 ? 15 LEU B CB   5  
ATOM 9930  C CG   . LEU B 1 11 ? -10.679 9.754   -2.726  1.00 0.00 ? 15 LEU B CG   5  
ATOM 9931  C CD1  . LEU B 1 11 ? -10.574 8.370   -3.369  1.00 0.00 ? 15 LEU B CD1  5  
ATOM 9932  C CD2  . LEU B 1 11 ? -12.037 10.407  -2.990  1.00 0.00 ? 15 LEU B CD2  5  
ATOM 9933  H H    . LEU B 1 11 ? -7.832  10.417  -1.160  1.00 0.00 ? 15 LEU B H    5  
ATOM 9934  H HA   . LEU B 1 11 ? -10.412 11.781  -0.874  1.00 0.00 ? 15 LEU B HA   5  
ATOM 9935  H HB2  . LEU B 1 11 ? -9.711  8.848   -1.046  1.00 0.00 ? 15 LEU B HB2  5  
ATOM 9936  H HB3  . LEU B 1 11 ? -11.315 9.464   -0.704  1.00 0.00 ? 15 LEU B HB3  5  
ATOM 9937  H HG   . LEU B 1 11 ? -9.922  10.384  -3.194  1.00 0.00 ? 15 LEU B HG   5  
ATOM 9938  H HD11 . LEU B 1 11 ? -10.589 7.606   -2.591  1.00 0.00 ? 15 LEU B HD11 5  
ATOM 9939  H HD12 . LEU B 1 11 ? -11.417 8.218   -4.044  1.00 0.00 ? 15 LEU B HD12 5  
ATOM 9940  H HD13 . LEU B 1 11 ? -9.642  8.299   -3.930  1.00 0.00 ? 15 LEU B HD13 5  
ATOM 9941  H HD21 . LEU B 1 11 ? -12.654 10.336  -2.094  1.00 0.00 ? 15 LEU B HD21 5  
ATOM 9942  H HD22 . LEU B 1 11 ? -11.892 11.456  -3.248  1.00 0.00 ? 15 LEU B HD22 5  
ATOM 9943  H HD23 . LEU B 1 11 ? -12.533 9.895   -3.814  1.00 0.00 ? 15 LEU B HD23 5  
ATOM 9944  N N    . GLN B 1 12 ? -10.816 10.764  1.559   1.00 0.00 ? 16 GLN B N    5  
ATOM 9945  C CA   . GLN B 1 12 ? -10.865 10.697  3.010   1.00 0.00 ? 16 GLN B CA   5  
ATOM 9946  C C    . GLN B 1 12 ? -10.681 9.253   3.481   1.00 0.00 ? 16 GLN B C    5  
ATOM 9947  O O    . GLN B 1 12 ? -10.472 9.005   4.667   1.00 0.00 ? 16 GLN B O    5  
ATOM 9948  C CB   . GLN B 1 12 ? -12.173 11.285  3.542   1.00 0.00 ? 16 GLN B CB   5  
ATOM 9949  C CG   . GLN B 1 12 ? -12.414 10.864  4.993   1.00 0.00 ? 16 GLN B CG   5  
ATOM 9950  C CD   . GLN B 1 12 ? -13.319 11.865  5.713   1.00 0.00 ? 16 GLN B CD   5  
ATOM 9951  O OE1  . GLN B 1 12 ? -13.191 12.116  6.900   1.00 0.00 ? 16 GLN B OE1  5  
ATOM 9952  N NE2  . GLN B 1 12 ? -14.239 12.422  4.930   1.00 0.00 ? 16 GLN B NE2  5  
ATOM 9953  H H    . GLN B 1 12 ? -11.705 10.714  1.104   1.00 0.00 ? 16 GLN B H    5  
ATOM 9954  H HA   . GLN B 1 12 ? -10.032 11.308  3.356   1.00 0.00 ? 16 GLN B HA   5  
ATOM 9955  H HB2  . GLN B 1 12 ? -12.141 12.373  3.477   1.00 0.00 ? 16 GLN B HB2  5  
ATOM 9956  H HB3  . GLN B 1 12 ? -13.005 10.953  2.921   1.00 0.00 ? 16 GLN B HB3  5  
ATOM 9957  H HG2  . GLN B 1 12 ? -12.869 9.874   5.017   1.00 0.00 ? 16 GLN B HG2  5  
ATOM 9958  H HG3  . GLN B 1 12 ? -11.460 10.789  5.517   1.00 0.00 ? 16 GLN B HG3  5  
ATOM 9959  H HE21 . GLN B 1 12 ? -14.290 12.172  3.963   1.00 0.00 ? 16 GLN B HE21 5  
ATOM 9960  H HE22 . GLN B 1 12 ? -14.879 13.090  5.308   1.00 0.00 ? 16 GLN B HE22 5  
ATOM 9961  N N    . GLY B 1 13 ? -10.766 8.338   2.526   1.00 0.00 ? 17 GLY B N    5  
ATOM 9962  C CA   . GLY B 1 13 ? -10.612 6.925   2.829   1.00 0.00 ? 17 GLY B CA   5  
ATOM 9963  C C    . GLY B 1 13 ? -11.484 6.069   1.908   1.00 0.00 ? 17 GLY B C    5  
ATOM 9964  O O    . GLY B 1 13 ? -11.055 5.012   1.447   1.00 0.00 ? 17 GLY B O    5  
ATOM 9965  H H    . GLY B 1 13 ? -10.937 8.548   1.564   1.00 0.00 ? 17 GLY B H    5  
ATOM 9966  H HA2  . GLY B 1 13 ? -9.567  6.637   2.716   1.00 0.00 ? 17 GLY B HA2  5  
ATOM 9967  H HA3  . GLY B 1 13 ? -10.884 6.740   3.868   1.00 0.00 ? 17 GLY B HA3  5  
ATOM 9968  N N    . ILE B 1 14 ? -12.692 6.557   1.668   1.00 0.00 ? 18 ILE B N    5  
ATOM 9969  C CA   . ILE B 1 14 ? -13.628 5.850   0.810   1.00 0.00 ? 18 ILE B CA   5  
ATOM 9970  C C    . ILE B 1 14 ? -13.823 4.428   1.339   1.00 0.00 ? 18 ILE B C    5  
ATOM 9971  O O    . ILE B 1 14 ? -13.038 3.953   2.158   1.00 0.00 ? 18 ILE B O    5  
ATOM 9972  C CB   . ILE B 1 14 ? -13.167 5.906   -0.648  1.00 0.00 ? 18 ILE B CB   5  
ATOM 9973  C CG1  . ILE B 1 14 ? -13.561 7.234   -1.297  1.00 0.00 ? 18 ILE B CG1  5  
ATOM 9974  C CG2  . ILE B 1 14 ? -13.693 4.705   -1.436  1.00 0.00 ? 18 ILE B CG2  5  
ATOM 9975  C CD1  . ILE B 1 14 ? -13.405 7.169   -2.818  1.00 0.00 ? 18 ILE B CD1  5  
ATOM 9976  H H    . ILE B 1 14 ? -13.033 7.418   2.046   1.00 0.00 ? 18 ILE B H    5  
ATOM 9977  H HA   . ILE B 1 14 ? -14.582 6.374   0.866   1.00 0.00 ? 18 ILE B HA   5  
ATOM 9978  H HB   . ILE B 1 14 ? -12.078 5.850   -0.664  1.00 0.00 ? 18 ILE B HB   5  
ATOM 9979  H HG12 . ILE B 1 14 ? -14.593 7.475   -1.043  1.00 0.00 ? 18 ILE B HG12 5  
ATOM 9980  H HG13 . ILE B 1 14 ? -12.939 8.036   -0.898  1.00 0.00 ? 18 ILE B HG13 5  
ATOM 9981  H HG21 . ILE B 1 14 ? -13.420 3.784   -0.919  1.00 0.00 ? 18 ILE B HG21 5  
ATOM 9982  H HG22 . ILE B 1 14 ? -14.778 4.769   -1.515  1.00 0.00 ? 18 ILE B HG22 5  
ATOM 9983  H HG23 . ILE B 1 14 ? -13.254 4.705   -2.434  1.00 0.00 ? 18 ILE B HG23 5  
ATOM 9984  H HD11 . ILE B 1 14 ? -12.431 6.747   -3.065  1.00 0.00 ? 18 ILE B HD11 5  
ATOM 9985  H HD12 . ILE B 1 14 ? -14.191 6.540   -3.236  1.00 0.00 ? 18 ILE B HD12 5  
ATOM 9986  H HD13 . ILE B 1 14 ? -13.483 8.173   -3.234  1.00 0.00 ? 18 ILE B HD13 5  
ATOM 9987  N N    . HIS B 1 15 ? -14.875 3.787   0.849   1.00 0.00 ? 19 HIS B N    5  
ATOM 9988  C CA   . HIS B 1 15 ? -15.183 2.429   1.263   1.00 0.00 ? 19 HIS B CA   5  
ATOM 9989  C C    . HIS B 1 15 ? -14.023 1.504   0.890   1.00 0.00 ? 19 HIS B C    5  
ATOM 9990  O O    . HIS B 1 15 ? -13.315 1.751   -0.085  1.00 0.00 ? 19 HIS B O    5  
ATOM 9991  C CB   . HIS B 1 15 ? -16.519 1.972   0.673   1.00 0.00 ? 19 HIS B CB   5  
ATOM 9992  C CG   . HIS B 1 15 ? -17.420 1.274   1.664   1.00 0.00 ? 19 HIS B CG   5  
ATOM 9993  N ND1  . HIS B 1 15 ? -18.620 1.813   2.095   1.00 0.00 ? 19 HIS B ND1  5  
ATOM 9994  C CD2  . HIS B 1 15 ? -17.285 0.075   2.301   1.00 0.00 ? 19 HIS B CD2  5  
ATOM 9995  C CE1  . HIS B 1 15 ? -19.173 0.969   2.953   1.00 0.00 ? 19 HIS B CE1  5  
ATOM 9996  N NE2  . HIS B 1 15 ? -18.344 -0.107  3.080   1.00 0.00 ? 19 HIS B NE2  5  
ATOM 9997  H H    . HIS B 1 15 ? -15.509 4.181   0.184   1.00 0.00 ? 19 HIS B H    5  
ATOM 9998  H HA   . HIS B 1 15 ? -15.287 2.448   2.348   1.00 0.00 ? 19 HIS B HA   5  
ATOM 9999  H HB2  . HIS B 1 15 ? -17.042 2.839   0.270   1.00 0.00 ? 19 HIS B HB2  5  
ATOM 10000 H HB3  . HIS B 1 15 ? -16.324 1.299   -0.162  1.00 0.00 ? 19 HIS B HB3  5  
ATOM 10001 H HD1  . HIS B 1 15 ? -19.004 2.690   1.807   1.00 0.00 ? 19 HIS B HD1  5  
ATOM 10002 H HD2  . HIS B 1 15 ? -16.449 -0.615  2.189   1.00 0.00 ? 19 HIS B HD2  5  
ATOM 10003 H HE1  . HIS B 1 15 ? -20.123 1.109   3.468   1.00 0.00 ? 19 HIS B HE1  5  
ATOM 10004 N N    . LEU B 1 16 ? -13.864 0.457   1.687   1.00 0.00 ? 20 LEU B N    5  
ATOM 10005 C CA   . LEU B 1 16 ? -12.802 -0.507  1.453   1.00 0.00 ? 20 LEU B CA   5  
ATOM 10006 C C    . LEU B 1 16 ? -13.370 -1.715  0.706   1.00 0.00 ? 20 LEU B C    5  
ATOM 10007 O O    . LEU B 1 16 ? -12.691 -2.728  0.549   1.00 0.00 ? 20 LEU B O    5  
ATOM 10008 C CB   . LEU B 1 16 ? -12.108 -0.868  2.768   1.00 0.00 ? 20 LEU B CB   5  
ATOM 10009 C CG   . LEU B 1 16 ? -10.740 -1.543  2.641   1.00 0.00 ? 20 LEU B CG   5  
ATOM 10010 C CD1  . LEU B 1 16 ? -10.891 -3.042  2.376   1.00 0.00 ? 20 LEU B CD1  5  
ATOM 10011 C CD2  . LEU B 1 16 ? -9.887  -0.855  1.574   1.00 0.00 ? 20 LEU B CD2  5  
ATOM 10012 H H    . LEU B 1 16 ? -14.444 0.263   2.478   1.00 0.00 ? 20 LEU B H    5  
ATOM 10013 H HA   . LEU B 1 16 ? -12.058 -0.026  0.818   1.00 0.00 ? 20 LEU B HA   5  
ATOM 10014 H HB2  . LEU B 1 16 ? -11.988 0.042   3.355   1.00 0.00 ? 20 LEU B HB2  5  
ATOM 10015 H HB3  . LEU B 1 16 ? -12.765 -1.529  3.333   1.00 0.00 ? 20 LEU B HB3  5  
ATOM 10016 H HG   . LEU B 1 16 ? -10.217 -1.435  3.591   1.00 0.00 ? 20 LEU B HG   5  
ATOM 10017 H HD11 . LEU B 1 16 ? -11.927 -3.338  2.542   1.00 0.00 ? 20 LEU B HD11 5  
ATOM 10018 H HD12 . LEU B 1 16 ? -10.612 -3.259  1.345   1.00 0.00 ? 20 LEU B HD12 5  
ATOM 10019 H HD13 . LEU B 1 16 ? -10.242 -3.598  3.053   1.00 0.00 ? 20 LEU B HD13 5  
ATOM 10020 H HD21 . LEU B 1 16 ? -10.260 0.154   1.405   1.00 0.00 ? 20 LEU B HD21 5  
ATOM 10021 H HD22 . LEU B 1 16 ? -8.851  -0.808  1.912   1.00 0.00 ? 20 LEU B HD22 5  
ATOM 10022 H HD23 . LEU B 1 16 ? -9.940  -1.423  0.645   1.00 0.00 ? 20 LEU B HD23 5  
ATOM 10023 N N    . LYS B 1 17 ? -14.611 -1.567  0.264   1.00 0.00 ? 21 LYS B N    5  
ATOM 10024 C CA   . LYS B 1 17 ? -15.278 -2.633  -0.464  1.00 0.00 ? 21 LYS B CA   5  
ATOM 10025 C C    . LYS B 1 17 ? -14.953 -2.509  -1.954  1.00 0.00 ? 21 LYS B C    5  
ATOM 10026 O O    . LYS B 1 17 ? -15.067 -3.480  -2.700  1.00 0.00 ? 21 LYS B O    5  
ATOM 10027 C CB   . LYS B 1 17 ? -16.778 -2.632  -0.159  1.00 0.00 ? 21 LYS B CB   5  
ATOM 10028 C CG   . LYS B 1 17 ? -17.469 -1.434  -0.813  1.00 0.00 ? 21 LYS B CG   5  
ATOM 10029 C CD   . LYS B 1 17 ? -18.991 -1.559  -0.715  1.00 0.00 ? 21 LYS B CD   5  
ATOM 10030 C CE   . LYS B 1 17 ? -19.683 -0.368  -1.382  1.00 0.00 ? 21 LYS B CE   5  
ATOM 10031 N NZ   . LYS B 1 17 ? -20.669 0.241   -0.462  1.00 0.00 ? 21 LYS B NZ   5  
ATOM 10032 H H    . LYS B 1 17 ? -15.156 -0.739  0.395   1.00 0.00 ? 21 LYS B H    5  
ATOM 10033 H HA   . LYS B 1 17 ? -14.876 -3.578  -0.100  1.00 0.00 ? 21 LYS B HA   5  
ATOM 10034 H HB2  . LYS B 1 17 ? -17.227 -3.557  -0.521  1.00 0.00 ? 21 LYS B HB2  5  
ATOM 10035 H HB3  . LYS B 1 17 ? -16.933 -2.603  0.919   1.00 0.00 ? 21 LYS B HB3  5  
ATOM 10036 H HG2  . LYS B 1 17 ? -17.145 -0.513  -0.327  1.00 0.00 ? 21 LYS B HG2  5  
ATOM 10037 H HG3  . LYS B 1 17 ? -17.172 -1.364  -1.859  1.00 0.00 ? 21 LYS B HG3  5  
ATOM 10038 H HD2  . LYS B 1 17 ? -19.314 -2.485  -1.190  1.00 0.00 ? 21 LYS B HD2  5  
ATOM 10039 H HD3  . LYS B 1 17 ? -19.289 -1.617  0.332   1.00 0.00 ? 21 LYS B HD3  5  
ATOM 10040 H HE2  . LYS B 1 17 ? -18.940 0.375   -1.673  1.00 0.00 ? 21 LYS B HE2  5  
ATOM 10041 H HE3  . LYS B 1 17 ? -20.181 -0.694  -2.295  1.00 0.00 ? 21 LYS B HE3  5  
ATOM 10042 H HZ1  . LYS B 1 17 ? -20.919 -0.422  0.244   1.00 0.00 ? 21 LYS B HZ1  5  
ATOM 10043 H HZ2  . LYS B 1 17 ? -20.268 1.050   -0.032  1.00 0.00 ? 21 LYS B HZ2  5  
ATOM 10044 H HZ3  . LYS B 1 17 ? -21.485 0.505   -0.975  1.00 0.00 ? 21 LYS B HZ3  5  
ATOM 10045 N N    . ASN B 1 18 ? -14.555 -1.306  -2.342  1.00 0.00 ? 22 ASN B N    5  
ATOM 10046 C CA   . ASN B 1 18 ? -14.213 -1.043  -3.729  1.00 0.00 ? 22 ASN B CA   5  
ATOM 10047 C C    . ASN B 1 18 ? -12.701 -1.187  -3.913  1.00 0.00 ? 22 ASN B C    5  
ATOM 10048 O O    . ASN B 1 18 ? -12.241 -1.661  -4.951  1.00 0.00 ? 22 ASN B O    5  
ATOM 10049 C CB   . ASN B 1 18 ? -14.605 0.380   -4.133  1.00 0.00 ? 22 ASN B CB   5  
ATOM 10050 C CG   . ASN B 1 18 ? -15.951 0.392   -4.860  1.00 0.00 ? 22 ASN B CG   5  
ATOM 10051 O OD1  . ASN B 1 18 ? -16.163 -0.304  -5.839  1.00 0.00 ? 22 ASN B OD1  5  
ATOM 10052 N ND2  . ASN B 1 18 ? -16.846 1.221   -4.329  1.00 0.00 ? 22 ASN B ND2  5  
ATOM 10053 H H    . ASN B 1 18 ? -14.466 -0.522  -1.728  1.00 0.00 ? 22 ASN B H    5  
ATOM 10054 H HA   . ASN B 1 18 ? -14.775 -1.777  -4.307  1.00 0.00 ? 22 ASN B HA   5  
ATOM 10055 H HB2  . ASN B 1 18 ? -14.661 1.011   -3.246  1.00 0.00 ? 22 ASN B HB2  5  
ATOM 10056 H HB3  . ASN B 1 18 ? -13.835 0.804   -4.777  1.00 0.00 ? 22 ASN B HB3  5  
ATOM 10057 H HD21 . ASN B 1 18 ? -16.607 1.765   -3.524  1.00 0.00 ? 22 ASN B HD21 5  
ATOM 10058 H HD22 . ASN B 1 18 ? -17.757 1.300   -4.734  1.00 0.00 ? 22 ASN B HD22 5  
ATOM 10059 N N    . ILE B 1 19 ? -11.970 -0.769  -2.890  1.00 0.00 ? 23 ILE B N    5  
ATOM 10060 C CA   . ILE B 1 19 ? -10.520 -0.845  -2.926  1.00 0.00 ? 23 ILE B CA   5  
ATOM 10061 C C    . ILE B 1 19 ? -10.095 -2.302  -3.120  1.00 0.00 ? 23 ILE B C    5  
ATOM 10062 O O    . ILE B 1 19 ? -10.601 -3.196  -2.444  1.00 0.00 ? 23 ILE B O    5  
ATOM 10063 C CB   . ILE B 1 19 ? -9.918  -0.190  -1.681  1.00 0.00 ? 23 ILE B CB   5  
ATOM 10064 C CG1  . ILE B 1 19 ? -9.773  1.321   -1.873  1.00 0.00 ? 23 ILE B CG1  5  
ATOM 10065 C CG2  . ILE B 1 19 ? -8.590  -0.849  -1.302  1.00 0.00 ? 23 ILE B CG2  5  
ATOM 10066 C CD1  . ILE B 1 19 ? -10.239 2.079   -0.629  1.00 0.00 ? 23 ILE B CD1  5  
ATOM 10067 H H    . ILE B 1 19 ? -12.353 -0.384  -2.050  1.00 0.00 ? 23 ILE B H    5  
ATOM 10068 H HA   . ILE B 1 19 ? -10.183 -0.269  -3.788  1.00 0.00 ? 23 ILE B HA   5  
ATOM 10069 H HB   . ILE B 1 19 ? -10.604 -0.344  -0.848  1.00 0.00 ? 23 ILE B HB   5  
ATOM 10070 H HG12 . ILE B 1 19 ? -8.732  1.566   -2.084  1.00 0.00 ? 23 ILE B HG12 5  
ATOM 10071 H HG13 . ILE B 1 19 ? -10.356 1.639   -2.737  1.00 0.00 ? 23 ILE B HG13 5  
ATOM 10072 H HG21 . ILE B 1 19 ? -8.753  -1.911  -1.115  1.00 0.00 ? 23 ILE B HG21 5  
ATOM 10073 H HG22 . ILE B 1 19 ? -7.878  -0.729  -2.118  1.00 0.00 ? 23 ILE B HG22 5  
ATOM 10074 H HG23 . ILE B 1 19 ? -8.195  -0.378  -0.402  1.00 0.00 ? 23 ILE B HG23 5  
ATOM 10075 H HD11 . ILE B 1 19 ? -11.101 1.572   -0.196  1.00 0.00 ? 23 ILE B HD11 5  
ATOM 10076 H HD12 . ILE B 1 19 ? -9.431  2.110   0.102   1.00 0.00 ? 23 ILE B HD12 5  
ATOM 10077 H HD13 . ILE B 1 19 ? -10.518 3.096   -0.906  1.00 0.00 ? 23 ILE B HD13 5  
ATOM 10078 N N    . GLN B 1 20 ? -9.169  -2.496  -4.048  1.00 0.00 ? 24 GLN B N    5  
ATOM 10079 C CA   . GLN B 1 20 ? -8.670  -3.829  -4.339  1.00 0.00 ? 24 GLN B CA   5  
ATOM 10080 C C    . GLN B 1 20 ? -7.204  -3.952  -3.918  1.00 0.00 ? 24 GLN B C    5  
ATOM 10081 O O    . GLN B 1 20 ? -6.724  -5.049  -3.638  1.00 0.00 ? 24 GLN B O    5  
ATOM 10082 C CB   . GLN B 1 20 ? -8.844  -4.168  -5.821  1.00 0.00 ? 24 GLN B CB   5  
ATOM 10083 C CG   . GLN B 1 20 ? -9.375  -5.592  -6.000  1.00 0.00 ? 24 GLN B CG   5  
ATOM 10084 C CD   . GLN B 1 20 ? -8.259  -6.621  -5.809  1.00 0.00 ? 24 GLN B CD   5  
ATOM 10085 O OE1  . GLN B 1 20 ? -8.223  -7.365  -4.843  1.00 0.00 ? 24 GLN B OE1  5  
ATOM 10086 N NE2  . GLN B 1 20 ? -7.352  -6.621  -6.782  1.00 0.00 ? 24 GLN B NE2  5  
ATOM 10087 H H    . GLN B 1 20 ? -8.762  -1.764  -4.594  1.00 0.00 ? 24 GLN B H    5  
ATOM 10088 H HA   . GLN B 1 20 ? -9.284  -4.505  -3.744  1.00 0.00 ? 24 GLN B HA   5  
ATOM 10089 H HB2  . GLN B 1 20 ? -9.533  -3.459  -6.281  1.00 0.00 ? 24 GLN B HB2  5  
ATOM 10090 H HB3  . GLN B 1 20 ? -7.889  -4.065  -6.337  1.00 0.00 ? 24 GLN B HB3  5  
ATOM 10091 H HG2  . GLN B 1 20 ? -10.173 -5.779  -5.281  1.00 0.00 ? 24 GLN B HG2  5  
ATOM 10092 H HG3  . GLN B 1 20 ? -9.809  -5.700  -6.994  1.00 0.00 ? 24 GLN B HG3  5  
ATOM 10093 H HE21 . GLN B 1 20 ? -7.440  -5.984  -7.548  1.00 0.00 ? 24 GLN B HE21 5  
ATOM 10094 H HE22 . GLN B 1 20 ? -6.582  -7.259  -6.748  1.00 0.00 ? 24 GLN B HE22 5  
ATOM 10095 N N    . SER B 1 21 ? -6.533  -2.809  -3.887  1.00 0.00 ? 25 SER B N    5  
ATOM 10096 C CA   . SER B 1 21 ? -5.132  -2.775  -3.504  1.00 0.00 ? 25 SER B CA   5  
ATOM 10097 C C    . SER B 1 21 ? -4.764  -1.382  -2.989  1.00 0.00 ? 25 SER B C    5  
ATOM 10098 O O    . SER B 1 21 ? -5.499  -0.420  -3.211  1.00 0.00 ? 25 SER B O    5  
ATOM 10099 C CB   . SER B 1 21 ? -4.231  -3.161  -4.679  1.00 0.00 ? 25 SER B CB   5  
ATOM 10100 O OG   . SER B 1 21 ? -4.981  -3.444  -5.857  1.00 0.00 ? 25 SER B OG   5  
ATOM 10101 H H    . SER B 1 21 ? -6.931  -1.921  -4.116  1.00 0.00 ? 25 SER B H    5  
ATOM 10102 H HA   . SER B 1 21 ? -5.031  -3.515  -2.711  1.00 0.00 ? 25 SER B HA   5  
ATOM 10103 H HB2  . SER B 1 21 ? -3.530  -2.351  -4.880  1.00 0.00 ? 25 SER B HB2  5  
ATOM 10104 H HB3  . SER B 1 21 ? -3.638  -4.035  -4.408  1.00 0.00 ? 25 SER B HB3  5  
ATOM 10105 H HG   . SER B 1 21 ? -4.371  -3.483  -6.649  1.00 0.00 ? 25 SER B HG   5  
ATOM 10106 N N    . VAL B 1 22 ? -3.627  -1.317  -2.312  1.00 0.00 ? 26 VAL B N    5  
ATOM 10107 C CA   . VAL B 1 22 ? -3.153  -0.058  -1.763  1.00 0.00 ? 26 VAL B CA   5  
ATOM 10108 C C    . VAL B 1 22 ? -1.710  0.177   -2.211  1.00 0.00 ? 26 VAL B C    5  
ATOM 10109 O O    . VAL B 1 22 ? -0.870  -0.715  -2.105  1.00 0.00 ? 26 VAL B O    5  
ATOM 10110 C CB   . VAL B 1 22 ? -3.315  -0.055  -0.242  1.00 0.00 ? 26 VAL B CB   5  
ATOM 10111 C CG1  . VAL B 1 22 ? -2.493  1.067   0.395   1.00 0.00 ? 26 VAL B CG1  5  
ATOM 10112 C CG2  . VAL B 1 22 ? -4.790  0.053   0.152   1.00 0.00 ? 26 VAL B CG2  5  
ATOM 10113 H H    . VAL B 1 22 ? -3.036  -2.104  -2.136  1.00 0.00 ? 26 VAL B H    5  
ATOM 10114 H HA   . VAL B 1 22 ? -3.781  0.735   -2.171  1.00 0.00 ? 26 VAL B HA   5  
ATOM 10115 H HB   . VAL B 1 22 ? -2.936  -1.005  0.137   1.00 0.00 ? 26 VAL B HB   5  
ATOM 10116 H HG11 . VAL B 1 22 ? -1.474  1.034   0.010   1.00 0.00 ? 26 VAL B HG11 5  
ATOM 10117 H HG12 . VAL B 1 22 ? -2.943  2.030   0.151   1.00 0.00 ? 26 VAL B HG12 5  
ATOM 10118 H HG13 . VAL B 1 22 ? -2.478  0.937   1.477   1.00 0.00 ? 26 VAL B HG13 5  
ATOM 10119 H HG21 . VAL B 1 22 ? -5.412  -0.321  -0.661  1.00 0.00 ? 26 VAL B HG21 5  
ATOM 10120 H HG22 . VAL B 1 22 ? -4.970  -0.539  1.050   1.00 0.00 ? 26 VAL B HG22 5  
ATOM 10121 H HG23 . VAL B 1 22 ? -5.038  1.096   0.349   1.00 0.00 ? 26 VAL B HG23 5  
ATOM 10122 N N    . LYS B 1 23 ? -1.465  1.383   -2.702  1.00 0.00 ? 27 LYS B N    5  
ATOM 10123 C CA   . LYS B 1 23 ? -0.137  1.747   -3.167  1.00 0.00 ? 27 LYS B CA   5  
ATOM 10124 C C    . LYS B 1 23 ? 0.335   2.996   -2.420  1.00 0.00 ? 27 LYS B C    5  
ATOM 10125 O O    . LYS B 1 23 ? -0.289  4.052   -2.513  1.00 0.00 ? 27 LYS B O    5  
ATOM 10126 C CB   . LYS B 1 23 ? -0.125  1.899   -4.689  1.00 0.00 ? 27 LYS B CB   5  
ATOM 10127 C CG   . LYS B 1 23 ? 1.237   2.397   -5.180  1.00 0.00 ? 27 LYS B CG   5  
ATOM 10128 C CD   . LYS B 1 23 ? 2.374   1.581   -4.562  1.00 0.00 ? 27 LYS B CD   5  
ATOM 10129 C CE   . LYS B 1 23 ? 3.737   2.111   -5.013  1.00 0.00 ? 27 LYS B CE   5  
ATOM 10130 N NZ   . LYS B 1 23 ? 4.171   1.434   -6.256  1.00 0.00 ? 27 LYS B NZ   5  
ATOM 10131 H H    . LYS B 1 23 ? -2.153  2.104   -2.785  1.00 0.00 ? 27 LYS B H    5  
ATOM 10132 H HA   . LYS B 1 23 ? 0.533   0.923   -2.920  1.00 0.00 ? 27 LYS B HA   5  
ATOM 10133 H HB2  . LYS B 1 23 ? -0.355  0.941   -5.156  1.00 0.00 ? 27 LYS B HB2  5  
ATOM 10134 H HB3  . LYS B 1 23 ? -0.903  2.597   -4.995  1.00 0.00 ? 27 LYS B HB3  5  
ATOM 10135 H HG2  . LYS B 1 23 ? 1.283   2.328   -6.266  1.00 0.00 ? 27 LYS B HG2  5  
ATOM 10136 H HG3  . LYS B 1 23 ? 1.357   3.449   -4.922  1.00 0.00 ? 27 LYS B HG3  5  
ATOM 10137 H HD2  . LYS B 1 23 ? 2.306   1.621   -3.475  1.00 0.00 ? 27 LYS B HD2  5  
ATOM 10138 H HD3  . LYS B 1 23 ? 2.274   0.534   -4.850  1.00 0.00 ? 27 LYS B HD3  5  
ATOM 10139 H HE2  . LYS B 1 23 ? 3.678   3.186   -5.180  1.00 0.00 ? 27 LYS B HE2  5  
ATOM 10140 H HE3  . LYS B 1 23 ? 4.474   1.950   -4.227  1.00 0.00 ? 27 LYS B HE3  5  
ATOM 10141 H HZ1  . LYS B 1 23 ? 3.576   0.650   -6.433  1.00 0.00 ? 27 LYS B HZ1  5  
ATOM 10142 H HZ2  . LYS B 1 23 ? 4.115   2.074   -7.021  1.00 0.00 ? 27 LYS B HZ2  5  
ATOM 10143 H HZ3  . LYS B 1 23 ? 5.114   1.119   -6.151  1.00 0.00 ? 27 LYS B HZ3  5  
ATOM 10144 N N    . VAL B 1 24 ? 1.434   2.835   -1.698  1.00 0.00 ? 28 VAL B N    5  
ATOM 10145 C CA   . VAL B 1 24 ? 1.997   3.937   -0.936  1.00 0.00 ? 28 VAL B CA   5  
ATOM 10146 C C    . VAL B 1 24 ? 3.314   4.376   -1.580  1.00 0.00 ? 28 VAL B C    5  
ATOM 10147 O O    . VAL B 1 24 ? 4.240   3.578   -1.714  1.00 0.00 ? 28 VAL B O    5  
ATOM 10148 C CB   . VAL B 1 24 ? 2.155   3.532   0.531   1.00 0.00 ? 28 VAL B CB   5  
ATOM 10149 C CG1  . VAL B 1 24 ? 2.889   4.616   1.323   1.00 0.00 ? 28 VAL B CG1  5  
ATOM 10150 C CG2  . VAL B 1 24 ? 0.798   3.216   1.162   1.00 0.00 ? 28 VAL B CG2  5  
ATOM 10151 H H    . VAL B 1 24 ? 1.936   1.973   -1.628  1.00 0.00 ? 28 VAL B H    5  
ATOM 10152 H HA   . VAL B 1 24 ? 1.290   4.765   -0.983  1.00 0.00 ? 28 VAL B HA   5  
ATOM 10153 H HB   . VAL B 1 24 ? 2.759   2.625   0.565   1.00 0.00 ? 28 VAL B HB   5  
ATOM 10154 H HG11 . VAL B 1 24 ? 3.467   5.238   0.639   1.00 0.00 ? 28 VAL B HG11 5  
ATOM 10155 H HG12 . VAL B 1 24 ? 2.163   5.234   1.851   1.00 0.00 ? 28 VAL B HG12 5  
ATOM 10156 H HG13 . VAL B 1 24 ? 3.561   4.148   2.043   1.00 0.00 ? 28 VAL B HG13 5  
ATOM 10157 H HG21 . VAL B 1 24 ? 0.010   3.371   0.425   1.00 0.00 ? 28 VAL B HG21 5  
ATOM 10158 H HG22 . VAL B 1 24 ? 0.785   2.178   1.495   1.00 0.00 ? 28 VAL B HG22 5  
ATOM 10159 H HG23 . VAL B 1 24 ? 0.632   3.874   2.015   1.00 0.00 ? 28 VAL B HG23 5  
ATOM 10160 N N    . LYS B 1 25 ? 3.355   5.644   -1.962  1.00 0.00 ? 29 LYS B N    5  
ATOM 10161 C CA   . LYS B 1 25 ? 4.543   6.199   -2.588  1.00 0.00 ? 29 LYS B CA   5  
ATOM 10162 C C    . LYS B 1 25 ? 5.058   7.370   -1.748  1.00 0.00 ? 29 LYS B C    5  
ATOM 10163 O O    . LYS B 1 25 ? 4.787   8.528   -2.060  1.00 0.00 ? 29 LYS B O    5  
ATOM 10164 C CB   . LYS B 1 25 ? 4.257   6.567   -4.046  1.00 0.00 ? 29 LYS B CB   5  
ATOM 10165 C CG   . LYS B 1 25 ? 5.554   6.654   -4.853  1.00 0.00 ? 29 LYS B CG   5  
ATOM 10166 C CD   . LYS B 1 25 ? 6.273   7.979   -4.594  1.00 0.00 ? 29 LYS B CD   5  
ATOM 10167 C CE   . LYS B 1 25 ? 6.858   8.548   -5.888  1.00 0.00 ? 29 LYS B CE   5  
ATOM 10168 N NZ   . LYS B 1 25 ? 8.172   7.932   -6.178  1.00 0.00 ? 29 LYS B NZ   5  
ATOM 10169 H H    . LYS B 1 25 ? 2.597   6.287   -1.849  1.00 0.00 ? 29 LYS B H    5  
ATOM 10170 H HA   . LYS B 1 25 ? 5.303   5.418   -2.596  1.00 0.00 ? 29 LYS B HA   5  
ATOM 10171 H HB2  . LYS B 1 25 ? 3.597   5.822   -4.490  1.00 0.00 ? 29 LYS B HB2  5  
ATOM 10172 H HB3  . LYS B 1 25 ? 3.733   7.522   -4.088  1.00 0.00 ? 29 LYS B HB3  5  
ATOM 10173 H HG2  . LYS B 1 25 ? 6.208   5.823   -4.588  1.00 0.00 ? 29 LYS B HG2  5  
ATOM 10174 H HG3  . LYS B 1 25 ? 5.332   6.558   -5.916  1.00 0.00 ? 29 LYS B HG3  5  
ATOM 10175 H HD2  . LYS B 1 25 ? 5.577   8.696   -4.159  1.00 0.00 ? 29 LYS B HD2  5  
ATOM 10176 H HD3  . LYS B 1 25 ? 7.070   7.828   -3.866  1.00 0.00 ? 29 LYS B HD3  5  
ATOM 10177 H HE2  . LYS B 1 25 ? 6.173   8.364   -6.716  1.00 0.00 ? 29 LYS B HE2  5  
ATOM 10178 H HE3  . LYS B 1 25 ? 6.968   9.629   -5.800  1.00 0.00 ? 29 LYS B HE3  5  
ATOM 10179 H HZ1  . LYS B 1 25 ? 8.088   6.936   -6.145  1.00 0.00 ? 29 LYS B HZ1  5  
ATOM 10180 H HZ2  . LYS B 1 25 ? 8.477   8.210   -7.089  1.00 0.00 ? 29 LYS B HZ2  5  
ATOM 10181 H HZ3  . LYS B 1 25 ? 8.839   8.233   -5.497  1.00 0.00 ? 29 LYS B HZ3  5  
ATOM 10182 N N    . SER B 1 26 ? 5.790   7.026   -0.699  1.00 0.00 ? 30 SER B N    5  
ATOM 10183 C CA   . SER B 1 26 ? 6.345   8.034   0.188   1.00 0.00 ? 30 SER B CA   5  
ATOM 10184 C C    . SER B 1 26 ? 6.932   9.186   -0.631  1.00 0.00 ? 30 SER B C    5  
ATOM 10185 O O    . SER B 1 26 ? 7.096   9.069   -1.844  1.00 0.00 ? 30 SER B O    5  
ATOM 10186 C CB   . SER B 1 26 ? 7.415   7.434   1.102   1.00 0.00 ? 30 SER B CB   5  
ATOM 10187 O OG   . SER B 1 26 ? 7.893   6.183   0.616   1.00 0.00 ? 30 SER B OG   5  
ATOM 10188 H H    . SER B 1 26 ? 6.005   6.081   -0.452  1.00 0.00 ? 30 SER B H    5  
ATOM 10189 H HA   . SER B 1 26 ? 5.507   8.381   0.791   1.00 0.00 ? 30 SER B HA   5  
ATOM 10190 H HB2  . SER B 1 26 ? 8.249   8.131   1.190   1.00 0.00 ? 30 SER B HB2  5  
ATOM 10191 H HB3  . SER B 1 26 ? 7.004   7.301   2.103   1.00 0.00 ? 30 SER B HB3  5  
ATOM 10192 H HG   . SER B 1 26 ? 8.089   6.249   -0.363  1.00 0.00 ? 30 SER B HG   5  
ATOM 10193 N N    . PRO B 1 27 ? 7.240   10.301  0.085   1.00 0.00 ? 31 PRO B N    5  
ATOM 10194 C CA   . PRO B 1 27 ? 7.804   11.473  -0.562  1.00 0.00 ? 31 PRO B CA   5  
ATOM 10195 C C    . PRO B 1 27 ? 9.277   11.249  -0.913  1.00 0.00 ? 31 PRO B C    5  
ATOM 10196 O O    . PRO B 1 27 ? 9.870   10.249  -0.512  1.00 0.00 ? 31 PRO B O    5  
ATOM 10197 C CB   . PRO B 1 27 ? 7.595   12.608  0.427   1.00 0.00 ? 31 PRO B CB   5  
ATOM 10198 C CG   . PRO B 1 27 ? 7.345   11.947  1.773   1.00 0.00 ? 31 PRO B CG   5  
ATOM 10199 C CD   . PRO B 1 27 ? 7.059   10.475  1.523   1.00 0.00 ? 31 PRO B CD   5  
ATOM 10200 H HA   . PRO B 1 27 ? 7.340   11.648  -1.431  1.00 0.00 ? 31 PRO B HA   5  
ATOM 10201 H HB2  . PRO B 1 27 ? 8.470   13.257  0.467   1.00 0.00 ? 31 PRO B HB2  5  
ATOM 10202 H HB3  . PRO B 1 27 ? 6.750   13.230  0.134   1.00 0.00 ? 31 PRO B HB3  5  
ATOM 10203 H HG2  . PRO B 1 27 ? 8.213   12.062  2.422   1.00 0.00 ? 31 PRO B HG2  5  
ATOM 10204 H HG3  . PRO B 1 27 ? 6.503   12.419  2.279   1.00 0.00 ? 31 PRO B HG3  5  
ATOM 10205 H HD2  . PRO B 1 27 ? 7.740   9.838   2.087   1.00 0.00 ? 31 PRO B HD2  5  
ATOM 10206 H HD3  . PRO B 1 27 ? 6.047   10.210  1.830   1.00 0.00 ? 31 PRO B HD3  5  
ATOM 10207 N N    . GLY B 1 28 ? 9.825   12.198  -1.660  1.00 0.00 ? 32 GLY B N    5  
ATOM 10208 C CA   . GLY B 1 28 ? 11.216  12.117  -2.069  1.00 0.00 ? 32 GLY B CA   5  
ATOM 10209 C C    . GLY B 1 28 ? 11.856  13.506  -2.114  1.00 0.00 ? 32 GLY B C    5  
ATOM 10210 O O    . GLY B 1 28 ? 11.373  14.437  -1.471  1.00 0.00 ? 32 GLY B O    5  
ATOM 10211 H H    . GLY B 1 28 ? 9.335   13.008  -1.982  1.00 0.00 ? 32 GLY B H    5  
ATOM 10212 H HA2  . GLY B 1 28 ? 11.767  11.481  -1.376  1.00 0.00 ? 32 GLY B HA2  5  
ATOM 10213 H HA3  . GLY B 1 28 ? 11.283  11.650  -3.052  1.00 0.00 ? 32 GLY B HA3  5  
ATOM 10214 N N    . PRO B 1 29 ? 12.962  13.604  -2.899  1.00 0.00 ? 33 PRO B N    5  
ATOM 10215 C CA   . PRO B 1 29 ? 13.673  14.864  -3.036  1.00 0.00 ? 33 PRO B CA   5  
ATOM 10216 C C    . PRO B 1 29 ? 12.905  15.832  -3.937  1.00 0.00 ? 33 PRO B C    5  
ATOM 10217 O O    . PRO B 1 29 ? 13.364  16.944  -4.194  1.00 0.00 ? 33 PRO B O    5  
ATOM 10218 C CB   . PRO B 1 29 ? 15.036  14.488  -3.594  1.00 0.00 ? 33 PRO B CB   5  
ATOM 10219 C CG   . PRO B 1 29 ? 14.876  13.096  -4.183  1.00 0.00 ? 33 PRO B CG   5  
ATOM 10220 C CD   . PRO B 1 29 ? 13.563  12.523  -3.674  1.00 0.00 ? 33 PRO B CD   5  
ATOM 10221 H HA   . PRO B 1 29 ? 13.749  15.318  -2.148  1.00 0.00 ? 33 PRO B HA   5  
ATOM 10222 H HB2  . PRO B 1 29 ? 15.357  15.199  -4.354  1.00 0.00 ? 33 PRO B HB2  5  
ATOM 10223 H HB3  . PRO B 1 29 ? 15.794  14.495  -2.810  1.00 0.00 ? 33 PRO B HB3  5  
ATOM 10224 H HG2  . PRO B 1 29 ? 14.877  13.140  -5.272  1.00 0.00 ? 33 PRO B HG2  5  
ATOM 10225 H HG3  . PRO B 1 29 ? 15.710  12.458  -3.890  1.00 0.00 ? 33 PRO B HG3  5  
ATOM 10226 H HD2  . PRO B 1 29 ? 12.917  12.221  -4.499  1.00 0.00 ? 33 PRO B HD2  5  
ATOM 10227 H HD3  . PRO B 1 29 ? 13.729  11.639  -3.059  1.00 0.00 ? 33 PRO B HD3  5  
ATOM 10228 N N    . HIS B 1 30 ? 11.748  15.375  -4.392  1.00 0.00 ? 34 HIS B N    5  
ATOM 10229 C CA   . HIS B 1 30 ? 10.911  16.187  -5.260  1.00 0.00 ? 34 HIS B CA   5  
ATOM 10230 C C    . HIS B 1 30 ? 9.627   16.570  -4.522  1.00 0.00 ? 34 HIS B C    5  
ATOM 10231 O O    . HIS B 1 30 ? 9.280   17.747  -4.443  1.00 0.00 ? 34 HIS B O    5  
ATOM 10232 C CB   . HIS B 1 30 ? 10.643  15.468  -6.584  1.00 0.00 ? 34 HIS B CB   5  
ATOM 10233 C CG   . HIS B 1 30 ? 10.566  13.965  -6.462  1.00 0.00 ? 34 HIS B CG   5  
ATOM 10234 N ND1  . HIS B 1 30 ? 11.658  13.183  -6.128  1.00 0.00 ? 34 HIS B ND1  5  
ATOM 10235 C CD2  . HIS B 1 30 ? 9.517   13.110  -6.632  1.00 0.00 ? 34 HIS B CD2  5  
ATOM 10236 C CE1  . HIS B 1 30 ? 11.272  11.916  -6.102  1.00 0.00 ? 34 HIS B CE1  5  
ATOM 10237 N NE2  . HIS B 1 30 ? 9.946   11.872  -6.416  1.00 0.00 ? 34 HIS B NE2  5  
ATOM 10238 H H    . HIS B 1 30 ? 11.381  14.469  -4.179  1.00 0.00 ? 34 HIS B H    5  
ATOM 10239 H HA   . HIS B 1 30 ? 11.476  17.092  -5.481  1.00 0.00 ? 34 HIS B HA   5  
ATOM 10240 H HB2  . HIS B 1 30 ? 9.706   15.837  -7.002  1.00 0.00 ? 34 HIS B HB2  5  
ATOM 10241 H HB3  . HIS B 1 30 ? 11.431  15.726  -7.291  1.00 0.00 ? 34 HIS B HB3  5  
ATOM 10242 H HD1  . HIS B 1 30 ? 12.581  13.518  -5.938  1.00 0.00 ? 34 HIS B HD1  5  
ATOM 10243 H HD2  . HIS B 1 30 ? 8.500   13.395  -6.901  1.00 0.00 ? 34 HIS B HD2  5  
ATOM 10244 H HE1  . HIS B 1 30 ? 11.905  11.058  -5.871  1.00 0.00 ? 34 HIS B HE1  5  
ATOM 10245 N N    . CYS B 1 31 ? 8.956   15.553  -4.000  1.00 0.00 ? 35 CYS B N    5  
ATOM 10246 C CA   . CYS B 1 31 ? 7.718   15.768  -3.272  1.00 0.00 ? 35 CYS B CA   5  
ATOM 10247 C C    . CYS B 1 31 ? 7.958   15.417  -1.802  1.00 0.00 ? 35 CYS B C    5  
ATOM 10248 O O    . CYS B 1 31 ? 8.299   14.281  -1.479  1.00 0.00 ? 35 CYS B O    5  
ATOM 10249 C CB   . CYS B 1 31 ? 6.563   14.962  -3.869  1.00 0.00 ? 35 CYS B CB   5  
ATOM 10250 S SG   . CYS B 1 31 ? 4.956   15.177  -3.019  1.00 0.00 ? 35 CYS B SG   5  
ATOM 10251 H H    . CYS B 1 31 ? 9.246   14.598  -4.069  1.00 0.00 ? 35 CYS B H    5  
ATOM 10252 H HA   . CYS B 1 31 ? 7.469   16.824  -3.382  1.00 0.00 ? 35 CYS B HA   5  
ATOM 10253 H HB2  . CYS B 1 31 ? 6.444   15.244  -4.916  1.00 0.00 ? 35 CYS B HB2  5  
ATOM 10254 H HB3  . CYS B 1 31 ? 6.828   13.905  -3.852  1.00 0.00 ? 35 CYS B HB3  5  
ATOM 10255 N N    . ALA B 1 32 ? 7.770   16.415  -0.950  1.00 0.00 ? 36 ALA B N    5  
ATOM 10256 C CA   . ALA B 1 32 ? 7.962   16.226  0.477   1.00 0.00 ? 36 ALA B CA   5  
ATOM 10257 C C    . ALA B 1 32 ? 6.629   15.836  1.120   1.00 0.00 ? 36 ALA B C    5  
ATOM 10258 O O    . ALA B 1 32 ? 6.427   16.046  2.314   1.00 0.00 ? 36 ALA B O    5  
ATOM 10259 C CB   . ALA B 1 32 ? 8.552   17.500  1.086   1.00 0.00 ? 36 ALA B CB   5  
ATOM 10260 H H    . ALA B 1 32 ? 7.492   17.337  -1.221  1.00 0.00 ? 36 ALA B H    5  
ATOM 10261 H HA   . ALA B 1 32 ? 8.673   15.411  0.612   1.00 0.00 ? 36 ALA B HA   5  
ATOM 10262 H HB1  . ALA B 1 32 ? 9.246   17.953  0.379   1.00 0.00 ? 36 ALA B HB1  5  
ATOM 10263 H HB2  . ALA B 1 32 ? 9.081   17.251  2.006   1.00 0.00 ? 36 ALA B HB2  5  
ATOM 10264 H HB3  . ALA B 1 32 ? 7.748   18.202  1.308   1.00 0.00 ? 36 ALA B HB3  5  
ATOM 10265 N N    . GLN B 1 33 ? 5.755   15.274  0.298   1.00 0.00 ? 37 GLN B N    5  
ATOM 10266 C CA   . GLN B 1 33 ? 4.447   14.853  0.770   1.00 0.00 ? 37 GLN B CA   5  
ATOM 10267 C C    . GLN B 1 33 ? 4.168   13.410  0.344   1.00 0.00 ? 37 GLN B C    5  
ATOM 10268 O O    . GLN B 1 33 ? 4.709   12.939  -0.655  1.00 0.00 ? 37 GLN B O    5  
ATOM 10269 C CB   . GLN B 1 33 ? 3.352   15.795  0.266   1.00 0.00 ? 37 GLN B CB   5  
ATOM 10270 C CG   . GLN B 1 33 ? 3.825   17.249  0.292   1.00 0.00 ? 37 GLN B CG   5  
ATOM 10271 C CD   . GLN B 1 33 ? 3.969   17.804  -1.126  1.00 0.00 ? 37 GLN B CD   5  
ATOM 10272 O OE1  . GLN B 1 33 ? 3.042   17.800  -1.919  1.00 0.00 ? 37 GLN B OE1  5  
ATOM 10273 N NE2  . GLN B 1 33 ? 5.181   18.281  -1.400  1.00 0.00 ? 37 GLN B NE2  5  
ATOM 10274 H H    . GLN B 1 33 ? 5.927   15.107  -0.673  1.00 0.00 ? 37 GLN B H    5  
ATOM 10275 H HA   . GLN B 1 33 ? 4.498   14.914  1.858   1.00 0.00 ? 37 GLN B HA   5  
ATOM 10276 H HB2  . GLN B 1 33 ? 3.069   15.519  -0.749  1.00 0.00 ? 37 GLN B HB2  5  
ATOM 10277 H HB3  . GLN B 1 33 ? 2.461   15.687  0.886   1.00 0.00 ? 37 GLN B HB3  5  
ATOM 10278 H HG2  . GLN B 1 33 ? 3.115   17.857  0.854   1.00 0.00 ? 37 GLN B HG2  5  
ATOM 10279 H HG3  . GLN B 1 33 ? 4.781   17.315  0.811   1.00 0.00 ? 37 GLN B HG3  5  
ATOM 10280 H HE21 . GLN B 1 33 ? 5.898   18.254  -0.704  1.00 0.00 ? 37 GLN B HE21 5  
ATOM 10281 H HE22 . GLN B 1 33 ? 5.374   18.665  -2.303  1.00 0.00 ? 37 GLN B HE22 5  
ATOM 10282 N N    . THR B 1 34 ? 3.325   12.749  1.123   1.00 0.00 ? 38 THR B N    5  
ATOM 10283 C CA   . THR B 1 34 ? 2.968   11.369  0.839   1.00 0.00 ? 38 THR B CA   5  
ATOM 10284 C C    . THR B 1 34 ? 1.945   11.306  -0.297  1.00 0.00 ? 38 THR B C    5  
ATOM 10285 O O    . THR B 1 34 ? 1.238   12.279  -0.555  1.00 0.00 ? 38 THR B O    5  
ATOM 10286 C CB   . THR B 1 34 ? 2.473   10.732  2.139   1.00 0.00 ? 38 THR B CB   5  
ATOM 10287 O OG1  . THR B 1 34 ? 3.412   11.166  3.118   1.00 0.00 ? 38 THR B OG1  5  
ATOM 10288 C CG2  . THR B 1 34 ? 2.615   9.208   2.135   1.00 0.00 ? 38 THR B CG2  5  
ATOM 10289 H H    . THR B 1 34 ? 2.890   13.139  1.935   1.00 0.00 ? 38 THR B H    5  
ATOM 10290 H HA   . THR B 1 34 ? 3.861   10.847  0.495   1.00 0.00 ? 38 THR B HA   5  
ATOM 10291 H HB   . THR B 1 34 ? 1.445   11.026  2.350   1.00 0.00 ? 38 THR B HB   5  
ATOM 10292 H HG1  . THR B 1 34 ? 4.297   10.728  2.961   1.00 0.00 ? 38 THR B HG1  5  
ATOM 10293 H HG21 . THR B 1 34 ? 3.586   8.935   1.722   1.00 0.00 ? 38 THR B HG21 5  
ATOM 10294 H HG22 . THR B 1 34 ? 2.536   8.833   3.155   1.00 0.00 ? 38 THR B HG22 5  
ATOM 10295 H HG23 . THR B 1 34 ? 1.825   8.771   1.525   1.00 0.00 ? 38 THR B HG23 5  
ATOM 10296 N N    . GLU B 1 35 ? 1.899   10.152  -0.946  1.00 0.00 ? 39 GLU B N    5  
ATOM 10297 C CA   . GLU B 1 35 ? 0.975   9.949   -2.048  1.00 0.00 ? 39 GLU B CA   5  
ATOM 10298 C C    . GLU B 1 35 ? 0.426   8.521   -2.025  1.00 0.00 ? 39 GLU B C    5  
ATOM 10299 O O    . GLU B 1 35 ? 0.981   7.629   -2.666  1.00 0.00 ? 39 GLU B O    5  
ATOM 10300 C CB   . GLU B 1 35 ? 1.644   10.258  -3.389  1.00 0.00 ? 39 GLU B CB   5  
ATOM 10301 C CG   . GLU B 1 35 ? 1.385   11.706  -3.810  1.00 0.00 ? 39 GLU B CG   5  
ATOM 10302 C CD   . GLU B 1 35 ? 2.343   12.664  -3.100  1.00 0.00 ? 39 GLU B CD   5  
ATOM 10303 O OE1  . GLU B 1 35 ? 3.550   12.341  -3.070  1.00 0.00 ? 39 GLU B OE1  5  
ATOM 10304 O OE2  . GLU B 1 35 ? 1.846   13.698  -2.602  1.00 0.00 ? 39 GLU B OE2  5  
ATOM 10305 H H    . GLU B 1 35 ? 2.478   9.366   -0.730  1.00 0.00 ? 39 GLU B H    5  
ATOM 10306 H HA   . GLU B 1 35 ? 0.165   10.660  -1.881  1.00 0.00 ? 39 GLU B HA   5  
ATOM 10307 H HB2  . GLU B 1 35 ? 2.717   10.085  -3.312  1.00 0.00 ? 39 GLU B HB2  5  
ATOM 10308 H HB3  . GLU B 1 35 ? 1.266   9.580   -4.153  1.00 0.00 ? 39 GLU B HB3  5  
ATOM 10309 H HG2  . GLU B 1 35 ? 1.504   11.801  -4.890  1.00 0.00 ? 39 GLU B HG2  5  
ATOM 10310 H HG3  . GLU B 1 35 ? 0.355   11.977  -3.578  1.00 0.00 ? 39 GLU B HG3  5  
ATOM 10311 N N    . VAL B 1 36 ? -0.656  8.349   -1.281  1.00 0.00 ? 40 VAL B N    5  
ATOM 10312 C CA   . VAL B 1 36 ? -1.286  7.045   -1.166  1.00 0.00 ? 40 VAL B CA   5  
ATOM 10313 C C    . VAL B 1 36 ? -2.249  6.843   -2.338  1.00 0.00 ? 40 VAL B C    5  
ATOM 10314 O O    . VAL B 1 36 ? -3.124  7.673   -2.576  1.00 0.00 ? 40 VAL B O    5  
ATOM 10315 C CB   . VAL B 1 36 ? -1.967  6.910   0.197   1.00 0.00 ? 40 VAL B CB   5  
ATOM 10316 C CG1  . VAL B 1 36 ? -2.603  5.528   0.359   1.00 0.00 ? 40 VAL B CG1  5  
ATOM 10317 C CG2  . VAL B 1 36 ? -0.982  7.197   1.333   1.00 0.00 ? 40 VAL B CG2  5  
ATOM 10318 H H    . VAL B 1 36 ? -1.101  9.080   -0.763  1.00 0.00 ? 40 VAL B H    5  
ATOM 10319 H HA   . VAL B 1 36 ? -0.498  6.293   -1.226  1.00 0.00 ? 40 VAL B HA   5  
ATOM 10320 H HB   . VAL B 1 36 ? -2.763  7.653   0.249   1.00 0.00 ? 40 VAL B HB   5  
ATOM 10321 H HG11 . VAL B 1 36 ? -2.094  4.816   -0.291  1.00 0.00 ? 40 VAL B HG11 5  
ATOM 10322 H HG12 . VAL B 1 36 ? -2.511  5.205   1.395   1.00 0.00 ? 40 VAL B HG12 5  
ATOM 10323 H HG13 . VAL B 1 36 ? -3.657  5.579   0.086   1.00 0.00 ? 40 VAL B HG13 5  
ATOM 10324 H HG21 . VAL B 1 36 ? 0.027   6.939   1.012   1.00 0.00 ? 40 VAL B HG21 5  
ATOM 10325 H HG22 . VAL B 1 36 ? -1.023  8.255   1.590   1.00 0.00 ? 40 VAL B HG22 5  
ATOM 10326 H HG23 . VAL B 1 36 ? -1.250  6.600   2.205   1.00 0.00 ? 40 VAL B HG23 5  
ATOM 10327 N N    . ILE B 1 37 ? -2.054  5.735   -3.038  1.00 0.00 ? 41 ILE B N    5  
ATOM 10328 C CA   . ILE B 1 37 ? -2.894  5.414   -4.180  1.00 0.00 ? 41 ILE B CA   5  
ATOM 10329 C C    . ILE B 1 37 ? -3.503  4.024   -3.984  1.00 0.00 ? 41 ILE B C    5  
ATOM 10330 O O    . ILE B 1 37 ? -2.792  3.021   -4.010  1.00 0.00 ? 41 ILE B O    5  
ATOM 10331 C CB   . ILE B 1 37 ? -2.107  5.563   -5.483  1.00 0.00 ? 41 ILE B CB   5  
ATOM 10332 C CG1  . ILE B 1 37 ? -1.326  6.878   -5.505  1.00 0.00 ? 41 ILE B CG1  5  
ATOM 10333 C CG2  . ILE B 1 37 ? -3.026  5.421   -6.698  1.00 0.00 ? 41 ILE B CG2  5  
ATOM 10334 C CD1  . ILE B 1 37 ? 0.181   6.622   -5.454  1.00 0.00 ? 41 ILE B CD1  5  
ATOM 10335 H H    . ILE B 1 37 ? -1.339  5.065   -2.838  1.00 0.00 ? 41 ILE B H    5  
ATOM 10336 H HA   . ILE B 1 37 ? -3.702  6.145   -4.206  1.00 0.00 ? 41 ILE B HA   5  
ATOM 10337 H HB   . ILE B 1 37 ? -1.378  4.754   -5.536  1.00 0.00 ? 41 ILE B HB   5  
ATOM 10338 H HG12 . ILE B 1 37 ? -1.573  7.437   -6.408  1.00 0.00 ? 41 ILE B HG12 5  
ATOM 10339 H HG13 . ILE B 1 37 ? -1.623  7.496   -4.658  1.00 0.00 ? 41 ILE B HG13 5  
ATOM 10340 H HG21 . ILE B 1 37 ? -3.938  5.995   -6.532  1.00 0.00 ? 41 ILE B HG21 5  
ATOM 10341 H HG22 . ILE B 1 37 ? -2.517  5.797   -7.585  1.00 0.00 ? 41 ILE B HG22 5  
ATOM 10342 H HG23 . ILE B 1 37 ? -3.279  4.370   -6.842  1.00 0.00 ? 41 ILE B HG23 5  
ATOM 10343 H HD11 . ILE B 1 37 ? 0.396   5.865   -4.700  1.00 0.00 ? 41 ILE B HD11 5  
ATOM 10344 H HD12 . ILE B 1 37 ? 0.524   6.271   -6.428  1.00 0.00 ? 41 ILE B HD12 5  
ATOM 10345 H HD13 . ILE B 1 37 ? 0.699   7.547   -5.199  1.00 0.00 ? 41 ILE B HD13 5  
ATOM 10346 N N    . ALA B 1 38 ? -4.814  4.010   -3.791  1.00 0.00 ? 42 ALA B N    5  
ATOM 10347 C CA   . ALA B 1 38 ? -5.527  2.759   -3.591  1.00 0.00 ? 42 ALA B CA   5  
ATOM 10348 C C    . ALA B 1 38 ? -6.182  2.335   -4.907  1.00 0.00 ? 42 ALA B C    5  
ATOM 10349 O O    . ALA B 1 38 ? -6.877  3.127   -5.543  1.00 0.00 ? 42 ALA B O    5  
ATOM 10350 C CB   . ALA B 1 38 ? -6.544  2.927   -2.461  1.00 0.00 ? 42 ALA B CB   5  
ATOM 10351 H H    . ALA B 1 38 ? -5.386  4.830   -3.771  1.00 0.00 ? 42 ALA B H    5  
ATOM 10352 H HA   . ALA B 1 38 ? -4.798  2.005   -3.298  1.00 0.00 ? 42 ALA B HA   5  
ATOM 10353 H HB1  . ALA B 1 38 ? -7.520  3.167   -2.883  1.00 0.00 ? 42 ALA B HB1  5  
ATOM 10354 H HB2  . ALA B 1 38 ? -6.613  1.999   -1.893  1.00 0.00 ? 42 ALA B HB2  5  
ATOM 10355 H HB3  . ALA B 1 38 ? -6.225  3.734   -1.801  1.00 0.00 ? 42 ALA B HB3  5  
ATOM 10356 N N    . THR B 1 39 ? -5.939  1.086   -5.277  1.00 0.00 ? 43 THR B N    5  
ATOM 10357 C CA   . THR B 1 39 ? -6.496  0.547   -6.505  1.00 0.00 ? 43 THR B CA   5  
ATOM 10358 C C    . THR B 1 39 ? -7.952  0.128   -6.291  1.00 0.00 ? 43 THR B C    5  
ATOM 10359 O O    . THR B 1 39 ? -8.315  -0.342  -5.214  1.00 0.00 ? 43 THR B O    5  
ATOM 10360 C CB   . THR B 1 39 ? -5.596  -0.600  -6.969  1.00 0.00 ? 43 THR B CB   5  
ATOM 10361 O OG1  . THR B 1 39 ? -4.408  0.049   -7.413  1.00 0.00 ? 43 THR B OG1  5  
ATOM 10362 C CG2  . THR B 1 39 ? -6.132  -1.294  -8.224  1.00 0.00 ? 43 THR B CG2  5  
ATOM 10363 H H    . THR B 1 39 ? -5.373  0.448   -4.754  1.00 0.00 ? 43 THR B H    5  
ATOM 10364 H HA   . THR B 1 39 ? -6.498  1.336   -7.257  1.00 0.00 ? 43 THR B HA   5  
ATOM 10365 H HB   . THR B 1 39 ? -5.436  -1.319  -6.166  1.00 0.00 ? 43 THR B HB   5  
ATOM 10366 H HG1  . THR B 1 39 ? -3.673  -0.621  -7.520  1.00 0.00 ? 43 THR B HG1  5  
ATOM 10367 H HG21 . THR B 1 39 ? -7.197  -1.493  -8.102  1.00 0.00 ? 43 THR B HG21 5  
ATOM 10368 H HG22 . THR B 1 39 ? -5.980  -0.649  -9.089  1.00 0.00 ? 43 THR B HG22 5  
ATOM 10369 H HG23 . THR B 1 39 ? -5.601  -2.234  -8.374  1.00 0.00 ? 43 THR B HG23 5  
ATOM 10370 N N    . LEU B 1 40 ? -8.748  0.315   -7.334  1.00 0.00 ? 44 LEU B N    5  
ATOM 10371 C CA   . LEU B 1 40 ? -10.156 -0.037  -7.274  1.00 0.00 ? 44 LEU B CA   5  
ATOM 10372 C C    . LEU B 1 40 ? -10.346 -1.456  -7.814  1.00 0.00 ? 44 LEU B C    5  
ATOM 10373 O O    . LEU B 1 40 ? -9.583  -1.907  -8.667  1.00 0.00 ? 44 LEU B O    5  
ATOM 10374 C CB   . LEU B 1 40 ? -11.002 1.013   -7.996  1.00 0.00 ? 44 LEU B CB   5  
ATOM 10375 C CG   . LEU B 1 40 ? -12.223 1.531   -7.233  1.00 0.00 ? 44 LEU B CG   5  
ATOM 10376 C CD1  . LEU B 1 40 ? -12.732 2.842   -7.836  1.00 0.00 ? 44 LEU B CD1  5  
ATOM 10377 C CD2  . LEU B 1 40 ? -13.320 0.467   -7.166  1.00 0.00 ? 44 LEU B CD2  5  
ATOM 10378 H H    . LEU B 1 40 ? -8.445  0.698   -8.207  1.00 0.00 ? 44 LEU B H    5  
ATOM 10379 H HA   . LEU B 1 40 ? -10.452 -0.024  -6.225  1.00 0.00 ? 44 LEU B HA   5  
ATOM 10380 H HB2  . LEU B 1 40 ? -10.363 1.862   -8.238  1.00 0.00 ? 44 LEU B HB2  5  
ATOM 10381 H HB3  . LEU B 1 40 ? -11.342 0.591   -8.941  1.00 0.00 ? 44 LEU B HB3  5  
ATOM 10382 H HG   . LEU B 1 40 ? -11.920 1.745   -6.208  1.00 0.00 ? 44 LEU B HG   5  
ATOM 10383 H HD11 . LEU B 1 40 ? -12.999 2.681   -8.881  1.00 0.00 ? 44 LEU B HD11 5  
ATOM 10384 H HD12 . LEU B 1 40 ? -13.609 3.179   -7.284  1.00 0.00 ? 44 LEU B HD12 5  
ATOM 10385 H HD13 . LEU B 1 40 ? -11.950 3.598   -7.773  1.00 0.00 ? 44 LEU B HD13 5  
ATOM 10386 H HD21 . LEU B 1 40 ? -13.335 -0.098  -8.099  1.00 0.00 ? 44 LEU B HD21 5  
ATOM 10387 H HD22 . LEU B 1 40 ? -13.121 -0.210  -6.335  1.00 0.00 ? 44 LEU B HD22 5  
ATOM 10388 H HD23 . LEU B 1 40 ? -14.286 0.949   -7.018  1.00 0.00 ? 44 LEU B HD23 5  
ATOM 10389 N N    . LYS B 1 41 ? -11.368 -2.121  -7.294  1.00 0.00 ? 45 LYS B N    5  
ATOM 10390 C CA   . LYS B 1 41 ? -11.667 -3.479  -7.713  1.00 0.00 ? 45 LYS B CA   5  
ATOM 10391 C C    . LYS B 1 41 ? -12.295 -3.452  -9.108  1.00 0.00 ? 45 LYS B C    5  
ATOM 10392 O O    . LYS B 1 41 ? -12.556 -4.500  -9.696  1.00 0.00 ? 45 LYS B O    5  
ATOM 10393 C CB   . LYS B 1 41 ? -12.530 -4.185  -6.665  1.00 0.00 ? 45 LYS B CB   5  
ATOM 10394 C CG   . LYS B 1 41 ? -12.661 -5.678  -6.977  1.00 0.00 ? 45 LYS B CG   5  
ATOM 10395 C CD   . LYS B 1 41 ? -13.906 -5.953  -7.822  1.00 0.00 ? 45 LYS B CD   5  
ATOM 10396 C CE   . LYS B 1 41 ? -15.054 -6.473  -6.954  1.00 0.00 ? 45 LYS B CE   5  
ATOM 10397 N NZ   . LYS B 1 41 ? -15.410 -7.857  -7.339  1.00 0.00 ? 45 LYS B NZ   5  
ATOM 10398 H H    . LYS B 1 41 ? -11.983 -1.747  -6.601  1.00 0.00 ? 45 LYS B H    5  
ATOM 10399 H HA   . LYS B 1 41 ? -10.723 -4.020  -7.770  1.00 0.00 ? 45 LYS B HA   5  
ATOM 10400 H HB2  . LYS B 1 41 ? -12.088 -4.054  -5.677  1.00 0.00 ? 45 LYS B HB2  5  
ATOM 10401 H HB3  . LYS B 1 41 ? -13.519 -3.728  -6.634  1.00 0.00 ? 45 LYS B HB3  5  
ATOM 10402 H HG2  . LYS B 1 41 ? -11.773 -6.021  -7.508  1.00 0.00 ? 45 LYS B HG2  5  
ATOM 10403 H HG3  . LYS B 1 41 ? -12.715 -6.244  -6.047  1.00 0.00 ? 45 LYS B HG3  5  
ATOM 10404 H HD2  . LYS B 1 41 ? -14.214 -5.040  -8.331  1.00 0.00 ? 45 LYS B HD2  5  
ATOM 10405 H HD3  . LYS B 1 41 ? -13.671 -6.685  -8.595  1.00 0.00 ? 45 LYS B HD3  5  
ATOM 10406 H HE2  . LYS B 1 41 ? -14.765 -6.444  -5.903  1.00 0.00 ? 45 LYS B HE2  5  
ATOM 10407 H HE3  . LYS B 1 41 ? -15.923 -5.824  -7.063  1.00 0.00 ? 45 LYS B HE3  5  
ATOM 10408 H HZ1  . LYS B 1 41 ? -14.599 -8.439  -7.276  1.00 0.00 ? 45 LYS B HZ1  5  
ATOM 10409 H HZ2  . LYS B 1 41 ? -16.117 -8.203  -6.723  1.00 0.00 ? 45 LYS B HZ2  5  
ATOM 10410 H HZ3  . LYS B 1 41 ? -15.753 -7.864  -8.278  1.00 0.00 ? 45 LYS B HZ3  5  
ATOM 10411 N N    . ASN B 1 42 ? -12.520 -2.241  -9.597  1.00 0.00 ? 46 ASN B N    5  
ATOM 10412 C CA   . ASN B 1 42 ? -13.112 -2.063  -10.912 1.00 0.00 ? 46 ASN B CA   5  
ATOM 10413 C C    . ASN B 1 42 ? -12.008 -1.763  -11.927 1.00 0.00 ? 46 ASN B C    5  
ATOM 10414 O O    . ASN B 1 42 ? -12.255 -1.746  -13.132 1.00 0.00 ? 46 ASN B O    5  
ATOM 10415 C CB   . ASN B 1 42 ? -14.093 -0.889  -10.920 1.00 0.00 ? 46 ASN B CB   5  
ATOM 10416 C CG   . ASN B 1 42 ? -13.984 -0.091  -12.221 1.00 0.00 ? 46 ASN B CG   5  
ATOM 10417 O OD1  . ASN B 1 42 ? -14.286 -0.572  -13.301 1.00 0.00 ? 46 ASN B OD1  5  
ATOM 10418 N ND2  . ASN B 1 42 ? -13.536 1.150   -12.058 1.00 0.00 ? 46 ASN B ND2  5  
ATOM 10419 H H    . ASN B 1 42 ? -12.305 -1.393  -9.112  1.00 0.00 ? 46 ASN B H    5  
ATOM 10420 H HA   . ASN B 1 42 ? -13.629 -2.999  -11.122 1.00 0.00 ? 46 ASN B HA   5  
ATOM 10421 H HB2  . ASN B 1 42 ? -15.111 -1.261  -10.801 1.00 0.00 ? 46 ASN B HB2  5  
ATOM 10422 H HB3  . ASN B 1 42 ? -13.892 -0.236  -10.070 1.00 0.00 ? 46 ASN B HB3  5  
ATOM 10423 H HD21 . ASN B 1 42 ? -13.306 1.483   -11.143 1.00 0.00 ? 46 ASN B HD21 5  
ATOM 10424 H HD22 . ASN B 1 42 ? -13.430 1.752   -12.850 1.00 0.00 ? 46 ASN B HD22 5  
ATOM 10425 N N    . GLY B 1 43 ? -10.813 -1.533  -11.404 1.00 0.00 ? 47 GLY B N    5  
ATOM 10426 C CA   . GLY B 1 43 ? -9.670  -1.234  -12.250 1.00 0.00 ? 47 GLY B CA   5  
ATOM 10427 C C    . GLY B 1 43 ? -9.228  0.221   -12.081 1.00 0.00 ? 47 GLY B C    5  
ATOM 10428 O O    . GLY B 1 43 ? -8.148  0.601   -12.529 1.00 0.00 ? 47 GLY B O    5  
ATOM 10429 H H    . GLY B 1 43 ? -10.620 -1.549  -10.423 1.00 0.00 ? 47 GLY B H    5  
ATOM 10430 H HA2  . GLY B 1 43 ? -8.844  -1.900  -11.999 1.00 0.00 ? 47 GLY B HA2  5  
ATOM 10431 H HA3  . GLY B 1 43 ? -9.926  -1.422  -13.292 1.00 0.00 ? 47 GLY B HA3  5  
ATOM 10432 N N    . GLN B 1 44 ? -10.087 0.995   -11.434 1.00 0.00 ? 48 GLN B N    5  
ATOM 10433 C CA   . GLN B 1 44 ? -9.798  2.400   -11.200 1.00 0.00 ? 48 GLN B CA   5  
ATOM 10434 C C    . GLN B 1 44 ? -8.874  2.558   -9.991  1.00 0.00 ? 48 GLN B C    5  
ATOM 10435 O O    . GLN B 1 44 ? -8.391  1.570   -9.441  1.00 0.00 ? 48 GLN B O    5  
ATOM 10436 C CB   . GLN B 1 44 ? -11.089 3.200   -11.012 1.00 0.00 ? 48 GLN B CB   5  
ATOM 10437 C CG   . GLN B 1 44 ? -11.625 3.700   -12.355 1.00 0.00 ? 48 GLN B CG   5  
ATOM 10438 C CD   . GLN B 1 44 ? -12.898 4.527   -12.164 1.00 0.00 ? 48 GLN B CD   5  
ATOM 10439 O OE1  . GLN B 1 44 ? -13.693 4.292   -11.269 1.00 0.00 ? 48 GLN B OE1  5  
ATOM 10440 N NE2  . GLN B 1 44 ? -13.045 5.506   -13.052 1.00 0.00 ? 48 GLN B NE2  5  
ATOM 10441 H H    . GLN B 1 44 ? -10.963 0.678   -11.072 1.00 0.00 ? 48 GLN B H    5  
ATOM 10442 H HA   . GLN B 1 44 ? -9.292  2.745   -12.101 1.00 0.00 ? 48 GLN B HA   5  
ATOM 10443 H HB2  . GLN B 1 44 ? -11.840 2.577   -10.526 1.00 0.00 ? 48 GLN B HB2  5  
ATOM 10444 H HB3  . GLN B 1 44 ? -10.903 4.048   -10.353 1.00 0.00 ? 48 GLN B HB3  5  
ATOM 10445 H HG2  . GLN B 1 44 ? -10.865 4.304   -12.852 1.00 0.00 ? 48 GLN B HG2  5  
ATOM 10446 H HG3  . GLN B 1 44 ? -11.833 2.851   -13.006 1.00 0.00 ? 48 GLN B HG3  5  
ATOM 10447 H HE21 . GLN B 1 44 ? -12.355 5.645   -13.762 1.00 0.00 ? 48 GLN B HE21 5  
ATOM 10448 H HE22 . GLN B 1 44 ? -13.847 6.103   -13.010 1.00 0.00 ? 48 GLN B HE22 5  
ATOM 10449 N N    . LYS B 1 45 ? -8.655  3.810   -9.614  1.00 0.00 ? 49 LYS B N    5  
ATOM 10450 C CA   . LYS B 1 45 ? -7.797  4.110   -8.481  1.00 0.00 ? 49 LYS B CA   5  
ATOM 10451 C C    . LYS B 1 45 ? -8.327  5.351   -7.760  1.00 0.00 ? 49 LYS B C    5  
ATOM 10452 O O    . LYS B 1 45 ? -8.848  6.267   -8.395  1.00 0.00 ? 49 LYS B O    5  
ATOM 10453 C CB   . LYS B 1 45 ? -6.340  4.236   -8.931  1.00 0.00 ? 49 LYS B CB   5  
ATOM 10454 C CG   . LYS B 1 45 ? -5.891  2.987   -9.692  1.00 0.00 ? 49 LYS B CG   5  
ATOM 10455 C CD   . LYS B 1 45 ? -4.438  3.118   -10.152 1.00 0.00 ? 49 LYS B CD   5  
ATOM 10456 C CE   . LYS B 1 45 ? -3.891  1.771   -10.631 1.00 0.00 ? 49 LYS B CE   5  
ATOM 10457 N NZ   . LYS B 1 45 ? -3.677  1.790   -12.095 1.00 0.00 ? 49 LYS B NZ   5  
ATOM 10458 H H    . LYS B 1 45 ? -9.051  4.608   -10.068 1.00 0.00 ? 49 LYS B H    5  
ATOM 10459 H HA   . LYS B 1 45 ? -7.851  3.264   -7.796  1.00 0.00 ? 49 LYS B HA   5  
ATOM 10460 H HB2  . LYS B 1 45 ? -6.226  5.114   -9.566  1.00 0.00 ? 49 LYS B HB2  5  
ATOM 10461 H HB3  . LYS B 1 45 ? -5.699  4.387   -8.062  1.00 0.00 ? 49 LYS B HB3  5  
ATOM 10462 H HG2  . LYS B 1 45 ? -5.996  2.110   -9.052  1.00 0.00 ? 49 LYS B HG2  5  
ATOM 10463 H HG3  . LYS B 1 45 ? -6.538  2.831   -10.555 1.00 0.00 ? 49 LYS B HG3  5  
ATOM 10464 H HD2  . LYS B 1 45 ? -4.373  3.848   -10.959 1.00 0.00 ? 49 LYS B HD2  5  
ATOM 10465 H HD3  . LYS B 1 45 ? -3.825  3.493   -9.333  1.00 0.00 ? 49 LYS B HD3  5  
ATOM 10466 H HE2  . LYS B 1 45 ? -2.952  1.552   -10.123 1.00 0.00 ? 49 LYS B HE2  5  
ATOM 10467 H HE3  . LYS B 1 45 ? -4.588  0.975   -10.370 1.00 0.00 ? 49 LYS B HE3  5  
ATOM 10468 H HZ1  . LYS B 1 45 ? -4.223  2.522   -12.503 1.00 0.00 ? 49 LYS B HZ1  5  
ATOM 10469 H HZ2  . LYS B 1 45 ? -2.709  1.950   -12.289 1.00 0.00 ? 49 LYS B HZ2  5  
ATOM 10470 H HZ3  . LYS B 1 45 ? -3.954  0.911   -12.484 1.00 0.00 ? 49 LYS B HZ3  5  
ATOM 10471 N N    . ALA B 1 46 ? -8.176  5.342   -6.444  1.00 0.00 ? 50 ALA B N    5  
ATOM 10472 C CA   . ALA B 1 46 ? -8.634  6.455   -5.630  1.00 0.00 ? 50 ALA B CA   5  
ATOM 10473 C C    . ALA B 1 46 ? -7.553  6.812   -4.607  1.00 0.00 ? 50 ALA B C    5  
ATOM 10474 O O    . ALA B 1 46 ? -7.274  6.033   -3.697  1.00 0.00 ? 50 ALA B O    5  
ATOM 10475 C CB   . ALA B 1 46 ? -9.965  6.092   -4.969  1.00 0.00 ? 50 ALA B CB   5  
ATOM 10476 H H    . ALA B 1 46 ? -7.751  4.593   -5.935  1.00 0.00 ? 50 ALA B H    5  
ATOM 10477 H HA   . ALA B 1 46 ? -8.791  7.307   -6.292  1.00 0.00 ? 50 ALA B HA   5  
ATOM 10478 H HB1  . ALA B 1 46 ? -10.729 6.807   -5.273  1.00 0.00 ? 50 ALA B HB1  5  
ATOM 10479 H HB2  . ALA B 1 46 ? -9.851  6.119   -3.885  1.00 0.00 ? 50 ALA B HB2  5  
ATOM 10480 H HB3  . ALA B 1 46 ? -10.262 5.090   -5.278  1.00 0.00 ? 50 ALA B HB3  5  
ATOM 10481 N N    . CYS B 1 47 ? -6.973  7.988   -4.793  1.00 0.00 ? 51 CYS B N    5  
ATOM 10482 C CA   . CYS B 1 47 ? -5.929  8.457   -3.897  1.00 0.00 ? 51 CYS B CA   5  
ATOM 10483 C C    . CYS B 1 47 ? -6.549  8.698   -2.520  1.00 0.00 ? 51 CYS B C    5  
ATOM 10484 O O    . CYS B 1 47 ? -7.668  9.200   -2.418  1.00 0.00 ? 51 CYS B O    5  
ATOM 10485 C CB   . CYS B 1 47 ? -5.240  9.711   -4.440  1.00 0.00 ? 51 CYS B CB   5  
ATOM 10486 S SG   . CYS B 1 47 ? -3.561  9.434   -5.112  1.00 0.00 ? 51 CYS B SG   5  
ATOM 10487 H H    . CYS B 1 47 ? -7.205  8.616   -5.536  1.00 0.00 ? 51 CYS B H    5  
ATOM 10488 H HA   . CYS B 1 47 ? -5.178  7.669   -3.852  1.00 0.00 ? 51 CYS B HA   5  
ATOM 10489 H HB2  . CYS B 1 47 ? -5.863  10.141  -5.224  1.00 0.00 ? 51 CYS B HB2  5  
ATOM 10490 H HB3  . CYS B 1 47 ? -5.179  10.450  -3.640  1.00 0.00 ? 51 CYS B HB3  5  
ATOM 10491 N N    . LEU B 1 48 ? -5.797  8.328   -1.494  1.00 0.00 ? 52 LEU B N    5  
ATOM 10492 C CA   . LEU B 1 48 ? -6.259  8.497   -0.127  1.00 0.00 ? 52 LEU B CA   5  
ATOM 10493 C C    . LEU B 1 48 ? -5.417  9.573   0.562   1.00 0.00 ? 52 LEU B C    5  
ATOM 10494 O O    . LEU B 1 48 ? -4.347  9.936   0.074   1.00 0.00 ? 52 LEU B O    5  
ATOM 10495 C CB   . LEU B 1 48 ? -6.262  7.155   0.607   1.00 0.00 ? 52 LEU B CB   5  
ATOM 10496 C CG   . LEU B 1 48 ? -7.122  6.053   -0.014  1.00 0.00 ? 52 LEU B CG   5  
ATOM 10497 C CD1  . LEU B 1 48 ? -6.729  4.678   0.531   1.00 0.00 ? 52 LEU B CD1  5  
ATOM 10498 C CD2  . LEU B 1 48 ? -8.611  6.343   0.183   1.00 0.00 ? 52 LEU B CD2  5  
ATOM 10499 H H    . LEU B 1 48 ? -4.888  7.920   -1.586  1.00 0.00 ? 52 LEU B H    5  
ATOM 10500 H HA   . LEU B 1 48 ? -7.291  8.843   -0.172  1.00 0.00 ? 52 LEU B HA   5  
ATOM 10501 H HB2  . LEU B 1 48 ? -5.235  6.795   0.670   1.00 0.00 ? 52 LEU B HB2  5  
ATOM 10502 H HB3  . LEU B 1 48 ? -6.603  7.323   1.629   1.00 0.00 ? 52 LEU B HB3  5  
ATOM 10503 H HG   . LEU B 1 48 ? -6.936  6.038   -1.088  1.00 0.00 ? 52 LEU B HG   5  
ATOM 10504 H HD11 . LEU B 1 48 ? -5.648  4.556   0.464   1.00 0.00 ? 52 LEU B HD11 5  
ATOM 10505 H HD12 . LEU B 1 48 ? -7.040  4.598   1.573   1.00 0.00 ? 52 LEU B HD12 5  
ATOM 10506 H HD13 . LEU B 1 48 ? -7.219  3.901   -0.055  1.00 0.00 ? 52 LEU B HD13 5  
ATOM 10507 H HD21 . LEU B 1 48 ? -8.735  7.099   0.958   1.00 0.00 ? 52 LEU B HD21 5  
ATOM 10508 H HD22 . LEU B 1 48 ? -9.037  6.708   -0.752  1.00 0.00 ? 52 LEU B HD22 5  
ATOM 10509 H HD23 . LEU B 1 48 ? -9.123  5.428   0.482   1.00 0.00 ? 52 LEU B HD23 5  
ATOM 10510 N N    . ASN B 1 49 ? -5.931  10.053  1.684   1.00 0.00 ? 53 ASN B N    5  
ATOM 10511 C CA   . ASN B 1 49 ? -5.240  11.080  2.445   1.00 0.00 ? 53 ASN B CA   5  
ATOM 10512 C C    . ASN B 1 49 ? -4.465  10.426  3.590   1.00 0.00 ? 53 ASN B C    5  
ATOM 10513 O O    . ASN B 1 49 ? -5.060  9.822   4.481   1.00 0.00 ? 53 ASN B O    5  
ATOM 10514 C CB   . ASN B 1 49 ? -6.230  12.076  3.052   1.00 0.00 ? 53 ASN B CB   5  
ATOM 10515 C CG   . ASN B 1 49 ? -5.534  13.389  3.417   1.00 0.00 ? 53 ASN B CG   5  
ATOM 10516 O OD1  . ASN B 1 49 ? -4.556  13.792  2.810   1.00 0.00 ? 53 ASN B OD1  5  
ATOM 10517 N ND2  . ASN B 1 49 ? -6.091  14.030  4.440   1.00 0.00 ? 53 ASN B ND2  5  
ATOM 10518 H H    . ASN B 1 49 ? -6.802  9.753   2.074   1.00 0.00 ? 53 ASN B H    5  
ATOM 10519 H HA   . ASN B 1 49 ? -4.586  11.576  1.728   1.00 0.00 ? 53 ASN B HA   5  
ATOM 10520 H HB2  . ASN B 1 49 ? -7.036  12.272  2.344   1.00 0.00 ? 53 ASN B HB2  5  
ATOM 10521 H HB3  . ASN B 1 49 ? -6.687  11.643  3.942   1.00 0.00 ? 53 ASN B HB3  5  
ATOM 10522 H HD21 . ASN B 1 49 ? -6.894  13.644  4.896   1.00 0.00 ? 53 ASN B HD21 5  
ATOM 10523 H HD22 . ASN B 1 49 ? -5.708  14.899  4.755   1.00 0.00 ? 53 ASN B HD22 5  
ATOM 10524 N N    . PRO B 1 50 ? -3.114  10.573  3.528   1.00 0.00 ? 54 PRO B N    5  
ATOM 10525 C CA   . PRO B 1 50 ? -2.252  10.003  4.549   1.00 0.00 ? 54 PRO B CA   5  
ATOM 10526 C C    . PRO B 1 50 ? -2.316  10.822  5.840   1.00 0.00 ? 54 PRO B C    5  
ATOM 10527 O O    . PRO B 1 50 ? -1.647  10.495  6.820   1.00 0.00 ? 54 PRO B O    5  
ATOM 10528 C CB   . PRO B 1 50 ? -0.865  9.983   3.926   1.00 0.00 ? 54 PRO B CB   5  
ATOM 10529 C CG   . PRO B 1 50 ? -0.916  10.963  2.765   1.00 0.00 ? 54 PRO B CG   5  
ATOM 10530 C CD   . PRO B 1 50 ? -2.376  11.282  2.487   1.00 0.00 ? 54 PRO B CD   5  
ATOM 10531 H HA   . PRO B 1 50 ? -2.562  9.084   4.792   1.00 0.00 ? 54 PRO B HA   5  
ATOM 10532 H HB2  . PRO B 1 50 ? -0.107  10.276  4.652   1.00 0.00 ? 54 PRO B HB2  5  
ATOM 10533 H HB3  . PRO B 1 50 ? -0.606  8.982   3.581   1.00 0.00 ? 54 PRO B HB3  5  
ATOM 10534 H HG2  . PRO B 1 50 ? -0.366  11.872  3.009   1.00 0.00 ? 54 PRO B HG2  5  
ATOM 10535 H HG3  . PRO B 1 50 ? -0.444  10.533  1.882   1.00 0.00 ? 54 PRO B HG3  5  
ATOM 10536 H HD2  . PRO B 1 50 ? -2.562  12.355  2.531   1.00 0.00 ? 54 PRO B HD2  5  
ATOM 10537 H HD3  . PRO B 1 50 ? -2.672  10.948  1.493   1.00 0.00 ? 54 PRO B HD3  5  
ATOM 10538 N N    . ALA B 1 51 ? -3.126  11.869  5.799   1.00 0.00 ? 55 ALA B N    5  
ATOM 10539 C CA   . ALA B 1 51 ? -3.286  12.737  6.953   1.00 0.00 ? 55 ALA B CA   5  
ATOM 10540 C C    . ALA B 1 51 ? -4.657  12.492  7.585   1.00 0.00 ? 55 ALA B C    5  
ATOM 10541 O O    . ALA B 1 51 ? -5.114  13.279  8.412   1.00 0.00 ? 55 ALA B O    5  
ATOM 10542 C CB   . ALA B 1 51 ? -3.092  14.194  6.528   1.00 0.00 ? 55 ALA B CB   5  
ATOM 10543 H H    . ALA B 1 51 ? -3.666  12.128  4.998   1.00 0.00 ? 55 ALA B H    5  
ATOM 10544 H HA   . ALA B 1 51 ? -2.511  12.476  7.675   1.00 0.00 ? 55 ALA B HA   5  
ATOM 10545 H HB1  . ALA B 1 51 ? -3.077  14.832  7.412   1.00 0.00 ? 55 ALA B HB1  5  
ATOM 10546 H HB2  . ALA B 1 51 ? -2.147  14.293  5.993   1.00 0.00 ? 55 ALA B HB2  5  
ATOM 10547 H HB3  . ALA B 1 51 ? -3.912  14.494  5.876   1.00 0.00 ? 55 ALA B HB3  5  
ATOM 10548 N N    . SER B 1 52 ? -5.277  11.396  7.170   1.00 0.00 ? 56 SER B N    5  
ATOM 10549 C CA   . SER B 1 52 ? -6.588  11.037  7.684   1.00 0.00 ? 56 SER B CA   5  
ATOM 10550 C C    . SER B 1 52 ? -6.480  9.792   8.566   1.00 0.00 ? 56 SER B C    5  
ATOM 10551 O O    . SER B 1 52 ? -5.694  8.890   8.280   1.00 0.00 ? 56 SER B O    5  
ATOM 10552 C CB   . SER B 1 52 ? -7.580  10.797  6.544   1.00 0.00 ? 56 SER B CB   5  
ATOM 10553 O OG   . SER B 1 52 ? -8.755  10.127  6.992   1.00 0.00 ? 56 SER B OG   5  
ATOM 10554 H H    . SER B 1 52 ? -4.899  10.761  6.496   1.00 0.00 ? 56 SER B H    5  
ATOM 10555 H HA   . SER B 1 52 ? -6.912  11.896  8.272   1.00 0.00 ? 56 SER B HA   5  
ATOM 10556 H HB2  . SER B 1 52 ? -7.855  11.752  6.096   1.00 0.00 ? 56 SER B HB2  5  
ATOM 10557 H HB3  . SER B 1 52 ? -7.100  10.206  5.764   1.00 0.00 ? 56 SER B HB3  5  
ATOM 10558 H HG   . SER B 1 52 ? -9.526  10.355  6.398   1.00 0.00 ? 56 SER B HG   5  
ATOM 10559 N N    . PRO B 1 53 ? -7.304  9.781   9.648   1.00 0.00 ? 57 PRO B N    5  
ATOM 10560 C CA   . PRO B 1 53 ? -7.310  8.661   10.573  1.00 0.00 ? 57 PRO B CA   5  
ATOM 10561 C C    . PRO B 1 53 ? -8.030  7.454   9.969   1.00 0.00 ? 57 PRO B C    5  
ATOM 10562 O O    . PRO B 1 53 ? -7.757  6.313   10.340  1.00 0.00 ? 57 PRO B O    5  
ATOM 10563 C CB   . PRO B 1 53 ? -7.986  9.190   11.827  1.00 0.00 ? 57 PRO B CB   5  
ATOM 10564 C CG   . PRO B 1 53 ? -8.747  10.433  11.398  1.00 0.00 ? 57 PRO B CG   5  
ATOM 10565 C CD   . PRO B 1 53 ? -8.249  10.831  10.017  1.00 0.00 ? 57 PRO B CD   5  
ATOM 10566 H HA   . PRO B 1 53 ? -6.375  8.357   10.756  1.00 0.00 ? 57 PRO B HA   5  
ATOM 10567 H HB2  . PRO B 1 53 ? -8.661  8.446   12.251  1.00 0.00 ? 57 PRO B HB2  5  
ATOM 10568 H HB3  . PRO B 1 53 ? -7.251  9.428   12.597  1.00 0.00 ? 57 PRO B HB3  5  
ATOM 10569 H HG2  . PRO B 1 53 ? -9.819  10.236  11.375  1.00 0.00 ? 57 PRO B HG2  5  
ATOM 10570 H HG3  . PRO B 1 53 ? -8.587  11.244  12.109  1.00 0.00 ? 57 PRO B HG3  5  
ATOM 10571 H HD2  . PRO B 1 53 ? -9.070  10.894  9.303   1.00 0.00 ? 57 PRO B HD2  5  
ATOM 10572 H HD3  . PRO B 1 53 ? -7.767  11.808  10.037  1.00 0.00 ? 57 PRO B HD3  5  
ATOM 10573 N N    . MET B 1 54 ? -8.937  7.746   9.048   1.00 0.00 ? 58 MET B N    5  
ATOM 10574 C CA   . MET B 1 54 ? -9.699  6.699   8.389   1.00 0.00 ? 58 MET B CA   5  
ATOM 10575 C C    . MET B 1 54 ? -8.888  6.058   7.262   1.00 0.00 ? 58 MET B C    5  
ATOM 10576 O O    . MET B 1 54 ? -9.188  4.945   6.831   1.00 0.00 ? 58 MET B O    5  
ATOM 10577 C CB   . MET B 1 54 ? -10.990 7.290   7.818   1.00 0.00 ? 58 MET B CB   5  
ATOM 10578 C CG   . MET B 1 54 ? -12.219 6.610   8.424   1.00 0.00 ? 58 MET B CG   5  
ATOM 10579 S SD   . MET B 1 54 ? -12.979 7.685   9.629   1.00 0.00 ? 58 MET B SD   5  
ATOM 10580 C CE   . MET B 1 54 ? -11.976 7.308   11.057  1.00 0.00 ? 58 MET B CE   5  
ATOM 10581 H H    . MET B 1 54 ? -9.153  8.677   8.752   1.00 0.00 ? 58 MET B H    5  
ATOM 10582 H HA   . MET B 1 54 ? -9.909  5.959   9.162   1.00 0.00 ? 58 MET B HA   5  
ATOM 10583 H HB2  . MET B 1 54 ? -11.025 8.360   8.020   1.00 0.00 ? 58 MET B HB2  5  
ATOM 10584 H HB3  . MET B 1 54 ? -11.001 7.169   6.735   1.00 0.00 ? 58 MET B HB3  5  
ATOM 10585 H HG2  . MET B 1 54 ? -12.935 6.367   7.639   1.00 0.00 ? 58 MET B HG2  5  
ATOM 10586 H HG3  . MET B 1 54 ? -11.930 5.670   8.894   1.00 0.00 ? 58 MET B HG3  5  
ATOM 10587 H HE1  . MET B 1 54 ? -10.922 7.409   10.798  1.00 0.00 ? 58 MET B HE1  5  
ATOM 10588 H HE2  . MET B 1 54 ? -12.220 7.998   11.865  1.00 0.00 ? 58 MET B HE2  5  
ATOM 10589 H HE3  . MET B 1 54 ? -12.174 6.286   11.380  1.00 0.00 ? 58 MET B HE3  5  
ATOM 10590 N N    . VAL B 1 55 ? -7.875  6.787   6.816   1.00 0.00 ? 59 VAL B N    5  
ATOM 10591 C CA   . VAL B 1 55 ? -7.019  6.303   5.746   1.00 0.00 ? 59 VAL B CA   5  
ATOM 10592 C C    . VAL B 1 55 ? -5.966  5.359   6.330   1.00 0.00 ? 59 VAL B C    5  
ATOM 10593 O O    . VAL B 1 55 ? -5.184  4.762   5.591   1.00 0.00 ? 59 VAL B O    5  
ATOM 10594 C CB   . VAL B 1 55 ? -6.409  7.484   4.989   1.00 0.00 ? 59 VAL B CB   5  
ATOM 10595 C CG1  . VAL B 1 55 ? -5.278  7.020   4.069   1.00 0.00 ? 59 VAL B CG1  5  
ATOM 10596 C CG2  . VAL B 1 55 ? -7.479  8.243   4.203   1.00 0.00 ? 59 VAL B CG2  5  
ATOM 10597 H H    . VAL B 1 55 ? -7.638  7.690   7.171   1.00 0.00 ? 59 VAL B H    5  
ATOM 10598 H HA   . VAL B 1 55 ? -7.645  5.743   5.051   1.00 0.00 ? 59 VAL B HA   5  
ATOM 10599 H HB   . VAL B 1 55 ? -5.984  8.169   5.723   1.00 0.00 ? 59 VAL B HB   5  
ATOM 10600 H HG11 . VAL B 1 55 ? -5.629  6.195   3.449   1.00 0.00 ? 59 VAL B HG11 5  
ATOM 10601 H HG12 . VAL B 1 55 ? -4.966  7.847   3.431   1.00 0.00 ? 59 VAL B HG12 5  
ATOM 10602 H HG13 . VAL B 1 55 ? -4.432  6.688   4.671   1.00 0.00 ? 59 VAL B HG13 5  
ATOM 10603 H HG21 . VAL B 1 55 ? -8.382  8.328   4.808   1.00 0.00 ? 59 VAL B HG21 5  
ATOM 10604 H HG22 . VAL B 1 55 ? -7.112  9.240   3.958   1.00 0.00 ? 59 VAL B HG22 5  
ATOM 10605 H HG23 . VAL B 1 55 ? -7.707  7.703   3.284   1.00 0.00 ? 59 VAL B HG23 5  
ATOM 10606 N N    . LYS B 1 56 ? -5.979  5.253   7.651   1.00 0.00 ? 60 LYS B N    5  
ATOM 10607 C CA   . LYS B 1 56 ? -5.035  4.392   8.342   1.00 0.00 ? 60 LYS B CA   5  
ATOM 10608 C C    . LYS B 1 56 ? -5.770  3.161   8.876   1.00 0.00 ? 60 LYS B C    5  
ATOM 10609 O O    . LYS B 1 56 ? -5.176  2.324   9.555   1.00 0.00 ? 60 LYS B O    5  
ATOM 10610 C CB   . LYS B 1 56 ? -4.285  5.176   9.421   1.00 0.00 ? 60 LYS B CB   5  
ATOM 10611 C CG   . LYS B 1 56 ? -3.768  6.507   8.872   1.00 0.00 ? 60 LYS B CG   5  
ATOM 10612 C CD   . LYS B 1 56 ? -2.562  6.292   7.956   1.00 0.00 ? 60 LYS B CD   5  
ATOM 10613 C CE   . LYS B 1 56 ? -1.269  6.191   8.767   1.00 0.00 ? 60 LYS B CE   5  
ATOM 10614 N NZ   . LYS B 1 56 ? -0.855  7.527   9.250   1.00 0.00 ? 60 LYS B NZ   5  
ATOM 10615 H H    . LYS B 1 56 ? -6.618  5.742   8.245   1.00 0.00 ? 60 LYS B H    5  
ATOM 10616 H HA   . LYS B 1 56 ? -4.296  4.063   7.611   1.00 0.00 ? 60 LYS B HA   5  
ATOM 10617 H HB2  . LYS B 1 56 ? -4.946  5.360   10.268  1.00 0.00 ? 60 LYS B HB2  5  
ATOM 10618 H HB3  . LYS B 1 56 ? -3.449  4.583   9.793   1.00 0.00 ? 60 LYS B HB3  5  
ATOM 10619 H HG2  . LYS B 1 56 ? -4.563  7.010   8.321   1.00 0.00 ? 60 LYS B HG2  5  
ATOM 10620 H HG3  . LYS B 1 56 ? -3.490  7.162   9.698   1.00 0.00 ? 60 LYS B HG3  5  
ATOM 10621 H HD2  . LYS B 1 56 ? -2.702  5.381   7.373   1.00 0.00 ? 60 LYS B HD2  5  
ATOM 10622 H HD3  . LYS B 1 56 ? -2.488  7.116   7.246   1.00 0.00 ? 60 LYS B HD3  5  
ATOM 10623 H HE2  . LYS B 1 56 ? -1.414  5.520   9.613   1.00 0.00 ? 60 LYS B HE2  5  
ATOM 10624 H HE3  . LYS B 1 56 ? -0.479  5.761   8.151   1.00 0.00 ? 60 LYS B HE3  5  
ATOM 10625 H HZ1  . LYS B 1 56 ? -1.407  8.230   8.801   1.00 0.00 ? 60 LYS B HZ1  5  
ATOM 10626 H HZ2  . LYS B 1 56 ? -0.990  7.580   10.240  1.00 0.00 ? 60 LYS B HZ2  5  
ATOM 10627 H HZ3  . LYS B 1 56 ? 0.111   7.675   9.037   1.00 0.00 ? 60 LYS B HZ3  5  
ATOM 10628 N N    . LYS B 1 57 ? -7.052  3.089   8.549   1.00 0.00 ? 61 LYS B N    5  
ATOM 10629 C CA   . LYS B 1 57 ? -7.874  1.974   8.986   1.00 0.00 ? 61 LYS B CA   5  
ATOM 10630 C C    . LYS B 1 57 ? -8.428  1.242   7.762   1.00 0.00 ? 61 LYS B C    5  
ATOM 10631 O O    . LYS B 1 57 ? -8.919  0.120   7.874   1.00 0.00 ? 61 LYS B O    5  
ATOM 10632 C CB   . LYS B 1 57 ? -8.956  2.454   9.956   1.00 0.00 ? 61 LYS B CB   5  
ATOM 10633 C CG   . LYS B 1 57 ? -10.142 3.057   9.201   1.00 0.00 ? 61 LYS B CG   5  
ATOM 10634 C CD   . LYS B 1 57 ? -11.284 2.046   9.077   1.00 0.00 ? 61 LYS B CD   5  
ATOM 10635 C CE   . LYS B 1 57 ? -12.555 2.717   8.554   1.00 0.00 ? 61 LYS B CE   5  
ATOM 10636 N NZ   . LYS B 1 57 ? -13.480 1.708   7.990   1.00 0.00 ? 61 LYS B NZ   5  
ATOM 10637 H H    . LYS B 1 57 ? -7.527  3.773   7.996   1.00 0.00 ? 61 LYS B H    5  
ATOM 10638 H HA   . LYS B 1 57 ? -7.230  1.288   9.536   1.00 0.00 ? 61 LYS B HA   5  
ATOM 10639 H HB2  . LYS B 1 57 ? -9.297  1.620   10.570  1.00 0.00 ? 61 LYS B HB2  5  
ATOM 10640 H HB3  . LYS B 1 57 ? -8.537  3.197   10.635  1.00 0.00 ? 61 LYS B HB3  5  
ATOM 10641 H HG2  . LYS B 1 57 ? -10.494 3.948   9.721   1.00 0.00 ? 61 LYS B HG2  5  
ATOM 10642 H HG3  . LYS B 1 57 ? -9.822  3.373   8.208   1.00 0.00 ? 61 LYS B HG3  5  
ATOM 10643 H HD2  . LYS B 1 57 ? -10.990 1.241   8.405   1.00 0.00 ? 61 LYS B HD2  5  
ATOM 10644 H HD3  . LYS B 1 57 ? -11.481 1.594   10.049  1.00 0.00 ? 61 LYS B HD3  5  
ATOM 10645 H HE2  . LYS B 1 57 ? -13.047 3.259   9.362   1.00 0.00 ? 61 LYS B HE2  5  
ATOM 10646 H HE3  . LYS B 1 57 ? -12.298 3.451   7.789   1.00 0.00 ? 61 LYS B HE3  5  
ATOM 10647 H HZ1  . LYS B 1 57 ? -13.278 0.813   8.388   1.00 0.00 ? 61 LYS B HZ1  5  
ATOM 10648 H HZ2  . LYS B 1 57 ? -14.423 1.963   8.205   1.00 0.00 ? 61 LYS B HZ2  5  
ATOM 10649 H HZ3  . LYS B 1 57 ? -13.363 1.666   6.998   1.00 0.00 ? 61 LYS B HZ3  5  
ATOM 10650 N N    . ILE B 1 58 ? -8.330  1.907   6.620   1.00 0.00 ? 62 ILE B N    5  
ATOM 10651 C CA   . ILE B 1 58 ? -8.814  1.334   5.376   1.00 0.00 ? 62 ILE B CA   5  
ATOM 10652 C C    . ILE B 1 58 ? -7.667  0.603   4.676   1.00 0.00 ? 62 ILE B C    5  
ATOM 10653 O O    . ILE B 1 58 ? -7.898  -0.203  3.775   1.00 0.00 ? 62 ILE B O    5  
ATOM 10654 C CB   . ILE B 1 58 ? -9.476  2.410   4.513   1.00 0.00 ? 62 ILE B CB   5  
ATOM 10655 C CG1  . ILE B 1 58 ? -10.616 3.096   5.268   1.00 0.00 ? 62 ILE B CG1  5  
ATOM 10656 C CG2  . ILE B 1 58 ? -9.942  1.830   3.175   1.00 0.00 ? 62 ILE B CG2  5  
ATOM 10657 C CD1  . ILE B 1 58 ? -10.778 4.549   4.817   1.00 0.00 ? 62 ILE B CD1  5  
ATOM 10658 H H    . ILE B 1 58 ? -7.929  2.820   6.537   1.00 0.00 ? 62 ILE B H    5  
ATOM 10659 H HA   . ILE B 1 58 ? -9.585  0.606   5.630   1.00 0.00 ? 62 ILE B HA   5  
ATOM 10660 H HB   . ILE B 1 58 ? -8.732  3.175   4.290   1.00 0.00 ? 62 ILE B HB   5  
ATOM 10661 H HG12 . ILE B 1 58 ? -11.546 2.553   5.100   1.00 0.00 ? 62 ILE B HG12 5  
ATOM 10662 H HG13 . ILE B 1 58 ? -10.418 3.064   6.340   1.00 0.00 ? 62 ILE B HG13 5  
ATOM 10663 H HG21 . ILE B 1 58 ? -10.150 0.767   3.293   1.00 0.00 ? 62 ILE B HG21 5  
ATOM 10664 H HG22 . ILE B 1 58 ? -10.847 2.344   2.852   1.00 0.00 ? 62 ILE B HG22 5  
ATOM 10665 H HG23 . ILE B 1 58 ? -9.160  1.967   2.428   1.00 0.00 ? 62 ILE B HG23 5  
ATOM 10666 H HD11 . ILE B 1 58 ? -9.809  4.944   4.512   1.00 0.00 ? 62 ILE B HD11 5  
ATOM 10667 H HD12 . ILE B 1 58 ? -11.470 4.593   3.976   1.00 0.00 ? 62 ILE B HD12 5  
ATOM 10668 H HD13 . ILE B 1 58 ? -11.169 5.144   5.642   1.00 0.00 ? 62 ILE B HD13 5  
ATOM 10669 N N    . ILE B 1 59 ? -6.456  0.910   5.115   1.00 0.00 ? 63 ILE B N    5  
ATOM 10670 C CA   . ILE B 1 59 ? -5.273  0.292   4.542   1.00 0.00 ? 63 ILE B CA   5  
ATOM 10671 C C    . ILE B 1 59 ? -4.873  -0.918  5.389   1.00 0.00 ? 63 ILE B C    5  
ATOM 10672 O O    . ILE B 1 59 ? -4.741  -2.026  4.872   1.00 0.00 ? 63 ILE B O    5  
ATOM 10673 C CB   . ILE B 1 59 ? -4.155  1.324   4.378   1.00 0.00 ? 63 ILE B CB   5  
ATOM 10674 C CG1  . ILE B 1 59 ? -4.435  2.252   3.194   1.00 0.00 ? 63 ILE B CG1  5  
ATOM 10675 C CG2  . ILE B 1 59 ? -2.791  0.641   4.261   1.00 0.00 ? 63 ILE B CG2  5  
ATOM 10676 C CD1  . ILE B 1 59 ? -3.791  3.623   3.408   1.00 0.00 ? 63 ILE B CD1  5  
ATOM 10677 H H    . ILE B 1 59 ? -6.277  1.566   5.848   1.00 0.00 ? 63 ILE B H    5  
ATOM 10678 H HA   . ILE B 1 59 ? -5.538  -0.058  3.544   1.00 0.00 ? 63 ILE B HA   5  
ATOM 10679 H HB   . ILE B 1 59 ? -4.129  1.944   5.274   1.00 0.00 ? 63 ILE B HB   5  
ATOM 10680 H HG12 . ILE B 1 59 ? -4.050  1.804   2.278   1.00 0.00 ? 63 ILE B HG12 5  
ATOM 10681 H HG13 . ILE B 1 59 ? -5.511  2.367   3.064   1.00 0.00 ? 63 ILE B HG13 5  
ATOM 10682 H HG21 . ILE B 1 59 ? -2.925  -0.380  3.904   1.00 0.00 ? 63 ILE B HG21 5  
ATOM 10683 H HG22 . ILE B 1 59 ? -2.167  1.193   3.558   1.00 0.00 ? 63 ILE B HG22 5  
ATOM 10684 H HG23 . ILE B 1 59 ? -2.309  0.623   5.238   1.00 0.00 ? 63 ILE B HG23 5  
ATOM 10685 H HD11 . ILE B 1 59 ? -3.588  3.768   4.469   1.00 0.00 ? 63 ILE B HD11 5  
ATOM 10686 H HD12 . ILE B 1 59 ? -2.857  3.677   2.849   1.00 0.00 ? 63 ILE B HD12 5  
ATOM 10687 H HD13 . ILE B 1 59 ? -4.470  4.401   3.058   1.00 0.00 ? 63 ILE B HD13 5  
ATOM 10688 N N    . GLU B 1 60 ? -4.691  -0.664  6.677   1.00 0.00 ? 64 GLU B N    5  
ATOM 10689 C CA   . GLU B 1 60 ? -4.310  -1.719  7.601   1.00 0.00 ? 64 GLU B CA   5  
ATOM 10690 C C    . GLU B 1 60 ? -5.293  -2.887  7.509   1.00 0.00 ? 64 GLU B C    5  
ATOM 10691 O O    . GLU B 1 60 ? -4.902  -4.045  7.646   1.00 0.00 ? 64 GLU B O    5  
ATOM 10692 C CB   . GLU B 1 60 ? -4.221  -1.187  9.033   1.00 0.00 ? 64 GLU B CB   5  
ATOM 10693 C CG   . GLU B 1 60 ? -3.083  -0.175  9.173   1.00 0.00 ? 64 GLU B CG   5  
ATOM 10694 C CD   . GLU B 1 60 ? -3.300  0.729   10.388  1.00 0.00 ? 64 GLU B CD   5  
ATOM 10695 O OE1  . GLU B 1 60 ? -4.060  0.304   11.284  1.00 0.00 ? 64 GLU B OE1  5  
ATOM 10696 O OE2  . GLU B 1 60 ? -2.699  1.826   10.394  1.00 0.00 ? 64 GLU B OE2  5  
ATOM 10697 H H    . GLU B 1 60 ? -4.801  0.240   7.090   1.00 0.00 ? 64 GLU B H    5  
ATOM 10698 H HA   . GLU B 1 60 ? -3.320  -2.042  7.278   1.00 0.00 ? 64 GLU B HA   5  
ATOM 10699 H HB2  . GLU B 1 60 ? -5.165  -0.719  9.310   1.00 0.00 ? 64 GLU B HB2  5  
ATOM 10700 H HB3  . GLU B 1 60 ? -4.062  -2.016  9.723   1.00 0.00 ? 64 GLU B HB3  5  
ATOM 10701 H HG2  . GLU B 1 60 ? -2.133  -0.700  9.271   1.00 0.00 ? 64 GLU B HG2  5  
ATOM 10702 H HG3  . GLU B 1 60 ? -3.019  0.433   8.270   1.00 0.00 ? 64 GLU B HG3  5  
ATOM 10703 N N    . LYS B 1 61 ? -6.552  -2.542  7.278   1.00 0.00 ? 65 LYS B N    5  
ATOM 10704 C CA   . LYS B 1 61 ? -7.595  -3.548  7.167   1.00 0.00 ? 65 LYS B CA   5  
ATOM 10705 C C    . LYS B 1 61 ? -7.432  -4.301  5.845   1.00 0.00 ? 65 LYS B C    5  
ATOM 10706 O O    . LYS B 1 61 ? -7.674  -5.505  5.778   1.00 0.00 ? 65 LYS B O    5  
ATOM 10707 C CB   . LYS B 1 61 ? -8.974  -2.911  7.346   1.00 0.00 ? 65 LYS B CB   5  
ATOM 10708 C CG   . LYS B 1 61 ? -9.257  -2.620  8.821   1.00 0.00 ? 65 LYS B CG   5  
ATOM 10709 C CD   . LYS B 1 61 ? -10.730 -2.271  9.039   1.00 0.00 ? 65 LYS B CD   5  
ATOM 10710 C CE   . LYS B 1 61 ? -10.957 -1.699  10.439  1.00 0.00 ? 65 LYS B CE   5  
ATOM 10711 N NZ   . LYS B 1 61 ? -12.365 -1.273  10.604  1.00 0.00 ? 65 LYS B NZ   5  
ATOM 10712 H H    . LYS B 1 61 ? -6.862  -1.598  7.168   1.00 0.00 ? 65 LYS B H    5  
ATOM 10713 H HA   . LYS B 1 61 ? -7.457  -4.254  7.986   1.00 0.00 ? 65 LYS B HA   5  
ATOM 10714 H HB2  . LYS B 1 61 ? -9.030  -1.986  6.772   1.00 0.00 ? 65 LYS B HB2  5  
ATOM 10715 H HB3  . LYS B 1 61 ? -9.740  -3.578  6.949   1.00 0.00 ? 65 LYS B HB3  5  
ATOM 10716 H HG2  . LYS B 1 61 ? -8.992  -3.489  9.424   1.00 0.00 ? 65 LYS B HG2  5  
ATOM 10717 H HG3  . LYS B 1 61 ? -8.630  -1.795  9.159   1.00 0.00 ? 65 LYS B HG3  5  
ATOM 10718 H HD2  . LYS B 1 61 ? -11.051 -1.547  8.290   1.00 0.00 ? 65 LYS B HD2  5  
ATOM 10719 H HD3  . LYS B 1 61 ? -11.343 -3.162  8.903   1.00 0.00 ? 65 LYS B HD3  5  
ATOM 10720 H HE2  . LYS B 1 61 ? -10.707 -2.448  11.190  1.00 0.00 ? 65 LYS B HE2  5  
ATOM 10721 H HE3  . LYS B 1 61 ? -10.293 -0.850  10.603  1.00 0.00 ? 65 LYS B HE3  5  
ATOM 10722 H HZ1  . LYS B 1 61 ? -12.894 -1.555  9.803   1.00 0.00 ? 65 LYS B HZ1  5  
ATOM 10723 H HZ2  . LYS B 1 61 ? -12.748 -1.699  11.423  1.00 0.00 ? 65 LYS B HZ2  5  
ATOM 10724 H HZ3  . LYS B 1 61 ? -12.404 -0.278  10.696  1.00 0.00 ? 65 LYS B HZ3  5  
ATOM 10725 N N    . MET B 1 62 ? -7.022  -3.561  4.825   1.00 0.00 ? 66 MET B N    5  
ATOM 10726 C CA   . MET B 1 62 ? -6.824  -4.143  3.509   1.00 0.00 ? 66 MET B CA   5  
ATOM 10727 C C    . MET B 1 62 ? -5.840  -5.313  3.570   1.00 0.00 ? 66 MET B C    5  
ATOM 10728 O O    . MET B 1 62 ? -6.011  -6.310  2.870   1.00 0.00 ? 66 MET B O    5  
ATOM 10729 C CB   . MET B 1 62 ? -6.289  -3.075  2.553   1.00 0.00 ? 66 MET B CB   5  
ATOM 10730 C CG   . MET B 1 62 ? -7.256  -2.847  1.390   1.00 0.00 ? 66 MET B CG   5  
ATOM 10731 S SD   . MET B 1 62 ? -7.240  -4.257  0.296   1.00 0.00 ? 66 MET B SD   5  
ATOM 10732 C CE   . MET B 1 62 ? -5.486  -4.394  -0.007  1.00 0.00 ? 66 MET B CE   5  
ATOM 10733 H H    . MET B 1 62 ? -6.827  -2.582  4.888   1.00 0.00 ? 66 MET B H    5  
ATOM 10734 H HA   . MET B 1 62 ? -7.805  -4.501  3.196   1.00 0.00 ? 66 MET B HA   5  
ATOM 10735 H HB2  . MET B 1 62 ? -6.137  -2.141  3.094   1.00 0.00 ? 66 MET B HB2  5  
ATOM 10736 H HB3  . MET B 1 62 ? -5.316  -3.382  2.167   1.00 0.00 ? 66 MET B HB3  5  
ATOM 10737 H HG2  . MET B 1 62 ? -8.264  -2.684  1.771   1.00 0.00 ? 66 MET B HG2  5  
ATOM 10738 H HG3  . MET B 1 62 ? -6.974  -1.948  0.842   1.00 0.00 ? 66 MET B HG3  5  
ATOM 10739 H HE1  . MET B 1 62 ? -5.003  -3.442  0.216   1.00 0.00 ? 66 MET B HE1  5  
ATOM 10740 H HE2  . MET B 1 62 ? -5.067  -5.172  0.631   1.00 0.00 ? 66 MET B HE2  5  
ATOM 10741 H HE3  . MET B 1 62 ? -5.317  -4.651  -1.053  1.00 0.00 ? 66 MET B HE3  5  
ATOM 10742 N N    . LEU B 1 63 ? -4.830  -5.153  4.413   1.00 0.00 ? 67 LEU B N    5  
ATOM 10743 C CA   . LEU B 1 63 ? -3.819  -6.183  4.575   1.00 0.00 ? 67 LEU B CA   5  
ATOM 10744 C C    . LEU B 1 63 ? -4.443  -7.402  5.258   1.00 0.00 ? 67 LEU B C    5  
ATOM 10745 O O    . LEU B 1 63 ? -3.868  -8.489  5.243   1.00 0.00 ? 67 LEU B O    5  
ATOM 10746 C CB   . LEU B 1 63 ? -2.598  -5.625  5.308   1.00 0.00 ? 67 LEU B CB   5  
ATOM 10747 C CG   . LEU B 1 63 ? -1.647  -4.767  4.471   1.00 0.00 ? 67 LEU B CG   5  
ATOM 10748 C CD1  . LEU B 1 63 ? -2.396  -3.616  3.798   1.00 0.00 ? 67 LEU B CD1  5  
ATOM 10749 C CD2  . LEU B 1 63 ? -0.471  -4.271  5.315   1.00 0.00 ? 67 LEU B CD2  5  
ATOM 10750 H H    . LEU B 1 63 ? -4.698  -4.339  4.979   1.00 0.00 ? 67 LEU B H    5  
ATOM 10751 H HA   . LEU B 1 63 ? -3.490  -6.477  3.578   1.00 0.00 ? 67 LEU B HA   5  
ATOM 10752 H HB2  . LEU B 1 63 ? -2.946  -5.029  6.152   1.00 0.00 ? 67 LEU B HB2  5  
ATOM 10753 H HB3  . LEU B 1 63 ? -2.033  -6.461  5.721   1.00 0.00 ? 67 LEU B HB3  5  
ATOM 10754 H HG   . LEU B 1 63 ? -1.234  -5.390  3.678   1.00 0.00 ? 67 LEU B HG   5  
ATOM 10755 H HD11 . LEU B 1 63 ? -3.235  -4.013  3.227   1.00 0.00 ? 67 LEU B HD11 5  
ATOM 10756 H HD12 . LEU B 1 63 ? -2.767  -2.929  4.559   1.00 0.00 ? 67 LEU B HD12 5  
ATOM 10757 H HD13 . LEU B 1 63 ? -1.720  -3.085  3.128   1.00 0.00 ? 67 LEU B HD13 5  
ATOM 10758 H HD21 . LEU B 1 63 ? -0.354  -4.911  6.189   1.00 0.00 ? 67 LEU B HD21 5  
ATOM 10759 H HD22 . LEU B 1 63 ? 0.442   -4.300  4.719   1.00 0.00 ? 67 LEU B HD22 5  
ATOM 10760 H HD23 . LEU B 1 63 ? -0.661  -3.247  5.637   1.00 0.00 ? 67 LEU B HD23 5  
ATOM 10761 N N    . LYS B 1 64 ? -5.611  -7.179  5.841   1.00 0.00 ? 68 LYS B N    5  
ATOM 10762 C CA   . LYS B 1 64 ? -6.320  -8.246  6.529   1.00 0.00 ? 68 LYS B CA   5  
ATOM 10763 C C    . LYS B 1 64 ? -7.458  -8.752  5.640   1.00 0.00 ? 68 LYS B C    5  
ATOM 10764 O O    . LYS B 1 64 ? -7.841  -9.918  5.720   1.00 0.00 ? 68 LYS B O    5  
ATOM 10765 C CB   . LYS B 1 64 ? -6.780  -7.779  7.911   1.00 0.00 ? 68 LYS B CB   5  
ATOM 10766 C CG   . LYS B 1 64 ? -5.803  -8.235  8.997   1.00 0.00 ? 68 LYS B CG   5  
ATOM 10767 C CD   . LYS B 1 64 ? -6.523  -8.440  10.331  1.00 0.00 ? 68 LYS B CD   5  
ATOM 10768 C CE   . LYS B 1 64 ? -5.992  -7.477  11.395  1.00 0.00 ? 68 LYS B CE   5  
ATOM 10769 N NZ   . LYS B 1 64 ? -7.091  -7.021  12.275  1.00 0.00 ? 68 LYS B NZ   5  
ATOM 10770 H H    . LYS B 1 64 ? -6.073  -6.292  5.849   1.00 0.00 ? 68 LYS B H    5  
ATOM 10771 H HA   . LYS B 1 64 ? -5.613  -9.061  6.682   1.00 0.00 ? 68 LYS B HA   5  
ATOM 10772 H HB2  . LYS B 1 64 ? -6.862  -6.692  7.924   1.00 0.00 ? 68 LYS B HB2  5  
ATOM 10773 H HB3  . LYS B 1 64 ? -7.773  -8.176  8.121   1.00 0.00 ? 68 LYS B HB3  5  
ATOM 10774 H HG2  . LYS B 1 64 ? -5.323  -9.165  8.692   1.00 0.00 ? 68 LYS B HG2  5  
ATOM 10775 H HG3  . LYS B 1 64 ? -5.014  -7.493  9.116   1.00 0.00 ? 68 LYS B HG3  5  
ATOM 10776 H HD2  . LYS B 1 64 ? -7.594  -8.287  10.198  1.00 0.00 ? 68 LYS B HD2  5  
ATOM 10777 H HD3  . LYS B 1 64 ? -6.388  -9.469  10.667  1.00 0.00 ? 68 LYS B HD3  5  
ATOM 10778 H HE2  . LYS B 1 64 ? -5.222  -7.969  11.988  1.00 0.00 ? 68 LYS B HE2  5  
ATOM 10779 H HE3  . LYS B 1 64 ? -5.524  -6.618  10.914  1.00 0.00 ? 68 LYS B HE3  5  
ATOM 10780 H HZ1  . LYS B 1 64 ? -7.513  -7.812  12.718  1.00 0.00 ? 68 LYS B HZ1  5  
ATOM 10781 H HZ2  . LYS B 1 64 ? -6.725  -6.404  12.973  1.00 0.00 ? 68 LYS B HZ2  5  
ATOM 10782 H HZ3  . LYS B 1 64 ? -7.777  -6.538  11.731  1.00 0.00 ? 68 LYS B HZ3  5  
ATOM 10783 N N    . ASN B 1 65 ? -7.967  -7.849  4.814   1.00 0.00 ? 69 ASN B N    5  
ATOM 10784 C CA   . ASN B 1 65 ? -9.053  -8.190  3.911   1.00 0.00 ? 69 ASN B CA   5  
ATOM 10785 C C    . ASN B 1 65 ? -10.274 -8.616  4.728   1.00 0.00 ? 69 ASN B C    5  
ATOM 10786 O O    . ASN B 1 65 ? -11.210 -7.837  4.906   1.00 0.00 ? 69 ASN B O    5  
ATOM 10787 C CB   . ASN B 1 65 ? -8.666  -9.354  2.997   1.00 0.00 ? 69 ASN B CB   5  
ATOM 10788 C CG   . ASN B 1 65 ? -9.880  -9.867  2.219   1.00 0.00 ? 69 ASN B CG   5  
ATOM 10789 O OD1  . ASN B 1 65 ? -10.455 -9.180  1.391   1.00 0.00 ? 69 ASN B OD1  5  
ATOM 10790 N ND2  . ASN B 1 65 ? -10.235 -11.110 2.531   1.00 0.00 ? 69 ASN B ND2  5  
ATOM 10791 H H    . ASN B 1 65 ? -7.649  -6.903  4.755   1.00 0.00 ? 69 ASN B H    5  
ATOM 10792 H HA   . ASN B 1 65 ? -9.236  -7.286  3.329   1.00 0.00 ? 69 ASN B HA   5  
ATOM 10793 H HB2  . ASN B 1 65 ? -7.893  -9.032  2.300   1.00 0.00 ? 69 ASN B HB2  5  
ATOM 10794 H HB3  . ASN B 1 65 ? -8.242  -10.163 3.592   1.00 0.00 ? 69 ASN B HB3  5  
ATOM 10795 H HD21 . ASN B 1 65 ? -9.720  -11.620 3.220   1.00 0.00 ? 69 ASN B HD21 5  
ATOM 10796 H HD22 . ASN B 1 65 ? -11.018 -11.536 2.076   1.00 0.00 ? 69 ASN B HD22 5  
ATOM 10797 N N    . GLY B 1 66 ? -10.226 -9.852  5.204   1.00 0.00 ? 70 GLY B N    5  
ATOM 10798 C CA   . GLY B 1 66 ? -11.317 -10.391 5.998   1.00 0.00 ? 70 GLY B CA   5  
ATOM 10799 C C    . GLY B 1 66 ? -11.120 -10.080 7.483   1.00 0.00 ? 70 GLY B C    5  
ATOM 10800 O O    . GLY B 1 66 ? -9.992  -10.057 7.972   1.00 0.00 ? 70 GLY B O    5  
ATOM 10801 H H    . GLY B 1 66 ? -9.462  -10.479 5.055   1.00 0.00 ? 70 GLY B H    5  
ATOM 10802 H HA2  . GLY B 1 66 ? -12.263 -9.970  5.657   1.00 0.00 ? 70 GLY B HA2  5  
ATOM 10803 H HA3  . GLY B 1 66 ? -11.378 -11.470 5.854   1.00 0.00 ? 70 GLY B HA3  5  
ATOM 10804 N N    . LYS B 1 67 ? -12.236 -9.849  8.160   1.00 0.00 ? 71 LYS B N    5  
ATOM 10805 C CA   . LYS B 1 67 ? -12.200 -9.540  9.579   1.00 0.00 ? 71 LYS B CA   5  
ATOM 10806 C C    . LYS B 1 67 ? -12.056 -10.838 10.375  1.00 0.00 ? 71 LYS B C    5  
ATOM 10807 O O    . LYS B 1 67 ? -11.824 -11.901 9.800   1.00 0.00 ? 71 LYS B O    5  
ATOM 10808 C CB   . LYS B 1 67 ? -13.420 -8.707  9.977   1.00 0.00 ? 71 LYS B CB   5  
ATOM 10809 C CG   . LYS B 1 67 ? -13.165 -7.216  9.745   1.00 0.00 ? 71 LYS B CG   5  
ATOM 10810 C CD   . LYS B 1 67 ? -12.681 -6.536  11.028  1.00 0.00 ? 71 LYS B CD   5  
ATOM 10811 C CE   . LYS B 1 67 ? -13.782 -5.665  11.635  1.00 0.00 ? 71 LYS B CE   5  
ATOM 10812 N NZ   . LYS B 1 67 ? -14.251 -6.239  12.916  1.00 0.00 ? 71 LYS B NZ   5  
ATOM 10813 H H    . LYS B 1 67 ? -13.150 -9.869  7.754   1.00 0.00 ? 71 LYS B H    5  
ATOM 10814 H HA   . LYS B 1 67 ? -11.318 -8.925  9.758   1.00 0.00 ? 71 LYS B HA   5  
ATOM 10815 H HB2  . LYS B 1 67 ? -14.287 -9.025  9.399   1.00 0.00 ? 71 LYS B HB2  5  
ATOM 10816 H HB3  . LYS B 1 67 ? -13.656 -8.880  11.027  1.00 0.00 ? 71 LYS B HB3  5  
ATOM 10817 H HG2  . LYS B 1 67 ? -12.421 -7.089  8.959   1.00 0.00 ? 71 LYS B HG2  5  
ATOM 10818 H HG3  . LYS B 1 67 ? -14.081 -6.737  9.398   1.00 0.00 ? 71 LYS B HG3  5  
ATOM 10819 H HD2  . LYS B 1 67 ? -12.371 -7.292  11.749  1.00 0.00 ? 71 LYS B HD2  5  
ATOM 10820 H HD3  . LYS B 1 67 ? -11.806 -5.925  10.811  1.00 0.00 ? 71 LYS B HD3  5  
ATOM 10821 H HE2  . LYS B 1 67 ? -13.406 -4.655  11.799  1.00 0.00 ? 71 LYS B HE2  5  
ATOM 10822 H HE3  . LYS B 1 67 ? -14.617 -5.585  10.939  1.00 0.00 ? 71 LYS B HE3  5  
ATOM 10823 H HZ1  . LYS B 1 67 ? -14.548 -7.183  12.769  1.00 0.00 ? 71 LYS B HZ1  5  
ATOM 10824 H HZ2  . LYS B 1 67 ? -13.504 -6.226  13.581  1.00 0.00 ? 71 LYS B HZ2  5  
ATOM 10825 H HZ3  . LYS B 1 67 ? -15.016 -5.698  13.264  1.00 0.00 ? 71 LYS B HZ3  5  
ATOM 10826 N N    . SER B 1 68 ? -12.199 -10.710 11.686  1.00 0.00 ? 72 SER B N    5  
ATOM 10827 C CA   . SER B 1 68 ? -12.087 -11.860 12.567  1.00 0.00 ? 72 SER B CA   5  
ATOM 10828 C C    . SER B 1 68 ? -13.267 -12.808 12.342  1.00 0.00 ? 72 SER B C    5  
ATOM 10829 O O    . SER B 1 68 ? -13.077 -13.960 11.955  1.00 0.00 ? 72 SER B O    5  
ATOM 10830 C CB   . SER B 1 68 ? -12.027 -11.427 14.033  1.00 0.00 ? 72 SER B CB   5  
ATOM 10831 O OG   . SER B 1 68 ? -11.269 -12.336 14.828  1.00 0.00 ? 72 SER B OG   5  
ATOM 10832 H H    . SER B 1 68 ? -12.387 -9.842  12.146  1.00 0.00 ? 72 SER B H    5  
ATOM 10833 H HA   . SER B 1 68 ? -11.150 -12.344 12.293  1.00 0.00 ? 72 SER B HA   5  
ATOM 10834 H HB2  . SER B 1 68 ? -11.585 -10.432 14.100  1.00 0.00 ? 72 SER B HB2  5  
ATOM 10835 H HB3  . SER B 1 68 ? -13.038 -11.354 14.432  1.00 0.00 ? 72 SER B HB3  5  
ATOM 10836 H HG   . SER B 1 68 ? -11.146 -11.965 15.748  1.00 0.00 ? 72 SER B HG   5  
ATOM 10837 N N    . ASN B 1 69 ? -14.459 -12.288 12.595  1.00 0.00 ? 73 ASN B N    5  
ATOM 10838 C CA   . ASN B 1 69 ? -15.669 -13.074 12.425  1.00 0.00 ? 73 ASN B CA   5  
ATOM 10839 C C    . ASN B 1 69 ? -15.591 -14.321 13.308  1.00 0.00 ? 73 ASN B C    5  
ATOM 10840 O O    . ASN B 1 69 ? -14.810 -15.231 13.036  1.00 0.00 ? 73 ASN B O    5  
ATOM 10841 C CB   . ASN B 1 69 ? -15.829 -13.532 10.974  1.00 0.00 ? 73 ASN B CB   5  
ATOM 10842 C CG   . ASN B 1 69 ? -17.038 -14.458 10.821  1.00 0.00 ? 73 ASN B CG   5  
ATOM 10843 O OD1  . ASN B 1 69 ? -16.916 -15.641 10.550  1.00 0.00 ? 73 ASN B OD1  5  
ATOM 10844 N ND2  . ASN B 1 69 ? -18.208 -13.855 11.009  1.00 0.00 ? 73 ASN B ND2  5  
ATOM 10845 H H    . ASN B 1 69 ? -14.605 -11.351 12.910  1.00 0.00 ? 73 ASN B H    5  
ATOM 10846 H HA   . ASN B 1 69 ? -16.485 -12.410 12.712  1.00 0.00 ? 73 ASN B HA   5  
ATOM 10847 H HB2  . ASN B 1 69 ? -15.947 -12.664 10.325  1.00 0.00 ? 73 ASN B HB2  5  
ATOM 10848 H HB3  . ASN B 1 69 ? -14.926 -14.051 10.651  1.00 0.00 ? 73 ASN B HB3  5  
ATOM 10849 H HD21 . ASN B 1 69 ? -18.238 -12.880 11.230  1.00 0.00 ? 73 ASN B HD21 5  
ATOM 10850 H HD22 . ASN B 1 69 ? -19.058 -14.377 10.931  1.00 0.00 ? 73 ASN B HD22 5  
ATOM 10851 N N    . THR A 1 1  ? -11.997 -17.723 -15.497 1.00 0.00 ? 5  THR A N    6  
ATOM 10852 C CA   . THR A 1 1  ? -11.499 -16.795 -14.496 1.00 0.00 ? 5  THR A CA   6  
ATOM 10853 C C    . THR A 1 1  ? -10.592 -17.521 -13.500 1.00 0.00 ? 5  THR A C    6  
ATOM 10854 O O    . THR A 1 1  ? -10.955 -17.695 -12.338 1.00 0.00 ? 5  THR A O    6  
ATOM 10855 C CB   . THR A 1 1  ? -12.702 -16.116 -13.839 1.00 0.00 ? 5  THR A CB   6  
ATOM 10856 O OG1  . THR A 1 1  ? -12.173 -15.555 -12.640 1.00 0.00 ? 5  THR A OG1  6  
ATOM 10857 C CG2  . THR A 1 1  ? -13.747 -17.121 -13.351 1.00 0.00 ? 5  THR A CG2  6  
ATOM 10858 H H    . THR A 1 1  ? -11.643 -18.655 -15.422 1.00 0.00 ? 5  THR A H    6  
ATOM 10859 H HA   . THR A 1 1  ? -10.887 -16.045 -14.997 1.00 0.00 ? 5  THR A HA   6  
ATOM 10860 H HB   . THR A 1 1  ? -13.150 -15.383 -14.511 1.00 0.00 ? 5  THR A HB   6  
ATOM 10861 H HG1  . THR A 1 1  ? -12.666 -14.717 -12.408 1.00 0.00 ? 5  THR A HG1  6  
ATOM 10862 H HG21 . THR A 1 1  ? -13.245 -18.007 -12.963 1.00 0.00 ? 5  THR A HG21 6  
ATOM 10863 H HG22 . THR A 1 1  ? -14.346 -16.668 -12.561 1.00 0.00 ? 5  THR A HG22 6  
ATOM 10864 H HG23 . THR A 1 1  ? -14.395 -17.404 -14.181 1.00 0.00 ? 5  THR A HG23 6  
ATOM 10865 N N    . GLU A 1 2  ? -9.430  -17.925 -13.992 1.00 0.00 ? 6  GLU A N    6  
ATOM 10866 C CA   . GLU A 1 2  ? -8.469  -18.628 -13.159 1.00 0.00 ? 6  GLU A CA   6  
ATOM 10867 C C    . GLU A 1 2  ? -7.212  -17.777 -12.965 1.00 0.00 ? 6  GLU A C    6  
ATOM 10868 O O    . GLU A 1 2  ? -6.230  -17.940 -13.688 1.00 0.00 ? 6  GLU A O    6  
ATOM 10869 C CB   . GLU A 1 2  ? -8.120  -19.992 -13.757 1.00 0.00 ? 6  GLU A CB   6  
ATOM 10870 C CG   . GLU A 1 2  ? -7.571  -20.936 -12.686 1.00 0.00 ? 6  GLU A CG   6  
ATOM 10871 C CD   . GLU A 1 2  ? -7.147  -22.273 -13.298 1.00 0.00 ? 6  GLU A CD   6  
ATOM 10872 O OE1  . GLU A 1 2  ? -6.460  -22.227 -14.341 1.00 0.00 ? 6  GLU A OE1  6  
ATOM 10873 O OE2  . GLU A 1 2  ? -7.520  -23.311 -12.710 1.00 0.00 ? 6  GLU A OE2  6  
ATOM 10874 H H    . GLU A 1 2  ? -9.143  -17.779 -14.938 1.00 0.00 ? 6  GLU A H    6  
ATOM 10875 H HA   . GLU A 1 2  ? -8.968  -18.775 -12.202 1.00 0.00 ? 6  GLU A HA   6  
ATOM 10876 H HB2  . GLU A 1 2  ? -9.008  -20.431 -14.214 1.00 0.00 ? 6  GLU A HB2  6  
ATOM 10877 H HB3  . GLU A 1 2  ? -7.383  -19.868 -14.550 1.00 0.00 ? 6  GLU A HB3  6  
ATOM 10878 H HG2  . GLU A 1 2  ? -6.718  -20.473 -12.190 1.00 0.00 ? 6  GLU A HG2  6  
ATOM 10879 H HG3  . GLU A 1 2  ? -8.330  -21.107 -11.923 1.00 0.00 ? 6  GLU A HG3  6  
ATOM 10880 N N    . LEU A 1 3  ? -7.284  -16.888 -11.985 1.00 0.00 ? 7  LEU A N    6  
ATOM 10881 C CA   . LEU A 1 3  ? -6.164  -16.011 -11.687 1.00 0.00 ? 7  LEU A CA   6  
ATOM 10882 C C    . LEU A 1 3  ? -5.466  -16.498 -10.416 1.00 0.00 ? 7  LEU A C    6  
ATOM 10883 O O    . LEU A 1 3  ? -5.989  -17.355 -9.705  1.00 0.00 ? 7  LEU A O    6  
ATOM 10884 C CB   . LEU A 1 3  ? -6.628  -14.555 -11.614 1.00 0.00 ? 7  LEU A CB   6  
ATOM 10885 C CG   . LEU A 1 3  ? -7.156  -13.954 -12.918 1.00 0.00 ? 7  LEU A CG   6  
ATOM 10886 C CD1  . LEU A 1 3  ? -8.650  -14.234 -13.086 1.00 0.00 ? 7  LEU A CD1  6  
ATOM 10887 C CD2  . LEU A 1 3  ? -6.841  -12.459 -12.999 1.00 0.00 ? 7  LEU A CD2  6  
ATOM 10888 H H    . LEU A 1 3  ? -8.086  -16.762 -11.402 1.00 0.00 ? 7  LEU A H    6  
ATOM 10889 H HA   . LEU A 1 3  ? -5.462  -16.085 -12.517 1.00 0.00 ? 7  LEU A HA   6  
ATOM 10890 H HB2  . LEU A 1 3  ? -7.412  -14.482 -10.860 1.00 0.00 ? 7  LEU A HB2  6  
ATOM 10891 H HB3  . LEU A 1 3  ? -5.794  -13.946 -11.267 1.00 0.00 ? 7  LEU A HB3  6  
ATOM 10892 H HG   . LEU A 1 3  ? -6.642  -14.436 -13.750 1.00 0.00 ? 7  LEU A HG   6  
ATOM 10893 H HD11 . LEU A 1 3  ? -9.071  -14.547 -12.131 1.00 0.00 ? 7  LEU A HD11 6  
ATOM 10894 H HD12 . LEU A 1 3  ? -9.154  -13.330 -13.427 1.00 0.00 ? 7  LEU A HD12 6  
ATOM 10895 H HD13 . LEU A 1 3  ? -8.791  -15.027 -13.822 1.00 0.00 ? 7  LEU A HD13 6  
ATOM 10896 H HD21 . LEU A 1 3  ? -5.959  -12.240 -12.397 1.00 0.00 ? 7  LEU A HD21 6  
ATOM 10897 H HD22 . LEU A 1 3  ? -6.650  -12.183 -14.037 1.00 0.00 ? 7  LEU A HD22 6  
ATOM 10898 H HD23 . LEU A 1 3  ? -7.689  -11.888 -12.622 1.00 0.00 ? 7  LEU A HD23 6  
ATOM 10899 N N    . ARG A 1 4  ? -4.294  -15.931 -10.168 1.00 0.00 ? 8  ARG A N    6  
ATOM 10900 C CA   . ARG A 1 4  ? -3.518  -16.296 -8.995  1.00 0.00 ? 8  ARG A CA   6  
ATOM 10901 C C    . ARG A 1 4  ? -2.957  -15.044 -8.319  1.00 0.00 ? 8  ARG A C    6  
ATOM 10902 O O    . ARG A 1 4  ? -3.606  -14.000 -8.301  1.00 0.00 ? 8  ARG A O    6  
ATOM 10903 C CB   . ARG A 1 4  ? -2.363  -17.228 -9.367  1.00 0.00 ? 8  ARG A CB   6  
ATOM 10904 C CG   . ARG A 1 4  ? -2.793  -18.235 -10.436 1.00 0.00 ? 8  ARG A CG   6  
ATOM 10905 C CD   . ARG A 1 4  ? -1.966  -19.519 -10.344 1.00 0.00 ? 8  ARG A CD   6  
ATOM 10906 N NE   . ARG A 1 4  ? -2.726  -20.560 -9.617  1.00 0.00 ? 8  ARG A NE   6  
ATOM 10907 C CZ   . ARG A 1 4  ? -2.278  -21.805 -9.401  1.00 0.00 ? 8  ARG A CZ   6  
ATOM 10908 N NH1  . ARG A 1 4  ? -1.072  -22.170 -9.855  1.00 0.00 ? 8  ARG A NH1  6  
ATOM 10909 N NH2  . ARG A 1 4  ? -3.037  -22.683 -8.731  1.00 0.00 ? 8  ARG A NH2  6  
ATOM 10910 H H    . ARG A 1 4  ? -3.876  -15.235 -10.752 1.00 0.00 ? 8  ARG A H    6  
ATOM 10911 H HA   . ARG A 1 4  ? -4.224  -16.811 -8.343  1.00 0.00 ? 8  ARG A HA   6  
ATOM 10912 H HB2  . ARG A 1 4  ? -1.521  -16.641 -9.734  1.00 0.00 ? 8  ARG A HB2  6  
ATOM 10913 H HB3  . ARG A 1 4  ? -2.019  -17.759 -8.479  1.00 0.00 ? 8  ARG A HB3  6  
ATOM 10914 H HG2  . ARG A 1 4  ? -3.851  -18.470 -10.314 1.00 0.00 ? 8  ARG A HG2  6  
ATOM 10915 H HG3  . ARG A 1 4  ? -2.677  -17.793 -11.425 1.00 0.00 ? 8  ARG A HG3  6  
ATOM 10916 H HD2  . ARG A 1 4  ? -1.715  -19.872 -11.344 1.00 0.00 ? 8  ARG A HD2  6  
ATOM 10917 H HD3  . ARG A 1 4  ? -1.025  -19.319 -9.831  1.00 0.00 ? 8  ARG A HD3  6  
ATOM 10918 H HE   . ARG A 1 4  ? -3.631  -20.320 -9.265  1.00 0.00 ? 8  ARG A HE   6  
ATOM 10919 H HH11 . ARG A 1 4  ? -0.506  -21.515 -10.355 1.00 0.00 ? 8  ARG A HH11 6  
ATOM 10920 H HH12 . ARG A 1 4  ? -0.738  -23.099 -9.694  1.00 0.00 ? 8  ARG A HH12 6  
ATOM 10921 H HH21 . ARG A 1 4  ? -3.937  -22.410 -8.392  1.00 0.00 ? 8  ARG A HH21 6  
ATOM 10922 H HH22 . ARG A 1 4  ? -2.702  -23.612 -8.570  1.00 0.00 ? 8  ARG A HH22 6  
ATOM 10923 N N    . CYS A 1 5  ? -1.756  -15.190 -7.779  1.00 0.00 ? 9  CYS A N    6  
ATOM 10924 C CA   . CYS A 1 5  ? -1.100  -14.084 -7.103  1.00 0.00 ? 9  CYS A CA   6  
ATOM 10925 C C    . CYS A 1 5  ? -0.118  -13.438 -8.082  1.00 0.00 ? 9  CYS A C    6  
ATOM 10926 O O    . CYS A 1 5  ? 0.216   -14.024 -9.110  1.00 0.00 ? 9  CYS A O    6  
ATOM 10927 C CB   . CYS A 1 5  ? -0.407  -14.538 -5.816  1.00 0.00 ? 9  CYS A CB   6  
ATOM 10928 S SG   . CYS A 1 5  ? -1.526  -14.789 -4.390  1.00 0.00 ? 9  CYS A SG   6  
ATOM 10929 H H    . CYS A 1 5  ? -1.234  -16.043 -7.797  1.00 0.00 ? 9  CYS A H    6  
ATOM 10930 H HA   . CYS A 1 5  ? -1.883  -13.381 -6.819  1.00 0.00 ? 9  CYS A HA   6  
ATOM 10931 H HB2  . CYS A 1 5  ? 0.121   -15.471 -6.014  1.00 0.00 ? 9  CYS A HB2  6  
ATOM 10932 H HB3  . CYS A 1 5  ? 0.345   -13.797 -5.544  1.00 0.00 ? 9  CYS A HB3  6  
ATOM 10933 N N    . GLN A 1 6  ? 0.317   -12.237 -7.728  1.00 0.00 ? 10 GLN A N    6  
ATOM 10934 C CA   . GLN A 1 6  ? 1.254   -11.505 -8.562  1.00 0.00 ? 10 GLN A CA   6  
ATOM 10935 C C    . GLN A 1 6  ? 2.690   -11.760 -8.098  1.00 0.00 ? 10 GLN A C    6  
ATOM 10936 O O    . GLN A 1 6  ? 3.641   -11.298 -8.728  1.00 0.00 ? 10 GLN A O    6  
ATOM 10937 C CB   . GLN A 1 6  ? 0.936   -10.008 -8.561  1.00 0.00 ? 10 GLN A CB   6  
ATOM 10938 C CG   . GLN A 1 6  ? 0.758   -9.485  -9.988  1.00 0.00 ? 10 GLN A CG   6  
ATOM 10939 C CD   . GLN A 1 6  ? 1.567   -8.204  -10.207 1.00 0.00 ? 10 GLN A CD   6  
ATOM 10940 O OE1  . GLN A 1 6  ? 2.407   -8.114  -11.087 1.00 0.00 ? 10 GLN A OE1  6  
ATOM 10941 N NE2  . GLN A 1 6  ? 1.267   -7.224  -9.360  1.00 0.00 ? 10 GLN A NE2  6  
ATOM 10942 H H    . GLN A 1 6  ? 0.041   -11.767 -6.890  1.00 0.00 ? 10 GLN A H    6  
ATOM 10943 H HA   . GLN A 1 6  ? 1.115   -11.899 -9.569  1.00 0.00 ? 10 GLN A HA   6  
ATOM 10944 H HB2  . GLN A 1 6  ? 0.027   -9.827  -7.987  1.00 0.00 ? 10 GLN A HB2  6  
ATOM 10945 H HB3  . GLN A 1 6  ? 1.739   -9.462  -8.067  1.00 0.00 ? 10 GLN A HB3  6  
ATOM 10946 H HG2  . GLN A 1 6  ? 1.074   -10.246 -10.701 1.00 0.00 ? 10 GLN A HG2  6  
ATOM 10947 H HG3  . GLN A 1 6  ? -0.298  -9.289  -10.178 1.00 0.00 ? 10 GLN A HG3  6  
ATOM 10948 H HE21 . GLN A 1 6  ? 0.566   -7.364  -8.660  1.00 0.00 ? 10 GLN A HE21 6  
ATOM 10949 H HE22 . GLN A 1 6  ? 1.743   -6.346  -9.423  1.00 0.00 ? 10 GLN A HE22 6  
ATOM 10950 N N    . CYS A 1 7  ? 2.802   -12.494 -7.001  1.00 0.00 ? 11 CYS A N    6  
ATOM 10951 C CA   . CYS A 1 7  ? 4.105   -12.816 -6.446  1.00 0.00 ? 11 CYS A CA   6  
ATOM 10952 C C    . CYS A 1 7  ? 4.054   -14.244 -5.897  1.00 0.00 ? 11 CYS A C    6  
ATOM 10953 O O    . CYS A 1 7  ? 3.148   -14.590 -5.141  1.00 0.00 ? 11 CYS A O    6  
ATOM 10954 C CB   . CYS A 1 7  ? 4.529   -11.808 -5.376  1.00 0.00 ? 11 CYS A CB   6  
ATOM 10955 S SG   . CYS A 1 7  ? 6.156   -11.022 -5.664  1.00 0.00 ? 11 CYS A SG   6  
ATOM 10956 H H    . CYS A 1 7  ? 2.023   -12.866 -6.496  1.00 0.00 ? 11 CYS A H    6  
ATOM 10957 H HA   . CYS A 1 7  ? 4.821   -12.742 -7.264  1.00 0.00 ? 11 CYS A HA   6  
ATOM 10958 H HB2  . CYS A 1 7  ? 3.771   -11.028 -5.311  1.00 0.00 ? 11 CYS A HB2  6  
ATOM 10959 H HB3  . CYS A 1 7  ? 4.551   -12.313 -4.410  1.00 0.00 ? 11 CYS A HB3  6  
ATOM 10960 N N    . LEU A 1 8  ? 5.039   -15.034 -6.299  1.00 0.00 ? 12 LEU A N    6  
ATOM 10961 C CA   . LEU A 1 8  ? 5.118   -16.416 -5.857  1.00 0.00 ? 12 LEU A CA   6  
ATOM 10962 C C    . LEU A 1 8  ? 6.085   -16.514 -4.676  1.00 0.00 ? 12 LEU A C    6  
ATOM 10963 O O    . LEU A 1 8  ? 6.094   -17.513 -3.958  1.00 0.00 ? 12 LEU A O    6  
ATOM 10964 C CB   . LEU A 1 8  ? 5.480   -17.333 -7.027  1.00 0.00 ? 12 LEU A CB   6  
ATOM 10965 C CG   . LEU A 1 8  ? 4.771   -17.042 -8.352  1.00 0.00 ? 12 LEU A CG   6  
ATOM 10966 C CD1  . LEU A 1 8  ? 5.643   -17.450 -9.541  1.00 0.00 ? 12 LEU A CD1  6  
ATOM 10967 C CD2  . LEU A 1 8  ? 3.395   -17.708 -8.395  1.00 0.00 ? 12 LEU A CD2  6  
ATOM 10968 H H    . LEU A 1 8  ? 5.772   -14.744 -6.915  1.00 0.00 ? 12 LEU A H    6  
ATOM 10969 H HA   . LEU A 1 8  ? 4.124   -16.706 -5.515  1.00 0.00 ? 12 LEU A HA   6  
ATOM 10970 H HB2  . LEU A 1 8  ? 6.556   -17.271 -7.192  1.00 0.00 ? 12 LEU A HB2  6  
ATOM 10971 H HB3  . LEU A 1 8  ? 5.261   -18.361 -6.739  1.00 0.00 ? 12 LEU A HB3  6  
ATOM 10972 H HG   . LEU A 1 8  ? 4.611   -15.966 -8.424  1.00 0.00 ? 12 LEU A HG   6  
ATOM 10973 H HD11 . LEU A 1 8  ? 5.978   -18.479 -9.410  1.00 0.00 ? 12 LEU A HD11 6  
ATOM 10974 H HD12 . LEU A 1 8  ? 5.063   -17.371 -10.461 1.00 0.00 ? 12 LEU A HD12 6  
ATOM 10975 H HD13 . LEU A 1 8  ? 6.509   -16.791 -9.600  1.00 0.00 ? 12 LEU A HD13 6  
ATOM 10976 H HD21 . LEU A 1 8  ? 2.900   -17.583 -7.431  1.00 0.00 ? 12 LEU A HD21 6  
ATOM 10977 H HD22 . LEU A 1 8  ? 2.791   -17.245 -9.176  1.00 0.00 ? 12 LEU A HD22 6  
ATOM 10978 H HD23 . LEU A 1 8  ? 3.512   -18.770 -8.608  1.00 0.00 ? 12 LEU A HD23 6  
ATOM 10979 N N    . GLN A 1 9  ? 6.877   -15.465 -4.511  1.00 0.00 ? 13 GLN A N    6  
ATOM 10980 C CA   . GLN A 1 9  ? 7.846   -15.421 -3.430  1.00 0.00 ? 13 GLN A CA   6  
ATOM 10981 C C    . GLN A 1 9  ? 7.745   -14.091 -2.680  1.00 0.00 ? 13 GLN A C    6  
ATOM 10982 O O    . GLN A 1 9  ? 7.082   -13.163 -3.142  1.00 0.00 ? 13 GLN A O    6  
ATOM 10983 C CB   . GLN A 1 9  ? 9.265   -15.647 -3.955  1.00 0.00 ? 13 GLN A CB   6  
ATOM 10984 C CG   . GLN A 1 9  ? 10.072  -16.523 -2.995  1.00 0.00 ? 13 GLN A CG   6  
ATOM 10985 C CD   . GLN A 1 9  ? 9.945   -18.002 -3.363  1.00 0.00 ? 13 GLN A CD   6  
ATOM 10986 O OE1  . GLN A 1 9  ? 8.861   -18.554 -3.457  1.00 0.00 ? 13 GLN A OE1  6  
ATOM 10987 N NE2  . GLN A 1 9  ? 11.109  -18.612 -3.565  1.00 0.00 ? 13 GLN A NE2  6  
ATOM 10988 H H    . GLN A 1 9  ? 6.863   -14.656 -5.100  1.00 0.00 ? 13 GLN A H    6  
ATOM 10989 H HA   . GLN A 1 9  ? 7.576   -16.241 -2.765  1.00 0.00 ? 13 GLN A HA   6  
ATOM 10990 H HB2  . GLN A 1 9  ? 9.222   -16.121 -4.936  1.00 0.00 ? 13 GLN A HB2  6  
ATOM 10991 H HB3  . GLN A 1 9  ? 9.765   -14.688 -4.086  1.00 0.00 ? 13 GLN A HB3  6  
ATOM 10992 H HG2  . GLN A 1 9  ? 11.121  -16.226 -3.021  1.00 0.00 ? 13 GLN A HG2  6  
ATOM 10993 H HG3  . GLN A 1 9  ? 9.723   -16.367 -1.974  1.00 0.00 ? 13 GLN A HG3  6  
ATOM 10994 H HE21 . GLN A 1 9  ? 11.964  -18.101 -3.471  1.00 0.00 ? 13 GLN A HE21 6  
ATOM 10995 H HE22 . GLN A 1 9  ? 11.130  -19.581 -3.810  1.00 0.00 ? 13 GLN A HE22 6  
ATOM 10996 N N    . THR A 1 10 ? 8.411   -14.040 -1.536  1.00 0.00 ? 14 THR A N    6  
ATOM 10997 C CA   . THR A 1 10 ? 8.404   -12.840 -0.718  1.00 0.00 ? 14 THR A CA   6  
ATOM 10998 C C    . THR A 1 10 ? 9.670   -12.771 0.139   1.00 0.00 ? 14 THR A C    6  
ATOM 10999 O O    . THR A 1 10 ? 10.383  -13.763 0.279   1.00 0.00 ? 14 THR A O    6  
ATOM 11000 C CB   . THR A 1 10 ? 7.113   -12.834 0.103   1.00 0.00 ? 14 THR A CB   6  
ATOM 11001 O OG1  . THR A 1 10 ? 6.895   -14.207 0.416   1.00 0.00 ? 14 THR A OG1  6  
ATOM 11002 C CG2  . THR A 1 10 ? 5.891   -12.443 -0.730  1.00 0.00 ? 14 THR A CG2  6  
ATOM 11003 H H    . THR A 1 10 ? 8.947   -14.800 -1.167  1.00 0.00 ? 14 THR A H    6  
ATOM 11004 H HA   . THR A 1 10 ? 8.418   -11.973 -1.379  1.00 0.00 ? 14 THR A HA   6  
ATOM 11005 H HB   . THR A 1 10 ? 7.211   -12.191 0.977   1.00 0.00 ? 14 THR A HB   6  
ATOM 11006 H HG1  . THR A 1 10 ? 7.560   -14.512 1.098   1.00 0.00 ? 14 THR A HG1  6  
ATOM 11007 H HG21 . THR A 1 10 ? 6.084   -11.498 -1.237  1.00 0.00 ? 14 THR A HG21 6  
ATOM 11008 H HG22 . THR A 1 10 ? 5.692   -13.219 -1.470  1.00 0.00 ? 14 THR A HG22 6  
ATOM 11009 H HG23 . THR A 1 10 ? 5.025   -12.334 -0.076  1.00 0.00 ? 14 THR A HG23 6  
ATOM 11010 N N    . LEU A 1 11 ? 9.909   -11.590 0.690   1.00 0.00 ? 15 LEU A N    6  
ATOM 11011 C CA   . LEU A 1 11 ? 11.076  -11.379 1.529   1.00 0.00 ? 15 LEU A CA   6  
ATOM 11012 C C    . LEU A 1 11 ? 10.679  -11.539 2.998   1.00 0.00 ? 15 LEU A C    6  
ATOM 11013 O O    . LEU A 1 11 ? 9.521   -11.819 3.304   1.00 0.00 ? 15 LEU A O    6  
ATOM 11014 C CB   . LEU A 1 11 ? 11.728  -10.031 1.212   1.00 0.00 ? 15 LEU A CB   6  
ATOM 11015 C CG   . LEU A 1 11 ? 12.366  -9.904  -0.173  1.00 0.00 ? 15 LEU A CG   6  
ATOM 11016 C CD1  . LEU A 1 11 ? 12.611  -8.437  -0.531  1.00 0.00 ? 15 LEU A CD1  6  
ATOM 11017 C CD2  . LEU A 1 11 ? 13.644  -10.739 -0.267  1.00 0.00 ? 15 LEU A CD2  6  
ATOM 11018 H H    . LEU A 1 11 ? 9.324   -10.788 0.571   1.00 0.00 ? 15 LEU A H    6  
ATOM 11019 H HA   . LEU A 1 11 ? 11.802  -12.154 1.281   1.00 0.00 ? 15 LEU A HA   6  
ATOM 11020 H HB2  . LEU A 1 11 ? 10.973  -9.252  1.316   1.00 0.00 ? 15 LEU A HB2  6  
ATOM 11021 H HB3  . LEU A 1 11 ? 12.494  -9.835  1.962   1.00 0.00 ? 15 LEU A HB3  6  
ATOM 11022 H HG   . LEU A 1 11 ? 11.667  -10.302 -0.909  1.00 0.00 ? 15 LEU A HG   6  
ATOM 11023 H HD11 . LEU A 1 11 ? 13.040  -7.921  0.328   1.00 0.00 ? 15 LEU A HD11 6  
ATOM 11024 H HD12 . LEU A 1 11 ? 13.302  -8.379  -1.372  1.00 0.00 ? 15 LEU A HD12 6  
ATOM 11025 H HD13 . LEU A 1 11 ? 11.667  -7.967  -0.804  1.00 0.00 ? 15 LEU A HD13 6  
ATOM 11026 H HD21 . LEU A 1 11 ? 14.359  -10.395 0.481   1.00 0.00 ? 15 LEU A HD21 6  
ATOM 11027 H HD22 . LEU A 1 11 ? 13.408  -11.788 -0.087  1.00 0.00 ? 15 LEU A HD22 6  
ATOM 11028 H HD23 . LEU A 1 11 ? 14.078  -10.629 -1.261  1.00 0.00 ? 15 LEU A HD23 6  
ATOM 11029 N N    . GLN A 1 12 ? 11.661  -11.354 3.868   1.00 0.00 ? 16 GLN A N    6  
ATOM 11030 C CA   . GLN A 1 12 ? 11.428  -11.474 5.297   1.00 0.00 ? 16 GLN A CA   6  
ATOM 11031 C C    . GLN A 1 12 ? 11.526  -10.103 5.968   1.00 0.00 ? 16 GLN A C    6  
ATOM 11032 O O    . GLN A 1 12 ? 11.109  -9.937  7.113   1.00 0.00 ? 16 GLN A O    6  
ATOM 11033 C CB   . GLN A 1 12 ? 12.406  -12.465 5.930   1.00 0.00 ? 16 GLN A CB   6  
ATOM 11034 C CG   . GLN A 1 12 ? 12.482  -12.268 7.446   1.00 0.00 ? 16 GLN A CG   6  
ATOM 11035 C CD   . GLN A 1 12 ? 12.955  -13.546 8.142   1.00 0.00 ? 16 GLN A CD   6  
ATOM 11036 O OE1  . GLN A 1 12 ? 14.045  -14.043 7.911   1.00 0.00 ? 16 GLN A OE1  6  
ATOM 11037 N NE2  . GLN A 1 12 ? 12.076  -14.049 9.004   1.00 0.00 ? 16 GLN A NE2  6  
ATOM 11038 H H    . GLN A 1 12 ? 12.600  -11.126 3.610   1.00 0.00 ? 16 GLN A H    6  
ATOM 11039 H HA   . GLN A 1 12 ? 10.414  -11.862 5.393   1.00 0.00 ? 16 GLN A HA   6  
ATOM 11040 H HB2  . GLN A 1 12 ? 12.091  -13.485 5.708   1.00 0.00 ? 16 GLN A HB2  6  
ATOM 11041 H HB3  . GLN A 1 12 ? 13.396  -12.335 5.493   1.00 0.00 ? 16 GLN A HB3  6  
ATOM 11042 H HG2  . GLN A 1 12 ? 13.165  -11.451 7.676   1.00 0.00 ? 16 GLN A HG2  6  
ATOM 11043 H HG3  . GLN A 1 12 ? 11.502  -11.983 7.828   1.00 0.00 ? 16 GLN A HG3  6  
ATOM 11044 H HE21 . GLN A 1 12 ? 11.198  -13.593 9.147   1.00 0.00 ? 16 GLN A HE21 6  
ATOM 11045 H HE22 . GLN A 1 12 ? 12.293  -14.885 9.509   1.00 0.00 ? 16 GLN A HE22 6  
ATOM 11046 N N    . GLY A 1 13 ? 12.079  -9.154  5.226   1.00 0.00 ? 17 GLY A N    6  
ATOM 11047 C CA   . GLY A 1 13 ? 12.237  -7.803  5.735   1.00 0.00 ? 17 GLY A CA   6  
ATOM 11048 C C    . GLY A 1 13 ? 13.586  -7.213  5.316   1.00 0.00 ? 17 GLY A C    6  
ATOM 11049 O O    . GLY A 1 13 ? 14.614  -7.516  5.921   1.00 0.00 ? 17 GLY A O    6  
ATOM 11050 H H    . GLY A 1 13 ? 12.416  -9.298  4.295   1.00 0.00 ? 17 GLY A H    6  
ATOM 11051 H HA2  . GLY A 1 13 ? 11.430  -7.173  5.362   1.00 0.00 ? 17 GLY A HA2  6  
ATOM 11052 H HA3  . GLY A 1 13 ? 12.160  -7.808  6.822   1.00 0.00 ? 17 GLY A HA3  6  
ATOM 11053 N N    . ILE A 1 14 ? 13.538  -6.383  4.285   1.00 0.00 ? 18 ILE A N    6  
ATOM 11054 C CA   . ILE A 1 14 ? 14.744  -5.749  3.779   1.00 0.00 ? 18 ILE A CA   6  
ATOM 11055 C C    . ILE A 1 14 ? 14.827  -4.319  4.318   1.00 0.00 ? 18 ILE A C    6  
ATOM 11056 O O    . ILE A 1 14 ? 13.836  -3.775  4.802   1.00 0.00 ? 18 ILE A O    6  
ATOM 11057 C CB   . ILE A 1 14 ? 14.793  -5.834  2.252   1.00 0.00 ? 18 ILE A CB   6  
ATOM 11058 C CG1  . ILE A 1 14 ? 15.154  -7.248  1.794   1.00 0.00 ? 18 ILE A CG1  6  
ATOM 11059 C CG2  . ILE A 1 14 ? 15.745  -4.784  1.675   1.00 0.00 ? 18 ILE A CG2  6  
ATOM 11060 C CD1  . ILE A 1 14 ? 15.481  -7.273  0.299   1.00 0.00 ? 18 ILE A CD1  6  
ATOM 11061 H H    . ILE A 1 14 ? 12.698  -6.142  3.799   1.00 0.00 ? 18 ILE A H    6  
ATOM 11062 H HA   . ILE A 1 14 ? 15.595  -6.312  4.161   1.00 0.00 ? 18 ILE A HA   6  
ATOM 11063 H HB   . ILE A 1 14 ? 13.798  -5.614  1.866   1.00 0.00 ? 18 ILE A HB   6  
ATOM 11064 H HG12 . ILE A 1 14 ? 16.010  -7.612  2.363   1.00 0.00 ? 18 ILE A HG12 6  
ATOM 11065 H HG13 . ILE A 1 14 ? 14.324  -7.924  2.000   1.00 0.00 ? 18 ILE A HG13 6  
ATOM 11066 H HG21 . ILE A 1 14 ? 15.430  -3.792  1.998   1.00 0.00 ? 18 ILE A HG21 6  
ATOM 11067 H HG22 . ILE A 1 14 ? 16.757  -4.977  2.029   1.00 0.00 ? 18 ILE A HG22 6  
ATOM 11068 H HG23 . ILE A 1 14 ? 15.724  -4.835  0.586   1.00 0.00 ? 18 ILE A HG23 6  
ATOM 11069 H HD11 . ILE A 1 14 ? 14.872  -6.531  -0.218  1.00 0.00 ? 18 ILE A HD11 6  
ATOM 11070 H HD12 . ILE A 1 14 ? 16.536  -7.043  0.154   1.00 0.00 ? 18 ILE A HD12 6  
ATOM 11071 H HD13 . ILE A 1 14 ? 15.266  -8.264  -0.103  1.00 0.00 ? 18 ILE A HD13 6  
ATOM 11072 N N    . HIS A 1 15 ? 16.020  -3.751  4.217   1.00 0.00 ? 19 HIS A N    6  
ATOM 11073 C CA   . HIS A 1 15 ? 16.246  -2.396  4.688   1.00 0.00 ? 19 HIS A CA   6  
ATOM 11074 C C    . HIS A 1 15 ? 15.225  -1.453  4.048   1.00 0.00 ? 19 HIS A C    6  
ATOM 11075 O O    . HIS A 1 15 ? 14.960  -1.540  2.850   1.00 0.00 ? 19 HIS A O    6  
ATOM 11076 C CB   . HIS A 1 15 ? 17.692  -1.965  4.432   1.00 0.00 ? 19 HIS A CB   6  
ATOM 11077 C CG   . HIS A 1 15 ? 18.323  -1.217  5.582   1.00 0.00 ? 19 HIS A CG   6  
ATOM 11078 N ND1  . HIS A 1 15 ? 19.672  -0.909  5.626   1.00 0.00 ? 19 HIS A ND1  6  
ATOM 11079 C CD2  . HIS A 1 15 ? 17.777  -0.719  6.728   1.00 0.00 ? 19 HIS A CD2  6  
ATOM 11080 C CE1  . HIS A 1 15 ? 19.915  -0.256  6.752   1.00 0.00 ? 19 HIS A CE1  6  
ATOM 11081 N NE2  . HIS A 1 15 ? 18.739  -0.139  7.434   1.00 0.00 ? 19 HIS A NE2  6  
ATOM 11082 H H    . HIS A 1 15 ? 16.822  -4.201  3.822   1.00 0.00 ? 19 HIS A H    6  
ATOM 11083 H HA   . HIS A 1 15 ? 16.090  -2.409  5.767   1.00 0.00 ? 19 HIS A HA   6  
ATOM 11084 H HB2  . HIS A 1 15 ? 18.291  -2.850  4.215   1.00 0.00 ? 19 HIS A HB2  6  
ATOM 11085 H HB3  . HIS A 1 15 ? 17.721  -1.336  3.543   1.00 0.00 ? 19 HIS A HB3  6  
ATOM 11086 H HD1  . HIS A 1 15 ? 20.348  -1.141  4.926   1.00 0.00 ? 19 HIS A HD1  6  
ATOM 11087 H HD2  . HIS A 1 15 ? 16.727  -0.786  7.015   1.00 0.00 ? 19 HIS A HD2  6  
ATOM 11088 H HE1  . HIS A 1 15 ? 20.884  0.123   7.077   1.00 0.00 ? 19 HIS A HE1  6  
ATOM 11089 N N    . LEU A 1 16 ? 14.680  -0.574  4.876   1.00 0.00 ? 20 LEU A N    6  
ATOM 11090 C CA   . LEU A 1 16 ? 13.693  0.384   4.406   1.00 0.00 ? 20 LEU A CA   6  
ATOM 11091 C C    . LEU A 1 16 ? 14.410  1.596   3.807   1.00 0.00 ? 20 LEU A C    6  
ATOM 11092 O O    . LEU A 1 16 ? 13.779  2.606   3.500   1.00 0.00 ? 20 LEU A O    6  
ATOM 11093 C CB   . LEU A 1 16 ? 12.717  0.742   5.528   1.00 0.00 ? 20 LEU A CB   6  
ATOM 11094 C CG   . LEU A 1 16 ? 11.549  1.650   5.137   1.00 0.00 ? 20 LEU A CG   6  
ATOM 11095 C CD1  . LEU A 1 16 ? 10.685  0.998   4.056   1.00 0.00 ? 20 LEU A CD1  6  
ATOM 11096 C CD2  . LEU A 1 16 ? 10.728  2.047   6.366   1.00 0.00 ? 20 LEU A CD2  6  
ATOM 11097 H H    . LEU A 1 16 ? 14.901  -0.509  5.849   1.00 0.00 ? 20 LEU A H    6  
ATOM 11098 H HA   . LEU A 1 16 ? 13.116  -0.100  3.619   1.00 0.00 ? 20 LEU A HA   6  
ATOM 11099 H HB2  . LEU A 1 16 ? 12.310  -0.184  5.937   1.00 0.00 ? 20 LEU A HB2  6  
ATOM 11100 H HB3  . LEU A 1 16 ? 13.275  1.225   6.329   1.00 0.00 ? 20 LEU A HB3  6  
ATOM 11101 H HG   . LEU A 1 16 ? 11.957  2.568   4.713   1.00 0.00 ? 20 LEU A HG   6  
ATOM 11102 H HD11 . LEU A 1 16 ? 11.142  0.059   3.743   1.00 0.00 ? 20 LEU A HD11 6  
ATOM 11103 H HD12 . LEU A 1 16 ? 9.690   0.803   4.455   1.00 0.00 ? 20 LEU A HD12 6  
ATOM 11104 H HD13 . LEU A 1 16 ? 10.608  1.668   3.200   1.00 0.00 ? 20 LEU A HD13 6  
ATOM 11105 H HD21 . LEU A 1 16 ? 10.522  1.161   6.967   1.00 0.00 ? 20 LEU A HD21 6  
ATOM 11106 H HD22 . LEU A 1 16 ? 11.289  2.767   6.961   1.00 0.00 ? 20 LEU A HD22 6  
ATOM 11107 H HD23 . LEU A 1 16 ? 9.787   2.495   6.045   1.00 0.00 ? 20 LEU A HD23 6  
ATOM 11108 N N    . LYS A 1 17 ? 15.719  1.454   3.658   1.00 0.00 ? 21 LYS A N    6  
ATOM 11109 C CA   . LYS A 1 17 ? 16.529  2.524   3.100   1.00 0.00 ? 21 LYS A CA   6  
ATOM 11110 C C    . LYS A 1 17 ? 16.472  2.459   1.573   1.00 0.00 ? 21 LYS A C    6  
ATOM 11111 O O    . LYS A 1 17 ? 16.843  3.414   0.892   1.00 0.00 ? 21 LYS A O    6  
ATOM 11112 C CB   . LYS A 1 17 ? 17.950  2.471   3.665   1.00 0.00 ? 21 LYS A CB   6  
ATOM 11113 C CG   . LYS A 1 17 ? 18.943  3.146   2.717   1.00 0.00 ? 21 LYS A CG   6  
ATOM 11114 C CD   . LYS A 1 17 ? 18.727  4.661   2.684   1.00 0.00 ? 21 LYS A CD   6  
ATOM 11115 C CE   . LYS A 1 17 ? 19.819  5.353   1.866   1.00 0.00 ? 21 LYS A CE   6  
ATOM 11116 N NZ   . LYS A 1 17 ? 19.383  5.525   0.462   1.00 0.00 ? 21 LYS A NZ   6  
ATOM 11117 H H    . LYS A 1 17 ? 16.225  0.629   3.910   1.00 0.00 ? 21 LYS A H    6  
ATOM 11118 H HA   . LYS A 1 17 ? 16.090  3.468   3.422   1.00 0.00 ? 21 LYS A HA   6  
ATOM 11119 H HB2  . LYS A 1 17 ? 17.978  2.963   4.637   1.00 0.00 ? 21 LYS A HB2  6  
ATOM 11120 H HB3  . LYS A 1 17 ? 18.243  1.434   3.825   1.00 0.00 ? 21 LYS A HB3  6  
ATOM 11121 H HG2  . LYS A 1 17 ? 19.962  2.928   3.035   1.00 0.00 ? 21 LYS A HG2  6  
ATOM 11122 H HG3  . LYS A 1 17 ? 18.828  2.737   1.713   1.00 0.00 ? 21 LYS A HG3  6  
ATOM 11123 H HD2  . LYS A 1 17 ? 17.750  4.883   2.256   1.00 0.00 ? 21 LYS A HD2  6  
ATOM 11124 H HD3  . LYS A 1 17 ? 18.726  5.053   3.701   1.00 0.00 ? 21 LYS A HD3  6  
ATOM 11125 H HE2  . LYS A 1 17 ? 20.049  6.324   2.304   1.00 0.00 ? 21 LYS A HE2  6  
ATOM 11126 H HE3  . LYS A 1 17 ? 20.735  4.763   1.899   1.00 0.00 ? 21 LYS A HE3  6  
ATOM 11127 H HZ1  . LYS A 1 17 ? 18.390  5.636   0.432   1.00 0.00 ? 21 LYS A HZ1  6  
ATOM 11128 H HZ2  . LYS A 1 17 ? 19.820  6.337   0.075   1.00 0.00 ? 21 LYS A HZ2  6  
ATOM 11129 H HZ3  . LYS A 1 17 ? 19.645  4.720   -0.070  1.00 0.00 ? 21 LYS A HZ3  6  
ATOM 11130 N N    . ASN A 1 18 ? 16.004  1.322   1.078   1.00 0.00 ? 22 ASN A N    6  
ATOM 11131 C CA   . ASN A 1 18 ? 15.893  1.119   -0.356  1.00 0.00 ? 22 ASN A CA   6  
ATOM 11132 C C    . ASN A 1 18 ? 14.432  1.286   -0.779  1.00 0.00 ? 22 ASN A C    6  
ATOM 11133 O O    . ASN A 1 18 ? 14.146  1.908   -1.802  1.00 0.00 ? 22 ASN A O    6  
ATOM 11134 C CB   . ASN A 1 18 ? 16.341  -0.290  -0.750  1.00 0.00 ? 22 ASN A CB   6  
ATOM 11135 C CG   . ASN A 1 18 ? 17.794  -0.290  -1.227  1.00 0.00 ? 22 ASN A CG   6  
ATOM 11136 O OD1  . ASN A 1 18 ? 18.148  0.318   -2.224  1.00 0.00 ? 22 ASN A OD1  6  
ATOM 11137 N ND2  . ASN A 1 18 ? 18.615  -1.004  -0.462  1.00 0.00 ? 22 ASN A ND2  6  
ATOM 11138 H H    . ASN A 1 18 ? 15.704  0.550   1.639   1.00 0.00 ? 22 ASN A H    6  
ATOM 11139 H HA   . ASN A 1 18 ? 16.545  1.870   -0.803  1.00 0.00 ? 22 ASN A HA   6  
ATOM 11140 H HB2  . ASN A 1 18 ? 16.234  -0.960  0.103   1.00 0.00 ? 22 ASN A HB2  6  
ATOM 11141 H HB3  . ASN A 1 18 ? 15.695  -0.673  -1.539  1.00 0.00 ? 22 ASN A HB3  6  
ATOM 11142 H HD21 . ASN A 1 18 ? 18.261  -1.480  0.343   1.00 0.00 ? 22 ASN A HD21 6  
ATOM 11143 H HD22 . ASN A 1 18 ? 19.586  -1.066  -0.692  1.00 0.00 ? 22 ASN A HD22 6  
ATOM 11144 N N    . ILE A 1 19 ? 13.547  0.721   0.028   1.00 0.00 ? 23 ILE A N    6  
ATOM 11145 C CA   . ILE A 1 19 ? 12.123  0.800   -0.250  1.00 0.00 ? 23 ILE A CA   6  
ATOM 11146 C C    . ILE A 1 19 ? 11.723  2.266   -0.427  1.00 0.00 ? 23 ILE A C    6  
ATOM 11147 O O    . ILE A 1 19 ? 12.066  3.111   0.398   1.00 0.00 ? 23 ILE A O    6  
ATOM 11148 C CB   . ILE A 1 19 ? 11.325  0.071   0.833   1.00 0.00 ? 23 ILE A CB   6  
ATOM 11149 C CG1  . ILE A 1 19 ? 11.211  -1.422  0.519   1.00 0.00 ? 23 ILE A CG1  6  
ATOM 11150 C CG2  . ILE A 1 19 ? 9.954   0.720   1.034   1.00 0.00 ? 23 ILE A CG2  6  
ATOM 11151 C CD1  . ILE A 1 19 ? 11.485  -2.267  1.764   1.00 0.00 ? 23 ILE A CD1  6  
ATOM 11152 H H    . ILE A 1 19 ? 13.789  0.217   0.858   1.00 0.00 ? 23 ILE A H    6  
ATOM 11153 H HA   . ILE A 1 19 ? 11.944  0.277   -1.189  1.00 0.00 ? 23 ILE A HA   6  
ATOM 11154 H HB   . ILE A 1 19 ? 11.865  0.161   1.775   1.00 0.00 ? 23 ILE A HB   6  
ATOM 11155 H HG12 . ILE A 1 19 ? 10.214  -1.643  0.137   1.00 0.00 ? 23 ILE A HG12 6  
ATOM 11156 H HG13 . ILE A 1 19 ? 11.919  -1.687  -0.267  1.00 0.00 ? 23 ILE A HG13 6  
ATOM 11157 H HG21 . ILE A 1 19 ? 10.084  1.776   1.270   1.00 0.00 ? 23 ILE A HG21 6  
ATOM 11158 H HG22 . ILE A 1 19 ? 9.367   0.620   0.121   1.00 0.00 ? 23 ILE A HG22 6  
ATOM 11159 H HG23 . ILE A 1 19 ? 9.435   0.226   1.856   1.00 0.00 ? 23 ILE A HG23 6  
ATOM 11160 H HD11 . ILE A 1 19 ? 12.245  -1.780  2.375   1.00 0.00 ? 23 ILE A HD11 6  
ATOM 11161 H HD12 . ILE A 1 19 ? 10.566  -2.371  2.342   1.00 0.00 ? 23 ILE A HD12 6  
ATOM 11162 H HD13 . ILE A 1 19 ? 11.838  -3.254  1.464   1.00 0.00 ? 23 ILE A HD13 6  
ATOM 11163 N N    . GLN A 1 20 ? 11.002  2.523   -1.508  1.00 0.00 ? 24 GLN A N    6  
ATOM 11164 C CA   . GLN A 1 20 ? 10.551  3.872   -1.804  1.00 0.00 ? 24 GLN A CA   6  
ATOM 11165 C C    . GLN A 1 20 ? 9.025   3.952   -1.722  1.00 0.00 ? 24 GLN A C    6  
ATOM 11166 O O    . GLN A 1 20 ? 8.468   5.022   -1.480  1.00 0.00 ? 24 GLN A O    6  
ATOM 11167 C CB   . GLN A 1 20 ? 11.050  4.328   -3.176  1.00 0.00 ? 24 GLN A CB   6  
ATOM 11168 C CG   . GLN A 1 20 ? 11.549  5.774   -3.125  1.00 0.00 ? 24 GLN A CG   6  
ATOM 11169 C CD   . GLN A 1 20 ? 10.383  6.751   -2.963  1.00 0.00 ? 24 GLN A CD   6  
ATOM 11170 O OE1  . GLN A 1 20 ? 10.345  7.567   -2.058  1.00 0.00 ? 24 GLN A OE1  6  
ATOM 11171 N NE2  . GLN A 1 20 ? 9.437   6.622   -3.889  1.00 0.00 ? 24 GLN A NE2  6  
ATOM 11172 H H    . GLN A 1 20 ? 10.727  1.829   -2.175  1.00 0.00 ? 24 GLN A H    6  
ATOM 11173 H HA   . GLN A 1 20 ? 10.997  4.502   -1.034  1.00 0.00 ? 24 GLN A HA   6  
ATOM 11174 H HB2  . GLN A 1 20 ? 11.855  3.674   -3.511  1.00 0.00 ? 24 GLN A HB2  6  
ATOM 11175 H HB3  . GLN A 1 20 ? 10.246  4.243   -3.907  1.00 0.00 ? 24 GLN A HB3  6  
ATOM 11176 H HG2  . GLN A 1 20 ? 12.246  5.893   -2.296  1.00 0.00 ? 24 GLN A HG2  6  
ATOM 11177 H HG3  . GLN A 1 20 ? 12.098  6.005   -4.038  1.00 0.00 ? 24 GLN A HG3  6  
ATOM 11178 H HE21 . GLN A 1 20 ? 9.529   5.931   -4.606  1.00 0.00 ? 24 GLN A HE21 6  
ATOM 11179 H HE22 . GLN A 1 20 ? 8.633   7.216   -3.868  1.00 0.00 ? 24 GLN A HE22 6  
ATOM 11180 N N    . SER A 1 21 ? 8.393   2.806   -1.926  1.00 0.00 ? 25 SER A N    6  
ATOM 11181 C CA   . SER A 1 21 ? 6.942   2.733   -1.878  1.00 0.00 ? 25 SER A CA   6  
ATOM 11182 C C    . SER A 1 21 ? 6.503   1.337   -1.429  1.00 0.00 ? 25 SER A C    6  
ATOM 11183 O O    . SER A 1 21 ? 7.300   0.400   -1.437  1.00 0.00 ? 25 SER A O    6  
ATOM 11184 C CB   . SER A 1 21 ? 6.328   3.071   -3.238  1.00 0.00 ? 25 SER A CB   6  
ATOM 11185 O OG   . SER A 1 21 ? 7.323   3.364   -4.215  1.00 0.00 ? 25 SER A OG   6  
ATOM 11186 H H    . SER A 1 21 ? 8.853   1.940   -2.122  1.00 0.00 ? 25 SER A H    6  
ATOM 11187 H HA   . SER A 1 21 ? 6.640   3.482   -1.147  1.00 0.00 ? 25 SER A HA   6  
ATOM 11188 H HB2  . SER A 1 21 ? 5.720   2.233   -3.579  1.00 0.00 ? 25 SER A HB2  6  
ATOM 11189 H HB3  . SER A 1 21 ? 5.661   3.926   -3.132  1.00 0.00 ? 25 SER A HB3  6  
ATOM 11190 H HG   . SER A 1 21 ? 7.945   4.067   -3.870  1.00 0.00 ? 25 SER A HG   6  
ATOM 11191 N N    . VAL A 1 22 ? 5.238   1.244   -1.050  1.00 0.00 ? 26 VAL A N    6  
ATOM 11192 C CA   . VAL A 1 22 ? 4.683   -0.022  -0.599  1.00 0.00 ? 26 VAL A CA   6  
ATOM 11193 C C    . VAL A 1 22 ? 3.369   -0.289  -1.335  1.00 0.00 ? 26 VAL A C    6  
ATOM 11194 O O    . VAL A 1 22 ? 2.533   0.604   -1.463  1.00 0.00 ? 26 VAL A O    6  
ATOM 11195 C CB   . VAL A 1 22 ? 4.525   -0.011  0.923   1.00 0.00 ? 26 VAL A CB   6  
ATOM 11196 C CG1  . VAL A 1 22 ? 3.616   -1.151  1.388   1.00 0.00 ? 26 VAL A CG1  6  
ATOM 11197 C CG2  . VAL A 1 22 ? 5.887   -0.078  1.616   1.00 0.00 ? 26 VAL A CG2  6  
ATOM 11198 H H    . VAL A 1 22 ? 4.596   2.011   -1.047  1.00 0.00 ? 26 VAL A H    6  
ATOM 11199 H HA   . VAL A 1 22 ? 5.396   -0.804  -0.858  1.00 0.00 ? 26 VAL A HA   6  
ATOM 11200 H HB   . VAL A 1 22 ? 4.052   0.930   1.204   1.00 0.00 ? 26 VAL A HB   6  
ATOM 11201 H HG11 . VAL A 1 22 ? 2.718   -1.175  0.770   1.00 0.00 ? 26 VAL A HG11 6  
ATOM 11202 H HG12 . VAL A 1 22 ? 4.146   -2.099  1.294   1.00 0.00 ? 26 VAL A HG12 6  
ATOM 11203 H HG13 . VAL A 1 22 ? 3.337   -0.992  2.429   1.00 0.00 ? 26 VAL A HG13 6  
ATOM 11204 H HG21 . VAL A 1 22 ? 6.628   0.449   1.014   1.00 0.00 ? 26 VAL A HG21 6  
ATOM 11205 H HG22 . VAL A 1 22 ? 5.818   0.390   2.599   1.00 0.00 ? 26 VAL A HG22 6  
ATOM 11206 H HG23 . VAL A 1 22 ? 6.186   -1.120  1.730   1.00 0.00 ? 26 VAL A HG23 6  
ATOM 11207 N N    . LYS A 1 23 ? 3.227   -1.522  -1.799  1.00 0.00 ? 27 LYS A N    6  
ATOM 11208 C CA   . LYS A 1 23 ? 2.029   -1.918  -2.518  1.00 0.00 ? 27 LYS A CA   6  
ATOM 11209 C C    . LYS A 1 23 ? 1.456   -3.188  -1.887  1.00 0.00 ? 27 LYS A C    6  
ATOM 11210 O O    . LYS A 1 23 ? 2.125   -4.219  -1.843  1.00 0.00 ? 27 LYS A O    6  
ATOM 11211 C CB   . LYS A 1 23 ? 2.322   -2.052  -4.014  1.00 0.00 ? 27 LYS A CB   6  
ATOM 11212 C CG   . LYS A 1 23 ? 1.048   -2.383  -4.795  1.00 0.00 ? 27 LYS A CG   6  
ATOM 11213 C CD   . LYS A 1 23 ? -0.147  -1.595  -4.254  1.00 0.00 ? 27 LYS A CD   6  
ATOM 11214 C CE   . LYS A 1 23 ? -1.247  -1.473  -5.310  1.00 0.00 ? 27 LYS A CE   6  
ATOM 11215 N NZ   . LYS A 1 23 ? -0.737  -0.774  -6.511  1.00 0.00 ? 27 LYS A NZ   6  
ATOM 11216 H H    . LYS A 1 23 ? 3.912   -2.242  -1.690  1.00 0.00 ? 27 LYS A H    6  
ATOM 11217 H HA   . LYS A 1 23 ? 1.299   -1.116  -2.404  1.00 0.00 ? 27 LYS A HA   6  
ATOM 11218 H HB2  . LYS A 1 23 ? 2.752   -1.124  -4.389  1.00 0.00 ? 27 LYS A HB2  6  
ATOM 11219 H HB3  . LYS A 1 23 ? 3.064   -2.834  -4.174  1.00 0.00 ? 27 LYS A HB3  6  
ATOM 11220 H HG2  . LYS A 1 23 ? 1.193   -2.151  -5.850  1.00 0.00 ? 27 LYS A HG2  6  
ATOM 11221 H HG3  . LYS A 1 23 ? 0.844   -3.451  -4.729  1.00 0.00 ? 27 LYS A HG3  6  
ATOM 11222 H HD2  . LYS A 1 23 ? -0.542  -2.090  -3.367  1.00 0.00 ? 27 LYS A HD2  6  
ATOM 11223 H HD3  . LYS A 1 23 ? 0.178   -0.601  -3.945  1.00 0.00 ? 27 LYS A HD3  6  
ATOM 11224 H HE2  . LYS A 1 23 ? -1.607  -2.464  -5.584  1.00 0.00 ? 27 LYS A HE2  6  
ATOM 11225 H HE3  . LYS A 1 23 ? -2.096  -0.928  -4.898  1.00 0.00 ? 27 LYS A HE3  6  
ATOM 11226 H HZ1  . LYS A 1 23 ? 0.183   -0.427  -6.329  1.00 0.00 ? 27 LYS A HZ1  6  
ATOM 11227 H HZ2  . LYS A 1 23 ? -0.707  -1.412  -7.280  1.00 0.00 ? 27 LYS A HZ2  6  
ATOM 11228 H HZ3  . LYS A 1 23 ? -1.343  -0.010  -6.734  1.00 0.00 ? 27 LYS A HZ3  6  
ATOM 11229 N N    . VAL A 1 24 ? 0.224   -3.072  -1.414  1.00 0.00 ? 28 VAL A N    6  
ATOM 11230 C CA   . VAL A 1 24 ? -0.446  -4.199  -0.787  1.00 0.00 ? 28 VAL A CA   6  
ATOM 11231 C C    . VAL A 1 24 ? -1.604  -4.658  -1.677  1.00 0.00 ? 28 VAL A C    6  
ATOM 11232 O O    . VAL A 1 24 ? -2.577  -3.928  -1.861  1.00 0.00 ? 28 VAL A O    6  
ATOM 11233 C CB   . VAL A 1 24 ? -0.893  -3.821  0.627   1.00 0.00 ? 28 VAL A CB   6  
ATOM 11234 C CG1  . VAL A 1 24 ? -1.740  -4.933  1.249   1.00 0.00 ? 28 VAL A CG1  6  
ATOM 11235 C CG2  . VAL A 1 24 ? 0.311   -3.489  1.511   1.00 0.00 ? 28 VAL A CG2  6  
ATOM 11236 H H    . VAL A 1 24 ? -0.314  -2.230  -1.454  1.00 0.00 ? 28 VAL A H    6  
ATOM 11237 H HA   . VAL A 1 24 ? 0.278   -5.009  -0.708  1.00 0.00 ? 28 VAL A HA   6  
ATOM 11238 H HB   . VAL A 1 24 ? -1.512  -2.928  0.555   1.00 0.00 ? 28 VAL A HB   6  
ATOM 11239 H HG11 . VAL A 1 24 ? -2.239  -5.494  0.459   1.00 0.00 ? 28 VAL A HG11 6  
ATOM 11240 H HG12 . VAL A 1 24 ? -1.098  -5.602  1.821   1.00 0.00 ? 28 VAL A HG12 6  
ATOM 11241 H HG13 . VAL A 1 24 ? -2.487  -4.493  1.910   1.00 0.00 ? 28 VAL A HG13 6  
ATOM 11242 H HG21 . VAL A 1 24 ? 1.211   -3.445  0.898   1.00 0.00 ? 28 VAL A HG21 6  
ATOM 11243 H HG22 . VAL A 1 24 ? 0.152   -2.525  1.994   1.00 0.00 ? 28 VAL A HG22 6  
ATOM 11244 H HG23 . VAL A 1 24 ? 0.427   -4.261  2.272   1.00 0.00 ? 28 VAL A HG23 6  
ATOM 11245 N N    . LYS A 1 25 ? -1.459  -5.864  -2.205  1.00 0.00 ? 29 LYS A N    6  
ATOM 11246 C CA   . LYS A 1 25 ? -2.481  -6.429  -3.071  1.00 0.00 ? 29 LYS A CA   6  
ATOM 11247 C C    . LYS A 1 25 ? -3.201  -7.559  -2.333  1.00 0.00 ? 29 LYS A C    6  
ATOM 11248 O O    . LYS A 1 25 ? -2.880  -8.732  -2.522  1.00 0.00 ? 29 LYS A O    6  
ATOM 11249 C CB   . LYS A 1 25 ? -1.873  -6.857  -4.408  1.00 0.00 ? 29 LYS A CB   6  
ATOM 11250 C CG   . LYS A 1 25 ? -2.952  -6.987  -5.485  1.00 0.00 ? 29 LYS A CG   6  
ATOM 11251 C CD   . LYS A 1 25 ? -3.703  -8.313  -5.351  1.00 0.00 ? 29 LYS A CD   6  
ATOM 11252 C CE   . LYS A 1 25 ? -3.890  -8.977  -6.716  1.00 0.00 ? 29 LYS A CE   6  
ATOM 11253 N NZ   . LYS A 1 25 ? -4.054  -10.440 -6.563  1.00 0.00 ? 29 LYS A NZ   6  
ATOM 11254 H H    . LYS A 1 25 ? -0.665  -6.451  -2.050  1.00 0.00 ? 29 LYS A H    6  
ATOM 11255 H HA   . LYS A 1 25 ? -3.202  -5.640  -3.283  1.00 0.00 ? 29 LYS A HA   6  
ATOM 11256 H HB2  . LYS A 1 25 ? -1.126  -6.128  -4.723  1.00 0.00 ? 29 LYS A HB2  6  
ATOM 11257 H HB3  . LYS A 1 25 ? -1.356  -7.809  -4.289  1.00 0.00 ? 29 LYS A HB3  6  
ATOM 11258 H HG2  . LYS A 1 25 ? -3.654  -6.157  -5.402  1.00 0.00 ? 29 LYS A HG2  6  
ATOM 11259 H HG3  . LYS A 1 25 ? -2.496  -6.921  -6.472  1.00 0.00 ? 29 LYS A HG3  6  
ATOM 11260 H HD2  . LYS A 1 25 ? -3.152  -8.982  -4.689  1.00 0.00 ? 29 LYS A HD2  6  
ATOM 11261 H HD3  . LYS A 1 25 ? -4.676  -8.140  -4.891  1.00 0.00 ? 29 LYS A HD3  6  
ATOM 11262 H HE2  . LYS A 1 25 ? -4.763  -8.558  -7.215  1.00 0.00 ? 29 LYS A HE2  6  
ATOM 11263 H HE3  . LYS A 1 25 ? -3.029  -8.767  -7.351  1.00 0.00 ? 29 LYS A HE3  6  
ATOM 11264 H HZ1  . LYS A 1 25 ? -3.279  -10.811 -6.051  1.00 0.00 ? 29 LYS A HZ1  6  
ATOM 11265 H HZ2  . LYS A 1 25 ? -4.902  -10.630 -6.068  1.00 0.00 ? 29 LYS A HZ2  6  
ATOM 11266 H HZ3  . LYS A 1 25 ? -4.093  -10.868 -7.466  1.00 0.00 ? 29 LYS A HZ3  6  
ATOM 11267 N N    . SER A 1 26 ? -4.160  -7.167  -1.507  1.00 0.00 ? 30 SER A N    6  
ATOM 11268 C CA   . SER A 1 26 ? -4.928  -8.133  -0.740  1.00 0.00 ? 30 SER A CA   6  
ATOM 11269 C C    . SER A 1 26 ? -5.387  -9.276  -1.647  1.00 0.00 ? 30 SER A C    6  
ATOM 11270 O O    . SER A 1 26 ? -5.214  -9.216  -2.864  1.00 0.00 ? 30 SER A O    6  
ATOM 11271 C CB   . SER A 1 26 ? -6.134  -7.471  -0.071  1.00 0.00 ? 30 SER A CB   6  
ATOM 11272 O OG   . SER A 1 26 ? -7.368  -7.974  -0.575  1.00 0.00 ? 30 SER A OG   6  
ATOM 11273 H H    . SER A 1 26 ? -4.415  -6.212  -1.359  1.00 0.00 ? 30 SER A H    6  
ATOM 11274 H HA   . SER A 1 26 ? -4.246  -8.502  0.025   1.00 0.00 ? 30 SER A HA   6  
ATOM 11275 H HB2  . SER A 1 26 ? -6.087  -7.637  1.006   1.00 0.00 ? 30 SER A HB2  6  
ATOM 11276 H HB3  . SER A 1 26 ? -6.090  -6.393  -0.229  1.00 0.00 ? 30 SER A HB3  6  
ATOM 11277 H HG   . SER A 1 26 ? -8.108  -7.333  -0.371  1.00 0.00 ? 30 SER A HG   6  
ATOM 11278 N N    . PRO A 1 27 ? -5.977  -10.319 -1.004  1.00 0.00 ? 31 PRO A N    6  
ATOM 11279 C CA   . PRO A 1 27 ? -6.461  -11.475 -1.740  1.00 0.00 ? 31 PRO A CA   6  
ATOM 11280 C C    . PRO A 1 27 ? -7.761  -11.150 -2.478  1.00 0.00 ? 31 PRO A C    6  
ATOM 11281 O O    . PRO A 1 27 ? -8.397  -10.133 -2.204  1.00 0.00 ? 31 PRO A O    6  
ATOM 11282 C CB   . PRO A 1 27 ? -6.629  -12.565 -0.694  1.00 0.00 ? 31 PRO A CB   6  
ATOM 11283 C CG   . PRO A 1 27 ? -6.679  -11.852 0.647   1.00 0.00 ? 31 PRO A CG   6  
ATOM 11284 C CD   . PRO A 1 27 ? -6.198  -10.426 0.435   1.00 0.00 ? 31 PRO A CD   6  
ATOM 11285 H HA   . PRO A 1 27 ? -5.804  -11.737 -2.446  1.00 0.00 ? 31 PRO A HA   6  
ATOM 11286 H HB2  . PRO A 1 27 ? -7.541  -13.136 -0.867  1.00 0.00 ? 31 PRO A HB2  6  
ATOM 11287 H HB3  . PRO A 1 27 ? -5.799  -13.272 -0.730  1.00 0.00 ? 31 PRO A HB3  6  
ATOM 11288 H HG2  . PRO A 1 27 ? -7.693  -11.857 1.045   1.00 0.00 ? 31 PRO A HG2  6  
ATOM 11289 H HG3  . PRO A 1 27 ? -6.048  -12.363 1.375   1.00 0.00 ? 31 PRO A HG3  6  
ATOM 11290 H HD2  . PRO A 1 27 ? -6.939  -9.703  0.776   1.00 0.00 ? 31 PRO A HD2  6  
ATOM 11291 H HD3  . PRO A 1 27 ? -5.281  -10.230 0.992   1.00 0.00 ? 31 PRO A HD3  6  
ATOM 11292 N N    . GLY A 1 28 ? -8.118  -12.032 -3.400  1.00 0.00 ? 32 GLY A N    6  
ATOM 11293 C CA   . GLY A 1 28 ? -9.330  -11.851 -4.179  1.00 0.00 ? 32 GLY A CA   6  
ATOM 11294 C C    . GLY A 1 28 ? -10.042 -13.187 -4.403  1.00 0.00 ? 32 GLY A C    6  
ATOM 11295 O O    . GLY A 1 28 ? -9.798  -14.153 -3.683  1.00 0.00 ? 32 GLY A O    6  
ATOM 11296 H H    . GLY A 1 28 ? -7.595  -12.856 -3.617  1.00 0.00 ? 32 GLY A H    6  
ATOM 11297 H HA2  . GLY A 1 28 ? -9.999  -11.161 -3.664  1.00 0.00 ? 32 GLY A HA2  6  
ATOM 11298 H HA3  . GLY A 1 28 ? -9.085  -11.400 -5.141  1.00 0.00 ? 32 GLY A HA3  6  
ATOM 11299 N N    . PRO A 1 29 ? -10.931 -13.199 -5.432  1.00 0.00 ? 33 PRO A N    6  
ATOM 11300 C CA   . PRO A 1 29 ? -11.680 -14.400 -5.761  1.00 0.00 ? 33 PRO A CA   6  
ATOM 11301 C C    . PRO A 1 29 ? -10.792 -15.423 -6.471  1.00 0.00 ? 33 PRO A C    6  
ATOM 11302 O O    . PRO A 1 29 ? -11.258 -16.495 -6.854  1.00 0.00 ? 33 PRO A O    6  
ATOM 11303 C CB   . PRO A 1 29 ? -12.838 -13.919 -6.621  1.00 0.00 ? 33 PRO A CB   6  
ATOM 11304 C CG   . PRO A 1 29 ? -12.437 -12.543 -7.127  1.00 0.00 ? 33 PRO A CG   6  
ATOM 11305 C CD   . PRO A 1 29 ? -11.246 -12.073 -6.307  1.00 0.00 ? 33 PRO A CD   6  
ATOM 11306 H HA   . PRO A 1 29 ? -12.000 -14.848 -4.926  1.00 0.00 ? 33 PRO A HA   6  
ATOM 11307 H HB2  . PRO A 1 29 ? -13.018 -14.603 -7.450  1.00 0.00 ? 33 PRO A HB2  6  
ATOM 11308 H HB3  . PRO A 1 29 ? -13.760 -13.870 -6.042  1.00 0.00 ? 33 PRO A HB3  6  
ATOM 11309 H HG2  . PRO A 1 29 ? -12.180 -12.585 -8.185  1.00 0.00 ? 33 PRO A HG2  6  
ATOM 11310 H HG3  . PRO A 1 29 ? -13.268 -11.844 -7.029  1.00 0.00 ? 33 PRO A HG3  6  
ATOM 11311 H HD2  . PRO A 1 29 ? -10.401 -11.820 -6.947  1.00 0.00 ? 33 PRO A HD2  6  
ATOM 11312 H HD3  . PRO A 1 29 ? -11.489 -11.180 -5.732  1.00 0.00 ? 33 PRO A HD3  6  
ATOM 11313 N N    . HIS A 1 30 ? -9.529  -15.055 -6.626  1.00 0.00 ? 34 HIS A N    6  
ATOM 11314 C CA   . HIS A 1 30 ? -8.571  -15.928 -7.284  1.00 0.00 ? 34 HIS A CA   6  
ATOM 11315 C C    . HIS A 1 30 ? -7.504  -16.368 -6.280  1.00 0.00 ? 34 HIS A C    6  
ATOM 11316 O O    . HIS A 1 30 ? -7.251  -17.561 -6.120  1.00 0.00 ? 34 HIS A O    6  
ATOM 11317 C CB   . HIS A 1 30 ? -7.978  -15.249 -8.521  1.00 0.00 ? 34 HIS A CB   6  
ATOM 11318 C CG   . HIS A 1 30 ? -7.827  -13.752 -8.387  1.00 0.00 ? 34 HIS A CG   6  
ATOM 11319 N ND1  . HIS A 1 30 ? -8.909  -12.898 -8.268  1.00 0.00 ? 34 HIS A ND1  6  
ATOM 11320 C CD2  . HIS A 1 30 ? -6.711  -12.968 -8.354  1.00 0.00 ? 34 HIS A CD2  6  
ATOM 11321 C CE1  . HIS A 1 30 ? -8.453  -11.658 -8.169  1.00 0.00 ? 34 HIS A CE1  6  
ATOM 11322 N NE2  . HIS A 1 30 ? -7.091  -11.703 -8.223  1.00 0.00 ? 34 HIS A NE2  6  
ATOM 11323 H H    . HIS A 1 30 ? -9.158  -14.181 -6.312  1.00 0.00 ? 34 HIS A H    6  
ATOM 11324 H HA   . HIS A 1 30 ? -9.125  -16.804 -7.620  1.00 0.00 ? 34 HIS A HA   6  
ATOM 11325 H HB2  . HIS A 1 30 ? -7.000  -15.685 -8.728  1.00 0.00 ? 34 HIS A HB2  6  
ATOM 11326 H HB3  . HIS A 1 30 ? -8.612  -15.465 -9.380  1.00 0.00 ? 34 HIS A HB3  6  
ATOM 11327 H HD1  . HIS A 1 30 ? -9.871  -13.170 -8.258  1.00 0.00 ? 34 HIS A HD1  6  
ATOM 11328 H HD2  . HIS A 1 30 ? -5.682  -13.321 -8.423  1.00 0.00 ? 34 HIS A HD2  6  
ATOM 11329 H HE1  . HIS A 1 30 ? -9.060  -10.758 -8.063  1.00 0.00 ? 34 HIS A HE1  6  
ATOM 11330 N N    . CYS A 1 31 ? -6.905  -15.381 -5.630  1.00 0.00 ? 35 CYS A N    6  
ATOM 11331 C CA   . CYS A 1 31 ? -5.871  -15.651 -4.646  1.00 0.00 ? 35 CYS A CA   6  
ATOM 11332 C C    . CYS A 1 31 ? -6.418  -15.290 -3.263  1.00 0.00 ? 35 CYS A C    6  
ATOM 11333 O O    . CYS A 1 31 ? -6.820  -14.151 -3.029  1.00 0.00 ? 35 CYS A O    6  
ATOM 11334 C CB   . CYS A 1 31 ? -4.578  -14.898 -4.963  1.00 0.00 ? 35 CYS A CB   6  
ATOM 11335 S SG   . CYS A 1 31 ? -3.089  -15.954 -5.099  1.00 0.00 ? 35 CYS A SG   6  
ATOM 11336 H H    . CYS A 1 31 ? -7.117  -14.413 -5.766  1.00 0.00 ? 35 CYS A H    6  
ATOM 11337 H HA   . CYS A 1 31 ? -5.651  -16.717 -4.708  1.00 0.00 ? 35 CYS A HA   6  
ATOM 11338 H HB2  . CYS A 1 31 ? -4.709  -14.357 -5.900  1.00 0.00 ? 35 CYS A HB2  6  
ATOM 11339 H HB3  . CYS A 1 31 ? -4.407  -14.153 -4.186  1.00 0.00 ? 35 CYS A HB3  6  
ATOM 11340 N N    . ALA A 1 32 ? -6.414  -16.280 -2.383  1.00 0.00 ? 36 ALA A N    6  
ATOM 11341 C CA   . ALA A 1 32 ? -6.905  -16.081 -1.030  1.00 0.00 ? 36 ALA A CA   6  
ATOM 11342 C C    . ALA A 1 32 ? -5.726  -15.764 -0.107  1.00 0.00 ? 36 ALA A C    6  
ATOM 11343 O O    . ALA A 1 32 ? -5.802  -15.987 1.101   1.00 0.00 ? 36 ALA A O    6  
ATOM 11344 C CB   . ALA A 1 32 ? -7.681  -17.320 -0.580  1.00 0.00 ? 36 ALA A CB   6  
ATOM 11345 H H    . ALA A 1 32 ? -6.085  -17.203 -2.582  1.00 0.00 ? 36 ALA A H    6  
ATOM 11346 H HA   . ALA A 1 32 ? -7.583  -15.227 -1.045  1.00 0.00 ? 36 ALA A HA   6  
ATOM 11347 H HB1  . ALA A 1 32 ? -7.509  -18.132 -1.286  1.00 0.00 ? 36 ALA A HB1  6  
ATOM 11348 H HB2  . ALA A 1 32 ? -7.342  -17.621 0.411   1.00 0.00 ? 36 ALA A HB2  6  
ATOM 11349 H HB3  . ALA A 1 32 ? -8.746  -17.088 -0.546  1.00 0.00 ? 36 ALA A HB3  6  
ATOM 11350 N N    . GLN A 1 33 ? -4.665  -15.250 -0.710  1.00 0.00 ? 37 GLN A N    6  
ATOM 11351 C CA   . GLN A 1 33 ? -3.472  -14.901 0.043   1.00 0.00 ? 37 GLN A CA   6  
ATOM 11352 C C    . GLN A 1 33 ? -3.050  -13.463 -0.268  1.00 0.00 ? 37 GLN A C    6  
ATOM 11353 O O    . GLN A 1 33 ? -3.399  -12.923 -1.317  1.00 0.00 ? 37 GLN A O    6  
ATOM 11354 C CB   . GLN A 1 33 ? -2.334  -15.881 -0.247  1.00 0.00 ? 37 GLN A CB   6  
ATOM 11355 C CG   . GLN A 1 33 ? -2.845  -17.323 -0.268  1.00 0.00 ? 37 GLN A CG   6  
ATOM 11356 C CD   . GLN A 1 33 ? -2.554  -17.988 -1.615  1.00 0.00 ? 37 GLN A CD   6  
ATOM 11357 O OE1  . GLN A 1 33 ? -1.997  -17.393 -2.523  1.00 0.00 ? 37 GLN A OE1  6  
ATOM 11358 N NE2  . GLN A 1 33 ? -2.961  -19.252 -1.693  1.00 0.00 ? 37 GLN A NE2  6  
ATOM 11359 H H    . GLN A 1 33 ? -4.611  -15.072 -1.692  1.00 0.00 ? 37 GLN A H    6  
ATOM 11360 H HA   . GLN A 1 33 ? -3.757  -14.984 1.092   1.00 0.00 ? 37 GLN A HA   6  
ATOM 11361 H HB2  . GLN A 1 33 ? -1.876  -15.640 -1.206  1.00 0.00 ? 37 GLN A HB2  6  
ATOM 11362 H HB3  . GLN A 1 33 ? -1.558  -15.778 0.512   1.00 0.00 ? 37 GLN A HB3  6  
ATOM 11363 H HG2  . GLN A 1 33 ? -2.372  -17.892 0.532   1.00 0.00 ? 37 GLN A HG2  6  
ATOM 11364 H HG3  . GLN A 1 33 ? -3.918  -17.336 -0.077  1.00 0.00 ? 37 GLN A HG3  6  
ATOM 11365 H HE21 . GLN A 1 33 ? -3.412  -19.682 -0.911  1.00 0.00 ? 37 GLN A HE21 6  
ATOM 11366 H HE22 . GLN A 1 33 ? -2.815  -19.773 -2.535  1.00 0.00 ? 37 GLN A HE22 6  
ATOM 11367 N N    . THR A 1 34 ? -2.304  -12.885 0.662   1.00 0.00 ? 38 THR A N    6  
ATOM 11368 C CA   . THR A 1 34 ? -1.831  -11.521 0.500   1.00 0.00 ? 38 THR A CA   6  
ATOM 11369 C C    . THR A 1 34 ? -0.603  -11.487 -0.411  1.00 0.00 ? 38 THR A C    6  
ATOM 11370 O O    . THR A 1 34 ? 0.006   -12.522 -0.677  1.00 0.00 ? 38 THR A O    6  
ATOM 11371 C CB   . THR A 1 34 ? -1.570  -10.942 1.893   1.00 0.00 ? 38 THR A CB   6  
ATOM 11372 O OG1  . THR A 1 34 ? -2.811  -11.104 2.574   1.00 0.00 ? 38 THR A OG1  6  
ATOM 11373 C CG2  . THR A 1 34 ? -1.353  -9.428  1.867   1.00 0.00 ? 38 THR A CG2  6  
ATOM 11374 H H    . THR A 1 34 ? -2.025  -13.331 1.512   1.00 0.00 ? 38 THR A H    6  
ATOM 11375 H HA   . THR A 1 34 ? -2.612  -10.942 0.006   1.00 0.00 ? 38 THR A HA   6  
ATOM 11376 H HB   . THR A 1 34 ? -0.732  -11.448 2.373   1.00 0.00 ? 38 THR A HB   6  
ATOM 11377 H HG1  . THR A 1 34 ? -2.677  -11.001 3.559   1.00 0.00 ? 38 THR A HG1  6  
ATOM 11378 H HG21 . THR A 1 34 ? -2.118  -8.962  1.245   1.00 0.00 ? 38 THR A HG21 6  
ATOM 11379 H HG22 . THR A 1 34 ? -1.419  -9.034  2.881   1.00 0.00 ? 38 THR A HG22 6  
ATOM 11380 H HG23 . THR A 1 34 ? -0.368  -9.209  1.455   1.00 0.00 ? 38 THR A HG23 6  
ATOM 11381 N N    . GLU A 1 35 ? -0.275  -10.286 -0.866  1.00 0.00 ? 39 GLU A N    6  
ATOM 11382 C CA   . GLU A 1 35 ? 0.869   -10.104 -1.742  1.00 0.00 ? 39 GLU A CA   6  
ATOM 11383 C C    . GLU A 1 35 ? 1.421   -8.684  -1.606  1.00 0.00 ? 39 GLU A C    6  
ATOM 11384 O O    . GLU A 1 35 ? 1.097   -7.808  -2.406  1.00 0.00 ? 39 GLU A O    6  
ATOM 11385 C CB   . GLU A 1 35 ? 0.502   -10.413 -3.195  1.00 0.00 ? 39 GLU A CB   6  
ATOM 11386 C CG   . GLU A 1 35 ? 1.586   -11.258 -3.867  1.00 0.00 ? 39 GLU A CG   6  
ATOM 11387 C CD   . GLU A 1 35 ? 1.640   -12.662 -3.263  1.00 0.00 ? 39 GLU A CD   6  
ATOM 11388 O OE1  . GLU A 1 35 ? 0.577   -13.320 -3.260  1.00 0.00 ? 39 GLU A OE1  6  
ATOM 11389 O OE2  . GLU A 1 35 ? 2.743   -13.047 -2.817  1.00 0.00 ? 39 GLU A OE2  6  
ATOM 11390 H H    . GLU A 1 35 ? -0.776  -9.449  -0.645  1.00 0.00 ? 39 GLU A H    6  
ATOM 11391 H HA   . GLU A 1 35 ? 1.613   -10.825 -1.401  1.00 0.00 ? 39 GLU A HA   6  
ATOM 11392 H HB2  . GLU A 1 35 ? -0.450  -10.943 -3.229  1.00 0.00 ? 39 GLU A HB2  6  
ATOM 11393 H HB3  . GLU A 1 35 ? 0.368   -9.482  -3.746  1.00 0.00 ? 39 GLU A HB3  6  
ATOM 11394 H HG2  . GLU A 1 35 ? 1.388   -11.325 -4.937  1.00 0.00 ? 39 GLU A HG2  6  
ATOM 11395 H HG3  . GLU A 1 35 ? 2.555   -10.771 -3.752  1.00 0.00 ? 39 GLU A HG3  6  
ATOM 11396 N N    . VAL A 1 36 ? 2.247   -8.500  -0.586  1.00 0.00 ? 40 VAL A N    6  
ATOM 11397 C CA   . VAL A 1 36 ? 2.847   -7.200  -0.334  1.00 0.00 ? 40 VAL A CA   6  
ATOM 11398 C C    . VAL A 1 36 ? 4.029   -6.997  -1.284  1.00 0.00 ? 40 VAL A C    6  
ATOM 11399 O O    . VAL A 1 36 ? 4.931   -7.831  -1.346  1.00 0.00 ? 40 VAL A O    6  
ATOM 11400 C CB   . VAL A 1 36 ? 3.238   -7.081  1.140   1.00 0.00 ? 40 VAL A CB   6  
ATOM 11401 C CG1  . VAL A 1 36 ? 3.861   -5.715  1.433   1.00 0.00 ? 40 VAL A CG1  6  
ATOM 11402 C CG2  . VAL A 1 36 ? 2.035   -7.341  2.049   1.00 0.00 ? 40 VAL A CG2  6  
ATOM 11403 H H    . VAL A 1 36 ? 2.506   -9.217  0.061   1.00 0.00 ? 40 VAL A H    6  
ATOM 11404 H HA   . VAL A 1 36 ? 2.093   -6.443  -0.546  1.00 0.00 ? 40 VAL A HA   6  
ATOM 11405 H HB   . VAL A 1 36 ? 3.988   -7.844  1.351   1.00 0.00 ? 40 VAL A HB   6  
ATOM 11406 H HG11 . VAL A 1 36 ? 4.712   -5.554  0.770   1.00 0.00 ? 40 VAL A HG11 6  
ATOM 11407 H HG12 . VAL A 1 36 ? 3.119   -4.934  1.268   1.00 0.00 ? 40 VAL A HG12 6  
ATOM 11408 H HG13 . VAL A 1 36 ? 4.197   -5.684  2.469   1.00 0.00 ? 40 VAL A HG13 6  
ATOM 11409 H HG21 . VAL A 1 36 ? 1.117   -7.089  1.518   1.00 0.00 ? 40 VAL A HG21 6  
ATOM 11410 H HG22 . VAL A 1 36 ? 2.013   -8.394  2.331   1.00 0.00 ? 40 VAL A HG22 6  
ATOM 11411 H HG23 . VAL A 1 36 ? 2.117   -6.726  2.945   1.00 0.00 ? 40 VAL A HG23 6  
ATOM 11412 N N    . ILE A 1 37 ? 3.986   -5.884  -2.002  1.00 0.00 ? 41 ILE A N    6  
ATOM 11413 C CA   . ILE A 1 37 ? 5.043   -5.561  -2.945  1.00 0.00 ? 41 ILE A CA   6  
ATOM 11414 C C    . ILE A 1 37 ? 5.528   -4.132  -2.692  1.00 0.00 ? 41 ILE A C    6  
ATOM 11415 O O    . ILE A 1 37 ? 4.775   -3.176  -2.870  1.00 0.00 ? 41 ILE A O    6  
ATOM 11416 C CB   . ILE A 1 37 ? 4.572   -5.804  -4.381  1.00 0.00 ? 41 ILE A CB   6  
ATOM 11417 C CG1  . ILE A 1 37 ? 3.930   -7.186  -4.520  1.00 0.00 ? 41 ILE A CG1  6  
ATOM 11418 C CG2  . ILE A 1 37 ? 5.717   -5.601  -5.375  1.00 0.00 ? 41 ILE A CG2  6  
ATOM 11419 C CD1  . ILE A 1 37 ? 2.453   -7.069  -4.902  1.00 0.00 ? 41 ILE A CD1  6  
ATOM 11420 H H    . ILE A 1 37 ? 3.249   -5.211  -1.945  1.00 0.00 ? 41 ILE A H    6  
ATOM 11421 H HA   . ILE A 1 37 ? 5.870   -6.245  -2.757  1.00 0.00 ? 41 ILE A HA   6  
ATOM 11422 H HB   . ILE A 1 37 ? 3.805   -5.068  -4.618  1.00 0.00 ? 41 ILE A HB   6  
ATOM 11423 H HG12 . ILE A 1 37 ? 4.461   -7.763  -5.278  1.00 0.00 ? 41 ILE A HG12 6  
ATOM 11424 H HG13 . ILE A 1 37 ? 4.024   -7.731  -3.581  1.00 0.00 ? 41 ILE A HG13 6  
ATOM 11425 H HG21 . ILE A 1 37 ? 6.562   -5.138  -4.867  1.00 0.00 ? 41 ILE A HG21 6  
ATOM 11426 H HG22 . ILE A 1 37 ? 6.021   -6.566  -5.781  1.00 0.00 ? 41 ILE A HG22 6  
ATOM 11427 H HG23 . ILE A 1 37 ? 5.382   -4.955  -6.187  1.00 0.00 ? 41 ILE A HG23 6  
ATOM 11428 H HD11 . ILE A 1 37 ? 2.034   -6.166  -4.459  1.00 0.00 ? 41 ILE A HD11 6  
ATOM 11429 H HD12 . ILE A 1 37 ? 2.362   -7.017  -5.987  1.00 0.00 ? 41 ILE A HD12 6  
ATOM 11430 H HD13 . ILE A 1 37 ? 1.912   -7.940  -4.533  1.00 0.00 ? 41 ILE A HD13 6  
ATOM 11431 N N    . ALA A 1 38 ? 6.783   -4.032  -2.279  1.00 0.00 ? 42 ALA A N    6  
ATOM 11432 C CA   . ALA A 1 38 ? 7.378   -2.736  -1.999  1.00 0.00 ? 42 ALA A CA   6  
ATOM 11433 C C    . ALA A 1 38 ? 8.259   -2.319  -3.178  1.00 0.00 ? 42 ALA A C    6  
ATOM 11434 O O    . ALA A 1 38 ? 9.032   -3.123  -3.695  1.00 0.00 ? 42 ALA A O    6  
ATOM 11435 C CB   . ALA A 1 38 ? 8.157   -2.805  -0.684  1.00 0.00 ? 42 ALA A CB   6  
ATOM 11436 H H    . ALA A 1 38 ? 7.389   -4.815  -2.136  1.00 0.00 ? 42 ALA A H    6  
ATOM 11437 H HA   . ALA A 1 38 ? 6.567   -2.016  -1.889  1.00 0.00 ? 42 ALA A HA   6  
ATOM 11438 H HB1  . ALA A 1 38 ? 8.245   -1.804  -0.261  1.00 0.00 ? 42 ALA A HB1  6  
ATOM 11439 H HB2  . ALA A 1 38 ? 7.629   -3.451  0.018   1.00 0.00 ? 42 ALA A HB2  6  
ATOM 11440 H HB3  . ALA A 1 38 ? 9.151   -3.210  -0.872  1.00 0.00 ? 42 ALA A HB3  6  
ATOM 11441 N N    . THR A 1 39 ? 8.113   -1.061  -3.569  1.00 0.00 ? 43 THR A N    6  
ATOM 11442 C CA   . THR A 1 39 ? 8.886   -0.527  -4.677  1.00 0.00 ? 43 THR A CA   6  
ATOM 11443 C C    . THR A 1 39 ? 10.239  -0.009  -4.183  1.00 0.00 ? 43 THR A C    6  
ATOM 11444 O O    . THR A 1 39 ? 10.320  0.613   -3.125  1.00 0.00 ? 43 THR A O    6  
ATOM 11445 C CB   . THR A 1 39 ? 8.042   0.544   -5.370  1.00 0.00 ? 43 THR A CB   6  
ATOM 11446 O OG1  . THR A 1 39 ? 7.048   -0.197  -6.072  1.00 0.00 ? 43 THR A OG1  6  
ATOM 11447 C CG2  . THR A 1 39 ? 8.811   1.274   -6.473  1.00 0.00 ? 43 THR A CG2  6  
ATOM 11448 H H    . THR A 1 39 ? 7.482   -0.413  -3.143  1.00 0.00 ? 43 THR A H    6  
ATOM 11449 H HA   . THR A 1 39 ? 9.090   -1.338  -5.376  1.00 0.00 ? 43 THR A HA   6  
ATOM 11450 H HB   . THR A 1 39 ? 7.638   1.251   -4.644  1.00 0.00 ? 43 THR A HB   6  
ATOM 11451 H HG1  . THR A 1 39 ? 6.533   0.409   -6.678  1.00 0.00 ? 43 THR A HG1  6  
ATOM 11452 H HG21 . THR A 1 39 ? 9.795   1.561   -6.101  1.00 0.00 ? 43 THR A HG21 6  
ATOM 11453 H HG22 . THR A 1 39 ? 8.926   0.614   -7.333  1.00 0.00 ? 43 THR A HG22 6  
ATOM 11454 H HG23 . THR A 1 39 ? 8.261   2.166   -6.771  1.00 0.00 ? 43 THR A HG23 6  
ATOM 11455 N N    . LEU A 1 40 ? 11.266  -0.286  -4.972  1.00 0.00 ? 44 LEU A N    6  
ATOM 11456 C CA   . LEU A 1 40 ? 12.611  0.144   -4.629  1.00 0.00 ? 44 LEU A CA   6  
ATOM 11457 C C    . LEU A 1 40 ? 12.835  1.566   -5.146  1.00 0.00 ? 44 LEU A C    6  
ATOM 11458 O O    . LEU A 1 40 ? 12.248  1.965   -6.151  1.00 0.00 ? 44 LEU A O    6  
ATOM 11459 C CB   . LEU A 1 40 ? 13.642  -0.865  -5.138  1.00 0.00 ? 44 LEU A CB   6  
ATOM 11460 C CG   . LEU A 1 40 ? 14.704  -1.307  -4.128  1.00 0.00 ? 44 LEU A CG   6  
ATOM 11461 C CD1  . LEU A 1 40 ? 15.376  -2.607  -4.572  1.00 0.00 ? 44 LEU A CD1  6  
ATOM 11462 C CD2  . LEU A 1 40 ? 15.721  -0.192  -3.878  1.00 0.00 ? 44 LEU A CD2  6  
ATOM 11463 H H    . LEU A 1 40 ? 11.191  -0.793  -5.831  1.00 0.00 ? 44 LEU A H    6  
ATOM 11464 H HA   . LEU A 1 40 ? 12.682  0.156   -3.541  1.00 0.00 ? 44 LEU A HA   6  
ATOM 11465 H HB2  . LEU A 1 40 ? 13.113  -1.751  -5.489  1.00 0.00 ? 44 LEU A HB2  6  
ATOM 11466 H HB3  . LEU A 1 40 ? 14.148  -0.433  -6.001  1.00 0.00 ? 44 LEU A HB3  6  
ATOM 11467 H HG   . LEU A 1 40 ? 14.208  -1.509  -3.178  1.00 0.00 ? 44 LEU A HG   6  
ATOM 11468 H HD11 . LEU A 1 40 ? 14.869  -2.994  -5.457  1.00 0.00 ? 44 LEU A HD11 6  
ATOM 11469 H HD12 . LEU A 1 40 ? 16.422  -2.413  -4.809  1.00 0.00 ? 44 LEU A HD12 6  
ATOM 11470 H HD13 . LEU A 1 40 ? 15.316  -3.341  -3.769  1.00 0.00 ? 44 LEU A HD13 6  
ATOM 11471 H HD21 . LEU A 1 40 ? 15.908  0.345   -4.809  1.00 0.00 ? 44 LEU A HD21 6  
ATOM 11472 H HD22 . LEU A 1 40 ? 15.327  0.500   -3.133  1.00 0.00 ? 44 LEU A HD22 6  
ATOM 11473 H HD23 . LEU A 1 40 ? 16.653  -0.625  -3.515  1.00 0.00 ? 44 LEU A HD23 6  
ATOM 11474 N N    . LYS A 1 41 ? 13.684  2.293   -4.435  1.00 0.00 ? 45 LYS A N    6  
ATOM 11475 C CA   . LYS A 1 41 ? 13.993  3.663   -4.810  1.00 0.00 ? 45 LYS A CA   6  
ATOM 11476 C C    . LYS A 1 41 ? 14.904  3.658   -6.039  1.00 0.00 ? 45 LYS A C    6  
ATOM 11477 O O    . LYS A 1 41 ? 15.222  4.713   -6.585  1.00 0.00 ? 45 LYS A O    6  
ATOM 11478 C CB   . LYS A 1 41 ? 14.573  4.427   -3.618  1.00 0.00 ? 45 LYS A CB   6  
ATOM 11479 C CG   . LYS A 1 41 ? 14.697  5.919   -3.931  1.00 0.00 ? 45 LYS A CG   6  
ATOM 11480 C CD   . LYS A 1 41 ? 16.109  6.262   -4.412  1.00 0.00 ? 45 LYS A CD   6  
ATOM 11481 C CE   . LYS A 1 41 ? 16.752  7.320   -3.513  1.00 0.00 ? 45 LYS A CE   6  
ATOM 11482 N NZ   . LYS A 1 41 ? 17.124  6.732   -2.206  1.00 0.00 ? 45 LYS A NZ   6  
ATOM 11483 H H    . LYS A 1 41 ? 14.157  1.962   -3.619  1.00 0.00 ? 45 LYS A H    6  
ATOM 11484 H HA   . LYS A 1 41 ? 13.054  4.148   -5.077  1.00 0.00 ? 45 LYS A HA   6  
ATOM 11485 H HB2  . LYS A 1 41 ? 13.935  4.287   -2.745  1.00 0.00 ? 45 LYS A HB2  6  
ATOM 11486 H HB3  . LYS A 1 41 ? 15.552  4.022   -3.363  1.00 0.00 ? 45 LYS A HB3  6  
ATOM 11487 H HG2  . LYS A 1 41 ? 13.971  6.196   -4.695  1.00 0.00 ? 45 LYS A HG2  6  
ATOM 11488 H HG3  . LYS A 1 41 ? 14.461  6.502   -3.041  1.00 0.00 ? 45 LYS A HG3  6  
ATOM 11489 H HD2  . LYS A 1 41 ? 16.724  5.362   -4.419  1.00 0.00 ? 45 LYS A HD2  6  
ATOM 11490 H HD3  . LYS A 1 41 ? 16.068  6.628   -5.438  1.00 0.00 ? 45 LYS A HD3  6  
ATOM 11491 H HE2  . LYS A 1 41 ? 17.638  7.729   -3.999  1.00 0.00 ? 45 LYS A HE2  6  
ATOM 11492 H HE3  . LYS A 1 41 ? 16.060  8.148   -3.362  1.00 0.00 ? 45 LYS A HE3  6  
ATOM 11493 H HZ1  . LYS A 1 41 ? 16.757  5.804   -2.142  1.00 0.00 ? 45 LYS A HZ1  6  
ATOM 11494 H HZ2  . LYS A 1 41 ? 18.120  6.704   -2.125  1.00 0.00 ? 45 LYS A HZ2  6  
ATOM 11495 H HZ3  . LYS A 1 41 ? 16.745  7.292   -1.469  1.00 0.00 ? 45 LYS A HZ3  6  
ATOM 11496 N N    . ASN A 1 42 ? 15.298  2.458   -6.439  1.00 0.00 ? 46 ASN A N    6  
ATOM 11497 C CA   . ASN A 1 42 ? 16.166  2.302   -7.594  1.00 0.00 ? 46 ASN A CA   6  
ATOM 11498 C C    . ASN A 1 42 ? 15.321  1.937   -8.816  1.00 0.00 ? 46 ASN A C    6  
ATOM 11499 O O    . ASN A 1 42 ? 15.825  1.912   -9.938  1.00 0.00 ? 46 ASN A O    6  
ATOM 11500 C CB   . ASN A 1 42 ? 17.183  1.180   -7.371  1.00 0.00 ? 46 ASN A CB   6  
ATOM 11501 C CG   . ASN A 1 42 ? 17.386  0.362   -8.648  1.00 0.00 ? 46 ASN A CG   6  
ATOM 11502 O OD1  . ASN A 1 42 ? 17.878  0.846   -9.654  1.00 0.00 ? 46 ASN A OD1  6  
ATOM 11503 N ND2  . ASN A 1 42 ? 16.981  -0.901  -8.552  1.00 0.00 ? 46 ASN A ND2  6  
ATOM 11504 H H    . ASN A 1 42 ? 15.035  1.604   -5.990  1.00 0.00 ? 46 ASN A H    6  
ATOM 11505 H HA   . ASN A 1 42 ? 16.669  3.262   -7.706  1.00 0.00 ? 46 ASN A HA   6  
ATOM 11506 H HB2  . ASN A 1 42 ? 18.134  1.605   -7.052  1.00 0.00 ? 46 ASN A HB2  6  
ATOM 11507 H HB3  . ASN A 1 42 ? 16.840  0.528   -6.568  1.00 0.00 ? 46 ASN A HB3  6  
ATOM 11508 H HD21 . ASN A 1 42 ? 16.585  -1.235  -7.696  1.00 0.00 ? 46 ASN A HD21 6  
ATOM 11509 H HD22 . ASN A 1 42 ? 17.072  -1.516  -9.335  1.00 0.00 ? 46 ASN A HD22 6  
ATOM 11510 N N    . GLY A 1 43 ? 14.050  1.665   -8.558  1.00 0.00 ? 47 GLY A N    6  
ATOM 11511 C CA   . GLY A 1 43 ? 13.131  1.303   -9.623  1.00 0.00 ? 47 GLY A CA   6  
ATOM 11512 C C    . GLY A 1 43 ? 12.736  -0.172  -9.529  1.00 0.00 ? 47 GLY A C    6  
ATOM 11513 O O    . GLY A 1 43 ? 11.807  -0.614  -10.204 1.00 0.00 ? 47 GLY A O    6  
ATOM 11514 H H    . GLY A 1 43 ? 13.649  1.688   -7.642  1.00 0.00 ? 47 GLY A H    6  
ATOM 11515 H HA2  . GLY A 1 43 ? 12.238  1.926   -9.564  1.00 0.00 ? 47 GLY A HA2  6  
ATOM 11516 H HA3  . GLY A 1 43 ? 13.594  1.499   -10.590 1.00 0.00 ? 47 GLY A HA3  6  
ATOM 11517 N N    . GLN A 1 44 ? 13.462  -0.894  -8.688  1.00 0.00 ? 48 GLN A N    6  
ATOM 11518 C CA   . GLN A 1 44 ? 13.200  -2.310  -8.497  1.00 0.00 ? 48 GLN A CA   6  
ATOM 11519 C C    . GLN A 1 44 ? 12.043  -2.508  -7.515  1.00 0.00 ? 48 GLN A C    6  
ATOM 11520 O O    . GLN A 1 44 ? 11.407  -1.542  -7.096  1.00 0.00 ? 48 GLN A O    6  
ATOM 11521 C CB   . GLN A 1 44 ? 14.456  -3.041  -8.020  1.00 0.00 ? 48 GLN A CB   6  
ATOM 11522 C CG   . GLN A 1 44 ? 15.299  -3.513  -9.206  1.00 0.00 ? 48 GLN A CG   6  
ATOM 11523 C CD   . GLN A 1 44 ? 16.563  -4.232  -8.729  1.00 0.00 ? 48 GLN A CD   6  
ATOM 11524 O OE1  . GLN A 1 44 ? 16.535  -5.068  -7.841  1.00 0.00 ? 48 GLN A OE1  6  
ATOM 11525 N NE2  . GLN A 1 44 ? 17.670  -3.859  -9.365  1.00 0.00 ? 48 GLN A NE2  6  
ATOM 11526 H H    . GLN A 1 44 ? 14.216  -0.526  -8.143  1.00 0.00 ? 48 GLN A H    6  
ATOM 11527 H HA   . GLN A 1 44 ? 12.918  -2.687  -9.480  1.00 0.00 ? 48 GLN A HA   6  
ATOM 11528 H HB2  . GLN A 1 44 ? 15.049  -2.379  -7.389  1.00 0.00 ? 48 GLN A HB2  6  
ATOM 11529 H HB3  . GLN A 1 44 ? 14.173  -3.897  -7.407  1.00 0.00 ? 48 GLN A HB3  6  
ATOM 11530 H HG2  . GLN A 1 44 ? 14.710  -4.183  -9.832  1.00 0.00 ? 48 GLN A HG2  6  
ATOM 11531 H HG3  . GLN A 1 44 ? 15.574  -2.659  -9.825  1.00 0.00 ? 48 GLN A HG3  6  
ATOM 11532 H HE21 . GLN A 1 44 ? 17.624  -3.166  -10.085 1.00 0.00 ? 48 GLN A HE21 6  
ATOM 11533 H HE22 . GLN A 1 44 ? 18.548  -4.273  -9.124  1.00 0.00 ? 48 GLN A HE22 6  
ATOM 11534 N N    . LYS A 1 45 ? 11.807  -3.767  -7.175  1.00 0.00 ? 49 LYS A N    6  
ATOM 11535 C CA   . LYS A 1 45 ? 10.739  -4.104  -6.250  1.00 0.00 ? 49 LYS A CA   6  
ATOM 11536 C C    . LYS A 1 45 ? 11.153  -5.322  -5.422  1.00 0.00 ? 49 LYS A C    6  
ATOM 11537 O O    . LYS A 1 45 ? 11.834  -6.215  -5.923  1.00 0.00 ? 49 LYS A O    6  
ATOM 11538 C CB   . LYS A 1 45 ? 9.419   -4.290  -7.000  1.00 0.00 ? 49 LYS A CB   6  
ATOM 11539 C CG   . LYS A 1 45 ? 9.093   -3.061  -7.851  1.00 0.00 ? 49 LYS A CG   6  
ATOM 11540 C CD   . LYS A 1 45 ? 7.762   -3.239  -8.585  1.00 0.00 ? 49 LYS A CD   6  
ATOM 11541 C CE   . LYS A 1 45 ? 7.898   -2.870  -10.063 1.00 0.00 ? 49 LYS A CE   6  
ATOM 11542 N NZ   . LYS A 1 45 ? 8.354   -4.039  -10.849 1.00 0.00 ? 49 LYS A NZ   6  
ATOM 11543 H H    . LYS A 1 45 ? 12.329  -4.547  -7.520  1.00 0.00 ? 49 LYS A H    6  
ATOM 11544 H HA   . LYS A 1 45 ? 10.610  -3.256  -5.577  1.00 0.00 ? 49 LYS A HA   6  
ATOM 11545 H HB2  . LYS A 1 45 ? 9.480   -5.172  -7.638  1.00 0.00 ? 49 LYS A HB2  6  
ATOM 11546 H HB3  . LYS A 1 45 ? 8.613   -4.468  -6.288  1.00 0.00 ? 49 LYS A HB3  6  
ATOM 11547 H HG2  . LYS A 1 45 ? 9.046   -2.177  -7.215  1.00 0.00 ? 49 LYS A HG2  6  
ATOM 11548 H HG3  . LYS A 1 45 ? 9.891   -2.892  -8.573  1.00 0.00 ? 49 LYS A HG3  6  
ATOM 11549 H HD2  . LYS A 1 45 ? 7.427   -4.272  -8.493  1.00 0.00 ? 49 LYS A HD2  6  
ATOM 11550 H HD3  . LYS A 1 45 ? 7.000   -2.614  -8.119  1.00 0.00 ? 49 LYS A HD3  6  
ATOM 11551 H HE2  . LYS A 1 45 ? 6.940   -2.519  -10.446 1.00 0.00 ? 49 LYS A HE2  6  
ATOM 11552 H HE3  . LYS A 1 45 ? 8.607   -2.050  -10.176 1.00 0.00 ? 49 LYS A HE3  6  
ATOM 11553 H HZ1  . LYS A 1 45 ? 8.500   -4.816  -10.236 1.00 0.00 ? 49 LYS A HZ1  6  
ATOM 11554 H HZ2  . LYS A 1 45 ? 7.659   -4.276  -11.528 1.00 0.00 ? 49 LYS A HZ2  6  
ATOM 11555 H HZ3  . LYS A 1 45 ? 9.211   -3.815  -11.313 1.00 0.00 ? 49 LYS A HZ3  6  
ATOM 11556 N N    . ALA A 1 46 ? 10.723  -5.319  -4.168  1.00 0.00 ? 50 ALA A N    6  
ATOM 11557 C CA   . ALA A 1 46 ? 11.041  -6.413  -3.266  1.00 0.00 ? 50 ALA A CA   6  
ATOM 11558 C C    . ALA A 1 46 ? 9.760   -6.890  -2.579  1.00 0.00 ? 50 ALA A C    6  
ATOM 11559 O O    . ALA A 1 46 ? 9.199   -6.182  -1.743  1.00 0.00 ? 50 ALA A O    6  
ATOM 11560 C CB   . ALA A 1 46 ? 12.104  -5.957  -2.265  1.00 0.00 ? 50 ALA A CB   6  
ATOM 11561 H H    . ALA A 1 46 ? 10.169  -4.589  -3.769  1.00 0.00 ? 50 ALA A H    6  
ATOM 11562 H HA   . ALA A 1 46 ? 11.448  -7.229  -3.863  1.00 0.00 ? 50 ALA A HA   6  
ATOM 11563 H HB1  . ALA A 1 46 ? 12.411  -4.937  -2.499  1.00 0.00 ? 50 ALA A HB1  6  
ATOM 11564 H HB2  . ALA A 1 46 ? 11.691  -5.989  -1.256  1.00 0.00 ? 50 ALA A HB2  6  
ATOM 11565 H HB3  . ALA A 1 46 ? 12.968  -6.619  -2.325  1.00 0.00 ? 50 ALA A HB3  6  
ATOM 11566 N N    . CYS A 1 47 ? 9.334   -8.086  -2.956  1.00 0.00 ? 51 CYS A N    6  
ATOM 11567 C CA   . CYS A 1 47 ? 8.129   -8.666  -2.387  1.00 0.00 ? 51 CYS A CA   6  
ATOM 11568 C C    . CYS A 1 47 ? 8.399   -8.986  -0.915  1.00 0.00 ? 51 CYS A C    6  
ATOM 11569 O O    . CYS A 1 47 ? 9.459   -9.510  -0.574  1.00 0.00 ? 51 CYS A O    6  
ATOM 11570 C CB   . CYS A 1 47 ? 7.674   -9.902  -3.165  1.00 0.00 ? 51 CYS A CB   6  
ATOM 11571 S SG   . CYS A 1 47 ? 6.289   -9.612  -4.325  1.00 0.00 ? 51 CYS A SG   6  
ATOM 11572 H H    . CYS A 1 47 ? 9.796   -8.655  -3.636  1.00 0.00 ? 51 CYS A H    6  
ATOM 11573 H HA   . CYS A 1 47 ? 7.345   -7.915  -2.482  1.00 0.00 ? 51 CYS A HA   6  
ATOM 11574 H HB2  . CYS A 1 47 ? 8.523   -10.294 -3.726  1.00 0.00 ? 51 CYS A HB2  6  
ATOM 11575 H HB3  . CYS A 1 47 ? 7.378   -10.674 -2.454  1.00 0.00 ? 51 CYS A HB3  6  
ATOM 11576 N N    . LEU A 1 48 ? 7.423   -8.657  -0.083  1.00 0.00 ? 52 LEU A N    6  
ATOM 11577 C CA   . LEU A 1 48 ? 7.542   -8.902  1.345   1.00 0.00 ? 52 LEU A CA   6  
ATOM 11578 C C    . LEU A 1 48 ? 6.552   -9.995  1.754   1.00 0.00 ? 52 LEU A C    6  
ATOM 11579 O O    . LEU A 1 48 ? 5.647   -10.335 0.993   1.00 0.00 ? 52 LEU A O    6  
ATOM 11580 C CB   . LEU A 1 48 ? 7.378   -7.599  2.128   1.00 0.00 ? 52 LEU A CB   6  
ATOM 11581 C CG   . LEU A 1 48 ? 8.375   -6.487  1.796   1.00 0.00 ? 52 LEU A CG   6  
ATOM 11582 C CD1  . LEU A 1 48 ? 7.864   -5.129  2.282   1.00 0.00 ? 52 LEU A CD1  6  
ATOM 11583 C CD2  . LEU A 1 48 ? 9.762   -6.810  2.354   1.00 0.00 ? 52 LEU A CD2  6  
ATOM 11584 H H    . LEU A 1 48 ? 6.564   -8.231  -0.368  1.00 0.00 ? 52 LEU A H    6  
ATOM 11585 H HA   . LEU A 1 48 ? 8.553   -9.265  1.531   1.00 0.00 ? 52 LEU A HA   6  
ATOM 11586 H HB2  . LEU A 1 48 ? 6.370   -7.219  1.957   1.00 0.00 ? 52 LEU A HB2  6  
ATOM 11587 H HB3  . LEU A 1 48 ? 7.457   -7.824  3.192   1.00 0.00 ? 52 LEU A HB3  6  
ATOM 11588 H HG   . LEU A 1 48 ? 8.470   -6.426  0.712   1.00 0.00 ? 52 LEU A HG   6  
ATOM 11589 H HD11 . LEU A 1 48 ? 6.778   -5.096  2.192   1.00 0.00 ? 52 LEU A HD11 6  
ATOM 11590 H HD12 . LEU A 1 48 ? 8.146   -4.986  3.325   1.00 0.00 ? 52 LEU A HD12 6  
ATOM 11591 H HD13 . LEU A 1 48 ? 8.303   -4.337  1.675   1.00 0.00 ? 52 LEU A HD13 6  
ATOM 11592 H HD21 . LEU A 1 48 ? 9.686   -7.632  3.065   1.00 0.00 ? 52 LEU A HD21 6  
ATOM 11593 H HD22 . LEU A 1 48 ? 10.425  -7.097  1.537   1.00 0.00 ? 52 LEU A HD22 6  
ATOM 11594 H HD23 . LEU A 1 48 ? 10.166  -5.931  2.857   1.00 0.00 ? 52 LEU A HD23 6  
ATOM 11595 N N    . ASN A 1 49 ? 6.756   -10.514 2.956   1.00 0.00 ? 53 ASN A N    6  
ATOM 11596 C CA   . ASN A 1 49 ? 5.893   -11.560 3.476   1.00 0.00 ? 53 ASN A CA   6  
ATOM 11597 C C    . ASN A 1 49 ? 4.892   -10.949 4.458   1.00 0.00 ? 53 ASN A C    6  
ATOM 11598 O O    . ASN A 1 49 ? 5.285   -10.344 5.454   1.00 0.00 ? 53 ASN A O    6  
ATOM 11599 C CB   . ASN A 1 49 ? 6.702   -12.621 4.225   1.00 0.00 ? 53 ASN A CB   6  
ATOM 11600 C CG   . ASN A 1 49 ? 5.882   -13.897 4.423   1.00 0.00 ? 53 ASN A CG   6  
ATOM 11601 O OD1  . ASN A 1 49 ? 5.062   -14.273 3.602   1.00 0.00 ? 53 ASN A OD1  6  
ATOM 11602 N ND2  . ASN A 1 49 ? 6.149   -14.541 5.556   1.00 0.00 ? 53 ASN A ND2  6  
ATOM 11603 H H    . ASN A 1 49 ? 7.494   -10.231 3.569   1.00 0.00 ? 53 ASN A H    6  
ATOM 11604 H HA   . ASN A 1 49 ? 5.407   -11.992 2.600   1.00 0.00 ? 53 ASN A HA   6  
ATOM 11605 H HB2  . ASN A 1 49 ? 7.610   -12.851 3.667   1.00 0.00 ? 53 ASN A HB2  6  
ATOM 11606 H HB3  . ASN A 1 49 ? 7.013   -12.230 5.193   1.00 0.00 ? 53 ASN A HB3  6  
ATOM 11607 H HD21 . ASN A 1 49 ? 6.834   -14.178 6.188   1.00 0.00 ? 53 ASN A HD21 6  
ATOM 11608 H HD22 . ASN A 1 49 ? 5.664   -15.387 5.777   1.00 0.00 ? 53 ASN A HD22 6  
ATOM 11609 N N    . PRO A 1 50 ? 3.583   -11.132 4.134   1.00 0.00 ? 54 PRO A N    6  
ATOM 11610 C CA   . PRO A 1 50 ? 2.523   -10.606 4.977   1.00 0.00 ? 54 PRO A CA   6  
ATOM 11611 C C    . PRO A 1 50 ? 2.363   -11.445 6.246   1.00 0.00 ? 54 PRO A C    6  
ATOM 11612 O O    . PRO A 1 50 ? 1.505   -11.159 7.080   1.00 0.00 ? 54 PRO A O    6  
ATOM 11613 C CB   . PRO A 1 50 ? 1.283   -10.614 4.099   1.00 0.00 ? 54 PRO A CB   6  
ATOM 11614 C CG   . PRO A 1 50 ? 1.586   -11.571 2.958   1.00 0.00 ? 54 PRO A CG   6  
ATOM 11615 C CD   . PRO A 1 50 ? 3.081   -11.844 2.963   1.00 0.00 ? 54 PRO A CD   6  
ATOM 11616 H HA   . PRO A 1 50 ? 2.752   -9.683  5.287   1.00 0.00 ? 54 PRO A HA   6  
ATOM 11617 H HB2  . PRO A 1 50 ? 0.408   -10.941 4.661   1.00 0.00 ? 54 PRO A HB2  6  
ATOM 11618 H HB3  . PRO A 1 50 ? 1.064   -9.614  3.723   1.00 0.00 ? 54 PRO A HB3  6  
ATOM 11619 H HG2  . PRO A 1 50 ? 1.028   -12.499 3.080   1.00 0.00 ? 54 PRO A HG2  6  
ATOM 11620 H HG3  . PRO A 1 50 ? 1.280   -11.138 2.005   1.00 0.00 ? 54 PRO A HG3  6  
ATOM 11621 H HD2  . PRO A 1 50 ? 3.289   -12.911 3.028   1.00 0.00 ? 54 PRO A HD2  6  
ATOM 11622 H HD3  . PRO A 1 50 ? 3.552   -11.483 2.048   1.00 0.00 ? 54 PRO A HD3  6  
ATOM 11623 N N    . ALA A 1 51 ? 3.202   -12.465 6.352   1.00 0.00 ? 55 ALA A N    6  
ATOM 11624 C CA   . ALA A 1 51 ? 3.165   -13.348 7.506   1.00 0.00 ? 55 ALA A CA   6  
ATOM 11625 C C    . ALA A 1 51 ? 4.369   -13.059 8.403   1.00 0.00 ? 55 ALA A C    6  
ATOM 11626 O O    . ALA A 1 51 ? 4.663   -13.825 9.320   1.00 0.00 ? 55 ALA A O    6  
ATOM 11627 C CB   . ALA A 1 51 ? 3.125   -14.803 7.034   1.00 0.00 ? 55 ALA A CB   6  
ATOM 11628 H H    . ALA A 1 51 ? 3.897   -12.691 5.670   1.00 0.00 ? 55 ALA A H    6  
ATOM 11629 H HA   . ALA A 1 51 ? 2.250   -13.133 8.059   1.00 0.00 ? 55 ALA A HA   6  
ATOM 11630 H HB1  . ALA A 1 51 ? 2.657   -14.853 6.051   1.00 0.00 ? 55 ALA A HB1  6  
ATOM 11631 H HB2  . ALA A 1 51 ? 2.548   -15.398 7.742   1.00 0.00 ? 55 ALA A HB2  6  
ATOM 11632 H HB3  . ALA A 1 51 ? 4.140   -15.193 6.973   1.00 0.00 ? 55 ALA A HB3  6  
ATOM 11633 N N    . SER A 1 52 ? 5.035   -11.952 8.109   1.00 0.00 ? 56 SER A N    6  
ATOM 11634 C CA   . SER A 1 52 ? 6.201   -11.552 8.878   1.00 0.00 ? 56 SER A CA   6  
ATOM 11635 C C    . SER A 1 52 ? 5.871   -10.325 9.730   1.00 0.00 ? 56 SER A C    6  
ATOM 11636 O O    . SER A 1 52 ? 5.078   -9.477  9.323   1.00 0.00 ? 56 SER A O    6  
ATOM 11637 C CB   . SER A 1 52 ? 7.390   -11.258 7.962   1.00 0.00 ? 56 SER A CB   6  
ATOM 11638 O OG   . SER A 1 52 ? 8.516   -10.771 8.688   1.00 0.00 ? 56 SER A OG   6  
ATOM 11639 H H    . SER A 1 52 ? 4.789   -11.334 7.362   1.00 0.00 ? 56 SER A H    6  
ATOM 11640 H HA   . SER A 1 52 ? 6.435   -12.407 9.513   1.00 0.00 ? 56 SER A HA   6  
ATOM 11641 H HB2  . SER A 1 52 ? 7.669   -12.166 7.427   1.00 0.00 ? 56 SER A HB2  6  
ATOM 11642 H HB3  . SER A 1 52 ? 7.097   -10.523 7.212   1.00 0.00 ? 56 SER A HB3  6  
ATOM 11643 H HG   . SER A 1 52 ? 9.149   -10.308 8.067   1.00 0.00 ? 56 SER A HG   6  
ATOM 11644 N N    . PRO A 1 53 ? 6.513   -10.267 10.927  1.00 0.00 ? 57 PRO A N    6  
ATOM 11645 C CA   . PRO A 1 53 ? 6.295   -9.157  11.840  1.00 0.00 ? 57 PRO A CA   6  
ATOM 11646 C C    . PRO A 1 53 ? 7.016   -7.898  11.354  1.00 0.00 ? 57 PRO A C    6  
ATOM 11647 O O    . PRO A 1 53 ? 6.450   -6.806  11.380  1.00 0.00 ? 57 PRO A O    6  
ATOM 11648 C CB   . PRO A 1 53 ? 6.802   -9.649  13.185  1.00 0.00 ? 57 PRO A CB   6  
ATOM 11649 C CG   . PRO A 1 53 ? 7.706   -10.834 12.882  1.00 0.00 ? 57 PRO A CG   6  
ATOM 11650 C CD   . PRO A 1 53 ? 7.459   -11.252 11.442  1.00 0.00 ? 57 PRO A CD   6  
ATOM 11651 H HA   . PRO A 1 53 ? 5.324   -8.921  11.874  1.00 0.00 ? 57 PRO A HA   6  
ATOM 11652 H HB2  . PRO A 1 53 ? 7.349   -8.865  13.708  1.00 0.00 ? 57 PRO A HB2  6  
ATOM 11653 H HB3  . PRO A 1 53 ? 5.975   -9.945  13.831  1.00 0.00 ? 57 PRO A HB3  6  
ATOM 11654 H HG2  . PRO A 1 53 ? 8.752   -10.563 13.027  1.00 0.00 ? 57 PRO A HG2  6  
ATOM 11655 H HG3  . PRO A 1 53 ? 7.494   -11.659 13.562  1.00 0.00 ? 57 PRO A HG3  6  
ATOM 11656 H HD2  . PRO A 1 53 ? 8.384   -11.252 10.866  1.00 0.00 ? 57 PRO A HD2  6  
ATOM 11657 H HD3  . PRO A 1 53 ? 7.049   -12.261 11.388  1.00 0.00 ? 57 PRO A HD3  6  
ATOM 11658 N N    . MET A 1 54 ? 8.253   -8.092  10.922  1.00 0.00 ? 58 MET A N    6  
ATOM 11659 C CA   . MET A 1 54 ? 9.056   -6.986  10.430  1.00 0.00 ? 58 MET A CA   6  
ATOM 11660 C C    . MET A 1 54 ? 8.418   -6.352  9.193   1.00 0.00 ? 58 MET A C    6  
ATOM 11661 O O    . MET A 1 54 ? 8.629   -5.172  8.917   1.00 0.00 ? 58 MET A O    6  
ATOM 11662 C CB   . MET A 1 54 ? 10.458  -7.489  10.080  1.00 0.00 ? 58 MET A CB   6  
ATOM 11663 C CG   . MET A 1 54 ? 11.520  -6.449  10.442  1.00 0.00 ? 58 MET A CG   6  
ATOM 11664 S SD   . MET A 1 54 ? 12.339  -6.914  11.958  1.00 0.00 ? 58 MET A SD   6  
ATOM 11665 C CE   . MET A 1 54 ? 10.928  -7.060  13.041  1.00 0.00 ? 58 MET A CE   6  
ATOM 11666 H H    . MET A 1 54 ? 8.705   -8.984  10.904  1.00 0.00 ? 58 MET A H    6  
ATOM 11667 H HA   . MET A 1 54 ? 9.086   -6.262  11.244  1.00 0.00 ? 58 MET A HA   6  
ATOM 11668 H HB2  . MET A 1 54 ? 10.659  -8.419  10.613  1.00 0.00 ? 58 MET A HB2  6  
ATOM 11669 H HB3  . MET A 1 54 ? 10.513  -7.714  9.015   1.00 0.00 ? 58 MET A HB3  6  
ATOM 11670 H HG2  . MET A 1 54 ? 12.249  -6.365  9.636   1.00 0.00 ? 58 MET A HG2  6  
ATOM 11671 H HG3  . MET A 1 54 ? 11.057  -5.468  10.555  1.00 0.00 ? 58 MET A HG3  6  
ATOM 11672 H HE1  . MET A 1 54 ? 10.328  -6.152  12.981  1.00 0.00 ? 58 MET A HE1  6  
ATOM 11673 H HE2  . MET A 1 54 ? 10.324  -7.915  12.737  1.00 0.00 ? 58 MET A HE2  6  
ATOM 11674 H HE3  . MET A 1 54 ? 11.269  -7.203  14.066  1.00 0.00 ? 58 MET A HE3  6  
ATOM 11675 N N    . VAL A 1 55 ? 7.649   -7.163  8.481   1.00 0.00 ? 59 VAL A N    6  
ATOM 11676 C CA   . VAL A 1 55 ? 6.979   -6.696  7.280   1.00 0.00 ? 59 VAL A CA   6  
ATOM 11677 C C    . VAL A 1 55 ? 5.838   -5.754  7.671   1.00 0.00 ? 59 VAL A C    6  
ATOM 11678 O O    . VAL A 1 55 ? 5.230   -5.119  6.811   1.00 0.00 ? 59 VAL A O    6  
ATOM 11679 C CB   . VAL A 1 55 ? 6.509   -7.889  6.445   1.00 0.00 ? 59 VAL A CB   6  
ATOM 11680 C CG1  . VAL A 1 55 ? 5.516   -7.448  5.368   1.00 0.00 ? 59 VAL A CG1  6  
ATOM 11681 C CG2  . VAL A 1 55 ? 7.698   -8.627  5.826   1.00 0.00 ? 59 VAL A CG2  6  
ATOM 11682 H H    . VAL A 1 55 ? 7.483   -8.121  8.713   1.00 0.00 ? 59 VAL A H    6  
ATOM 11683 H HA   . VAL A 1 55 ? 7.708   -6.139  6.692   1.00 0.00 ? 59 VAL A HA   6  
ATOM 11684 H HB   . VAL A 1 55 ? 5.995   -8.582  7.111   1.00 0.00 ? 59 VAL A HB   6  
ATOM 11685 H HG11 . VAL A 1 55 ? 5.943   -6.625  4.795   1.00 0.00 ? 59 VAL A HG11 6  
ATOM 11686 H HG12 . VAL A 1 55 ? 5.306   -8.285  4.702   1.00 0.00 ? 59 VAL A HG12 6  
ATOM 11687 H HG13 . VAL A 1 55 ? 4.590   -7.119  5.841   1.00 0.00 ? 59 VAL A HG13 6  
ATOM 11688 H HG21 . VAL A 1 55 ? 8.440   -8.832  6.597   1.00 0.00 ? 59 VAL A HG21 6  
ATOM 11689 H HG22 . VAL A 1 55 ? 7.356   -9.566  5.391   1.00 0.00 ? 59 VAL A HG22 6  
ATOM 11690 H HG23 . VAL A 1 55 ? 8.144   -8.007  5.048   1.00 0.00 ? 59 VAL A HG23 6  
ATOM 11691 N N    . LYS A 1 56 ? 5.582   -5.694  8.970   1.00 0.00 ? 60 LYS A N    6  
ATOM 11692 C CA   . LYS A 1 56 ? 4.526   -4.840  9.486   1.00 0.00 ? 60 LYS A CA   6  
ATOM 11693 C C    . LYS A 1 56 ? 5.148   -3.617  10.161  1.00 0.00 ? 60 LYS A C    6  
ATOM 11694 O O    . LYS A 1 56 ? 4.438   -2.785  10.724  1.00 0.00 ? 60 LYS A O    6  
ATOM 11695 C CB   . LYS A 1 56 ? 3.591   -5.637  10.398  1.00 0.00 ? 60 LYS A CB   6  
ATOM 11696 C CG   . LYS A 1 56 ? 3.207   -6.973  9.758   1.00 0.00 ? 60 LYS A CG   6  
ATOM 11697 C CD   . LYS A 1 56 ? 2.307   -6.759  8.539   1.00 0.00 ? 60 LYS A CD   6  
ATOM 11698 C CE   . LYS A 1 56 ? 0.884   -6.394  8.966   1.00 0.00 ? 60 LYS A CE   6  
ATOM 11699 N NZ   . LYS A 1 56 ? 0.554   -5.014  8.545   1.00 0.00 ? 60 LYS A NZ   6  
ATOM 11700 H H    . LYS A 1 56 ? 6.082   -6.214  9.663   1.00 0.00 ? 60 LYS A H    6  
ATOM 11701 H HA   . LYS A 1 56 ? 3.935   -4.502  8.635   1.00 0.00 ? 60 LYS A HA   6  
ATOM 11702 H HB2  . LYS A 1 56 ? 4.077   -5.815  11.357  1.00 0.00 ? 60 LYS A HB2  6  
ATOM 11703 H HB3  . LYS A 1 56 ? 2.691   -5.055  10.600  1.00 0.00 ? 60 LYS A HB3  6  
ATOM 11704 H HG2  . LYS A 1 56 ? 4.108   -7.509  9.459   1.00 0.00 ? 60 LYS A HG2  6  
ATOM 11705 H HG3  . LYS A 1 56 ? 2.693   -7.596  10.489  1.00 0.00 ? 60 LYS A HG3  6  
ATOM 11706 H HD2  . LYS A 1 56 ? 2.718   -5.965  7.914   1.00 0.00 ? 60 LYS A HD2  6  
ATOM 11707 H HD3  . LYS A 1 56 ? 2.288   -7.664  7.933   1.00 0.00 ? 60 LYS A HD3  6  
ATOM 11708 H HE2  . LYS A 1 56 ? 0.175   -7.095  8.525   1.00 0.00 ? 60 LYS A HE2  6  
ATOM 11709 H HE3  . LYS A 1 56 ? 0.789   -6.483  10.048  1.00 0.00 ? 60 LYS A HE3  6  
ATOM 11710 H HZ1  . LYS A 1 56 ? 1.063   -4.789  7.714   1.00 0.00 ? 60 LYS A HZ1  6  
ATOM 11711 H HZ2  . LYS A 1 56 ? -0.427  -4.947  8.363   1.00 0.00 ? 60 LYS A HZ2  6  
ATOM 11712 H HZ3  . LYS A 1 56 ? 0.803   -4.375  9.272   1.00 0.00 ? 60 LYS A HZ3  6  
ATOM 11713 N N    . LYS A 1 57 ? 6.469   -3.545  10.083  1.00 0.00 ? 61 LYS A N    6  
ATOM 11714 C CA   . LYS A 1 57 ? 7.195   -2.437  10.680  1.00 0.00 ? 61 LYS A CA   6  
ATOM 11715 C C    . LYS A 1 57 ? 7.944   -1.675  9.585   1.00 0.00 ? 61 LYS A C    6  
ATOM 11716 O O    . LYS A 1 57 ? 8.386   -0.548  9.799   1.00 0.00 ? 61 LYS A O    6  
ATOM 11717 C CB   . LYS A 1 57 ? 8.098   -2.935  11.810  1.00 0.00 ? 61 LYS A CB   6  
ATOM 11718 C CG   . LYS A 1 57 ? 7.277   -3.609  12.911  1.00 0.00 ? 61 LYS A CG   6  
ATOM 11719 C CD   . LYS A 1 57 ? 7.794   -3.219  14.297  1.00 0.00 ? 61 LYS A CD   6  
ATOM 11720 C CE   . LYS A 1 57 ? 6.864   -3.738  15.395  1.00 0.00 ? 61 LYS A CE   6  
ATOM 11721 N NZ   . LYS A 1 57 ? 6.661   -2.704  16.435  1.00 0.00 ? 61 LYS A NZ   6  
ATOM 11722 H H    . LYS A 1 57 ? 7.040   -4.226  9.623   1.00 0.00 ? 61 LYS A H    6  
ATOM 11723 H HA   . LYS A 1 57 ? 6.460   -1.767  11.126  1.00 0.00 ? 61 LYS A HA   6  
ATOM 11724 H HB2  . LYS A 1 57 ? 8.829   -3.640  11.413  1.00 0.00 ? 61 LYS A HB2  6  
ATOM 11725 H HB3  . LYS A 1 57 ? 8.658   -2.099  12.229  1.00 0.00 ? 61 LYS A HB3  6  
ATOM 11726 H HG2  . LYS A 1 57 ? 6.230   -3.323  12.815  1.00 0.00 ? 61 LYS A HG2  6  
ATOM 11727 H HG3  . LYS A 1 57 ? 7.324   -4.692  12.793  1.00 0.00 ? 61 LYS A HG3  6  
ATOM 11728 H HD2  . LYS A 1 57 ? 8.796   -3.623  14.443  1.00 0.00 ? 61 LYS A HD2  6  
ATOM 11729 H HD3  . LYS A 1 57 ? 7.875   -2.134  14.367  1.00 0.00 ? 61 LYS A HD3  6  
ATOM 11730 H HE2  . LYS A 1 57 ? 5.904   -4.021  14.963  1.00 0.00 ? 61 LYS A HE2  6  
ATOM 11731 H HE3  . LYS A 1 57 ? 7.288   -4.636  15.845  1.00 0.00 ? 61 LYS A HE3  6  
ATOM 11732 H HZ1  . LYS A 1 57 ? 7.440   -2.077  16.437  1.00 0.00 ? 61 LYS A HZ1  6  
ATOM 11733 H HZ2  . LYS A 1 57 ? 5.823   -2.194  16.239  1.00 0.00 ? 61 LYS A HZ2  6  
ATOM 11734 H HZ3  . LYS A 1 57 ? 6.583   -3.142  17.330  1.00 0.00 ? 61 LYS A HZ3  6  
ATOM 11735 N N    . ILE A 1 58 ? 8.064   -2.322  8.434   1.00 0.00 ? 62 ILE A N    6  
ATOM 11736 C CA   . ILE A 1 58 ? 8.753   -1.720  7.305   1.00 0.00 ? 62 ILE A CA   6  
ATOM 11737 C C    . ILE A 1 58 ? 7.738   -0.981  6.430   1.00 0.00 ? 62 ILE A C    6  
ATOM 11738 O O    . ILE A 1 58 ? 8.113   -0.151  5.604   1.00 0.00 ? 62 ILE A O    6  
ATOM 11739 C CB   . ILE A 1 58 ? 9.565   -2.772  6.549   1.00 0.00 ? 62 ILE A CB   6  
ATOM 11740 C CG1  . ILE A 1 58 ? 10.547  -3.483  7.483   1.00 0.00 ? 62 ILE A CG1  6  
ATOM 11741 C CG2  . ILE A 1 58 ? 10.269  -2.156  5.338   1.00 0.00 ? 62 ILE A CG2  6  
ATOM 11742 C CD1  . ILE A 1 58 ? 10.797  -4.921  7.025   1.00 0.00 ? 62 ILE A CD1  6  
ATOM 11743 H H    . ILE A 1 58 ? 7.702   -3.239  8.268   1.00 0.00 ? 62 ILE A H    6  
ATOM 11744 H HA   . ILE A 1 58 ? 9.459   -0.992  7.704   1.00 0.00 ? 62 ILE A HA   6  
ATOM 11745 H HB   . ILE A 1 58 ? 8.877   -3.528  6.171   1.00 0.00 ? 62 ILE A HB   6  
ATOM 11746 H HG12 . ILE A 1 58 ? 11.490  -2.936  7.509   1.00 0.00 ? 62 ILE A HG12 6  
ATOM 11747 H HG13 . ILE A 1 58 ? 10.152  -3.484  8.499   1.00 0.00 ? 62 ILE A HG13 6  
ATOM 11748 H HG21 . ILE A 1 58 ? 10.623  -1.157  5.593   1.00 0.00 ? 62 ILE A HG21 6  
ATOM 11749 H HG22 . ILE A 1 58 ? 11.117  -2.780  5.055   1.00 0.00 ? 62 ILE A HG22 6  
ATOM 11750 H HG23 . ILE A 1 58 ? 9.570   -2.092  4.505   1.00 0.00 ? 62 ILE A HG23 6  
ATOM 11751 H HD11 . ILE A 1 58 ? 11.156  -4.917  5.996   1.00 0.00 ? 62 ILE A HD11 6  
ATOM 11752 H HD12 . ILE A 1 58 ? 11.545  -5.382  7.670   1.00 0.00 ? 62 ILE A HD12 6  
ATOM 11753 H HD13 . ILE A 1 58 ? 9.868   -5.487  7.084   1.00 0.00 ? 62 ILE A HD13 6  
ATOM 11754 N N    . ILE A 1 59 ? 6.472   -1.309  6.642   1.00 0.00 ? 63 ILE A N    6  
ATOM 11755 C CA   . ILE A 1 59 ? 5.400   -0.687  5.884   1.00 0.00 ? 63 ILE A CA   6  
ATOM 11756 C C    . ILE A 1 59 ? 4.862   0.515   6.661   1.00 0.00 ? 63 ILE A C    6  
ATOM 11757 O O    . ILE A 1 59 ? 4.840   1.633   6.148   1.00 0.00 ? 63 ILE A O    6  
ATOM 11758 C CB   . ILE A 1 59 ? 4.328   -1.718  5.526   1.00 0.00 ? 63 ILE A CB   6  
ATOM 11759 C CG1  . ILE A 1 59 ? 4.805   -2.637  4.399   1.00 0.00 ? 63 ILE A CG1  6  
ATOM 11760 C CG2  . ILE A 1 59 ? 3.002   -1.035  5.186   1.00 0.00 ? 63 ILE A CG2  6  
ATOM 11761 C CD1  . ILE A 1 59 ? 4.157   -4.019  4.507   1.00 0.00 ? 63 ILE A CD1  6  
ATOM 11762 H H    . ILE A 1 59 ? 6.175   -1.985  7.317   1.00 0.00 ? 63 ILE A H    6  
ATOM 11763 H HA   . ILE A 1 59 ? 5.828   -0.329  4.947   1.00 0.00 ? 63 ILE A HA   6  
ATOM 11764 H HB   . ILE A 1 59 ? 4.152   -2.345  6.400   1.00 0.00 ? 63 ILE A HB   6  
ATOM 11765 H HG12 . ILE A 1 59 ? 4.563   -2.192  3.434   1.00 0.00 ? 63 ILE A HG12 6  
ATOM 11766 H HG13 . ILE A 1 59 ? 5.890   -2.736  4.441   1.00 0.00 ? 63 ILE A HG13 6  
ATOM 11767 H HG21 . ILE A 1 59 ? 3.167   -0.289  4.409   1.00 0.00 ? 63 ILE A HG21 6  
ATOM 11768 H HG22 . ILE A 1 59 ? 2.291   -1.780  4.829   1.00 0.00 ? 63 ILE A HG22 6  
ATOM 11769 H HG23 . ILE A 1 59 ? 2.604   -0.551  6.077   1.00 0.00 ? 63 ILE A HG23 6  
ATOM 11770 H HD11 . ILE A 1 59 ? 3.570   -4.074  5.423   1.00 0.00 ? 63 ILE A HD11 6  
ATOM 11771 H HD12 . ILE A 1 59 ? 3.507   -4.183  3.648   1.00 0.00 ? 63 ILE A HD12 6  
ATOM 11772 H HD13 . ILE A 1 59 ? 4.933   -4.784  4.526   1.00 0.00 ? 63 ILE A HD13 6  
ATOM 11773 N N    . GLU A 1 60 ? 4.440   0.245   7.888   1.00 0.00 ? 64 GLU A N    6  
ATOM 11774 C CA   . GLU A 1 60 ? 3.902   1.291   8.742   1.00 0.00 ? 64 GLU A CA   6  
ATOM 11775 C C    . GLU A 1 60 ? 4.890   2.456   8.840   1.00 0.00 ? 64 GLU A C    6  
ATOM 11776 O O    . GLU A 1 60 ? 4.484   3.615   8.911   1.00 0.00 ? 64 GLU A O    6  
ATOM 11777 C CB   . GLU A 1 60 ? 3.560   0.744   10.129  1.00 0.00 ? 64 GLU A CB   6  
ATOM 11778 C CG   . GLU A 1 60 ? 2.415   -0.268  10.052  1.00 0.00 ? 64 GLU A CG   6  
ATOM 11779 C CD   . GLU A 1 60 ? 2.428   -1.203  11.263  1.00 0.00 ? 64 GLU A CD   6  
ATOM 11780 O OE1  . GLU A 1 60 ? 3.202   -0.909  12.199  1.00 0.00 ? 64 GLU A OE1  6  
ATOM 11781 O OE2  . GLU A 1 60 ? 1.662   -2.190  11.226  1.00 0.00 ? 64 GLU A OE2  6  
ATOM 11782 H H    . GLU A 1 60 ? 4.461   -0.666  8.299   1.00 0.00 ? 64 GLU A H    6  
ATOM 11783 H HA   . GLU A 1 60 ? 2.987   1.623   8.253   1.00 0.00 ? 64 GLU A HA   6  
ATOM 11784 H HB2  . GLU A 1 60 ? 4.440   0.271   10.565  1.00 0.00 ? 64 GLU A HB2  6  
ATOM 11785 H HB3  . GLU A 1 60 ? 3.280   1.566   10.789  1.00 0.00 ? 64 GLU A HB3  6  
ATOM 11786 H HG2  . GLU A 1 60 ? 1.462   0.258   10.004  1.00 0.00 ? 64 GLU A HG2  6  
ATOM 11787 H HG3  . GLU A 1 60 ? 2.503   -0.853  9.136   1.00 0.00 ? 64 GLU A HG3  6  
ATOM 11788 N N    . LYS A 1 61 ? 6.168   2.107   8.841   1.00 0.00 ? 65 LYS A N    6  
ATOM 11789 C CA   . LYS A 1 61 ? 7.217   3.109   8.929   1.00 0.00 ? 65 LYS A CA   6  
ATOM 11790 C C    . LYS A 1 61 ? 7.287   3.885   7.612   1.00 0.00 ? 65 LYS A C    6  
ATOM 11791 O O    . LYS A 1 61 ? 7.560   5.085   7.608   1.00 0.00 ? 65 LYS A O    6  
ATOM 11792 C CB   . LYS A 1 61 ? 8.543   2.463   9.334   1.00 0.00 ? 65 LYS A CB   6  
ATOM 11793 C CG   . LYS A 1 61 ? 8.658   2.352   10.855  1.00 0.00 ? 65 LYS A CG   6  
ATOM 11794 C CD   . LYS A 1 61 ? 10.040  1.840   11.265  1.00 0.00 ? 65 LYS A CD   6  
ATOM 11795 C CE   . LYS A 1 61 ? 10.849  2.940   11.955  1.00 0.00 ? 65 LYS A CE   6  
ATOM 11796 N NZ   . LYS A 1 61 ? 11.666  3.680   10.968  1.00 0.00 ? 65 LYS A NZ   6  
ATOM 11797 H H    . LYS A 1 61 ? 6.490   1.162   8.783   1.00 0.00 ? 65 LYS A H    6  
ATOM 11798 H HA   . LYS A 1 61 ? 6.941   3.802   9.724   1.00 0.00 ? 65 LYS A HA   6  
ATOM 11799 H HB2  . LYS A 1 61 ? 8.621   1.472   8.886   1.00 0.00 ? 65 LYS A HB2  6  
ATOM 11800 H HB3  . LYS A 1 61 ? 9.373   3.053   8.945   1.00 0.00 ? 65 LYS A HB3  6  
ATOM 11801 H HG2  . LYS A 1 61 ? 8.478   3.326   11.309  1.00 0.00 ? 65 LYS A HG2  6  
ATOM 11802 H HG3  . LYS A 1 61 ? 7.890   1.677   11.233  1.00 0.00 ? 65 LYS A HG3  6  
ATOM 11803 H HD2  . LYS A 1 61 ? 9.932   0.988   11.936  1.00 0.00 ? 65 LYS A HD2  6  
ATOM 11804 H HD3  . LYS A 1 61 ? 10.577  1.487   10.385  1.00 0.00 ? 65 LYS A HD3  6  
ATOM 11805 H HE2  . LYS A 1 61 ? 10.177  3.628   12.468  1.00 0.00 ? 65 LYS A HE2  6  
ATOM 11806 H HE3  . LYS A 1 61 ? 11.496  2.501   12.715  1.00 0.00 ? 65 LYS A HE3  6  
ATOM 11807 H HZ1  . LYS A 1 61 ? 12.173  3.031   10.400  1.00 0.00 ? 65 LYS A HZ1  6  
ATOM 11808 H HZ2  . LYS A 1 61 ? 11.068  4.233   10.388  1.00 0.00 ? 65 LYS A HZ2  6  
ATOM 11809 H HZ3  . LYS A 1 61 ? 12.310  4.277   11.447  1.00 0.00 ? 65 LYS A HZ3  6  
ATOM 11810 N N    . MET A 1 62 ? 7.036   3.169   6.526   1.00 0.00 ? 66 MET A N    6  
ATOM 11811 C CA   . MET A 1 62 ? 7.068   3.775   5.206   1.00 0.00 ? 66 MET A CA   6  
ATOM 11812 C C    . MET A 1 62 ? 6.103   4.960   5.124   1.00 0.00 ? 66 MET A C    6  
ATOM 11813 O O    . MET A 1 62 ? 6.430   5.991   4.538   1.00 0.00 ? 66 MET A O    6  
ATOM 11814 C CB   . MET A 1 62 ? 6.685   2.731   4.156   1.00 0.00 ? 66 MET A CB   6  
ATOM 11815 C CG   . MET A 1 62 ? 7.808   2.544   3.133   1.00 0.00 ? 66 MET A CG   6  
ATOM 11816 S SD   . MET A 1 62 ? 7.975   4.014   2.134   1.00 0.00 ? 66 MET A SD   6  
ATOM 11817 C CE   . MET A 1 62 ? 6.291   4.198   1.569   1.00 0.00 ? 66 MET A CE   6  
ATOM 11818 H H    . MET A 1 62 ? 6.815   2.194   6.538   1.00 0.00 ? 66 MET A H    6  
ATOM 11819 H HA   . MET A 1 62 ? 8.092   4.121   5.067   1.00 0.00 ? 66 MET A HA   6  
ATOM 11820 H HB2  . MET A 1 62 ? 6.471   1.780   4.644   1.00 0.00 ? 66 MET A HB2  6  
ATOM 11821 H HB3  . MET A 1 62 ? 5.772   3.040   3.646   1.00 0.00 ? 66 MET A HB3  6  
ATOM 11822 H HG2  . MET A 1 62 ? 8.746   2.335   3.646   1.00 0.00 ? 66 MET A HG2  6  
ATOM 11823 H HG3  . MET A 1 62 ? 7.593   1.685   2.498   1.00 0.00 ? 66 MET A HG3  6  
ATOM 11824 H HE1  . MET A 1 62 ? 5.762   3.253   1.693   1.00 0.00 ? 66 MET A HE1  6  
ATOM 11825 H HE2  . MET A 1 62 ? 5.794   4.972   2.154   1.00 0.00 ? 66 MET A HE2  6  
ATOM 11826 H HE3  . MET A 1 62 ? 6.290   4.480   0.516   1.00 0.00 ? 66 MET A HE3  6  
ATOM 11827 N N    . LEU A 1 63 ? 4.935   4.773   5.720   1.00 0.00 ? 67 LEU A N    6  
ATOM 11828 C CA   . LEU A 1 63 ? 3.920   5.814   5.721   1.00 0.00 ? 67 LEU A CA   6  
ATOM 11829 C C    . LEU A 1 63 ? 4.418   7.004   6.544   1.00 0.00 ? 67 LEU A C    6  
ATOM 11830 O O    . LEU A 1 63 ? 3.866   8.099   6.455   1.00 0.00 ? 67 LEU A O    6  
ATOM 11831 C CB   . LEU A 1 63 ? 2.579   5.254   6.199   1.00 0.00 ? 67 LEU A CB   6  
ATOM 11832 C CG   . LEU A 1 63 ? 1.787   4.442