data_1QO0
# 
_entry.id   1QO0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QO0         
PDBE  EBI-4275     
WWPDB D_1290004275 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1PEA unspecified 
'AMIDE RECEPTOR/NEGATIVE REGULATOR OF THE AMIDASE OPERON OF PSEUDOMONAS AERUGINOSA (AMIC) COMPLEXED WITH ACETAMIDE'  
PDB 1QNL unspecified 
'AMIDE RECEPTOR/NEGATIVE REGULATOR OF THE AMIDASE OPERON OF PSEUDOMONAS AERUGINOSA (AMIC) COMPLEXED WITH BUTYRAMIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QO0 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pearl, L.H.'  1 
;O'Hara, B.P.
;
2 
'Roe, S.M.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex' 
'Embo J.'   18  5175 ? 1999 EMJODG UK 0261-4189 0897 ? 10508151 10.1093/EMBOJ/18.19.5175       
1       
'Crystal Structure of Amic: The Controller of Transcription Antitermination in the Amidase Operon of Pseudomonas Aeruginosa'   
'Embo J.'   13  5810 ? 1994 EMJODG UK 0261-4189 0897 ? 7813419  ?                              
2       
'Antitermination of Amidase Expression in Pseudomonas Aeruginosa is Controlled by a Novel Cytoplasmic Amide- Binding Protein'  
'Embo J.'   12  3637 ? 1993 EMJODG UK 0261-4189 0897 ? 8253087  ?                              
3       
'Crystallization and Preliminary X-Ray Data for the Negative Regulator (Amic) of the Amidase Operon of Pseudomonas Aeruginosa' 
J.Mol.Biol. 222 869  ? 1991 JMOBAK UK 0022-2836 0070 ? 1762155  '10.1016/0022-2836(91)90579-U' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 
;O'Hara, B.P.
;
1  ? 
primary 'Norman, R.A.'   2  ? 
primary 'Wan, P.T.C.'    3  ? 
primary 'Roe, S.M.'      4  ? 
primary 'Barrett, T.E.'  5  ? 
primary 'Drew, R.E.'     6  ? 
primary 'Pearl, L.H.'    7  ? 
1       'Pearl, L.H.'    8  ? 
1       
;O'Hara, B.P.
;
9  ? 
1       'Drew, R.E.'     10 ? 
1       'Wilson, S.W.'   11 ? 
2       'Wilson, S.A.'   12 ? 
2       'Wachira, S.J.'  13 ? 
2       'Drew, R.E.'     14 ? 
2       'Jones, D.'      15 ? 
2       'Pearl, L.H.'    16 ? 
3       'Wilson, S.A.'   17 ? 
3       'Chayen, N.E.'   18 ? 
3       'Hemmings, A.M.' 19 ? 
3       'Drew, R.E.'     20 ? 
3       'Pearl, L.H.'    21 ? 
# 
_cell.entry_id           1QO0 
_cell.length_a           308.440 
_cell.length_b           67.150 
_cell.length_c           76.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.33 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QO0 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man AMIC       42960.031 2   ? ? 'AMIDE RECEPTOR'                    'COMPLEXED WITH BUTYRAMIDE MOLECULE' 
2 polymer     man AMIR       21903.287 2   ? ? 'AMIDE RECEPTOR/NEGATIVE REGULATOR' ?                                    
3 non-polymer syn BUTYRAMIDE 87.120    2   ? ? ?                                   ?                                    
4 water       nat water      18.015    851 ? ? ?                                   ?                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSHQERPLIGLLFSETGVTADIERSQRYGALLAVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLV
GCYMSHTRKAVMPVVERADALLCYPTPYEGFEYSPNIVYGGPAPNQNSAPLAAYLIRHYGERVVFIGSDYIYPRESNHVM
RHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAEVA
KMESDVAEGQVVVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYDIDI
DAPQGPVRVERQNNHSRLSSRIAEIDARGVFQVRWQSPEPIRPDPYVVVHNLDDWSASMGGGPLP
;
;MGSHQERPLIGLLFSETGVTADIERSQRYGALLAVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLV
GCYMSHTRKAVMPVVERADALLCYPTPYEGFEYSPNIVYGGPAPNQNSAPLAAYLIRHYGERVVFIGSDYIYPRESNHVM
RHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAEVA
KMESDVAEGQVVVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYDIDI
DAPQGPVRVERQNNHSRLSSRIAEIDARGVFQVRWQSPEPIRPDPYVVVHNLDDWSASMGGGPLP
;
A,B ? 
2 'polypeptide(L)' no no 
;MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNRHHDEIAALLAAGTPRT
TLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRH
GWDEREAHQHLSREAMKRREPILKIAQELLGNEPSA
;
;MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNRHHDEIAALLAAGTPRT
TLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRH
GWDEREAHQHLSREAMKRREPILKIAQELLGNEPSA
;
D,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   HIS n 
1 5   GLN n 
1 6   GLU n 
1 7   ARG n 
1 8   PRO n 
1 9   LEU n 
1 10  ILE n 
1 11  GLY n 
1 12  LEU n 
1 13  LEU n 
1 14  PHE n 
1 15  SER n 
1 16  GLU n 
1 17  THR n 
1 18  GLY n 
1 19  VAL n 
1 20  THR n 
1 21  ALA n 
1 22  ASP n 
1 23  ILE n 
1 24  GLU n 
1 25  ARG n 
1 26  SER n 
1 27  GLN n 
1 28  ARG n 
1 29  TYR n 
1 30  GLY n 
1 31  ALA n 
1 32  LEU n 
1 33  LEU n 
1 34  ALA n 
1 35  VAL n 
1 36  GLU n 
1 37  GLN n 
1 38  LEU n 
1 39  ASN n 
1 40  ARG n 
1 41  GLU n 
1 42  GLY n 
1 43  GLY n 
1 44  VAL n 
1 45  GLY n 
1 46  GLY n 
1 47  ARG n 
1 48  PRO n 
1 49  ILE n 
1 50  GLU n 
1 51  THR n 
1 52  LEU n 
1 53  SER n 
1 54  GLN n 
1 55  ASP n 
1 56  PRO n 
1 57  GLY n 
1 58  GLY n 
1 59  ASP n 
1 60  PRO n 
1 61  ASP n 
1 62  ARG n 
1 63  TYR n 
1 64  ARG n 
1 65  LEU n 
1 66  CYS n 
1 67  ALA n 
1 68  GLU n 
1 69  ASP n 
1 70  PHE n 
1 71  ILE n 
1 72  ARG n 
1 73  ASN n 
1 74  ARG n 
1 75  GLY n 
1 76  VAL n 
1 77  ARG n 
1 78  PHE n 
1 79  LEU n 
1 80  VAL n 
1 81  GLY n 
1 82  CYS n 
1 83  TYR n 
1 84  MET n 
1 85  SER n 
1 86  HIS n 
1 87  THR n 
1 88  ARG n 
1 89  LYS n 
1 90  ALA n 
1 91  VAL n 
1 92  MET n 
1 93  PRO n 
1 94  VAL n 
1 95  VAL n 
1 96  GLU n 
1 97  ARG n 
1 98  ALA n 
1 99  ASP n 
1 100 ALA n 
1 101 LEU n 
1 102 LEU n 
1 103 CYS n 
1 104 TYR n 
1 105 PRO n 
1 106 THR n 
1 107 PRO n 
1 108 TYR n 
1 109 GLU n 
1 110 GLY n 
1 111 PHE n 
1 112 GLU n 
1 113 TYR n 
1 114 SER n 
1 115 PRO n 
1 116 ASN n 
1 117 ILE n 
1 118 VAL n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 PRO n 
1 123 ALA n 
1 124 PRO n 
1 125 ASN n 
1 126 GLN n 
1 127 ASN n 
1 128 SER n 
1 129 ALA n 
1 130 PRO n 
1 131 LEU n 
1 132 ALA n 
1 133 ALA n 
1 134 TYR n 
1 135 LEU n 
1 136 ILE n 
1 137 ARG n 
1 138 HIS n 
1 139 TYR n 
1 140 GLY n 
1 141 GLU n 
1 142 ARG n 
1 143 VAL n 
1 144 VAL n 
1 145 PHE n 
1 146 ILE n 
1 147 GLY n 
1 148 SER n 
1 149 ASP n 
1 150 TYR n 
1 151 ILE n 
1 152 TYR n 
1 153 PRO n 
1 154 ARG n 
1 155 GLU n 
1 156 SER n 
1 157 ASN n 
1 158 HIS n 
1 159 VAL n 
1 160 MET n 
1 161 ARG n 
1 162 HIS n 
1 163 LEU n 
1 164 TYR n 
1 165 ARG n 
1 166 GLN n 
1 167 HIS n 
1 168 GLY n 
1 169 GLY n 
1 170 THR n 
1 171 VAL n 
1 172 LEU n 
1 173 GLU n 
1 174 GLU n 
1 175 ILE n 
1 176 TYR n 
1 177 ILE n 
1 178 PRO n 
1 179 LEU n 
1 180 TYR n 
1 181 PRO n 
1 182 SER n 
1 183 ASP n 
1 184 ASP n 
1 185 ASP n 
1 186 LEU n 
1 187 GLN n 
1 188 ARG n 
1 189 ALA n 
1 190 VAL n 
1 191 GLU n 
1 192 ARG n 
1 193 ILE n 
1 194 TYR n 
1 195 GLN n 
1 196 ALA n 
1 197 ARG n 
1 198 ALA n 
1 199 ASP n 
1 200 VAL n 
1 201 VAL n 
1 202 PHE n 
1 203 SER n 
1 204 THR n 
1 205 VAL n 
1 206 VAL n 
1 207 GLY n 
1 208 THR n 
1 209 GLY n 
1 210 THR n 
1 211 ALA n 
1 212 GLU n 
1 213 LEU n 
1 214 TYR n 
1 215 ARG n 
1 216 ALA n 
1 217 ILE n 
1 218 ALA n 
1 219 ARG n 
1 220 ARG n 
1 221 TYR n 
1 222 GLY n 
1 223 ASP n 
1 224 GLY n 
1 225 ARG n 
1 226 ARG n 
1 227 PRO n 
1 228 PRO n 
1 229 ILE n 
1 230 ALA n 
1 231 SER n 
1 232 LEU n 
1 233 THR n 
1 234 THR n 
1 235 SER n 
1 236 GLU n 
1 237 ALA n 
1 238 GLU n 
1 239 VAL n 
1 240 ALA n 
1 241 LYS n 
1 242 MET n 
1 243 GLU n 
1 244 SER n 
1 245 ASP n 
1 246 VAL n 
1 247 ALA n 
1 248 GLU n 
1 249 GLY n 
1 250 GLN n 
1 251 VAL n 
1 252 VAL n 
1 253 VAL n 
1 254 ALA n 
1 255 PRO n 
1 256 TYR n 
1 257 PHE n 
1 258 SER n 
1 259 SER n 
1 260 ILE n 
1 261 ASP n 
1 262 THR n 
1 263 PRO n 
1 264 ALA n 
1 265 SER n 
1 266 ARG n 
1 267 ALA n 
1 268 PHE n 
1 269 VAL n 
1 270 GLN n 
1 271 ALA n 
1 272 CYS n 
1 273 HIS n 
1 274 GLY n 
1 275 PHE n 
1 276 PHE n 
1 277 PRO n 
1 278 GLU n 
1 279 ASN n 
1 280 ALA n 
1 281 THR n 
1 282 ILE n 
1 283 THR n 
1 284 ALA n 
1 285 TRP n 
1 286 ALA n 
1 287 GLU n 
1 288 ALA n 
1 289 ALA n 
1 290 TYR n 
1 291 TRP n 
1 292 GLN n 
1 293 THR n 
1 294 LEU n 
1 295 LEU n 
1 296 LEU n 
1 297 GLY n 
1 298 ARG n 
1 299 ALA n 
1 300 ALA n 
1 301 GLN n 
1 302 ALA n 
1 303 ALA n 
1 304 GLY n 
1 305 ASN n 
1 306 TRP n 
1 307 ARG n 
1 308 VAL n 
1 309 GLU n 
1 310 ASP n 
1 311 VAL n 
1 312 GLN n 
1 313 ARG n 
1 314 HIS n 
1 315 LEU n 
1 316 TYR n 
1 317 ASP n 
1 318 ILE n 
1 319 ASP n 
1 320 ILE n 
1 321 ASP n 
1 322 ALA n 
1 323 PRO n 
1 324 GLN n 
1 325 GLY n 
1 326 PRO n 
1 327 VAL n 
1 328 ARG n 
1 329 VAL n 
1 330 GLU n 
1 331 ARG n 
1 332 GLN n 
1 333 ASN n 
1 334 ASN n 
1 335 HIS n 
1 336 SER n 
1 337 ARG n 
1 338 LEU n 
1 339 SER n 
1 340 SER n 
1 341 ARG n 
1 342 ILE n 
1 343 ALA n 
1 344 GLU n 
1 345 ILE n 
1 346 ASP n 
1 347 ALA n 
1 348 ARG n 
1 349 GLY n 
1 350 VAL n 
1 351 PHE n 
1 352 GLN n 
1 353 VAL n 
1 354 ARG n 
1 355 TRP n 
1 356 GLN n 
1 357 SER n 
1 358 PRO n 
1 359 GLU n 
1 360 PRO n 
1 361 ILE n 
1 362 ARG n 
1 363 PRO n 
1 364 ASP n 
1 365 PRO n 
1 366 TYR n 
1 367 VAL n 
1 368 VAL n 
1 369 VAL n 
1 370 HIS n 
1 371 ASN n 
1 372 LEU n 
1 373 ASP n 
1 374 ASP n 
1 375 TRP n 
1 376 SER n 
1 377 ALA n 
1 378 SER n 
1 379 MET n 
1 380 GLY n 
1 381 GLY n 
1 382 GLY n 
1 383 PRO n 
1 384 LEU n 
1 385 PRO n 
2 1   MET n 
2 2   SER n 
2 3   ALA n 
2 4   ASN n 
2 5   SER n 
2 6   LEU n 
2 7   LEU n 
2 8   GLY n 
2 9   SER n 
2 10  LEU n 
2 11  ARG n 
2 12  GLU n 
2 13  LEU n 
2 14  GLN n 
2 15  VAL n 
2 16  LEU n 
2 17  VAL n 
2 18  LEU n 
2 19  ASN n 
2 20  PRO n 
2 21  PRO n 
2 22  GLY n 
2 23  GLU n 
2 24  VAL n 
2 25  SER n 
2 26  ASP n 
2 27  ALA n 
2 28  LEU n 
2 29  VAL n 
2 30  LEU n 
2 31  GLN n 
2 32  LEU n 
2 33  ILE n 
2 34  ARG n 
2 35  ILE n 
2 36  GLY n 
2 37  CYS n 
2 38  SER n 
2 39  VAL n 
2 40  ARG n 
2 41  GLN n 
2 42  CYS n 
2 43  TRP n 
2 44  PRO n 
2 45  PRO n 
2 46  PRO n 
2 47  GLU n 
2 48  ALA n 
2 49  PHE n 
2 50  ASP n 
2 51  VAL n 
2 52  PRO n 
2 53  VAL n 
2 54  ASP n 
2 55  VAL n 
2 56  VAL n 
2 57  PHE n 
2 58  THR n 
2 59  SER n 
2 60  ILE n 
2 61  PHE n 
2 62  GLN n 
2 63  ASN n 
2 64  ARG n 
2 65  HIS n 
2 66  HIS n 
2 67  ASP n 
2 68  GLU n 
2 69  ILE n 
2 70  ALA n 
2 71  ALA n 
2 72  LEU n 
2 73  LEU n 
2 74  ALA n 
2 75  ALA n 
2 76  GLY n 
2 77  THR n 
2 78  PRO n 
2 79  ARG n 
2 80  THR n 
2 81  THR n 
2 82  LEU n 
2 83  VAL n 
2 84  ALA n 
2 85  LEU n 
2 86  VAL n 
2 87  GLU n 
2 88  TYR n 
2 89  GLU n 
2 90  SER n 
2 91  PRO n 
2 92  ALA n 
2 93  VAL n 
2 94  LEU n 
2 95  SER n 
2 96  GLN n 
2 97  ILE n 
2 98  ILE n 
2 99  GLU n 
2 100 LEU n 
2 101 GLU n 
2 102 CYS n 
2 103 HIS n 
2 104 GLY n 
2 105 VAL n 
2 106 ILE n 
2 107 THR n 
2 108 GLN n 
2 109 PRO n 
2 110 LEU n 
2 111 ASP n 
2 112 ALA n 
2 113 HIS n 
2 114 ARG n 
2 115 VAL n 
2 116 LEU n 
2 117 PRO n 
2 118 VAL n 
2 119 LEU n 
2 120 VAL n 
2 121 SER n 
2 122 ALA n 
2 123 ARG n 
2 124 ARG n 
2 125 ILE n 
2 126 SER n 
2 127 GLU n 
2 128 GLU n 
2 129 MET n 
2 130 ALA n 
2 131 LYS n 
2 132 LEU n 
2 133 LYS n 
2 134 GLN n 
2 135 LYS n 
2 136 THR n 
2 137 GLU n 
2 138 GLN n 
2 139 LEU n 
2 140 GLN n 
2 141 ASP n 
2 142 ARG n 
2 143 ILE n 
2 144 ALA n 
2 145 GLY n 
2 146 GLN n 
2 147 ALA n 
2 148 ARG n 
2 149 ILE n 
2 150 ASN n 
2 151 GLN n 
2 152 ALA n 
2 153 LYS n 
2 154 VAL n 
2 155 LEU n 
2 156 LEU n 
2 157 MET n 
2 158 GLN n 
2 159 ARG n 
2 160 HIS n 
2 161 GLY n 
2 162 TRP n 
2 163 ASP n 
2 164 GLU n 
2 165 ARG n 
2 166 GLU n 
2 167 ALA n 
2 168 HIS n 
2 169 GLN n 
2 170 HIS n 
2 171 LEU n 
2 172 SER n 
2 173 ARG n 
2 174 GLU n 
2 175 ALA n 
2 176 MET n 
2 177 LYS n 
2 178 ARG n 
2 179 ARG n 
2 180 GLU n 
2 181 PRO n 
2 182 ILE n 
2 183 LEU n 
2 184 LYS n 
2 185 ILE n 
2 186 ALA n 
2 187 GLN n 
2 188 GLU n 
2 189 LEU n 
2 190 LEU n 
2 191 GLY n 
2 192 ASN n 
2 193 GLU n 
2 194 PRO n 
2 195 SER n 
2 196 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? PAC1 ? ? ? ? 'PSEUDOMONAS AERUGINOSA' 287 ? ? ? ? ? ? ? ? 'PSEUDOMONAS AERUGINOSA' 287 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? ? ? PAC1 ? ? ? ? 'PSEUDOMONAS AERUGINOSA' 287 ? ? ? ? ? ? ? ? 'PSEUDOMONAS AERUGINOSA' 287 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP AMIC_PSEAE 1 ? ? P27017 ? 
2 UNP AMIR_PSEAE 2 ? ? P10932 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QO0 A 7 ? 379 ? P27017 6 ? 378 ? 7 379 
2 1 1QO0 B 7 ? 380 ? P27017 6 ? 379 ? 7 380 
3 2 1QO0 D 2 ? 190 ? P10932 2 ? 190 ? 2 190 
4 2 1QO0 E 2 ? 195 ? P10932 2 ? 195 ? 2 195 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QO0 GLN A 27 ? UNP P27017 HIS 26 conflict 27 1 
1 1QO0 ARG A 28 ? UNP P27017 ALA 27 conflict 28 2 
2 1QO0 GLN B 27 ? UNP P27017 HIS 26 conflict 27 3 
2 1QO0 ARG B 28 ? UNP P27017 ALA 27 conflict 28 4 
3 1QO0 ARG D 64 ? UNP P10932 GLY 64 conflict 64 5 
4 1QO0 ARG E 64 ? UNP P10932 GLY 64 conflict 64 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BMD non-polymer         . BUTYRAMIDE      ? 'C4 H9 N O'      87.120  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QO0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CRYSTALLISATION WAS BY MICRO-BATCH AND STREAK SEEDING. WELLS CONTAINED 8-8.5% PEG4000, 20%(V/V) 2-PROPANOL, 50MM SODIUM CITRATE BUFFERED AT PH 5.6 AND AMIC-AMIR COMPLEX AT 5MG/ML (FINAL CONCENTRATION).
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.488 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX7.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX7.2 
_diffrn_source.pdbx_wavelength             1.488 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QO0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             33.600 
_reflns.d_resolution_high            2.250 
_reflns.number_obs                   67099 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         83.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05200 
_reflns.pdbx_netI_over_sigmaI        6.8000 
_reflns.B_iso_Wilson_estimate        23.6 
_reflns.pdbx_redundancy              2.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.36 
_reflns_shell.percent_possible_all   69.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.17700 
_reflns_shell.meanI_over_sigI_obs    3.000 
_reflns_shell.pdbx_redundancy        1.50 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QO0 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     62185 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    83 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3055 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               9.48 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1PEA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.31 
_refine.pdbx_overall_ESU_R_Free                  0.24 
_refine.overall_SU_ML                            0.16 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.63 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8798 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             851 
_refine_hist.number_atoms_total               9661 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.010 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.034 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.060 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.305 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        2.051 2.500 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         3.000 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        4.298 4.500 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.022 ?     ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.122 0.150 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.185 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.255 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      0.000 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.155 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        6.8   7.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     18.8  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    28.2  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       0.0   15.0  ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QO0 
_struct.title                     
'Amide receptor of the amidase operon of Pseudomonas aeruginosa (AmiC) complexed with the negative regulator AmiR.' 
_struct.pdbx_descriptor           'AMIC, AMIR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QO0 
_struct_keywords.pdbx_keywords   'BINDING PROTEIN' 
_struct_keywords.text            'BINDING PROTEIN, GENE REGULATOR, RECEPTOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 20  ? GLU A 41  ? THR A 20  GLU A 41  1 ? 22 
HELX_P HELX_P2  2  ASP A 59  ? ARG A 74  ? ASP A 59  ARG A 74  1 ? 16 
HELX_P HELX_P3  3  MET A 84  ? ASP A 99  ? MET A 84  ASP A 99  1 ? 16 
HELX_P HELX_P4  4  ALA A 123 ? GLN A 126 ? ALA A 123 GLN A 126 5 ? 4  
HELX_P HELX_P5  5  ASN A 127 ? TYR A 139 ? ASN A 127 TYR A 139 1 ? 13 
HELX_P HELX_P6  6  TYR A 150 ? GLN A 166 ? TYR A 150 GLN A 166 1 ? 17 
HELX_P HELX_P7  7  SER A 182 ? ARG A 197 ? SER A 182 ARG A 197 1 ? 16 
HELX_P HELX_P8  8  GLY A 209 ? GLY A 222 ? GLY A 209 GLY A 222 1 ? 14 
HELX_P HELX_P9  9  SER A 235 ? ALA A 240 ? SER A 235 ALA A 240 1 ? 6  
HELX_P HELX_P10 10 GLU A 243 ? GLU A 248 ? GLU A 243 GLU A 248 1 ? 6  
HELX_P HELX_P11 11 THR A 262 ? PHE A 276 ? THR A 262 PHE A 276 1 ? 15 
HELX_P HELX_P12 12 THR A 283 ? GLY A 304 ? THR A 283 GLY A 304 1 ? 22 
HELX_P HELX_P13 13 ARG A 307 ? TYR A 316 ? ARG A 307 TYR A 316 1 ? 10 
HELX_P HELX_P14 14 ASN A 371 ? MET A 379 ? ASN A 371 MET A 379 5 ? 9  
HELX_P HELX_P15 15 THR B 20  ? GLU B 41  ? THR B 20  GLU B 41  1 ? 22 
HELX_P HELX_P16 16 ASP B 59  ? ARG B 74  ? ASP B 59  ARG B 74  1 ? 16 
HELX_P HELX_P17 17 MET B 84  ? ASP B 99  ? MET B 84  ASP B 99  1 ? 16 
HELX_P HELX_P18 18 ALA B 123 ? GLN B 126 ? ALA B 123 GLN B 126 5 ? 4  
HELX_P HELX_P19 19 ASN B 127 ? TYR B 139 ? ASN B 127 TYR B 139 1 ? 13 
HELX_P HELX_P20 20 TYR B 150 ? HIS B 167 ? TYR B 150 HIS B 167 1 ? 18 
HELX_P HELX_P21 21 SER B 182 ? ARG B 197 ? SER B 182 ARG B 197 1 ? 16 
HELX_P HELX_P22 22 GLY B 209 ? TYR B 221 ? GLY B 209 TYR B 221 1 ? 13 
HELX_P HELX_P23 23 SER B 235 ? ALA B 240 ? SER B 235 ALA B 240 1 ? 6  
HELX_P HELX_P24 24 GLU B 243 ? GLU B 248 ? GLU B 243 GLU B 248 1 ? 6  
HELX_P HELX_P25 25 THR B 262 ? GLY B 274 ? THR B 262 GLY B 274 1 ? 13 
HELX_P HELX_P26 26 THR B 283 ? GLY B 304 ? THR B 283 GLY B 304 1 ? 22 
HELX_P HELX_P27 27 ARG B 307 ? HIS B 314 ? ARG B 307 HIS B 314 1 ? 8  
HELX_P HELX_P28 28 ASN B 371 ? ASP B 374 ? ASN B 371 ASP B 374 5 ? 4  
HELX_P HELX_P29 29 TRP B 375 ? GLY B 380 ? TRP B 375 GLY B 380 1 ? 6  
HELX_P HELX_P30 30 SER C 2   ? SER C 9   ? SER D 2   SER D 9   1 ? 8  
HELX_P HELX_P31 31 LEU C 10  ? GLU C 12  ? LEU D 10  GLU D 12  5 ? 3  
HELX_P HELX_P32 32 GLY C 22  ? GLY C 36  ? GLY D 22  GLY D 36  1 ? 15 
HELX_P HELX_P33 33 ARG C 64  ? GLY C 76  ? ARG D 64  GLY D 76  1 ? 13 
HELX_P HELX_P34 34 SER C 90  ? GLU C 101 ? SER D 90  GLU D 101 1 ? 12 
HELX_P HELX_P35 35 ASP C 111 ? HIS C 113 ? ASP D 111 HIS D 113 5 ? 3  
HELX_P HELX_P36 36 ARG C 114 ? GLY C 161 ? ARG D 114 GLY D 161 1 ? 48 
HELX_P HELX_P37 37 ASP C 163 ? MET C 176 ? ASP D 163 MET D 176 1 ? 14 
HELX_P HELX_P38 38 PRO C 181 ? LEU C 190 ? PRO D 181 LEU D 190 1 ? 10 
HELX_P HELX_P39 39 SER D 2   ? LEU D 10  ? SER E 2   LEU E 10  1 ? 9  
HELX_P HELX_P40 40 GLY D 22  ? GLY D 36  ? GLY E 22  GLY E 36  1 ? 15 
HELX_P HELX_P41 41 ARG D 64  ? GLY D 76  ? ARG E 64  GLY E 76  1 ? 13 
HELX_P HELX_P42 42 SER D 90  ? GLU D 101 ? SER E 90  GLU E 101 1 ? 12 
HELX_P HELX_P43 43 ASP D 111 ? HIS D 113 ? ASP E 111 HIS E 113 5 ? 3  
HELX_P HELX_P44 44 ARG D 114 ? GLY D 161 ? ARG E 114 GLY E 161 1 ? 48 
HELX_P HELX_P45 45 ASP D 163 ? LYS D 177 ? ASP E 163 LYS E 177 1 ? 15 
HELX_P HELX_P46 46 PRO D 181 ? LEU D 190 ? PRO E 181 LEU E 190 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 108 C . ? GLN 108 D PRO 109 C ? PRO 109 D 1 2.07  
2 GLN 108 D . ? GLN 108 E PRO 109 D ? PRO 109 E 1 -1.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 3 ? 
D ? 2 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
H ? 2 ? 
I ? 5 ? 
J ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 50  ? GLN A 54  ? GLU A 50  GLN A 54  
A 2 LEU A 9   ? LEU A 13  ? LEU A 9   LEU A 13  
A 3 PHE A 78  ? GLY A 81  ? PHE A 78  GLY A 81  
A 4 LEU A 101 ? TYR A 104 ? LEU A 101 TYR A 104 
A 5 ILE A 117 ? TYR A 119 ? ILE A 117 TYR A 119 
B 1 PRO A 228 ? SER A 231 ? PRO A 228 SER A 231 
B 2 VAL A 200 ? THR A 204 ? VAL A 200 THR A 204 
B 3 ARG A 142 ? SER A 148 ? ARG A 142 SER A 148 
B 4 THR A 170 ? ILE A 177 ? THR A 170 ILE A 177 
C 1 VAL A 251 ? ALA A 254 ? VAL A 251 ALA A 254 
C 2 ARG A 341 ? ILE A 345 ? ARG A 341 ILE A 345 
C 3 PHE A 351 ? GLN A 356 ? PHE A 351 GLN A 356 
D 1 ILE A 320 ? ALA A 322 ? ILE A 320 ALA A 322 
D 2 GLY A 325 ? VAL A 327 ? GLY A 325 VAL A 327 
E 1 GLU B 50  ? GLN B 54  ? GLU B 50  GLN B 54  
E 2 LEU B 9   ? LEU B 13  ? LEU B 9   LEU B 13  
E 3 PHE B 78  ? GLY B 81  ? PHE B 78  GLY B 81  
E 4 LEU B 101 ? TYR B 104 ? LEU B 101 TYR B 104 
E 5 ILE B 117 ? TYR B 119 ? ILE B 117 TYR B 119 
F 1 PRO B 228 ? SER B 231 ? PRO B 228 SER B 231 
F 2 VAL B 200 ? THR B 204 ? VAL B 200 THR B 204 
F 3 ARG B 142 ? SER B 148 ? ARG B 142 SER B 148 
F 4 THR B 170 ? ILE B 177 ? THR B 170 ILE B 177 
G 1 VAL B 251 ? ALA B 254 ? VAL B 251 ALA B 254 
G 2 ARG B 341 ? ILE B 345 ? ARG B 341 ILE B 345 
G 3 PHE B 351 ? GLN B 356 ? PHE B 351 GLN B 356 
H 1 ILE B 320 ? ALA B 322 ? ILE B 320 ALA B 322 
H 2 GLY B 325 ? VAL B 327 ? GLY B 325 VAL B 327 
I 1 SER C 38  ? CYS C 42  ? SER D 38  CYS D 42  
I 2 GLN C 14  ? LEU C 18  ? GLN D 14  LEU D 18  
I 3 VAL C 55  ? SER C 59  ? VAL D 55  SER D 59  
I 4 THR C 81  ? VAL C 86  ? THR D 81  VAL D 86  
I 5 GLY C 104 ? THR C 107 ? GLY D 104 THR D 107 
J 1 SER D 38  ? CYS D 42  ? SER E 38  CYS E 42  
J 2 GLN D 14  ? LEU D 18  ? GLN E 14  LEU E 18  
J 3 VAL D 55  ? SER D 59  ? VAL E 55  SER E 59  
J 4 THR D 81  ? VAL D 86  ? THR E 81  VAL E 86  
J 5 GLY D 104 ? THR D 107 ? GLY E 104 THR E 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 50  ? O GLU A 50  N ILE A 10  ? N ILE A 10  
A 2 3 O GLY A 11  ? O GLY A 11  N PHE A 78  ? N PHE A 78  
A 3 4 O LEU A 79  ? O LEU A 79  N LEU A 101 ? N LEU A 101 
A 4 5 O LEU A 102 ? O LEU A 102 N VAL A 118 ? N VAL A 118 
B 1 2 O PRO A 228 ? O PRO A 228 N VAL A 201 ? N VAL A 201 
B 2 3 O VAL A 200 ? O VAL A 200 N VAL A 144 ? N VAL A 144 
B 3 4 O VAL A 143 ? O VAL A 143 N THR A 170 ? N THR A 170 
C 1 2 O VAL A 252 ? O VAL A 252 N ALA A 343 ? N ALA A 343 
C 2 3 O ILE A 342 ? O ILE A 342 N TRP A 355 ? N TRP A 355 
D 1 2 O ILE A 320 ? O ILE A 320 N VAL A 327 ? N VAL A 327 
E 1 2 O GLU B 50  ? O GLU B 50  N ILE B 10  ? N ILE B 10  
E 2 3 O GLY B 11  ? O GLY B 11  N PHE B 78  ? N PHE B 78  
E 3 4 O LEU B 79  ? O LEU B 79  N LEU B 101 ? N LEU B 101 
E 4 5 O LEU B 102 ? O LEU B 102 N VAL B 118 ? N VAL B 118 
F 1 2 O PRO B 228 ? O PRO B 228 N VAL B 201 ? N VAL B 201 
F 2 3 O VAL B 200 ? O VAL B 200 N VAL B 144 ? N VAL B 144 
F 3 4 O VAL B 143 ? O VAL B 143 N THR B 170 ? N THR B 170 
G 1 2 O VAL B 252 ? O VAL B 252 N ALA B 343 ? N ALA B 343 
G 2 3 O ILE B 342 ? O ILE B 342 N TRP B 355 ? N TRP B 355 
H 1 2 O ILE B 320 ? O ILE B 320 N VAL B 327 ? N VAL B 327 
I 1 2 O SER C 38  ? O SER D 38  N VAL C 15  ? N VAL D 15  
I 2 3 O LEU C 16  ? O LEU D 16  N VAL C 55  ? N VAL D 55  
I 3 4 O VAL C 56  ? O VAL D 56  N THR C 81  ? N THR D 81  
I 4 5 O ALA C 84  ? O ALA D 84  N GLY C 104 ? N GLY D 104 
J 1 2 O SER D 38  ? O SER E 38  N VAL D 15  ? N VAL E 15  
J 2 3 O LEU D 16  ? O LEU E 16  N VAL D 55  ? N VAL E 55  
J 3 4 O VAL D 56  ? O VAL E 56  N THR D 81  ? N THR E 81  
J 4 5 O ALA D 84  ? O ALA E 84  N GLY D 104 ? N GLY E 104 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE BMD A 400' 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE BMD B 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 TYR A 83  ? TYR A 83  . ? 1_555 ? 
2  AC1 8 MET A 84  ? MET A 84  . ? 1_555 ? 
3  AC1 8 SER A 85  ? SER A 85  . ? 1_555 ? 
4  AC1 8 TYR A 104 ? TYR A 104 . ? 1_555 ? 
5  AC1 8 PRO A 107 ? PRO A 107 . ? 1_555 ? 
6  AC1 8 TYR A 108 ? TYR A 108 . ? 1_555 ? 
7  AC1 8 TYR A 150 ? TYR A 150 . ? 1_555 ? 
8  AC1 8 TYR A 152 ? TYR A 152 . ? 1_555 ? 
9  AC2 8 TYR B 83  ? TYR B 83  . ? 1_555 ? 
10 AC2 8 MET B 84  ? MET B 84  . ? 1_555 ? 
11 AC2 8 SER B 85  ? SER B 85  . ? 1_555 ? 
12 AC2 8 TYR B 104 ? TYR B 104 . ? 1_555 ? 
13 AC2 8 PRO B 107 ? PRO B 107 . ? 1_555 ? 
14 AC2 8 TYR B 108 ? TYR B 108 . ? 1_555 ? 
15 AC2 8 TYR B 150 ? TYR B 150 . ? 1_555 ? 
16 AC2 8 TYR B 152 ? TYR B 152 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QO0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QO0 
_atom_sites.fract_transf_matrix[1][1]   0.003242 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000768 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014892 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013450 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 7   ? 74.710  -1.966  -18.659 1.00 43.95  ? 7    ARG A N   1 
ATOM   2    C CA  . ARG A 1 7   ? 75.160  -1.372  -17.346 1.00 42.63  ? 7    ARG A CA  1 
ATOM   3    C C   . ARG A 1 7   ? 76.206  -2.228  -16.726 1.00 42.05  ? 7    ARG A C   1 
ATOM   4    O O   . ARG A 1 7   ? 76.998  -2.163  -17.689 1.00 43.33  ? 7    ARG A O   1 
ATOM   5    C CB  . ARG A 1 7   ? 73.990  -1.176  -16.416 1.00 41.22  ? 7    ARG A CB  1 
ATOM   6    N N   . PRO A 1 8   ? 75.947  -3.299  -16.039 1.00 40.26  ? 8    PRO A N   1 
ATOM   7    C CA  . PRO A 1 8   ? 75.259  -3.411  -14.799 1.00 37.82  ? 8    PRO A CA  1 
ATOM   8    C C   . PRO A 1 8   ? 75.767  -2.328  -13.830 1.00 34.12  ? 8    PRO A C   1 
ATOM   9    O O   . PRO A 1 8   ? 76.914  -2.449  -13.416 1.00 32.70  ? 8    PRO A O   1 
ATOM   10   C CB  . PRO A 1 8   ? 75.395  -4.822  -14.262 1.00 38.48  ? 8    PRO A CB  1 
ATOM   11   C CG  . PRO A 1 8   ? 76.493  -5.403  -15.080 1.00 40.43  ? 8    PRO A CG  1 
ATOM   12   C CD  . PRO A 1 8   ? 77.115  -4.207  -15.755 1.00 39.94  ? 8    PRO A CD  1 
ATOM   13   N N   . LEU A 1 9   ? 74.988  -1.283  -13.614 1.00 30.69  ? 9    LEU A N   1 
ATOM   14   C CA  . LEU A 1 9   ? 75.324  -0.156  -12.769 1.00 27.09  ? 9    LEU A CA  1 
ATOM   15   C C   . LEU A 1 9   ? 74.243  0.022   -11.701 1.00 25.26  ? 9    LEU A C   1 
ATOM   16   O O   . LEU A 1 9   ? 73.083  0.247   -12.051 1.00 25.03  ? 9    LEU A O   1 
ATOM   17   C CB  . LEU A 1 9   ? 75.460  1.152   -13.557 1.00 24.51  ? 9    LEU A CB  1 
ATOM   18   C CG  . LEU A 1 9   ? 75.933  2.407   -12.828 1.00 25.21  ? 9    LEU A CG  1 
ATOM   19   C CD1 . LEU A 1 9   ? 77.213  2.222   -12.016 1.00 19.39  ? 9    LEU A CD1 1 
ATOM   20   C CD2 . LEU A 1 9   ? 76.170  3.528   -13.833 1.00 25.90  ? 9    LEU A CD2 1 
ATOM   21   N N   . ILE A 1 10  ? 74.608  -0.111  -10.428 1.00 22.91  ? 10   ILE A N   1 
ATOM   22   C CA  . ILE A 1 10  ? 73.608  0.021   -9.365  1.00 19.86  ? 10   ILE A CA  1 
ATOM   23   C C   . ILE A 1 10  ? 73.802  1.403   -8.747  1.00 18.63  ? 10   ILE A C   1 
ATOM   24   O O   . ILE A 1 10  ? 74.915  1.767   -8.401  1.00 18.14  ? 10   ILE A O   1 
ATOM   25   C CB  . ILE A 1 10  ? 73.686  -1.090  -8.327  1.00 18.00  ? 10   ILE A CB  1 
ATOM   26   C CG1 . ILE A 1 10  ? 73.437  -2.499  -8.909  1.00 18.24  ? 10   ILE A CG1 1 
ATOM   27   C CG2 . ILE A 1 10  ? 72.750  -0.898  -7.132  1.00 19.39  ? 10   ILE A CG2 1 
ATOM   28   C CD1 . ILE A 1 10  ? 73.713  -3.572  -7.847  1.00 21.51  ? 10   ILE A CD1 1 
ATOM   29   N N   . GLY A 1 11  ? 72.723  2.166   -8.612  1.00 17.28  ? 11   GLY A N   1 
ATOM   30   C CA  . GLY A 1 11  ? 72.847  3.465   -7.960  1.00 15.10  ? 11   GLY A CA  1 
ATOM   31   C C   . GLY A 1 11  ? 72.549  3.317   -6.476  1.00 13.92  ? 11   GLY A C   1 
ATOM   32   O O   . GLY A 1 11  ? 71.516  2.753   -6.100  1.00 15.31  ? 11   GLY A O   1 
ATOM   33   N N   . LEU A 1 12  ? 73.435  3.782   -5.635  1.00 11.43  ? 12   LEU A N   1 
ATOM   34   C CA  . LEU A 1 12  ? 73.349  3.766   -4.201  1.00 12.26  ? 12   LEU A CA  1 
ATOM   35   C C   . LEU A 1 12  ? 72.935  5.169   -3.735  1.00 13.74  ? 12   LEU A C   1 
ATOM   36   O O   . LEU A 1 12  ? 73.592  6.199   -3.899  1.00 13.21  ? 12   LEU A O   1 
ATOM   37   C CB  . LEU A 1 12  ? 74.687  3.336   -3.569  1.00 10.78  ? 12   LEU A CB  1 
ATOM   38   C CG  . LEU A 1 12  ? 75.249  1.981   -4.035  1.00 14.55  ? 12   LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 12  ? 76.488  1.558   -3.238  1.00 11.74  ? 12   LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 12  ? 74.189  0.880   -3.949  1.00 13.24  ? 12   LEU A CD2 1 
ATOM   41   N N   . LEU A 1 13  ? 71.728  5.233   -3.184  1.00 14.37  ? 13   LEU A N   1 
ATOM   42   C CA  . LEU A 1 13  ? 71.142  6.508   -2.763  1.00 13.35  ? 13   LEU A CA  1 
ATOM   43   C C   . LEU A 1 13  ? 71.057  6.554   -1.246  1.00 12.05  ? 13   LEU A C   1 
ATOM   44   O O   . LEU A 1 13  ? 69.992  6.439   -0.652  1.00 11.82  ? 13   LEU A O   1 
ATOM   45   C CB  . LEU A 1 13  ? 69.811  6.660   -3.504  1.00 13.09  ? 13   LEU A CB  1 
ATOM   46   C CG  . LEU A 1 13  ? 69.384  8.021   -4.035  1.00 19.19  ? 13   LEU A CG  1 
ATOM   47   C CD1 . LEU A 1 13  ? 67.869  8.212   -4.074  1.00 14.96  ? 13   LEU A CD1 1 
ATOM   48   C CD2 . LEU A 1 13  ? 70.034  9.212   -3.333  1.00 13.67  ? 13   LEU A CD2 1 
ATOM   49   N N   . PHE A 1 14  ? 72.202  6.723   -0.597  1.00 12.10  ? 14   PHE A N   1 
ATOM   50   C CA  . PHE A 1 14  ? 72.298  6.687   0.861   1.00 13.18  ? 14   PHE A CA  1 
ATOM   51   C C   . PHE A 1 14  ? 73.046  7.899   1.405   1.00 14.72  ? 14   PHE A C   1 
ATOM   52   O O   . PHE A 1 14  ? 74.081  8.214   0.819   1.00 16.22  ? 14   PHE A O   1 
ATOM   53   C CB  . PHE A 1 14  ? 73.021  5.417   1.315   1.00 12.17  ? 14   PHE A CB  1 
ATOM   54   C CG  . PHE A 1 14  ? 72.181  4.162   1.254   1.00 14.18  ? 14   PHE A CG  1 
ATOM   55   C CD1 . PHE A 1 14  ? 70.998  4.063   1.986   1.00 14.26  ? 14   PHE A CD1 1 
ATOM   56   C CD2 . PHE A 1 14  ? 72.563  3.102   0.457   1.00 10.39  ? 14   PHE A CD2 1 
ATOM   57   C CE1 . PHE A 1 14  ? 70.227  2.904   1.918   1.00 13.50  ? 14   PHE A CE1 1 
ATOM   58   C CE2 . PHE A 1 14  ? 71.802  1.952   0.398   1.00 12.94  ? 14   PHE A CE2 1 
ATOM   59   C CZ  . PHE A 1 14  ? 70.614  1.847   1.117   1.00 11.21  ? 14   PHE A CZ  1 
ATOM   60   N N   . SER A 1 15  ? 72.548  8.609   2.393   1.00 13.58  ? 15   SER A N   1 
ATOM   61   C CA  . SER A 1 15  ? 73.264  9.765   2.895   1.00 14.44  ? 15   SER A CA  1 
ATOM   62   C C   . SER A 1 15  ? 74.622  9.404   3.517   1.00 16.04  ? 15   SER A C   1 
ATOM   63   O O   . SER A 1 15  ? 74.671  8.377   4.191   1.00 14.47  ? 15   SER A O   1 
ATOM   64   C CB  . SER A 1 15  ? 72.487  10.464  4.010   1.00 10.73  ? 15   SER A CB  1 
ATOM   65   O OG  . SER A 1 15  ? 71.250  10.851  3.434   1.00 15.74  ? 15   SER A OG  1 
ATOM   66   N N   . GLU A 1 16  ? 75.596  10.285  3.261   1.00 15.65  ? 16   GLU A N   1 
ATOM   67   C CA  . GLU A 1 16  ? 76.908  10.148  3.883   1.00 15.91  ? 16   GLU A CA  1 
ATOM   68   C C   . GLU A 1 16  ? 77.018  11.188  5.000   1.00 15.12  ? 16   GLU A C   1 
ATOM   69   O O   . GLU A 1 16  ? 77.932  11.177  5.793   1.00 12.00  ? 16   GLU A O   1 
ATOM   70   C CB  . GLU A 1 16  ? 78.017  10.470  2.885   1.00 24.50  ? 16   GLU A CB  1 
ATOM   71   C CG  . GLU A 1 16  ? 79.171  9.495   2.789   1.00 35.90  ? 16   GLU A CG  1 
ATOM   72   C CD  . GLU A 1 16  ? 79.973  9.296   4.066   1.00 39.84  ? 16   GLU A CD  1 
ATOM   73   O OE1 . GLU A 1 16  ? 80.313  10.326  4.685   1.00 40.91  ? 16   GLU A OE1 1 
ATOM   74   O OE2 . GLU A 1 16  ? 80.270  8.141   4.456   1.00 42.64  ? 16   GLU A OE2 1 
ATOM   75   N N   . THR A 1 17  ? 76.180  12.219  4.927   1.00 14.65  ? 17   THR A N   1 
ATOM   76   C CA  . THR A 1 17  ? 76.086  13.331  5.825   1.00 15.04  ? 17   THR A CA  1 
ATOM   77   C C   . THR A 1 17  ? 74.623  13.536  6.216   1.00 14.60  ? 17   THR A C   1 
ATOM   78   O O   . THR A 1 17  ? 73.769  12.896  5.601   1.00 16.53  ? 17   THR A O   1 
ATOM   79   C CB  . THR A 1 17  ? 76.494  14.728  5.239   1.00 14.12  ? 17   THR A CB  1 
ATOM   80   O OG1 . THR A 1 17  ? 75.741  14.912  4.031   1.00 16.69  ? 17   THR A OG1 1 
ATOM   81   C CG2 . THR A 1 17  ? 77.982  14.836  4.915   1.00 9.08   ? 17   THR A CG2 1 
ATOM   82   N N   . GLY A 1 18  ? 74.351  14.362  7.203   1.00 14.84  ? 18   GLY A N   1 
ATOM   83   C CA  . GLY A 1 18  ? 72.987  14.613  7.628   1.00 13.96  ? 18   GLY A CA  1 
ATOM   84   C C   . GLY A 1 18  ? 72.623  13.761  8.829   1.00 14.41  ? 18   GLY A C   1 
ATOM   85   O O   . GLY A 1 18  ? 73.454  13.045  9.383   1.00 15.70  ? 18   GLY A O   1 
ATOM   86   N N   . VAL A 1 19  ? 71.346  13.826  9.245   1.00 13.45  ? 19   VAL A N   1 
ATOM   87   C CA  . VAL A 1 19  ? 70.936  13.249  10.510  1.00 9.19   ? 19   VAL A CA  1 
ATOM   88   C C   . VAL A 1 19  ? 71.003  11.756  10.586  1.00 10.32  ? 19   VAL A C   1 
ATOM   89   O O   . VAL A 1 19  ? 71.305  11.259  11.698  1.00 8.73   ? 19   VAL A O   1 
ATOM   90   C CB  . VAL A 1 19  ? 69.564  13.882  10.843  1.00 11.01  ? 19   VAL A CB  1 
ATOM   91   C CG1 . VAL A 1 19  ? 68.542  13.429  9.812   1.00 2.96   ? 19   VAL A CG1 1 
ATOM   92   C CG2 . VAL A 1 19  ? 69.083  13.585  12.243  1.00 9.14   ? 19   VAL A CG2 1 
ATOM   93   N N   . THR A 1 20  ? 70.812  11.022  9.504   1.00 9.11   ? 20   THR A N   1 
ATOM   94   C CA  . THR A 1 20  ? 70.896  9.561   9.557   1.00 12.83  ? 20   THR A CA  1 
ATOM   95   C C   . THR A 1 20  ? 72.106  9.026   8.790   1.00 12.74  ? 20   THR A C   1 
ATOM   96   O O   . THR A 1 20  ? 72.114  7.919   8.245   1.00 11.87  ? 20   THR A O   1 
ATOM   97   C CB  . THR A 1 20  ? 69.615  8.936   8.938   1.00 14.23  ? 20   THR A CB  1 
ATOM   98   O OG1 . THR A 1 20  ? 69.416  9.561   7.653   1.00 11.46  ? 20   THR A OG1 1 
ATOM   99   C CG2 . THR A 1 20  ? 68.345  9.201   9.728   1.00 15.02  ? 20   THR A CG2 1 
ATOM   100  N N   . ALA A 1 21  ? 73.174  9.811   8.705   1.00 13.67  ? 21   ALA A N   1 
ATOM   101  C CA  . ALA A 1 21  ? 74.391  9.410   8.031   1.00 15.73  ? 21   ALA A CA  1 
ATOM   102  C C   . ALA A 1 21  ? 74.999  8.135   8.638   1.00 15.46  ? 21   ALA A C   1 
ATOM   103  O O   . ALA A 1 21  ? 75.518  7.363   7.842   1.00 17.48  ? 21   ALA A O   1 
ATOM   104  C CB  . ALA A 1 21  ? 75.466  10.506  8.163   1.00 14.97  ? 21   ALA A CB  1 
ATOM   105  N N   . ASP A 1 22  ? 75.001  7.966   9.951   1.00 13.45  ? 22   ASP A N   1 
ATOM   106  C CA  . ASP A 1 22  ? 75.604  6.777   10.530  1.00 16.52  ? 22   ASP A CA  1 
ATOM   107  C C   . ASP A 1 22  ? 74.901  5.492   10.084  1.00 16.01  ? 22   ASP A C   1 
ATOM   108  O O   . ASP A 1 22  ? 75.625  4.585   9.731   1.00 15.84  ? 22   ASP A O   1 
ATOM   109  C CB  . ASP A 1 22  ? 75.609  6.783   12.062  1.00 18.10  ? 22   ASP A CB  1 
ATOM   110  C CG  . ASP A 1 22  ? 76.424  7.935   12.611  1.00 19.93  ? 22   ASP A CG  1 
ATOM   111  O OD1 . ASP A 1 22  ? 77.541  8.156   12.107  1.00 21.27  ? 22   ASP A OD1 1 
ATOM   112  O OD2 . ASP A 1 22  ? 75.912  8.584   13.535  1.00 23.00  ? 22   ASP A OD2 1 
ATOM   113  N N   . ILE A 1 23  ? 73.568  5.462   10.088  1.00 15.94  ? 23   ILE A N   1 
ATOM   114  C CA  . ILE A 1 23  ? 72.894  4.246   9.627   1.00 14.85  ? 23   ILE A CA  1 
ATOM   115  C C   . ILE A 1 23  ? 72.986  4.168   8.111   1.00 12.13  ? 23   ILE A C   1 
ATOM   116  O O   . ILE A 1 23  ? 73.329  3.075   7.601   1.00 12.07  ? 23   ILE A O   1 
ATOM   117  C CB  . ILE A 1 23  ? 71.440  4.195   10.140  1.00 18.02  ? 23   ILE A CB  1 
ATOM   118  C CG1 . ILE A 1 23  ? 71.411  3.745   11.608  1.00 17.67  ? 23   ILE A CG1 1 
ATOM   119  C CG2 . ILE A 1 23  ? 70.521  3.302   9.317   1.00 16.52  ? 23   ILE A CG2 1 
ATOM   120  C CD1 . ILE A 1 23  ? 70.010  3.942   12.226  1.00 17.55  ? 23   ILE A CD1 1 
ATOM   121  N N   . GLU A 1 24  ? 72.771  5.261   7.387   1.00 10.64  ? 24   GLU A N   1 
ATOM   122  C CA  . GLU A 1 24  ? 72.866  5.149   5.912   1.00 11.74  ? 24   GLU A CA  1 
ATOM   123  C C   . GLU A 1 24  ? 74.261  4.832   5.409   1.00 13.18  ? 24   GLU A C   1 
ATOM   124  O O   . GLU A 1 24  ? 74.381  4.157   4.390   1.00 13.40  ? 24   GLU A O   1 
ATOM   125  C CB  . GLU A 1 24  ? 72.287  6.381   5.214   1.00 13.48  ? 24   GLU A CB  1 
ATOM   126  C CG  . GLU A 1 24  ? 70.779  6.538   5.488   1.00 11.86  ? 24   GLU A CG  1 
ATOM   127  C CD  . GLU A 1 24  ? 70.274  7.762   4.749   1.00 13.93  ? 24   GLU A CD  1 
ATOM   128  O OE1 . GLU A 1 24  ? 69.939  7.590   3.567   1.00 12.13  ? 24   GLU A OE1 1 
ATOM   129  O OE2 . GLU A 1 24  ? 70.253  8.901   5.268   1.00 14.73  ? 24   GLU A OE2 1 
ATOM   130  N N   . ARG A 1 25  ? 75.328  5.258   6.098   1.00 14.07  ? 25   ARG A N   1 
ATOM   131  C CA  . ARG A 1 25  ? 76.684  4.918   5.665   1.00 16.39  ? 25   ARG A CA  1 
ATOM   132  C C   . ARG A 1 25  ? 76.831  3.395   5.777   1.00 15.63  ? 25   ARG A C   1 
ATOM   133  O O   . ARG A 1 25  ? 77.354  2.729   4.897   1.00 15.84  ? 25   ARG A O   1 
ATOM   134  C CB  . ARG A 1 25  ? 77.755  5.631   6.514   1.00 17.53  ? 25   ARG A CB  1 
ATOM   135  C CG  . ARG A 1 25  ? 79.190  5.214   6.316   1.00 23.52  ? 25   ARG A CG  1 
ATOM   136  C CD  . ARG A 1 25  ? 80.245  6.027   7.106   1.00 26.83  ? 25   ARG A CD  1 
ATOM   137  N NE  . ARG A 1 25  ? 79.862  7.434   7.039   1.00 26.83  ? 25   ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 25  ? 79.417  8.137   8.067   1.00 29.66  ? 25   ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 25  ? 79.361  7.658   9.308   1.00 28.47  ? 25   ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 25  ? 79.067  9.406   7.828   1.00 30.44  ? 25   ARG A NH2 1 
ATOM   141  N N   . SER A 1 26  ? 76.323  2.811   6.863   1.00 14.23  ? 26   SER A N   1 
ATOM   142  C CA  . SER A 1 26  ? 76.428  1.368   7.004   1.00 14.72  ? 26   SER A CA  1 
ATOM   143  C C   . SER A 1 26  ? 75.507  0.660   6.023   1.00 13.78  ? 26   SER A C   1 
ATOM   144  O O   . SER A 1 26  ? 75.978  -0.340  5.451   1.00 14.66  ? 26   SER A O   1 
ATOM   145  C CB  . SER A 1 26  ? 76.181  0.954   8.447   1.00 18.12  ? 26   SER A CB  1 
ATOM   146  O OG  . SER A 1 26  ? 74.841  0.662   8.685   1.00 25.59  ? 26   SER A OG  1 
ATOM   147  N N   . GLN A 1 27  ? 74.350  1.216   5.662   1.00 11.88  ? 27   GLN A N   1 
ATOM   148  C CA  . GLN A 1 27  ? 73.572  0.585   4.605   1.00 11.57  ? 27   GLN A CA  1 
ATOM   149  C C   . GLN A 1 27  ? 74.411  0.591   3.335   1.00 11.76  ? 27   GLN A C   1 
ATOM   150  O O   . GLN A 1 27  ? 74.440  -0.398  2.627   1.00 11.58  ? 27   GLN A O   1 
ATOM   151  C CB  . GLN A 1 27  ? 72.245  1.308   4.277   1.00 9.68   ? 27   GLN A CB  1 
ATOM   152  C CG  . GLN A 1 27  ? 71.271  1.297   5.437   1.00 8.61   ? 27   GLN A CG  1 
ATOM   153  C CD  . GLN A 1 27  ? 69.997  2.052   5.186   1.00 10.22  ? 27   GLN A CD  1 
ATOM   154  O OE1 . GLN A 1 27  ? 70.007  3.292   5.184   1.00 11.25  ? 27   GLN A OE1 1 
ATOM   155  N NE2 . GLN A 1 27  ? 68.890  1.330   4.957   1.00 9.61   ? 27   GLN A NE2 1 
ATOM   156  N N   . ARG A 1 28  ? 74.983  1.753   3.015   1.00 11.85  ? 28   ARG A N   1 
ATOM   157  C CA  . ARG A 1 28  ? 75.774  1.890   1.800   1.00 12.71  ? 28   ARG A CA  1 
ATOM   158  C C   . ARG A 1 28  ? 76.901  0.838   1.769   1.00 12.73  ? 28   ARG A C   1 
ATOM   159  O O   . ARG A 1 28  ? 77.088  0.199   0.719   1.00 10.85  ? 28   ARG A O   1 
ATOM   160  C CB  . ARG A 1 28  ? 76.317  3.305   1.625   1.00 9.68   ? 28   ARG A CB  1 
ATOM   161  C CG  . ARG A 1 28  ? 77.396  3.467   0.536   1.00 16.24  ? 28   ARG A CG  1 
ATOM   162  C CD  . ARG A 1 28  ? 77.791  4.944   0.301   1.00 14.75  ? 28   ARG A CD  1 
ATOM   163  N NE  . ARG A 1 28  ? 78.615  5.052   -0.903  1.00 15.75  ? 28   ARG A NE  1 
ATOM   164  C CZ  . ARG A 1 28  ? 79.933  5.221   -0.920  1.00 13.44  ? 28   ARG A CZ  1 
ATOM   165  N NH1 . ARG A 1 28  ? 80.606  5.364   0.183   1.00 12.38  ? 28   ARG A NH1 1 
ATOM   166  N NH2 . ARG A 1 28  ? 80.644  5.246   -2.043  1.00 19.26  ? 28   ARG A NH2 1 
ATOM   167  N N   . TYR A 1 29  ? 77.599  0.638   2.881   1.00 11.28  ? 29   TYR A N   1 
ATOM   168  C CA  . TYR A 1 29  ? 78.660  -0.350  2.905   1.00 12.94  ? 29   TYR A CA  1 
ATOM   169  C C   . TYR A 1 29  ? 78.185  -1.803  2.835   1.00 13.09  ? 29   TYR A C   1 
ATOM   170  O O   . TYR A 1 29  ? 78.873  -2.672  2.265   1.00 10.99  ? 29   TYR A O   1 
ATOM   171  C CB  . TYR A 1 29  ? 79.548  -0.111  4.136   1.00 14.21  ? 29   TYR A CB  1 
ATOM   172  C CG  . TYR A 1 29  ? 80.527  0.967   3.704   1.00 19.47  ? 29   TYR A CG  1 
ATOM   173  C CD1 . TYR A 1 29  ? 81.601  0.594   2.883   1.00 22.80  ? 29   TYR A CD1 1 
ATOM   174  C CD2 . TYR A 1 29  ? 80.376  2.277   4.101   1.00 19.05  ? 29   TYR A CD2 1 
ATOM   175  C CE1 . TYR A 1 29  ? 82.522  1.546   2.467   1.00 26.43  ? 29   TYR A CE1 1 
ATOM   176  C CE2 . TYR A 1 29  ? 81.283  3.210   3.677   1.00 23.57  ? 29   TYR A CE2 1 
ATOM   177  C CZ  . TYR A 1 29  ? 82.335  2.851   2.865   1.00 27.02  ? 29   TYR A CZ  1 
ATOM   178  O OH  . TYR A 1 29  ? 83.219  3.812   2.470   1.00 32.85  ? 29   TYR A OH  1 
ATOM   179  N N   . GLY A 1 30  ? 76.958  -2.046  3.327   1.00 12.23  ? 30   GLY A N   1 
ATOM   180  C CA  . GLY A 1 30  ? 76.399  -3.399  3.235   1.00 12.48  ? 30   GLY A CA  1 
ATOM   181  C C   . GLY A 1 30  ? 76.178  -3.659  1.735   1.00 13.53  ? 30   GLY A C   1 
ATOM   182  O O   . GLY A 1 30  ? 76.421  -4.782  1.276   1.00 13.51  ? 30   GLY A O   1 
ATOM   183  N N   . ALA A 1 31  ? 75.672  -2.662  0.996   1.00 10.62  ? 31   ALA A N   1 
ATOM   184  C CA  . ALA A 1 31  ? 75.443  -2.913  -0.424  1.00 12.20  ? 31   ALA A CA  1 
ATOM   185  C C   . ALA A 1 31  ? 76.780  -3.012  -1.165  1.00 13.85  ? 31   ALA A C   1 
ATOM   186  O O   . ALA A 1 31  ? 76.958  -3.853  -2.041  1.00 13.63  ? 31   ALA A O   1 
ATOM   187  C CB  . ALA A 1 31  ? 74.566  -1.846  -1.060  1.00 10.08  ? 31   ALA A CB  1 
ATOM   188  N N   . LEU A 1 32  ? 77.748  -2.145  -0.835  1.00 13.02  ? 32   LEU A N   1 
ATOM   189  C CA  . LEU A 1 32  ? 79.053  -2.200  -1.483  1.00 14.07  ? 32   LEU A CA  1 
ATOM   190  C C   . LEU A 1 32  ? 79.697  -3.575  -1.264  1.00 14.25  ? 32   LEU A C   1 
ATOM   191  O O   . LEU A 1 32  ? 80.275  -4.113  -2.200  1.00 12.37  ? 32   LEU A O   1 
ATOM   192  C CB  . LEU A 1 32  ? 79.963  -1.095  -0.904  1.00 14.70  ? 32   LEU A CB  1 
ATOM   193  C CG  . LEU A 1 32  ? 79.677  0.310   -1.430  1.00 15.54  ? 32   LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 32  ? 80.497  1.350   -0.645  1.00 17.34  ? 32   LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 32  ? 79.894  0.429   -2.938  1.00 11.08  ? 32   LEU A CD2 1 
ATOM   196  N N   . LEU A 1 33  ? 79.575  -4.122  -0.052  1.00 14.18  ? 33   LEU A N   1 
ATOM   197  C CA  . LEU A 1 33  ? 80.114  -5.427  0.291   1.00 15.30  ? 33   LEU A CA  1 
ATOM   198  C C   . LEU A 1 33  ? 79.487  -6.536  -0.556  1.00 15.95  ? 33   LEU A C   1 
ATOM   199  O O   . LEU A 1 33  ? 80.184  -7.345  -1.173  1.00 16.23  ? 33   LEU A O   1 
ATOM   200  C CB  . LEU A 1 33  ? 79.917  -5.729  1.781   1.00 15.84  ? 33   LEU A CB  1 
ATOM   201  C CG  . LEU A 1 33  ? 80.310  -7.149  2.255   1.00 18.06  ? 33   LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 33  ? 81.830  -7.331  2.004   1.00 17.24  ? 33   LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 33  ? 79.989  -7.314  3.726   1.00 11.22  ? 33   LEU A CD2 1 
ATOM   204  N N   . ALA A 1 34  ? 78.177  -6.513  -0.747  1.00 15.04  ? 34   ALA A N   1 
ATOM   205  C CA  . ALA A 1 34  ? 77.451  -7.437  -1.590  1.00 14.41  ? 34   ALA A CA  1 
ATOM   206  C C   . ALA A 1 34  ? 77.926  -7.313  -3.039  1.00 14.86  ? 34   ALA A C   1 
ATOM   207  O O   . ALA A 1 34  ? 78.050  -8.344  -3.686  1.00 14.63  ? 34   ALA A O   1 
ATOM   208  C CB  . ALA A 1 34  ? 75.943  -7.249  -1.585  1.00 8.99   ? 34   ALA A CB  1 
ATOM   209  N N   . VAL A 1 35  ? 78.165  -6.086  -3.504  1.00 14.75  ? 35   VAL A N   1 
ATOM   210  C CA  . VAL A 1 35  ? 78.649  -5.921  -4.869  1.00 15.11  ? 35   VAL A CA  1 
ATOM   211  C C   . VAL A 1 35  ? 80.048  -6.552  -4.989  1.00 16.57  ? 35   VAL A C   1 
ATOM   212  O O   . VAL A 1 35  ? 80.339  -7.226  -5.969  1.00 14.98  ? 35   VAL A O   1 
ATOM   213  C CB  . VAL A 1 35  ? 78.590  -4.465  -5.380  1.00 10.99  ? 35   VAL A CB  1 
ATOM   214  C CG1 . VAL A 1 35  ? 79.242  -4.337  -6.748  1.00 12.55  ? 35   VAL A CG1 1 
ATOM   215  C CG2 . VAL A 1 35  ? 77.112  -4.009  -5.516  1.00 7.60   ? 35   VAL A CG2 1 
ATOM   216  N N   . GLU A 1 36  ? 80.901  -6.352  -4.009  1.00 17.71  ? 36   GLU A N   1 
ATOM   217  C CA  . GLU A 1 36  ? 82.217  -6.987  -4.050  1.00 23.01  ? 36   GLU A CA  1 
ATOM   218  C C   . GLU A 1 36  ? 82.007  -8.511  -4.110  1.00 24.54  ? 36   GLU A C   1 
ATOM   219  O O   . GLU A 1 36  ? 82.622  -9.139  -4.981  1.00 26.89  ? 36   GLU A O   1 
ATOM   220  C CB  . GLU A 1 36  ? 83.076  -6.649  -2.860  1.00 22.61  ? 36   GLU A CB  1 
ATOM   221  C CG  . GLU A 1 36  ? 84.492  -7.220  -2.952  1.00 32.76  ? 36   GLU A CG  1 
ATOM   222  C CD  . GLU A 1 36  ? 85.468  -6.039  -3.063  1.00 36.21  ? 36   GLU A CD  1 
ATOM   223  O OE1 . GLU A 1 36  ? 85.113  -5.117  -3.838  1.00 37.40  ? 36   GLU A OE1 1 
ATOM   224  O OE2 . GLU A 1 36  ? 86.455  -6.059  -2.297  1.00 37.23  ? 36   GLU A OE2 1 
ATOM   225  N N   . GLN A 1 37  ? 81.125  -9.077  -3.291  1.00 23.34  ? 37   GLN A N   1 
ATOM   226  C CA  . GLN A 1 37  ? 80.856  -10.495 -3.320  1.00 24.29  ? 37   GLN A CA  1 
ATOM   227  C C   . GLN A 1 37  ? 80.255  -10.972 -4.632  1.00 24.77  ? 37   GLN A C   1 
ATOM   228  O O   . GLN A 1 37  ? 80.695  -11.974 -5.209  1.00 25.92  ? 37   GLN A O   1 
ATOM   229  C CB  . GLN A 1 37  ? 79.905  -10.937 -2.196  1.00 23.98  ? 37   GLN A CB  1 
ATOM   230  C CG  . GLN A 1 37  ? 79.758  -12.450 -2.144  1.00 19.66  ? 37   GLN A CG  1 
ATOM   231  C CD  . GLN A 1 37  ? 78.906  -12.892 -0.963  1.00 20.57  ? 37   GLN A CD  1 
ATOM   232  O OE1 . GLN A 1 37  ? 79.008  -12.273 0.104   1.00 20.09  ? 37   GLN A OE1 1 
ATOM   233  N NE2 . GLN A 1 37  ? 78.115  -13.931 -1.245  1.00 17.76  ? 37   GLN A NE2 1 
ATOM   234  N N   . LEU A 1 38  ? 79.342  -10.192 -5.205  1.00 24.04  ? 38   LEU A N   1 
ATOM   235  C CA  . LEU A 1 38  ? 78.776  -10.555 -6.486  1.00 24.29  ? 38   LEU A CA  1 
ATOM   236  C C   . LEU A 1 38  ? 79.844  -10.613 -7.587  1.00 25.22  ? 38   LEU A C   1 
ATOM   237  O O   . LEU A 1 38  ? 79.669  -11.375 -8.543  1.00 24.60  ? 38   LEU A O   1 
ATOM   238  C CB  . LEU A 1 38  ? 77.635  -9.649  -6.865  1.00 19.06  ? 38   LEU A CB  1 
ATOM   239  C CG  . LEU A 1 38  ? 76.340  -9.710  -6.061  1.00 22.37  ? 38   LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 38  ? 75.436  -8.515  -6.406  1.00 20.39  ? 38   LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 38  ? 75.583  -11.000 -6.354  1.00 22.49  ? 38   LEU A CD2 1 
ATOM   242  N N   . ASN A 1 39  ? 80.872  -9.772  -7.515  1.00 25.20  ? 39   ASN A N   1 
ATOM   243  C CA  . ASN A 1 39  ? 81.872  -9.763  -8.558  1.00 27.01  ? 39   ASN A CA  1 
ATOM   244  C C   . ASN A 1 39  ? 82.778  -10.987 -8.410  1.00 29.20  ? 39   ASN A C   1 
ATOM   245  O O   . ASN A 1 39  ? 82.927  -11.743 -9.376  1.00 28.04  ? 39   ASN A O   1 
ATOM   246  C CB  . ASN A 1 39  ? 82.603  -8.433  -8.612  1.00 23.25  ? 39   ASN A CB  1 
ATOM   247  C CG  . ASN A 1 39  ? 81.705  -7.342  -9.183  1.00 21.67  ? 39   ASN A CG  1 
ATOM   248  O OD1 . ASN A 1 39  ? 80.766  -7.583  -9.927  1.00 21.79  ? 39   ASN A OD1 1 
ATOM   249  N ND2 . ASN A 1 39  ? 81.956  -6.109  -8.782  1.00 18.09  ? 39   ASN A ND2 1 
ATOM   250  N N   . ARG A 1 40  ? 83.081  -11.350 -7.166  1.00 30.82  ? 40   ARG A N   1 
ATOM   251  C CA  . ARG A 1 40  ? 83.839  -12.568 -6.905  1.00 33.53  ? 40   ARG A CA  1 
ATOM   252  C C   . ARG A 1 40  ? 83.057  -13.804 -7.295  1.00 33.96  ? 40   ARG A C   1 
ATOM   253  O O   . ARG A 1 40  ? 83.696  -14.797 -7.622  1.00 34.58  ? 40   ARG A O   1 
ATOM   254  C CB  . ARG A 1 40  ? 84.415  -12.631 -5.503  1.00 33.97  ? 40   ARG A CB  1 
ATOM   255  C CG  . ARG A 1 40  ? 85.521  -11.597 -5.310  1.00 36.01  ? 40   ARG A CG  1 
ATOM   256  C CD  . ARG A 1 40  ? 85.793  -11.452 -3.817  1.00 41.93  ? 40   ARG A CD  1 
ATOM   257  N NE  . ARG A 1 40  ? 86.881  -10.568 -3.475  1.00 42.90  ? 40   ARG A NE  1 
ATOM   258  C CZ  . ARG A 1 40  ? 87.769  -10.869 -2.533  1.00 50.37  ? 40   ARG A CZ  1 
ATOM   259  N NH1 . ARG A 1 40  ? 87.729  -12.015 -1.860  1.00 50.54  ? 40   ARG A NH1 1 
ATOM   260  N NH2 . ARG A 1 40  ? 88.769  -10.034 -2.228  1.00 52.07  ? 40   ARG A NH2 1 
ATOM   261  N N   . GLU A 1 41  ? 81.745  -13.750 -7.405  1.00 34.87  ? 41   GLU A N   1 
ATOM   262  C CA  . GLU A 1 41  ? 80.867  -14.762 -7.879  1.00 35.13  ? 41   GLU A CA  1 
ATOM   263  C C   . GLU A 1 41  ? 80.508  -14.533 -9.357  1.00 36.67  ? 41   GLU A C   1 
ATOM   264  O O   . GLU A 1 41  ? 79.454  -15.055 -9.797  1.00 37.97  ? 41   GLU A O   1 
ATOM   265  C CB  . GLU A 1 41  ? 79.512  -14.808 -7.186  1.00 35.18  ? 41   GLU A CB  1 
ATOM   266  C CG  . GLU A 1 41  ? 79.367  -15.053 -5.715  1.00 33.76  ? 41   GLU A CG  1 
ATOM   267  C CD  . GLU A 1 41  ? 77.901  -14.957 -5.302  1.00 33.89  ? 41   GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 41  ? 76.928  -14.878 -6.118  1.00 32.53  ? 41   GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 41  ? 77.778  -14.949 -4.059  1.00 29.08  ? 41   GLU A OE2 1 
ATOM   270  N N   . GLY A 1 42  ? 81.338  -13.861 -10.153 1.00 36.79  ? 42   GLY A N   1 
ATOM   271  C CA  . GLY A 1 42  ? 81.051  -13.736 -11.556 1.00 37.02  ? 42   GLY A CA  1 
ATOM   272  C C   . GLY A 1 42  ? 80.340  -12.572 -12.184 1.00 38.25  ? 42   GLY A C   1 
ATOM   273  O O   . GLY A 1 42  ? 80.086  -12.638 -13.401 1.00 37.45  ? 42   GLY A O   1 
ATOM   274  N N   . GLY A 1 43  ? 80.020  -11.494 -11.474 1.00 38.43  ? 43   GLY A N   1 
ATOM   275  C CA  . GLY A 1 43  ? 79.340  -10.363 -12.101 1.00 39.09  ? 43   GLY A CA  1 
ATOM   276  C C   . GLY A 1 43  ? 78.113  -10.840 -12.861 1.00 39.51  ? 43   GLY A C   1 
ATOM   277  O O   . GLY A 1 43  ? 77.476  -11.810 -12.447 1.00 38.84  ? 43   GLY A O   1 
ATOM   278  N N   . VAL A 1 44  ? 77.721  -10.134 -13.916 1.00 40.53  ? 44   VAL A N   1 
ATOM   279  C CA  . VAL A 1 44  ? 76.507  -10.506 -14.647 1.00 42.99  ? 44   VAL A CA  1 
ATOM   280  C C   . VAL A 1 44  ? 76.751  -10.534 -16.153 1.00 44.01  ? 44   VAL A C   1 
ATOM   281  O O   . VAL A 1 44  ? 77.256  -9.583  -16.736 1.00 44.37  ? 44   VAL A O   1 
ATOM   282  C CB  . VAL A 1 44  ? 75.314  -9.555  -14.421 1.00 42.69  ? 44   VAL A CB  1 
ATOM   283  C CG1 . VAL A 1 44  ? 74.118  -10.034 -15.257 1.00 44.43  ? 44   VAL A CG1 1 
ATOM   284  C CG2 . VAL A 1 44  ? 74.912  -9.429  -12.977 1.00 41.16  ? 44   VAL A CG2 1 
ATOM   285  N N   . GLY A 1 45  ? 76.392  -11.643 -16.800 1.00 45.91  ? 45   GLY A N   1 
ATOM   286  C CA  . GLY A 1 45  ? 76.614  -11.810 -18.238 1.00 45.02  ? 45   GLY A CA  1 
ATOM   287  C C   . GLY A 1 45  ? 78.082  -11.512 -18.542 1.00 45.44  ? 45   GLY A C   1 
ATOM   288  O O   . GLY A 1 45  ? 78.409  -10.728 -19.449 1.00 47.07  ? 45   GLY A O   1 
ATOM   289  N N   . GLY A 1 46  ? 79.011  -12.081 -17.790 1.00 43.76  ? 46   GLY A N   1 
ATOM   290  C CA  . GLY A 1 46  ? 80.421  -11.864 -17.994 1.00 42.15  ? 46   GLY A CA  1 
ATOM   291  C C   . GLY A 1 46  ? 81.003  -10.610 -17.386 1.00 41.76  ? 46   GLY A C   1 
ATOM   292  O O   . GLY A 1 46  ? 82.203  -10.687 -17.050 1.00 42.70  ? 46   GLY A O   1 
ATOM   293  N N   . ARG A 1 47  ? 80.289  -9.497  -17.193 1.00 39.77  ? 47   ARG A N   1 
ATOM   294  C CA  . ARG A 1 47  ? 80.967  -8.303  -16.672 1.00 37.73  ? 47   ARG A CA  1 
ATOM   295  C C   . ARG A 1 47  ? 80.728  -8.015  -15.186 1.00 34.04  ? 47   ARG A C   1 
ATOM   296  O O   . ARG A 1 47  ? 79.731  -8.434  -14.610 1.00 34.20  ? 47   ARG A O   1 
ATOM   297  C CB  . ARG A 1 47  ? 80.576  -7.067  -17.465 1.00 41.77  ? 47   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 47  ? 80.111  -7.237  -18.891 1.00 47.09  ? 47   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 47  ? 79.298  -6.013  -19.297 1.00 52.74  ? 47   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 47  ? 79.983  -4.879  -19.849 1.00 56.77  ? 47   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 47  ? 81.217  -4.414  -19.863 1.00 59.56  ? 47   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 47  ? 82.242  -5.041  -19.283 1.00 59.89  ? 47   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 47  ? 81.477  -3.266  -20.501 1.00 60.01  ? 47   ARG A NH2 1 
ATOM   304  N N   . PRO A 1 48  ? 81.662  -7.288  -14.580 1.00 30.67  ? 48   PRO A N   1 
ATOM   305  C CA  . PRO A 1 48  ? 81.584  -6.852  -13.197 1.00 29.81  ? 48   PRO A CA  1 
ATOM   306  C C   . PRO A 1 48  ? 80.497  -5.808  -12.928 1.00 27.61  ? 48   PRO A C   1 
ATOM   307  O O   . PRO A 1 48  ? 80.243  -4.900  -13.716 1.00 28.43  ? 48   PRO A O   1 
ATOM   308  C CB  . PRO A 1 48  ? 82.927  -6.217  -12.850 1.00 28.41  ? 48   PRO A CB  1 
ATOM   309  C CG  . PRO A 1 48  ? 83.729  -6.285  -14.093 1.00 30.19  ? 48   PRO A CG  1 
ATOM   310  C CD  . PRO A 1 48  ? 82.861  -6.732  -15.239 1.00 29.46  ? 48   PRO A CD  1 
ATOM   311  N N   . ILE A 1 49  ? 79.801  -5.951  -11.814 1.00 25.48  ? 49   ILE A N   1 
ATOM   312  C CA  . ILE A 1 49  ? 78.749  -5.012  -11.458 1.00 22.76  ? 49   ILE A CA  1 
ATOM   313  C C   . ILE A 1 49  ? 79.401  -3.739  -10.917 1.00 20.71  ? 49   ILE A C   1 
ATOM   314  O O   . ILE A 1 49  ? 80.266  -3.813  -10.039 1.00 19.41  ? 49   ILE A O   1 
ATOM   315  C CB  . ILE A 1 49  ? 77.824  -5.628  -10.398 1.00 25.00  ? 49   ILE A CB  1 
ATOM   316  C CG1 . ILE A 1 49  ? 77.056  -6.813  -10.976 1.00 27.24  ? 49   ILE A CG1 1 
ATOM   317  C CG2 . ILE A 1 49  ? 76.876  -4.555  -9.856  1.00 22.87  ? 49   ILE A CG2 1 
ATOM   318  C CD1 . ILE A 1 49  ? 76.345  -7.671  -9.954  1.00 26.95  ? 49   ILE A CD1 1 
ATOM   319  N N   . GLU A 1 50  ? 79.028  -2.580  -11.449 1.00 19.34  ? 50   GLU A N   1 
ATOM   320  C CA  . GLU A 1 50  ? 79.515  -1.306  -10.904 1.00 18.54  ? 50   GLU A CA  1 
ATOM   321  C C   . GLU A 1 50  ? 78.478  -0.594  -10.029 1.00 17.15  ? 50   GLU A C   1 
ATOM   322  O O   . GLU A 1 50  ? 77.244  -0.762  -10.152 1.00 15.14  ? 50   GLU A O   1 
ATOM   323  C CB  . GLU A 1 50  ? 79.869  -0.362  -12.056 1.00 20.80  ? 50   GLU A CB  1 
ATOM   324  C CG  . GLU A 1 50  ? 80.938  -0.913  -12.997 1.00 30.61  ? 50   GLU A CG  1 
ATOM   325  C CD  . GLU A 1 50  ? 81.047  0.008   -14.201 1.00 35.11  ? 50   GLU A CD  1 
ATOM   326  O OE1 . GLU A 1 50  ? 81.692  1.073   -14.043 1.00 41.08  ? 50   GLU A OE1 1 
ATOM   327  O OE2 . GLU A 1 50  ? 80.459  -0.278  -15.264 1.00 40.58  ? 50   GLU A OE2 1 
ATOM   328  N N   . THR A 1 51  ? 78.993  0.328   -9.206  1.00 15.33  ? 51   THR A N   1 
ATOM   329  C CA  . THR A 1 51  ? 78.100  1.156   -8.409  1.00 16.01  ? 51   THR A CA  1 
ATOM   330  C C   . THR A 1 51  ? 78.402  2.642   -8.622  1.00 17.05  ? 51   THR A C   1 
ATOM   331  O O   . THR A 1 51  ? 79.518  3.008   -8.983  1.00 17.64  ? 51   THR A O   1 
ATOM   332  C CB  . THR A 1 51  ? 78.151  0.878   -6.909  1.00 13.57  ? 51   THR A CB  1 
ATOM   333  O OG1 . THR A 1 51  ? 79.488  1.120   -6.451  1.00 18.81  ? 51   THR A OG1 1 
ATOM   334  C CG2 . THR A 1 51  ? 77.660  -0.506  -6.494  1.00 9.00   ? 51   THR A CG2 1 
ATOM   335  N N   . LEU A 1 52  ? 77.409  3.490   -8.471  1.00 16.91  ? 52   LEU A N   1 
ATOM   336  C CA  . LEU A 1 52  ? 77.490  4.943   -8.493  1.00 17.04  ? 52   LEU A CA  1 
ATOM   337  C C   . LEU A 1 52  ? 76.726  5.478   -7.273  1.00 16.64  ? 52   LEU A C   1 
ATOM   338  O O   . LEU A 1 52  ? 75.501  5.261   -7.105  1.00 15.58  ? 52   LEU A O   1 
ATOM   339  C CB  . LEU A 1 52  ? 76.989  5.585   -9.788  1.00 16.33  ? 52   LEU A CB  1 
ATOM   340  C CG  . LEU A 1 52  ? 77.089  7.129   -9.859  1.00 17.68  ? 52   LEU A CG  1 
ATOM   341  C CD1 . LEU A 1 52  ? 78.545  7.598   -9.830  1.00 11.38  ? 52   LEU A CD1 1 
ATOM   342  C CD2 . LEU A 1 52  ? 76.384  7.651   -11.110 1.00 14.48  ? 52   LEU A CD2 1 
ATOM   343  N N   . SER A 1 53  ? 77.443  6.085   -6.343  1.00 16.10  ? 53   SER A N   1 
ATOM   344  C CA  . SER A 1 53  ? 76.860  6.585   -5.110  1.00 15.85  ? 53   SER A CA  1 
ATOM   345  C C   . SER A 1 53  ? 76.556  8.088   -5.122  1.00 15.48  ? 53   SER A C   1 
ATOM   346  O O   . SER A 1 53  ? 77.344  8.884   -5.626  1.00 14.07  ? 53   SER A O   1 
ATOM   347  C CB  . SER A 1 53  ? 77.818  6.419   -3.935  1.00 15.02  ? 53   SER A CB  1 
ATOM   348  O OG  . SER A 1 53  ? 77.942  5.180   -3.343  1.00 22.18  ? 53   SER A OG  1 
ATOM   349  N N   . GLN A 1 54  ? 75.488  8.540   -4.476  1.00 15.12  ? 54   GLN A N   1 
ATOM   350  C CA  . GLN A 1 54  ? 75.246  9.983   -4.440  1.00 16.74  ? 54   GLN A CA  1 
ATOM   351  C C   . GLN A 1 54  ? 74.750  10.295  -3.044  1.00 16.37  ? 54   GLN A C   1 
ATOM   352  O O   . GLN A 1 54  ? 73.897  9.557   -2.556  1.00 17.31  ? 54   GLN A O   1 
ATOM   353  C CB  . GLN A 1 54  ? 74.263  10.537  -5.466  1.00 17.63  ? 54   GLN A CB  1 
ATOM   354  C CG  . GLN A 1 54  ? 74.684  10.407  -6.911  1.00 16.93  ? 54   GLN A CG  1 
ATOM   355  C CD  . GLN A 1 54  ? 73.921  11.213  -7.913  1.00 19.67  ? 54   GLN A CD  1 
ATOM   356  O OE1 . GLN A 1 54  ? 73.645  10.685  -9.009  1.00 24.79  ? 54   GLN A OE1 1 
ATOM   357  N NE2 . GLN A 1 54  ? 73.569  12.457  -7.592  1.00 16.70  ? 54   GLN A NE2 1 
ATOM   358  N N   . ASP A 1 55  ? 75.230  11.392  -2.489  1.00 15.87  ? 55   ASP A N   1 
ATOM   359  C CA  . ASP A 1 55  ? 74.838  11.791  -1.142  1.00 16.08  ? 55   ASP A CA  1 
ATOM   360  C C   . ASP A 1 55  ? 73.777  12.876  -1.089  1.00 14.95  ? 55   ASP A C   1 
ATOM   361  O O   . ASP A 1 55  ? 74.067  14.056  -1.282  1.00 15.85  ? 55   ASP A O   1 
ATOM   362  C CB  . ASP A 1 55  ? 76.112  12.257  -0.399  1.00 14.74  ? 55   ASP A CB  1 
ATOM   363  C CG  . ASP A 1 55  ? 75.810  12.762  1.000   1.00 19.52  ? 55   ASP A CG  1 
ATOM   364  O OD1 . ASP A 1 55  ? 74.758  12.421  1.599   1.00 21.39  ? 55   ASP A OD1 1 
ATOM   365  O OD2 . ASP A 1 55  ? 76.620  13.506  1.571   1.00 18.04  ? 55   ASP A OD2 1 
ATOM   366  N N   . PRO A 1 56  ? 72.572  12.557  -0.685  1.00 15.74  ? 56   PRO A N   1 
ATOM   367  C CA  . PRO A 1 56  ? 71.488  13.520  -0.508  1.00 16.11  ? 56   PRO A CA  1 
ATOM   368  C C   . PRO A 1 56  ? 71.490  14.204  0.845   1.00 15.81  ? 56   PRO A C   1 
ATOM   369  O O   . PRO A 1 56  ? 70.579  15.013  1.119   1.00 16.84  ? 56   PRO A O   1 
ATOM   370  C CB  . PRO A 1 56  ? 70.210  12.677  -0.683  1.00 15.74  ? 56   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 56  ? 70.601  11.345  -0.121  1.00 16.42  ? 56   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 56  ? 72.084  11.166  -0.432  1.00 16.66  ? 56   PRO A CD  1 
ATOM   373  N N   . GLY A 1 57  ? 72.360  13.862  1.799   1.00 15.44  ? 57   GLY A N   1 
ATOM   374  C CA  . GLY A 1 57  ? 72.420  14.575  3.056   1.00 14.01  ? 57   GLY A CA  1 
ATOM   375  C C   . GLY A 1 57  ? 71.188  14.553  3.918   1.00 15.27  ? 57   GLY A C   1 
ATOM   376  O O   . GLY A 1 57  ? 70.978  15.448  4.739   1.00 14.75  ? 57   GLY A O   1 
ATOM   377  N N   . GLY A 1 58  ? 70.313  13.536  3.855   1.00 14.85  ? 58   GLY A N   1 
ATOM   378  C CA  . GLY A 1 58  ? 69.148  13.410  4.672   1.00 14.01  ? 58   GLY A CA  1 
ATOM   379  C C   . GLY A 1 58  ? 68.008  14.310  4.196   1.00 14.76  ? 58   GLY A C   1 
ATOM   380  O O   . GLY A 1 58  ? 66.928  14.336  4.783   1.00 13.29  ? 58   GLY A O   1 
ATOM   381  N N   . ASP A 1 59  ? 68.226  14.962  3.059   1.00 15.31  ? 59   ASP A N   1 
ATOM   382  C CA  . ASP A 1 59  ? 67.233  15.899  2.514   1.00 15.29  ? 59   ASP A CA  1 
ATOM   383  C C   . ASP A 1 59  ? 66.396  15.287  1.413   1.00 14.20  ? 59   ASP A C   1 
ATOM   384  O O   . ASP A 1 59  ? 66.865  14.916  0.346   1.00 16.43  ? 59   ASP A O   1 
ATOM   385  C CB  . ASP A 1 59  ? 67.996  17.155  2.131   1.00 12.73  ? 59   ASP A CB  1 
ATOM   386  C CG  . ASP A 1 59  ? 67.193  18.271  1.516   1.00 13.76  ? 59   ASP A CG  1 
ATOM   387  O OD1 . ASP A 1 59  ? 66.002  18.146  1.181   1.00 15.79  ? 59   ASP A OD1 1 
ATOM   388  O OD2 . ASP A 1 59  ? 67.827  19.333  1.326   1.00 17.94  ? 59   ASP A OD2 1 
ATOM   389  N N   . PRO A 1 60  ? 65.101  15.172  1.633   1.00 13.62  ? 60   PRO A N   1 
ATOM   390  C CA  . PRO A 1 60  ? 64.137  14.528  0.743   1.00 12.45  ? 60   PRO A CA  1 
ATOM   391  C C   . PRO A 1 60  ? 64.130  15.088  -0.648  1.00 13.00  ? 60   PRO A C   1 
ATOM   392  O O   . PRO A 1 60  ? 64.118  14.342  -1.603  1.00 11.25  ? 60   PRO A O   1 
ATOM   393  C CB  . PRO A 1 60  ? 62.762  14.750  1.392   1.00 13.03  ? 60   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 60  ? 63.024  15.743  2.480   1.00 14.49  ? 60   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 60  ? 64.458  15.546  2.940   1.00 12.89  ? 60   PRO A CD  1 
ATOM   396  N N   . ASP A 1 61  ? 64.149  16.420  -0.799  1.00 14.44  ? 61   ASP A N   1 
ATOM   397  C CA  . ASP A 1 61  ? 64.294  17.064  -2.088  1.00 15.15  ? 61   ASP A CA  1 
ATOM   398  C C   . ASP A 1 61  ? 65.595  16.639  -2.793  1.00 14.08  ? 61   ASP A C   1 
ATOM   399  O O   . ASP A 1 61  ? 65.536  16.413  -4.008  1.00 13.38  ? 61   ASP A O   1 
ATOM   400  C CB  . ASP A 1 61  ? 64.348  18.595  -1.950  1.00 22.97  ? 61   ASP A CB  1 
ATOM   401  C CG  . ASP A 1 61  ? 63.110  19.212  -1.355  1.00 32.07  ? 61   ASP A CG  1 
ATOM   402  O OD1 . ASP A 1 61  ? 61.986  18.656  -1.356  1.00 34.08  ? 61   ASP A OD1 1 
ATOM   403  O OD2 . ASP A 1 61  ? 63.268  20.361  -0.843  1.00 38.36  ? 61   ASP A OD2 1 
ATOM   404  N N   . ARG A 1 62  ? 66.695  16.514  -2.056  1.00 11.51  ? 62   ARG A N   1 
ATOM   405  C CA  . ARG A 1 62  ? 67.936  16.049  -2.682  1.00 12.58  ? 62   ARG A CA  1 
ATOM   406  C C   . ARG A 1 62  ? 67.897  14.548  -3.056  1.00 12.78  ? 62   ARG A C   1 
ATOM   407  O O   . ARG A 1 62  ? 68.563  14.145  -4.015  1.00 10.39  ? 62   ARG A O   1 
ATOM   408  C CB  . ARG A 1 62  ? 69.095  16.406  -1.740  1.00 7.29   ? 62   ARG A CB  1 
ATOM   409  C CG  . ARG A 1 62  ? 69.497  17.858  -1.772  1.00 5.48   ? 62   ARG A CG  1 
ATOM   410  C CD  . ARG A 1 62  ? 70.574  18.206  -0.780  1.00 5.69   ? 62   ARG A CD  1 
ATOM   411  N NE  . ARG A 1 62  ? 71.785  17.386  -0.909  1.00 6.21   ? 62   ARG A NE  1 
ATOM   412  C CZ  . ARG A 1 62  ? 72.707  17.429  0.064   1.00 4.18   ? 62   ARG A CZ  1 
ATOM   413  N NH1 . ARG A 1 62  ? 72.494  18.144  1.174   1.00 7.19   ? 62   ARG A NH1 1 
ATOM   414  N NH2 . ARG A 1 62  ? 73.810  16.710  -0.002  1.00 7.15   ? 62   ARG A NH2 1 
ATOM   415  N N   . TYR A 1 63  ? 67.120  13.703  -2.373  1.00 12.81  ? 63   TYR A N   1 
ATOM   416  C CA  . TYR A 1 63  ? 67.029  12.275  -2.757  1.00 12.91  ? 63   TYR A CA  1 
ATOM   417  C C   . TYR A 1 63  ? 66.300  12.226  -4.111  1.00 13.43  ? 63   TYR A C   1 
ATOM   418  O O   . TYR A 1 63  ? 66.626  11.528  -5.059  1.00 12.08  ? 63   TYR A O   1 
ATOM   419  C CB  . TYR A 1 63  ? 66.171  11.485  -1.783  1.00 13.24  ? 63   TYR A CB  1 
ATOM   420  C CG  . TYR A 1 63  ? 66.822  10.984  -0.522  1.00 12.86  ? 63   TYR A CG  1 
ATOM   421  C CD1 . TYR A 1 63  ? 66.994  11.850  0.538   1.00 10.72  ? 63   TYR A CD1 1 
ATOM   422  C CD2 . TYR A 1 63  ? 67.256  9.671   -0.383  1.00 11.03  ? 63   TYR A CD2 1 
ATOM   423  C CE1 . TYR A 1 63  ? 67.625  11.464  1.696   1.00 11.12  ? 63   TYR A CE1 1 
ATOM   424  C CE2 . TYR A 1 63  ? 67.869  9.275   0.785   1.00 11.84  ? 63   TYR A CE2 1 
ATOM   425  C CZ  . TYR A 1 63  ? 68.030  10.156  1.829   1.00 11.55  ? 63   TYR A CZ  1 
ATOM   426  O OH  . TYR A 1 63  ? 68.644  9.761   2.985   1.00 12.57  ? 63   TYR A OH  1 
ATOM   427  N N   . ARG A 1 64  ? 65.229  13.024  -4.190  1.00 14.12  ? 64   ARG A N   1 
ATOM   428  C CA  . ARG A 1 64  ? 64.506  13.199  -5.415  1.00 15.52  ? 64   ARG A CA  1 
ATOM   429  C C   . ARG A 1 64  ? 65.455  13.646  -6.542  1.00 16.27  ? 64   ARG A C   1 
ATOM   430  O O   . ARG A 1 64  ? 65.465  13.008  -7.586  1.00 15.21  ? 64   ARG A O   1 
ATOM   431  C CB  . ARG A 1 64  ? 63.397  14.235  -5.278  1.00 15.80  ? 64   ARG A CB  1 
ATOM   432  C CG  . ARG A 1 64  ? 62.531  14.122  -6.545  1.00 18.26  ? 64   ARG A CG  1 
ATOM   433  C CD  . ARG A 1 64  ? 61.485  15.232  -6.550  1.00 24.76  ? 64   ARG A CD  1 
ATOM   434  N NE  . ARG A 1 64  ? 62.068  16.322  -7.340  1.00 33.70  ? 64   ARG A NE  1 
ATOM   435  C CZ  . ARG A 1 64  ? 62.375  17.544  -6.958  1.00 34.78  ? 64   ARG A CZ  1 
ATOM   436  N NH1 . ARG A 1 64  ? 62.136  17.952  -5.720  1.00 37.55  ? 64   ARG A NH1 1 
ATOM   437  N NH2 . ARG A 1 64  ? 62.910  18.365  -7.842  1.00 37.78  ? 64   ARG A NH2 1 
ATOM   438  N N   . LEU A 1 65  ? 66.167  14.749  -6.395  1.00 16.37  ? 65   LEU A N   1 
ATOM   439  C CA  . LEU A 1 65  ? 67.056  15.235  -7.449  1.00 17.25  ? 65   LEU A CA  1 
ATOM   440  C C   . LEU A 1 65  ? 68.136  14.210  -7.769  1.00 16.82  ? 65   LEU A C   1 
ATOM   441  O O   . LEU A 1 65  ? 68.357  13.944  -8.961  1.00 16.45  ? 65   LEU A O   1 
ATOM   442  C CB  . LEU A 1 65  ? 67.757  16.551  -7.069  1.00 17.86  ? 65   LEU A CB  1 
ATOM   443  C CG  . LEU A 1 65  ? 66.765  17.722  -6.934  1.00 20.96  ? 65   LEU A CG  1 
ATOM   444  C CD1 . LEU A 1 65  ? 67.410  18.893  -6.211  1.00 16.53  ? 65   LEU A CD1 1 
ATOM   445  C CD2 . LEU A 1 65  ? 66.221  18.099  -8.309  1.00 18.14  ? 65   LEU A CD2 1 
ATOM   446  N N   . CYS A 1 66  ? 68.742  13.592  -6.743  1.00 15.14  ? 66   CYS A N   1 
ATOM   447  C CA  . CYS A 1 66  ? 69.754  12.587  -7.125  1.00 13.97  ? 66   CYS A CA  1 
ATOM   448  C C   . CYS A 1 66  ? 69.118  11.408  -7.851  1.00 13.58  ? 66   CYS A C   1 
ATOM   449  O O   . CYS A 1 66  ? 69.674  10.931  -8.847  1.00 13.13  ? 66   CYS A O   1 
ATOM   450  C CB  . CYS A 1 66  ? 70.626  12.157  -5.975  1.00 9.84   ? 66   CYS A CB  1 
ATOM   451  S SG  . CYS A 1 66  ? 71.519  13.443  -5.114  1.00 10.83  ? 66   CYS A SG  1 
ATOM   452  N N   . ALA A 1 67  ? 67.950  10.945  -7.416  1.00 14.31  ? 67   ALA A N   1 
ATOM   453  C CA  . ALA A 1 67  ? 67.259  9.850   -8.091  1.00 14.78  ? 67   ALA A CA  1 
ATOM   454  C C   . ALA A 1 67  ? 67.074  10.209  -9.575  1.00 15.50  ? 67   ALA A C   1 
ATOM   455  O O   . ALA A 1 67  ? 67.340  9.381   -10.456 1.00 14.91  ? 67   ALA A O   1 
ATOM   456  C CB  . ALA A 1 67  ? 65.910  9.543   -7.448  1.00 13.74  ? 67   ALA A CB  1 
ATOM   457  N N   . GLU A 1 68  ? 66.673  11.417  -9.886  1.00 14.37  ? 68   GLU A N   1 
ATOM   458  C CA  . GLU A 1 68  ? 66.461  11.899  -11.238 1.00 16.79  ? 68   GLU A CA  1 
ATOM   459  C C   . GLU A 1 68  ? 67.750  11.956  -12.051 1.00 15.57  ? 68   GLU A C   1 
ATOM   460  O O   . GLU A 1 68  ? 67.803  11.602  -13.203 1.00 13.25  ? 68   GLU A O   1 
ATOM   461  C CB  . GLU A 1 68  ? 65.907  13.328  -11.203 1.00 16.85  ? 68   GLU A CB  1 
ATOM   462  C CG  . GLU A 1 68  ? 64.390  13.294  -11.282 1.00 26.45  ? 68   GLU A CG  1 
ATOM   463  C CD  . GLU A 1 68  ? 63.939  14.647  -10.756 1.00 33.00  ? 68   GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 68  ? 64.627  15.659  -11.049 1.00 37.37  ? 68   GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 68  ? 62.932  14.653  -10.059 1.00 36.41  ? 68   GLU A OE2 1 
ATOM   466  N N   . ASP A 1 69  ? 68.808  12.421  -11.394 1.00 15.75  ? 69   ASP A N   1 
ATOM   467  C CA  . ASP A 1 69  ? 70.131  12.431  -12.000 1.00 15.94  ? 69   ASP A CA  1 
ATOM   468  C C   . ASP A 1 69  ? 70.529  10.990  -12.341 1.00 16.00  ? 69   ASP A C   1 
ATOM   469  O O   . ASP A 1 69  ? 70.941  10.749  -13.483 1.00 16.78  ? 69   ASP A O   1 
ATOM   470  C CB  . ASP A 1 69  ? 71.152  13.077  -11.047 1.00 13.42  ? 69   ASP A CB  1 
ATOM   471  C CG  . ASP A 1 69  ? 72.523  13.061  -11.722 1.00 16.20  ? 69   ASP A CG  1 
ATOM   472  O OD1 . ASP A 1 69  ? 72.693  13.858  -12.647 1.00 15.78  ? 69   ASP A OD1 1 
ATOM   473  O OD2 . ASP A 1 69  ? 73.445  12.284  -11.408 1.00 18.17  ? 69   ASP A OD2 1 
ATOM   474  N N   . PHE A 1 70  ? 70.339  10.041  -11.426 1.00 13.62  ? 70   PHE A N   1 
ATOM   475  C CA  . PHE A 1 70  ? 70.645  8.638   -11.709 1.00 15.54  ? 70   PHE A CA  1 
ATOM   476  C C   . PHE A 1 70  ? 69.909  8.114   -12.948 1.00 16.24  ? 70   PHE A C   1 
ATOM   477  O O   . PHE A 1 70  ? 70.472  7.581   -13.925 1.00 16.96  ? 70   PHE A O   1 
ATOM   478  C CB  . PHE A 1 70  ? 70.296  7.746   -10.514 1.00 11.13  ? 70   PHE A CB  1 
ATOM   479  C CG  . PHE A 1 70  ? 71.308  7.585   -9.407  1.00 8.07   ? 70   PHE A CG  1 
ATOM   480  C CD1 . PHE A 1 70  ? 72.605  7.207   -9.677  1.00 6.93   ? 70   PHE A CD1 1 
ATOM   481  C CD2 . PHE A 1 70  ? 70.953  7.783   -8.077  1.00 5.30   ? 70   PHE A CD2 1 
ATOM   482  C CE1 . PHE A 1 70  ? 73.544  7.021   -8.686  1.00 6.61   ? 70   PHE A CE1 1 
ATOM   483  C CE2 . PHE A 1 70  ? 71.879  7.559   -7.064  1.00 5.44   ? 70   PHE A CE2 1 
ATOM   484  C CZ  . PHE A 1 70  ? 73.176  7.198   -7.369  1.00 5.27   ? 70   PHE A CZ  1 
ATOM   485  N N   . ILE A 1 71  ? 68.597  8.312   -12.986 1.00 14.96  ? 71   ILE A N   1 
ATOM   486  C CA  . ILE A 1 71  ? 67.795  7.908   -14.112 1.00 16.79  ? 71   ILE A CA  1 
ATOM   487  C C   . ILE A 1 71  ? 67.962  8.747   -15.360 1.00 18.16  ? 71   ILE A C   1 
ATOM   488  O O   . ILE A 1 71  ? 68.094  8.172   -16.449 1.00 19.43  ? 71   ILE A O   1 
ATOM   489  C CB  . ILE A 1 71  ? 66.300  7.852   -13.710 1.00 19.65  ? 71   ILE A CB  1 
ATOM   490  C CG1 . ILE A 1 71  ? 66.211  6.615   -12.788 1.00 21.36  ? 71   ILE A CG1 1 
ATOM   491  C CG2 . ILE A 1 71  ? 65.415  7.775   -14.932 1.00 15.18  ? 71   ILE A CG2 1 
ATOM   492  C CD1 . ILE A 1 71  ? 65.280  6.775   -11.619 1.00 24.88  ? 71   ILE A CD1 1 
ATOM   493  N N   . ARG A 1 72  ? 67.875  10.063  -15.303 1.00 18.90  ? 72   ARG A N   1 
ATOM   494  C CA  . ARG A 1 72  ? 67.981  10.844  -16.534 1.00 21.24  ? 72   ARG A CA  1 
ATOM   495  C C   . ARG A 1 72  ? 69.399  10.857  -17.074 1.00 20.74  ? 72   ARG A C   1 
ATOM   496  O O   . ARG A 1 72  ? 69.592  10.846  -18.283 1.00 20.89  ? 72   ARG A O   1 
ATOM   497  C CB  . ARG A 1 72  ? 67.490  12.277  -16.357 1.00 22.77  ? 72   ARG A CB  1 
ATOM   498  C CG  . ARG A 1 72  ? 66.050  12.450  -15.881 1.00 27.40  ? 72   ARG A CG  1 
ATOM   499  C CD  . ARG A 1 72  ? 65.913  13.851  -15.331 1.00 33.45  ? 72   ARG A CD  1 
ATOM   500  N NE  . ARG A 1 72  ? 64.707  14.486  -15.054 1.00 40.31  ? 72   ARG A NE  1 
ATOM   501  C CZ  . ARG A 1 72  ? 63.452  14.623  -14.773 1.00 47.14  ? 72   ARG A CZ  1 
ATOM   502  N NH1 . ARG A 1 72  ? 62.561  13.634  -14.659 1.00 49.51  ? 72   ARG A NH1 1 
ATOM   503  N NH2 . ARG A 1 72  ? 62.936  15.843  -14.581 1.00 47.99  ? 72   ARG A NH2 1 
ATOM   504  N N   . ASN A 1 73  ? 70.433  11.016  -16.250 1.00 20.70  ? 73   ASN A N   1 
ATOM   505  C CA  . ASN A 1 73  ? 71.775  11.189  -16.796 1.00 19.33  ? 73   ASN A CA  1 
ATOM   506  C C   . ASN A 1 73  ? 72.764  10.075  -16.614 1.00 20.68  ? 73   ASN A C   1 
ATOM   507  O O   . ASN A 1 73  ? 73.875  10.232  -17.142 1.00 19.33  ? 73   ASN A O   1 
ATOM   508  C CB  . ASN A 1 73  ? 72.363  12.458  -16.126 1.00 18.21  ? 73   ASN A CB  1 
ATOM   509  C CG  . ASN A 1 73  ? 71.354  13.590  -16.377 1.00 19.86  ? 73   ASN A CG  1 
ATOM   510  O OD1 . ASN A 1 73  ? 70.844  13.754  -17.477 1.00 22.09  ? 73   ASN A OD1 1 
ATOM   511  N ND2 . ASN A 1 73  ? 70.956  14.317  -15.362 1.00 22.15  ? 73   ASN A ND2 1 
ATOM   512  N N   . ARG A 1 74  ? 72.447  9.017   -15.841 1.00 20.23  ? 74   ARG A N   1 
ATOM   513  C CA  . ARG A 1 74  ? 73.491  7.996   -15.640 1.00 18.29  ? 74   ARG A CA  1 
ATOM   514  C C   . ARG A 1 74  ? 73.040  6.651   -16.160 1.00 16.97  ? 74   ARG A C   1 
ATOM   515  O O   . ARG A 1 74  ? 73.682  5.648   -15.977 1.00 15.78  ? 74   ARG A O   1 
ATOM   516  C CB  . ARG A 1 74  ? 73.911  7.888   -14.180 1.00 17.73  ? 74   ARG A CB  1 
ATOM   517  C CG  . ARG A 1 74  ? 74.197  9.166   -13.454 1.00 17.68  ? 74   ARG A CG  1 
ATOM   518  C CD  . ARG A 1 74  ? 75.366  10.010  -13.945 1.00 18.54  ? 74   ARG A CD  1 
ATOM   519  N NE  . ARG A 1 74  ? 75.088  11.431  -13.747 1.00 18.72  ? 74   ARG A NE  1 
ATOM   520  C CZ  . ARG A 1 74  ? 75.539  12.520  -14.323 1.00 20.28  ? 74   ARG A CZ  1 
ATOM   521  N NH1 . ARG A 1 74  ? 76.467  12.368  -15.272 1.00 19.66  ? 74   ARG A NH1 1 
ATOM   522  N NH2 . ARG A 1 74  ? 75.101  13.745  -13.988 1.00 17.10  ? 74   ARG A NH2 1 
ATOM   523  N N   . GLY A 1 75  ? 71.877  6.605   -16.786 1.00 19.32  ? 75   GLY A N   1 
ATOM   524  C CA  . GLY A 1 75  ? 71.267  5.395   -17.307 1.00 19.94  ? 75   GLY A CA  1 
ATOM   525  C C   . GLY A 1 75  ? 70.983  4.347   -16.230 1.00 21.17  ? 75   GLY A C   1 
ATOM   526  O O   . GLY A 1 75  ? 70.882  3.170   -16.602 1.00 21.19  ? 75   GLY A O   1 
ATOM   527  N N   . VAL A 1 76  ? 70.872  4.696   -14.945 1.00 19.52  ? 76   VAL A N   1 
ATOM   528  C CA  . VAL A 1 76  ? 70.641  3.723   -13.903 1.00 17.49  ? 76   VAL A CA  1 
ATOM   529  C C   . VAL A 1 76  ? 69.158  3.348   -13.800 1.00 17.54  ? 76   VAL A C   1 
ATOM   530  O O   . VAL A 1 76  ? 68.269  4.183   -13.936 1.00 14.38  ? 76   VAL A O   1 
ATOM   531  C CB  . VAL A 1 76  ? 71.153  4.314   -12.578 1.00 18.86  ? 76   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 76  ? 70.648  3.488   -11.405 1.00 19.59  ? 76   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 76  ? 72.666  4.492   -12.590 1.00 14.10  ? 76   VAL A CG2 1 
ATOM   534  N N   . ARG A 1 77  ? 68.871  2.050   -13.619 1.00 17.73  ? 77   ARG A N   1 
ATOM   535  C CA  . ARG A 1 77  ? 67.493  1.561   -13.495 1.00 18.40  ? 77   ARG A CA  1 
ATOM   536  C C   . ARG A 1 77  ? 67.281  0.730   -12.242 1.00 17.67  ? 77   ARG A C   1 
ATOM   537  O O   . ARG A 1 77  ? 66.162  0.366   -11.899 1.00 17.47  ? 77   ARG A O   1 
ATOM   538  C CB  . ARG A 1 77  ? 67.060  0.741   -14.731 1.00 21.59  ? 77   ARG A CB  1 
ATOM   539  C CG  . ARG A 1 77  ? 66.773  1.676   -15.920 1.00 24.25  ? 77   ARG A CG  1 
ATOM   540  C CD  . ARG A 1 77  ? 65.639  2.656   -15.569 1.00 26.10  ? 77   ARG A CD  1 
ATOM   541  N NE  . ARG A 1 77  ? 65.403  3.582   -16.658 1.00 28.72  ? 77   ARG A NE  1 
ATOM   542  C CZ  . ARG A 1 77  ? 66.143  4.606   -17.033 1.00 29.31  ? 77   ARG A CZ  1 
ATOM   543  N NH1 . ARG A 1 77  ? 67.235  4.952   -16.365 1.00 31.58  ? 77   ARG A NH1 1 
ATOM   544  N NH2 . ARG A 1 77  ? 65.769  5.316   -18.090 1.00 30.97  ? 77   ARG A NH2 1 
ATOM   545  N N   . PHE A 1 78  ? 68.383  0.446   -11.540 1.00 16.60  ? 78   PHE A N   1 
ATOM   546  C CA  . PHE A 1 78  ? 68.407  -0.245  -10.290 1.00 15.51  ? 78   PHE A CA  1 
ATOM   547  C C   . PHE A 1 78  ? 69.073  0.655   -9.241  1.00 15.19  ? 78   PHE A C   1 
ATOM   548  O O   . PHE A 1 78  ? 70.250  0.995   -9.381  1.00 15.10  ? 78   PHE A O   1 
ATOM   549  C CB  . PHE A 1 78  ? 69.213  -1.558  -10.271 1.00 16.44  ? 78   PHE A CB  1 
ATOM   550  C CG  . PHE A 1 78  ? 68.633  -2.554  -11.235 1.00 16.37  ? 78   PHE A CG  1 
ATOM   551  C CD1 . PHE A 1 78  ? 67.600  -3.380  -10.844 1.00 15.80  ? 78   PHE A CD1 1 
ATOM   552  C CD2 . PHE A 1 78  ? 69.104  -2.599  -12.538 1.00 16.33  ? 78   PHE A CD2 1 
ATOM   553  C CE1 . PHE A 1 78  ? 67.060  -4.273  -11.741 1.00 18.39  ? 78   PHE A CE1 1 
ATOM   554  C CE2 . PHE A 1 78  ? 68.558  -3.506  -13.438 1.00 19.58  ? 78   PHE A CE2 1 
ATOM   555  C CZ  . PHE A 1 78  ? 67.523  -4.328  -13.041 1.00 17.38  ? 78   PHE A CZ  1 
ATOM   556  N N   . LEU A 1 79  ? 68.302  0.893   -8.185  1.00 12.63  ? 79   LEU A N   1 
ATOM   557  C CA  . LEU A 1 79  ? 68.761  1.703   -7.086  1.00 11.91  ? 79   LEU A CA  1 
ATOM   558  C C   . LEU A 1 79  ? 68.655  0.940   -5.783  1.00 11.17  ? 79   LEU A C   1 
ATOM   559  O O   . LEU A 1 79  ? 67.730  0.152   -5.608  1.00 12.90  ? 79   LEU A O   1 
ATOM   560  C CB  . LEU A 1 79  ? 67.938  2.990   -6.953  1.00 12.94  ? 79   LEU A CB  1 
ATOM   561  C CG  . LEU A 1 79  ? 67.962  4.041   -8.045  1.00 19.27  ? 79   LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 79  ? 66.951  5.164   -7.833  1.00 20.91  ? 79   LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 79  ? 69.335  4.715   -8.071  1.00 20.83  ? 79   LEU A CD2 1 
ATOM   564  N N   . VAL A 1 80  ? 69.493  1.207   -4.808  1.00 11.32  ? 80   VAL A N   1 
ATOM   565  C CA  . VAL A 1 80  ? 69.396  0.656   -3.453  1.00 12.65  ? 80   VAL A CA  1 
ATOM   566  C C   . VAL A 1 80  ? 69.482  1.907   -2.573  1.00 12.96  ? 80   VAL A C   1 
ATOM   567  O O   . VAL A 1 80  ? 70.500  2.629   -2.686  1.00 13.17  ? 80   VAL A O   1 
ATOM   568  C CB  . VAL A 1 80  ? 70.487  -0.347  -3.044  1.00 13.99  ? 80   VAL A CB  1 
ATOM   569  C CG1 . VAL A 1 80  ? 70.296  -0.966  -1.657  1.00 10.99  ? 80   VAL A CG1 1 
ATOM   570  C CG2 . VAL A 1 80  ? 70.595  -1.464  -4.077  1.00 14.24  ? 80   VAL A CG2 1 
ATOM   571  N N   . GLY A 1 81  ? 68.435  2.188   -1.791  1.00 14.02  ? 81   GLY A N   1 
ATOM   572  C CA  . GLY A 1 81  ? 68.555  3.445   -1.011  1.00 13.91  ? 81   GLY A CA  1 
ATOM   573  C C   . GLY A 1 81  ? 67.333  3.838   -0.207  1.00 12.34  ? 81   GLY A C   1 
ATOM   574  O O   . GLY A 1 81  ? 66.309  3.180   -0.190  1.00 10.61  ? 81   GLY A O   1 
ATOM   575  N N   . CYS A 1 82  ? 67.465  4.972   0.445   1.00 11.72  ? 82   CYS A N   1 
ATOM   576  C CA  . CYS A 1 82  ? 66.475  5.683   1.224   1.00 11.81  ? 82   CYS A CA  1 
ATOM   577  C C   . CYS A 1 82  ? 66.382  5.119   2.639   1.00 11.61  ? 82   CYS A C   1 
ATOM   578  O O   . CYS A 1 82  ? 66.482  3.915   2.874   1.00 10.67  ? 82   CYS A O   1 
ATOM   579  C CB  . CYS A 1 82  ? 65.088  5.741   0.539   1.00 9.32   ? 82   CYS A CB  1 
ATOM   580  S SG  . CYS A 1 82  ? 65.079  6.489   -1.116  1.00 9.11   ? 82   CYS A SG  1 
ATOM   581  N N   . TYR A 1 83  ? 66.082  5.988   3.608   1.00 10.01  ? 83   TYR A N   1 
ATOM   582  C CA  . TYR A 1 83  ? 65.928  5.533   4.971   1.00 10.32  ? 83   TYR A CA  1 
ATOM   583  C C   . TYR A 1 83  ? 64.695  6.150   5.601   1.00 11.65  ? 83   TYR A C   1 
ATOM   584  O O   . TYR A 1 83  ? 63.701  5.443   5.646   1.00 12.41  ? 83   TYR A O   1 
ATOM   585  C CB  . TYR A 1 83  ? 67.220  5.826   5.743   1.00 9.00   ? 83   TYR A CB  1 
ATOM   586  C CG  . TYR A 1 83  ? 67.162  5.178   7.108   1.00 9.83   ? 83   TYR A CG  1 
ATOM   587  C CD1 . TYR A 1 83  ? 67.282  3.783   7.253   1.00 9.30   ? 83   TYR A CD1 1 
ATOM   588  C CD2 . TYR A 1 83  ? 67.004  5.960   8.228   1.00 11.75  ? 83   TYR A CD2 1 
ATOM   589  C CE1 . TYR A 1 83  ? 67.262  3.231   8.517   1.00 10.58  ? 83   TYR A CE1 1 
ATOM   590  C CE2 . TYR A 1 83  ? 66.980  5.412   9.512   1.00 14.14  ? 83   TYR A CE2 1 
ATOM   591  C CZ  . TYR A 1 83  ? 67.092  4.024   9.615   1.00 14.17  ? 83   TYR A CZ  1 
ATOM   592  O OH  . TYR A 1 83  ? 67.064  3.494   10.879  1.00 19.09  ? 83   TYR A OH  1 
ATOM   593  N N   . MET A 1 84  ? 64.691  7.407   6.074   1.00 11.97  ? 84   MET A N   1 
ATOM   594  C CA  . MET A 1 84  ? 63.487  8.037   6.580   1.00 10.27  ? 84   MET A CA  1 
ATOM   595  C C   . MET A 1 84  ? 62.400  8.002   5.498   1.00 11.15  ? 84   MET A C   1 
ATOM   596  O O   . MET A 1 84  ? 62.641  8.311   4.327   1.00 9.85   ? 84   MET A O   1 
ATOM   597  C CB  . MET A 1 84  ? 63.715  9.474   7.072   1.00 7.56   ? 84   MET A CB  1 
ATOM   598  C CG  . MET A 1 84  ? 64.686  9.551   8.269   1.00 7.97   ? 84   MET A CG  1 
ATOM   599  S SD  . MET A 1 84  ? 65.066  11.195  8.815   1.00 9.33   ? 84   MET A SD  1 
ATOM   600  C CE  . MET A 1 84  ? 65.924  12.004  7.515   1.00 5.18   ? 84   MET A CE  1 
ATOM   601  N N   . SER A 1 85  ? 61.158  7.749   5.909   1.00 10.96  ? 85   SER A N   1 
ATOM   602  C CA  . SER A 1 85  ? 60.020  7.605   5.013   1.00 12.68  ? 85   SER A CA  1 
ATOM   603  C C   . SER A 1 85  ? 59.711  8.743   4.074   1.00 12.44  ? 85   SER A C   1 
ATOM   604  O O   . SER A 1 85  ? 59.350  8.455   2.933   1.00 12.84  ? 85   SER A O   1 
ATOM   605  C CB  . SER A 1 85  ? 58.780  7.212   5.836   1.00 13.11  ? 85   SER A CB  1 
ATOM   606  O OG  . SER A 1 85  ? 58.877  5.803   6.179   1.00 10.57  ? 85   SER A OG  1 
ATOM   607  N N   . HIS A 1 86  ? 59.878  10.012  4.407   1.00 12.23  ? 86   HIS A N   1 
ATOM   608  C CA  . HIS A 1 86  ? 59.699  11.137  3.515   1.00 13.94  ? 86   HIS A CA  1 
ATOM   609  C C   . HIS A 1 86  ? 60.777  11.110  2.415   1.00 12.96  ? 86   HIS A C   1 
ATOM   610  O O   . HIS A 1 86  ? 60.465  11.581  1.311   1.00 12.55  ? 86   HIS A O   1 
ATOM   611  C CB  . HIS A 1 86  ? 59.654  12.509  4.222   1.00 12.28  ? 86   HIS A CB  1 
ATOM   612  C CG  . HIS A 1 86  ? 60.717  12.628  5.294   1.00 16.76  ? 86   HIS A CG  1 
ATOM   613  N ND1 . HIS A 1 86  ? 61.436  13.795  5.522   1.00 19.54  ? 86   HIS A ND1 1 
ATOM   614  C CD2 . HIS A 1 86  ? 61.180  11.773  6.209   1.00 9.73   ? 86   HIS A CD2 1 
ATOM   615  C CE1 . HIS A 1 86  ? 62.259  13.623  6.534   1.00 14.45  ? 86   HIS A CE1 1 
ATOM   616  N NE2 . HIS A 1 86  ? 62.116  12.388  6.961   1.00 14.18  ? 86   HIS A NE2 1 
ATOM   617  N N   . THR A 1 87  ? 61.948  10.506  2.643   1.00 12.94  ? 87   THR A N   1 
ATOM   618  C CA  . THR A 1 87  ? 62.960  10.343  1.601   1.00 11.94  ? 87   THR A CA  1 
ATOM   619  C C   . THR A 1 87  ? 62.531  9.252   0.625   1.00 12.96  ? 87   THR A C   1 
ATOM   620  O O   . THR A 1 87  ? 62.627  9.426   -0.595  1.00 13.77  ? 87   THR A O   1 
ATOM   621  C CB  . THR A 1 87  ? 64.373  10.081  2.146   1.00 12.00  ? 87   THR A CB  1 
ATOM   622  O OG1 . THR A 1 87  ? 64.570  8.731   2.590   1.00 7.35   ? 87   THR A OG1 1 
ATOM   623  C CG2 . THR A 1 87  ? 64.610  11.002  3.352   1.00 8.16   ? 87   THR A CG2 1 
ATOM   624  N N   . ARG A 1 88  ? 61.889  8.191   1.104   1.00 13.29  ? 88   ARG A N   1 
ATOM   625  C CA  . ARG A 1 88  ? 61.350  7.147   0.219   1.00 13.49  ? 88   ARG A CA  1 
ATOM   626  C C   . ARG A 1 88  ? 60.197  7.714   -0.595  1.00 12.11  ? 88   ARG A C   1 
ATOM   627  O O   . ARG A 1 88  ? 60.156  7.547   -1.828  1.00 10.31  ? 88   ARG A O   1 
ATOM   628  C CB  . ARG A 1 88  ? 60.905  5.885   0.980   1.00 13.80  ? 88   ARG A CB  1 
ATOM   629  C CG  . ARG A 1 88  ? 60.414  4.693   0.204   1.00 13.98  ? 88   ARG A CG  1 
ATOM   630  C CD  . ARG A 1 88  ? 59.627  3.633   0.994   1.00 11.25  ? 88   ARG A CD  1 
ATOM   631  N NE  . ARG A 1 88  ? 58.291  4.115   1.399   1.00 9.19   ? 88   ARG A NE  1 
ATOM   632  C CZ  . ARG A 1 88  ? 57.985  4.537   2.612   1.00 10.20  ? 88   ARG A CZ  1 
ATOM   633  N NH1 . ARG A 1 88  ? 58.923  4.507   3.569   1.00 11.26  ? 88   ARG A NH1 1 
ATOM   634  N NH2 . ARG A 1 88  ? 56.768  4.978   2.935   1.00 9.84   ? 88   ARG A NH2 1 
ATOM   635  N N   . LYS A 1 89  ? 59.314  8.514   0.043   1.00 11.10  ? 89   LYS A N   1 
ATOM   636  C CA  . LYS A 1 89  ? 58.190  9.049   -0.729  1.00 11.67  ? 89   LYS A CA  1 
ATOM   637  C C   . LYS A 1 89  ? 58.653  9.975   -1.850  1.00 12.23  ? 89   LYS A C   1 
ATOM   638  O O   . LYS A 1 89  ? 57.981  10.121  -2.882  1.00 9.89   ? 89   LYS A O   1 
ATOM   639  C CB  . LYS A 1 89  ? 57.155  9.834   0.106   1.00 14.07  ? 89   LYS A CB  1 
ATOM   640  C CG  . LYS A 1 89  ? 56.340  9.006   1.094   1.00 12.65  ? 89   LYS A CG  1 
ATOM   641  C CD  . LYS A 1 89  ? 55.471  7.992   0.374   1.00 12.97  ? 89   LYS A CD  1 
ATOM   642  C CE  . LYS A 1 89  ? 54.272  7.555   1.223   1.00 10.69  ? 89   LYS A CE  1 
ATOM   643  N NZ  . LYS A 1 89  ? 53.538  6.463   0.506   1.00 11.88  ? 89   LYS A NZ  1 
ATOM   644  N N   . ALA A 1 90  ? 59.770  10.671  -1.603  1.00 12.91  ? 90   ALA A N   1 
ATOM   645  C CA  . ALA A 1 90  ? 60.294  11.600  -2.581  1.00 13.69  ? 90   ALA A CA  1 
ATOM   646  C C   . ALA A 1 90  ? 60.851  10.860  -3.786  1.00 13.70  ? 90   ALA A C   1 
ATOM   647  O O   . ALA A 1 90  ? 60.785  11.457  -4.861  1.00 15.71  ? 90   ALA A O   1 
ATOM   648  C CB  . ALA A 1 90  ? 61.463  12.424  -2.013  1.00 11.86  ? 90   ALA A CB  1 
ATOM   649  N N   . VAL A 1 91  ? 61.444  9.696   -3.595  1.00 12.94  ? 91   VAL A N   1 
ATOM   650  C CA  . VAL A 1 91  ? 62.057  8.957   -4.705  1.00 11.93  ? 91   VAL A CA  1 
ATOM   651  C C   . VAL A 1 91  ? 61.078  8.067   -5.465  1.00 11.77  ? 91   VAL A C   1 
ATOM   652  O O   . VAL A 1 91  ? 61.181  7.826   -6.675  1.00 9.54   ? 91   VAL A O   1 
ATOM   653  C CB  . VAL A 1 91  ? 63.233  8.151   -4.114  1.00 11.02  ? 91   VAL A CB  1 
ATOM   654  C CG1 . VAL A 1 91  ? 63.855  7.116   -5.043  1.00 11.91  ? 91   VAL A CG1 1 
ATOM   655  C CG2 . VAL A 1 91  ? 64.329  9.148   -3.673  1.00 11.44  ? 91   VAL A CG2 1 
ATOM   656  N N   . MET A 1 92  ? 60.063  7.538   -4.780  1.00 11.45  ? 92   MET A N   1 
ATOM   657  C CA  . MET A 1 92  ? 59.086  6.599   -5.335  1.00 12.36  ? 92   MET A CA  1 
ATOM   658  C C   . MET A 1 92  ? 58.487  6.973   -6.668  1.00 12.88  ? 92   MET A C   1 
ATOM   659  O O   . MET A 1 92  ? 58.609  6.228   -7.668  1.00 13.33  ? 92   MET A O   1 
ATOM   660  C CB  . MET A 1 92  ? 58.051  6.276   -4.228  1.00 14.10  ? 92   MET A CB  1 
ATOM   661  C CG  . MET A 1 92  ? 57.034  5.185   -4.630  1.00 14.22  ? 92   MET A CG  1 
ATOM   662  S SD  . MET A 1 92  ? 55.932  4.769   -3.274  1.00 11.99  ? 92   MET A SD  1 
ATOM   663  C CE  . MET A 1 92  ? 54.856  6.195   -3.189  1.00 6.86   ? 92   MET A CE  1 
ATOM   664  N N   . PRO A 1 93  ? 57.889  8.146   -6.833  1.00 12.49  ? 93   PRO A N   1 
ATOM   665  C CA  . PRO A 1 93  ? 57.390  8.608   -8.112  1.00 13.03  ? 93   PRO A CA  1 
ATOM   666  C C   . PRO A 1 93  ? 58.434  8.634   -9.230  1.00 13.82  ? 93   PRO A C   1 
ATOM   667  O O   . PRO A 1 93  ? 58.080  8.355   -10.386 1.00 10.64  ? 93   PRO A O   1 
ATOM   668  C CB  . PRO A 1 93  ? 56.859  10.013  -7.870  1.00 13.75  ? 93   PRO A CB  1 
ATOM   669  C CG  . PRO A 1 93  ? 56.964  10.282  -6.404  1.00 14.62  ? 93   PRO A CG  1 
ATOM   670  C CD  . PRO A 1 93  ? 57.725  9.155   -5.757  1.00 13.12  ? 93   PRO A CD  1 
ATOM   671  N N   . VAL A 1 94  ? 59.681  9.006   -8.915  1.00 12.28  ? 94   VAL A N   1 
ATOM   672  C CA  . VAL A 1 94  ? 60.719  9.072   -9.929  1.00 15.01  ? 94   VAL A CA  1 
ATOM   673  C C   . VAL A 1 94  ? 60.993  7.647   -10.423 1.00 13.61  ? 94   VAL A C   1 
ATOM   674  O O   . VAL A 1 94  ? 61.041  7.458   -11.629 1.00 13.80  ? 94   VAL A O   1 
ATOM   675  C CB  . VAL A 1 94  ? 62.076  9.646   -9.417  1.00 14.05  ? 94   VAL A CB  1 
ATOM   676  C CG1 . VAL A 1 94  ? 63.133  9.564   -10.477 1.00 13.47  ? 94   VAL A CG1 1 
ATOM   677  C CG2 . VAL A 1 94  ? 61.946  11.103  -8.973  1.00 15.66  ? 94   VAL A CG2 1 
ATOM   678  N N   . VAL A 1 95  ? 61.166  6.693   -9.520  1.00 13.02  ? 95   VAL A N   1 
ATOM   679  C CA  . VAL A 1 95  ? 61.406  5.325   -9.984  1.00 13.91  ? 95   VAL A CA  1 
ATOM   680  C C   . VAL A 1 95  ? 60.180  4.707   -10.653 1.00 13.83  ? 95   VAL A C   1 
ATOM   681  O O   . VAL A 1 95  ? 60.326  3.973   -11.655 1.00 11.23  ? 95   VAL A O   1 
ATOM   682  C CB  . VAL A 1 95  ? 62.071  4.442   -8.928  1.00 15.79  ? 95   VAL A CB  1 
ATOM   683  C CG1 . VAL A 1 95  ? 63.164  5.211   -8.134  1.00 16.59  ? 95   VAL A CG1 1 
ATOM   684  C CG2 . VAL A 1 95  ? 61.158  3.794   -7.953  1.00 15.56  ? 95   VAL A CG2 1 
ATOM   685  N N   . GLU A 1 96  ? 58.970  4.992   -10.183 1.00 12.90  ? 96   GLU A N   1 
ATOM   686  C CA  . GLU A 1 96  ? 57.779  4.451   -10.801 1.00 15.14  ? 96   GLU A CA  1 
ATOM   687  C C   . GLU A 1 96  ? 57.636  4.977   -12.222 1.00 15.69  ? 96   GLU A C   1 
ATOM   688  O O   . GLU A 1 96  ? 57.407  4.140   -13.118 1.00 15.42  ? 96   GLU A O   1 
ATOM   689  C CB  . GLU A 1 96  ? 56.462  4.717   -10.055 1.00 16.45  ? 96   GLU A CB  1 
ATOM   690  C CG  . GLU A 1 96  ? 56.350  3.840   -8.829  1.00 15.51  ? 96   GLU A CG  1 
ATOM   691  C CD  . GLU A 1 96  ? 55.214  4.154   -7.872  1.00 16.25  ? 96   GLU A CD  1 
ATOM   692  O OE1 . GLU A 1 96  ? 54.586  5.218   -8.023  1.00 13.31  ? 96   GLU A OE1 1 
ATOM   693  O OE2 . GLU A 1 96  ? 54.932  3.370   -6.927  1.00 14.53  ? 96   GLU A OE2 1 
ATOM   694  N N   . ARG A 1 97  ? 57.861  6.282   -12.442 1.00 15.31  ? 97   ARG A N   1 
ATOM   695  C CA  . ARG A 1 97  ? 57.714  6.780   -13.810 1.00 15.79  ? 97   ARG A CA  1 
ATOM   696  C C   . ARG A 1 97  ? 58.746  6.199   -14.783 1.00 16.82  ? 97   ARG A C   1 
ATOM   697  O O   . ARG A 1 97  ? 58.465  6.236   -15.979 1.00 14.80  ? 97   ARG A O   1 
ATOM   698  C CB  . ARG A 1 97  ? 57.905  8.284   -13.888 1.00 19.20  ? 97   ARG A CB  1 
ATOM   699  C CG  . ARG A 1 97  ? 56.722  9.097   -13.339 1.00 19.16  ? 97   ARG A CG  1 
ATOM   700  C CD  . ARG A 1 97  ? 57.147  10.565  -13.621 1.00 23.83  ? 97   ARG A CD  1 
ATOM   701  N NE  . ARG A 1 97  ? 56.842  11.344  -12.487 1.00 30.12  ? 97   ARG A NE  1 
ATOM   702  C CZ  . ARG A 1 97  ? 57.179  11.997  -11.414 1.00 30.33  ? 97   ARG A CZ  1 
ATOM   703  N NH1 . ARG A 1 97  ? 58.425  12.211  -11.045 1.00 22.63  ? 97   ARG A NH1 1 
ATOM   704  N NH2 . ARG A 1 97  ? 56.130  12.480  -10.710 1.00 33.70  ? 97   ARG A NH2 1 
ATOM   705  N N   . ALA A 1 98  ? 59.928  5.853   -14.272 1.00 15.38  ? 98   ALA A N   1 
ATOM   706  C CA  . ALA A 1 98  ? 60.975  5.355   -15.157 1.00 17.58  ? 98   ALA A CA  1 
ATOM   707  C C   . ALA A 1 98  ? 60.961  3.853   -15.337 1.00 16.81  ? 98   ALA A C   1 
ATOM   708  O O   . ALA A 1 98  ? 61.807  3.275   -16.011 1.00 19.12  ? 98   ALA A O   1 
ATOM   709  C CB  . ALA A 1 98  ? 62.341  5.740   -14.538 1.00 11.75  ? 98   ALA A CB  1 
ATOM   710  N N   . ASP A 1 99  ? 60.095  3.140   -14.625 1.00 17.74  ? 99   ASP A N   1 
ATOM   711  C CA  . ASP A 1 99  ? 60.027  1.694   -14.656 1.00 17.20  ? 99   ASP A CA  1 
ATOM   712  C C   . ASP A 1 99  ? 61.340  1.151   -14.127 1.00 18.20  ? 99   ASP A C   1 
ATOM   713  O O   . ASP A 1 99  ? 61.861  0.152   -14.609 1.00 19.47  ? 99   ASP A O   1 
ATOM   714  C CB  . ASP A 1 99  ? 59.747  1.150   -16.051 1.00 19.57  ? 99   ASP A CB  1 
ATOM   715  C CG  . ASP A 1 99  ? 58.418  1.576   -16.632 1.00 24.10  ? 99   ASP A CG  1 
ATOM   716  O OD1 . ASP A 1 99  ? 57.417  1.738   -15.896 1.00 24.63  ? 99   ASP A OD1 1 
ATOM   717  O OD2 . ASP A 1 99  ? 58.304  1.784   -17.873 1.00 27.57  ? 99   ASP A OD2 1 
ATOM   718  N N   . ALA A 1 100 ? 61.927  1.833   -13.146 1.00 18.01  ? 100  ALA A N   1 
ATOM   719  C CA  . ALA A 1 100 ? 63.155  1.439   -12.484 1.00 15.91  ? 100  ALA A CA  1 
ATOM   720  C C   . ALA A 1 100 ? 62.751  0.578   -11.284 1.00 14.53  ? 100  ALA A C   1 
ATOM   721  O O   . ALA A 1 100 ? 61.569  0.303   -11.048 1.00 16.14  ? 100  ALA A O   1 
ATOM   722  C CB  . ALA A 1 100 ? 63.898  2.662   -12.006 1.00 15.44  ? 100  ALA A CB  1 
ATOM   723  N N   . LEU A 1 101 ? 63.695  0.215   -10.468 1.00 13.80  ? 101  LEU A N   1 
ATOM   724  C CA  . LEU A 1 101 ? 63.467  -0.590  -9.291  1.00 12.11  ? 101  LEU A CA  1 
ATOM   725  C C   . LEU A 1 101 ? 64.319  -0.116  -8.136  1.00 13.00  ? 101  LEU A C   1 
ATOM   726  O O   . LEU A 1 101 ? 65.536  0.041   -8.281  1.00 14.22  ? 101  LEU A O   1 
ATOM   727  C CB  . LEU A 1 101 ? 63.835  -2.030  -9.687  1.00 12.66  ? 101  LEU A CB  1 
ATOM   728  C CG  . LEU A 1 101 ? 63.601  -3.136  -8.671  1.00 14.66  ? 101  LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 101 ? 62.097  -3.267  -8.433  1.00 17.03  ? 101  LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 101 ? 64.144  -4.456  -9.203  1.00 14.06  ? 101  LEU A CD2 1 
ATOM   731  N N   . LEU A 1 102 ? 63.709  0.161   -7.000  1.00 13.14  ? 102  LEU A N   1 
ATOM   732  C CA  . LEU A 1 102 ? 64.492  0.591   -5.825  1.00 13.57  ? 102  LEU A CA  1 
ATOM   733  C C   . LEU A 1 102 ? 64.427  -0.493  -4.766  1.00 11.02  ? 102  LEU A C   1 
ATOM   734  O O   . LEU A 1 102 ? 63.314  -0.898  -4.455  1.00 12.02  ? 102  LEU A O   1 
ATOM   735  C CB  . LEU A 1 102 ? 63.899  1.903   -5.250  1.00 13.55  ? 102  LEU A CB  1 
ATOM   736  C CG  . LEU A 1 102 ? 64.268  2.272   -3.794  1.00 12.82  ? 102  LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 102 ? 65.700  2.805   -3.749  1.00 10.79  ? 102  LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 102 ? 63.263  3.292   -3.267  1.00 10.70  ? 102  LEU A CD2 1 
ATOM   739  N N   . CYS A 1 103 ? 65.515  -0.831  -4.118  1.00 10.72  ? 103  CYS A N   1 
ATOM   740  C CA  . CYS A 1 103 ? 65.552  -1.717  -2.996  1.00 10.03  ? 103  CYS A CA  1 
ATOM   741  C C   . CYS A 1 103 ? 65.643  -0.808  -1.779  1.00 9.28   ? 103  CYS A C   1 
ATOM   742  O O   . CYS A 1 103 ? 66.587  -0.066  -1.610  1.00 8.94   ? 103  CYS A O   1 
ATOM   743  C CB  . CYS A 1 103 ? 66.763  -2.707  -2.938  1.00 10.78  ? 103  CYS A CB  1 
ATOM   744  S SG  . CYS A 1 103 ? 66.578  -3.949  -4.251  1.00 12.89  ? 103  CYS A SG  1 
ATOM   745  N N   . TYR A 1 104 ? 64.681  -0.916  -0.878  1.00 9.90   ? 104  TYR A N   1 
ATOM   746  C CA  . TYR A 1 104 ? 64.558  -0.157  0.324   1.00 9.13   ? 104  TYR A CA  1 
ATOM   747  C C   . TYR A 1 104 ? 64.869  -1.039  1.510   1.00 9.17   ? 104  TYR A C   1 
ATOM   748  O O   . TYR A 1 104 ? 63.973  -1.656  2.103   1.00 9.92   ? 104  TYR A O   1 
ATOM   749  C CB  . TYR A 1 104 ? 63.073  0.317   0.409   1.00 9.29   ? 104  TYR A CB  1 
ATOM   750  C CG  . TYR A 1 104 ? 62.725  1.237   1.548   1.00 9.67   ? 104  TYR A CG  1 
ATOM   751  C CD1 . TYR A 1 104 ? 63.459  2.423   1.742   1.00 10.46  ? 104  TYR A CD1 1 
ATOM   752  C CD2 . TYR A 1 104 ? 61.683  0.956   2.428   1.00 10.97  ? 104  TYR A CD2 1 
ATOM   753  C CE1 . TYR A 1 104 ? 63.140  3.266   2.808   1.00 10.86  ? 104  TYR A CE1 1 
ATOM   754  C CE2 . TYR A 1 104 ? 61.329  1.793   3.477   1.00 10.31  ? 104  TYR A CE2 1 
ATOM   755  C CZ  . TYR A 1 104 ? 62.074  2.955   3.626   1.00 12.45  ? 104  TYR A CZ  1 
ATOM   756  O OH  . TYR A 1 104 ? 61.767  3.818   4.643   1.00 15.51  ? 104  TYR A OH  1 
ATOM   757  N N   . PRO A 1 105 ? 66.114  -1.117  1.959   1.00 9.43   ? 105  PRO A N   1 
ATOM   758  C CA  . PRO A 1 105 ? 66.470  -2.009  3.061   1.00 8.62   ? 105  PRO A CA  1 
ATOM   759  C C   . PRO A 1 105 ? 66.279  -1.428  4.425   1.00 8.56   ? 105  PRO A C   1 
ATOM   760  O O   . PRO A 1 105 ? 67.199  -1.292  5.258   1.00 10.29  ? 105  PRO A O   1 
ATOM   761  C CB  . PRO A 1 105 ? 67.928  -2.322  2.739   1.00 9.27   ? 105  PRO A CB  1 
ATOM   762  C CG  . PRO A 1 105 ? 68.440  -1.182  1.933   1.00 9.04   ? 105  PRO A CG  1 
ATOM   763  C CD  . PRO A 1 105 ? 67.277  -0.425  1.364   1.00 7.79   ? 105  PRO A CD  1 
ATOM   764  N N   . THR A 1 106 ? 65.072  -1.044  4.780   1.00 8.72   ? 106  THR A N   1 
ATOM   765  C CA  . THR A 1 106 ? 64.806  -0.204  5.950   1.00 8.27   ? 106  THR A CA  1 
ATOM   766  C C   . THR A 1 106 ? 63.462  -0.479  6.584   1.00 9.09   ? 106  THR A C   1 
ATOM   767  O O   . THR A 1 106 ? 62.493  -0.767  5.906   1.00 7.64   ? 106  THR A O   1 
ATOM   768  C CB  . THR A 1 106 ? 64.678  1.226   5.299   1.00 7.93   ? 106  THR A CB  1 
ATOM   769  O OG1 . THR A 1 106 ? 65.922  1.620   4.688   1.00 8.65   ? 106  THR A OG1 1 
ATOM   770  C CG2 . THR A 1 106 ? 64.144  2.293   6.274   1.00 7.99   ? 106  THR A CG2 1 
ATOM   771  N N   . PRO A 1 107 ? 63.343  -0.343  7.894   1.00 10.49  ? 107  PRO A N   1 
ATOM   772  C CA  . PRO A 1 107 ? 62.047  -0.497  8.549   1.00 11.73  ? 107  PRO A CA  1 
ATOM   773  C C   . PRO A 1 107 ? 61.055  0.574   8.208   1.00 10.30  ? 107  PRO A C   1 
ATOM   774  O O   . PRO A 1 107 ? 61.468  1.731   8.051   1.00 12.47  ? 107  PRO A O   1 
ATOM   775  C CB  . PRO A 1 107 ? 62.387  -0.449  10.036  1.00 11.16  ? 107  PRO A CB  1 
ATOM   776  C CG  . PRO A 1 107 ? 63.726  0.176   10.109  1.00 11.37  ? 107  PRO A CG  1 
ATOM   777  C CD  . PRO A 1 107 ? 64.433  -0.025  8.820   1.00 9.59   ? 107  PRO A CD  1 
ATOM   778  N N   . TYR A 1 108 ? 59.751  0.336   8.199   1.00 10.58  ? 108  TYR A N   1 
ATOM   779  C CA  . TYR A 1 108 ? 58.838  1.477   7.980   1.00 9.65   ? 108  TYR A CA  1 
ATOM   780  C C   . TYR A 1 108 ? 57.432  1.229   8.523   1.00 10.31  ? 108  TYR A C   1 
ATOM   781  O O   . TYR A 1 108 ? 57.060  0.203   9.091   1.00 9.75   ? 108  TYR A O   1 
ATOM   782  C CB  . TYR A 1 108 ? 58.904  1.914   6.529   1.00 9.13   ? 108  TYR A CB  1 
ATOM   783  C CG  . TYR A 1 108 ? 57.871  1.216   5.642   1.00 9.70   ? 108  TYR A CG  1 
ATOM   784  C CD1 . TYR A 1 108 ? 57.956  -0.137  5.407   1.00 10.57  ? 108  TYR A CD1 1 
ATOM   785  C CD2 . TYR A 1 108 ? 56.843  1.936   5.040   1.00 9.51   ? 108  TYR A CD2 1 
ATOM   786  C CE1 . TYR A 1 108 ? 57.031  -0.784  4.597   1.00 11.44  ? 108  TYR A CE1 1 
ATOM   787  C CE2 . TYR A 1 108 ? 55.951  1.337   4.172   1.00 9.99   ? 108  TYR A CE2 1 
ATOM   788  C CZ  . TYR A 1 108 ? 56.025  -0.034  3.983   1.00 11.11  ? 108  TYR A CZ  1 
ATOM   789  O OH  . TYR A 1 108 ? 55.100  -0.686  3.231   1.00 7.44   ? 108  TYR A OH  1 
ATOM   790  N N   . GLU A 1 109 ? 56.573  2.227   8.436   1.00 8.73   ? 109  GLU A N   1 
ATOM   791  C CA  . GLU A 1 109 ? 55.237  2.340   8.919   1.00 10.36  ? 109  GLU A CA  1 
ATOM   792  C C   . GLU A 1 109 ? 54.220  1.453   8.199   1.00 11.12  ? 109  GLU A C   1 
ATOM   793  O O   . GLU A 1 109 ? 53.081  1.428   8.681   1.00 11.72  ? 109  GLU A O   1 
ATOM   794  C CB  . GLU A 1 109 ? 54.727  3.808   8.851   1.00 9.82   ? 109  GLU A CB  1 
ATOM   795  C CG  . GLU A 1 109 ? 54.491  4.521   7.533   1.00 10.28  ? 109  GLU A CG  1 
ATOM   796  C CD  . GLU A 1 109 ? 55.753  5.028   6.822   1.00 11.61  ? 109  GLU A CD  1 
ATOM   797  O OE1 . GLU A 1 109 ? 56.826  5.013   7.462   1.00 10.98  ? 109  GLU A OE1 1 
ATOM   798  O OE2 . GLU A 1 109 ? 55.719  5.438   5.615   1.00 9.50   ? 109  GLU A OE2 1 
ATOM   799  N N   . GLY A 1 110 ? 54.587  0.808   7.104   1.00 10.87  ? 110  GLY A N   1 
ATOM   800  C CA  . GLY A 1 110 ? 53.691  -0.013  6.323   1.00 10.93  ? 110  GLY A CA  1 
ATOM   801  C C   . GLY A 1 110 ? 52.734  0.824   5.482   1.00 12.61  ? 110  GLY A C   1 
ATOM   802  O O   . GLY A 1 110 ? 53.028  1.989   5.141   1.00 12.56  ? 110  GLY A O   1 
ATOM   803  N N   . PHE A 1 111 ? 51.654  0.215   5.014   1.00 10.81  ? 111  PHE A N   1 
ATOM   804  C CA  . PHE A 1 111 ? 50.616  0.897   4.262   1.00 11.48  ? 111  PHE A CA  1 
ATOM   805  C C   . PHE A 1 111 ? 51.104  1.535   2.972   1.00 11.90  ? 111  PHE A C   1 
ATOM   806  O O   . PHE A 1 111 ? 50.737  2.660   2.608   1.00 9.15   ? 111  PHE A O   1 
ATOM   807  C CB  . PHE A 1 111 ? 49.875  1.980   5.093   1.00 8.08   ? 111  PHE A CB  1 
ATOM   808  C CG  . PHE A 1 111 ? 49.177  1.336   6.271   1.00 9.29   ? 111  PHE A CG  1 
ATOM   809  C CD1 . PHE A 1 111 ? 49.890  1.097   7.443   1.00 8.64   ? 111  PHE A CD1 1 
ATOM   810  C CD2 . PHE A 1 111 ? 47.819  1.020   6.214   1.00 8.11   ? 111  PHE A CD2 1 
ATOM   811  C CE1 . PHE A 1 111 ? 49.300  0.520   8.546   1.00 10.30  ? 111  PHE A CE1 1 
ATOM   812  C CE2 . PHE A 1 111 ? 47.232  0.425   7.327   1.00 8.25   ? 111  PHE A CE2 1 
ATOM   813  C CZ  . PHE A 1 111 ? 47.942  0.173   8.485   1.00 7.47   ? 111  PHE A CZ  1 
ATOM   814  N N   . GLU A 1 112 ? 51.876  0.749   2.220   1.00 11.82  ? 112  GLU A N   1 
ATOM   815  C CA  . GLU A 1 112 ? 52.292  1.233   0.916   1.00 11.72  ? 112  GLU A CA  1 
ATOM   816  C C   . GLU A 1 112 ? 52.518  -0.011  0.064   1.00 12.71  ? 112  GLU A C   1 
ATOM   817  O O   . GLU A 1 112 ? 52.934  -1.048  0.563   1.00 13.80  ? 112  GLU A O   1 
ATOM   818  C CB  . GLU A 1 112 ? 53.564  2.070   0.971   1.00 12.38  ? 112  GLU A CB  1 
ATOM   819  C CG  . GLU A 1 112 ? 54.029  2.671   -0.387  1.00 9.13   ? 112  GLU A CG  1 
ATOM   820  C CD  . GLU A 1 112 ? 55.346  3.409   -0.069  1.00 15.04  ? 112  GLU A CD  1 
ATOM   821  O OE1 . GLU A 1 112 ? 55.219  4.556   0.407   1.00 17.77  ? 112  GLU A OE1 1 
ATOM   822  O OE2 . GLU A 1 112 ? 56.470  2.891   -0.240  1.00 12.12  ? 112  GLU A OE2 1 
ATOM   823  N N   . TYR A 1 113 ? 52.267  0.147   -1.213  1.00 12.58  ? 113  TYR A N   1 
ATOM   824  C CA  . TYR A 1 113 ? 52.577  -0.855  -2.184  1.00 13.23  ? 113  TYR A CA  1 
ATOM   825  C C   . TYR A 1 113 ? 52.985  -0.087  -3.450  1.00 14.23  ? 113  TYR A C   1 
ATOM   826  O O   . TYR A 1 113 ? 52.157  0.618   -4.004  1.00 14.35  ? 113  TYR A O   1 
ATOM   827  C CB  . TYR A 1 113 ? 51.457  -1.854  -2.538  1.00 13.92  ? 113  TYR A CB  1 
ATOM   828  C CG  . TYR A 1 113 ? 51.876  -2.668  -3.756  1.00 15.64  ? 113  TYR A CG  1 
ATOM   829  C CD1 . TYR A 1 113 ? 52.790  -3.702  -3.584  1.00 17.70  ? 113  TYR A CD1 1 
ATOM   830  C CD2 . TYR A 1 113 ? 51.452  -2.373  -5.028  1.00 17.17  ? 113  TYR A CD2 1 
ATOM   831  C CE1 . TYR A 1 113 ? 53.241  -4.447  -4.645  1.00 16.59  ? 113  TYR A CE1 1 
ATOM   832  C CE2 . TYR A 1 113 ? 51.896  -3.105  -6.128  1.00 17.31  ? 113  TYR A CE2 1 
ATOM   833  C CZ  . TYR A 1 113 ? 52.775  -4.144  -5.904  1.00 16.08  ? 113  TYR A CZ  1 
ATOM   834  O OH  . TYR A 1 113 ? 53.223  -4.907  -6.937  1.00 14.12  ? 113  TYR A OH  1 
ATOM   835  N N   . SER A 1 114 ? 54.194  -0.340  -3.894  1.00 13.11  ? 114  SER A N   1 
ATOM   836  C CA  . SER A 1 114 ? 54.669  0.203   -5.144  1.00 13.69  ? 114  SER A CA  1 
ATOM   837  C C   . SER A 1 114 ? 55.176  -1.018  -5.909  1.00 13.48  ? 114  SER A C   1 
ATOM   838  O O   . SER A 1 114 ? 56.018  -1.740  -5.366  1.00 13.98  ? 114  SER A O   1 
ATOM   839  C CB  . SER A 1 114 ? 55.864  1.145   -4.944  1.00 14.81  ? 114  SER A CB  1 
ATOM   840  O OG  . SER A 1 114 ? 56.486  1.483   -6.201  1.00 14.12  ? 114  SER A OG  1 
ATOM   841  N N   . PRO A 1 115 ? 54.852  -1.167  -7.179  1.00 13.15  ? 115  PRO A N   1 
ATOM   842  C CA  . PRO A 1 115 ? 55.426  -2.242  -7.975  1.00 13.31  ? 115  PRO A CA  1 
ATOM   843  C C   . PRO A 1 115 ? 56.930  -2.069  -8.172  1.00 13.40  ? 115  PRO A C   1 
ATOM   844  O O   . PRO A 1 115 ? 57.656  -2.989  -8.554  1.00 13.78  ? 115  PRO A O   1 
ATOM   845  C CB  . PRO A 1 115 ? 54.670  -2.167  -9.304  1.00 12.27  ? 115  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 115 ? 53.479  -1.295  -9.069  1.00 12.55  ? 115  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 115 ? 53.845  -0.373  -7.916  1.00 13.24  ? 115  PRO A CD  1 
ATOM   848  N N   . ASN A 1 116 ? 57.486  -0.885  -7.946  1.00 12.66  ? 116  ASN A N   1 
ATOM   849  C CA  . ASN A 1 116 ? 58.869  -0.558  -8.196  1.00 12.94  ? 116  ASN A CA  1 
ATOM   850  C C   . ASN A 1 116 ? 59.751  -0.508  -6.978  1.00 13.57  ? 116  ASN A C   1 
ATOM   851  O O   . ASN A 1 116 ? 60.888  -0.032  -7.075  1.00 14.74  ? 116  ASN A O   1 
ATOM   852  C CB  . ASN A 1 116 ? 58.903  0.794   -8.959  1.00 9.13   ? 116  ASN A CB  1 
ATOM   853  C CG  . ASN A 1 116 ? 58.015  0.772   -10.182 1.00 9.58   ? 116  ASN A CG  1 
ATOM   854  O OD1 . ASN A 1 116 ? 56.771  0.814   -10.134 1.00 8.21   ? 116  ASN A OD1 1 
ATOM   855  N ND2 . ASN A 1 116 ? 58.666  0.713   -11.344 1.00 10.47  ? 116  ASN A ND2 1 
ATOM   856  N N   . ILE A 1 117 ? 59.272  -0.953  -5.818  1.00 14.02  ? 117  ILE A N   1 
ATOM   857  C CA  . ILE A 1 117 ? 60.090  -0.882  -4.613  1.00 14.49  ? 117  ILE A CA  1 
ATOM   858  C C   . ILE A 1 117 ? 60.116  -2.293  -4.007  1.00 17.10  ? 117  ILE A C   1 
ATOM   859  O O   . ILE A 1 117 ? 59.097  -2.958  -3.951  1.00 17.16  ? 117  ILE A O   1 
ATOM   860  C CB  . ILE A 1 117 ? 59.552  0.090   -3.556  1.00 12.26  ? 117  ILE A CB  1 
ATOM   861  C CG1 . ILE A 1 117 ? 59.627  1.542   -4.059  1.00 16.40  ? 117  ILE A CG1 1 
ATOM   862  C CG2 . ILE A 1 117 ? 60.247  -0.068  -2.214  1.00 7.37   ? 117  ILE A CG2 1 
ATOM   863  C CD1 . ILE A 1 117 ? 59.161  2.627   -3.131  1.00 10.78  ? 117  ILE A CD1 1 
ATOM   864  N N   . VAL A 1 118 ? 61.281  -2.784  -3.656  1.00 16.20  ? 118  VAL A N   1 
ATOM   865  C CA  . VAL A 1 118 ? 61.399  -4.049  -2.942  1.00 17.42  ? 118  VAL A CA  1 
ATOM   866  C C   . VAL A 1 118 ? 61.668  -3.685  -1.478  1.00 14.75  ? 118  VAL A C   1 
ATOM   867  O O   . VAL A 1 118 ? 62.706  -3.064  -1.204  1.00 15.17  ? 118  VAL A O   1 
ATOM   868  C CB  . VAL A 1 118 ? 62.550  -4.927  -3.478  1.00 20.22  ? 118  VAL A CB  1 
ATOM   869  C CG1 . VAL A 1 118 ? 62.529  -6.223  -2.707  1.00 19.91  ? 118  VAL A CG1 1 
ATOM   870  C CG2 . VAL A 1 118 ? 62.343  -5.087  -4.977  1.00 19.84  ? 118  VAL A CG2 1 
ATOM   871  N N   . TYR A 1 119 ? 60.747  -4.015  -0.604  1.00 12.46  ? 119  TYR A N   1 
ATOM   872  C CA  . TYR A 1 119 ? 60.834  -3.607  0.789   1.00 12.17  ? 119  TYR A CA  1 
ATOM   873  C C   . TYR A 1 119 ? 61.639  -4.634  1.562   1.00 12.13  ? 119  TYR A C   1 
ATOM   874  O O   . TYR A 1 119 ? 61.120  -5.729  1.775   1.00 11.96  ? 119  TYR A O   1 
ATOM   875  C CB  . TYR A 1 119 ? 59.407  -3.409  1.356   1.00 12.58  ? 119  TYR A CB  1 
ATOM   876  C CG  . TYR A 1 119 ? 58.555  -2.414  0.611   1.00 12.02  ? 119  TYR A CG  1 
ATOM   877  C CD1 . TYR A 1 119 ? 57.949  -2.672  -0.606  1.00 12.71  ? 119  TYR A CD1 1 
ATOM   878  C CD2 . TYR A 1 119 ? 58.360  -1.136  1.130   1.00 14.12  ? 119  TYR A CD2 1 
ATOM   879  C CE1 . TYR A 1 119 ? 57.161  -1.742  -1.276  1.00 12.18  ? 119  TYR A CE1 1 
ATOM   880  C CE2 . TYR A 1 119 ? 57.635  -0.170  0.474   1.00 12.36  ? 119  TYR A CE2 1 
ATOM   881  C CZ  . TYR A 1 119 ? 57.026  -0.487  -0.733  1.00 12.98  ? 119  TYR A CZ  1 
ATOM   882  O OH  . TYR A 1 119 ? 56.294  0.489   -1.365  1.00 11.77  ? 119  TYR A OH  1 
ATOM   883  N N   . GLY A 1 120 ? 62.890  -4.328  1.932   1.00 11.73  ? 120  GLY A N   1 
ATOM   884  C CA  . GLY A 1 120 ? 63.728  -5.238  2.677   1.00 10.15  ? 120  GLY A CA  1 
ATOM   885  C C   . GLY A 1 120 ? 63.747  -5.113  4.179   1.00 10.40  ? 120  GLY A C   1 
ATOM   886  O O   . GLY A 1 120 ? 64.498  -5.854  4.860   1.00 10.19  ? 120  GLY A O   1 
ATOM   887  N N   . GLY A 1 121 ? 63.021  -4.141  4.732   1.00 8.07   ? 121  GLY A N   1 
ATOM   888  C CA  . GLY A 1 121 ? 62.993  -3.963  6.180   1.00 7.98   ? 121  GLY A CA  1 
ATOM   889  C C   . GLY A 1 121 ? 61.552  -4.210  6.665   1.00 8.75   ? 121  GLY A C   1 
ATOM   890  O O   . GLY A 1 121 ? 60.573  -4.284  5.897   1.00 9.35   ? 121  GLY A O   1 
ATOM   891  N N   . PRO A 1 122 ? 61.367  -4.333  7.961   1.00 8.48   ? 122  PRO A N   1 
ATOM   892  C CA  . PRO A 1 122 ? 60.069  -4.734  8.493   1.00 8.16   ? 122  PRO A CA  1 
ATOM   893  C C   . PRO A 1 122 ? 58.954  -3.715  8.454   1.00 9.63   ? 122  PRO A C   1 
ATOM   894  O O   . PRO A 1 122 ? 59.221  -2.546  8.727   1.00 10.21  ? 122  PRO A O   1 
ATOM   895  C CB  . PRO A 1 122 ? 60.348  -4.993  9.969   1.00 7.27   ? 122  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 122 ? 61.716  -4.570  10.285  1.00 6.28   ? 122  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 122 ? 62.449  -4.350  8.975   1.00 7.94   ? 122  PRO A CD  1 
ATOM   898  N N   . ALA A 1 123 ? 57.749  -4.170  8.184   1.00 10.81  ? 123  ALA A N   1 
ATOM   899  C CA  . ALA A 1 123 ? 56.490  -3.453  8.383   1.00 11.02  ? 123  ALA A CA  1 
ATOM   900  C C   . ALA A 1 123 ? 56.146  -3.643  9.856   1.00 11.61  ? 123  ALA A C   1 
ATOM   901  O O   . ALA A 1 123 ? 56.721  -4.492  10.544  1.00 11.36  ? 123  ALA A O   1 
ATOM   902  C CB  . ALA A 1 123 ? 55.481  -4.097  7.468   1.00 11.28  ? 123  ALA A CB  1 
ATOM   903  N N   . PRO A 1 124 ? 55.257  -2.879  10.456  1.00 13.47  ? 124  PRO A N   1 
ATOM   904  C CA  . PRO A 1 124 ? 54.909  -2.949  11.870  1.00 13.43  ? 124  PRO A CA  1 
ATOM   905  C C   . PRO A 1 124 ? 54.463  -4.278  12.424  1.00 13.64  ? 124  PRO A C   1 
ATOM   906  O O   . PRO A 1 124 ? 54.869  -4.614  13.565  1.00 13.11  ? 124  PRO A O   1 
ATOM   907  C CB  . PRO A 1 124 ? 53.790  -1.911  12.026  1.00 14.42  ? 124  PRO A CB  1 
ATOM   908  C CG  . PRO A 1 124 ? 54.054  -0.964  10.903  1.00 12.98  ? 124  PRO A CG  1 
ATOM   909  C CD  . PRO A 1 124 ? 54.415  -1.865  9.765   1.00 12.41  ? 124  PRO A CD  1 
ATOM   910  N N   . ASN A 1 125 ? 53.840  -5.140  11.600  1.00 14.09  ? 125  ASN A N   1 
ATOM   911  C CA  . ASN A 1 125 ? 53.543  -6.500  12.084  1.00 15.55  ? 125  ASN A CA  1 
ATOM   912  C C   . ASN A 1 125 ? 54.820  -7.298  12.294  1.00 15.55  ? 125  ASN A C   1 
ATOM   913  O O   . ASN A 1 125 ? 54.801  -8.330  12.997  1.00 16.53  ? 125  ASN A O   1 
ATOM   914  C CB  . ASN A 1 125 ? 52.588  -7.263  11.154  1.00 16.30  ? 125  ASN A CB  1 
ATOM   915  C CG  . ASN A 1 125 ? 53.174  -7.780  9.868   1.00 16.63  ? 125  ASN A CG  1 
ATOM   916  O OD1 . ASN A 1 125 ? 53.604  -7.040  8.967   1.00 18.38  ? 125  ASN A OD1 1 
ATOM   917  N ND2 . ASN A 1 125 ? 53.237  -9.095  9.684   1.00 12.71  ? 125  ASN A ND2 1 
ATOM   918  N N   . GLN A 1 126 ? 55.958  -6.874  11.738  1.00 16.37  ? 126  GLN A N   1 
ATOM   919  C CA  . GLN A 1 126 ? 57.223  -7.591  11.887  1.00 17.21  ? 126  GLN A CA  1 
ATOM   920  C C   . GLN A 1 126 ? 58.179  -7.090  12.941  1.00 17.02  ? 126  GLN A C   1 
ATOM   921  O O   . GLN A 1 126 ? 59.182  -7.767  13.214  1.00 18.38  ? 126  GLN A O   1 
ATOM   922  C CB  . GLN A 1 126 ? 57.955  -7.666  10.537  1.00 14.06  ? 126  GLN A CB  1 
ATOM   923  C CG  . GLN A 1 126 ? 57.035  -8.066  9.407   1.00 13.32  ? 126  GLN A CG  1 
ATOM   924  C CD  . GLN A 1 126 ? 57.668  -8.079  8.029   1.00 13.84  ? 126  GLN A CD  1 
ATOM   925  O OE1 . GLN A 1 126 ? 57.894  -7.024  7.450   1.00 15.30  ? 126  GLN A OE1 1 
ATOM   926  N NE2 . GLN A 1 126 ? 57.954  -9.225  7.444   1.00 10.59  ? 126  GLN A NE2 1 
ATOM   927  N N   . ASN A 1 127 ? 57.965  -5.957  13.572  1.00 17.80  ? 127  ASN A N   1 
ATOM   928  C CA  . ASN A 1 127 ? 58.818  -5.418  14.614  1.00 17.95  ? 127  ASN A CA  1 
ATOM   929  C C   . ASN A 1 127 ? 57.990  -4.659  15.639  1.00 18.31  ? 127  ASN A C   1 
ATOM   930  O O   . ASN A 1 127 ? 58.220  -4.951  16.815  1.00 19.25  ? 127  ASN A O   1 
ATOM   931  C CB  . ASN A 1 127 ? 59.945  -4.483  14.133  1.00 16.55  ? 127  ASN A CB  1 
ATOM   932  C CG  . ASN A 1 127 ? 59.485  -3.332  13.252  1.00 17.46  ? 127  ASN A CG  1 
ATOM   933  O OD1 . ASN A 1 127 ? 58.302  -3.117  12.915  1.00 15.59  ? 127  ASN A OD1 1 
ATOM   934  N ND2 . ASN A 1 127 ? 60.460  -2.539  12.819  1.00 9.10   ? 127  ASN A ND2 1 
ATOM   935  N N   . SER A 1 128 ? 57.084  -3.746  15.287  1.00 17.60  ? 128  SER A N   1 
ATOM   936  C CA  . SER A 1 128 ? 56.376  -3.050  16.364  1.00 19.06  ? 128  SER A CA  1 
ATOM   937  C C   . SER A 1 128 ? 55.446  -3.958  17.167  1.00 18.22  ? 128  SER A C   1 
ATOM   938  O O   . SER A 1 128 ? 55.465  -3.859  18.405  1.00 18.45  ? 128  SER A O   1 
ATOM   939  C CB  . SER A 1 128 ? 55.558  -1.834  15.906  1.00 20.51  ? 128  SER A CB  1 
ATOM   940  O OG  . SER A 1 128 ? 56.246  -1.084  14.928  1.00 21.27  ? 128  SER A OG  1 
ATOM   941  N N   . ALA A 1 129 ? 54.658  -4.772  16.486  1.00 17.48  ? 129  ALA A N   1 
ATOM   942  C CA  . ALA A 1 129 ? 53.701  -5.679  17.130  1.00 16.59  ? 129  ALA A CA  1 
ATOM   943  C C   . ALA A 1 129 ? 54.370  -6.601  18.123  1.00 16.49  ? 129  ALA A C   1 
ATOM   944  O O   . ALA A 1 129 ? 54.087  -6.543  19.327  1.00 14.72  ? 129  ALA A O   1 
ATOM   945  C CB  . ALA A 1 129 ? 52.840  -6.412  16.092  1.00 11.10  ? 129  ALA A CB  1 
ATOM   946  N N   . PRO A 1 130 ? 55.356  -7.391  17.706  1.00 17.70  ? 130  PRO A N   1 
ATOM   947  C CA  . PRO A 1 130 ? 56.113  -8.222  18.638  1.00 18.83  ? 130  PRO A CA  1 
ATOM   948  C C   . PRO A 1 130 ? 56.738  -7.394  19.751  1.00 19.33  ? 130  PRO A C   1 
ATOM   949  O O   . PRO A 1 130 ? 56.836  -7.827  20.909  1.00 20.05  ? 130  PRO A O   1 
ATOM   950  C CB  . PRO A 1 130 ? 57.188  -8.904  17.813  1.00 17.63  ? 130  PRO A CB  1 
ATOM   951  C CG  . PRO A 1 130 ? 56.965  -8.523  16.395  1.00 16.20  ? 130  PRO A CG  1 
ATOM   952  C CD  . PRO A 1 130 ? 55.813  -7.579  16.326  1.00 16.79  ? 130  PRO A CD  1 
ATOM   953  N N   . LEU A 1 131 ? 57.291  -6.217  19.457  1.00 20.20  ? 131  LEU A N   1 
ATOM   954  C CA  . LEU A 1 131 ? 57.928  -5.422  20.513  1.00 19.29  ? 131  LEU A CA  1 
ATOM   955  C C   . LEU A 1 131 ? 56.881  -5.004  21.569  1.00 20.28  ? 131  LEU A C   1 
ATOM   956  O O   . LEU A 1 131 ? 57.116  -5.031  22.773  1.00 19.51  ? 131  LEU A O   1 
ATOM   957  C CB  . LEU A 1 131 ? 58.626  -4.186  19.960  1.00 14.94  ? 131  LEU A CB  1 
ATOM   958  C CG  . LEU A 1 131 ? 59.136  -3.268  21.087  1.00 15.74  ? 131  LEU A CG  1 
ATOM   959  C CD1 . LEU A 1 131 ? 60.201  -3.976  21.916  1.00 15.25  ? 131  LEU A CD1 1 
ATOM   960  C CD2 . LEU A 1 131 ? 59.663  -1.978  20.506  1.00 19.69  ? 131  LEU A CD2 1 
ATOM   961  N N   . ALA A 1 132 ? 55.728  -4.526  21.101  1.00 18.92  ? 132  ALA A N   1 
ATOM   962  C CA  . ALA A 1 132 ? 54.633  -4.222  21.982  1.00 20.68  ? 132  ALA A CA  1 
ATOM   963  C C   . ALA A 1 132 ? 54.316  -5.404  22.898  1.00 20.50  ? 132  ALA A C   1 
ATOM   964  O O   . ALA A 1 132 ? 54.137  -5.291  24.118  1.00 19.94  ? 132  ALA A O   1 
ATOM   965  C CB  . ALA A 1 132 ? 53.399  -3.940  21.101  1.00 19.92  ? 132  ALA A CB  1 
ATOM   966  N N   . ALA A 1 133 ? 54.206  -6.608  22.319  1.00 20.92  ? 133  ALA A N   1 
ATOM   967  C CA  . ALA A 1 133 ? 53.856  -7.808  23.068  1.00 20.71  ? 133  ALA A CA  1 
ATOM   968  C C   . ALA A 1 133 ? 54.902  -8.018  24.172  1.00 22.33  ? 133  ALA A C   1 
ATOM   969  O O   . ALA A 1 133 ? 54.510  -8.302  25.301  1.00 21.63  ? 133  ALA A O   1 
ATOM   970  C CB  . ALA A 1 133 ? 53.736  -9.023  22.188  1.00 18.90  ? 133  ALA A CB  1 
ATOM   971  N N   . TYR A 1 134 ? 56.170  -7.893  23.820  1.00 21.07  ? 134  TYR A N   1 
ATOM   972  C CA  . TYR A 1 134 ? 57.280  -8.054  24.707  1.00 21.21  ? 134  TYR A CA  1 
ATOM   973  C C   . TYR A 1 134 ? 57.236  -7.038  25.846  1.00 22.31  ? 134  TYR A C   1 
ATOM   974  O O   . TYR A 1 134 ? 57.399  -7.447  26.998  1.00 21.22  ? 134  TYR A O   1 
ATOM   975  C CB  . TYR A 1 134 ? 58.606  -7.987  23.935  1.00 20.25  ? 134  TYR A CB  1 
ATOM   976  C CG  . TYR A 1 134 ? 59.840  -8.329  24.757  1.00 21.59  ? 134  TYR A CG  1 
ATOM   977  C CD1 . TYR A 1 134 ? 60.302  -9.635  24.861  1.00 20.91  ? 134  TYR A CD1 1 
ATOM   978  C CD2 . TYR A 1 134 ? 60.538  -7.335  25.428  1.00 19.94  ? 134  TYR A CD2 1 
ATOM   979  C CE1 . TYR A 1 134 ? 61.419  -9.940  25.621  1.00 22.22  ? 134  TYR A CE1 1 
ATOM   980  C CE2 . TYR A 1 134 ? 61.662  -7.625  26.161  1.00 21.25  ? 134  TYR A CE2 1 
ATOM   981  C CZ  . TYR A 1 134 ? 62.089  -8.928  26.274  1.00 22.99  ? 134  TYR A CZ  1 
ATOM   982  O OH  . TYR A 1 134 ? 63.207  -9.213  27.038  1.00 23.45  ? 134  TYR A OH  1 
ATOM   983  N N   . LEU A 1 135 ? 57.039  -5.761  25.565  1.00 23.51  ? 135  LEU A N   1 
ATOM   984  C CA  . LEU A 1 135 ? 57.073  -4.706  26.572  1.00 24.85  ? 135  LEU A CA  1 
ATOM   985  C C   . LEU A 1 135 ? 55.938  -4.823  27.574  1.00 27.36  ? 135  LEU A C   1 
ATOM   986  O O   . LEU A 1 135 ? 56.138  -4.639  28.783  1.00 27.46  ? 135  LEU A O   1 
ATOM   987  C CB  . LEU A 1 135 ? 57.039  -3.311  25.950  1.00 21.10  ? 135  LEU A CB  1 
ATOM   988  C CG  . LEU A 1 135 ? 58.254  -2.951  25.050  1.00 19.26  ? 135  LEU A CG  1 
ATOM   989  C CD1 . LEU A 1 135 ? 57.991  -1.597  24.396  1.00 18.09  ? 135  LEU A CD1 1 
ATOM   990  C CD2 . LEU A 1 135 ? 59.545  -2.987  25.834  1.00 19.07  ? 135  LEU A CD2 1 
ATOM   991  N N   . ILE A 1 136 ? 54.752  -5.101  27.045  1.00 28.03  ? 136  ILE A N   1 
ATOM   992  C CA  . ILE A 1 136 ? 53.581  -5.292  27.894  1.00 30.77  ? 136  ILE A CA  1 
ATOM   993  C C   . ILE A 1 136 ? 53.788  -6.535  28.760  1.00 33.31  ? 136  ILE A C   1 
ATOM   994  O O   . ILE A 1 136 ? 53.359  -6.510  29.921  1.00 33.52  ? 136  ILE A O   1 
ATOM   995  C CB  . ILE A 1 136 ? 52.299  -5.354  27.051  1.00 29.49  ? 136  ILE A CB  1 
ATOM   996  C CG1 . ILE A 1 136 ? 52.061  -3.972  26.405  1.00 29.06  ? 136  ILE A CG1 1 
ATOM   997  C CG2 . ILE A 1 136 ? 51.124  -5.802  27.898  1.00 28.65  ? 136  ILE A CG2 1 
ATOM   998  C CD1 . ILE A 1 136 ? 51.004  -3.991  25.304  1.00 27.18  ? 136  ILE A CD1 1 
ATOM   999  N N   . ARG A 1 137 ? 54.460  -7.588  28.292  1.00 34.58  ? 137  ARG A N   1 
ATOM   1000 C CA  . ARG A 1 137 ? 54.689  -8.749  29.127  1.00 36.40  ? 137  ARG A CA  1 
ATOM   1001 C C   . ARG A 1 137 ? 55.720  -8.529  30.226  1.00 36.32  ? 137  ARG A C   1 
ATOM   1002 O O   . ARG A 1 137 ? 55.542  -9.040  31.341  1.00 36.53  ? 137  ARG A O   1 
ATOM   1003 C CB  . ARG A 1 137 ? 55.114  -9.990  28.319  1.00 42.04  ? 137  ARG A CB  1 
ATOM   1004 C CG  . ARG A 1 137 ? 54.004  -10.965 27.969  1.00 50.01  ? 137  ARG A CG  1 
ATOM   1005 C CD  . ARG A 1 137 ? 53.305  -10.618 26.672  1.00 56.75  ? 137  ARG A CD  1 
ATOM   1006 N NE  . ARG A 1 137 ? 51.849  -10.533 26.681  1.00 61.88  ? 137  ARG A NE  1 
ATOM   1007 C CZ  . ARG A 1 137 ? 51.169  -9.649  25.942  1.00 64.44  ? 137  ARG A CZ  1 
ATOM   1008 N NH1 . ARG A 1 137 ? 51.847  -8.797  25.176  1.00 65.49  ? 137  ARG A NH1 1 
ATOM   1009 N NH2 . ARG A 1 137 ? 49.843  -9.572  25.932  1.00 64.56  ? 137  ARG A NH2 1 
ATOM   1010 N N   . HIS A 1 138 ? 56.851  -7.884  29.937  1.00 35.65  ? 138  HIS A N   1 
ATOM   1011 C CA  . HIS A 1 138 ? 57.951  -7.783  30.870  1.00 34.13  ? 138  HIS A CA  1 
ATOM   1012 C C   . HIS A 1 138 ? 58.139  -6.458  31.577  1.00 34.89  ? 138  HIS A C   1 
ATOM   1013 O O   . HIS A 1 138 ? 59.064  -6.355  32.410  1.00 35.42  ? 138  HIS A O   1 
ATOM   1014 C CB  . HIS A 1 138 ? 59.266  -8.119  30.121  1.00 33.30  ? 138  HIS A CB  1 
ATOM   1015 C CG  . HIS A 1 138 ? 59.281  -9.435  29.421  1.00 34.02  ? 138  HIS A CG  1 
ATOM   1016 N ND1 . HIS A 1 138 ? 59.335  -10.649 30.071  1.00 35.95  ? 138  HIS A ND1 1 
ATOM   1017 C CD2 . HIS A 1 138 ? 59.190  -9.748  28.105  1.00 33.91  ? 138  HIS A CD2 1 
ATOM   1018 C CE1 . HIS A 1 138 ? 59.296  -11.650 29.208  1.00 34.41  ? 138  HIS A CE1 1 
ATOM   1019 N NE2 . HIS A 1 138 ? 59.200  -11.114 28.002  1.00 34.00  ? 138  HIS A NE2 1 
ATOM   1020 N N   . TYR A 1 139 ? 57.493  -5.368  31.181  1.00 34.01  ? 139  TYR A N   1 
ATOM   1021 C CA  . TYR A 1 139 ? 57.748  -4.060  31.774  1.00 33.96  ? 139  TYR A CA  1 
ATOM   1022 C C   . TYR A 1 139 ? 56.468  -3.395  32.272  1.00 35.21  ? 139  TYR A C   1 
ATOM   1023 O O   . TYR A 1 139 ? 55.364  -3.855  31.960  1.00 35.95  ? 139  TYR A O   1 
ATOM   1024 C CB  . TYR A 1 139 ? 58.462  -3.155  30.781  1.00 32.39  ? 139  TYR A CB  1 
ATOM   1025 C CG  . TYR A 1 139 ? 59.859  -3.594  30.417  1.00 30.75  ? 139  TYR A CG  1 
ATOM   1026 C CD1 . TYR A 1 139 ? 60.957  -3.225  31.174  1.00 29.05  ? 139  TYR A CD1 1 
ATOM   1027 C CD2 . TYR A 1 139 ? 60.054  -4.428  29.313  1.00 29.32  ? 139  TYR A CD2 1 
ATOM   1028 C CE1 . TYR A 1 139 ? 62.221  -3.663  30.819  1.00 29.02  ? 139  TYR A CE1 1 
ATOM   1029 C CE2 . TYR A 1 139 ? 61.302  -4.873  28.964  1.00 27.07  ? 139  TYR A CE2 1 
ATOM   1030 C CZ  . TYR A 1 139 ? 62.387  -4.474  29.717  1.00 27.85  ? 139  TYR A CZ  1 
ATOM   1031 O OH  . TYR A 1 139 ? 63.656  -4.896  29.381  1.00 25.83  ? 139  TYR A OH  1 
ATOM   1032 N N   . GLY A 1 140 ? 56.594  -2.333  33.060  1.00 35.21  ? 140  GLY A N   1 
ATOM   1033 C CA  . GLY A 1 140 ? 55.503  -1.635  33.689  1.00 34.28  ? 140  GLY A CA  1 
ATOM   1034 C C   . GLY A 1 140 ? 54.445  -1.116  32.754  1.00 34.70  ? 140  GLY A C   1 
ATOM   1035 O O   . GLY A 1 140 ? 54.655  -1.024  31.542  1.00 35.71  ? 140  GLY A O   1 
ATOM   1036 N N   . GLU A 1 141 ? 53.312  -0.686  33.295  1.00 34.09  ? 141  GLU A N   1 
ATOM   1037 C CA  . GLU A 1 141 ? 52.223  -0.173  32.483  1.00 33.73  ? 141  GLU A CA  1 
ATOM   1038 C C   . GLU A 1 141 ? 52.368  1.335   32.309  1.00 31.89  ? 141  GLU A C   1 
ATOM   1039 O O   . GLU A 1 141 ? 51.557  1.933   31.597  1.00 32.17  ? 141  GLU A O   1 
ATOM   1040 C CB  . GLU A 1 141 ? 50.858  -0.476  33.112  1.00 39.90  ? 141  GLU A CB  1 
ATOM   1041 C CG  . GLU A 1 141 ? 50.760  0.093   34.519  1.00 48.39  ? 141  GLU A CG  1 
ATOM   1042 C CD  . GLU A 1 141 ? 49.344  0.416   34.946  1.00 55.90  ? 141  GLU A CD  1 
ATOM   1043 O OE1 . GLU A 1 141 ? 48.650  1.205   34.250  1.00 60.86  ? 141  GLU A OE1 1 
ATOM   1044 O OE2 . GLU A 1 141 ? 48.903  -0.125  35.986  1.00 56.90  ? 141  GLU A OE2 1 
ATOM   1045 N N   . ARG A 1 142 ? 53.329  1.952   32.977  1.00 29.02  ? 142  ARG A N   1 
ATOM   1046 C CA  . ARG A 1 142 ? 53.520  3.391   32.755  1.00 28.18  ? 142  ARG A CA  1 
ATOM   1047 C C   . ARG A 1 142 ? 54.552  3.622   31.645  1.00 26.58  ? 142  ARG A C   1 
ATOM   1048 O O   . ARG A 1 142 ? 55.756  3.329   31.770  1.00 25.51  ? 142  ARG A O   1 
ATOM   1049 C CB  . ARG A 1 142 ? 53.878  4.065   34.090  1.00 29.53  ? 142  ARG A CB  1 
ATOM   1050 C CG  . ARG A 1 142 ? 52.757  4.177   35.113  1.00 26.52  ? 142  ARG A CG  1 
ATOM   1051 C CD  . ARG A 1 142 ? 53.279  4.636   36.466  1.00 27.24  ? 142  ARG A CD  1 
ATOM   1052 N NE  . ARG A 1 142 ? 53.822  5.989   36.472  1.00 24.24  ? 142  ARG A NE  1 
ATOM   1053 C CZ  . ARG A 1 142 ? 52.991  7.040   36.411  1.00 25.92  ? 142  ARG A CZ  1 
ATOM   1054 N NH1 . ARG A 1 142 ? 51.670  6.838   36.374  1.00 21.20  ? 142  ARG A NH1 1 
ATOM   1055 N NH2 . ARG A 1 142 ? 53.537  8.248   36.412  1.00 23.76  ? 142  ARG A NH2 1 
ATOM   1056 N N   . VAL A 1 143 ? 54.091  4.146   30.498  1.00 25.10  ? 143  VAL A N   1 
ATOM   1057 C CA  . VAL A 1 143 ? 55.020  4.442   29.411  1.00 22.86  ? 143  VAL A CA  1 
ATOM   1058 C C   . VAL A 1 143 ? 55.007  5.893   28.941  1.00 23.01  ? 143  VAL A C   1 
ATOM   1059 O O   . VAL A 1 143 ? 53.956  6.491   28.717  1.00 23.44  ? 143  VAL A O   1 
ATOM   1060 C CB  . VAL A 1 143 ? 54.777  3.522   28.204  1.00 19.82  ? 143  VAL A CB  1 
ATOM   1061 C CG1 . VAL A 1 143 ? 53.430  3.799   27.535  1.00 15.99  ? 143  VAL A CG1 1 
ATOM   1062 C CG2 . VAL A 1 143 ? 55.955  3.621   27.244  1.00 17.63  ? 143  VAL A CG2 1 
ATOM   1063 N N   . VAL A 1 144 ? 56.181  6.493   28.758  1.00 21.77  ? 144  VAL A N   1 
ATOM   1064 C CA  . VAL A 1 144 ? 56.290  7.836   28.171  1.00 21.65  ? 144  VAL A CA  1 
ATOM   1065 C C   . VAL A 1 144 ? 56.877  7.598   26.775  1.00 20.87  ? 144  VAL A C   1 
ATOM   1066 O O   . VAL A 1 144 ? 57.767  6.734   26.621  1.00 22.03  ? 144  VAL A O   1 
ATOM   1067 C CB  . VAL A 1 144 ? 57.111  8.832   28.975  1.00 23.18  ? 144  VAL A CB  1 
ATOM   1068 C CG1 . VAL A 1 144 ? 58.600  8.459   29.068  1.00 22.30  ? 144  VAL A CG1 1 
ATOM   1069 C CG2 . VAL A 1 144 ? 57.062  10.258  28.432  1.00 22.99  ? 144  VAL A CG2 1 
ATOM   1070 N N   . PHE A 1 145 ? 56.415  8.329   25.777  1.00 20.08  ? 145  PHE A N   1 
ATOM   1071 C CA  . PHE A 1 145 ? 56.911  8.201   24.406  1.00 19.03  ? 145  PHE A CA  1 
ATOM   1072 C C   . PHE A 1 145 ? 57.792  9.393   24.011  1.00 18.12  ? 145  PHE A C   1 
ATOM   1073 O O   . PHE A 1 145 ? 57.428  10.527  24.329  1.00 17.70  ? 145  PHE A O   1 
ATOM   1074 C CB  . PHE A 1 145 ? 55.700  8.147   23.483  1.00 20.22  ? 145  PHE A CB  1 
ATOM   1075 C CG  . PHE A 1 145 ? 54.829  6.967   23.269  1.00 19.35  ? 145  PHE A CG  1 
ATOM   1076 C CD1 . PHE A 1 145 ? 54.934  5.793   23.985  1.00 20.06  ? 145  PHE A CD1 1 
ATOM   1077 C CD2 . PHE A 1 145 ? 53.812  7.044   22.314  1.00 22.10  ? 145  PHE A CD2 1 
ATOM   1078 C CE1 . PHE A 1 145 ? 54.139  4.688   23.782  1.00 15.75  ? 145  PHE A CE1 1 
ATOM   1079 C CE2 . PHE A 1 145 ? 52.952  5.957   22.098  1.00 20.28  ? 145  PHE A CE2 1 
ATOM   1080 C CZ  . PHE A 1 145 ? 53.140  4.795   22.831  1.00 20.23  ? 145  PHE A CZ  1 
ATOM   1081 N N   . ILE A 1 146 ? 58.898  9.208   23.325  1.00 16.36  ? 146  ILE A N   1 
ATOM   1082 C CA  . ILE A 1 146 ? 59.799  10.217  22.811  1.00 17.02  ? 146  ILE A CA  1 
ATOM   1083 C C   . ILE A 1 146 ? 60.239  9.872   21.367  1.00 17.41  ? 146  ILE A C   1 
ATOM   1084 O O   . ILE A 1 146 ? 60.781  8.779   21.089  1.00 18.03  ? 146  ILE A O   1 
ATOM   1085 C CB  . ILE A 1 146 ? 61.067  10.499  23.633  1.00 17.92  ? 146  ILE A CB  1 
ATOM   1086 C CG1 . ILE A 1 146 ? 61.839  11.652  22.946  1.00 20.45  ? 146  ILE A CG1 1 
ATOM   1087 C CG2 . ILE A 1 146 ? 62.025  9.324   23.756  1.00 12.38  ? 146  ILE A CG2 1 
ATOM   1088 C CD1 . ILE A 1 146 ? 61.913  12.893  23.784  1.00 20.54  ? 146  ILE A CD1 1 
ATOM   1089 N N   . GLY A 1 147 ? 59.925  10.735  20.407  1.00 16.64  ? 147  GLY A N   1 
ATOM   1090 C CA  . GLY A 1 147 ? 60.283  10.497  19.019  1.00 16.43  ? 147  GLY A CA  1 
ATOM   1091 C C   . GLY A 1 147 ? 60.832  11.726  18.295  1.00 15.93  ? 147  GLY A C   1 
ATOM   1092 O O   . GLY A 1 147 ? 60.701  12.887  18.709  1.00 15.86  ? 147  GLY A O   1 
ATOM   1093 N N   . SER A 1 148 ? 61.457  11.460  17.156  1.00 15.02  ? 148  SER A N   1 
ATOM   1094 C CA  . SER A 1 148 ? 61.919  12.528  16.281  1.00 14.24  ? 148  SER A CA  1 
ATOM   1095 C C   . SER A 1 148 ? 60.654  13.015  15.567  1.00 13.52  ? 148  SER A C   1 
ATOM   1096 O O   . SER A 1 148 ? 59.752  12.231  15.341  1.00 13.88  ? 148  SER A O   1 
ATOM   1097 C CB  . SER A 1 148 ? 62.999  12.124  15.274  1.00 7.24   ? 148  SER A CB  1 
ATOM   1098 O OG  . SER A 1 148 ? 64.105  11.745  16.050  1.00 9.32   ? 148  SER A OG  1 
ATOM   1099 N N   . ASP A 1 149 ? 60.569  14.297  15.266  1.00 14.35  ? 149  ASP A N   1 
ATOM   1100 C CA  . ASP A 1 149 ? 59.398  14.872  14.652  1.00 15.23  ? 149  ASP A CA  1 
ATOM   1101 C C   . ASP A 1 149 ? 59.304  14.769  13.125  1.00 14.93  ? 149  ASP A C   1 
ATOM   1102 O O   . ASP A 1 149 ? 59.658  15.699  12.409  1.00 15.22  ? 149  ASP A O   1 
ATOM   1103 C CB  . ASP A 1 149 ? 59.278  16.342  15.059  1.00 15.18  ? 149  ASP A CB  1 
ATOM   1104 C CG  . ASP A 1 149 ? 57.892  16.846  14.641  1.00 22.07  ? 149  ASP A CG  1 
ATOM   1105 O OD1 . ASP A 1 149 ? 56.999  16.117  14.163  1.00 21.76  ? 149  ASP A OD1 1 
ATOM   1106 O OD2 . ASP A 1 149 ? 57.675  18.046  14.855  1.00 25.67  ? 149  ASP A OD2 1 
ATOM   1107 N N   . TYR A 1 150 ? 58.800  13.669  12.625  1.00 14.29  ? 150  TYR A N   1 
ATOM   1108 C CA  . TYR A 1 150 ? 58.530  13.404  11.218  1.00 13.52  ? 150  TYR A CA  1 
ATOM   1109 C C   . TYR A 1 150 ? 57.614  12.173  11.234  1.00 13.98  ? 150  TYR A C   1 
ATOM   1110 O O   . TYR A 1 150 ? 57.306  11.615  12.328  1.00 11.47  ? 150  TYR A O   1 
ATOM   1111 C CB  . TYR A 1 150 ? 59.798  13.294  10.363  1.00 13.03  ? 150  TYR A CB  1 
ATOM   1112 C CG  . TYR A 1 150 ? 60.530  11.970  10.468  1.00 12.07  ? 150  TYR A CG  1 
ATOM   1113 C CD1 . TYR A 1 150 ? 61.313  11.637  11.548  1.00 13.06  ? 150  TYR A CD1 1 
ATOM   1114 C CD2 . TYR A 1 150 ? 60.399  11.022  9.466   1.00 12.04  ? 150  TYR A CD2 1 
ATOM   1115 C CE1 . TYR A 1 150 ? 61.961  10.406  11.628  1.00 14.56  ? 150  TYR A CE1 1 
ATOM   1116 C CE2 . TYR A 1 150 ? 61.007  9.792   9.535   1.00 13.07  ? 150  TYR A CE2 1 
ATOM   1117 C CZ  . TYR A 1 150 ? 61.808  9.487   10.618  1.00 14.74  ? 150  TYR A CZ  1 
ATOM   1118 O OH  . TYR A 1 150 ? 62.427  8.250   10.672  1.00 14.30  ? 150  TYR A OH  1 
ATOM   1119 N N   . ILE A 1 151 ? 57.130  11.754  10.065  1.00 13.74  ? 151  ILE A N   1 
ATOM   1120 C CA  . ILE A 1 151 ? 56.080  10.774  9.944   1.00 13.26  ? 151  ILE A CA  1 
ATOM   1121 C C   . ILE A 1 151 ? 56.256  9.426   10.617  1.00 14.72  ? 151  ILE A C   1 
ATOM   1122 O O   . ILE A 1 151 ? 55.266  8.951   11.256  1.00 12.68  ? 151  ILE A O   1 
ATOM   1123 C CB  . ILE A 1 151 ? 55.640  10.613  8.467   1.00 15.14  ? 151  ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 151 ? 54.316  9.821   8.337   1.00 14.76  ? 151  ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 151 ? 56.668  9.926   7.588   1.00 13.46  ? 151  ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 151 ? 53.096  10.565  8.859   1.00 12.17  ? 151  ILE A CD1 1 
ATOM   1127 N N   . TYR A 1 152 ? 57.439  8.808   10.491  1.00 13.58  ? 152  TYR A N   1 
ATOM   1128 C CA  . TYR A 1 152 ? 57.618  7.455   11.038  1.00 13.43  ? 152  TYR A CA  1 
ATOM   1129 C C   . TYR A 1 152 ? 57.434  7.355   12.530  1.00 13.15  ? 152  TYR A C   1 
ATOM   1130 O O   . TYR A 1 152 ? 56.633  6.540   12.996  1.00 14.05  ? 152  TYR A O   1 
ATOM   1131 C CB  . TYR A 1 152 ? 58.906  6.805   10.516  1.00 12.90  ? 152  TYR A CB  1 
ATOM   1132 C CG  . TYR A 1 152 ? 59.137  5.439   11.127  1.00 12.44  ? 152  TYR A CG  1 
ATOM   1133 C CD1 . TYR A 1 152 ? 58.435  4.340   10.632  1.00 14.26  ? 152  TYR A CD1 1 
ATOM   1134 C CD2 . TYR A 1 152 ? 59.929  5.267   12.258  1.00 12.56  ? 152  TYR A CD2 1 
ATOM   1135 C CE1 . TYR A 1 152 ? 58.567  3.094   11.200  1.00 14.59  ? 152  TYR A CE1 1 
ATOM   1136 C CE2 . TYR A 1 152 ? 60.057  4.022   12.843  1.00 15.45  ? 152  TYR A CE2 1 
ATOM   1137 C CZ  . TYR A 1 152 ? 59.415  2.927   12.285  1.00 17.05  ? 152  TYR A CZ  1 
ATOM   1138 O OH  . TYR A 1 152 ? 59.554  1.668   12.837  1.00 17.09  ? 152  TYR A OH  1 
ATOM   1139 N N   . PRO A 1 153 ? 58.084  8.135   13.370  1.00 14.01  ? 153  PRO A N   1 
ATOM   1140 C CA  . PRO A 1 153 ? 57.865  8.153   14.820  1.00 13.85  ? 153  PRO A CA  1 
ATOM   1141 C C   . PRO A 1 153 ? 56.396  8.413   15.179  1.00 14.05  ? 153  PRO A C   1 
ATOM   1142 O O   . PRO A 1 153 ? 55.794  7.771   16.045  1.00 11.77  ? 153  PRO A O   1 
ATOM   1143 C CB  . PRO A 1 153 ? 58.795  9.236   15.321  1.00 13.72  ? 153  PRO A CB  1 
ATOM   1144 C CG  . PRO A 1 153 ? 59.935  9.184   14.300  1.00 14.76  ? 153  PRO A CG  1 
ATOM   1145 C CD  . PRO A 1 153 ? 59.146  9.118   12.979  1.00 14.79  ? 153  PRO A CD  1 
ATOM   1146 N N   . ARG A 1 154 ? 55.751  9.305   14.444  1.00 12.66  ? 154  ARG A N   1 
ATOM   1147 C CA  . ARG A 1 154 ? 54.364  9.662   14.660  1.00 15.06  ? 154  ARG A CA  1 
ATOM   1148 C C   . ARG A 1 154 ? 53.434  8.485   14.369  1.00 15.92  ? 154  ARG A C   1 
ATOM   1149 O O   . ARG A 1 154 ? 52.580  8.167   15.197  1.00 16.57  ? 154  ARG A O   1 
ATOM   1150 C CB  . ARG A 1 154 ? 53.939  10.914  13.872  1.00 8.71   ? 154  ARG A CB  1 
ATOM   1151 C CG  . ARG A 1 154 ? 54.593  12.121  14.554  1.00 16.04  ? 154  ARG A CG  1 
ATOM   1152 C CD  . ARG A 1 154 ? 54.416  13.369  13.725  1.00 17.53  ? 154  ARG A CD  1 
ATOM   1153 N NE  . ARG A 1 154 ? 54.834  14.572  14.421  1.00 20.73  ? 154  ARG A NE  1 
ATOM   1154 C CZ  . ARG A 1 154 ? 54.271  15.251  15.406  1.00 16.48  ? 154  ARG A CZ  1 
ATOM   1155 N NH1 . ARG A 1 154 ? 53.134  14.848  15.930  1.00 16.52  ? 154  ARG A NH1 1 
ATOM   1156 N NH2 . ARG A 1 154 ? 54.862  16.334  15.871  1.00 14.22  ? 154  ARG A NH2 1 
ATOM   1157 N N   . GLU A 1 155 ? 53.613  7.839   13.232  1.00 15.82  ? 155  GLU A N   1 
ATOM   1158 C CA  . GLU A 1 155 ? 52.804  6.686   12.893  1.00 15.28  ? 155  GLU A CA  1 
ATOM   1159 C C   . GLU A 1 155 ? 53.135  5.551   13.849  1.00 15.65  ? 155  GLU A C   1 
ATOM   1160 O O   . GLU A 1 155 ? 52.199  4.887   14.313  1.00 15.70  ? 155  GLU A O   1 
ATOM   1161 C CB  . GLU A 1 155 ? 53.023  6.293   11.426  1.00 13.40  ? 155  GLU A CB  1 
ATOM   1162 C CG  . GLU A 1 155 ? 52.414  7.265   10.451  1.00 16.94  ? 155  GLU A CG  1 
ATOM   1163 C CD  . GLU A 1 155 ? 50.902  7.134   10.308  1.00 18.24  ? 155  GLU A CD  1 
ATOM   1164 O OE1 . GLU A 1 155 ? 50.290  6.339   11.020  1.00 12.33  ? 155  GLU A OE1 1 
ATOM   1165 O OE2 . GLU A 1 155 ? 50.317  7.816   9.441   1.00 17.92  ? 155  GLU A OE2 1 
ATOM   1166 N N   . SER A 1 156 ? 54.429  5.332   14.159  1.00 15.45  ? 156  SER A N   1 
ATOM   1167 C CA  . SER A 1 156 ? 54.764  4.277   15.099  1.00 17.10  ? 156  SER A CA  1 
ATOM   1168 C C   . SER A 1 156 ? 54.071  4.496   16.457  1.00 18.32  ? 156  SER A C   1 
ATOM   1169 O O   . SER A 1 156 ? 53.562  3.566   17.101  1.00 17.29  ? 156  SER A O   1 
ATOM   1170 C CB  . SER A 1 156 ? 56.281  4.118   15.303  1.00 14.94  ? 156  SER A CB  1 
ATOM   1171 O OG  . SER A 1 156 ? 56.922  3.833   14.050  1.00 15.13  ? 156  SER A OG  1 
ATOM   1172 N N   . ASN A 1 157 ? 54.065  5.747   16.934  1.00 17.70  ? 157  ASN A N   1 
ATOM   1173 C CA  . ASN A 1 157 ? 53.476  6.065   18.220  1.00 17.95  ? 157  ASN A CA  1 
ATOM   1174 C C   . ASN A 1 157 ? 51.975  5.922   18.212  1.00 18.29  ? 157  ASN A C   1 
ATOM   1175 O O   . ASN A 1 157 ? 51.356  5.649   19.247  1.00 19.33  ? 157  ASN A O   1 
ATOM   1176 C CB  . ASN A 1 157 ? 53.923  7.462   18.680  1.00 20.24  ? 157  ASN A CB  1 
ATOM   1177 C CG  . ASN A 1 157 ? 55.360  7.403   19.205  1.00 18.99  ? 157  ASN A CG  1 
ATOM   1178 O OD1 . ASN A 1 157 ? 55.858  6.330   19.516  1.00 18.95  ? 157  ASN A OD1 1 
ATOM   1179 N ND2 . ASN A 1 157 ? 56.027  8.526   19.271  1.00 18.72  ? 157  ASN A ND2 1 
ATOM   1180 N N   . HIS A 1 158 ? 51.332  6.181   17.098  1.00 17.66  ? 158  HIS A N   1 
ATOM   1181 C CA  . HIS A 1 158 ? 49.882  6.008   16.964  1.00 17.64  ? 158  HIS A CA  1 
ATOM   1182 C C   . HIS A 1 158 ? 49.528  4.540   17.197  1.00 19.64  ? 158  HIS A C   1 
ATOM   1183 O O   . HIS A 1 158 ? 48.594  4.179   17.918  1.00 21.36  ? 158  HIS A O   1 
ATOM   1184 C CB  . HIS A 1 158 ? 49.558  6.361   15.519  1.00 15.38  ? 158  HIS A CB  1 
ATOM   1185 C CG  . HIS A 1 158 ? 48.114  6.235   15.173  1.00 19.36  ? 158  HIS A CG  1 
ATOM   1186 N ND1 . HIS A 1 158 ? 47.241  7.288   15.343  1.00 18.19  ? 158  HIS A ND1 1 
ATOM   1187 C CD2 . HIS A 1 158 ? 47.393  5.220   14.619  1.00 16.21  ? 158  HIS A CD2 1 
ATOM   1188 C CE1 . HIS A 1 158 ? 46.040  6.928   14.941  1.00 17.58  ? 158  HIS A CE1 1 
ATOM   1189 N NE2 . HIS A 1 158 ? 46.115  5.685   14.516  1.00 16.69  ? 158  HIS A NE2 1 
ATOM   1190 N N   . VAL A 1 159 ? 50.287  3.628   16.577  1.00 19.15  ? 159  VAL A N   1 
ATOM   1191 C CA  . VAL A 1 159 ? 50.074  2.204   16.761  1.00 19.82  ? 159  VAL A CA  1 
ATOM   1192 C C   . VAL A 1 159 ? 50.414  1.793   18.199  1.00 21.31  ? 159  VAL A C   1 
ATOM   1193 O O   . VAL A 1 159 ? 49.575  1.203   18.897  1.00 19.81  ? 159  VAL A O   1 
ATOM   1194 C CB  . VAL A 1 159 ? 50.841  1.389   15.712  1.00 18.11  ? 159  VAL A CB  1 
ATOM   1195 C CG1 . VAL A 1 159 ? 50.961  -0.054  16.120  1.00 16.94  ? 159  VAL A CG1 1 
ATOM   1196 C CG2 . VAL A 1 159 ? 50.117  1.530   14.367  1.00 20.93  ? 159  VAL A CG2 1 
ATOM   1197 N N   . MET A 1 160 ? 51.598  2.175   18.695  1.00 20.95  ? 160  MET A N   1 
ATOM   1198 C CA  . MET A 1 160 ? 52.003  1.822   20.047  1.00 21.81  ? 160  MET A CA  1 
ATOM   1199 C C   . MET A 1 160 ? 51.071  2.315   21.153  1.00 22.24  ? 160  MET A C   1 
ATOM   1200 O O   . MET A 1 160 ? 50.788  1.611   22.135  1.00 20.07  ? 160  MET A O   1 
ATOM   1201 C CB  . MET A 1 160 ? 53.434  2.303   20.305  1.00 20.46  ? 160  MET A CB  1 
ATOM   1202 C CG  . MET A 1 160 ? 54.119  1.676   21.501  1.00 22.11  ? 160  MET A CG  1 
ATOM   1203 S SD  . MET A 1 160 ? 54.185  -0.099  21.555  1.00 20.19  ? 160  MET A SD  1 
ATOM   1204 C CE  . MET A 1 160 ? 55.209  -0.615  20.206  1.00 19.26  ? 160  MET A CE  1 
ATOM   1205 N N   . ARG A 1 161 ? 50.591  3.550   21.061  1.00 22.96  ? 161  ARG A N   1 
ATOM   1206 C CA  . ARG A 1 161 ? 49.726  4.084   22.101  1.00 24.47  ? 161  ARG A CA  1 
ATOM   1207 C C   . ARG A 1 161 ? 48.394  3.346   22.118  1.00 25.80  ? 161  ARG A C   1 
ATOM   1208 O O   . ARG A 1 161 ? 47.924  3.043   23.209  1.00 25.03  ? 161  ARG A O   1 
ATOM   1209 C CB  . ARG A 1 161 ? 49.509  5.578   22.006  1.00 28.43  ? 161  ARG A CB  1 
ATOM   1210 C CG  . ARG A 1 161 ? 48.530  6.030   20.947  1.00 34.11  ? 161  ARG A CG  1 
ATOM   1211 C CD  . ARG A 1 161 ? 48.144  7.490   21.295  1.00 39.69  ? 161  ARG A CD  1 
ATOM   1212 N NE  . ARG A 1 161 ? 47.488  8.057   20.126  1.00 42.24  ? 161  ARG A NE  1 
ATOM   1213 C CZ  . ARG A 1 161 ? 48.068  8.649   19.095  1.00 42.25  ? 161  ARG A CZ  1 
ATOM   1214 N NH1 . ARG A 1 161 ? 49.394  8.769   19.153  1.00 40.94  ? 161  ARG A NH1 1 
ATOM   1215 N NH2 . ARG A 1 161 ? 47.247  9.061   18.137  1.00 40.78  ? 161  ARG A NH2 1 
ATOM   1216 N N   . HIS A 1 162 ? 47.855  2.992   20.954  1.00 26.09  ? 162  HIS A N   1 
ATOM   1217 C CA  . HIS A 1 162 ? 46.620  2.235   20.907  1.00 27.41  ? 162  HIS A CA  1 
ATOM   1218 C C   . HIS A 1 162 ? 46.823  0.899   21.601  1.00 26.71  ? 162  HIS A C   1 
ATOM   1219 O O   . HIS A 1 162 ? 46.018  0.461   22.417  1.00 26.21  ? 162  HIS A O   1 
ATOM   1220 C CB  . HIS A 1 162 ? 46.177  2.052   19.445  1.00 31.08  ? 162  HIS A CB  1 
ATOM   1221 C CG  . HIS A 1 162 ? 45.331  3.197   18.986  1.00 38.83  ? 162  HIS A CG  1 
ATOM   1222 N ND1 . HIS A 1 162 ? 45.688  4.534   19.137  1.00 41.77  ? 162  HIS A ND1 1 
ATOM   1223 C CD2 . HIS A 1 162 ? 44.120  3.208   18.370  1.00 40.71  ? 162  HIS A CD2 1 
ATOM   1224 C CE1 . HIS A 1 162 ? 44.726  5.305   18.657  1.00 41.27  ? 162  HIS A CE1 1 
ATOM   1225 N NE2 . HIS A 1 162 ? 43.793  4.525   18.156  1.00 39.67  ? 162  HIS A NE2 1 
ATOM   1226 N N   . LEU A 1 163 ? 47.942  0.258   21.295  1.00 26.22  ? 163  LEU A N   1 
ATOM   1227 C CA  . LEU A 1 163 ? 48.293  -1.035  21.857  1.00 26.83  ? 163  LEU A CA  1 
ATOM   1228 C C   . LEU A 1 163 ? 48.403  -1.030  23.376  1.00 27.23  ? 163  LEU A C   1 
ATOM   1229 O O   . LEU A 1 163 ? 47.845  -1.903  24.051  1.00 25.43  ? 163  LEU A O   1 
ATOM   1230 C CB  . LEU A 1 163 ? 49.538  -1.547  21.135  1.00 25.61  ? 163  LEU A CB  1 
ATOM   1231 C CG  . LEU A 1 163 ? 49.403  -2.627  20.084  1.00 27.88  ? 163  LEU A CG  1 
ATOM   1232 C CD1 . LEU A 1 163 ? 47.990  -2.781  19.516  1.00 26.39  ? 163  LEU A CD1 1 
ATOM   1233 C CD2 . LEU A 1 163 ? 50.418  -2.472  18.963  1.00 27.26  ? 163  LEU A CD2 1 
ATOM   1234 N N   . TYR A 1 164 ? 49.119  -0.064  23.942  1.00 26.21  ? 164  TYR A N   1 
ATOM   1235 C CA  . TYR A 1 164 ? 49.207  0.082   25.377  1.00 27.44  ? 164  TYR A CA  1 
ATOM   1236 C C   . TYR A 1 164 ? 47.830  0.379   26.006  1.00 28.71  ? 164  TYR A C   1 
ATOM   1237 O O   . TYR A 1 164 ? 47.502  -0.223  27.023  1.00 27.32  ? 164  TYR A O   1 
ATOM   1238 C CB  . TYR A 1 164 ? 50.159  1.225   25.751  1.00 25.10  ? 164  TYR A CB  1 
ATOM   1239 C CG  . TYR A 1 164 ? 51.555  0.744   26.029  1.00 24.90  ? 164  TYR A CG  1 
ATOM   1240 C CD1 . TYR A 1 164 ? 52.489  0.592   24.996  1.00 25.20  ? 164  TYR A CD1 1 
ATOM   1241 C CD2 . TYR A 1 164 ? 51.928  0.400   27.326  1.00 24.19  ? 164  TYR A CD2 1 
ATOM   1242 C CE1 . TYR A 1 164 ? 53.774  0.147   25.263  1.00 25.09  ? 164  TYR A CE1 1 
ATOM   1243 C CE2 . TYR A 1 164 ? 53.211  -0.051  27.586  1.00 24.48  ? 164  TYR A CE2 1 
ATOM   1244 C CZ  . TYR A 1 164 ? 54.125  -0.167  26.563  1.00 25.16  ? 164  TYR A CZ  1 
ATOM   1245 O OH  . TYR A 1 164 ? 55.399  -0.606  26.830  1.00 25.88  ? 164  TYR A OH  1 
ATOM   1246 N N   . ARG A 1 165 ? 47.059  1.308   25.437  1.00 29.87  ? 165  ARG A N   1 
ATOM   1247 C CA  . ARG A 1 165 ? 45.757  1.658   25.979  1.00 34.21  ? 165  ARG A CA  1 
ATOM   1248 C C   . ARG A 1 165 ? 44.781  0.469   25.986  1.00 36.02  ? 165  ARG A C   1 
ATOM   1249 O O   . ARG A 1 165 ? 44.027  0.293   26.937  1.00 36.74  ? 165  ARG A O   1 
ATOM   1250 C CB  . ARG A 1 165 ? 45.051  2.820   25.292  1.00 35.40  ? 165  ARG A CB  1 
ATOM   1251 C CG  . ARG A 1 165 ? 45.627  4.160   25.721  1.00 40.15  ? 165  ARG A CG  1 
ATOM   1252 C CD  . ARG A 1 165 ? 45.177  5.255   24.769  1.00 43.41  ? 165  ARG A CD  1 
ATOM   1253 N NE  . ARG A 1 165 ? 45.726  6.541   25.209  1.00 48.69  ? 165  ARG A NE  1 
ATOM   1254 C CZ  . ARG A 1 165 ? 45.690  7.628   24.440  1.00 52.99  ? 165  ARG A CZ  1 
ATOM   1255 N NH1 . ARG A 1 165 ? 45.154  7.580   23.216  1.00 55.82  ? 165  ARG A NH1 1 
ATOM   1256 N NH2 . ARG A 1 165 ? 46.211  8.752   24.909  1.00 53.14  ? 165  ARG A NH2 1 
ATOM   1257 N N   . GLN A 1 166 ? 44.866  -0.371  24.989  1.00 36.03  ? 166  GLN A N   1 
ATOM   1258 C CA  . GLN A 1 166 ? 44.070  -1.561  24.825  1.00 38.02  ? 166  GLN A CA  1 
ATOM   1259 C C   . GLN A 1 166 ? 44.570  -2.763  25.597  1.00 38.06  ? 166  GLN A C   1 
ATOM   1260 O O   . GLN A 1 166 ? 43.915  -3.810  25.587  1.00 38.14  ? 166  GLN A O   1 
ATOM   1261 C CB  . GLN A 1 166 ? 44.043  -1.746  23.326  1.00 43.48  ? 166  GLN A CB  1 
ATOM   1262 C CG  . GLN A 1 166 ? 43.880  -3.064  22.635  1.00 49.27  ? 166  GLN A CG  1 
ATOM   1263 C CD  . GLN A 1 166 ? 42.850  -2.839  21.529  1.00 53.20  ? 166  GLN A CD  1 
ATOM   1264 O OE1 . GLN A 1 166 ? 42.804  -1.755  20.931  1.00 54.89  ? 166  GLN A OE1 1 
ATOM   1265 N NE2 . GLN A 1 166 ? 42.027  -3.867  21.343  1.00 55.43  ? 166  GLN A NE2 1 
ATOM   1266 N N   . HIS A 1 167 ? 45.709  -2.691  26.282  1.00 37.18  ? 167  HIS A N   1 
ATOM   1267 C CA  . HIS A 1 167 ? 46.235  -3.785  27.069  1.00 36.41  ? 167  HIS A CA  1 
ATOM   1268 C C   . HIS A 1 167 ? 46.477  -3.348  28.505  1.00 37.48  ? 167  HIS A C   1 
ATOM   1269 O O   . HIS A 1 167 ? 47.428  -3.813  29.137  1.00 37.96  ? 167  HIS A O   1 
ATOM   1270 C CB  . HIS A 1 167 ? 47.544  -4.344  26.471  1.00 33.94  ? 167  HIS A CB  1 
ATOM   1271 C CG  . HIS A 1 167 ? 47.180  -5.188  25.286  1.00 32.82  ? 167  HIS A CG  1 
ATOM   1272 N ND1 . HIS A 1 167 ? 46.937  -4.606  24.068  1.00 31.78  ? 167  HIS A ND1 1 
ATOM   1273 C CD2 . HIS A 1 167 ? 46.923  -6.510  25.155  1.00 31.65  ? 167  HIS A CD2 1 
ATOM   1274 C CE1 . HIS A 1 167 ? 46.547  -5.540  23.225  1.00 32.43  ? 167  HIS A CE1 1 
ATOM   1275 N NE2 . HIS A 1 167 ? 46.563  -6.707  23.841  1.00 31.96  ? 167  HIS A NE2 1 
ATOM   1276 N N   . GLY A 1 168 ? 45.690  -2.414  29.030  1.00 37.61  ? 168  GLY A N   1 
ATOM   1277 C CA  . GLY A 1 168 ? 45.865  -1.961  30.386  1.00 39.28  ? 168  GLY A CA  1 
ATOM   1278 C C   . GLY A 1 168 ? 46.882  -0.914  30.751  1.00 40.02  ? 168  GLY A C   1 
ATOM   1279 O O   . GLY A 1 168 ? 46.864  -0.457  31.912  1.00 41.17  ? 168  GLY A O   1 
ATOM   1280 N N   . GLY A 1 169 ? 47.755  -0.452  29.848  1.00 39.66  ? 169  GLY A N   1 
ATOM   1281 C CA  . GLY A 1 169 ? 48.769  0.533   30.117  1.00 36.25  ? 169  GLY A CA  1 
ATOM   1282 C C   . GLY A 1 169 ? 48.328  1.974   30.019  1.00 36.33  ? 169  GLY A C   1 
ATOM   1283 O O   . GLY A 1 169 ? 47.244  2.313   29.558  1.00 35.33  ? 169  GLY A O   1 
ATOM   1284 N N   . THR A 1 170 ? 49.203  2.899   30.421  1.00 36.35  ? 170  THR A N   1 
ATOM   1285 C CA  . THR A 1 170 ? 48.937  4.325   30.380  1.00 35.94  ? 170  THR A CA  1 
ATOM   1286 C C   . THR A 1 170 ? 50.044  5.062   29.620  1.00 35.15  ? 170  THR A C   1 
ATOM   1287 O O   . THR A 1 170 ? 51.208  5.063   30.050  1.00 35.12  ? 170  THR A O   1 
ATOM   1288 C CB  . THR A 1 170 ? 48.900  4.941   31.797  1.00 38.93  ? 170  THR A CB  1 
ATOM   1289 O OG1 . THR A 1 170 ? 48.152  4.144   32.720  1.00 41.93  ? 170  THR A OG1 1 
ATOM   1290 C CG2 . THR A 1 170 ? 48.349  6.357   31.771  1.00 38.43  ? 170  THR A CG2 1 
ATOM   1291 N N   . VAL A 1 171 ? 49.688  5.757   28.556  1.00 33.48  ? 171  VAL A N   1 
ATOM   1292 C CA  . VAL A 1 171 ? 50.648  6.545   27.795  1.00 33.34  ? 171  VAL A CA  1 
ATOM   1293 C C   . VAL A 1 171 ? 50.731  7.917   28.456  1.00 34.16  ? 171  VAL A C   1 
ATOM   1294 O O   . VAL A 1 171 ? 49.801  8.710   28.279  1.00 35.35  ? 171  VAL A O   1 
ATOM   1295 C CB  . VAL A 1 171 ? 50.293  6.703   26.299  1.00 32.85  ? 171  VAL A CB  1 
ATOM   1296 C CG1 . VAL A 1 171 ? 51.371  7.533   25.581  1.00 32.46  ? 171  VAL A CG1 1 
ATOM   1297 C CG2 . VAL A 1 171 ? 50.142  5.366   25.595  1.00 28.02  ? 171  VAL A CG2 1 
ATOM   1298 N N   . LEU A 1 172 ? 51.746  8.177   29.267  1.00 33.30  ? 172  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 172 ? 51.858  9.384   30.040  1.00 34.05  ? 172  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 172 ? 52.222  10.666  29.305  1.00 35.43  ? 172  LEU A C   1 
ATOM   1301 O O   . LEU A 1 172 ? 52.086  11.772  29.844  1.00 37.80  ? 172  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 172 ? 52.963  9.209   31.105  1.00 30.03  ? 172  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 172 ? 52.756  8.140   32.159  1.00 29.20  ? 172  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 172 ? 54.038  7.970   32.949  1.00 26.38  ? 172  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 172 ? 51.611  8.483   33.114  1.00 29.48  ? 172  LEU A CD2 1 
ATOM   1306 N N   . GLU A 1 173 ? 52.777  10.552  28.114  1.00 35.03  ? 173  GLU A N   1 
ATOM   1307 C CA  . GLU A 1 173 ? 53.206  11.698  27.357  1.00 32.68  ? 173  GLU A CA  1 
ATOM   1308 C C   . GLU A 1 173 ? 53.848  11.227  26.050  1.00 29.21  ? 173  GLU A C   1 
ATOM   1309 O O   . GLU A 1 173 ? 54.571  10.250  26.088  1.00 28.03  ? 173  GLU A O   1 
ATOM   1310 C CB  . GLU A 1 173 ? 54.295  12.480  28.111  1.00 38.26  ? 173  GLU A CB  1 
ATOM   1311 C CG  . GLU A 1 173 ? 53.980  13.985  28.080  1.00 42.54  ? 173  GLU A CG  1 
ATOM   1312 C CD  . GLU A 1 173 ? 54.489  14.625  29.355  1.00 42.26  ? 173  GLU A CD  1 
ATOM   1313 O OE1 . GLU A 1 173 ? 54.535  13.922  30.379  1.00 45.71  ? 173  GLU A OE1 1 
ATOM   1314 O OE2 . GLU A 1 173 ? 54.869  15.801  29.371  1.00 44.80  ? 173  GLU A OE2 1 
ATOM   1315 N N   . GLU A 1 174 ? 53.564  12.009  25.036  1.00 26.28  ? 174  GLU A N   1 
ATOM   1316 C CA  . GLU A 1 174 ? 54.122  11.805  23.716  1.00 25.77  ? 174  GLU A CA  1 
ATOM   1317 C C   . GLU A 1 174 ? 54.909  13.067  23.398  1.00 23.67  ? 174  GLU A C   1 
ATOM   1318 O O   . GLU A 1 174 ? 54.339  14.125  23.248  1.00 21.59  ? 174  GLU A O   1 
ATOM   1319 C CB  . GLU A 1 174 ? 52.982  11.505  22.750  1.00 24.89  ? 174  GLU A CB  1 
ATOM   1320 C CG  . GLU A 1 174 ? 53.415  10.778  21.508  1.00 25.03  ? 174  GLU A CG  1 
ATOM   1321 C CD  . GLU A 1 174 ? 52.286  10.504  20.535  1.00 27.16  ? 174  GLU A CD  1 
ATOM   1322 O OE1 . GLU A 1 174 ? 51.220  9.961   20.898  1.00 30.94  ? 174  GLU A OE1 1 
ATOM   1323 O OE2 . GLU A 1 174 ? 52.437  10.814  19.350  1.00 24.66  ? 174  GLU A OE2 1 
ATOM   1324 N N   . ILE A 1 175 ? 56.232  12.993  23.468  1.00 23.54  ? 175  ILE A N   1 
ATOM   1325 C CA  . ILE A 1 175 ? 57.083  14.150  23.216  1.00 21.63  ? 175  ILE A CA  1 
ATOM   1326 C C   . ILE A 1 175 ? 57.780  14.034  21.867  1.00 21.85  ? 175  ILE A C   1 
ATOM   1327 O O   . ILE A 1 175 ? 58.316  12.981  21.507  1.00 20.62  ? 175  ILE A O   1 
ATOM   1328 C CB  . ILE A 1 175 ? 58.196  14.189  24.293  1.00 22.03  ? 175  ILE A CB  1 
ATOM   1329 C CG1 . ILE A 1 175 ? 57.615  14.141  25.711  1.00 22.29  ? 175  ILE A CG1 1 
ATOM   1330 C CG2 . ILE A 1 175 ? 59.069  15.412  24.116  1.00 18.46  ? 175  ILE A CG2 1 
ATOM   1331 C CD1 . ILE A 1 175 ? 58.594  13.489  26.680  1.00 23.21  ? 175  ILE A CD1 1 
ATOM   1332 N N   . TYR A 1 176 ? 57.850  15.143  21.128  1.00 21.35  ? 176  TYR A N   1 
ATOM   1333 C CA  . TYR A 1 176 ? 58.500  15.170  19.840  1.00 20.44  ? 176  TYR A CA  1 
ATOM   1334 C C   . TYR A 1 176 ? 59.637  16.185  19.859  1.00 20.40  ? 176  TYR A C   1 
ATOM   1335 O O   . TYR A 1 176 ? 59.420  17.323  20.279  1.00 21.45  ? 176  TYR A O   1 
ATOM   1336 C CB  . TYR A 1 176 ? 57.573  15.467  18.642  1.00 17.19  ? 176  TYR A CB  1 
ATOM   1337 C CG  . TYR A 1 176 ? 56.676  14.245  18.461  1.00 18.04  ? 176  TYR A CG  1 
ATOM   1338 C CD1 . TYR A 1 176 ? 57.165  13.096  17.851  1.00 16.30  ? 176  TYR A CD1 1 
ATOM   1339 C CD2 . TYR A 1 176 ? 55.374  14.233  18.943  1.00 17.48  ? 176  TYR A CD2 1 
ATOM   1340 C CE1 . TYR A 1 176 ? 56.384  11.976  17.722  1.00 15.34  ? 176  TYR A CE1 1 
ATOM   1341 C CE2 . TYR A 1 176 ? 54.575  13.116  18.816  1.00 15.81  ? 176  TYR A CE2 1 
ATOM   1342 C CZ  . TYR A 1 176 ? 55.081  11.991  18.203  1.00 15.32  ? 176  TYR A CZ  1 
ATOM   1343 O OH  . TYR A 1 176 ? 54.308  10.864  18.042  1.00 12.20  ? 176  TYR A OH  1 
ATOM   1344 N N   . ILE A 1 177 ? 60.803  15.750  19.414  1.00 19.60  ? 177  ILE A N   1 
ATOM   1345 C CA  . ILE A 1 177 ? 61.937  16.671  19.262  1.00 18.38  ? 177  ILE A CA  1 
ATOM   1346 C C   . ILE A 1 177 ? 62.294  16.701  17.782  1.00 18.25  ? 177  ILE A C   1 
ATOM   1347 O O   . ILE A 1 177 ? 62.078  15.704  17.083  1.00 17.73  ? 177  ILE A O   1 
ATOM   1348 C CB  . ILE A 1 177 ? 63.159  16.225  20.070  1.00 15.83  ? 177  ILE A CB  1 
ATOM   1349 C CG1 . ILE A 1 177 ? 63.477  14.740  19.797  1.00 9.95   ? 177  ILE A CG1 1 
ATOM   1350 C CG2 . ILE A 1 177 ? 62.862  16.576  21.537  1.00 10.06  ? 177  ILE A CG2 1 
ATOM   1351 C CD1 . ILE A 1 177 ? 64.790  14.332  20.470  1.00 9.41   ? 177  ILE A CD1 1 
ATOM   1352 N N   . PRO A 1 178 ? 62.889  17.780  17.305  1.00 17.79  ? 178  PRO A N   1 
ATOM   1353 C CA  . PRO A 1 178 ? 63.298  17.840  15.921  1.00 17.78  ? 178  PRO A CA  1 
ATOM   1354 C C   . PRO A 1 178 ? 64.415  16.836  15.578  1.00 16.22  ? 178  PRO A C   1 
ATOM   1355 O O   . PRO A 1 178 ? 65.191  16.448  16.443  1.00 12.87  ? 178  PRO A O   1 
ATOM   1356 C CB  . PRO A 1 178 ? 63.834  19.263  15.722  1.00 17.70  ? 178  PRO A CB  1 
ATOM   1357 C CG  . PRO A 1 178 ? 63.568  20.005  16.976  1.00 18.30  ? 178  PRO A CG  1 
ATOM   1358 C CD  . PRO A 1 178 ? 63.287  18.986  18.050  1.00 18.26  ? 178  PRO A CD  1 
ATOM   1359 N N   . LEU A 1 179 ? 64.468  16.506  14.294  1.00 15.44  ? 179  LEU A N   1 
ATOM   1360 C CA  . LEU A 1 179 ? 65.623  15.783  13.756  1.00 18.58  ? 179  LEU A CA  1 
ATOM   1361 C C   . LEU A 1 179 ? 66.842  16.653  14.076  1.00 20.09  ? 179  LEU A C   1 
ATOM   1362 O O   . LEU A 1 179 ? 66.692  17.901  14.044  1.00 19.30  ? 179  LEU A O   1 
ATOM   1363 C CB  . LEU A 1 179 ? 65.370  15.557  12.256  1.00 11.06  ? 179  LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 179 ? 64.418  14.377  12.039  1.00 9.10   ? 179  LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 179 ? 63.933  14.339  10.599  1.00 10.83  ? 179  LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 179 ? 65.038  13.050  12.486  1.00 4.91   ? 179  LEU A CD2 1 
ATOM   1367 N N   . TYR A 1 180 ? 67.990  16.119  14.477  1.00 20.89  ? 180  TYR A N   1 
ATOM   1368 C CA  . TYR A 1 180 ? 69.057  17.052  14.884  1.00 24.00  ? 180  TYR A CA  1 
ATOM   1369 C C   . TYR A 1 180 ? 68.626  18.018  15.992  1.00 24.82  ? 180  TYR A C   1 
ATOM   1370 O O   . TYR A 1 180 ? 68.570  19.230  15.741  1.00 26.00  ? 180  TYR A O   1 
ATOM   1371 C CB  . TYR A 1 180 ? 69.408  17.999  13.706  1.00 25.77  ? 180  TYR A CB  1 
ATOM   1372 C CG  . TYR A 1 180 ? 70.560  17.473  12.884  1.00 25.68  ? 180  TYR A CG  1 
ATOM   1373 C CD1 . TYR A 1 180 ? 71.752  17.168  13.522  1.00 25.93  ? 180  TYR A CD1 1 
ATOM   1374 C CD2 . TYR A 1 180 ? 70.417  17.272  11.527  1.00 27.85  ? 180  TYR A CD2 1 
ATOM   1375 C CE1 . TYR A 1 180 ? 72.813  16.648  12.798  1.00 28.62  ? 180  TYR A CE1 1 
ATOM   1376 C CE2 . TYR A 1 180 ? 71.485  16.761  10.779  1.00 29.33  ? 180  TYR A CE2 1 
ATOM   1377 C CZ  . TYR A 1 180 ? 72.656  16.448  11.445  1.00 29.15  ? 180  TYR A CZ  1 
ATOM   1378 O OH  . TYR A 1 180 ? 73.707  15.959  10.741  1.00 31.84  ? 180  TYR A OH  1 
ATOM   1379 N N   . PRO A 1 181 ? 68.301  17.536  17.184  1.00 23.52  ? 181  PRO A N   1 
ATOM   1380 C CA  . PRO A 1 181 ? 67.855  18.369  18.273  1.00 23.52  ? 181  PRO A CA  1 
ATOM   1381 C C   . PRO A 1 181 ? 68.940  19.271  18.835  1.00 24.25  ? 181  PRO A C   1 
ATOM   1382 O O   . PRO A 1 181 ? 70.089  18.852  18.920  1.00 25.06  ? 181  PRO A O   1 
ATOM   1383 C CB  . PRO A 1 181 ? 67.468  17.366  19.378  1.00 21.37  ? 181  PRO A CB  1 
ATOM   1384 C CG  . PRO A 1 181 ? 68.326  16.182  19.095  1.00 21.31  ? 181  PRO A CG  1 
ATOM   1385 C CD  . PRO A 1 181 ? 68.367  16.103  17.574  1.00 21.81  ? 181  PRO A CD  1 
ATOM   1386 N N   . SER A 1 182 ? 68.556  20.434  19.328  1.00 26.05  ? 182  SER A N   1 
ATOM   1387 C CA  . SER A 1 182 ? 69.517  21.335  19.977  1.00 28.06  ? 182  SER A CA  1 
ATOM   1388 C C   . SER A 1 182 ? 69.674  20.791  21.397  1.00 29.06  ? 182  SER A C   1 
ATOM   1389 O O   . SER A 1 182 ? 68.790  20.063  21.849  1.00 27.21  ? 182  SER A O   1 
ATOM   1390 C CB  . SER A 1 182 ? 68.925  22.748  20.072  1.00 24.42  ? 182  SER A CB  1 
ATOM   1391 O OG  . SER A 1 182 ? 68.053  22.738  21.197  1.00 25.59  ? 182  SER A OG  1 
ATOM   1392 N N   . ASP A 1 183 ? 70.702  21.210  22.120  1.00 31.17  ? 183  ASP A N   1 
ATOM   1393 C CA  . ASP A 1 183 ? 70.896  20.803  23.521  1.00 30.85  ? 183  ASP A CA  1 
ATOM   1394 C C   . ASP A 1 183 ? 69.723  21.292  24.357  1.00 30.20  ? 183  ASP A C   1 
ATOM   1395 O O   . ASP A 1 183 ? 69.280  20.606  25.264  1.00 29.00  ? 183  ASP A O   1 
ATOM   1396 C CB  . ASP A 1 183 ? 72.245  21.337  24.033  1.00 37.57  ? 183  ASP A CB  1 
ATOM   1397 C CG  . ASP A 1 183 ? 73.285  21.078  22.939  1.00 45.21  ? 183  ASP A CG  1 
ATOM   1398 O OD1 . ASP A 1 183 ? 73.885  19.975  22.928  1.00 46.25  ? 183  ASP A OD1 1 
ATOM   1399 O OD2 . ASP A 1 183 ? 73.436  21.987  22.075  1.00 48.88  ? 183  ASP A OD2 1 
ATOM   1400 N N   . ASP A 1 184 ? 69.153  22.451  24.064  1.00 29.56  ? 184  ASP A N   1 
ATOM   1401 C CA  . ASP A 1 184 ? 67.985  22.972  24.712  1.00 31.58  ? 184  ASP A CA  1 
ATOM   1402 C C   . ASP A 1 184 ? 66.813  21.989  24.512  1.00 32.56  ? 184  ASP A C   1 
ATOM   1403 O O   . ASP A 1 184 ? 66.076  21.644  25.445  1.00 31.69  ? 184  ASP A O   1 
ATOM   1404 C CB  . ASP A 1 184 ? 67.593  24.300  24.092  1.00 41.37  ? 184  ASP A CB  1 
ATOM   1405 C CG  . ASP A 1 184 ? 68.675  25.221  23.572  1.00 50.45  ? 184  ASP A CG  1 
ATOM   1406 O OD1 . ASP A 1 184 ? 69.740  24.821  23.015  1.00 52.94  ? 184  ASP A OD1 1 
ATOM   1407 O OD2 . ASP A 1 184 ? 68.441  26.469  23.712  1.00 53.08  ? 184  ASP A OD2 1 
ATOM   1408 N N   . ASP A 1 185 ? 66.607  21.572  23.249  1.00 31.30  ? 185  ASP A N   1 
ATOM   1409 C CA  . ASP A 1 185 ? 65.541  20.654  22.908  1.00 31.83  ? 185  ASP A CA  1 
ATOM   1410 C C   . ASP A 1 185 ? 65.664  19.384  23.772  1.00 30.68  ? 185  ASP A C   1 
ATOM   1411 O O   . ASP A 1 185 ? 64.699  18.943  24.400  1.00 30.81  ? 185  ASP A O   1 
ATOM   1412 C CB  . ASP A 1 185 ? 65.556  20.179  21.461  1.00 30.46  ? 185  ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 185 ? 65.217  21.207  20.416  1.00 30.77  ? 185  ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 185 ? 64.376  22.071  20.691  1.00 29.63  ? 185  ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 185 ? 65.784  21.119  19.306  1.00 31.68  ? 185  ASP A OD2 1 
ATOM   1416 N N   . LEU A 1 186 ? 66.872  18.838  23.758  1.00 28.92  ? 186  LEU A N   1 
ATOM   1417 C CA  . LEU A 1 186 ? 67.136  17.616  24.514  1.00 28.32  ? 186  LEU A CA  1 
ATOM   1418 C C   . LEU A 1 186 ? 66.864  17.829  25.995  1.00 28.17  ? 186  LEU A C   1 
ATOM   1419 O O   . LEU A 1 186 ? 66.190  17.016  26.648  1.00 26.31  ? 186  LEU A O   1 
ATOM   1420 C CB  . LEU A 1 186 ? 68.534  17.136  24.233  1.00 27.30  ? 186  LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 186 ? 68.963  15.924  23.430  1.00 26.83  ? 186  LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 186 ? 67.899  15.200  22.636  1.00 23.49  ? 186  LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 186 ? 70.084  16.313  22.461  1.00 28.91  ? 186  LEU A CD2 1 
ATOM   1424 N N   . GLN A 1 187 ? 67.364  18.937  26.554  1.00 28.51  ? 187  GLN A N   1 
ATOM   1425 C CA  . GLN A 1 187 ? 67.163  19.182  27.974  1.00 29.38  ? 187  GLN A CA  1 
ATOM   1426 C C   . GLN A 1 187 ? 65.701  19.293  28.338  1.00 26.98  ? 187  GLN A C   1 
ATOM   1427 O O   . GLN A 1 187 ? 65.289  18.634  29.292  1.00 28.06  ? 187  GLN A O   1 
ATOM   1428 C CB  . GLN A 1 187 ? 67.977  20.367  28.497  1.00 35.83  ? 187  GLN A CB  1 
ATOM   1429 C CG  . GLN A 1 187 ? 68.641  19.939  29.807  1.00 43.30  ? 187  GLN A CG  1 
ATOM   1430 C CD  . GLN A 1 187 ? 69.788  18.962  29.615  1.00 47.51  ? 187  GLN A CD  1 
ATOM   1431 O OE1 . GLN A 1 187 ? 70.889  19.416  29.291  1.00 49.53  ? 187  GLN A OE1 1 
ATOM   1432 N NE2 . GLN A 1 187 ? 69.554  17.662  29.835  1.00 49.11  ? 187  GLN A NE2 1 
ATOM   1433 N N   . ARG A 1 188 ? 64.877  20.007  27.616  1.00 27.05  ? 188  ARG A N   1 
ATOM   1434 C CA  . ARG A 1 188 ? 63.452  20.087  27.897  1.00 27.85  ? 188  ARG A CA  1 
ATOM   1435 C C   . ARG A 1 188 ? 62.782  18.719  27.721  1.00 27.57  ? 188  ARG A C   1 
ATOM   1436 O O   . ARG A 1 188 ? 61.918  18.363  28.527  1.00 26.61  ? 188  ARG A O   1 
ATOM   1437 C CB  . ARG A 1 188 ? 62.755  21.133  27.013  1.00 30.71  ? 188  ARG A CB  1 
ATOM   1438 C CG  . ARG A 1 188 ? 63.250  22.540  27.385  1.00 37.58  ? 188  ARG A CG  1 
ATOM   1439 C CD  . ARG A 1 188 ? 62.559  23.617  26.554  1.00 41.35  ? 188  ARG A CD  1 
ATOM   1440 N NE  . ARG A 1 188 ? 63.126  23.685  25.227  1.00 45.97  ? 188  ARG A NE  1 
ATOM   1441 C CZ  . ARG A 1 188 ? 62.700  23.342  24.023  1.00 48.22  ? 188  ARG A CZ  1 
ATOM   1442 N NH1 . ARG A 1 188 ? 61.485  22.844  23.819  1.00 47.82  ? 188  ARG A NH1 1 
ATOM   1443 N NH2 . ARG A 1 188 ? 63.527  23.547  22.983  1.00 47.67  ? 188  ARG A NH2 1 
ATOM   1444 N N   . ALA A 1 189 ? 63.173  17.954  26.695  1.00 25.93  ? 189  ALA A N   1 
ATOM   1445 C CA  . ALA A 1 189 ? 62.532  16.645  26.517  1.00 25.90  ? 189  ALA A CA  1 
ATOM   1446 C C   . ALA A 1 189 ? 62.817  15.772  27.730  1.00 24.39  ? 189  ALA A C   1 
ATOM   1447 O O   . ALA A 1 189 ? 61.894  15.212  28.312  1.00 24.44  ? 189  ALA A O   1 
ATOM   1448 C CB  . ALA A 1 189 ? 62.910  15.940  25.214  1.00 20.69  ? 189  ALA A CB  1 
ATOM   1449 N N   . VAL A 1 190 ? 64.069  15.698  28.151  1.00 24.59  ? 190  VAL A N   1 
ATOM   1450 C CA  . VAL A 1 190 ? 64.517  14.897  29.267  1.00 24.86  ? 190  VAL A CA  1 
ATOM   1451 C C   . VAL A 1 190 ? 63.845  15.235  30.585  1.00 26.26  ? 190  VAL A C   1 
ATOM   1452 O O   . VAL A 1 190 ? 63.539  14.330  31.379  1.00 25.56  ? 190  VAL A O   1 
ATOM   1453 C CB  . VAL A 1 190 ? 66.052  14.987  29.402  1.00 24.01  ? 190  VAL A CB  1 
ATOM   1454 C CG1 . VAL A 1 190 ? 66.554  14.330  30.671  1.00 18.83  ? 190  VAL A CG1 1 
ATOM   1455 C CG2 . VAL A 1 190 ? 66.694  14.348  28.157  1.00 23.48  ? 190  VAL A CG2 1 
ATOM   1456 N N   . GLU A 1 191 ? 63.635  16.523  30.827  1.00 27.41  ? 191  GLU A N   1 
ATOM   1457 C CA  . GLU A 1 191 ? 62.982  16.984  32.051  1.00 28.28  ? 191  GLU A CA  1 
ATOM   1458 C C   . GLU A 1 191 ? 61.543  16.459  32.067  1.00 29.14  ? 191  GLU A C   1 
ATOM   1459 O O   . GLU A 1 191 ? 61.112  15.884  33.071  1.00 28.37  ? 191  GLU A O   1 
ATOM   1460 C CB  . GLU A 1 191 ? 63.043  18.496  32.111  1.00 29.58  ? 191  GLU A CB  1 
ATOM   1461 C CG  . GLU A 1 191 ? 62.430  19.155  33.330  1.00 34.94  ? 191  GLU A CG  1 
ATOM   1462 C CD  . GLU A 1 191 ? 62.993  18.684  34.653  1.00 35.75  ? 191  GLU A CD  1 
ATOM   1463 O OE1 . GLU A 1 191 ? 64.132  18.183  34.754  1.00 34.67  ? 191  GLU A OE1 1 
ATOM   1464 O OE2 . GLU A 1 191 ? 62.245  18.802  35.647  1.00 39.09  ? 191  GLU A OE2 1 
ATOM   1465 N N   . ARG A 1 192 ? 60.839  16.580  30.931  1.00 27.90  ? 192  ARG A N   1 
ATOM   1466 C CA  . ARG A 1 192 ? 59.495  16.032  30.833  1.00 28.74  ? 192  ARG A CA  1 
ATOM   1467 C C   . ARG A 1 192 ? 59.518  14.502  31.002  1.00 29.08  ? 192  ARG A C   1 
ATOM   1468 O O   . ARG A 1 192 ? 58.667  13.952  31.721  1.00 28.88  ? 192  ARG A O   1 
ATOM   1469 C CB  . ARG A 1 192 ? 58.826  16.367  29.520  1.00 31.96  ? 192  ARG A CB  1 
ATOM   1470 C CG  . ARG A 1 192 ? 58.690  17.828  29.133  1.00 31.95  ? 192  ARG A CG  1 
ATOM   1471 C CD  . ARG A 1 192 ? 57.290  17.947  28.530  1.00 38.14  ? 192  ARG A CD  1 
ATOM   1472 N NE  . ARG A 1 192 ? 57.281  18.166  27.114  1.00 44.14  ? 192  ARG A NE  1 
ATOM   1473 C CZ  . ARG A 1 192 ? 56.384  17.862  26.195  1.00 45.13  ? 192  ARG A CZ  1 
ATOM   1474 N NH1 . ARG A 1 192 ? 55.277  17.211  26.514  1.00 46.13  ? 192  ARG A NH1 1 
ATOM   1475 N NH2 . ARG A 1 192 ? 56.672  18.240  24.951  1.00 46.16  ? 192  ARG A NH2 1 
ATOM   1476 N N   . ILE A 1 193 ? 60.483  13.798  30.403  1.00 27.12  ? 193  ILE A N   1 
ATOM   1477 C CA  . ILE A 1 193 ? 60.599  12.367  30.615  1.00 27.51  ? 193  ILE A CA  1 
ATOM   1478 C C   . ILE A 1 193 ? 60.711  12.123  32.129  1.00 27.74  ? 193  ILE A C   1 
ATOM   1479 O O   . ILE A 1 193 ? 60.052  11.222  32.658  1.00 28.25  ? 193  ILE A O   1 
ATOM   1480 C CB  . ILE A 1 193 ? 61.767  11.693  29.849  1.00 24.99  ? 193  ILE A CB  1 
ATOM   1481 C CG1 . ILE A 1 193 ? 61.402  11.465  28.373  1.00 23.29  ? 193  ILE A CG1 1 
ATOM   1482 C CG2 . ILE A 1 193 ? 62.183  10.343  30.426  1.00 21.20  ? 193  ILE A CG2 1 
ATOM   1483 C CD1 . ILE A 1 193 ? 62.630  11.312  27.507  1.00 24.86  ? 193  ILE A CD1 1 
ATOM   1484 N N   . TYR A 1 194 ? 61.564  12.841  32.840  1.00 28.06  ? 194  TYR A N   1 
ATOM   1485 C CA  . TYR A 1 194 ? 61.748  12.634  34.266  1.00 29.86  ? 194  TYR A CA  1 
ATOM   1486 C C   . TYR A 1 194 ? 60.526  12.978  35.108  1.00 30.67  ? 194  TYR A C   1 
ATOM   1487 O O   . TYR A 1 194 ? 60.087  12.195  35.960  1.00 28.94  ? 194  TYR A O   1 
ATOM   1488 C CB  . TYR A 1 194 ? 63.013  13.379  34.683  1.00 31.40  ? 194  TYR A CB  1 
ATOM   1489 C CG  . TYR A 1 194 ? 63.312  13.232  36.151  1.00 35.37  ? 194  TYR A CG  1 
ATOM   1490 C CD1 . TYR A 1 194 ? 64.017  12.160  36.644  1.00 36.40  ? 194  TYR A CD1 1 
ATOM   1491 C CD2 . TYR A 1 194 ? 62.842  14.187  37.050  1.00 38.54  ? 194  TYR A CD2 1 
ATOM   1492 C CE1 . TYR A 1 194 ? 64.280  12.035  37.997  1.00 38.37  ? 194  TYR A CE1 1 
ATOM   1493 C CE2 . TYR A 1 194 ? 63.090  14.077  38.407  1.00 39.88  ? 194  TYR A CE2 1 
ATOM   1494 C CZ  . TYR A 1 194 ? 63.811  12.993  38.863  1.00 40.39  ? 194  TYR A CZ  1 
ATOM   1495 O OH  . TYR A 1 194 ? 64.057  12.876  40.211  1.00 42.38  ? 194  TYR A OH  1 
ATOM   1496 N N   . GLN A 1 195 ? 59.853  14.101  34.907  1.00 32.85  ? 195  GLN A N   1 
ATOM   1497 C CA  . GLN A 1 195 ? 58.655  14.403  35.685  1.00 36.38  ? 195  GLN A CA  1 
ATOM   1498 C C   . GLN A 1 195 ? 57.541  13.384  35.455  1.00 37.54  ? 195  GLN A C   1 
ATOM   1499 O O   . GLN A 1 195 ? 56.729  13.211  36.366  1.00 38.11  ? 195  GLN A O   1 
ATOM   1500 C CB  . GLN A 1 195 ? 58.093  15.793  35.379  1.00 41.10  ? 195  GLN A CB  1 
ATOM   1501 C CG  . GLN A 1 195 ? 59.131  16.897  35.397  1.00 46.41  ? 195  GLN A CG  1 
ATOM   1502 C CD  . GLN A 1 195 ? 59.671  17.255  36.764  1.00 50.20  ? 195  GLN A CD  1 
ATOM   1503 O OE1 . GLN A 1 195 ? 59.954  16.452  37.655  1.00 50.46  ? 195  GLN A OE1 1 
ATOM   1504 N NE2 . GLN A 1 195 ? 59.864  18.566  36.946  1.00 53.25  ? 195  GLN A NE2 1 
ATOM   1505 N N   . ALA A 1 196 ? 57.450  12.763  34.281  1.00 36.99  ? 196  ALA A N   1 
ATOM   1506 C CA  . ALA A 1 196 ? 56.412  11.790  33.997  1.00 36.69  ? 196  ALA A CA  1 
ATOM   1507 C C   . ALA A 1 196 ? 56.570  10.494  34.774  1.00 36.55  ? 196  ALA A C   1 
ATOM   1508 O O   . ALA A 1 196 ? 55.572  9.795   34.946  1.00 35.71  ? 196  ALA A O   1 
ATOM   1509 C CB  . ALA A 1 196 ? 56.359  11.526  32.490  1.00 35.26  ? 196  ALA A CB  1 
ATOM   1510 N N   . ARG A 1 197 ? 57.759  10.118  35.236  1.00 36.96  ? 197  ARG A N   1 
ATOM   1511 C CA  . ARG A 1 197 ? 57.930  8.918   36.031  1.00 37.06  ? 197  ARG A CA  1 
ATOM   1512 C C   . ARG A 1 197 ? 57.371  7.655   35.389  1.00 36.21  ? 197  ARG A C   1 
ATOM   1513 O O   . ARG A 1 197 ? 56.489  7.010   35.984  1.00 35.86  ? 197  ARG A O   1 
ATOM   1514 C CB  . ARG A 1 197 ? 57.249  9.055   37.399  1.00 40.93  ? 197  ARG A CB  1 
ATOM   1515 C CG  . ARG A 1 197 ? 58.154  9.425   38.542  1.00 47.50  ? 197  ARG A CG  1 
ATOM   1516 C CD  . ARG A 1 197 ? 58.489  10.914  38.539  1.00 52.57  ? 197  ARG A CD  1 
ATOM   1517 N NE  . ARG A 1 197 ? 59.676  11.117  39.372  1.00 58.43  ? 197  ARG A NE  1 
ATOM   1518 C CZ  . ARG A 1 197 ? 59.953  12.155  40.151  1.00 60.75  ? 197  ARG A CZ  1 
ATOM   1519 N NH1 . ARG A 1 197 ? 59.148  13.205  40.279  1.00 59.11  ? 197  ARG A NH1 1 
ATOM   1520 N NH2 . ARG A 1 197 ? 61.092  12.129  40.846  1.00 62.96  ? 197  ARG A NH2 1 
ATOM   1521 N N   . ALA A 1 198 ? 57.920  7.281   34.235  1.00 33.81  ? 198  ALA A N   1 
ATOM   1522 C CA  . ALA A 1 198 ? 57.422  6.070   33.581  1.00 31.84  ? 198  ALA A CA  1 
ATOM   1523 C C   . ALA A 1 198 ? 58.170  4.821   34.034  1.00 31.04  ? 198  ALA A C   1 
ATOM   1524 O O   . ALA A 1 198 ? 59.313  4.875   34.517  1.00 29.82  ? 198  ALA A O   1 
ATOM   1525 C CB  . ALA A 1 198 ? 57.592  6.226   32.074  1.00 31.42  ? 198  ALA A CB  1 
ATOM   1526 N N   . ASP A 1 199 ? 57.557  3.682   33.744  1.00 29.42  ? 199  ASP A N   1 
ATOM   1527 C CA  . ASP A 1 199 ? 58.247  2.418   33.991  1.00 30.16  ? 199  ASP A CA  1 
ATOM   1528 C C   . ASP A 1 199 ? 59.129  2.176   32.777  1.00 29.47  ? 199  ASP A C   1 
ATOM   1529 O O   . ASP A 1 199 ? 60.198  1.571   32.892  1.00 31.22  ? 199  ASP A O   1 
ATOM   1530 C CB  . ASP A 1 199 ? 57.305  1.236   34.170  1.00 30.60  ? 199  ASP A CB  1 
ATOM   1531 C CG  . ASP A 1 199 ? 56.228  1.497   35.204  1.00 31.57  ? 199  ASP A CG  1 
ATOM   1532 O OD1 . ASP A 1 199 ? 56.607  1.848   36.345  1.00 34.94  ? 199  ASP A OD1 1 
ATOM   1533 O OD2 . ASP A 1 199 ? 55.027  1.396   34.899  1.00 31.29  ? 199  ASP A OD2 1 
ATOM   1534 N N   . VAL A 1 200 ? 58.689  2.602   31.596  1.00 27.91  ? 200  VAL A N   1 
ATOM   1535 C CA  . VAL A 1 200 ? 59.462  2.415   30.378  1.00 25.34  ? 200  VAL A CA  1 
ATOM   1536 C C   . VAL A 1 200 ? 59.338  3.650   29.466  1.00 24.37  ? 200  VAL A C   1 
ATOM   1537 O O   . VAL A 1 200 ? 58.301  4.272   29.341  1.00 21.37  ? 200  VAL A O   1 
ATOM   1538 C CB  . VAL A 1 200 ? 59.120  1.232   29.475  1.00 24.46  ? 200  VAL A CB  1 
ATOM   1539 C CG1 . VAL A 1 200 ? 59.279  -0.106  30.157  1.00 28.00  ? 200  VAL A CG1 1 
ATOM   1540 C CG2 . VAL A 1 200 ? 57.674  1.281   28.975  1.00 28.26  ? 200  VAL A CG2 1 
ATOM   1541 N N   . VAL A 1 201 ? 60.483  3.927   28.833  1.00 23.46  ? 201  VAL A N   1 
ATOM   1542 C CA  . VAL A 1 201 ? 60.614  4.972   27.873  1.00 22.46  ? 201  VAL A CA  1 
ATOM   1543 C C   . VAL A 1 201 ? 60.552  4.297   26.493  1.00 21.49  ? 201  VAL A C   1 
ATOM   1544 O O   . VAL A 1 201 ? 61.395  3.443   26.216  1.00 22.27  ? 201  VAL A O   1 
ATOM   1545 C CB  . VAL A 1 201 ? 61.891  5.812   27.996  1.00 22.80  ? 201  VAL A CB  1 
ATOM   1546 C CG1 . VAL A 1 201 ? 62.053  6.645   26.727  1.00 19.61  ? 201  VAL A CG1 1 
ATOM   1547 C CG2 . VAL A 1 201 ? 61.798  6.715   29.223  1.00 20.19  ? 201  VAL A CG2 1 
ATOM   1548 N N   . PHE A 1 202 ? 59.569  4.728   25.697  1.00 18.69  ? 202  PHE A N   1 
ATOM   1549 C CA  . PHE A 1 202 ? 59.484  4.144   24.342  1.00 17.78  ? 202  PHE A CA  1 
ATOM   1550 C C   . PHE A 1 202 ? 60.071  5.144   23.362  1.00 15.88  ? 202  PHE A C   1 
ATOM   1551 O O   . PHE A 1 202 ? 59.467  6.194   23.127  1.00 16.44  ? 202  PHE A O   1 
ATOM   1552 C CB  . PHE A 1 202 ? 58.051  3.777   23.962  1.00 16.74  ? 202  PHE A CB  1 
ATOM   1553 C CG  . PHE A 1 202 ? 57.947  3.289   22.543  1.00 18.10  ? 202  PHE A CG  1 
ATOM   1554 C CD1 . PHE A 1 202 ? 58.687  2.182   22.116  1.00 19.68  ? 202  PHE A CD1 1 
ATOM   1555 C CD2 . PHE A 1 202 ? 57.117  3.915   21.643  1.00 16.90  ? 202  PHE A CD2 1 
ATOM   1556 C CE1 . PHE A 1 202 ? 58.608  1.752   20.810  1.00 18.08  ? 202  PHE A CE1 1 
ATOM   1557 C CE2 . PHE A 1 202 ? 57.019  3.457   20.344  1.00 18.22  ? 202  PHE A CE2 1 
ATOM   1558 C CZ  . PHE A 1 202 ? 57.769  2.381   19.916  1.00 15.38  ? 202  PHE A CZ  1 
ATOM   1559 N N   . SER A 1 203 ? 61.237  4.873   22.801  1.00 16.62  ? 203  SER A N   1 
ATOM   1560 C CA  . SER A 1 203 ? 61.874  5.844   21.889  1.00 15.88  ? 203  SER A CA  1 
ATOM   1561 C C   . SER A 1 203 ? 61.793  5.501   20.411  1.00 15.22  ? 203  SER A C   1 
ATOM   1562 O O   . SER A 1 203 ? 62.062  4.371   19.970  1.00 16.22  ? 203  SER A O   1 
ATOM   1563 C CB  . SER A 1 203 ? 63.342  5.968   22.304  1.00 15.03  ? 203  SER A CB  1 
ATOM   1564 O OG  . SER A 1 203 ? 64.094  6.830   21.460  1.00 14.40  ? 203  SER A OG  1 
ATOM   1565 N N   . THR A 1 204 ? 61.418  6.480   19.612  1.00 14.90  ? 204  THR A N   1 
ATOM   1566 C CA  . THR A 1 204 ? 61.401  6.495   18.165  1.00 13.24  ? 204  THR A CA  1 
ATOM   1567 C C   . THR A 1 204 ? 62.280  7.657   17.636  1.00 12.97  ? 204  THR A C   1 
ATOM   1568 O O   . THR A 1 204 ? 62.092  8.222   16.553  1.00 11.87  ? 204  THR A O   1 
ATOM   1569 C CB  . THR A 1 204 ? 59.993  6.592   17.587  1.00 15.52  ? 204  THR A CB  1 
ATOM   1570 O OG1 . THR A 1 204 ? 59.247  7.628   18.230  1.00 16.02  ? 204  THR A OG1 1 
ATOM   1571 C CG2 . THR A 1 204 ? 59.212  5.289   17.818  1.00 15.49  ? 204  THR A CG2 1 
ATOM   1572 N N   . VAL A 1 205 ? 63.285  8.008   18.442  1.00 10.79  ? 205  VAL A N   1 
ATOM   1573 C CA  . VAL A 1 205 ? 64.227  9.088   18.086  1.00 11.24  ? 205  VAL A CA  1 
ATOM   1574 C C   . VAL A 1 205 ? 65.165  8.537   17.029  1.00 9.72   ? 205  VAL A C   1 
ATOM   1575 O O   . VAL A 1 205 ? 65.571  7.400   17.111  1.00 12.56  ? 205  VAL A O   1 
ATOM   1576 C CB  . VAL A 1 205 ? 64.930  9.685   19.304  1.00 12.75  ? 205  VAL A CB  1 
ATOM   1577 C CG1 . VAL A 1 205 ? 66.085  10.604  18.935  1.00 14.38  ? 205  VAL A CG1 1 
ATOM   1578 C CG2 . VAL A 1 205 ? 63.898  10.469  20.153  1.00 12.75  ? 205  VAL A CG2 1 
ATOM   1579 N N   . VAL A 1 206 ? 65.403  9.216   15.929  1.00 10.96  ? 206  VAL A N   1 
ATOM   1580 C CA  . VAL A 1 206 ? 66.182  8.746   14.811  1.00 11.44  ? 206  VAL A CA  1 
ATOM   1581 C C   . VAL A 1 206 ? 67.393  9.603   14.551  1.00 14.11  ? 206  VAL A C   1 
ATOM   1582 O O   . VAL A 1 206 ? 67.294  10.827  14.557  1.00 15.29  ? 206  VAL A O   1 
ATOM   1583 C CB  . VAL A 1 206 ? 65.280  8.740   13.547  1.00 9.95   ? 206  VAL A CB  1 
ATOM   1584 C CG1 . VAL A 1 206 ? 65.994  8.406   12.265  1.00 4.22   ? 206  VAL A CG1 1 
ATOM   1585 C CG2 . VAL A 1 206 ? 64.142  7.725   13.779  1.00 8.49   ? 206  VAL A CG2 1 
ATOM   1586 N N   . GLY A 1 207 ? 68.535  8.954   14.374  1.00 15.96  ? 207  GLY A N   1 
ATOM   1587 C CA  . GLY A 1 207 ? 69.759  9.573   13.996  1.00 17.00  ? 207  GLY A CA  1 
ATOM   1588 C C   . GLY A 1 207 ? 70.503  10.354  15.053  1.00 17.71  ? 207  GLY A C   1 
ATOM   1589 O O   . GLY A 1 207 ? 70.390  10.018  16.223  1.00 18.89  ? 207  GLY A O   1 
ATOM   1590 N N   . THR A 1 208 ? 71.236  11.361  14.603  1.00 18.18  ? 208  THR A N   1 
ATOM   1591 C CA  . THR A 1 208 ? 72.090  12.157  15.476  1.00 18.50  ? 208  THR A CA  1 
ATOM   1592 C C   . THR A 1 208 ? 71.303  12.822  16.581  1.00 18.66  ? 208  THR A C   1 
ATOM   1593 O O   . THR A 1 208 ? 70.271  13.464  16.411  1.00 18.07  ? 208  THR A O   1 
ATOM   1594 C CB  . THR A 1 208 ? 72.913  13.212  14.727  1.00 19.52  ? 208  THR A CB  1 
ATOM   1595 O OG1 . THR A 1 208 ? 73.577  12.539  13.645  1.00 20.09  ? 208  THR A OG1 1 
ATOM   1596 C CG2 . THR A 1 208 ? 73.933  13.844  15.687  1.00 19.46  ? 208  THR A CG2 1 
ATOM   1597 N N   . GLY A 1 209 ? 71.840  12.611  17.783  1.00 18.74  ? 209  GLY A N   1 
ATOM   1598 C CA  . GLY A 1 209 ? 71.101  13.148  18.942  1.00 18.87  ? 209  GLY A CA  1 
ATOM   1599 C C   . GLY A 1 209 ? 70.521  11.939  19.691  1.00 18.51  ? 209  GLY A C   1 
ATOM   1600 O O   . GLY A 1 209 ? 70.306  12.180  20.865  1.00 18.95  ? 209  GLY A O   1 
ATOM   1601 N N   . THR A 1 210 ? 70.411  10.743  19.120  1.00 17.43  ? 210  THR A N   1 
ATOM   1602 C CA  . THR A 1 210 ? 70.021  9.581   19.919  1.00 18.10  ? 210  THR A CA  1 
ATOM   1603 C C   . THR A 1 210 ? 70.998  9.319   21.063  1.00 19.74  ? 210  THR A C   1 
ATOM   1604 O O   . THR A 1 210 ? 70.509  9.115   22.186  1.00 20.10  ? 210  THR A O   1 
ATOM   1605 C CB  . THR A 1 210 ? 69.913  8.298   19.093  1.00 18.77  ? 210  THR A CB  1 
ATOM   1606 O OG1 . THR A 1 210 ? 68.999  8.533   18.010  1.00 20.74  ? 210  THR A OG1 1 
ATOM   1607 C CG2 . THR A 1 210 ? 69.398  7.094   19.869  1.00 16.54  ? 210  THR A CG2 1 
ATOM   1608 N N   . ALA A 1 211 ? 72.310  9.278   20.832  1.00 19.49  ? 211  ALA A N   1 
ATOM   1609 C CA  . ALA A 1 211 ? 73.275  8.987   21.867  1.00 20.52  ? 211  ALA A CA  1 
ATOM   1610 C C   . ALA A 1 211 ? 73.173  9.979   23.026  1.00 21.26  ? 211  ALA A C   1 
ATOM   1611 O O   . ALA A 1 211 ? 73.115  9.617   24.203  1.00 19.97  ? 211  ALA A O   1 
ATOM   1612 C CB  . ALA A 1 211 ? 74.721  9.021   21.367  1.00 20.81  ? 211  ALA A CB  1 
ATOM   1613 N N   . GLU A 1 212 ? 73.166  11.258  22.640  1.00 20.57  ? 212  GLU A N   1 
ATOM   1614 C CA  . GLU A 1 212 ? 73.066  12.340  23.602  1.00 20.70  ? 212  GLU A CA  1 
ATOM   1615 C C   . GLU A 1 212 ? 71.776  12.283  24.405  1.00 21.47  ? 212  GLU A C   1 
ATOM   1616 O O   . GLU A 1 212 ? 71.825  12.553  25.600  1.00 21.30  ? 212  GLU A O   1 
ATOM   1617 C CB  . GLU A 1 212 ? 73.176  13.675  22.842  1.00 22.26  ? 212  GLU A CB  1 
ATOM   1618 C CG  . GLU A 1 212 ? 74.547  13.855  22.199  1.00 23.51  ? 212  GLU A CG  1 
ATOM   1619 C CD  . GLU A 1 212 ? 74.707  13.214  20.838  1.00 29.06  ? 212  GLU A CD  1 
ATOM   1620 O OE1 . GLU A 1 212 ? 73.757  12.673  20.216  1.00 28.30  ? 212  GLU A OE1 1 
ATOM   1621 O OE2 . GLU A 1 212 ? 75.859  13.254  20.343  1.00 33.31  ? 212  GLU A OE2 1 
ATOM   1622 N N   . LEU A 1 213 ? 70.636  11.969  23.783  1.00 20.41  ? 213  LEU A N   1 
ATOM   1623 C CA  . LEU A 1 213 ? 69.381  11.814  24.462  1.00 20.75  ? 213  LEU A CA  1 
ATOM   1624 C C   . LEU A 1 213 ? 69.476  10.753  25.563  1.00 21.61  ? 213  LEU A C   1 
ATOM   1625 O O   . LEU A 1 213 ? 69.007  11.017  26.667  1.00 21.78  ? 213  LEU A O   1 
ATOM   1626 C CB  . LEU A 1 213 ? 68.285  11.323  23.479  1.00 22.12  ? 213  LEU A CB  1 
ATOM   1627 C CG  . LEU A 1 213 ? 66.973  10.879  24.122  1.00 21.46  ? 213  LEU A CG  1 
ATOM   1628 C CD1 . LEU A 1 213 ? 66.312  12.020  24.878  1.00 21.12  ? 213  LEU A CD1 1 
ATOM   1629 C CD2 . LEU A 1 213 ? 65.978  10.404  23.061  1.00 24.51  ? 213  LEU A CD2 1 
ATOM   1630 N N   . TYR A 1 214 ? 69.979  9.561   25.255  1.00 20.18  ? 214  TYR A N   1 
ATOM   1631 C CA  . TYR A 1 214 ? 70.123  8.460   26.170  1.00 20.87  ? 214  TYR A CA  1 
ATOM   1632 C C   . TYR A 1 214 ? 71.094  8.762   27.343  1.00 22.04  ? 214  TYR A C   1 
ATOM   1633 O O   . TYR A 1 214 ? 70.903  8.237   28.443  1.00 21.64  ? 214  TYR A O   1 
ATOM   1634 C CB  . TYR A 1 214 ? 70.613  7.190   25.480  1.00 18.88  ? 214  TYR A CB  1 
ATOM   1635 C CG  . TYR A 1 214 ? 69.684  6.322   24.703  1.00 20.13  ? 214  TYR A CG  1 
ATOM   1636 C CD1 . TYR A 1 214 ? 68.825  6.815   23.723  1.00 19.21  ? 214  TYR A CD1 1 
ATOM   1637 C CD2 . TYR A 1 214 ? 69.728  4.931   24.874  1.00 19.98  ? 214  TYR A CD2 1 
ATOM   1638 C CE1 . TYR A 1 214 ? 67.960  5.995   23.025  1.00 19.03  ? 214  TYR A CE1 1 
ATOM   1639 C CE2 . TYR A 1 214 ? 68.863  4.102   24.192  1.00 18.16  ? 214  TYR A CE2 1 
ATOM   1640 C CZ  . TYR A 1 214 ? 67.998  4.637   23.277  1.00 18.86  ? 214  TYR A CZ  1 
ATOM   1641 O OH  . TYR A 1 214 ? 67.147  3.805   22.577  1.00 17.82  ? 214  TYR A OH  1 
ATOM   1642 N N   . ARG A 1 215 ? 72.147  9.524   27.092  1.00 22.33  ? 215  ARG A N   1 
ATOM   1643 C CA  . ARG A 1 215 ? 73.131  9.943   28.056  1.00 23.60  ? 215  ARG A CA  1 
ATOM   1644 C C   . ARG A 1 215 ? 72.456  10.959  28.995  1.00 23.22  ? 215  ARG A C   1 
ATOM   1645 O O   . ARG A 1 215 ? 72.581  10.836  30.217  1.00 21.91  ? 215  ARG A O   1 
ATOM   1646 C CB  . ARG A 1 215 ? 74.348  10.561  27.390  1.00 27.68  ? 215  ARG A CB  1 
ATOM   1647 C CG  . ARG A 1 215 ? 75.534  10.863  28.271  1.00 36.26  ? 215  ARG A CG  1 
ATOM   1648 C CD  . ARG A 1 215 ? 76.486  11.926  27.780  1.00 40.35  ? 215  ARG A CD  1 
ATOM   1649 N NE  . ARG A 1 215 ? 76.638  12.243  26.413  1.00 47.63  ? 215  ARG A NE  1 
ATOM   1650 C CZ  . ARG A 1 215 ? 77.047  11.790  25.253  1.00 53.15  ? 215  ARG A CZ  1 
ATOM   1651 N NH1 . ARG A 1 215 ? 77.559  10.570  25.087  1.00 55.09  ? 215  ARG A NH1 1 
ATOM   1652 N NH2 . ARG A 1 215 ? 76.941  12.590  24.181  1.00 53.45  ? 215  ARG A NH2 1 
ATOM   1653 N N   . ALA A 1 216 ? 71.700  11.881  28.415  1.00 21.90  ? 216  ALA A N   1 
ATOM   1654 C CA  . ALA A 1 216 ? 70.996  12.890  29.206  1.00 22.34  ? 216  ALA A CA  1 
ATOM   1655 C C   . ALA A 1 216 ? 69.882  12.252  30.038  1.00 23.80  ? 216  ALA A C   1 
ATOM   1656 O O   . ALA A 1 216 ? 69.678  12.680  31.163  1.00 24.39  ? 216  ALA A O   1 
ATOM   1657 C CB  . ALA A 1 216 ? 70.451  14.004  28.346  1.00 14.17  ? 216  ALA A CB  1 
ATOM   1658 N N   . ILE A 1 217 ? 69.250  11.172  29.603  1.00 24.28  ? 217  ILE A N   1 
ATOM   1659 C CA  . ILE A 1 217 ? 68.264  10.501  30.429  1.00 26.57  ? 217  ILE A CA  1 
ATOM   1660 C C   . ILE A 1 217 ? 69.017  9.864   31.601  1.00 28.55  ? 217  ILE A C   1 
ATOM   1661 O O   . ILE A 1 217 ? 68.621  9.974   32.763  1.00 28.63  ? 217  ILE A O   1 
ATOM   1662 C CB  . ILE A 1 217 ? 67.429  9.473   29.656  1.00 22.80  ? 217  ILE A CB  1 
ATOM   1663 C CG1 . ILE A 1 217 ? 66.482  10.217  28.700  1.00 24.41  ? 217  ILE A CG1 1 
ATOM   1664 C CG2 . ILE A 1 217 ? 66.654  8.550   30.570  1.00 19.72  ? 217  ILE A CG2 1 
ATOM   1665 C CD1 . ILE A 1 217 ? 65.779  9.327   27.696  1.00 23.57  ? 217  ILE A CD1 1 
ATOM   1666 N N   . ALA A 1 218 ? 70.111  9.187   31.290  1.00 30.97  ? 218  ALA A N   1 
ATOM   1667 C CA  . ALA A 1 218 ? 70.918  8.499   32.288  1.00 33.67  ? 218  ALA A CA  1 
ATOM   1668 C C   . ALA A 1 218 ? 71.388  9.440   33.386  1.00 35.46  ? 218  ALA A C   1 
ATOM   1669 O O   . ALA A 1 218 ? 71.245  9.112   34.556  1.00 36.74  ? 218  ALA A O   1 
ATOM   1670 C CB  . ALA A 1 218 ? 72.100  7.795   31.640  1.00 31.28  ? 218  ALA A CB  1 
ATOM   1671 N N   . ARG A 1 219 ? 71.879  10.617  33.035  1.00 37.77  ? 219  ARG A N   1 
ATOM   1672 C CA  . ARG A 1 219 ? 72.416  11.585  33.963  1.00 39.50  ? 219  ARG A CA  1 
ATOM   1673 C C   . ARG A 1 219 ? 71.351  12.358  34.711  1.00 40.44  ? 219  ARG A C   1 
ATOM   1674 O O   . ARG A 1 219 ? 71.591  12.689  35.886  1.00 39.92  ? 219  ARG A O   1 
ATOM   1675 C CB  . ARG A 1 219 ? 73.461  12.476  33.291  1.00 43.06  ? 219  ARG A CB  1 
ATOM   1676 C CG  . ARG A 1 219 ? 74.650  11.711  32.704  1.00 48.09  ? 219  ARG A CG  1 
ATOM   1677 C CD  . ARG A 1 219 ? 74.984  10.401  33.406  1.00 52.03  ? 219  ARG A CD  1 
ATOM   1678 N NE  . ARG A 1 219 ? 76.098  9.654   32.840  1.00 55.08  ? 219  ARG A NE  1 
ATOM   1679 C CZ  . ARG A 1 219 ? 76.356  8.364   32.968  1.00 57.38  ? 219  ARG A CZ  1 
ATOM   1680 N NH1 . ARG A 1 219 ? 75.576  7.543   33.669  1.00 58.45  ? 219  ARG A NH1 1 
ATOM   1681 N NH2 . ARG A 1 219 ? 77.421  7.813   32.388  1.00 58.78  ? 219  ARG A NH2 1 
ATOM   1682 N N   . ARG A 1 220 ? 70.161  12.524  34.150  1.00 40.42  ? 220  ARG A N   1 
ATOM   1683 C CA  . ARG A 1 220 ? 69.060  13.168  34.827  1.00 41.47  ? 220  ARG A CA  1 
ATOM   1684 C C   . ARG A 1 220 ? 68.624  12.409  36.084  1.00 43.35  ? 220  ARG A C   1 
ATOM   1685 O O   . ARG A 1 220 ? 68.106  12.980  37.039  1.00 42.41  ? 220  ARG A O   1 
ATOM   1686 C CB  . ARG A 1 220 ? 67.828  13.225  33.906  1.00 41.10  ? 220  ARG A CB  1 
ATOM   1687 C CG  . ARG A 1 220 ? 66.628  13.952  34.509  1.00 37.63  ? 220  ARG A CG  1 
ATOM   1688 C CD  . ARG A 1 220 ? 66.970  15.417  34.679  1.00 36.45  ? 220  ARG A CD  1 
ATOM   1689 N NE  . ARG A 1 220 ? 66.055  16.225  35.457  1.00 39.60  ? 220  ARG A NE  1 
ATOM   1690 C CZ  . ARG A 1 220 ? 65.743  16.125  36.745  1.00 39.37  ? 220  ARG A CZ  1 
ATOM   1691 N NH1 . ARG A 1 220 ? 66.244  15.179  37.527  1.00 39.35  ? 220  ARG A NH1 1 
ATOM   1692 N NH2 . ARG A 1 220 ? 64.905  17.002  37.269  1.00 39.01  ? 220  ARG A NH2 1 
ATOM   1693 N N   . TYR A 1 221 ? 68.749  11.093  36.054  1.00 45.34  ? 221  TYR A N   1 
ATOM   1694 C CA  . TYR A 1 221 ? 68.346  10.213  37.119  1.00 48.66  ? 221  TYR A CA  1 
ATOM   1695 C C   . TYR A 1 221 ? 69.528  9.934   38.045  1.00 51.50  ? 221  TYR A C   1 
ATOM   1696 O O   . TYR A 1 221 ? 69.295  9.481   39.157  1.00 51.16  ? 221  TYR A O   1 
ATOM   1697 C CB  . TYR A 1 221 ? 67.826  8.871   36.595  1.00 46.92  ? 221  TYR A CB  1 
ATOM   1698 C CG  . TYR A 1 221 ? 66.416  8.914   36.072  1.00 46.66  ? 221  TYR A CG  1 
ATOM   1699 C CD1 . TYR A 1 221 ? 66.118  9.300   34.768  1.00 46.74  ? 221  TYR A CD1 1 
ATOM   1700 C CD2 . TYR A 1 221 ? 65.352  8.559   36.895  1.00 46.29  ? 221  TYR A CD2 1 
ATOM   1701 C CE1 . TYR A 1 221 ? 64.814  9.319   34.306  1.00 45.95  ? 221  TYR A CE1 1 
ATOM   1702 C CE2 . TYR A 1 221 ? 64.046  8.573   36.451  1.00 45.07  ? 221  TYR A CE2 1 
ATOM   1703 C CZ  . TYR A 1 221 ? 63.784  8.956   35.151  1.00 45.57  ? 221  TYR A CZ  1 
ATOM   1704 O OH  . TYR A 1 221 ? 62.484  8.981   34.697  1.00 44.91  ? 221  TYR A OH  1 
ATOM   1705 N N   . GLY A 1 222 ? 70.737  10.193  37.555  1.00 54.59  ? 222  GLY A N   1 
ATOM   1706 C CA  . GLY A 1 222 ? 71.934  9.888   38.347  1.00 58.41  ? 222  GLY A CA  1 
ATOM   1707 C C   . GLY A 1 222 ? 71.844  8.405   38.753  1.00 61.10  ? 222  GLY A C   1 
ATOM   1708 O O   . GLY A 1 222 ? 71.587  7.503   37.940  1.00 61.47  ? 222  GLY A O   1 
ATOM   1709 N N   . ASP A 1 223 ? 72.029  8.196   40.055  1.00 62.65  ? 223  ASP A N   1 
ATOM   1710 C CA  . ASP A 1 223 ? 71.816  6.867   40.635  1.00 64.00  ? 223  ASP A CA  1 
ATOM   1711 C C   . ASP A 1 223 ? 70.337  6.858   41.023  1.00 64.07  ? 223  ASP A C   1 
ATOM   1712 O O   . ASP A 1 223 ? 69.747  7.926   41.184  1.00 64.16  ? 223  ASP A O   1 
ATOM   1713 C CB  . ASP A 1 223 ? 72.688  6.587   41.844  1.00 67.72  ? 223  ASP A CB  1 
ATOM   1714 C CG  . ASP A 1 223 ? 72.739  7.722   42.848  1.00 68.66  ? 223  ASP A CG  1 
ATOM   1715 O OD1 . ASP A 1 223 ? 71.891  8.638   42.817  1.00 69.67  ? 223  ASP A OD1 1 
ATOM   1716 O OD2 . ASP A 1 223 ? 73.662  7.722   43.695  1.00 70.68  ? 223  ASP A OD2 1 
ATOM   1717 N N   . GLY A 1 224 ? 69.757  5.687   41.162  1.00 64.27  ? 224  GLY A N   1 
ATOM   1718 C CA  . GLY A 1 224 ? 68.313  5.604   41.461  1.00 63.19  ? 224  GLY A CA  1 
ATOM   1719 C C   . GLY A 1 224 ? 67.748  4.852   40.244  1.00 61.95  ? 224  GLY A C   1 
ATOM   1720 O O   . GLY A 1 224 ? 68.327  5.008   39.166  1.00 61.95  ? 224  GLY A O   1 
ATOM   1721 N N   . ARG A 1 225 ? 66.736  4.019   40.463  1.00 60.81  ? 225  ARG A N   1 
ATOM   1722 C CA  . ARG A 1 225 ? 66.224  3.276   39.320  1.00 58.81  ? 225  ARG A CA  1 
ATOM   1723 C C   . ARG A 1 225 ? 65.768  4.290   38.259  1.00 56.20  ? 225  ARG A C   1 
ATOM   1724 O O   . ARG A 1 225 ? 65.054  5.260   38.469  1.00 55.71  ? 225  ARG A O   1 
ATOM   1725 C CB  . ARG A 1 225 ? 65.135  2.293   39.662  1.00 64.02  ? 225  ARG A CB  1 
ATOM   1726 C CG  . ARG A 1 225 ? 65.463  1.071   40.497  1.00 68.74  ? 225  ARG A CG  1 
ATOM   1727 C CD  . ARG A 1 225 ? 64.353  0.027   40.431  1.00 71.51  ? 225  ARG A CD  1 
ATOM   1728 N NE  . ARG A 1 225 ? 63.025  0.602   40.346  1.00 74.63  ? 225  ARG A NE  1 
ATOM   1729 C CZ  . ARG A 1 225 ? 62.415  1.464   41.152  1.00 76.61  ? 225  ARG A CZ  1 
ATOM   1730 N NH1 . ARG A 1 225 ? 62.996  1.970   42.235  1.00 76.97  ? 225  ARG A NH1 1 
ATOM   1731 N NH2 . ARG A 1 225 ? 61.180  1.852   40.838  1.00 77.16  ? 225  ARG A NH2 1 
ATOM   1732 N N   . ARG A 1 226 ? 66.304  4.071   37.073  1.00 52.83  ? 226  ARG A N   1 
ATOM   1733 C CA  . ARG A 1 226 ? 65.931  4.849   35.894  1.00 49.05  ? 226  ARG A CA  1 
ATOM   1734 C C   . ARG A 1 226 ? 65.176  3.832   35.037  1.00 44.48  ? 226  ARG A C   1 
ATOM   1735 O O   . ARG A 1 226 ? 65.470  2.634   35.080  1.00 44.17  ? 226  ARG A O   1 
ATOM   1736 C CB  . ARG A 1 226 ? 67.146  5.430   35.207  1.00 51.75  ? 226  ARG A CB  1 
ATOM   1737 C CG  . ARG A 1 226 ? 67.874  4.551   34.213  1.00 52.93  ? 226  ARG A CG  1 
ATOM   1738 C CD  . ARG A 1 226 ? 69.135  5.245   33.704  1.00 56.23  ? 226  ARG A CD  1 
ATOM   1739 N NE  . ARG A 1 226 ? 69.731  4.494   32.596  1.00 58.34  ? 226  ARG A NE  1 
ATOM   1740 C CZ  . ARG A 1 226 ? 71.039  4.249   32.500  1.00 58.64  ? 226  ARG A CZ  1 
ATOM   1741 N NH1 . ARG A 1 226 ? 71.840  4.700   33.461  1.00 58.16  ? 226  ARG A NH1 1 
ATOM   1742 N NH2 . ARG A 1 226 ? 71.514  3.550   31.477  1.00 56.65  ? 226  ARG A NH2 1 
ATOM   1743 N N   . PRO A 1 227 ? 64.098  4.263   34.419  1.00 41.38  ? 227  PRO A N   1 
ATOM   1744 C CA  . PRO A 1 227 ? 63.322  3.354   33.570  1.00 38.38  ? 227  PRO A CA  1 
ATOM   1745 C C   . PRO A 1 227 ? 64.158  3.024   32.344  1.00 33.95  ? 227  PRO A C   1 
ATOM   1746 O O   . PRO A 1 227 ? 64.927  3.860   31.875  1.00 32.70  ? 227  PRO A O   1 
ATOM   1747 C CB  . PRO A 1 227 ? 62.074  4.144   33.247  1.00 38.60  ? 227  PRO A CB  1 
ATOM   1748 C CG  . PRO A 1 227 ? 62.404  5.563   33.464  1.00 40.22  ? 227  PRO A CG  1 
ATOM   1749 C CD  . PRO A 1 227 ? 63.621  5.652   34.347  1.00 40.54  ? 227  PRO A CD  1 
ATOM   1750 N N   . PRO A 1 228 ? 64.051  1.810   31.849  1.00 30.17  ? 228  PRO A N   1 
ATOM   1751 C CA  . PRO A 1 228 ? 64.766  1.391   30.655  1.00 28.78  ? 228  PRO A CA  1 
ATOM   1752 C C   . PRO A 1 228 ? 64.142  2.017   29.400  1.00 26.43  ? 228  PRO A C   1 
ATOM   1753 O O   . PRO A 1 228 ? 62.940  2.282   29.362  1.00 23.09  ? 228  PRO A O   1 
ATOM   1754 C CB  . PRO A 1 228 ? 64.550  -0.123  30.654  1.00 29.08  ? 228  PRO A CB  1 
ATOM   1755 C CG  . PRO A 1 228 ? 63.187  -0.278  31.243  1.00 28.51  ? 228  PRO A CG  1 
ATOM   1756 C CD  . PRO A 1 228 ? 63.156  0.756   32.338  1.00 29.59  ? 228  PRO A CD  1 
ATOM   1757 N N   . ILE A 1 229 ? 64.942  2.178   28.367  1.00 24.28  ? 229  ILE A N   1 
ATOM   1758 C CA  . ILE A 1 229 ? 64.536  2.716   27.086  1.00 22.77  ? 229  ILE A CA  1 
ATOM   1759 C C   . ILE A 1 229 ? 64.374  1.572   26.081  1.00 23.34  ? 229  ILE A C   1 
ATOM   1760 O O   . ILE A 1 229 ? 65.347  0.855   25.830  1.00 21.95  ? 229  ILE A O   1 
ATOM   1761 C CB  . ILE A 1 229 ? 65.548  3.738   26.499  1.00 18.73  ? 229  ILE A CB  1 
ATOM   1762 C CG1 . ILE A 1 229 ? 65.616  4.973   27.391  1.00 17.01  ? 229  ILE A CG1 1 
ATOM   1763 C CG2 . ILE A 1 229 ? 65.191  4.126   25.059  1.00 12.78  ? 229  ILE A CG2 1 
ATOM   1764 C CD1 . ILE A 1 229 ? 66.919  5.759   27.329  1.00 19.72  ? 229  ILE A CD1 1 
ATOM   1765 N N   . ALA A 1 230 ? 63.164  1.460   25.525  1.00 22.56  ? 230  ALA A N   1 
ATOM   1766 C CA  . ALA A 1 230 ? 62.890  0.483   24.485  1.00 21.78  ? 230  ALA A CA  1 
ATOM   1767 C C   . ALA A 1 230 ? 62.705  1.320   23.201  1.00 21.80  ? 230  ALA A C   1 
ATOM   1768 O O   . ALA A 1 230 ? 62.035  2.368   23.236  1.00 22.72  ? 230  ALA A O   1 
ATOM   1769 C CB  . ALA A 1 230 ? 61.668  -0.394  24.671  1.00 20.19  ? 230  ALA A CB  1 
ATOM   1770 N N   . SER A 1 231 ? 63.283  0.839   22.130  1.00 20.60  ? 231  SER A N   1 
ATOM   1771 C CA  . SER A 1 231 ? 63.286  1.533   20.877  1.00 20.43  ? 231  SER A CA  1 
ATOM   1772 C C   . SER A 1 231 ? 63.131  0.604   19.682  1.00 20.60  ? 231  SER A C   1 
ATOM   1773 O O   . SER A 1 231 ? 63.682  -0.465  19.532  1.00 19.38  ? 231  SER A O   1 
ATOM   1774 C CB  . SER A 1 231 ? 64.592  2.366   20.683  1.00 20.31  ? 231  SER A CB  1 
ATOM   1775 O OG  . SER A 1 231 ? 64.473  3.152   19.483  1.00 15.10  ? 231  SER A OG  1 
ATOM   1776 N N   . LEU A 1 232 ? 62.428  1.167   18.703  1.00 20.49  ? 232  LEU A N   1 
ATOM   1777 C CA  . LEU A 1 232 ? 62.136  0.620   17.422  1.00 19.53  ? 232  LEU A CA  1 
ATOM   1778 C C   . LEU A 1 232 ? 63.184  1.147   16.433  1.00 19.09  ? 232  LEU A C   1 
ATOM   1779 O O   . LEU A 1 232 ? 63.314  0.567   15.364  1.00 20.09  ? 232  LEU A O   1 
ATOM   1780 C CB  . LEU A 1 232 ? 60.817  1.212   16.896  1.00 21.21  ? 232  LEU A CB  1 
ATOM   1781 C CG  . LEU A 1 232 ? 59.482  0.517   16.885  1.00 23.53  ? 232  LEU A CG  1 
ATOM   1782 C CD1 . LEU A 1 232 ? 58.499  1.259   15.965  1.00 18.87  ? 232  LEU A CD1 1 
ATOM   1783 C CD2 . LEU A 1 232 ? 59.579  -0.954  16.484  1.00 20.24  ? 232  LEU A CD2 1 
ATOM   1784 N N   . THR A 1 233 ? 63.862  2.224   16.783  1.00 16.60  ? 233  THR A N   1 
ATOM   1785 C CA  . THR A 1 233 ? 64.756  2.896   15.867  1.00 15.40  ? 233  THR A CA  1 
ATOM   1786 C C   . THR A 1 233 ? 66.233  2.846   16.178  1.00 15.42  ? 233  THR A C   1 
ATOM   1787 O O   . THR A 1 233 ? 67.052  2.843   15.235  1.00 14.76  ? 233  THR A O   1 
ATOM   1788 C CB  . THR A 1 233 ? 64.286  4.381   15.810  1.00 15.85  ? 233  THR A CB  1 
ATOM   1789 O OG1 . THR A 1 233 ? 64.150  4.895   17.150  1.00 14.44  ? 233  THR A OG1 1 
ATOM   1790 C CG2 . THR A 1 233 ? 62.913  4.520   15.165  1.00 14.40  ? 233  THR A CG2 1 
ATOM   1791 N N   . THR A 1 234 ? 66.643  2.952   17.441  1.00 14.79  ? 234  THR A N   1 
ATOM   1792 C CA  . THR A 1 234 ? 68.057  2.886   17.780  1.00 14.76  ? 234  THR A CA  1 
ATOM   1793 C C   . THR A 1 234 ? 68.768  1.706   17.150  1.00 16.14  ? 234  THR A C   1 
ATOM   1794 O O   . THR A 1 234 ? 68.277  0.571   17.294  1.00 16.40  ? 234  THR A O   1 
ATOM   1795 C CB  . THR A 1 234 ? 68.184  2.725   19.305  1.00 12.85  ? 234  THR A CB  1 
ATOM   1796 O OG1 . THR A 1 234 ? 67.453  3.823   19.852  1.00 14.70  ? 234  THR A OG1 1 
ATOM   1797 C CG2 . THR A 1 234 ? 69.631  2.792   19.753  1.00 8.70   ? 234  THR A CG2 1 
ATOM   1798 N N   . SER A 1 235 ? 69.881  1.912   16.455  1.00 16.59  ? 235  SER A N   1 
ATOM   1799 C CA  . SER A 1 235 ? 70.583  0.759   15.883  1.00 17.02  ? 235  SER A CA  1 
ATOM   1800 C C   . SER A 1 235 ? 71.904  0.582   16.632  1.00 17.98  ? 235  SER A C   1 
ATOM   1801 O O   . SER A 1 235 ? 72.258  1.333   17.528  1.00 17.53  ? 235  SER A O   1 
ATOM   1802 C CB  . SER A 1 235 ? 70.895  0.915   14.396  1.00 15.65  ? 235  SER A CB  1 
ATOM   1803 O OG  . SER A 1 235 ? 71.926  1.874   14.161  1.00 14.27  ? 235  SER A OG  1 
ATOM   1804 N N   . GLU A 1 236 ? 72.748  -0.314  16.122  1.00 19.37  ? 236  GLU A N   1 
ATOM   1805 C CA  . GLU A 1 236 ? 74.078  -0.586  16.655  1.00 19.62  ? 236  GLU A CA  1 
ATOM   1806 C C   . GLU A 1 236 ? 75.007  0.607   16.499  1.00 20.22  ? 236  GLU A C   1 
ATOM   1807 O O   . GLU A 1 236 ? 75.880  0.901   17.357  1.00 20.12  ? 236  GLU A O   1 
ATOM   1808 C CB  . GLU A 1 236 ? 74.638  -1.852  15.945  1.00 17.88  ? 236  GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 236 ? 74.135  -3.124  16.609  1.00 17.03  ? 236  GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 236 ? 74.783  -4.432  16.193  1.00 21.22  ? 236  GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 236 ? 76.041  -4.564  16.220  1.00 19.88  ? 236  GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 236 ? 74.035  -5.390  15.849  1.00 18.48  ? 236  GLU A OE2 1 
ATOM   1813 N N   . ALA A 1 237 ? 74.779  1.362   15.409  1.00 18.34  ? 237  ALA A N   1 
ATOM   1814 C CA  . ALA A 1 237 ? 75.621  2.529   15.171  1.00 19.74  ? 237  ALA A CA  1 
ATOM   1815 C C   . ALA A 1 237 ? 75.437  3.616   16.240  1.00 19.85  ? 237  ALA A C   1 
ATOM   1816 O O   . ALA A 1 237 ? 76.401  4.295   16.593  1.00 17.93  ? 237  ALA A O   1 
ATOM   1817 C CB  . ALA A 1 237 ? 75.413  3.050   13.755  1.00 19.70  ? 237  ALA A CB  1 
ATOM   1818 N N   . GLU A 1 238 ? 74.232  3.804   16.784  1.00 19.46  ? 238  GLU A N   1 
ATOM   1819 C CA  . GLU A 1 238 ? 73.984  4.792   17.815  1.00 20.54  ? 238  GLU A CA  1 
ATOM   1820 C C   . GLU A 1 238 ? 74.502  4.272   19.167  1.00 21.59  ? 238  GLU A C   1 
ATOM   1821 O O   . GLU A 1 238 ? 75.073  5.005   19.967  1.00 22.25  ? 238  GLU A O   1 
ATOM   1822 C CB  . GLU A 1 238 ? 72.508  5.063   17.988  1.00 20.44  ? 238  GLU A CB  1 
ATOM   1823 C CG  . GLU A 1 238 ? 71.709  5.803   16.977  1.00 23.81  ? 238  GLU A CG  1 
ATOM   1824 C CD  . GLU A 1 238 ? 71.554  5.173   15.616  1.00 24.77  ? 238  GLU A CD  1 
ATOM   1825 O OE1 . GLU A 1 238 ? 71.278  3.961   15.487  1.00 26.68  ? 238  GLU A OE1 1 
ATOM   1826 O OE2 . GLU A 1 238 ? 71.750  5.965   14.679  1.00 23.34  ? 238  GLU A OE2 1 
ATOM   1827 N N   . VAL A 1 239 ? 74.305  2.963   19.389  1.00 21.19  ? 239  VAL A N   1 
ATOM   1828 C CA  . VAL A 1 239 ? 74.759  2.345   20.623  1.00 20.78  ? 239  VAL A CA  1 
ATOM   1829 C C   . VAL A 1 239 ? 76.272  2.430   20.708  1.00 21.54  ? 239  VAL A C   1 
ATOM   1830 O O   . VAL A 1 239 ? 76.798  2.708   21.788  1.00 21.19  ? 239  VAL A O   1 
ATOM   1831 C CB  . VAL A 1 239 ? 74.236  0.900   20.746  1.00 21.38  ? 239  VAL A CB  1 
ATOM   1832 C CG1 . VAL A 1 239 ? 74.880  0.117   21.890  1.00 20.59  ? 239  VAL A CG1 1 
ATOM   1833 C CG2 . VAL A 1 239 ? 72.721  0.915   20.939  1.00 19.34  ? 239  VAL A CG2 1 
ATOM   1834 N N   . ALA A 1 240 ? 76.999  2.316   19.583  1.00 22.06  ? 240  ALA A N   1 
ATOM   1835 C CA  . ALA A 1 240 ? 78.456  2.420   19.655  1.00 22.39  ? 240  ALA A CA  1 
ATOM   1836 C C   . ALA A 1 240 ? 78.912  3.801   20.095  1.00 23.99  ? 240  ALA A C   1 
ATOM   1837 O O   . ALA A 1 240 ? 80.050  3.878   20.584  1.00 25.50  ? 240  ALA A O   1 
ATOM   1838 C CB  . ALA A 1 240 ? 79.158  2.055   18.359  1.00 18.16  ? 240  ALA A CB  1 
ATOM   1839 N N   . LYS A 1 241 ? 78.128  4.863   19.920  1.00 23.89  ? 241  LYS A N   1 
ATOM   1840 C CA  . LYS A 1 241 ? 78.482  6.187   20.381  1.00 23.65  ? 241  LYS A CA  1 
ATOM   1841 C C   . LYS A 1 241 ? 78.133  6.338   21.859  1.00 23.74  ? 241  LYS A C   1 
ATOM   1842 O O   . LYS A 1 241 ? 78.319  7.424   22.397  1.00 24.41  ? 241  LYS A O   1 
ATOM   1843 C CB  . LYS A 1 241 ? 77.775  7.303   19.573  1.00 24.35  ? 241  LYS A CB  1 
ATOM   1844 C CG  . LYS A 1 241 ? 77.954  7.236   18.083  1.00 29.53  ? 241  LYS A CG  1 
ATOM   1845 C CD  . LYS A 1 241 ? 77.477  8.372   17.167  1.00 30.40  ? 241  LYS A CD  1 
ATOM   1846 C CE  . LYS A 1 241 ? 78.625  8.595   16.189  1.00 36.11  ? 241  LYS A CE  1 
ATOM   1847 N NZ  . LYS A 1 241 ? 78.494  9.147   14.831  1.00 34.32  ? 241  LYS A NZ  1 
ATOM   1848 N N   . MET A 1 242 ? 77.524  5.374   22.538  1.00 24.16  ? 242  MET A N   1 
ATOM   1849 C CA  . MET A 1 242 ? 77.146  5.505   23.931  1.00 24.77  ? 242  MET A CA  1 
ATOM   1850 C C   . MET A 1 242 ? 78.203  4.895   24.863  1.00 27.34  ? 242  MET A C   1 
ATOM   1851 O O   . MET A 1 242 ? 78.826  3.888   24.518  1.00 26.47  ? 242  MET A O   1 
ATOM   1852 C CB  . MET A 1 242 ? 75.823  4.797   24.197  1.00 20.01  ? 242  MET A CB  1 
ATOM   1853 C CG  . MET A 1 242 ? 74.597  5.360   23.475  1.00 19.10  ? 242  MET A CG  1 
ATOM   1854 S SD  . MET A 1 242 ? 73.130  4.327   23.721  1.00 19.20  ? 242  MET A SD  1 
ATOM   1855 C CE  . MET A 1 242 ? 72.033  4.990   22.444  1.00 18.28  ? 242  MET A CE  1 
ATOM   1856 N N   . GLU A 1 243 ? 78.302  5.400   26.087  1.00 28.89  ? 243  GLU A N   1 
ATOM   1857 C CA  . GLU A 1 243 ? 79.176  4.749   27.065  1.00 32.22  ? 243  GLU A CA  1 
ATOM   1858 C C   . GLU A 1 243 ? 78.421  3.538   27.600  1.00 33.45  ? 243  GLU A C   1 
ATOM   1859 O O   . GLU A 1 243 ? 77.185  3.499   27.729  1.00 32.81  ? 243  GLU A O   1 
ATOM   1860 C CB  . GLU A 1 243 ? 79.612  5.716   28.168  1.00 36.75  ? 243  GLU A CB  1 
ATOM   1861 C CG  . GLU A 1 243 ? 78.479  6.591   28.655  1.00 43.98  ? 243  GLU A CG  1 
ATOM   1862 C CD  . GLU A 1 243 ? 78.863  7.878   29.345  1.00 46.66  ? 243  GLU A CD  1 
ATOM   1863 O OE1 . GLU A 1 243 ? 79.332  7.687   30.499  1.00 51.65  ? 243  GLU A OE1 1 
ATOM   1864 O OE2 . GLU A 1 243 ? 78.698  8.998   28.832  1.00 45.36  ? 243  GLU A OE2 1 
ATOM   1865 N N   . SER A 1 244 ? 79.169  2.487   27.911  1.00 34.24  ? 244  SER A N   1 
ATOM   1866 C CA  . SER A 1 244 ? 78.684  1.220   28.410  1.00 35.47  ? 244  SER A CA  1 
ATOM   1867 C C   . SER A 1 244 ? 77.559  1.226   29.424  1.00 35.51  ? 244  SER A C   1 
ATOM   1868 O O   . SER A 1 244 ? 76.545  0.503   29.321  1.00 35.18  ? 244  SER A O   1 
ATOM   1869 C CB  . SER A 1 244 ? 79.874  0.422   28.988  1.00 38.58  ? 244  SER A CB  1 
ATOM   1870 O OG  . SER A 1 244 ? 80.364  -0.445  27.946  1.00 42.81  ? 244  SER A OG  1 
ATOM   1871 N N   . ASP A 1 245 ? 77.675  2.091   30.423  1.00 35.19  ? 245  ASP A N   1 
ATOM   1872 C CA  . ASP A 1 245 ? 76.650  2.141   31.466  1.00 35.50  ? 245  ASP A CA  1 
ATOM   1873 C C   . ASP A 1 245 ? 75.429  2.914   31.014  1.00 33.93  ? 245  ASP A C   1 
ATOM   1874 O O   . ASP A 1 245 ? 74.358  2.778   31.607  1.00 33.36  ? 245  ASP A O   1 
ATOM   1875 C CB  . ASP A 1 245 ? 77.265  2.714   32.750  1.00 39.68  ? 245  ASP A CB  1 
ATOM   1876 C CG  . ASP A 1 245 ? 77.517  4.200   32.568  1.00 44.90  ? 245  ASP A CG  1 
ATOM   1877 O OD1 . ASP A 1 245 ? 78.497  4.551   31.889  1.00 46.53  ? 245  ASP A OD1 1 
ATOM   1878 O OD2 . ASP A 1 245 ? 76.705  4.999   33.092  1.00 49.69  ? 245  ASP A OD2 1 
ATOM   1879 N N   . VAL A 1 246 ? 75.593  3.748   29.978  1.00 33.23  ? 246  VAL A N   1 
ATOM   1880 C CA  . VAL A 1 246 ? 74.421  4.482   29.471  1.00 31.16  ? 246  VAL A CA  1 
ATOM   1881 C C   . VAL A 1 246 ? 73.596  3.504   28.644  1.00 29.60  ? 246  VAL A C   1 
ATOM   1882 O O   . VAL A 1 246 ? 72.382  3.505   28.737  1.00 30.29  ? 246  VAL A O   1 
ATOM   1883 C CB  . VAL A 1 246 ? 74.835  5.721   28.675  1.00 32.00  ? 246  VAL A CB  1 
ATOM   1884 C CG1 . VAL A 1 246 ? 73.745  6.281   27.772  1.00 28.91  ? 246  VAL A CG1 1 
ATOM   1885 C CG2 . VAL A 1 246 ? 75.292  6.815   29.650  1.00 30.44  ? 246  VAL A CG2 1 
ATOM   1886 N N   . ALA A 1 247 ? 74.251  2.630   27.897  1.00 28.51  ? 247  ALA A N   1 
ATOM   1887 C CA  . ALA A 1 247 ? 73.589  1.669   27.032  1.00 27.68  ? 247  ALA A CA  1 
ATOM   1888 C C   . ALA A 1 247 ? 73.016  0.438   27.718  1.00 26.93  ? 247  ALA A C   1 
ATOM   1889 O O   . ALA A 1 247 ? 72.101  -0.200  27.212  1.00 24.62  ? 247  ALA A O   1 
ATOM   1890 C CB  . ALA A 1 247 ? 74.573  1.200   25.947  1.00 24.48  ? 247  ALA A CB  1 
ATOM   1891 N N   . GLU A 1 248 ? 73.545  0.100   28.889  1.00 27.99  ? 248  GLU A N   1 
ATOM   1892 C CA  . GLU A 1 248 ? 73.169  -1.114  29.605  1.00 27.76  ? 248  GLU A CA  1 
ATOM   1893 C C   . GLU A 1 248 ? 71.683  -1.183  29.859  1.00 26.28  ? 248  GLU A C   1 
ATOM   1894 O O   . GLU A 1 248 ? 71.146  -0.139  30.242  1.00 28.22  ? 248  GLU A O   1 
ATOM   1895 C CB  . GLU A 1 248 ? 73.984  -1.164  30.910  1.00 30.09  ? 248  GLU A CB  1 
ATOM   1896 C CG  . GLU A 1 248 ? 73.658  -2.347  31.809  1.00 36.83  ? 248  GLU A CG  1 
ATOM   1897 C CD  . GLU A 1 248 ? 74.707  -2.573  32.897  1.00 40.75  ? 248  GLU A CD  1 
ATOM   1898 O OE1 . GLU A 1 248 ? 75.163  -1.600  33.548  1.00 41.59  ? 248  GLU A OE1 1 
ATOM   1899 O OE2 . GLU A 1 248 ? 75.084  -3.753  33.093  1.00 41.54  ? 248  GLU A OE2 1 
ATOM   1900 N N   . GLY A 1 249 ? 71.006  -2.312  29.676  1.00 24.15  ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? 69.604  -2.423  29.964  1.00 22.72  ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? 68.666  -1.960  28.867  1.00 24.08  ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? 67.457  -2.224  28.974  1.00 24.64  ? 249  GLY A O   1 
ATOM   1904 N N   . GLN A 1 250 ? 69.131  -1.302  27.812  1.00 23.89  ? 250  GLN A N   1 
ATOM   1905 C CA  . GLN A 1 250 ? 68.224  -0.833  26.759  1.00 23.99  ? 250  GLN A CA  1 
ATOM   1906 C C   . GLN A 1 250 ? 67.818  -1.929  25.786  1.00 23.56  ? 250  GLN A C   1 
ATOM   1907 O O   . GLN A 1 250 ? 68.562  -2.895  25.552  1.00 22.62  ? 250  GLN A O   1 
ATOM   1908 C CB  . GLN A 1 250 ? 68.829  0.352   26.020  1.00 25.65  ? 250  GLN A CB  1 
ATOM   1909 C CG  . GLN A 1 250 ? 69.519  1.303   26.973  1.00 33.66  ? 250  GLN A CG  1 
ATOM   1910 C CD  . GLN A 1 250 ? 68.834  2.023   28.097  1.00 35.54  ? 250  GLN A CD  1 
ATOM   1911 O OE1 . GLN A 1 250 ? 67.751  1.708   28.579  1.00 33.69  ? 250  GLN A OE1 1 
ATOM   1912 N NE2 . GLN A 1 250 ? 69.503  3.108   28.549  1.00 37.22  ? 250  GLN A NE2 1 
ATOM   1913 N N   . VAL A 1 251 ? 66.599  -1.757  25.279  1.00 22.02  ? 251  VAL A N   1 
ATOM   1914 C CA  . VAL A 1 251 ? 66.000  -2.754  24.399  1.00 22.15  ? 251  VAL A CA  1 
ATOM   1915 C C   . VAL A 1 251 ? 65.813  -2.218  22.993  1.00 22.43  ? 251  VAL A C   1 
ATOM   1916 O O   . VAL A 1 251 ? 65.299  -1.117  22.765  1.00 21.62  ? 251  VAL A O   1 
ATOM   1917 C CB  . VAL A 1 251 ? 64.648  -3.250  24.981  1.00 23.45  ? 251  VAL A CB  1 
ATOM   1918 C CG1 . VAL A 1 251 ? 63.842  -4.116  24.038  1.00 21.90  ? 251  VAL A CG1 1 
ATOM   1919 C CG2 . VAL A 1 251 ? 64.908  -3.975  26.308  1.00 21.04  ? 251  VAL A CG2 1 
ATOM   1920 N N   . VAL A 1 252 ? 66.257  -3.036  22.032  1.00 20.40  ? 252  VAL A N   1 
ATOM   1921 C CA  . VAL A 1 252 ? 66.204  -2.675  20.629  1.00 21.05  ? 252  VAL A CA  1 
ATOM   1922 C C   . VAL A 1 252 ? 65.614  -3.857  19.875  1.00 21.16  ? 252  VAL A C   1 
ATOM   1923 O O   . VAL A 1 252 ? 65.599  -4.963  20.424  1.00 20.85  ? 252  VAL A O   1 
ATOM   1924 C CB  . VAL A 1 252 ? 67.606  -2.307  20.119  1.00 23.32  ? 252  VAL A CB  1 
ATOM   1925 C CG1 . VAL A 1 252 ? 68.048  -0.929  20.613  1.00 20.18  ? 252  VAL A CG1 1 
ATOM   1926 C CG2 . VAL A 1 252 ? 68.607  -3.351  20.620  1.00 24.85  ? 252  VAL A CG2 1 
ATOM   1927 N N   . VAL A 1 253 ? 65.099  -3.629  18.696  1.00 21.33  ? 253  VAL A N   1 
ATOM   1928 C CA  . VAL A 1 253 ? 64.429  -4.636  17.871  1.00 21.26  ? 253  VAL A CA  1 
ATOM   1929 C C   . VAL A 1 253 ? 65.017  -4.615  16.467  1.00 19.67  ? 253  VAL A C   1 
ATOM   1930 O O   . VAL A 1 253 ? 65.338  -3.537  15.958  1.00 21.84  ? 253  VAL A O   1 
ATOM   1931 C CB  . VAL A 1 253 ? 62.921  -4.342  17.798  1.00 25.02  ? 253  VAL A CB  1 
ATOM   1932 C CG1 . VAL A 1 253 ? 62.663  -3.068  16.988  1.00 25.84  ? 253  VAL A CG1 1 
ATOM   1933 C CG2 . VAL A 1 253 ? 62.054  -5.398  17.132  1.00 28.72  ? 253  VAL A CG2 1 
ATOM   1934 N N   . ALA A 1 254 ? 65.154  -5.753  15.814  1.00 16.99  ? 254  ALA A N   1 
ATOM   1935 C CA  . ALA A 1 254 ? 65.676  -5.837  14.471  1.00 15.47  ? 254  ALA A CA  1 
ATOM   1936 C C   . ALA A 1 254 ? 65.660  -7.295  14.007  1.00 15.78  ? 254  ALA A C   1 
ATOM   1937 O O   . ALA A 1 254 ? 65.618  -8.230  14.803  1.00 16.06  ? 254  ALA A O   1 
ATOM   1938 C CB  . ALA A 1 254 ? 67.109  -5.316  14.499  1.00 13.96  ? 254  ALA A CB  1 
ATOM   1939 N N   . PRO A 1 255 ? 65.685  -7.500  12.702  1.00 15.46  ? 255  PRO A N   1 
ATOM   1940 C CA  . PRO A 1 255 ? 65.803  -8.807  12.104  1.00 15.43  ? 255  PRO A CA  1 
ATOM   1941 C C   . PRO A 1 255 ? 67.177  -9.395  12.375  1.00 15.14  ? 255  PRO A C   1 
ATOM   1942 O O   . PRO A 1 255 ? 67.353  -10.612 12.408  1.00 15.51  ? 255  PRO A O   1 
ATOM   1943 C CB  . PRO A 1 255 ? 65.614  -8.559  10.600  1.00 16.11  ? 255  PRO A CB  1 
ATOM   1944 C CG  . PRO A 1 255 ? 64.976  -7.193  10.539  1.00 15.61  ? 255  PRO A CG  1 
ATOM   1945 C CD  . PRO A 1 255 ? 65.699  -6.433  11.650  1.00 15.69  ? 255  PRO A CD  1 
ATOM   1946 N N   . TYR A 1 256 ? 68.194  -8.561  12.552  1.00 14.59  ? 256  TYR A N   1 
ATOM   1947 C CA  . TYR A 1 256 ? 69.568  -8.959  12.682  1.00 13.83  ? 256  TYR A CA  1 
ATOM   1948 C C   . TYR A 1 256 ? 70.287  -8.224  13.788  1.00 13.74  ? 256  TYR A C   1 
ATOM   1949 O O   . TYR A 1 256 ? 70.074  -7.021  13.940  1.00 14.29  ? 256  TYR A O   1 
ATOM   1950 C CB  . TYR A 1 256 ? 70.323  -8.676  11.347  1.00 11.29  ? 256  TYR A CB  1 
ATOM   1951 C CG  . TYR A 1 256 ? 71.772  -9.064  11.459  1.00 14.40  ? 256  TYR A CG  1 
ATOM   1952 C CD1 . TYR A 1 256 ? 72.106  -10.418 11.397  1.00 13.19  ? 256  TYR A CD1 1 
ATOM   1953 C CD2 . TYR A 1 256 ? 72.808  -8.133  11.656  1.00 16.09  ? 256  TYR A CD2 1 
ATOM   1954 C CE1 . TYR A 1 256 ? 73.421  -10.811 11.550  1.00 15.13  ? 256  TYR A CE1 1 
ATOM   1955 C CE2 . TYR A 1 256 ? 74.134  -8.522  11.766  1.00 14.14  ? 256  TYR A CE2 1 
ATOM   1956 C CZ  . TYR A 1 256 ? 74.423  -9.872  11.744  1.00 16.38  ? 256  TYR A CZ  1 
ATOM   1957 O OH  . TYR A 1 256 ? 75.704  -10.371 11.885  1.00 16.93  ? 256  TYR A OH  1 
ATOM   1958 N N   . PHE A 1 257 ? 71.150  -8.893  14.541  1.00 14.10  ? 257  PHE A N   1 
ATOM   1959 C CA  . PHE A 1 257 ? 72.068  -8.238  15.491  1.00 14.61  ? 257  PHE A CA  1 
ATOM   1960 C C   . PHE A 1 257 ? 73.447  -8.847  15.227  1.00 15.54  ? 257  PHE A C   1 
ATOM   1961 O O   . PHE A 1 257 ? 73.549  -10.033 14.830  1.00 14.56  ? 257  PHE A O   1 
ATOM   1962 C CB  . PHE A 1 257 ? 71.723  -8.303  16.971  1.00 11.82  ? 257  PHE A CB  1 
ATOM   1963 C CG  . PHE A 1 257 ? 70.524  -7.482  17.340  1.00 10.95  ? 257  PHE A CG  1 
ATOM   1964 C CD1 . PHE A 1 257 ? 70.629  -6.118  17.541  1.00 8.28   ? 257  PHE A CD1 1 
ATOM   1965 C CD2 . PHE A 1 257 ? 69.276  -8.092  17.451  1.00 11.17  ? 257  PHE A CD2 1 
ATOM   1966 C CE1 . PHE A 1 257 ? 69.520  -5.358  17.824  1.00 7.18   ? 257  PHE A CE1 1 
ATOM   1967 C CE2 . PHE A 1 257 ? 68.161  -7.337  17.780  1.00 11.84  ? 257  PHE A CE2 1 
ATOM   1968 C CZ  . PHE A 1 257 ? 68.285  -5.959  17.950  1.00 9.25   ? 257  PHE A CZ  1 
ATOM   1969 N N   . SER A 1 258 ? 74.520  -8.088  15.378  1.00 15.53  ? 258  SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? 75.847  -8.610  15.075  1.00 17.67  ? 258  SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? 76.308  -9.702  16.029  1.00 19.15  ? 258  SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? 77.333  -10.296 15.734  1.00 21.13  ? 258  SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? 76.914  -7.515  15.129  1.00 14.97  ? 258  SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? 76.896  -6.962  16.450  1.00 16.80  ? 258  SER A OG  1 
ATOM   1975 N N   . SER A 1 259 ? 75.652  -9.960  17.139  1.00 20.19  ? 259  SER A N   1 
ATOM   1976 C CA  . SER A 1 259 ? 76.016  -10.965 18.107  1.00 22.08  ? 259  SER A CA  1 
ATOM   1977 C C   . SER A 1 259 ? 75.435  -12.323 17.724  1.00 22.66  ? 259  SER A C   1 
ATOM   1978 O O   . SER A 1 259 ? 75.687  -13.276 18.456  1.00 24.04  ? 259  SER A O   1 
ATOM   1979 C CB  . SER A 1 259 ? 75.491  -10.589 19.509  1.00 19.72  ? 259  SER A CB  1 
ATOM   1980 O OG  . SER A 1 259 ? 74.087  -10.284 19.458  1.00 19.85  ? 259  SER A OG  1 
ATOM   1981 N N   . ILE A 1 260 ? 74.621  -12.438 16.672  1.00 21.70  ? 260  ILE A N   1 
ATOM   1982 C CA  . ILE A 1 260 ? 74.032  -13.737 16.353  1.00 21.49  ? 260  ILE A CA  1 
ATOM   1983 C C   . ILE A 1 260 ? 75.177  -14.718 16.167  1.00 22.08  ? 260  ILE A C   1 
ATOM   1984 O O   . ILE A 1 260 ? 76.159  -14.382 15.521  1.00 23.56  ? 260  ILE A O   1 
ATOM   1985 C CB  . ILE A 1 260 ? 73.048  -13.679 15.183  1.00 19.09  ? 260  ILE A CB  1 
ATOM   1986 C CG1 . ILE A 1 260 ? 71.753  -12.903 15.573  1.00 17.95  ? 260  ILE A CG1 1 
ATOM   1987 C CG2 . ILE A 1 260 ? 72.592  -15.058 14.708  1.00 15.02  ? 260  ILE A CG2 1 
ATOM   1988 C CD1 . ILE A 1 260 ? 70.929  -12.595 14.331  1.00 11.59  ? 260  ILE A CD1 1 
ATOM   1989 N N   . ASP A 1 261 ? 75.100  -15.913 16.707  1.00 23.40  ? 261  ASP A N   1 
ATOM   1990 C CA  . ASP A 1 261 ? 76.168  -16.896 16.548  1.00 23.66  ? 261  ASP A CA  1 
ATOM   1991 C C   . ASP A 1 261 ? 75.723  -18.046 15.653  1.00 22.58  ? 261  ASP A C   1 
ATOM   1992 O O   . ASP A 1 261 ? 75.279  -19.105 16.095  1.00 22.21  ? 261  ASP A O   1 
ATOM   1993 C CB  . ASP A 1 261 ? 76.592  -17.473 17.897  1.00 30.06  ? 261  ASP A CB  1 
ATOM   1994 C CG  . ASP A 1 261 ? 77.753  -18.464 17.763  1.00 30.41  ? 261  ASP A CG  1 
ATOM   1995 O OD1 . ASP A 1 261 ? 78.285  -18.696 16.669  1.00 28.93  ? 261  ASP A OD1 1 
ATOM   1996 O OD2 . ASP A 1 261 ? 78.054  -19.002 18.845  1.00 35.23  ? 261  ASP A OD2 1 
ATOM   1997 N N   . THR A 1 262 ? 75.678  -17.772 14.365  1.00 21.48  ? 262  THR A N   1 
ATOM   1998 C CA  . THR A 1 262 ? 75.320  -18.755 13.364  1.00 19.97  ? 262  THR A CA  1 
ATOM   1999 C C   . THR A 1 262 ? 76.467  -18.577 12.352  1.00 21.01  ? 262  THR A C   1 
ATOM   2000 O O   . THR A 1 262 ? 77.121  -17.535 12.335  1.00 20.18  ? 262  THR A O   1 
ATOM   2001 C CB  . THR A 1 262 ? 73.981  -18.522 12.674  1.00 20.04  ? 262  THR A CB  1 
ATOM   2002 O OG1 . THR A 1 262 ? 74.059  -17.239 12.007  1.00 17.70  ? 262  THR A OG1 1 
ATOM   2003 C CG2 . THR A 1 262 ? 72.732  -18.558 13.563  1.00 16.89  ? 262  THR A CG2 1 
ATOM   2004 N N   . PRO A 1 263 ? 76.723  -19.583 11.551  1.00 21.78  ? 263  PRO A N   1 
ATOM   2005 C CA  . PRO A 1 263 ? 77.768  -19.524 10.538  1.00 21.90  ? 263  PRO A CA  1 
ATOM   2006 C C   . PRO A 1 263 ? 77.560  -18.386 9.546   1.00 20.91  ? 263  PRO A C   1 
ATOM   2007 O O   . PRO A 1 263 ? 78.535  -17.693 9.229   1.00 20.21  ? 263  PRO A O   1 
ATOM   2008 C CB  . PRO A 1 263 ? 77.743  -20.893 9.882   1.00 21.45  ? 263  PRO A CB  1 
ATOM   2009 C CG  . PRO A 1 263 ? 76.855  -21.751 10.713  1.00 21.31  ? 263  PRO A CG  1 
ATOM   2010 C CD  . PRO A 1 263 ? 76.018  -20.887 11.585  1.00 21.38  ? 263  PRO A CD  1 
ATOM   2011 N N   . ALA A 1 264 ? 76.339  -18.150 9.079   1.00 19.63  ? 264  ALA A N   1 
ATOM   2012 C CA  . ALA A 1 264 ? 76.036  -17.039 8.188   1.00 18.93  ? 264  ALA A CA  1 
ATOM   2013 C C   . ALA A 1 264 ? 76.240  -15.669 8.863   1.00 19.03  ? 264  ALA A C   1 
ATOM   2014 O O   . ALA A 1 264 ? 76.740  -14.740 8.219   1.00 18.43  ? 264  ALA A O   1 
ATOM   2015 C CB  . ALA A 1 264 ? 74.617  -17.072 7.636   1.00 13.63  ? 264  ALA A CB  1 
ATOM   2016 N N   . SER A 1 265 ? 75.891  -15.565 10.143  1.00 17.86  ? 265  SER A N   1 
ATOM   2017 C CA  . SER A 1 265 ? 76.086  -14.297 10.823  1.00 16.27  ? 265  SER A CA  1 
ATOM   2018 C C   . SER A 1 265 ? 77.577  -14.024 11.014  1.00 17.09  ? 265  SER A C   1 
ATOM   2019 O O   . SER A 1 265 ? 78.012  -12.865 10.927  1.00 14.69  ? 265  SER A O   1 
ATOM   2020 C CB  . SER A 1 265 ? 75.350  -14.320 12.167  1.00 11.85  ? 265  SER A CB  1 
ATOM   2021 O OG  . SER A 1 265 ? 75.755  -13.149 12.891  1.00 13.81  ? 265  SER A OG  1 
ATOM   2022 N N   . ARG A 1 266 ? 78.376  -15.064 11.334  1.00 16.81  ? 266  ARG A N   1 
ATOM   2023 C CA  . ARG A 1 266 ? 79.808  -14.855 11.577  1.00 16.85  ? 266  ARG A CA  1 
ATOM   2024 C C   . ARG A 1 266 ? 80.519  -14.576 10.243  1.00 16.08  ? 266  ARG A C   1 
ATOM   2025 O O   . ARG A 1 266 ? 81.385  -13.717 10.224  1.00 15.01  ? 266  ARG A O   1 
ATOM   2026 C CB  . ARG A 1 266 ? 80.528  -15.999 12.256  1.00 22.31  ? 266  ARG A CB  1 
ATOM   2027 C CG  . ARG A 1 266 ? 79.970  -16.616 13.510  1.00 29.35  ? 266  ARG A CG  1 
ATOM   2028 C CD  . ARG A 1 266 ? 79.414  -15.618 14.508  1.00 32.32  ? 266  ARG A CD  1 
ATOM   2029 N NE  . ARG A 1 266 ? 80.284  -14.489 14.821  1.00 34.40  ? 266  ARG A NE  1 
ATOM   2030 C CZ  . ARG A 1 266 ? 79.763  -13.368 15.362  1.00 37.15  ? 266  ARG A CZ  1 
ATOM   2031 N NH1 . ARG A 1 266 ? 78.451  -13.226 15.610  1.00 36.55  ? 266  ARG A NH1 1 
ATOM   2032 N NH2 . ARG A 1 266 ? 80.612  -12.388 15.626  1.00 34.59  ? 266  ARG A NH2 1 
ATOM   2033 N N   . ALA A 1 267 ? 80.042  -15.181 9.148   1.00 14.86  ? 267  ALA A N   1 
ATOM   2034 C CA  . ALA A 1 267 ? 80.652  -14.836 7.869   1.00 15.87  ? 267  ALA A CA  1 
ATOM   2035 C C   . ALA A 1 267 ? 80.408  -13.341 7.613   1.00 16.00  ? 267  ALA A C   1 
ATOM   2036 O O   . ALA A 1 267 ? 81.357  -12.674 7.187   1.00 17.10  ? 267  ALA A O   1 
ATOM   2037 C CB  . ALA A 1 267 ? 80.164  -15.646 6.693   1.00 9.34   ? 267  ALA A CB  1 
ATOM   2038 N N   . PHE A 1 268 ? 79.175  -12.871 7.858   1.00 15.91  ? 268  PHE A N   1 
ATOM   2039 C CA  . PHE A 1 268 ? 78.867  -11.460 7.620   1.00 14.72  ? 268  PHE A CA  1 
ATOM   2040 C C   . PHE A 1 268 ? 79.706  -10.547 8.492   1.00 12.56  ? 268  PHE A C   1 
ATOM   2041 O O   . PHE A 1 268 ? 80.270  -9.606  7.957   1.00 15.10  ? 268  PHE A O   1 
ATOM   2042 C CB  . PHE A 1 268 ? 77.396  -11.137 7.861   1.00 15.26  ? 268  PHE A CB  1 
ATOM   2043 C CG  . PHE A 1 268 ? 76.942  -9.720  7.627   1.00 16.12  ? 268  PHE A CG  1 
ATOM   2044 C CD1 . PHE A 1 268 ? 77.047  -9.158  6.352   1.00 13.87  ? 268  PHE A CD1 1 
ATOM   2045 C CD2 . PHE A 1 268 ? 76.337  -8.992  8.647   1.00 13.80  ? 268  PHE A CD2 1 
ATOM   2046 C CE1 . PHE A 1 268 ? 76.567  -7.875  6.122   1.00 15.40  ? 268  PHE A CE1 1 
ATOM   2047 C CE2 . PHE A 1 268 ? 75.869  -7.718  8.391   1.00 14.27  ? 268  PHE A CE2 1 
ATOM   2048 C CZ  . PHE A 1 268 ? 75.979  -7.139  7.136   1.00 13.35  ? 268  PHE A CZ  1 
ATOM   2049 N N   . VAL A 1 269 ? 79.783  -10.719 9.788   1.00 14.34  ? 269  VAL A N   1 
ATOM   2050 C CA  . VAL A 1 269 ? 80.624  -9.906  10.675  1.00 14.75  ? 269  VAL A CA  1 
ATOM   2051 C C   . VAL A 1 269 ? 82.064  -9.798  10.196  1.00 16.15  ? 269  VAL A C   1 
ATOM   2052 O O   . VAL A 1 269 ? 82.635  -8.721  10.044  1.00 13.84  ? 269  VAL A O   1 
ATOM   2053 C CB  . VAL A 1 269 ? 80.547  -10.414 12.114  1.00 14.19  ? 269  VAL A CB  1 
ATOM   2054 C CG1 . VAL A 1 269 ? 81.561  -9.746  13.053  1.00 9.70   ? 269  VAL A CG1 1 
ATOM   2055 C CG2 . VAL A 1 269 ? 79.108  -10.291 12.620  1.00 12.03  ? 269  VAL A CG2 1 
ATOM   2056 N N   . GLN A 1 270 ? 82.672  -10.910 9.827   1.00 18.35  ? 270  GLN A N   1 
ATOM   2057 C CA  . GLN A 1 270 ? 84.045  -10.926 9.296   1.00 20.27  ? 270  GLN A CA  1 
ATOM   2058 C C   . GLN A 1 270 ? 84.144  -10.262 7.935   1.00 20.46  ? 270  GLN A C   1 
ATOM   2059 O O   . GLN A 1 270 ? 85.087  -9.507  7.706   1.00 18.72  ? 270  GLN A O   1 
ATOM   2060 C CB  . GLN A 1 270 ? 84.502  -12.388 9.301   1.00 22.40  ? 270  GLN A CB  1 
ATOM   2061 C CG  . GLN A 1 270 ? 84.231  -12.823 10.766  1.00 29.94  ? 270  GLN A CG  1 
ATOM   2062 C CD  . GLN A 1 270 ? 85.039  -14.057 11.040  1.00 36.83  ? 270  GLN A CD  1 
ATOM   2063 O OE1 . GLN A 1 270 ? 84.867  -14.978 10.238  1.00 40.04  ? 270  GLN A OE1 1 
ATOM   2064 N NE2 . GLN A 1 270 ? 85.869  -13.913 12.064  1.00 39.81  ? 270  GLN A NE2 1 
ATOM   2065 N N   . ALA A 1 271 ? 83.127  -10.408 7.064   1.00 20.71  ? 271  ALA A N   1 
ATOM   2066 C CA  . ALA A 1 271 ? 83.225  -9.661  5.817   1.00 21.55  ? 271  ALA A CA  1 
ATOM   2067 C C   . ALA A 1 271 ? 83.137  -8.181  6.179   1.00 21.36  ? 271  ALA A C   1 
ATOM   2068 O O   . ALA A 1 271 ? 83.932  -7.387  5.669   1.00 22.46  ? 271  ALA A O   1 
ATOM   2069 C CB  . ALA A 1 271 ? 82.179  -10.076 4.810   1.00 25.95  ? 271  ALA A CB  1 
ATOM   2070 N N   . CYS A 1 272 ? 82.248  -7.763  7.072   1.00 21.86  ? 272  CYS A N   1 
ATOM   2071 C CA  . CYS A 1 272 ? 82.175  -6.323  7.390   1.00 21.72  ? 272  CYS A CA  1 
ATOM   2072 C C   . CYS A 1 272 ? 83.462  -5.808  8.004   1.00 23.59  ? 272  CYS A C   1 
ATOM   2073 O O   . CYS A 1 272 ? 83.937  -4.695  7.686   1.00 24.83  ? 272  CYS A O   1 
ATOM   2074 C CB  . CYS A 1 272 ? 80.938  -5.976  8.216   1.00 13.47  ? 272  CYS A CB  1 
ATOM   2075 S SG  . CYS A 1 272 ? 79.360  -6.325  7.361   1.00 9.37   ? 272  CYS A SG  1 
ATOM   2076 N N   . HIS A 1 273 ? 84.030  -6.534  8.952   1.00 25.23  ? 273  HIS A N   1 
ATOM   2077 C CA  . HIS A 1 273 ? 85.265  -6.106  9.621   1.00 26.25  ? 273  HIS A CA  1 
ATOM   2078 C C   . HIS A 1 273 ? 86.360  -5.994  8.573   1.00 24.40  ? 273  HIS A C   1 
ATOM   2079 O O   . HIS A 1 273 ? 87.087  -5.012  8.612   1.00 24.83  ? 273  HIS A O   1 
ATOM   2080 C CB  . HIS A 1 273 ? 85.664  -6.986  10.795  1.00 31.14  ? 273  HIS A CB  1 
ATOM   2081 C CG  . HIS A 1 273 ? 84.829  -6.810  12.020  1.00 38.22  ? 273  HIS A CG  1 
ATOM   2082 N ND1 . HIS A 1 273 ? 84.681  -7.792  12.979  1.00 41.28  ? 273  HIS A ND1 1 
ATOM   2083 C CD2 . HIS A 1 273 ? 84.084  -5.763  12.461  1.00 42.09  ? 273  HIS A CD2 1 
ATOM   2084 C CE1 . HIS A 1 273 ? 83.890  -7.357  13.949  1.00 43.07  ? 273  HIS A CE1 1 
ATOM   2085 N NE2 . HIS A 1 273 ? 83.510  -6.126  13.660  1.00 43.78  ? 273  HIS A NE2 1 
ATOM   2086 N N   . GLY A 1 274 ? 86.472  -6.849  7.576   1.00 24.89  ? 274  GLY A N   1 
ATOM   2087 C CA  . GLY A 1 274 ? 87.498  -6.626  6.565   1.00 26.58  ? 274  GLY A CA  1 
ATOM   2088 C C   . GLY A 1 274 ? 87.143  -5.589  5.512   1.00 27.22  ? 274  GLY A C   1 
ATOM   2089 O O   . GLY A 1 274 ? 88.016  -5.259  4.705   1.00 28.76  ? 274  GLY A O   1 
ATOM   2090 N N   . PHE A 1 275 ? 85.921  -5.067  5.417   1.00 25.76  ? 275  PHE A N   1 
ATOM   2091 C CA  . PHE A 1 275 ? 85.583  -4.170  4.323   1.00 24.68  ? 275  PHE A CA  1 
ATOM   2092 C C   . PHE A 1 275 ? 85.150  -2.795  4.796   1.00 24.23  ? 275  PHE A C   1 
ATOM   2093 O O   . PHE A 1 275 ? 85.354  -1.843  4.058   1.00 23.60  ? 275  PHE A O   1 
ATOM   2094 C CB  . PHE A 1 275 ? 84.417  -4.799  3.546   1.00 25.08  ? 275  PHE A CB  1 
ATOM   2095 C CG  . PHE A 1 275 ? 84.060  -4.144  2.257   1.00 24.91  ? 275  PHE A CG  1 
ATOM   2096 C CD1 . PHE A 1 275 ? 84.735  -4.448  1.090   1.00 21.84  ? 275  PHE A CD1 1 
ATOM   2097 C CD2 . PHE A 1 275 ? 83.019  -3.219  2.206   1.00 24.83  ? 275  PHE A CD2 1 
ATOM   2098 C CE1 . PHE A 1 275 ? 84.386  -3.828  -0.102  1.00 22.02  ? 275  PHE A CE1 1 
ATOM   2099 C CE2 . PHE A 1 275 ? 82.666  -2.614  1.019   1.00 21.11  ? 275  PHE A CE2 1 
ATOM   2100 C CZ  . PHE A 1 275 ? 83.359  -2.921  -0.131  1.00 21.64  ? 275  PHE A CZ  1 
ATOM   2101 N N   . PHE A 1 276 ? 84.561  -2.713  5.988   1.00 24.35  ? 276  PHE A N   1 
ATOM   2102 C CA  . PHE A 1 276 ? 84.039  -1.419  6.431   1.00 24.58  ? 276  PHE A CA  1 
ATOM   2103 C C   . PHE A 1 276 ? 85.179  -0.527  6.890   1.00 26.53  ? 276  PHE A C   1 
ATOM   2104 O O   . PHE A 1 276 ? 86.151  -0.978  7.512   1.00 27.32  ? 276  PHE A O   1 
ATOM   2105 C CB  . PHE A 1 276 ? 82.979  -1.628  7.515   1.00 20.49  ? 276  PHE A CB  1 
ATOM   2106 C CG  . PHE A 1 276 ? 81.590  -2.075  7.088   1.00 18.04  ? 276  PHE A CG  1 
ATOM   2107 C CD1 . PHE A 1 276 ? 81.343  -2.912  6.029   1.00 12.03  ? 276  PHE A CD1 1 
ATOM   2108 C CD2 . PHE A 1 276 ? 80.492  -1.648  7.841   1.00 16.07  ? 276  PHE A CD2 1 
ATOM   2109 C CE1 . PHE A 1 276 ? 80.058  -3.317  5.718   1.00 17.05  ? 276  PHE A CE1 1 
ATOM   2110 C CE2 . PHE A 1 276 ? 79.207  -2.027  7.531   1.00 15.88  ? 276  PHE A CE2 1 
ATOM   2111 C CZ  . PHE A 1 276 ? 78.957  -2.870  6.456   1.00 14.88  ? 276  PHE A CZ  1 
ATOM   2112 N N   . PRO A 1 277 ? 85.085  0.753   6.553   1.00 26.87  ? 277  PRO A N   1 
ATOM   2113 C CA  . PRO A 1 277 ? 86.030  1.757   7.080   1.00 26.43  ? 277  PRO A CA  1 
ATOM   2114 C C   . PRO A 1 277 ? 85.696  1.861   8.552   1.00 28.01  ? 277  PRO A C   1 
ATOM   2115 O O   . PRO A 1 277 ? 84.575  1.443   8.892   1.00 25.25  ? 277  PRO A O   1 
ATOM   2116 C CB  . PRO A 1 277 ? 85.615  3.021   6.353   1.00 26.71  ? 277  PRO A CB  1 
ATOM   2117 C CG  . PRO A 1 277 ? 84.134  2.834   6.088   1.00 25.25  ? 277  PRO A CG  1 
ATOM   2118 C CD  . PRO A 1 277 ? 83.961  1.373   5.806   1.00 25.49  ? 277  PRO A CD  1 
ATOM   2119 N N   . GLU A 1 278 ? 86.533  2.415   9.414   1.00 31.27  ? 278  GLU A N   1 
ATOM   2120 C CA  . GLU A 1 278 ? 86.260  2.555   10.833  1.00 35.15  ? 278  GLU A CA  1 
ATOM   2121 C C   . GLU A 1 278 ? 85.062  3.401   11.221  1.00 35.66  ? 278  GLU A C   1 
ATOM   2122 O O   . GLU A 1 278 ? 84.493  3.206   12.306  1.00 36.95  ? 278  GLU A O   1 
ATOM   2123 C CB  . GLU A 1 278 ? 87.445  3.179   11.600  1.00 42.11  ? 278  GLU A CB  1 
ATOM   2124 C CG  . GLU A 1 278 ? 88.182  4.293   10.912  1.00 52.22  ? 278  GLU A CG  1 
ATOM   2125 C CD  . GLU A 1 278 ? 87.623  5.689   10.791  1.00 56.99  ? 278  GLU A CD  1 
ATOM   2126 O OE1 . GLU A 1 278 ? 87.465  6.411   11.809  1.00 58.40  ? 278  GLU A OE1 1 
ATOM   2127 O OE2 . GLU A 1 278 ? 87.372  6.113   9.625   1.00 59.37  ? 278  GLU A OE2 1 
ATOM   2128 N N   . ASN A 1 279 ? 84.675  4.387   10.416  1.00 35.63  ? 279  ASN A N   1 
ATOM   2129 C CA  . ASN A 1 279 ? 83.522  5.221   10.757  1.00 34.99  ? 279  ASN A CA  1 
ATOM   2130 C C   . ASN A 1 279 ? 82.203  4.614   10.303  1.00 33.17  ? 279  ASN A C   1 
ATOM   2131 O O   . ASN A 1 279 ? 81.219  5.358   10.158  1.00 35.82  ? 279  ASN A O   1 
ATOM   2132 C CB  . ASN A 1 279 ? 83.698  6.619   10.138  1.00 35.85  ? 279  ASN A CB  1 
ATOM   2133 C CG  . ASN A 1 279 ? 83.525  6.561   8.634   1.00 37.65  ? 279  ASN A CG  1 
ATOM   2134 O OD1 . ASN A 1 279 ? 83.898  5.566   8.025   1.00 38.54  ? 279  ASN A OD1 1 
ATOM   2135 N ND2 . ASN A 1 279 ? 82.920  7.586   8.038   1.00 41.01  ? 279  ASN A ND2 1 
ATOM   2136 N N   . ALA A 1 280 ? 82.137  3.336   9.999   1.00 30.54  ? 280  ALA A N   1 
ATOM   2137 C CA  . ALA A 1 280 ? 80.949  2.634   9.573   1.00 28.92  ? 280  ALA A CA  1 
ATOM   2138 C C   . ALA A 1 280 ? 80.664  1.406   10.438  1.00 27.64  ? 280  ALA A C   1 
ATOM   2139 O O   . ALA A 1 280 ? 81.334  0.381   10.274  1.00 29.10  ? 280  ALA A O   1 
ATOM   2140 C CB  . ALA A 1 280 ? 81.094  2.204   8.121   1.00 26.43  ? 280  ALA A CB  1 
ATOM   2141 N N   . THR A 1 281 ? 79.690  1.462   11.325  1.00 25.82  ? 281  THR A N   1 
ATOM   2142 C CA  . THR A 1 281 ? 79.323  0.358   12.204  1.00 24.05  ? 281  THR A CA  1 
ATOM   2143 C C   . THR A 1 281 ? 78.364  -0.619  11.533  1.00 22.22  ? 281  THR A C   1 
ATOM   2144 O O   . THR A 1 281 ? 77.464  -0.149  10.864  1.00 21.03  ? 281  THR A O   1 
ATOM   2145 C CB  . THR A 1 281 ? 78.646  0.887   13.479  1.00 25.76  ? 281  THR A CB  1 
ATOM   2146 O OG1 . THR A 1 281 ? 79.559  1.812   14.089  1.00 27.90  ? 281  THR A OG1 1 
ATOM   2147 C CG2 . THR A 1 281 ? 78.290  -0.207  14.467  1.00 24.63  ? 281  THR A CG2 1 
ATOM   2148 N N   . ILE A 1 282 ? 78.523  -1.925  11.713  1.00 20.71  ? 282  ILE A N   1 
ATOM   2149 C CA  . ILE A 1 282 ? 77.660  -2.957  11.216  1.00 18.23  ? 282  ILE A CA  1 
ATOM   2150 C C   . ILE A 1 282 ? 76.271  -2.752  11.814  1.00 17.63  ? 282  ILE A C   1 
ATOM   2151 O O   . ILE A 1 282 ? 76.162  -2.383  12.989  1.00 18.47  ? 282  ILE A O   1 
ATOM   2152 C CB  . ILE A 1 282 ? 78.139  -4.362  11.608  1.00 22.73  ? 282  ILE A CB  1 
ATOM   2153 C CG1 . ILE A 1 282 ? 79.472  -4.678  10.928  1.00 27.05  ? 282  ILE A CG1 1 
ATOM   2154 C CG2 . ILE A 1 282 ? 77.128  -5.476  11.257  1.00 19.07  ? 282  ILE A CG2 1 
ATOM   2155 C CD1 . ILE A 1 282 ? 80.171  -5.943  11.452  1.00 29.37  ? 282  ILE A CD1 1 
ATOM   2156 N N   . THR A 1 283 ? 75.186  -2.853  11.063  1.00 15.08  ? 283  THR A N   1 
ATOM   2157 C CA  . THR A 1 283 ? 73.861  -2.645  11.668  1.00 14.04  ? 283  THR A CA  1 
ATOM   2158 C C   . THR A 1 283 ? 72.888  -3.617  11.009  1.00 11.49  ? 283  THR A C   1 
ATOM   2159 O O   . THR A 1 283 ? 73.218  -4.273  10.030  1.00 11.36  ? 283  THR A O   1 
ATOM   2160 C CB  . THR A 1 283 ? 73.303  -1.214  11.544  1.00 14.53  ? 283  THR A CB  1 
ATOM   2161 O OG1 . THR A 1 283 ? 72.965  -0.908  10.179  1.00 13.79  ? 283  THR A OG1 1 
ATOM   2162 C CG2 . THR A 1 283 ? 74.235  -0.075  11.934  1.00 11.74  ? 283  THR A CG2 1 
ATOM   2163 N N   . ALA A 1 284 ? 71.626  -3.632  11.437  1.00 11.82  ? 284  ALA A N   1 
ATOM   2164 C CA  . ALA A 1 284 ? 70.606  -4.451  10.815  1.00 9.68   ? 284  ALA A CA  1 
ATOM   2165 C C   . ALA A 1 284 ? 70.321  -3.960  9.392   1.00 7.52   ? 284  ALA A C   1 
ATOM   2166 O O   . ALA A 1 284 ? 69.927  -4.744  8.544   1.00 6.47   ? 284  ALA A O   1 
ATOM   2167 C CB  . ALA A 1 284 ? 69.262  -4.405  11.562  1.00 6.97   ? 284  ALA A CB  1 
ATOM   2168 N N   . TRP A 1 285 ? 70.501  -2.652  9.161   1.00 8.02   ? 285  TRP A N   1 
ATOM   2169 C CA  . TRP A 1 285 ? 70.172  -2.083  7.851   1.00 8.23   ? 285  TRP A CA  1 
ATOM   2170 C C   . TRP A 1 285 ? 71.344  -2.316  6.894   1.00 9.52   ? 285  TRP A C   1 
ATOM   2171 O O   . TRP A 1 285 ? 71.144  -2.456  5.676   1.00 8.50   ? 285  TRP A O   1 
ATOM   2172 C CB  . TRP A 1 285 ? 69.575  -0.685  8.051   1.00 8.93   ? 285  TRP A CB  1 
ATOM   2173 C CG  . TRP A 1 285 ? 68.582  -0.770  9.196   1.00 12.27  ? 285  TRP A CG  1 
ATOM   2174 C CD1 . TRP A 1 285 ? 68.635  -0.029  10.334  1.00 11.63  ? 285  TRP A CD1 1 
ATOM   2175 C CD2 . TRP A 1 285 ? 67.497  -1.702  9.366   1.00 10.25  ? 285  TRP A CD2 1 
ATOM   2176 N NE1 . TRP A 1 285 ? 67.624  -0.416  11.177  1.00 13.80  ? 285  TRP A NE1 1 
ATOM   2177 C CE2 . TRP A 1 285 ? 66.932  -1.465  10.623  1.00 10.57  ? 285  TRP A CE2 1 
ATOM   2178 C CE3 . TRP A 1 285 ? 66.945  -2.716  8.580   1.00 12.00  ? 285  TRP A CE3 1 
ATOM   2179 C CZ2 . TRP A 1 285 ? 65.837  -2.170  11.126  1.00 9.27   ? 285  TRP A CZ2 1 
ATOM   2180 C CZ3 . TRP A 1 285 ? 65.859  -3.439  9.051   1.00 10.22  ? 285  TRP A CZ3 1 
ATOM   2181 C CH2 . TRP A 1 285 ? 65.310  -3.168  10.331  1.00 8.71   ? 285  TRP A CH2 1 
ATOM   2182 N N   . ALA A 1 286 ? 72.553  -2.513  7.392   1.00 6.62   ? 286  ALA A N   1 
ATOM   2183 C CA  . ALA A 1 286 ? 73.655  -2.900  6.513   1.00 8.75   ? 286  ALA A CA  1 
ATOM   2184 C C   . ALA A 1 286 ? 73.367  -4.335  6.066   1.00 9.15   ? 286  ALA A C   1 
ATOM   2185 O O   . ALA A 1 286 ? 73.540  -4.702  4.916   1.00 11.29  ? 286  ALA A O   1 
ATOM   2186 C CB  . ALA A 1 286 ? 75.009  -2.844  7.262   1.00 6.40   ? 286  ALA A CB  1 
ATOM   2187 N N   . GLU A 1 287 ? 72.874  -5.191  6.965   1.00 10.72  ? 287  GLU A N   1 
ATOM   2188 C CA  . GLU A 1 287 ? 72.545  -6.598  6.681   1.00 10.89  ? 287  GLU A CA  1 
ATOM   2189 C C   . GLU A 1 287 ? 71.415  -6.628  5.668   1.00 12.00  ? 287  GLU A C   1 
ATOM   2190 O O   . GLU A 1 287 ? 71.463  -7.365  4.660   1.00 13.20  ? 287  GLU A O   1 
ATOM   2191 C CB  . GLU A 1 287 ? 72.185  -7.371  7.948   1.00 5.31   ? 287  GLU A CB  1 
ATOM   2192 C CG  . GLU A 1 287 ? 71.977  -8.884  7.848   1.00 10.45  ? 287  GLU A CG  1 
ATOM   2193 C CD  . GLU A 1 287 ? 70.643  -9.422  7.428   1.00 12.14  ? 287  GLU A CD  1 
ATOM   2194 O OE1 . GLU A 1 287 ? 69.617  -8.688  7.507   1.00 12.40  ? 287  GLU A OE1 1 
ATOM   2195 O OE2 . GLU A 1 287 ? 70.537  -10.589 6.939   1.00 11.28  ? 287  GLU A OE2 1 
ATOM   2196 N N   . ALA A 1 288 ? 70.437  -5.712  5.874   1.00 12.17  ? 288  ALA A N   1 
ATOM   2197 C CA  . ALA A 1 288 ? 69.325  -5.673  4.916   1.00 11.04  ? 288  ALA A CA  1 
ATOM   2198 C C   . ALA A 1 288 ? 69.825  -5.237  3.559   1.00 11.66  ? 288  ALA A C   1 
ATOM   2199 O O   . ALA A 1 288 ? 69.510  -5.887  2.560   1.00 13.54  ? 288  ALA A O   1 
ATOM   2200 C CB  . ALA A 1 288 ? 68.137  -4.863  5.381   1.00 7.97   ? 288  ALA A CB  1 
ATOM   2201 N N   . ALA A 1 289 ? 70.639  -4.193  3.479   1.00 10.94  ? 289  ALA A N   1 
ATOM   2202 C CA  . ALA A 1 289 ? 71.131  -3.692  2.199   1.00 11.71  ? 289  ALA A CA  1 
ATOM   2203 C C   . ALA A 1 289 ? 72.009  -4.743  1.541   1.00 12.94  ? 289  ALA A C   1 
ATOM   2204 O O   . ALA A 1 289 ? 71.976  -5.023  0.359   1.00 12.24  ? 289  ALA A O   1 
ATOM   2205 C CB  . ALA A 1 289 ? 71.830  -2.358  2.441   1.00 5.46   ? 289  ALA A CB  1 
ATOM   2206 N N   . TYR A 1 290 ? 72.790  -5.445  2.382   1.00 15.31  ? 290  TYR A N   1 
ATOM   2207 C CA  . TYR A 1 290 ? 73.582  -6.564  1.869   1.00 14.96  ? 290  TYR A CA  1 
ATOM   2208 C C   . TYR A 1 290 ? 72.772  -7.670  1.229   1.00 14.37  ? 290  TYR A C   1 
ATOM   2209 O O   . TYR A 1 290 ? 73.039  -7.994  0.071   1.00 13.72  ? 290  TYR A O   1 
ATOM   2210 C CB  . TYR A 1 290 ? 74.416  -7.074  3.045   1.00 14.50  ? 290  TYR A CB  1 
ATOM   2211 C CG  . TYR A 1 290 ? 75.154  -8.354  2.738   1.00 14.95  ? 290  TYR A CG  1 
ATOM   2212 C CD1 . TYR A 1 290 ? 76.335  -8.333  1.986   1.00 14.74  ? 290  TYR A CD1 1 
ATOM   2213 C CD2 . TYR A 1 290 ? 74.682  -9.572  3.229   1.00 14.07  ? 290  TYR A CD2 1 
ATOM   2214 C CE1 . TYR A 1 290 ? 77.028  -9.498  1.719   1.00 14.65  ? 290  TYR A CE1 1 
ATOM   2215 C CE2 . TYR A 1 290 ? 75.386  -10.740 2.958   1.00 14.93  ? 290  TYR A CE2 1 
ATOM   2216 C CZ  . TYR A 1 290 ? 76.536  -10.709 2.205   1.00 15.43  ? 290  TYR A CZ  1 
ATOM   2217 O OH  . TYR A 1 290 ? 77.231  -11.883 1.944   1.00 15.85  ? 290  TYR A OH  1 
ATOM   2218 N N   . TRP A 1 291 ? 71.799  -8.291  1.920   1.00 14.26  ? 291  TRP A N   1 
ATOM   2219 C CA  . TRP A 1 291 ? 71.078  -9.415  1.349   1.00 14.77  ? 291  TRP A CA  1 
ATOM   2220 C C   . TRP A 1 291 ? 70.251  -8.941  0.142   1.00 15.64  ? 291  TRP A C   1 
ATOM   2221 O O   . TRP A 1 291 ? 70.251  -9.614  -0.896  1.00 14.43  ? 291  TRP A O   1 
ATOM   2222 C CB  . TRP A 1 291 ? 70.217  -10.217 2.345   1.00 12.21  ? 291  TRP A CB  1 
ATOM   2223 C CG  . TRP A 1 291 ? 68.908  -9.657  2.822   1.00 9.48   ? 291  TRP A CG  1 
ATOM   2224 C CD1 . TRP A 1 291 ? 68.671  -9.131  4.066   1.00 7.17   ? 291  TRP A CD1 1 
ATOM   2225 C CD2 . TRP A 1 291 ? 67.685  -9.489  2.104   1.00 7.89   ? 291  TRP A CD2 1 
ATOM   2226 N NE1 . TRP A 1 291 ? 67.380  -8.685  4.168   1.00 7.85   ? 291  TRP A NE1 1 
ATOM   2227 C CE2 . TRP A 1 291 ? 66.744  -8.905  2.986   1.00 9.29   ? 291  TRP A CE2 1 
ATOM   2228 C CE3 . TRP A 1 291 ? 67.246  -9.863  0.833   1.00 6.00   ? 291  TRP A CE3 1 
ATOM   2229 C CZ2 . TRP A 1 291 ? 65.426  -8.641  2.629   1.00 7.17   ? 291  TRP A CZ2 1 
ATOM   2230 C CZ3 . TRP A 1 291 ? 65.943  -9.577  0.478   1.00 7.90   ? 291  TRP A CZ3 1 
ATOM   2231 C CH2 . TRP A 1 291 ? 65.030  -8.975  1.349   1.00 5.43   ? 291  TRP A CH2 1 
ATOM   2232 N N   . GLN A 1 292 ? 69.686  -7.724  0.188   1.00 15.45  ? 292  GLN A N   1 
ATOM   2233 C CA  . GLN A 1 292 ? 68.907  -7.259  -0.960  1.00 15.57  ? 292  GLN A CA  1 
ATOM   2234 C C   . GLN A 1 292 ? 69.765  -7.094  -2.202  1.00 15.22  ? 292  GLN A C   1 
ATOM   2235 O O   . GLN A 1 292 ? 69.310  -7.495  -3.277  1.00 14.34  ? 292  GLN A O   1 
ATOM   2236 C CB  . GLN A 1 292 ? 68.181  -5.935  -0.684  1.00 15.60  ? 292  GLN A CB  1 
ATOM   2237 C CG  . GLN A 1 292 ? 67.007  -6.017  0.272   1.00 16.35  ? 292  GLN A CG  1 
ATOM   2238 C CD  . GLN A 1 292 ? 65.998  -4.883  0.121   1.00 17.18  ? 292  GLN A CD  1 
ATOM   2239 O OE1 . GLN A 1 292 ? 66.248  -3.769  0.594   1.00 15.31  ? 292  GLN A OE1 1 
ATOM   2240 N NE2 . GLN A 1 292 ? 64.880  -5.139  -0.532  1.00 12.62  ? 292  GLN A NE2 1 
ATOM   2241 N N   . THR A 1 293 ? 70.974  -6.528  -2.036  1.00 14.75  ? 293  THR A N   1 
ATOM   2242 C CA  . THR A 1 293 ? 71.832  -6.325  -3.206  1.00 15.74  ? 293  THR A CA  1 
ATOM   2243 C C   . THR A 1 293 ? 72.284  -7.662  -3.811  1.00 16.21  ? 293  THR A C   1 
ATOM   2244 O O   . THR A 1 293 ? 72.348  -7.861  -5.028  1.00 13.72  ? 293  THR A O   1 
ATOM   2245 C CB  . THR A 1 293 ? 73.040  -5.440  -2.819  1.00 16.59  ? 293  THR A CB  1 
ATOM   2246 O OG1 . THR A 1 293 ? 72.602  -4.182  -2.291  1.00 15.60  ? 293  THR A OG1 1 
ATOM   2247 C CG2 . THR A 1 293 ? 73.963  -5.152  -3.996  1.00 9.99   ? 293  THR A CG2 1 
ATOM   2248 N N   . LEU A 1 294 ? 72.603  -8.619  -2.938  1.00 15.97  ? 294  LEU A N   1 
ATOM   2249 C CA  . LEU A 1 294 ? 72.960  -9.978  -3.344  1.00 17.80  ? 294  LEU A CA  1 
ATOM   2250 C C   . LEU A 1 294 ? 71.811  -10.651 -4.091  1.00 17.39  ? 294  LEU A C   1 
ATOM   2251 O O   . LEU A 1 294 ? 72.021  -11.239 -5.159  1.00 16.98  ? 294  LEU A O   1 
ATOM   2252 C CB  . LEU A 1 294 ? 73.218  -10.834 -2.102  1.00 21.80  ? 294  LEU A CB  1 
ATOM   2253 C CG  . LEU A 1 294 ? 74.356  -11.828 -2.014  1.00 25.20  ? 294  LEU A CG  1 
ATOM   2254 C CD1 . LEU A 1 294 ? 75.688  -11.317 -2.538  1.00 21.73  ? 294  LEU A CD1 1 
ATOM   2255 C CD2 . LEU A 1 294 ? 74.530  -12.261 -0.534  1.00 24.13  ? 294  LEU A CD2 1 
ATOM   2256 N N   . LEU A 1 295 ? 70.597  -10.490 -3.526  1.00 15.53  ? 295  LEU A N   1 
ATOM   2257 C CA  . LEU A 1 295 ? 69.433  -11.073 -4.158  1.00 16.62  ? 295  LEU A CA  1 
ATOM   2258 C C   . LEU A 1 295 ? 69.352  -10.540 -5.577  1.00 16.75  ? 295  LEU A C   1 
ATOM   2259 O O   . LEU A 1 295 ? 69.262  -11.248 -6.559  1.00 17.07  ? 295  LEU A O   1 
ATOM   2260 C CB  . LEU A 1 295 ? 68.141  -10.757 -3.400  1.00 19.42  ? 295  LEU A CB  1 
ATOM   2261 C CG  . LEU A 1 295 ? 66.834  -11.162 -4.087  1.00 22.70  ? 295  LEU A CG  1 
ATOM   2262 C CD1 . LEU A 1 295 ? 66.817  -12.682 -4.296  1.00 22.32  ? 295  LEU A CD1 1 
ATOM   2263 C CD2 . LEU A 1 295 ? 65.621  -10.751 -3.258  1.00 19.93  ? 295  LEU A CD2 1 
ATOM   2264 N N   . LEU A 1 296 ? 69.493  -9.227  -5.714  1.00 17.98  ? 296  LEU A N   1 
ATOM   2265 C CA  . LEU A 1 296 ? 69.402  -8.529  -6.982  1.00 19.28  ? 296  LEU A CA  1 
ATOM   2266 C C   . LEU A 1 296 ? 70.420  -8.968  -8.022  1.00 19.45  ? 296  LEU A C   1 
ATOM   2267 O O   . LEU A 1 296 ? 70.038  -9.204  -9.168  1.00 20.95  ? 296  LEU A O   1 
ATOM   2268 C CB  . LEU A 1 296 ? 69.571  -7.051  -6.635  1.00 19.55  ? 296  LEU A CB  1 
ATOM   2269 C CG  . LEU A 1 296 ? 69.126  -6.047  -7.666  1.00 20.40  ? 296  LEU A CG  1 
ATOM   2270 C CD1 . LEU A 1 296 ? 67.604  -6.134  -7.800  1.00 21.39  ? 296  LEU A CD1 1 
ATOM   2271 C CD2 . LEU A 1 296 ? 69.620  -4.673  -7.212  1.00 24.48  ? 296  LEU A CD2 1 
ATOM   2272 N N   . GLY A 1 297 ? 71.682  -9.054  -7.668  1.00 17.95  ? 297  GLY A N   1 
ATOM   2273 C CA  . GLY A 1 297 ? 72.737  -9.555  -8.517  1.00 18.71  ? 297  GLY A CA  1 
ATOM   2274 C C   . GLY A 1 297 ? 72.503  -11.011 -8.902  1.00 18.94  ? 297  GLY A C   1 
ATOM   2275 O O   . GLY A 1 297 ? 72.683  -11.377 -10.077 1.00 19.59  ? 297  GLY A O   1 
ATOM   2276 N N   . ARG A 1 298 ? 72.030  -11.846 -7.973  1.00 18.86  ? 298  ARG A N   1 
ATOM   2277 C CA  . ARG A 1 298 ? 71.742  -13.232 -8.313  1.00 19.31  ? 298  ARG A CA  1 
ATOM   2278 C C   . ARG A 1 298 ? 70.542  -13.322 -9.230  1.00 20.68  ? 298  ARG A C   1 
ATOM   2279 O O   . ARG A 1 298 ? 70.589  -14.127 -10.163 1.00 21.52  ? 298  ARG A O   1 
ATOM   2280 C CB  . ARG A 1 298 ? 71.507  -14.103 -7.061  1.00 19.53  ? 298  ARG A CB  1 
ATOM   2281 C CG  . ARG A 1 298 ? 72.903  -14.235 -6.440  1.00 19.75  ? 298  ARG A CG  1 
ATOM   2282 C CD  . ARG A 1 298 ? 72.937  -14.885 -5.067  1.00 19.58  ? 298  ARG A CD  1 
ATOM   2283 N NE  . ARG A 1 298 ? 74.345  -14.896 -4.608  1.00 21.60  ? 298  ARG A NE  1 
ATOM   2284 C CZ  . ARG A 1 298 ? 74.600  -15.347 -3.385  1.00 26.08  ? 298  ARG A CZ  1 
ATOM   2285 N NH1 . ARG A 1 298 ? 73.540  -15.771 -2.689  1.00 25.32  ? 298  ARG A NH1 1 
ATOM   2286 N NH2 . ARG A 1 298 ? 75.836  -15.345 -2.904  1.00 25.38  ? 298  ARG A NH2 1 
ATOM   2287 N N   . ALA A 1 299 ? 69.526  -12.476 -8.979  1.00 19.67  ? 299  ALA A N   1 
ATOM   2288 C CA  . ALA A 1 299 ? 68.370  -12.497 -9.855  1.00 20.01  ? 299  ALA A CA  1 
ATOM   2289 C C   . ALA A 1 299 ? 68.868  -12.090 -11.233 1.00 19.14  ? 299  ALA A C   1 
ATOM   2290 O O   . ALA A 1 299 ? 68.435  -12.711 -12.202 1.00 17.58  ? 299  ALA A O   1 
ATOM   2291 C CB  . ALA A 1 299 ? 67.154  -11.690 -9.376  1.00 16.12  ? 299  ALA A CB  1 
ATOM   2292 N N   . ALA A 1 300 ? 69.739  -11.093 -11.330 1.00 20.98  ? 300  ALA A N   1 
ATOM   2293 C CA  . ALA A 1 300 ? 70.290  -10.691 -12.622 1.00 24.84  ? 300  ALA A CA  1 
ATOM   2294 C C   . ALA A 1 300 ? 71.055  -11.841 -13.307 1.00 26.56  ? 300  ALA A C   1 
ATOM   2295 O O   . ALA A 1 300 ? 70.845  -12.117 -14.495 1.00 26.62  ? 300  ALA A O   1 
ATOM   2296 C CB  . ALA A 1 300 ? 71.270  -9.543  -12.489 1.00 22.76  ? 300  ALA A CB  1 
ATOM   2297 N N   . GLN A 1 301 ? 71.910  -12.533 -12.551 1.00 27.64  ? 301  GLN A N   1 
ATOM   2298 C CA  . GLN A 1 301 ? 72.602  -13.689 -13.135 1.00 28.86  ? 301  GLN A CA  1 
ATOM   2299 C C   . GLN A 1 301 ? 71.569  -14.700 -13.629 1.00 29.08  ? 301  GLN A C   1 
ATOM   2300 O O   . GLN A 1 301 ? 71.776  -15.182 -14.754 1.00 29.45  ? 301  GLN A O   1 
ATOM   2301 C CB  . GLN A 1 301 ? 73.638  -14.309 -12.213 1.00 28.52  ? 301  GLN A CB  1 
ATOM   2302 C CG  . GLN A 1 301 ? 74.568  -13.287 -11.549 1.00 30.48  ? 301  GLN A CG  1 
ATOM   2303 C CD  . GLN A 1 301 ? 75.375  -13.975 -10.451 1.00 33.76  ? 301  GLN A CD  1 
ATOM   2304 O OE1 . GLN A 1 301 ? 74.861  -14.888 -9.811  1.00 31.67  ? 301  GLN A OE1 1 
ATOM   2305 N NE2 . GLN A 1 301 ? 76.627  -13.582 -10.220 1.00 34.48  ? 301  GLN A NE2 1 
ATOM   2306 N N   . ALA A 1 302 ? 70.495  -14.994 -12.904 1.00 27.60  ? 302  ALA A N   1 
ATOM   2307 C CA  . ALA A 1 302 ? 69.514  -15.925 -13.409 1.00 28.64  ? 302  ALA A CA  1 
ATOM   2308 C C   . ALA A 1 302 ? 68.778  -15.424 -14.652 1.00 31.01  ? 302  ALA A C   1 
ATOM   2309 O O   . ALA A 1 302 ? 68.387  -16.221 -15.523 1.00 31.46  ? 302  ALA A O   1 
ATOM   2310 C CB  . ALA A 1 302 ? 68.487  -16.322 -12.366 1.00 25.03  ? 302  ALA A CB  1 
ATOM   2311 N N   . ALA A 1 303 ? 68.472  -14.134 -14.753 1.00 31.44  ? 303  ALA A N   1 
ATOM   2312 C CA  . ALA A 1 303 ? 67.787  -13.605 -15.931 1.00 31.73  ? 303  ALA A CA  1 
ATOM   2313 C C   . ALA A 1 303 ? 68.726  -13.589 -17.149 1.00 31.64  ? 303  ALA A C   1 
ATOM   2314 O O   . ALA A 1 303 ? 68.276  -13.529 -18.305 1.00 31.10  ? 303  ALA A O   1 
ATOM   2315 C CB  . ALA A 1 303 ? 67.317  -12.183 -15.643 1.00 29.77  ? 303  ALA A CB  1 
ATOM   2316 N N   . GLY A 1 304 ? 70.023  -13.494 -16.897 1.00 30.23  ? 304  GLY A N   1 
ATOM   2317 C CA  . GLY A 1 304 ? 71.033  -13.426 -17.916 1.00 32.03  ? 304  GLY A CA  1 
ATOM   2318 C C   . GLY A 1 304 ? 71.261  -12.047 -18.516 1.00 32.75  ? 304  GLY A C   1 
ATOM   2319 O O   . GLY A 1 304 ? 72.010  -11.887 -19.480 1.00 33.56  ? 304  GLY A O   1 
ATOM   2320 N N   . ASN A 1 305 ? 70.648  -11.016 -17.965 1.00 32.59  ? 305  ASN A N   1 
ATOM   2321 C CA  . ASN A 1 305 ? 70.705  -9.657  -18.456 1.00 31.88  ? 305  ASN A CA  1 
ATOM   2322 C C   . ASN A 1 305 ? 70.464  -8.655  -17.333 1.00 32.44  ? 305  ASN A C   1 
ATOM   2323 O O   . ASN A 1 305 ? 70.268  -9.077  -16.190 1.00 32.08  ? 305  ASN A O   1 
ATOM   2324 C CB  . ASN A 1 305 ? 69.658  -9.505  -19.555 1.00 30.29  ? 305  ASN A CB  1 
ATOM   2325 C CG  . ASN A 1 305 ? 68.218  -9.502  -19.127 1.00 31.93  ? 305  ASN A CG  1 
ATOM   2326 O OD1 . ASN A 1 305 ? 67.814  -9.009  -18.064 1.00 30.48  ? 305  ASN A OD1 1 
ATOM   2327 N ND2 . ASN A 1 305 ? 67.359  -10.032 -20.004 1.00 29.77  ? 305  ASN A ND2 1 
ATOM   2328 N N   . TRP A 1 306 ? 70.395  -7.369  -17.658 1.00 32.20  ? 306  TRP A N   1 
ATOM   2329 C CA  . TRP A 1 306 ? 70.231  -6.317  -16.663 1.00 32.16  ? 306  TRP A CA  1 
ATOM   2330 C C   . TRP A 1 306 ? 68.989  -5.465  -16.874 1.00 31.00  ? 306  TRP A C   1 
ATOM   2331 O O   . TRP A 1 306 ? 68.930  -4.279  -16.546 1.00 31.58  ? 306  TRP A O   1 
ATOM   2332 C CB  . TRP A 1 306 ? 71.525  -5.471  -16.664 1.00 34.76  ? 306  TRP A CB  1 
ATOM   2333 C CG  . TRP A 1 306 ? 71.712  -4.566  -15.490 1.00 37.16  ? 306  TRP A CG  1 
ATOM   2334 C CD1 . TRP A 1 306 ? 71.620  -3.195  -15.466 1.00 36.84  ? 306  TRP A CD1 1 
ATOM   2335 C CD2 . TRP A 1 306 ? 71.989  -4.971  -14.137 1.00 37.97  ? 306  TRP A CD2 1 
ATOM   2336 N NE1 . TRP A 1 306 ? 71.850  -2.719  -14.189 1.00 37.72  ? 306  TRP A NE1 1 
ATOM   2337 C CE2 . TRP A 1 306 ? 72.089  -3.793  -13.365 1.00 38.78  ? 306  TRP A CE2 1 
ATOM   2338 C CE3 . TRP A 1 306 ? 72.202  -6.199  -13.526 1.00 36.41  ? 306  TRP A CE3 1 
ATOM   2339 C CZ2 . TRP A 1 306 ? 72.356  -3.840  -12.004 1.00 40.34  ? 306  TRP A CZ2 1 
ATOM   2340 C CZ3 . TRP A 1 306 ? 72.484  -6.245  -12.176 1.00 38.33  ? 306  TRP A CZ3 1 
ATOM   2341 C CH2 . TRP A 1 306 ? 72.546  -5.068  -11.418 1.00 38.93  ? 306  TRP A CH2 1 
ATOM   2342 N N   . ARG A 1 307 ? 67.927  -6.007  -17.425 1.00 30.52  ? 307  ARG A N   1 
ATOM   2343 C CA  . ARG A 1 307 ? 66.631  -5.383  -17.609 1.00 29.69  ? 307  ARG A CA  1 
ATOM   2344 C C   . ARG A 1 307 ? 65.690  -5.567  -16.427 1.00 27.67  ? 307  ARG A C   1 
ATOM   2345 O O   . ARG A 1 307 ? 65.525  -6.690  -15.949 1.00 26.61  ? 307  ARG A O   1 
ATOM   2346 C CB  . ARG A 1 307 ? 65.967  -6.014  -18.850 1.00 35.46  ? 307  ARG A CB  1 
ATOM   2347 C CG  . ARG A 1 307 ? 66.913  -5.755  -20.011 1.00 43.33  ? 307  ARG A CG  1 
ATOM   2348 C CD  . ARG A 1 307 ? 66.897  -6.883  -20.996 1.00 51.98  ? 307  ARG A CD  1 
ATOM   2349 N NE  . ARG A 1 307 ? 66.056  -6.676  -22.173 1.00 58.52  ? 307  ARG A NE  1 
ATOM   2350 C CZ  . ARG A 1 307 ? 66.401  -7.312  -23.312 1.00 63.70  ? 307  ARG A CZ  1 
ATOM   2351 N NH1 . ARG A 1 307 ? 67.486  -8.090  -23.378 1.00 65.36  ? 307  ARG A NH1 1 
ATOM   2352 N NH2 . ARG A 1 307 ? 65.667  -7.174  -24.411 1.00 65.11  ? 307  ARG A NH2 1 
ATOM   2353 N N   . VAL A 1 308 ? 65.049  -4.484  -15.982 1.00 24.87  ? 308  VAL A N   1 
ATOM   2354 C CA  . VAL A 1 308 ? 64.185  -4.571  -14.814 1.00 24.30  ? 308  VAL A CA  1 
ATOM   2355 C C   . VAL A 1 308 ? 63.188  -5.727  -14.884 1.00 25.21  ? 308  VAL A C   1 
ATOM   2356 O O   . VAL A 1 308 ? 63.079  -6.521  -13.942 1.00 22.56  ? 308  VAL A O   1 
ATOM   2357 C CB  . VAL A 1 308 ? 63.541  -3.202  -14.500 1.00 21.30  ? 308  VAL A CB  1 
ATOM   2358 C CG1 . VAL A 1 308 ? 62.494  -3.255  -13.409 1.00 17.49  ? 308  VAL A CG1 1 
ATOM   2359 C CG2 . VAL A 1 308 ? 64.615  -2.211  -14.040 1.00 22.45  ? 308  VAL A CG2 1 
ATOM   2360 N N   . GLU A 1 309 ? 62.391  -5.831  -15.938 1.00 25.19  ? 309  GLU A N   1 
ATOM   2361 C CA  . GLU A 1 309 ? 61.369  -6.845  -16.063 1.00 26.68  ? 309  GLU A CA  1 
ATOM   2362 C C   . GLU A 1 309 ? 61.880  -8.260  -15.876 1.00 26.37  ? 309  GLU A C   1 
ATOM   2363 O O   . GLU A 1 309 ? 61.215  -9.013  -15.171 1.00 25.76  ? 309  GLU A O   1 
ATOM   2364 C CB  . GLU A 1 309 ? 60.688  -6.710  -17.449 1.00 34.47  ? 309  GLU A CB  1 
ATOM   2365 C CG  . GLU A 1 309 ? 59.536  -7.692  -17.600 1.00 42.14  ? 309  GLU A CG  1 
ATOM   2366 C CD  . GLU A 1 309 ? 58.639  -7.424  -18.789 1.00 47.14  ? 309  GLU A CD  1 
ATOM   2367 O OE1 . GLU A 1 309 ? 59.135  -6.812  -19.761 1.00 49.68  ? 309  GLU A OE1 1 
ATOM   2368 O OE2 . GLU A 1 309 ? 57.451  -7.822  -18.746 1.00 49.79  ? 309  GLU A OE2 1 
ATOM   2369 N N   . ASP A 1 310 ? 63.000  -8.625  -16.487 1.00 25.39  ? 310  ASP A N   1 
ATOM   2370 C CA  . ASP A 1 310 ? 63.609  -9.926  -16.407 1.00 26.60  ? 310  ASP A CA  1 
ATOM   2371 C C   . ASP A 1 310 ? 64.247  -10.238 -15.053 1.00 26.61  ? 310  ASP A C   1 
ATOM   2372 O O   . ASP A 1 310 ? 64.039  -11.338 -14.535 1.00 25.76  ? 310  ASP A O   1 
ATOM   2373 C CB  . ASP A 1 310 ? 64.701  -10.129 -17.477 1.00 28.32  ? 310  ASP A CB  1 
ATOM   2374 C CG  . ASP A 1 310 ? 64.177  -9.941  -18.889 1.00 31.56  ? 310  ASP A CG  1 
ATOM   2375 O OD1 . ASP A 1 310 ? 62.987  -10.216 -19.158 1.00 33.01  ? 310  ASP A OD1 1 
ATOM   2376 O OD2 . ASP A 1 310 ? 64.933  -9.508  -19.783 1.00 32.34  ? 310  ASP A OD2 1 
ATOM   2377 N N   . VAL A 1 311 ? 65.002  -9.307  -14.503 1.00 25.59  ? 311  VAL A N   1 
ATOM   2378 C CA  . VAL A 1 311 ? 65.622  -9.423  -13.201 1.00 25.20  ? 311  VAL A CA  1 
ATOM   2379 C C   . VAL A 1 311 ? 64.541  -9.456  -12.123 1.00 26.60  ? 311  VAL A C   1 
ATOM   2380 O O   . VAL A 1 311 ? 64.558  -10.321 -11.243 1.00 26.60  ? 311  VAL A O   1 
ATOM   2381 C CB  . VAL A 1 311 ? 66.556  -8.234  -12.881 1.00 23.57  ? 311  VAL A CB  1 
ATOM   2382 C CG1 . VAL A 1 311 ? 67.081  -8.292  -11.446 1.00 19.73  ? 311  VAL A CG1 1 
ATOM   2383 C CG2 . VAL A 1 311 ? 67.723  -8.130  -13.850 1.00 20.70  ? 311  VAL A CG2 1 
ATOM   2384 N N   . GLN A 1 312 ? 63.605  -8.500  -12.161 1.00 27.42  ? 312  GLN A N   1 
ATOM   2385 C CA  . GLN A 1 312 ? 62.558  -8.475  -11.141 1.00 28.17  ? 312  GLN A CA  1 
ATOM   2386 C C   . GLN A 1 312 ? 61.786  -9.796  -11.072 1.00 28.51  ? 312  GLN A C   1 
ATOM   2387 O O   . GLN A 1 312 ? 61.504  -10.239 -9.952  1.00 29.85  ? 312  GLN A O   1 
ATOM   2388 C CB  . GLN A 1 312 ? 61.536  -7.368  -11.330 1.00 26.68  ? 312  GLN A CB  1 
ATOM   2389 C CG  . GLN A 1 312 ? 60.563  -7.238  -10.171 1.00 27.65  ? 312  GLN A CG  1 
ATOM   2390 C CD  . GLN A 1 312 ? 59.877  -5.883  -10.162 1.00 28.93  ? 312  GLN A CD  1 
ATOM   2391 O OE1 . GLN A 1 312 ? 59.134  -5.561  -9.232  1.00 30.20  ? 312  GLN A OE1 1 
ATOM   2392 N NE2 . GLN A 1 312 ? 60.140  -5.067  -11.162 1.00 26.69  ? 312  GLN A NE2 1 
ATOM   2393 N N   . ARG A 1 313 ? 61.426  -10.395 -12.177 1.00 27.69  ? 313  ARG A N   1 
ATOM   2394 C CA  . ARG A 1 313 ? 60.701  -11.666 -12.229 1.00 29.27  ? 313  ARG A CA  1 
ATOM   2395 C C   . ARG A 1 313 ? 61.317  -12.752 -11.362 1.00 29.18  ? 313  ARG A C   1 
ATOM   2396 O O   . ARG A 1 313 ? 60.744  -13.381 -10.470 1.00 29.73  ? 313  ARG A O   1 
ATOM   2397 C CB  . ARG A 1 313 ? 60.711  -12.140 -13.699 1.00 32.40  ? 313  ARG A CB  1 
ATOM   2398 C CG  . ARG A 1 313 ? 59.598  -13.060 -14.104 1.00 39.45  ? 313  ARG A CG  1 
ATOM   2399 C CD  . ARG A 1 313 ? 59.438  -13.304 -15.587 1.00 44.78  ? 313  ARG A CD  1 
ATOM   2400 N NE  . ARG A 1 313 ? 60.676  -13.567 -16.328 1.00 48.19  ? 313  ARG A NE  1 
ATOM   2401 C CZ  . ARG A 1 313 ? 61.148  -12.767 -17.273 1.00 49.29  ? 313  ARG A CZ  1 
ATOM   2402 N NH1 . ARG A 1 313 ? 60.457  -11.665 -17.575 1.00 51.89  ? 313  ARG A NH1 1 
ATOM   2403 N NH2 . ARG A 1 313 ? 62.275  -13.045 -17.912 1.00 50.55  ? 313  ARG A NH2 1 
ATOM   2404 N N   . HIS A 1 314 ? 62.592  -13.005 -11.622 1.00 28.42  ? 314  HIS A N   1 
ATOM   2405 C CA  . HIS A 1 314 ? 63.486  -13.922 -10.989 1.00 27.36  ? 314  HIS A CA  1 
ATOM   2406 C C   . HIS A 1 314 ? 63.819  -13.642 -9.551  1.00 26.82  ? 314  HIS A C   1 
ATOM   2407 O O   . HIS A 1 314 ? 64.422  -14.491 -8.941  1.00 26.73  ? 314  HIS A O   1 
ATOM   2408 C CB  . HIS A 1 314 ? 64.877  -13.854 -11.714 1.00 27.45  ? 314  HIS A CB  1 
ATOM   2409 C CG  . HIS A 1 314 ? 64.807  -14.804 -12.875 1.00 27.86  ? 314  HIS A CG  1 
ATOM   2410 N ND1 . HIS A 1 314 ? 64.452  -14.408 -14.146 1.00 28.22  ? 314  HIS A ND1 1 
ATOM   2411 C CD2 . HIS A 1 314 ? 64.985  -16.143 -12.904 1.00 24.93  ? 314  HIS A CD2 1 
ATOM   2412 C CE1 . HIS A 1 314 ? 64.451  -15.477 -14.934 1.00 27.86  ? 314  HIS A CE1 1 
ATOM   2413 N NE2 . HIS A 1 314 ? 64.763  -16.535 -14.204 1.00 26.69  ? 314  HIS A NE2 1 
ATOM   2414 N N   . LEU A 1 315 ? 63.531  -12.465 -9.014  1.00 27.40  ? 315  LEU A N   1 
ATOM   2415 C CA  . LEU A 1 315 ? 63.873  -12.145 -7.628  1.00 26.62  ? 315  LEU A CA  1 
ATOM   2416 C C   . LEU A 1 315 ? 62.817  -12.607 -6.645  1.00 28.11  ? 315  LEU A C   1 
ATOM   2417 O O   . LEU A 1 315 ? 63.099  -12.817 -5.451  1.00 25.82  ? 315  LEU A O   1 
ATOM   2418 C CB  . LEU A 1 315 ? 64.150  -10.684 -7.767  1.00 29.46  ? 315  LEU A CB  1 
ATOM   2419 C CG  . LEU A 1 315 ? 63.923  -9.399  -7.046  1.00 27.95  ? 315  LEU A CG  1 
ATOM   2420 C CD1 . LEU A 1 315 ? 62.779  -9.570  -6.058  1.00 29.31  ? 315  LEU A CD1 1 
ATOM   2421 C CD2 . LEU A 1 315 ? 65.218  -8.968  -6.388  1.00 29.39  ? 315  LEU A CD2 1 
ATOM   2422 N N   . TYR A 1 316 ? 61.610  -12.893 -7.114  1.00 28.53  ? 316  TYR A N   1 
ATOM   2423 C CA  . TYR A 1 316 ? 60.491  -13.314 -6.270  1.00 32.85  ? 316  TYR A CA  1 
ATOM   2424 C C   . TYR A 1 316 ? 60.537  -14.806 -5.971  1.00 35.40  ? 316  TYR A C   1 
ATOM   2425 O O   . TYR A 1 316 ? 59.995  -15.329 -4.987  1.00 36.23  ? 316  TYR A O   1 
ATOM   2426 C CB  . TYR A 1 316 ? 59.168  -12.883 -6.918  1.00 30.33  ? 316  TYR A CB  1 
ATOM   2427 C CG  . TYR A 1 316 ? 59.027  -11.390 -7.117  1.00 27.07  ? 316  TYR A CG  1 
ATOM   2428 C CD1 . TYR A 1 316 ? 58.977  -10.535 -6.015  1.00 25.71  ? 316  TYR A CD1 1 
ATOM   2429 C CD2 . TYR A 1 316 ? 58.931  -10.839 -8.385  1.00 26.22  ? 316  TYR A CD2 1 
ATOM   2430 C CE1 . TYR A 1 316 ? 58.789  -9.183  -6.177  1.00 26.30  ? 316  TYR A CE1 1 
ATOM   2431 C CE2 . TYR A 1 316 ? 58.746  -9.480  -8.569  1.00 26.33  ? 316  TYR A CE2 1 
ATOM   2432 C CZ  . TYR A 1 316 ? 58.676  -8.653  -7.454  1.00 27.31  ? 316  TYR A CZ  1 
ATOM   2433 O OH  . TYR A 1 316 ? 58.508  -7.298  -7.601  1.00 26.95  ? 316  TYR A OH  1 
ATOM   2434 N N   . ASP A 1 317 ? 61.312  -15.490 -6.804  1.00 39.63  ? 317  ASP A N   1 
ATOM   2435 C CA  . ASP A 1 317 ? 61.617  -16.894 -6.741  1.00 43.45  ? 317  ASP A CA  1 
ATOM   2436 C C   . ASP A 1 317 ? 62.964  -17.292 -6.140  1.00 44.12  ? 317  ASP A C   1 
ATOM   2437 O O   . ASP A 1 317 ? 63.128  -18.508 -5.930  1.00 43.66  ? 317  ASP A O   1 
ATOM   2438 C CB  . ASP A 1 317 ? 61.611  -17.502 -8.165  1.00 50.07  ? 317  ASP A CB  1 
ATOM   2439 C CG  . ASP A 1 317 ? 60.196  -17.784 -8.630  1.00 54.21  ? 317  ASP A CG  1 
ATOM   2440 O OD1 . ASP A 1 317 ? 59.439  -18.451 -7.887  1.00 56.27  ? 317  ASP A OD1 1 
ATOM   2441 O OD2 . ASP A 1 317 ? 59.882  -17.290 -9.735  1.00 56.47  ? 317  ASP A OD2 1 
ATOM   2442 N N   . ILE A 1 318 ? 63.866  -16.396 -5.765  1.00 44.43  ? 318  ILE A N   1 
ATOM   2443 C CA  . ILE A 1 318 ? 65.130  -16.834 -5.169  1.00 44.49  ? 318  ILE A CA  1 
ATOM   2444 C C   . ILE A 1 318 ? 65.147  -16.647 -3.655  1.00 45.36  ? 318  ILE A C   1 
ATOM   2445 O O   . ILE A 1 318 ? 64.894  -15.551 -3.139  1.00 45.31  ? 318  ILE A O   1 
ATOM   2446 C CB  . ILE A 1 318 ? 66.345  -16.139 -5.823  1.00 43.82  ? 318  ILE A CB  1 
ATOM   2447 C CG1 . ILE A 1 318 ? 66.516  -16.645 -7.267  1.00 41.50  ? 318  ILE A CG1 1 
ATOM   2448 C CG2 . ILE A 1 318 ? 67.647  -16.341 -5.045  1.00 43.40  ? 318  ILE A CG2 1 
ATOM   2449 C CD1 . ILE A 1 318 ? 67.478  -15.821 -8.089  1.00 39.32  ? 318  ILE A CD1 1 
ATOM   2450 N N   . ASP A 1 319 ? 65.459  -17.726 -2.916  1.00 45.20  ? 319  ASP A N   1 
ATOM   2451 C CA  . ASP A 1 319 ? 65.594  -17.583 -1.473  1.00 43.75  ? 319  ASP A CA  1 
ATOM   2452 C C   . ASP A 1 319 ? 67.056  -17.247 -1.202  1.00 41.89  ? 319  ASP A C   1 
ATOM   2453 O O   . ASP A 1 319 ? 67.883  -17.673 -2.011  1.00 43.69  ? 319  ASP A O   1 
ATOM   2454 C CB  . ASP A 1 319 ? 65.215  -18.712 -0.535  1.00 43.41  ? 319  ASP A CB  1 
ATOM   2455 C CG  . ASP A 1 319 ? 63.706  -18.877 -0.712  1.00 47.65  ? 319  ASP A CG  1 
ATOM   2456 O OD1 . ASP A 1 319 ? 63.111  -17.851 -1.127  1.00 46.29  ? 319  ASP A OD1 1 
ATOM   2457 O OD2 . ASP A 1 319 ? 63.225  -20.000 -0.468  1.00 49.60  ? 319  ASP A OD2 1 
ATOM   2458 N N   . ILE A 1 320 ? 67.184  -16.450 -0.149  1.00 37.58  ? 320  ILE A N   1 
ATOM   2459 C CA  . ILE A 1 320 ? 68.540  -16.050 0.206   1.00 32.62  ? 320  ILE A CA  1 
ATOM   2460 C C   . ILE A 1 320 ? 68.795  -16.531 1.634   1.00 28.45  ? 320  ILE A C   1 
ATOM   2461 O O   . ILE A 1 320 ? 67.988  -16.283 2.522   1.00 24.32  ? 320  ILE A O   1 
ATOM   2462 C CB  . ILE A 1 320 ? 68.699  -14.518 0.133   1.00 35.35  ? 320  ILE A CB  1 
ATOM   2463 C CG1 . ILE A 1 320 ? 68.646  -14.003 -1.298  1.00 36.99  ? 320  ILE A CG1 1 
ATOM   2464 C CG2 . ILE A 1 320 ? 70.034  -14.076 0.768   1.00 38.04  ? 320  ILE A CG2 1 
ATOM   2465 C CD1 . ILE A 1 320 ? 69.895  -14.227 -2.145  1.00 30.63  ? 320  ILE A CD1 1 
ATOM   2466 N N   . ASP A 1 321 ? 69.951  -17.131 1.831   1.00 26.08  ? 321  ASP A N   1 
ATOM   2467 C CA  . ASP A 1 321 ? 70.366  -17.462 3.202   1.00 25.46  ? 321  ASP A CA  1 
ATOM   2468 C C   . ASP A 1 321 ? 71.061  -16.163 3.625   1.00 23.39  ? 321  ASP A C   1 
ATOM   2469 O O   . ASP A 1 321 ? 72.179  -15.897 3.172   1.00 25.41  ? 321  ASP A O   1 
ATOM   2470 C CB  . ASP A 1 321 ? 71.305  -18.647 3.283   1.00 27.97  ? 321  ASP A CB  1 
ATOM   2471 C CG  . ASP A 1 321 ? 70.612  -19.897 2.762   1.00 31.29  ? 321  ASP A CG  1 
ATOM   2472 O OD1 . ASP A 1 321 ? 69.494  -20.179 3.253   1.00 30.12  ? 321  ASP A OD1 1 
ATOM   2473 O OD2 . ASP A 1 321 ? 71.208  -20.526 1.870   1.00 35.34  ? 321  ASP A OD2 1 
ATOM   2474 N N   . ALA A 1 322 ? 70.356  -15.300 4.330   1.00 19.43  ? 322  ALA A N   1 
ATOM   2475 C CA  . ALA A 1 322 ? 70.956  -14.009 4.669   1.00 15.78  ? 322  ALA A CA  1 
ATOM   2476 C C   . ALA A 1 322 ? 71.713  -14.241 5.958   1.00 14.25  ? 322  ALA A C   1 
ATOM   2477 O O   . ALA A 1 322 ? 71.471  -15.214 6.659   1.00 15.26  ? 322  ALA A O   1 
ATOM   2478 C CB  . ALA A 1 322 ? 69.809  -13.007 4.788   1.00 10.06  ? 322  ALA A CB  1 
ATOM   2479 N N   . PRO A 1 323 ? 72.467  -13.269 6.430   1.00 13.63  ? 323  PRO A N   1 
ATOM   2480 C CA  . PRO A 1 323 ? 73.144  -13.387 7.721   1.00 14.04  ? 323  PRO A CA  1 
ATOM   2481 C C   . PRO A 1 323 ? 72.128  -13.504 8.854   1.00 14.05  ? 323  PRO A C   1 
ATOM   2482 O O   . PRO A 1 323 ? 72.316  -14.214 9.843   1.00 12.65  ? 323  PRO A O   1 
ATOM   2483 C CB  . PRO A 1 323 ? 73.957  -12.113 7.782   1.00 12.92  ? 323  PRO A CB  1 
ATOM   2484 C CG  . PRO A 1 323 ? 74.178  -11.724 6.379   1.00 12.50  ? 323  PRO A CG  1 
ATOM   2485 C CD  . PRO A 1 323 ? 72.880  -12.077 5.649   1.00 11.74  ? 323  PRO A CD  1 
ATOM   2486 N N   . GLN A 1 324 ? 70.934  -12.924 8.687   1.00 14.99  ? 324  GLN A N   1 
ATOM   2487 C CA  . GLN A 1 324 ? 69.866  -12.987 9.660   1.00 14.73  ? 324  GLN A CA  1 
ATOM   2488 C C   . GLN A 1 324 ? 69.144  -14.319 9.672   1.00 14.98  ? 324  GLN A C   1 
ATOM   2489 O O   . GLN A 1 324 ? 68.464  -14.549 10.671  1.00 17.76  ? 324  GLN A O   1 
ATOM   2490 C CB  . GLN A 1 324 ? 68.720  -11.979 9.409   1.00 8.88   ? 324  GLN A CB  1 
ATOM   2491 C CG  . GLN A 1 324 ? 67.878  -12.272 8.159   1.00 5.12   ? 324  GLN A CG  1 
ATOM   2492 C CD  . GLN A 1 324 ? 66.746  -11.302 7.962   1.00 10.56  ? 324  GLN A CD  1 
ATOM   2493 O OE1 . GLN A 1 324 ? 65.581  -11.684 8.157   1.00 14.57  ? 324  GLN A OE1 1 
ATOM   2494 N NE2 . GLN A 1 324 ? 67.008  -10.045 7.562   1.00 8.12   ? 324  GLN A NE2 1 
ATOM   2495 N N   . GLY A 1 325 ? 69.158  -15.063 8.584   1.00 15.76  ? 325  GLY A N   1 
ATOM   2496 C CA  . GLY A 1 325 ? 68.282  -16.242 8.481   1.00 13.54  ? 325  GLY A CA  1 
ATOM   2497 C C   . GLY A 1 325 ? 67.794  -16.244 7.026   1.00 15.15  ? 325  GLY A C   1 
ATOM   2498 O O   . GLY A 1 325 ? 68.266  -15.487 6.135   1.00 14.69  ? 325  GLY A O   1 
ATOM   2499 N N   . PRO A 1 326 ? 66.860  -17.138 6.727   1.00 15.08  ? 326  PRO A N   1 
ATOM   2500 C CA  . PRO A 1 326 ? 66.347  -17.257 5.362   1.00 15.22  ? 326  PRO A CA  1 
ATOM   2501 C C   . PRO A 1 326 ? 65.376  -16.121 5.116   1.00 15.62  ? 326  PRO A C   1 
ATOM   2502 O O   . PRO A 1 326 ? 64.525  -15.917 5.971   1.00 14.49  ? 326  PRO A O   1 
ATOM   2503 C CB  . PRO A 1 326 ? 65.605  -18.591 5.316   1.00 14.37  ? 326  PRO A CB  1 
ATOM   2504 C CG  . PRO A 1 326 ? 65.245  -18.863 6.730   1.00 14.68  ? 326  PRO A CG  1 
ATOM   2505 C CD  . PRO A 1 326 ? 66.242  -18.127 7.621   1.00 14.61  ? 326  PRO A CD  1 
ATOM   2506 N N   . VAL A 1 327 ? 65.472  -15.481 3.958   1.00 16.67  ? 327  VAL A N   1 
ATOM   2507 C CA  . VAL A 1 327 ? 64.615  -14.408 3.571   1.00 17.38  ? 327  VAL A CA  1 
ATOM   2508 C C   . VAL A 1 327 ? 64.105  -14.661 2.160   1.00 17.93  ? 327  VAL A C   1 
ATOM   2509 O O   . VAL A 1 327 ? 64.732  -15.310 1.332   1.00 18.19  ? 327  VAL A O   1 
ATOM   2510 C CB  . VAL A 1 327 ? 65.299  -13.005 3.586   1.00 20.88  ? 327  VAL A CB  1 
ATOM   2511 C CG1 . VAL A 1 327 ? 65.868  -12.605 4.940   1.00 13.47  ? 327  VAL A CG1 1 
ATOM   2512 C CG2 . VAL A 1 327 ? 66.431  -12.926 2.570   1.00 20.42  ? 327  VAL A CG2 1 
ATOM   2513 N N   . ARG A 1 328 ? 62.933  -14.104 1.873   1.00 18.68  ? 328  ARG A N   1 
ATOM   2514 C CA  . ARG A 1 328 ? 62.378  -14.122 0.534   1.00 18.09  ? 328  ARG A CA  1 
ATOM   2515 C C   . ARG A 1 328 ? 61.443  -12.909 0.384   1.00 16.51  ? 328  ARG A C   1 
ATOM   2516 O O   . ARG A 1 328 ? 60.944  -12.412 1.386   1.00 15.56  ? 328  ARG A O   1 
ATOM   2517 C CB  . ARG A 1 328 ? 61.605  -15.361 0.173   1.00 24.22  ? 328  ARG A CB  1 
ATOM   2518 C CG  . ARG A 1 328 ? 60.392  -15.672 1.034   1.00 30.76  ? 328  ARG A CG  1 
ATOM   2519 C CD  . ARG A 1 328 ? 60.177  -17.185 0.894   1.00 35.89  ? 328  ARG A CD  1 
ATOM   2520 N NE  . ARG A 1 328 ? 59.090  -17.503 0.006   1.00 42.91  ? 328  ARG A NE  1 
ATOM   2521 C CZ  . ARG A 1 328 ? 58.799  -18.750 -0.405  1.00 44.34  ? 328  ARG A CZ  1 
ATOM   2522 N NH1 . ARG A 1 328 ? 59.574  -19.753 -0.023  1.00 43.23  ? 328  ARG A NH1 1 
ATOM   2523 N NH2 . ARG A 1 328 ? 57.737  -18.888 -1.192  1.00 43.71  ? 328  ARG A NH2 1 
ATOM   2524 N N   . VAL A 1 329 ? 61.270  -12.510 -0.857  1.00 14.52  ? 329  VAL A N   1 
ATOM   2525 C CA  . VAL A 1 329 ? 60.454  -11.387 -1.212  1.00 15.99  ? 329  VAL A CA  1 
ATOM   2526 C C   . VAL A 1 329 ? 59.169  -11.952 -1.815  1.00 17.58  ? 329  VAL A C   1 
ATOM   2527 O O   . VAL A 1 329 ? 59.338  -12.798 -2.680  1.00 18.14  ? 329  VAL A O   1 
ATOM   2528 C CB  . VAL A 1 329 ? 61.151  -10.476 -2.236  1.00 15.07  ? 329  VAL A CB  1 
ATOM   2529 C CG1 . VAL A 1 329 ? 60.278  -9.257  -2.557  1.00 13.28  ? 329  VAL A CG1 1 
ATOM   2530 C CG2 . VAL A 1 329 ? 62.499  -10.086 -1.661  1.00 14.71  ? 329  VAL A CG2 1 
ATOM   2531 N N   . GLU A 1 330 ? 58.019  -11.569 -1.337  1.00 16.95  ? 330  GLU A N   1 
ATOM   2532 C CA  . GLU A 1 330 ? 56.748  -12.093 -1.801  1.00 17.36  ? 330  GLU A CA  1 
ATOM   2533 C C   . GLU A 1 330 ? 56.260  -11.305 -2.992  1.00 17.67  ? 330  GLU A C   1 
ATOM   2534 O O   . GLU A 1 330 ? 56.009  -10.114 -2.890  1.00 16.28  ? 330  GLU A O   1 
ATOM   2535 C CB  . GLU A 1 330 ? 55.679  -11.988 -0.693  1.00 15.26  ? 330  GLU A CB  1 
ATOM   2536 C CG  . GLU A 1 330 ? 56.142  -12.721 0.579   1.00 19.66  ? 330  GLU A CG  1 
ATOM   2537 C CD  . GLU A 1 330 ? 55.021  -13.046 1.544   1.00 20.64  ? 330  GLU A CD  1 
ATOM   2538 O OE1 . GLU A 1 330 ? 53.975  -12.344 1.547   1.00 22.40  ? 330  GLU A OE1 1 
ATOM   2539 O OE2 . GLU A 1 330 ? 55.150  -13.980 2.349   1.00 19.97  ? 330  GLU A OE2 1 
ATOM   2540 N N   . ARG A 1 331 ? 56.039  -11.970 -4.106  1.00 19.65  ? 331  ARG A N   1 
ATOM   2541 C CA  . ARG A 1 331 ? 55.542  -11.332 -5.318  1.00 21.85  ? 331  ARG A CA  1 
ATOM   2542 C C   . ARG A 1 331 ? 54.215  -10.651 -5.005  1.00 21.51  ? 331  ARG A C   1 
ATOM   2543 O O   . ARG A 1 331 ? 53.976  -9.560  -5.534  1.00 21.91  ? 331  ARG A O   1 
ATOM   2544 C CB  . ARG A 1 331 ? 55.410  -12.365 -6.415  1.00 27.80  ? 331  ARG A CB  1 
ATOM   2545 C CG  . ARG A 1 331 ? 55.441  -12.002 -7.878  1.00 38.24  ? 331  ARG A CG  1 
ATOM   2546 C CD  . ARG A 1 331 ? 55.133  -13.242 -8.741  1.00 44.51  ? 331  ARG A CD  1 
ATOM   2547 N NE  . ARG A 1 331 ? 55.749  -14.458 -8.183  1.00 51.77  ? 331  ARG A NE  1 
ATOM   2548 C CZ  . ARG A 1 331 ? 56.867  -15.027 -8.630  1.00 53.97  ? 331  ARG A CZ  1 
ATOM   2549 N NH1 . ARG A 1 331 ? 57.463  -14.458 -9.684  1.00 55.30  ? 331  ARG A NH1 1 
ATOM   2550 N NH2 . ARG A 1 331 ? 57.445  -16.113 -8.144  1.00 55.94  ? 331  ARG A NH2 1 
ATOM   2551 N N   . GLN A 1 332 ? 53.344  -11.118 -4.139  1.00 20.66  ? 332  GLN A N   1 
ATOM   2552 C CA  . GLN A 1 332 ? 52.079  -10.438 -3.902  1.00 21.64  ? 332  GLN A CA  1 
ATOM   2553 C C   . GLN A 1 332 ? 52.243  -9.023  -3.390  1.00 19.31  ? 332  GLN A C   1 
ATOM   2554 O O   . GLN A 1 332 ? 51.292  -8.231  -3.567  1.00 21.28  ? 332  GLN A O   1 
ATOM   2555 C CB  . GLN A 1 332 ? 51.136  -11.238 -2.981  1.00 30.00  ? 332  GLN A CB  1 
ATOM   2556 C CG  . GLN A 1 332 ? 51.346  -11.055 -1.492  1.00 40.85  ? 332  GLN A CG  1 
ATOM   2557 C CD  . GLN A 1 332 ? 50.897  -12.164 -0.568  1.00 48.69  ? 332  GLN A CD  1 
ATOM   2558 O OE1 . GLN A 1 332 ? 51.455  -13.270 -0.428  1.00 51.13  ? 332  GLN A OE1 1 
ATOM   2559 N NE2 . GLN A 1 332 ? 49.814  -11.944 0.192   1.00 50.70  ? 332  GLN A NE2 1 
ATOM   2560 N N   . ASN A 1 333 ? 53.282  -8.643  -2.665  1.00 17.57  ? 333  ASN A N   1 
ATOM   2561 C CA  . ASN A 1 333 ? 53.319  -7.293  -2.140  1.00 15.41  ? 333  ASN A CA  1 
ATOM   2562 C C   . ASN A 1 333 ? 54.669  -6.636  -2.121  1.00 15.55  ? 333  ASN A C   1 
ATOM   2563 O O   . ASN A 1 333 ? 54.866  -5.558  -1.529  1.00 12.11  ? 333  ASN A O   1 
ATOM   2564 C CB  . ASN A 1 333 ? 52.692  -7.391  -0.739  1.00 13.87  ? 333  ASN A CB  1 
ATOM   2565 C CG  . ASN A 1 333 ? 53.483  -8.303  0.159   1.00 17.57  ? 333  ASN A CG  1 
ATOM   2566 O OD1 . ASN A 1 333 ? 54.693  -8.526  0.062   1.00 14.45  ? 333  ASN A OD1 1 
ATOM   2567 N ND2 . ASN A 1 333 ? 52.749  -8.842  1.131   1.00 22.38  ? 333  ASN A ND2 1 
ATOM   2568 N N   . ASN A 1 334 ? 55.682  -7.316  -2.692  1.00 15.63  ? 334  ASN A N   1 
ATOM   2569 C CA  . ASN A 1 334 ? 57.026  -6.734  -2.705  1.00 14.78  ? 334  ASN A CA  1 
ATOM   2570 C C   . ASN A 1 334 ? 57.629  -6.608  -1.314  1.00 13.80  ? 334  ASN A C   1 
ATOM   2571 O O   . ASN A 1 334 ? 58.676  -5.957  -1.240  1.00 12.68  ? 334  ASN A O   1 
ATOM   2572 C CB  . ASN A 1 334 ? 57.043  -5.346  -3.365  1.00 14.85  ? 334  ASN A CB  1 
ATOM   2573 C CG  . ASN A 1 334 ? 57.160  -5.483  -4.865  1.00 17.61  ? 334  ASN A CG  1 
ATOM   2574 O OD1 . ASN A 1 334 ? 57.544  -6.563  -5.290  1.00 19.82  ? 334  ASN A OD1 1 
ATOM   2575 N ND2 . ASN A 1 334 ? 56.862  -4.483  -5.682  1.00 17.75  ? 334  ASN A ND2 1 
ATOM   2576 N N   . HIS A 1 335 ? 57.008  -7.102  -0.257  1.00 12.18  ? 335  HIS A N   1 
ATOM   2577 C CA  . HIS A 1 335 ? 57.658  -6.971  1.053   1.00 13.02  ? 335  HIS A CA  1 
ATOM   2578 C C   . HIS A 1 335 ? 58.393  -8.276  1.327   1.00 12.50  ? 335  HIS A C   1 
ATOM   2579 O O   . HIS A 1 335 ? 58.242  -9.230  0.561   1.00 12.92  ? 335  HIS A O   1 
ATOM   2580 C CB  . HIS A 1 335 ? 56.651  -6.607  2.134   1.00 12.79  ? 335  HIS A CB  1 
ATOM   2581 C CG  . HIS A 1 335 ? 56.201  -5.176  2.138   1.00 9.67   ? 335  HIS A CG  1 
ATOM   2582 N ND1 . HIS A 1 335 ? 55.578  -4.591  1.063   1.00 6.70   ? 335  HIS A ND1 1 
ATOM   2583 C CD2 . HIS A 1 335 ? 56.321  -4.208  3.075   1.00 9.27   ? 335  HIS A CD2 1 
ATOM   2584 C CE1 . HIS A 1 335 ? 55.303  -3.327  1.333   1.00 8.01   ? 335  HIS A CE1 1 
ATOM   2585 N NE2 . HIS A 1 335 ? 55.703  -3.081  2.563   1.00 9.49   ? 335  HIS A NE2 1 
ATOM   2586 N N   . SER A 1 336 ? 59.127  -8.386  2.412   1.00 13.87  ? 336  SER A N   1 
ATOM   2587 C CA  . SER A 1 336 ? 59.908  -9.576  2.672   1.00 15.16  ? 336  SER A CA  1 
ATOM   2588 C C   . SER A 1 336 ? 59.547  -10.427 3.874   1.00 15.58  ? 336  SER A C   1 
ATOM   2589 O O   . SER A 1 336 ? 59.117  -9.873  4.887   1.00 15.66  ? 336  SER A O   1 
ATOM   2590 C CB  . SER A 1 336 ? 61.352  -9.077  2.966   1.00 14.73  ? 336  SER A CB  1 
ATOM   2591 O OG  . SER A 1 336 ? 61.801  -8.330  1.866   1.00 14.65  ? 336  SER A OG  1 
ATOM   2592 N N   . ARG A 1 337 ? 59.831  -11.735 3.763   1.00 15.48  ? 337  ARG A N   1 
ATOM   2593 C CA  . ARG A 1 337 ? 59.660  -12.604 4.945   1.00 14.41  ? 337  ARG A CA  1 
ATOM   2594 C C   . ARG A 1 337 ? 60.900  -12.419 5.817   1.00 13.42  ? 337  ARG A C   1 
ATOM   2595 O O   . ARG A 1 337 ? 61.981  -12.704 5.300   1.00 11.98  ? 337  ARG A O   1 
ATOM   2596 C CB  . ARG A 1 337 ? 59.525  -14.055 4.521   1.00 18.78  ? 337  ARG A CB  1 
ATOM   2597 C CG  . ARG A 1 337 ? 58.190  -14.354 3.891   1.00 21.38  ? 337  ARG A CG  1 
ATOM   2598 C CD  . ARG A 1 337 ? 58.010  -15.852 3.628   1.00 21.03  ? 337  ARG A CD  1 
ATOM   2599 N NE  . ARG A 1 337 ? 56.836  -15.954 2.748   1.00 21.13  ? 337  ARG A NE  1 
ATOM   2600 C CZ  . ARG A 1 337 ? 56.373  -17.123 2.324   1.00 24.38  ? 337  ARG A CZ  1 
ATOM   2601 N NH1 . ARG A 1 337 ? 57.014  -18.212 2.746   1.00 26.28  ? 337  ARG A NH1 1 
ATOM   2602 N NH2 . ARG A 1 337 ? 55.314  -17.172 1.528   1.00 22.61  ? 337  ARG A NH2 1 
ATOM   2603 N N   . LEU A 1 338 ? 60.776  -11.867 7.012   1.00 12.52  ? 338  LEU A N   1 
ATOM   2604 C CA  . LEU A 1 338 ? 61.913  -11.548 7.836   1.00 12.97  ? 338  LEU A CA  1 
ATOM   2605 C C   . LEU A 1 338 ? 61.944  -12.095 9.258   1.00 13.45  ? 338  LEU A C   1 
ATOM   2606 O O   . LEU A 1 338 ? 60.910  -12.232 9.918   1.00 12.88  ? 338  LEU A O   1 
ATOM   2607 C CB  . LEU A 1 338 ? 62.002  -10.013 7.977   1.00 14.22  ? 338  LEU A CB  1 
ATOM   2608 C CG  . LEU A 1 338 ? 62.161  -9.147  6.732   1.00 12.46  ? 338  LEU A CG  1 
ATOM   2609 C CD1 . LEU A 1 338 ? 62.140  -7.660  7.117   1.00 10.30  ? 338  LEU A CD1 1 
ATOM   2610 C CD2 . LEU A 1 338 ? 63.487  -9.444  6.028   1.00 10.45  ? 338  LEU A CD2 1 
ATOM   2611 N N   . SER A 1 339 ? 63.179  -12.367 9.733   1.00 13.29  ? 339  SER A N   1 
ATOM   2612 C CA  . SER A 1 339 ? 63.373  -12.766 11.105  1.00 13.45  ? 339  SER A CA  1 
ATOM   2613 C C   . SER A 1 339 ? 63.055  -11.547 11.971  1.00 16.07  ? 339  SER A C   1 
ATOM   2614 O O   . SER A 1 339 ? 62.964  -10.418 11.468  1.00 15.85  ? 339  SER A O   1 
ATOM   2615 C CB  . SER A 1 339 ? 64.753  -13.343 11.403  1.00 12.75  ? 339  SER A CB  1 
ATOM   2616 O OG  . SER A 1 339 ? 64.854  -14.652 10.818  1.00 14.88  ? 339  SER A OG  1 
ATOM   2617 N N   . SER A 1 340 ? 62.925  -11.749 13.278  1.00 16.23  ? 340  SER A N   1 
ATOM   2618 C CA  . SER A 1 340 ? 62.563  -10.645 14.163  1.00 16.95  ? 340  SER A CA  1 
ATOM   2619 C C   . SER A 1 340 ? 63.076  -10.899 15.563  1.00 17.89  ? 340  SER A C   1 
ATOM   2620 O O   . SER A 1 340 ? 62.875  -12.011 16.055  1.00 17.81  ? 340  SER A O   1 
ATOM   2621 C CB  . SER A 1 340 ? 61.032  -10.531 14.196  1.00 15.53  ? 340  SER A CB  1 
ATOM   2622 O OG  . SER A 1 340 ? 60.763  -9.353  14.967  1.00 13.57  ? 340  SER A OG  1 
ATOM   2623 N N   . ARG A 1 341 ? 63.938  -10.032 16.075  1.00 17.93  ? 341  ARG A N   1 
ATOM   2624 C CA  . ARG A 1 341 ? 64.617  -10.258 17.335  1.00 17.79  ? 341  ARG A CA  1 
ATOM   2625 C C   . ARG A 1 341 ? 64.507  -9.054  18.245  1.00 18.00  ? 341  ARG A C   1 
ATOM   2626 O O   . ARG A 1 341 ? 64.538  -7.917  17.793  1.00 17.93  ? 341  ARG A O   1 
ATOM   2627 C CB  . ARG A 1 341 ? 66.127  -10.553 17.093  1.00 15.65  ? 341  ARG A CB  1 
ATOM   2628 C CG  . ARG A 1 341 ? 66.340  -11.706 16.114  1.00 17.37  ? 341  ARG A CG  1 
ATOM   2629 C CD  . ARG A 1 341 ? 67.790  -12.059 15.922  1.00 21.45  ? 341  ARG A CD  1 
ATOM   2630 N NE  . ARG A 1 341 ? 68.063  -13.416 15.495  1.00 22.44  ? 341  ARG A NE  1 
ATOM   2631 C CZ  . ARG A 1 341 ? 68.064  -14.039 14.341  1.00 19.75  ? 341  ARG A CZ  1 
ATOM   2632 N NH1 . ARG A 1 341 ? 67.784  -13.402 13.218  1.00 16.00  ? 341  ARG A NH1 1 
ATOM   2633 N NH2 . ARG A 1 341 ? 68.429  -15.321 14.320  1.00 18.60  ? 341  ARG A NH2 1 
ATOM   2634 N N   . ILE A 1 342 ? 64.425  -9.299  19.555  1.00 19.48  ? 342  ILE A N   1 
ATOM   2635 C CA  . ILE A 1 342 ? 64.351  -8.211  20.538  1.00 17.62  ? 342  ILE A CA  1 
ATOM   2636 C C   . ILE A 1 342 ? 65.574  -8.429  21.404  1.00 18.94  ? 342  ILE A C   1 
ATOM   2637 O O   . ILE A 1 342 ? 65.747  -9.571  21.874  1.00 19.25  ? 342  ILE A O   1 
ATOM   2638 C CB  . ILE A 1 342 ? 63.021  -8.257  21.290  1.00 14.02  ? 342  ILE A CB  1 
ATOM   2639 C CG1 . ILE A 1 342 ? 61.848  -7.871  20.378  1.00 13.31  ? 342  ILE A CG1 1 
ATOM   2640 C CG2 . ILE A 1 342 ? 63.056  -7.333  22.487  1.00 13.62  ? 342  ILE A CG2 1 
ATOM   2641 C CD1 . ILE A 1 342 ? 60.495  -8.062  21.052  1.00 14.21  ? 342  ILE A CD1 1 
ATOM   2642 N N   . ALA A 1 343 ? 66.425  -7.420  21.572  1.00 18.16  ? 343  ALA A N   1 
ATOM   2643 C CA  . ALA A 1 343 ? 67.619  -7.609  22.366  1.00 17.37  ? 343  ALA A CA  1 
ATOM   2644 C C   . ALA A 1 343 ? 67.726  -6.580  23.475  1.00 18.82  ? 343  ALA A C   1 
ATOM   2645 O O   . ALA A 1 343 ? 67.296  -5.432  23.395  1.00 20.05  ? 343  ALA A O   1 
ATOM   2646 C CB  . ALA A 1 343 ? 68.891  -7.558  21.512  1.00 13.56  ? 343  ALA A CB  1 
ATOM   2647 N N   . GLU A 1 344 ? 68.498  -6.951  24.473  1.00 19.37  ? 344  GLU A N   1 
ATOM   2648 C CA  . GLU A 1 344 ? 68.796  -6.165  25.659  1.00 20.78  ? 344  GLU A CA  1 
ATOM   2649 C C   . GLU A 1 344 ? 70.302  -5.910  25.670  1.00 20.59  ? 344  GLU A C   1 
ATOM   2650 O O   . GLU A 1 344 ? 71.090  -6.857  25.483  1.00 19.35  ? 344  GLU A O   1 
ATOM   2651 C CB  . GLU A 1 344 ? 68.318  -6.944  26.881  1.00 22.14  ? 344  GLU A CB  1 
ATOM   2652 C CG  . GLU A 1 344 ? 68.233  -6.147  28.157  1.00 31.77  ? 344  GLU A CG  1 
ATOM   2653 C CD  . GLU A 1 344 ? 67.750  -6.874  29.393  1.00 34.09  ? 344  GLU A CD  1 
ATOM   2654 O OE1 . GLU A 1 344 ? 67.086  -7.920  29.361  1.00 37.25  ? 344  GLU A OE1 1 
ATOM   2655 O OE2 . GLU A 1 344 ? 68.051  -6.376  30.494  1.00 36.47  ? 344  GLU A OE2 1 
ATOM   2656 N N   . ILE A 1 345 ? 70.737  -4.667  25.809  1.00 20.45  ? 345  ILE A N   1 
ATOM   2657 C CA  . ILE A 1 345 ? 72.195  -4.470  25.792  1.00 22.86  ? 345  ILE A CA  1 
ATOM   2658 C C   . ILE A 1 345 ? 72.772  -4.804  27.172  1.00 24.43  ? 345  ILE A C   1 
ATOM   2659 O O   . ILE A 1 345 ? 72.193  -4.451  28.201  1.00 22.50  ? 345  ILE A O   1 
ATOM   2660 C CB  . ILE A 1 345 ? 72.657  -3.081  25.363  1.00 23.08  ? 345  ILE A CB  1 
ATOM   2661 C CG1 . ILE A 1 345 ? 72.293  -2.822  23.888  1.00 22.44  ? 345  ILE A CG1 1 
ATOM   2662 C CG2 . ILE A 1 345 ? 74.157  -2.888  25.506  1.00 19.41  ? 345  ILE A CG2 1 
ATOM   2663 C CD1 . ILE A 1 345 ? 70.999  -2.088  23.776  1.00 26.86  ? 345  ILE A CD1 1 
ATOM   2664 N N   . ASP A 1 346 ? 73.902  -5.497  27.184  1.00 27.38  ? 346  ASP A N   1 
ATOM   2665 C CA  . ASP A 1 346 ? 74.547  -5.784  28.477  1.00 33.25  ? 346  ASP A CA  1 
ATOM   2666 C C   . ASP A 1 346 ? 75.548  -4.673  28.776  1.00 34.66  ? 346  ASP A C   1 
ATOM   2667 O O   . ASP A 1 346 ? 75.824  -3.784  27.993  1.00 34.74  ? 346  ASP A O   1 
ATOM   2668 C CB  . ASP A 1 346 ? 75.124  -7.181  28.575  1.00 33.45  ? 346  ASP A CB  1 
ATOM   2669 C CG  . ASP A 1 346 ? 76.270  -7.553  27.681  1.00 39.54  ? 346  ASP A CG  1 
ATOM   2670 O OD1 . ASP A 1 346 ? 76.785  -6.766  26.840  1.00 41.66  ? 346  ASP A OD1 1 
ATOM   2671 O OD2 . ASP A 1 346 ? 76.706  -8.728  27.815  1.00 42.54  ? 346  ASP A OD2 1 
ATOM   2672 N N   . ALA A 1 347 ? 76.267  -4.821  29.874  1.00 37.47  ? 347  ALA A N   1 
ATOM   2673 C CA  . ALA A 1 347 ? 77.292  -3.933  30.392  1.00 38.61  ? 347  ALA A CA  1 
ATOM   2674 C C   . ALA A 1 347 ? 78.523  -3.777  29.513  1.00 39.55  ? 347  ALA A C   1 
ATOM   2675 O O   . ALA A 1 347 ? 79.372  -2.929  29.784  1.00 39.29  ? 347  ALA A O   1 
ATOM   2676 C CB  . ALA A 1 347 ? 77.759  -4.477  31.741  1.00 39.34  ? 347  ALA A CB  1 
ATOM   2677 N N   . ARG A 1 348 ? 78.632  -4.567  28.458  1.00 40.26  ? 348  ARG A N   1 
ATOM   2678 C CA  . ARG A 1 348 ? 79.788  -4.503  27.580  1.00 42.95  ? 348  ARG A CA  1 
ATOM   2679 C C   . ARG A 1 348 ? 79.437  -4.100  26.158  1.00 42.82  ? 348  ARG A C   1 
ATOM   2680 O O   . ARG A 1 348 ? 80.179  -4.290  25.183  1.00 42.42  ? 348  ARG A O   1 
ATOM   2681 C CB  . ARG A 1 348 ? 80.457  -5.871  27.708  1.00 48.91  ? 348  ARG A CB  1 
ATOM   2682 C CG  . ARG A 1 348 ? 81.985  -5.720  27.785  1.00 56.11  ? 348  ARG A CG  1 
ATOM   2683 C CD  . ARG A 1 348 ? 82.509  -6.294  26.455  1.00 61.35  ? 348  ARG A CD  1 
ATOM   2684 N NE  . ARG A 1 348 ? 82.172  -7.728  26.433  1.00 63.12  ? 348  ARG A NE  1 
ATOM   2685 C CZ  . ARG A 1 348 ? 82.110  -8.450  25.321  1.00 64.71  ? 348  ARG A CZ  1 
ATOM   2686 N NH1 . ARG A 1 348 ? 82.358  -7.891  24.140  1.00 63.39  ? 348  ARG A NH1 1 
ATOM   2687 N NH2 . ARG A 1 348 ? 81.788  -9.738  25.443  1.00 64.97  ? 348  ARG A NH2 1 
ATOM   2688 N N   . GLY A 1 349 ? 78.220  -3.548  26.048  1.00 41.20  ? 349  GLY A N   1 
ATOM   2689 C CA  . GLY A 1 349 ? 77.687  -3.060  24.797  1.00 39.59  ? 349  GLY A CA  1 
ATOM   2690 C C   . GLY A 1 349 ? 77.236  -4.173  23.862  1.00 38.52  ? 349  GLY A C   1 
ATOM   2691 O O   . GLY A 1 349 ? 77.107  -3.892  22.658  1.00 38.62  ? 349  GLY A O   1 
ATOM   2692 N N   . VAL A 1 350 ? 77.046  -5.398  24.359  1.00 36.63  ? 350  VAL A N   1 
ATOM   2693 C CA  . VAL A 1 350 ? 76.664  -6.420  23.394  1.00 35.56  ? 350  VAL A CA  1 
ATOM   2694 C C   . VAL A 1 350 ? 75.168  -6.735  23.516  1.00 33.23  ? 350  VAL A C   1 
ATOM   2695 O O   . VAL A 1 350 ? 74.581  -6.819  24.583  1.00 32.23  ? 350  VAL A O   1 
ATOM   2696 C CB  . VAL A 1 350 ? 77.476  -7.715  23.322  1.00 39.03  ? 350  VAL A CB  1 
ATOM   2697 C CG1 . VAL A 1 350 ? 78.931  -7.440  23.668  1.00 39.23  ? 350  VAL A CG1 1 
ATOM   2698 C CG2 . VAL A 1 350 ? 76.862  -8.858  24.128  1.00 38.79  ? 350  VAL A CG2 1 
ATOM   2699 N N   . PHE A 1 351 ? 74.631  -6.927  22.324  1.00 31.21  ? 351  PHE A N   1 
ATOM   2700 C CA  . PHE A 1 351 ? 73.227  -7.194  22.090  1.00 30.64  ? 351  PHE A CA  1 
ATOM   2701 C C   . PHE A 1 351 ? 72.901  -8.647  22.388  1.00 29.43  ? 351  PHE A C   1 
ATOM   2702 O O   . PHE A 1 351 ? 73.165  -9.524  21.569  1.00 29.47  ? 351  PHE A O   1 
ATOM   2703 C CB  . PHE A 1 351 ? 72.858  -6.812  20.637  1.00 26.47  ? 351  PHE A CB  1 
ATOM   2704 C CG  . PHE A 1 351 ? 73.084  -5.340  20.435  1.00 31.69  ? 351  PHE A CG  1 
ATOM   2705 C CD1 . PHE A 1 351 ? 74.371  -4.808  20.423  1.00 35.30  ? 351  PHE A CD1 1 
ATOM   2706 C CD2 . PHE A 1 351 ? 72.029  -4.465  20.277  1.00 31.97  ? 351  PHE A CD2 1 
ATOM   2707 C CE1 . PHE A 1 351 ? 74.593  -3.453  20.277  1.00 34.92  ? 351  PHE A CE1 1 
ATOM   2708 C CE2 . PHE A 1 351 ? 72.227  -3.110  20.116  1.00 31.34  ? 351  PHE A CE2 1 
ATOM   2709 C CZ  . PHE A 1 351 ? 73.504  -2.625  20.123  1.00 32.89  ? 351  PHE A CZ  1 
ATOM   2710 N N   . GLN A 1 352 ? 72.289  -8.867  23.532  1.00 29.21  ? 352  GLN A N   1 
ATOM   2711 C CA  . GLN A 1 352 ? 71.834  -10.187 23.964  1.00 28.74  ? 352  GLN A CA  1 
ATOM   2712 C C   . GLN A 1 352 ? 70.414  -10.421 23.478  1.00 26.88  ? 352  GLN A C   1 
ATOM   2713 O O   . GLN A 1 352 ? 69.493  -9.779  23.993  1.00 26.47  ? 352  GLN A O   1 
ATOM   2714 C CB  . GLN A 1 352 ? 71.901  -10.297 25.489  1.00 33.78  ? 352  GLN A CB  1 
ATOM   2715 C CG  . GLN A 1 352 ? 72.888  -11.291 26.062  1.00 40.80  ? 352  GLN A CG  1 
ATOM   2716 C CD  . GLN A 1 352 ? 74.345  -11.163 25.734  1.00 42.15  ? 352  GLN A CD  1 
ATOM   2717 O OE1 . GLN A 1 352 ? 74.801  -11.431 24.628  1.00 43.05  ? 352  GLN A OE1 1 
ATOM   2718 N NE2 . GLN A 1 352 ? 75.173  -10.764 26.700  1.00 47.28  ? 352  GLN A NE2 1 
ATOM   2719 N N   . VAL A 1 353 ? 70.204  -11.353 22.568  1.00 25.74  ? 353  VAL A N   1 
ATOM   2720 C CA  . VAL A 1 353 ? 68.876  -11.646 22.023  1.00 25.47  ? 353  VAL A CA  1 
ATOM   2721 C C   . VAL A 1 353 ? 68.057  -12.342 23.092  1.00 26.49  ? 353  VAL A C   1 
ATOM   2722 O O   . VAL A 1 353 ? 68.484  -13.344 23.644  1.00 27.86  ? 353  VAL A O   1 
ATOM   2723 C CB  . VAL A 1 353 ? 68.957  -12.453 20.718  1.00 23.09  ? 353  VAL A CB  1 
ATOM   2724 C CG1 . VAL A 1 353 ? 67.561  -12.817 20.192  1.00 20.52  ? 353  VAL A CG1 1 
ATOM   2725 C CG2 . VAL A 1 353 ? 69.741  -11.695 19.644  1.00 19.05  ? 353  VAL A CG2 1 
ATOM   2726 N N   . ARG A 1 354 ? 66.890  -11.847 23.437  1.00 27.59  ? 354  ARG A N   1 
ATOM   2727 C CA  . ARG A 1 354 ? 66.030  -12.368 24.481  1.00 27.52  ? 354  ARG A CA  1 
ATOM   2728 C C   . ARG A 1 354 ? 64.774  -13.009 23.911  1.00 26.75  ? 354  ARG A C   1 
ATOM   2729 O O   . ARG A 1 354 ? 64.032  -13.686 24.626  1.00 26.05  ? 354  ARG A O   1 
ATOM   2730 C CB  . ARG A 1 354 ? 65.544  -11.210 25.384  1.00 31.30  ? 354  ARG A CB  1 
ATOM   2731 C CG  . ARG A 1 354 ? 66.707  -10.407 25.967  1.00 36.63  ? 354  ARG A CG  1 
ATOM   2732 C CD  . ARG A 1 354 ? 66.793  -10.673 27.453  1.00 41.91  ? 354  ARG A CD  1 
ATOM   2733 N NE  . ARG A 1 354 ? 68.149  -10.635 27.965  1.00 46.80  ? 354  ARG A NE  1 
ATOM   2734 C CZ  . ARG A 1 354 ? 68.940  -11.708 27.897  1.00 50.81  ? 354  ARG A CZ  1 
ATOM   2735 N NH1 . ARG A 1 354 ? 68.467  -12.819 27.334  1.00 53.13  ? 354  ARG A NH1 1 
ATOM   2736 N NH2 . ARG A 1 354 ? 70.188  -11.717 28.353  1.00 48.98  ? 354  ARG A NH2 1 
ATOM   2737 N N   . TRP A 1 355 ? 64.542  -12.707 22.634  1.00 25.24  ? 355  TRP A N   1 
ATOM   2738 C CA  . TRP A 1 355 ? 63.370  -13.235 21.971  1.00 24.23  ? 355  TRP A CA  1 
ATOM   2739 C C   . TRP A 1 355 ? 63.595  -13.143 20.474  1.00 24.67  ? 355  TRP A C   1 
ATOM   2740 O O   . TRP A 1 355 ? 64.138  -12.151 20.013  1.00 23.91  ? 355  TRP A O   1 
ATOM   2741 C CB  . TRP A 1 355 ? 62.089  -12.501 22.372  1.00 22.89  ? 355  TRP A CB  1 
ATOM   2742 C CG  . TRP A 1 355 ? 60.905  -13.005 21.602  1.00 25.35  ? 355  TRP A CG  1 
ATOM   2743 C CD1 . TRP A 1 355 ? 60.039  -13.988 22.001  1.00 26.43  ? 355  TRP A CD1 1 
ATOM   2744 C CD2 . TRP A 1 355 ? 60.467  -12.577 20.310  1.00 25.56  ? 355  TRP A CD2 1 
ATOM   2745 N NE1 . TRP A 1 355 ? 59.080  -14.186 21.030  1.00 24.96  ? 355  TRP A NE1 1 
ATOM   2746 C CE2 . TRP A 1 355 ? 59.329  -13.340 19.983  1.00 27.31  ? 355  TRP A CE2 1 
ATOM   2747 C CE3 . TRP A 1 355 ? 60.933  -11.632 19.399  1.00 26.53  ? 355  TRP A CE3 1 
ATOM   2748 C CZ2 . TRP A 1 355 ? 58.636  -13.181 18.781  1.00 27.50  ? 355  TRP A CZ2 1 
ATOM   2749 C CZ3 . TRP A 1 355 ? 60.247  -11.460 18.204  1.00 29.16  ? 355  TRP A CZ3 1 
ATOM   2750 C CH2 . TRP A 1 355 ? 59.103  -12.224 17.916  1.00 29.32  ? 355  TRP A CH2 1 
ATOM   2751 N N   . GLN A 1 356 ? 63.149  -14.170 19.764  1.00 24.93  ? 356  GLN A N   1 
ATOM   2752 C CA  . GLN A 1 356 ? 63.220  -14.190 18.321  1.00 25.24  ? 356  GLN A CA  1 
ATOM   2753 C C   . GLN A 1 356 ? 61.947  -14.873 17.816  1.00 25.20  ? 356  GLN A C   1 
ATOM   2754 O O   . GLN A 1 356 ? 61.535  -15.810 18.492  1.00 26.90  ? 356  GLN A O   1 
ATOM   2755 C CB  . GLN A 1 356 ? 64.460  -14.842 17.766  1.00 25.46  ? 356  GLN A CB  1 
ATOM   2756 C CG  . GLN A 1 356 ? 64.705  -16.307 18.047  1.00 30.69  ? 356  GLN A CG  1 
ATOM   2757 C CD  . GLN A 1 356 ? 66.160  -16.668 17.754  1.00 33.66  ? 356  GLN A CD  1 
ATOM   2758 O OE1 . GLN A 1 356 ? 66.532  -17.001 16.632  1.00 34.51  ? 356  GLN A OE1 1 
ATOM   2759 N NE2 . GLN A 1 356 ? 67.034  -16.595 18.753  1.00 35.16  ? 356  GLN A NE2 1 
ATOM   2760 N N   . SER A 1 357 ? 61.355  -14.388 16.732  1.00 23.73  ? 357  SER A N   1 
ATOM   2761 C CA  . SER A 1 357 ? 60.186  -15.077 16.223  1.00 23.29  ? 357  SER A CA  1 
ATOM   2762 C C   . SER A 1 357 ? 60.633  -16.482 15.850  1.00 22.91  ? 357  SER A C   1 
ATOM   2763 O O   . SER A 1 357 ? 61.720  -16.708 15.307  1.00 21.50  ? 357  SER A O   1 
ATOM   2764 C CB  . SER A 1 357 ? 59.562  -14.357 15.016  1.00 24.54  ? 357  SER A CB  1 
ATOM   2765 O OG  . SER A 1 357 ? 60.519  -14.227 13.949  1.00 24.81  ? 357  SER A OG  1 
ATOM   2766 N N   . PRO A 1 358 ? 59.796  -17.469 16.143  1.00 23.84  ? 358  PRO A N   1 
ATOM   2767 C CA  . PRO A 1 358 ? 60.085  -18.868 15.849  1.00 23.98  ? 358  PRO A CA  1 
ATOM   2768 C C   . PRO A 1 358 ? 60.443  -19.094 14.393  1.00 24.87  ? 358  PRO A C   1 
ATOM   2769 O O   . PRO A 1 358 ? 61.278  -19.930 14.063  1.00 25.21  ? 358  PRO A O   1 
ATOM   2770 C CB  . PRO A 1 358 ? 58.767  -19.592 16.136  1.00 23.45  ? 358  PRO A CB  1 
ATOM   2771 C CG  . PRO A 1 358 ? 58.050  -18.723 17.097  1.00 23.78  ? 358  PRO A CG  1 
ATOM   2772 C CD  . PRO A 1 358 ? 58.498  -17.308 16.834  1.00 23.69  ? 358  PRO A CD  1 
ATOM   2773 N N   . GLU A 1 359 ? 59.752  -18.421 13.478  1.00 24.80  ? 359  GLU A N   1 
ATOM   2774 C CA  . GLU A 1 359 ? 60.024  -18.535 12.049  1.00 26.05  ? 359  GLU A CA  1 
ATOM   2775 C C   . GLU A 1 359 ? 59.900  -17.140 11.447  1.00 23.68  ? 359  GLU A C   1 
ATOM   2776 O O   . GLU A 1 359 ? 59.348  -16.285 12.106  1.00 22.44  ? 359  GLU A O   1 
ATOM   2777 C CB  . GLU A 1 359 ? 59.094  -19.531 11.388  1.00 31.57  ? 359  GLU A CB  1 
ATOM   2778 C CG  . GLU A 1 359 ? 57.619  -19.534 11.723  1.00 41.55  ? 359  GLU A CG  1 
ATOM   2779 C CD  . GLU A 1 359 ? 56.930  -20.639 10.909  1.00 49.03  ? 359  GLU A CD  1 
ATOM   2780 O OE1 . GLU A 1 359 ? 57.402  -21.810 11.014  1.00 51.84  ? 359  GLU A OE1 1 
ATOM   2781 O OE2 . GLU A 1 359 ? 55.975  -20.349 10.151  1.00 50.94  ? 359  GLU A OE2 1 
ATOM   2782 N N   . PRO A 1 360 ? 60.457  -16.891 10.269  1.00 23.00  ? 360  PRO A N   1 
ATOM   2783 C CA  . PRO A 1 360 ? 60.365  -15.576 9.644   1.00 22.37  ? 360  PRO A CA  1 
ATOM   2784 C C   . PRO A 1 360 ? 58.910  -15.085 9.663   1.00 21.29  ? 360  PRO A C   1 
ATOM   2785 O O   . PRO A 1 360 ? 57.994  -15.916 9.611   1.00 21.34  ? 360  PRO A O   1 
ATOM   2786 C CB  . PRO A 1 360 ? 60.964  -15.795 8.282   1.00 21.93  ? 360  PRO A CB  1 
ATOM   2787 C CG  . PRO A 1 360 ? 61.890  -16.979 8.459   1.00 22.63  ? 360  PRO A CG  1 
ATOM   2788 C CD  . PRO A 1 360 ? 61.181  -17.873 9.436   1.00 22.31  ? 360  PRO A CD  1 
ATOM   2789 N N   . ILE A 1 361 ? 58.660  -13.803 9.890   1.00 19.37  ? 361  ILE A N   1 
ATOM   2790 C CA  . ILE A 1 361 ? 57.299  -13.264 9.952   1.00 18.14  ? 361  ILE A CA  1 
ATOM   2791 C C   . ILE A 1 361 ? 56.915  -12.827 8.534   1.00 18.30  ? 361  ILE A C   1 
ATOM   2792 O O   . ILE A 1 361 ? 57.712  -12.134 7.901   1.00 18.38  ? 361  ILE A O   1 
ATOM   2793 C CB  . ILE A 1 361 ? 57.146  -12.061 10.880  1.00 15.41  ? 361  ILE A CB  1 
ATOM   2794 C CG1 . ILE A 1 361 ? 57.689  -12.363 12.278  1.00 11.93  ? 361  ILE A CG1 1 
ATOM   2795 C CG2 . ILE A 1 361 ? 55.727  -11.505 10.927  1.00 13.15  ? 361  ILE A CG2 1 
ATOM   2796 C CD1 . ILE A 1 361 ? 57.683  -11.227 13.275  1.00 10.49  ? 361  ILE A CD1 1 
ATOM   2797 N N   . ARG A 1 362 ? 55.747  -13.268 8.077   1.00 17.04  ? 362  ARG A N   1 
ATOM   2798 C CA  . ARG A 1 362 ? 55.293  -12.863 6.737   1.00 17.52  ? 362  ARG A CA  1 
ATOM   2799 C C   . ARG A 1 362 ? 54.819  -11.418 6.834   1.00 14.66  ? 362  ARG A C   1 
ATOM   2800 O O   . ARG A 1 362 ? 54.252  -11.109 7.862   1.00 13.58  ? 362  ARG A O   1 
ATOM   2801 C CB  . ARG A 1 362 ? 54.176  -13.798 6.256   1.00 17.65  ? 362  ARG A CB  1 
ATOM   2802 C CG  . ARG A 1 362 ? 54.642  -15.217 5.914   1.00 21.92  ? 362  ARG A CG  1 
ATOM   2803 C CD  . ARG A 1 362 ? 53.572  -15.924 5.074   1.00 27.72  ? 362  ARG A CD  1 
ATOM   2804 N NE  . ARG A 1 362 ? 53.057  -15.063 4.009   1.00 32.39  ? 362  ARG A NE  1 
ATOM   2805 C CZ  . ARG A 1 362 ? 52.370  -15.363 2.930   1.00 34.35  ? 362  ARG A CZ  1 
ATOM   2806 N NH1 . ARG A 1 362 ? 52.015  -16.612 2.651   1.00 37.89  ? 362  ARG A NH1 1 
ATOM   2807 N NH2 . ARG A 1 362 ? 51.979  -14.430 2.063   1.00 37.21  ? 362  ARG A NH2 1 
ATOM   2808 N N   . PRO A 1 363 ? 55.088  -10.569 5.857   1.00 14.96  ? 363  PRO A N   1 
ATOM   2809 C CA  . PRO A 1 363 ? 54.696  -9.173  5.908   1.00 15.41  ? 363  PRO A CA  1 
ATOM   2810 C C   . PRO A 1 363 ? 53.232  -8.963  5.555   1.00 16.24  ? 363  PRO A C   1 
ATOM   2811 O O   . PRO A 1 363 ? 52.738  -9.536  4.570   1.00 14.61  ? 363  PRO A O   1 
ATOM   2812 C CB  . PRO A 1 363 ? 55.589  -8.502  4.873   1.00 15.91  ? 363  PRO A CB  1 
ATOM   2813 C CG  . PRO A 1 363 ? 55.713  -9.576  3.831   1.00 15.85  ? 363  PRO A CG  1 
ATOM   2814 C CD  . PRO A 1 363 ? 55.832  -10.858 4.609   1.00 14.31  ? 363  PRO A CD  1 
ATOM   2815 N N   . ASP A 1 364 ? 52.608  -8.090  6.340   1.00 15.15  ? 364  ASP A N   1 
ATOM   2816 C CA  . ASP A 1 364 ? 51.214  -7.694  6.182   1.00 14.55  ? 364  ASP A CA  1 
ATOM   2817 C C   . ASP A 1 364 ? 51.146  -6.186  6.471   1.00 13.63  ? 364  ASP A C   1 
ATOM   2818 O O   . ASP A 1 364 ? 50.789  -5.769  7.566   1.00 13.67  ? 364  ASP A O   1 
ATOM   2819 C CB  . ASP A 1 364 ? 50.269  -8.361  7.196   1.00 12.18  ? 364  ASP A CB  1 
ATOM   2820 C CG  . ASP A 1 364 ? 48.813  -8.121  6.765   1.00 15.63  ? 364  ASP A CG  1 
ATOM   2821 O OD1 . ASP A 1 364 ? 48.514  -7.440  5.743   1.00 11.86  ? 364  ASP A OD1 1 
ATOM   2822 O OD2 . ASP A 1 364 ? 47.909  -8.677  7.423   1.00 15.59  ? 364  ASP A OD2 1 
ATOM   2823 N N   . PRO A 1 365 ? 51.604  -5.361  5.548   1.00 13.24  ? 365  PRO A N   1 
ATOM   2824 C CA  . PRO A 1 365 ? 51.787  -3.939  5.815   1.00 13.01  ? 365  PRO A CA  1 
ATOM   2825 C C   . PRO A 1 365 ? 50.534  -3.118  6.017   1.00 13.17  ? 365  PRO A C   1 
ATOM   2826 O O   . PRO A 1 365 ? 50.617  -2.075  6.650   1.00 11.12  ? 365  PRO A O   1 
ATOM   2827 C CB  . PRO A 1 365 ? 52.615  -3.439  4.626   1.00 12.96  ? 365  PRO A CB  1 
ATOM   2828 C CG  . PRO A 1 365 ? 52.333  -4.428  3.528   1.00 12.88  ? 365  PRO A CG  1 
ATOM   2829 C CD  . PRO A 1 365 ? 52.145  -5.757  4.230   1.00 12.08  ? 365  PRO A CD  1 
ATOM   2830 N N   . TYR A 1 366 ? 49.392  -3.553  5.521   1.00 13.16  ? 366  TYR A N   1 
ATOM   2831 C CA  . TYR A 1 366 ? 48.140  -2.821  5.690   1.00 14.21  ? 366  TYR A CA  1 
ATOM   2832 C C   . TYR A 1 366 ? 47.348  -3.302  6.898   1.00 16.13  ? 366  TYR A C   1 
ATOM   2833 O O   . TYR A 1 366 ? 46.216  -2.877  7.148   1.00 15.39  ? 366  TYR A O   1 
ATOM   2834 C CB  . TYR A 1 366 ? 47.345  -3.035  4.387   1.00 13.03  ? 366  TYR A CB  1 
ATOM   2835 C CG  . TYR A 1 366 ? 47.805  -2.111  3.283   1.00 10.27  ? 366  TYR A CG  1 
ATOM   2836 C CD1 . TYR A 1 366 ? 47.274  -0.823  3.177   1.00 10.30  ? 366  TYR A CD1 1 
ATOM   2837 C CD2 . TYR A 1 366 ? 48.796  -2.506  2.389   1.00 10.31  ? 366  TYR A CD2 1 
ATOM   2838 C CE1 . TYR A 1 366 ? 47.711  0.040   2.181   1.00 11.04  ? 366  TYR A CE1 1 
ATOM   2839 C CE2 . TYR A 1 366 ? 49.263  -1.651  1.389   1.00 9.01   ? 366  TYR A CE2 1 
ATOM   2840 C CZ  . TYR A 1 366 ? 48.709  -0.391  1.299   1.00 10.06  ? 366  TYR A CZ  1 
ATOM   2841 O OH  . TYR A 1 366 ? 49.147  0.481   0.335   1.00 8.93   ? 366  TYR A OH  1 
ATOM   2842 N N   . VAL A 1 367 ? 47.838  -4.263  7.690   1.00 17.51  ? 367  VAL A N   1 
ATOM   2843 C CA  . VAL A 1 367 ? 47.024  -4.695  8.833   1.00 18.80  ? 367  VAL A CA  1 
ATOM   2844 C C   . VAL A 1 367 ? 46.885  -3.522  9.811   1.00 20.39  ? 367  VAL A C   1 
ATOM   2845 O O   . VAL A 1 367 ? 47.851  -2.805  10.126  1.00 20.77  ? 367  VAL A O   1 
ATOM   2846 C CB  . VAL A 1 367 ? 47.533  -5.967  9.488   1.00 20.48  ? 367  VAL A CB  1 
ATOM   2847 C CG1 . VAL A 1 367 ? 48.817  -5.718  10.279  1.00 18.27  ? 367  VAL A CG1 1 
ATOM   2848 C CG2 . VAL A 1 367 ? 46.398  -6.594  10.298  1.00 21.10  ? 367  VAL A CG2 1 
ATOM   2849 N N   . VAL A 1 368 ? 45.667  -3.241  10.225  1.00 18.96  ? 368  VAL A N   1 
ATOM   2850 C CA  . VAL A 1 368 ? 45.374  -2.181  11.179  1.00 19.35  ? 368  VAL A CA  1 
ATOM   2851 C C   . VAL A 1 368 ? 45.386  -2.748  12.597  1.00 20.39  ? 368  VAL A C   1 
ATOM   2852 O O   . VAL A 1 368 ? 46.020  -2.199  13.489  1.00 21.32  ? 368  VAL A O   1 
ATOM   2853 C CB  . VAL A 1 368 ? 43.984  -1.592  10.861  1.00 19.76  ? 368  VAL A CB  1 
ATOM   2854 C CG1 . VAL A 1 368 ? 43.458  -0.637  11.926  1.00 17.70  ? 368  VAL A CG1 1 
ATOM   2855 C CG2 . VAL A 1 368 ? 44.032  -0.901  9.501   1.00 17.88  ? 368  VAL A CG2 1 
ATOM   2856 N N   . VAL A 1 369 ? 44.644  -3.846  12.833  1.00 19.90  ? 369  VAL A N   1 
ATOM   2857 C CA  . VAL A 1 369 ? 44.533  -4.416  14.154  1.00 19.57  ? 369  VAL A CA  1 
ATOM   2858 C C   . VAL A 1 369 ? 45.612  -5.455  14.394  1.00 19.47  ? 369  VAL A C   1 
ATOM   2859 O O   . VAL A 1 369 ? 45.597  -6.552  13.836  1.00 18.24  ? 369  VAL A O   1 
ATOM   2860 C CB  . VAL A 1 369 ? 43.129  -5.017  14.427  1.00 21.96  ? 369  VAL A CB  1 
ATOM   2861 C CG1 . VAL A 1 369 ? 43.097  -5.748  15.766  1.00 19.32  ? 369  VAL A CG1 1 
ATOM   2862 C CG2 . VAL A 1 369 ? 42.051  -3.943  14.407  1.00 21.09  ? 369  VAL A CG2 1 
ATOM   2863 N N   . HIS A 1 370 ? 46.576  -5.079  15.235  1.00 20.19  ? 370  HIS A N   1 
ATOM   2864 C CA  . HIS A 1 370 ? 47.627  -6.010  15.623  1.00 20.56  ? 370  HIS A CA  1 
ATOM   2865 C C   . HIS A 1 370 ? 47.141  -6.847  16.810  1.00 22.58  ? 370  HIS A C   1 
ATOM   2866 O O   . HIS A 1 370 ? 46.902  -6.338  17.908  1.00 21.72  ? 370  HIS A O   1 
ATOM   2867 C CB  . HIS A 1 370 ? 48.904  -5.282  16.049  1.00 18.93  ? 370  HIS A CB  1 
ATOM   2868 C CG  . HIS A 1 370 ? 49.482  -4.477  14.927  1.00 19.22  ? 370  HIS A CG  1 
ATOM   2869 N ND1 . HIS A 1 370 ? 50.192  -5.079  13.912  1.00 19.54  ? 370  HIS A ND1 1 
ATOM   2870 C CD2 . HIS A 1 370 ? 49.424  -3.152  14.642  1.00 15.65  ? 370  HIS A CD2 1 
ATOM   2871 C CE1 . HIS A 1 370 ? 50.572  -4.162  13.040  1.00 17.59  ? 370  HIS A CE1 1 
ATOM   2872 N NE2 . HIS A 1 370 ? 50.103  -2.985  13.468  1.00 16.59  ? 370  HIS A NE2 1 
ATOM   2873 N N   . ASN A 1 371 ? 47.002  -8.141  16.583  1.00 23.61  ? 371  ASN A N   1 
ATOM   2874 C CA  . ASN A 1 371 ? 46.611  -9.033  17.673  1.00 23.68  ? 371  ASN A CA  1 
ATOM   2875 C C   . ASN A 1 371 ? 47.836  -9.532  18.418  1.00 23.98  ? 371  ASN A C   1 
ATOM   2876 O O   . ASN A 1 371 ? 48.422  -10.557 18.066  1.00 21.47  ? 371  ASN A O   1 
ATOM   2877 C CB  . ASN A 1 371 ? 45.838  -10.234 17.088  1.00 23.72  ? 371  ASN A CB  1 
ATOM   2878 C CG  . ASN A 1 371 ? 45.195  -11.047 18.204  1.00 24.02  ? 371  ASN A CG  1 
ATOM   2879 O OD1 . ASN A 1 371 ? 45.519  -10.941 19.389  1.00 23.66  ? 371  ASN A OD1 1 
ATOM   2880 N ND2 . ASN A 1 371 ? 44.242  -11.871 17.799  1.00 25.72  ? 371  ASN A ND2 1 
ATOM   2881 N N   . LEU A 1 372 ? 48.168  -8.940  19.550  1.00 25.99  ? 372  LEU A N   1 
ATOM   2882 C CA  . LEU A 1 372 ? 49.333  -9.283  20.362  1.00 27.65  ? 372  LEU A CA  1 
ATOM   2883 C C   . LEU A 1 372 ? 49.330  -10.671 20.957  1.00 30.20  ? 372  LEU A C   1 
ATOM   2884 O O   . LEU A 1 372 ? 50.359  -11.232 21.349  1.00 29.86  ? 372  LEU A O   1 
ATOM   2885 C CB  . LEU A 1 372 ? 49.453  -8.253  21.488  1.00 26.31  ? 372  LEU A CB  1 
ATOM   2886 C CG  . LEU A 1 372 ? 50.209  -6.959  21.193  1.00 29.03  ? 372  LEU A CG  1 
ATOM   2887 C CD1 . LEU A 1 372 ? 50.405  -6.668  19.714  1.00 25.45  ? 372  LEU A CD1 1 
ATOM   2888 C CD2 . LEU A 1 372 ? 49.542  -5.781  21.891  1.00 25.77  ? 372  LEU A CD2 1 
ATOM   2889 N N   . ASP A 1 373 ? 48.150  -11.308 20.977  1.00 31.04  ? 373  ASP A N   1 
ATOM   2890 C CA  . ASP A 1 373 ? 47.931  -12.674 21.360  1.00 30.83  ? 373  ASP A CA  1 
ATOM   2891 C C   . ASP A 1 373 ? 48.745  -13.587 20.463  1.00 29.57  ? 373  ASP A C   1 
ATOM   2892 O O   . ASP A 1 373 ? 49.203  -14.631 20.926  1.00 28.79  ? 373  ASP A O   1 
ATOM   2893 C CB  . ASP A 1 373 ? 46.465  -13.079 21.170  1.00 36.73  ? 373  ASP A CB  1 
ATOM   2894 C CG  . ASP A 1 373 ? 45.641  -12.886 22.420  1.00 41.48  ? 373  ASP A CG  1 
ATOM   2895 O OD1 . ASP A 1 373 ? 46.170  -12.334 23.412  1.00 44.09  ? 373  ASP A OD1 1 
ATOM   2896 O OD2 . ASP A 1 373 ? 44.455  -13.307 22.376  1.00 47.15  ? 373  ASP A OD2 1 
ATOM   2897 N N   . ASP A 1 374 ? 48.978  -13.148 19.216  1.00 28.82  ? 374  ASP A N   1 
ATOM   2898 C CA  . ASP A 1 374 ? 49.821  -13.903 18.298  1.00 28.35  ? 374  ASP A CA  1 
ATOM   2899 C C   . ASP A 1 374 ? 51.166  -14.283 18.922  1.00 28.18  ? 374  ASP A C   1 
ATOM   2900 O O   . ASP A 1 374 ? 51.743  -15.297 18.548  1.00 28.71  ? 374  ASP A O   1 
ATOM   2901 C CB  . ASP A 1 374 ? 50.117  -13.114 17.032  1.00 25.37  ? 374  ASP A CB  1 
ATOM   2902 C CG  . ASP A 1 374 ? 48.974  -12.797 16.112  1.00 25.87  ? 374  ASP A CG  1 
ATOM   2903 O OD1 . ASP A 1 374 ? 47.778  -13.055 16.374  1.00 25.32  ? 374  ASP A OD1 1 
ATOM   2904 O OD2 . ASP A 1 374 ? 49.236  -12.230 15.030  1.00 24.67  ? 374  ASP A OD2 1 
ATOM   2905 N N   . TRP A 1 375 ? 51.761  -13.454 19.758  1.00 28.19  ? 375  TRP A N   1 
ATOM   2906 C CA  . TRP A 1 375 ? 53.070  -13.644 20.325  1.00 28.64  ? 375  TRP A CA  1 
ATOM   2907 C C   . TRP A 1 375 ? 53.118  -14.266 21.706  1.00 30.05  ? 375  TRP A C   1 
ATOM   2908 O O   . TRP A 1 375 ? 54.202  -14.632 22.172  1.00 29.42  ? 375  TRP A O   1 
ATOM   2909 C CB  . TRP A 1 375 ? 53.791  -12.277 20.323  1.00 24.11  ? 375  TRP A CB  1 
ATOM   2910 C CG  . TRP A 1 375 ? 53.797  -11.756 18.901  1.00 23.08  ? 375  TRP A CG  1 
ATOM   2911 C CD1 . TRP A 1 375 ? 53.151  -10.650 18.416  1.00 20.58  ? 375  TRP A CD1 1 
ATOM   2912 C CD2 . TRP A 1 375 ? 54.447  -12.374 17.793  1.00 22.38  ? 375  TRP A CD2 1 
ATOM   2913 N NE1 . TRP A 1 375 ? 53.374  -10.548 17.066  1.00 21.55  ? 375  TRP A NE1 1 
ATOM   2914 C CE2 . TRP A 1 375 ? 54.162  -11.592 16.658  1.00 22.32  ? 375  TRP A CE2 1 
ATOM   2915 C CE3 . TRP A 1 375 ? 55.234  -13.517 17.648  1.00 23.91  ? 375  TRP A CE3 1 
ATOM   2916 C CZ2 . TRP A 1 375 ? 54.653  -11.913 15.394  1.00 21.89  ? 375  TRP A CZ2 1 
ATOM   2917 C CZ3 . TRP A 1 375 ? 55.718  -13.842 16.393  1.00 22.18  ? 375  TRP A CZ3 1 
ATOM   2918 C CH2 . TRP A 1 375 ? 55.427  -13.036 15.285  1.00 23.23  ? 375  TRP A CH2 1 
ATOM   2919 N N   . SER A 1 376 ? 51.961  -14.437 22.345  1.00 32.32  ? 376  SER A N   1 
ATOM   2920 C CA  . SER A 1 376 ? 51.915  -14.957 23.704  1.00 34.29  ? 376  SER A CA  1 
ATOM   2921 C C   . SER A 1 376 ? 52.563  -16.324 23.853  1.00 34.87  ? 376  SER A C   1 
ATOM   2922 O O   . SER A 1 376 ? 53.392  -16.484 24.746  1.00 35.29  ? 376  SER A O   1 
ATOM   2923 C CB  . SER A 1 376 ? 50.466  -14.947 24.186  1.00 36.28  ? 376  SER A CB  1 
ATOM   2924 O OG  . SER A 1 376 ? 49.979  -16.266 24.003  1.00 41.64  ? 376  SER A OG  1 
ATOM   2925 N N   . ALA A 1 377 ? 52.356  -17.267 22.946  1.00 35.41  ? 377  ALA A N   1 
ATOM   2926 C CA  . ALA A 1 377 ? 52.959  -18.579 22.995  1.00 35.84  ? 377  ALA A CA  1 
ATOM   2927 C C   . ALA A 1 377 ? 54.474  -18.596 22.883  1.00 36.02  ? 377  ALA A C   1 
ATOM   2928 O O   . ALA A 1 377 ? 55.078  -19.444 23.548  1.00 37.22  ? 377  ALA A O   1 
ATOM   2929 C CB  . ALA A 1 377 ? 52.391  -19.462 21.886  1.00 36.00  ? 377  ALA A CB  1 
ATOM   2930 N N   . SER A 1 378 ? 55.119  -17.730 22.099  1.00 35.07  ? 378  SER A N   1 
ATOM   2931 C CA  . SER A 1 378 ? 56.567  -17.801 21.975  1.00 33.93  ? 378  SER A CA  1 
ATOM   2932 C C   . SER A 1 378 ? 57.297  -16.869 22.920  1.00 32.51  ? 378  SER A C   1 
ATOM   2933 O O   . SER A 1 378 ? 58.525  -16.780 22.843  1.00 32.49  ? 378  SER A O   1 
ATOM   2934 C CB  . SER A 1 378 ? 57.068  -17.488 20.552  1.00 33.60  ? 378  SER A CB  1 
ATOM   2935 O OG  . SER A 1 378 ? 56.744  -16.134 20.298  1.00 35.06  ? 378  SER A OG  1 
ATOM   2936 N N   . MET A 1 379 ? 56.553  -16.175 23.758  1.00 32.18  ? 379  MET A N   1 
ATOM   2937 C CA  . MET A 1 379 ? 57.115  -15.255 24.724  1.00 31.69  ? 379  MET A CA  1 
ATOM   2938 C C   . MET A 1 379 ? 56.858  -15.773 26.137  1.00 31.13  ? 379  MET A C   1 
ATOM   2939 O O   . MET A 1 379 ? 57.074  -14.918 27.033  1.00 32.49  ? 379  MET A O   1 
ATOM   2940 C CB  . MET A 1 379 ? 56.540  -13.841 24.562  1.00 31.11  ? 379  MET A CB  1 
ATOM   2941 C CG  . MET A 1 379 ? 57.082  -13.133 23.330  1.00 30.30  ? 379  MET A CG  1 
ATOM   2942 S SD  . MET A 1 379 ? 56.530  -11.441 23.117  1.00 29.02  ? 379  MET A SD  1 
ATOM   2943 C CE  . MET A 1 379 ? 57.239  -11.083 21.498  1.00 27.15  ? 379  MET A CE  1 
ATOM   2944 N N   . ARG B 1 7   ? 69.808  12.542  -30.317 1.00 46.24  ? 7    ARG B N   1 
ATOM   2945 C CA  . ARG B 1 7   ? 69.247  12.298  -31.678 1.00 46.79  ? 7    ARG B CA  1 
ATOM   2946 C C   . ARG B 1 7   ? 67.946  13.043  -31.915 1.00 44.85  ? 7    ARG B C   1 
ATOM   2947 O O   . ARG B 1 7   ? 66.982  12.788  -31.199 1.00 47.02  ? 7    ARG B O   1 
ATOM   2948 C CB  . ARG B 1 7   ? 68.994  10.801  -31.858 1.00 47.14  ? 7    ARG B CB  1 
ATOM   2949 N N   . PRO B 1 8   ? 67.890  13.949  -32.872 1.00 43.25  ? 8    PRO B N   1 
ATOM   2950 C CA  . PRO B 1 8   ? 66.684  14.679  -33.231 1.00 41.30  ? 8    PRO B CA  1 
ATOM   2951 C C   . PRO B 1 8   ? 65.748  13.727  -33.970 1.00 38.13  ? 8    PRO B C   1 
ATOM   2952 O O   . PRO B 1 8   ? 65.787  13.664  -35.185 1.00 37.26  ? 8    PRO B O   1 
ATOM   2953 C CB  . PRO B 1 8   ? 67.128  15.809  -34.141 1.00 41.77  ? 8    PRO B CB  1 
ATOM   2954 C CG  . PRO B 1 8   ? 68.570  15.604  -34.409 1.00 42.61  ? 8    PRO B CG  1 
ATOM   2955 C CD  . PRO B 1 8   ? 68.997  14.296  -33.792 1.00 43.40  ? 8    PRO B CD  1 
ATOM   2956 N N   . LEU B 1 9   ? 64.975  12.950  -33.243 1.00 35.27  ? 9    LEU B N   1 
ATOM   2957 C CA  . LEU B 1 9   ? 64.094  11.941  -33.796 1.00 33.31  ? 9    LEU B CA  1 
ATOM   2958 C C   . LEU B 1 9   ? 62.647  12.198  -33.389 1.00 32.37  ? 9    LEU B C   1 
ATOM   2959 O O   . LEU B 1 9   ? 62.341  12.248  -32.186 1.00 31.98  ? 9    LEU B O   1 
ATOM   2960 C CB  . LEU B 1 9   ? 64.602  10.582  -33.307 1.00 32.22  ? 9    LEU B CB  1 
ATOM   2961 C CG  . LEU B 1 9   ? 63.736  9.356   -33.496 1.00 33.13  ? 9    LEU B CG  1 
ATOM   2962 C CD1 . LEU B 1 9   ? 63.414  9.133   -34.972 1.00 36.22  ? 9    LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 1 9   ? 64.349  8.087   -32.929 1.00 32.55  ? 9    LEU B CD2 1 
ATOM   2964 N N   . ILE B 1 10  ? 61.771  12.430  -34.365 1.00 30.07  ? 10   ILE B N   1 
ATOM   2965 C CA  . ILE B 1 10  ? 60.372  12.654  -34.040 1.00 27.73  ? 10   ILE B CA  1 
ATOM   2966 C C   . ILE B 1 10  ? 59.601  11.355  -34.266 1.00 28.40  ? 10   ILE B C   1 
ATOM   2967 O O   . ILE B 1 10  ? 59.649  10.817  -35.375 1.00 28.75  ? 10   ILE B O   1 
ATOM   2968 C CB  . ILE B 1 10  ? 59.684  13.749  -34.850 1.00 25.78  ? 10   ILE B CB  1 
ATOM   2969 C CG1 . ILE B 1 10  ? 60.377  15.105  -34.748 1.00 21.26  ? 10   ILE B CG1 1 
ATOM   2970 C CG2 . ILE B 1 10  ? 58.226  13.891  -34.381 1.00 25.64  ? 10   ILE B CG2 1 
ATOM   2971 C CD1 . ILE B 1 10  ? 59.758  16.185  -35.604 1.00 18.69  ? 10   ILE B CD1 1 
ATOM   2972 N N   . GLY B 1 11  ? 58.869  10.876  -33.258 1.00 27.74  ? 11   GLY B N   1 
ATOM   2973 C CA  . GLY B 1 11  ? 58.046  9.677   -33.434 1.00 26.46  ? 11   GLY B CA  1 
ATOM   2974 C C   . GLY B 1 11  ? 56.668  10.113  -33.971 1.00 25.69  ? 11   GLY B C   1 
ATOM   2975 O O   . GLY B 1 11  ? 56.052  11.017  -33.417 1.00 26.00  ? 11   GLY B O   1 
ATOM   2976 N N   . LEU B 1 12  ? 56.197  9.555   -35.064 1.00 24.99  ? 12   LEU B N   1 
ATOM   2977 C CA  . LEU B 1 12  ? 54.899  9.882   -35.651 1.00 26.62  ? 12   LEU B CA  1 
ATOM   2978 C C   . LEU B 1 12  ? 53.872  8.804   -35.320 1.00 26.12  ? 12   LEU B C   1 
ATOM   2979 O O   . LEU B 1 12  ? 54.091  7.707   -35.827 1.00 26.06  ? 12   LEU B O   1 
ATOM   2980 C CB  . LEU B 1 12  ? 55.015  10.044  -37.169 1.00 27.46  ? 12   LEU B CB  1 
ATOM   2981 C CG  . LEU B 1 12  ? 55.980  11.166  -37.567 1.00 29.01  ? 12   LEU B CG  1 
ATOM   2982 C CD1 . LEU B 1 12  ? 56.302  11.165  -39.044 1.00 29.83  ? 12   LEU B CD1 1 
ATOM   2983 C CD2 . LEU B 1 12  ? 55.381  12.493  -37.106 1.00 29.97  ? 12   LEU B CD2 1 
ATOM   2984 N N   . LEU B 1 13  ? 52.865  9.057   -34.500 1.00 25.85  ? 13   LEU B N   1 
ATOM   2985 C CA  . LEU B 1 13  ? 51.882  8.038   -34.154 1.00 26.73  ? 13   LEU B CA  1 
ATOM   2986 C C   . LEU B 1 13  ? 50.544  8.250   -34.875 1.00 27.11  ? 13   LEU B C   1 
ATOM   2987 O O   . LEU B 1 13  ? 49.546  8.682   -34.261 1.00 25.17  ? 13   LEU B O   1 
ATOM   2988 C CB  . LEU B 1 13  ? 51.534  8.013   -32.665 1.00 30.81  ? 13   LEU B CB  1 
ATOM   2989 C CG  . LEU B 1 13  ? 52.551  7.618   -31.604 1.00 34.47  ? 13   LEU B CG  1 
ATOM   2990 C CD1 . LEU B 1 13  ? 52.280  8.419   -30.329 1.00 35.09  ? 13   LEU B CD1 1 
ATOM   2991 C CD2 . LEU B 1 13  ? 52.487  6.134   -31.315 1.00 35.41  ? 13   LEU B CD2 1 
ATOM   2992 N N   . PHE B 1 14  ? 50.507  7.936   -36.155 1.00 26.88  ? 14   PHE B N   1 
ATOM   2993 C CA  . PHE B 1 14  ? 49.281  8.084   -36.942 1.00 28.10  ? 14   PHE B CA  1 
ATOM   2994 C C   . PHE B 1 14  ? 48.903  6.773   -37.628 1.00 28.76  ? 14   PHE B C   1 
ATOM   2995 O O   . PHE B 1 14  ? 49.733  6.065   -38.202 1.00 28.77  ? 14   PHE B O   1 
ATOM   2996 C CB  . PHE B 1 14  ? 49.418  9.190   -37.981 1.00 26.75  ? 14   PHE B CB  1 
ATOM   2997 C CG  . PHE B 1 14  ? 49.521  10.575  -37.399 1.00 27.71  ? 14   PHE B CG  1 
ATOM   2998 C CD1 . PHE B 1 14  ? 48.426  11.172  -36.804 1.00 25.55  ? 14   PHE B CD1 1 
ATOM   2999 C CD2 . PHE B 1 14  ? 50.718  11.277  -37.437 1.00 25.85  ? 14   PHE B CD2 1 
ATOM   3000 C CE1 . PHE B 1 14  ? 48.499  12.431  -36.268 1.00 23.26  ? 14   PHE B CE1 1 
ATOM   3001 C CE2 . PHE B 1 14  ? 50.798  12.544  -36.895 1.00 23.61  ? 14   PHE B CE2 1 
ATOM   3002 C CZ  . PHE B 1 14  ? 49.691  13.119  -36.331 1.00 23.31  ? 14   PHE B CZ  1 
ATOM   3003 N N   . SER B 1 15  ? 47.637  6.393   -37.527 1.00 28.86  ? 15   SER B N   1 
ATOM   3004 C CA  . SER B 1 15  ? 47.185  5.185   -38.195 1.00 29.89  ? 15   SER B CA  1 
ATOM   3005 C C   . SER B 1 15  ? 47.415  5.232   -39.702 1.00 30.13  ? 15   SER B C   1 
ATOM   3006 O O   . SER B 1 15  ? 47.225  6.239   -40.371 1.00 29.45  ? 15   SER B O   1 
ATOM   3007 C CB  . SER B 1 15  ? 45.678  5.042   -37.927 1.00 30.66  ? 15   SER B CB  1 
ATOM   3008 O OG  . SER B 1 15  ? 45.529  4.594   -36.591 1.00 34.30  ? 15   SER B OG  1 
ATOM   3009 N N   . GLU B 1 16  ? 47.678  4.076   -40.287 1.00 31.67  ? 16   GLU B N   1 
ATOM   3010 C CA  . GLU B 1 16  ? 47.785  3.922   -41.730 1.00 33.79  ? 16   GLU B CA  1 
ATOM   3011 C C   . GLU B 1 16  ? 46.575  3.155   -42.251 1.00 33.04  ? 16   GLU B C   1 
ATOM   3012 O O   . GLU B 1 16  ? 46.117  3.225   -43.375 1.00 31.95  ? 16   GLU B O   1 
ATOM   3013 C CB  . GLU B 1 16  ? 49.059  3.154   -42.082 1.00 39.12  ? 16   GLU B CB  1 
ATOM   3014 C CG  . GLU B 1 16  ? 49.280  3.012   -43.578 1.00 46.54  ? 16   GLU B CG  1 
ATOM   3015 C CD  . GLU B 1 16  ? 49.293  4.344   -44.306 1.00 49.27  ? 16   GLU B CD  1 
ATOM   3016 O OE1 . GLU B 1 16  ? 49.629  5.383   -43.708 1.00 53.31  ? 16   GLU B OE1 1 
ATOM   3017 O OE2 . GLU B 1 16  ? 48.949  4.298   -45.496 1.00 52.80  ? 16   GLU B OE2 1 
ATOM   3018 N N   . THR B 1 17  ? 46.084  2.314   -41.349 1.00 33.21  ? 17   THR B N   1 
ATOM   3019 C CA  . THR B 1 17  ? 44.936  1.450   -41.529 1.00 32.49  ? 17   THR B CA  1 
ATOM   3020 C C   . THR B 1 17  ? 43.904  1.762   -40.441 1.00 32.73  ? 17   THR B C   1 
ATOM   3021 O O   . THR B 1 17  ? 44.249  2.428   -39.453 1.00 31.63  ? 17   THR B O   1 
ATOM   3022 C CB  . THR B 1 17  ? 45.385  -0.008  -41.367 1.00 34.18  ? 17   THR B CB  1 
ATOM   3023 O OG1 . THR B 1 17  ? 45.895  -0.151  -40.030 1.00 32.94  ? 17   THR B OG1 1 
ATOM   3024 C CG2 . THR B 1 17  ? 46.560  -0.385  -42.279 1.00 33.97  ? 17   THR B CG2 1 
ATOM   3025 N N   . GLY B 1 18  ? 42.665  1.296   -40.611 1.00 30.71  ? 18   GLY B N   1 
ATOM   3026 C CA  . GLY B 1 18  ? 41.619  1.497   -39.641 1.00 29.01  ? 18   GLY B CA  1 
ATOM   3027 C C   . GLY B 1 18  ? 40.636  2.597   -39.992 1.00 28.69  ? 18   GLY B C   1 
ATOM   3028 O O   . GLY B 1 18  ? 40.814  3.355   -40.932 1.00 29.80  ? 18   GLY B O   1 
ATOM   3029 N N   . VAL B 1 19  ? 39.604  2.769   -39.171 1.00 28.13  ? 19   VAL B N   1 
ATOM   3030 C CA  . VAL B 1 19  ? 38.539  3.720   -39.341 1.00 27.19  ? 19   VAL B CA  1 
ATOM   3031 C C   . VAL B 1 19  ? 38.960  5.138   -39.646 1.00 26.64  ? 19   VAL B C   1 
ATOM   3032 O O   . VAL B 1 19  ? 38.249  5.752   -40.455 1.00 24.75  ? 19   VAL B O   1 
ATOM   3033 C CB  . VAL B 1 19  ? 37.531  3.643   -38.171 1.00 28.28  ? 19   VAL B CB  1 
ATOM   3034 C CG1 . VAL B 1 19  ? 38.134  4.100   -36.855 1.00 27.93  ? 19   VAL B CG1 1 
ATOM   3035 C CG2 . VAL B 1 19  ? 36.236  4.388   -38.498 1.00 24.78  ? 19   VAL B CG2 1 
ATOM   3036 N N   . THR B 1 20  ? 40.054  5.671   -39.106 1.00 27.04  ? 20   THR B N   1 
ATOM   3037 C CA  . THR B 1 20  ? 40.383  7.071   -39.392 1.00 27.44  ? 20   THR B CA  1 
ATOM   3038 C C   . THR B 1 20  ? 41.660  7.173   -40.207 1.00 27.88  ? 20   THR B C   1 
ATOM   3039 O O   . THR B 1 20  ? 42.315  8.217   -40.203 1.00 29.15  ? 20   THR B O   1 
ATOM   3040 C CB  . THR B 1 20  ? 40.542  7.922   -38.110 1.00 28.55  ? 20   THR B CB  1 
ATOM   3041 O OG1 . THR B 1 20  ? 41.420  7.234   -37.193 1.00 25.72  ? 20   THR B OG1 1 
ATOM   3042 C CG2 . THR B 1 20  ? 39.221  8.178   -37.409 1.00 23.47  ? 20   THR B CG2 1 
ATOM   3043 N N   . ALA B 1 21  ? 42.016  6.114   -40.910 1.00 28.19  ? 21   ALA B N   1 
ATOM   3044 C CA  . ALA B 1 21  ? 43.210  6.032   -41.739 1.00 28.93  ? 21   ALA B CA  1 
ATOM   3045 C C   . ALA B 1 21  ? 43.407  7.173   -42.724 1.00 29.62  ? 21   ALA B C   1 
ATOM   3046 O O   . ALA B 1 21  ? 44.548  7.621   -42.893 1.00 30.30  ? 21   ALA B O   1 
ATOM   3047 C CB  . ALA B 1 21  ? 43.187  4.748   -42.567 1.00 28.88  ? 21   ALA B CB  1 
ATOM   3048 N N   . ASP B 1 22  ? 42.349  7.638   -43.359 1.00 29.11  ? 22   ASP B N   1 
ATOM   3049 C CA  . ASP B 1 22  ? 42.470  8.740   -44.287 1.00 30.32  ? 22   ASP B CA  1 
ATOM   3050 C C   . ASP B 1 22  ? 42.943  10.025  -43.632 1.00 31.00  ? 22   ASP B C   1 
ATOM   3051 O O   . ASP B 1 22  ? 43.983  10.516  -44.082 1.00 32.31  ? 22   ASP B O   1 
ATOM   3052 C CB  . ASP B 1 22  ? 41.141  8.987   -45.003 1.00 31.05  ? 22   ASP B CB  1 
ATOM   3053 C CG  . ASP B 1 22  ? 40.939  7.922   -46.068 1.00 35.29  ? 22   ASP B CG  1 
ATOM   3054 O OD1 . ASP B 1 22  ? 41.888  7.638   -46.826 1.00 38.05  ? 22   ASP B OD1 1 
ATOM   3055 O OD2 . ASP B 1 22  ? 39.819  7.383   -46.106 1.00 37.64  ? 22   ASP B OD2 1 
ATOM   3056 N N   . ILE B 1 23  ? 42.239  10.586  -42.653 1.00 29.66  ? 23   ILE B N   1 
ATOM   3057 C CA  . ILE B 1 23  ? 42.691  11.805  -42.010 1.00 29.71  ? 23   ILE B CA  1 
ATOM   3058 C C   . ILE B 1 23  ? 44.064  11.605  -41.348 1.00 28.32  ? 23   ILE B C   1 
ATOM   3059 O O   . ILE B 1 23  ? 44.856  12.556  -41.389 1.00 27.44  ? 23   ILE B O   1 
ATOM   3060 C CB  . ILE B 1 23  ? 41.711  12.354  -40.960 1.00 31.47  ? 23   ILE B CB  1 
ATOM   3061 C CG1 . ILE B 1 23  ? 40.491  12.986  -41.625 1.00 30.46  ? 23   ILE B CG1 1 
ATOM   3062 C CG2 . ILE B 1 23  ? 42.358  13.431  -40.079 1.00 32.20  ? 23   ILE B CG2 1 
ATOM   3063 C CD1 . ILE B 1 23  ? 39.284  13.162  -40.721 1.00 28.12  ? 23   ILE B CD1 1 
ATOM   3064 N N   . GLU B 1 24  ? 44.338  10.452  -40.731 1.00 27.14  ? 24   GLU B N   1 
ATOM   3065 C CA  . GLU B 1 24  ? 45.636  10.312  -40.072 1.00 28.36  ? 24   GLU B CA  1 
ATOM   3066 C C   . GLU B 1 24  ? 46.803  10.127  -41.031 1.00 28.96  ? 24   GLU B C   1 
ATOM   3067 O O   . GLU B 1 24  ? 47.929  10.411  -40.626 1.00 28.91  ? 24   GLU B O   1 
ATOM   3068 C CB  . GLU B 1 24  ? 45.691  9.153   -39.070 1.00 26.63  ? 24   GLU B CB  1 
ATOM   3069 C CG  . GLU B 1 24  ? 44.783  9.462   -37.883 1.00 27.18  ? 24   GLU B CG  1 
ATOM   3070 C CD  . GLU B 1 24  ? 44.781  8.255   -36.965 1.00 27.76  ? 24   GLU B CD  1 
ATOM   3071 O OE1 . GLU B 1 24  ? 45.715  8.118   -36.161 1.00 26.65  ? 24   GLU B OE1 1 
ATOM   3072 O OE2 . GLU B 1 24  ? 43.826  7.482   -37.151 1.00 31.03  ? 24   GLU B OE2 1 
ATOM   3073 N N   . ARG B 1 25  ? 46.548  9.678   -42.252 1.00 29.44  ? 25   ARG B N   1 
ATOM   3074 C CA  . ARG B 1 25  ? 47.640  9.530   -43.235 1.00 29.81  ? 25   ARG B CA  1 
ATOM   3075 C C   . ARG B 1 25  ? 47.933  10.965  -43.653 1.00 29.03  ? 25   ARG B C   1 
ATOM   3076 O O   . ARG B 1 25  ? 49.049  11.469  -43.783 1.00 28.54  ? 25   ARG B O   1 
ATOM   3077 C CB  . ARG B 1 25  ? 47.164  8.614   -44.353 1.00 32.76  ? 25   ARG B CB  1 
ATOM   3078 C CG  . ARG B 1 25  ? 48.150  8.325   -45.460 1.00 39.20  ? 25   ARG B CG  1 
ATOM   3079 C CD  . ARG B 1 25  ? 47.584  7.468   -46.604 1.00 41.50  ? 25   ARG B CD  1 
ATOM   3080 N NE  . ARG B 1 25  ? 46.983  6.251   -46.097 1.00 42.04  ? 25   ARG B NE  1 
ATOM   3081 C CZ  . ARG B 1 25  ? 45.689  5.970   -46.128 1.00 45.65  ? 25   ARG B CZ  1 
ATOM   3082 N NH1 . ARG B 1 25  ? 44.764  6.759   -46.677 1.00 44.85  ? 25   ARG B NH1 1 
ATOM   3083 N NH2 . ARG B 1 25  ? 45.296  4.816   -45.585 1.00 47.08  ? 25   ARG B NH2 1 
ATOM   3084 N N   . SER B 1 26  ? 46.828  11.722  -43.746 1.00 27.74  ? 26   SER B N   1 
ATOM   3085 C CA  . SER B 1 26  ? 46.894  13.146  -44.045 1.00 27.99  ? 26   SER B CA  1 
ATOM   3086 C C   . SER B 1 26  ? 47.743  13.873  -42.995 1.00 28.27  ? 26   SER B C   1 
ATOM   3087 O O   . SER B 1 26  ? 48.560  14.739  -43.366 1.00 26.47  ? 26   SER B O   1 
ATOM   3088 C CB  . SER B 1 26  ? 45.470  13.682  -44.068 1.00 25.99  ? 26   SER B CB  1 
ATOM   3089 O OG  . SER B 1 26  ? 45.478  15.069  -44.328 1.00 29.91  ? 26   SER B OG  1 
ATOM   3090 N N   . GLN B 1 27  ? 47.574  13.492  -41.706 1.00 26.10  ? 27   GLN B N   1 
ATOM   3091 C CA  . GLN B 1 27  ? 48.386  14.140  -40.669 1.00 26.12  ? 27   GLN B CA  1 
ATOM   3092 C C   . GLN B 1 27  ? 49.854  13.733  -40.790 1.00 25.77  ? 27   GLN B C   1 
ATOM   3093 O O   . GLN B 1 27  ? 50.799  14.525  -40.636 1.00 23.99  ? 27   GLN B O   1 
ATOM   3094 C CB  . GLN B 1 27  ? 47.857  13.868  -39.252 1.00 24.08  ? 27   GLN B CB  1 
ATOM   3095 C CG  . GLN B 1 27  ? 46.425  14.294  -38.995 1.00 23.62  ? 27   GLN B CG  1 
ATOM   3096 C CD  . GLN B 1 27  ? 45.793  13.906  -37.680 1.00 23.45  ? 27   GLN B CD  1 
ATOM   3097 O OE1 . GLN B 1 27  ? 45.481  12.746  -37.409 1.00 21.58  ? 27   GLN B OE1 1 
ATOM   3098 N NE2 . GLN B 1 27  ? 45.637  14.887  -36.790 1.00 23.87  ? 27   GLN B NE2 1 
ATOM   3099 N N   . ARG B 1 28  ? 50.077  12.462  -41.127 1.00 25.32  ? 28   ARG B N   1 
ATOM   3100 C CA  . ARG B 1 28  ? 51.438  11.947  -41.235 1.00 24.97  ? 28   ARG B CA  1 
ATOM   3101 C C   . ARG B 1 28  ? 52.240  12.699  -42.292 1.00 25.45  ? 28   ARG B C   1 
ATOM   3102 O O   . ARG B 1 28  ? 53.372  13.061  -42.012 1.00 22.55  ? 28   ARG B O   1 
ATOM   3103 C CB  . ARG B 1 28  ? 51.495  10.437  -41.460 1.00 23.20  ? 28   ARG B CB  1 
ATOM   3104 C CG  . ARG B 1 28  ? 52.963  10.006  -41.571 1.00 28.17  ? 28   ARG B CG  1 
ATOM   3105 C CD  . ARG B 1 28  ? 53.121  8.530   -41.199 1.00 31.11  ? 28   ARG B CD  1 
ATOM   3106 N NE  . ARG B 1 28  ? 52.285  7.840   -42.173 1.00 38.12  ? 28   ARG B NE  1 
ATOM   3107 C CZ  . ARG B 1 28  ? 52.692  7.356   -43.341 1.00 40.25  ? 28   ARG B CZ  1 
ATOM   3108 N NH1 . ARG B 1 28  ? 53.973  7.435   -43.700 1.00 40.11  ? 28   ARG B NH1 1 
ATOM   3109 N NH2 . ARG B 1 28  ? 51.743  6.783   -44.068 1.00 38.47  ? 28   ARG B NH2 1 
ATOM   3110 N N   . TYR B 1 29  ? 51.655  12.900  -43.477 1.00 26.55  ? 29   TYR B N   1 
ATOM   3111 C CA  . TYR B 1 29  ? 52.303  13.590  -44.573 1.00 27.71  ? 29   TYR B CA  1 
ATOM   3112 C C   . TYR B 1 29  ? 52.456  15.054  -44.248 1.00 28.41  ? 29   TYR B C   1 
ATOM   3113 O O   . TYR B 1 29  ? 53.486  15.670  -44.602 1.00 29.65  ? 29   TYR B O   1 
ATOM   3114 C CB  . TYR B 1 29  ? 51.610  13.332  -45.947 1.00 29.07  ? 29   TYR B CB  1 
ATOM   3115 C CG  . TYR B 1 29  ? 52.012  11.915  -46.356 1.00 31.76  ? 29   TYR B CG  1 
ATOM   3116 C CD1 . TYR B 1 29  ? 53.229  11.663  -46.971 1.00 33.18  ? 29   TYR B CD1 1 
ATOM   3117 C CD2 . TYR B 1 29  ? 51.194  10.838  -46.086 1.00 33.46  ? 29   TYR B CD2 1 
ATOM   3118 C CE1 . TYR B 1 29  ? 53.631  10.382  -47.303 1.00 34.31  ? 29   TYR B CE1 1 
ATOM   3119 C CE2 . TYR B 1 29  ? 51.552  9.546   -46.407 1.00 35.70  ? 29   TYR B CE2 1 
ATOM   3120 C CZ  . TYR B 1 29  ? 52.783  9.335   -47.009 1.00 38.31  ? 29   TYR B CZ  1 
ATOM   3121 O OH  . TYR B 1 29  ? 53.115  8.035   -47.330 1.00 42.82  ? 29   TYR B OH  1 
ATOM   3122 N N   . GLY B 1 30  ? 51.502  15.665  -43.539 1.00 27.65  ? 30   GLY B N   1 
ATOM   3123 C CA  . GLY B 1 30  ? 51.688  17.068  -43.158 1.00 26.84  ? 30   GLY B CA  1 
ATOM   3124 C C   . GLY B 1 30  ? 52.935  17.181  -42.270 1.00 28.59  ? 30   GLY B C   1 
ATOM   3125 O O   . GLY B 1 30  ? 53.715  18.146  -42.334 1.00 28.25  ? 30   GLY B O   1 
ATOM   3126 N N   . ALA B 1 31  ? 53.115  16.221  -41.362 1.00 28.24  ? 31   ALA B N   1 
ATOM   3127 C CA  . ALA B 1 31  ? 54.234  16.239  -40.424 1.00 28.85  ? 31   ALA B CA  1 
ATOM   3128 C C   . ALA B 1 31  ? 55.543  15.966  -41.165 1.00 29.37  ? 31   ALA B C   1 
ATOM   3129 O O   . ALA B 1 31  ? 56.587  16.565  -40.908 1.00 29.74  ? 31   ALA B O   1 
ATOM   3130 C CB  . ALA B 1 31  ? 54.027  15.223  -39.307 1.00 22.72  ? 31   ALA B CB  1 
ATOM   3131 N N   . LEU B 1 32  ? 55.509  15.054  -42.123 1.00 30.03  ? 32   LEU B N   1 
ATOM   3132 C CA  . LEU B 1 32  ? 56.656  14.710  -42.951 1.00 30.09  ? 32   LEU B CA  1 
ATOM   3133 C C   . LEU B 1 32  ? 57.045  15.892  -43.833 1.00 30.78  ? 32   LEU B C   1 
ATOM   3134 O O   . LEU B 1 32  ? 58.255  16.124  -44.038 1.00 30.93  ? 32   LEU B O   1 
ATOM   3135 C CB  . LEU B 1 32  ? 56.375  13.468  -43.800 1.00 25.60  ? 32   LEU B CB  1 
ATOM   3136 C CG  . LEU B 1 32  ? 56.363  12.212  -42.915 1.00 25.86  ? 32   LEU B CG  1 
ATOM   3137 C CD1 . LEU B 1 32  ? 55.828  11.021  -43.688 1.00 27.81  ? 32   LEU B CD1 1 
ATOM   3138 C CD2 . LEU B 1 32  ? 57.767  11.938  -42.378 1.00 23.13  ? 32   LEU B CD2 1 
ATOM   3139 N N   . LEU B 1 33  ? 56.024  16.610  -44.306 1.00 29.83  ? 33   LEU B N   1 
ATOM   3140 C CA  . LEU B 1 33  ? 56.270  17.796  -45.115 1.00 29.51  ? 33   LEU B CA  1 
ATOM   3141 C C   . LEU B 1 33  ? 57.091  18.784  -44.288 1.00 29.95  ? 33   LEU B C   1 
ATOM   3142 O O   . LEU B 1 33  ? 58.060  19.341  -44.793 1.00 31.21  ? 33   LEU B O   1 
ATOM   3143 C CB  . LEU B 1 33  ? 55.015  18.541  -45.513 1.00 30.83  ? 33   LEU B CB  1 
ATOM   3144 C CG  . LEU B 1 33  ? 54.835  19.214  -46.862 1.00 33.11  ? 33   LEU B CG  1 
ATOM   3145 C CD1 . LEU B 1 33  ? 54.044  20.509  -46.744 1.00 32.58  ? 33   LEU B CD1 1 
ATOM   3146 C CD2 . LEU B 1 33  ? 56.140  19.505  -47.587 1.00 33.36  ? 33   LEU B CD2 1 
ATOM   3147 N N   . ALA B 1 34  ? 56.686  19.018  -43.044 1.00 29.35  ? 34   ALA B N   1 
ATOM   3148 C CA  . ALA B 1 34  ? 57.415  19.916  -42.160 1.00 29.85  ? 34   ALA B CA  1 
ATOM   3149 C C   . ALA B 1 34  ? 58.859  19.470  -41.929 1.00 28.68  ? 34   ALA B C   1 
ATOM   3150 O O   . ALA B 1 34  ? 59.759  20.301  -41.964 1.00 27.89  ? 34   ALA B O   1 
ATOM   3151 C CB  . ALA B 1 34  ? 56.741  20.062  -40.797 1.00 25.84  ? 34   ALA B CB  1 
ATOM   3152 N N   . VAL B 1 35  ? 59.095  18.193  -41.723 1.00 29.35  ? 35   VAL B N   1 
ATOM   3153 C CA  . VAL B 1 35  ? 60.425  17.671  -41.404 1.00 31.59  ? 35   VAL B CA  1 
ATOM   3154 C C   . VAL B 1 35  ? 61.430  17.990  -42.502 1.00 32.70  ? 35   VAL B C   1 
ATOM   3155 O O   . VAL B 1 35  ? 62.558  18.454  -42.310 1.00 31.28  ? 35   VAL B O   1 
ATOM   3156 C CB  . VAL B 1 35  ? 60.403  16.182  -41.036 1.00 30.74  ? 35   VAL B CB  1 
ATOM   3157 C CG1 . VAL B 1 35  ? 61.804  15.570  -41.061 1.00 31.31  ? 35   VAL B CG1 1 
ATOM   3158 C CG2 . VAL B 1 35  ? 59.819  15.986  -39.637 1.00 28.50  ? 35   VAL B CG2 1 
ATOM   3159 N N   . GLU B 1 36  ? 60.954  17.747  -43.705 1.00 34.00  ? 36   GLU B N   1 
ATOM   3160 C CA  . GLU B 1 36  ? 61.622  18.005  -44.968 1.00 35.03  ? 36   GLU B CA  1 
ATOM   3161 C C   . GLU B 1 36  ? 61.973  19.481  -45.083 1.00 34.42  ? 36   GLU B C   1 
ATOM   3162 O O   . GLU B 1 36  ? 63.098  19.857  -45.423 1.00 34.59  ? 36   GLU B O   1 
ATOM   3163 C CB  . GLU B 1 36  ? 60.607  17.587  -46.028 1.00 37.29  ? 36   GLU B CB  1 
ATOM   3164 C CG  . GLU B 1 36  ? 61.026  17.622  -47.460 1.00 42.60  ? 36   GLU B CG  1 
ATOM   3165 C CD  . GLU B 1 36  ? 61.476  16.285  -48.012 1.00 45.38  ? 36   GLU B CD  1 
ATOM   3166 O OE1 . GLU B 1 36  ? 62.354  15.662  -47.376 1.00 45.64  ? 36   GLU B OE1 1 
ATOM   3167 O OE2 . GLU B 1 36  ? 60.939  15.933  -49.094 1.00 45.11  ? 36   GLU B OE2 1 
ATOM   3168 N N   . GLN B 1 37  ? 61.026  20.351  -44.757 1.00 34.43  ? 37   GLN B N   1 
ATOM   3169 C CA  . GLN B 1 37  ? 61.272  21.789  -44.818 1.00 35.15  ? 37   GLN B CA  1 
ATOM   3170 C C   . GLN B 1 37  ? 62.264  22.193  -43.740 1.00 36.08  ? 37   GLN B C   1 
ATOM   3171 O O   . GLN B 1 37  ? 63.181  22.967  -44.019 1.00 37.01  ? 37   GLN B O   1 
ATOM   3172 C CB  . GLN B 1 37  ? 59.970  22.567  -44.735 1.00 34.11  ? 37   GLN B CB  1 
ATOM   3173 C CG  . GLN B 1 37  ? 60.099  24.077  -44.643 1.00 30.35  ? 37   GLN B CG  1 
ATOM   3174 C CD  . GLN B 1 37  ? 58.739  24.751  -44.586 1.00 31.24  ? 37   GLN B CD  1 
ATOM   3175 O OE1 . GLN B 1 37  ? 57.703  24.155  -44.936 1.00 29.21  ? 37   GLN B OE1 1 
ATOM   3176 N NE2 . GLN B 1 37  ? 58.767  26.008  -44.135 1.00 28.75  ? 37   GLN B NE2 1 
ATOM   3177 N N   . LEU B 1 38  ? 62.144  21.666  -42.531 1.00 36.26  ? 38   LEU B N   1 
ATOM   3178 C CA  . LEU B 1 38  ? 63.079  21.920  -41.456 1.00 37.29  ? 38   LEU B CA  1 
ATOM   3179 C C   . LEU B 1 38  ? 64.488  21.439  -41.832 1.00 38.79  ? 38   LEU B C   1 
ATOM   3180 O O   . LEU B 1 38  ? 65.474  22.112  -41.540 1.00 37.99  ? 38   LEU B O   1 
ATOM   3181 C CB  . LEU B 1 38  ? 62.663  21.200  -40.170 1.00 37.34  ? 38   LEU B CB  1 
ATOM   3182 C CG  . LEU B 1 38  ? 61.324  21.583  -39.530 1.00 37.44  ? 38   LEU B CG  1 
ATOM   3183 C CD1 . LEU B 1 38  ? 60.923  20.561  -38.479 1.00 34.62  ? 38   LEU B CD1 1 
ATOM   3184 C CD2 . LEU B 1 38  ? 61.434  22.999  -38.967 1.00 35.96  ? 38   LEU B CD2 1 
ATOM   3185 N N   . ASN B 1 39  ? 64.611  20.301  -42.508 1.00 39.32  ? 39   ASN B N   1 
ATOM   3186 C CA  . ASN B 1 39  ? 65.900  19.780  -42.926 1.00 41.26  ? 39   ASN B CA  1 
ATOM   3187 C C   . ASN B 1 39  ? 66.540  20.646  -44.009 1.00 44.05  ? 39   ASN B C   1 
ATOM   3188 O O   . ASN B 1 39  ? 67.769  20.749  -44.024 1.00 43.01  ? 39   ASN B O   1 
ATOM   3189 C CB  . ASN B 1 39  ? 65.796  18.308  -43.282 1.00 33.26  ? 39   ASN B CB  1 
ATOM   3190 C CG  . ASN B 1 39  ? 65.782  17.503  -41.997 1.00 33.72  ? 39   ASN B CG  1 
ATOM   3191 O OD1 . ASN B 1 39  ? 66.124  18.079  -40.959 1.00 32.15  ? 39   ASN B OD1 1 
ATOM   3192 N ND2 . ASN B 1 39  ? 65.418  16.225  -42.023 1.00 32.15  ? 39   ASN B ND2 1 
ATOM   3193 N N   . ARG B 1 40  ? 65.750  21.399  -44.776 1.00 46.32  ? 40   ARG B N   1 
ATOM   3194 C CA  . ARG B 1 40  ? 66.293  22.339  -45.745 1.00 49.22  ? 40   ARG B CA  1 
ATOM   3195 C C   . ARG B 1 40  ? 66.664  23.651  -45.049 1.00 50.90  ? 40   ARG B C   1 
ATOM   3196 O O   . ARG B 1 40  ? 67.403  24.480  -45.582 1.00 51.43  ? 40   ARG B O   1 
ATOM   3197 C CB  . ARG B 1 40  ? 65.344  22.638  -46.897 1.00 49.26  ? 40   ARG B CB  1 
ATOM   3198 C CG  . ARG B 1 40  ? 64.983  21.490  -47.822 1.00 49.94  ? 40   ARG B CG  1 
ATOM   3199 C CD  . ARG B 1 40  ? 64.161  21.995  -49.000 1.00 50.75  ? 40   ARG B CD  1 
ATOM   3200 N NE  . ARG B 1 40  ? 63.016  22.811  -48.610 1.00 52.29  ? 40   ARG B NE  1 
ATOM   3201 C CZ  . ARG B 1 40  ? 61.754  22.389  -48.479 1.00 51.86  ? 40   ARG B CZ  1 
ATOM   3202 N NH1 . ARG B 1 40  ? 61.483  21.113  -48.737 1.00 47.79  ? 40   ARG B NH1 1 
ATOM   3203 N NH2 . ARG B 1 40  ? 60.777  23.220  -48.111 1.00 50.40  ? 40   ARG B NH2 1 
ATOM   3204 N N   . GLU B 1 41  ? 66.195  23.873  -43.827 1.00 52.67  ? 41   GLU B N   1 
ATOM   3205 C CA  . GLU B 1 41  ? 66.499  25.070  -43.062 1.00 54.27  ? 41   GLU B CA  1 
ATOM   3206 C C   . GLU B 1 41  ? 67.648  24.864  -42.079 1.00 56.01  ? 41   GLU B C   1 
ATOM   3207 O O   . GLU B 1 41  ? 67.938  25.747  -41.271 1.00 55.68  ? 41   GLU B O   1 
ATOM   3208 C CB  . GLU B 1 41  ? 65.253  25.590  -42.333 1.00 52.14  ? 41   GLU B CB  1 
ATOM   3209 C CG  . GLU B 1 41  ? 64.066  25.807  -43.253 1.00 50.97  ? 41   GLU B CG  1 
ATOM   3210 C CD  . GLU B 1 41  ? 62.779  26.170  -42.550 1.00 50.01  ? 41   GLU B CD  1 
ATOM   3211 O OE1 . GLU B 1 41  ? 62.688  25.960  -41.320 1.00 49.15  ? 41   GLU B OE1 1 
ATOM   3212 O OE2 . GLU B 1 41  ? 61.820  26.695  -43.160 1.00 49.59  ? 41   GLU B OE2 1 
ATOM   3213 N N   . GLY B 1 42  ? 68.344  23.737  -42.137 1.00 57.77  ? 42   GLY B N   1 
ATOM   3214 C CA  . GLY B 1 42  ? 69.507  23.489  -41.307 1.00 60.10  ? 42   GLY B CA  1 
ATOM   3215 C C   . GLY B 1 42  ? 69.330  22.407  -40.262 1.00 61.53  ? 42   GLY B C   1 
ATOM   3216 O O   . GLY B 1 42  ? 70.171  22.220  -39.377 1.00 61.31  ? 42   GLY B O   1 
ATOM   3217 N N   . GLY B 1 43  ? 68.231  21.664  -40.359 1.00 62.92  ? 43   GLY B N   1 
ATOM   3218 C CA  . GLY B 1 43  ? 67.952  20.614  -39.378 1.00 64.49  ? 43   GLY B CA  1 
ATOM   3219 C C   . GLY B 1 43  ? 68.070  21.212  -37.975 1.00 65.89  ? 43   GLY B C   1 
ATOM   3220 O O   . GLY B 1 43  ? 67.782  22.381  -37.724 1.00 65.38  ? 43   GLY B O   1 
ATOM   3221 N N   . VAL B 1 44  ? 68.526  20.383  -37.039 1.00 66.84  ? 44   VAL B N   1 
ATOM   3222 C CA  . VAL B 1 44  ? 68.663  20.796  -35.651 1.00 67.74  ? 44   VAL B CA  1 
ATOM   3223 C C   . VAL B 1 44  ? 70.137  20.844  -35.253 1.00 67.83  ? 44   VAL B C   1 
ATOM   3224 O O   . VAL B 1 44  ? 70.731  19.908  -34.732 1.00 67.64  ? 44   VAL B O   1 
ATOM   3225 C CB  . VAL B 1 44  ? 67.857  19.937  -34.663 1.00 68.33  ? 44   VAL B CB  1 
ATOM   3226 C CG1 . VAL B 1 44  ? 68.154  20.333  -33.216 1.00 69.13  ? 44   VAL B CG1 1 
ATOM   3227 C CG2 . VAL B 1 44  ? 66.357  20.048  -34.882 1.00 67.10  ? 44   VAL B CG2 1 
ATOM   3228 N N   . GLY B 1 45  ? 70.731  22.007  -35.518 1.00 67.90  ? 45   GLY B N   1 
ATOM   3229 C CA  . GLY B 1 45  ? 72.126  22.249  -35.175 1.00 67.68  ? 45   GLY B CA  1 
ATOM   3230 C C   . GLY B 1 45  ? 73.071  21.484  -36.081 1.00 66.90  ? 45   GLY B C   1 
ATOM   3231 O O   . GLY B 1 45  ? 74.060  20.926  -35.608 1.00 67.65  ? 45   GLY B O   1 
ATOM   3232 N N   . GLY B 1 46  ? 72.748  21.424  -37.372 1.00 66.09  ? 46   GLY B N   1 
ATOM   3233 C CA  . GLY B 1 46  ? 73.572  20.687  -38.324 1.00 63.90  ? 46   GLY B CA  1 
ATOM   3234 C C   . GLY B 1 46  ? 73.093  19.253  -38.522 1.00 61.85  ? 46   GLY B C   1 
ATOM   3235 O O   . GLY B 1 46  ? 73.287  18.704  -39.609 1.00 62.40  ? 46   GLY B O   1 
ATOM   3236 N N   . ARG B 1 47  ? 72.494  18.638  -37.514 1.00 59.05  ? 47   ARG B N   1 
ATOM   3237 C CA  . ARG B 1 47  ? 71.966  17.290  -37.617 1.00 56.20  ? 47   ARG B CA  1 
ATOM   3238 C C   . ARG B 1 47  ? 70.546  17.287  -38.177 1.00 52.86  ? 47   ARG B C   1 
ATOM   3239 O O   . ARG B 1 47  ? 69.674  18.042  -37.750 1.00 52.34  ? 47   ARG B O   1 
ATOM   3240 C CB  . ARG B 1 47  ? 71.991  16.600  -36.256 1.00 59.23  ? 47   ARG B CB  1 
ATOM   3241 C CG  . ARG B 1 47  ? 72.987  15.462  -36.139 1.00 64.01  ? 47   ARG B CG  1 
ATOM   3242 C CD  . ARG B 1 47  ? 72.747  14.647  -34.887 1.00 65.40  ? 47   ARG B CD  1 
ATOM   3243 N NE  . ARG B 1 47  ? 72.690  13.219  -35.022 1.00 67.47  ? 47   ARG B NE  1 
ATOM   3244 C CZ  . ARG B 1 47  ? 72.363  12.369  -35.978 1.00 67.81  ? 47   ARG B CZ  1 
ATOM   3245 N NH1 . ARG B 1 47  ? 72.032  12.725  -37.209 1.00 67.33  ? 47   ARG B NH1 1 
ATOM   3246 N NH2 . ARG B 1 47  ? 72.397  11.069  -35.686 1.00 67.08  ? 47   ARG B NH2 1 
ATOM   3247 N N   . PRO B 1 48  ? 70.313  16.431  -39.159 1.00 49.96  ? 48   PRO B N   1 
ATOM   3248 C CA  . PRO B 1 48  ? 69.011  16.329  -39.801 1.00 47.49  ? 48   PRO B CA  1 
ATOM   3249 C C   . PRO B 1 48  ? 67.943  15.758  -38.879 1.00 44.28  ? 48   PRO B C   1 
ATOM   3250 O O   . PRO B 1 48  ? 68.263  14.966  -37.998 1.00 42.38  ? 48   PRO B O   1 
ATOM   3251 C CB  . PRO B 1 48  ? 69.263  15.429  -40.995 1.00 48.32  ? 48   PRO B CB  1 
ATOM   3252 C CG  . PRO B 1 48  ? 70.540  14.732  -40.762 1.00 48.51  ? 48   PRO B CG  1 
ATOM   3253 C CD  . PRO B 1 48  ? 71.316  15.516  -39.744 1.00 49.22  ? 48   PRO B CD  1 
ATOM   3254 N N   . ILE B 1 49  ? 66.698  16.195  -39.054 1.00 40.83  ? 49   ILE B N   1 
ATOM   3255 C CA  . ILE B 1 49  ? 65.627  15.684  -38.189 1.00 37.58  ? 49   ILE B CA  1 
ATOM   3256 C C   . ILE B 1 49  ? 65.163  14.388  -38.845 1.00 36.78  ? 49   ILE B C   1 
ATOM   3257 O O   . ILE B 1 49  ? 64.971  14.345  -40.062 1.00 36.18  ? 49   ILE B O   1 
ATOM   3258 C CB  . ILE B 1 49  ? 64.482  16.692  -38.001 1.00 34.36  ? 49   ILE B CB  1 
ATOM   3259 C CG1 . ILE B 1 49  ? 64.985  17.962  -37.315 1.00 30.91  ? 49   ILE B CG1 1 
ATOM   3260 C CG2 . ILE B 1 49  ? 63.312  16.095  -37.226 1.00 33.84  ? 49   ILE B CG2 1 
ATOM   3261 C CD1 . ILE B 1 49  ? 64.172  19.219  -37.501 1.00 26.37  ? 49   ILE B CD1 1 
ATOM   3262 N N   . GLU B 1 50  ? 65.112  13.324  -38.061 1.00 35.41  ? 50   GLU B N   1 
ATOM   3263 C CA  . GLU B 1 50  ? 64.672  12.011  -38.487 1.00 34.41  ? 50   GLU B CA  1 
ATOM   3264 C C   . GLU B 1 50  ? 63.269  11.761  -37.926 1.00 34.51  ? 50   GLU B C   1 
ATOM   3265 O O   . GLU B 1 50  ? 62.825  12.432  -36.989 1.00 33.63  ? 50   GLU B O   1 
ATOM   3266 C CB  . GLU B 1 50  ? 65.614  10.916  -37.975 1.00 32.92  ? 50   GLU B CB  1 
ATOM   3267 C CG  . GLU B 1 50  ? 66.974  10.860  -38.654 1.00 33.52  ? 50   GLU B CG  1 
ATOM   3268 C CD  . GLU B 1 50  ? 67.832  9.689   -38.221 1.00 32.56  ? 50   GLU B CD  1 
ATOM   3269 O OE1 . GLU B 1 50  ? 67.358  8.529   -38.324 1.00 33.11  ? 50   GLU B OE1 1 
ATOM   3270 O OE2 . GLU B 1 50  ? 68.974  9.912   -37.751 1.00 28.54  ? 50   GLU B OE2 1 
ATOM   3271 N N   . THR B 1 51  ? 62.550  10.796  -38.479 1.00 34.02  ? 51   THR B N   1 
ATOM   3272 C CA  . THR B 1 51  ? 61.221  10.444  -38.054 1.00 33.80  ? 51   THR B CA  1 
ATOM   3273 C C   . THR B 1 51  ? 61.129  8.915   -38.024 1.00 35.16  ? 51   THR B C   1 
ATOM   3274 O O   . THR B 1 51  ? 61.822  8.199   -38.738 1.00 35.35  ? 51   THR B O   1 
ATOM   3275 C CB  . THR B 1 51  ? 60.041  10.895  -38.937 1.00 33.76  ? 51   THR B CB  1 
ATOM   3276 O OG1 . THR B 1 51  ? 60.142  10.197  -40.199 1.00 30.68  ? 51   THR B OG1 1 
ATOM   3277 C CG2 . THR B 1 51  ? 59.932  12.397  -39.140 1.00 31.36  ? 51   THR B CG2 1 
ATOM   3278 N N   . LEU B 1 52  ? 60.216  8.456   -37.194 1.00 35.36  ? 52   LEU B N   1 
ATOM   3279 C CA  . LEU B 1 52  ? 59.945  7.026   -37.037 1.00 35.87  ? 52   LEU B CA  1 
ATOM   3280 C C   . LEU B 1 52  ? 58.425  6.911   -36.997 1.00 35.67  ? 52   LEU B C   1 
ATOM   3281 O O   . LEU B 1 52  ? 57.790  7.687   -36.274 1.00 35.13  ? 52   LEU B O   1 
ATOM   3282 C CB  . LEU B 1 52  ? 60.679  6.561   -35.799 1.00 39.05  ? 52   LEU B CB  1 
ATOM   3283 C CG  . LEU B 1 52  ? 60.502  5.203   -35.162 1.00 42.80  ? 52   LEU B CG  1 
ATOM   3284 C CD1 . LEU B 1 52  ? 60.144  4.074   -36.115 1.00 43.22  ? 52   LEU B CD1 1 
ATOM   3285 C CD2 . LEU B 1 52  ? 61.799  4.848   -34.416 1.00 46.05  ? 52   LEU B CD2 1 
ATOM   3286 N N   . SER B 1 53  ? 57.845  6.052   -37.808 1.00 34.87  ? 53   SER B N   1 
ATOM   3287 C CA  . SER B 1 53  ? 56.418  5.842   -37.912 1.00 33.99  ? 53   SER B CA  1 
ATOM   3288 C C   . SER B 1 53  ? 56.000  4.395   -37.654 1.00 33.94  ? 53   SER B C   1 
ATOM   3289 O O   . SER B 1 53  ? 56.677  3.469   -38.078 1.00 33.20  ? 53   SER B O   1 
ATOM   3290 C CB  . SER B 1 53  ? 55.893  6.075   -39.337 1.00 33.27  ? 53   SER B CB  1 
ATOM   3291 O OG  . SER B 1 53  ? 55.604  7.428   -39.563 1.00 36.31  ? 53   SER B OG  1 
ATOM   3292 N N   . GLN B 1 54  ? 54.865  4.246   -36.999 1.00 34.04  ? 54   GLN B N   1 
ATOM   3293 C CA  . GLN B 1 54  ? 54.312  2.913   -36.752 1.00 35.33  ? 54   GLN B CA  1 
ATOM   3294 C C   . GLN B 1 54  ? 52.804  3.039   -36.994 1.00 34.54  ? 54   GLN B C   1 
ATOM   3295 O O   . GLN B 1 54  ? 52.293  4.150   -36.808 1.00 34.95  ? 54   GLN B O   1 
ATOM   3296 C CB  . GLN B 1 54  ? 54.643  2.455   -35.352 1.00 41.09  ? 54   GLN B CB  1 
ATOM   3297 C CG  . GLN B 1 54  ? 55.386  1.128   -35.257 1.00 46.17  ? 54   GLN B CG  1 
ATOM   3298 C CD  . GLN B 1 54  ? 55.981  0.958   -33.874 1.00 48.68  ? 54   GLN B CD  1 
ATOM   3299 O OE1 . GLN B 1 54  ? 57.169  1.202   -33.657 1.00 51.55  ? 54   GLN B OE1 1 
ATOM   3300 N NE2 . GLN B 1 54  ? 55.160  0.553   -32.915 1.00 50.46  ? 54   GLN B NE2 1 
ATOM   3301 N N   . ASP B 1 55  ? 52.138  1.995   -37.433 1.00 32.85  ? 55   ASP B N   1 
ATOM   3302 C CA  . ASP B 1 55  ? 50.711  2.052   -37.700 1.00 33.53  ? 55   ASP B CA  1 
ATOM   3303 C C   . ASP B 1 55  ? 49.874  1.419   -36.607 1.00 32.67  ? 55   ASP B C   1 
ATOM   3304 O O   . ASP B 1 55  ? 49.701  0.204   -36.549 1.00 34.30  ? 55   ASP B O   1 
ATOM   3305 C CB  . ASP B 1 55  ? 50.416  1.376   -39.054 1.00 31.98  ? 55   ASP B CB  1 
ATOM   3306 C CG  . ASP B 1 55  ? 48.926  1.228   -39.298 1.00 33.76  ? 55   ASP B CG  1 
ATOM   3307 O OD1 . ASP B 1 55  ? 48.137  2.068   -38.826 1.00 29.81  ? 55   ASP B OD1 1 
ATOM   3308 O OD2 . ASP B 1 55  ? 48.519  0.245   -39.960 1.00 36.80  ? 55   ASP B OD2 1 
ATOM   3309 N N   . PRO B 1 56  ? 49.267  2.201   -35.728 1.00 32.15  ? 56   PRO B N   1 
ATOM   3310 C CA  . PRO B 1 56  ? 48.432  1.673   -34.656 1.00 32.23  ? 56   PRO B CA  1 
ATOM   3311 C C   . PRO B 1 56  ? 47.032  1.299   -35.118 1.00 31.75  ? 56   PRO B C   1 
ATOM   3312 O O   . PRO B 1 56  ? 46.246  0.743   -34.339 1.00 32.11  ? 56   PRO B O   1 
ATOM   3313 C CB  . PRO B 1 56  ? 48.496  2.749   -33.581 1.00 31.23  ? 56   PRO B CB  1 
ATOM   3314 C CG  . PRO B 1 56  ? 48.908  3.998   -34.257 1.00 30.88  ? 56   PRO B CG  1 
ATOM   3315 C CD  . PRO B 1 56  ? 49.380  3.670   -35.648 1.00 31.22  ? 56   PRO B CD  1 
ATOM   3316 N N   . GLY B 1 57  ? 46.629  1.527   -36.362 1.00 31.87  ? 57   GLY B N   1 
ATOM   3317 C CA  . GLY B 1 57  ? 45.373  1.068   -36.914 1.00 31.54  ? 57   GLY B CA  1 
ATOM   3318 C C   . GLY B 1 57  ? 44.106  1.442   -36.193 1.00 32.94  ? 57   GLY B C   1 
ATOM   3319 O O   . GLY B 1 57  ? 43.124  0.707   -36.075 1.00 32.16  ? 57   GLY B O   1 
ATOM   3320 N N   . GLY B 1 58  ? 44.077  2.647   -35.609 1.00 33.44  ? 58   GLY B N   1 
ATOM   3321 C CA  . GLY B 1 58  ? 42.987  3.240   -34.892 1.00 32.59  ? 58   GLY B CA  1 
ATOM   3322 C C   . GLY B 1 58  ? 42.674  2.586   -33.554 1.00 31.70  ? 58   GLY B C   1 
ATOM   3323 O O   . GLY B 1 58  ? 41.683  2.936   -32.917 1.00 30.27  ? 58   GLY B O   1 
ATOM   3324 N N   . ASP B 1 59  ? 43.487  1.642   -33.131 1.00 31.08  ? 59   ASP B N   1 
ATOM   3325 C CA  . ASP B 1 59  ? 43.289  0.937   -31.880 1.00 32.05  ? 59   ASP B CA  1 
ATOM   3326 C C   . ASP B 1 59  ? 44.058  1.619   -30.751 1.00 32.80  ? 59   ASP B C   1 
ATOM   3327 O O   . ASP B 1 59  ? 45.295  1.706   -30.734 1.00 32.77  ? 59   ASP B O   1 
ATOM   3328 C CB  . ASP B 1 59  ? 43.754  -0.503  -32.080 1.00 31.41  ? 59   ASP B CB  1 
ATOM   3329 C CG  . ASP B 1 59  ? 43.612  -1.418  -30.896 1.00 32.15  ? 59   ASP B CG  1 
ATOM   3330 O OD1 . ASP B 1 59  ? 43.379  -0.987  -29.749 1.00 33.35  ? 59   ASP B OD1 1 
ATOM   3331 O OD2 . ASP B 1 59  ? 43.732  -2.650  -31.101 1.00 35.19  ? 59   ASP B OD2 1 
ATOM   3332 N N   . PRO B 1 60  ? 43.329  2.112   -29.753 1.00 32.43  ? 60   PRO B N   1 
ATOM   3333 C CA  . PRO B 1 60  ? 43.928  2.744   -28.587 1.00 32.34  ? 60   PRO B CA  1 
ATOM   3334 C C   . PRO B 1 60  ? 45.019  1.919   -27.933 1.00 31.87  ? 60   PRO B C   1 
ATOM   3335 O O   . PRO B 1 60  ? 46.049  2.486   -27.579 1.00 31.42  ? 60   PRO B O   1 
ATOM   3336 C CB  . PRO B 1 60  ? 42.775  2.990   -27.636 1.00 31.98  ? 60   PRO B CB  1 
ATOM   3337 C CG  . PRO B 1 60  ? 41.642  2.164   -28.160 1.00 32.70  ? 60   PRO B CG  1 
ATOM   3338 C CD  . PRO B 1 60  ? 41.854  2.049   -29.649 1.00 31.76  ? 60   PRO B CD  1 
ATOM   3339 N N   . ASP B 1 61  ? 44.865  0.610   -27.767 1.00 32.45  ? 61   ASP B N   1 
ATOM   3340 C CA  . ASP B 1 61  ? 45.912  -0.227  -27.188 1.00 32.67  ? 61   ASP B CA  1 
ATOM   3341 C C   . ASP B 1 61  ? 47.136  -0.290  -28.090 1.00 31.11  ? 61   ASP B C   1 
ATOM   3342 O O   . ASP B 1 61  ? 48.258  -0.221  -27.577 1.00 31.56  ? 61   ASP B O   1 
ATOM   3343 C CB  . ASP B 1 61  ? 45.412  -1.612  -26.807 1.00 36.84  ? 61   ASP B CB  1 
ATOM   3344 C CG  . ASP B 1 61  ? 44.170  -1.597  -25.936 1.00 43.56  ? 61   ASP B CG  1 
ATOM   3345 O OD1 . ASP B 1 61  ? 43.787  -0.562  -25.333 1.00 46.23  ? 61   ASP B OD1 1 
ATOM   3346 O OD2 . ASP B 1 61  ? 43.489  -2.654  -25.821 1.00 46.05  ? 61   ASP B OD2 1 
ATOM   3347 N N   . ARG B 1 62  ? 46.973  -0.327  -29.409 1.00 30.72  ? 62   ARG B N   1 
ATOM   3348 C CA  . ARG B 1 62  ? 48.140  -0.302  -30.289 1.00 29.57  ? 62   ARG B CA  1 
ATOM   3349 C C   . ARG B 1 62  ? 48.834  1.058   -30.206 1.00 28.56  ? 62   ARG B C   1 
ATOM   3350 O O   . ARG B 1 62  ? 50.072  1.137   -30.326 1.00 27.79  ? 62   ARG B O   1 
ATOM   3351 C CB  . ARG B 1 62  ? 47.811  -0.671  -31.716 1.00 28.86  ? 62   ARG B CB  1 
ATOM   3352 C CG  . ARG B 1 62  ? 47.328  -2.100  -31.924 1.00 33.59  ? 62   ARG B CG  1 
ATOM   3353 C CD  . ARG B 1 62  ? 47.758  -2.580  -33.302 1.00 33.52  ? 62   ARG B CD  1 
ATOM   3354 N NE  . ARG B 1 62  ? 46.756  -2.705  -34.300 1.00 36.70  ? 62   ARG B NE  1 
ATOM   3355 C CZ  . ARG B 1 62  ? 46.827  -2.541  -35.613 1.00 37.53  ? 62   ARG B CZ  1 
ATOM   3356 N NH1 . ARG B 1 62  ? 47.923  -2.165  -36.244 1.00 38.16  ? 62   ARG B NH1 1 
ATOM   3357 N NH2 . ARG B 1 62  ? 45.718  -2.743  -36.322 1.00 37.47  ? 62   ARG B NH2 1 
ATOM   3358 N N   . TYR B 1 63  ? 48.085  2.158   -30.040 1.00 26.92  ? 63   TYR B N   1 
ATOM   3359 C CA  . TYR B 1 63  ? 48.742  3.456   -29.893 1.00 26.55  ? 63   TYR B CA  1 
ATOM   3360 C C   . TYR B 1 63  ? 49.639  3.425   -28.638 1.00 25.92  ? 63   TYR B C   1 
ATOM   3361 O O   . TYR B 1 63  ? 50.772  3.911   -28.661 1.00 24.10  ? 63   TYR B O   1 
ATOM   3362 C CB  . TYR B 1 63  ? 47.844  4.652   -29.696 1.00 25.09  ? 63   TYR B CB  1 
ATOM   3363 C CG  . TYR B 1 63  ? 47.189  5.203   -30.938 1.00 25.18  ? 63   TYR B CG  1 
ATOM   3364 C CD1 . TYR B 1 63  ? 46.098  4.500   -31.459 1.00 25.38  ? 63   TYR B CD1 1 
ATOM   3365 C CD2 . TYR B 1 63  ? 47.604  6.350   -31.576 1.00 22.89  ? 63   TYR B CD2 1 
ATOM   3366 C CE1 . TYR B 1 63  ? 45.452  4.944   -32.587 1.00 26.29  ? 63   TYR B CE1 1 
ATOM   3367 C CE2 . TYR B 1 63  ? 46.941  6.799   -32.701 1.00 25.59  ? 63   TYR B CE2 1 
ATOM   3368 C CZ  . TYR B 1 63  ? 45.866  6.109   -33.201 1.00 26.01  ? 63   TYR B CZ  1 
ATOM   3369 O OH  . TYR B 1 63  ? 45.171  6.518   -34.318 1.00 26.17  ? 63   TYR B OH  1 
ATOM   3370 N N   . ARG B 1 64  ? 49.051  2.938   -27.546 1.00 26.05  ? 64   ARG B N   1 
ATOM   3371 C CA  . ARG B 1 64  ? 49.851  2.874   -26.317 1.00 27.96  ? 64   ARG B CA  1 
ATOM   3372 C C   . ARG B 1 64  ? 51.131  2.053   -26.532 1.00 27.89  ? 64   ARG B C   1 
ATOM   3373 O O   . ARG B 1 64  ? 52.212  2.485   -26.168 1.00 27.58  ? 64   ARG B O   1 
ATOM   3374 C CB  . ARG B 1 64  ? 49.039  2.297   -25.149 1.00 27.97  ? 64   ARG B CB  1 
ATOM   3375 C CG  . ARG B 1 64  ? 49.919  2.286   -23.891 1.00 32.21  ? 64   ARG B CG  1 
ATOM   3376 C CD  . ARG B 1 64  ? 49.199  1.681   -22.705 1.00 35.34  ? 64   ARG B CD  1 
ATOM   3377 N NE  . ARG B 1 64  ? 48.583  0.434   -23.083 1.00 40.69  ? 64   ARG B NE  1 
ATOM   3378 C CZ  . ARG B 1 64  ? 49.021  -0.813  -23.174 1.00 44.25  ? 64   ARG B CZ  1 
ATOM   3379 N NH1 . ARG B 1 64  ? 50.258  -1.212  -22.883 1.00 40.68  ? 64   ARG B NH1 1 
ATOM   3380 N NH2 . ARG B 1 64  ? 48.116  -1.711  -23.607 1.00 45.83  ? 64   ARG B NH2 1 
ATOM   3381 N N   . LEU B 1 65  ? 51.034  0.867   -27.103 1.00 28.66  ? 65   LEU B N   1 
ATOM   3382 C CA  . LEU B 1 65  ? 52.154  -0.010  -27.398 1.00 30.04  ? 65   LEU B CA  1 
ATOM   3383 C C   . LEU B 1 65  ? 53.176  0.651   -28.314 1.00 29.72  ? 65   LEU B C   1 
ATOM   3384 O O   . LEU B 1 65  ? 54.375  0.643   -28.037 1.00 28.22  ? 65   LEU B O   1 
ATOM   3385 C CB  . LEU B 1 65  ? 51.575  -1.306  -27.990 1.00 31.95  ? 65   LEU B CB  1 
ATOM   3386 C CG  . LEU B 1 65  ? 51.065  -2.351  -26.989 1.00 33.53  ? 65   LEU B CG  1 
ATOM   3387 C CD1 . LEU B 1 65  ? 50.246  -3.447  -27.657 1.00 33.56  ? 65   LEU B CD1 1 
ATOM   3388 C CD2 . LEU B 1 65  ? 52.235  -3.001  -26.253 1.00 32.96  ? 65   LEU B CD2 1 
ATOM   3389 N N   . CYS B 1 66  ? 52.726  1.357   -29.360 1.00 29.94  ? 66   CYS B N   1 
ATOM   3390 C CA  . CYS B 1 66  ? 53.659  2.066   -30.253 1.00 29.57  ? 66   CYS B CA  1 
ATOM   3391 C C   . CYS B 1 66  ? 54.356  3.209   -29.523 1.00 29.48  ? 66   CYS B C   1 
ATOM   3392 O O   . CYS B 1 66  ? 55.579  3.392   -29.621 1.00 29.04  ? 66   CYS B O   1 
ATOM   3393 C CB  . CYS B 1 66  ? 52.945  2.500   -31.532 1.00 30.49  ? 66   CYS B CB  1 
ATOM   3394 S SG  . CYS B 1 66  ? 52.325  1.071   -32.499 1.00 28.23  ? 66   CYS B SG  1 
ATOM   3395 N N   . ALA B 1 67  ? 53.631  3.976   -28.711 1.00 27.25  ? 67   ALA B N   1 
ATOM   3396 C CA  . ALA B 1 67  ? 54.241  5.028   -27.912 1.00 26.13  ? 67   ALA B CA  1 
ATOM   3397 C C   . ALA B 1 67  ? 55.291  4.450   -26.957 1.00 24.39  ? 67   ALA B C   1 
ATOM   3398 O O   . ALA B 1 67  ? 56.340  5.061   -26.731 1.00 21.93  ? 67   ALA B O   1 
ATOM   3399 C CB  . ALA B 1 67  ? 53.167  5.790   -27.133 1.00 25.95  ? 67   ALA B CB  1 
ATOM   3400 N N   . GLU B 1 68  ? 54.995  3.329   -26.329 1.00 24.52  ? 68   GLU B N   1 
ATOM   3401 C CA  . GLU B 1 68  ? 55.873  2.627   -25.411 1.00 27.87  ? 68   GLU B CA  1 
ATOM   3402 C C   . GLU B 1 68  ? 57.139  2.068   -26.083 1.00 28.48  ? 68   GLU B C   1 
ATOM   3403 O O   . GLU B 1 68  ? 58.245  2.227   -25.558 1.00 27.51  ? 68   GLU B O   1 
ATOM   3404 C CB  . GLU B 1 68  ? 55.134  1.471   -24.741 1.00 31.95  ? 68   GLU B CB  1 
ATOM   3405 C CG  . GLU B 1 68  ? 54.269  1.914   -23.592 1.00 37.15  ? 68   GLU B CG  1 
ATOM   3406 C CD  . GLU B 1 68  ? 53.366  0.868   -23.004 1.00 38.64  ? 68   GLU B CD  1 
ATOM   3407 O OE1 . GLU B 1 68  ? 53.250  -0.239  -23.559 1.00 42.10  ? 68   GLU B OE1 1 
ATOM   3408 O OE2 . GLU B 1 68  ? 52.749  1.157   -21.956 1.00 42.67  ? 68   GLU B OE2 1 
ATOM   3409 N N   . ASP B 1 69  ? 56.988  1.501   -27.274 1.00 27.94  ? 69   ASP B N   1 
ATOM   3410 C CA  . ASP B 1 69  ? 58.124  1.036   -28.052 1.00 29.16  ? 69   ASP B CA  1 
ATOM   3411 C C   . ASP B 1 69  ? 59.061  2.210   -28.337 1.00 29.49  ? 69   ASP B C   1 
ATOM   3412 O O   . ASP B 1 69  ? 60.256  2.168   -28.018 1.00 28.81  ? 69   ASP B O   1 
ATOM   3413 C CB  . ASP B 1 69  ? 57.646  0.438   -29.391 1.00 29.88  ? 69   ASP B CB  1 
ATOM   3414 C CG  . ASP B 1 69  ? 58.812  -0.110  -30.192 1.00 31.67  ? 69   ASP B CG  1 
ATOM   3415 O OD1 . ASP B 1 69  ? 59.696  -0.731  -29.577 1.00 31.38  ? 69   ASP B OD1 1 
ATOM   3416 O OD2 . ASP B 1 69  ? 58.886  0.087   -31.420 1.00 33.69  ? 69   ASP B OD2 1 
ATOM   3417 N N   . PHE B 1 70  ? 58.499  3.283   -28.904 1.00 29.82  ? 70   PHE B N   1 
ATOM   3418 C CA  . PHE B 1 70  ? 59.263  4.464   -29.243 1.00 29.90  ? 70   PHE B CA  1 
ATOM   3419 C C   . PHE B 1 70  ? 60.031  5.030   -28.046 1.00 30.29  ? 70   PHE B C   1 
ATOM   3420 O O   . PHE B 1 70  ? 61.243  5.237   -28.177 1.00 29.70  ? 70   PHE B O   1 
ATOM   3421 C CB  . PHE B 1 70  ? 58.454  5.614   -29.804 1.00 29.91  ? 70   PHE B CB  1 
ATOM   3422 C CG  . PHE B 1 70  ? 57.775  5.585   -31.113 1.00 32.95  ? 70   PHE B CG  1 
ATOM   3423 C CD1 . PHE B 1 70  ? 58.166  4.769   -32.161 1.00 34.32  ? 70   PHE B CD1 1 
ATOM   3424 C CD2 . PHE B 1 70  ? 56.718  6.469   -31.350 1.00 33.73  ? 70   PHE B CD2 1 
ATOM   3425 C CE1 . PHE B 1 70  ? 57.494  4.780   -33.376 1.00 35.09  ? 70   PHE B CE1 1 
ATOM   3426 C CE2 . PHE B 1 70  ? 56.062  6.500   -32.564 1.00 33.08  ? 70   PHE B CE2 1 
ATOM   3427 C CZ  . PHE B 1 70  ? 56.443  5.647   -33.579 1.00 33.49  ? 70   PHE B CZ  1 
ATOM   3428 N N   . ILE B 1 71  ? 59.353  5.329   -26.949 1.00 29.82  ? 71   ILE B N   1 
ATOM   3429 C CA  . ILE B 1 71  ? 59.958  5.903   -25.758 1.00 29.62  ? 71   ILE B CA  1 
ATOM   3430 C C   . ILE B 1 71  ? 60.929  4.982   -25.029 1.00 31.45  ? 71   ILE B C   1 
ATOM   3431 O O   . ILE B 1 71  ? 61.994  5.421   -24.569 1.00 30.02  ? 71   ILE B O   1 
ATOM   3432 C CB  . ILE B 1 71  ? 58.871  6.385   -24.777 1.00 27.94  ? 71   ILE B CB  1 
ATOM   3433 C CG1 . ILE B 1 71  ? 58.130  7.602   -25.342 1.00 25.03  ? 71   ILE B CG1 1 
ATOM   3434 C CG2 . ILE B 1 71  ? 59.426  6.698   -23.395 1.00 24.52  ? 71   ILE B CG2 1 
ATOM   3435 C CD1 . ILE B 1 71  ? 56.821  7.891   -24.628 1.00 26.93  ? 71   ILE B CD1 1 
ATOM   3436 N N   . ARG B 1 72  ? 60.558  3.710   -24.875 1.00 32.95  ? 72   ARG B N   1 
ATOM   3437 C CA  . ARG B 1 72  ? 61.373  2.724   -24.209 1.00 34.06  ? 72   ARG B CA  1 
ATOM   3438 C C   . ARG B 1 72  ? 62.555  2.223   -25.034 1.00 34.74  ? 72   ARG B C   1 
ATOM   3439 O O   . ARG B 1 72  ? 63.621  2.028   -24.471 1.00 34.61  ? 72   ARG B O   1 
ATOM   3440 C CB  . ARG B 1 72  ? 60.604  1.404   -24.017 1.00 37.56  ? 72   ARG B CB  1 
ATOM   3441 C CG  . ARG B 1 72  ? 60.394  0.998   -22.592 1.00 39.76  ? 72   ARG B CG  1 
ATOM   3442 C CD  . ARG B 1 72  ? 59.182  1.707   -22.052 1.00 43.25  ? 72   ARG B CD  1 
ATOM   3443 N NE  . ARG B 1 72  ? 58.063  0.786   -21.820 1.00 47.17  ? 72   ARG B NE  1 
ATOM   3444 C CZ  . ARG B 1 72  ? 57.008  1.271   -21.145 1.00 51.25  ? 72   ARG B CZ  1 
ATOM   3445 N NH1 . ARG B 1 72  ? 57.035  2.545   -20.724 1.00 54.27  ? 72   ARG B NH1 1 
ATOM   3446 N NH2 . ARG B 1 72  ? 55.958  0.511   -20.892 1.00 51.24  ? 72   ARG B NH2 1 
ATOM   3447 N N   . ASN B 1 73  ? 62.270  1.858   -26.288 1.00 34.13  ? 73   ASN B N   1 
ATOM   3448 C CA  . ASN B 1 73  ? 63.325  1.220   -27.064 1.00 35.07  ? 73   ASN B CA  1 
ATOM   3449 C C   . ASN B 1 73  ? 63.964  2.099   -28.117 1.00 34.94  ? 73   ASN B C   1 
ATOM   3450 O O   . ASN B 1 73  ? 64.978  1.647   -28.660 1.00 34.64  ? 73   ASN B O   1 
ATOM   3451 C CB  . ASN B 1 73  ? 62.763  -0.029  -27.777 1.00 34.86  ? 73   ASN B CB  1 
ATOM   3452 C CG  . ASN B 1 73  ? 62.073  -0.963  -26.816 1.00 33.21  ? 73   ASN B CG  1 
ATOM   3453 O OD1 . ASN B 1 73  ? 62.580  -1.223  -25.728 1.00 37.11  ? 73   ASN B OD1 1 
ATOM   3454 N ND2 . ASN B 1 73  ? 60.933  -1.510  -27.168 1.00 31.04  ? 73   ASN B ND2 1 
ATOM   3455 N N   . ARG B 1 74  ? 63.392  3.261   -28.450 1.00 33.75  ? 74   ARG B N   1 
ATOM   3456 C CA  . ARG B 1 74  ? 64.036  4.023   -29.520 1.00 33.31  ? 74   ARG B CA  1 
ATOM   3457 C C   . ARG B 1 74  ? 64.560  5.352   -29.048 1.00 31.42  ? 74   ARG B C   1 
ATOM   3458 O O   . ARG B 1 74  ? 64.967  6.166   -29.877 1.00 32.27  ? 74   ARG B O   1 
ATOM   3459 C CB  . ARG B 1 74  ? 63.103  4.208   -30.725 1.00 36.78  ? 74   ARG B CB  1 
ATOM   3460 C CG  . ARG B 1 74  ? 62.503  2.921   -31.277 1.00 40.23  ? 74   ARG B CG  1 
ATOM   3461 C CD  . ARG B 1 74  ? 63.596  1.934   -31.666 1.00 45.13  ? 74   ARG B CD  1 
ATOM   3462 N NE  . ARG B 1 74  ? 64.533  2.520   -32.639 1.00 49.31  ? 74   ARG B NE  1 
ATOM   3463 C CZ  . ARG B 1 74  ? 64.351  2.433   -33.965 1.00 49.86  ? 74   ARG B CZ  1 
ATOM   3464 N NH1 . ARG B 1 74  ? 63.302  1.779   -34.453 1.00 49.68  ? 74   ARG B NH1 1 
ATOM   3465 N NH2 . ARG B 1 74  ? 65.212  2.982   -34.809 1.00 49.66  ? 74   ARG B NH2 1 
ATOM   3466 N N   . GLY B 1 75  ? 64.457  5.608   -27.762 1.00 30.62  ? 75   GLY B N   1 
ATOM   3467 C CA  . GLY B 1 75  ? 64.837  6.877   -27.187 1.00 29.99  ? 75   GLY B CA  1 
ATOM   3468 C C   . GLY B 1 75  ? 64.021  8.070   -27.648 1.00 28.46  ? 75   GLY B C   1 
ATOM   3469 O O   . GLY B 1 75  ? 64.469  9.200   -27.428 1.00 29.24  ? 75   GLY B O   1 
ATOM   3470 N N   . VAL B 1 76  ? 62.883  7.916   -28.283 1.00 27.63  ? 76   VAL B N   1 
ATOM   3471 C CA  . VAL B 1 76  ? 62.054  9.048   -28.712 1.00 27.74  ? 76   VAL B CA  1 
ATOM   3472 C C   . VAL B 1 76  ? 61.471  9.865   -27.561 1.00 26.01  ? 76   VAL B C   1 
ATOM   3473 O O   . VAL B 1 76  ? 60.928  9.352   -26.594 1.00 23.51  ? 76   VAL B O   1 
ATOM   3474 C CB  . VAL B 1 76  ? 60.907  8.440   -29.561 1.00 29.19  ? 76   VAL B CB  1 
ATOM   3475 C CG1 . VAL B 1 76  ? 59.733  9.400   -29.686 1.00 28.62  ? 76   VAL B CG1 1 
ATOM   3476 C CG2 . VAL B 1 76  ? 61.484  8.016   -30.899 1.00 25.93  ? 76   VAL B CG2 1 
ATOM   3477 N N   . ARG B 1 77  ? 61.572  11.183  -27.636 1.00 26.64  ? 77   ARG B N   1 
ATOM   3478 C CA  . ARG B 1 77  ? 61.089  12.132  -26.652 1.00 25.42  ? 77   ARG B CA  1 
ATOM   3479 C C   . ARG B 1 77  ? 60.169  13.180  -27.252 1.00 24.44  ? 77   ARG B C   1 
ATOM   3480 O O   . ARG B 1 77  ? 59.589  14.009  -26.541 1.00 22.48  ? 77   ARG B O   1 
ATOM   3481 C CB  . ARG B 1 77  ? 62.254  12.826  -25.935 1.00 29.74  ? 77   ARG B CB  1 
ATOM   3482 C CG  . ARG B 1 77  ? 62.999  11.940  -24.937 1.00 33.17  ? 77   ARG B CG  1 
ATOM   3483 C CD  . ARG B 1 77  ? 62.055  11.385  -23.863 1.00 34.34  ? 77   ARG B CD  1 
ATOM   3484 N NE  . ARG B 1 77  ? 62.641  10.324  -23.076 1.00 34.57  ? 77   ARG B NE  1 
ATOM   3485 C CZ  . ARG B 1 77  ? 62.780  9.030   -23.284 1.00 34.80  ? 77   ARG B CZ  1 
ATOM   3486 N NH1 . ARG B 1 77  ? 62.315  8.407   -24.361 1.00 34.22  ? 77   ARG B NH1 1 
ATOM   3487 N NH2 . ARG B 1 77  ? 63.369  8.286   -22.342 1.00 34.75  ? 77   ARG B NH2 1 
ATOM   3488 N N   . PHE B 1 78  ? 60.055  13.168  -28.593 1.00 24.23  ? 78   PHE B N   1 
ATOM   3489 C CA  . PHE B 1 78  ? 59.190  14.105  -29.288 1.00 23.75  ? 78   PHE B CA  1 
ATOM   3490 C C   . PHE B 1 78  ? 58.312  13.299  -30.246 1.00 24.39  ? 78   PHE B C   1 
ATOM   3491 O O   . PHE B 1 78  ? 58.787  12.550  -31.105 1.00 23.26  ? 78   PHE B O   1 
ATOM   3492 C CB  . PHE B 1 78  ? 59.849  15.217  -30.091 1.00 22.06  ? 78   PHE B CB  1 
ATOM   3493 C CG  . PHE B 1 78  ? 60.720  16.131  -29.290 1.00 20.24  ? 78   PHE B CG  1 
ATOM   3494 C CD1 . PHE B 1 78  ? 61.995  15.707  -28.920 1.00 19.97  ? 78   PHE B CD1 1 
ATOM   3495 C CD2 . PHE B 1 78  ? 60.287  17.372  -28.898 1.00 19.35  ? 78   PHE B CD2 1 
ATOM   3496 C CE1 . PHE B 1 78  ? 62.841  16.523  -28.188 1.00 22.34  ? 78   PHE B CE1 1 
ATOM   3497 C CE2 . PHE B 1 78  ? 61.139  18.187  -28.159 1.00 23.67  ? 78   PHE B CE2 1 
ATOM   3498 C CZ  . PHE B 1 78  ? 62.414  17.775  -27.793 1.00 22.01  ? 78   PHE B CZ  1 
ATOM   3499 N N   . LEU B 1 79  ? 57.009  13.458  -29.981 1.00 24.95  ? 79   LEU B N   1 
ATOM   3500 C CA  . LEU B 1 79  ? 56.023  12.702  -30.744 1.00 24.55  ? 79   LEU B CA  1 
ATOM   3501 C C   . LEU B 1 79  ? 54.988  13.613  -31.373 1.00 24.79  ? 79   LEU B C   1 
ATOM   3502 O O   . LEU B 1 79  ? 54.735  14.712  -30.899 1.00 25.89  ? 79   LEU B O   1 
ATOM   3503 C CB  . LEU B 1 79  ? 55.312  11.688  -29.868 1.00 20.59  ? 79   LEU B CB  1 
ATOM   3504 C CG  . LEU B 1 79  ? 56.158  10.638  -29.147 1.00 21.14  ? 79   LEU B CG  1 
ATOM   3505 C CD1 . LEU B 1 79  ? 56.537  11.136  -27.757 1.00 18.46  ? 79   LEU B CD1 1 
ATOM   3506 C CD2 . LEU B 1 79  ? 55.374  9.347   -29.126 1.00 22.17  ? 79   LEU B CD2 1 
ATOM   3507 N N   . VAL B 1 80  ? 54.468  13.160  -32.513 1.00 25.42  ? 80   VAL B N   1 
ATOM   3508 C CA  . VAL B 1 80  ? 53.392  13.871  -33.214 1.00 24.27  ? 80   VAL B CA  1 
ATOM   3509 C C   . VAL B 1 80  ? 52.378  12.768  -33.513 1.00 23.97  ? 80   VAL B C   1 
ATOM   3510 O O   . VAL B 1 80  ? 52.808  11.735  -34.036 1.00 25.23  ? 80   VAL B O   1 
ATOM   3511 C CB  . VAL B 1 80  ? 53.806  14.644  -34.459 1.00 23.22  ? 80   VAL B CB  1 
ATOM   3512 C CG1 . VAL B 1 80  ? 52.574  15.321  -35.084 1.00 21.14  ? 80   VAL B CG1 1 
ATOM   3513 C CG2 . VAL B 1 80  ? 54.866  15.715  -34.186 1.00 18.18  ? 80   VAL B CG2 1 
ATOM   3514 N N   . GLY B 1 81  ? 51.117  12.896  -33.100 1.00 22.73  ? 81   GLY B N   1 
ATOM   3515 C CA  . GLY B 1 81  ? 50.220  11.757  -33.366 1.00 21.27  ? 81   GLY B CA  1 
ATOM   3516 C C   . GLY B 1 81  ? 48.887  11.880  -32.659 1.00 19.45  ? 81   GLY B C   1 
ATOM   3517 O O   . GLY B 1 81  ? 48.590  12.865  -31.992 1.00 19.98  ? 81   GLY B O   1 
ATOM   3518 N N   . CYS B 1 82  ? 48.098  10.860  -32.802 1.00 18.35  ? 82   CYS B N   1 
ATOM   3519 C CA  . CYS B 1 82  ? 46.813  10.627  -32.184 1.00 19.49  ? 82   CYS B CA  1 
ATOM   3520 C C   . CYS B 1 82  ? 45.674  11.424  -32.823 1.00 18.67  ? 82   CYS B C   1 
ATOM   3521 O O   . CYS B 1 82  ? 45.880  12.547  -33.286 1.00 18.67  ? 82   CYS B O   1 
ATOM   3522 C CB  . CYS B 1 82  ? 46.782  10.867  -30.667 1.00 17.60  ? 82   CYS B CB  1 
ATOM   3523 S SG  . CYS B 1 82  ? 47.974  9.949   -29.687 1.00 17.36  ? 82   CYS B SG  1 
ATOM   3524 N N   . TYR B 1 83  ? 44.503  10.770  -32.891 1.00 17.48  ? 83   TYR B N   1 
ATOM   3525 C CA  . TYR B 1 83  ? 43.372  11.505  -33.483 1.00 18.66  ? 83   TYR B CA  1 
ATOM   3526 C C   . TYR B 1 83  ? 42.155  11.352  -32.571 1.00 18.02  ? 83   TYR B C   1 
ATOM   3527 O O   . TYR B 1 83  ? 41.854  12.306  -31.863 1.00 18.01  ? 83   TYR B O   1 
ATOM   3528 C CB  . TYR B 1 83  ? 43.165  11.081  -34.932 1.00 17.15  ? 83   TYR B CB  1 
ATOM   3529 C CG  . TYR B 1 83  ? 42.134  11.897  -35.666 1.00 17.75  ? 83   TYR B CG  1 
ATOM   3530 C CD1 . TYR B 1 83  ? 42.461  13.197  -36.072 1.00 19.11  ? 83   TYR B CD1 1 
ATOM   3531 C CD2 . TYR B 1 83  ? 40.860  11.419  -35.941 1.00 18.17  ? 83   TYR B CD2 1 
ATOM   3532 C CE1 . TYR B 1 83  ? 41.544  13.974  -36.747 1.00 20.27  ? 83   TYR B CE1 1 
ATOM   3533 C CE2 . TYR B 1 83  ? 39.914  12.205  -36.602 1.00 18.68  ? 83   TYR B CE2 1 
ATOM   3534 C CZ  . TYR B 1 83  ? 40.284  13.471  -37.010 1.00 21.25  ? 83   TYR B CZ  1 
ATOM   3535 O OH  . TYR B 1 83  ? 39.388  14.265  -37.687 1.00 23.26  ? 83   TYR B OH  1 
ATOM   3536 N N   . MET B 1 84  ? 41.462  10.232  -32.600 1.00 17.07  ? 84   MET B N   1 
ATOM   3537 C CA  . MET B 1 84  ? 40.288  9.968   -31.785 1.00 17.30  ? 84   MET B CA  1 
ATOM   3538 C C   . MET B 1 84  ? 40.729  10.060  -30.316 1.00 18.25  ? 84   MET B C   1 
ATOM   3539 O O   . MET B 1 84  ? 41.804  9.537   -29.964 1.00 16.47  ? 84   MET B O   1 
ATOM   3540 C CB  . MET B 1 84  ? 39.748  8.591   -32.162 1.00 16.60  ? 84   MET B CB  1 
ATOM   3541 C CG  . MET B 1 84  ? 39.070  8.536   -33.539 1.00 16.88  ? 84   MET B CG  1 
ATOM   3542 S SD  . MET B 1 84  ? 38.128  6.997   -33.702 1.00 16.69  ? 84   MET B SD  1 
ATOM   3543 C CE  . MET B 1 84  ? 39.415  5.766   -33.657 1.00 12.24  ? 84   MET B CE  1 
ATOM   3544 N N   . SER B 1 85  ? 39.936  10.743  -29.493 1.00 17.37  ? 85   SER B N   1 
ATOM   3545 C CA  . SER B 1 85  ? 40.319  11.112  -28.146 1.00 18.22  ? 85   SER B CA  1 
ATOM   3546 C C   . SER B 1 85  ? 40.771  10.004  -27.241 1.00 18.50  ? 85   SER B C   1 
ATOM   3547 O O   . SER B 1 85  ? 41.675  10.190  -26.421 1.00 18.78  ? 85   SER B O   1 
ATOM   3548 C CB  . SER B 1 85  ? 39.198  11.846  -27.400 1.00 19.77  ? 85   SER B CB  1 
ATOM   3549 O OG  . SER B 1 85  ? 39.016  13.138  -27.919 1.00 16.32  ? 85   SER B OG  1 
ATOM   3550 N N   . HIS B 1 86  ? 40.142  8.843   -27.358 1.00 19.66  ? 86   HIS B N   1 
ATOM   3551 C CA  . HIS B 1 86  ? 40.600  7.701   -26.563 1.00 21.23  ? 86   HIS B CA  1 
ATOM   3552 C C   . HIS B 1 86  ? 41.991  7.220   -26.989 1.00 21.29  ? 86   HIS B C   1 
ATOM   3553 O O   . HIS B 1 86  ? 42.617  6.500   -26.174 1.00 21.09  ? 86   HIS B O   1 
ATOM   3554 C CB  . HIS B 1 86  ? 39.527  6.638   -26.563 1.00 18.42  ? 86   HIS B CB  1 
ATOM   3555 C CG  . HIS B 1 86  ? 39.093  6.180   -27.917 1.00 24.90  ? 86   HIS B CG  1 
ATOM   3556 N ND1 . HIS B 1 86  ? 38.706  7.044   -28.924 1.00 23.02  ? 86   HIS B ND1 1 
ATOM   3557 C CD2 . HIS B 1 86  ? 38.987  4.916   -28.414 1.00 25.06  ? 86   HIS B CD2 1 
ATOM   3558 C CE1 . HIS B 1 86  ? 38.388  6.336   -29.991 1.00 27.11  ? 86   HIS B CE1 1 
ATOM   3559 N NE2 . HIS B 1 86  ? 38.547  5.038   -29.712 1.00 28.17  ? 86   HIS B NE2 1 
ATOM   3560 N N   . THR B 1 87  ? 42.465  7.541   -28.191 1.00 20.68  ? 87   THR B N   1 
ATOM   3561 C CA  . THR B 1 87  ? 43.819  7.164   -28.604 1.00 20.74  ? 87   THR B CA  1 
ATOM   3562 C C   . THR B 1 87  ? 44.816  8.135   -27.947 1.00 20.05  ? 87   THR B C   1 
ATOM   3563 O O   . THR B 1 87  ? 45.949  7.779   -27.614 1.00 19.50  ? 87   THR B O   1 
ATOM   3564 C CB  . THR B 1 87  ? 44.061  7.125   -30.122 1.00 20.74  ? 87   THR B CB  1 
ATOM   3565 O OG1 . THR B 1 87  ? 44.014  8.441   -30.695 1.00 19.00  ? 87   THR B OG1 1 
ATOM   3566 C CG2 . THR B 1 87  ? 43.016  6.286   -30.847 1.00 21.01  ? 87   THR B CG2 1 
ATOM   3567 N N   . ARG B 1 88  ? 44.365  9.376   -27.744 1.00 19.29  ? 88   ARG B N   1 
ATOM   3568 C CA  . ARG B 1 88  ? 45.152  10.382  -27.026 1.00 18.63  ? 88   ARG B CA  1 
ATOM   3569 C C   . ARG B 1 88  ? 45.240  10.013  -25.539 1.00 18.21  ? 88   ARG B C   1 
ATOM   3570 O O   . ARG B 1 88  ? 46.328  9.995   -24.961 1.00 16.48  ? 88   ARG B O   1 
ATOM   3571 C CB  . ARG B 1 88  ? 44.524  11.782  -27.174 1.00 19.67  ? 88   ARG B CB  1 
ATOM   3572 C CG  . ARG B 1 88  ? 45.356  12.853  -26.484 1.00 20.24  ? 88   ARG B CG  1 
ATOM   3573 C CD  . ARG B 1 88  ? 44.737  14.226  -26.385 1.00 15.59  ? 88   ARG B CD  1 
ATOM   3574 N NE  . ARG B 1 88  ? 43.670  14.226  -25.374 1.00 18.12  ? 88   ARG B NE  1 
ATOM   3575 C CZ  . ARG B 1 88  ? 42.372  14.098  -25.640 1.00 19.66  ? 88   ARG B CZ  1 
ATOM   3576 N NH1 . ARG B 1 88  ? 41.956  13.997  -26.920 1.00 17.68  ? 88   ARG B NH1 1 
ATOM   3577 N NH2 . ARG B 1 88  ? 41.482  14.127  -24.651 1.00 17.80  ? 88   ARG B NH2 1 
ATOM   3578 N N   . LYS B 1 89  ? 44.128  9.573   -24.927 1.00 16.82  ? 89   LYS B N   1 
ATOM   3579 C CA  . LYS B 1 89  ? 44.100  9.138   -23.550 1.00 17.06  ? 89   LYS B CA  1 
ATOM   3580 C C   . LYS B 1 89  ? 45.005  7.944   -23.296 1.00 18.58  ? 89   LYS B C   1 
ATOM   3581 O O   . LYS B 1 89  ? 45.630  7.827   -22.254 1.00 18.89  ? 89   LYS B O   1 
ATOM   3582 C CB  . LYS B 1 89  ? 42.695  8.763   -23.046 1.00 15.13  ? 89   LYS B CB  1 
ATOM   3583 C CG  . LYS B 1 89  ? 41.751  9.911   -22.806 1.00 15.04  ? 89   LYS B CG  1 
ATOM   3584 C CD  . LYS B 1 89  ? 42.268  11.030  -21.911 1.00 12.46  ? 89   LYS B CD  1 
ATOM   3585 C CE  . LYS B 1 89  ? 41.220  12.089  -21.628 1.00 12.48  ? 89   LYS B CE  1 
ATOM   3586 N NZ  . LYS B 1 89  ? 41.656  12.997  -20.495 1.00 14.39  ? 89   LYS B NZ  1 
ATOM   3587 N N   . ALA B 1 90  ? 45.092  6.992   -24.214 1.00 19.71  ? 90   ALA B N   1 
ATOM   3588 C CA  . ALA B 1 90  ? 45.936  5.815   -24.109 1.00 19.97  ? 90   ALA B CA  1 
ATOM   3589 C C   . ALA B 1 90  ? 47.422  6.163   -24.177 1.00 21.00  ? 90   ALA B C   1 
ATOM   3590 O O   . ALA B 1 90  ? 48.230  5.492   -23.548 1.00 21.15  ? 90   ALA B O   1 
ATOM   3591 C CB  . ALA B 1 90  ? 45.584  4.907   -25.306 1.00 16.65  ? 90   ALA B CB  1 
ATOM   3592 N N   . VAL B 1 91  ? 47.823  7.178   -24.937 1.00 22.83  ? 91   VAL B N   1 
ATOM   3593 C CA  . VAL B 1 91  ? 49.220  7.592   -25.060 1.00 22.89  ? 91   VAL B CA  1 
ATOM   3594 C C   . VAL B 1 91  ? 49.652  8.582   -23.984 1.00 23.29  ? 91   VAL B C   1 
ATOM   3595 O O   . VAL B 1 91  ? 50.793  8.583   -23.534 1.00 23.11  ? 91   VAL B O   1 
ATOM   3596 C CB  . VAL B 1 91  ? 49.398  8.231   -26.461 1.00 22.87  ? 91   VAL B CB  1 
ATOM   3597 C CG1 . VAL B 1 91  ? 50.724  8.968   -26.671 1.00 19.98  ? 91   VAL B CG1 1 
ATOM   3598 C CG2 . VAL B 1 91  ? 49.250  7.119   -27.513 1.00 24.07  ? 91   VAL B CG2 1 
ATOM   3599 N N   . MET B 1 92  ? 48.792  9.497   -23.544 1.00 22.07  ? 92   MET B N   1 
ATOM   3600 C CA  . MET B 1 92  ? 49.091  10.554  -22.614 1.00 20.81  ? 92   MET B CA  1 
ATOM   3601 C C   . MET B 1 92  ? 49.954  10.123  -21.436 1.00 21.16  ? 92   MET B C   1 
ATOM   3602 O O   . MET B 1 92  ? 50.989  10.760  -21.239 1.00 19.78  ? 92   MET B O   1 
ATOM   3603 C CB  . MET B 1 92  ? 47.843  11.269  -22.110 1.00 18.25  ? 92   MET B CB  1 
ATOM   3604 C CG  . MET B 1 92  ? 48.089  12.512  -21.249 1.00 16.56  ? 92   MET B CG  1 
ATOM   3605 S SD  . MET B 1 92  ? 46.548  13.491  -21.173 1.00 15.03  ? 92   MET B SD  1 
ATOM   3606 C CE  . MET B 1 92  ? 45.583  12.376  -20.188 1.00 16.81  ? 92   MET B CE  1 
ATOM   3607 N N   . PRO B 1 93  ? 49.557  9.132   -20.645 1.00 21.05  ? 93   PRO B N   1 
ATOM   3608 C CA  . PRO B 1 93  ? 50.319  8.682   -19.496 1.00 21.30  ? 93   PRO B CA  1 
ATOM   3609 C C   . PRO B 1 93  ? 51.752  8.237   -19.803 1.00 20.81  ? 93   PRO B C   1 
ATOM   3610 O O   . PRO B 1 93  ? 52.668  8.462   -18.992 1.00 20.06  ? 93   PRO B O   1 
ATOM   3611 C CB  . PRO B 1 93  ? 49.489  7.523   -18.933 1.00 21.35  ? 93   PRO B CB  1 
ATOM   3612 C CG  . PRO B 1 93  ? 48.131  7.625   -19.545 1.00 21.38  ? 93   PRO B CG  1 
ATOM   3613 C CD  . PRO B 1 93  ? 48.264  8.396   -20.800 1.00 21.25  ? 93   PRO B CD  1 
ATOM   3614 N N   . VAL B 1 94  ? 52.018  7.643   -20.951 1.00 19.12  ? 94   VAL B N   1 
ATOM   3615 C CA  . VAL B 1 94  ? 53.319  7.156   -21.344 1.00 20.46  ? 94   VAL B CA  1 
ATOM   3616 C C   . VAL B 1 94  ? 54.264  8.347   -21.580 1.00 19.87  ? 94   VAL B C   1 
ATOM   3617 O O   . VAL B 1 94  ? 55.376  8.303   -21.069 1.00 17.60  ? 94   VAL B O   1 
ATOM   3618 C CB  . VAL B 1 94  ? 53.389  6.322   -22.644 1.00 22.00  ? 94   VAL B CB  1 
ATOM   3619 C CG1 . VAL B 1 94  ? 54.809  5.787   -22.823 1.00 21.87  ? 94   VAL B CG1 1 
ATOM   3620 C CG2 . VAL B 1 94  ? 52.397  5.202   -22.655 1.00 21.73  ? 94   VAL B CG2 1 
ATOM   3621 N N   . VAL B 1 95  ? 53.736  9.314   -22.339 1.00 18.50  ? 95   VAL B N   1 
ATOM   3622 C CA  . VAL B 1 95  ? 54.532  10.510  -22.585 1.00 18.96  ? 95   VAL B CA  1 
ATOM   3623 C C   . VAL B 1 95  ? 54.757  11.284  -21.292 1.00 18.65  ? 95   VAL B C   1 
ATOM   3624 O O   . VAL B 1 95  ? 55.910  11.721  -21.073 1.00 17.82  ? 95   VAL B O   1 
ATOM   3625 C CB  . VAL B 1 95  ? 53.984  11.337  -23.766 1.00 21.56  ? 95   VAL B CB  1 
ATOM   3626 C CG1 . VAL B 1 95  ? 52.595  10.908  -24.134 1.00 23.43  ? 95   VAL B CG1 1 
ATOM   3627 C CG2 . VAL B 1 95  ? 53.965  12.848  -23.565 1.00 21.06  ? 95   VAL B CG2 1 
ATOM   3628 N N   . GLU B 1 96  ? 53.759  11.446  -20.428 1.00 17.06  ? 96   GLU B N   1 
ATOM   3629 C CA  . GLU B 1 96  ? 53.976  12.148  -19.173 1.00 17.87  ? 96   GLU B CA  1 
ATOM   3630 C C   . GLU B 1 96  ? 54.990  11.418  -18.302 1.00 17.09  ? 96   GLU B C   1 
ATOM   3631 O O   . GLU B 1 96  ? 55.948  12.089  -17.874 1.00 15.74  ? 96   GLU B O   1 
ATOM   3632 C CB  . GLU B 1 96  ? 52.714  12.431  -18.357 1.00 18.10  ? 96   GLU B CB  1 
ATOM   3633 C CG  . GLU B 1 96  ? 51.672  13.206  -19.151 1.00 18.11  ? 96   GLU B CG  1 
ATOM   3634 C CD  . GLU B 1 96  ? 50.339  13.363  -18.451 1.00 19.79  ? 96   GLU B CD  1 
ATOM   3635 O OE1 . GLU B 1 96  ? 49.948  12.477  -17.645 1.00 20.01  ? 96   GLU B OE1 1 
ATOM   3636 O OE2 . GLU B 1 96  ? 49.656  14.372  -18.710 1.00 16.88  ? 96   GLU B OE2 1 
ATOM   3637 N N   . ARG B 1 97  ? 54.881  10.084  -18.148 1.00 15.97  ? 97   ARG B N   1 
ATOM   3638 C CA  . ARG B 1 97  ? 55.921  9.433   -17.330 1.00 16.15  ? 97   ARG B CA  1 
ATOM   3639 C C   . ARG B 1 97  ? 57.324  9.551   -17.940 1.00 17.92  ? 97   ARG B C   1 
ATOM   3640 O O   . ARG B 1 97  ? 58.276  9.612   -17.154 1.00 17.32  ? 97   ARG B O   1 
ATOM   3641 C CB  . ARG B 1 97  ? 55.694  7.976   -17.008 1.00 13.39  ? 97   ARG B CB  1 
ATOM   3642 C CG  . ARG B 1 97  ? 54.389  7.765   -16.221 1.00 15.69  ? 97   ARG B CG  1 
ATOM   3643 C CD  . ARG B 1 97  ? 54.213  6.307   -15.900 1.00 16.90  ? 97   ARG B CD  1 
ATOM   3644 N NE  . ARG B 1 97  ? 53.944  5.442   -17.011 1.00 23.07  ? 97   ARG B NE  1 
ATOM   3645 C CZ  . ARG B 1 97  ? 52.712  5.105   -17.470 1.00 23.13  ? 97   ARG B CZ  1 
ATOM   3646 N NH1 . ARG B 1 97  ? 51.607  5.559   -16.915 1.00 21.86  ? 97   ARG B NH1 1 
ATOM   3647 N NH2 . ARG B 1 97  ? 52.594  4.278   -18.497 1.00 17.03  ? 97   ARG B NH2 1 
ATOM   3648 N N   . ALA B 1 98  ? 57.487  9.653   -19.254 1.00 17.44  ? 98   ALA B N   1 
ATOM   3649 C CA  . ALA B 1 98  ? 58.836  9.726   -19.807 1.00 18.40  ? 98   ALA B CA  1 
ATOM   3650 C C   . ALA B 1 98  ? 59.335  11.148  -19.928 1.00 18.30  ? 98   ALA B C   1 
ATOM   3651 O O   . ALA B 1 98  ? 60.446  11.368  -20.374 1.00 16.69  ? 98   ALA B O   1 
ATOM   3652 C CB  . ALA B 1 98  ? 58.781  9.053   -21.182 1.00 20.02  ? 98   ALA B CB  1 
ATOM   3653 N N   . ASP B 1 99  ? 58.526  12.142  -19.550 1.00 18.61  ? 99   ASP B N   1 
ATOM   3654 C CA  . ASP B 1 99  ? 58.893  13.535  -19.701 1.00 21.12  ? 99   ASP B CA  1 
ATOM   3655 C C   . ASP B 1 99  ? 59.094  13.873  -21.187 1.00 21.81  ? 99   ASP B C   1 
ATOM   3656 O O   . ASP B 1 99  ? 59.944  14.679  -21.568 1.00 22.81  ? 99   ASP B O   1 
ATOM   3657 C CB  . ASP B 1 99  ? 60.175  13.919  -18.946 1.00 22.27  ? 99   ASP B CB  1 
ATOM   3658 C CG  . ASP B 1 99  ? 60.074  13.706  -17.457 1.00 24.83  ? 99   ASP B CG  1 
ATOM   3659 O OD1 . ASP B 1 99  ? 58.981  13.975  -16.916 1.00 24.46  ? 99   ASP B OD1 1 
ATOM   3660 O OD2 . ASP B 1 99  ? 61.071  13.257  -16.805 1.00 25.46  ? 99   ASP B OD2 1 
ATOM   3661 N N   . ALA B 1 100 ? 58.311  13.297  -22.060 1.00 21.81  ? 100  ALA B N   1 
ATOM   3662 C CA  . ALA B 1 100 ? 58.341  13.492  -23.494 1.00 22.51  ? 100  ALA B CA  1 
ATOM   3663 C C   . ALA B 1 100 ? 57.340  14.585  -23.851 1.00 22.42  ? 100  ALA B C   1 
ATOM   3664 O O   . ALA B 1 100 ? 56.617  15.083  -22.992 1.00 22.38  ? 100  ALA B O   1 
ATOM   3665 C CB  . ALA B 1 100 ? 57.985  12.171  -24.169 1.00 22.80  ? 100  ALA B CB  1 
ATOM   3666 N N   . LEU B 1 101 ? 57.255  14.954  -25.116 1.00 22.45  ? 101  LEU B N   1 
ATOM   3667 C CA  . LEU B 1 101 ? 56.355  16.016  -25.543 1.00 21.57  ? 101  LEU B CA  1 
ATOM   3668 C C   . LEU B 1 101 ? 55.575  15.476  -26.747 1.00 21.39  ? 101  LEU B C   1 
ATOM   3669 O O   . LEU B 1 101 ? 56.249  15.035  -27.680 1.00 20.30  ? 101  LEU B O   1 
ATOM   3670 C CB  . LEU B 1 101 ? 57.147  17.218  -25.995 1.00 20.42  ? 101  LEU B CB  1 
ATOM   3671 C CG  . LEU B 1 101 ? 56.709  18.666  -25.865 1.00 24.67  ? 101  LEU B CG  1 
ATOM   3672 C CD1 . LEU B 1 101 ? 57.130  19.440  -27.121 1.00 26.36  ? 101  LEU B CD1 1 
ATOM   3673 C CD2 . LEU B 1 101 ? 55.272  18.954  -25.578 1.00 20.59  ? 101  LEU B CD2 1 
ATOM   3674 N N   . LEU B 1 102 ? 54.258  15.504  -26.688 1.00 20.39  ? 102  LEU B N   1 
ATOM   3675 C CA  . LEU B 1 102 ? 53.449  15.031  -27.797 1.00 20.31  ? 102  LEU B CA  1 
ATOM   3676 C C   . LEU B 1 102 ? 52.676  16.196  -28.405 1.00 20.89  ? 102  LEU B C   1 
ATOM   3677 O O   . LEU B 1 102 ? 52.029  16.881  -27.626 1.00 22.52  ? 102  LEU B O   1 
ATOM   3678 C CB  . LEU B 1 102 ? 52.407  14.010  -27.313 1.00 21.27  ? 102  LEU B CB  1 
ATOM   3679 C CG  . LEU B 1 102 ? 51.228  13.797  -28.312 1.00 23.24  ? 102  LEU B CG  1 
ATOM   3680 C CD1 . LEU B 1 102 ? 51.661  13.009  -29.537 1.00 18.75  ? 102  LEU B CD1 1 
ATOM   3681 C CD2 . LEU B 1 102 ? 50.085  13.087  -27.611 1.00 22.01  ? 102  LEU B CD2 1 
ATOM   3682 N N   . CYS B 1 103 ? 52.671  16.398  -29.704 1.00 22.03  ? 103  CYS B N   1 
ATOM   3683 C CA  . CYS B 1 103 ? 51.870  17.425  -30.359 1.00 21.68  ? 103  CYS B CA  1 
ATOM   3684 C C   . CYS B 1 103 ? 50.607  16.736  -30.870 1.00 20.62  ? 103  CYS B C   1 
ATOM   3685 O O   . CYS B 1 103 ? 50.776  15.763  -31.595 1.00 20.00  ? 103  CYS B O   1 
ATOM   3686 C CB  . CYS B 1 103 ? 52.606  18.075  -31.528 1.00 22.77  ? 103  CYS B CB  1 
ATOM   3687 S SG  . CYS B 1 103 ? 54.105  19.024  -31.149 1.00 21.31  ? 103  CYS B SG  1 
ATOM   3688 N N   . TYR B 1 104 ? 49.419  17.172  -30.496 1.00 21.46  ? 104  TYR B N   1 
ATOM   3689 C CA  . TYR B 1 104 ? 48.139  16.590  -30.881 1.00 20.42  ? 104  TYR B CA  1 
ATOM   3690 C C   . TYR B 1 104 ? 47.423  17.555  -31.821 1.00 20.96  ? 104  TYR B C   1 
ATOM   3691 O O   . TYR B 1 104 ? 46.827  18.539  -31.370 1.00 22.02  ? 104  TYR B O   1 
ATOM   3692 C CB  . TYR B 1 104 ? 47.309  16.384  -29.629 1.00 19.19  ? 104  TYR B CB  1 
ATOM   3693 C CG  . TYR B 1 104 ? 45.927  15.760  -29.750 1.00 18.79  ? 104  TYR B CG  1 
ATOM   3694 C CD1 . TYR B 1 104 ? 45.693  14.494  -30.277 1.00 17.01  ? 104  TYR B CD1 1 
ATOM   3695 C CD2 . TYR B 1 104 ? 44.829  16.482  -29.311 1.00 17.83  ? 104  TYR B CD2 1 
ATOM   3696 C CE1 . TYR B 1 104 ? 44.412  13.971  -30.363 1.00 16.76  ? 104  TYR B CE1 1 
ATOM   3697 C CE2 . TYR B 1 104 ? 43.545  15.988  -29.376 1.00 17.48  ? 104  TYR B CE2 1 
ATOM   3698 C CZ  . TYR B 1 104 ? 43.346  14.720  -29.897 1.00 17.90  ? 104  TYR B CZ  1 
ATOM   3699 O OH  . TYR B 1 104 ? 42.050  14.267  -29.948 1.00 15.82  ? 104  TYR B OH  1 
ATOM   3700 N N   . PRO B 1 105 ? 47.547  17.379  -33.131 1.00 21.02  ? 105  PRO B N   1 
ATOM   3701 C CA  . PRO B 1 105 ? 47.045  18.324  -34.129 1.00 20.12  ? 105  PRO B CA  1 
ATOM   3702 C C   . PRO B 1 105 ? 45.648  17.972  -34.571 1.00 20.54  ? 105  PRO B C   1 
ATOM   3703 O O   . PRO B 1 105 ? 45.339  17.640  -35.717 1.00 21.97  ? 105  PRO B O   1 
ATOM   3704 C CB  . PRO B 1 105 ? 48.048  18.152  -35.271 1.00 21.03  ? 105  PRO B CB  1 
ATOM   3705 C CG  . PRO B 1 105 ? 48.670  16.806  -35.126 1.00 21.40  ? 105  PRO B CG  1 
ATOM   3706 C CD  . PRO B 1 105 ? 48.300  16.261  -33.773 1.00 21.08  ? 105  PRO B CD  1 
ATOM   3707 N N   . THR B 1 106 ? 44.767  17.842  -33.586 1.00 18.70  ? 106  THR B N   1 
ATOM   3708 C CA  . THR B 1 106 ? 43.422  17.321  -33.677 1.00 16.82  ? 106  THR B CA  1 
ATOM   3709 C C   . THR B 1 106 ? 42.410  18.097  -32.864 1.00 16.10  ? 106  THR B C   1 
ATOM   3710 O O   . THR B 1 106 ? 42.729  18.641  -31.801 1.00 16.26  ? 106  THR B O   1 
ATOM   3711 C CB  . THR B 1 106 ? 43.595  15.895  -33.108 1.00 16.26  ? 106  THR B CB  1 
ATOM   3712 O OG1 . THR B 1 106 ? 44.613  15.203  -33.880 1.00 16.18  ? 106  THR B OG1 1 
ATOM   3713 C CG2 . THR B 1 106 ? 42.331  15.043  -33.090 1.00 11.31  ? 106  THR B CG2 1 
ATOM   3714 N N   . PRO B 1 107 ? 41.213  18.290  -33.385 1.00 15.50  ? 107  PRO B N   1 
ATOM   3715 C CA  . PRO B 1 107 ? 40.130  18.968  -32.666 1.00 15.09  ? 107  PRO B CA  1 
ATOM   3716 C C   . PRO B 1 107 ? 39.672  18.116  -31.521 1.00 14.51  ? 107  PRO B C   1 
ATOM   3717 O O   . PRO B 1 107 ? 39.753  16.885  -31.676 1.00 15.22  ? 107  PRO B O   1 
ATOM   3718 C CB  . PRO B 1 107 ? 39.014  19.125  -33.716 1.00 14.71  ? 107  PRO B CB  1 
ATOM   3719 C CG  . PRO B 1 107 ? 39.235  17.939  -34.595 1.00 15.79  ? 107  PRO B CG  1 
ATOM   3720 C CD  . PRO B 1 107 ? 40.725  17.696  -34.657 1.00 15.50  ? 107  PRO B CD  1 
ATOM   3721 N N   . TYR B 1 108 ? 39.270  18.630  -30.357 1.00 15.96  ? 108  TYR B N   1 
ATOM   3722 C CA  . TYR B 1 108 ? 38.824  17.664  -29.323 1.00 14.55  ? 108  TYR B CA  1 
ATOM   3723 C C   . TYR B 1 108 ? 37.803  18.303  -28.411 1.00 13.94  ? 108  TYR B C   1 
ATOM   3724 O O   . TYR B 1 108 ? 37.421  19.459  -28.571 1.00 13.36  ? 108  TYR B O   1 
ATOM   3725 C CB  . TYR B 1 108 ? 40.027  16.966  -28.641 1.00 14.25  ? 108  TYR B CB  1 
ATOM   3726 C CG  . TYR B 1 108 ? 40.579  17.787  -27.485 1.00 13.70  ? 108  TYR B CG  1 
ATOM   3727 C CD1 . TYR B 1 108 ? 41.021  19.090  -27.665 1.00 13.77  ? 108  TYR B CD1 1 
ATOM   3728 C CD2 . TYR B 1 108 ? 40.533  17.258  -26.204 1.00 13.76  ? 108  TYR B CD2 1 
ATOM   3729 C CE1 . TYR B 1 108 ? 41.441  19.848  -26.577 1.00 14.54  ? 108  TYR B CE1 1 
ATOM   3730 C CE2 . TYR B 1 108 ? 41.004  17.986  -25.117 1.00 13.80  ? 108  TYR B CE2 1 
ATOM   3731 C CZ  . TYR B 1 108 ? 41.448  19.269  -25.311 1.00 13.64  ? 108  TYR B CZ  1 
ATOM   3732 O OH  . TYR B 1 108 ? 41.879  19.967  -24.220 1.00 15.00  ? 108  TYR B OH  1 
ATOM   3733 N N   . GLU B 1 109 ? 37.252  17.515  -27.479 1.00 13.45  ? 109  GLU B N   1 
ATOM   3734 C CA  . GLU B 1 109 ? 36.242  17.900  -26.534 1.00 13.86  ? 109  GLU B CA  1 
ATOM   3735 C C   . GLU B 1 109 ? 36.667  18.866  -25.444 1.00 14.20  ? 109  GLU B C   1 
ATOM   3736 O O   . GLU B 1 109 ? 35.755  19.367  -24.742 1.00 15.30  ? 109  GLU B O   1 
ATOM   3737 C CB  . GLU B 1 109 ? 35.624  16.650  -25.863 1.00 14.07  ? 109  GLU B CB  1 
ATOM   3738 C CG  . GLU B 1 109 ? 36.533  15.858  -24.944 1.00 15.27  ? 109  GLU B CG  1 
ATOM   3739 C CD  . GLU B 1 109 ? 37.536  14.929  -25.604 1.00 19.25  ? 109  GLU B CD  1 
ATOM   3740 O OE1 . GLU B 1 109 ? 37.458  14.697  -26.831 1.00 14.16  ? 109  GLU B OE1 1 
ATOM   3741 O OE2 . GLU B 1 109 ? 38.430  14.365  -24.885 1.00 18.57  ? 109  GLU B OE2 1 
ATOM   3742 N N   . GLY B 1 110 ? 37.942  19.179  -25.276 1.00 13.41  ? 110  GLY B N   1 
ATOM   3743 C CA  . GLY B 1 110 ? 38.354  20.112  -24.237 1.00 13.24  ? 110  GLY B CA  1 
ATOM   3744 C C   . GLY B 1 110 ? 38.547  19.383  -22.908 1.00 13.79  ? 110  GLY B C   1 
ATOM   3745 O O   . GLY B 1 110 ? 38.659  18.153  -22.881 1.00 10.89  ? 110  GLY B O   1 
ATOM   3746 N N   . PHE B 1 111 ? 38.519  20.172  -21.823 1.00 13.38  ? 111  PHE B N   1 
ATOM   3747 C CA  . PHE B 1 111 ? 38.617  19.622  -20.471 1.00 15.31  ? 111  PHE B CA  1 
ATOM   3748 C C   . PHE B 1 111 ? 39.825  18.734  -20.228 1.00 15.22  ? 111  PHE B C   1 
ATOM   3749 O O   . PHE B 1 111 ? 39.771  17.678  -19.566 1.00 16.12  ? 111  PHE B O   1 
ATOM   3750 C CB  . PHE B 1 111 ? 37.326  18.862  -20.029 1.00 11.74  ? 111  PHE B CB  1 
ATOM   3751 C CG  . PHE B 1 111 ? 36.175  19.829  -20.034 1.00 12.69  ? 111  PHE B CG  1 
ATOM   3752 C CD1 . PHE B 1 111 ? 35.505  20.114  -21.216 1.00 12.71  ? 111  PHE B CD1 1 
ATOM   3753 C CD2 . PHE B 1 111 ? 35.809  20.521  -18.908 1.00 15.46  ? 111  PHE B CD2 1 
ATOM   3754 C CE1 . PHE B 1 111 ? 34.471  21.021  -21.241 1.00 12.73  ? 111  PHE B CE1 1 
ATOM   3755 C CE2 . PHE B 1 111 ? 34.796  21.458  -18.926 1.00 14.14  ? 111  PHE B CE2 1 
ATOM   3756 C CZ  . PHE B 1 111 ? 34.106  21.706  -20.105 1.00 15.25  ? 111  PHE B CZ  1 
ATOM   3757 N N   . GLU B 1 112 ? 40.965  19.251  -20.661 1.00 15.41  ? 112  GLU B N   1 
ATOM   3758 C CA  . GLU B 1 112 ? 42.216  18.522  -20.420 1.00 16.44  ? 112  GLU B CA  1 
ATOM   3759 C C   . GLU B 1 112 ? 43.393  19.497  -20.363 1.00 15.58  ? 112  GLU B C   1 
ATOM   3760 O O   . GLU B 1 112 ? 43.402  20.536  -21.024 1.00 16.05  ? 112  GLU B O   1 
ATOM   3761 C CB  . GLU B 1 112 ? 42.490  17.449  -21.462 1.00 16.37  ? 112  GLU B CB  1 
ATOM   3762 C CG  . GLU B 1 112 ? 43.614  16.458  -21.103 1.00 15.06  ? 112  GLU B CG  1 
ATOM   3763 C CD  . GLU B 1 112 ? 43.788  15.516  -22.300 1.00 16.31  ? 112  GLU B CD  1 
ATOM   3764 O OE1 . GLU B 1 112 ? 43.030  14.538  -22.418 1.00 14.14  ? 112  GLU B OE1 1 
ATOM   3765 O OE2 . GLU B 1 112 ? 44.697  15.761  -23.128 1.00 16.79  ? 112  GLU B OE2 1 
ATOM   3766 N N   . TYR B 1 113 ? 44.301  19.229  -19.439 1.00 15.51  ? 113  TYR B N   1 
ATOM   3767 C CA  . TYR B 1 113 ? 45.536  19.994  -19.387 1.00 15.88  ? 113  TYR B CA  1 
ATOM   3768 C C   . TYR B 1 113 ? 46.646  18.970  -19.133 1.00 15.75  ? 113  TYR B C   1 
ATOM   3769 O O   . TYR B 1 113 ? 46.628  18.330  -18.072 1.00 18.50  ? 113  TYR B O   1 
ATOM   3770 C CB  . TYR B 1 113 ? 45.729  21.118  -18.398 1.00 13.67  ? 113  TYR B CB  1 
ATOM   3771 C CG  . TYR B 1 113 ? 47.187  21.584  -18.355 1.00 15.29  ? 113  TYR B CG  1 
ATOM   3772 C CD1 . TYR B 1 113 ? 47.718  22.342  -19.394 1.00 14.04  ? 113  TYR B CD1 1 
ATOM   3773 C CD2 . TYR B 1 113 ? 48.032  21.313  -17.284 1.00 16.87  ? 113  TYR B CD2 1 
ATOM   3774 C CE1 . TYR B 1 113 ? 49.009  22.805  -19.377 1.00 13.71  ? 113  TYR B CE1 1 
ATOM   3775 C CE2 . TYR B 1 113 ? 49.352  21.736  -17.244 1.00 13.54  ? 113  TYR B CE2 1 
ATOM   3776 C CZ  . TYR B 1 113 ? 49.823  22.477  -18.308 1.00 14.97  ? 113  TYR B CZ  1 
ATOM   3777 O OH  . TYR B 1 113 ? 51.130  22.941  -18.362 1.00 16.21  ? 113  TYR B OH  1 
ATOM   3778 N N   . SER B 1 114 ? 47.543  18.857  -20.063 1.00 15.93  ? 114  SER B N   1 
ATOM   3779 C CA  . SER B 1 114 ? 48.699  17.979  -19.874 1.00 16.68  ? 114  SER B CA  1 
ATOM   3780 C C   . SER B 1 114 ? 49.926  18.826  -20.158 1.00 17.21  ? 114  SER B C   1 
ATOM   3781 O O   . SER B 1 114 ? 49.962  19.487  -21.181 1.00 16.82  ? 114  SER B O   1 
ATOM   3782 C CB  . SER B 1 114 ? 48.737  16.713  -20.696 1.00 16.13  ? 114  SER B CB  1 
ATOM   3783 O OG  . SER B 1 114 ? 49.991  16.046  -20.585 1.00 14.34  ? 114  SER B OG  1 
ATOM   3784 N N   . PRO B 1 115 ? 50.866  18.862  -19.207 1.00 17.03  ? 115  PRO B N   1 
ATOM   3785 C CA  . PRO B 1 115 ? 52.085  19.607  -19.344 1.00 16.81  ? 115  PRO B CA  1 
ATOM   3786 C C   . PRO B 1 115 ? 52.860  19.096  -20.549 1.00 17.72  ? 115  PRO B C   1 
ATOM   3787 O O   . PRO B 1 115 ? 53.575  19.899  -21.159 1.00 18.43  ? 115  PRO B O   1 
ATOM   3788 C CB  . PRO B 1 115 ? 52.901  19.329  -18.079 1.00 16.51  ? 115  PRO B CB  1 
ATOM   3789 C CG  . PRO B 1 115 ? 51.990  18.606  -17.135 1.00 16.00  ? 115  PRO B CG  1 
ATOM   3790 C CD  . PRO B 1 115 ? 50.828  18.091  -17.939 1.00 16.63  ? 115  PRO B CD  1 
ATOM   3791 N N   . ASN B 1 116 ? 52.724  17.823  -20.903 1.00 17.84  ? 116  ASN B N   1 
ATOM   3792 C CA  . ASN B 1 116 ? 53.431  17.209  -22.008 1.00 17.63  ? 116  ASN B CA  1 
ATOM   3793 C C   . ASN B 1 116 ? 52.640  17.149  -23.306 1.00 18.27  ? 116  ASN B C   1 
ATOM   3794 O O   . ASN B 1 116 ? 53.094  16.404  -24.180 1.00 19.11  ? 116  ASN B O   1 
ATOM   3795 C CB  . ASN B 1 116 ? 53.811  15.768  -21.629 1.00 14.79  ? 116  ASN B CB  1 
ATOM   3796 C CG  . ASN B 1 116 ? 54.563  15.664  -20.315 1.00 14.29  ? 116  ASN B CG  1 
ATOM   3797 O OD1 . ASN B 1 116 ? 53.977  15.822  -19.266 1.00 16.14  ? 116  ASN B OD1 1 
ATOM   3798 N ND2 . ASN B 1 116 ? 55.849  15.351  -20.222 1.00 17.51  ? 116  ASN B ND2 1 
ATOM   3799 N N   . ILE B 1 117 ? 51.540  17.873  -23.506 1.00 16.46  ? 117  ILE B N   1 
ATOM   3800 C CA  . ILE B 1 117 ? 50.818  17.750  -24.780 1.00 16.24  ? 117  ILE B CA  1 
ATOM   3801 C C   . ILE B 1 117 ? 50.650  19.151  -25.371 1.00 16.77  ? 117  ILE B C   1 
ATOM   3802 O O   . ILE B 1 117 ? 50.338  20.063  -24.630 1.00 14.64  ? 117  ILE B O   1 
ATOM   3803 C CB  . ILE B 1 117 ? 49.440  17.067  -24.680 1.00 17.92  ? 117  ILE B CB  1 
ATOM   3804 C CG1 . ILE B 1 117 ? 49.563  15.604  -24.275 1.00 16.91  ? 117  ILE B CG1 1 
ATOM   3805 C CG2 . ILE B 1 117 ? 48.622  17.206  -25.985 1.00 16.09  ? 117  ILE B CG2 1 
ATOM   3806 C CD1 . ILE B 1 117 ? 48.320  14.760  -24.314 1.00 15.53  ? 117  ILE B CD1 1 
ATOM   3807 N N   . VAL B 1 118 ? 50.975  19.354  -26.640 1.00 16.24  ? 118  VAL B N   1 
ATOM   3808 C CA  . VAL B 1 118 ? 50.781  20.706  -27.210 1.00 17.61  ? 118  VAL B CA  1 
ATOM   3809 C C   . VAL B 1 118 ? 49.536  20.548  -28.091 1.00 17.77  ? 118  VAL B C   1 
ATOM   3810 O O   . VAL B 1 118 ? 49.543  19.661  -28.957 1.00 17.13  ? 118  VAL B O   1 
ATOM   3811 C CB  . VAL B 1 118 ? 52.019  21.161  -27.975 1.00 20.04  ? 118  VAL B CB  1 
ATOM   3812 C CG1 . VAL B 1 118 ? 51.769  22.448  -28.746 1.00 19.53  ? 118  VAL B CG1 1 
ATOM   3813 C CG2 . VAL B 1 118 ? 53.182  21.385  -26.996 1.00 19.47  ? 118  VAL B CG2 1 
ATOM   3814 N N   . TYR B 1 119 ? 48.441  21.185  -27.747 1.00 17.36  ? 119  TYR B N   1 
ATOM   3815 C CA  . TYR B 1 119 ? 47.189  20.962  -28.469 1.00 19.07  ? 119  TYR B CA  1 
ATOM   3816 C C   . TYR B 1 119 ? 47.104  21.857  -29.692 1.00 19.89  ? 119  TYR B C   1 
ATOM   3817 O O   . TYR B 1 119 ? 46.880  23.055  -29.566 1.00 21.16  ? 119  TYR B O   1 
ATOM   3818 C CB  . TYR B 1 119 ? 45.998  21.164  -27.524 1.00 17.85  ? 119  TYR B CB  1 
ATOM   3819 C CG  . TYR B 1 119 ? 46.020  20.256  -26.301 1.00 18.78  ? 119  TYR B CG  1 
ATOM   3820 C CD1 . TYR B 1 119 ? 46.896  20.519  -25.245 1.00 20.38  ? 119  TYR B CD1 1 
ATOM   3821 C CD2 . TYR B 1 119 ? 45.169  19.172  -26.159 1.00 17.73  ? 119  TYR B CD2 1 
ATOM   3822 C CE1 . TYR B 1 119 ? 46.934  19.703  -24.118 1.00 20.13  ? 119  TYR B CE1 1 
ATOM   3823 C CE2 . TYR B 1 119 ? 45.203  18.348  -25.058 1.00 19.27  ? 119  TYR B CE2 1 
ATOM   3824 C CZ  . TYR B 1 119 ? 46.068  18.642  -24.010 1.00 20.01  ? 119  TYR B CZ  1 
ATOM   3825 O OH  . TYR B 1 119 ? 46.113  17.866  -22.865 1.00 18.53  ? 119  TYR B OH  1 
ATOM   3826 N N   . GLY B 1 120 ? 47.278  21.291  -30.892 1.00 21.46  ? 120  GLY B N   1 
ATOM   3827 C CA  . GLY B 1 120 ? 47.248  22.087  -32.112 1.00 21.16  ? 120  GLY B CA  1 
ATOM   3828 C C   . GLY B 1 120 ? 45.898  22.167  -32.803 1.00 21.94  ? 120  GLY B C   1 
ATOM   3829 O O   . GLY B 1 120 ? 45.821  22.762  -33.876 1.00 19.81  ? 120  GLY B O   1 
ATOM   3830 N N   . GLY B 1 121 ? 44.863  21.528  -32.244 1.00 21.60  ? 121  GLY B N   1 
ATOM   3831 C CA  . GLY B 1 121 ? 43.524  21.539  -32.839 1.00 21.16  ? 121  GLY B CA  1 
ATOM   3832 C C   . GLY B 1 121 ? 42.591  22.232  -31.832 1.00 21.21  ? 121  GLY B C   1 
ATOM   3833 O O   . GLY B 1 121 ? 42.970  22.457  -30.677 1.00 20.76  ? 121  GLY B O   1 
ATOM   3834 N N   . PRO B 1 122 ? 41.444  22.719  -32.295 1.00 20.71  ? 122  PRO B N   1 
ATOM   3835 C CA  . PRO B 1 122 ? 40.566  23.521  -31.471 1.00 19.90  ? 122  PRO B CA  1 
ATOM   3836 C C   . PRO B 1 122 ? 39.798  22.810  -30.367 1.00 19.43  ? 122  PRO B C   1 
ATOM   3837 O O   . PRO B 1 122 ? 39.413  21.646  -30.490 1.00 17.28  ? 122  PRO B O   1 
ATOM   3838 C CB  . PRO B 1 122 ? 39.569  24.076  -32.489 1.00 21.22  ? 122  PRO B CB  1 
ATOM   3839 C CG  . PRO B 1 122 ? 39.525  23.052  -33.581 1.00 20.71  ? 122  PRO B CG  1 
ATOM   3840 C CD  . PRO B 1 122 ? 40.940  22.558  -33.677 1.00 19.92  ? 122  PRO B CD  1 
ATOM   3841 N N   . ALA B 1 123 ? 39.624  23.548  -29.270 1.00 17.85  ? 123  ALA B N   1 
ATOM   3842 C CA  . ALA B 1 123 ? 38.771  23.077  -28.168 1.00 17.37  ? 123  ALA B CA  1 
ATOM   3843 C C   . ALA B 1 123 ? 37.361  23.525  -28.612 1.00 17.86  ? 123  ALA B C   1 
ATOM   3844 O O   . ALA B 1 123 ? 37.231  24.362  -29.515 1.00 17.32  ? 123  ALA B O   1 
ATOM   3845 C CB  . ALA B 1 123 ? 39.173  23.756  -26.887 1.00 12.24  ? 123  ALA B CB  1 
ATOM   3846 N N   . PRO B 1 124 ? 36.296  23.120  -27.937 1.00 17.97  ? 124  PRO B N   1 
ATOM   3847 C CA  . PRO B 1 124 ? 34.937  23.468  -28.308 1.00 17.44  ? 124  PRO B CA  1 
ATOM   3848 C C   . PRO B 1 124 ? 34.683  24.951  -28.417 1.00 18.79  ? 124  PRO B C   1 
ATOM   3849 O O   . PRO B 1 124 ? 33.890  25.323  -29.301 1.00 18.16  ? 124  PRO B O   1 
ATOM   3850 C CB  . PRO B 1 124 ? 34.039  22.786  -27.276 1.00 15.71  ? 124  PRO B CB  1 
ATOM   3851 C CG  . PRO B 1 124 ? 34.867  21.594  -26.885 1.00 15.59  ? 124  PRO B CG  1 
ATOM   3852 C CD  . PRO B 1 124 ? 36.296  22.142  -26.811 1.00 17.17  ? 124  PRO B CD  1 
ATOM   3853 N N   . ASN B 1 125 ? 35.308  25.834  -27.615 1.00 18.76  ? 125  ASN B N   1 
ATOM   3854 C CA  . ASN B 1 125 ? 35.105  27.254  -27.766 1.00 20.03  ? 125  ASN B CA  1 
ATOM   3855 C C   . ASN B 1 125 ? 35.691  27.745  -29.103 1.00 19.67  ? 125  ASN B C   1 
ATOM   3856 O O   . ASN B 1 125 ? 35.321  28.872  -29.464 1.00 19.40  ? 125  ASN B O   1 
ATOM   3857 C CB  . ASN B 1 125 ? 35.635  28.208  -26.693 1.00 19.53  ? 125  ASN B CB  1 
ATOM   3858 C CG  . ASN B 1 125 ? 37.137  28.397  -26.722 1.00 19.57  ? 125  ASN B CG  1 
ATOM   3859 O OD1 . ASN B 1 125 ? 37.850  27.395  -26.698 1.00 20.10  ? 125  ASN B OD1 1 
ATOM   3860 N ND2 . ASN B 1 125 ? 37.617  29.631  -26.762 1.00 15.27  ? 125  ASN B ND2 1 
ATOM   3861 N N   . GLN B 1 126 ? 36.547  26.961  -29.732 1.00 19.49  ? 126  GLN B N   1 
ATOM   3862 C CA  . GLN B 1 126 ? 37.120  27.351  -31.012 1.00 20.96  ? 126  GLN B CA  1 
ATOM   3863 C C   . GLN B 1 126 ? 36.422  26.751  -32.222 1.00 20.88  ? 126  GLN B C   1 
ATOM   3864 O O   . GLN B 1 126 ? 36.765  27.187  -33.320 1.00 21.57  ? 126  GLN B O   1 
ATOM   3865 C CB  . GLN B 1 126 ? 38.639  27.051  -31.026 1.00 17.53  ? 126  GLN B CB  1 
ATOM   3866 C CG  . GLN B 1 126 ? 39.331  27.673  -29.814 1.00 17.08  ? 126  GLN B CG  1 
ATOM   3867 C CD  . GLN B 1 126 ? 40.769  27.214  -29.670 1.00 16.94  ? 126  GLN B CD  1 
ATOM   3868 O OE1 . GLN B 1 126 ? 41.029  26.040  -29.389 1.00 15.38  ? 126  GLN B OE1 1 
ATOM   3869 N NE2 . GLN B 1 126 ? 41.710  28.136  -29.910 1.00 16.39  ? 126  GLN B NE2 1 
ATOM   3870 N N   . ASN B 1 127 ? 35.584  25.732  -32.171 1.00 21.38  ? 127  ASN B N   1 
ATOM   3871 C CA  . ASN B 1 127 ? 34.893  25.201  -33.332 1.00 22.99  ? 127  ASN B CA  1 
ATOM   3872 C C   . ASN B 1 127 ? 33.392  24.944  -33.087 1.00 23.72  ? 127  ASN B C   1 
ATOM   3873 O O   . ASN B 1 127 ? 32.576  25.555  -33.808 1.00 22.63  ? 127  ASN B O   1 
ATOM   3874 C CB  . ASN B 1 127 ? 35.541  23.970  -33.953 1.00 18.58  ? 127  ASN B CB  1 
ATOM   3875 C CG  . ASN B 1 127 ? 35.825  22.800  -33.054 1.00 18.60  ? 127  ASN B CG  1 
ATOM   3876 O OD1 . ASN B 1 127 ? 35.676  22.752  -31.837 1.00 16.68  ? 127  ASN B OD1 1 
ATOM   3877 N ND2 . ASN B 1 127 ? 36.304  21.700  -33.636 1.00 20.27  ? 127  ASN B ND2 1 
ATOM   3878 N N   . SER B 1 128 ? 32.992  24.127  -32.113 1.00 23.60  ? 128  SER B N   1 
ATOM   3879 C CA  . SER B 1 128 ? 31.577  23.846  -31.897 1.00 24.29  ? 128  SER B CA  1 
ATOM   3880 C C   . SER B 1 128 ? 30.734  25.085  -31.587 1.00 24.66  ? 128  SER B C   1 
ATOM   3881 O O   . SER B 1 128 ? 29.574  25.160  -31.980 1.00 24.28  ? 128  SER B O   1 
ATOM   3882 C CB  . SER B 1 128 ? 31.306  22.904  -30.720 1.00 24.61  ? 128  SER B CB  1 
ATOM   3883 O OG  . SER B 1 128 ? 32.234  21.840  -30.658 1.00 29.55  ? 128  SER B OG  1 
ATOM   3884 N N   . ALA B 1 129 ? 31.272  25.976  -30.761 1.00 24.68  ? 129  ALA B N   1 
ATOM   3885 C CA  . ALA B 1 129 ? 30.510  27.126  -30.303 1.00 25.62  ? 129  ALA B CA  1 
ATOM   3886 C C   . ALA B 1 129 ? 30.146  28.003  -31.495 1.00 27.37  ? 129  ALA B C   1 
ATOM   3887 O O   . ALA B 1 129 ? 28.961  28.220  -31.725 1.00 27.57  ? 129  ALA B O   1 
ATOM   3888 C CB  . ALA B 1 129 ? 31.213  27.886  -29.202 1.00 20.56  ? 129  ALA B CB  1 
ATOM   3889 N N   . PRO B 1 130 ? 31.136  28.497  -32.247 1.00 27.69  ? 130  PRO B N   1 
ATOM   3890 C CA  . PRO B 1 130 ? 30.874  29.288  -33.432 1.00 27.53  ? 130  PRO B CA  1 
ATOM   3891 C C   . PRO B 1 130 ? 29.935  28.538  -34.372 1.00 27.34  ? 130  PRO B C   1 
ATOM   3892 O O   . PRO B 1 130 ? 28.912  29.102  -34.773 1.00 26.02  ? 130  PRO B O   1 
ATOM   3893 C CB  . PRO B 1 130 ? 32.237  29.573  -34.043 1.00 27.98  ? 130  PRO B CB  1 
ATOM   3894 C CG  . PRO B 1 130 ? 33.263  28.860  -33.241 1.00 26.74  ? 130  PRO B CG  1 
ATOM   3895 C CD  . PRO B 1 130 ? 32.579  28.311  -32.013 1.00 27.60  ? 130  PRO B CD  1 
ATOM   3896 N N   . LEU B 1 131 ? 30.159  27.244  -34.609 1.00 27.81  ? 131  LEU B N   1 
ATOM   3897 C CA  . LEU B 1 131 ? 29.288  26.453  -35.457 1.00 27.26  ? 131  LEU B CA  1 
ATOM   3898 C C   . LEU B 1 131 ? 27.859  26.405  -34.930 1.00 27.34  ? 131  LEU B C   1 
ATOM   3899 O O   . LEU B 1 131 ? 26.915  26.438  -35.712 1.00 27.97  ? 131  LEU B O   1 
ATOM   3900 C CB  . LEU B 1 131 ? 29.785  25.011  -35.686 1.00 26.06  ? 131  LEU B CB  1 
ATOM   3901 C CG  . LEU B 1 131 ? 28.862  24.193  -36.607 1.00 27.56  ? 131  LEU B CG  1 
ATOM   3902 C CD1 . LEU B 1 131 ? 28.755  24.782  -38.015 1.00 27.66  ? 131  LEU B CD1 1 
ATOM   3903 C CD2 . LEU B 1 131 ? 29.289  22.741  -36.737 1.00 25.55  ? 131  LEU B CD2 1 
ATOM   3904 N N   . ALA B 1 132 ? 27.656  26.348  -33.619 1.00 27.36  ? 132  ALA B N   1 
ATOM   3905 C CA  . ALA B 1 132 ? 26.327  26.320  -33.024 1.00 27.09  ? 132  ALA B CA  1 
ATOM   3906 C C   . ALA B 1 132 ? 25.629  27.648  -33.286 1.00 26.95  ? 132  ALA B C   1 
ATOM   3907 O O   . ALA B 1 132 ? 24.447  27.671  -33.629 1.00 26.16  ? 132  ALA B O   1 
ATOM   3908 C CB  . ALA B 1 132 ? 26.369  26.065  -31.530 1.00 24.29  ? 132  ALA B CB  1 
ATOM   3909 N N   . ALA B 1 133 ? 26.380  28.734  -33.085 1.00 26.19  ? 133  ALA B N   1 
ATOM   3910 C CA  . ALA B 1 133 ? 25.806  30.055  -33.323 1.00 26.61  ? 133  ALA B CA  1 
ATOM   3911 C C   . ALA B 1 133 ? 25.343  30.165  -34.780 1.00 27.74  ? 133  ALA B C   1 
ATOM   3912 O O   . ALA B 1 133 ? 24.298  30.717  -35.095 1.00 26.38  ? 133  ALA B O   1 
ATOM   3913 C CB  . ALA B 1 133 ? 26.798  31.166  -32.989 1.00 21.25  ? 133  ALA B CB  1 
ATOM   3914 N N   . TYR B 1 134 ? 26.191  29.705  -35.700 1.00 28.58  ? 134  TYR B N   1 
ATOM   3915 C CA  . TYR B 1 134 ? 25.944  29.779  -37.117 1.00 29.35  ? 134  TYR B CA  1 
ATOM   3916 C C   . TYR B 1 134 ? 24.677  29.019  -37.520 1.00 29.24  ? 134  TYR B C   1 
ATOM   3917 O O   . TYR B 1 134 ? 23.827  29.535  -38.236 1.00 27.24  ? 134  TYR B O   1 
ATOM   3918 C CB  . TYR B 1 134 ? 27.181  29.253  -37.847 1.00 29.37  ? 134  TYR B CB  1 
ATOM   3919 C CG  . TYR B 1 134 ? 27.119  29.374  -39.351 1.00 30.89  ? 134  TYR B CG  1 
ATOM   3920 C CD1 . TYR B 1 134 ? 27.588  30.513  -39.995 1.00 31.65  ? 134  TYR B CD1 1 
ATOM   3921 C CD2 . TYR B 1 134 ? 26.609  28.336  -40.121 1.00 31.79  ? 134  TYR B CD2 1 
ATOM   3922 C CE1 . TYR B 1 134 ? 27.546  30.594  -41.379 1.00 33.39  ? 134  TYR B CE1 1 
ATOM   3923 C CE2 . TYR B 1 134 ? 26.558  28.413  -41.502 1.00 33.04  ? 134  TYR B CE2 1 
ATOM   3924 C CZ  . TYR B 1 134 ? 27.029  29.552  -42.116 1.00 33.63  ? 134  TYR B CZ  1 
ATOM   3925 O OH  . TYR B 1 134 ? 27.001  29.653  -43.482 1.00 35.98  ? 134  TYR B OH  1 
ATOM   3926 N N   . LEU B 1 135 ? 24.611  27.770  -37.088 1.00 29.72  ? 135  LEU B N   1 
ATOM   3927 C CA  . LEU B 1 135 ? 23.495  26.882  -37.339 1.00 31.40  ? 135  LEU B CA  1 
ATOM   3928 C C   . LEU B 1 135 ? 22.163  27.385  -36.806 1.00 31.57  ? 135  LEU B C   1 
ATOM   3929 O O   . LEU B 1 135 ? 21.117  27.315  -37.463 1.00 31.01  ? 135  LEU B O   1 
ATOM   3930 C CB  . LEU B 1 135 ? 23.766  25.488  -36.753 1.00 29.06  ? 135  LEU B CB  1 
ATOM   3931 C CG  . LEU B 1 135 ? 24.930  24.740  -37.396 1.00 32.73  ? 135  LEU B CG  1 
ATOM   3932 C CD1 . LEU B 1 135 ? 25.010  23.310  -36.879 1.00 29.97  ? 135  LEU B CD1 1 
ATOM   3933 C CD2 . LEU B 1 135 ? 24.811  24.777  -38.927 1.00 33.34  ? 135  LEU B CD2 1 
ATOM   3934 N N   . ILE B 1 136 ? 22.167  27.888  -35.584 1.00 32.28  ? 136  ILE B N   1 
ATOM   3935 C CA  . ILE B 1 136 ? 20.911  28.408  -35.000 1.00 33.02  ? 136  ILE B CA  1 
ATOM   3936 C C   . ILE B 1 136 ? 20.504  29.668  -35.747 1.00 34.76  ? 136  ILE B C   1 
ATOM   3937 O O   . ILE B 1 136 ? 19.320  30.003  -35.845 1.00 34.43  ? 136  ILE B O   1 
ATOM   3938 C CB  . ILE B 1 136 ? 21.146  28.602  -33.499 1.00 29.95  ? 136  ILE B CB  1 
ATOM   3939 C CG1 . ILE B 1 136 ? 21.212  27.213  -32.839 1.00 28.63  ? 136  ILE B CG1 1 
ATOM   3940 C CG2 . ILE B 1 136 ? 20.109  29.474  -32.832 1.00 29.54  ? 136  ILE B CG2 1 
ATOM   3941 C CD1 . ILE B 1 136 ? 21.921  27.224  -31.495 1.00 27.84  ? 136  ILE B CD1 1 
ATOM   3942 N N   . ARG B 1 137 ? 21.461  30.408  -36.274 1.00 36.17  ? 137  ARG B N   1 
ATOM   3943 C CA  . ARG B 1 137 ? 21.244  31.622  -37.024 1.00 39.74  ? 137  ARG B CA  1 
ATOM   3944 C C   . ARG B 1 137 ? 20.655  31.401  -38.416 1.00 40.78  ? 137  ARG B C   1 
ATOM   3945 O O   . ARG B 1 137 ? 19.823  32.203  -38.841 1.00 41.06  ? 137  ARG B O   1 
ATOM   3946 C CB  . ARG B 1 137 ? 22.568  32.385  -37.205 1.00 41.69  ? 137  ARG B CB  1 
ATOM   3947 C CG  . ARG B 1 137 ? 22.402  33.749  -37.850 1.00 47.43  ? 137  ARG B CG  1 
ATOM   3948 C CD  . ARG B 1 137 ? 23.528  34.697  -37.497 1.00 50.93  ? 137  ARG B CD  1 
ATOM   3949 N NE  . ARG B 1 137 ? 23.506  35.156  -36.114 1.00 53.58  ? 137  ARG B NE  1 
ATOM   3950 C CZ  . ARG B 1 137 ? 23.023  36.316  -35.691 1.00 53.39  ? 137  ARG B CZ  1 
ATOM   3951 N NH1 . ARG B 1 137 ? 22.512  37.153  -36.585 1.00 54.60  ? 137  ARG B NH1 1 
ATOM   3952 N NH2 . ARG B 1 137 ? 23.073  36.598  -34.398 1.00 53.46  ? 137  ARG B NH2 1 
ATOM   3953 N N   . HIS B 1 138 ? 21.134  30.410  -39.165 1.00 41.04  ? 138  HIS B N   1 
ATOM   3954 C CA  . HIS B 1 138 ? 20.726  30.212  -40.534 1.00 40.66  ? 138  HIS B CA  1 
ATOM   3955 C C   . HIS B 1 138 ? 19.837  29.020  -40.815 1.00 41.14  ? 138  HIS B C   1 
ATOM   3956 O O   . HIS B 1 138 ? 19.398  28.948  -41.966 1.00 40.91  ? 138  HIS B O   1 
ATOM   3957 C CB  . HIS B 1 138 ? 21.967  29.992  -41.437 1.00 38.21  ? 138  HIS B CB  1 
ATOM   3958 C CG  . HIS B 1 138 ? 22.866  31.183  -41.357 1.00 41.05  ? 138  HIS B CG  1 
ATOM   3959 N ND1 . HIS B 1 138 ? 22.352  32.462  -41.436 1.00 41.68  ? 138  HIS B ND1 1 
ATOM   3960 C CD2 . HIS B 1 138 ? 24.198  31.311  -41.168 1.00 40.89  ? 138  HIS B CD2 1 
ATOM   3961 C CE1 . HIS B 1 138 ? 23.346  33.327  -41.297 1.00 42.91  ? 138  HIS B CE1 1 
ATOM   3962 N NE2 . HIS B 1 138 ? 24.472  32.653  -41.139 1.00 42.27  ? 138  HIS B NE2 1 
ATOM   3963 N N   . TYR B 1 139 ? 19.796  28.015  -39.947 1.00 40.61  ? 139  TYR B N   1 
ATOM   3964 C CA  . TYR B 1 139 ? 19.019  26.809  -40.286 1.00 40.23  ? 139  TYR B CA  1 
ATOM   3965 C C   . TYR B 1 139 ? 17.825  26.724  -39.359 1.00 39.33  ? 139  TYR B C   1 
ATOM   3966 O O   . TYR B 1 139 ? 17.764  27.482  -38.396 1.00 38.49  ? 139  TYR B O   1 
ATOM   3967 C CB  . TYR B 1 139 ? 19.959  25.605  -40.331 1.00 40.64  ? 139  TYR B CB  1 
ATOM   3968 C CG  . TYR B 1 139 ? 21.021  25.694  -41.407 1.00 42.27  ? 139  TYR B CG  1 
ATOM   3969 C CD1 . TYR B 1 139 ? 22.204  26.388  -41.172 1.00 42.92  ? 139  TYR B CD1 1 
ATOM   3970 C CD2 . TYR B 1 139 ? 20.852  25.133  -42.667 1.00 42.98  ? 139  TYR B CD2 1 
ATOM   3971 C CE1 . TYR B 1 139 ? 23.180  26.521  -42.139 1.00 42.74  ? 139  TYR B CE1 1 
ATOM   3972 C CE2 . TYR B 1 139 ? 21.819  25.249  -43.644 1.00 43.42  ? 139  TYR B CE2 1 
ATOM   3973 C CZ  . TYR B 1 139 ? 22.979  25.950  -43.381 1.00 43.44  ? 139  TYR B CZ  1 
ATOM   3974 O OH  . TYR B 1 139 ? 23.954  26.064  -44.348 1.00 42.69  ? 139  TYR B OH  1 
ATOM   3975 N N   . GLY B 1 140 ? 16.831  25.908  -39.656 1.00 39.93  ? 140  GLY B N   1 
ATOM   3976 C CA  . GLY B 1 140 ? 15.627  25.762  -38.842 1.00 40.65  ? 140  GLY B CA  1 
ATOM   3977 C C   . GLY B 1 140 ? 16.043  25.187  -37.493 1.00 41.71  ? 140  GLY B C   1 
ATOM   3978 O O   . GLY B 1 140 ? 17.105  24.580  -37.432 1.00 42.13  ? 140  GLY B O   1 
ATOM   3979 N N   . GLU B 1 141 ? 15.255  25.350  -36.448 1.00 42.42  ? 141  GLU B N   1 
ATOM   3980 C CA  . GLU B 1 141 ? 15.626  24.878  -35.133 1.00 43.46  ? 141  GLU B CA  1 
ATOM   3981 C C   . GLU B 1 141 ? 15.252  23.438  -34.798 1.00 41.77  ? 141  GLU B C   1 
ATOM   3982 O O   . GLU B 1 141 ? 15.497  23.095  -33.629 1.00 41.20  ? 141  GLU B O   1 
ATOM   3983 C CB  . GLU B 1 141 ? 15.069  25.789  -34.032 1.00 49.69  ? 141  GLU B CB  1 
ATOM   3984 C CG  . GLU B 1 141 ? 13.798  26.533  -34.337 1.00 51.87  ? 141  GLU B CG  1 
ATOM   3985 C CD  . GLU B 1 141 ? 12.614  25.688  -34.710 1.00 54.98  ? 141  GLU B CD  1 
ATOM   3986 O OE1 . GLU B 1 141 ? 12.791  24.497  -35.040 1.00 56.99  ? 141  GLU B OE1 1 
ATOM   3987 O OE2 . GLU B 1 141 ? 11.470  26.203  -34.685 1.00 56.37  ? 141  GLU B OE2 1 
ATOM   3988 N N   . ARG B 1 142 ? 14.675  22.683  -35.734 1.00 38.83  ? 142  ARG B N   1 
ATOM   3989 C CA  . ARG B 1 142 ? 14.453  21.260  -35.437 1.00 35.07  ? 142  ARG B CA  1 
ATOM   3990 C C   . ARG B 1 142 ? 15.663  20.509  -35.993 1.00 32.53  ? 142  ARG B C   1 
ATOM   3991 O O   . ARG B 1 142 ? 15.946  20.526  -37.197 1.00 32.43  ? 142  ARG B O   1 
ATOM   3992 C CB  . ARG B 1 142 ? 13.118  20.734  -35.949 1.00 36.88  ? 142  ARG B CB  1 
ATOM   3993 C CG  . ARG B 1 142 ? 11.939  21.429  -35.288 1.00 39.37  ? 142  ARG B CG  1 
ATOM   3994 C CD  . ARG B 1 142 ? 10.592  21.216  -35.964 1.00 43.25  ? 142  ARG B CD  1 
ATOM   3995 N NE  . ARG B 1 142 ? 10.130  19.849  -35.814 1.00 46.92  ? 142  ARG B NE  1 
ATOM   3996 C CZ  . ARG B 1 142 ? 10.278  18.904  -36.742 1.00 49.95  ? 142  ARG B CZ  1 
ATOM   3997 N NH1 . ARG B 1 142 ? 10.803  19.173  -37.932 1.00 49.40  ? 142  ARG B NH1 1 
ATOM   3998 N NH2 . ARG B 1 142 ? 9.836   17.664  -36.500 1.00 51.63  ? 142  ARG B NH2 1 
ATOM   3999 N N   . VAL B 1 143 ? 16.470  19.939  -35.096 1.00 28.51  ? 143  VAL B N   1 
ATOM   4000 C CA  . VAL B 1 143 ? 17.674  19.261  -35.564 1.00 25.90  ? 143  VAL B CA  1 
ATOM   4001 C C   . VAL B 1 143 ? 17.697  17.789  -35.232 1.00 24.23  ? 143  VAL B C   1 
ATOM   4002 O O   . VAL B 1 143 ? 17.092  17.363  -34.248 1.00 25.06  ? 143  VAL B O   1 
ATOM   4003 C CB  . VAL B 1 143 ? 18.882  19.979  -34.924 1.00 25.59  ? 143  VAL B CB  1 
ATOM   4004 C CG1 . VAL B 1 143 ? 18.869  19.740  -33.406 1.00 22.40  ? 143  VAL B CG1 1 
ATOM   4005 C CG2 . VAL B 1 143 ? 20.183  19.501  -35.533 1.00 22.57  ? 143  VAL B CG2 1 
ATOM   4006 N N   . VAL B 1 144 ? 18.401  16.973  -35.988 1.00 23.32  ? 144  VAL B N   1 
ATOM   4007 C CA  . VAL B 1 144 ? 18.617  15.555  -35.712 1.00 21.68  ? 144  VAL B CA  1 
ATOM   4008 C C   . VAL B 1 144 ? 20.143  15.304  -35.654 1.00 22.18  ? 144  VAL B C   1 
ATOM   4009 O O   . VAL B 1 144 ? 20.933  15.779  -36.491 1.00 20.36  ? 144  VAL B O   1 
ATOM   4010 C CB  . VAL B 1 144 ? 17.938  14.656  -36.739 1.00 25.62  ? 144  VAL B CB  1 
ATOM   4011 C CG1 . VAL B 1 144 ? 18.472  14.862  -38.164 1.00 24.76  ? 144  VAL B CG1 1 
ATOM   4012 C CG2 . VAL B 1 144 ? 18.065  13.179  -36.390 1.00 23.84  ? 144  VAL B CG2 1 
ATOM   4013 N N   . PHE B 1 145 ? 20.630  14.634  -34.586 1.00 20.04  ? 145  PHE B N   1 
ATOM   4014 C CA  . PHE B 1 145 ? 22.025  14.357  -34.412 1.00 17.39  ? 145  PHE B CA  1 
ATOM   4015 C C   . PHE B 1 145 ? 22.334  12.911  -34.802 1.00 17.79  ? 145  PHE B C   1 
ATOM   4016 O O   . PHE B 1 145 ? 21.574  12.007  -34.477 1.00 18.04  ? 145  PHE B O   1 
ATOM   4017 C CB  . PHE B 1 145 ? 22.513  14.538  -32.962 1.00 15.97  ? 145  PHE B CB  1 
ATOM   4018 C CG  . PHE B 1 145 ? 22.378  15.864  -32.276 1.00 16.03  ? 145  PHE B CG  1 
ATOM   4019 C CD1 . PHE B 1 145 ? 21.960  17.007  -32.935 1.00 16.66  ? 145  PHE B CD1 1 
ATOM   4020 C CD2 . PHE B 1 145 ? 22.762  16.011  -30.950 1.00 18.13  ? 145  PHE B CD2 1 
ATOM   4021 C CE1 . PHE B 1 145 ? 21.838  18.216  -32.292 1.00 16.45  ? 145  PHE B CE1 1 
ATOM   4022 C CE2 . PHE B 1 145 ? 22.669  17.216  -30.283 1.00 15.47  ? 145  PHE B CE2 1 
ATOM   4023 C CZ  . PHE B 1 145 ? 22.211  18.321  -30.964 1.00 18.16  ? 145  PHE B CZ  1 
ATOM   4024 N N   . ILE B 1 146 ? 23.496  12.700  -35.413 1.00 17.03  ? 146  ILE B N   1 
ATOM   4025 C CA  . ILE B 1 146 ? 24.030  11.404  -35.753 1.00 18.96  ? 146  ILE B CA  1 
ATOM   4026 C C   . ILE B 1 146 ? 25.554  11.430  -35.543 1.00 20.30  ? 146  ILE B C   1 
ATOM   4027 O O   . ILE B 1 146 ? 26.263  12.273  -36.093 1.00 19.32  ? 146  ILE B O   1 
ATOM   4028 C CB  . ILE B 1 146 ? 23.703  10.897  -37.180 1.00 22.37  ? 146  ILE B CB  1 
ATOM   4029 C CG1 . ILE B 1 146 ? 24.428  9.565   -37.378 1.00 22.87  ? 146  ILE B CG1 1 
ATOM   4030 C CG2 . ILE B 1 146 ? 24.055  11.893  -38.277 1.00 14.56  ? 146  ILE B CG2 1 
ATOM   4031 C CD1 . ILE B 1 146 ? 23.644  8.464   -38.002 1.00 25.53  ? 146  ILE B CD1 1 
ATOM   4032 N N   . GLY B 1 147 ? 26.083  10.522  -34.713 1.00 21.58  ? 147  GLY B N   1 
ATOM   4033 C CA  . GLY B 1 147 ? 27.516  10.541  -34.405 1.00 21.31  ? 147  GLY B CA  1 
ATOM   4034 C C   . GLY B 1 147 ? 28.035  9.117   -34.224 1.00 22.88  ? 147  GLY B C   1 
ATOM   4035 O O   . GLY B 1 147 ? 27.212  8.188   -34.082 1.00 22.17  ? 147  GLY B O   1 
ATOM   4036 N N   . SER B 1 148 ? 29.351  8.962   -34.338 1.00 21.27  ? 148  SER B N   1 
ATOM   4037 C CA  . SER B 1 148 ? 29.951  7.665   -34.087 1.00 22.74  ? 148  SER B CA  1 
ATOM   4038 C C   . SER B 1 148 ? 29.927  7.429   -32.565 1.00 22.00  ? 148  SER B C   1 
ATOM   4039 O O   . SER B 1 148 ? 30.080  8.385   -31.807 1.00 23.10  ? 148  SER B O   1 
ATOM   4040 C CB  . SER B 1 148 ? 31.402  7.538   -34.538 1.00 22.39  ? 148  SER B CB  1 
ATOM   4041 O OG  . SER B 1 148 ? 31.520  8.001   -35.866 1.00 22.60  ? 148  SER B OG  1 
ATOM   4042 N N   . ASP B 1 149 ? 29.770  6.194   -32.141 1.00 21.37  ? 149  ASP B N   1 
ATOM   4043 C CA  . ASP B 1 149 ? 29.731  5.881   -30.734 1.00 22.58  ? 149  ASP B CA  1 
ATOM   4044 C C   . ASP B 1 149 ? 31.068  5.780   -30.013 1.00 21.94  ? 149  ASP B C   1 
ATOM   4045 O O   . ASP B 1 149 ? 31.623  4.702   -29.797 1.00 22.49  ? 149  ASP B O   1 
ATOM   4046 C CB  . ASP B 1 149 ? 28.873  4.634   -30.535 1.00 23.92  ? 149  ASP B CB  1 
ATOM   4047 C CG  . ASP B 1 149 ? 28.618  4.348   -29.067 1.00 27.28  ? 149  ASP B CG  1 
ATOM   4048 O OD1 . ASP B 1 149 ? 28.637  5.286   -28.240 1.00 26.35  ? 149  ASP B OD1 1 
ATOM   4049 O OD2 . ASP B 1 149 ? 28.443  3.148   -28.766 1.00 31.07  ? 149  ASP B OD2 1 
ATOM   4050 N N   . TYR B 1 150 ? 31.612  6.939   -29.623 1.00 21.12  ? 150  TYR B N   1 
ATOM   4051 C CA  . TYR B 1 150 ? 32.817  7.012   -28.790 1.00 18.43  ? 150  TYR B CA  1 
ATOM   4052 C C   . TYR B 1 150 ? 32.737  8.376   -28.102 1.00 18.76  ? 150  TYR B C   1 
ATOM   4053 O O   . TYR B 1 150 ? 31.779  9.101   -28.409 1.00 18.96  ? 150  TYR B O   1 
ATOM   4054 C CB  . TYR B 1 150 ? 34.133  6.730   -29.468 1.00 18.03  ? 150  TYR B CB  1 
ATOM   4055 C CG  . TYR B 1 150 ? 34.676  7.793   -30.386 1.00 18.58  ? 150  TYR B CG  1 
ATOM   4056 C CD1 . TYR B 1 150 ? 34.170  8.051   -31.667 1.00 17.37  ? 150  TYR B CD1 1 
ATOM   4057 C CD2 . TYR B 1 150 ? 35.752  8.558   -29.944 1.00 17.86  ? 150  TYR B CD2 1 
ATOM   4058 C CE1 . TYR B 1 150 ? 34.726  9.055   -32.450 1.00 17.34  ? 150  TYR B CE1 1 
ATOM   4059 C CE2 . TYR B 1 150 ? 36.276  9.578   -30.703 1.00 16.47  ? 150  TYR B CE2 1 
ATOM   4060 C CZ  . TYR B 1 150 ? 35.759  9.820   -31.958 1.00 16.92  ? 150  TYR B CZ  1 
ATOM   4061 O OH  . TYR B 1 150 ? 36.345  10.847  -32.673 1.00 15.92  ? 150  TYR B OH  1 
ATOM   4062 N N   . ILE B 1 151 ? 33.635  8.708   -27.180 1.00 17.57  ? 151  ILE B N   1 
ATOM   4063 C CA  . ILE B 1 151 ? 33.550  9.925   -26.384 1.00 16.39  ? 151  ILE B CA  1 
ATOM   4064 C C   . ILE B 1 151 ? 33.460  11.233  -27.110 1.00 15.22  ? 151  ILE B C   1 
ATOM   4065 O O   . ILE B 1 151 ? 32.672  12.128  -26.725 1.00 15.53  ? 151  ILE B O   1 
ATOM   4066 C CB  . ILE B 1 151 ? 34.721  9.907   -25.346 1.00 19.91  ? 151  ILE B CB  1 
ATOM   4067 C CG1 . ILE B 1 151 ? 34.557  10.983  -24.244 1.00 22.13  ? 151  ILE B CG1 1 
ATOM   4068 C CG2 . ILE B 1 151 ? 36.073  10.140  -25.998 1.00 19.87  ? 151  ILE B CG2 1 
ATOM   4069 C CD1 . ILE B 1 151 ? 33.409  10.654  -23.293 1.00 19.96  ? 151  ILE B CD1 1 
ATOM   4070 N N   . TYR B 1 152 ? 34.267  11.503  -28.146 1.00 14.48  ? 152  TYR B N   1 
ATOM   4071 C CA  . TYR B 1 152 ? 34.145  12.836  -28.774 1.00 16.16  ? 152  TYR B CA  1 
ATOM   4072 C C   . TYR B 1 152 ? 32.786  13.209  -29.332 1.00 15.46  ? 152  TYR B C   1 
ATOM   4073 O O   . TYR B 1 152 ? 32.272  14.285  -29.007 1.00 17.43  ? 152  TYR B O   1 
ATOM   4074 C CB  . TYR B 1 152 ? 35.285  13.067  -29.783 1.00 15.75  ? 152  TYR B CB  1 
ATOM   4075 C CG  . TYR B 1 152 ? 35.181  14.402  -30.481 1.00 17.16  ? 152  TYR B CG  1 
ATOM   4076 C CD1 . TYR B 1 152 ? 35.524  15.559  -29.809 1.00 16.05  ? 152  TYR B CD1 1 
ATOM   4077 C CD2 . TYR B 1 152 ? 34.681  14.498  -31.782 1.00 18.65  ? 152  TYR B CD2 1 
ATOM   4078 C CE1 . TYR B 1 152 ? 35.437  16.787  -30.418 1.00 16.81  ? 152  TYR B CE1 1 
ATOM   4079 C CE2 . TYR B 1 152 ? 34.615  15.736  -32.421 1.00 18.42  ? 152  TYR B CE2 1 
ATOM   4080 C CZ  . TYR B 1 152 ? 34.991  16.869  -31.729 1.00 18.05  ? 152  TYR B CZ  1 
ATOM   4081 O OH  . TYR B 1 152 ? 34.940  18.113  -32.285 1.00 15.36  ? 152  TYR B OH  1 
ATOM   4082 N N   . PRO B 1 153 ? 32.139  12.468  -30.201 1.00 15.58  ? 153  PRO B N   1 
ATOM   4083 C CA  . PRO B 1 153 ? 30.811  12.782  -30.720 1.00 16.93  ? 153  PRO B CA  1 
ATOM   4084 C C   . PRO B 1 153 ? 29.827  12.927  -29.554 1.00 18.08  ? 153  PRO B C   1 
ATOM   4085 O O   . PRO B 1 153 ? 28.963  13.782  -29.487 1.00 17.35  ? 153  PRO B O   1 
ATOM   4086 C CB  . PRO B 1 153 ? 30.473  11.549  -31.581 1.00 17.17  ? 153  PRO B CB  1 
ATOM   4087 C CG  . PRO B 1 153 ? 31.795  10.994  -32.002 1.00 16.66  ? 153  PRO B CG  1 
ATOM   4088 C CD  . PRO B 1 153 ? 32.689  11.201  -30.770 1.00 17.24  ? 153  PRO B CD  1 
ATOM   4089 N N   . ARG B 1 154 ? 29.911  12.055  -28.536 1.00 18.81  ? 154  ARG B N   1 
ATOM   4090 C CA  . ARG B 1 154 ? 29.092  12.082  -27.345 1.00 19.90  ? 154  ARG B CA  1 
ATOM   4091 C C   . ARG B 1 154 ? 29.267  13.344  -26.517 1.00 20.44  ? 154  ARG B C   1 
ATOM   4092 O O   . ARG B 1 154 ? 28.239  13.953  -26.170 1.00 18.90  ? 154  ARG B O   1 
ATOM   4093 C CB  . ARG B 1 154 ? 29.372  10.826  -26.499 1.00 21.87  ? 154  ARG B CB  1 
ATOM   4094 C CG  . ARG B 1 154 ? 28.465  9.726   -27.062 1.00 27.76  ? 154  ARG B CG  1 
ATOM   4095 C CD  . ARG B 1 154 ? 28.798  8.384   -26.459 1.00 29.09  ? 154  ARG B CD  1 
ATOM   4096 N NE  . ARG B 1 154 ? 27.860  7.357   -26.832 1.00 28.78  ? 154  ARG B NE  1 
ATOM   4097 C CZ  . ARG B 1 154 ? 26.571  7.150   -26.822 1.00 23.65  ? 154  ARG B CZ  1 
ATOM   4098 N NH1 . ARG B 1 154 ? 25.719  8.047   -26.376 1.00 26.36  ? 154  ARG B NH1 1 
ATOM   4099 N NH2 . ARG B 1 154 ? 26.110  5.980   -27.255 1.00 16.81  ? 154  ARG B NH2 1 
ATOM   4100 N N   . GLU B 1 155 ? 30.524  13.784  -26.309 1.00 19.49  ? 155  GLU B N   1 
ATOM   4101 C CA  . GLU B 1 155 ? 30.723  15.032  -25.585 1.00 19.33  ? 155  GLU B CA  1 
ATOM   4102 C C   . GLU B 1 155 ? 30.257  16.189  -26.470 1.00 18.28  ? 155  GLU B C   1 
ATOM   4103 O O   . GLU B 1 155 ? 29.555  17.116  -26.031 1.00 15.53  ? 155  GLU B O   1 
ATOM   4104 C CB  . GLU B 1 155 ? 32.204  15.235  -25.177 1.00 24.11  ? 155  GLU B CB  1 
ATOM   4105 C CG  . GLU B 1 155 ? 32.638  14.350  -24.012 1.00 23.50  ? 155  GLU B CG  1 
ATOM   4106 C CD  . GLU B 1 155 ? 31.975  14.691  -22.692 1.00 23.36  ? 155  GLU B CD  1 
ATOM   4107 O OE1 . GLU B 1 155 ? 31.187  15.665  -22.570 1.00 21.50  ? 155  GLU B OE1 1 
ATOM   4108 O OE2 . GLU B 1 155 ? 32.246  13.988  -21.703 1.00 19.50  ? 155  GLU B OE2 1 
ATOM   4109 N N   . SER B 1 156 ? 30.629  16.097  -27.757 1.00 17.32  ? 156  SER B N   1 
ATOM   4110 C CA  . SER B 1 156 ? 30.190  17.153  -28.709 1.00 17.83  ? 156  SER B CA  1 
ATOM   4111 C C   . SER B 1 156 ? 28.666  17.252  -28.773 1.00 17.94  ? 156  SER B C   1 
ATOM   4112 O O   . SER B 1 156 ? 28.128  18.369  -28.739 1.00 16.99  ? 156  SER B O   1 
ATOM   4113 C CB  . SER B 1 156 ? 30.794  16.889  -30.079 1.00 19.02  ? 156  SER B CB  1 
ATOM   4114 O OG  . SER B 1 156 ? 32.222  16.843  -30.031 1.00 22.89  ? 156  SER B OG  1 
ATOM   4115 N N   . ASN B 1 157 ? 27.935  16.139  -28.745 1.00 16.67  ? 157  ASN B N   1 
ATOM   4116 C CA  . ASN B 1 157 ? 26.474  16.183  -28.712 1.00 18.74  ? 157  ASN B CA  1 
ATOM   4117 C C   . ASN B 1 157 ? 25.912  16.708  -27.394 1.00 20.52  ? 157  ASN B C   1 
ATOM   4118 O O   . ASN B 1 157 ? 24.920  17.446  -27.385 1.00 18.64  ? 157  ASN B O   1 
ATOM   4119 C CB  . ASN B 1 157 ? 25.895  14.808  -29.027 1.00 15.15  ? 157  ASN B CB  1 
ATOM   4120 C CG  . ASN B 1 157 ? 25.947  14.619  -30.551 1.00 15.34  ? 157  ASN B CG  1 
ATOM   4121 O OD1 . ASN B 1 157 ? 26.070  15.618  -31.264 1.00 15.22  ? 157  ASN B OD1 1 
ATOM   4122 N ND2 . ASN B 1 157 ? 25.828  13.373  -30.985 1.00 11.29  ? 157  ASN B ND2 1 
ATOM   4123 N N   . HIS B 1 158 ? 26.644  16.374  -26.299 1.00 20.62  ? 158  HIS B N   1 
ATOM   4124 C CA  . HIS B 1 158 ? 26.226  16.864  -24.992 1.00 20.65  ? 158  HIS B CA  1 
ATOM   4125 C C   . HIS B 1 158 ? 26.177  18.375  -25.040 1.00 21.27  ? 158  HIS B C   1 
ATOM   4126 O O   . HIS B 1 158 ? 25.175  18.948  -24.610 1.00 22.03  ? 158  HIS B O   1 
ATOM   4127 C CB  . HIS B 1 158 ? 27.145  16.299  -23.896 1.00 21.92  ? 158  HIS B CB  1 
ATOM   4128 C CG  . HIS B 1 158 ? 26.766  16.814  -22.539 1.00 19.96  ? 158  HIS B CG  1 
ATOM   4129 N ND1 . HIS B 1 158 ? 26.005  16.068  -21.644 1.00 21.36  ? 158  HIS B ND1 1 
ATOM   4130 C CD2 . HIS B 1 158 ? 27.028  18.003  -21.950 1.00 18.20  ? 158  HIS B CD2 1 
ATOM   4131 C CE1 . HIS B 1 158 ? 25.835  16.802  -20.554 1.00 19.31  ? 158  HIS B CE1 1 
ATOM   4132 N NE2 . HIS B 1 158 ? 26.429  17.976  -20.711 1.00 19.07  ? 158  HIS B NE2 1 
ATOM   4133 N N   . VAL B 1 159 ? 27.167  19.089  -25.556 1.00 20.42  ? 159  VAL B N   1 
ATOM   4134 C CA  . VAL B 1 159 ? 27.121  20.535  -25.654 1.00 20.94  ? 159  VAL B CA  1 
ATOM   4135 C C   . VAL B 1 159 ? 26.056  21.044  -26.630 1.00 20.78  ? 159  VAL B C   1 
ATOM   4136 O O   . VAL B 1 159 ? 25.316  21.987  -26.354 1.00 20.30  ? 159  VAL B O   1 
ATOM   4137 C CB  . VAL B 1 159 ? 28.486  21.070  -26.168 1.00 21.65  ? 159  VAL B CB  1 
ATOM   4138 C CG1 . VAL B 1 159 ? 28.429  22.514  -26.604 1.00 17.97  ? 159  VAL B CG1 1 
ATOM   4139 C CG2 . VAL B 1 159 ? 29.566  20.865  -25.112 1.00 24.35  ? 159  VAL B CG2 1 
ATOM   4140 N N   . MET B 1 160 ? 26.042  20.500  -27.840 1.00 21.93  ? 160  MET B N   1 
ATOM   4141 C CA  . MET B 1 160 ? 25.122  20.939  -28.897 1.00 21.99  ? 160  MET B CA  1 
ATOM   4142 C C   . MET B 1 160 ? 23.685  20.716  -28.467 1.00 22.62  ? 160  MET B C   1 
ATOM   4143 O O   . MET B 1 160 ? 22.823  21.561  -28.677 1.00 24.33  ? 160  MET B O   1 
ATOM   4144 C CB  . MET B 1 160 ? 25.472  20.273  -30.222 1.00 22.61  ? 160  MET B CB  1 
ATOM   4145 C CG  . MET B 1 160 ? 24.952  20.856  -31.534 1.00 20.48  ? 160  MET B CG  1 
ATOM   4146 S SD  . MET B 1 160 ? 25.491  22.574  -31.719 1.00 18.52  ? 160  MET B SD  1 
ATOM   4147 C CE  . MET B 1 160 ? 27.165  22.318  -32.303 1.00 20.11  ? 160  MET B CE  1 
ATOM   4148 N N   . ARG B 1 161 ? 23.352  19.616  -27.818 1.00 24.43  ? 161  ARG B N   1 
ATOM   4149 C CA  . ARG B 1 161 ? 22.015  19.320  -27.319 1.00 24.50  ? 161  ARG B CA  1 
ATOM   4150 C C   . ARG B 1 161 ? 21.620  20.466  -26.410 1.00 25.13  ? 161  ARG B C   1 
ATOM   4151 O O   . ARG B 1 161 ? 20.560  21.039  -26.626 1.00 25.44  ? 161  ARG B O   1 
ATOM   4152 C CB  . ARG B 1 161 ? 21.985  17.994  -26.554 1.00 24.87  ? 161  ARG B CB  1 
ATOM   4153 C CG  . ARG B 1 161 ? 20.728  17.688  -25.769 1.00 27.02  ? 161  ARG B CG  1 
ATOM   4154 C CD  . ARG B 1 161 ? 20.755  16.423  -24.930 1.00 25.90  ? 161  ARG B CD  1 
ATOM   4155 N NE  . ARG B 1 161 ? 21.713  15.429  -25.377 1.00 25.19  ? 161  ARG B NE  1 
ATOM   4156 C CZ  . ARG B 1 161 ? 22.799  15.032  -24.738 1.00 28.37  ? 161  ARG B CZ  1 
ATOM   4157 N NH1 . ARG B 1 161 ? 23.073  15.494  -23.513 1.00 28.57  ? 161  ARG B NH1 1 
ATOM   4158 N NH2 . ARG B 1 161 ? 23.633  14.138  -25.275 1.00 27.54  ? 161  ARG B NH2 1 
ATOM   4159 N N   . HIS B 1 162 ? 22.454  20.783  -25.409 1.00 25.54  ? 162  HIS B N   1 
ATOM   4160 C CA  . HIS B 1 162 ? 22.139  21.871  -24.492 1.00 26.97  ? 162  HIS B CA  1 
ATOM   4161 C C   . HIS B 1 162 ? 22.017  23.217  -25.199 1.00 25.86  ? 162  HIS B C   1 
ATOM   4162 O O   . HIS B 1 162 ? 21.165  24.015  -24.834 1.00 25.40  ? 162  HIS B O   1 
ATOM   4163 C CB  . HIS B 1 162 ? 23.122  21.978  -23.302 1.00 28.89  ? 162  HIS B CB  1 
ATOM   4164 C CG  . HIS B 1 162 ? 23.015  20.853  -22.306 1.00 35.19  ? 162  HIS B CG  1 
ATOM   4165 N ND1 . HIS B 1 162 ? 23.443  19.556  -22.584 1.00 37.14  ? 162  HIS B ND1 1 
ATOM   4166 C CD2 . HIS B 1 162 ? 22.527  20.790  -21.045 1.00 34.65  ? 162  HIS B CD2 1 
ATOM   4167 C CE1 . HIS B 1 162 ? 23.230  18.772  -21.552 1.00 36.11  ? 162  HIS B CE1 1 
ATOM   4168 N NE2 . HIS B 1 162 ? 22.675  19.497  -20.595 1.00 34.17  ? 162  HIS B NE2 1 
ATOM   4169 N N   . LEU B 1 163 ? 22.858  23.524  -26.175 1.00 25.40  ? 163  LEU B N   1 
ATOM   4170 C CA  . LEU B 1 163 ? 22.822  24.796  -26.883 1.00 25.46  ? 163  LEU B CA  1 
ATOM   4171 C C   . LEU B 1 163 ? 21.535  25.007  -27.676 1.00 25.89  ? 163  LEU B C   1 
ATOM   4172 O O   . LEU B 1 163 ? 20.978  26.086  -27.636 1.00 24.76  ? 163  LEU B O   1 
ATOM   4173 C CB  . LEU B 1 163 ? 24.057  24.917  -27.769 1.00 20.88  ? 163  LEU B CB  1 
ATOM   4174 C CG  . LEU B 1 163 ? 25.239  25.789  -27.372 1.00 23.08  ? 163  LEU B CG  1 
ATOM   4175 C CD1 . LEU B 1 163 ? 25.379  26.114  -25.901 1.00 17.42  ? 163  LEU B CD1 1 
ATOM   4176 C CD2 . LEU B 1 163 ? 26.560  25.167  -27.851 1.00 18.03  ? 163  LEU B CD2 1 
ATOM   4177 N N   . TYR B 1 164 ? 21.103  24.022  -28.445 1.00 26.65  ? 164  TYR B N   1 
ATOM   4178 C CA  . TYR B 1 164 ? 19.858  24.071  -29.187 1.00 28.32  ? 164  TYR B CA  1 
ATOM   4179 C C   . TYR B 1 164 ? 18.652  24.258  -28.263 1.00 29.20  ? 164  TYR B C   1 
ATOM   4180 O O   . TYR B 1 164 ? 17.832  25.140  -28.536 1.00 29.82  ? 164  TYR B O   1 
ATOM   4181 C CB  . TYR B 1 164 ? 19.678  22.790  -30.003 1.00 27.19  ? 164  TYR B CB  1 
ATOM   4182 C CG  . TYR B 1 164 ? 20.142  22.949  -31.428 1.00 27.18  ? 164  TYR B CG  1 
ATOM   4183 C CD1 . TYR B 1 164 ? 21.442  22.689  -31.830 1.00 25.38  ? 164  TYR B CD1 1 
ATOM   4184 C CD2 . TYR B 1 164 ? 19.210  23.371  -32.388 1.00 27.30  ? 164  TYR B CD2 1 
ATOM   4185 C CE1 . TYR B 1 164 ? 21.828  22.859  -33.144 1.00 25.75  ? 164  TYR B CE1 1 
ATOM   4186 C CE2 . TYR B 1 164 ? 19.592  23.543  -33.696 1.00 26.50  ? 164  TYR B CE2 1 
ATOM   4187 C CZ  . TYR B 1 164 ? 20.898  23.293  -34.077 1.00 26.10  ? 164  TYR B CZ  1 
ATOM   4188 O OH  . TYR B 1 164 ? 21.248  23.479  -35.394 1.00 24.09  ? 164  TYR B OH  1 
ATOM   4189 N N   . ARG B 1 165 ? 18.560  23.527  -27.152 1.00 29.78  ? 165  ARG B N   1 
ATOM   4190 C CA  . ARG B 1 165 ? 17.437  23.641  -26.224 1.00 29.45  ? 165  ARG B CA  1 
ATOM   4191 C C   . ARG B 1 165 ? 17.400  25.006  -25.549 1.00 30.46  ? 165  ARG B C   1 
ATOM   4192 O O   . ARG B 1 165 ? 16.329  25.583  -25.309 1.00 28.91  ? 165  ARG B O   1 
ATOM   4193 C CB  . ARG B 1 165 ? 17.449  22.545  -25.155 1.00 26.97  ? 165  ARG B CB  1 
ATOM   4194 C CG  . ARG B 1 165 ? 17.025  21.206  -25.688 1.00 24.69  ? 165  ARG B CG  1 
ATOM   4195 C CD  . ARG B 1 165 ? 17.315  20.007  -24.808 1.00 25.23  ? 165  ARG B CD  1 
ATOM   4196 N NE  . ARG B 1 165 ? 16.726  18.797  -25.398 1.00 21.66  ? 165  ARG B NE  1 
ATOM   4197 C CZ  . ARG B 1 165 ? 16.909  17.568  -24.932 1.00 24.21  ? 165  ARG B CZ  1 
ATOM   4198 N NH1 . ARG B 1 165 ? 17.677  17.348  -23.857 1.00 19.85  ? 165  ARG B NH1 1 
ATOM   4199 N NH2 . ARG B 1 165 ? 16.283  16.546  -25.535 1.00 23.30  ? 165  ARG B NH2 1 
ATOM   4200 N N   . GLN B 1 166 ? 18.598  25.565  -25.316 1.00 29.84  ? 166  GLN B N   1 
ATOM   4201 C CA  . GLN B 1 166 ? 18.619  26.894  -24.720 1.00 30.76  ? 166  GLN B CA  1 
ATOM   4202 C C   . GLN B 1 166 ? 18.149  27.950  -25.710 1.00 31.89  ? 166  GLN B C   1 
ATOM   4203 O O   . GLN B 1 166 ? 17.647  28.979  -25.253 1.00 33.32  ? 166  GLN B O   1 
ATOM   4204 C CB  . GLN B 1 166 ? 20.011  27.268  -24.227 1.00 29.59  ? 166  GLN B CB  1 
ATOM   4205 C CG  . GLN B 1 166 ? 20.177  28.702  -23.792 1.00 29.23  ? 166  GLN B CG  1 
ATOM   4206 C CD  . GLN B 1 166 ? 21.573  28.961  -23.259 1.00 34.69  ? 166  GLN B CD  1 
ATOM   4207 O OE1 . GLN B 1 166 ? 22.444  28.091  -23.307 1.00 36.78  ? 166  GLN B OE1 1 
ATOM   4208 N NE2 . GLN B 1 166 ? 21.790  30.166  -22.758 1.00 35.68  ? 166  GLN B NE2 1 
ATOM   4209 N N   . HIS B 1 167 ? 18.367  27.770  -27.005 1.00 32.19  ? 167  HIS B N   1 
ATOM   4210 C CA  . HIS B 1 167 ? 17.999  28.810  -27.963 1.00 33.61  ? 167  HIS B CA  1 
ATOM   4211 C C   . HIS B 1 167 ? 16.718  28.530  -28.726 1.00 33.74  ? 167  HIS B C   1 
ATOM   4212 O O   . HIS B 1 167 ? 16.512  29.000  -29.849 1.00 35.21  ? 167  HIS B O   1 
ATOM   4213 C CB  . HIS B 1 167 ? 19.212  29.061  -28.885 1.00 33.05  ? 167  HIS B CB  1 
ATOM   4214 C CG  . HIS B 1 167 ? 20.358  29.603  -28.070 1.00 33.27  ? 167  HIS B CG  1 
ATOM   4215 N ND1 . HIS B 1 167 ? 20.574  30.946  -27.887 1.00 32.41  ? 167  HIS B ND1 1 
ATOM   4216 C CD2 . HIS B 1 167 ? 21.348  28.972  -27.399 1.00 34.34  ? 167  HIS B CD2 1 
ATOM   4217 C CE1 . HIS B 1 167 ? 21.649  31.120  -27.143 1.00 33.06  ? 167  HIS B CE1 1 
ATOM   4218 N NE2 . HIS B 1 167 ? 22.138  29.940  -26.817 1.00 34.41  ? 167  HIS B NE2 1 
ATOM   4219 N N   . GLY B 1 168 ? 15.803  27.777  -28.136 1.00 33.93  ? 168  GLY B N   1 
ATOM   4220 C CA  . GLY B 1 168 ? 14.505  27.483  -28.693 1.00 33.78  ? 168  GLY B CA  1 
ATOM   4221 C C   . GLY B 1 168 ? 14.428  26.397  -29.750 1.00 32.74  ? 168  GLY B C   1 
ATOM   4222 O O   . GLY B 1 168 ? 13.404  26.312  -30.425 1.00 33.41  ? 168  GLY B O   1 
ATOM   4223 N N   . GLY B 1 169 ? 15.429  25.519  -29.833 1.00 30.86  ? 169  GLY B N   1 
ATOM   4224 C CA  . GLY B 1 169 ? 15.425  24.456  -30.814 1.00 28.02  ? 169  GLY B CA  1 
ATOM   4225 C C   . GLY B 1 169 ? 14.872  23.171  -30.219 1.00 27.60  ? 169  GLY B C   1 
ATOM   4226 O O   . GLY B 1 169 ? 14.539  23.058  -29.043 1.00 27.68  ? 169  GLY B O   1 
ATOM   4227 N N   . THR B 1 170 ? 14.713  22.182  -31.073 1.00 27.01  ? 170  THR B N   1 
ATOM   4228 C CA  . THR B 1 170 ? 14.261  20.870  -30.667 1.00 28.78  ? 170  THR B CA  1 
ATOM   4229 C C   . THR B 1 170 ? 15.266  19.871  -31.220 1.00 29.03  ? 170  THR B C   1 
ATOM   4230 O O   . THR B 1 170 ? 15.567  19.996  -32.397 1.00 30.43  ? 170  THR B O   1 
ATOM   4231 C CB  . THR B 1 170 ? 12.855  20.517  -31.197 1.00 30.73  ? 170  THR B CB  1 
ATOM   4232 O OG1 . THR B 1 170 ? 11.960  21.554  -30.754 1.00 29.97  ? 170  THR B OG1 1 
ATOM   4233 C CG2 . THR B 1 170 ? 12.385  19.171  -30.665 1.00 26.52  ? 170  THR B CG2 1 
ATOM   4234 N N   . VAL B 1 171 ? 15.782  18.980  -30.406 1.00 28.47  ? 171  VAL B N   1 
ATOM   4235 C CA  . VAL B 1 171 ? 16.689  17.942  -30.849 1.00 28.09  ? 171  VAL B CA  1 
ATOM   4236 C C   . VAL B 1 171 ? 15.813  16.702  -30.960 1.00 29.11  ? 171  VAL B C   1 
ATOM   4237 O O   . VAL B 1 171 ? 15.483  16.093  -29.942 1.00 29.89  ? 171  VAL B O   1 
ATOM   4238 C CB  . VAL B 1 171 ? 17.841  17.650  -29.865 1.00 25.68  ? 171  VAL B CB  1 
ATOM   4239 C CG1 . VAL B 1 171 ? 18.776  16.602  -30.449 1.00 23.51  ? 171  VAL B CG1 1 
ATOM   4240 C CG2 . VAL B 1 171 ? 18.569  18.961  -29.599 1.00 24.94  ? 171  VAL B CG2 1 
ATOM   4241 N N   . LEU B 1 172 ? 15.403  16.380  -32.168 1.00 29.47  ? 172  LEU B N   1 
ATOM   4242 C CA  . LEU B 1 172 ? 14.441  15.335  -32.410 1.00 28.86  ? 172  LEU B CA  1 
ATOM   4243 C C   . LEU B 1 172 ? 14.906  13.934  -32.116 1.00 29.26  ? 172  LEU B C   1 
ATOM   4244 O O   . LEU B 1 172 ? 14.204  13.140  -31.492 1.00 26.87  ? 172  LEU B O   1 
ATOM   4245 C CB  . LEU B 1 172 ? 13.957  15.463  -33.859 1.00 30.83  ? 172  LEU B CB  1 
ATOM   4246 C CG  . LEU B 1 172 ? 13.073  16.686  -34.140 1.00 31.39  ? 172  LEU B CG  1 
ATOM   4247 C CD1 . LEU B 1 172 ? 12.936  16.828  -35.656 1.00 36.54  ? 172  LEU B CD1 1 
ATOM   4248 C CD2 . LEU B 1 172 ? 11.666  16.572  -33.568 1.00 29.66  ? 172  LEU B CD2 1 
ATOM   4249 N N   . GLU B 1 173 ? 16.066  13.565  -32.621 1.00 29.55  ? 173  GLU B N   1 
ATOM   4250 C CA  . GLU B 1 173 ? 16.665  12.259  -32.442 1.00 29.21  ? 173  GLU B CA  1 
ATOM   4251 C C   . GLU B 1 173 ? 18.171  12.485  -32.246 1.00 27.85  ? 173  GLU B C   1 
ATOM   4252 O O   . GLU B 1 173 ? 18.731  13.412  -32.817 1.00 25.34  ? 173  GLU B O   1 
ATOM   4253 C CB  . GLU B 1 173 ? 16.434  11.373  -33.652 1.00 37.97  ? 173  GLU B CB  1 
ATOM   4254 C CG  . GLU B 1 173 ? 15.023  11.037  -34.095 1.00 42.57  ? 173  GLU B CG  1 
ATOM   4255 C CD  . GLU B 1 173 ? 14.309  10.017  -33.229 1.00 46.61  ? 173  GLU B CD  1 
ATOM   4256 O OE1 . GLU B 1 173 ? 14.503  10.009  -31.993 1.00 46.47  ? 173  GLU B OE1 1 
ATOM   4257 O OE2 . GLU B 1 173 ? 13.528  9.197   -33.774 1.00 50.11  ? 173  GLU B OE2 1 
ATOM   4258 N N   . GLU B 1 174 ? 18.779  11.675  -31.389 1.00 26.56  ? 174  GLU B N   1 
ATOM   4259 C CA  . GLU B 1 174 ? 20.220  11.717  -31.194 1.00 25.14  ? 174  GLU B CA  1 
ATOM   4260 C C   . GLU B 1 174 ? 20.686  10.292  -31.452 1.00 25.37  ? 174  GLU B C   1 
ATOM   4261 O O   . GLU B 1 174 ? 20.490  9.445   -30.598 1.00 25.00  ? 174  GLU B O   1 
ATOM   4262 C CB  . GLU B 1 174 ? 20.578  12.291  -29.846 1.00 25.12  ? 174  GLU B CB  1 
ATOM   4263 C CG  . GLU B 1 174 ? 22.018  12.169  -29.451 1.00 27.48  ? 174  GLU B CG  1 
ATOM   4264 C CD  . GLU B 1 174 ? 22.441  13.008  -28.256 1.00 31.36  ? 174  GLU B CD  1 
ATOM   4265 O OE1 . GLU B 1 174 ? 21.861  14.089  -28.016 1.00 28.93  ? 174  GLU B OE1 1 
ATOM   4266 O OE2 . GLU B 1 174 ? 23.419  12.533  -27.606 1.00 33.60  ? 174  GLU B OE2 1 
ATOM   4267 N N   . ILE B 1 175 ? 21.233  10.021  -32.640 1.00 25.44  ? 175  ILE B N   1 
ATOM   4268 C CA  . ILE B 1 175 ? 21.616  8.694   -33.073 1.00 24.73  ? 175  ILE B CA  1 
ATOM   4269 C C   . ILE B 1 175 ? 23.119  8.472   -33.107 1.00 26.06  ? 175  ILE B C   1 
ATOM   4270 O O   . ILE B 1 175 ? 23.923  9.331   -33.470 1.00 25.37  ? 175  ILE B O   1 
ATOM   4271 C CB  . ILE B 1 175 ? 21.074  8.430   -34.504 1.00 25.27  ? 175  ILE B CB  1 
ATOM   4272 C CG1 . ILE B 1 175 ? 19.574  8.715   -34.607 1.00 26.57  ? 175  ILE B CG1 1 
ATOM   4273 C CG2 . ILE B 1 175 ? 21.272  6.986   -34.941 1.00 22.33  ? 175  ILE B CG2 1 
ATOM   4274 C CD1 . ILE B 1 175 ? 19.173  9.236   -35.975 1.00 31.00  ? 175  ILE B CD1 1 
ATOM   4275 N N   . TYR B 1 176 ? 23.528  7.276   -32.718 1.00 25.91  ? 176  TYR B N   1 
ATOM   4276 C CA  . TYR B 1 176 ? 24.887  6.817   -32.677 1.00 26.77  ? 176  TYR B CA  1 
ATOM   4277 C C   . TYR B 1 176 ? 25.005  5.524   -33.484 1.00 27.63  ? 176  TYR B C   1 
ATOM   4278 O O   . TYR B 1 176 ? 24.137  4.644   -33.435 1.00 27.58  ? 176  TYR B O   1 
ATOM   4279 C CB  . TYR B 1 176 ? 25.395  6.531   -31.224 1.00 25.16  ? 176  TYR B CB  1 
ATOM   4280 C CG  . TYR B 1 176 ? 25.499  7.876   -30.503 1.00 23.17  ? 176  TYR B CG  1 
ATOM   4281 C CD1 . TYR B 1 176 ? 26.531  8.758   -30.780 1.00 20.92  ? 176  TYR B CD1 1 
ATOM   4282 C CD2 . TYR B 1 176 ? 24.509  8.236   -29.590 1.00 21.71  ? 176  TYR B CD2 1 
ATOM   4283 C CE1 . TYR B 1 176 ? 26.600  9.986   -30.126 1.00 21.29  ? 176  TYR B CE1 1 
ATOM   4284 C CE2 . TYR B 1 176 ? 24.563  9.453   -28.952 1.00 22.01  ? 176  TYR B CE2 1 
ATOM   4285 C CZ  . TYR B 1 176 ? 25.621  10.324  -29.213 1.00 21.89  ? 176  TYR B CZ  1 
ATOM   4286 O OH  . TYR B 1 176 ? 25.636  11.541  -28.574 1.00 21.61  ? 176  TYR B OH  1 
ATOM   4287 N N   . ILE B 1 177 ? 26.111  5.434   -34.211 1.00 27.65  ? 177  ILE B N   1 
ATOM   4288 C CA  . ILE B 1 177 ? 26.400  4.234   -34.987 1.00 28.84  ? 177  ILE B CA  1 
ATOM   4289 C C   . ILE B 1 177 ? 27.812  3.828   -34.566 1.00 29.02  ? 177  ILE B C   1 
ATOM   4290 O O   . ILE B 1 177 ? 28.559  4.706   -34.148 1.00 28.20  ? 177  ILE B O   1 
ATOM   4291 C CB  . ILE B 1 177 ? 26.304  4.428   -36.505 1.00 27.67  ? 177  ILE B CB  1 
ATOM   4292 C CG1 . ILE B 1 177 ? 27.140  5.610   -37.011 1.00 25.49  ? 177  ILE B CG1 1 
ATOM   4293 C CG2 . ILE B 1 177 ? 24.841  4.638   -36.922 1.00 27.47  ? 177  ILE B CG2 1 
ATOM   4294 C CD1 . ILE B 1 177 ? 27.163  5.688   -38.543 1.00 25.38  ? 177  ILE B CD1 1 
ATOM   4295 N N   . PRO B 1 178 ? 28.139  2.558   -34.694 1.00 29.08  ? 178  PRO B N   1 
ATOM   4296 C CA  . PRO B 1 178 ? 29.465  2.083   -34.383 1.00 29.12  ? 178  PRO B CA  1 
ATOM   4297 C C   . PRO B 1 178 ? 30.474  2.749   -35.296 1.00 29.95  ? 178  PRO B C   1 
ATOM   4298 O O   . PRO B 1 178 ? 30.099  3.221   -36.366 1.00 28.56  ? 178  PRO B O   1 
ATOM   4299 C CB  . PRO B 1 178 ? 29.433  0.577   -34.642 1.00 28.76  ? 178  PRO B CB  1 
ATOM   4300 C CG  . PRO B 1 178 ? 27.970  0.245   -34.687 1.00 30.00  ? 178  PRO B CG  1 
ATOM   4301 C CD  . PRO B 1 178 ? 27.272  1.476   -35.234 1.00 28.41  ? 178  PRO B CD  1 
ATOM   4302 N N   . LEU B 1 179 ? 31.732  2.707   -34.876 1.00 31.30  ? 179  LEU B N   1 
ATOM   4303 C CA  . LEU B 1 179 ? 32.855  3.220   -35.632 1.00 33.50  ? 179  LEU B CA  1 
ATOM   4304 C C   . LEU B 1 179 ? 33.036  2.458   -36.924 1.00 36.33  ? 179  LEU B C   1 
ATOM   4305 O O   . LEU B 1 179 ? 33.289  3.209   -37.893 1.00 38.20  ? 179  LEU B O   1 
ATOM   4306 C CB  . LEU B 1 179 ? 34.151  3.278   -34.819 1.00 28.87  ? 179  LEU B CB  1 
ATOM   4307 C CG  . LEU B 1 179 ? 34.257  4.526   -33.939 1.00 27.76  ? 179  LEU B CG  1 
ATOM   4308 C CD1 . LEU B 1 179 ? 35.313  4.372   -32.851 1.00 25.28  ? 179  LEU B CD1 1 
ATOM   4309 C CD2 . LEU B 1 179 ? 34.595  5.725   -34.828 1.00 25.83  ? 179  LEU B CD2 1 
ATOM   4310 N N   . TYR B 1 180 ? 32.927  1.161   -37.125 1.00 38.46  ? 180  TYR B N   1 
ATOM   4311 C CA  . TYR B 1 180 ? 32.986  0.697   -38.547 1.00 41.39  ? 180  TYR B CA  1 
ATOM   4312 C C   . TYR B 1 180 ? 31.545  0.173   -38.738 1.00 41.01  ? 180  TYR B C   1 
ATOM   4313 O O   . TYR B 1 180 ? 31.207  -0.903  -38.276 1.00 40.31  ? 180  TYR B O   1 
ATOM   4314 C CB  . TYR B 1 180 ? 33.976  -0.341  -38.963 1.00 43.91  ? 180  TYR B CB  1 
ATOM   4315 C CG  . TYR B 1 180 ? 35.454  -0.128  -38.762 1.00 48.12  ? 180  TYR B CG  1 
ATOM   4316 C CD1 . TYR B 1 180 ? 35.962  -0.294  -37.474 1.00 50.36  ? 180  TYR B CD1 1 
ATOM   4317 C CD2 . TYR B 1 180 ? 36.341  0.193   -39.777 1.00 48.38  ? 180  TYR B CD2 1 
ATOM   4318 C CE1 . TYR B 1 180 ? 37.310  -0.133  -37.213 1.00 51.42  ? 180  TYR B CE1 1 
ATOM   4319 C CE2 . TYR B 1 180 ? 37.687  0.352   -39.523 1.00 48.93  ? 180  TYR B CE2 1 
ATOM   4320 C CZ  . TYR B 1 180 ? 38.164  0.194   -38.247 1.00 50.91  ? 180  TYR B CZ  1 
ATOM   4321 O OH  . TYR B 1 180 ? 39.490  0.360   -37.897 1.00 51.88  ? 180  TYR B OH  1 
ATOM   4322 N N   . PRO B 1 181 ? 30.673  1.068   -39.133 1.00 41.32  ? 181  PRO B N   1 
ATOM   4323 C CA  . PRO B 1 181 ? 29.250  0.738   -39.181 1.00 42.77  ? 181  PRO B CA  1 
ATOM   4324 C C   . PRO B 1 181 ? 28.906  -0.206  -40.318 1.00 43.70  ? 181  PRO B C   1 
ATOM   4325 O O   . PRO B 1 181 ? 29.338  0.023   -41.451 1.00 43.84  ? 181  PRO B O   1 
ATOM   4326 C CB  . PRO B 1 181 ? 28.583  2.087   -39.348 1.00 41.33  ? 181  PRO B CB  1 
ATOM   4327 C CG  . PRO B 1 181 ? 29.567  2.904   -40.118 1.00 41.36  ? 181  PRO B CG  1 
ATOM   4328 C CD  . PRO B 1 181 ? 30.926  2.420   -39.674 1.00 40.73  ? 181  PRO B CD  1 
ATOM   4329 N N   . SER B 1 182 ? 28.189  -1.261  -39.960 1.00 44.06  ? 182  SER B N   1 
ATOM   4330 C CA  . SER B 1 182 ? 27.706  -2.206  -40.965 1.00 44.09  ? 182  SER B CA  1 
ATOM   4331 C C   . SER B 1 182 ? 26.739  -1.470  -41.889 1.00 44.28  ? 182  SER B C   1 
ATOM   4332 O O   . SER B 1 182 ? 26.271  -0.370  -41.596 1.00 44.65  ? 182  SER B O   1 
ATOM   4333 C CB  . SER B 1 182 ? 26.903  -3.329  -40.279 1.00 41.48  ? 182  SER B CB  1 
ATOM   4334 O OG  . SER B 1 182 ? 25.595  -2.800  -40.020 1.00 40.65  ? 182  SER B OG  1 
ATOM   4335 N N   . ASP B 1 183 ? 26.288  -2.168  -42.924 1.00 45.08  ? 183  ASP B N   1 
ATOM   4336 C CA  . ASP B 1 183 ? 25.251  -1.666  -43.819 1.00 44.23  ? 183  ASP B CA  1 
ATOM   4337 C C   . ASP B 1 183 ? 23.917  -1.468  -43.116 1.00 41.97  ? 183  ASP B C   1 
ATOM   4338 O O   . ASP B 1 183 ? 23.216  -0.472  -43.329 1.00 41.62  ? 183  ASP B O   1 
ATOM   4339 C CB  . ASP B 1 183 ? 25.043  -2.707  -44.933 1.00 51.23  ? 183  ASP B CB  1 
ATOM   4340 C CG  . ASP B 1 183 ? 25.942  -2.453  -46.128 1.00 54.65  ? 183  ASP B CG  1 
ATOM   4341 O OD1 . ASP B 1 183 ? 27.094  -2.929  -46.140 1.00 57.75  ? 183  ASP B OD1 1 
ATOM   4342 O OD2 . ASP B 1 183 ? 25.420  -1.759  -47.035 1.00 56.80  ? 183  ASP B OD2 1 
ATOM   4343 N N   . ASP B 1 184 ? 23.545  -2.414  -42.260 1.00 40.11  ? 184  ASP B N   1 
ATOM   4344 C CA  . ASP B 1 184 ? 22.267  -2.316  -41.549 1.00 39.55  ? 184  ASP B CA  1 
ATOM   4345 C C   . ASP B 1 184 ? 22.221  -1.113  -40.619 1.00 38.88  ? 184  ASP B C   1 
ATOM   4346 O O   . ASP B 1 184 ? 21.277  -0.307  -40.561 1.00 37.85  ? 184  ASP B O   1 
ATOM   4347 C CB  . ASP B 1 184 ? 21.971  -3.611  -40.808 1.00 40.91  ? 184  ASP B CB  1 
ATOM   4348 N N   . ASP B 1 185 ? 23.335  -0.918  -39.904 1.00 38.57  ? 185  ASP B N   1 
ATOM   4349 C CA  . ASP B 1 185 ? 23.541  0.233   -39.044 1.00 37.18  ? 185  ASP B CA  1 
ATOM   4350 C C   . ASP B 1 185 ? 23.214  1.524   -39.774 1.00 36.11  ? 185  ASP B C   1 
ATOM   4351 O O   . ASP B 1 185 ? 22.501  2.365   -39.252 1.00 36.91  ? 185  ASP B O   1 
ATOM   4352 C CB  . ASP B 1 185 ? 25.002  0.302   -38.572 1.00 35.48  ? 185  ASP B CB  1 
ATOM   4353 C CG  . ASP B 1 185 ? 25.336  -0.704  -37.502 1.00 33.56  ? 185  ASP B CG  1 
ATOM   4354 O OD1 . ASP B 1 185 ? 24.428  -1.194  -36.801 1.00 33.32  ? 185  ASP B OD1 1 
ATOM   4355 O OD2 . ASP B 1 185 ? 26.539  -1.011  -37.352 1.00 35.51  ? 185  ASP B OD2 1 
ATOM   4356 N N   . LEU B 1 186 ? 23.731  1.708   -40.968 1.00 35.76  ? 186  LEU B N   1 
ATOM   4357 C CA  . LEU B 1 186 ? 23.507  2.897   -41.784 1.00 35.77  ? 186  LEU B CA  1 
ATOM   4358 C C   . LEU B 1 186 ? 22.074  3.076   -42.240 1.00 35.59  ? 186  LEU B C   1 
ATOM   4359 O O   . LEU B 1 186 ? 21.419  4.118   -42.101 1.00 34.13  ? 186  LEU B O   1 
ATOM   4360 C CB  . LEU B 1 186 ? 24.490  2.805   -42.969 1.00 37.42  ? 186  LEU B CB  1 
ATOM   4361 C CG  . LEU B 1 186 ? 25.858  3.478   -42.770 1.00 38.88  ? 186  LEU B CG  1 
ATOM   4362 C CD1 . LEU B 1 186 ? 26.350  3.336   -41.346 1.00 40.38  ? 186  LEU B CD1 1 
ATOM   4363 C CD2 . LEU B 1 186 ? 26.914  2.909   -43.710 1.00 37.35  ? 186  LEU B CD2 1 
ATOM   4364 N N   . GLN B 1 187 ? 21.542  1.979   -42.795 1.00 36.25  ? 187  GLN B N   1 
ATOM   4365 C CA  . GLN B 1 187 ? 20.143  1.984   -43.209 1.00 37.80  ? 187  GLN B CA  1 
ATOM   4366 C C   . GLN B 1 187 ? 19.254  2.254   -42.014 1.00 36.29  ? 187  GLN B C   1 
ATOM   4367 O O   . GLN B 1 187 ? 18.427  3.160   -42.097 1.00 36.03  ? 187  GLN B O   1 
ATOM   4368 C CB  . GLN B 1 187 ? 19.786  0.722   -44.007 1.00 42.74  ? 187  GLN B CB  1 
ATOM   4369 C CG  . GLN B 1 187 ? 20.190  0.819   -45.470 1.00 48.54  ? 187  GLN B CG  1 
ATOM   4370 C CD  . GLN B 1 187 ? 20.380  2.225   -46.015 1.00 51.21  ? 187  GLN B CD  1 
ATOM   4371 O OE1 . GLN B 1 187 ? 21.527  2.589   -46.321 1.00 55.19  ? 187  GLN B OE1 1 
ATOM   4372 N NE2 . GLN B 1 187 ? 19.346  3.043   -46.121 1.00 51.69  ? 187  GLN B NE2 1 
ATOM   4373 N N   . ARG B 1 188 ? 19.443  1.593   -40.873 1.00 36.36  ? 188  ARG B N   1 
ATOM   4374 C CA  . ARG B 1 188 ? 18.556  1.949   -39.755 1.00 37.29  ? 188  ARG B CA  1 
ATOM   4375 C C   . ARG B 1 188 ? 18.704  3.414   -39.381 1.00 35.50  ? 188  ARG B C   1 
ATOM   4376 O O   . ARG B 1 188 ? 17.708  4.092   -39.187 1.00 34.04  ? 188  ARG B O   1 
ATOM   4377 C CB  . ARG B 1 188 ? 18.796  1.055   -38.552 1.00 44.04  ? 188  ARG B CB  1 
ATOM   4378 C CG  . ARG B 1 188 ? 18.724  -0.426  -38.892 1.00 50.43  ? 188  ARG B CG  1 
ATOM   4379 C CD  . ARG B 1 188 ? 18.485  -1.206  -37.602 1.00 57.63  ? 188  ARG B CD  1 
ATOM   4380 N NE  . ARG B 1 188 ? 18.203  -2.604  -37.934 1.00 64.04  ? 188  ARG B NE  1 
ATOM   4381 C CZ  . ARG B 1 188 ? 19.157  -3.482  -38.224 1.00 67.24  ? 188  ARG B CZ  1 
ATOM   4382 N NH1 . ARG B 1 188 ? 20.431  -3.111  -38.201 1.00 68.32  ? 188  ARG B NH1 1 
ATOM   4383 N NH2 . ARG B 1 188 ? 18.801  -4.729  -38.514 1.00 69.59  ? 188  ARG B NH2 1 
ATOM   4384 N N   . ALA B 1 189 ? 19.943  3.912   -39.307 1.00 35.29  ? 189  ALA B N   1 
ATOM   4385 C CA  . ALA B 1 189 ? 20.203  5.293   -38.945 1.00 33.50  ? 189  ALA B CA  1 
ATOM   4386 C C   . ALA B 1 189 ? 19.584  6.252   -39.947 1.00 32.52  ? 189  ALA B C   1 
ATOM   4387 O O   . ALA B 1 189 ? 18.961  7.224   -39.502 1.00 32.26  ? 189  ALA B O   1 
ATOM   4388 C CB  . ALA B 1 189 ? 21.701  5.561   -38.824 1.00 33.40  ? 189  ALA B CB  1 
ATOM   4389 N N   . VAL B 1 190 ? 19.737  5.983   -41.243 1.00 32.33  ? 190  VAL B N   1 
ATOM   4390 C CA  . VAL B 1 190 ? 19.172  6.910   -42.227 1.00 34.41  ? 190  VAL B CA  1 
ATOM   4391 C C   . VAL B 1 190 ? 17.653  6.963   -42.213 1.00 34.66  ? 190  VAL B C   1 
ATOM   4392 O O   . VAL B 1 190 ? 17.039  8.032   -42.353 1.00 34.02  ? 190  VAL B O   1 
ATOM   4393 C CB  . VAL B 1 190 ? 19.719  6.627   -43.634 1.00 37.84  ? 190  VAL B CB  1 
ATOM   4394 C CG1 . VAL B 1 190 ? 19.152  7.624   -44.638 1.00 36.74  ? 190  VAL B CG1 1 
ATOM   4395 C CG2 . VAL B 1 190 ? 21.244  6.742   -43.611 1.00 39.65  ? 190  VAL B CG2 1 
ATOM   4396 N N   . GLU B 1 191 ? 17.007  5.826   -41.991 1.00 35.59  ? 191  GLU B N   1 
ATOM   4397 C CA  . GLU B 1 191 ? 15.545  5.772   -41.873 1.00 36.90  ? 191  GLU B CA  1 
ATOM   4398 C C   . GLU B 1 191 ? 15.038  6.614   -40.714 1.00 36.84  ? 191  GLU B C   1 
ATOM   4399 O O   . GLU B 1 191 ? 14.111  7.421   -40.838 1.00 36.20  ? 191  GLU B O   1 
ATOM   4400 C CB  . GLU B 1 191 ? 15.135  4.302   -41.727 1.00 39.26  ? 191  GLU B CB  1 
ATOM   4401 C CG  . GLU B 1 191 ? 13.628  4.091   -41.772 1.00 43.82  ? 191  GLU B CG  1 
ATOM   4402 C CD  . GLU B 1 191 ? 13.028  4.489   -43.107 1.00 45.13  ? 191  GLU B CD  1 
ATOM   4403 O OE1 . GLU B 1 191 ? 13.705  4.388   -44.147 1.00 43.54  ? 191  GLU B OE1 1 
ATOM   4404 O OE2 . GLU B 1 191 ? 11.862  4.937   -43.135 1.00 49.45  ? 191  GLU B OE2 1 
ATOM   4405 N N   . ARG B 1 192 ? 15.699  6.564   -39.555 1.00 37.69  ? 192  ARG B N   1 
ATOM   4406 C CA  . ARG B 1 192 ? 15.341  7.418   -38.418 1.00 38.28  ? 192  ARG B CA  1 
ATOM   4407 C C   . ARG B 1 192 ? 15.516  8.888   -38.760 1.00 38.84  ? 192  ARG B C   1 
ATOM   4408 O O   . ARG B 1 192 ? 14.659  9.732   -38.480 1.00 39.44  ? 192  ARG B O   1 
ATOM   4409 C CB  . ARG B 1 192 ? 16.183  7.026   -37.199 1.00 38.48  ? 192  ARG B CB  1 
ATOM   4410 C CG  . ARG B 1 192 ? 15.920  5.584   -36.773 1.00 38.30  ? 192  ARG B CG  1 
ATOM   4411 C CD  . ARG B 1 192 ? 16.612  5.192   -35.484 1.00 40.31  ? 192  ARG B CD  1 
ATOM   4412 N NE  . ARG B 1 192 ? 16.416  6.182   -34.449 1.00 43.05  ? 192  ARG B NE  1 
ATOM   4413 C CZ  . ARG B 1 192 ? 17.090  6.357   -33.329 1.00 45.75  ? 192  ARG B CZ  1 
ATOM   4414 N NH1 . ARG B 1 192 ? 18.115  5.576   -33.020 1.00 46.90  ? 192  ARG B NH1 1 
ATOM   4415 N NH2 . ARG B 1 192 ? 16.745  7.349   -32.503 1.00 45.38  ? 192  ARG B NH2 1 
ATOM   4416 N N   . ILE B 1 193 ? 16.627  9.227   -39.433 1.00 39.02  ? 193  ILE B N   1 
ATOM   4417 C CA  . ILE B 1 193 ? 16.883  10.599  -39.864 1.00 38.02  ? 193  ILE B CA  1 
ATOM   4418 C C   . ILE B 1 193 ? 15.755  11.029  -40.806 1.00 37.42  ? 193  ILE B C   1 
ATOM   4419 O O   . ILE B 1 193 ? 15.197  12.112  -40.661 1.00 36.02  ? 193  ILE B O   1 
ATOM   4420 C CB  . ILE B 1 193 ? 18.250  10.750  -40.575 1.00 36.78  ? 193  ILE B CB  1 
ATOM   4421 C CG1 . ILE B 1 193 ? 19.407  10.654  -39.580 1.00 35.07  ? 193  ILE B CG1 1 
ATOM   4422 C CG2 . ILE B 1 193 ? 18.296  12.074  -41.319 1.00 35.90  ? 193  ILE B CG2 1 
ATOM   4423 C CD1 . ILE B 1 193 ? 20.761  10.278  -40.110 1.00 32.41  ? 193  ILE B CD1 1 
ATOM   4424 N N   . TYR B 1 194 ? 15.445  10.173  -41.769 1.00 38.10  ? 194  TYR B N   1 
ATOM   4425 C CA  . TYR B 1 194 ? 14.336  10.432  -42.690 1.00 40.36  ? 194  TYR B CA  1 
ATOM   4426 C C   . TYR B 1 194 ? 13.018  10.514  -41.921 1.00 40.27  ? 194  TYR B C   1 
ATOM   4427 O O   . TYR B 1 194 ? 12.282  11.477  -42.141 1.00 39.89  ? 194  TYR B O   1 
ATOM   4428 C CB  . TYR B 1 194 ? 14.245  9.388   -43.794 1.00 43.38  ? 194  TYR B CB  1 
ATOM   4429 C CG  . TYR B 1 194 ? 13.300  9.666   -44.936 1.00 49.33  ? 194  TYR B CG  1 
ATOM   4430 C CD1 . TYR B 1 194 ? 13.509  10.682  -45.858 1.00 51.49  ? 194  TYR B CD1 1 
ATOM   4431 C CD2 . TYR B 1 194 ? 12.172  8.878   -45.119 1.00 51.93  ? 194  TYR B CD2 1 
ATOM   4432 C CE1 . TYR B 1 194 ? 12.640  10.905  -46.907 1.00 53.70  ? 194  TYR B CE1 1 
ATOM   4433 C CE2 . TYR B 1 194 ? 11.294  9.060   -46.172 1.00 53.61  ? 194  TYR B CE2 1 
ATOM   4434 C CZ  . TYR B 1 194 ? 11.547  10.069  -47.072 1.00 55.01  ? 194  TYR B CZ  1 
ATOM   4435 O OH  . TYR B 1 194 ? 10.632  10.290  -48.090 1.00 56.11  ? 194  TYR B OH  1 
ATOM   4436 N N   . GLN B 1 195 ? 12.721  9.624   -40.973 1.00 39.54  ? 195  GLN B N   1 
ATOM   4437 C CA  . GLN B 1 195 ? 11.447  9.766   -40.267 1.00 39.96  ? 195  GLN B CA  1 
ATOM   4438 C C   . GLN B 1 195 ? 11.345  10.999  -39.396 1.00 39.64  ? 195  GLN B C   1 
ATOM   4439 O O   . GLN B 1 195 ? 10.207  11.453  -39.204 1.00 39.32  ? 195  GLN B O   1 
ATOM   4440 C CB  . GLN B 1 195 ? 11.079  8.490   -39.515 1.00 39.66  ? 195  GLN B CB  1 
ATOM   4441 C CG  . GLN B 1 195 ? 10.987  7.270   -40.413 1.00 42.38  ? 195  GLN B CG  1 
ATOM   4442 C CD  . GLN B 1 195 ? 9.851   7.232   -41.410 1.00 46.11  ? 195  GLN B CD  1 
ATOM   4443 O OE1 . GLN B 1 195 ? 9.747   6.247   -42.167 1.00 47.28  ? 195  GLN B OE1 1 
ATOM   4444 N NE2 . GLN B 1 195 ? 8.976   8.236   -41.484 1.00 45.89  ? 195  GLN B NE2 1 
ATOM   4445 N N   . ALA B 1 196 ? 12.427  11.619  -38.922 1.00 39.01  ? 196  ALA B N   1 
ATOM   4446 C CA  . ALA B 1 196 ? 12.299  12.812  -38.076 1.00 37.04  ? 196  ALA B CA  1 
ATOM   4447 C C   . ALA B 1 196 ? 11.959  14.083  -38.815 1.00 36.12  ? 196  ALA B C   1 
ATOM   4448 O O   . ALA B 1 196 ? 11.523  15.072  -38.192 1.00 36.96  ? 196  ALA B O   1 
ATOM   4449 C CB  . ALA B 1 196 ? 13.555  13.004  -37.230 1.00 34.25  ? 196  ALA B CB  1 
ATOM   4450 N N   . ARG B 1 197 ? 12.129  14.163  -40.130 1.00 35.41  ? 197  ARG B N   1 
ATOM   4451 C CA  . ARG B 1 197 ? 11.814  15.385  -40.855 1.00 34.39  ? 197  ARG B CA  1 
ATOM   4452 C C   . ARG B 1 197 ? 12.512  16.571  -40.179 1.00 33.33  ? 197  ARG B C   1 
ATOM   4453 O O   . ARG B 1 197 ? 11.883  17.556  -39.775 1.00 31.81  ? 197  ARG B O   1 
ATOM   4454 C CB  . ARG B 1 197 ? 10.324  15.686  -40.881 1.00 38.68  ? 197  ARG B CB  1 
ATOM   4455 C CG  . ARG B 1 197 ? 9.294   14.623  -41.115 1.00 41.66  ? 197  ARG B CG  1 
ATOM   4456 C CD  . ARG B 1 197 ? 8.968   14.461  -42.592 1.00 42.07  ? 197  ARG B CD  1 
ATOM   4457 N NE  . ARG B 1 197 ? 7.681   13.758  -42.713 1.00 42.67  ? 197  ARG B NE  1 
ATOM   4458 C CZ  . ARG B 1 197 ? 6.750   14.209  -43.549 1.00 40.91  ? 197  ARG B CZ  1 
ATOM   4459 N NH1 . ARG B 1 197 ? 6.925   15.298  -44.292 1.00 40.00  ? 197  ARG B NH1 1 
ATOM   4460 N NH2 . ARG B 1 197 ? 5.622   13.536  -43.611 1.00 45.13  ? 197  ARG B NH2 1 
ATOM   4461 N N   . ALA B 1 198 ? 13.848  16.506  -40.092 1.00 33.01  ? 198  ALA B N   1 
ATOM   4462 C CA  . ALA B 1 198 ? 14.537  17.612  -39.416 1.00 31.90  ? 198  ALA B CA  1 
ATOM   4463 C C   . ALA B 1 198 ? 14.818  18.738  -40.405 1.00 32.08  ? 198  ALA B C   1 
ATOM   4464 O O   . ALA B 1 198 ? 14.865  18.465  -41.612 1.00 31.24  ? 198  ALA B O   1 
ATOM   4465 C CB  . ALA B 1 198 ? 15.819  17.106  -38.783 1.00 29.58  ? 198  ALA B CB  1 
ATOM   4466 N N   . ASP B 1 199 ? 15.012  19.950  -39.901 1.00 31.30  ? 199  ASP B N   1 
ATOM   4467 C CA  . ASP B 1 199 ? 15.508  21.019  -40.758 1.00 32.62  ? 199  ASP B CA  1 
ATOM   4468 C C   . ASP B 1 199 ? 16.997  20.778  -41.040 1.00 32.40  ? 199  ASP B C   1 
ATOM   4469 O O   . ASP B 1 199 ? 17.468  21.019  -42.144 1.00 32.15  ? 199  ASP B O   1 
ATOM   4470 C CB  . ASP B 1 199 ? 15.383  22.401  -40.106 1.00 33.42  ? 199  ASP B CB  1 
ATOM   4471 C CG  . ASP B 1 199 ? 13.956  22.643  -39.685 1.00 36.42  ? 199  ASP B CG  1 
ATOM   4472 O OD1 . ASP B 1 199 ? 13.071  22.202  -40.464 1.00 39.93  ? 199  ASP B OD1 1 
ATOM   4473 O OD2 . ASP B 1 199 ? 13.665  23.228  -38.625 1.00 35.77  ? 199  ASP B OD2 1 
ATOM   4474 N N   . VAL B 1 200 ? 17.795  20.315  -40.068 1.00 31.49  ? 200  VAL B N   1 
ATOM   4475 C CA  . VAL B 1 200 ? 19.217  20.138  -40.208 1.00 29.53  ? 200  VAL B CA  1 
ATOM   4476 C C   . VAL B 1 200 ? 19.693  18.819  -39.606 1.00 29.09  ? 200  VAL B C   1 
ATOM   4477 O O   . VAL B 1 200 ? 19.124  18.323  -38.632 1.00 28.42  ? 200  VAL B O   1 
ATOM   4478 C CB  . VAL B 1 200 ? 20.051  21.213  -39.467 1.00 31.32  ? 200  VAL B CB  1 
ATOM   4479 C CG1 . VAL B 1 200 ? 21.488  21.324  -39.991 1.00 29.72  ? 200  VAL B CG1 1 
ATOM   4480 C CG2 . VAL B 1 200 ? 19.467  22.597  -39.467 1.00 30.36  ? 200  VAL B CG2 1 
ATOM   4481 N N   . VAL B 1 201 ? 20.795  18.302  -40.125 1.00 27.20  ? 201  VAL B N   1 
ATOM   4482 C CA  . VAL B 1 201 ? 21.423  17.101  -39.624 1.00 27.29  ? 201  VAL B CA  1 
ATOM   4483 C C   . VAL B 1 201 ? 22.778  17.566  -39.064 1.00 28.67  ? 201  VAL B C   1 
ATOM   4484 O O   . VAL B 1 201 ? 23.485  18.286  -39.781 1.00 28.10  ? 201  VAL B O   1 
ATOM   4485 C CB  . VAL B 1 201 ? 21.631  16.013  -40.674 1.00 27.83  ? 201  VAL B CB  1 
ATOM   4486 C CG1 . VAL B 1 201 ? 22.336  14.795  -40.076 1.00 28.30  ? 201  VAL B CG1 1 
ATOM   4487 C CG2 . VAL B 1 201 ? 20.307  15.565  -41.297 1.00 26.40  ? 201  VAL B CG2 1 
ATOM   4488 N N   . PHE B 1 202 ? 23.016  17.314  -37.781 1.00 27.37  ? 202  PHE B N   1 
ATOM   4489 C CA  . PHE B 1 202 ? 24.295  17.685  -37.183 1.00 25.76  ? 202  PHE B CA  1 
ATOM   4490 C C   . PHE B 1 202 ? 25.061  16.375  -37.046 1.00 24.86  ? 202  PHE B C   1 
ATOM   4491 O O   . PHE B 1 202 ? 24.641  15.495  -36.284 1.00 26.24  ? 202  PHE B O   1 
ATOM   4492 C CB  . PHE B 1 202 ? 24.174  18.407  -35.858 1.00 26.91  ? 202  PHE B CB  1 
ATOM   4493 C CG  . PHE B 1 202 ? 25.494  18.614  -35.158 1.00 26.09  ? 202  PHE B CG  1 
ATOM   4494 C CD1 . PHE B 1 202 ? 26.482  19.401  -35.725 1.00 25.36  ? 202  PHE B CD1 1 
ATOM   4495 C CD2 . PHE B 1 202 ? 25.735  18.016  -33.931 1.00 25.74  ? 202  PHE B CD2 1 
ATOM   4496 C CE1 . PHE B 1 202 ? 27.691  19.589  -35.074 1.00 26.62  ? 202  PHE B CE1 1 
ATOM   4497 C CE2 . PHE B 1 202 ? 26.945  18.214  -33.273 1.00 24.96  ? 202  PHE B CE2 1 
ATOM   4498 C CZ  . PHE B 1 202 ? 27.931  18.984  -33.851 1.00 22.29  ? 202  PHE B CZ  1 
ATOM   4499 N N   . SER B 1 203 ? 26.118  16.219  -37.826 1.00 23.38  ? 203  SER B N   1 
ATOM   4500 C CA  . SER B 1 203 ? 26.848  14.962  -37.788 1.00 21.99  ? 203  SER B CA  1 
ATOM   4501 C C   . SER B 1 203 ? 28.153  15.067  -37.008 1.00 21.67  ? 203  SER B C   1 
ATOM   4502 O O   . SER B 1 203 ? 28.837  16.081  -37.054 1.00 20.53  ? 203  SER B O   1 
ATOM   4503 C CB  . SER B 1 203 ? 27.193  14.511  -39.211 1.00 17.50  ? 203  SER B CB  1 
ATOM   4504 O OG  . SER B 1 203 ? 27.752  13.211  -39.190 1.00 17.08  ? 203  SER B OG  1 
ATOM   4505 N N   . THR B 1 204 ? 28.480  13.977  -36.359 1.00 21.51  ? 204  THR B N   1 
ATOM   4506 C CA  . THR B 1 204 ? 29.703  13.827  -35.567 1.00 23.16  ? 204  THR B CA  1 
ATOM   4507 C C   . THR B 1 204 ? 30.244  12.437  -35.896 1.00 21.27  ? 204  THR B C   1 
ATOM   4508 O O   . THR B 1 204 ? 30.943  11.806  -35.139 1.00 21.17  ? 204  THR B O   1 
ATOM   4509 C CB  . THR B 1 204 ? 29.539  14.016  -34.051 1.00 22.00  ? 204  THR B CB  1 
ATOM   4510 O OG1 . THR B 1 204 ? 28.418  13.290  -33.517 1.00 19.59  ? 204  THR B OG1 1 
ATOM   4511 C CG2 . THR B 1 204 ? 29.361  15.496  -33.714 1.00 18.59  ? 204  THR B CG2 1 
ATOM   4512 N N   . VAL B 1 205 ? 29.785  11.931  -37.037 1.00 21.08  ? 205  VAL B N   1 
ATOM   4513 C CA  . VAL B 1 205 ? 30.277  10.631  -37.550 1.00 21.25  ? 205  VAL B CA  1 
ATOM   4514 C C   . VAL B 1 205 ? 31.729  10.838  -37.961 1.00 21.93  ? 205  VAL B C   1 
ATOM   4515 O O   . VAL B 1 205 ? 32.078  11.934  -38.448 1.00 22.05  ? 205  VAL B O   1 
ATOM   4516 C CB  . VAL B 1 205 ? 29.349  10.154  -38.677 1.00 20.34  ? 205  VAL B CB  1 
ATOM   4517 C CG1 . VAL B 1 205 ? 29.947  8.967   -39.431 1.00 19.67  ? 205  VAL B CG1 1 
ATOM   4518 C CG2 . VAL B 1 205 ? 27.989  9.748   -38.066 1.00 17.94  ? 205  VAL B CG2 1 
ATOM   4519 N N   . VAL B 1 206 ? 32.659  9.958   -37.615 1.00 22.19  ? 206  VAL B N   1 
ATOM   4520 C CA  . VAL B 1 206 ? 34.049  10.197  -37.973 1.00 23.81  ? 206  VAL B CA  1 
ATOM   4521 C C   . VAL B 1 206 ? 34.613  8.978   -38.687 1.00 24.40  ? 206  VAL B C   1 
ATOM   4522 O O   . VAL B 1 206 ? 34.309  7.842   -38.381 1.00 24.78  ? 206  VAL B O   1 
ATOM   4523 C CB  . VAL B 1 206 ? 34.967  10.742  -36.857 1.00 25.36  ? 206  VAL B CB  1 
ATOM   4524 C CG1 . VAL B 1 206 ? 34.265  11.290  -35.623 1.00 22.19  ? 206  VAL B CG1 1 
ATOM   4525 C CG2 . VAL B 1 206 ? 36.114  9.815   -36.460 1.00 20.55  ? 206  VAL B CG2 1 
ATOM   4526 N N   . GLY B 1 207 ? 35.460  9.193   -39.685 1.00 27.33  ? 207  GLY B N   1 
ATOM   4527 C CA  . GLY B 1 207 ? 36.144  8.206   -40.484 1.00 29.22  ? 207  GLY B CA  1 
ATOM   4528 C C   . GLY B 1 207 ? 35.288  7.439   -41.501 1.00 31.01  ? 207  GLY B C   1 
ATOM   4529 O O   . GLY B 1 207 ? 34.230  7.843   -41.987 1.00 29.55  ? 207  GLY B O   1 
ATOM   4530 N N   . THR B 1 208 ? 35.804  6.264   -41.847 1.00 31.41  ? 208  THR B N   1 
ATOM   4531 C CA  . THR B 1 208 ? 35.174  5.359   -42.792 1.00 33.70  ? 208  THR B CA  1 
ATOM   4532 C C   . THR B 1 208 ? 33.699  5.165   -42.500 1.00 34.43  ? 208  THR B C   1 
ATOM   4533 O O   . THR B 1 208 ? 33.230  4.951   -41.376 1.00 35.55  ? 208  THR B O   1 
ATOM   4534 C CB  . THR B 1 208 ? 36.015  4.075   -42.813 1.00 35.72  ? 208  THR B CB  1 
ATOM   4535 O OG1 . THR B 1 208 ? 37.318  4.470   -43.313 1.00 38.41  ? 208  THR B OG1 1 
ATOM   4536 C CG2 . THR B 1 208 ? 35.442  3.004   -43.713 1.00 36.72  ? 208  THR B CG2 1 
ATOM   4537 N N   . GLY B 1 209 ? 32.864  5.340   -43.522 1.00 34.36  ? 209  GLY B N   1 
ATOM   4538 C CA  . GLY B 1 209 ? 31.408  5.248   -43.339 1.00 34.17  ? 209  GLY B CA  1 
ATOM   4539 C C   . GLY B 1 209 ? 30.796  6.641   -43.402 1.00 33.76  ? 209  GLY B C   1 
ATOM   4540 O O   . GLY B 1 209 ? 29.610  6.815   -43.714 1.00 34.97  ? 209  GLY B O   1 
ATOM   4541 N N   . THR B 1 210 ? 31.611  7.675   -43.206 1.00 32.32  ? 210  THR B N   1 
ATOM   4542 C CA  . THR B 1 210 ? 31.106  9.040   -43.371 1.00 31.55  ? 210  THR B CA  1 
ATOM   4543 C C   . THR B 1 210 ? 30.513  9.206   -44.775 1.00 32.62  ? 210  THR B C   1 
ATOM   4544 O O   . THR B 1 210 ? 29.353  9.614   -44.868 1.00 31.69  ? 210  THR B O   1 
ATOM   4545 C CB  . THR B 1 210 ? 32.187  10.102  -43.110 1.00 28.73  ? 210  THR B CB  1 
ATOM   4546 O OG1 . THR B 1 210 ? 32.744  9.941   -41.786 1.00 28.91  ? 210  THR B OG1 1 
ATOM   4547 C CG2 . THR B 1 210 ? 31.619  11.495  -43.276 1.00 25.47  ? 210  THR B CG2 1 
ATOM   4548 N N   . ALA B 1 211 ? 31.273  8.911   -45.836 1.00 32.63  ? 211  ALA B N   1 
ATOM   4549 C CA  . ALA B 1 211 ? 30.831  9.062   -47.215 1.00 33.52  ? 211  ALA B CA  1 
ATOM   4550 C C   . ALA B 1 211 ? 29.548  8.300   -47.542 1.00 33.95  ? 211  ALA B C   1 
ATOM   4551 O O   . ALA B 1 211 ? 28.615  8.827   -48.129 1.00 32.74  ? 211  ALA B O   1 
ATOM   4552 C CB  . ALA B 1 211 ? 31.905  8.575   -48.192 1.00 32.00  ? 211  ALA B CB  1 
ATOM   4553 N N   . GLU B 1 212 ? 29.513  7.038   -47.145 1.00 34.98  ? 212  GLU B N   1 
ATOM   4554 C CA  . GLU B 1 212 ? 28.348  6.180   -47.318 1.00 37.37  ? 212  GLU B CA  1 
ATOM   4555 C C   . GLU B 1 212 ? 27.163  6.766   -46.568 1.00 37.58  ? 212  GLU B C   1 
ATOM   4556 O O   . GLU B 1 212 ? 26.033  6.889   -47.055 1.00 38.31  ? 212  GLU B O   1 
ATOM   4557 C CB  . GLU B 1 212 ? 28.677  4.775   -46.815 1.00 40.54  ? 212  GLU B CB  1 
ATOM   4558 C CG  . GLU B 1 212 ? 29.888  4.157   -47.492 1.00 48.35  ? 212  GLU B CG  1 
ATOM   4559 C CD  . GLU B 1 212 ? 31.234  4.451   -46.846 1.00 52.47  ? 212  GLU B CD  1 
ATOM   4560 O OE1 . GLU B 1 212 ? 31.529  5.607   -46.467 1.00 52.23  ? 212  GLU B OE1 1 
ATOM   4561 O OE2 . GLU B 1 212 ? 32.051  3.498   -46.699 1.00 53.85  ? 212  GLU B OE2 1 
ATOM   4562 N N   . LEU B 1 213 ? 27.429  7.255   -45.348 1.00 37.65  ? 213  LEU B N   1 
ATOM   4563 C CA  . LEU B 1 213 ? 26.328  7.863   -44.597 1.00 37.34  ? 213  LEU B CA  1 
ATOM   4564 C C   . LEU B 1 213 ? 25.665  8.993   -45.379 1.00 37.02  ? 213  LEU B C   1 
ATOM   4565 O O   . LEU B 1 213 ? 24.431  9.056   -45.502 1.00 36.09  ? 213  LEU B O   1 
ATOM   4566 C CB  . LEU B 1 213 ? 26.812  8.313   -43.221 1.00 33.47  ? 213  LEU B CB  1 
ATOM   4567 C CG  . LEU B 1 213 ? 25.905  9.263   -42.447 1.00 31.94  ? 213  LEU B CG  1 
ATOM   4568 C CD1 . LEU B 1 213 ? 24.468  8.787   -42.390 1.00 29.61  ? 213  LEU B CD1 1 
ATOM   4569 C CD2 . LEU B 1 213 ? 26.429  9.392   -41.011 1.00 32.87  ? 213  LEU B CD2 1 
ATOM   4570 N N   . TYR B 1 214 ? 26.469  9.920   -45.891 1.00 36.07  ? 214  TYR B N   1 
ATOM   4571 C CA  . TYR B 1 214 ? 25.979  11.088  -46.602 1.00 37.23  ? 214  TYR B CA  1 
ATOM   4572 C C   . TYR B 1 214 ? 25.301  10.696  -47.926 1.00 38.54  ? 214  TYR B C   1 
ATOM   4573 O O   . TYR B 1 214 ? 24.453  11.426  -48.435 1.00 38.09  ? 214  TYR B O   1 
ATOM   4574 C CB  . TYR B 1 214 ? 27.066  12.107  -46.904 1.00 34.62  ? 214  TYR B CB  1 
ATOM   4575 C CG  . TYR B 1 214 ? 27.589  13.031  -45.847 1.00 31.55  ? 214  TYR B CG  1 
ATOM   4576 C CD1 . TYR B 1 214 ? 28.138  12.574  -44.647 1.00 29.79  ? 214  TYR B CD1 1 
ATOM   4577 C CD2 . TYR B 1 214 ? 27.593  14.404  -46.081 1.00 29.52  ? 214  TYR B CD2 1 
ATOM   4578 C CE1 . TYR B 1 214 ? 28.625  13.468  -43.695 1.00 28.08  ? 214  TYR B CE1 1 
ATOM   4579 C CE2 . TYR B 1 214 ? 28.075  15.303  -45.147 1.00 28.28  ? 214  TYR B CE2 1 
ATOM   4580 C CZ  . TYR B 1 214 ? 28.602  14.816  -43.956 1.00 26.89  ? 214  TYR B CZ  1 
ATOM   4581 O OH  . TYR B 1 214 ? 29.083  15.712  -43.040 1.00 25.46  ? 214  TYR B OH  1 
ATOM   4582 N N   . ARG B 1 215 ? 25.761  9.605   -48.514 1.00 40.20  ? 215  ARG B N   1 
ATOM   4583 C CA  . ARG B 1 215 ? 25.199  9.100   -49.767 1.00 42.28  ? 215  ARG B CA  1 
ATOM   4584 C C   . ARG B 1 215 ? 23.844  8.480   -49.442 1.00 41.96  ? 215  ARG B C   1 
ATOM   4585 O O   . ARG B 1 215 ? 22.864  8.860   -50.084 1.00 41.30  ? 215  ARG B O   1 
ATOM   4586 C CB  . ARG B 1 215 ? 26.212  8.169   -50.404 1.00 44.90  ? 215  ARG B CB  1 
ATOM   4587 C CG  . ARG B 1 215 ? 25.877  7.495   -51.708 1.00 49.44  ? 215  ARG B CG  1 
ATOM   4588 C CD  . ARG B 1 215 ? 27.065  7.115   -52.556 1.00 53.11  ? 215  ARG B CD  1 
ATOM   4589 N NE  . ARG B 1 215 ? 28.317  6.709   -51.977 1.00 55.38  ? 215  ARG B NE  1 
ATOM   4590 C CZ  . ARG B 1 215 ? 29.330  7.446   -51.525 1.00 58.34  ? 215  ARG B CZ  1 
ATOM   4591 N NH1 . ARG B 1 215 ? 29.286  8.780   -51.540 1.00 58.22  ? 215  ARG B NH1 1 
ATOM   4592 N NH2 . ARG B 1 215 ? 30.434  6.866   -51.041 1.00 58.95  ? 215  ARG B NH2 1 
ATOM   4593 N N   . ALA B 1 216 ? 23.749  7.682   -48.380 1.00 41.74  ? 216  ALA B N   1 
ATOM   4594 C CA  . ALA B 1 216 ? 22.468  7.088   -47.983 1.00 41.56  ? 216  ALA B CA  1 
ATOM   4595 C C   . ALA B 1 216 ? 21.465  8.152   -47.580 1.00 42.22  ? 216  ALA B C   1 
ATOM   4596 O O   . ALA B 1 216 ? 20.315  8.120   -48.056 1.00 41.93  ? 216  ALA B O   1 
ATOM   4597 C CB  . ALA B 1 216 ? 22.619  6.044   -46.904 1.00 39.75  ? 216  ALA B CB  1 
ATOM   4598 N N   . ILE B 1 217 ? 21.877  9.183   -46.838 1.00 42.73  ? 217  ILE B N   1 
ATOM   4599 C CA  . ILE B 1 217 ? 20.925  10.270  -46.563 1.00 43.50  ? 217  ILE B CA  1 
ATOM   4600 C C   . ILE B 1 217 ? 20.408  10.808  -47.900 1.00 45.61  ? 217  ILE B C   1 
ATOM   4601 O O   . ILE B 1 217 ? 19.211  10.980  -48.075 1.00 44.34  ? 217  ILE B O   1 
ATOM   4602 C CB  . ILE B 1 217 ? 21.498  11.417  -45.726 1.00 38.13  ? 217  ILE B CB  1 
ATOM   4603 C CG1 . ILE B 1 217 ? 21.918  10.881  -44.346 1.00 38.64  ? 217  ILE B CG1 1 
ATOM   4604 C CG2 . ILE B 1 217 ? 20.517  12.563  -45.625 1.00 33.80  ? 217  ILE B CG2 1 
ATOM   4605 C CD1 . ILE B 1 217 ? 22.570  11.845  -43.392 1.00 31.19  ? 217  ILE B CD1 1 
ATOM   4606 N N   . ALA B 1 218 ? 21.335  11.082  -48.816 1.00 48.23  ? 218  ALA B N   1 
ATOM   4607 C CA  . ALA B 1 218 ? 21.008  11.589  -50.138 1.00 51.59  ? 218  ALA B CA  1 
ATOM   4608 C C   . ALA B 1 218 ? 19.947  10.749  -50.857 1.00 53.73  ? 218  ALA B C   1 
ATOM   4609 O O   . ALA B 1 218 ? 18.913  11.298  -51.220 1.00 53.20  ? 218  ALA B O   1 
ATOM   4610 C CB  . ALA B 1 218 ? 22.259  11.663  -51.007 1.00 48.08  ? 218  ALA B CB  1 
ATOM   4611 N N   . ARG B 1 219 ? 20.218  9.473   -51.097 1.00 56.29  ? 219  ARG B N   1 
ATOM   4612 C CA  . ARG B 1 219 ? 19.305  8.596   -51.803 1.00 59.82  ? 219  ARG B CA  1 
ATOM   4613 C C   . ARG B 1 219 ? 17.974  8.475   -51.056 1.00 61.12  ? 219  ARG B C   1 
ATOM   4614 O O   . ARG B 1 219 ? 16.893  8.585   -51.639 1.00 60.92  ? 219  ARG B O   1 
ATOM   4615 C CB  . ARG B 1 219 ? 19.893  7.211   -52.010 1.00 62.79  ? 219  ARG B CB  1 
ATOM   4616 C CG  . ARG B 1 219 ? 21.335  7.062   -52.450 1.00 67.28  ? 219  ARG B CG  1 
ATOM   4617 C CD  . ARG B 1 219 ? 21.783  5.634   -52.183 1.00 72.25  ? 219  ARG B CD  1 
ATOM   4618 N NE  . ARG B 1 219 ? 23.064  5.201   -52.674 1.00 76.25  ? 219  ARG B NE  1 
ATOM   4619 C CZ  . ARG B 1 219 ? 23.536  5.210   -53.914 1.00 78.60  ? 219  ARG B CZ  1 
ATOM   4620 N NH1 . ARG B 1 219 ? 22.836  5.682   -54.939 1.00 78.70  ? 219  ARG B NH1 1 
ATOM   4621 N NH2 . ARG B 1 219 ? 24.757  4.732   -54.150 1.00 79.80  ? 219  ARG B NH2 1 
ATOM   4622 N N   . ARG B 1 220 ? 18.035  8.280   -49.743 1.00 62.60  ? 220  ARG B N   1 
ATOM   4623 C CA  . ARG B 1 220 ? 16.843  8.130   -48.927 1.00 64.19  ? 220  ARG B CA  1 
ATOM   4624 C C   . ARG B 1 220 ? 15.821  9.221   -49.210 1.00 64.60  ? 220  ARG B C   1 
ATOM   4625 O O   . ARG B 1 220 ? 14.640  8.972   -49.433 1.00 64.37  ? 220  ARG B O   1 
ATOM   4626 C CB  . ARG B 1 220 ? 17.185  8.161   -47.433 1.00 66.03  ? 220  ARG B CB  1 
ATOM   4627 C CG  . ARG B 1 220 ? 16.009  7.721   -46.574 1.00 68.32  ? 220  ARG B CG  1 
ATOM   4628 C CD  . ARG B 1 220 ? 15.744  6.233   -46.811 1.00 70.11  ? 220  ARG B CD  1 
ATOM   4629 N NE  . ARG B 1 220 ? 14.508  5.803   -46.179 1.00 71.66  ? 220  ARG B NE  1 
ATOM   4630 C CZ  . ARG B 1 220 ? 13.281  6.164   -46.524 1.00 71.03  ? 220  ARG B CZ  1 
ATOM   4631 N NH1 . ARG B 1 220 ? 13.048  6.991   -47.532 1.00 71.14  ? 220  ARG B NH1 1 
ATOM   4632 N NH2 . ARG B 1 220 ? 12.257  5.688   -45.826 1.00 70.78  ? 220  ARG B NH2 1 
ATOM   4633 N N   . TYR B 1 221 ? 16.281  10.464  -49.117 1.00 65.55  ? 221  TYR B N   1 
ATOM   4634 C CA  . TYR B 1 221 ? 15.393  11.602  -49.333 1.00 66.78  ? 221  TYR B CA  1 
ATOM   4635 C C   . TYR B 1 221 ? 14.867  11.539  -50.745 1.00 68.61  ? 221  TYR B C   1 
ATOM   4636 O O   . TYR B 1 221 ? 15.527  10.946  -51.611 1.00 68.74  ? 221  TYR B O   1 
ATOM   4637 C CB  . TYR B 1 221 ? 16.104  12.916  -49.001 1.00 64.81  ? 221  TYR B CB  1 
ATOM   4638 C CG  . TYR B 1 221 ? 15.819  13.261  -47.549 1.00 61.80  ? 221  TYR B CG  1 
ATOM   4639 C CD1 . TYR B 1 221 ? 16.513  12.673  -46.503 1.00 60.48  ? 221  TYR B CD1 1 
ATOM   4640 C CD2 . TYR B 1 221 ? 14.800  14.152  -47.260 1.00 59.96  ? 221  TYR B CD2 1 
ATOM   4641 C CE1 . TYR B 1 221 ? 16.210  12.987  -45.190 1.00 58.90  ? 221  TYR B CE1 1 
ATOM   4642 C CE2 . TYR B 1 221 ? 14.491  14.461  -45.951 1.00 59.16  ? 221  TYR B CE2 1 
ATOM   4643 C CZ  . TYR B 1 221 ? 15.199  13.877  -44.922 1.00 58.03  ? 221  TYR B CZ  1 
ATOM   4644 O OH  . TYR B 1 221 ? 14.904  14.185  -43.619 1.00 56.37  ? 221  TYR B OH  1 
ATOM   4645 N N   . GLY B 1 222 ? 13.740  12.174  -51.047 1.00 70.39  ? 222  GLY B N   1 
ATOM   4646 C CA  . GLY B 1 222 ? 13.170  12.101  -52.403 1.00 72.95  ? 222  GLY B CA  1 
ATOM   4647 C C   . GLY B 1 222 ? 13.873  13.088  -53.310 1.00 73.85  ? 222  GLY B C   1 
ATOM   4648 O O   . GLY B 1 222 ? 13.367  14.083  -53.828 1.00 73.70  ? 222  GLY B O   1 
ATOM   4649 N N   . ASP B 1 223 ? 15.181  12.935  -53.395 1.00 74.73  ? 223  ASP B N   1 
ATOM   4650 C CA  . ASP B 1 223 ? 16.229  13.706  -54.025 1.00 75.48  ? 223  ASP B CA  1 
ATOM   4651 C C   . ASP B 1 223 ? 15.728  15.140  -54.163 1.00 74.97  ? 223  ASP B C   1 
ATOM   4652 O O   . ASP B 1 223 ? 15.738  15.807  -55.184 1.00 75.22  ? 223  ASP B O   1 
ATOM   4653 C CB  . ASP B 1 223 ? 16.764  12.983  -55.248 1.00 78.45  ? 223  ASP B CB  1 
ATOM   4654 C CG  . ASP B 1 223 ? 17.377  11.645  -54.833 1.00 79.76  ? 223  ASP B CG  1 
ATOM   4655 O OD1 . ASP B 1 223 ? 16.719  10.825  -54.156 1.00 79.54  ? 223  ASP B OD1 1 
ATOM   4656 O OD2 . ASP B 1 223 ? 18.552  11.418  -55.204 1.00 80.55  ? 223  ASP B OD2 1 
ATOM   4657 N N   . GLY B 1 224 ? 15.351  15.612  -52.952 1.00 73.92  ? 224  GLY B N   1 
ATOM   4658 C CA  . GLY B 1 224 ? 14.646  16.814  -52.754 1.00 72.70  ? 224  GLY B CA  1 
ATOM   4659 C C   . GLY B 1 224 ? 14.533  17.572  -51.473 1.00 70.95  ? 224  GLY B C   1 
ATOM   4660 O O   . GLY B 1 224 ? 13.888  17.365  -50.458 1.00 71.12  ? 224  GLY B O   1 
ATOM   4661 N N   . ARG B 1 225 ? 15.230  18.694  -51.599 1.00 69.88  ? 225  ARG B N   1 
ATOM   4662 C CA  . ARG B 1 225 ? 15.539  19.721  -50.631 1.00 67.36  ? 225  ARG B CA  1 
ATOM   4663 C C   . ARG B 1 225 ? 15.583  19.019  -49.267 1.00 64.55  ? 225  ARG B C   1 
ATOM   4664 O O   . ARG B 1 225 ? 14.756  19.194  -48.390 1.00 65.17  ? 225  ARG B O   1 
ATOM   4665 C CB  . ARG B 1 225 ? 14.759  21.002  -50.691 1.00 68.23  ? 225  ARG B CB  1 
ATOM   4666 C CG  . ARG B 1 225 ? 13.505  21.023  -51.533 1.00 70.19  ? 225  ARG B CG  1 
ATOM   4667 C CD  . ARG B 1 225 ? 12.496  22.055  -51.076 1.00 71.46  ? 225  ARG B CD  1 
ATOM   4668 N NE  . ARG B 1 225 ? 12.337  22.132  -49.641 1.00 73.90  ? 225  ARG B NE  1 
ATOM   4669 C CZ  . ARG B 1 225 ? 12.069  21.235  -48.708 1.00 74.48  ? 225  ARG B CZ  1 
ATOM   4670 N NH1 . ARG B 1 225 ? 11.874  19.943  -48.923 1.00 73.92  ? 225  ARG B NH1 1 
ATOM   4671 N NH2 . ARG B 1 225 ? 12.004  21.665  -47.447 1.00 74.68  ? 225  ARG B NH2 1 
ATOM   4672 N N   . ARG B 1 226 ? 16.606  18.158  -49.197 1.00 61.03  ? 226  ARG B N   1 
ATOM   4673 C CA  . ARG B 1 226 ? 16.857  17.420  -47.975 1.00 57.28  ? 226  ARG B CA  1 
ATOM   4674 C C   . ARG B 1 226 ? 17.281  18.503  -46.963 1.00 52.57  ? 226  ARG B C   1 
ATOM   4675 O O   . ARG B 1 226 ? 17.574  19.646  -47.332 1.00 52.50  ? 226  ARG B O   1 
ATOM   4676 C CB  . ARG B 1 226 ? 18.043  16.463  -48.073 1.00 60.25  ? 226  ARG B CB  1 
ATOM   4677 C CG  . ARG B 1 226 ? 18.477  16.029  -49.449 1.00 62.88  ? 226  ARG B CG  1 
ATOM   4678 C CD  . ARG B 1 226 ? 19.824  15.335  -49.463 1.00 65.35  ? 226  ARG B CD  1 
ATOM   4679 N NE  . ARG B 1 226 ? 20.954  16.244  -49.676 1.00 67.01  ? 226  ARG B NE  1 
ATOM   4680 C CZ  . ARG B 1 226 ? 21.875  16.001  -50.611 1.00 68.32  ? 226  ARG B CZ  1 
ATOM   4681 N NH1 . ARG B 1 226 ? 21.768  14.925  -51.388 1.00 67.50  ? 226  ARG B NH1 1 
ATOM   4682 N NH2 . ARG B 1 226 ? 22.894  16.833  -50.785 1.00 68.52  ? 226  ARG B NH2 1 
ATOM   4683 N N   . PRO B 1 227 ? 17.297  18.084  -45.713 1.00 48.30  ? 227  PRO B N   1 
ATOM   4684 C CA  . PRO B 1 227 ? 17.883  18.948  -44.686 1.00 44.41  ? 227  PRO B CA  1 
ATOM   4685 C C   . PRO B 1 227 ? 19.381  18.896  -44.963 1.00 39.74  ? 227  PRO B C   1 
ATOM   4686 O O   . PRO B 1 227 ? 19.905  17.851  -45.364 1.00 38.67  ? 227  PRO B O   1 
ATOM   4687 C CB  . PRO B 1 227 ? 17.491  18.202  -43.428 1.00 45.09  ? 227  PRO B CB  1 
ATOM   4688 C CG  . PRO B 1 227 ? 17.524  16.757  -43.801 1.00 46.25  ? 227  PRO B CG  1 
ATOM   4689 C CD  . PRO B 1 227 ? 17.042  16.715  -45.226 1.00 47.26  ? 227  PRO B CD  1 
ATOM   4690 N N   . PRO B 1 228 ? 20.076  20.003  -44.863 1.00 36.32  ? 228  PRO B N   1 
ATOM   4691 C CA  . PRO B 1 228 ? 21.520  20.051  -45.029 1.00 34.91  ? 228  PRO B CA  1 
ATOM   4692 C C   . PRO B 1 228 ? 22.236  19.344  -43.873 1.00 32.55  ? 228  PRO B C   1 
ATOM   4693 O O   . PRO B 1 228 ? 21.731  19.290  -42.762 1.00 30.45  ? 228  PRO B O   1 
ATOM   4694 C CB  . PRO B 1 228 ? 21.889  21.527  -44.943 1.00 35.26  ? 228  PRO B CB  1 
ATOM   4695 C CG  . PRO B 1 228 ? 20.587  22.248  -44.991 1.00 36.88  ? 228  PRO B CG  1 
ATOM   4696 C CD  . PRO B 1 228 ? 19.542  21.312  -44.431 1.00 36.42  ? 228  PRO B CD  1 
ATOM   4697 N N   . ILE B 1 229 ? 23.400  18.797  -44.116 1.00 30.43  ? 229  ILE B N   1 
ATOM   4698 C CA  . ILE B 1 229 ? 24.223  18.152  -43.133 1.00 29.61  ? 229  ILE B CA  1 
ATOM   4699 C C   . ILE B 1 229 ? 25.325  19.116  -42.666 1.00 30.47  ? 229  ILE B C   1 
ATOM   4700 O O   . ILE B 1 229 ? 26.107  19.639  -43.467 1.00 30.28  ? 229  ILE B O   1 
ATOM   4701 C CB  . ILE B 1 229 ? 24.874  16.862  -43.649 1.00 25.89  ? 229  ILE B CB  1 
ATOM   4702 C CG1 . ILE B 1 229 ? 23.793  15.934  -44.198 1.00 20.72  ? 229  ILE B CG1 1 
ATOM   4703 C CG2 . ILE B 1 229 ? 25.712  16.204  -42.546 1.00 23.17  ? 229  ILE B CG2 1 
ATOM   4704 C CD1 . ILE B 1 229 ? 24.270  14.580  -44.645 1.00 15.48  ? 229  ILE B CD1 1 
ATOM   4705 N N   . ALA B 1 230 ? 25.341  19.351  -41.363 1.00 30.02  ? 230  ALA B N   1 
ATOM   4706 C CA  . ALA B 1 230 ? 26.349  20.225  -40.750 1.00 29.60  ? 230  ALA B CA  1 
ATOM   4707 C C   . ALA B 1 230 ? 27.198  19.305  -39.871 1.00 28.93  ? 230  ALA B C   1 
ATOM   4708 O O   . ALA B 1 230 ? 26.693  18.493  -39.085 1.00 28.64  ? 230  ALA B O   1 
ATOM   4709 C CB  . ALA B 1 230 ? 25.747  21.379  -39.999 1.00 29.85  ? 230  ALA B CB  1 
ATOM   4710 N N   . SER B 1 231 ? 28.501  19.326  -40.103 1.00 27.33  ? 231  SER B N   1 
ATOM   4711 C CA  . SER B 1 231 ? 29.351  18.420  -39.373 1.00 27.20  ? 231  SER B CA  1 
ATOM   4712 C C   . SER B 1 231 ? 30.488  19.138  -38.687 1.00 28.35  ? 231  SER B C   1 
ATOM   4713 O O   . SER B 1 231 ? 31.029  20.101  -39.189 1.00 27.82  ? 231  SER B O   1 
ATOM   4714 C CB  . SER B 1 231 ? 29.941  17.292  -40.228 1.00 24.43  ? 231  SER B CB  1 
ATOM   4715 O OG  . SER B 1 231 ? 30.559  16.370  -39.304 1.00 23.13  ? 231  SER B OG  1 
ATOM   4716 N N   . LEU B 1 232 ? 30.906  18.527  -37.583 1.00 29.59  ? 232  LEU B N   1 
ATOM   4717 C CA  . LEU B 1 232 ? 32.039  19.034  -36.814 1.00 30.11  ? 232  LEU B CA  1 
ATOM   4718 C C   . LEU B 1 232 ? 33.260  18.189  -37.162 1.00 30.20  ? 232  LEU B C   1 
ATOM   4719 O O   . LEU B 1 232 ? 34.395  18.508  -36.866 1.00 29.42  ? 232  LEU B O   1 
ATOM   4720 C CB  . LEU B 1 232 ? 31.691  18.725  -35.374 1.00 31.78  ? 232  LEU B CB  1 
ATOM   4721 C CG  . LEU B 1 232 ? 31.742  19.675  -34.208 1.00 29.32  ? 232  LEU B CG  1 
ATOM   4722 C CD1 . LEU B 1 232 ? 32.116  18.824  -32.989 1.00 21.98  ? 232  LEU B CD1 1 
ATOM   4723 C CD2 . LEU B 1 232 ? 32.635  20.876  -34.461 1.00 28.42  ? 232  LEU B CD2 1 
ATOM   4724 N N   . THR B 1 233 ? 32.989  17.009  -37.726 1.00 30.01  ? 233  THR B N   1 
ATOM   4725 C CA  . THR B 1 233 ? 34.009  16.012  -38.009 1.00 29.60  ? 233  THR B CA  1 
ATOM   4726 C C   . THR B 1 233 ? 34.401  15.774  -39.456 1.00 29.29  ? 233  THR B C   1 
ATOM   4727 O O   . THR B 1 233 ? 35.586  15.511  -39.717 1.00 29.57  ? 233  THR B O   1 
ATOM   4728 C CB  . THR B 1 233 ? 33.518  14.652  -37.435 1.00 29.09  ? 233  THR B CB  1 
ATOM   4729 O OG1 . THR B 1 233 ? 32.207  14.329  -37.950 1.00 27.07  ? 233  THR B OG1 1 
ATOM   4730 C CG2 . THR B 1 233 ? 33.479  14.735  -35.910 1.00 29.31  ? 233  THR B CG2 1 
ATOM   4731 N N   . THR B 1 234 ? 33.458  15.785  -40.395 1.00 27.92  ? 234  THR B N   1 
ATOM   4732 C CA  . THR B 1 234 ? 33.783  15.555  -41.800 1.00 25.97  ? 234  THR B CA  1 
ATOM   4733 C C   . THR B 1 234 ? 34.967  16.379  -42.308 1.00 23.83  ? 234  THR B C   1 
ATOM   4734 O O   . THR B 1 234 ? 35.017  17.602  -42.145 1.00 21.05  ? 234  THR B O   1 
ATOM   4735 C CB  . THR B 1 234 ? 32.542  15.857  -42.678 1.00 27.25  ? 234  THR B CB  1 
ATOM   4736 O OG1 . THR B 1 234 ? 31.557  14.872  -42.326 1.00 25.39  ? 234  THR B OG1 1 
ATOM   4737 C CG2 . THR B 1 234 ? 32.880  15.773  -44.165 1.00 23.39  ? 234  THR B CG2 1 
ATOM   4738 N N   . SER B 1 235 ? 35.921  15.722  -42.953 1.00 23.31  ? 235  SER B N   1 
ATOM   4739 C CA  . SER B 1 235 ? 37.021  16.510  -43.513 1.00 27.18  ? 235  SER B CA  1 
ATOM   4740 C C   . SER B 1 235 ? 37.027  16.425  -45.042 1.00 28.78  ? 235  SER B C   1 
ATOM   4741 O O   . SER B 1 235 ? 36.383  15.584  -45.678 1.00 27.31  ? 235  SER B O   1 
ATOM   4742 C CB  . SER B 1 235 ? 38.415  16.085  -43.066 1.00 24.54  ? 235  SER B CB  1 
ATOM   4743 O OG  . SER B 1 235 ? 38.702  14.825  -43.665 1.00 26.87  ? 235  SER B OG  1 
ATOM   4744 N N   . GLU B 1 236 ? 37.981  17.202  -45.586 1.00 30.64  ? 236  GLU B N   1 
ATOM   4745 C CA  . GLU B 1 236 ? 38.231  17.105  -47.032 1.00 32.33  ? 236  GLU B CA  1 
ATOM   4746 C C   . GLU B 1 236 ? 38.459  15.656  -47.442 1.00 32.50  ? 236  GLU B C   1 
ATOM   4747 O O   . GLU B 1 236 ? 38.026  15.266  -48.533 1.00 33.97  ? 236  GLU B O   1 
ATOM   4748 C CB  . GLU B 1 236 ? 39.454  17.905  -47.390 1.00 35.87  ? 236  GLU B CB  1 
ATOM   4749 C CG  . GLU B 1 236 ? 39.290  19.112  -48.282 1.00 39.21  ? 236  GLU B CG  1 
ATOM   4750 C CD  . GLU B 1 236 ? 39.488  20.370  -47.464 1.00 40.20  ? 236  GLU B CD  1 
ATOM   4751 O OE1 . GLU B 1 236 ? 38.784  20.413  -46.428 1.00 44.35  ? 236  GLU B OE1 1 
ATOM   4752 O OE2 . GLU B 1 236 ? 40.295  21.227  -47.841 1.00 36.53  ? 236  GLU B OE2 1 
ATOM   4753 N N   . ALA B 1 237 ? 39.122  14.814  -46.643 1.00 32.17  ? 237  ALA B N   1 
ATOM   4754 C CA  . ALA B 1 237 ? 39.321  13.418  -46.994 1.00 32.69  ? 237  ALA B CA  1 
ATOM   4755 C C   . ALA B 1 237 ? 37.982  12.697  -47.156 1.00 33.96  ? 237  ALA B C   1 
ATOM   4756 O O   . ALA B 1 237 ? 37.913  11.845  -48.059 1.00 35.98  ? 237  ALA B O   1 
ATOM   4757 C CB  . ALA B 1 237 ? 40.239  12.684  -46.038 1.00 28.76  ? 237  ALA B CB  1 
ATOM   4758 N N   . GLU B 1 238 ? 36.950  13.015  -46.394 1.00 33.03  ? 238  GLU B N   1 
ATOM   4759 C CA  . GLU B 1 238 ? 35.657  12.370  -46.579 1.00 34.05  ? 238  GLU B CA  1 
ATOM   4760 C C   . GLU B 1 238 ? 34.893  12.939  -47.781 1.00 34.56  ? 238  GLU B C   1 
ATOM   4761 O O   . GLU B 1 238 ? 34.201  12.210  -48.494 1.00 32.40  ? 238  GLU B O   1 
ATOM   4762 C CB  . GLU B 1 238 ? 34.792  12.475  -45.314 1.00 31.05  ? 238  GLU B CB  1 
ATOM   4763 C CG  . GLU B 1 238 ? 35.177  11.532  -44.184 1.00 32.67  ? 238  GLU B CG  1 
ATOM   4764 C CD  . GLU B 1 238 ? 36.451  11.927  -43.454 1.00 33.57  ? 238  GLU B CD  1 
ATOM   4765 O OE1 . GLU B 1 238 ? 36.744  13.111  -43.159 1.00 29.18  ? 238  GLU B OE1 1 
ATOM   4766 O OE2 . GLU B 1 238 ? 37.234  10.989  -43.172 1.00 37.72  ? 238  GLU B OE2 1 
ATOM   4767 N N   . VAL B 1 239 ? 34.986  14.250  -48.015 1.00 35.12  ? 239  VAL B N   1 
ATOM   4768 C CA  . VAL B 1 239 ? 34.266  14.880  -49.121 1.00 37.13  ? 239  VAL B CA  1 
ATOM   4769 C C   . VAL B 1 239 ? 34.770  14.470  -50.496 1.00 39.05  ? 239  VAL B C   1 
ATOM   4770 O O   . VAL B 1 239 ? 33.978  14.330  -51.448 1.00 39.19  ? 239  VAL B O   1 
ATOM   4771 C CB  . VAL B 1 239 ? 34.277  16.401  -48.944 1.00 35.01  ? 239  VAL B CB  1 
ATOM   4772 C CG1 . VAL B 1 239 ? 33.646  17.121  -50.112 1.00 34.64  ? 239  VAL B CG1 1 
ATOM   4773 C CG2 . VAL B 1 239 ? 33.537  16.730  -47.645 1.00 32.84  ? 239  VAL B CG2 1 
ATOM   4774 N N   . ALA B 1 240 ? 36.045  14.102  -50.626 1.00 39.38  ? 240  ALA B N   1 
ATOM   4775 C CA  . ALA B 1 240 ? 36.590  13.601  -51.879 1.00 40.30  ? 240  ALA B CA  1 
ATOM   4776 C C   . ALA B 1 240 ? 36.009  12.240  -52.239 1.00 41.97  ? 240  ALA B C   1 
ATOM   4777 O O   . ALA B 1 240 ? 36.141  11.780  -53.379 1.00 42.20  ? 240  ALA B O   1 
ATOM   4778 C CB  . ALA B 1 240 ? 38.111  13.487  -51.804 1.00 33.67  ? 240  ALA B CB  1 
ATOM   4779 N N   . LYS B 1 241 ? 35.437  11.498  -51.297 1.00 43.16  ? 241  LYS B N   1 
ATOM   4780 C CA  . LYS B 1 241 ? 34.860  10.188  -51.589 1.00 44.24  ? 241  LYS B CA  1 
ATOM   4781 C C   . LYS B 1 241 ? 33.374  10.327  -51.913 1.00 44.35  ? 241  LYS B C   1 
ATOM   4782 O O   . LYS B 1 241 ? 32.722  9.334   -52.198 1.00 44.55  ? 241  LYS B O   1 
ATOM   4783 C CB  . LYS B 1 241 ? 35.058  9.197   -50.446 1.00 46.12  ? 241  LYS B CB  1 
ATOM   4784 C CG  . LYS B 1 241 ? 36.493  9.187   -49.931 1.00 49.19  ? 241  LYS B CG  1 
ATOM   4785 C CD  . LYS B 1 241 ? 36.648  8.269   -48.738 1.00 52.29  ? 241  LYS B CD  1 
ATOM   4786 C CE  . LYS B 1 241 ? 37.039  6.854   -49.122 1.00 55.12  ? 241  LYS B CE  1 
ATOM   4787 N NZ  . LYS B 1 241 ? 37.101  5.977   -47.911 1.00 56.98  ? 241  LYS B NZ  1 
ATOM   4788 N N   . MET B 1 242 ? 32.853  11.547  -51.899 1.00 44.24  ? 242  MET B N   1 
ATOM   4789 C CA  . MET B 1 242 ? 31.458  11.805  -52.153 1.00 44.41  ? 242  MET B CA  1 
ATOM   4790 C C   . MET B 1 242 ? 31.145  12.301  -53.567 1.00 44.88  ? 242  MET B C   1 
ATOM   4791 O O   . MET B 1 242 ? 31.766  13.232  -54.083 1.00 44.94  ? 242  MET B O   1 
ATOM   4792 C CB  . MET B 1 242 ? 30.937  12.844  -51.152 1.00 41.42  ? 242  MET B CB  1 
ATOM   4793 C CG  . MET B 1 242 ? 30.782  12.388  -49.699 1.00 37.83  ? 242  MET B CG  1 
ATOM   4794 S SD  . MET B 1 242 ? 30.322  13.816  -48.680 1.00 32.05  ? 242  MET B SD  1 
ATOM   4795 C CE  . MET B 1 242 ? 30.976  13.260  -47.102 1.00 34.79  ? 242  MET B CE  1 
ATOM   4796 N N   . GLU B 1 243 ? 30.067  11.766  -54.138 1.00 44.57  ? 243  GLU B N   1 
ATOM   4797 C CA  . GLU B 1 243 ? 29.597  12.240  -55.439 1.00 45.05  ? 243  GLU B CA  1 
ATOM   4798 C C   . GLU B 1 243 ? 29.374  13.751  -55.294 1.00 43.18  ? 243  GLU B C   1 
ATOM   4799 O O   . GLU B 1 243 ? 29.104  14.248  -54.205 1.00 42.83  ? 243  GLU B O   1 
ATOM   4800 C CB  . GLU B 1 243 ? 28.334  11.558  -55.956 1.00 47.37  ? 243  GLU B CB  1 
ATOM   4801 C CG  . GLU B 1 243 ? 28.501  10.132  -56.432 1.00 53.54  ? 243  GLU B CG  1 
ATOM   4802 C CD  . GLU B 1 243 ? 28.689  9.098   -55.340 1.00 58.02  ? 243  GLU B CD  1 
ATOM   4803 O OE1 . GLU B 1 243 ? 28.700  9.465   -54.133 1.00 59.84  ? 243  GLU B OE1 1 
ATOM   4804 O OE2 . GLU B 1 243 ? 28.820  7.892   -55.671 1.00 58.78  ? 243  GLU B OE2 1 
ATOM   4805 N N   . SER B 1 244 ? 29.476  14.461  -56.395 1.00 41.46  ? 244  SER B N   1 
ATOM   4806 C CA  . SER B 1 244 ? 29.350  15.904  -56.382 1.00 41.05  ? 244  SER B CA  1 
ATOM   4807 C C   . SER B 1 244 ? 28.035  16.333  -55.762 1.00 40.43  ? 244  SER B C   1 
ATOM   4808 O O   . SER B 1 244 ? 28.091  17.186  -54.871 1.00 40.41  ? 244  SER B O   1 
ATOM   4809 C CB  . SER B 1 244 ? 29.635  16.531  -57.740 1.00 42.95  ? 244  SER B CB  1 
ATOM   4810 O OG  . SER B 1 244 ? 28.713  16.315  -58.783 1.00 41.87  ? 244  SER B OG  1 
ATOM   4811 N N   . ASP B 1 245 ? 26.907  15.781  -56.179 1.00 39.58  ? 245  ASP B N   1 
ATOM   4812 C CA  . ASP B 1 245 ? 25.597  16.198  -55.682 1.00 38.71  ? 245  ASP B CA  1 
ATOM   4813 C C   . ASP B 1 245 ? 25.340  15.830  -54.226 1.00 37.40  ? 245  ASP B C   1 
ATOM   4814 O O   . ASP B 1 245 ? 24.597  16.528  -53.547 1.00 36.97  ? 245  ASP B O   1 
ATOM   4815 C CB  . ASP B 1 245 ? 24.444  15.691  -56.551 1.00 35.82  ? 245  ASP B CB  1 
ATOM   4816 C CG  . ASP B 1 245 ? 24.545  14.223  -56.850 1.00 35.85  ? 245  ASP B CG  1 
ATOM   4817 O OD1 . ASP B 1 245 ? 25.574  13.826  -57.425 1.00 35.55  ? 245  ASP B OD1 1 
ATOM   4818 O OD2 . ASP B 1 245 ? 23.644  13.419  -56.549 1.00 40.08  ? 245  ASP B OD2 1 
ATOM   4819 N N   . VAL B 1 246 ? 25.891  14.715  -53.770 1.00 37.14  ? 246  VAL B N   1 
ATOM   4820 C CA  . VAL B 1 246 ? 25.732  14.366  -52.353 1.00 36.49  ? 246  VAL B CA  1 
ATOM   4821 C C   . VAL B 1 246 ? 26.410  15.452  -51.532 1.00 35.72  ? 246  VAL B C   1 
ATOM   4822 O O   . VAL B 1 246 ? 25.780  16.253  -50.844 1.00 35.82  ? 246  VAL B O   1 
ATOM   4823 C CB  . VAL B 1 246 ? 26.371  12.989  -52.164 1.00 37.89  ? 246  VAL B CB  1 
ATOM   4824 C CG1 . VAL B 1 246 ? 26.772  12.750  -50.716 1.00 37.51  ? 246  VAL B CG1 1 
ATOM   4825 C CG2 . VAL B 1 246 ? 25.389  11.958  -52.722 1.00 37.87  ? 246  VAL B CG2 1 
ATOM   4826 N N   . ALA B 1 247 ? 27.710  15.624  -51.731 1.00 34.36  ? 247  ALA B N   1 
ATOM   4827 C CA  . ALA B 1 247 ? 28.502  16.617  -51.034 1.00 33.97  ? 247  ALA B CA  1 
ATOM   4828 C C   . ALA B 1 247 ? 28.016  18.045  -51.106 1.00 34.57  ? 247  ALA B C   1 
ATOM   4829 O O   . ALA B 1 247 ? 28.291  18.789  -50.154 1.00 34.51  ? 247  ALA B O   1 
ATOM   4830 C CB  . ALA B 1 247 ? 29.946  16.584  -51.546 1.00 29.52  ? 247  ALA B CB  1 
ATOM   4831 N N   . GLU B 1 248 ? 27.361  18.492  -52.163 1.00 34.92  ? 248  GLU B N   1 
ATOM   4832 C CA  . GLU B 1 248 ? 26.949  19.864  -52.349 1.00 35.90  ? 248  GLU B CA  1 
ATOM   4833 C C   . GLU B 1 248 ? 26.082  20.473  -51.282 1.00 35.82  ? 248  GLU B C   1 
ATOM   4834 O O   . GLU B 1 248 ? 25.129  19.848  -50.808 1.00 37.64  ? 248  GLU B O   1 
ATOM   4835 C CB  . GLU B 1 248 ? 26.196  19.968  -53.696 1.00 40.45  ? 248  GLU B CB  1 
ATOM   4836 C CG  . GLU B 1 248 ? 26.350  21.357  -54.269 1.00 42.86  ? 248  GLU B CG  1 
ATOM   4837 C CD  . GLU B 1 248 ? 25.146  22.236  -54.336 1.00 46.90  ? 248  GLU B CD  1 
ATOM   4838 O OE1 . GLU B 1 248 ? 24.459  22.151  -55.381 1.00 51.48  ? 248  GLU B OE1 1 
ATOM   4839 O OE2 . GLU B 1 248 ? 24.857  23.030  -53.425 1.00 49.13  ? 248  GLU B OE2 1 
ATOM   4840 N N   . GLY B 1 249 ? 26.354  21.695  -50.833 1.00 36.25  ? 249  GLY B N   1 
ATOM   4841 C CA  . GLY B 1 249 ? 25.589  22.340  -49.779 1.00 35.13  ? 249  GLY B CA  1 
ATOM   4842 C C   . GLY B 1 249 ? 25.884  21.796  -48.377 1.00 35.17  ? 249  GLY B C   1 
ATOM   4843 O O   . GLY B 1 249 ? 25.317  22.338  -47.405 1.00 34.19  ? 249  GLY B O   1 
ATOM   4844 N N   . GLN B 1 250 ? 26.731  20.775  -48.210 1.00 33.76  ? 250  GLN B N   1 
ATOM   4845 C CA  . GLN B 1 250 ? 26.990  20.308  -46.847 1.00 34.20  ? 250  GLN B CA  1 
ATOM   4846 C C   . GLN B 1 250 ? 27.865  21.322  -46.112 1.00 33.19  ? 250  GLN B C   1 
ATOM   4847 O O   . GLN B 1 250 ? 28.550  22.165  -46.711 1.00 32.32  ? 250  GLN B O   1 
ATOM   4848 C CB  . GLN B 1 250 ? 27.511  18.880  -46.793 1.00 38.30  ? 250  GLN B CB  1 
ATOM   4849 C CG  . GLN B 1 250 ? 26.714  17.893  -47.623 1.00 41.93  ? 250  GLN B CG  1 
ATOM   4850 C CD  . GLN B 1 250 ? 25.241  17.709  -47.377 1.00 44.52  ? 250  GLN B CD  1 
ATOM   4851 O OE1 . GLN B 1 250 ? 24.446  18.537  -46.925 1.00 42.74  ? 250  GLN B OE1 1 
ATOM   4852 N NE2 . GLN B 1 250 ? 24.793  16.484  -47.693 1.00 45.15  ? 250  GLN B NE2 1 
ATOM   4853 N N   . VAL B 1 251 ? 27.744  21.334  -44.774 1.00 32.16  ? 251  VAL B N   1 
ATOM   4854 C CA  . VAL B 1 251 ? 28.486  22.298  -43.970 1.00 30.45  ? 251  VAL B CA  1 
ATOM   4855 C C   . VAL B 1 251 ? 29.543  21.669  -43.080 1.00 30.80  ? 251  VAL B C   1 
ATOM   4856 O O   . VAL B 1 251 ? 29.422  20.654  -42.403 1.00 28.46  ? 251  VAL B O   1 
ATOM   4857 C CB  . VAL B 1 251 ? 27.575  23.251  -43.203 1.00 26.81  ? 251  VAL B CB  1 
ATOM   4858 C CG1 . VAL B 1 251 ? 28.388  24.216  -42.357 1.00 26.33  ? 251  VAL B CG1 1 
ATOM   4859 C CG2 . VAL B 1 251 ? 26.695  24.064  -44.144 1.00 25.75  ? 251  VAL B CG2 1 
ATOM   4860 N N   . VAL B 1 252 ? 30.663  22.410  -43.028 1.00 32.23  ? 252  VAL B N   1 
ATOM   4861 C CA  . VAL B 1 252 ? 31.863  21.863  -42.332 1.00 31.85  ? 252  VAL B CA  1 
ATOM   4862 C C   . VAL B 1 252 ? 32.629  22.974  -41.704 1.00 31.63  ? 252  VAL B C   1 
ATOM   4863 O O   . VAL B 1 252 ? 32.546  24.138  -42.119 1.00 32.66  ? 252  VAL B O   1 
ATOM   4864 C CB  . VAL B 1 252 ? 32.492  21.131  -43.535 1.00 33.86  ? 252  VAL B CB  1 
ATOM   4865 C CG1 . VAL B 1 252 ? 33.620  21.914  -44.147 1.00 35.02  ? 252  VAL B CG1 1 
ATOM   4866 C CG2 . VAL B 1 252 ? 32.767  19.675  -43.279 1.00 33.62  ? 252  VAL B CG2 1 
ATOM   4867 N N   . VAL B 1 253 ? 33.353  22.701  -40.635 1.00 31.66  ? 253  VAL B N   1 
ATOM   4868 C CA  . VAL B 1 253 ? 34.051  23.718  -39.830 1.00 30.18  ? 253  VAL B CA  1 
ATOM   4869 C C   . VAL B 1 253 ? 35.500  23.300  -39.619 1.00 29.04  ? 253  VAL B C   1 
ATOM   4870 O O   . VAL B 1 253 ? 35.825  22.118  -39.483 1.00 28.63  ? 253  VAL B O   1 
ATOM   4871 C CB  . VAL B 1 253 ? 33.218  23.832  -38.541 1.00 31.37  ? 253  VAL B CB  1 
ATOM   4872 C CG1 . VAL B 1 253 ? 33.752  22.953  -37.415 1.00 30.35  ? 253  VAL B CG1 1 
ATOM   4873 C CG2 . VAL B 1 253 ? 33.080  25.237  -37.991 1.00 34.57  ? 253  VAL B CG2 1 
ATOM   4874 N N   . ALA B 1 254 ? 36.452  24.214  -39.597 1.00 27.32  ? 254  ALA B N   1 
ATOM   4875 C CA  . ALA B 1 254 ? 37.858  23.935  -39.391 1.00 25.99  ? 254  ALA B CA  1 
ATOM   4876 C C   . ALA B 1 254 ? 38.642  25.240  -39.400 1.00 25.58  ? 254  ALA B C   1 
ATOM   4877 O O   . ALA B 1 254 ? 38.157  26.314  -39.749 1.00 25.07  ? 254  ALA B O   1 
ATOM   4878 C CB  . ALA B 1 254 ? 38.450  22.994  -40.444 1.00 24.85  ? 254  ALA B CB  1 
ATOM   4879 N N   . PRO B 1 255 ? 39.874  25.147  -38.896 1.00 25.18  ? 255  PRO B N   1 
ATOM   4880 C CA  . PRO B 1 255 ? 40.752  26.311  -38.844 1.00 24.43  ? 255  PRO B CA  1 
ATOM   4881 C C   . PRO B 1 255 ? 41.269  26.618  -40.238 1.00 24.10  ? 255  PRO B C   1 
ATOM   4882 O O   . PRO B 1 255 ? 41.520  27.777  -40.551 1.00 22.76  ? 255  PRO B O   1 
ATOM   4883 C CB  . PRO B 1 255 ? 41.824  25.909  -37.857 1.00 25.07  ? 255  PRO B CB  1 
ATOM   4884 C CG  . PRO B 1 255 ? 41.421  24.588  -37.293 1.00 24.35  ? 255  PRO B CG  1 
ATOM   4885 C CD  . PRO B 1 255 ? 40.552  23.958  -38.349 1.00 24.28  ? 255  PRO B CD  1 
ATOM   4886 N N   . TYR B 1 256 ? 41.397  25.589  -41.075 1.00 23.87  ? 256  TYR B N   1 
ATOM   4887 C CA  . TYR B 1 256 ? 41.912  25.658  -42.413 1.00 24.97  ? 256  TYR B CA  1 
ATOM   4888 C C   . TYR B 1 256 ? 41.109  24.907  -43.463 1.00 25.23  ? 256  TYR B C   1 
ATOM   4889 O O   . TYR B 1 256 ? 40.615  23.802  -43.258 1.00 25.05  ? 256  TYR B O   1 
ATOM   4890 C CB  . TYR B 1 256 ? 43.332  25.043  -42.458 1.00 24.70  ? 256  TYR B CB  1 
ATOM   4891 C CG  . TYR B 1 256 ? 43.970  25.036  -43.817 1.00 25.77  ? 256  TYR B CG  1 
ATOM   4892 C CD1 . TYR B 1 256 ? 44.625  26.173  -44.274 1.00 26.10  ? 256  TYR B CD1 1 
ATOM   4893 C CD2 . TYR B 1 256 ? 43.938  23.926  -44.649 1.00 28.47  ? 256  TYR B CD2 1 
ATOM   4894 C CE1 . TYR B 1 256 ? 45.213  26.232  -45.520 1.00 26.46  ? 256  TYR B CE1 1 
ATOM   4895 C CE2 . TYR B 1 256 ? 44.537  23.959  -45.902 1.00 28.98  ? 256  TYR B CE2 1 
ATOM   4896 C CZ  . TYR B 1 256 ? 45.173  25.114  -46.325 1.00 28.08  ? 256  TYR B CZ  1 
ATOM   4897 O OH  . TYR B 1 256 ? 45.750  25.161  -47.562 1.00 28.57  ? 256  TYR B OH  1 
ATOM   4898 N N   . PHE B 1 257 ? 41.087  25.445  -44.671 1.00 25.71  ? 257  PHE B N   1 
ATOM   4899 C CA  . PHE B 1 257 ? 40.464  24.810  -45.840 1.00 27.60  ? 257  PHE B CA  1 
ATOM   4900 C C   . PHE B 1 257 ? 41.385  24.993  -47.041 1.00 27.72  ? 257  PHE B C   1 
ATOM   4901 O O   . PHE B 1 257 ? 41.905  26.100  -47.226 1.00 27.71  ? 257  PHE B O   1 
ATOM   4902 C CB  . PHE B 1 257 ? 39.066  25.362  -46.194 1.00 26.63  ? 257  PHE B CB  1 
ATOM   4903 C CG  . PHE B 1 257 ? 38.039  24.886  -45.186 1.00 24.23  ? 257  PHE B CG  1 
ATOM   4904 C CD1 . PHE B 1 257 ? 37.612  23.588  -45.188 1.00 24.25  ? 257  PHE B CD1 1 
ATOM   4905 C CD2 . PHE B 1 257 ? 37.557  25.756  -44.232 1.00 25.17  ? 257  PHE B CD2 1 
ATOM   4906 C CE1 . PHE B 1 257 ? 36.691  23.153  -44.249 1.00 26.09  ? 257  PHE B CE1 1 
ATOM   4907 C CE2 . PHE B 1 257 ? 36.630  25.345  -43.300 1.00 27.34  ? 257  PHE B CE2 1 
ATOM   4908 C CZ  . PHE B 1 257 ? 36.208  24.028  -43.300 1.00 25.01  ? 257  PHE B CZ  1 
ATOM   4909 N N   . SER B 1 258 ? 41.630  23.974  -47.851 1.00 29.09  ? 258  SER B N   1 
ATOM   4910 C CA  . SER B 1 258 ? 42.528  24.106  -48.996 1.00 31.38  ? 258  SER B CA  1 
ATOM   4911 C C   . SER B 1 258 ? 42.176  25.201  -49.989 1.00 31.94  ? 258  SER B C   1 
ATOM   4912 O O   . SER B 1 258 ? 43.054  25.580  -50.783 1.00 33.29  ? 258  SER B O   1 
ATOM   4913 C CB  . SER B 1 258 ? 42.691  22.768  -49.746 1.00 27.79  ? 258  SER B CB  1 
ATOM   4914 O OG  . SER B 1 258 ? 41.393  22.439  -50.227 1.00 27.14  ? 258  SER B OG  1 
ATOM   4915 N N   . SER B 1 259 ? 41.005  25.795  -49.979 1.00 33.36  ? 259  SER B N   1 
ATOM   4916 C CA  . SER B 1 259 ? 40.512  26.863  -50.796 1.00 33.28  ? 259  SER B CA  1 
ATOM   4917 C C   . SER B 1 259 ? 40.839  28.252  -50.285 1.00 33.35  ? 259  SER B C   1 
ATOM   4918 O O   . SER B 1 259 ? 40.403  29.257  -50.873 1.00 33.43  ? 259  SER B O   1 
ATOM   4919 C CB  . SER B 1 259 ? 38.964  26.835  -50.840 1.00 35.07  ? 259  SER B CB  1 
ATOM   4920 O OG  . SER B 1 259 ? 38.523  27.328  -49.568 1.00 37.81  ? 259  SER B OG  1 
ATOM   4921 N N   . ILE B 1 260 ? 41.507  28.335  -49.157 1.00 33.89  ? 260  ILE B N   1 
ATOM   4922 C CA  . ILE B 1 260 ? 41.809  29.659  -48.582 1.00 35.54  ? 260  ILE B CA  1 
ATOM   4923 C C   . ILE B 1 260 ? 42.552  30.484  -49.630 1.00 36.21  ? 260  ILE B C   1 
ATOM   4924 O O   . ILE B 1 260 ? 43.413  30.026  -50.369 1.00 33.40  ? 260  ILE B O   1 
ATOM   4925 C CB  . ILE B 1 260 ? 42.571  29.540  -47.242 1.00 35.41  ? 260  ILE B CB  1 
ATOM   4926 C CG1 . ILE B 1 260 ? 41.698  28.840  -46.191 1.00 36.21  ? 260  ILE B CG1 1 
ATOM   4927 C CG2 . ILE B 1 260 ? 42.977  30.910  -46.739 1.00 35.07  ? 260  ILE B CG2 1 
ATOM   4928 C CD1 . ILE B 1 260 ? 42.284  28.660  -44.807 1.00 32.51  ? 260  ILE B CD1 1 
ATOM   4929 N N   . ASP B 1 261 ? 42.223  31.770  -49.679 1.00 37.77  ? 261  ASP B N   1 
ATOM   4930 C CA  . ASP B 1 261 ? 42.798  32.694  -50.636 1.00 38.89  ? 261  ASP B CA  1 
ATOM   4931 C C   . ASP B 1 261 ? 43.955  33.536  -50.161 1.00 37.05  ? 261  ASP B C   1 
ATOM   4932 O O   . ASP B 1 261 ? 43.872  34.754  -49.952 1.00 36.31  ? 261  ASP B O   1 
ATOM   4933 C CB  . ASP B 1 261 ? 41.624  33.603  -51.069 1.00 49.69  ? 261  ASP B CB  1 
ATOM   4934 C CG  . ASP B 1 261 ? 41.781  33.960  -52.544 1.00 56.66  ? 261  ASP B CG  1 
ATOM   4935 O OD1 . ASP B 1 261 ? 42.717  33.432  -53.197 1.00 57.53  ? 261  ASP B OD1 1 
ATOM   4936 O OD2 . ASP B 1 261 ? 40.947  34.767  -53.034 1.00 62.25  ? 261  ASP B OD2 1 
ATOM   4937 N N   . THR B 1 262 ? 45.076  32.918  -49.803 1.00 35.82  ? 262  THR B N   1 
ATOM   4938 C CA  . THR B 1 262 ? 46.255  33.632  -49.356 1.00 34.52  ? 262  THR B CA  1 
ATOM   4939 C C   . THR B 1 262 ? 47.483  32.970  -49.963 1.00 34.04  ? 262  THR B C   1 
ATOM   4940 O O   . THR B 1 262 ? 47.415  31.790  -50.310 1.00 34.49  ? 262  THR B O   1 
ATOM   4941 C CB  . THR B 1 262 ? 46.408  33.648  -47.819 1.00 34.17  ? 262  THR B CB  1 
ATOM   4942 O OG1 . THR B 1 262 ? 46.707  32.334  -47.337 1.00 32.88  ? 262  THR B OG1 1 
ATOM   4943 C CG2 . THR B 1 262 ? 45.183  34.153  -47.071 1.00 32.55  ? 262  THR B CG2 1 
ATOM   4944 N N   . PRO B 1 263 ? 48.588  33.685  -50.079 1.00 33.91  ? 263  PRO B N   1 
ATOM   4945 C CA  . PRO B 1 263 ? 49.848  33.122  -50.533 1.00 34.81  ? 263  PRO B CA  1 
ATOM   4946 C C   . PRO B 1 263 ? 50.302  31.996  -49.600 1.00 34.87  ? 263  PRO B C   1 
ATOM   4947 O O   . PRO B 1 263 ? 50.688  30.913  -50.063 1.00 34.82  ? 263  PRO B O   1 
ATOM   4948 C CB  . PRO B 1 263 ? 50.845  34.269  -50.508 1.00 34.73  ? 263  PRO B CB  1 
ATOM   4949 C CG  . PRO B 1 263 ? 50.059  35.503  -50.243 1.00 34.91  ? 263  PRO B CG  1 
ATOM   4950 C CD  . PRO B 1 263 ? 48.729  35.102  -49.671 1.00 34.29  ? 263  PRO B CD  1 
ATOM   4951 N N   . ALA B 1 264 ? 50.168  32.188  -48.280 1.00 34.54  ? 264  ALA B N   1 
ATOM   4952 C CA  . ALA B 1 264 ? 50.534  31.127  -47.336 1.00 35.25  ? 264  ALA B CA  1 
ATOM   4953 C C   . ALA B 1 264 ? 49.735  29.857  -47.590 1.00 34.91  ? 264  ALA B C   1 
ATOM   4954 O O   . ALA B 1 264 ? 50.338  28.778  -47.650 1.00 35.59  ? 264  ALA B O   1 
ATOM   4955 C CB  . ALA B 1 264 ? 50.470  31.578  -45.883 1.00 33.13  ? 264  ALA B CB  1 
ATOM   4956 N N   . SER B 1 265 ? 48.430  29.956  -47.809 1.00 35.09  ? 265  SER B N   1 
ATOM   4957 C CA  . SER B 1 265 ? 47.618  28.790  -48.126 1.00 35.05  ? 265  SER B CA  1 
ATOM   4958 C C   . SER B 1 265 ? 48.021  28.209  -49.480 1.00 35.79  ? 265  SER B C   1 
ATOM   4959 O O   . SER B 1 265 ? 48.224  26.997  -49.672 1.00 35.09  ? 265  SER B O   1 
ATOM   4960 C CB  . SER B 1 265 ? 46.123  29.144  -48.105 1.00 33.23  ? 265  SER B CB  1 
ATOM   4961 O OG  . SER B 1 265 ? 45.369  27.946  -48.282 1.00 31.05  ? 265  SER B OG  1 
ATOM   4962 N N   . ARG B 1 266 ? 48.225  29.101  -50.458 1.00 36.23  ? 266  ARG B N   1 
ATOM   4963 C CA  . ARG B 1 266 ? 48.621  28.650  -51.796 1.00 36.76  ? 266  ARG B CA  1 
ATOM   4964 C C   . ARG B 1 266 ? 49.921  27.858  -51.751 1.00 36.43  ? 266  ARG B C   1 
ATOM   4965 O O   . ARG B 1 266 ? 50.009  26.776  -52.347 1.00 35.44  ? 266  ARG B O   1 
ATOM   4966 C CB  . ARG B 1 266 ? 48.690  29.819  -52.779 1.00 38.12  ? 266  ARG B CB  1 
ATOM   4967 C CG  . ARG B 1 266 ? 47.293  30.214  -53.251 1.00 41.16  ? 266  ARG B CG  1 
ATOM   4968 C CD  . ARG B 1 266 ? 47.248  31.249  -54.348 1.00 42.47  ? 266  ARG B CD  1 
ATOM   4969 N NE  . ARG B 1 266 ? 47.615  32.587  -53.887 1.00 44.70  ? 266  ARG B NE  1 
ATOM   4970 C CZ  . ARG B 1 266 ? 46.725  33.456  -53.418 1.00 45.65  ? 266  ARG B CZ  1 
ATOM   4971 N NH1 . ARG B 1 266 ? 45.431  33.123  -53.343 1.00 47.47  ? 266  ARG B NH1 1 
ATOM   4972 N NH2 . ARG B 1 266 ? 47.091  34.662  -53.007 1.00 43.88  ? 266  ARG B NH2 1 
ATOM   4973 N N   . ALA B 1 267 ? 50.882  28.360  -50.982 1.00 35.34  ? 267  ALA B N   1 
ATOM   4974 C CA  . ALA B 1 267 ? 52.177  27.701  -50.847 1.00 35.51  ? 267  ALA B CA  1 
ATOM   4975 C C   . ALA B 1 267 ? 52.051  26.322  -50.236 1.00 35.44  ? 267  ALA B C   1 
ATOM   4976 O O   . ALA B 1 267 ? 52.716  25.369  -50.635 1.00 36.28  ? 267  ALA B O   1 
ATOM   4977 C CB  . ALA B 1 267 ? 53.082  28.616  -50.034 1.00 34.46  ? 267  ALA B CB  1 
ATOM   4978 N N   . PHE B 1 268 ? 51.166  26.149  -49.255 1.00 35.92  ? 268  PHE B N   1 
ATOM   4979 C CA  . PHE B 1 268 ? 50.913  24.858  -48.617 1.00 33.97  ? 268  PHE B CA  1 
ATOM   4980 C C   . PHE B 1 268 ? 50.262  23.870  -49.573 1.00 34.43  ? 268  PHE B C   1 
ATOM   4981 O O   . PHE B 1 268 ? 50.667  22.704  -49.704 1.00 33.49  ? 268  PHE B O   1 
ATOM   4982 C CB  . PHE B 1 268 ? 50.065  25.130  -47.356 1.00 30.75  ? 268  PHE B CB  1 
ATOM   4983 C CG  . PHE B 1 268 ? 49.760  23.864  -46.595 1.00 27.59  ? 268  PHE B CG  1 
ATOM   4984 C CD1 . PHE B 1 268 ? 50.775  23.116  -46.027 1.00 26.45  ? 268  PHE B CD1 1 
ATOM   4985 C CD2 . PHE B 1 268 ? 48.457  23.415  -46.474 1.00 26.27  ? 268  PHE B CD2 1 
ATOM   4986 C CE1 . PHE B 1 268 ? 50.501  21.943  -45.362 1.00 25.64  ? 268  PHE B CE1 1 
ATOM   4987 C CE2 . PHE B 1 268 ? 48.167  22.245  -45.804 1.00 25.49  ? 268  PHE B CE2 1 
ATOM   4988 C CZ  . PHE B 1 268 ? 49.196  21.506  -45.232 1.00 25.25  ? 268  PHE B CZ  1 
ATOM   4989 N N   . VAL B 1 269 ? 49.220  24.286  -50.319 1.00 34.67  ? 269  VAL B N   1 
ATOM   4990 C CA  . VAL B 1 269 ? 48.593  23.417  -51.295 1.00 34.75  ? 269  VAL B CA  1 
ATOM   4991 C C   . VAL B 1 269 ? 49.623  22.832  -52.268 1.00 37.11  ? 269  VAL B C   1 
ATOM   4992 O O   . VAL B 1 269 ? 49.643  21.617  -52.504 1.00 36.87  ? 269  VAL B O   1 
ATOM   4993 C CB  . VAL B 1 269 ? 47.517  24.084  -52.165 1.00 32.44  ? 269  VAL B CB  1 
ATOM   4994 C CG1 . VAL B 1 269 ? 46.930  23.107  -53.191 1.00 29.25  ? 269  VAL B CG1 1 
ATOM   4995 C CG2 . VAL B 1 269 ? 46.389  24.644  -51.330 1.00 32.04  ? 269  VAL B CG2 1 
ATOM   4996 N N   . GLN B 1 270 ? 50.429  23.714  -52.862 1.00 38.63  ? 270  GLN B N   1 
ATOM   4997 C CA  . GLN B 1 270 ? 51.437  23.349  -53.839 1.00 39.81  ? 270  GLN B CA  1 
ATOM   4998 C C   . GLN B 1 270 ? 52.434  22.373  -53.235 1.00 39.49  ? 270  GLN B C   1 
ATOM   4999 O O   . GLN B 1 270 ? 52.748  21.372  -53.859 1.00 39.46  ? 270  GLN B O   1 
ATOM   5000 C CB  . GLN B 1 270 ? 52.238  24.557  -54.329 1.00 45.32  ? 270  GLN B CB  1 
ATOM   5001 C CG  . GLN B 1 270 ? 51.502  25.650  -55.067 1.00 52.75  ? 270  GLN B CG  1 
ATOM   5002 C CD  . GLN B 1 270 ? 51.117  25.321  -56.492 1.00 57.30  ? 270  GLN B CD  1 
ATOM   5003 O OE1 . GLN B 1 270 ? 50.632  26.157  -57.280 1.00 61.25  ? 270  GLN B OE1 1 
ATOM   5004 N NE2 . GLN B 1 270 ? 51.337  24.073  -56.909 1.00 57.72  ? 270  GLN B NE2 1 
ATOM   5005 N N   . ALA B 1 271 ? 52.905  22.694  -52.030 1.00 39.12  ? 271  ALA B N   1 
ATOM   5006 C CA  . ALA B 1 271 ? 53.827  21.825  -51.313 1.00 39.15  ? 271  ALA B CA  1 
ATOM   5007 C C   . ALA B 1 271 ? 53.208  20.459  -51.051 1.00 39.74  ? 271  ALA B C   1 
ATOM   5008 O O   . ALA B 1 271 ? 53.923  19.468  -51.187 1.00 39.67  ? 271  ALA B O   1 
ATOM   5009 C CB  . ALA B 1 271 ? 54.244  22.474  -50.001 1.00 38.05  ? 271  ALA B CB  1 
ATOM   5010 N N   . CYS B 1 272 ? 51.920  20.399  -50.704 1.00 40.08  ? 272  CYS B N   1 
ATOM   5011 C CA  . CYS B 1 272 ? 51.271  19.132  -50.437 1.00 41.64  ? 272  CYS B CA  1 
ATOM   5012 C C   . CYS B 1 272 ? 51.016  18.333  -51.709 1.00 44.54  ? 272  CYS B C   1 
ATOM   5013 O O   . CYS B 1 272 ? 51.220  17.108  -51.733 1.00 44.18  ? 272  CYS B O   1 
ATOM   5014 C CB  . CYS B 1 272 ? 49.936  19.319  -49.719 1.00 38.00  ? 272  CYS B CB  1 
ATOM   5015 S SG  . CYS B 1 272 ? 50.048  19.735  -47.965 1.00 29.14  ? 272  CYS B SG  1 
ATOM   5016 N N   . HIS B 1 273 ? 50.607  19.052  -52.762 1.00 46.57  ? 273  HIS B N   1 
ATOM   5017 C CA  . HIS B 1 273 ? 50.364  18.392  -54.048 1.00 49.41  ? 273  HIS B CA  1 
ATOM   5018 C C   . HIS B 1 273 ? 51.636  17.742  -54.572 1.00 49.24  ? 273  HIS B C   1 
ATOM   5019 O O   . HIS B 1 273 ? 51.601  16.578  -54.991 1.00 49.10  ? 273  HIS B O   1 
ATOM   5020 C CB  . HIS B 1 273 ? 49.705  19.349  -55.027 1.00 56.44  ? 273  HIS B CB  1 
ATOM   5021 C CG  . HIS B 1 273 ? 48.210  19.279  -54.994 1.00 62.44  ? 273  HIS B CG  1 
ATOM   5022 N ND1 . HIS B 1 273 ? 47.476  18.499  -55.869 1.00 66.17  ? 273  HIS B ND1 1 
ATOM   5023 C CD2 . HIS B 1 273 ? 47.303  19.872  -54.182 1.00 65.00  ? 273  HIS B CD2 1 
ATOM   5024 C CE1 . HIS B 1 273 ? 46.181  18.621  -55.614 1.00 65.88  ? 273  HIS B CE1 1 
ATOM   5025 N NE2 . HIS B 1 273 ? 46.052  19.457  -54.596 1.00 66.49  ? 273  HIS B NE2 1 
ATOM   5026 N N   . GLY B 1 274 ? 52.769  18.424  -54.458 1.00 49.53  ? 274  GLY B N   1 
ATOM   5027 C CA  . GLY B 1 274 ? 54.043  17.836  -54.832 1.00 50.42  ? 274  GLY B CA  1 
ATOM   5028 C C   . GLY B 1 274 ? 54.764  17.264  -53.615 1.00 50.98  ? 274  GLY B C   1 
ATOM   5029 O O   . GLY B 1 274 ? 55.776  17.838  -53.191 1.00 52.89  ? 274  GLY B O   1 
ATOM   5030 N N   . PHE B 1 275 ? 54.271  16.197  -53.027 1.00 50.04  ? 275  PHE B N   1 
ATOM   5031 C CA  . PHE B 1 275 ? 54.878  15.488  -51.915 1.00 49.08  ? 275  PHE B CA  1 
ATOM   5032 C C   . PHE B 1 275 ? 53.927  14.398  -51.404 1.00 49.45  ? 275  PHE B C   1 
ATOM   5033 O O   . PHE B 1 275 ? 54.337  13.250  -51.191 1.00 49.81  ? 275  PHE B O   1 
ATOM   5034 C CB  . PHE B 1 275 ? 55.356  16.396  -50.794 1.00 46.13  ? 275  PHE B CB  1 
ATOM   5035 C CG  . PHE B 1 275 ? 55.961  15.687  -49.615 1.00 44.65  ? 275  PHE B CG  1 
ATOM   5036 C CD1 . PHE B 1 275 ? 55.154  15.248  -48.568 1.00 42.82  ? 275  PHE B CD1 1 
ATOM   5037 C CD2 . PHE B 1 275 ? 57.318  15.444  -49.550 1.00 42.21  ? 275  PHE B CD2 1 
ATOM   5038 C CE1 . PHE B 1 275 ? 55.691  14.594  -47.485 1.00 41.26  ? 275  PHE B CE1 1 
ATOM   5039 C CE2 . PHE B 1 275 ? 57.878  14.791  -48.467 1.00 42.37  ? 275  PHE B CE2 1 
ATOM   5040 C CZ  . PHE B 1 275 ? 57.059  14.372  -47.435 1.00 43.25  ? 275  PHE B CZ  1 
ATOM   5041 N N   . PHE B 1 276 ? 52.648  14.714  -51.236 1.00 49.93  ? 276  PHE B N   1 
ATOM   5042 C CA  . PHE B 1 276 ? 51.697  13.723  -50.742 1.00 50.59  ? 276  PHE B CA  1 
ATOM   5043 C C   . PHE B 1 276 ? 51.397  12.664  -51.794 1.00 51.11  ? 276  PHE B C   1 
ATOM   5044 O O   . PHE B 1 276 ? 51.252  12.967  -52.974 1.00 51.50  ? 276  PHE B O   1 
ATOM   5045 C CB  . PHE B 1 276 ? 50.352  14.340  -50.387 1.00 49.16  ? 276  PHE B CB  1 
ATOM   5046 C CG  . PHE B 1 276 ? 50.160  15.063  -49.102 1.00 47.54  ? 276  PHE B CG  1 
ATOM   5047 C CD1 . PHE B 1 276 ? 51.175  15.751  -48.468 1.00 46.43  ? 276  PHE B CD1 1 
ATOM   5048 C CD2 . PHE B 1 276 ? 48.889  15.096  -48.537 1.00 47.72  ? 276  PHE B CD2 1 
ATOM   5049 C CE1 . PHE B 1 276 ? 50.934  16.432  -47.291 1.00 47.40  ? 276  PHE B CE1 1 
ATOM   5050 C CE2 . PHE B 1 276 ? 48.637  15.771  -47.363 1.00 46.09  ? 276  PHE B CE2 1 
ATOM   5051 C CZ  . PHE B 1 276 ? 49.667  16.442  -46.737 1.00 46.98  ? 276  PHE B CZ  1 
ATOM   5052 N N   . PRO B 1 277 ? 51.133  11.458  -51.333 1.00 51.86  ? 277  PRO B N   1 
ATOM   5053 C CA  . PRO B 1 277 ? 50.735  10.379  -52.218 1.00 52.45  ? 277  PRO B CA  1 
ATOM   5054 C C   . PRO B 1 277 ? 49.347  10.658  -52.768 1.00 53.39  ? 277  PRO B C   1 
ATOM   5055 O O   . PRO B 1 277 ? 48.636  11.600  -52.403 1.00 52.29  ? 277  PRO B O   1 
ATOM   5056 C CB  . PRO B 1 277 ? 50.792  9.127   -51.365 1.00 52.28  ? 277  PRO B CB  1 
ATOM   5057 C CG  . PRO B 1 277 ? 51.444  9.520   -50.094 1.00 52.39  ? 277  PRO B CG  1 
ATOM   5058 C CD  . PRO B 1 277 ? 51.228  11.007  -49.926 1.00 51.99  ? 277  PRO B CD  1 
ATOM   5059 N N   . GLU B 1 278 ? 48.937  9.792   -53.687 1.00 54.83  ? 278  GLU B N   1 
ATOM   5060 C CA  . GLU B 1 278 ? 47.646  9.846   -54.344 1.00 56.12  ? 278  GLU B CA  1 
ATOM   5061 C C   . GLU B 1 278 ? 46.475  9.605   -53.405 1.00 55.95  ? 278  GLU B C   1 
ATOM   5062 O O   . GLU B 1 278 ? 45.375  10.106  -53.633 1.00 55.70  ? 278  GLU B O   1 
ATOM   5063 C CB  . GLU B 1 278 ? 47.598  8.706   -55.377 1.00 60.07  ? 278  GLU B CB  1 
ATOM   5064 C CG  . GLU B 1 278 ? 48.150  7.414   -54.798 1.00 64.72  ? 278  GLU B CG  1 
ATOM   5065 C CD  . GLU B 1 278 ? 47.174  6.314   -54.450 1.00 68.06  ? 278  GLU B CD  1 
ATOM   5066 O OE1 . GLU B 1 278 ? 45.998  6.268   -54.888 1.00 67.88  ? 278  GLU B OE1 1 
ATOM   5067 O OE2 . GLU B 1 278 ? 47.645  5.416   -53.699 1.00 69.42  ? 278  GLU B OE2 1 
ATOM   5068 N N   . ASN B 1 279 ? 46.737  8.798   -52.381 1.00 55.60  ? 279  ASN B N   1 
ATOM   5069 C CA  . ASN B 1 279 ? 45.724  8.387   -51.422 1.00 55.36  ? 279  ASN B CA  1 
ATOM   5070 C C   . ASN B 1 279 ? 45.762  9.170   -50.120 1.00 54.43  ? 279  ASN B C   1 
ATOM   5071 O O   . ASN B 1 279 ? 45.337  8.698   -49.061 1.00 54.29  ? 279  ASN B O   1 
ATOM   5072 C CB  . ASN B 1 279 ? 45.944  6.885   -51.151 1.00 55.74  ? 279  ASN B CB  1 
ATOM   5073 C CG  . ASN B 1 279 ? 47.264  6.635   -50.454 1.00 57.06  ? 279  ASN B CG  1 
ATOM   5074 O OD1 . ASN B 1 279 ? 48.157  7.480   -50.434 1.00 59.11  ? 279  ASN B OD1 1 
ATOM   5075 N ND2 . ASN B 1 279 ? 47.424  5.473   -49.843 1.00 57.81  ? 279  ASN B ND2 1 
ATOM   5076 N N   . ALA B 1 280 ? 46.321  10.370  -50.187 1.00 52.90  ? 280  ALA B N   1 
ATOM   5077 C CA  . ALA B 1 280 ? 46.451  11.248  -49.040 1.00 51.01  ? 280  ALA B CA  1 
ATOM   5078 C C   . ALA B 1 280 ? 45.997  12.649  -49.425 1.00 49.99  ? 280  ALA B C   1 
ATOM   5079 O O   . ALA B 1 280 ? 46.722  13.440  -50.021 1.00 50.77  ? 280  ALA B O   1 
ATOM   5080 C CB  . ALA B 1 280 ? 47.886  11.230  -48.550 1.00 51.18  ? 280  ALA B CB  1 
ATOM   5081 N N   . THR B 1 281 ? 44.752  12.962  -49.109 1.00 47.88  ? 281  THR B N   1 
ATOM   5082 C CA  . THR B 1 281 ? 44.128  14.243  -49.389 1.00 44.67  ? 281  THR B CA  1 
ATOM   5083 C C   . THR B 1 281 ? 44.583  15.296  -48.396 1.00 42.55  ? 281  THR B C   1 
ATOM   5084 O O   . THR B 1 281 ? 44.793  14.942  -47.239 1.00 42.93  ? 281  THR B O   1 
ATOM   5085 C CB  . THR B 1 281 ? 42.595  14.046  -49.216 1.00 44.88  ? 281  THR B CB  1 
ATOM   5086 O OG1 . THR B 1 281 ? 42.217  12.915  -50.012 1.00 46.03  ? 281  THR B OG1 1 
ATOM   5087 C CG2 . THR B 1 281 ? 41.776  15.268  -49.554 1.00 40.79  ? 281  THR B CG2 1 
ATOM   5088 N N   . ILE B 1 282 ? 44.687  16.546  -48.789 1.00 40.24  ? 282  ILE B N   1 
ATOM   5089 C CA  . ILE B 1 282 ? 44.973  17.648  -47.887 1.00 37.98  ? 282  ILE B CA  1 
ATOM   5090 C C   . ILE B 1 282 ? 43.757  17.863  -46.989 1.00 37.18  ? 282  ILE B C   1 
ATOM   5091 O O   . ILE B 1 282 ? 42.592  17.867  -47.436 1.00 37.97  ? 282  ILE B O   1 
ATOM   5092 C CB  . ILE B 1 282 ? 45.235  18.945  -48.674 1.00 37.86  ? 282  ILE B CB  1 
ATOM   5093 C CG1 . ILE B 1 282 ? 46.491  18.741  -49.532 1.00 40.16  ? 282  ILE B CG1 1 
ATOM   5094 C CG2 . ILE B 1 282 ? 45.397  20.146  -47.774 1.00 36.38  ? 282  ILE B CG2 1 
ATOM   5095 C CD1 . ILE B 1 282 ? 46.729  19.736  -50.639 1.00 41.24  ? 282  ILE B CD1 1 
ATOM   5096 N N   . THR B 1 283 ? 43.990  18.022  -45.691 1.00 34.49  ? 283  THR B N   1 
ATOM   5097 C CA  . THR B 1 283 ? 42.934  18.268  -44.730 1.00 30.00  ? 283  THR B CA  1 
ATOM   5098 C C   . THR B 1 283 ? 43.440  19.311  -43.731 1.00 28.49  ? 283  THR B C   1 
ATOM   5099 O O   . THR B 1 283 ? 44.651  19.535  -43.611 1.00 26.05  ? 283  THR B O   1 
ATOM   5100 C CB  . THR B 1 283 ? 42.551  17.072  -43.837 1.00 32.35  ? 283  THR B CB  1 
ATOM   5101 O OG1 . THR B 1 283 ? 43.686  16.854  -42.971 1.00 26.01  ? 283  THR B OG1 1 
ATOM   5102 C CG2 . THR B 1 283 ? 42.140  15.809  -44.580 1.00 28.64  ? 283  THR B CG2 1 
ATOM   5103 N N   . ALA B 1 284 ? 42.492  19.828  -42.931 1.00 25.37  ? 284  ALA B N   1 
ATOM   5104 C CA  . ALA B 1 284 ? 42.846  20.792  -41.902 1.00 22.95  ? 284  ALA B CA  1 
ATOM   5105 C C   . ALA B 1 284 ? 43.827  20.213  -40.871 1.00 22.17  ? 284  ALA B C   1 
ATOM   5106 O O   . ALA B 1 284 ? 44.537  20.989  -40.242 1.00 20.49  ? 284  ALA B O   1 
ATOM   5107 C CB  . ALA B 1 284 ? 41.596  21.289  -41.213 1.00 25.01  ? 284  ALA B CB  1 
ATOM   5108 N N   . TRP B 1 285 ? 43.854  18.909  -40.654 1.00 20.96  ? 285  TRP B N   1 
ATOM   5109 C CA  . TRP B 1 285 ? 44.651  18.214  -39.684 1.00 22.67  ? 285  TRP B CA  1 
ATOM   5110 C C   . TRP B 1 285 ? 46.040  17.908  -40.232 1.00 24.85  ? 285  TRP B C   1 
ATOM   5111 O O   . TRP B 1 285 ? 47.018  17.737  -39.497 1.00 23.97  ? 285  TRP B O   1 
ATOM   5112 C CB  . TRP B 1 285 ? 43.862  17.010  -39.126 1.00 20.99  ? 285  TRP B CB  1 
ATOM   5113 C CG  . TRP B 1 285 ? 42.458  17.489  -38.847 1.00 19.78  ? 285  TRP B CG  1 
ATOM   5114 C CD1 . TRP B 1 285 ? 41.297  16.954  -39.344 1.00 20.85  ? 285  TRP B CD1 1 
ATOM   5115 C CD2 . TRP B 1 285 ? 42.089  18.660  -38.105 1.00 16.83  ? 285  TRP B CD2 1 
ATOM   5116 N NE1 . TRP B 1 285 ? 40.233  17.724  -38.944 1.00 19.83  ? 285  TRP B NE1 1 
ATOM   5117 C CE2 . TRP B 1 285 ? 40.696  18.782  -38.187 1.00 18.38  ? 285  TRP B CE2 1 
ATOM   5118 C CE3 . TRP B 1 285 ? 42.811  19.631  -37.416 1.00 17.21  ? 285  TRP B CE3 1 
ATOM   5119 C CZ2 . TRP B 1 285 ? 39.989  19.817  -37.588 1.00 16.38  ? 285  TRP B CZ2 1 
ATOM   5120 C CZ3 . TRP B 1 285 ? 42.134  20.667  -36.786 1.00 17.41  ? 285  TRP B CZ3 1 
ATOM   5121 C CH2 . TRP B 1 285 ? 40.738  20.748  -36.904 1.00 19.57  ? 285  TRP B CH2 1 
ATOM   5122 N N   . ALA B 1 286 ? 46.165  17.929  -41.577 1.00 24.56  ? 286  ALA B N   1 
ATOM   5123 C CA  . ALA B 1 286 ? 47.486  17.868  -42.202 1.00 23.35  ? 286  ALA B CA  1 
ATOM   5124 C C   . ALA B 1 286 ? 48.114  19.263  -41.975 1.00 22.62  ? 286  ALA B C   1 
ATOM   5125 O O   . ALA B 1 286 ? 49.309  19.403  -41.701 1.00 22.40  ? 286  ALA B O   1 
ATOM   5126 C CB  . ALA B 1 286 ? 47.432  17.572  -43.678 1.00 20.32  ? 286  ALA B CB  1 
ATOM   5127 N N   . GLU B 1 287 ? 47.275  20.302  -42.027 1.00 20.54  ? 287  GLU B N   1 
ATOM   5128 C CA  . GLU B 1 287 ? 47.699  21.659  -41.839 1.00 20.63  ? 287  GLU B CA  1 
ATOM   5129 C C   . GLU B 1 287 ? 48.272  21.842  -40.421 1.00 21.30  ? 287  GLU B C   1 
ATOM   5130 O O   . GLU B 1 287 ? 49.323  22.468  -40.273 1.00 21.44  ? 287  GLU B O   1 
ATOM   5131 C CB  . GLU B 1 287 ? 46.608  22.713  -42.069 1.00 20.11  ? 287  GLU B CB  1 
ATOM   5132 C CG  . GLU B 1 287 ? 47.228  24.125  -42.166 1.00 20.12  ? 287  GLU B CG  1 
ATOM   5133 C CD  . GLU B 1 287 ? 47.123  24.953  -40.907 1.00 24.40  ? 287  GLU B CD  1 
ATOM   5134 O OE1 . GLU B 1 287 ? 46.521  24.471  -39.903 1.00 23.40  ? 287  GLU B OE1 1 
ATOM   5135 O OE2 . GLU B 1 287 ? 47.662  26.102  -40.879 1.00 23.17  ? 287  GLU B OE2 1 
ATOM   5136 N N   . ALA B 1 288 ? 47.536  21.325  -39.442 1.00 20.13  ? 288  ALA B N   1 
ATOM   5137 C CA  . ALA B 1 288 ? 47.932  21.405  -38.039 1.00 20.07  ? 288  ALA B CA  1 
ATOM   5138 C C   . ALA B 1 288 ? 49.153  20.550  -37.769 1.00 18.01  ? 288  ALA B C   1 
ATOM   5139 O O   . ALA B 1 288 ? 49.966  20.940  -36.966 1.00 15.84  ? 288  ALA B O   1 
ATOM   5140 C CB  . ALA B 1 288 ? 46.761  21.022  -37.119 1.00 18.29  ? 288  ALA B CB  1 
ATOM   5141 N N   . ALA B 1 289 ? 49.276  19.368  -38.373 1.00 19.79  ? 289  ALA B N   1 
ATOM   5142 C CA  . ALA B 1 289 ? 50.460  18.529  -38.157 1.00 22.57  ? 289  ALA B CA  1 
ATOM   5143 C C   . ALA B 1 289 ? 51.686  19.256  -38.716 1.00 24.02  ? 289  ALA B C   1 
ATOM   5144 O O   . ALA B 1 289 ? 52.793  19.265  -38.180 1.00 25.01  ? 289  ALA B O   1 
ATOM   5145 C CB  . ALA B 1 289 ? 50.300  17.171  -38.828 1.00 18.22  ? 289  ALA B CB  1 
ATOM   5146 N N   . TYR B 1 290 ? 51.480  19.891  -39.879 1.00 25.57  ? 290  TYR B N   1 
ATOM   5147 C CA  . TYR B 1 290 ? 52.508  20.686  -40.514 1.00 26.13  ? 290  TYR B CA  1 
ATOM   5148 C C   . TYR B 1 290 ? 52.970  21.827  -39.609 1.00 26.52  ? 290  TYR B C   1 
ATOM   5149 O O   . TYR B 1 290 ? 54.163  21.845  -39.289 1.00 25.40  ? 290  TYR B O   1 
ATOM   5150 C CB  . TYR B 1 290 ? 52.005  21.250  -41.839 1.00 27.46  ? 290  TYR B CB  1 
ATOM   5151 C CG  . TYR B 1 290 ? 52.921  22.237  -42.534 1.00 27.49  ? 290  TYR B CG  1 
ATOM   5152 C CD1 . TYR B 1 290 ? 54.116  21.827  -43.126 1.00 28.25  ? 290  TYR B CD1 1 
ATOM   5153 C CD2 . TYR B 1 290 ? 52.572  23.571  -42.591 1.00 27.39  ? 290  TYR B CD2 1 
ATOM   5154 C CE1 . TYR B 1 290 ? 54.946  22.735  -43.760 1.00 29.72  ? 290  TYR B CE1 1 
ATOM   5155 C CE2 . TYR B 1 290 ? 53.375  24.481  -43.225 1.00 29.97  ? 290  TYR B CE2 1 
ATOM   5156 C CZ  . TYR B 1 290 ? 54.559  24.059  -43.809 1.00 30.94  ? 290  TYR B CZ  1 
ATOM   5157 O OH  . TYR B 1 290 ? 55.335  24.997  -44.434 1.00 31.69  ? 290  TYR B OH  1 
ATOM   5158 N N   . TRP B 1 291 ? 52.081  22.725  -39.183 1.00 25.66  ? 291  TRP B N   1 
ATOM   5159 C CA  . TRP B 1 291 ? 52.554  23.866  -38.413 1.00 26.23  ? 291  TRP B CA  1 
ATOM   5160 C C   . TRP B 1 291 ? 53.143  23.447  -37.061 1.00 27.02  ? 291  TRP B C   1 
ATOM   5161 O O   . TRP B 1 291 ? 54.175  24.056  -36.701 1.00 25.74  ? 291  TRP B O   1 
ATOM   5162 C CB  . TRP B 1 291 ? 51.567  25.024  -38.267 1.00 25.87  ? 291  TRP B CB  1 
ATOM   5163 C CG  . TRP B 1 291 ? 50.424  24.933  -37.314 1.00 25.77  ? 291  TRP B CG  1 
ATOM   5164 C CD1 . TRP B 1 291 ? 49.096  24.710  -37.610 1.00 24.79  ? 291  TRP B CD1 1 
ATOM   5165 C CD2 . TRP B 1 291 ? 50.492  25.047  -35.886 1.00 24.83  ? 291  TRP B CD2 1 
ATOM   5166 N NE1 . TRP B 1 291 ? 48.330  24.680  -36.473 1.00 24.01  ? 291  TRP B NE1 1 
ATOM   5167 C CE2 . TRP B 1 291 ? 49.174  24.873  -35.393 1.00 25.70  ? 291  TRP B CE2 1 
ATOM   5168 C CE3 . TRP B 1 291 ? 51.545  25.264  -34.986 1.00 22.89  ? 291  TRP B CE3 1 
ATOM   5169 C CZ2 . TRP B 1 291 ? 48.890  24.952  -34.033 1.00 24.06  ? 291  TRP B CZ2 1 
ATOM   5170 C CZ3 . TRP B 1 291 ? 51.253  25.331  -33.634 1.00 22.55  ? 291  TRP B CZ3 1 
ATOM   5171 C CH2 . TRP B 1 291 ? 49.933  25.166  -33.168 1.00 24.61  ? 291  TRP B CH2 1 
ATOM   5172 N N   . GLN B 1 292 ? 52.548  22.452  -36.394 1.00 24.81  ? 292  GLN B N   1 
ATOM   5173 C CA  . GLN B 1 292 ? 53.108  22.017  -35.107 1.00 22.96  ? 292  GLN B CA  1 
ATOM   5174 C C   . GLN B 1 292 ? 54.501  21.429  -35.250 1.00 22.58  ? 292  GLN B C   1 
ATOM   5175 O O   . GLN B 1 292 ? 55.442  21.763  -34.535 1.00 17.98  ? 292  GLN B O   1 
ATOM   5176 C CB  . GLN B 1 292 ? 52.198  21.022  -34.396 1.00 20.42  ? 292  GLN B CB  1 
ATOM   5177 C CG  . GLN B 1 292 ? 50.873  21.629  -33.868 1.00 20.02  ? 292  GLN B CG  1 
ATOM   5178 C CD  . GLN B 1 292 ? 50.324  20.731  -32.755 1.00 21.24  ? 292  GLN B CD  1 
ATOM   5179 O OE1 . GLN B 1 292 ? 49.831  19.642  -33.063 1.00 19.15  ? 292  GLN B OE1 1 
ATOM   5180 N NE2 . GLN B 1 292 ? 50.449  21.146  -31.488 1.00 16.77  ? 292  GLN B NE2 1 
ATOM   5181 N N   . THR B 1 293 ? 54.649  20.546  -36.249 1.00 23.54  ? 293  THR B N   1 
ATOM   5182 C CA  . THR B 1 293 ? 55.946  19.929  -36.531 1.00 23.96  ? 293  THR B CA  1 
ATOM   5183 C C   . THR B 1 293 ? 57.006  20.962  -36.908 1.00 25.41  ? 293  THR B C   1 
ATOM   5184 O O   . THR B 1 293 ? 58.143  20.900  -36.413 1.00 24.70  ? 293  THR B O   1 
ATOM   5185 C CB  . THR B 1 293 ? 55.857  18.821  -37.574 1.00 20.16  ? 293  THR B CB  1 
ATOM   5186 O OG1 . THR B 1 293 ? 54.846  17.879  -37.155 1.00 17.90  ? 293  THR B OG1 1 
ATOM   5187 C CG2 . THR B 1 293 ? 57.186  18.075  -37.616 1.00 20.15  ? 293  THR B CG2 1 
ATOM   5188 N N   . LEU B 1 294 ? 56.565  21.997  -37.594 1.00 25.54  ? 294  LEU B N   1 
ATOM   5189 C CA  . LEU B 1 294 ? 57.381  23.143  -37.955 1.00 28.48  ? 294  LEU B CA  1 
ATOM   5190 C C   . LEU B 1 294 ? 57.777  23.924  -36.720 1.00 28.87  ? 294  LEU B C   1 
ATOM   5191 O O   . LEU B 1 294 ? 58.946  24.265  -36.527 1.00 29.62  ? 294  LEU B O   1 
ATOM   5192 C CB  . LEU B 1 294 ? 56.586  24.011  -38.943 1.00 31.37  ? 294  LEU B CB  1 
ATOM   5193 C CG  . LEU B 1 294 ? 57.338  24.783  -40.017 1.00 35.59  ? 294  LEU B CG  1 
ATOM   5194 C CD1 . LEU B 1 294 ? 58.328  23.912  -40.782 1.00 34.27  ? 294  LEU B CD1 1 
ATOM   5195 C CD2 . LEU B 1 294 ? 56.364  25.446  -40.996 1.00 37.02  ? 294  LEU B CD2 1 
ATOM   5196 N N   . LEU B 1 295 ? 56.821  24.154  -35.807 1.00 28.70  ? 295  LEU B N   1 
ATOM   5197 C CA  . LEU B 1 295 ? 57.129  24.850  -34.566 1.00 28.83  ? 295  LEU B CA  1 
ATOM   5198 C C   . LEU B 1 295 ? 58.195  24.097  -33.759 1.00 30.12  ? 295  LEU B C   1 
ATOM   5199 O O   . LEU B 1 295 ? 59.179  24.647  -33.277 1.00 28.33  ? 295  LEU B O   1 
ATOM   5200 C CB  . LEU B 1 295 ? 55.858  25.067  -33.754 1.00 27.78  ? 295  LEU B CB  1 
ATOM   5201 C CG  . LEU B 1 295 ? 55.997  25.772  -32.394 1.00 28.09  ? 295  LEU B CG  1 
ATOM   5202 C CD1 . LEU B 1 295 ? 56.528  27.197  -32.572 1.00 24.66  ? 295  LEU B CD1 1 
ATOM   5203 C CD2 . LEU B 1 295 ? 54.643  25.781  -31.672 1.00 23.22  ? 295  LEU B CD2 1 
ATOM   5204 N N   . LEU B 1 296 ? 58.060  22.773  -33.652 1.00 30.15  ? 296  LEU B N   1 
ATOM   5205 C CA  . LEU B 1 296 ? 58.995  21.938  -32.924 1.00 31.88  ? 296  LEU B CA  1 
ATOM   5206 C C   . LEU B 1 296 ? 60.431  22.177  -33.391 1.00 31.97  ? 296  LEU B C   1 
ATOM   5207 O O   . LEU B 1 296 ? 61.336  22.412  -32.596 1.00 31.94  ? 296  LEU B O   1 
ATOM   5208 C CB  . LEU B 1 296 ? 58.601  20.491  -33.137 1.00 31.32  ? 296  LEU B CB  1 
ATOM   5209 C CG  . LEU B 1 296 ? 58.549  19.504  -31.994 1.00 33.40  ? 296  LEU B CG  1 
ATOM   5210 C CD1 . LEU B 1 296 ? 58.480  20.113  -30.605 1.00 33.54  ? 296  LEU B CD1 1 
ATOM   5211 C CD2 . LEU B 1 296 ? 57.296  18.659  -32.215 1.00 34.64  ? 296  LEU B CD2 1 
ATOM   5212 N N   . GLY B 1 297 ? 60.605  22.106  -34.698 1.00 32.34  ? 297  GLY B N   1 
ATOM   5213 C CA  . GLY B 1 297 ? 61.864  22.290  -35.381 1.00 33.15  ? 297  GLY B CA  1 
ATOM   5214 C C   . GLY B 1 297 ? 62.485  23.647  -35.142 1.00 33.23  ? 297  GLY B C   1 
ATOM   5215 O O   . GLY B 1 297 ? 63.651  23.672  -34.809 1.00 33.93  ? 297  GLY B O   1 
ATOM   5216 N N   . ARG B 1 298 ? 61.751  24.736  -35.257 1.00 34.51  ? 298  ARG B N   1 
ATOM   5217 C CA  . ARG B 1 298 ? 62.226  26.079  -35.007 1.00 34.82  ? 298  ARG B CA  1 
ATOM   5218 C C   . ARG B 1 298 ? 62.555  26.327  -33.537 1.00 35.66  ? 298  ARG B C   1 
ATOM   5219 O O   . ARG B 1 298 ? 63.481  27.086  -33.226 1.00 36.42  ? 298  ARG B O   1 
ATOM   5220 C CB  . ARG B 1 298 ? 61.198  27.140  -35.386 1.00 35.46  ? 298  ARG B CB  1 
ATOM   5221 C CG  . ARG B 1 298 ? 60.429  26.956  -36.660 1.00 38.72  ? 298  ARG B CG  1 
ATOM   5222 C CD  . ARG B 1 298 ? 61.068  27.522  -37.904 1.00 39.75  ? 298  ARG B CD  1 
ATOM   5223 N NE  . ARG B 1 298 ? 60.121  27.487  -39.020 1.00 43.99  ? 298  ARG B NE  1 
ATOM   5224 C CZ  . ARG B 1 298 ? 60.405  27.743  -40.293 1.00 45.93  ? 298  ARG B CZ  1 
ATOM   5225 N NH1 . ARG B 1 298 ? 61.642  28.087  -40.628 1.00 47.90  ? 298  ARG B NH1 1 
ATOM   5226 N NH2 . ARG B 1 298 ? 59.483  27.699  -41.243 1.00 44.44  ? 298  ARG B NH2 1 
ATOM   5227 N N   . ALA B 1 299 ? 61.779  25.741  -32.632 1.00 34.33  ? 299  ALA B N   1 
ATOM   5228 C CA  . ALA B 1 299 ? 62.032  25.870  -31.204 1.00 33.42  ? 299  ALA B CA  1 
ATOM   5229 C C   . ALA B 1 299 ? 63.345  25.156  -30.894 1.00 33.27  ? 299  ALA B C   1 
ATOM   5230 O O   . ALA B 1 299 ? 64.184  25.632  -30.159 1.00 32.26  ? 299  ALA B O   1 
ATOM   5231 C CB  . ALA B 1 299 ? 60.870  25.286  -30.414 1.00 29.75  ? 299  ALA B CB  1 
ATOM   5232 N N   . ALA B 1 300 ? 63.545  23.979  -31.477 1.00 34.16  ? 300  ALA B N   1 
ATOM   5233 C CA  . ALA B 1 300 ? 64.766  23.210  -31.333 1.00 35.96  ? 300  ALA B CA  1 
ATOM   5234 C C   . ALA B 1 300 ? 65.981  23.958  -31.916 1.00 36.49  ? 300  ALA B C   1 
ATOM   5235 O O   . ALA B 1 300 ? 67.042  24.045  -31.291 1.00 34.64  ? 300  ALA B O   1 
ATOM   5236 C CB  . ALA B 1 300 ? 64.586  21.846  -31.971 1.00 34.30  ? 300  ALA B CB  1 
ATOM   5237 N N   . GLN B 1 301 ? 65.815  24.542  -33.085 1.00 37.07  ? 301  GLN B N   1 
ATOM   5238 C CA  . GLN B 1 301 ? 66.829  25.356  -33.740 1.00 39.03  ? 301  GLN B CA  1 
ATOM   5239 C C   . GLN B 1 301 ? 67.154  26.516  -32.804 1.00 38.84  ? 301  GLN B C   1 
ATOM   5240 O O   . GLN B 1 301 ? 68.301  26.641  -32.407 1.00 38.08  ? 301  GLN B O   1 
ATOM   5241 C CB  . GLN B 1 301 ? 66.363  25.825  -35.120 1.00 41.97  ? 301  GLN B CB  1 
ATOM   5242 C CG  . GLN B 1 301 ? 66.231  24.764  -36.183 1.00 44.19  ? 301  GLN B CG  1 
ATOM   5243 C CD  . GLN B 1 301 ? 65.467  25.089  -37.444 1.00 47.82  ? 301  GLN B CD  1 
ATOM   5244 O OE1 . GLN B 1 301 ? 64.844  26.124  -37.715 1.00 48.34  ? 301  GLN B OE1 1 
ATOM   5245 N NE2 . GLN B 1 301 ? 65.461  24.120  -38.377 1.00 48.98  ? 301  GLN B NE2 1 
ATOM   5246 N N   . ALA B 1 302 ? 66.184  27.262  -32.293 1.00 39.07  ? 302  ALA B N   1 
ATOM   5247 C CA  . ALA B 1 302 ? 66.429  28.320  -31.320 1.00 39.21  ? 302  ALA B CA  1 
ATOM   5248 C C   . ALA B 1 302 ? 67.064  27.813  -30.027 1.00 40.41  ? 302  ALA B C   1 
ATOM   5249 O O   . ALA B 1 302 ? 67.663  28.604  -29.298 1.00 40.43  ? 302  ALA B O   1 
ATOM   5250 C CB  . ALA B 1 302 ? 65.144  29.059  -30.945 1.00 32.95  ? 302  ALA B CB  1 
ATOM   5251 N N   . ALA B 1 303 ? 66.810  26.573  -29.601 1.00 40.68  ? 303  ALA B N   1 
ATOM   5252 C CA  . ALA B 1 303 ? 67.399  26.104  -28.349 1.00 40.87  ? 303  ALA B CA  1 
ATOM   5253 C C   . ALA B 1 303 ? 68.831  25.633  -28.601 1.00 41.21  ? 303  ALA B C   1 
ATOM   5254 O O   . ALA B 1 303 ? 69.704  25.621  -27.731 1.00 41.86  ? 303  ALA B O   1 
ATOM   5255 C CB  . ALA B 1 303 ? 66.539  25.014  -27.749 1.00 35.64  ? 303  ALA B CB  1 
ATOM   5256 N N   . GLY B 1 304 ? 69.075  25.126  -29.807 1.00 40.43  ? 304  GLY B N   1 
ATOM   5257 C CA  . GLY B 1 304 ? 70.363  24.596  -30.209 1.00 38.88  ? 304  GLY B CA  1 
ATOM   5258 C C   . GLY B 1 304 ? 70.514  23.135  -29.828 1.00 38.15  ? 304  GLY B C   1 
ATOM   5259 O O   . GLY B 1 304 ? 71.536  22.489  -30.078 1.00 37.78  ? 304  GLY B O   1 
ATOM   5260 N N   . ASN B 1 305 ? 69.473  22.573  -29.209 1.00 37.53  ? 305  ASN B N   1 
ATOM   5261 C CA  . ASN B 1 305 ? 69.512  21.182  -28.813 1.00 36.25  ? 305  ASN B CA  1 
ATOM   5262 C C   . ASN B 1 305 ? 68.136  20.541  -28.926 1.00 36.43  ? 305  ASN B C   1 
ATOM   5263 O O   . ASN B 1 305 ? 67.111  21.175  -29.170 1.00 35.71  ? 305  ASN B O   1 
ATOM   5264 C CB  . ASN B 1 305 ? 70.078  21.016  -27.400 1.00 35.49  ? 305  ASN B CB  1 
ATOM   5265 C CG  . ASN B 1 305 ? 69.156  21.559  -26.327 1.00 38.21  ? 305  ASN B CG  1 
ATOM   5266 O OD1 . ASN B 1 305 ? 67.985  21.146  -26.199 1.00 37.75  ? 305  ASN B OD1 1 
ATOM   5267 N ND2 . ASN B 1 305 ? 69.699  22.494  -25.548 1.00 35.54  ? 305  ASN B ND2 1 
ATOM   5268 N N   . TRP B 1 306 ? 68.156  19.259  -28.612 1.00 35.46  ? 306  TRP B N   1 
ATOM   5269 C CA  . TRP B 1 306 ? 66.953  18.425  -28.672 1.00 36.36  ? 306  TRP B CA  1 
ATOM   5270 C C   . TRP B 1 306 ? 66.556  17.961  -27.280 1.00 34.83  ? 306  TRP B C   1 
ATOM   5271 O O   . TRP B 1 306 ? 66.362  16.760  -27.083 1.00 34.78  ? 306  TRP B O   1 
ATOM   5272 C CB  . TRP B 1 306 ? 67.317  17.259  -29.603 1.00 37.41  ? 306  TRP B CB  1 
ATOM   5273 C CG  . TRP B 1 306 ? 66.135  16.553  -30.175 1.00 40.45  ? 306  TRP B CG  1 
ATOM   5274 C CD1 . TRP B 1 306 ? 65.721  15.275  -29.876 1.00 41.00  ? 306  TRP B CD1 1 
ATOM   5275 C CD2 . TRP B 1 306 ? 65.201  17.073  -31.126 1.00 39.91  ? 306  TRP B CD2 1 
ATOM   5276 N NE1 . TRP B 1 306 ? 64.599  14.966  -30.590 1.00 40.36  ? 306  TRP B NE1 1 
ATOM   5277 C CE2 . TRP B 1 306 ? 64.248  16.060  -31.352 1.00 41.39  ? 306  TRP B CE2 1 
ATOM   5278 C CE3 . TRP B 1 306 ? 65.078  18.279  -31.803 1.00 40.80  ? 306  TRP B CE3 1 
ATOM   5279 C CZ2 . TRP B 1 306 ? 63.185  16.224  -32.235 1.00 42.27  ? 306  TRP B CZ2 1 
ATOM   5280 C CZ3 . TRP B 1 306 ? 64.020  18.456  -32.685 1.00 41.72  ? 306  TRP B CZ3 1 
ATOM   5281 C CH2 . TRP B 1 306 ? 63.082  17.433  -32.879 1.00 42.63  ? 306  TRP B CH2 1 
ATOM   5282 N N   . ARG B 1 307 ? 66.610  18.849  -26.288 1.00 33.83  ? 307  ARG B N   1 
ATOM   5283 C CA  . ARG B 1 307 ? 66.232  18.479  -24.922 1.00 33.15  ? 307  ARG B CA  1 
ATOM   5284 C C   . ARG B 1 307 ? 64.789  18.918  -24.741 1.00 30.80  ? 307  ARG B C   1 
ATOM   5285 O O   . ARG B 1 307 ? 64.530  20.084  -25.049 1.00 30.70  ? 307  ARG B O   1 
ATOM   5286 C CB  . ARG B 1 307 ? 67.104  19.140  -23.854 1.00 38.02  ? 307  ARG B CB  1 
ATOM   5287 C CG  . ARG B 1 307 ? 68.551  18.665  -23.824 1.00 41.20  ? 307  ARG B CG  1 
ATOM   5288 C CD  . ARG B 1 307 ? 69.257  19.015  -22.520 1.00 45.99  ? 307  ARG B CD  1 
ATOM   5289 N NE  . ARG B 1 307 ? 68.409  18.883  -21.344 1.00 50.21  ? 307  ARG B NE  1 
ATOM   5290 C CZ  . ARG B 1 307 ? 67.893  19.828  -20.568 1.00 52.74  ? 307  ARG B CZ  1 
ATOM   5291 N NH1 . ARG B 1 307 ? 68.133  21.123  -20.768 1.00 51.15  ? 307  ARG B NH1 1 
ATOM   5292 N NH2 . ARG B 1 307 ? 67.102  19.516  -19.534 1.00 53.08  ? 307  ARG B NH2 1 
ATOM   5293 N N   . VAL B 1 308 ? 63.869  18.091  -24.262 1.00 29.66  ? 308  VAL B N   1 
ATOM   5294 C CA  . VAL B 1 308 ? 62.481  18.550  -24.140 1.00 27.53  ? 308  VAL B CA  1 
ATOM   5295 C C   . VAL B 1 308 ? 62.441  19.875  -23.397 1.00 28.59  ? 308  VAL B C   1 
ATOM   5296 O O   . VAL B 1 308 ? 61.814  20.820  -23.872 1.00 26.51  ? 308  VAL B O   1 
ATOM   5297 C CB  . VAL B 1 308 ? 61.545  17.531  -23.488 1.00 24.81  ? 308  VAL B CB  1 
ATOM   5298 C CG1 . VAL B 1 308 ? 60.161  18.106  -23.156 1.00 21.94  ? 308  VAL B CG1 1 
ATOM   5299 C CG2 . VAL B 1 308 ? 61.421  16.284  -24.350 1.00 24.29  ? 308  VAL B CG2 1 
ATOM   5300 N N   . GLU B 1 309 ? 63.111  19.944  -22.238 1.00 29.60  ? 309  GLU B N   1 
ATOM   5301 C CA  . GLU B 1 309 ? 63.070  21.178  -21.468 1.00 31.56  ? 309  GLU B CA  1 
ATOM   5302 C C   . GLU B 1 309 ? 63.490  22.402  -22.265 1.00 30.85  ? 309  GLU B C   1 
ATOM   5303 O O   . GLU B 1 309 ? 62.812  23.419  -22.167 1.00 31.00  ? 309  GLU B O   1 
ATOM   5304 C CB  . GLU B 1 309 ? 63.932  21.050  -20.211 1.00 37.09  ? 309  GLU B CB  1 
ATOM   5305 C CG  . GLU B 1 309 ? 63.753  22.254  -19.288 1.00 45.59  ? 309  GLU B CG  1 
ATOM   5306 C CD  . GLU B 1 309 ? 64.570  22.099  -18.018 1.00 51.33  ? 309  GLU B CD  1 
ATOM   5307 O OE1 . GLU B 1 309 ? 65.172  21.007  -17.852 1.00 53.20  ? 309  GLU B OE1 1 
ATOM   5308 O OE2 . GLU B 1 309 ? 64.619  23.047  -17.202 1.00 55.03  ? 309  GLU B OE2 1 
ATOM   5309 N N   . ASP B 1 310 ? 64.596  22.336  -22.992 1.00 30.86  ? 310  ASP B N   1 
ATOM   5310 C CA  . ASP B 1 310 ? 65.073  23.459  -23.772 1.00 32.58  ? 310  ASP B CA  1 
ATOM   5311 C C   . ASP B 1 310 ? 64.145  23.720  -24.956 1.00 33.40  ? 310  ASP B C   1 
ATOM   5312 O O   . ASP B 1 310 ? 63.806  24.873  -25.252 1.00 32.29  ? 310  ASP B O   1 
ATOM   5313 C CB  . ASP B 1 310 ? 66.521  23.201  -24.244 1.00 33.78  ? 310  ASP B CB  1 
ATOM   5314 C CG  . ASP B 1 310 ? 67.443  22.982  -23.065 1.00 36.11  ? 310  ASP B CG  1 
ATOM   5315 O OD1 . ASP B 1 310 ? 67.204  23.580  -21.987 1.00 40.23  ? 310  ASP B OD1 1 
ATOM   5316 O OD2 . ASP B 1 310 ? 68.426  22.216  -23.098 1.00 38.15  ? 310  ASP B OD2 1 
ATOM   5317 N N   . VAL B 1 311 ? 63.747  22.634  -25.646 1.00 32.90  ? 311  VAL B N   1 
ATOM   5318 C CA  . VAL B 1 311 ? 62.887  22.895  -26.811 1.00 34.33  ? 311  VAL B CA  1 
ATOM   5319 C C   . VAL B 1 311 ? 61.596  23.544  -26.332 1.00 35.56  ? 311  VAL B C   1 
ATOM   5320 O O   . VAL B 1 311 ? 61.188  24.576  -26.845 1.00 35.80  ? 311  VAL B O   1 
ATOM   5321 C CB  . VAL B 1 311 ? 62.579  21.664  -27.663 1.00 29.70  ? 311  VAL B CB  1 
ATOM   5322 C CG1 . VAL B 1 311 ? 61.597  22.026  -28.765 1.00 27.34  ? 311  VAL B CG1 1 
ATOM   5323 C CG2 . VAL B 1 311 ? 63.841  21.053  -28.253 1.00 26.05  ? 311  VAL B CG2 1 
ATOM   5324 N N   . GLN B 1 312 ? 60.966  22.928  -25.341 1.00 37.56  ? 312  GLN B N   1 
ATOM   5325 C CA  . GLN B 1 312 ? 59.678  23.366  -24.824 1.00 39.29  ? 312  GLN B CA  1 
ATOM   5326 C C   . GLN B 1 312 ? 59.652  24.831  -24.439 1.00 40.49  ? 312  GLN B C   1 
ATOM   5327 O O   . GLN B 1 312 ? 58.768  25.563  -24.895 1.00 40.64  ? 312  GLN B O   1 
ATOM   5328 C CB  . GLN B 1 312 ? 59.217  22.407  -23.727 1.00 38.53  ? 312  GLN B CB  1 
ATOM   5329 C CG  . GLN B 1 312 ? 57.954  22.785  -23.007 1.00 39.03  ? 312  GLN B CG  1 
ATOM   5330 C CD  . GLN B 1 312 ? 56.981  21.644  -22.810 1.00 39.59  ? 312  GLN B CD  1 
ATOM   5331 O OE1 . GLN B 1 312 ? 55.770  21.781  -23.024 1.00 40.23  ? 312  GLN B OE1 1 
ATOM   5332 N NE2 . GLN B 1 312 ? 57.493  20.501  -22.419 1.00 38.95  ? 312  GLN B NE2 1 
ATOM   5333 N N   . ARG B 1 313 ? 60.629  25.332  -23.717 1.00 41.79  ? 313  ARG B N   1 
ATOM   5334 C CA  . ARG B 1 313 ? 60.708  26.724  -23.315 1.00 43.24  ? 313  ARG B CA  1 
ATOM   5335 C C   . ARG B 1 313 ? 60.532  27.660  -24.497 1.00 43.00  ? 313  ARG B C   1 
ATOM   5336 O O   . ARG B 1 313 ? 59.662  28.538  -24.476 1.00 42.69  ? 313  ARG B O   1 
ATOM   5337 C CB  . ARG B 1 313 ? 62.043  26.939  -22.595 1.00 46.96  ? 313  ARG B CB  1 
ATOM   5338 C CG  . ARG B 1 313 ? 61.992  28.061  -21.574 1.00 52.93  ? 313  ARG B CG  1 
ATOM   5339 C CD  . ARG B 1 313 ? 63.290  28.243  -20.809 1.00 57.12  ? 313  ARG B CD  1 
ATOM   5340 N NE  . ARG B 1 313 ? 64.465  28.258  -21.681 1.00 60.01  ? 313  ARG B NE  1 
ATOM   5341 C CZ  . ARG B 1 313 ? 65.266  27.207  -21.834 1.00 63.48  ? 313  ARG B CZ  1 
ATOM   5342 N NH1 . ARG B 1 313 ? 65.028  26.075  -21.174 1.00 63.86  ? 313  ARG B NH1 1 
ATOM   5343 N NH2 . ARG B 1 313 ? 66.307  27.311  -22.658 1.00 65.69  ? 313  ARG B NH2 1 
ATOM   5344 N N   . HIS B 1 314 ? 61.274  27.445  -25.575 1.00 43.05  ? 314  HIS B N   1 
ATOM   5345 C CA  . HIS B 1 314 ? 61.220  28.187  -26.817 1.00 43.10  ? 314  HIS B CA  1 
ATOM   5346 C C   . HIS B 1 314 ? 59.958  28.031  -27.660 1.00 42.01  ? 314  HIS B C   1 
ATOM   5347 O O   . HIS B 1 314 ? 59.828  28.661  -28.705 1.00 41.72  ? 314  HIS B O   1 
ATOM   5348 C CB  . HIS B 1 314 ? 62.374  27.760  -27.750 1.00 43.74  ? 314  HIS B CB  1 
ATOM   5349 C CG  . HIS B 1 314 ? 63.701  28.239  -27.248 1.00 46.29  ? 314  HIS B CG  1 
ATOM   5350 N ND1 . HIS B 1 314 ? 64.558  27.429  -26.534 1.00 46.36  ? 314  HIS B ND1 1 
ATOM   5351 C CD2 . HIS B 1 314 ? 64.310  29.449  -27.352 1.00 45.90  ? 314  HIS B CD2 1 
ATOM   5352 C CE1 . HIS B 1 314 ? 65.642  28.120  -26.211 1.00 45.74  ? 314  HIS B CE1 1 
ATOM   5353 N NE2 . HIS B 1 314 ? 65.510  29.339  -26.695 1.00 43.97  ? 314  HIS B NE2 1 
ATOM   5354 N N   . LEU B 1 315 ? 59.039  27.185  -27.284 1.00 41.20  ? 315  LEU B N   1 
ATOM   5355 C CA  . LEU B 1 315 ? 57.803  26.901  -27.984 1.00 41.48  ? 315  LEU B CA  1 
ATOM   5356 C C   . LEU B 1 315 ? 56.725  27.959  -27.827 1.00 40.39  ? 315  LEU B C   1 
ATOM   5357 O O   . LEU B 1 315 ? 56.063  28.246  -28.827 1.00 39.58  ? 315  LEU B O   1 
ATOM   5358 C CB  . LEU B 1 315 ? 57.378  25.552  -27.400 1.00 44.22  ? 315  LEU B CB  1 
ATOM   5359 C CG  . LEU B 1 315 ? 56.665  24.441  -28.111 1.00 44.06  ? 315  LEU B CG  1 
ATOM   5360 C CD1 . LEU B 1 315 ? 55.175  24.746  -28.155 1.00 46.02  ? 315  LEU B CD1 1 
ATOM   5361 C CD2 . LEU B 1 315 ? 57.236  24.246  -29.507 1.00 45.32  ? 315  LEU B CD2 1 
ATOM   5362 N N   . TYR B 1 316 ? 56.502  28.525  -26.665 1.00 40.42  ? 316  TYR B N   1 
ATOM   5363 C CA  . TYR B 1 316 ? 55.460  29.487  -26.344 1.00 42.32  ? 316  TYR B CA  1 
ATOM   5364 C C   . TYR B 1 316 ? 55.708  30.886  -26.867 1.00 44.21  ? 316  TYR B C   1 
ATOM   5365 O O   . TYR B 1 316 ? 54.823  31.700  -27.097 1.00 44.77  ? 316  TYR B O   1 
ATOM   5366 C CB  . TYR B 1 316 ? 55.220  29.506  -24.807 1.00 40.27  ? 316  TYR B CB  1 
ATOM   5367 C CG  . TYR B 1 316 ? 55.040  28.052  -24.378 1.00 37.42  ? 316  TYR B CG  1 
ATOM   5368 C CD1 . TYR B 1 316 ? 53.925  27.327  -24.762 1.00 35.43  ? 316  TYR B CD1 1 
ATOM   5369 C CD2 . TYR B 1 316 ? 56.029  27.401  -23.656 1.00 37.33  ? 316  TYR B CD2 1 
ATOM   5370 C CE1 . TYR B 1 316 ? 53.763  26.004  -24.421 1.00 34.61  ? 316  TYR B CE1 1 
ATOM   5371 C CE2 . TYR B 1 316 ? 55.903  26.066  -23.317 1.00 37.31  ? 316  TYR B CE2 1 
ATOM   5372 C CZ  . TYR B 1 316 ? 54.752  25.370  -23.693 1.00 36.95  ? 316  TYR B CZ  1 
ATOM   5373 O OH  . TYR B 1 316 ? 54.623  24.037  -23.366 1.00 33.80  ? 316  TYR B OH  1 
ATOM   5374 N N   . ASP B 1 317 ? 56.959  31.157  -27.162 1.00 47.20  ? 317  ASP B N   1 
ATOM   5375 C CA  . ASP B 1 317 ? 57.488  32.379  -27.711 1.00 51.39  ? 317  ASP B CA  1 
ATOM   5376 C C   . ASP B 1 317 ? 57.527  32.453  -29.237 1.00 52.43  ? 317  ASP B C   1 
ATOM   5377 O O   . ASP B 1 317 ? 57.673  33.574  -29.747 1.00 53.45  ? 317  ASP B O   1 
ATOM   5378 C CB  . ASP B 1 317 ? 58.932  32.544  -27.175 1.00 54.36  ? 317  ASP B CB  1 
ATOM   5379 C CG  . ASP B 1 317 ? 58.951  32.786  -25.678 1.00 54.94  ? 317  ASP B CG  1 
ATOM   5380 O OD1 . ASP B 1 317 ? 57.910  33.246  -25.152 1.00 55.90  ? 317  ASP B OD1 1 
ATOM   5381 O OD2 . ASP B 1 317 ? 60.002  32.519  -25.051 1.00 55.51  ? 317  ASP B OD2 1 
ATOM   5382 N N   . ILE B 1 318 ? 57.335  31.360  -29.959 1.00 52.62  ? 318  ILE B N   1 
ATOM   5383 C CA  . ILE B 1 318 ? 57.353  31.394  -31.413 1.00 53.63  ? 318  ILE B CA  1 
ATOM   5384 C C   . ILE B 1 318 ? 55.976  31.310  -32.082 1.00 54.13  ? 318  ILE B C   1 
ATOM   5385 O O   . ILE B 1 318 ? 55.410  30.268  -32.433 1.00 53.39  ? 318  ILE B O   1 
ATOM   5386 C CB  . ILE B 1 318 ? 58.286  30.287  -31.946 1.00 53.65  ? 318  ILE B CB  1 
ATOM   5387 C CG1 . ILE B 1 318 ? 59.718  30.503  -31.429 1.00 53.71  ? 318  ILE B CG1 1 
ATOM   5388 C CG2 . ILE B 1 318 ? 58.287  30.207  -33.463 1.00 53.26  ? 318  ILE B CG2 1 
ATOM   5389 C CD1 . ILE B 1 318 ? 60.636  29.318  -31.630 1.00 50.77  ? 318  ILE B CD1 1 
ATOM   5390 N N   . ASP B 1 319 ? 55.414  32.491  -32.332 1.00 53.61  ? 319  ASP B N   1 
ATOM   5391 C CA  . ASP B 1 319 ? 54.194  32.664  -33.116 1.00 53.07  ? 319  ASP B CA  1 
ATOM   5392 C C   . ASP B 1 319 ? 54.532  32.335  -34.568 1.00 50.88  ? 319  ASP B C   1 
ATOM   5393 O O   . ASP B 1 319 ? 55.426  33.013  -35.067 1.00 51.41  ? 319  ASP B O   1 
ATOM   5394 C CB  . ASP B 1 319 ? 53.725  34.115  -32.966 1.00 56.76  ? 319  ASP B CB  1 
ATOM   5395 C CG  . ASP B 1 319 ? 52.370  34.331  -33.604 1.00 61.97  ? 319  ASP B CG  1 
ATOM   5396 O OD1 . ASP B 1 319 ? 52.086  33.566  -34.562 1.00 64.77  ? 319  ASP B OD1 1 
ATOM   5397 O OD2 . ASP B 1 319 ? 51.567  35.198  -33.191 1.00 63.15  ? 319  ASP B OD2 1 
ATOM   5398 N N   . ILE B 1 320 ? 53.964  31.333  -35.210 1.00 48.79  ? 320  ILE B N   1 
ATOM   5399 C CA  . ILE B 1 320 ? 54.292  30.962  -36.581 1.00 46.32  ? 320  ILE B CA  1 
ATOM   5400 C C   . ILE B 1 320 ? 53.296  31.508  -37.609 1.00 43.50  ? 320  ILE B C   1 
ATOM   5401 O O   . ILE B 1 320 ? 52.162  31.886  -37.323 1.00 42.61  ? 320  ILE B O   1 
ATOM   5402 C CB  . ILE B 1 320 ? 54.380  29.423  -36.719 1.00 48.93  ? 320  ILE B CB  1 
ATOM   5403 C CG1 . ILE B 1 320 ? 55.511  28.883  -35.850 1.00 51.43  ? 320  ILE B CG1 1 
ATOM   5404 C CG2 . ILE B 1 320 ? 54.569  28.943  -38.154 1.00 51.25  ? 320  ILE B CG2 1 
ATOM   5405 C CD1 . ILE B 1 320 ? 56.034  27.506  -36.177 1.00 52.71  ? 320  ILE B CD1 1 
ATOM   5406 N N   . ASP B 1 321 ? 53.736  31.580  -38.861 1.00 40.16  ? 321  ASP B N   1 
ATOM   5407 C CA  . ASP B 1 321 ? 52.919  31.957  -39.993 1.00 36.97  ? 321  ASP B CA  1 
ATOM   5408 C C   . ASP B 1 321 ? 52.529  30.655  -40.690 1.00 35.07  ? 321  ASP B C   1 
ATOM   5409 O O   . ASP B 1 321 ? 53.229  30.132  -41.553 1.00 33.68  ? 321  ASP B O   1 
ATOM   5410 C CB  . ASP B 1 321 ? 53.602  32.938  -40.928 1.00 38.67  ? 321  ASP B CB  1 
ATOM   5411 C CG  . ASP B 1 321 ? 53.739  34.275  -40.208 1.00 41.20  ? 321  ASP B CG  1 
ATOM   5412 O OD1 . ASP B 1 321 ? 52.856  34.630  -39.401 1.00 41.48  ? 321  ASP B OD1 1 
ATOM   5413 O OD2 . ASP B 1 321 ? 54.748  34.965  -40.428 1.00 45.09  ? 321  ASP B OD2 1 
ATOM   5414 N N   . ALA B 1 322 ? 51.388  30.130  -40.213 1.00 31.73  ? 322  ALA B N   1 
ATOM   5415 C CA  . ALA B 1 322 ? 50.906  28.857  -40.745 1.00 28.56  ? 322  ALA B CA  1 
ATOM   5416 C C   . ALA B 1 322 ? 50.048  29.102  -41.972 1.00 25.74  ? 322  ALA B C   1 
ATOM   5417 O O   . ALA B 1 322 ? 49.513  30.178  -42.187 1.00 24.00  ? 322  ALA B O   1 
ATOM   5418 C CB  . ALA B 1 322 ? 50.095  28.145  -39.666 1.00 28.51  ? 322  ALA B CB  1 
ATOM   5419 N N   . PRO B 1 323 ? 49.813  28.060  -42.728 1.00 25.30  ? 323  PRO B N   1 
ATOM   5420 C CA  . PRO B 1 323 ? 48.903  28.109  -43.867 1.00 27.06  ? 323  PRO B CA  1 
ATOM   5421 C C   . PRO B 1 323 ? 47.535  28.674  -43.519 1.00 27.45  ? 323  PRO B C   1 
ATOM   5422 O O   . PRO B 1 323 ? 46.955  29.428  -44.296 1.00 28.17  ? 323  PRO B O   1 
ATOM   5423 C CB  . PRO B 1 323 ? 48.780  26.656  -44.308 1.00 25.36  ? 323  PRO B CB  1 
ATOM   5424 C CG  . PRO B 1 323 ? 50.065  26.033  -43.869 1.00 24.55  ? 323  PRO B CG  1 
ATOM   5425 C CD  . PRO B 1 323 ? 50.380  26.700  -42.550 1.00 25.49  ? 323  PRO B CD  1 
ATOM   5426 N N   . GLN B 1 324 ? 47.018  28.415  -42.308 1.00 27.54  ? 324  GLN B N   1 
ATOM   5427 C CA  . GLN B 1 324 ? 45.704  28.891  -41.918 1.00 24.79  ? 324  GLN B CA  1 
ATOM   5428 C C   . GLN B 1 324 ? 45.732  30.357  -41.572 1.00 22.56  ? 324  GLN B C   1 
ATOM   5429 O O   . GLN B 1 324 ? 44.662  30.911  -41.433 1.00 22.22  ? 324  GLN B O   1 
ATOM   5430 C CB  . GLN B 1 324 ? 45.173  28.141  -40.662 1.00 24.46  ? 324  GLN B CB  1 
ATOM   5431 C CG  . GLN B 1 324 ? 45.895  28.556  -39.376 1.00 23.60  ? 324  GLN B CG  1 
ATOM   5432 C CD  . GLN B 1 324 ? 45.346  27.873  -38.134 1.00 22.01  ? 324  GLN B CD  1 
ATOM   5433 O OE1 . GLN B 1 324 ? 44.738  28.544  -37.290 1.00 19.39  ? 324  GLN B OE1 1 
ATOM   5434 N NE2 . GLN B 1 324 ? 45.551  26.558  -38.057 1.00 17.77  ? 324  GLN B NE2 1 
ATOM   5435 N N   . GLY B 1 325 ? 46.895  30.877  -41.221 1.00 22.07  ? 325  GLY B N   1 
ATOM   5436 C CA  . GLY B 1 325 ? 47.025  32.230  -40.694 1.00 19.62  ? 325  GLY B CA  1 
ATOM   5437 C C   . GLY B 1 325 ? 48.008  32.099  -39.506 1.00 19.80  ? 325  GLY B C   1 
ATOM   5438 O O   . GLY B 1 325 ? 48.693  31.096  -39.329 1.00 18.33  ? 325  GLY B O   1 
ATOM   5439 N N   . PRO B 1 326 ? 48.090  33.139  -38.689 1.00 19.45  ? 326  PRO B N   1 
ATOM   5440 C CA  . PRO B 1 326 ? 49.057  33.190  -37.626 1.00 20.44  ? 326  PRO B CA  1 
ATOM   5441 C C   . PRO B 1 326 ? 48.692  32.348  -36.417 1.00 21.43  ? 326  PRO B C   1 
ATOM   5442 O O   . PRO B 1 326 ? 47.561  32.562  -35.955 1.00 22.57  ? 326  PRO B O   1 
ATOM   5443 C CB  . PRO B 1 326 ? 49.064  34.668  -37.212 1.00 20.32  ? 326  PRO B CB  1 
ATOM   5444 C CG  . PRO B 1 326 ? 47.751  35.226  -37.652 1.00 19.77  ? 326  PRO B CG  1 
ATOM   5445 C CD  . PRO B 1 326 ? 47.359  34.428  -38.884 1.00 18.96  ? 326  PRO B CD  1 
ATOM   5446 N N   . VAL B 1 327 ? 49.553  31.473  -35.909 1.00 21.00  ? 327  VAL B N   1 
ATOM   5447 C CA  . VAL B 1 327 ? 49.214  30.720  -34.718 1.00 23.21  ? 327  VAL B CA  1 
ATOM   5448 C C   . VAL B 1 327 ? 50.281  30.811  -33.615 1.00 26.08  ? 327  VAL B C   1 
ATOM   5449 O O   . VAL B 1 327 ? 51.499  30.989  -33.814 1.00 24.12  ? 327  VAL B O   1 
ATOM   5450 C CB  . VAL B 1 327 ? 49.048  29.210  -35.009 1.00 24.18  ? 327  VAL B CB  1 
ATOM   5451 C CG1 . VAL B 1 327 ? 47.931  28.885  -35.985 1.00 22.00  ? 327  VAL B CG1 1 
ATOM   5452 C CG2 . VAL B 1 327 ? 50.368  28.645  -35.511 1.00 27.80  ? 327  VAL B CG2 1 
ATOM   5453 N N   . ARG B 1 328 ? 49.816  30.625  -32.367 1.00 26.71  ? 328  ARG B N   1 
ATOM   5454 C CA  . ARG B 1 328 ? 50.765  30.510  -31.268 1.00 28.46  ? 328  ARG B CA  1 
ATOM   5455 C C   . ARG B 1 328 ? 50.195  29.523  -30.245 1.00 26.96  ? 328  ARG B C   1 
ATOM   5456 O O   . ARG B 1 328 ? 49.013  29.197  -30.247 1.00 25.98  ? 328  ARG B O   1 
ATOM   5457 C CB  . ARG B 1 328 ? 51.137  31.810  -30.567 1.00 35.48  ? 328  ARG B CB  1 
ATOM   5458 C CG  . ARG B 1 328 ? 49.904  32.612  -30.195 1.00 42.24  ? 328  ARG B CG  1 
ATOM   5459 C CD  . ARG B 1 328 ? 50.266  34.087  -30.066 1.00 47.75  ? 328  ARG B CD  1 
ATOM   5460 N NE  . ARG B 1 328 ? 50.671  34.409  -28.695 1.00 51.60  ? 328  ARG B NE  1 
ATOM   5461 C CZ  . ARG B 1 328 ? 51.018  35.648  -28.339 1.00 53.22  ? 328  ARG B CZ  1 
ATOM   5462 N NH1 . ARG B 1 328 ? 51.004  36.633  -29.233 1.00 52.07  ? 328  ARG B NH1 1 
ATOM   5463 N NH2 . ARG B 1 328 ? 51.364  35.883  -27.073 1.00 54.39  ? 328  ARG B NH2 1 
ATOM   5464 N N   . VAL B 1 329 ? 51.112  29.053  -29.416 1.00 25.64  ? 329  VAL B N   1 
ATOM   5465 C CA  . VAL B 1 329 ? 50.771  28.124  -28.342 1.00 23.28  ? 329  VAL B CA  1 
ATOM   5466 C C   . VAL B 1 329 ? 50.827  28.898  -27.040 1.00 22.27  ? 329  VAL B C   1 
ATOM   5467 O O   . VAL B 1 329 ? 51.827  29.547  -26.751 1.00 21.92  ? 329  VAL B O   1 
ATOM   5468 C CB  . VAL B 1 329 ? 51.731  26.941  -28.383 1.00 23.23  ? 329  VAL B CB  1 
ATOM   5469 C CG1 . VAL B 1 329 ? 51.553  26.015  -27.174 1.00 23.83  ? 329  VAL B CG1 1 
ATOM   5470 C CG2 . VAL B 1 329 ? 51.538  26.147  -29.680 1.00 19.57  ? 329  VAL B CG2 1 
ATOM   5471 N N   . GLU B 1 330 ? 49.783  28.871  -26.238 1.00 22.42  ? 330  GLU B N   1 
ATOM   5472 C CA  . GLU B 1 330 ? 49.772  29.569  -24.960 1.00 22.52  ? 330  GLU B CA  1 
ATOM   5473 C C   . GLU B 1 330 ? 50.460  28.753  -23.886 1.00 23.10  ? 330  GLU B C   1 
ATOM   5474 O O   . GLU B 1 330 ? 50.068  27.613  -23.656 1.00 23.79  ? 330  GLU B O   1 
ATOM   5475 C CB  . GLU B 1 330 ? 48.342  29.894  -24.521 1.00 21.62  ? 330  GLU B CB  1 
ATOM   5476 C CG  . GLU B 1 330 ? 47.723  30.816  -25.559 1.00 24.78  ? 330  GLU B CG  1 
ATOM   5477 C CD  . GLU B 1 330 ? 46.458  31.504  -25.099 1.00 24.68  ? 330  GLU B CD  1 
ATOM   5478 O OE1 . GLU B 1 330 ? 45.911  31.093  -24.050 1.00 25.77  ? 330  GLU B OE1 1 
ATOM   5479 O OE2 . GLU B 1 330 ? 46.039  32.435  -25.817 1.00 23.17  ? 330  GLU B OE2 1 
ATOM   5480 N N   . ARG B 1 331 ? 51.412  29.359  -23.184 1.00 23.16  ? 331  ARG B N   1 
ATOM   5481 C CA  . ARG B 1 331 ? 52.100  28.667  -22.099 1.00 23.75  ? 331  ARG B CA  1 
ATOM   5482 C C   . ARG B 1 331 ? 51.150  28.324  -20.951 1.00 22.55  ? 331  ARG B C   1 
ATOM   5483 O O   . ARG B 1 331 ? 51.294  27.268  -20.345 1.00 20.38  ? 331  ARG B O   1 
ATOM   5484 C CB  . ARG B 1 331 ? 53.332  29.454  -21.613 1.00 23.16  ? 331  ARG B CB  1 
ATOM   5485 C CG  . ARG B 1 331 ? 54.246  28.590  -20.740 1.00 28.98  ? 331  ARG B CG  1 
ATOM   5486 C CD  . ARG B 1 331 ? 55.423  29.392  -20.178 1.00 36.09  ? 331  ARG B CD  1 
ATOM   5487 N NE  . ARG B 1 331 ? 55.831  30.442  -21.098 1.00 43.93  ? 331  ARG B NE  1 
ATOM   5488 C CZ  . ARG B 1 331 ? 56.823  30.716  -21.916 1.00 46.21  ? 331  ARG B CZ  1 
ATOM   5489 N NH1 . ARG B 1 331 ? 57.904  29.946  -22.079 1.00 45.46  ? 331  ARG B NH1 1 
ATOM   5490 N NH2 . ARG B 1 331 ? 56.724  31.864  -22.612 1.00 47.25  ? 331  ARG B NH2 1 
ATOM   5491 N N   . GLN B 1 332 ? 50.160  29.129  -20.634 1.00 23.12  ? 332  GLN B N   1 
ATOM   5492 C CA  . GLN B 1 332 ? 49.200  28.829  -19.562 1.00 25.22  ? 332  GLN B CA  1 
ATOM   5493 C C   . GLN B 1 332 ? 48.426  27.516  -19.702 1.00 23.62  ? 332  GLN B C   1 
ATOM   5494 O O   . GLN B 1 332 ? 48.063  26.893  -18.674 1.00 24.27  ? 332  GLN B O   1 
ATOM   5495 C CB  . GLN B 1 332 ? 48.237  30.021  -19.449 1.00 28.73  ? 332  GLN B CB  1 
ATOM   5496 C CG  . GLN B 1 332 ? 47.313  30.243  -20.638 1.00 37.42  ? 332  GLN B CG  1 
ATOM   5497 C CD  . GLN B 1 332 ? 46.761  31.653  -20.773 1.00 43.78  ? 332  GLN B CD  1 
ATOM   5498 O OE1 . GLN B 1 332 ? 47.361  32.646  -20.317 1.00 48.15  ? 332  GLN B OE1 1 
ATOM   5499 N NE2 . GLN B 1 332 ? 45.611  31.851  -21.421 1.00 43.28  ? 332  GLN B NE2 1 
ATOM   5500 N N   . ASN B 1 333 ? 48.106  27.060  -20.915 1.00 21.01  ? 333  ASN B N   1 
ATOM   5501 C CA  . ASN B 1 333 ? 47.304  25.854  -21.067 1.00 19.38  ? 333  ASN B CA  1 
ATOM   5502 C C   . ASN B 1 333 ? 47.744  24.865  -22.126 1.00 16.86  ? 333  ASN B C   1 
ATOM   5503 O O   . ASN B 1 333 ? 47.023  23.903  -22.368 1.00 14.17  ? 333  ASN B O   1 
ATOM   5504 C CB  . ASN B 1 333 ? 45.846  26.284  -21.393 1.00 22.35  ? 333  ASN B CB  1 
ATOM   5505 C CG  . ASN B 1 333 ? 45.873  27.269  -22.550 1.00 27.46  ? 333  ASN B CG  1 
ATOM   5506 O OD1 . ASN B 1 333 ? 46.604  27.166  -23.540 1.00 27.05  ? 333  ASN B OD1 1 
ATOM   5507 N ND2 . ASN B 1 333 ? 45.094  28.326  -22.463 1.00 32.68  ? 333  ASN B ND2 1 
ATOM   5508 N N   . ASN B 1 334 ? 48.872  25.062  -22.808 1.00 16.46  ? 334  ASN B N   1 
ATOM   5509 C CA  . ASN B 1 334 ? 49.359  24.227  -23.876 1.00 16.85  ? 334  ASN B CA  1 
ATOM   5510 C C   . ASN B 1 334 ? 48.402  24.132  -25.082 1.00 17.54  ? 334  ASN B C   1 
ATOM   5511 O O   . ASN B 1 334 ? 48.668  23.295  -25.948 1.00 17.62  ? 334  ASN B O   1 
ATOM   5512 C CB  . ASN B 1 334 ? 49.744  22.817  -23.428 1.00 12.53  ? 334  ASN B CB  1 
ATOM   5513 C CG  . ASN B 1 334 ? 51.153  22.811  -22.865 1.00 19.37  ? 334  ASN B CG  1 
ATOM   5514 O OD1 . ASN B 1 334 ? 51.917  23.773  -23.022 1.00 18.11  ? 334  ASN B OD1 1 
ATOM   5515 N ND2 . ASN B 1 334 ? 51.559  21.733  -22.204 1.00 17.81  ? 334  ASN B ND2 1 
ATOM   5516 N N   . HIS B 1 335 ? 47.397  24.967  -25.199 1.00 16.09  ? 335  HIS B N   1 
ATOM   5517 C CA  . HIS B 1 335 ? 46.474  24.969  -26.317 1.00 20.02  ? 335  HIS B CA  1 
ATOM   5518 C C   . HIS B 1 335 ? 46.930  26.104  -27.246 1.00 21.09  ? 335  HIS B C   1 
ATOM   5519 O O   . HIS B 1 335 ? 47.770  26.892  -26.829 1.00 21.04  ? 335  HIS B O   1 
ATOM   5520 C CB  . HIS B 1 335 ? 44.988  25.118  -25.918 1.00 11.17  ? 335  HIS B CB  1 
ATOM   5521 C CG  . HIS B 1 335 ? 44.453  23.873  -25.267 1.00 13.11  ? 335  HIS B CG  1 
ATOM   5522 N ND1 . HIS B 1 335 ? 44.993  23.344  -24.102 1.00 12.54  ? 335  HIS B ND1 1 
ATOM   5523 C CD2 . HIS B 1 335 ? 43.436  23.032  -25.614 1.00 11.45  ? 335  HIS B CD2 1 
ATOM   5524 C CE1 . HIS B 1 335 ? 44.354  22.248  -23.784 1.00 12.60  ? 335  HIS B CE1 1 
ATOM   5525 N NE2 . HIS B 1 335 ? 43.400  22.039  -24.672 1.00 10.30  ? 335  HIS B NE2 1 
ATOM   5526 N N   . SER B 1 336 ? 46.334  26.212  -28.417 1.00 22.69  ? 336  SER B N   1 
ATOM   5527 C CA  . SER B 1 336 ? 46.754  27.187  -29.409 1.00 23.55  ? 336  SER B CA  1 
ATOM   5528 C C   . SER B 1 336 ? 45.729  28.248  -29.752 1.00 24.06  ? 336  SER B C   1 
ATOM   5529 O O   . SER B 1 336 ? 44.515  28.098  -29.522 1.00 25.47  ? 336  SER B O   1 
ATOM   5530 C CB  . SER B 1 336 ? 47.077  26.381  -30.695 1.00 21.43  ? 336  SER B CB  1 
ATOM   5531 O OG  . SER B 1 336 ? 47.991  25.341  -30.411 1.00 19.47  ? 336  SER B OG  1 
ATOM   5532 N N   . ARG B 1 337 ? 46.214  29.352  -30.313 1.00 24.10  ? 337  ARG B N   1 
ATOM   5533 C CA  . ARG B 1 337 ? 45.338  30.420  -30.799 1.00 24.03  ? 337  ARG B CA  1 
ATOM   5534 C C   . ARG B 1 337 ? 45.145  30.040  -32.265 1.00 24.64  ? 337  ARG B C   1 
ATOM   5535 O O   . ARG B 1 337 ? 46.150  29.939  -32.966 1.00 23.95  ? 337  ARG B O   1 
ATOM   5536 C CB  . ARG B 1 337 ? 45.935  31.804  -30.677 1.00 27.76  ? 337  ARG B CB  1 
ATOM   5537 C CG  . ARG B 1 337 ? 46.155  32.224  -29.238 1.00 31.90  ? 337  ARG B CG  1 
ATOM   5538 C CD  . ARG B 1 337 ? 46.294  33.751  -29.139 1.00 33.27  ? 337  ARG B CD  1 
ATOM   5539 N NE  . ARG B 1 337 ? 47.239  34.029  -28.074 1.00 37.08  ? 337  ARG B NE  1 
ATOM   5540 C CZ  . ARG B 1 337 ? 47.290  35.105  -27.313 1.00 40.47  ? 337  ARG B CZ  1 
ATOM   5541 N NH1 . ARG B 1 337 ? 46.394  36.074  -27.452 1.00 45.38  ? 337  ARG B NH1 1 
ATOM   5542 N NH2 . ARG B 1 337 ? 48.242  35.158  -26.402 1.00 40.23  ? 337  ARG B NH2 1 
ATOM   5543 N N   . LEU B 1 338 ? 43.920  29.724  -32.636 1.00 23.77  ? 338  LEU B N   1 
ATOM   5544 C CA  . LEU B 1 338 ? 43.580  29.207  -33.938 1.00 22.67  ? 338  LEU B CA  1 
ATOM   5545 C C   . LEU B 1 338 ? 42.504  29.996  -34.666 1.00 22.47  ? 338  LEU B C   1 
ATOM   5546 O O   . LEU B 1 338 ? 41.594  30.535  -34.050 1.00 21.02  ? 338  LEU B O   1 
ATOM   5547 C CB  . LEU B 1 338 ? 42.925  27.806  -33.729 1.00 21.43  ? 338  LEU B CB  1 
ATOM   5548 C CG  . LEU B 1 338 ? 43.866  26.734  -33.155 1.00 19.95  ? 338  LEU B CG  1 
ATOM   5549 C CD1 . LEU B 1 338 ? 43.153  25.450  -32.809 1.00 10.47  ? 338  LEU B CD1 1 
ATOM   5550 C CD2 . LEU B 1 338 ? 44.965  26.415  -34.158 1.00 19.54  ? 338  LEU B CD2 1 
ATOM   5551 N N   . SER B 1 339 ? 42.630  30.030  -35.979 1.00 22.07  ? 339  SER B N   1 
ATOM   5552 C CA  . SER B 1 339 ? 41.594  30.648  -36.802 1.00 21.40  ? 339  SER B CA  1 
ATOM   5553 C C   . SER B 1 339 ? 40.402  29.696  -36.789 1.00 21.26  ? 339  SER B C   1 
ATOM   5554 O O   . SER B 1 339 ? 40.566  28.497  -36.506 1.00 19.74  ? 339  SER B O   1 
ATOM   5555 C CB  . SER B 1 339 ? 42.069  30.747  -38.254 1.00 22.18  ? 339  SER B CB  1 
ATOM   5556 O OG  . SER B 1 339 ? 43.136  31.665  -38.379 1.00 27.44  ? 339  SER B OG  1 
ATOM   5557 N N   . SER B 1 340 ? 39.248  30.187  -37.226 1.00 20.98  ? 340  SER B N   1 
ATOM   5558 C CA  . SER B 1 340 ? 38.118  29.241  -37.276 1.00 21.02  ? 340  SER B CA  1 
ATOM   5559 C C   . SER B 1 340 ? 37.259  29.574  -38.483 1.00 21.54  ? 340  SER B C   1 
ATOM   5560 O O   . SER B 1 340 ? 36.781  30.703  -38.560 1.00 20.44  ? 340  SER B O   1 
ATOM   5561 C CB  . SER B 1 340 ? 37.369  29.274  -35.953 1.00 20.10  ? 340  SER B CB  1 
ATOM   5562 O OG  . SER B 1 340 ? 36.211  28.497  -35.901 1.00 17.83  ? 340  SER B OG  1 
ATOM   5563 N N   . ARG B 1 341 ? 37.098  28.618  -39.404 1.00 21.43  ? 341  ARG B N   1 
ATOM   5564 C CA  . ARG B 1 341 ? 36.297  28.912  -40.601 1.00 23.11  ? 341  ARG B CA  1 
ATOM   5565 C C   . ARG B 1 341 ? 35.087  27.976  -40.716 1.00 24.07  ? 341  ARG B C   1 
ATOM   5566 O O   . ARG B 1 341 ? 35.200  26.779  -40.390 1.00 22.96  ? 341  ARG B O   1 
ATOM   5567 C CB  . ARG B 1 341 ? 37.202  28.796  -41.843 1.00 18.85  ? 341  ARG B CB  1 
ATOM   5568 C CG  . ARG B 1 341 ? 38.271  29.871  -41.971 1.00 20.98  ? 341  ARG B CG  1 
ATOM   5569 C CD  . ARG B 1 341 ? 39.454  29.446  -42.852 1.00 18.25  ? 341  ARG B CD  1 
ATOM   5570 N NE  . ARG B 1 341 ? 40.184  30.679  -43.194 1.00 21.54  ? 341  ARG B NE  1 
ATOM   5571 C CZ  . ARG B 1 341 ? 41.337  31.085  -42.688 1.00 20.47  ? 341  ARG B CZ  1 
ATOM   5572 N NH1 . ARG B 1 341 ? 41.976  30.339  -41.797 1.00 15.77  ? 341  ARG B NH1 1 
ATOM   5573 N NH2 . ARG B 1 341 ? 41.902  32.242  -43.029 1.00 21.00  ? 341  ARG B NH2 1 
ATOM   5574 N N   . ILE B 1 342 ? 33.966  28.498  -41.226 1.00 24.70  ? 342  ILE B N   1 
ATOM   5575 C CA  . ILE B 1 342 ? 32.789  27.644  -41.458 1.00 25.76  ? 342  ILE B CA  1 
ATOM   5576 C C   . ILE B 1 342 ? 32.583  27.622  -42.972 1.00 27.11  ? 342  ILE B C   1 
ATOM   5577 O O   . ILE B 1 342 ? 32.504  28.690  -43.593 1.00 27.85  ? 342  ILE B O   1 
ATOM   5578 C CB  . ILE B 1 342 ? 31.510  28.070  -40.712 1.00 23.49  ? 342  ILE B CB  1 
ATOM   5579 C CG1 . ILE B 1 342 ? 31.648  27.828  -39.204 1.00 21.50  ? 342  ILE B CG1 1 
ATOM   5580 C CG2 . ILE B 1 342 ? 30.273  27.335  -41.253 1.00 17.71  ? 342  ILE B CG2 1 
ATOM   5581 C CD1 . ILE B 1 342 ? 30.716  28.616  -38.296 1.00 18.04  ? 342  ILE B CD1 1 
ATOM   5582 N N   . ALA B 1 343 ? 32.538  26.459  -43.590 1.00 27.23  ? 343  ALA B N   1 
ATOM   5583 C CA  . ALA B 1 343 ? 32.469  26.447  -45.047 1.00 28.89  ? 343  ALA B CA  1 
ATOM   5584 C C   . ALA B 1 343 ? 31.326  25.607  -45.601 1.00 29.44  ? 343  ALA B C   1 
ATOM   5585 O O   . ALA B 1 343 ? 31.004  24.566  -45.026 1.00 29.93  ? 343  ALA B O   1 
ATOM   5586 C CB  . ALA B 1 343 ? 33.777  25.882  -45.613 1.00 27.43  ? 343  ALA B CB  1 
ATOM   5587 N N   . GLU B 1 344 ? 30.818  26.056  -46.737 1.00 29.25  ? 344  GLU B N   1 
ATOM   5588 C CA  . GLU B 1 344 ? 29.749  25.339  -47.418 1.00 30.37  ? 344  GLU B CA  1 
ATOM   5589 C C   . GLU B 1 344 ? 30.300  24.753  -48.706 1.00 30.33  ? 344  GLU B C   1 
ATOM   5590 O O   . GLU B 1 344 ? 30.977  25.474  -49.464 1.00 30.56  ? 344  GLU B O   1 
ATOM   5591 C CB  . GLU B 1 344 ? 28.567  26.286  -47.670 1.00 31.74  ? 344  GLU B CB  1 
ATOM   5592 C CG  . GLU B 1 344 ? 27.299  25.514  -48.009 1.00 35.03  ? 344  GLU B CG  1 
ATOM   5593 C CD  . GLU B 1 344 ? 26.219  26.387  -48.599 1.00 40.38  ? 344  GLU B CD  1 
ATOM   5594 O OE1 . GLU B 1 344 ? 26.046  27.522  -48.108 1.00 43.86  ? 344  GLU B OE1 1 
ATOM   5595 O OE2 . GLU B 1 344 ? 25.542  25.956  -49.560 1.00 42.99  ? 344  GLU B OE2 1 
ATOM   5596 N N   . ILE B 1 345 ? 30.089  23.470  -48.957 1.00 29.68  ? 345  ILE B N   1 
ATOM   5597 C CA  . ILE B 1 345 ? 30.615  22.857  -50.185 1.00 31.03  ? 345  ILE B CA  1 
ATOM   5598 C C   . ILE B 1 345 ? 29.790  23.185  -51.426 1.00 31.76  ? 345  ILE B C   1 
ATOM   5599 O O   . ILE B 1 345 ? 28.572  22.976  -51.442 1.00 30.91  ? 345  ILE B O   1 
ATOM   5600 C CB  . ILE B 1 345 ? 30.674  21.337  -49.995 1.00 31.71  ? 345  ILE B CB  1 
ATOM   5601 C CG1 . ILE B 1 345 ? 31.509  21.036  -48.737 1.00 31.33  ? 345  ILE B CG1 1 
ATOM   5602 C CG2 . ILE B 1 345 ? 31.252  20.674  -51.232 1.00 31.68  ? 345  ILE B CG2 1 
ATOM   5603 C CD1 . ILE B 1 345 ? 31.265  19.652  -48.183 1.00 32.74  ? 345  ILE B CD1 1 
ATOM   5604 N N   . ASP B 1 346 ? 30.437  23.712  -52.466 1.00 31.15  ? 346  ASP B N   1 
ATOM   5605 C CA  . ASP B 1 346 ? 29.702  24.072  -53.685 1.00 31.59  ? 346  ASP B CA  1 
ATOM   5606 C C   . ASP B 1 346 ? 29.518  22.852  -54.568 1.00 33.28  ? 346  ASP B C   1 
ATOM   5607 O O   . ASP B 1 346 ? 29.915  21.738  -54.173 1.00 32.61  ? 346  ASP B O   1 
ATOM   5608 C CB  . ASP B 1 346 ? 30.429  25.200  -54.402 1.00 30.04  ? 346  ASP B CB  1 
ATOM   5609 C CG  . ASP B 1 346 ? 31.765  24.810  -54.994 1.00 27.81  ? 346  ASP B CG  1 
ATOM   5610 O OD1 . ASP B 1 346 ? 32.154  23.631  -55.098 1.00 25.03  ? 346  ASP B OD1 1 
ATOM   5611 O OD2 . ASP B 1 346 ? 32.465  25.762  -55.382 1.00 29.50  ? 346  ASP B OD2 1 
ATOM   5612 N N   . ALA B 1 347 ? 28.968  22.995  -55.777 1.00 34.18  ? 347  ALA B N   1 
ATOM   5613 C CA  . ALA B 1 347 ? 28.721  21.869  -56.666 1.00 34.94  ? 347  ALA B CA  1 
ATOM   5614 C C   . ALA B 1 347 ? 29.957  21.176  -57.206 1.00 36.09  ? 347  ALA B C   1 
ATOM   5615 O O   . ALA B 1 347 ? 29.842  20.006  -57.589 1.00 37.61  ? 347  ALA B O   1 
ATOM   5616 C CB  . ALA B 1 347 ? 27.889  22.308  -57.873 1.00 33.65  ? 347  ALA B CB  1 
ATOM   5617 N N   . ARG B 1 348 ? 31.107  21.808  -57.274 1.00 37.48  ? 348  ARG B N   1 
ATOM   5618 C CA  . ARG B 1 348 ? 32.331  21.195  -57.760 1.00 40.64  ? 348  ARG B CA  1 
ATOM   5619 C C   . ARG B 1 348 ? 33.201  20.692  -56.616 1.00 42.08  ? 348  ARG B C   1 
ATOM   5620 O O   . ARG B 1 348 ? 34.433  20.698  -56.711 1.00 43.69  ? 348  ARG B O   1 
ATOM   5621 C CB  . ARG B 1 348 ? 33.148  22.167  -58.633 1.00 39.93  ? 348  ARG B CB  1 
ATOM   5622 C CG  . ARG B 1 348 ? 32.427  22.575  -59.912 1.00 38.93  ? 348  ARG B CG  1 
ATOM   5623 C CD  . ARG B 1 348 ? 32.795  23.972  -60.314 1.00 39.85  ? 348  ARG B CD  1 
ATOM   5624 N NE  . ARG B 1 348 ? 32.043  24.605  -61.372 1.00 40.44  ? 348  ARG B NE  1 
ATOM   5625 C CZ  . ARG B 1 348 ? 32.493  25.666  -62.037 1.00 42.99  ? 348  ARG B CZ  1 
ATOM   5626 N NH1 . ARG B 1 348 ? 33.703  26.123  -61.741 1.00 44.51  ? 348  ARG B NH1 1 
ATOM   5627 N NH2 . ARG B 1 348 ? 31.778  26.257  -62.983 1.00 42.25  ? 348  ARG B NH2 1 
ATOM   5628 N N   . GLY B 1 349 ? 32.607  20.320  -55.486 1.00 42.99  ? 349  GLY B N   1 
ATOM   5629 C CA  . GLY B 1 349 ? 33.305  19.758  -54.347 1.00 43.40  ? 349  GLY B CA  1 
ATOM   5630 C C   . GLY B 1 349 ? 34.259  20.641  -53.573 1.00 43.65  ? 349  GLY B C   1 
ATOM   5631 O O   . GLY B 1 349 ? 35.049  20.155  -52.755 1.00 43.35  ? 349  GLY B O   1 
ATOM   5632 N N   . VAL B 1 350 ? 34.207  21.939  -53.812 1.00 42.68  ? 350  VAL B N   1 
ATOM   5633 C CA  . VAL B 1 350 ? 35.067  22.929  -53.224 1.00 42.24  ? 350  VAL B CA  1 
ATOM   5634 C C   . VAL B 1 350 ? 34.396  23.595  -52.024 1.00 42.06  ? 350  VAL B C   1 
ATOM   5635 O O   . VAL B 1 350 ? 33.257  24.029  -52.022 1.00 41.67  ? 350  VAL B O   1 
ATOM   5636 C CB  . VAL B 1 350 ? 35.405  24.022  -54.259 1.00 43.62  ? 350  VAL B CB  1 
ATOM   5637 C CG1 . VAL B 1 350 ? 36.089  25.246  -53.687 1.00 42.42  ? 350  VAL B CG1 1 
ATOM   5638 C CG2 . VAL B 1 350 ? 36.289  23.428  -55.356 1.00 46.53  ? 350  VAL B CG2 1 
ATOM   5639 N N   . PHE B 1 351 ? 35.219  23.792  -51.008 1.00 41.20  ? 351  PHE B N   1 
ATOM   5640 C CA  . PHE B 1 351 ? 34.910  24.418  -49.763 1.00 39.61  ? 351  PHE B CA  1 
ATOM   5641 C C   . PHE B 1 351 ? 34.892  25.928  -49.810 1.00 39.16  ? 351  PHE B C   1 
ATOM   5642 O O   . PHE B 1 351 ? 35.941  26.554  -49.773 1.00 40.16  ? 351  PHE B O   1 
ATOM   5643 C CB  . PHE B 1 351 ? 35.982  23.950  -48.755 1.00 40.07  ? 351  PHE B CB  1 
ATOM   5644 C CG  . PHE B 1 351 ? 35.771  22.490  -48.437 1.00 39.28  ? 351  PHE B CG  1 
ATOM   5645 C CD1 . PHE B 1 351 ? 34.916  22.133  -47.411 1.00 39.07  ? 351  PHE B CD1 1 
ATOM   5646 C CD2 . PHE B 1 351 ? 36.398  21.509  -49.176 1.00 40.74  ? 351  PHE B CD2 1 
ATOM   5647 C CE1 . PHE B 1 351 ? 34.704  20.805  -47.107 1.00 40.23  ? 351  PHE B CE1 1 
ATOM   5648 C CE2 . PHE B 1 351 ? 36.175  20.176  -48.894 1.00 41.65  ? 351  PHE B CE2 1 
ATOM   5649 C CZ  . PHE B 1 351 ? 35.342  19.832  -47.850 1.00 41.70  ? 351  PHE B CZ  1 
ATOM   5650 N N   . GLN B 1 352 ? 33.710  26.518  -49.764 1.00 38.21  ? 352  GLN B N   1 
ATOM   5651 C CA  . GLN B 1 352 ? 33.507  27.951  -49.794 1.00 36.68  ? 352  GLN B CA  1 
ATOM   5652 C C   . GLN B 1 352 ? 33.342  28.489  -48.378 1.00 35.66  ? 352  GLN B C   1 
ATOM   5653 O O   . GLN B 1 352 ? 32.312  28.209  -47.740 1.00 35.33  ? 352  GLN B O   1 
ATOM   5654 C CB  . GLN B 1 352 ? 32.260  28.335  -50.612 1.00 36.87  ? 352  GLN B CB  1 
ATOM   5655 C CG  . GLN B 1 352 ? 32.262  27.768  -52.033 1.00 39.05  ? 352  GLN B CG  1 
ATOM   5656 C CD  . GLN B 1 352 ? 33.455  28.351  -52.793 1.00 42.39  ? 352  GLN B CD  1 
ATOM   5657 O OE1 . GLN B 1 352 ? 33.800  29.508  -52.514 1.00 43.99  ? 352  GLN B OE1 1 
ATOM   5658 N NE2 . GLN B 1 352 ? 34.062  27.595  -53.692 1.00 41.47  ? 352  GLN B NE2 1 
ATOM   5659 N N   . VAL B 1 353 ? 34.350  29.226  -47.915 1.00 33.04  ? 353  VAL B N   1 
ATOM   5660 C CA  . VAL B 1 353 ? 34.266  29.765  -46.553 1.00 30.93  ? 353  VAL B CA  1 
ATOM   5661 C C   . VAL B 1 353 ? 33.146  30.777  -46.424 1.00 30.44  ? 353  VAL B C   1 
ATOM   5662 O O   . VAL B 1 353 ? 33.166  31.778  -47.122 1.00 30.29  ? 353  VAL B O   1 
ATOM   5663 C CB  . VAL B 1 353 ? 35.638  30.351  -46.139 1.00 25.28  ? 353  VAL B CB  1 
ATOM   5664 C CG1 . VAL B 1 353 ? 35.547  31.079  -44.815 1.00 20.84  ? 353  VAL B CG1 1 
ATOM   5665 C CG2 . VAL B 1 353 ? 36.618  29.184  -46.081 1.00 17.62  ? 353  VAL B CG2 1 
ATOM   5666 N N   . ARG B 1 354 ? 32.178  30.589  -45.553 1.00 29.76  ? 354  ARG B N   1 
ATOM   5667 C CA  . ARG B 1 354 ? 31.085  31.520  -45.395 1.00 30.60  ? 354  ARG B CA  1 
ATOM   5668 C C   . ARG B 1 354 ? 31.212  32.451  -44.213 1.00 29.73  ? 354  ARG B C   1 
ATOM   5669 O O   . ARG B 1 354 ? 30.375  33.347  -44.131 1.00 30.65  ? 354  ARG B O   1 
ATOM   5670 C CB  . ARG B 1 354 ? 29.731  30.809  -45.171 1.00 36.69  ? 354  ARG B CB  1 
ATOM   5671 C CG  . ARG B 1 354 ? 29.683  29.509  -45.948 1.00 42.47  ? 354  ARG B CG  1 
ATOM   5672 C CD  . ARG B 1 354 ? 28.365  29.434  -46.681 1.00 51.34  ? 354  ARG B CD  1 
ATOM   5673 N NE  . ARG B 1 354 ? 28.478  29.571  -48.123 1.00 55.04  ? 354  ARG B NE  1 
ATOM   5674 C CZ  . ARG B 1 354 ? 28.857  30.670  -48.761 1.00 57.02  ? 354  ARG B CZ  1 
ATOM   5675 N NH1 . ARG B 1 354 ? 29.182  31.754  -48.062 1.00 56.20  ? 354  ARG B NH1 1 
ATOM   5676 N NH2 . ARG B 1 354 ? 28.885  30.637  -50.096 1.00 57.38  ? 354  ARG B NH2 1 
ATOM   5677 N N   . TRP B 1 355 ? 32.036  32.094  -43.249 1.00 28.53  ? 355  TRP B N   1 
ATOM   5678 C CA  . TRP B 1 355 ? 32.222  32.916  -42.065 1.00 28.09  ? 355  TRP B CA  1 
ATOM   5679 C C   . TRP B 1 355 ? 33.622  32.606  -41.545 1.00 29.31  ? 355  TRP B C   1 
ATOM   5680 O O   . TRP B 1 355 ? 34.129  31.506  -41.771 1.00 30.51  ? 355  TRP B O   1 
ATOM   5681 C CB  . TRP B 1 355 ? 31.170  32.612  -41.002 1.00 27.93  ? 355  TRP B CB  1 
ATOM   5682 C CG  . TRP B 1 355 ? 31.445  33.282  -39.686 1.00 27.16  ? 355  TRP B CG  1 
ATOM   5683 C CD1 . TRP B 1 355 ? 31.043  34.538  -39.325 1.00 28.26  ? 355  TRP B CD1 1 
ATOM   5684 C CD2 . TRP B 1 355 ? 32.213  32.767  -38.598 1.00 24.22  ? 355  TRP B CD2 1 
ATOM   5685 N NE1 . TRP B 1 355 ? 31.526  34.841  -38.076 1.00 28.67  ? 355  TRP B NE1 1 
ATOM   5686 C CE2 . TRP B 1 355 ? 32.245  33.764  -37.610 1.00 26.81  ? 355  TRP B CE2 1 
ATOM   5687 C CE3 . TRP B 1 355 ? 32.918  31.586  -38.382 1.00 22.99  ? 355  TRP B CE3 1 
ATOM   5688 C CZ2 . TRP B 1 355 ? 32.908  33.592  -36.390 1.00 25.45  ? 355  TRP B CZ2 1 
ATOM   5689 C CZ3 . TRP B 1 355 ? 33.589  31.426  -37.179 1.00 22.05  ? 355  TRP B CZ3 1 
ATOM   5690 C CH2 . TRP B 1 355 ? 33.578  32.410  -36.202 1.00 21.69  ? 355  TRP B CH2 1 
ATOM   5691 N N   . GLN B 1 356 ? 34.254  33.561  -40.913 1.00 29.46  ? 356  GLN B N   1 
ATOM   5692 C CA  . GLN B 1 356 ? 35.572  33.422  -40.332 1.00 30.70  ? 356  GLN B CA  1 
ATOM   5693 C C   . GLN B 1 356 ? 35.574  34.239  -39.034 1.00 30.40  ? 356  GLN B C   1 
ATOM   5694 O O   . GLN B 1 356 ? 34.923  35.289  -39.039 1.00 28.39  ? 356  GLN B O   1 
ATOM   5695 C CB  . GLN B 1 356 ? 36.629  34.067  -41.204 1.00 34.57  ? 356  GLN B CB  1 
ATOM   5696 C CG  . GLN B 1 356 ? 37.587  33.212  -41.982 1.00 41.68  ? 356  GLN B CG  1 
ATOM   5697 C CD  . GLN B 1 356 ? 38.127  34.103  -43.118 1.00 44.65  ? 356  GLN B CD  1 
ATOM   5698 O OE1 . GLN B 1 356 ? 38.633  35.179  -42.802 1.00 44.76  ? 356  GLN B OE1 1 
ATOM   5699 N NE2 . GLN B 1 356 ? 37.979  33.653  -44.362 1.00 44.77  ? 356  GLN B NE2 1 
ATOM   5700 N N   . SER B 1 357 ? 36.261  33.760  -38.004 1.00 30.03  ? 357  SER B N   1 
ATOM   5701 C CA  . SER B 1 357 ? 36.323  34.619  -36.812 1.00 30.86  ? 357  SER B CA  1 
ATOM   5702 C C   . SER B 1 357 ? 37.196  35.788  -37.220 1.00 31.22  ? 357  SER B C   1 
ATOM   5703 O O   . SER B 1 357 ? 38.232  35.589  -37.850 1.00 30.50  ? 357  SER B O   1 
ATOM   5704 C CB  . SER B 1 357 ? 36.918  33.864  -35.619 1.00 30.60  ? 357  SER B CB  1 
ATOM   5705 O OG  . SER B 1 357 ? 38.159  33.291  -36.009 1.00 30.29  ? 357  SER B OG  1 
ATOM   5706 N N   . PRO B 1 358 ? 36.865  37.012  -36.834 1.00 32.75  ? 358  PRO B N   1 
ATOM   5707 C CA  . PRO B 1 358 ? 37.652  38.191  -37.161 1.00 33.77  ? 358  PRO B CA  1 
ATOM   5708 C C   . PRO B 1 358 ? 39.126  38.028  -36.816 1.00 35.00  ? 358  PRO B C   1 
ATOM   5709 O O   . PRO B 1 358 ? 40.040  38.565  -37.454 1.00 35.41  ? 358  PRO B O   1 
ATOM   5710 C CB  . PRO B 1 358 ? 37.008  39.302  -36.359 1.00 33.52  ? 358  PRO B CB  1 
ATOM   5711 C CG  . PRO B 1 358 ? 35.685  38.813  -35.902 1.00 32.74  ? 358  PRO B CG  1 
ATOM   5712 C CD  . PRO B 1 358 ? 35.640  37.326  -36.053 1.00 32.97  ? 358  PRO B CD  1 
ATOM   5713 N N   . GLU B 1 359 ? 39.438  37.295  -35.754 1.00 35.24  ? 359  GLU B N   1 
ATOM   5714 C CA  . GLU B 1 359 ? 40.795  36.972  -35.358 1.00 35.17  ? 359  GLU B CA  1 
ATOM   5715 C C   . GLU B 1 359 ? 40.848  35.556  -34.774 1.00 33.69  ? 359  GLU B C   1 
ATOM   5716 O O   . GLU B 1 359 ? 39.820  34.942  -34.479 1.00 33.07  ? 359  GLU B O   1 
ATOM   5717 C CB  . GLU B 1 359 ? 41.378  37.986  -34.411 1.00 38.58  ? 359  GLU B CB  1 
ATOM   5718 C CG  . GLU B 1 359 ? 40.514  38.883  -33.566 1.00 45.64  ? 359  GLU B CG  1 
ATOM   5719 C CD  . GLU B 1 359 ? 41.446  39.948  -32.977 1.00 51.84  ? 359  GLU B CD  1 
ATOM   5720 O OE1 . GLU B 1 359 ? 42.350  39.572  -32.188 1.00 54.99  ? 359  GLU B OE1 1 
ATOM   5721 O OE2 . GLU B 1 359 ? 41.292  41.130  -33.344 1.00 54.60  ? 359  GLU B OE2 1 
ATOM   5722 N N   . PRO B 1 360 ? 42.072  35.056  -34.644 1.00 32.23  ? 360  PRO B N   1 
ATOM   5723 C CA  . PRO B 1 360 ? 42.285  33.732  -34.065 1.00 30.61  ? 360  PRO B CA  1 
ATOM   5724 C C   . PRO B 1 360 ? 41.615  33.696  -32.692 1.00 28.28  ? 360  PRO B C   1 
ATOM   5725 O O   . PRO B 1 360 ? 41.600  34.713  -32.001 1.00 24.86  ? 360  PRO B O   1 
ATOM   5726 C CB  . PRO B 1 360 ? 43.792  33.544  -34.060 1.00 31.08  ? 360  PRO B CB  1 
ATOM   5727 C CG  . PRO B 1 360 ? 44.359  34.630  -34.921 1.00 31.70  ? 360  PRO B CG  1 
ATOM   5728 C CD  . PRO B 1 360 ? 43.356  35.743  -34.931 1.00 31.11  ? 360  PRO B CD  1 
ATOM   5729 N N   . ILE B 1 361 ? 40.972  32.568  -32.383 1.00 26.37  ? 361  ILE B N   1 
ATOM   5730 C CA  . ILE B 1 361 ? 40.248  32.454  -31.113 1.00 24.76  ? 361  ILE B CA  1 
ATOM   5731 C C   . ILE B 1 361 ? 41.178  31.934  -30.034 1.00 24.38  ? 361  ILE B C   1 
ATOM   5732 O O   . ILE B 1 361 ? 41.894  30.956  -30.262 1.00 25.28  ? 361  ILE B O   1 
ATOM   5733 C CB  . ILE B 1 361 ? 39.034  31.527  -31.255 1.00 23.79  ? 361  ILE B CB  1 
ATOM   5734 C CG1 . ILE B 1 361 ? 38.140  32.015  -32.416 1.00 23.12  ? 361  ILE B CG1 1 
ATOM   5735 C CG2 . ILE B 1 361 ? 38.197  31.366  -29.983 1.00 19.76  ? 361  ILE B CG2 1 
ATOM   5736 C CD1 . ILE B 1 361 ? 37.250  30.912  -32.965 1.00 21.48  ? 361  ILE B CD1 1 
ATOM   5737 N N   . ARG B 1 362 ? 41.203  32.573  -28.881 1.00 23.20  ? 362  ARG B N   1 
ATOM   5738 C CA  . ARG B 1 362 ? 41.999  32.042  -27.776 1.00 23.13  ? 362  ARG B CA  1 
ATOM   5739 C C   . ARG B 1 362 ? 41.282  30.820  -27.182 1.00 22.61  ? 362  ARG B C   1 
ATOM   5740 O O   . ARG B 1 362 ? 40.073  30.745  -27.009 1.00 20.94  ? 362  ARG B O   1 
ATOM   5741 C CB  . ARG B 1 362 ? 42.210  33.106  -26.706 1.00 25.50  ? 362  ARG B CB  1 
ATOM   5742 C CG  . ARG B 1 362 ? 42.988  34.306  -27.234 1.00 27.96  ? 362  ARG B CG  1 
ATOM   5743 C CD  . ARG B 1 362 ? 43.469  35.134  -26.057 1.00 34.22  ? 362  ARG B CD  1 
ATOM   5744 N NE  . ARG B 1 362 ? 44.355  34.384  -25.160 1.00 35.76  ? 362  ARG B NE  1 
ATOM   5745 C CZ  . ARG B 1 362 ? 44.737  34.858  -23.983 1.00 38.52  ? 362  ARG B CZ  1 
ATOM   5746 N NH1 . ARG B 1 362 ? 44.322  36.057  -23.578 1.00 40.69  ? 362  ARG B NH1 1 
ATOM   5747 N NH2 . ARG B 1 362 ? 45.550  34.152  -23.213 1.00 39.60  ? 362  ARG B NH2 1 
ATOM   5748 N N   . PRO B 1 363 ? 42.088  29.815  -26.866 1.00 22.36  ? 363  PRO B N   1 
ATOM   5749 C CA  . PRO B 1 363 ? 41.605  28.565  -26.338 1.00 22.17  ? 363  PRO B CA  1 
ATOM   5750 C C   . PRO B 1 363 ? 41.173  28.640  -24.884 1.00 22.56  ? 363  PRO B C   1 
ATOM   5751 O O   . PRO B 1 363 ? 41.803  29.265  -24.031 1.00 21.91  ? 363  PRO B O   1 
ATOM   5752 C CB  . PRO B 1 363 ? 42.789  27.627  -26.559 1.00 21.34  ? 363  PRO B CB  1 
ATOM   5753 C CG  . PRO B 1 363 ? 43.982  28.513  -26.458 1.00 21.70  ? 363  PRO B CG  1 
ATOM   5754 C CD  . PRO B 1 363 ? 43.578  29.828  -27.056 1.00 21.67  ? 363  PRO B CD  1 
ATOM   5755 N N   . ASP B 1 364 ? 40.050  27.976  -24.589 1.00 21.83  ? 364  ASP B N   1 
ATOM   5756 C CA  . ASP B 1 364 ? 39.534  27.924  -23.202 1.00 20.98  ? 364  ASP B CA  1 
ATOM   5757 C C   . ASP B 1 364 ? 38.894  26.549  -23.059 1.00 19.47  ? 364  ASP B C   1 
ATOM   5758 O O   . ASP B 1 364 ? 37.670  26.405  -23.142 1.00 18.94  ? 364  ASP B O   1 
ATOM   5759 C CB  . ASP B 1 364 ? 38.571  29.079  -22.963 1.00 22.23  ? 364  ASP B CB  1 
ATOM   5760 C CG  . ASP B 1 364 ? 38.111  29.206  -21.529 1.00 22.39  ? 364  ASP B CG  1 
ATOM   5761 O OD1 . ASP B 1 364 ? 38.644  28.479  -20.664 1.00 23.25  ? 364  ASP B OD1 1 
ATOM   5762 O OD2 . ASP B 1 364 ? 37.229  30.017  -21.198 1.00 23.28  ? 364  ASP B OD2 1 
ATOM   5763 N N   . PRO B 1 365 ? 39.730  25.524  -22.912 1.00 18.60  ? 365  PRO B N   1 
ATOM   5764 C CA  . PRO B 1 365 ? 39.274  24.142  -22.940 1.00 18.34  ? 365  PRO B CA  1 
ATOM   5765 C C   . PRO B 1 365 ? 38.262  23.784  -21.875 1.00 17.10  ? 365  PRO B C   1 
ATOM   5766 O O   . PRO B 1 365 ? 37.424  22.909  -22.092 1.00 16.48  ? 365  PRO B O   1 
ATOM   5767 C CB  . PRO B 1 365 ? 40.528  23.275  -22.950 1.00 17.03  ? 365  PRO B CB  1 
ATOM   5768 C CG  . PRO B 1 365 ? 41.619  24.181  -22.444 1.00 18.21  ? 365  PRO B CG  1 
ATOM   5769 C CD  . PRO B 1 365 ? 41.213  25.598  -22.804 1.00 18.43  ? 365  PRO B CD  1 
ATOM   5770 N N   . TYR B 1 366 ? 38.288  24.433  -20.733 1.00 16.99  ? 366  TYR B N   1 
ATOM   5771 C CA  . TYR B 1 366 ? 37.342  24.145  -19.660 1.00 18.32  ? 366  TYR B CA  1 
ATOM   5772 C C   . TYR B 1 366 ? 36.094  25.020  -19.637 1.00 18.05  ? 366  TYR B C   1 
ATOM   5773 O O   . TYR B 1 366 ? 35.342  24.867  -18.669 1.00 18.02  ? 366  TYR B O   1 
ATOM   5774 C CB  . TYR B 1 366 ? 38.063  24.312  -18.302 1.00 16.61  ? 366  TYR B CB  1 
ATOM   5775 C CG  . TYR B 1 366 ? 38.996  23.116  -18.070 1.00 15.12  ? 366  TYR B CG  1 
ATOM   5776 C CD1 . TYR B 1 366 ? 38.558  21.955  -17.466 1.00 13.67  ? 366  TYR B CD1 1 
ATOM   5777 C CD2 . TYR B 1 366 ? 40.308  23.208  -18.500 1.00 14.77  ? 366  TYR B CD2 1 
ATOM   5778 C CE1 . TYR B 1 366 ? 39.425  20.906  -17.291 1.00 14.54  ? 366  TYR B CE1 1 
ATOM   5779 C CE2 . TYR B 1 366 ? 41.201  22.177  -18.315 1.00 14.44  ? 366  TYR B CE2 1 
ATOM   5780 C CZ  . TYR B 1 366 ? 40.754  21.034  -17.699 1.00 14.25  ? 366  TYR B CZ  1 
ATOM   5781 O OH  . TYR B 1 366 ? 41.634  20.005  -17.539 1.00 12.49  ? 366  TYR B OH  1 
ATOM   5782 N N   . VAL B 1 367 ? 35.834  25.889  -20.601 1.00 17.39  ? 367  VAL B N   1 
ATOM   5783 C CA  . VAL B 1 367 ? 34.617  26.727  -20.438 1.00 17.98  ? 367  VAL B CA  1 
ATOM   5784 C C   . VAL B 1 367 ? 33.396  25.824  -20.531 1.00 16.89  ? 367  VAL B C   1 
ATOM   5785 O O   . VAL B 1 367 ? 33.386  24.867  -21.308 1.00 18.06  ? 367  VAL B O   1 
ATOM   5786 C CB  . VAL B 1 367 ? 34.616  27.908  -21.396 1.00 17.89  ? 367  VAL B CB  1 
ATOM   5787 C CG1 . VAL B 1 367 ? 34.333  27.459  -22.836 1.00 18.67  ? 367  VAL B CG1 1 
ATOM   5788 C CG2 . VAL B 1 367 ? 33.653  28.997  -20.971 1.00 19.43  ? 367  VAL B CG2 1 
ATOM   5789 N N   . VAL B 1 368 ? 32.465  25.947  -19.606 1.00 18.02  ? 368  VAL B N   1 
ATOM   5790 C CA  . VAL B 1 368 ? 31.263  25.112  -19.575 1.00 18.41  ? 368  VAL B CA  1 
ATOM   5791 C C   . VAL B 1 368 ? 30.096  25.818  -20.278 1.00 18.47  ? 368  VAL B C   1 
ATOM   5792 O O   . VAL B 1 368 ? 29.444  25.185  -21.106 1.00 19.34  ? 368  VAL B O   1 
ATOM   5793 C CB  . VAL B 1 368 ? 30.862  24.710  -18.158 1.00 17.86  ? 368  VAL B CB  1 
ATOM   5794 C CG1 . VAL B 1 368 ? 29.483  24.002  -18.180 1.00 14.15  ? 368  VAL B CG1 1 
ATOM   5795 C CG2 . VAL B 1 368 ? 31.912  23.784  -17.558 1.00 16.13  ? 368  VAL B CG2 1 
ATOM   5796 N N   . VAL B 1 369 ? 29.859  27.080  -19.993 1.00 19.14  ? 369  VAL B N   1 
ATOM   5797 C CA  . VAL B 1 369 ? 28.786  27.833  -20.635 1.00 21.46  ? 369  VAL B CA  1 
ATOM   5798 C C   . VAL B 1 369 ? 29.291  28.631  -21.838 1.00 22.60  ? 369  VAL B C   1 
ATOM   5799 O O   . VAL B 1 369 ? 29.987  29.641  -21.706 1.00 22.39  ? 369  VAL B O   1 
ATOM   5800 C CB  . VAL B 1 369 ? 28.026  28.754  -19.664 1.00 24.47  ? 369  VAL B CB  1 
ATOM   5801 C CG1 . VAL B 1 369 ? 26.756  29.317  -20.330 1.00 18.23  ? 369  VAL B CG1 1 
ATOM   5802 C CG2 . VAL B 1 369 ? 27.611  28.004  -18.382 1.00 22.16  ? 369  VAL B CG2 1 
ATOM   5803 N N   . HIS B 1 370 ? 29.006  28.109  -23.035 1.00 22.57  ? 370  HIS B N   1 
ATOM   5804 C CA  . HIS B 1 370 ? 29.387  28.780  -24.273 1.00 22.71  ? 370  HIS B CA  1 
ATOM   5805 C C   . HIS B 1 370 ? 28.360  29.883  -24.556 1.00 24.32  ? 370  HIS B C   1 
ATOM   5806 O O   . HIS B 1 370 ? 27.194  29.581  -24.808 1.00 22.30  ? 370  HIS B O   1 
ATOM   5807 C CB  . HIS B 1 370 ? 29.399  27.791  -25.462 1.00 19.55  ? 370  HIS B CB  1 
ATOM   5808 C CG  . HIS B 1 370 ? 30.399  26.682  -25.335 1.00 16.32  ? 370  HIS B CG  1 
ATOM   5809 N ND1 . HIS B 1 370 ? 31.765  26.887  -25.538 1.00 16.51  ? 370  HIS B ND1 1 
ATOM   5810 C CD2 . HIS B 1 370 ? 30.265  25.377  -25.017 1.00 11.56  ? 370  HIS B CD2 1 
ATOM   5811 C CE1 . HIS B 1 370 ? 32.405  25.769  -25.357 1.00 11.33  ? 370  HIS B CE1 1 
ATOM   5812 N NE2 . HIS B 1 370 ? 31.513  24.829  -25.052 1.00 14.07  ? 370  HIS B NE2 1 
ATOM   5813 N N   . ASN B 1 371 ? 28.758  31.144  -24.446 1.00 25.51  ? 371  ASN B N   1 
ATOM   5814 C CA  . ASN B 1 371 ? 27.861  32.253  -24.722 1.00 26.78  ? 371  ASN B CA  1 
ATOM   5815 C C   . ASN B 1 371 ? 27.843  32.557  -26.220 1.00 28.12  ? 371  ASN B C   1 
ATOM   5816 O O   . ASN B 1 371 ? 28.764  33.155  -26.781 1.00 27.30  ? 371  ASN B O   1 
ATOM   5817 C CB  . ASN B 1 371 ? 28.268  33.514  -23.946 1.00 27.85  ? 371  ASN B CB  1 
ATOM   5818 C CG  . ASN B 1 371 ? 27.199  34.596  -24.076 1.00 28.25  ? 371  ASN B CG  1 
ATOM   5819 O OD1 . ASN B 1 371 ? 26.246  34.481  -24.854 1.00 26.96  ? 371  ASN B OD1 1 
ATOM   5820 N ND2 . ASN B 1 371 ? 27.374  35.639  -23.273 1.00 28.21  ? 371  ASN B ND2 1 
ATOM   5821 N N   . LEU B 1 372 ? 26.724  32.178  -26.851 1.00 28.25  ? 372  LEU B N   1 
ATOM   5822 C CA  . LEU B 1 372 ? 26.590  32.350  -28.288 1.00 29.43  ? 372  LEU B CA  1 
ATOM   5823 C C   . LEU B 1 372 ? 26.528  33.792  -28.737 1.00 30.64  ? 372  LEU B C   1 
ATOM   5824 O O   . LEU B 1 372 ? 26.998  34.054  -29.847 1.00 30.11  ? 372  LEU B O   1 
ATOM   5825 C CB  . LEU B 1 372 ? 25.442  31.531  -28.847 1.00 27.39  ? 372  LEU B CB  1 
ATOM   5826 C CG  . LEU B 1 372 ? 25.787  30.138  -29.368 1.00 28.72  ? 372  LEU B CG  1 
ATOM   5827 C CD1 . LEU B 1 372 ? 27.068  29.567  -28.768 1.00 25.71  ? 372  LEU B CD1 1 
ATOM   5828 C CD2 . LEU B 1 372 ? 24.597  29.214  -29.125 1.00 25.25  ? 372  LEU B CD2 1 
ATOM   5829 N N   . ASP B 1 373 ? 26.120  34.720  -27.885 1.00 32.28  ? 373  ASP B N   1 
ATOM   5830 C CA  . ASP B 1 373 ? 26.140  36.137  -28.199 1.00 34.75  ? 373  ASP B CA  1 
ATOM   5831 C C   . ASP B 1 373 ? 27.532  36.595  -28.594 1.00 34.76  ? 373  ASP B C   1 
ATOM   5832 O O   . ASP B 1 373 ? 27.650  37.504  -29.408 1.00 35.68  ? 373  ASP B O   1 
ATOM   5833 C CB  . ASP B 1 373 ? 25.759  37.002  -26.997 1.00 40.76  ? 373  ASP B CB  1 
ATOM   5834 C CG  . ASP B 1 373 ? 24.337  36.792  -26.516 1.00 44.21  ? 373  ASP B CG  1 
ATOM   5835 O OD1 . ASP B 1 373 ? 23.535  36.223  -27.290 1.00 45.96  ? 373  ASP B OD1 1 
ATOM   5836 O OD2 . ASP B 1 373 ? 24.078  37.208  -25.362 1.00 46.55  ? 373  ASP B OD2 1 
ATOM   5837 N N   . ASP B 1 374 ? 28.612  35.996  -28.083 1.00 35.06  ? 374  ASP B N   1 
ATOM   5838 C CA  . ASP B 1 374 ? 29.967  36.315  -28.481 1.00 33.65  ? 374  ASP B CA  1 
ATOM   5839 C C   . ASP B 1 374 ? 30.092  36.425  -30.006 1.00 33.16  ? 374  ASP B C   1 
ATOM   5840 O O   . ASP B 1 374 ? 30.943  37.184  -30.464 1.00 32.88  ? 374  ASP B O   1 
ATOM   5841 C CB  . ASP B 1 374 ? 30.962  35.211  -28.108 1.00 32.42  ? 374  ASP B CB  1 
ATOM   5842 C CG  . ASP B 1 374 ? 31.194  35.052  -26.619 1.00 33.28  ? 374  ASP B CG  1 
ATOM   5843 O OD1 . ASP B 1 374 ? 30.543  35.823  -25.890 1.00 31.68  ? 374  ASP B OD1 1 
ATOM   5844 O OD2 . ASP B 1 374 ? 32.010  34.171  -26.240 1.00 30.35  ? 374  ASP B OD2 1 
ATOM   5845 N N   . TRP B 1 375 ? 29.378  35.592  -30.743 1.00 32.01  ? 375  TRP B N   1 
ATOM   5846 C CA  . TRP B 1 375 ? 29.421  35.530  -32.173 1.00 34.39  ? 375  TRP B CA  1 
ATOM   5847 C C   . TRP B 1 375 ? 28.352  36.319  -32.916 1.00 35.32  ? 375  TRP B C   1 
ATOM   5848 O O   . TRP B 1 375 ? 28.261  36.111  -34.130 1.00 35.19  ? 375  TRP B O   1 
ATOM   5849 C CB  . TRP B 1 375 ? 29.336  34.023  -32.574 1.00 31.91  ? 375  TRP B CB  1 
ATOM   5850 C CG  . TRP B 1 375 ? 30.484  33.281  -31.934 1.00 30.45  ? 375  TRP B CG  1 
ATOM   5851 C CD1 . TRP B 1 375 ? 30.416  32.279  -31.019 1.00 28.65  ? 375  TRP B CD1 1 
ATOM   5852 C CD2 . TRP B 1 375 ? 31.879  33.512  -32.171 1.00 31.20  ? 375  TRP B CD2 1 
ATOM   5853 N NE1 . TRP B 1 375 ? 31.673  31.854  -30.667 1.00 28.79  ? 375  TRP B NE1 1 
ATOM   5854 C CE2 . TRP B 1 375 ? 32.594  32.608  -31.358 1.00 31.53  ? 375  TRP B CE2 1 
ATOM   5855 C CE3 . TRP B 1 375 ? 32.593  34.387  -32.990 1.00 32.66  ? 375  TRP B CE3 1 
ATOM   5856 C CZ2 . TRP B 1 375 ? 33.989  32.563  -31.332 1.00 30.17  ? 375  TRP B CZ2 1 
ATOM   5857 C CZ3 . TRP B 1 375 ? 33.978  34.355  -32.958 1.00 32.83  ? 375  TRP B CZ3 1 
ATOM   5858 C CH2 . TRP B 1 375 ? 34.655  33.448  -32.124 1.00 32.29  ? 375  TRP B CH2 1 
ATOM   5859 N N   . SER B 1 376 ? 27.548  37.179  -32.303 1.00 36.68  ? 376  SER B N   1 
ATOM   5860 C CA  . SER B 1 376 ? 26.533  37.916  -33.037 1.00 39.37  ? 376  SER B CA  1 
ATOM   5861 C C   . SER B 1 376 ? 27.073  38.901  -34.069 1.00 40.33  ? 376  SER B C   1 
ATOM   5862 O O   . SER B 1 376 ? 26.684  38.875  -35.238 1.00 39.98  ? 376  SER B O   1 
ATOM   5863 C CB  . SER B 1 376 ? 25.591  38.670  -32.100 1.00 41.46  ? 376  SER B CB  1 
ATOM   5864 O OG  . SER B 1 376 ? 24.607  37.769  -31.637 1.00 46.16  ? 376  SER B OG  1 
ATOM   5865 N N   . ALA B 1 377 ? 27.974  39.775  -33.656 1.00 41.20  ? 377  ALA B N   1 
ATOM   5866 C CA  . ALA B 1 377 ? 28.564  40.762  -34.539 1.00 42.54  ? 377  ALA B CA  1 
ATOM   5867 C C   . ALA B 1 377 ? 29.152  40.193  -35.822 1.00 43.22  ? 377  ALA B C   1 
ATOM   5868 O O   . ALA B 1 377 ? 28.832  40.659  -36.925 1.00 44.17  ? 377  ALA B O   1 
ATOM   5869 C CB  . ALA B 1 377 ? 29.674  41.495  -33.777 1.00 42.62  ? 377  ALA B CB  1 
ATOM   5870 N N   . SER B 1 378 ? 30.041  39.210  -35.748 1.00 42.53  ? 378  SER B N   1 
ATOM   5871 C CA  . SER B 1 378 ? 30.715  38.703  -36.923 1.00 42.89  ? 378  SER B CA  1 
ATOM   5872 C C   . SER B 1 378 ? 29.884  37.815  -37.822 1.00 43.40  ? 378  SER B C   1 
ATOM   5873 O O   . SER B 1 378 ? 30.408  37.463  -38.884 1.00 42.96  ? 378  SER B O   1 
ATOM   5874 C CB  . SER B 1 378 ? 31.993  37.936  -36.508 1.00 43.96  ? 378  SER B CB  1 
ATOM   5875 O OG  . SER B 1 378 ? 31.623  36.630  -36.098 1.00 45.01  ? 378  SER B OG  1 
ATOM   5876 N N   . MET B 1 379 ? 28.685  37.389  -37.449 1.00 43.77  ? 379  MET B N   1 
ATOM   5877 C CA  . MET B 1 379 ? 27.907  36.528  -38.320 1.00 45.16  ? 379  MET B CA  1 
ATOM   5878 C C   . MET B 1 379 ? 26.612  37.151  -38.824 1.00 46.52  ? 379  MET B C   1 
ATOM   5879 O O   . MET B 1 379 ? 25.929  36.583  -39.663 1.00 46.98  ? 379  MET B O   1 
ATOM   5880 C CB  . MET B 1 379 ? 27.487  35.265  -37.578 1.00 44.32  ? 379  MET B CB  1 
ATOM   5881 C CG  . MET B 1 379 ? 28.620  34.424  -37.011 1.00 40.29  ? 379  MET B CG  1 
ATOM   5882 S SD  . MET B 1 379 ? 27.958  32.874  -36.408 1.00 36.43  ? 379  MET B SD  1 
ATOM   5883 C CE  . MET B 1 379 ? 26.577  33.486  -35.441 1.00 39.95  ? 379  MET B CE  1 
ATOM   5884 N N   . GLY B 1 380 ? 26.213  38.266  -38.258 1.00 48.17  ? 380  GLY B N   1 
ATOM   5885 C CA  . GLY B 1 380 ? 24.981  38.940  -38.611 1.00 49.27  ? 380  GLY B CA  1 
ATOM   5886 C C   . GLY B 1 380 ? 25.049  40.420  -38.223 1.00 50.25  ? 380  GLY B C   1 
ATOM   5887 O O   . GLY B 1 380 ? 23.966  41.059  -38.317 1.00 50.81  ? 380  GLY B O   1 
ATOM   5888 N N   . SER C 2 2   ? 20.722  20.153  -12.694 1.00 22.13  ? 2    SER D N   1 
ATOM   5889 C CA  . SER C 2 2   ? 21.599  20.146  -11.478 1.00 21.52  ? 2    SER D CA  1 
ATOM   5890 C C   . SER C 2 2   ? 22.960  19.505  -11.757 1.00 17.66  ? 2    SER D C   1 
ATOM   5891 O O   . SER C 2 2   ? 23.860  20.246  -11.411 1.00 15.72  ? 2    SER D O   1 
ATOM   5892 C CB  . SER C 2 2   ? 21.002  19.703  -10.186 1.00 25.53  ? 2    SER D CB  1 
ATOM   5893 O OG  . SER C 2 2   ? 21.873  20.021  -9.074  1.00 35.15  ? 2    SER D OG  1 
ATOM   5894 N N   . ALA C 2 3   ? 23.212  18.454  -12.509 1.00 18.61  ? 3    ALA D N   1 
ATOM   5895 C CA  . ALA C 2 3   ? 24.615  18.144  -12.864 1.00 19.58  ? 3    ALA D CA  1 
ATOM   5896 C C   . ALA C 2 3   ? 25.100  19.298  -13.762 1.00 21.78  ? 3    ALA D C   1 
ATOM   5897 O O   . ALA C 2 3   ? 26.146  19.952  -13.638 1.00 22.13  ? 3    ALA D O   1 
ATOM   5898 C CB  . ALA C 2 3   ? 24.788  16.843  -13.609 1.00 15.05  ? 3    ALA D CB  1 
ATOM   5899 N N   . ASN C 2 4   ? 24.192  19.668  -14.666 1.00 22.41  ? 4    ASN D N   1 
ATOM   5900 C CA  . ASN C 2 4   ? 24.344  20.797  -15.551 1.00 25.48  ? 4    ASN D CA  1 
ATOM   5901 C C   . ASN C 2 4   ? 24.517  22.132  -14.843 1.00 25.66  ? 4    ASN D C   1 
ATOM   5902 O O   . ASN C 2 4   ? 25.387  22.952  -15.214 1.00 25.52  ? 4    ASN D O   1 
ATOM   5903 C CB  . ASN C 2 4   ? 23.141  20.788  -16.547 1.00 29.07  ? 4    ASN D CB  1 
ATOM   5904 C CG  . ASN C 2 4   ? 23.333  22.013  -17.440 1.00 35.48  ? 4    ASN D CG  1 
ATOM   5905 O OD1 . ASN C 2 4   ? 22.726  23.059  -17.192 1.00 37.25  ? 4    ASN D OD1 1 
ATOM   5906 N ND2 . ASN C 2 4   ? 24.225  21.855  -18.425 1.00 34.57  ? 4    ASN D ND2 1 
ATOM   5907 N N   . SER C 2 5   ? 23.757  22.409  -13.788 1.00 24.86  ? 5    SER D N   1 
ATOM   5908 C CA  . SER C 2 5   ? 23.913  23.699  -13.107 1.00 25.54  ? 5    SER D CA  1 
ATOM   5909 C C   . SER C 2 5   ? 25.154  23.688  -12.228 1.00 25.95  ? 5    SER D C   1 
ATOM   5910 O O   . SER C 2 5   ? 25.872  24.699  -12.132 1.00 24.38  ? 5    SER D O   1 
ATOM   5911 C CB  . SER C 2 5   ? 22.623  24.063  -12.366 1.00 27.22  ? 5    SER D CB  1 
ATOM   5912 O OG  . SER C 2 5   ? 22.529  23.312  -11.160 1.00 31.96  ? 5    SER D OG  1 
ATOM   5913 N N   . LEU C 2 6   ? 25.426  22.527  -11.610 1.00 24.80  ? 6    LEU D N   1 
ATOM   5914 C CA  . LEU C 2 6   ? 26.654  22.345  -10.835 1.00 24.54  ? 6    LEU D CA  1 
ATOM   5915 C C   . LEU C 2 6   ? 27.887  22.610  -11.718 1.00 23.83  ? 6    LEU D C   1 
ATOM   5916 O O   . LEU C 2 6   ? 28.788  23.364  -11.347 1.00 22.44  ? 6    LEU D O   1 
ATOM   5917 C CB  . LEU C 2 6   ? 26.750  20.903  -10.318 1.00 25.17  ? 6    LEU D CB  1 
ATOM   5918 C CG  . LEU C 2 6   ? 27.580  20.671  -9.046  1.00 27.69  ? 6    LEU D CG  1 
ATOM   5919 C CD1 . LEU C 2 6   ? 27.806  19.183  -8.771  1.00 28.00  ? 6    LEU D CD1 1 
ATOM   5920 C CD2 . LEU C 2 6   ? 28.930  21.327  -9.099  1.00 27.26  ? 6    LEU D CD2 1 
ATOM   5921 N N   . LEU C 2 7   ? 27.940  21.988  -12.906 1.00 22.59  ? 7    LEU D N   1 
ATOM   5922 C CA  . LEU C 2 7   ? 29.072  22.230  -13.801 1.00 21.94  ? 7    LEU D CA  1 
ATOM   5923 C C   . LEU C 2 7   ? 29.156  23.676  -14.272 1.00 22.06  ? 7    LEU D C   1 
ATOM   5924 O O   . LEU C 2 7   ? 30.212  24.329  -14.294 1.00 19.29  ? 7    LEU D O   1 
ATOM   5925 C CB  . LEU C 2 7   ? 28.976  21.269  -15.001 1.00 19.32  ? 7    LEU D CB  1 
ATOM   5926 C CG  . LEU C 2 7   ? 29.280  19.818  -14.643 1.00 20.75  ? 7    LEU D CG  1 
ATOM   5927 C CD1 . LEU C 2 7   ? 29.067  18.879  -15.808 1.00 18.17  ? 7    LEU D CD1 1 
ATOM   5928 C CD2 . LEU C 2 7   ? 30.696  19.682  -14.047 1.00 20.20  ? 7    LEU D CD2 1 
ATOM   5929 N N   . GLY C 2 8   ? 27.992  24.269  -14.580 1.00 22.27  ? 8    GLY D N   1 
ATOM   5930 C CA  . GLY C 2 8   ? 27.916  25.633  -15.073 1.00 21.76  ? 8    GLY D CA  1 
ATOM   5931 C C   . GLY C 2 8   ? 28.288  26.657  -14.034 1.00 23.78  ? 8    GLY D C   1 
ATOM   5932 O O   . GLY C 2 8   ? 28.605  27.797  -14.387 1.00 25.34  ? 8    GLY D O   1 
ATOM   5933 N N   . SER C 2 9   ? 28.264  26.322  -12.737 1.00 24.79  ? 9    SER D N   1 
ATOM   5934 C CA  . SER C 2 9   ? 28.628  27.366  -11.780 1.00 26.57  ? 9    SER D CA  1 
ATOM   5935 C C   . SER C 2 9   ? 30.038  27.264  -11.222 1.00 25.45  ? 9    SER D C   1 
ATOM   5936 O O   . SER C 2 9   ? 30.290  28.022  -10.282 1.00 24.40  ? 9    SER D O   1 
ATOM   5937 C CB  . SER C 2 9   ? 27.619  27.421  -10.620 1.00 25.11  ? 9    SER D CB  1 
ATOM   5938 O OG  . SER C 2 9   ? 27.472  26.100  -10.160 1.00 29.84  ? 9    SER D OG  1 
ATOM   5939 N N   . LEU C 2 10  ? 30.902  26.408  -11.751 1.00 25.43  ? 10   LEU D N   1 
ATOM   5940 C CA  . LEU C 2 10  ? 32.262  26.283  -11.236 1.00 25.17  ? 10   LEU D CA  1 
ATOM   5941 C C   . LEU C 2 10  ? 33.047  27.576  -11.329 1.00 23.72  ? 10   LEU D C   1 
ATOM   5942 O O   . LEU C 2 10  ? 33.842  27.831  -10.415 1.00 23.31  ? 10   LEU D O   1 
ATOM   5943 C CB  . LEU C 2 10  ? 33.119  25.236  -11.985 1.00 27.41  ? 10   LEU D CB  1 
ATOM   5944 C CG  . LEU C 2 10  ? 32.576  23.806  -11.987 1.00 28.12  ? 10   LEU D CG  1 
ATOM   5945 C CD1 . LEU C 2 10  ? 33.451  22.900  -12.839 1.00 28.21  ? 10   LEU D CD1 1 
ATOM   5946 C CD2 . LEU C 2 10  ? 32.497  23.321  -10.546 1.00 25.46  ? 10   LEU D CD2 1 
ATOM   5947 N N   . ARG C 2 11  ? 32.846  28.376  -12.376 1.00 22.23  ? 11   ARG D N   1 
ATOM   5948 C CA  . ARG C 2 11  ? 33.603  29.624  -12.479 1.00 23.64  ? 11   ARG D CA  1 
ATOM   5949 C C   . ARG C 2 11  ? 33.209  30.687  -11.478 1.00 24.85  ? 11   ARG D C   1 
ATOM   5950 O O   . ARG C 2 11  ? 33.945  31.678  -11.402 1.00 27.02  ? 11   ARG D O   1 
ATOM   5951 C CB  . ARG C 2 11  ? 33.595  30.150  -13.927 1.00 25.15  ? 11   ARG D CB  1 
ATOM   5952 C CG  . ARG C 2 11  ? 34.255  29.108  -14.831 1.00 20.21  ? 11   ARG D CG  1 
ATOM   5953 C CD  . ARG C 2 11  ? 34.546  29.589  -16.217 1.00 19.74  ? 11   ARG D CD  1 
ATOM   5954 N NE  . ARG C 2 11  ? 35.616  28.810  -16.809 1.00 20.55  ? 11   ARG D NE  1 
ATOM   5955 C CZ  . ARG C 2 11  ? 36.273  28.972  -17.941 1.00 21.38  ? 11   ARG D CZ  1 
ATOM   5956 N NH1 . ARG C 2 11  ? 36.006  29.960  -18.789 1.00 18.68  ? 11   ARG D NH1 1 
ATOM   5957 N NH2 . ARG C 2 11  ? 37.244  28.093  -18.195 1.00 20.27  ? 11   ARG D NH2 1 
ATOM   5958 N N   . GLU C 2 12  ? 32.183  30.552  -10.658 1.00 23.62  ? 12   GLU D N   1 
ATOM   5959 C CA  . GLU C 2 12  ? 31.828  31.493  -9.627  1.00 24.54  ? 12   GLU D CA  1 
ATOM   5960 C C   . GLU C 2 12  ? 32.340  30.984  -8.284  1.00 23.67  ? 12   GLU D C   1 
ATOM   5961 O O   . GLU C 2 12  ? 32.313  31.716  -7.295  1.00 22.68  ? 12   GLU D O   1 
ATOM   5962 C CB  . GLU C 2 12  ? 30.303  31.692  -9.587  1.00 33.47  ? 12   GLU D CB  1 
ATOM   5963 C CG  . GLU C 2 12  ? 29.671  31.898  -10.963 1.00 42.50  ? 12   GLU D CG  1 
ATOM   5964 C CD  . GLU C 2 12  ? 28.164  31.785  -10.945 1.00 47.95  ? 12   GLU D CD  1 
ATOM   5965 O OE1 . GLU C 2 12  ? 27.586  32.444  -10.040 1.00 54.52  ? 12   GLU D OE1 1 
ATOM   5966 O OE2 . GLU C 2 12  ? 27.518  31.098  -11.764 1.00 49.59  ? 12   GLU D OE2 1 
ATOM   5967 N N   . LEU C 2 13  ? 32.845  29.748  -8.198  1.00 23.32  ? 13   LEU D N   1 
ATOM   5968 C CA  . LEU C 2 13  ? 33.350  29.257  -6.915  1.00 22.41  ? 13   LEU D CA  1 
ATOM   5969 C C   . LEU C 2 13  ? 34.581  30.048  -6.501  1.00 23.56  ? 13   LEU D C   1 
ATOM   5970 O O   . LEU C 2 13  ? 35.423  30.457  -7.313  1.00 24.36  ? 13   LEU D O   1 
ATOM   5971 C CB  . LEU C 2 13  ? 33.692  27.768  -6.861  1.00 19.45  ? 13   LEU D CB  1 
ATOM   5972 C CG  . LEU C 2 13  ? 32.500  26.829  -7.088  1.00 22.67  ? 13   LEU D CG  1 
ATOM   5973 C CD1 . LEU C 2 13  ? 32.970  25.391  -7.227  1.00 23.48  ? 13   LEU D CD1 1 
ATOM   5974 C CD2 . LEU C 2 13  ? 31.494  26.976  -5.954  1.00 20.20  ? 13   LEU D CD2 1 
ATOM   5975 N N   . GLN C 2 14  ? 34.675  30.256  -5.187  1.00 23.74  ? 14   GLN D N   1 
ATOM   5976 C CA  . GLN C 2 14  ? 35.812  30.966  -4.610  1.00 22.63  ? 14   GLN D CA  1 
ATOM   5977 C C   . GLN C 2 14  ? 36.607  29.862  -3.877  1.00 22.63  ? 14   GLN D C   1 
ATOM   5978 O O   . GLN C 2 14  ? 36.034  29.327  -2.938  1.00 20.53  ? 14   GLN D O   1 
ATOM   5979 C CB  . GLN C 2 14  ? 35.441  31.920  -3.502  1.00 26.62  ? 14   GLN D CB  1 
ATOM   5980 C CG  . GLN C 2 14  ? 36.149  33.262  -3.702  1.00 34.24  ? 14   GLN D CG  1 
ATOM   5981 C CD  . GLN C 2 14  ? 35.155  34.116  -4.474  1.00 33.97  ? 14   GLN D CD  1 
ATOM   5982 O OE1 . GLN C 2 14  ? 35.533  34.909  -5.316  1.00 34.35  ? 14   GLN D OE1 1 
ATOM   5983 N NE2 . GLN C 2 14  ? 33.897  33.836  -4.161  1.00 35.29  ? 14   GLN D NE2 1 
ATOM   5984 N N   . VAL C 2 15  ? 37.775  29.570  -4.419  1.00 20.84  ? 15   VAL D N   1 
ATOM   5985 C CA  . VAL C 2 15  ? 38.597  28.510  -3.960  1.00 20.29  ? 15   VAL D CA  1 
ATOM   5986 C C   . VAL C 2 15  ? 39.843  29.102  -3.301  1.00 22.80  ? 15   VAL D C   1 
ATOM   5987 O O   . VAL C 2 15  ? 40.521  30.050  -3.693  1.00 22.26  ? 15   VAL D O   1 
ATOM   5988 C CB  . VAL C 2 15  ? 39.002  27.576  -5.126  1.00 21.22  ? 15   VAL D CB  1 
ATOM   5989 C CG1 . VAL C 2 15  ? 39.735  26.343  -4.564  1.00 19.12  ? 15   VAL D CG1 1 
ATOM   5990 C CG2 . VAL C 2 15  ? 37.840  27.143  -6.012  1.00 17.38  ? 15   VAL D CG2 1 
ATOM   5991 N N   . LEU C 2 16  ? 40.146  28.473  -2.179  1.00 22.91  ? 16   LEU D N   1 
ATOM   5992 C CA  . LEU C 2 16  ? 41.288  28.805  -1.357  1.00 23.35  ? 16   LEU D CA  1 
ATOM   5993 C C   . LEU C 2 16  ? 42.230  27.596  -1.290  1.00 22.62  ? 16   LEU D C   1 
ATOM   5994 O O   . LEU C 2 16  ? 41.792  26.486  -0.986  1.00 21.86  ? 16   LEU D O   1 
ATOM   5995 C CB  . LEU C 2 16  ? 40.736  29.177  0.023   1.00 26.79  ? 16   LEU D CB  1 
ATOM   5996 C CG  . LEU C 2 16  ? 41.714  29.945  0.919   1.00 30.85  ? 16   LEU D CG  1 
ATOM   5997 C CD1 . LEU C 2 16  ? 40.924  30.914  1.785   1.00 34.78  ? 16   LEU D CD1 1 
ATOM   5998 C CD2 . LEU C 2 16  ? 42.472  28.993  1.804   1.00 31.46  ? 16   LEU D CD2 1 
ATOM   5999 N N   . VAL C 2 17  ? 43.493  27.827  -1.631  1.00 21.70  ? 17   VAL D N   1 
ATOM   6000 C CA  . VAL C 2 17  ? 44.471  26.753  -1.518  1.00 22.24  ? 17   VAL D CA  1 
ATOM   6001 C C   . VAL C 2 17  ? 45.191  27.038  -0.189  1.00 23.03  ? 17   VAL D C   1 
ATOM   6002 O O   . VAL C 2 17  ? 46.114  27.853  -0.134  1.00 21.12  ? 17   VAL D O   1 
ATOM   6003 C CB  . VAL C 2 17  ? 45.418  26.668  -2.706  1.00 22.60  ? 17   VAL D CB  1 
ATOM   6004 C CG1 . VAL C 2 17  ? 46.567  25.691  -2.451  1.00 20.02  ? 17   VAL D CG1 1 
ATOM   6005 C CG2 . VAL C 2 17  ? 44.691  26.243  -3.998  1.00 21.81  ? 17   VAL D CG2 1 
ATOM   6006 N N   . LEU C 2 18  ? 44.760  26.389  0.881   1.00 22.94  ? 18   LEU D N   1 
ATOM   6007 C CA  . LEU C 2 18  ? 45.361  26.589  2.205   1.00 24.28  ? 18   LEU D CA  1 
ATOM   6008 C C   . LEU C 2 18  ? 46.536  25.672  2.381   1.00 23.60  ? 18   LEU D C   1 
ATOM   6009 O O   . LEU C 2 18  ? 46.467  24.608  2.980   1.00 24.17  ? 18   LEU D O   1 
ATOM   6010 C CB  . LEU C 2 18  ? 44.263  26.366  3.261   1.00 29.87  ? 18   LEU D CB  1 
ATOM   6011 C CG  . LEU C 2 18  ? 44.631  26.603  4.732   1.00 31.94  ? 18   LEU D CG  1 
ATOM   6012 C CD1 . LEU C 2 18  ? 45.057  28.043  4.979   1.00 33.23  ? 18   LEU D CD1 1 
ATOM   6013 C CD2 . LEU C 2 18  ? 43.446  26.273  5.639   1.00 31.76  ? 18   LEU D CD2 1 
ATOM   6014 N N   . ASN C 2 19  ? 47.683  26.024  1.820   1.00 25.52  ? 19   ASN D N   1 
ATOM   6015 C CA  . ASN C 2 19  ? 48.885  25.181  1.800   1.00 25.75  ? 19   ASN D CA  1 
ATOM   6016 C C   . ASN C 2 19  ? 50.132  26.022  1.630   1.00 26.47  ? 19   ASN D C   1 
ATOM   6017 O O   . ASN C 2 19  ? 50.084  27.064  1.002   1.00 26.43  ? 19   ASN D O   1 
ATOM   6018 C CB  . ASN C 2 19  ? 48.768  24.279  0.559   1.00 23.41  ? 19   ASN D CB  1 
ATOM   6019 C CG  . ASN C 2 19  ? 49.590  23.017  0.604   1.00 22.35  ? 19   ASN D CG  1 
ATOM   6020 O OD1 . ASN C 2 19  ? 49.456  22.250  1.563   1.00 24.37  ? 19   ASN D OD1 1 
ATOM   6021 N ND2 . ASN C 2 19  ? 50.443  22.764  -0.375  1.00 18.05  ? 19   ASN D ND2 1 
ATOM   6022 N N   . PRO C 2 20  ? 51.260  25.606  2.173   1.00 28.13  ? 20   PRO D N   1 
ATOM   6023 C CA  . PRO C 2 20  ? 52.503  26.341  2.012   1.00 29.33  ? 20   PRO D CA  1 
ATOM   6024 C C   . PRO C 2 20  ? 52.861  26.640  0.557   1.00 30.63  ? 20   PRO D C   1 
ATOM   6025 O O   . PRO C 2 20  ? 52.671  25.833  -0.354  1.00 29.44  ? 20   PRO D O   1 
ATOM   6026 C CB  . PRO C 2 20  ? 53.577  25.423  2.588   1.00 27.56  ? 20   PRO D CB  1 
ATOM   6027 C CG  . PRO C 2 20  ? 52.883  24.405  3.385   1.00 27.26  ? 20   PRO D CG  1 
ATOM   6028 C CD  . PRO C 2 20  ? 51.441  24.376  2.972   1.00 27.95  ? 20   PRO D CD  1 
ATOM   6029 N N   . PRO C 2 21  ? 53.479  27.806  0.354   1.00 31.86  ? 21   PRO D N   1 
ATOM   6030 C CA  . PRO C 2 21  ? 53.982  28.219  -0.951  1.00 31.79  ? 21   PRO D CA  1 
ATOM   6031 C C   . PRO C 2 21  ? 54.938  27.165  -1.481  1.00 31.23  ? 21   PRO D C   1 
ATOM   6032 O O   . PRO C 2 21  ? 55.593  26.502  -0.681  1.00 32.71  ? 21   PRO D O   1 
ATOM   6033 C CB  . PRO C 2 21  ? 54.722  29.525  -0.697  1.00 31.92  ? 21   PRO D CB  1 
ATOM   6034 C CG  . PRO C 2 21  ? 54.700  29.792  0.762   1.00 31.62  ? 21   PRO D CG  1 
ATOM   6035 C CD  . PRO C 2 21  ? 53.750  28.820  1.416   1.00 31.41  ? 21   PRO D CD  1 
ATOM   6036 N N   . GLY C 2 22  ? 55.006  26.904  -2.771  1.00 30.51  ? 22   GLY D N   1 
ATOM   6037 C CA  . GLY C 2 22  ? 55.869  25.841  -3.283  1.00 29.19  ? 22   GLY D CA  1 
ATOM   6038 C C   . GLY C 2 22  ? 55.220  25.294  -4.562  1.00 29.58  ? 22   GLY D C   1 
ATOM   6039 O O   . GLY C 2 22  ? 54.191  25.769  -5.075  1.00 30.01  ? 22   GLY D O   1 
ATOM   6040 N N   . GLU C 2 23  ? 55.843  24.275  -5.091  1.00 27.24  ? 23   GLU D N   1 
ATOM   6041 C CA  . GLU C 2 23  ? 55.453  23.628  -6.319  1.00 27.17  ? 23   GLU D CA  1 
ATOM   6042 C C   . GLU C 2 23  ? 54.046  23.054  -6.290  1.00 23.57  ? 23   GLU D C   1 
ATOM   6043 O O   . GLU C 2 23  ? 53.303  23.159  -7.261  1.00 24.43  ? 23   GLU D O   1 
ATOM   6044 C CB  . GLU C 2 23  ? 56.514  22.557  -6.662  1.00 31.08  ? 23   GLU D CB  1 
ATOM   6045 C CG  . GLU C 2 23  ? 57.550  23.135  -7.617  1.00 43.15  ? 23   GLU D CG  1 
ATOM   6046 C CD  . GLU C 2 23  ? 58.899  22.448  -7.676  1.00 49.34  ? 23   GLU D CD  1 
ATOM   6047 O OE1 . GLU C 2 23  ? 59.040  21.258  -8.091  1.00 52.83  ? 23   GLU D OE1 1 
ATOM   6048 O OE2 . GLU C 2 23  ? 59.878  23.140  -7.281  1.00 50.98  ? 23   GLU D OE2 1 
ATOM   6049 N N   . VAL C 2 24  ? 53.669  22.399  -5.230  1.00 22.15  ? 24   VAL D N   1 
ATOM   6050 C CA  . VAL C 2 24  ? 52.365  21.774  -5.068  1.00 21.92  ? 24   VAL D CA  1 
ATOM   6051 C C   . VAL C 2 24  ? 51.286  22.840  -5.125  1.00 20.68  ? 24   VAL D C   1 
ATOM   6052 O O   . VAL C 2 24  ? 50.518  22.769  -6.078  1.00 20.37  ? 24   VAL D O   1 
ATOM   6053 C CB  . VAL C 2 24  ? 52.255  20.946  -3.776  1.00 22.34  ? 24   VAL D CB  1 
ATOM   6054 C CG1 . VAL C 2 24  ? 50.866  20.315  -3.676  1.00 21.89  ? 24   VAL D CG1 1 
ATOM   6055 C CG2 . VAL C 2 24  ? 53.401  19.933  -3.789  1.00 19.71  ? 24   VAL D CG2 1 
ATOM   6056 N N   . SER C 2 25  ? 51.389  23.865  -4.263  1.00 19.86  ? 25   SER D N   1 
ATOM   6057 C CA  . SER C 2 25  ? 50.421  24.943  -4.321  1.00 18.61  ? 25   SER D CA  1 
ATOM   6058 C C   . SER C 2 25  ? 50.308  25.565  -5.710  1.00 17.40  ? 25   SER D C   1 
ATOM   6059 O O   . SER C 2 25  ? 49.169  25.801  -6.129  1.00 17.07  ? 25   SER D O   1 
ATOM   6060 C CB  . SER C 2 25  ? 50.760  26.002  -3.279  1.00 19.64  ? 25   SER D CB  1 
ATOM   6061 O OG  . SER C 2 25  ? 50.508  25.500  -1.985  1.00 19.14  ? 25   SER D OG  1 
ATOM   6062 N N   . ASP C 2 26  ? 51.428  25.844  -6.359  1.00 17.09  ? 26   ASP D N   1 
ATOM   6063 C CA  . ASP C 2 26  ? 51.546  26.451  -7.641  1.00 18.70  ? 26   ASP D CA  1 
ATOM   6064 C C   . ASP C 2 26  ? 50.783  25.681  -8.719  1.00 20.66  ? 26   ASP D C   1 
ATOM   6065 O O   . ASP C 2 26  ? 49.956  26.260  -9.428  1.00 21.71  ? 26   ASP D O   1 
ATOM   6066 C CB  . ASP C 2 26  ? 52.988  26.572  -8.175  1.00 21.88  ? 26   ASP D CB  1 
ATOM   6067 C CG  . ASP C 2 26  ? 53.815  27.663  -7.540  1.00 24.63  ? 26   ASP D CG  1 
ATOM   6068 O OD1 . ASP C 2 26  ? 53.223  28.557  -6.900  1.00 24.77  ? 26   ASP D OD1 1 
ATOM   6069 O OD2 . ASP C 2 26  ? 55.070  27.673  -7.619  1.00 27.03  ? 26   ASP D OD2 1 
ATOM   6070 N N   . ALA C 2 27  ? 51.082  24.373  -8.794  1.00 20.59  ? 27   ALA D N   1 
ATOM   6071 C CA  . ALA C 2 27  ? 50.474  23.523  -9.798  1.00 19.15  ? 27   ALA D CA  1 
ATOM   6072 C C   . ALA C 2 27  ? 48.965  23.444  -9.578  1.00 18.48  ? 27   ALA D C   1 
ATOM   6073 O O   . ALA C 2 27  ? 48.226  23.418  -10.538 1.00 17.28  ? 27   ALA D O   1 
ATOM   6074 C CB  . ALA C 2 27  ? 51.100  22.136  -9.781  1.00 16.03  ? 27   ALA D CB  1 
ATOM   6075 N N   . LEU C 2 28  ? 48.518  23.315  -8.337  1.00 19.59  ? 28   LEU D N   1 
ATOM   6076 C CA  . LEU C 2 28  ? 47.109  23.290  -7.973  1.00 19.59  ? 28   LEU D CA  1 
ATOM   6077 C C   . LEU C 2 28  ? 46.415  24.609  -8.311  1.00 18.86  ? 28   LEU D C   1 
ATOM   6078 O O   . LEU C 2 28  ? 45.414  24.581  -9.017  1.00 18.43  ? 28   LEU D O   1 
ATOM   6079 C CB  . LEU C 2 28  ? 46.993  22.975  -6.481  1.00 20.24  ? 28   LEU D CB  1 
ATOM   6080 C CG  . LEU C 2 28  ? 45.577  22.767  -5.913  1.00 21.08  ? 28   LEU D CG  1 
ATOM   6081 C CD1 . LEU C 2 28  ? 44.711  21.856  -6.782  1.00 19.20  ? 28   LEU D CD1 1 
ATOM   6082 C CD2 . LEU C 2 28  ? 45.723  22.179  -4.516  1.00 20.33  ? 28   LEU D CD2 1 
ATOM   6083 N N   . VAL C 2 29  ? 46.982  25.762  -7.935  1.00 19.60  ? 29   VAL D N   1 
ATOM   6084 C CA  . VAL C 2 29  ? 46.430  27.066  -8.320  1.00 19.05  ? 29   VAL D CA  1 
ATOM   6085 C C   . VAL C 2 29  ? 46.405  27.167  -9.842  1.00 20.38  ? 29   VAL D C   1 
ATOM   6086 O O   . VAL C 2 29  ? 45.332  27.535  -10.337 1.00 19.63  ? 29   VAL D O   1 
ATOM   6087 C CB  . VAL C 2 29  ? 47.216  28.262  -7.751  1.00 21.47  ? 29   VAL D CB  1 
ATOM   6088 C CG1 . VAL C 2 29  ? 46.869  29.622  -8.334  1.00 16.33  ? 29   VAL D CG1 1 
ATOM   6089 C CG2 . VAL C 2 29  ? 47.056  28.374  -6.220  1.00 21.98  ? 29   VAL D CG2 1 
ATOM   6090 N N   . LEU C 2 30  ? 47.483  26.777  -10.574 1.00 19.35  ? 30   LEU D N   1 
ATOM   6091 C CA  . LEU C 2 30  ? 47.384  26.893  -12.031 1.00 18.19  ? 30   LEU D CA  1 
ATOM   6092 C C   . LEU C 2 30  ? 46.270  26.044  -12.623 1.00 16.95  ? 30   LEU D C   1 
ATOM   6093 O O   . LEU C 2 30  ? 45.573  26.518  -13.526 1.00 12.81  ? 30   LEU D O   1 
ATOM   6094 C CB  . LEU C 2 30  ? 48.708  26.662  -12.783 1.00 19.80  ? 30   LEU D CB  1 
ATOM   6095 C CG  . LEU C 2 30  ? 49.808  27.708  -12.441 1.00 20.95  ? 30   LEU D CG  1 
ATOM   6096 C CD1 . LEU C 2 30  ? 51.131  27.351  -13.099 1.00 21.58  ? 30   LEU D CD1 1 
ATOM   6097 C CD2 . LEU C 2 30  ? 49.388  29.118  -12.782 1.00 18.44  ? 30   LEU D CD2 1 
ATOM   6098 N N   . GLN C 2 31  ? 46.054  24.825  -12.087 1.00 16.00  ? 31   GLN D N   1 
ATOM   6099 C CA  . GLN C 2 31  ? 44.969  24.023  -12.658 1.00 15.94  ? 31   GLN D CA  1 
ATOM   6100 C C   . GLN C 2 31  ? 43.606  24.575  -12.256 1.00 16.85  ? 31   GLN D C   1 
ATOM   6101 O O   . GLN C 2 31  ? 42.660  24.495  -13.060 1.00 17.05  ? 31   GLN D O   1 
ATOM   6102 C CB  . GLN C 2 31  ? 45.183  22.533  -12.375 1.00 11.70  ? 31   GLN D CB  1 
ATOM   6103 C CG  . GLN C 2 31  ? 44.058  21.648  -12.932 1.00 8.06   ? 31   GLN D CG  1 
ATOM   6104 C CD  . GLN C 2 31  ? 43.985  21.653  -14.441 1.00 11.89  ? 31   GLN D CD  1 
ATOM   6105 O OE1 . GLN C 2 31  ? 44.880  22.162  -15.164 1.00 11.18  ? 31   GLN D OE1 1 
ATOM   6106 N NE2 . GLN C 2 31  ? 42.928  21.083  -15.003 1.00 6.71   ? 31   GLN D NE2 1 
ATOM   6107 N N   . LEU C 2 32  ? 43.454  25.211  -11.088 1.00 17.60  ? 32   LEU D N   1 
ATOM   6108 C CA  . LEU C 2 32  ? 42.142  25.816  -10.755 1.00 18.54  ? 32   LEU D CA  1 
ATOM   6109 C C   . LEU C 2 32  ? 41.852  27.061  -11.598 1.00 19.79  ? 32   LEU D C   1 
ATOM   6110 O O   . LEU C 2 32  ? 40.702  27.317  -11.993 1.00 21.09  ? 32   LEU D O   1 
ATOM   6111 C CB  . LEU C 2 32  ? 42.024  26.075  -9.263  1.00 15.34  ? 32   LEU D CB  1 
ATOM   6112 C CG  . LEU C 2 32  ? 41.935  24.781  -8.427  1.00 17.12  ? 32   LEU D CG  1 
ATOM   6113 C CD1 . LEU C 2 32  ? 42.485  25.000  -7.019  1.00 16.13  ? 32   LEU D CD1 1 
ATOM   6114 C CD2 . LEU C 2 32  ? 40.490  24.315  -8.391  1.00 16.95  ? 32   LEU D CD2 1 
ATOM   6115 N N   . ILE C 2 33  ? 42.853  27.822  -12.005 1.00 18.42  ? 33   ILE D N   1 
ATOM   6116 C CA  . ILE C 2 33  ? 42.663  28.915  -12.938 1.00 19.68  ? 33   ILE D CA  1 
ATOM   6117 C C   . ILE C 2 33  ? 42.343  28.396  -14.339 1.00 17.78  ? 33   ILE D C   1 
ATOM   6118 O O   . ILE C 2 33  ? 41.513  29.011  -14.995 1.00 18.62  ? 33   ILE D O   1 
ATOM   6119 C CB  . ILE C 2 33  ? 43.925  29.813  -13.005 1.00 20.65  ? 33   ILE D CB  1 
ATOM   6120 C CG1 . ILE C 2 33  ? 44.162  30.509  -11.649 1.00 16.92  ? 33   ILE D CG1 1 
ATOM   6121 C CG2 . ILE C 2 33  ? 43.813  30.891  -14.076 1.00 13.18  ? 33   ILE D CG2 1 
ATOM   6122 C CD1 . ILE C 2 33  ? 45.612  30.997  -11.592 1.00 17.27  ? 33   ILE D CD1 1 
ATOM   6123 N N   . ARG C 2 34  ? 42.887  27.305  -14.849 1.00 17.38  ? 34   ARG D N   1 
ATOM   6124 C CA  . ARG C 2 34  ? 42.509  26.763  -16.147 1.00 16.90  ? 34   ARG D CA  1 
ATOM   6125 C C   . ARG C 2 34  ? 41.049  26.319  -16.131 1.00 16.73  ? 34   ARG D C   1 
ATOM   6126 O O   . ARG C 2 34  ? 40.330  26.554  -17.085 1.00 16.66  ? 34   ARG D O   1 
ATOM   6127 C CB  . ARG C 2 34  ? 43.380  25.586  -16.576 1.00 17.43  ? 34   ARG D CB  1 
ATOM   6128 C CG  . ARG C 2 34  ? 44.833  25.971  -16.831 1.00 17.86  ? 34   ARG D CG  1 
ATOM   6129 C CD  . ARG C 2 34  ? 45.620  24.745  -17.361 1.00 16.46  ? 34   ARG D CD  1 
ATOM   6130 N NE  . ARG C 2 34  ? 46.960  24.973  -16.904 1.00 16.24  ? 34   ARG D NE  1 
ATOM   6131 C CZ  . ARG C 2 34  ? 47.687  24.536  -15.906 1.00 18.26  ? 34   ARG D CZ  1 
ATOM   6132 N NH1 . ARG C 2 34  ? 47.300  23.597  -15.069 1.00 17.34  ? 34   ARG D NH1 1 
ATOM   6133 N NH2 . ARG C 2 34  ? 48.925  25.028  -15.751 1.00 17.38  ? 34   ARG D NH2 1 
ATOM   6134 N N   . ILE C 2 35  ? 40.585  25.684  -15.065 1.00 18.03  ? 35   ILE D N   1 
ATOM   6135 C CA  . ILE C 2 35  ? 39.190  25.273  -14.860 1.00 17.13  ? 35   ILE D CA  1 
ATOM   6136 C C   . ILE C 2 35  ? 38.316  26.521  -14.775 1.00 18.79  ? 35   ILE D C   1 
ATOM   6137 O O   . ILE C 2 35  ? 37.202  26.576  -15.282 1.00 17.36  ? 35   ILE D O   1 
ATOM   6138 C CB  . ILE C 2 35  ? 39.074  24.454  -13.570 1.00 16.05  ? 35   ILE D CB  1 
ATOM   6139 C CG1 . ILE C 2 35  ? 39.653  23.024  -13.704 1.00 9.58   ? 35   ILE D CG1 1 
ATOM   6140 C CG2 . ILE C 2 35  ? 37.639  24.381  -13.035 1.00 14.08  ? 35   ILE D CG2 1 
ATOM   6141 C CD1 . ILE C 2 35  ? 40.137  22.514  -12.332 1.00 5.85   ? 35   ILE D CD1 1 
ATOM   6142 N N   . GLY C 2 36  ? 38.859  27.609  -14.199 1.00 20.16  ? 36   GLY D N   1 
ATOM   6143 C CA  . GLY C 2 36  ? 38.199  28.893  -14.233 1.00 21.26  ? 36   GLY D CA  1 
ATOM   6144 C C   . GLY C 2 36  ? 37.658  29.475  -12.940 1.00 22.93  ? 36   GLY D C   1 
ATOM   6145 O O   . GLY C 2 36  ? 37.074  30.568  -12.941 1.00 20.47  ? 36   GLY D O   1 
ATOM   6146 N N   . CYS C 2 37  ? 37.831  28.745  -11.835 1.00 23.00  ? 37   CYS D N   1 
ATOM   6147 C CA  . CYS C 2 37  ? 37.449  29.202  -10.521 1.00 24.78  ? 37   CYS D CA  1 
ATOM   6148 C C   . CYS C 2 37  ? 38.224  30.442  -10.064 1.00 24.91  ? 37   CYS D C   1 
ATOM   6149 O O   . CYS C 2 37  ? 39.282  30.678  -10.603 1.00 24.02  ? 37   CYS D O   1 
ATOM   6150 C CB  . CYS C 2 37  ? 37.876  28.130  -9.482  1.00 24.16  ? 37   CYS D CB  1 
ATOM   6151 S SG  . CYS C 2 37  ? 37.055  26.566  -9.666  1.00 19.16  ? 37   CYS D SG  1 
ATOM   6152 N N   . SER C 2 38  ? 37.725  31.176  -9.090  1.00 26.36  ? 38   SER D N   1 
ATOM   6153 C CA  . SER C 2 38  ? 38.453  32.288  -8.519  1.00 28.47  ? 38   SER D CA  1 
ATOM   6154 C C   . SER C 2 38  ? 39.316  31.560  -7.475  1.00 28.22  ? 38   SER D C   1 
ATOM   6155 O O   . SER C 2 38  ? 38.748  30.731  -6.774  1.00 28.93  ? 38   SER D O   1 
ATOM   6156 C CB  . SER C 2 38  ? 37.609  33.349  -7.811  1.00 29.95  ? 38   SER D CB  1 
ATOM   6157 O OG  . SER C 2 38  ? 36.960  34.133  -8.782  1.00 34.29  ? 38   SER D OG  1 
ATOM   6158 N N   . VAL C 2 39  ? 40.603  31.791  -7.483  1.00 28.69  ? 39   VAL D N   1 
ATOM   6159 C CA  . VAL C 2 39  ? 41.523  31.019  -6.686  1.00 29.43  ? 39   VAL D CA  1 
ATOM   6160 C C   . VAL C 2 39  ? 42.503  31.917  -5.940  1.00 30.99  ? 39   VAL D C   1 
ATOM   6161 O O   . VAL C 2 39  ? 43.184  32.672  -6.600  1.00 31.39  ? 39   VAL D O   1 
ATOM   6162 C CB  . VAL C 2 39  ? 42.525  30.155  -7.510  1.00 24.99  ? 39   VAL D CB  1 
ATOM   6163 C CG1 . VAL C 2 39  ? 43.133  29.099  -6.592  1.00 22.94  ? 39   VAL D CG1 1 
ATOM   6164 C CG2 . VAL C 2 39  ? 41.913  29.582  -8.747  1.00 20.79  ? 39   VAL D CG2 1 
ATOM   6165 N N   . ARG C 2 40  ? 42.607  31.662  -4.658  1.00 33.26  ? 40   ARG D N   1 
ATOM   6166 C CA  . ARG C 2 40  ? 43.567  32.345  -3.811  1.00 36.21  ? 40   ARG D CA  1 
ATOM   6167 C C   . ARG C 2 40  ? 44.309  31.211  -3.078  1.00 35.48  ? 40   ARG D C   1 
ATOM   6168 O O   . ARG C 2 40  ? 43.829  30.108  -2.866  1.00 35.04  ? 40   ARG D O   1 
ATOM   6169 C CB  . ARG C 2 40  ? 42.981  33.282  -2.767  1.00 42.24  ? 40   ARG D CB  1 
ATOM   6170 C CG  . ARG C 2 40  ? 42.159  34.464  -3.193  1.00 49.32  ? 40   ARG D CG  1 
ATOM   6171 C CD  . ARG C 2 40  ? 42.947  35.756  -3.284  1.00 56.81  ? 40   ARG D CD  1 
ATOM   6172 N NE  . ARG C 2 40  ? 42.189  36.786  -3.991  1.00 63.78  ? 40   ARG D NE  1 
ATOM   6173 C CZ  . ARG C 2 40  ? 42.377  38.102  -3.882  1.00 67.68  ? 40   ARG D CZ  1 
ATOM   6174 N NH1 . ARG C 2 40  ? 43.307  38.602  -3.071  1.00 67.74  ? 40   ARG D NH1 1 
ATOM   6175 N NH2 . ARG C 2 40  ? 41.617  38.923  -4.608  1.00 69.01  ? 40   ARG D NH2 1 
ATOM   6176 N N   . GLN C 2 41  ? 45.444  31.599  -2.588  1.00 35.62  ? 41   GLN D N   1 
ATOM   6177 C CA  . GLN C 2 41  ? 46.366  30.723  -1.882  1.00 37.52  ? 41   GLN D CA  1 
ATOM   6178 C C   . GLN C 2 41  ? 46.662  31.386  -0.553  1.00 37.55  ? 41   GLN D C   1 
ATOM   6179 O O   . GLN C 2 41  ? 46.800  32.613  -0.621  1.00 38.61  ? 41   GLN D O   1 
ATOM   6180 C CB  . GLN C 2 41  ? 47.585  30.719  -2.780  1.00 36.55  ? 41   GLN D CB  1 
ATOM   6181 C CG  . GLN C 2 41  ? 48.659  29.727  -2.464  1.00 39.50  ? 41   GLN D CG  1 
ATOM   6182 C CD  . GLN C 2 41  ? 49.860  30.053  -3.344  1.00 39.55  ? 41   GLN D CD  1 
ATOM   6183 O OE1 . GLN C 2 41  ? 50.970  29.767  -2.932  1.00 41.13  ? 41   GLN D OE1 1 
ATOM   6184 N NE2 . GLN C 2 41  ? 49.604  30.646  -4.507  1.00 39.69  ? 41   GLN D NE2 1 
ATOM   6185 N N   . CYS C 2 42  ? 46.737  30.685  0.547   1.00 37.49  ? 42   CYS D N   1 
ATOM   6186 C CA  . CYS C 2 42  ? 46.967  31.370  1.822   1.00 38.59  ? 42   CYS D CA  1 
ATOM   6187 C C   . CYS C 2 42  ? 47.923  30.536  2.647   1.00 39.02  ? 42   CYS D C   1 
ATOM   6188 O O   . CYS C 2 42  ? 47.841  29.324  2.457   1.00 38.38  ? 42   CYS D O   1 
ATOM   6189 C CB  . CYS C 2 42  ? 45.615  31.534  2.526   1.00 39.16  ? 42   CYS D CB  1 
ATOM   6190 S SG  . CYS C 2 42  ? 45.641  32.353  4.138   1.00 43.80  ? 42   CYS D SG  1 
ATOM   6191 N N   . TRP C 2 43  ? 48.811  31.113  3.437   1.00 39.88  ? 43   TRP D N   1 
ATOM   6192 C CA  . TRP C 2 43  ? 49.660  30.351  4.321   1.00 42.58  ? 43   TRP D CA  1 
ATOM   6193 C C   . TRP C 2 43  ? 50.525  31.144  5.275   1.00 45.68  ? 43   TRP D C   1 
ATOM   6194 O O   . TRP C 2 43  ? 50.811  32.091  4.525   1.00 46.04  ? 43   TRP D O   1 
ATOM   6195 C CB  . TRP C 2 43  ? 50.561  29.294  3.645   1.00 39.33  ? 43   TRP D CB  1 
ATOM   6196 C CG  . TRP C 2 43  ? 51.067  28.332  4.698   1.00 39.49  ? 43   TRP D CG  1 
ATOM   6197 C CD1 . TRP C 2 43  ? 52.274  28.393  5.349   1.00 40.21  ? 43   TRP D CD1 1 
ATOM   6198 C CD2 . TRP C 2 43  ? 50.371  27.213  5.254   1.00 37.35  ? 43   TRP D CD2 1 
ATOM   6199 N NE1 . TRP C 2 43  ? 52.364  27.382  6.269   1.00 38.33  ? 43   TRP D NE1 1 
ATOM   6200 C CE2 . TRP C 2 43  ? 51.218  26.641  6.235   1.00 37.81  ? 43   TRP D CE2 1 
ATOM   6201 C CE3 . TRP C 2 43  ? 49.122  26.631  5.027   1.00 34.42  ? 43   TRP D CE3 1 
ATOM   6202 C CZ2 . TRP C 2 43  ? 50.846  25.514  6.967   1.00 35.52  ? 43   TRP D CZ2 1 
ATOM   6203 C CZ3 . TRP C 2 43  ? 48.765  25.503  5.743   1.00 32.86  ? 43   TRP D CZ3 1 
ATOM   6204 C CH2 . TRP C 2 43  ? 49.615  24.971  6.720   1.00 32.13  ? 43   TRP D CH2 1 
ATOM   6205 N N   . PRO C 2 44  ? 50.167  31.301  6.530   1.00 46.83  ? 44   PRO D N   1 
ATOM   6206 C CA  . PRO C 2 44  ? 49.852  30.291  7.492   1.00 47.72  ? 44   PRO D CA  1 
ATOM   6207 C C   . PRO C 2 44  ? 48.328  30.392  7.662   1.00 48.75  ? 44   PRO D C   1 
ATOM   6208 O O   . PRO C 2 44  ? 47.759  31.431  7.351   1.00 48.19  ? 44   PRO D O   1 
ATOM   6209 C CB  . PRO C 2 44  ? 50.534  30.489  8.823   1.00 47.58  ? 44   PRO D CB  1 
ATOM   6210 C CG  . PRO C 2 44  ? 51.426  31.648  8.621   1.00 47.17  ? 44   PRO D CG  1 
ATOM   6211 C CD  . PRO C 2 44  ? 50.927  32.255  7.364   1.00 47.09  ? 44   PRO D CD  1 
ATOM   6212 N N   . PRO C 2 45  ? 47.678  29.347  8.120   1.00 50.57  ? 45   PRO D N   1 
ATOM   6213 C CA  . PRO C 2 45  ? 46.238  29.362  8.306   1.00 52.22  ? 45   PRO D CA  1 
ATOM   6214 C C   . PRO C 2 45  ? 45.774  30.482  9.213   1.00 54.34  ? 45   PRO D C   1 
ATOM   6215 O O   . PRO C 2 45  ? 46.240  30.640  10.336  1.00 54.89  ? 45   PRO D O   1 
ATOM   6216 C CB  . PRO C 2 45  ? 45.910  28.000  8.898   1.00 51.12  ? 45   PRO D CB  1 
ATOM   6217 C CG  . PRO C 2 45  ? 47.171  27.272  9.103   1.00 50.16  ? 45   PRO D CG  1 
ATOM   6218 C CD  . PRO C 2 45  ? 48.295  28.055  8.495   1.00 50.46  ? 45   PRO D CD  1 
ATOM   6219 N N   . PRO C 2 46  ? 44.808  31.267  8.768   1.00 56.96  ? 46   PRO D N   1 
ATOM   6220 C CA  . PRO C 2 46  ? 44.247  32.363  9.549   1.00 58.94  ? 46   PRO D CA  1 
ATOM   6221 C C   . PRO C 2 46  ? 43.260  31.889  10.600  1.00 60.67  ? 46   PRO D C   1 
ATOM   6222 O O   . PRO C 2 46  ? 43.158  30.681  10.845  1.00 60.88  ? 46   PRO D O   1 
ATOM   6223 C CB  . PRO C 2 46  ? 43.615  33.228  8.462   1.00 58.68  ? 46   PRO D CB  1 
ATOM   6224 C CG  . PRO C 2 46  ? 43.079  32.205  7.510   1.00 58.11  ? 46   PRO D CG  1 
ATOM   6225 C CD  . PRO C 2 46  ? 44.180  31.178  7.427   1.00 57.38  ? 46   PRO D CD  1 
ATOM   6226 N N   . GLU C 2 47  ? 42.518  32.791  11.239  1.00 62.18  ? 47   GLU D N   1 
ATOM   6227 C CA  . GLU C 2 47  ? 41.572  32.423  12.289  1.00 63.70  ? 47   GLU D CA  1 
ATOM   6228 C C   . GLU C 2 47  ? 40.127  32.511  11.829  1.00 63.99  ? 47   GLU D C   1 
ATOM   6229 O O   . GLU C 2 47  ? 39.237  31.885  12.389  1.00 64.15  ? 47   GLU D O   1 
ATOM   6230 C CB  . GLU C 2 47  ? 41.751  33.278  13.542  1.00 67.21  ? 47   GLU D CB  1 
ATOM   6231 C CG  . GLU C 2 47  ? 42.166  34.717  13.273  1.00 71.84  ? 47   GLU D CG  1 
ATOM   6232 C CD  . GLU C 2 47  ? 43.664  34.836  13.030  1.00 74.58  ? 47   GLU D CD  1 
ATOM   6233 O OE1 . GLU C 2 47  ? 44.396  34.260  13.870  1.00 76.21  ? 47   GLU D OE1 1 
ATOM   6234 O OE2 . GLU C 2 47  ? 44.057  35.467  12.024  1.00 75.71  ? 47   GLU D OE2 1 
ATOM   6235 N N   . ALA C 2 48  ? 39.903  33.301  10.798  1.00 63.97  ? 48   ALA D N   1 
ATOM   6236 C CA  . ALA C 2 48  ? 38.607  33.481  10.163  1.00 63.46  ? 48   ALA D CA  1 
ATOM   6237 C C   . ALA C 2 48  ? 38.921  33.853  8.706   1.00 63.25  ? 48   ALA D C   1 
ATOM   6238 O O   . ALA C 2 48  ? 40.026  34.338  8.447   1.00 62.64  ? 48   ALA D O   1 
ATOM   6239 C CB  . ALA C 2 48  ? 37.746  34.500  10.853  1.00 63.32  ? 48   ALA D CB  1 
ATOM   6240 N N   . PHE C 2 49  ? 37.985  33.595  7.792   1.00 62.60  ? 49   PHE D N   1 
ATOM   6241 C CA  . PHE C 2 49  ? 38.354  33.838  6.406   1.00 61.93  ? 49   PHE D CA  1 
ATOM   6242 C C   . PHE C 2 49  ? 38.518  35.247  5.933   1.00 61.41  ? 49   PHE D C   1 
ATOM   6243 O O   . PHE C 2 49  ? 39.573  35.399  5.269   1.00 61.53  ? 49   PHE D O   1 
ATOM   6244 C CB  . PHE C 2 49  ? 37.575  32.884  5.475   1.00 59.21  ? 49   PHE D CB  1 
ATOM   6245 C CG  . PHE C 2 49  ? 38.371  31.593  5.412   1.00 57.00  ? 49   PHE D CG  1 
ATOM   6246 C CD1 . PHE C 2 49  ? 39.747  31.649  5.193   1.00 55.75  ? 49   PHE D CD1 1 
ATOM   6247 C CD2 . PHE C 2 49  ? 37.770  30.366  5.585   1.00 55.20  ? 49   PHE D CD2 1 
ATOM   6248 C CE1 . PHE C 2 49  ? 40.506  30.503  5.152   1.00 55.35  ? 49   PHE D CE1 1 
ATOM   6249 C CE2 . PHE C 2 49  ? 38.519  29.209  5.532   1.00 54.22  ? 49   PHE D CE2 1 
ATOM   6250 C CZ  . PHE C 2 49  ? 39.879  29.283  5.315   1.00 56.07  ? 49   PHE D CZ  1 
ATOM   6251 N N   . ASP C 2 50  ? 37.686  36.230  6.187   1.00 60.60  ? 50   ASP D N   1 
ATOM   6252 C CA  . ASP C 2 50  ? 37.904  37.601  5.697   1.00 59.84  ? 50   ASP D CA  1 
ATOM   6253 C C   . ASP C 2 50  ? 36.969  37.807  4.505   1.00 58.59  ? 50   ASP D C   1 
ATOM   6254 O O   . ASP C 2 50  ? 36.063  38.633  4.509   1.00 59.27  ? 50   ASP D O   1 
ATOM   6255 C CB  . ASP C 2 50  ? 39.327  37.975  5.324   1.00 60.56  ? 50   ASP D CB  1 
ATOM   6256 N N   . VAL C 2 51  ? 37.154  36.963  3.500   1.00 56.73  ? 51   VAL D N   1 
ATOM   6257 C CA  . VAL C 2 51  ? 36.314  36.919  2.312   1.00 53.71  ? 51   VAL D CA  1 
ATOM   6258 C C   . VAL C 2 51  ? 35.650  35.549  2.252   1.00 51.06  ? 51   VAL D C   1 
ATOM   6259 O O   . VAL C 2 51  ? 36.253  34.541  2.638   1.00 50.76  ? 51   VAL D O   1 
ATOM   6260 C CB  . VAL C 2 51  ? 37.205  37.132  1.071   1.00 55.78  ? 51   VAL D CB  1 
ATOM   6261 C CG1 . VAL C 2 51  ? 36.464  36.938  -0.240  1.00 56.44  ? 51   VAL D CG1 1 
ATOM   6262 C CG2 . VAL C 2 51  ? 37.863  38.516  1.079   1.00 56.10  ? 51   VAL D CG2 1 
ATOM   6263 N N   . PRO C 2 52  ? 34.417  35.493  1.774   1.00 48.24  ? 52   PRO D N   1 
ATOM   6264 C CA  . PRO C 2 52  ? 33.685  34.257  1.551   1.00 45.13  ? 52   PRO D CA  1 
ATOM   6265 C C   . PRO C 2 52  ? 34.504  33.222  0.804   1.00 41.42  ? 52   PRO D C   1 
ATOM   6266 O O   . PRO C 2 52  ? 35.235  33.575  -0.129  1.00 41.82  ? 52   PRO D O   1 
ATOM   6267 C CB  . PRO C 2 52  ? 32.507  34.716  0.675   1.00 46.46  ? 52   PRO D CB  1 
ATOM   6268 C CG  . PRO C 2 52  ? 32.243  36.093  1.191   1.00 47.39  ? 52   PRO D CG  1 
ATOM   6269 C CD  . PRO C 2 52  ? 33.630  36.685  1.348   1.00 48.25  ? 52   PRO D CD  1 
ATOM   6270 N N   . VAL C 2 53  ? 34.470  31.957  1.204   1.00 36.87  ? 53   VAL D N   1 
ATOM   6271 C CA  . VAL C 2 53  ? 35.240  30.892  0.587   1.00 31.27  ? 53   VAL D CA  1 
ATOM   6272 C C   . VAL C 2 53  ? 34.299  29.722  0.297   1.00 29.64  ? 53   VAL D C   1 
ATOM   6273 O O   . VAL C 2 53  ? 33.662  29.261  1.258   1.00 27.35  ? 53   VAL D O   1 
ATOM   6274 C CB  . VAL C 2 53  ? 36.372  30.355  1.486   1.00 28.86  ? 53   VAL D CB  1 
ATOM   6275 C CG1 . VAL C 2 53  ? 37.019  29.124  0.876   1.00 24.54  ? 53   VAL D CG1 1 
ATOM   6276 C CG2 . VAL C 2 53  ? 37.445  31.380  1.821   1.00 30.25  ? 53   VAL D CG2 1 
ATOM   6277 N N   . ASP C 2 54  ? 34.254  29.234  -0.953  1.00 26.84  ? 54   ASP D N   1 
ATOM   6278 C CA  . ASP C 2 54  ? 33.389  28.084  -1.204  1.00 24.48  ? 54   ASP D CA  1 
ATOM   6279 C C   . ASP C 2 54  ? 34.071  26.721  -1.100  1.00 23.25  ? 54   ASP D C   1 
ATOM   6280 O O   . ASP C 2 54  ? 33.404  25.700  -0.817  1.00 21.81  ? 54   ASP D O   1 
ATOM   6281 C CB  . ASP C 2 54  ? 32.783  28.169  -2.610  1.00 27.10  ? 54   ASP D CB  1 
ATOM   6282 C CG  . ASP C 2 54  ? 31.914  29.388  -2.800  1.00 27.72  ? 54   ASP D CG  1 
ATOM   6283 O OD1 . ASP C 2 54  ? 30.952  29.564  -2.021  1.00 30.50  ? 54   ASP D OD1 1 
ATOM   6284 O OD2 . ASP C 2 54  ? 32.233  30.158  -3.716  1.00 27.94  ? 54   ASP D OD2 1 
ATOM   6285 N N   . VAL C 2 55  ? 35.361  26.646  -1.436  1.00 21.14  ? 55   VAL D N   1 
ATOM   6286 C CA  . VAL C 2 55  ? 36.088  25.374  -1.451  1.00 20.05  ? 55   VAL D CA  1 
ATOM   6287 C C   . VAL C 2 55  ? 37.529  25.614  -0.972  1.00 20.46  ? 55   VAL D C   1 
ATOM   6288 O O   . VAL C 2 55  ? 38.255  26.517  -1.414  1.00 19.48  ? 55   VAL D O   1 
ATOM   6289 C CB  . VAL C 2 55  ? 36.153  24.771  -2.867  1.00 20.97  ? 55   VAL D CB  1 
ATOM   6290 C CG1 . VAL C 2 55  ? 37.038  23.532  -2.928  1.00 16.74  ? 55   VAL D CG1 1 
ATOM   6291 C CG2 . VAL C 2 55  ? 34.797  24.460  -3.538  1.00 17.28  ? 55   VAL D CG2 1 
ATOM   6292 N N   . VAL C 2 56  ? 37.964  24.773  -0.026  1.00 19.25  ? 56   VAL D N   1 
ATOM   6293 C CA  . VAL C 2 56  ? 39.300  24.785  0.507   1.00 18.56  ? 56   VAL D CA  1 
ATOM   6294 C C   . VAL C 2 56  ? 40.037  23.479  0.161   1.00 18.86  ? 56   VAL D C   1 
ATOM   6295 O O   . VAL C 2 56  ? 39.500  22.377  0.367   1.00 19.81  ? 56   VAL D O   1 
ATOM   6296 C CB  . VAL C 2 56  ? 39.309  24.923  2.050   1.00 18.51  ? 56   VAL D CB  1 
ATOM   6297 C CG1 . VAL C 2 56  ? 40.714  24.850  2.633   1.00 12.70  ? 56   VAL D CG1 1 
ATOM   6298 C CG2 . VAL C 2 56  ? 38.677  26.255  2.476   1.00 19.51  ? 56   VAL D CG2 1 
ATOM   6299 N N   . PHE C 2 57  ? 41.255  23.612  -0.316  1.00 16.83  ? 57   PHE D N   1 
ATOM   6300 C CA  . PHE C 2 57  ? 42.165  22.506  -0.589  1.00 17.88  ? 57   PHE D CA  1 
ATOM   6301 C C   . PHE C 2 57  ? 43.267  22.635  0.474   1.00 18.33  ? 57   PHE D C   1 
ATOM   6302 O O   . PHE C 2 57  ? 43.750  23.731  0.698   1.00 18.96  ? 57   PHE D O   1 
ATOM   6303 C CB  . PHE C 2 57  ? 42.862  22.561  -1.962  1.00 14.79  ? 57   PHE D CB  1 
ATOM   6304 C CG  . PHE C 2 57  ? 41.944  22.228  -3.110  1.00 12.98  ? 57   PHE D CG  1 
ATOM   6305 C CD1 . PHE C 2 57  ? 41.047  23.142  -3.606  1.00 11.04  ? 57   PHE D CD1 1 
ATOM   6306 C CD2 . PHE C 2 57  ? 41.898  20.923  -3.606  1.00 13.07  ? 57   PHE D CD2 1 
ATOM   6307 C CE1 . PHE C 2 57  ? 40.187  22.843  -4.643  1.00 13.31  ? 57   PHE D CE1 1 
ATOM   6308 C CE2 . PHE C 2 57  ? 41.031  20.618  -4.648  1.00 14.23  ? 57   PHE D CE2 1 
ATOM   6309 C CZ  . PHE C 2 57  ? 40.175  21.557  -5.162  1.00 12.97  ? 57   PHE D CZ  1 
ATOM   6310 N N   . THR C 2 58  ? 43.609  21.613  1.202   1.00 19.25  ? 58   THR D N   1 
ATOM   6311 C CA  . THR C 2 58  ? 44.662  21.775  2.196   1.00 21.92  ? 58   THR D CA  1 
ATOM   6312 C C   . THR C 2 58  ? 45.457  20.477  2.194   1.00 22.46  ? 58   THR D C   1 
ATOM   6313 O O   . THR C 2 58  ? 45.040  19.589  1.426   1.00 24.23  ? 58   THR D O   1 
ATOM   6314 C CB  . THR C 2 58  ? 44.046  22.156  3.555   1.00 24.61  ? 58   THR D CB  1 
ATOM   6315 O OG1 . THR C 2 58  ? 45.133  22.363  4.449   1.00 26.32  ? 58   THR D OG1 1 
ATOM   6316 C CG2 . THR C 2 58  ? 43.099  21.121  4.110   1.00 20.79  ? 58   THR D CG2 1 
ATOM   6317 N N   . SER C 2 59  ? 46.522  20.430  2.928   1.00 21.67  ? 59   SER D N   1 
ATOM   6318 C CA  . SER C 2 59  ? 47.306  19.216  3.094   1.00 23.51  ? 59   SER D CA  1 
ATOM   6319 C C   . SER C 2 59  ? 47.151  18.753  4.552   1.00 22.86  ? 59   SER D C   1 
ATOM   6320 O O   . SER C 2 59  ? 46.433  19.365  5.358   1.00 23.49  ? 59   SER D O   1 
ATOM   6321 C CB  . SER C 2 59  ? 48.777  19.434  2.766   1.00 24.48  ? 59   SER D CB  1 
ATOM   6322 O OG  . SER C 2 59  ? 48.954  19.769  1.399   1.00 20.26  ? 59   SER D OG  1 
ATOM   6323 N N   . ILE C 2 60  ? 47.735  17.635  4.882   1.00 22.46  ? 60   ILE D N   1 
ATOM   6324 C CA  . ILE C 2 60  ? 47.646  17.062  6.221   1.00 23.44  ? 60   ILE D CA  1 
ATOM   6325 C C   . ILE C 2 60  ? 48.981  17.245  6.946   1.00 24.54  ? 60   ILE D C   1 
ATOM   6326 O O   . ILE C 2 60  ? 50.050  16.757  6.571   1.00 24.61  ? 60   ILE D O   1 
ATOM   6327 C CB  . ILE C 2 60  ? 47.192  15.603  6.110   1.00 21.61  ? 60   ILE D CB  1 
ATOM   6328 C CG1 . ILE C 2 60  ? 45.819  15.483  5.448   1.00 20.81  ? 60   ILE D CG1 1 
ATOM   6329 C CG2 . ILE C 2 60  ? 47.229  14.933  7.474   1.00 20.73  ? 60   ILE D CG2 1 
ATOM   6330 C CD1 . ILE C 2 60  ? 44.658  16.032  6.239   1.00 20.30  ? 60   ILE D CD1 1 
ATOM   6331 N N   . PHE C 2 61  ? 48.968  18.092  7.965   1.00 24.64  ? 61   PHE D N   1 
ATOM   6332 C CA  . PHE C 2 61  ? 50.145  18.430  8.751   1.00 25.68  ? 61   PHE D CA  1 
ATOM   6333 C C   . PHE C 2 61  ? 50.141  17.821  10.155  1.00 27.45  ? 61   PHE D C   1 
ATOM   6334 O O   . PHE C 2 61  ? 49.143  17.749  10.887  1.00 26.91  ? 61   PHE D O   1 
ATOM   6335 C CB  . PHE C 2 61  ? 50.208  19.951  8.855   1.00 24.42  ? 61   PHE D CB  1 
ATOM   6336 C CG  . PHE C 2 61  ? 50.008  20.657  7.532   1.00 28.04  ? 61   PHE D CG  1 
ATOM   6337 C CD1 . PHE C 2 61  ? 51.098  20.867  6.702   1.00 28.12  ? 61   PHE D CD1 1 
ATOM   6338 C CD2 . PHE C 2 61  ? 48.773  21.116  7.126   1.00 26.71  ? 61   PHE D CD2 1 
ATOM   6339 C CE1 . PHE C 2 61  ? 50.957  21.502  5.497   1.00 26.83  ? 61   PHE D CE1 1 
ATOM   6340 C CE2 . PHE C 2 61  ? 48.606  21.757  5.916   1.00 28.35  ? 61   PHE D CE2 1 
ATOM   6341 C CZ  . PHE C 2 61  ? 49.714  21.937  5.102   1.00 29.23  ? 61   PHE D CZ  1 
ATOM   6342 N N   . GLN C 2 62  ? 51.314  17.359  10.545  1.00 28.08  ? 62   GLN D N   1 
ATOM   6343 C CA  . GLN C 2 62  ? 51.590  16.826  11.870  1.00 31.25  ? 62   GLN D CA  1 
ATOM   6344 C C   . GLN C 2 62  ? 52.292  17.967  12.619  1.00 32.54  ? 62   GLN D C   1 
ATOM   6345 O O   . GLN C 2 62  ? 53.504  18.138  12.618  1.00 33.67  ? 62   GLN D O   1 
ATOM   6346 C CB  . GLN C 2 62  ? 52.446  15.565  11.840  1.00 29.04  ? 62   GLN D CB  1 
ATOM   6347 C CG  . GLN C 2 62  ? 51.708  14.302  11.371  1.00 25.93  ? 62   GLN D CG  1 
ATOM   6348 C CD  . GLN C 2 62  ? 51.694  14.338  9.852   1.00 24.01  ? 62   GLN D CD  1 
ATOM   6349 O OE1 . GLN C 2 62  ? 52.764  14.522  9.256   1.00 25.32  ? 62   GLN D OE1 1 
ATOM   6350 N NE2 . GLN C 2 62  ? 50.507  14.202  9.297   1.00 23.11  ? 62   GLN D NE2 1 
ATOM   6351 N N   . ASN C 2 63  ? 51.515  18.931  13.065  1.00 34.68  ? 63   ASN D N   1 
ATOM   6352 C CA  . ASN C 2 63  ? 52.013  20.134  13.728  1.00 36.85  ? 63   ASN D CA  1 
ATOM   6353 C C   . ASN C 2 63  ? 50.785  20.999  13.992  1.00 37.91  ? 63   ASN D C   1 
ATOM   6354 O O   . ASN C 2 63  ? 49.715  20.588  13.540  1.00 36.76  ? 63   ASN D O   1 
ATOM   6355 C CB  . ASN C 2 63  ? 53.060  20.886  12.925  1.00 38.39  ? 63   ASN D CB  1 
ATOM   6356 C CG  . ASN C 2 63  ? 52.646  21.649  11.704  1.00 39.69  ? 63   ASN D CG  1 
ATOM   6357 O OD1 . ASN C 2 63  ? 51.540  22.193  11.555  1.00 41.39  ? 63   ASN D OD1 1 
ATOM   6358 N ND2 . ASN C 2 63  ? 53.554  21.740  10.735  1.00 39.86  ? 63   ASN D ND2 1 
ATOM   6359 N N   . ARG C 2 64  ? 50.981  22.219  14.470  1.00 38.97  ? 64   ARG D N   1 
ATOM   6360 C CA  . ARG C 2 64  ? 49.892  23.086  14.867  1.00 40.27  ? 64   ARG D CA  1 
ATOM   6361 C C   . ARG C 2 64  ? 48.993  23.636  13.778  1.00 40.12  ? 64   ARG D C   1 
ATOM   6362 O O   . ARG C 2 64  ? 47.899  24.144  14.116  1.00 39.52  ? 64   ARG D O   1 
ATOM   6363 C CB  . ARG C 2 64  ? 50.404  24.235  15.751  1.00 43.64  ? 64   ARG D CB  1 
ATOM   6364 C CG  . ARG C 2 64  ? 50.642  25.560  15.062  1.00 47.96  ? 64   ARG D CG  1 
ATOM   6365 C CD  . ARG C 2 64  ? 51.778  26.355  15.685  1.00 50.35  ? 64   ARG D CD  1 
ATOM   6366 N NE  . ARG C 2 64  ? 53.066  25.976  15.105  1.00 53.76  ? 64   ARG D NE  1 
ATOM   6367 C CZ  . ARG C 2 64  ? 53.772  26.669  14.221  1.00 54.00  ? 64   ARG D CZ  1 
ATOM   6368 N NH1 . ARG C 2 64  ? 53.324  27.842  13.786  1.00 52.27  ? 64   ARG D NH1 1 
ATOM   6369 N NH2 . ARG C 2 64  ? 54.925  26.158  13.799  1.00 55.12  ? 64   ARG D NH2 1 
ATOM   6370 N N   . HIS C 2 65  ? 49.352  23.448  12.509  1.00 39.51  ? 65   HIS D N   1 
ATOM   6371 C CA  . HIS C 2 65  ? 48.483  23.968  11.449  1.00 38.20  ? 65   HIS D CA  1 
ATOM   6372 C C   . HIS C 2 65  ? 47.276  23.066  11.275  1.00 37.08  ? 65   HIS D C   1 
ATOM   6373 O O   . HIS C 2 65  ? 46.224  23.547  10.847  1.00 36.60  ? 65   HIS D O   1 
ATOM   6374 C CB  . HIS C 2 65  ? 49.290  24.159  10.172  1.00 38.83  ? 65   HIS D CB  1 
ATOM   6375 C CG  . HIS C 2 65  ? 50.423  25.127  10.416  1.00 38.02  ? 65   HIS D CG  1 
ATOM   6376 N ND1 . HIS C 2 65  ? 50.223  26.399  10.927  1.00 35.96  ? 65   HIS D ND1 1 
ATOM   6377 C CD2 . HIS C 2 65  ? 51.753  24.977  10.214  1.00 35.40  ? 65   HIS D CD2 1 
ATOM   6378 C CE1 . HIS C 2 65  ? 51.389  27.003  11.000  1.00 35.67  ? 65   HIS D CE1 1 
ATOM   6379 N NE2 . HIS C 2 65  ? 52.325  26.167  10.573  1.00 35.42  ? 65   HIS D NE2 1 
ATOM   6380 N N   . HIS C 2 66  ? 47.427  21.811  11.673  1.00 36.11  ? 66   HIS D N   1 
ATOM   6381 C CA  . HIS C 2 66  ? 46.303  20.881  11.647  1.00 36.39  ? 66   HIS D CA  1 
ATOM   6382 C C   . HIS C 2 66  ? 45.164  21.411  12.519  1.00 35.71  ? 66   HIS D C   1 
ATOM   6383 O O   . HIS C 2 66  ? 44.058  21.581  12.002  1.00 35.18  ? 66   HIS D O   1 
ATOM   6384 C CB  . HIS C 2 66  ? 46.677  19.451  12.101  1.00 33.79  ? 66   HIS D CB  1 
ATOM   6385 C CG  . HIS C 2 66  ? 45.471  18.566  11.888  1.00 34.63  ? 66   HIS D CG  1 
ATOM   6386 N ND1 . HIS C 2 66  ? 45.076  18.117  10.625  1.00 34.02  ? 66   HIS D ND1 1 
ATOM   6387 C CD2 . HIS C 2 66  ? 44.556  18.121  12.775  1.00 32.57  ? 66   HIS D CD2 1 
ATOM   6388 C CE1 . HIS C 2 66  ? 43.992  17.399  10.753  1.00 32.84  ? 66   HIS D CE1 1 
ATOM   6389 N NE2 . HIS C 2 66  ? 43.652  17.389  12.038  1.00 33.96  ? 66   HIS D NE2 1 
ATOM   6390 N N   . ASP C 2 67  ? 45.425  21.697  13.777  1.00 35.89  ? 67   ASP D N   1 
ATOM   6391 C CA  . ASP C 2 67  ? 44.436  22.238  14.715  1.00 38.19  ? 67   ASP D CA  1 
ATOM   6392 C C   . ASP C 2 67  ? 43.916  23.608  14.274  1.00 37.77  ? 67   ASP D C   1 
ATOM   6393 O O   . ASP C 2 67  ? 42.710  23.884  14.299  1.00 38.02  ? 67   ASP D O   1 
ATOM   6394 C CB  . ASP C 2 67  ? 45.012  22.360  16.126  1.00 41.63  ? 67   ASP D CB  1 
ATOM   6395 C CG  . ASP C 2 67  ? 45.103  21.035  16.861  1.00 46.56  ? 67   ASP D CG  1 
ATOM   6396 O OD1 . ASP C 2 67  ? 44.340  20.114  16.482  1.00 47.51  ? 67   ASP D OD1 1 
ATOM   6397 O OD2 . ASP C 2 67  ? 45.958  20.929  17.779  1.00 48.13  ? 67   ASP D OD2 1 
ATOM   6398 N N   . GLU C 2 68  ? 44.819  24.454  13.790  1.00 37.09  ? 68   GLU D N   1 
ATOM   6399 C CA  . GLU C 2 68  ? 44.406  25.743  13.245  1.00 37.73  ? 68   GLU D CA  1 
ATOM   6400 C C   . GLU C 2 68  ? 43.427  25.536  12.097  1.00 37.13  ? 68   GLU D C   1 
ATOM   6401 O O   . GLU C 2 68  ? 42.327  26.106  12.097  1.00 35.96  ? 68   GLU D O   1 
ATOM   6402 C CB  . GLU C 2 68  ? 45.637  26.534  12.789  1.00 39.92  ? 68   GLU D CB  1 
ATOM   6403 C CG  . GLU C 2 68  ? 46.527  26.881  13.980  1.00 42.62  ? 68   GLU D CG  1 
ATOM   6404 C CD  . GLU C 2 68  ? 47.928  27.291  13.583  1.00 45.20  ? 68   GLU D CD  1 
ATOM   6405 O OE1 . GLU C 2 68  ? 48.234  27.115  12.374  1.00 48.34  ? 68   GLU D OE1 1 
ATOM   6406 O OE2 . GLU C 2 68  ? 48.686  27.764  14.458  1.00 42.71  ? 68   GLU D OE2 1 
ATOM   6407 N N   . ILE C 2 69  ? 43.827  24.685  11.134  1.00 37.07  ? 69   ILE D N   1 
ATOM   6408 C CA  . ILE C 2 69  ? 42.962  24.451  9.978   1.00 37.10  ? 69   ILE D CA  1 
ATOM   6409 C C   . ILE C 2 69  ? 41.627  23.868  10.444  1.00 37.47  ? 69   ILE D C   1 
ATOM   6410 O O   . ILE C 2 69  ? 40.553  24.314  9.991   1.00 38.55  ? 69   ILE D O   1 
ATOM   6411 C CB  . ILE C 2 69  ? 43.600  23.588  8.885   1.00 36.06  ? 69   ILE D CB  1 
ATOM   6412 C CG1 . ILE C 2 69  ? 44.796  24.283  8.228   1.00 33.44  ? 69   ILE D CG1 1 
ATOM   6413 C CG2 . ILE C 2 69  ? 42.563  23.245  7.809   1.00 36.13  ? 69   ILE D CG2 1 
ATOM   6414 C CD1 . ILE C 2 69  ? 45.941  23.375  7.842   1.00 30.06  ? 69   ILE D CD1 1 
ATOM   6415 N N   . ALA C 2 70  ? 41.690  22.908  11.344  1.00 36.96  ? 70   ALA D N   1 
ATOM   6416 C CA  . ALA C 2 70  ? 40.507  22.253  11.883  1.00 38.78  ? 70   ALA D CA  1 
ATOM   6417 C C   . ALA C 2 70  ? 39.543  23.253  12.498  1.00 39.46  ? 70   ALA D C   1 
ATOM   6418 O O   . ALA C 2 70  ? 38.358  23.277  12.149  1.00 40.52  ? 70   ALA D O   1 
ATOM   6419 C CB  . ALA C 2 70  ? 40.934  21.230  12.932  1.00 38.44  ? 70   ALA D CB  1 
ATOM   6420 N N   . ALA C 2 71  ? 40.058  24.090  13.393  1.00 40.26  ? 71   ALA D N   1 
ATOM   6421 C CA  . ALA C 2 71  ? 39.271  25.134  14.041  1.00 40.95  ? 71   ALA D CA  1 
ATOM   6422 C C   . ALA C 2 71  ? 38.761  26.129  13.008  1.00 41.57  ? 71   ALA D C   1 
ATOM   6423 O O   . ALA C 2 71  ? 37.590  26.508  13.011  1.00 41.08  ? 71   ALA D O   1 
ATOM   6424 C CB  . ALA C 2 71  ? 40.136  25.846  15.077  1.00 41.90  ? 71   ALA D CB  1 
ATOM   6425 N N   . LEU C 2 72  ? 39.627  26.530  12.083  1.00 42.65  ? 72   LEU D N   1 
ATOM   6426 C CA  . LEU C 2 72  ? 39.259  27.452  11.006  1.00 43.72  ? 72   LEU D CA  1 
ATOM   6427 C C   . LEU C 2 72  ? 38.043  26.943  10.251  1.00 44.71  ? 72   LEU D C   1 
ATOM   6428 O O   . LEU C 2 72  ? 37.061  27.684  10.118  1.00 45.35  ? 72   LEU D O   1 
ATOM   6429 C CB  . LEU C 2 72  ? 40.435  27.668  10.069  1.00 42.20  ? 72   LEU D CB  1 
ATOM   6430 C CG  . LEU C 2 72  ? 40.263  28.429  8.755   1.00 40.65  ? 72   LEU D CG  1 
ATOM   6431 C CD1 . LEU C 2 72  ? 39.713  29.820  8.993   1.00 40.23  ? 72   LEU D CD1 1 
ATOM   6432 C CD2 . LEU C 2 72  ? 41.615  28.513  8.045   1.00 39.45  ? 72   LEU D CD2 1 
ATOM   6433 N N   . LEU C 2 73  ? 38.019  25.661  9.864   1.00 45.88  ? 73   LEU D N   1 
ATOM   6434 C CA  . LEU C 2 73  ? 36.847  25.173  9.123   1.00 46.10  ? 73   LEU D CA  1 
ATOM   6435 C C   . LEU C 2 73  ? 35.715  24.747  10.038  1.00 46.75  ? 73   LEU D C   1 
ATOM   6436 O O   . LEU C 2 73  ? 34.579  24.603  9.587   1.00 46.47  ? 73   LEU D O   1 
ATOM   6437 C CB  . LEU C 2 73  ? 37.238  24.044  8.171   1.00 45.80  ? 73   LEU D CB  1 
ATOM   6438 C CG  . LEU C 2 73  ? 38.367  24.321  7.173   1.00 44.79  ? 73   LEU D CG  1 
ATOM   6439 C CD1 . LEU C 2 73  ? 38.818  23.042  6.486   1.00 46.25  ? 73   LEU D CD1 1 
ATOM   6440 C CD2 . LEU C 2 73  ? 37.964  25.350  6.135   1.00 45.08  ? 73   LEU D CD2 1 
ATOM   6441 N N   . ALA C 2 74  ? 35.958  24.577  11.335  1.00 47.36  ? 74   ALA D N   1 
ATOM   6442 C CA  . ALA C 2 74  ? 34.895  24.134  12.238  1.00 47.81  ? 74   ALA D CA  1 
ATOM   6443 C C   . ALA C 2 74  ? 33.908  25.272  12.443  1.00 48.47  ? 74   ALA D C   1 
ATOM   6444 O O   . ALA C 2 74  ? 32.691  25.112  12.533  1.00 48.59  ? 74   ALA D O   1 
ATOM   6445 C CB  . ALA C 2 74  ? 35.493  23.681  13.557  1.00 46.59  ? 74   ALA D CB  1 
ATOM   6446 N N   . ALA C 2 75  ? 34.495  26.459  12.499  1.00 48.63  ? 75   ALA D N   1 
ATOM   6447 C CA  . ALA C 2 75  ? 33.765  27.693  12.716  1.00 49.99  ? 75   ALA D CA  1 
ATOM   6448 C C   . ALA C 2 75  ? 33.206  28.275  11.427  1.00 49.74  ? 75   ALA D C   1 
ATOM   6449 O O   . ALA C 2 75  ? 32.384  29.181  11.483  1.00 51.00  ? 75   ALA D O   1 
ATOM   6450 C CB  . ALA C 2 75  ? 34.714  28.735  13.323  1.00 49.46  ? 75   ALA D CB  1 
ATOM   6451 N N   . GLY C 2 76  ? 33.682  27.799  10.297  1.00 49.69  ? 76   GLY D N   1 
ATOM   6452 C CA  . GLY C 2 76  ? 33.301  28.311  9.006   1.00 49.49  ? 76   GLY D CA  1 
ATOM   6453 C C   . GLY C 2 76  ? 31.966  27.856  8.463   1.00 48.85  ? 76   GLY D C   1 
ATOM   6454 O O   . GLY C 2 76  ? 31.270  27.019  9.031   1.00 49.03  ? 76   GLY D O   1 
ATOM   6455 N N   . THR C 2 77  ? 31.625  28.428  7.305   1.00 48.41  ? 77   THR D N   1 
ATOM   6456 C CA  . THR C 2 77  ? 30.365  28.049  6.663   1.00 47.80  ? 77   THR D CA  1 
ATOM   6457 C C   . THR C 2 77  ? 30.386  26.579  6.285   1.00 47.46  ? 77   THR D C   1 
ATOM   6458 O O   . THR C 2 77  ? 31.217  26.107  5.502   1.00 48.70  ? 77   THR D O   1 
ATOM   6459 C CB  . THR C 2 77  ? 30.134  28.935  5.430   1.00 47.69  ? 77   THR D CB  1 
ATOM   6460 O OG1 . THR C 2 77  ? 31.354  29.022  4.684   1.00 46.72  ? 77   THR D OG1 1 
ATOM   6461 C CG2 . THR C 2 77  ? 29.686  30.330  5.828   1.00 46.41  ? 77   THR D CG2 1 
ATOM   6462 N N   . PRO C 2 78  ? 29.433  25.803  6.786   1.00 46.03  ? 78   PRO D N   1 
ATOM   6463 C CA  . PRO C 2 78  ? 29.300  24.388  6.507   1.00 44.60  ? 78   PRO D CA  1 
ATOM   6464 C C   . PRO C 2 78  ? 29.247  24.030  5.028   1.00 42.63  ? 78   PRO D C   1 
ATOM   6465 O O   . PRO C 2 78  ? 29.753  22.965  4.621   1.00 41.76  ? 78   PRO D O   1 
ATOM   6466 C CB  . PRO C 2 78  ? 28.018  23.978  7.234   1.00 45.27  ? 78   PRO D CB  1 
ATOM   6467 C CG  . PRO C 2 78  ? 27.280  25.259  7.458   1.00 45.83  ? 78   PRO D CG  1 
ATOM   6468 C CD  . PRO C 2 78  ? 28.372  26.262  7.722   1.00 46.09  ? 78   PRO D CD  1 
ATOM   6469 N N   . ARG C 2 79  ? 28.765  24.941  4.159   1.00 38.38  ? 79   ARG D N   1 
ATOM   6470 C CA  . ARG C 2 79  ? 28.779  24.634  2.735   1.00 33.94  ? 79   ARG D CA  1 
ATOM   6471 C C   . ARG C 2 79  ? 30.185  24.768  2.130   1.00 30.21  ? 79   ARG D C   1 
ATOM   6472 O O   . ARG C 2 79  ? 30.319  24.633  0.909   1.00 27.24  ? 79   ARG D O   1 
ATOM   6473 C CB  . ARG C 2 79  ? 27.741  25.437  1.966   1.00 32.39  ? 79   ARG D CB  1 
ATOM   6474 C CG  . ARG C 2 79  ? 26.310  25.005  2.210   1.00 37.22  ? 79   ARG D CG  1 
ATOM   6475 C CD  . ARG C 2 79  ? 25.540  25.007  0.905   1.00 44.21  ? 79   ARG D CD  1 
ATOM   6476 N NE  . ARG C 2 79  ? 24.756  26.138  0.550   1.00 48.20  ? 79   ARG D NE  1 
ATOM   6477 C CZ  . ARG C 2 79  ? 24.513  26.765  -0.588  1.00 53.31  ? 79   ARG D CZ  1 
ATOM   6478 N NH1 . ARG C 2 79  ? 25.033  26.438  -1.764  1.00 53.30  ? 79   ARG D NH1 1 
ATOM   6479 N NH2 . ARG C 2 79  ? 23.673  27.812  -0.578  1.00 54.53  ? 79   ARG D NH2 1 
ATOM   6480 N N   . THR C 2 80  ? 31.214  25.061  2.914   1.00 27.15  ? 80   THR D N   1 
ATOM   6481 C CA  . THR C 2 80  ? 32.560  25.154  2.379   1.00 25.44  ? 80   THR D CA  1 
ATOM   6482 C C   . THR C 2 80  ? 33.054  23.744  2.054   1.00 23.01  ? 80   THR D C   1 
ATOM   6483 O O   . THR C 2 80  ? 33.247  22.982  2.988   1.00 23.66  ? 80   THR D O   1 
ATOM   6484 C CB  . THR C 2 80  ? 33.585  25.876  3.268   1.00 25.87  ? 80   THR D CB  1 
ATOM   6485 O OG1 . THR C 2 80  ? 33.168  27.250  3.328   1.00 28.71  ? 80   THR D OG1 1 
ATOM   6486 C CG2 . THR C 2 80  ? 35.004  25.885  2.679   1.00 21.26  ? 80   THR D CG2 1 
ATOM   6487 N N   . THR C 2 81  ? 33.239  23.428  0.776   1.00 21.05  ? 81   THR D N   1 
ATOM   6488 C CA  . THR C 2 81  ? 33.734  22.093  0.404   1.00 19.49  ? 81   THR D CA  1 
ATOM   6489 C C   . THR C 2 81  ? 35.185  21.885  0.825   1.00 17.91  ? 81   THR D C   1 
ATOM   6490 O O   . THR C 2 81  ? 35.999  22.809  0.821   1.00 16.25  ? 81   THR D O   1 
ATOM   6491 C CB  . THR C 2 81  ? 33.530  21.923  -1.118  1.00 16.48  ? 81   THR D CB  1 
ATOM   6492 O OG1 . THR C 2 81  ? 32.157  22.201  -1.402  1.00 18.58  ? 81   THR D OG1 1 
ATOM   6493 C CG2 . THR C 2 81  ? 33.915  20.529  -1.547  1.00 13.77  ? 81   THR D CG2 1 
ATOM   6494 N N   . LEU C 2 82  ? 35.524  20.679  1.280   1.00 18.83  ? 82   LEU D N   1 
ATOM   6495 C CA  . LEU C 2 82  ? 36.878  20.402  1.775   1.00 18.82  ? 82   LEU D CA  1 
ATOM   6496 C C   . LEU C 2 82  ? 37.566  19.247  1.073   1.00 17.52  ? 82   LEU D C   1 
ATOM   6497 O O   . LEU C 2 82  ? 37.081  18.127  1.019   1.00 15.97  ? 82   LEU D O   1 
ATOM   6498 C CB  . LEU C 2 82  ? 36.911  20.160  3.294   1.00 20.90  ? 82   LEU D CB  1 
ATOM   6499 C CG  . LEU C 2 82  ? 38.268  19.925  3.948   1.00 23.38  ? 82   LEU D CG  1 
ATOM   6500 C CD1 . LEU C 2 82  ? 39.263  21.046  3.790   1.00 20.89  ? 82   LEU D CD1 1 
ATOM   6501 C CD2 . LEU C 2 82  ? 38.114  19.596  5.442   1.00 25.76  ? 82   LEU D CD2 1 
ATOM   6502 N N   . VAL C 2 83  ? 38.732  19.573  0.500   1.00 17.80  ? 83   VAL D N   1 
ATOM   6503 C CA  . VAL C 2 83  ? 39.546  18.592  -0.221  1.00 16.85  ? 83   VAL D CA  1 
ATOM   6504 C C   . VAL C 2 83  ? 40.953  18.496  0.365   1.00 16.63  ? 83   VAL D C   1 
ATOM   6505 O O   . VAL C 2 83  ? 41.668  19.482  0.500   1.00 15.86  ? 83   VAL D O   1 
ATOM   6506 C CB  . VAL C 2 83  ? 39.608  18.872  -1.737  1.00 13.84  ? 83   VAL D CB  1 
ATOM   6507 C CG1 . VAL C 2 83  ? 40.507  17.848  -2.451  1.00 11.75  ? 83   VAL D CG1 1 
ATOM   6508 C CG2 . VAL C 2 83  ? 38.198  18.811  -2.312  1.00 9.35   ? 83   VAL D CG2 1 
ATOM   6509 N N   . ALA C 2 84  ? 41.354  17.276  0.723   1.00 17.58  ? 84   ALA D N   1 
ATOM   6510 C CA  . ALA C 2 84  ? 42.677  17.097  1.316   1.00 19.00  ? 84   ALA D CA  1 
ATOM   6511 C C   . ALA C 2 84  ? 43.677  16.508  0.307   1.00 18.42  ? 84   ALA D C   1 
ATOM   6512 O O   . ALA C 2 84  ? 43.348  15.599  -0.416  1.00 17.09  ? 84   ALA D O   1 
ATOM   6513 C CB  . ALA C 2 84  ? 42.607  16.227  2.578   1.00 14.96  ? 84   ALA D CB  1 
ATOM   6514 N N   . LEU C 2 85  ? 44.884  17.044  0.289   1.00 18.46  ? 85   LEU D N   1 
ATOM   6515 C CA  . LEU C 2 85  ? 45.993  16.522  -0.488  1.00 19.37  ? 85   LEU D CA  1 
ATOM   6516 C C   . LEU C 2 85  ? 46.688  15.542  0.472   1.00 18.58  ? 85   LEU D C   1 
ATOM   6517 O O   . LEU C 2 85  ? 46.913  15.984  1.612   1.00 17.04  ? 85   LEU D O   1 
ATOM   6518 C CB  . LEU C 2 85  ? 46.998  17.597  -0.906  1.00 19.50  ? 85   LEU D CB  1 
ATOM   6519 C CG  . LEU C 2 85  ? 46.361  18.815  -1.586  1.00 23.68  ? 85   LEU D CG  1 
ATOM   6520 C CD1 . LEU C 2 85  ? 47.440  19.739  -2.143  1.00 24.77  ? 85   LEU D CD1 1 
ATOM   6521 C CD2 . LEU C 2 85  ? 45.372  18.434  -2.672  1.00 21.55  ? 85   LEU D CD2 1 
ATOM   6522 N N   . VAL C 2 86  ? 46.770  14.298  0.086   1.00 17.58  ? 86   VAL D N   1 
ATOM   6523 C CA  . VAL C 2 86  ? 47.260  13.260  0.958   1.00 20.21  ? 86   VAL D CA  1 
ATOM   6524 C C   . VAL C 2 86  ? 48.496  12.587  0.353   1.00 19.85  ? 86   VAL D C   1 
ATOM   6525 O O   . VAL C 2 86  ? 48.436  12.134  -0.798  1.00 19.26  ? 86   VAL D O   1 
ATOM   6526 C CB  . VAL C 2 86  ? 46.278  12.055  1.119   1.00 25.03  ? 86   VAL D CB  1 
ATOM   6527 C CG1 . VAL C 2 86  ? 46.646  11.382  2.450   1.00 25.60  ? 86   VAL D CG1 1 
ATOM   6528 C CG2 . VAL C 2 86  ? 44.810  12.330  1.017   1.00 23.65  ? 86   VAL D CG2 1 
ATOM   6529 N N   . GLU C 2 87  ? 49.496  12.322  1.159   1.00 21.50  ? 87   GLU D N   1 
ATOM   6530 C CA  . GLU C 2 87  ? 50.671  11.635  0.621   1.00 22.10  ? 87   GLU D CA  1 
ATOM   6531 C C   . GLU C 2 87  ? 50.904  10.355  1.397   1.00 20.67  ? 87   GLU D C   1 
ATOM   6532 O O   . GLU C 2 87  ? 51.763  9.601   0.925   1.00 23.40  ? 87   GLU D O   1 
ATOM   6533 C CB  . GLU C 2 87  ? 51.965  12.441  0.575   1.00 27.79  ? 87   GLU D CB  1 
ATOM   6534 C CG  . GLU C 2 87  ? 53.037  11.741  -0.290  1.00 30.85  ? 87   GLU D CG  1 
ATOM   6535 C CD  . GLU C 2 87  ? 54.347  12.470  -0.316  1.00 36.52  ? 87   GLU D CD  1 
ATOM   6536 O OE1 . GLU C 2 87  ? 54.831  12.956  0.744   1.00 38.11  ? 87   GLU D OE1 1 
ATOM   6537 O OE2 . GLU C 2 87  ? 54.879  12.574  -1.443  1.00 40.46  ? 87   GLU D OE2 1 
ATOM   6538 N N   . TYR C 2 88  ? 50.203  10.069  2.482   1.00 16.90  ? 88   TYR D N   1 
ATOM   6539 C CA  . TYR C 2 88  ? 50.478  8.822   3.191   1.00 14.38  ? 88   TYR D CA  1 
ATOM   6540 C C   . TYR C 2 88  ? 49.145  8.099   3.327   1.00 15.31  ? 88   TYR D C   1 
ATOM   6541 O O   . TYR C 2 88  ? 48.122  8.780   3.378   1.00 13.43  ? 88   TYR D O   1 
ATOM   6542 C CB  . TYR C 2 88  ? 51.043  8.990   4.613   1.00 12.87  ? 88   TYR D CB  1 
ATOM   6543 C CG  . TYR C 2 88  ? 52.478  9.480   4.543   1.00 13.30  ? 88   TYR D CG  1 
ATOM   6544 C CD1 . TYR C 2 88  ? 52.759  10.839  4.486   1.00 12.93  ? 88   TYR D CD1 1 
ATOM   6545 C CD2 . TYR C 2 88  ? 53.538  8.577   4.530   1.00 11.89  ? 88   TYR D CD2 1 
ATOM   6546 C CE1 . TYR C 2 88  ? 54.058  11.278  4.372   1.00 13.91  ? 88   TYR D CE1 1 
ATOM   6547 C CE2 . TYR C 2 88  ? 54.837  9.019   4.446   1.00 12.07  ? 88   TYR D CE2 1 
ATOM   6548 C CZ  . TYR C 2 88  ? 55.082  10.359  4.350   1.00 14.12  ? 88   TYR D CZ  1 
ATOM   6549 O OH  . TYR C 2 88  ? 56.375  10.815  4.259   1.00 17.72  ? 88   TYR D OH  1 
ATOM   6550 N N   . GLU C 2 89  ? 49.202  6.785   3.422   1.00 14.29  ? 89   GLU D N   1 
ATOM   6551 C CA  . GLU C 2 89  ? 47.991  6.010   3.561   1.00 15.53  ? 89   GLU D CA  1 
ATOM   6552 C C   . GLU C 2 89  ? 47.966  5.410   4.965   1.00 14.30  ? 89   GLU D C   1 
ATOM   6553 O O   . GLU C 2 89  ? 47.216  4.473   5.106   1.00 13.65  ? 89   GLU D O   1 
ATOM   6554 C CB  . GLU C 2 89  ? 47.957  4.838   2.575   1.00 17.16  ? 89   GLU D CB  1 
ATOM   6555 C CG  . GLU C 2 89  ? 48.165  5.145   1.115   1.00 16.47  ? 89   GLU D CG  1 
ATOM   6556 C CD  . GLU C 2 89  ? 48.412  3.889   0.307   1.00 20.10  ? 89   GLU D CD  1 
ATOM   6557 O OE1 . GLU C 2 89  ? 47.834  2.814   0.547   1.00 20.59  ? 89   GLU D OE1 1 
ATOM   6558 O OE2 . GLU C 2 89  ? 49.218  3.862   -0.628  1.00 22.26  ? 89   GLU D OE2 1 
ATOM   6559 N N   . SER C 2 90  ? 48.863  5.823   5.847   1.00 14.21  ? 90   SER D N   1 
ATOM   6560 C CA  . SER C 2 90  ? 48.971  5.177   7.138   1.00 14.54  ? 90   SER D CA  1 
ATOM   6561 C C   . SER C 2 90  ? 47.925  5.710   8.093   1.00 14.57  ? 90   SER D C   1 
ATOM   6562 O O   . SER C 2 90  ? 47.350  6.754   7.871   1.00 14.34  ? 90   SER D O   1 
ATOM   6563 C CB  . SER C 2 90  ? 50.426  5.353   7.583   1.00 17.97  ? 90   SER D CB  1 
ATOM   6564 O OG  . SER C 2 90  ? 50.852  6.640   7.132   1.00 16.90  ? 90   SER D OG  1 
ATOM   6565 N N   . PRO C 2 91  ? 47.631  5.001   9.164   1.00 15.30  ? 91   PRO D N   1 
ATOM   6566 C CA  . PRO C 2 91  ? 46.551  5.336   10.084  1.00 14.93  ? 91   PRO D CA  1 
ATOM   6567 C C   . PRO C 2 91  ? 46.543  6.699   10.722  1.00 15.16  ? 91   PRO D C   1 
ATOM   6568 O O   . PRO C 2 91  ? 45.444  7.287   10.710  1.00 13.08  ? 91   PRO D O   1 
ATOM   6569 C CB  . PRO C 2 91  ? 46.513  4.184   11.089  1.00 15.56  ? 91   PRO D CB  1 
ATOM   6570 C CG  . PRO C 2 91  ? 47.161  3.040   10.360  1.00 16.91  ? 91   PRO D CG  1 
ATOM   6571 C CD  . PRO C 2 91  ? 48.248  3.662   9.475   1.00 16.22  ? 91   PRO D CD  1 
ATOM   6572 N N   . ALA C 2 92  ? 47.634  7.276   11.225  1.00 14.89  ? 92   ALA D N   1 
ATOM   6573 C CA  . ALA C 2 92  ? 47.501  8.622   11.794  1.00 16.58  ? 92   ALA D CA  1 
ATOM   6574 C C   . ALA C 2 92  ? 47.159  9.648   10.730  1.00 17.03  ? 92   ALA D C   1 
ATOM   6575 O O   . ALA C 2 92  ? 46.345  10.538  11.018  1.00 18.30  ? 92   ALA D O   1 
ATOM   6576 C CB  . ALA C 2 92  ? 48.734  9.091   12.566  1.00 17.42  ? 92   ALA D CB  1 
ATOM   6577 N N   . VAL C 2 93  ? 47.703  9.569   9.536   1.00 16.21  ? 93   VAL D N   1 
ATOM   6578 C CA  . VAL C 2 93  ? 47.374  10.536  8.497   1.00 16.83  ? 93   VAL D CA  1 
ATOM   6579 C C   . VAL C 2 93  ? 45.909  10.390  8.083   1.00 16.80  ? 93   VAL D C   1 
ATOM   6580 O O   . VAL C 2 93  ? 45.199  11.412  8.004   1.00 15.77  ? 93   VAL D O   1 
ATOM   6581 C CB  . VAL C 2 93  ? 48.307  10.415  7.271   1.00 18.45  ? 93   VAL D CB  1 
ATOM   6582 C CG1 . VAL C 2 93  ? 47.752  11.165  6.073   1.00 15.52  ? 93   VAL D CG1 1 
ATOM   6583 C CG2 . VAL C 2 93  ? 49.701  10.918  7.661   1.00 16.45  ? 93   VAL D CG2 1 
ATOM   6584 N N   . LEU C 2 94  ? 45.480  9.163   7.840   1.00 15.37  ? 94   LEU D N   1 
ATOM   6585 C CA  . LEU C 2 94  ? 44.091  8.921   7.456   1.00 16.39  ? 94   LEU D CA  1 
ATOM   6586 C C   . LEU C 2 94  ? 43.078  9.314   8.532   1.00 15.83  ? 94   LEU D C   1 
ATOM   6587 O O   . LEU C 2 94  ? 41.935  9.590   8.200   1.00 16.90  ? 94   LEU D O   1 
ATOM   6588 C CB  . LEU C 2 94  ? 43.729  7.453   7.181   1.00 17.43  ? 94   LEU D CB  1 
ATOM   6589 C CG  . LEU C 2 94  ? 44.436  6.689   6.074   1.00 21.54  ? 94   LEU D CG  1 
ATOM   6590 C CD1 . LEU C 2 94  ? 43.944  5.249   6.012   1.00 21.99  ? 94   LEU D CD1 1 
ATOM   6591 C CD2 . LEU C 2 94  ? 44.221  7.343   4.712   1.00 21.69  ? 94   LEU D CD2 1 
ATOM   6592 N N   . SER C 2 95  ? 43.460  9.245   9.793   1.00 17.05  ? 95   SER D N   1 
ATOM   6593 C CA  . SER C 2 95  ? 42.581  9.556   10.919  1.00 17.66  ? 95   SER D CA  1 
ATOM   6594 C C   . SER C 2 95  ? 42.342  11.064  10.888  1.00 19.04  ? 95   SER D C   1 
ATOM   6595 O O   . SER C 2 95  ? 41.225  11.496  11.116  1.00 17.76  ? 95   SER D O   1 
ATOM   6596 C CB  . SER C 2 95  ? 43.201  9.071   12.218  1.00 15.98  ? 95   SER D CB  1 
ATOM   6597 O OG  . SER C 2 95  ? 43.142  7.629   12.261  1.00 22.98  ? 95   SER D OG  1 
ATOM   6598 N N   . GLN C 2 96  ? 43.423  11.804  10.539  1.00 18.33  ? 96   GLN D N   1 
ATOM   6599 C CA  . GLN C 2 96  ? 43.389  13.234  10.368  1.00 18.49  ? 96   GLN D CA  1 
ATOM   6600 C C   . GLN C 2 96  ? 42.390  13.572  9.256   1.00 18.00  ? 96   GLN D C   1 
ATOM   6601 O O   . GLN C 2 96  ? 41.531  14.415  9.465   1.00 18.42  ? 96   GLN D O   1 
ATOM   6602 C CB  . GLN C 2 96  ? 44.744  13.877  10.059  1.00 17.51  ? 96   GLN D CB  1 
ATOM   6603 C CG  . GLN C 2 96  ? 45.735  13.823  11.202  1.00 21.87  ? 96   GLN D CG  1 
ATOM   6604 C CD  . GLN C 2 96  ? 47.053  14.545  10.938  1.00 25.95  ? 96   GLN D CD  1 
ATOM   6605 O OE1 . GLN C 2 96  ? 47.088  15.805  10.835  1.00 27.29  ? 96   GLN D OE1 1 
ATOM   6606 N NE2 . GLN C 2 96  ? 48.094  13.726  10.841  1.00 16.96  ? 96   GLN D NE2 1 
ATOM   6607 N N   . ILE C 2 97  ? 42.408  12.856  8.136   1.00 17.76  ? 97   ILE D N   1 
ATOM   6608 C CA  . ILE C 2 97  ? 41.436  13.114  7.070   1.00 18.09  ? 97   ILE D CA  1 
ATOM   6609 C C   . ILE C 2 97  ? 40.016  12.892  7.561   1.00 17.62  ? 97   ILE D C   1 
ATOM   6610 O O   . ILE C 2 97  ? 39.078  13.652  7.275   1.00 18.68  ? 97   ILE D O   1 
ATOM   6611 C CB  . ILE C 2 97  ? 41.766  12.218  5.869   1.00 20.93  ? 97   ILE D CB  1 
ATOM   6612 C CG1 . ILE C 2 97  ? 43.120  12.660  5.263   1.00 21.16  ? 97   ILE D CG1 1 
ATOM   6613 C CG2 . ILE C 2 97  ? 40.689  12.193  4.814   1.00 17.35  ? 97   ILE D CG2 1 
ATOM   6614 C CD1 . ILE C 2 97  ? 43.844  11.493  4.634   1.00 23.68  ? 97   ILE D CD1 1 
ATOM   6615 N N   . ILE C 2 98  ? 39.806  11.796  8.262   1.00 17.79  ? 98   ILE D N   1 
ATOM   6616 C CA  . ILE C 2 98  ? 38.501  11.430  8.788   1.00 18.06  ? 98   ILE D CA  1 
ATOM   6617 C C   . ILE C 2 98  ? 38.034  12.490  9.789   1.00 18.58  ? 98   ILE D C   1 
ATOM   6618 O O   . ILE C 2 98  ? 36.898  12.907  9.657   1.00 18.37  ? 98   ILE D O   1 
ATOM   6619 C CB  . ILE C 2 98  ? 38.531  10.057  9.463   1.00 13.06  ? 98   ILE D CB  1 
ATOM   6620 C CG1 . ILE C 2 98  ? 38.882  9.003   8.419   1.00 13.28  ? 98   ILE D CG1 1 
ATOM   6621 C CG2 . ILE C 2 98  ? 37.205  9.714   10.149  1.00 13.62  ? 98   ILE D CG2 1 
ATOM   6622 C CD1 . ILE C 2 98  ? 39.149  7.619   8.961   1.00 13.12  ? 98   ILE D CD1 1 
ATOM   6623 N N   . GLU C 2 99  ? 38.896  12.930  10.693  1.00 19.78  ? 99   GLU D N   1 
ATOM   6624 C CA  . GLU C 2 99  ? 38.523  13.906  11.723  1.00 20.14  ? 99   GLU D CA  1 
ATOM   6625 C C   . GLU C 2 99  ? 38.224  15.251  11.076  1.00 19.46  ? 99   GLU D C   1 
ATOM   6626 O O   . GLU C 2 99  ? 37.307  15.905  11.571  1.00 21.58  ? 99   GLU D O   1 
ATOM   6627 C CB  . GLU C 2 99  ? 39.589  14.032  12.821  1.00 22.45  ? 99   GLU D CB  1 
ATOM   6628 C CG  . GLU C 2 99  ? 39.517  12.971  13.908  1.00 29.66  ? 99   GLU D CG  1 
ATOM   6629 C CD  . GLU C 2 99  ? 40.848  12.485  14.469  1.00 34.71  ? 99   GLU D CD  1 
ATOM   6630 O OE1 . GLU C 2 99  ? 41.849  13.241  14.457  1.00 34.78  ? 99   GLU D OE1 1 
ATOM   6631 O OE2 . GLU C 2 99  ? 40.948  11.308  14.930  1.00 34.92  ? 99   GLU D OE2 1 
ATOM   6632 N N   . LEU C 2 100 ? 38.907  15.693  10.040  1.00 16.67  ? 100  LEU D N   1 
ATOM   6633 C CA  . LEU C 2 100 ? 38.618  16.904  9.305   1.00 16.74  ? 100  LEU D CA  1 
ATOM   6634 C C   . LEU C 2 100 ? 37.315  16.730  8.494   1.00 17.00  ? 100  LEU D C   1 
ATOM   6635 O O   . LEU C 2 100 ? 36.750  17.723  8.061   1.00 16.95  ? 100  LEU D O   1 
ATOM   6636 C CB  . LEU C 2 100 ? 39.720  17.240  8.286   1.00 19.84  ? 100  LEU D CB  1 
ATOM   6637 C CG  . LEU C 2 100 ? 41.052  17.748  8.883   1.00 23.73  ? 100  LEU D CG  1 
ATOM   6638 C CD1 . LEU C 2 100 ? 42.124  17.851  7.836   1.00 19.92  ? 100  LEU D CD1 1 
ATOM   6639 C CD2 . LEU C 2 100 ? 40.781  19.096  9.567   1.00 24.37  ? 100  LEU D CD2 1 
ATOM   6640 N N   . GLU C 2 101 ? 36.845  15.523  8.227   1.00 15.12  ? 101  GLU D N   1 
ATOM   6641 C CA  . GLU C 2 101 ? 35.646  15.249  7.481   1.00 18.39  ? 101  GLU D CA  1 
ATOM   6642 C C   . GLU C 2 101 ? 35.713  15.839  6.074   1.00 18.05  ? 101  GLU D C   1 
ATOM   6643 O O   . GLU C 2 101 ? 34.814  16.577  5.645   1.00 19.59  ? 101  GLU D O   1 
ATOM   6644 C CB  . GLU C 2 101 ? 34.339  15.713  8.186   1.00 19.91  ? 101  GLU D CB  1 
ATOM   6645 C CG  . GLU C 2 101 ? 34.231  15.131  9.573   1.00 26.77  ? 101  GLU D CG  1 
ATOM   6646 C CD  . GLU C 2 101 ? 33.059  15.475  10.441  1.00 32.55  ? 101  GLU D CD  1 
ATOM   6647 O OE1 . GLU C 2 101 ? 32.251  16.371  10.125  1.00 35.54  ? 101  GLU D OE1 1 
ATOM   6648 O OE2 . GLU C 2 101 ? 32.930  14.836  11.521  1.00 36.21  ? 101  GLU D OE2 1 
ATOM   6649 N N   . CYS C 2 102 ? 36.734  15.472  5.323   1.00 16.81  ? 102  CYS D N   1 
ATOM   6650 C CA  . CYS C 2 102 ? 36.911  15.947  3.963   1.00 15.84  ? 102  CYS D CA  1 
ATOM   6651 C C   . CYS C 2 102 ? 35.731  15.501  3.102   1.00 16.08  ? 102  CYS D C   1 
ATOM   6652 O O   . CYS C 2 102 ? 35.134  14.442  3.371   1.00 15.63  ? 102  CYS D O   1 
ATOM   6653 C CB  . CYS C 2 102 ? 38.231  15.344  3.437   1.00 15.20  ? 102  CYS D CB  1 
ATOM   6654 S SG  . CYS C 2 102 ? 39.631  15.808  4.470   1.00 23.24  ? 102  CYS D SG  1 
ATOM   6655 N N   . HIS C 2 103 ? 35.474  16.237  2.031   1.00 14.97  ? 103  HIS D N   1 
ATOM   6656 C CA  . HIS C 2 103 ? 34.457  15.812  1.055   1.00 14.04  ? 103  HIS D CA  1 
ATOM   6657 C C   . HIS C 2 103 ? 35.135  15.150  -0.141  1.00 14.38  ? 103  HIS D C   1 
ATOM   6658 O O   . HIS C 2 103 ? 34.485  14.601  -1.036  1.00 11.90  ? 103  HIS D O   1 
ATOM   6659 C CB  . HIS C 2 103 ? 33.683  17.044  0.609   1.00 16.33  ? 103  HIS D CB  1 
ATOM   6660 C CG  . HIS C 2 103 ? 32.981  17.726  1.748   1.00 17.47  ? 103  HIS D CG  1 
ATOM   6661 N ND1 . HIS C 2 103 ? 33.344  18.967  2.208   1.00 16.85  ? 103  HIS D ND1 1 
ATOM   6662 C CD2 . HIS C 2 103 ? 31.921  17.259  2.500   1.00 14.17  ? 103  HIS D CD2 1 
ATOM   6663 C CE1 . HIS C 2 103 ? 32.520  19.256  3.221   1.00 18.00  ? 103  HIS D CE1 1 
ATOM   6664 N NE2 . HIS C 2 103 ? 31.674  18.260  3.398   1.00 15.97  ? 103  HIS D NE2 1 
ATOM   6665 N N   . GLY C 2 104 ? 36.479  15.199  -0.162  1.00 13.02  ? 104  GLY D N   1 
ATOM   6666 C CA  . GLY C 2 104 ? 37.221  14.573  -1.261  1.00 12.41  ? 104  GLY D CA  1 
ATOM   6667 C C   . GLY C 2 104 ? 38.709  14.607  -0.987  1.00 12.57  ? 104  GLY D C   1 
ATOM   6668 O O   . GLY C 2 104 ? 39.172  15.347  -0.097  1.00 13.23  ? 104  GLY D O   1 
ATOM   6669 N N   . VAL C 2 105 ? 39.491  13.743  -1.615  1.00 13.10  ? 105  VAL D N   1 
ATOM   6670 C CA  . VAL C 2 105 ? 40.937  13.682  -1.386  1.00 14.98  ? 105  VAL D CA  1 
ATOM   6671 C C   . VAL C 2 105 ? 41.674  13.635  -2.720  1.00 14.54  ? 105  VAL D C   1 
ATOM   6672 O O   . VAL C 2 105 ? 41.055  13.182  -3.686  1.00 15.51  ? 105  VAL D O   1 
ATOM   6673 C CB  . VAL C 2 105 ? 41.399  12.453  -0.559  1.00 16.80  ? 105  VAL D CB  1 
ATOM   6674 C CG1 . VAL C 2 105 ? 40.858  12.439  0.872   1.00 16.43  ? 105  VAL D CG1 1 
ATOM   6675 C CG2 . VAL C 2 105 ? 41.048  11.143  -1.265  1.00 11.90  ? 105  VAL D CG2 1 
ATOM   6676 N N   . ILE C 2 106 ? 42.928  13.997  -2.803  1.00 13.61  ? 106  ILE D N   1 
ATOM   6677 C CA  . ILE C 2 106 ? 43.736  13.882  -4.016  1.00 12.89  ? 106  ILE D CA  1 
ATOM   6678 C C   . ILE C 2 106 ? 45.073  13.309  -3.495  1.00 14.74  ? 106  ILE D C   1 
ATOM   6679 O O   . ILE C 2 106 ? 45.695  13.925  -2.626  1.00 11.40  ? 106  ILE D O   1 
ATOM   6680 C CB  . ILE C 2 106 ? 43.978  15.178  -4.768  1.00 15.46  ? 106  ILE D CB  1 
ATOM   6681 C CG1 . ILE C 2 106 ? 42.751  15.794  -5.499  1.00 17.75  ? 106  ILE D CG1 1 
ATOM   6682 C CG2 . ILE C 2 106 ? 45.075  15.043  -5.831  1.00 15.12  ? 106  ILE D CG2 1 
ATOM   6683 C CD1 . ILE C 2 106 ? 42.955  17.300  -5.723  1.00 15.73  ? 106  ILE D CD1 1 
ATOM   6684 N N   . THR C 2 107 ? 45.411  12.087  -3.898  1.00 14.36  ? 107  THR D N   1 
ATOM   6685 C CA  . THR C 2 107 ? 46.665  11.502  -3.404  1.00 16.72  ? 107  THR D CA  1 
ATOM   6686 C C   . THR C 2 107 ? 47.819  12.060  -4.216  1.00 18.62  ? 107  THR D C   1 
ATOM   6687 O O   . THR C 2 107 ? 47.617  12.529  -5.335  1.00 19.38  ? 107  THR D O   1 
ATOM   6688 C CB  . THR C 2 107 ? 46.632  9.984   -3.389  1.00 16.77  ? 107  THR D CB  1 
ATOM   6689 O OG1 . THR C 2 107 ? 46.457  9.552   -4.750  1.00 17.72  ? 107  THR D OG1 1 
ATOM   6690 C CG2 . THR C 2 107 ? 45.443  9.511   -2.548  1.00 14.83  ? 107  THR D CG2 1 
ATOM   6691 N N   . GLN C 2 108 ? 48.958  12.259  -3.568  1.00 19.82  ? 108  GLN D N   1 
ATOM   6692 C CA  . GLN C 2 108 ? 50.140  12.831  -4.210  1.00 21.95  ? 108  GLN D CA  1 
ATOM   6693 C C   . GLN C 2 108 ? 51.049  11.758  -4.768  1.00 23.64  ? 108  GLN D C   1 
ATOM   6694 O O   . GLN C 2 108 ? 50.986  10.608  -4.335  1.00 23.62  ? 108  GLN D O   1 
ATOM   6695 C CB  . GLN C 2 108 ? 50.840  13.727  -3.165  1.00 22.69  ? 108  GLN D CB  1 
ATOM   6696 C CG  . GLN C 2 108 ? 49.806  14.743  -2.712  1.00 24.71  ? 108  GLN D CG  1 
ATOM   6697 C CD  . GLN C 2 108 ? 50.238  15.894  -1.888  1.00 26.75  ? 108  GLN D CD  1 
ATOM   6698 O OE1 . GLN C 2 108 ? 50.234  15.796  -0.651  1.00 32.70  ? 108  GLN D OE1 1 
ATOM   6699 N NE2 . GLN C 2 108 ? 50.586  17.017  -2.492  1.00 24.82  ? 108  GLN D NE2 1 
ATOM   6700 N N   . PRO C 2 109 ? 51.863  12.120  -5.763  1.00 24.19  ? 109  PRO D N   1 
ATOM   6701 C CA  . PRO C 2 109 ? 51.944  13.465  -6.287  1.00 23.03  ? 109  PRO D CA  1 
ATOM   6702 C C   . PRO C 2 109 ? 50.775  13.907  -7.165  1.00 24.05  ? 109  PRO D C   1 
ATOM   6703 O O   . PRO C 2 109 ? 50.268  13.271  -8.103  1.00 23.43  ? 109  PRO D O   1 
ATOM   6704 C CB  . PRO C 2 109 ? 53.203  13.435  -7.178  1.00 21.97  ? 109  PRO D CB  1 
ATOM   6705 C CG  . PRO C 2 109 ? 53.360  12.022  -7.567  1.00 22.63  ? 109  PRO D CG  1 
ATOM   6706 C CD  . PRO C 2 109 ? 52.815  11.190  -6.436  1.00 22.58  ? 109  PRO D CD  1 
ATOM   6707 N N   . LEU C 2 110 ? 50.309  15.112  -6.886  1.00 23.95  ? 110  LEU D N   1 
ATOM   6708 C CA  . LEU C 2 110 ? 49.268  15.789  -7.648  1.00 25.08  ? 110  LEU D CA  1 
ATOM   6709 C C   . LEU C 2 110 ? 49.705  16.019  -9.088  1.00 24.72  ? 110  LEU D C   1 
ATOM   6710 O O   . LEU C 2 110 ? 50.886  16.155  -9.424  1.00 25.61  ? 110  LEU D O   1 
ATOM   6711 C CB  . LEU C 2 110 ? 49.061  17.130  -6.929  1.00 27.14  ? 110  LEU D CB  1 
ATOM   6712 C CG  . LEU C 2 110 ? 48.389  18.247  -7.714  1.00 30.72  ? 110  LEU D CG  1 
ATOM   6713 C CD1 . LEU C 2 110 ? 46.899  18.218  -7.468  1.00 30.29  ? 110  LEU D CD1 1 
ATOM   6714 C CD2 . LEU C 2 110 ? 49.008  19.588  -7.348  1.00 33.32  ? 110  LEU D CD2 1 
ATOM   6715 N N   . ASP C 2 111 ? 48.761  16.036  -9.992  1.00 23.28  ? 111  ASP D N   1 
ATOM   6716 C CA  . ASP C 2 111 ? 48.957  16.347  -11.409 1.00 21.09  ? 111  ASP D CA  1 
ATOM   6717 C C   . ASP C 2 111 ? 47.608  16.963  -11.832 1.00 18.87  ? 111  ASP D C   1 
ATOM   6718 O O   . ASP C 2 111 ? 46.631  16.713  -11.143 1.00 17.28  ? 111  ASP D O   1 
ATOM   6719 C CB  . ASP C 2 111 ? 49.334  15.205  -12.310 1.00 17.19  ? 111  ASP D CB  1 
ATOM   6720 C CG  . ASP C 2 111 ? 48.280  14.179  -12.586 1.00 19.49  ? 111  ASP D CG  1 
ATOM   6721 O OD1 . ASP C 2 111 ? 47.135  14.476  -12.988 1.00 18.35  ? 111  ASP D OD1 1 
ATOM   6722 O OD2 . ASP C 2 111 ? 48.609  12.978  -12.428 1.00 24.96  ? 111  ASP D OD2 1 
ATOM   6723 N N   . ALA C 2 112 ? 47.544  17.698  -12.906 1.00 17.91  ? 112  ALA D N   1 
ATOM   6724 C CA  . ALA C 2 112 ? 46.331  18.364  -13.335 1.00 18.49  ? 112  ALA D CA  1 
ATOM   6725 C C   . ALA C 2 112 ? 45.137  17.452  -13.539 1.00 17.77  ? 112  ALA D C   1 
ATOM   6726 O O   . ALA C 2 112 ? 44.039  17.897  -13.197 1.00 18.37  ? 112  ALA D O   1 
ATOM   6727 C CB  . ALA C 2 112 ? 46.638  19.187  -14.582 1.00 15.69  ? 112  ALA D CB  1 
ATOM   6728 N N   . HIS C 2 113 ? 45.250  16.236  -14.037 1.00 16.19  ? 113  HIS D N   1 
ATOM   6729 C CA  . HIS C 2 113 ? 44.145  15.346  -14.311 1.00 15.77  ? 113  HIS D CA  1 
ATOM   6730 C C   . HIS C 2 113 ? 43.273  14.949  -13.130 1.00 16.55  ? 113  HIS D C   1 
ATOM   6731 O O   . HIS C 2 113 ? 42.144  14.490  -13.352 1.00 15.20  ? 113  HIS D O   1 
ATOM   6732 C CB  . HIS C 2 113 ? 44.606  14.014  -14.958 1.00 11.75  ? 113  HIS D CB  1 
ATOM   6733 C CG  . HIS C 2 113 ? 45.550  14.286  -16.090 1.00 14.74  ? 113  HIS D CG  1 
ATOM   6734 N ND1 . HIS C 2 113 ? 45.212  15.029  -17.187 1.00 15.23  ? 113  HIS D ND1 1 
ATOM   6735 C CD2 . HIS C 2 113 ? 46.855  13.951  -16.262 1.00 16.34  ? 113  HIS D CD2 1 
ATOM   6736 C CE1 . HIS C 2 113 ? 46.267  15.093  -18.000 1.00 18.92  ? 113  HIS D CE1 1 
ATOM   6737 N NE2 . HIS C 2 113 ? 47.291  14.434  -17.462 1.00 13.72  ? 113  HIS D NE2 1 
ATOM   6738 N N   . ARG C 2 114 ? 43.814  15.038  -11.927 1.00 16.22  ? 114  ARG D N   1 
ATOM   6739 C CA  . ARG C 2 114 ? 43.119  14.630  -10.740 1.00 17.97  ? 114  ARG D CA  1 
ATOM   6740 C C   . ARG C 2 114 ? 42.215  15.717  -10.157 1.00 17.93  ? 114  ARG D C   1 
ATOM   6741 O O   . ARG C 2 114 ? 41.442  15.446  -9.224  1.00 19.95  ? 114  ARG D O   1 
ATOM   6742 C CB  . ARG C 2 114 ? 44.200  14.372  -9.676  1.00 19.11  ? 114  ARG D CB  1 
ATOM   6743 C CG  . ARG C 2 114 ? 45.329  13.459  -10.140 1.00 23.46  ? 114  ARG D CG  1 
ATOM   6744 C CD  . ARG C 2 114 ? 46.080  12.847  -8.964  1.00 21.95  ? 114  ARG D CD  1 
ATOM   6745 N NE  . ARG C 2 114 ? 46.984  11.836  -9.460  1.00 26.71  ? 114  ARG D NE  1 
ATOM   6746 C CZ  . ARG C 2 114 ? 47.797  11.004  -8.817  1.00 24.13  ? 114  ARG D CZ  1 
ATOM   6747 N NH1 . ARG C 2 114 ? 47.914  10.994  -7.500  1.00 19.84  ? 114  ARG D NH1 1 
ATOM   6748 N NH2 . ARG C 2 114 ? 48.533  10.152  -9.552  1.00 24.29  ? 114  ARG D NH2 1 
ATOM   6749 N N   . VAL C 2 115 ? 42.400  16.952  -10.568 1.00 16.30  ? 115  VAL D N   1 
ATOM   6750 C CA  . VAL C 2 115 ? 41.663  18.024  -9.903  1.00 16.71  ? 115  VAL D CA  1 
ATOM   6751 C C   . VAL C 2 115 ? 40.172  18.186  -10.168 1.00 16.00  ? 115  VAL D C   1 
ATOM   6752 O O   . VAL C 2 115 ? 39.415  18.163  -9.178  1.00 15.13  ? 115  VAL D O   1 
ATOM   6753 C CB  . VAL C 2 115 ? 42.454  19.314  -10.147 1.00 14.18  ? 115  VAL D CB  1 
ATOM   6754 C CG1 . VAL C 2 115 ? 41.808  20.523  -9.501  1.00 14.38  ? 115  VAL D CG1 1 
ATOM   6755 C CG2 . VAL C 2 115 ? 43.857  19.047  -9.570  1.00 13.02  ? 115  VAL D CG2 1 
ATOM   6756 N N   . LEU C 2 116 ? 39.742  18.312  -11.417 1.00 13.46  ? 116  LEU D N   1 
ATOM   6757 C CA  . LEU C 2 116 ? 38.377  18.612  -11.761 1.00 12.07  ? 116  LEU D CA  1 
ATOM   6758 C C   . LEU C 2 116 ? 37.417  17.522  -11.335 1.00 11.95  ? 116  LEU D C   1 
ATOM   6759 O O   . LEU C 2 116 ? 36.398  17.791  -10.715 1.00 12.95  ? 116  LEU D O   1 
ATOM   6760 C CB  . LEU C 2 116 ? 38.209  19.075  -13.219 1.00 12.18  ? 116  LEU D CB  1 
ATOM   6761 C CG  . LEU C 2 116 ? 36.768  19.562  -13.563 1.00 17.48  ? 116  LEU D CG  1 
ATOM   6762 C CD1 . LEU C 2 116 ? 36.432  20.804  -12.737 1.00 13.82  ? 116  LEU D CD1 1 
ATOM   6763 C CD2 . LEU C 2 116 ? 36.538  19.852  -15.043 1.00 15.17  ? 116  LEU D CD2 1 
ATOM   6764 N N   . PRO C 2 117 ? 37.697  16.254  -11.553 1.00 13.08  ? 117  PRO D N   1 
ATOM   6765 C CA  . PRO C 2 117 ? 36.814  15.174  -11.111 1.00 13.69  ? 117  PRO D CA  1 
ATOM   6766 C C   . PRO C 2 117 ? 36.616  15.194  -9.600  1.00 13.05  ? 117  PRO D C   1 
ATOM   6767 O O   . PRO C 2 117 ? 35.482  15.068  -9.107  1.00 13.11  ? 117  PRO D O   1 
ATOM   6768 C CB  . PRO C 2 117 ? 37.482  13.915  -11.661 1.00 13.63  ? 117  PRO D CB  1 
ATOM   6769 C CG  . PRO C 2 117 ? 38.295  14.429  -12.828 1.00 14.10  ? 117  PRO D CG  1 
ATOM   6770 C CD  . PRO C 2 117 ? 38.862  15.736  -12.331 1.00 12.16  ? 117  PRO D CD  1 
ATOM   6771 N N   . VAL C 2 118 ? 37.656  15.450  -8.815  1.00 13.05  ? 118  VAL D N   1 
ATOM   6772 C CA  . VAL C 2 118 ? 37.546  15.528  -7.358  1.00 13.37  ? 118  VAL D CA  1 
ATOM   6773 C C   . VAL C 2 118 ? 36.807  16.779  -6.892  1.00 12.46  ? 118  VAL D C   1 
ATOM   6774 O O   . VAL C 2 118 ? 35.934  16.692  -6.033  1.00 10.00  ? 118  VAL D O   1 
ATOM   6775 C CB  . VAL C 2 118 ? 38.922  15.439  -6.686  1.00 13.75  ? 118  VAL D CB  1 
ATOM   6776 C CG1 . VAL C 2 118 ? 38.915  15.867  -5.231  1.00 11.40  ? 118  VAL D CG1 1 
ATOM   6777 C CG2 . VAL C 2 118 ? 39.417  13.994  -6.791  1.00 14.91  ? 118  VAL D CG2 1 
ATOM   6778 N N   . LEU C 2 119 ? 37.071  17.927  -7.515  1.00 13.45  ? 119  LEU D N   1 
ATOM   6779 C CA  . LEU C 2 119 ? 36.389  19.156  -7.138  1.00 13.94  ? 119  LEU D CA  1 
ATOM   6780 C C   . LEU C 2 119 ? 34.879  19.009  -7.353  1.00 16.28  ? 119  LEU D C   1 
ATOM   6781 O O   . LEU C 2 119 ? 34.135  19.515  -6.499  1.00 17.58  ? 119  LEU D O   1 
ATOM   6782 C CB  . LEU C 2 119 ? 36.932  20.310  -7.937  1.00 14.23  ? 119  LEU D CB  1 
ATOM   6783 C CG  . LEU C 2 119 ? 36.175  21.632  -7.986  1.00 13.96  ? 119  LEU D CG  1 
ATOM   6784 C CD1 . LEU C 2 119 ? 36.094  22.196  -6.560  1.00 14.38  ? 119  LEU D CD1 1 
ATOM   6785 C CD2 . LEU C 2 119 ? 36.900  22.616  -8.905  1.00 14.26  ? 119  LEU D CD2 1 
ATOM   6786 N N   . VAL C 2 120 ? 34.448  18.428  -8.463  1.00 14.67  ? 120  VAL D N   1 
ATOM   6787 C CA  . VAL C 2 120 ? 33.037  18.268  -8.777  1.00 16.35  ? 120  VAL D CA  1 
ATOM   6788 C C   . VAL C 2 120 ? 32.358  17.240  -7.882  1.00 16.70  ? 120  VAL D C   1 
ATOM   6789 O O   . VAL C 2 120 ? 31.299  17.527  -7.341  1.00 16.59  ? 120  VAL D O   1 
ATOM   6790 C CB  . VAL C 2 120 ? 32.828  17.802  -10.244 1.00 19.38  ? 120  VAL D CB  1 
ATOM   6791 C CG1 . VAL C 2 120 ? 31.409  17.326  -10.500 1.00 18.50  ? 120  VAL D CG1 1 
ATOM   6792 C CG2 . VAL C 2 120 ? 33.155  18.918  -11.213 1.00 18.94  ? 120  VAL D CG2 1 
ATOM   6793 N N   . SER C 2 121 ? 32.952  16.039  -7.740  1.00 18.01  ? 121  SER D N   1 
ATOM   6794 C CA  . SER C 2 121 ? 32.347  15.031  -6.872  1.00 17.71  ? 121  SER D CA  1 
ATOM   6795 C C   . SER C 2 121 ? 32.331  15.544  -5.432  1.00 16.98  ? 121  SER D C   1 
ATOM   6796 O O   . SER C 2 121 ? 31.318  15.265  -4.802  1.00 14.75  ? 121  SER D O   1 
ATOM   6797 C CB  . SER C 2 121 ? 33.029  13.660  -6.863  1.00 17.02  ? 121  SER D CB  1 
ATOM   6798 O OG  . SER C 2 121 ? 34.425  13.853  -6.783  1.00 23.35  ? 121  SER D OG  1 
ATOM   6799 N N   . ALA C 2 122 ? 33.381  16.220  -4.956  1.00 16.39  ? 122  ALA D N   1 
ATOM   6800 C CA  . ALA C 2 122 ? 33.355  16.708  -3.581  1.00 16.95  ? 122  ALA D CA  1 
ATOM   6801 C C   . ALA C 2 122 ? 32.300  17.823  -3.420  1.00 18.39  ? 122  ALA D C   1 
ATOM   6802 O O   . ALA C 2 122 ? 31.679  17.987  -2.372  1.00 18.24  ? 122  ALA D O   1 
ATOM   6803 C CB  . ALA C 2 122 ? 34.707  17.258  -3.119  1.00 8.96   ? 122  ALA D CB  1 
ATOM   6804 N N   . ARG C 2 123 ? 32.163  18.694  -4.418  1.00 18.64  ? 123  ARG D N   1 
ATOM   6805 C CA  . ARG C 2 123 ? 31.189  19.774  -4.337  1.00 18.75  ? 123  ARG D CA  1 
ATOM   6806 C C   . ARG C 2 123 ? 29.757  19.208  -4.302  1.00 18.30  ? 123  ARG D C   1 
ATOM   6807 O O   . ARG C 2 123 ? 28.915  19.640  -3.510  1.00 18.86  ? 123  ARG D O   1 
ATOM   6808 C CB  . ARG C 2 123 ? 31.349  20.725  -5.507  1.00 16.96  ? 123  ARG D CB  1 
ATOM   6809 C CG  . ARG C 2 123 ? 30.402  21.928  -5.433  1.00 15.20  ? 123  ARG D CG  1 
ATOM   6810 C CD  . ARG C 2 123 ? 30.611  22.709  -4.155  1.00 14.35  ? 123  ARG D CD  1 
ATOM   6811 N NE  . ARG C 2 123 ? 29.835  23.941  -4.121  1.00 15.86  ? 123  ARG D NE  1 
ATOM   6812 C CZ  . ARG C 2 123 ? 29.926  24.876  -3.175  1.00 15.64  ? 123  ARG D CZ  1 
ATOM   6813 N NH1 . ARG C 2 123 ? 30.767  24.704  -2.166  1.00 14.46  ? 123  ARG D NH1 1 
ATOM   6814 N NH2 . ARG C 2 123 ? 29.180  25.987  -3.237  1.00 13.97  ? 123  ARG D NH2 1 
ATOM   6815 N N   . ARG C 2 124 ? 29.431  18.213  -5.094  1.00 16.50  ? 124  ARG D N   1 
ATOM   6816 C CA  . ARG C 2 124 ? 28.138  17.578  -5.073  1.00 17.26  ? 124  ARG D CA  1 
ATOM   6817 C C   . ARG C 2 124 ? 27.911  17.058  -3.639  1.00 18.75  ? 124  ARG D C   1 
ATOM   6818 O O   . ARG C 2 124 ? 26.847  17.288  -3.058  1.00 17.59  ? 124  ARG D O   1 
ATOM   6819 C CB  . ARG C 2 124 ? 28.087  16.389  -6.035  1.00 16.88  ? 124  ARG D CB  1 
ATOM   6820 C CG  . ARG C 2 124 ? 26.718  15.716  -6.119  1.00 19.97  ? 124  ARG D CG  1 
ATOM   6821 C CD  . ARG C 2 124 ? 26.822  14.295  -6.657  1.00 18.55  ? 124  ARG D CD  1 
ATOM   6822 N NE  . ARG C 2 124 ? 27.202  13.329  -5.635  1.00 19.79  ? 124  ARG D NE  1 
ATOM   6823 C CZ  . ARG C 2 124 ? 26.539  12.948  -4.552  1.00 21.40  ? 124  ARG D CZ  1 
ATOM   6824 N NH1 . ARG C 2 124 ? 25.327  13.482  -4.308  1.00 20.86  ? 124  ARG D NH1 1 
ATOM   6825 N NH2 . ARG C 2 124 ? 27.037  12.058  -3.702  1.00 13.81  ? 124  ARG D NH2 1 
ATOM   6826 N N   . ILE C 2 125 ? 28.948  16.372  -3.101  1.00 17.80  ? 125  ILE D N   1 
ATOM   6827 C CA  . ILE C 2 125 ? 28.850  15.763  -1.797  1.00 16.15  ? 125  ILE D CA  1 
ATOM   6828 C C   . ILE C 2 125 ? 28.521  16.769  -0.705  1.00 16.85  ? 125  ILE D C   1 
ATOM   6829 O O   . ILE C 2 125 ? 27.558  16.511  0.019   1.00 16.57  ? 125  ILE D O   1 
ATOM   6830 C CB  . ILE C 2 125 ? 30.097  14.926  -1.446  1.00 15.36  ? 125  ILE D CB  1 
ATOM   6831 C CG1 . ILE C 2 125 ? 30.042  13.590  -2.224  1.00 14.40  ? 125  ILE D CG1 1 
ATOM   6832 C CG2 . ILE C 2 125 ? 30.266  14.614  0.034   1.00 11.37  ? 125  ILE D CG2 1 
ATOM   6833 C CD1 . ILE C 2 125 ? 31.443  13.041  -2.485  1.00 13.83  ? 125  ILE D CD1 1 
ATOM   6834 N N   . SER C 2 126 ? 29.228  17.886  -0.636  1.00 16.41  ? 126  SER D N   1 
ATOM   6835 C CA  . SER C 2 126 ? 29.024  18.843  0.420   1.00 18.38  ? 126  SER D CA  1 
ATOM   6836 C C   . SER C 2 126 ? 27.677  19.558  0.310   1.00 19.80  ? 126  SER D C   1 
ATOM   6837 O O   . SER C 2 126 ? 27.092  19.945  1.333   1.00 19.43  ? 126  SER D O   1 
ATOM   6838 C CB  . SER C 2 126 ? 30.188  19.848  0.479   1.00 16.35  ? 126  SER D CB  1 
ATOM   6839 O OG  . SER C 2 126 ? 30.302  20.598  -0.732  1.00 13.92  ? 126  SER D OG  1 
ATOM   6840 N N   . GLU C 2 127 ? 27.252  19.820  -0.915  1.00 19.85  ? 127  GLU D N   1 
ATOM   6841 C CA  . GLU C 2 127 ? 25.975  20.455  -1.191  1.00 21.11  ? 127  GLU D CA  1 
ATOM   6842 C C   . GLU C 2 127 ? 24.848  19.481  -0.828  1.00 19.86  ? 127  GLU D C   1 
ATOM   6843 O O   . GLU C 2 127 ? 23.886  19.916  -0.236  1.00 19.74  ? 127  GLU D O   1 
ATOM   6844 C CB  . GLU C 2 127 ? 25.848  20.810  -2.680  1.00 21.75  ? 127  GLU D CB  1 
ATOM   6845 C CG  . GLU C 2 127 ? 26.765  21.946  -3.087  1.00 26.71  ? 127  GLU D CG  1 
ATOM   6846 C CD  . GLU C 2 127 ? 26.189  23.260  -2.610  1.00 27.70  ? 127  GLU D CD  1 
ATOM   6847 O OE1 . GLU C 2 127 ? 25.315  23.715  -3.367  1.00 33.29  ? 127  GLU D OE1 1 
ATOM   6848 O OE2 . GLU C 2 127 ? 26.547  23.823  -1.562  1.00 27.19  ? 127  GLU D OE2 1 
ATOM   6849 N N   . GLU C 2 128 ? 24.983  18.203  -1.165  1.00 20.43  ? 128  GLU D N   1 
ATOM   6850 C CA  . GLU C 2 128 ? 23.955  17.221  -0.806  1.00 20.11  ? 128  GLU D CA  1 
ATOM   6851 C C   . GLU C 2 128 ? 23.889  17.110  0.719   1.00 21.03  ? 128  GLU D C   1 
ATOM   6852 O O   . GLU C 2 128 ? 22.792  17.106  1.290   1.00 19.60  ? 128  GLU D O   1 
ATOM   6853 C CB  . GLU C 2 128 ? 24.175  15.901  -1.500  1.00 19.33  ? 128  GLU D CB  1 
ATOM   6854 C CG  . GLU C 2 128 ? 23.173  14.801  -1.215  1.00 25.24  ? 128  GLU D CG  1 
ATOM   6855 C CD  . GLU C 2 128 ? 21.805  15.177  -1.776  1.00 32.74  ? 128  GLU D CD  1 
ATOM   6856 O OE1 . GLU C 2 128 ? 21.646  15.983  -2.731  1.00 31.09  ? 128  GLU D OE1 1 
ATOM   6857 O OE2 . GLU C 2 128 ? 20.798  14.650  -1.240  1.00 38.00  ? 128  GLU D OE2 1 
ATOM   6858 N N   . MET C 2 129 ? 25.050  17.126  1.419   1.00 20.29  ? 129  MET D N   1 
ATOM   6859 C CA  . MET C 2 129 ? 24.988  17.116  2.883   1.00 19.82  ? 129  MET D CA  1 
ATOM   6860 C C   . MET C 2 129 ? 24.235  18.323  3.449   1.00 20.43  ? 129  MET D C   1 
ATOM   6861 O O   . MET C 2 129 ? 23.395  18.146  4.343   1.00 19.37  ? 129  MET D O   1 
ATOM   6862 C CB  . MET C 2 129 ? 26.382  17.136  3.528   1.00 14.04  ? 129  MET D CB  1 
ATOM   6863 C CG  . MET C 2 129 ? 27.050  15.779  3.393   1.00 15.11  ? 129  MET D CG  1 
ATOM   6864 S SD  . MET C 2 129 ? 28.719  15.787  4.107   1.00 16.43  ? 129  MET D SD  1 
ATOM   6865 C CE  . MET C 2 129 ? 29.129  14.068  3.842   1.00 17.69  ? 129  MET D CE  1 
ATOM   6866 N N   . ALA C 2 130 ? 24.572  19.528  2.948   1.00 19.09  ? 130  ALA D N   1 
ATOM   6867 C CA  . ALA C 2 130 ? 23.921  20.726  3.423   1.00 20.75  ? 130  ALA D CA  1 
ATOM   6868 C C   . ALA C 2 130 ? 22.408  20.676  3.150   1.00 22.72  ? 130  ALA D C   1 
ATOM   6869 O O   . ALA C 2 130 ? 21.656  21.192  3.978   1.00 23.34  ? 130  ALA D O   1 
ATOM   6870 C CB  . ALA C 2 130 ? 24.516  21.990  2.852   1.00 15.92  ? 130  ALA D CB  1 
ATOM   6871 N N   . LYS C 2 131 ? 21.968  20.094  2.053   1.00 22.28  ? 131  LYS D N   1 
ATOM   6872 C CA  . LYS C 2 131 ? 20.550  20.023  1.709   1.00 23.51  ? 131  LYS D CA  1 
ATOM   6873 C C   . LYS C 2 131 ? 19.786  19.095  2.635   1.00 23.98  ? 131  LYS D C   1 
ATOM   6874 O O   . LYS C 2 131 ? 18.671  19.371  3.086   1.00 22.76  ? 131  LYS D O   1 
ATOM   6875 C CB  . LYS C 2 131 ? 20.503  19.563  0.247   1.00 27.74  ? 131  LYS D CB  1 
ATOM   6876 C CG  . LYS C 2 131 ? 19.183  19.571  -0.452  1.00 34.71  ? 131  LYS D CG  1 
ATOM   6877 C CD  . LYS C 2 131 ? 18.860  18.304  -1.238  1.00 39.96  ? 131  LYS D CD  1 
ATOM   6878 C CE  . LYS C 2 131 ? 18.844  17.089  -0.310  1.00 43.31  ? 131  LYS D CE  1 
ATOM   6879 N NZ  . LYS C 2 131 ? 18.159  15.915  -0.936  1.00 45.25  ? 131  LYS D NZ  1 
ATOM   6880 N N   . LEU C 2 132 ? 20.367  17.930  2.971   1.00 23.05  ? 132  LEU D N   1 
ATOM   6881 C CA  . LEU C 2 132 ? 19.744  16.977  3.860   1.00 22.69  ? 132  LEU D CA  1 
ATOM   6882 C C   . LEU C 2 132 ? 19.598  17.588  5.261   1.00 23.99  ? 132  LEU D C   1 
ATOM   6883 O O   . LEU C 2 132 ? 18.598  17.342  5.961   1.00 23.80  ? 132  LEU D O   1 
ATOM   6884 C CB  . LEU C 2 132 ? 20.493  15.650  3.907   1.00 18.99  ? 132  LEU D CB  1 
ATOM   6885 C CG  . LEU C 2 132 ? 20.528  14.853  2.597   1.00 20.15  ? 132  LEU D CG  1 
ATOM   6886 C CD1 . LEU C 2 132 ? 21.614  13.806  2.604   1.00 17.69  ? 132  LEU D CD1 1 
ATOM   6887 C CD2 . LEU C 2 132 ? 19.189  14.175  2.328   1.00 18.79  ? 132  LEU D CD2 1 
ATOM   6888 N N   . LYS C 2 133 ? 20.558  18.412  5.669   1.00 23.39  ? 133  LYS D N   1 
ATOM   6889 C CA  . LYS C 2 133 ? 20.480  19.028  6.979   1.00 25.09  ? 133  LYS D CA  1 
ATOM   6890 C C   . LYS C 2 133 ? 19.363  20.073  7.005   1.00 24.98  ? 133  LYS D C   1 
ATOM   6891 O O   . LYS C 2 133 ? 18.630  20.171  7.967   1.00 23.31  ? 133  LYS D O   1 
ATOM   6892 C CB  . LYS C 2 133 ? 21.794  19.613  7.452   1.00 23.72  ? 133  LYS D CB  1 
ATOM   6893 C CG  . LYS C 2 133 ? 22.807  18.494  7.749   1.00 26.72  ? 133  LYS D CG  1 
ATOM   6894 C CD  . LYS C 2 133 ? 24.117  19.171  8.169   1.00 27.55  ? 133  LYS D CD  1 
ATOM   6895 C CE  . LYS C 2 133 ? 25.319  18.295  7.821   1.00 26.52  ? 133  LYS D CE  1 
ATOM   6896 N NZ  . LYS C 2 133 ? 26.560  18.970  8.321   1.00 27.94  ? 133  LYS D NZ  1 
ATOM   6897 N N   . GLN C 2 134 ? 19.260  20.854  5.951   1.00 26.99  ? 134  GLN D N   1 
ATOM   6898 C CA  . GLN C 2 134 ? 18.207  21.831  5.753   1.00 27.20  ? 134  GLN D CA  1 
ATOM   6899 C C   . GLN C 2 134 ? 16.831  21.133  5.694   1.00 26.71  ? 134  GLN D C   1 
ATOM   6900 O O   . GLN C 2 134 ? 15.921  21.580  6.386   1.00 25.75  ? 134  GLN D O   1 
ATOM   6901 C CB  . GLN C 2 134 ? 18.463  22.645  4.504   1.00 29.34  ? 134  GLN D CB  1 
ATOM   6902 C CG  . GLN C 2 134 ? 17.349  23.642  4.243   1.00 36.42  ? 134  GLN D CG  1 
ATOM   6903 C CD  . GLN C 2 134 ? 17.516  24.475  3.000   1.00 40.52  ? 134  GLN D CD  1 
ATOM   6904 O OE1 . GLN C 2 134 ? 17.825  24.024  1.897   1.00 43.82  ? 134  GLN D OE1 1 
ATOM   6905 N NE2 . GLN C 2 134 ? 17.309  25.777  3.175   1.00 44.45  ? 134  GLN D NE2 1 
ATOM   6906 N N   . LYS C 2 135 ? 16.678  19.998  5.046   1.00 25.69  ? 135  LYS D N   1 
ATOM   6907 C CA  . LYS C 2 135 ? 15.435  19.281  4.973   1.00 27.82  ? 135  LYS D CA  1 
ATOM   6908 C C   . LYS C 2 135 ? 15.057  18.755  6.359   1.00 28.64  ? 135  LYS D C   1 
ATOM   6909 O O   . LYS C 2 135 ? 13.883  18.737  6.715   1.00 28.05  ? 135  LYS D O   1 
ATOM   6910 C CB  . LYS C 2 135 ? 15.409  18.126  3.968   1.00 26.20  ? 135  LYS D CB  1 
ATOM   6911 N N   . THR C 2 136 ? 16.074  18.305  7.102   1.00 28.02  ? 136  THR D N   1 
ATOM   6912 C CA  . THR C 2 136 ? 15.876  17.817  8.453   1.00 25.14  ? 136  THR D CA  1 
ATOM   6913 C C   . THR C 2 136 ? 15.285  18.910  9.317   1.00 24.48  ? 136  THR D C   1 
ATOM   6914 O O   . THR C 2 136 ? 14.284  18.634  9.986   1.00 23.43  ? 136  THR D O   1 
ATOM   6915 C CB  . THR C 2 136 ? 17.177  17.229  9.031   1.00 23.69  ? 136  THR D CB  1 
ATOM   6916 O OG1 . THR C 2 136 ? 17.476  16.054  8.251   1.00 23.86  ? 136  THR D OG1 1 
ATOM   6917 C CG2 . THR C 2 136 ? 17.023  16.789  10.474  1.00 20.85  ? 136  THR D CG2 1 
ATOM   6918 N N   . GLU C 2 137 ? 15.822  20.125  9.301   1.00 24.74  ? 137  GLU D N   1 
ATOM   6919 C CA  . GLU C 2 137 ? 15.236  21.206  10.085  1.00 24.97  ? 137  GLU D CA  1 
ATOM   6920 C C   . GLU C 2 137 ? 13.810  21.542  9.615   1.00 24.22  ? 137  GLU D C   1 
ATOM   6921 O O   . GLU C 2 137 ? 12.926  21.768  10.435  1.00 21.79  ? 137  GLU D O   1 
ATOM   6922 C CB  . GLU C 2 137 ? 16.069  22.474  10.062  1.00 28.58  ? 137  GLU D CB  1 
ATOM   6923 C CG  . GLU C 2 137 ? 17.515  22.283  10.476  1.00 40.58  ? 137  GLU D CG  1 
ATOM   6924 C CD  . GLU C 2 137 ? 18.209  23.617  10.722  1.00 47.70  ? 137  GLU D CD  1 
ATOM   6925 O OE1 . GLU C 2 137 ? 17.513  24.635  10.973  1.00 49.63  ? 137  GLU D OE1 1 
ATOM   6926 O OE2 . GLU C 2 137 ? 19.462  23.636  10.656  1.00 50.44  ? 137  GLU D OE2 1 
ATOM   6927 N N   . GLN C 2 138 ? 13.566  21.595  8.314   1.00 23.49  ? 138  GLN D N   1 
ATOM   6928 C CA  . GLN C 2 138 ? 12.260  21.923  7.759   1.00 24.57  ? 138  GLN D CA  1 
ATOM   6929 C C   . GLN C 2 138 ? 11.224  20.920  8.244   1.00 23.41  ? 138  GLN D C   1 
ATOM   6930 O O   . GLN C 2 138 ? 10.166  21.339  8.688   1.00 23.10  ? 138  GLN D O   1 
ATOM   6931 C CB  . GLN C 2 138 ? 12.199  22.018  6.228   1.00 24.29  ? 138  GLN D CB  1 
ATOM   6932 C CG  . GLN C 2 138 ? 12.993  23.214  5.731   1.00 32.05  ? 138  GLN D CG  1 
ATOM   6933 C CD  . GLN C 2 138 ? 13.213  23.275  4.237   1.00 36.83  ? 138  GLN D CD  1 
ATOM   6934 O OE1 . GLN C 2 138 ? 12.807  22.370  3.486   1.00 40.98  ? 138  GLN D OE1 1 
ATOM   6935 N NE2 . GLN C 2 138 ? 13.836  24.364  3.775   1.00 36.09  ? 138  GLN D NE2 1 
ATOM   6936 N N   . LEU C 2 139 ? 11.537  19.642  8.159   1.00 22.93  ? 139  LEU D N   1 
ATOM   6937 C CA  . LEU C 2 139 ? 10.685  18.569  8.600   1.00 22.98  ? 139  LEU D CA  1 
ATOM   6938 C C   . LEU C 2 139 ? 10.472  18.585  10.113  1.00 24.42  ? 139  LEU D C   1 
ATOM   6939 O O   . LEU C 2 139 ? 9.383   18.259  10.580  1.00 21.86  ? 139  LEU D O   1 
ATOM   6940 C CB  . LEU C 2 139 ? 11.279  17.219  8.195   1.00 21.35  ? 139  LEU D CB  1 
ATOM   6941 C CG  . LEU C 2 139 ? 11.210  16.832  6.730   1.00 21.86  ? 139  LEU D CG  1 
ATOM   6942 C CD1 . LEU C 2 139 ? 12.057  15.596  6.451   1.00 17.26  ? 139  LEU D CD1 1 
ATOM   6943 C CD2 . LEU C 2 139 ? 9.770   16.555  6.267   1.00 19.16  ? 139  LEU D CD2 1 
ATOM   6944 N N   . GLN C 2 140 ? 11.526  18.929  10.886  1.00 25.17  ? 140  GLN D N   1 
ATOM   6945 C CA  . GLN C 2 140 ? 11.333  19.027  12.337  1.00 25.81  ? 140  GLN D CA  1 
ATOM   6946 C C   . GLN C 2 140 ? 10.321  20.144  12.615  1.00 25.37  ? 140  GLN D C   1 
ATOM   6947 O O   . GLN C 2 140 ? 9.355   19.854  13.337  1.00 25.46  ? 140  GLN D O   1 
ATOM   6948 C CB  . GLN C 2 140 ? 12.618  19.250  13.120  1.00 23.38  ? 140  GLN D CB  1 
ATOM   6949 C CG  . GLN C 2 140 ? 13.577  18.074  13.040  1.00 22.39  ? 140  GLN D CG  1 
ATOM   6950 C CD  . GLN C 2 140 ? 14.970  18.510  13.509  1.00 24.83  ? 140  GLN D CD  1 
ATOM   6951 O OE1 . GLN C 2 140 ? 15.376  19.656  13.285  1.00 25.42  ? 140  GLN D OE1 1 
ATOM   6952 N NE2 . GLN C 2 140 ? 15.654  17.590  14.181  1.00 21.70  ? 140  GLN D NE2 1 
ATOM   6953 N N   . ASP C 2 141 ? 10.510  21.323  12.051  1.00 24.25  ? 141  ASP D N   1 
ATOM   6954 C CA  . ASP C 2 141 ? 9.590   22.421  12.208  1.00 28.24  ? 141  ASP D CA  1 
ATOM   6955 C C   . ASP C 2 141 ? 8.187   21.985  11.737  1.00 31.64  ? 141  ASP D C   1 
ATOM   6956 O O   . ASP C 2 141 ? 7.259   22.188  12.510  1.00 33.70  ? 141  ASP D O   1 
ATOM   6957 C CB  . ASP C 2 141 ? 9.954   23.658  11.380  1.00 25.77  ? 141  ASP D CB  1 
ATOM   6958 C CG  . ASP C 2 141 ? 11.246  24.325  11.784  1.00 28.06  ? 141  ASP D CG  1 
ATOM   6959 O OD1 . ASP C 2 141 ? 11.757  24.052  12.901  1.00 27.19  ? 141  ASP D OD1 1 
ATOM   6960 O OD2 . ASP C 2 141 ? 11.759  25.159  11.004  1.00 24.44  ? 141  ASP D OD2 1 
ATOM   6961 N N   . ARG C 2 142 ? 8.036   21.397  10.571  1.00 32.48  ? 142  ARG D N   1 
ATOM   6962 C CA  . ARG C 2 142 ? 6.778   20.929  10.038  1.00 36.25  ? 142  ARG D CA  1 
ATOM   6963 C C   . ARG C 2 142 ? 6.004   19.983  10.953  1.00 36.08  ? 142  ARG D C   1 
ATOM   6964 O O   . ARG C 2 142 ? 4.812   20.259  11.121  1.00 34.02  ? 142  ARG D O   1 
ATOM   6965 C CB  . ARG C 2 142 ? 6.946   20.282  8.648   1.00 40.02  ? 142  ARG D CB  1 
ATOM   6966 C CG  . ARG C 2 142 ? 5.686   20.375  7.801   1.00 47.18  ? 142  ARG D CG  1 
ATOM   6967 C CD  . ARG C 2 142 ? 5.856   19.810  6.399   1.00 51.36  ? 142  ARG D CD  1 
ATOM   6968 N NE  . ARG C 2 142 ? 6.914   20.490  5.653   1.00 55.52  ? 142  ARG D NE  1 
ATOM   6969 C CZ  . ARG C 2 142 ? 7.597   19.901  4.672   1.00 58.51  ? 142  ARG D CZ  1 
ATOM   6970 N NH1 . ARG C 2 142 ? 7.346   18.649  4.312   1.00 58.47  ? 142  ARG D NH1 1 
ATOM   6971 N NH2 . ARG C 2 142 ? 8.542   20.617  4.071   1.00 59.92  ? 142  ARG D NH2 1 
ATOM   6972 N N   . ILE C 2 143 ? 6.604   18.964  11.542  1.00 36.47  ? 143  ILE D N   1 
ATOM   6973 C CA  . ILE C 2 143 ? 5.962   18.039  12.451  1.00 37.57  ? 143  ILE D CA  1 
ATOM   6974 C C   . ILE C 2 143 ? 5.370   18.754  13.676  1.00 38.80  ? 143  ILE D C   1 
ATOM   6975 O O   . ILE C 2 143 ? 4.275   18.434  14.140  1.00 37.41  ? 143  ILE D O   1 
ATOM   6976 C CB  . ILE C 2 143 ? 6.910   16.974  13.045  1.00 37.56  ? 143  ILE D CB  1 
ATOM   6977 C CG1 . ILE C 2 143 ? 7.772   16.433  11.929  1.00 39.83  ? 143  ILE D CG1 1 
ATOM   6978 C CG2 . ILE C 2 143 ? 6.098   15.890  13.746  1.00 36.26  ? 143  ILE D CG2 1 
ATOM   6979 C CD1 . ILE C 2 143 ? 8.395   15.065  11.953  1.00 41.32  ? 143  ILE D CD1 1 
ATOM   6980 N N   . ALA C 2 144 ? 6.147   19.715  14.170  1.00 39.11  ? 144  ALA D N   1 
ATOM   6981 C CA  . ALA C 2 144 ? 5.760   20.520  15.308  1.00 40.95  ? 144  ALA D CA  1 
ATOM   6982 C C   . ALA C 2 144 ? 4.587   21.421  14.909  1.00 40.85  ? 144  ALA D C   1 
ATOM   6983 O O   . ALA C 2 144 ? 3.632   21.470  15.667  1.00 40.53  ? 144  ALA D O   1 
ATOM   6984 C CB  . ALA C 2 144 ? 6.920   21.366  15.846  1.00 42.18  ? 144  ALA D CB  1 
ATOM   6985 N N   . GLY C 2 145 ? 4.683   22.085  13.778  1.00 40.13  ? 145  GLY D N   1 
ATOM   6986 C CA  . GLY C 2 145 ? 3.650   22.955  13.270  1.00 42.38  ? 145  GLY D CA  1 
ATOM   6987 C C   . GLY C 2 145 ? 2.334   22.190  13.088  1.00 44.42  ? 145  GLY D C   1 
ATOM   6988 O O   . GLY C 2 145 ? 1.306   22.507  13.693  1.00 44.16  ? 145  GLY D O   1 
ATOM   6989 N N   . GLN C 2 146 ? 2.350   21.122  12.302  1.00 44.17  ? 146  GLN D N   1 
ATOM   6990 C CA  . GLN C 2 146 ? 1.224   20.247  12.081  1.00 44.64  ? 146  GLN D CA  1 
ATOM   6991 C C   . GLN C 2 146 ? 0.510   19.899  13.390  1.00 45.07  ? 146  GLN D C   1 
ATOM   6992 O O   . GLN C 2 146 ? -0.714  19.913  13.441  1.00 43.34  ? 146  GLN D O   1 
ATOM   6993 C CB  . GLN C 2 146 ? 1.709   18.957  11.410  1.00 45.08  ? 146  GLN D CB  1 
ATOM   6994 C CG  . GLN C 2 146 ? 0.615   18.060  10.871  1.00 45.82  ? 146  GLN D CG  1 
ATOM   6995 C CD  . GLN C 2 146 ? 1.127   16.800  10.201  1.00 46.80  ? 146  GLN D CD  1 
ATOM   6996 O OE1 . GLN C 2 146 ? 1.603   15.896  10.888  1.00 47.24  ? 146  GLN D OE1 1 
ATOM   6997 N NE2 . GLN C 2 146 ? 1.028   16.699  8.878   1.00 46.65  ? 146  GLN D NE2 1 
ATOM   6998 N N   . ALA C 2 147 ? 1.245   19.561  14.441  1.00 45.77  ? 147  ALA D N   1 
ATOM   6999 C CA  . ALA C 2 147 ? 0.686   19.213  15.733  1.00 46.92  ? 147  ALA D CA  1 
ATOM   7000 C C   . ALA C 2 147 ? -0.152  20.331  16.348  1.00 48.12  ? 147  ALA D C   1 
ATOM   7001 O O   . ALA C 2 147 ? -1.286  20.103  16.774  1.00 48.62  ? 147  ALA D O   1 
ATOM   7002 C CB  . ALA C 2 147 ? 1.774   18.777  16.692  1.00 42.38  ? 147  ALA D CB  1 
ATOM   7003 N N   . ARG C 2 148 ? 0.347   21.553  16.367  1.00 48.69  ? 148  ARG D N   1 
ATOM   7004 C CA  . ARG C 2 148 ? -0.350  22.700  16.919  1.00 48.07  ? 148  ARG D CA  1 
ATOM   7005 C C   . ARG C 2 148 ? -1.504  23.140  16.038  1.00 47.77  ? 148  ARG D C   1 
ATOM   7006 O O   . ARG C 2 148 ? -2.461  23.782  16.508  1.00 47.80  ? 148  ARG D O   1 
ATOM   7007 C CB  . ARG C 2 148 ? 0.661   23.829  17.169  1.00 50.72  ? 148  ARG D CB  1 
ATOM   7008 C CG  . ARG C 2 148 ? 1.877   23.388  17.984  1.00 55.12  ? 148  ARG D CG  1 
ATOM   7009 C CD  . ARG C 2 148 ? 1.546   22.605  19.229  1.00 59.44  ? 148  ARG D CD  1 
ATOM   7010 N NE  . ARG C 2 148 ? 2.655   22.088  20.018  1.00 63.00  ? 148  ARG D NE  1 
ATOM   7011 C CZ  . ARG C 2 148 ? 2.697   22.114  21.358  1.00 64.63  ? 148  ARG D CZ  1 
ATOM   7012 N NH1 . ARG C 2 148 ? 1.704   22.643  22.074  1.00 64.16  ? 148  ARG D NH1 1 
ATOM   7013 N NH2 . ARG C 2 148 ? 3.748   21.630  22.027  1.00 65.53  ? 148  ARG D NH2 1 
ATOM   7014 N N   . ILE C 2 149 ? -1.449  22.842  14.741  1.00 45.91  ? 149  ILE D N   1 
ATOM   7015 C CA  . ILE C 2 149 ? -2.564  23.206  13.874  1.00 44.89  ? 149  ILE D CA  1 
ATOM   7016 C C   . ILE C 2 149 ? -3.700  22.215  14.156  1.00 44.99  ? 149  ILE D C   1 
ATOM   7017 O O   . ILE C 2 149 ? -4.866  22.600  14.178  1.00 45.37  ? 149  ILE D O   1 
ATOM   7018 C CB  . ILE C 2 149 ? -2.209  23.319  12.405  1.00 42.45  ? 149  ILE D CB  1 
ATOM   7019 C CG1 . ILE C 2 149 ? -1.401  24.616  12.175  1.00 42.17  ? 149  ILE D CG1 1 
ATOM   7020 C CG2 . ILE C 2 149 ? -3.420  23.316  11.484  1.00 39.52  ? 149  ILE D CG2 1 
ATOM   7021 C CD1 . ILE C 2 149 ? -0.544  24.525  10.920  1.00 39.34  ? 149  ILE D CD1 1 
ATOM   7022 N N   . ASN C 2 150 ? -3.357  20.975  14.437  1.00 43.86  ? 150  ASN D N   1 
ATOM   7023 C CA  . ASN C 2 150 ? -4.231  19.884  14.746  1.00 42.15  ? 150  ASN D CA  1 
ATOM   7024 C C   . ASN C 2 150 ? -4.796  19.961  16.170  1.00 42.31  ? 150  ASN D C   1 
ATOM   7025 O O   . ASN C 2 150 ? -5.946  19.534  16.362  1.00 42.82  ? 150  ASN D O   1 
ATOM   7026 C CB  . ASN C 2 150 ? -3.529  18.533  14.640  1.00 37.81  ? 150  ASN D CB  1 
ATOM   7027 C CG  . ASN C 2 150 ? -3.368  18.019  13.230  1.00 37.12  ? 150  ASN D CG  1 
ATOM   7028 O OD1 . ASN C 2 150 ? -3.847  18.656  12.298  1.00 38.57  ? 150  ASN D OD1 1 
ATOM   7029 N ND2 . ASN C 2 150 ? -2.700  16.875  13.064  1.00 32.48  ? 150  ASN D ND2 1 
ATOM   7030 N N   . GLN C 2 151 ? -4.010  20.430  17.131  1.00 40.00  ? 151  GLN D N   1 
ATOM   7031 C CA  . GLN C 2 151 ? -4.520  20.545  18.491  1.00 37.91  ? 151  GLN D CA  1 
ATOM   7032 C C   . GLN C 2 151 ? -5.422  21.773  18.612  1.00 37.18  ? 151  GLN D C   1 
ATOM   7033 O O   . GLN C 2 151 ? -6.401  21.722  19.370  1.00 37.11  ? 151  GLN D O   1 
ATOM   7034 C CB  . GLN C 2 151 ? -3.437  20.595  19.543  1.00 36.66  ? 151  GLN D CB  1 
ATOM   7035 C CG  . GLN C 2 151 ? -2.606  19.327  19.601  1.00 37.95  ? 151  GLN D CG  1 
ATOM   7036 C CD  . GLN C 2 151 ? -1.263  19.610  20.255  1.00 38.08  ? 151  GLN D CD  1 
ATOM   7037 O OE1 . GLN C 2 151 ? -0.942  20.751  20.588  1.00 39.09  ? 151  GLN D OE1 1 
ATOM   7038 N NE2 . GLN C 2 151 ? -0.513  18.550  20.525  1.00 39.33  ? 151  GLN D NE2 1 
ATOM   7039 N N   . ALA C 2 152 ? -5.115  22.819  17.860  1.00 35.66  ? 152  ALA D N   1 
ATOM   7040 C CA  . ALA C 2 152 ? -5.904  24.028  17.792  1.00 34.86  ? 152  ALA D CA  1 
ATOM   7041 C C   . ALA C 2 152 ? -7.246  23.726  17.086  1.00 35.89  ? 152  ALA D C   1 
ATOM   7042 O O   . ALA C 2 152 ? -8.301  24.204  17.467  1.00 34.49  ? 152  ALA D O   1 
ATOM   7043 C CB  . ALA C 2 152 ? -5.204  25.117  16.992  1.00 28.31  ? 152  ALA D CB  1 
ATOM   7044 N N   . LYS C 2 153 ? -7.200  22.863  16.078  1.00 36.05  ? 153  LYS D N   1 
ATOM   7045 C CA  . LYS C 2 153 ? -8.382  22.487  15.333  1.00 38.15  ? 153  LYS D CA  1 
ATOM   7046 C C   . LYS C 2 153 ? -9.325  21.665  16.211  1.00 38.69  ? 153  LYS D C   1 
ATOM   7047 O O   . LYS C 2 153 ? -10.531 21.898  16.178  1.00 39.13  ? 153  LYS D O   1 
ATOM   7048 C CB  . LYS C 2 153 ? -8.046  21.714  14.075  1.00 39.15  ? 153  LYS D CB  1 
ATOM   7049 C CG  . LYS C 2 153 ? -7.752  22.568  12.841  1.00 38.46  ? 153  LYS D CG  1 
ATOM   7050 C CD  . LYS C 2 153 ? -6.942  21.654  11.924  1.00 39.67  ? 153  LYS D CD  1 
ATOM   7051 C CE  . LYS C 2 153 ? -7.623  21.460  10.590  1.00 39.17  ? 153  LYS D CE  1 
ATOM   7052 N NZ  . LYS C 2 153 ? -7.123  20.204  9.957   1.00 39.31  ? 153  LYS D NZ  1 
ATOM   7053 N N   . VAL C 2 154 ? -8.757  20.732  16.964  1.00 38.81  ? 154  VAL D N   1 
ATOM   7054 C CA  . VAL C 2 154 ? -9.561  19.941  17.884  1.00 39.37  ? 154  VAL D CA  1 
ATOM   7055 C C   . VAL C 2 154 ? -10.192 20.895  18.906  1.00 39.87  ? 154  VAL D C   1 
ATOM   7056 O O   . VAL C 2 154 ? -11.390 20.802  19.182  1.00 38.03  ? 154  VAL D O   1 
ATOM   7057 C CB  . VAL C 2 154 ? -8.741  18.817  18.511  1.00 39.09  ? 154  VAL D CB  1 
ATOM   7058 C CG1 . VAL C 2 154 ? -9.429  18.203  19.721  1.00 39.15  ? 154  VAL D CG1 1 
ATOM   7059 C CG2 . VAL C 2 154 ? -8.530  17.750  17.438  1.00 38.88  ? 154  VAL D CG2 1 
ATOM   7060 N N   . LEU C 2 155 ? -9.403  21.844  19.397  1.00 39.93  ? 155  LEU D N   1 
ATOM   7061 C CA  . LEU C 2 155 ? -9.866  22.855  20.323  1.00 41.07  ? 155  LEU D CA  1 
ATOM   7062 C C   . LEU C 2 155 ? -11.091 23.610  19.793  1.00 40.62  ? 155  LEU D C   1 
ATOM   7063 O O   . LEU C 2 155 ? -12.081 23.753  20.517  1.00 40.43  ? 155  LEU D O   1 
ATOM   7064 C CB  . LEU C 2 155 ? -8.727  23.833  20.611  1.00 42.66  ? 155  LEU D CB  1 
ATOM   7065 C CG  . LEU C 2 155 ? -8.859  24.805  21.774  1.00 45.36  ? 155  LEU D CG  1 
ATOM   7066 C CD1 . LEU C 2 155 ? -9.094  24.043  23.076  1.00 48.23  ? 155  LEU D CD1 1 
ATOM   7067 C CD2 . LEU C 2 155 ? -7.596  25.644  21.975  1.00 44.95  ? 155  LEU D CD2 1 
ATOM   7068 N N   . LEU C 2 156 ? -11.044 24.112  18.568  1.00 39.94  ? 156  LEU D N   1 
ATOM   7069 C CA  . LEU C 2 156 ? -12.145 24.838  17.960  1.00 40.25  ? 156  LEU D CA  1 
ATOM   7070 C C   . LEU C 2 156 ? -13.352 23.931  17.731  1.00 39.83  ? 156  LEU D C   1 
ATOM   7071 O O   . LEU C 2 156 ? -14.482 24.262  18.067  1.00 39.17  ? 156  LEU D O   1 
ATOM   7072 C CB  . LEU C 2 156 ? -11.729 25.482  16.638  1.00 42.14  ? 156  LEU D CB  1 
ATOM   7073 C CG  . LEU C 2 156 ? -10.819 26.709  16.700  1.00 42.05  ? 156  LEU D CG  1 
ATOM   7074 C CD1 . LEU C 2 156 ? -10.144 26.935  15.348  1.00 42.18  ? 156  LEU D CD1 1 
ATOM   7075 C CD2 . LEU C 2 156 ? -11.618 27.934  17.110  1.00 42.28  ? 156  LEU D CD2 1 
ATOM   7076 N N   . MET C 2 157 ? -13.099 22.753  17.177  1.00 39.79  ? 157  MET D N   1 
ATOM   7077 C CA  . MET C 2 157 ? -14.088 21.735  16.926  1.00 40.18  ? 157  MET D CA  1 
ATOM   7078 C C   . MET C 2 157 ? -14.965 21.565  18.171  1.00 41.31  ? 157  MET D C   1 
ATOM   7079 O O   . MET C 2 157 ? -16.144 21.863  18.210  1.00 40.19  ? 157  MET D O   1 
ATOM   7080 C CB  . MET C 2 157 ? -13.445 20.392  16.578  1.00 36.88  ? 157  MET D CB  1 
ATOM   7081 C CG  . MET C 2 157 ? -12.918 20.239  15.161  1.00 36.90  ? 157  MET D CG  1 
ATOM   7082 S SD  . MET C 2 157 ? -12.064 18.696  14.807  1.00 34.50  ? 157  MET D SD  1 
ATOM   7083 C CE  . MET C 2 157 ? -13.369 17.478  14.841  1.00 30.06  ? 157  MET D CE  1 
ATOM   7084 N N   . GLN C 2 158 ? -14.313 21.116  19.234  1.00 42.48  ? 158  GLN D N   1 
ATOM   7085 C CA  . GLN C 2 158 ? -14.842 20.834  20.541  1.00 42.80  ? 158  GLN D CA  1 
ATOM   7086 C C   . GLN C 2 158 ? -15.355 22.070  21.253  1.00 42.89  ? 158  GLN D C   1 
ATOM   7087 O O   . GLN C 2 158 ? -16.371 21.933  21.947  1.00 43.23  ? 158  GLN D O   1 
ATOM   7088 C CB  . GLN C 2 158 ? -13.757 20.163  21.368  1.00 47.02  ? 158  GLN D CB  1 
ATOM   7089 C CG  . GLN C 2 158 ? -14.203 19.216  22.464  1.00 50.31  ? 158  GLN D CG  1 
ATOM   7090 C CD  . GLN C 2 158 ? -13.018 18.696  23.259  1.00 52.65  ? 158  GLN D CD  1 
ATOM   7091 O OE1 . GLN C 2 158 ? -13.155 18.322  24.426  1.00 53.99  ? 158  GLN D OE1 1 
ATOM   7092 N NE2 . GLN C 2 158 ? -11.838 18.675  22.641  1.00 51.74  ? 158  GLN D NE2 1 
ATOM   7093 N N   . ARG C 2 159 ? -14.733 23.231  21.084  1.00 42.07  ? 159  ARG D N   1 
ATOM   7094 C CA  . ARG C 2 159 ? -15.277 24.415  21.737  1.00 41.43  ? 159  ARG D CA  1 
ATOM   7095 C C   . ARG C 2 159 ? -16.664 24.748  21.179  1.00 40.93  ? 159  ARG D C   1 
ATOM   7096 O O   . ARG C 2 159 ? -17.649 24.902  21.896  1.00 40.65  ? 159  ARG D O   1 
ATOM   7097 C CB  . ARG C 2 159 ? -14.328 25.609  21.561  1.00 44.18  ? 159  ARG D CB  1 
ATOM   7098 C CG  . ARG C 2 159 ? -14.588 26.759  22.508  1.00 48.41  ? 159  ARG D CG  1 
ATOM   7099 C CD  . ARG C 2 159 ? -13.479 27.778  22.608  1.00 51.39  ? 159  ARG D CD  1 
ATOM   7100 N NE  . ARG C 2 159 ? -12.334 27.398  23.427  1.00 53.36  ? 159  ARG D NE  1 
ATOM   7101 C CZ  . ARG C 2 159 ? -11.238 28.157  23.503  1.00 53.75  ? 159  ARG D CZ  1 
ATOM   7102 N NH1 . ARG C 2 159 ? -11.152 29.305  22.837  1.00 54.20  ? 159  ARG D NH1 1 
ATOM   7103 N NH2 . ARG C 2 159 ? -10.225 27.742  24.241  1.00 54.84  ? 159  ARG D NH2 1 
ATOM   7104 N N   . HIS C 2 160 ? -16.737 24.927  19.872  1.00 39.24  ? 160  HIS D N   1 
ATOM   7105 C CA  . HIS C 2 160 ? -17.859 25.416  19.132  1.00 37.61  ? 160  HIS D CA  1 
ATOM   7106 C C   . HIS C 2 160 ? -18.834 24.390  18.591  1.00 35.93  ? 160  HIS D C   1 
ATOM   7107 O O   . HIS C 2 160 ? -19.832 24.808  18.009  1.00 35.13  ? 160  HIS D O   1 
ATOM   7108 C CB  . HIS C 2 160 ? -17.366 26.235  17.916  1.00 39.52  ? 160  HIS D CB  1 
ATOM   7109 C CG  . HIS C 2 160 ? -16.435 27.351  18.263  1.00 41.82  ? 160  HIS D CG  1 
ATOM   7110 N ND1 . HIS C 2 160 ? -16.871 28.630  18.527  1.00 43.65  ? 160  HIS D ND1 1 
ATOM   7111 C CD2 . HIS C 2 160 ? -15.084 27.395  18.388  1.00 42.34  ? 160  HIS D CD2 1 
ATOM   7112 C CE1 . HIS C 2 160 ? -15.847 29.424  18.795  1.00 42.89  ? 160  HIS D CE1 1 
ATOM   7113 N NE2 . HIS C 2 160 ? -14.751 28.690  18.716  1.00 43.14  ? 160  HIS D NE2 1 
ATOM   7114 N N   . GLY C 2 161 ? -18.524 23.118  18.669  1.00 34.23  ? 161  GLY D N   1 
ATOM   7115 C CA  . GLY C 2 161 ? -19.363 22.104  18.061  1.00 34.16  ? 161  GLY D CA  1 
ATOM   7116 C C   . GLY C 2 161 ? -19.188 22.163  16.550  1.00 33.87  ? 161  GLY D C   1 
ATOM   7117 O O   . GLY C 2 161 ? -20.147 22.055  15.805  1.00 33.98  ? 161  GLY D O   1 
ATOM   7118 N N   . TRP C 2 162 ? -17.951 22.357  16.117  1.00 34.43  ? 162  TRP D N   1 
ATOM   7119 C CA  . TRP C 2 162 ? -17.601 22.457  14.710  1.00 34.03  ? 162  TRP D CA  1 
ATOM   7120 C C   . TRP C 2 162 ? -16.948 21.187  14.168  1.00 33.25  ? 162  TRP D C   1 
ATOM   7121 O O   . TRP C 2 162 ? -16.272 20.515  14.956  1.00 32.47  ? 162  TRP D O   1 
ATOM   7122 C CB  . TRP C 2 162 ? -16.577 23.567  14.500  1.00 34.53  ? 162  TRP D CB  1 
ATOM   7123 C CG  . TRP C 2 162 ? -17.039 24.986  14.520  1.00 34.91  ? 162  TRP D CG  1 
ATOM   7124 C CD1 . TRP C 2 162 ? -18.312 25.484  14.467  1.00 34.69  ? 162  TRP D CD1 1 
ATOM   7125 C CD2 . TRP C 2 162 ? -16.167 26.134  14.537  1.00 35.18  ? 162  TRP D CD2 1 
ATOM   7126 N NE1 . TRP C 2 162 ? -18.283 26.856  14.477  1.00 34.16  ? 162  TRP D NE1 1 
ATOM   7127 C CE2 . TRP C 2 162 ? -16.983 27.279  14.517  1.00 35.03  ? 162  TRP D CE2 1 
ATOM   7128 C CE3 . TRP C 2 162 ? -14.777 26.292  14.581  1.00 34.34  ? 162  TRP D CE3 1 
ATOM   7129 C CZ2 . TRP C 2 162 ? -16.448 28.565  14.540  1.00 36.49  ? 162  TRP D CZ2 1 
ATOM   7130 C CZ3 . TRP C 2 162 ? -14.246 27.561  14.622  1.00 33.32  ? 162  TRP D CZ3 1 
ATOM   7131 C CH2 . TRP C 2 162 ? -15.080 28.679  14.608  1.00 35.57  ? 162  TRP D CH2 1 
ATOM   7132 N N   . ASP C 2 163 ? -17.148 20.905  12.875  1.00 32.88  ? 163  ASP D N   1 
ATOM   7133 C CA  . ASP C 2 163 ? -16.424 19.794  12.259  1.00 33.24  ? 163  ASP D CA  1 
ATOM   7134 C C   . ASP C 2 163 ? -15.020 20.261  11.853  1.00 33.59  ? 163  ASP D C   1 
ATOM   7135 O O   . ASP C 2 163 ? -14.670 21.441  11.912  1.00 32.60  ? 163  ASP D O   1 
ATOM   7136 C CB  . ASP C 2 163 ? -17.176 19.147  11.111  1.00 32.69  ? 163  ASP D CB  1 
ATOM   7137 C CG  . ASP C 2 163 ? -17.348 20.030  9.907   1.00 36.91  ? 163  ASP D CG  1 
ATOM   7138 O OD1 . ASP C 2 163 ? -16.449 20.853  9.625   1.00 37.59  ? 163  ASP D OD1 1 
ATOM   7139 O OD2 . ASP C 2 163 ? -18.404 19.919  9.226   1.00 38.34  ? 163  ASP D OD2 1 
ATOM   7140 N N   . GLU C 2 164 ? -14.173 19.340  11.429  1.00 35.42  ? 164  GLU D N   1 
ATOM   7141 C CA  . GLU C 2 164 ? -12.782 19.590  11.039  1.00 36.99  ? 164  GLU D CA  1 
ATOM   7142 C C   . GLU C 2 164 ? -12.623 20.673  9.991   1.00 37.93  ? 164  GLU D C   1 
ATOM   7143 O O   . GLU C 2 164 ? -11.839 21.625  10.074  1.00 37.63  ? 164  GLU D O   1 
ATOM   7144 C CB  . GLU C 2 164 ? -12.165 18.265  10.598  1.00 37.11  ? 164  GLU D CB  1 
ATOM   7145 C CG  . GLU C 2 164 ? -10.672 18.253  10.346  1.00 40.01  ? 164  GLU D CG  1 
ATOM   7146 C CD  . GLU C 2 164 ? -10.370 18.852  8.977   1.00 41.45  ? 164  GLU D CD  1 
ATOM   7147 O OE1 . GLU C 2 164 ? -11.148 18.596  8.032   1.00 40.50  ? 164  GLU D OE1 1 
ATOM   7148 O OE2 . GLU C 2 164 ? -9.391  19.600  8.880   1.00 41.78  ? 164  GLU D OE2 1 
ATOM   7149 N N   . ARG C 2 165 ? -13.451 20.597  8.969   1.00 39.07  ? 165  ARG D N   1 
ATOM   7150 C CA  . ARG C 2 165 ? -13.551 21.515  7.848   1.00 40.34  ? 165  ARG D CA  1 
ATOM   7151 C C   . ARG C 2 165 ? -13.900 22.907  8.346   1.00 39.81  ? 165  ARG D C   1 
ATOM   7152 O O   . ARG C 2 165 ? -13.258 23.890  7.976   1.00 39.40  ? 165  ARG D O   1 
ATOM   7153 C CB  . ARG C 2 165 ? -14.561 20.973  6.832   1.00 45.32  ? 165  ARG D CB  1 
ATOM   7154 C CG  . ARG C 2 165 ? -14.502 19.460  6.661   1.00 52.63  ? 165  ARG D CG  1 
ATOM   7155 C CD  . ARG C 2 165 ? -15.085 18.627  7.792   1.00 55.63  ? 165  ARG D CD  1 
ATOM   7156 N NE  . ARG C 2 165 ? -15.061 17.187  7.563   1.00 61.28  ? 165  ARG D NE  1 
ATOM   7157 C CZ  . ARG C 2 165 ? -15.728 16.562  6.587   1.00 63.24  ? 165  ARG D CZ  1 
ATOM   7158 N NH1 . ARG C 2 165 ? -16.459 17.307  5.764   1.00 64.06  ? 165  ARG D NH1 1 
ATOM   7159 N NH2 . ARG C 2 165 ? -15.682 15.244  6.403   1.00 63.96  ? 165  ARG D NH2 1 
ATOM   7160 N N   . GLU C 2 166 ? -14.885 23.016  9.238   1.00 38.61  ? 166  GLU D N   1 
ATOM   7161 C CA  . GLU C 2 166 ? -15.233 24.290  9.832   1.00 38.16  ? 166  GLU D CA  1 
ATOM   7162 C C   . GLU C 2 166 ? -14.044 24.844  10.631  1.00 37.90  ? 166  GLU D C   1 
ATOM   7163 O O   . GLU C 2 166 ? -13.800 26.048  10.606  1.00 36.93  ? 166  GLU D O   1 
ATOM   7164 C CB  . GLU C 2 166 ? -16.431 24.176  10.795  1.00 34.92  ? 166  GLU D CB  1 
ATOM   7165 C CG  . GLU C 2 166 ? -17.741 24.132  10.027  1.00 35.23  ? 166  GLU D CG  1 
ATOM   7166 C CD  . GLU C 2 166 ? -18.934 23.678  10.843  1.00 33.97  ? 166  GLU D CD  1 
ATOM   7167 O OE1 . GLU C 2 166 ? -18.855 22.728  11.649  1.00 28.82  ? 166  GLU D OE1 1 
ATOM   7168 O OE2 . GLU C 2 166 ? -19.984 24.331  10.644  1.00 35.59  ? 166  GLU D OE2 1 
ATOM   7169 N N   . ALA C 2 167 ? -13.395 24.006  11.425  1.00 37.83  ? 167  ALA D N   1 
ATOM   7170 C CA  . ALA C 2 167 ? -12.265 24.466  12.232  1.00 41.37  ? 167  ALA D CA  1 
ATOM   7171 C C   . ALA C 2 167 ? -11.163 24.986  11.306  1.00 43.60  ? 167  ALA D C   1 
ATOM   7172 O O   . ALA C 2 167 ? -10.638 26.079  11.497  1.00 42.55  ? 167  ALA D O   1 
ATOM   7173 C CB  . ALA C 2 167 ? -11.803 23.389  13.182  1.00 39.37  ? 167  ALA D CB  1 
ATOM   7174 N N   . HIS C 2 168 ? -10.879 24.228  10.245  1.00 46.65  ? 168  HIS D N   1 
ATOM   7175 C CA  . HIS C 2 168 ? -9.925  24.639  9.230   1.00 49.83  ? 168  HIS D CA  1 
ATOM   7176 C C   . HIS C 2 168 ? -10.341 25.940  8.551   1.00 50.71  ? 168  HIS D C   1 
ATOM   7177 O O   . HIS C 2 168 ? -9.477  26.827  8.454   1.00 50.56  ? 168  HIS D O   1 
ATOM   7178 C CB  . HIS C 2 168 ? -9.708  23.565  8.157   1.00 53.52  ? 168  HIS D CB  1 
ATOM   7179 C CG  . HIS C 2 168 ? -8.733  24.057  7.131   1.00 57.93  ? 168  HIS D CG  1 
ATOM   7180 N ND1 . HIS C 2 168 ? -7.396  24.224  7.423   1.00 60.10  ? 168  HIS D ND1 1 
ATOM   7181 C CD2 . HIS C 2 168 ? -8.902  24.452  5.848   1.00 59.76  ? 168  HIS D CD2 1 
ATOM   7182 C CE1 . HIS C 2 168 ? -6.775  24.684  6.351   1.00 61.75  ? 168  HIS D CE1 1 
ATOM   7183 N NE2 . HIS C 2 168 ? -7.666  24.834  5.384   1.00 62.17  ? 168  HIS D NE2 1 
ATOM   7184 N N   . GLN C 2 169 ? -11.597 26.100  8.147   1.00 51.42  ? 169  GLN D N   1 
ATOM   7185 C CA  . GLN C 2 169 ? -11.989 27.366  7.520   1.00 53.55  ? 169  GLN D CA  1 
ATOM   7186 C C   . GLN C 2 169 ? -11.780 28.556  8.448   1.00 53.90  ? 169  GLN D C   1 
ATOM   7187 O O   . GLN C 2 169 ? -11.259 29.589  8.022   1.00 53.81  ? 169  GLN D O   1 
ATOM   7188 C CB  . GLN C 2 169 ? -13.421 27.343  7.000   1.00 56.79  ? 169  GLN D CB  1 
ATOM   7189 C CG  . GLN C 2 169 ? -13.730 26.139  6.134   1.00 62.63  ? 169  GLN D CG  1 
ATOM   7190 C CD  . GLN C 2 169 ? -15.156 26.042  5.640   1.00 66.40  ? 169  GLN D CD  1 
ATOM   7191 O OE1 . GLN C 2 169 ? -15.868 27.049  5.553   1.00 70.75  ? 169  GLN D OE1 1 
ATOM   7192 N NE2 . GLN C 2 169 ? -15.565 24.824  5.283   1.00 66.37  ? 169  GLN D NE2 1 
ATOM   7193 N N   . HIS C 2 170 ? -12.128 28.435  9.717   1.00 54.41  ? 170  HIS D N   1 
ATOM   7194 C CA  . HIS C 2 170 ? -11.953 29.488  10.707  1.00 54.98  ? 170  HIS D CA  1 
ATOM   7195 C C   . HIS C 2 170 ? -10.484 29.849  10.913  1.00 55.75  ? 170  HIS D C   1 
ATOM   7196 O O   . HIS C 2 170 ? -10.129 31.032  10.832  1.00 55.01  ? 170  HIS D O   1 
ATOM   7197 C CB  . HIS C 2 170 ? -12.649 29.089  12.012  1.00 53.07  ? 170  HIS D CB  1 
ATOM   7198 C CG  . HIS C 2 170 ? -12.342 30.005  13.151  1.00 53.08  ? 170  HIS D CG  1 
ATOM   7199 N ND1 . HIS C 2 170 ? -13.023 31.172  13.400  1.00 53.19  ? 170  HIS D ND1 1 
ATOM   7200 C CD2 . HIS C 2 170 ? -11.388 29.913  14.108  1.00 53.68  ? 170  HIS D CD2 1 
ATOM   7201 C CE1 . HIS C 2 170 ? -12.503 31.767  14.454  1.00 52.94  ? 170  HIS D CE1 1 
ATOM   7202 N NE2 . HIS C 2 170 ? -11.508 31.025  14.905  1.00 53.92  ? 170  HIS D NE2 1 
ATOM   7203 N N   . LEU C 2 171 ? -9.607  28.882  11.144  1.00 56.42  ? 171  LEU D N   1 
ATOM   7204 C CA  . LEU C 2 171 ? -8.181  29.155  11.271  1.00 57.92  ? 171  LEU D CA  1 
ATOM   7205 C C   . LEU C 2 171 ? -7.650  29.945  10.073  1.00 59.79  ? 171  LEU D C   1 
ATOM   7206 O O   . LEU C 2 171 ? -7.047  31.007  10.204  1.00 59.40  ? 171  LEU D O   1 
ATOM   7207 C CB  . LEU C 2 171 ? -7.370  27.861  11.347  1.00 53.93  ? 171  LEU D CB  1 
ATOM   7208 C CG  . LEU C 2 171 ? -7.443  27.033  12.621  1.00 51.32  ? 171  LEU D CG  1 
ATOM   7209 C CD1 . LEU C 2 171 ? -6.646  25.753  12.443  1.00 50.56  ? 171  LEU D CD1 1 
ATOM   7210 C CD2 . LEU C 2 171 ? -6.932  27.794  13.830  1.00 50.07  ? 171  LEU D CD2 1 
ATOM   7211 N N   . SER C 2 172 ? -7.864  29.407  8.877   1.00 62.15  ? 172  SER D N   1 
ATOM   7212 C CA  . SER C 2 172 ? -7.433  30.027  7.640   1.00 65.54  ? 172  SER D CA  1 
ATOM   7213 C C   . SER C 2 172 ? -7.947  31.454  7.514   1.00 68.03  ? 172  SER D C   1 
ATOM   7214 O O   . SER C 2 172 ? -7.170  32.356  7.217   1.00 68.17  ? 172  SER D O   1 
ATOM   7215 C CB  . SER C 2 172 ? -7.856  29.206  6.425   1.00 64.07  ? 172  SER D CB  1 
ATOM   7216 O OG  . SER C 2 172 ? -7.730  29.990  5.251   1.00 63.02  ? 172  SER D OG  1 
ATOM   7217 N N   . ARG C 2 173 ? -9.233  31.658  7.747   1.00 71.30  ? 173  ARG D N   1 
ATOM   7218 C CA  . ARG C 2 173 ? -9.842  32.979  7.657   1.00 74.92  ? 173  ARG D CA  1 
ATOM   7219 C C   . ARG C 2 173 ? -9.176  33.975  8.592   1.00 77.43  ? 173  ARG D C   1 
ATOM   7220 O O   . ARG C 2 173 ? -8.642  34.991  8.137   1.00 77.75  ? 173  ARG D O   1 
ATOM   7221 C CB  . ARG C 2 173 ? -11.340 32.891  7.895   1.00 73.95  ? 173  ARG D CB  1 
ATOM   7222 N N   . GLU C 2 174 ? -9.141  33.711  9.893   1.00 80.34  ? 174  GLU D N   1 
ATOM   7223 C CA  . GLU C 2 174 ? -8.494  34.639  10.825  1.00 83.48  ? 174  GLU D CA  1 
ATOM   7224 C C   . GLU C 2 174 ? -7.038  34.838  10.409  1.00 85.75  ? 174  GLU D C   1 
ATOM   7225 O O   . GLU C 2 174 ? -6.562  35.964  10.261  1.00 85.78  ? 174  GLU D O   1 
ATOM   7226 C CB  . GLU C 2 174 ? -8.635  34.155  12.251  1.00 82.96  ? 174  GLU D CB  1 
ATOM   7227 N N   . ALA C 2 175 ? -6.320  33.748  10.165  1.00 87.73  ? 175  ALA D N   1 
ATOM   7228 C CA  . ALA C 2 175 ? -4.937  33.778  9.733   1.00 90.25  ? 175  ALA D CA  1 
ATOM   7229 C C   . ALA C 2 175 ? -4.722  34.750  8.580   1.00 92.05  ? 175  ALA D C   1 
ATOM   7230 O O   . ALA C 2 175 ? -3.929  35.688  8.662   1.00 92.05  ? 175  ALA D O   1 
ATOM   7231 C CB  . ALA C 2 175 ? -4.498  32.388  9.278   1.00 90.35  ? 175  ALA D CB  1 
ATOM   7232 N N   . MET C 2 176 ? -5.482  34.564  7.505   1.00 93.65  ? 176  MET D N   1 
ATOM   7233 C CA  . MET C 2 176 ? -5.408  35.386  6.310   1.00 95.49  ? 176  MET D CA  1 
ATOM   7234 C C   . MET C 2 176 ? -6.231  36.667  6.367   1.00 96.59  ? 176  MET D C   1 
ATOM   7235 O O   . MET C 2 176 ? -6.702  37.189  5.352   1.00 96.72  ? 176  MET D O   1 
ATOM   7236 C CB  . MET C 2 176 ? -5.836  34.557  5.097   1.00 95.49  ? 176  MET D CB  1 
ATOM   7237 N N   . LYS C 2 177 ? -6.423  37.209  7.557   1.00 97.50  ? 177  LYS D N   1 
ATOM   7238 C CA  . LYS C 2 177 ? -7.131  38.442  7.823   1.00 98.35  ? 177  LYS D CA  1 
ATOM   7239 C C   . LYS C 2 177 ? -6.310  39.247  8.837   1.00 98.72  ? 177  LYS D C   1 
ATOM   7240 O O   . LYS C 2 177 ? -6.566  40.420  9.087   1.00 99.08  ? 177  LYS D O   1 
ATOM   7241 C CB  . LYS C 2 177 ? -8.531  38.205  8.356   1.00 98.81  ? 177  LYS D CB  1 
ATOM   7242 N N   . ARG C 2 178 ? -5.312  38.575  9.403   1.00 98.57  ? 178  ARG D N   1 
ATOM   7243 C CA  . ARG C 2 178 ? -4.405  39.190  10.366  1.00 98.19  ? 178  ARG D CA  1 
ATOM   7244 C C   . ARG C 2 178 ? -2.977  39.121  9.826   1.00 97.75  ? 178  ARG D C   1 
ATOM   7245 O O   . ARG C 2 178 ? -1.984  39.339  10.512  1.00 97.70  ? 178  ARG D O   1 
ATOM   7246 C CB  . ARG C 2 178 ? -4.527  38.508  11.720  1.00 97.70  ? 178  ARG D CB  1 
ATOM   7247 N N   . ARG C 2 179 ? -2.870  38.773  8.548   1.00 97.09  ? 179  ARG D N   1 
ATOM   7248 C CA  . ARG C 2 179 ? -1.616  38.641  7.826   1.00 95.91  ? 179  ARG D CA  1 
ATOM   7249 C C   . ARG C 2 179 ? -0.538  37.957  8.658   1.00 94.88  ? 179  ARG D C   1 
ATOM   7250 O O   . ARG C 2 179 ? 0.548   38.486  8.893   1.00 95.13  ? 179  ARG D O   1 
ATOM   7251 C CB  . ARG C 2 179 ? -1.142  40.000  7.333   1.00 96.77  ? 179  ARG D CB  1 
ATOM   7252 N N   . GLU C 2 180 ? -0.839  36.738  9.094   1.00 93.14  ? 180  GLU D N   1 
ATOM   7253 C CA  . GLU C 2 180 ? 0.081   35.961  9.912   1.00 90.78  ? 180  GLU D CA  1 
ATOM   7254 C C   . GLU C 2 180 ? -0.057  34.496  9.528   1.00 89.02  ? 180  GLU D C   1 
ATOM   7255 O O   . GLU C 2 180 ? -0.991  34.127  8.823   1.00 89.00  ? 180  GLU D O   1 
ATOM   7256 C CB  . GLU C 2 180 ? -0.222  36.201  11.379  1.00 91.01  ? 180  GLU D CB  1 
ATOM   7257 N N   . PRO C 2 181 ? 0.899   33.681  9.947   1.00 87.56  ? 181  PRO D N   1 
ATOM   7258 C CA  . PRO C 2 181 ? 0.901   32.255  9.663   1.00 85.79  ? 181  PRO D CA  1 
ATOM   7259 C C   . PRO C 2 181 ? -0.260  31.529  10.318  1.00 83.46  ? 181  PRO D C   1 
ATOM   7260 O O   . PRO C 2 181 ? -0.671  31.901  11.423  1.00 82.89  ? 181  PRO D O   1 
ATOM   7261 C CB  . PRO C 2 181 ? 2.230   31.764  10.227  1.00 86.16  ? 181  PRO D CB  1 
ATOM   7262 C CG  . PRO C 2 181 ? 3.044   32.970  10.520  1.00 86.83  ? 181  PRO D CG  1 
ATOM   7263 C CD  . PRO C 2 181 ? 2.066   34.082  10.775  1.00 87.22  ? 181  PRO D CD  1 
ATOM   7264 N N   . ILE C 2 182 ? -0.757  30.439  9.725   1.00 80.51  ? 182  ILE D N   1 
ATOM   7265 C CA  . ILE C 2 182 ? -1.847  29.668  10.330  1.00 76.84  ? 182  ILE D CA  1 
ATOM   7266 C C   . ILE C 2 182 ? -1.409  29.182  11.707  1.00 74.41  ? 182  ILE D C   1 
ATOM   7267 O O   . ILE C 2 182 ? -2.159  29.149  12.679  1.00 73.97  ? 182  ILE D O   1 
ATOM   7268 C CB  . ILE C 2 182 ? -2.329  28.496  9.466   1.00 76.87  ? 182  ILE D CB  1 
ATOM   7269 C CG1 . ILE C 2 182 ? -3.386  28.989  8.466   1.00 77.39  ? 182  ILE D CG1 1 
ATOM   7270 C CG2 . ILE C 2 182 ? -2.917  27.350  10.279  1.00 76.56  ? 182  ILE D CG2 1 
ATOM   7271 C CD1 . ILE C 2 182 ? -3.910  27.911  7.544   1.00 78.93  ? 182  ILE D CD1 1 
ATOM   7272 N N   . LEU C 2 183 ? -0.146  28.801  11.790  1.00 71.47  ? 183  LEU D N   1 
ATOM   7273 C CA  . LEU C 2 183 ? 0.520   28.357  12.988  1.00 68.64  ? 183  LEU D CA  1 
ATOM   7274 C C   . LEU C 2 183 ? 0.500   29.378  14.114  1.00 66.69  ? 183  LEU D C   1 
ATOM   7275 O O   . LEU C 2 183 ? 0.430   28.980  15.282  1.00 65.59  ? 183  LEU D O   1 
ATOM   7276 C CB  . LEU C 2 183 ? 1.953   27.996  12.579  1.00 67.14  ? 183  LEU D CB  1 
ATOM   7277 C CG  . LEU C 2 183 ? 2.823   27.194  13.533  1.00 66.54  ? 183  LEU D CG  1 
ATOM   7278 C CD1 . LEU C 2 183 ? 2.127   25.960  14.075  1.00 65.69  ? 183  LEU D CD1 1 
ATOM   7279 C CD2 . LEU C 2 183 ? 4.110   26.771  12.826  1.00 66.38  ? 183  LEU D CD2 1 
ATOM   7280 N N   . LYS C 2 184 ? 0.592   30.673  13.829  1.00 65.17  ? 184  LYS D N   1 
ATOM   7281 C CA  . LYS C 2 184 ? 0.564   31.687  14.885  1.00 64.30  ? 184  LYS D CA  1 
ATOM   7282 C C   . LYS C 2 184 ? -0.827  31.724  15.528  1.00 63.23  ? 184  LYS D C   1 
ATOM   7283 O O   . LYS C 2 184 ? -0.990  31.691  16.748  1.00 62.48  ? 184  LYS D O   1 
ATOM   7284 C CB  . LYS C 2 184 ? 0.971   33.059  14.388  1.00 62.79  ? 184  LYS D CB  1 
ATOM   7285 N N   . ILE C 2 185 ? -1.849  31.724  14.682  1.00 62.29  ? 185  ILE D N   1 
ATOM   7286 C CA  . ILE C 2 185 ? -3.233  31.677  15.147  1.00 61.67  ? 185  ILE D CA  1 
ATOM   7287 C C   . ILE C 2 185 ? -3.378  30.451  16.039  1.00 61.18  ? 185  ILE D C   1 
ATOM   7288 O O   . ILE C 2 185 ? -3.726  30.563  17.213  1.00 60.70  ? 185  ILE D O   1 
ATOM   7289 C CB  . ILE C 2 185 ? -4.202  31.673  13.959  1.00 61.65  ? 185  ILE D CB  1 
ATOM   7290 C CG1 . ILE C 2 185 ? -3.859  32.779  12.954  1.00 61.44  ? 185  ILE D CG1 1 
ATOM   7291 C CG2 . ILE C 2 185 ? -5.644  31.830  14.408  1.00 61.85  ? 185  ILE D CG2 1 
ATOM   7292 C CD1 . ILE C 2 185 ? -3.613  34.155  13.521  1.00 60.47  ? 185  ILE D CD1 1 
ATOM   7293 N N   . ALA C 2 186 ? -2.990  29.283  15.536  1.00 60.46  ? 186  ALA D N   1 
ATOM   7294 C CA  . ALA C 2 186 ? -3.050  28.046  16.295  1.00 60.28  ? 186  ALA D CA  1 
ATOM   7295 C C   . ALA C 2 186 ? -2.358  28.148  17.642  1.00 60.08  ? 186  ALA D C   1 
ATOM   7296 O O   . ALA C 2 186 ? -2.958  27.800  18.666  1.00 60.10  ? 186  ALA D O   1 
ATOM   7297 C CB  . ALA C 2 186 ? -2.470  26.899  15.471  1.00 59.75  ? 186  ALA D CB  1 
ATOM   7298 N N   . GLN C 2 187 ? -1.119  28.629  17.685  1.00 59.87  ? 187  GLN D N   1 
ATOM   7299 C CA  . GLN C 2 187 ? -0.413  28.775  18.957  1.00 59.89  ? 187  GLN D CA  1 
ATOM   7300 C C   . GLN C 2 187 ? -1.070  29.814  19.856  1.00 59.32  ? 187  GLN D C   1 
ATOM   7301 O O   . GLN C 2 187 ? -1.064  29.666  21.082  1.00 58.83  ? 187  GLN D O   1 
ATOM   7302 C CB  . GLN C 2 187 ? 1.069   29.074  18.750  1.00 61.60  ? 187  GLN D CB  1 
ATOM   7303 C CG  . GLN C 2 187 ? 1.916   27.858  18.413  1.00 62.89  ? 187  GLN D CG  1 
ATOM   7304 C CD  . GLN C 2 187 ? 2.125   26.944  19.601  1.00 65.07  ? 187  GLN D CD  1 
ATOM   7305 O OE1 . GLN C 2 187 ? 1.628   27.182  20.707  1.00 65.78  ? 187  GLN D OE1 1 
ATOM   7306 N NE2 . GLN C 2 187 ? 2.872   25.855  19.440  1.00 65.95  ? 187  GLN D NE2 1 
ATOM   7307 N N   . GLU C 2 188 ? -1.691  30.849  19.299  1.00 59.33  ? 188  GLU D N   1 
ATOM   7308 C CA  . GLU C 2 188 ? -2.383  31.844  20.122  1.00 59.21  ? 188  GLU D CA  1 
ATOM   7309 C C   . GLU C 2 188 ? -3.501  31.120  20.860  1.00 58.97  ? 188  GLU D C   1 
ATOM   7310 O O   . GLU C 2 188 ? -3.617  31.166  22.082  1.00 59.11  ? 188  GLU D O   1 
ATOM   7311 C CB  . GLU C 2 188 ? -2.865  33.016  19.294  1.00 58.01  ? 188  GLU D CB  1 
ATOM   7312 N N   . LEU C 2 189 ? -4.290  30.317  20.149  1.00 58.55  ? 189  LEU D N   1 
ATOM   7313 C CA  . LEU C 2 189 ? -5.365  29.542  20.739  1.00 57.88  ? 189  LEU D CA  1 
ATOM   7314 C C   . LEU C 2 189 ? -4.902  28.600  21.847  1.00 57.41  ? 189  LEU D C   1 
ATOM   7315 O O   . LEU C 2 189 ? -5.582  28.367  22.848  1.00 57.02  ? 189  LEU D O   1 
ATOM   7316 C CB  . LEU C 2 189 ? -6.088  28.708  19.686  1.00 58.94  ? 189  LEU D CB  1 
ATOM   7317 C CG  . LEU C 2 189 ? -6.816  29.359  18.523  1.00 59.00  ? 189  LEU D CG  1 
ATOM   7318 C CD1 . LEU C 2 189 ? -7.948  28.450  18.048  1.00 58.71  ? 189  LEU D CD1 1 
ATOM   7319 C CD2 . LEU C 2 189 ? -7.337  30.742  18.861  1.00 60.29  ? 189  LEU D CD2 1 
ATOM   7320 N N   . LEU C 2 190 ? -3.769  27.953  21.630  1.00 57.03  ? 190  LEU D N   1 
ATOM   7321 C CA  . LEU C 2 190 ? -3.209  27.032  22.605  1.00 55.81  ? 190  LEU D CA  1 
ATOM   7322 C C   . LEU C 2 190 ? -2.584  27.866  23.722  1.00 54.93  ? 190  LEU D C   1 
ATOM   7323 O O   . LEU C 2 190 ? -2.579  27.351  24.862  1.00 53.68  ? 190  LEU D O   1 
ATOM   7324 C CB  . LEU C 2 190 ? -2.221  26.074  21.947  1.00 55.08  ? 190  LEU D CB  1 
ATOM   7325 C CG  . LEU C 2 190 ? -2.696  25.258  20.742  1.00 54.37  ? 190  LEU D CG  1 
ATOM   7326 C CD1 . LEU C 2 190 ? -1.600  24.307  20.266  1.00 53.81  ? 190  LEU D CD1 1 
ATOM   7327 C CD2 . LEU C 2 190 ? -3.946  24.447  21.063  1.00 53.10  ? 190  LEU D CD2 1 
ATOM   7328 N N   . SER D 2 2   ? 33.886  6.299   14.146  1.00 29.74  ? 2    SER E N   1 
ATOM   7329 C CA  . SER D 2 2   ? 35.234  6.671   14.668  1.00 28.85  ? 2    SER E CA  1 
ATOM   7330 C C   . SER D 2 2   ? 36.365  6.478   13.658  1.00 28.18  ? 2    SER E C   1 
ATOM   7331 O O   . SER D 2 2   ? 36.285  5.607   12.784  1.00 26.13  ? 2    SER E O   1 
ATOM   7332 C CB  . SER D 2 2   ? 35.414  5.779   15.898  1.00 32.24  ? 2    SER E CB  1 
ATOM   7333 O OG  . SER D 2 2   ? 36.719  5.831   16.368  1.00 34.92  ? 2    SER E OG  1 
ATOM   7334 N N   . ALA D 2 3   ? 37.466  7.239   13.789  1.00 26.52  ? 3    ALA E N   1 
ATOM   7335 C CA  . ALA D 2 3   ? 38.593  7.036   12.888  1.00 26.65  ? 3    ALA E CA  1 
ATOM   7336 C C   . ALA D 2 3   ? 39.087  5.598   13.040  1.00 26.18  ? 3    ALA E C   1 
ATOM   7337 O O   . ALA D 2 3   ? 39.104  4.847   12.078  1.00 25.14  ? 3    ALA E O   1 
ATOM   7338 C CB  . ALA D 2 3   ? 39.714  8.039   13.115  1.00 23.10  ? 3    ALA E CB  1 
ATOM   7339 N N   . ASN D 2 4   ? 39.337  5.180   14.285  1.00 27.73  ? 4    ASN E N   1 
ATOM   7340 C CA  . ASN D 2 4   ? 39.791  3.817   14.572  1.00 28.77  ? 4    ASN E CA  1 
ATOM   7341 C C   . ASN D 2 4   ? 38.722  2.791   14.245  1.00 26.20  ? 4    ASN E C   1 
ATOM   7342 O O   . ASN D 2 4   ? 39.057  1.689   13.824  1.00 27.36  ? 4    ASN E O   1 
ATOM   7343 C CB  . ASN D 2 4   ? 40.293  3.665   16.019  1.00 37.66  ? 4    ASN E CB  1 
ATOM   7344 C CG  . ASN D 2 4   ? 40.557  2.240   16.486  1.00 45.29  ? 4    ASN E CG  1 
ATOM   7345 O OD1 . ASN D 2 4   ? 39.832  1.669   17.333  1.00 48.16  ? 4    ASN E OD1 1 
ATOM   7346 N ND2 . ASN D 2 4   ? 41.598  1.571   15.978  1.00 45.71  ? 4    ASN E ND2 1 
ATOM   7347 N N   . SER D 2 5   ? 37.428  3.066   14.395  1.00 25.40  ? 5    SER E N   1 
ATOM   7348 C CA  . SER D 2 5   ? 36.468  1.998   14.057  1.00 24.03  ? 5    SER E CA  1 
ATOM   7349 C C   . SER D 2 5   ? 36.349  1.955   12.539  1.00 22.56  ? 5    SER E C   1 
ATOM   7350 O O   . SER D 2 5   ? 36.203  0.873   11.975  1.00 23.63  ? 5    SER E O   1 
ATOM   7351 C CB  . SER D 2 5   ? 35.148  2.124   14.798  1.00 21.63  ? 5    SER E CB  1 
ATOM   7352 O OG  . SER D 2 5   ? 34.277  3.045   14.160  1.00 26.28  ? 5    SER E OG  1 
ATOM   7353 N N   . LEU D 2 6   ? 36.473  3.096   11.851  1.00 21.35  ? 6    LEU E N   1 
ATOM   7354 C CA  . LEU D 2 6   ? 36.418  3.060   10.395  1.00 20.96  ? 6    LEU E CA  1 
ATOM   7355 C C   . LEU D 2 6   ? 37.634  2.302   9.852   1.00 18.92  ? 6    LEU E C   1 
ATOM   7356 O O   . LEU D 2 6   ? 37.517  1.387   9.061   1.00 17.74  ? 6    LEU E O   1 
ATOM   7357 C CB  . LEU D 2 6   ? 36.411  4.463   9.797   1.00 23.75  ? 6    LEU E CB  1 
ATOM   7358 C CG  . LEU D 2 6   ? 35.623  4.705   8.517   1.00 25.39  ? 6    LEU E CG  1 
ATOM   7359 C CD1 . LEU D 2 6   ? 36.107  5.981   7.846   1.00 22.99  ? 6    LEU E CD1 1 
ATOM   7360 C CD2 . LEU D 2 6   ? 35.602  3.534   7.567   1.00 25.17  ? 6    LEU E CD2 1 
ATOM   7361 N N   . LEU D 2 7   ? 38.827  2.641   10.302  1.00 18.84  ? 7    LEU E N   1 
ATOM   7362 C CA  . LEU D 2 7   ? 40.052  1.970   9.856   1.00 19.97  ? 7    LEU E CA  1 
ATOM   7363 C C   . LEU D 2 7   ? 40.053  0.515   10.240  1.00 19.67  ? 7    LEU E C   1 
ATOM   7364 O O   . LEU D 2 7   ? 40.439  -0.337  9.453   1.00 19.09  ? 7    LEU E O   1 
ATOM   7365 C CB  . LEU D 2 7   ? 41.319  2.680   10.404  1.00 17.23  ? 7    LEU E CB  1 
ATOM   7366 C CG  . LEU D 2 7   ? 41.520  4.105   9.849   1.00 18.32  ? 7    LEU E CG  1 
ATOM   7367 C CD1 . LEU D 2 7   ? 42.876  4.628   10.295  1.00 20.48  ? 7    LEU E CD1 1 
ATOM   7368 C CD2 . LEU D 2 7   ? 41.414  4.152   8.326   1.00 15.42  ? 7    LEU E CD2 1 
ATOM   7369 N N   . GLY D 2 8   ? 39.612  0.190   11.469  1.00 22.81  ? 8    GLY E N   1 
ATOM   7370 C CA  . GLY D 2 8   ? 39.584  -1.228  11.882  1.00 23.09  ? 8    GLY E CA  1 
ATOM   7371 C C   . GLY D 2 8   ? 38.532  -2.028  11.134  1.00 25.52  ? 8    GLY E C   1 
ATOM   7372 O O   . GLY D 2 8   ? 38.659  -3.258  11.119  1.00 28.44  ? 8    GLY E O   1 
ATOM   7373 N N   . SER D 2 9   ? 37.484  -1.487  10.516  1.00 25.15  ? 9    SER E N   1 
ATOM   7374 C CA  . SER D 2 9   ? 36.477  -2.309  9.853   1.00 26.91  ? 9    SER E CA  1 
ATOM   7375 C C   . SER D 2 9   ? 36.749  -2.645  8.395   1.00 26.87  ? 9    SER E C   1 
ATOM   7376 O O   . SER D 2 9   ? 35.996  -3.433  7.799   1.00 27.26  ? 9    SER E O   1 
ATOM   7377 C CB  . SER D 2 9   ? 35.150  -1.526  9.888   1.00 26.74  ? 9    SER E CB  1 
ATOM   7378 O OG  . SER D 2 9   ? 35.142  -0.603  8.794   1.00 31.09  ? 9    SER E OG  1 
ATOM   7379 N N   . LEU D 2 10  ? 37.790  -2.089  7.776   1.00 25.38  ? 10   LEU E N   1 
ATOM   7380 C CA  . LEU D 2 10  ? 38.050  -2.276  6.361   1.00 23.17  ? 10   LEU E CA  1 
ATOM   7381 C C   . LEU D 2 10  ? 38.136  -3.712  5.923   1.00 21.97  ? 10   LEU E C   1 
ATOM   7382 O O   . LEU D 2 10  ? 37.622  -4.003  4.838   1.00 21.95  ? 10   LEU E O   1 
ATOM   7383 C CB  . LEU D 2 10  ? 39.326  -1.568  5.869   1.00 22.94  ? 10   LEU E CB  1 
ATOM   7384 C CG  . LEU D 2 10  ? 39.343  -0.055  6.162   1.00 25.81  ? 10   LEU E CG  1 
ATOM   7385 C CD1 . LEU D 2 10  ? 40.765  0.467   6.119   1.00 25.33  ? 10   LEU E CD1 1 
ATOM   7386 C CD2 . LEU D 2 10  ? 38.423  0.669   5.192   1.00 21.35  ? 10   LEU E CD2 1 
ATOM   7387 N N   . ARG D 2 11  ? 38.783  -4.574  6.681   1.00 21.60  ? 11   ARG E N   1 
ATOM   7388 C CA  . ARG D 2 11  ? 38.921  -5.974  6.325   1.00 23.25  ? 11   ARG E CA  1 
ATOM   7389 C C   . ARG D 2 11  ? 37.597  -6.732  6.322   1.00 24.85  ? 11   ARG E C   1 
ATOM   7390 O O   . ARG D 2 11  ? 37.567  -7.840  5.787   1.00 25.56  ? 11   ARG E O   1 
ATOM   7391 C CB  . ARG D 2 11  ? 39.995  -6.688  7.169   1.00 18.20  ? 11   ARG E CB  1 
ATOM   7392 C CG  . ARG D 2 11  ? 41.356  -6.132  6.830   1.00 21.41  ? 11   ARG E CG  1 
ATOM   7393 C CD  . ARG D 2 11  ? 42.574  -6.927  7.246   1.00 19.95  ? 11   ARG E CD  1 
ATOM   7394 N NE  . ARG D 2 11  ? 43.724  -6.410  6.517   1.00 21.91  ? 11   ARG E NE  1 
ATOM   7395 C CZ  . ARG D 2 11  ? 44.972  -6.864  6.544   1.00 20.58  ? 11   ARG E CZ  1 
ATOM   7396 N NH1 . ARG D 2 11  ? 45.358  -7.892  7.301   1.00 18.44  ? 11   ARG E NH1 1 
ATOM   7397 N NH2 . ARG D 2 11  ? 45.845  -6.277  5.738   1.00 16.58  ? 11   ARG E NH2 1 
ATOM   7398 N N   . GLU D 2 12  ? 36.505  -6.196  6.864   1.00 26.11  ? 12   GLU E N   1 
ATOM   7399 C CA  . GLU D 2 12  ? 35.217  -6.866  6.800   1.00 25.83  ? 12   GLU E CA  1 
ATOM   7400 C C   . GLU D 2 12  ? 34.402  -6.300  5.640   1.00 25.17  ? 12   GLU E C   1 
ATOM   7401 O O   . GLU D 2 12  ? 33.289  -6.796  5.457   1.00 24.84  ? 12   GLU E O   1 
ATOM   7402 C CB  . GLU D 2 12  ? 34.414  -6.702  8.071   1.00 28.75  ? 12   GLU E CB  1 
ATOM   7403 C CG  . GLU D 2 12  ? 35.053  -7.149  9.374   1.00 32.69  ? 12   GLU E CG  1 
ATOM   7404 C CD  . GLU D 2 12  ? 34.550  -6.251  10.488  1.00 38.61  ? 12   GLU E CD  1 
ATOM   7405 O OE1 . GLU D 2 12  ? 33.445  -5.675  10.341  1.00 42.47  ? 12   GLU E OE1 1 
ATOM   7406 O OE2 . GLU D 2 12  ? 35.237  -6.064  11.518  1.00 44.78  ? 12   GLU E OE2 1 
ATOM   7407 N N   . LEU D 2 13  ? 34.907  -5.290  4.922   1.00 24.04  ? 13   LEU E N   1 
ATOM   7408 C CA  . LEU D 2 13  ? 34.106  -4.781  3.804   1.00 23.00  ? 13   LEU E CA  1 
ATOM   7409 C C   . LEU D 2 13  ? 34.170  -5.781  2.638   1.00 23.07  ? 13   LEU E C   1 
ATOM   7410 O O   . LEU D 2 13  ? 35.156  -6.414  2.309   1.00 22.75  ? 13   LEU E O   1 
ATOM   7411 C CB  . LEU D 2 13  ? 34.485  -3.416  3.294   1.00 20.93  ? 13   LEU E CB  1 
ATOM   7412 C CG  . LEU D 2 13  ? 34.586  -2.185  4.173   1.00 22.18  ? 13   LEU E CG  1 
ATOM   7413 C CD1 . LEU D 2 13  ? 35.394  -1.081  3.487   1.00 22.34  ? 13   LEU E CD1 1 
ATOM   7414 C CD2 . LEU D 2 13  ? 33.231  -1.622  4.563   1.00 22.25  ? 13   LEU E CD2 1 
ATOM   7415 N N   . GLN D 2 14  ? 33.053  -5.910  1.970   1.00 22.95  ? 14   GLN E N   1 
ATOM   7416 C CA  . GLN D 2 14  ? 32.835  -6.727  0.802   1.00 23.46  ? 14   GLN E CA  1 
ATOM   7417 C C   . GLN D 2 14  ? 32.820  -5.736  -0.361  1.00 22.48  ? 14   GLN E C   1 
ATOM   7418 O O   . GLN D 2 14  ? 31.979  -4.840  -0.476  1.00 22.41  ? 14   GLN E O   1 
ATOM   7419 C CB  . GLN D 2 14  ? 31.478  -7.455  0.926   1.00 29.59  ? 14   GLN E CB  1 
ATOM   7420 C CG  . GLN D 2 14  ? 31.606  -8.921  0.541   1.00 34.38  ? 14   GLN E CG  1 
ATOM   7421 C CD  . GLN D 2 14  ? 32.178  -9.801  1.622   1.00 36.37  ? 14   GLN E CD  1 
ATOM   7422 O OE1 . GLN D 2 14  ? 32.461  -10.986 1.416   1.00 40.41  ? 14   GLN E OE1 1 
ATOM   7423 N NE2 . GLN D 2 14  ? 32.398  -9.249  2.813   1.00 38.64  ? 14   GLN E NE2 1 
ATOM   7424 N N   . VAL D 2 15  ? 33.841  -5.865  -1.191  1.00 21.75  ? 15   VAL E N   1 
ATOM   7425 C CA  . VAL D 2 15  ? 34.055  -4.933  -2.274  1.00 20.95  ? 15   VAL E CA  1 
ATOM   7426 C C   . VAL D 2 15  ? 33.809  -5.552  -3.629  1.00 20.74  ? 15   VAL E C   1 
ATOM   7427 O O   . VAL D 2 15  ? 34.250  -6.663  -3.852  1.00 21.55  ? 15   VAL E O   1 
ATOM   7428 C CB  . VAL D 2 15  ? 35.512  -4.383  -2.186  1.00 19.38  ? 15   VAL E CB  1 
ATOM   7429 C CG1 . VAL D 2 15  ? 35.701  -3.366  -3.291  1.00 18.94  ? 15   VAL E CG1 1 
ATOM   7430 C CG2 . VAL D 2 15  ? 35.744  -3.734  -0.820  1.00 16.83  ? 15   VAL E CG2 1 
ATOM   7431 N N   . LEU D 2 16  ? 33.132  -4.825  -4.502  1.00 20.22  ? 16   LEU E N   1 
ATOM   7432 C CA  . LEU D 2 16  ? 32.948  -5.302  -5.851  1.00 20.91  ? 16   LEU E CA  1 
ATOM   7433 C C   . LEU D 2 16  ? 33.609  -4.412  -6.906  1.00 19.08  ? 16   LEU E C   1 
ATOM   7434 O O   . LEU D 2 16  ? 33.369  -3.207  -6.879  1.00 19.10  ? 16   LEU E O   1 
ATOM   7435 C CB  . LEU D 2 16  ? 31.441  -5.344  -6.214  1.00 20.99  ? 16   LEU E CB  1 
ATOM   7436 C CG  . LEU D 2 16  ? 31.352  -6.084  -7.567  1.00 24.49  ? 16   LEU E CG  1 
ATOM   7437 C CD1 . LEU D 2 16  ? 31.058  -7.548  -7.296  1.00 26.36  ? 16   LEU E CD1 1 
ATOM   7438 C CD2 . LEU D 2 16  ? 30.387  -5.387  -8.480  1.00 25.23  ? 16   LEU E CD2 1 
ATOM   7439 N N   . VAL D 2 17  ? 34.334  -5.006  -7.822  1.00 18.00  ? 17   VAL E N   1 
ATOM   7440 C CA  . VAL D 2 17  ? 34.961  -4.246  -8.907  1.00 20.16  ? 17   VAL E CA  1 
ATOM   7441 C C   . VAL D 2 17  ? 34.121  -4.469  -10.154 1.00 20.96  ? 17   VAL E C   1 
ATOM   7442 O O   . VAL D 2 17  ? 34.108  -5.571  -10.702 1.00 20.91  ? 17   VAL E O   1 
ATOM   7443 C CB  . VAL D 2 17  ? 36.431  -4.627  -9.140  1.00 18.54  ? 17   VAL E CB  1 
ATOM   7444 C CG1 . VAL D 2 17  ? 37.026  -3.988  -10.375 1.00 18.22  ? 17   VAL E CG1 1 
ATOM   7445 C CG2 . VAL D 2 17  ? 37.218  -4.195  -7.903  1.00 15.40  ? 17   VAL E CG2 1 
ATOM   7446 N N   . LEU D 2 18  ? 33.250  -3.513  -10.424 1.00 21.98  ? 18   LEU E N   1 
ATOM   7447 C CA  . LEU D 2 18  ? 32.300  -3.705  -11.558 1.00 22.81  ? 18   LEU E CA  1 
ATOM   7448 C C   . LEU D 2 18  ? 32.916  -3.052  -12.780 1.00 21.87  ? 18   LEU E C   1 
ATOM   7449 O O   . LEU D 2 18  ? 32.767  -1.873  -13.089 1.00 21.65  ? 18   LEU E O   1 
ATOM   7450 C CB  . LEU D 2 18  ? 30.940  -3.145  -11.118 1.00 23.49  ? 18   LEU E CB  1 
ATOM   7451 C CG  . LEU D 2 18  ? 29.836  -3.263  -12.183 1.00 23.99  ? 18   LEU E CG  1 
ATOM   7452 C CD1 . LEU D 2 18  ? 29.443  -4.719  -12.364 1.00 24.12  ? 18   LEU E CD1 1 
ATOM   7453 C CD2 . LEU D 2 18  ? 28.658  -2.378  -11.821 1.00 25.69  ? 18   LEU E CD2 1 
ATOM   7454 N N   . ASN D 2 19  ? 33.743  -3.835  -13.464 1.00 22.39  ? 19   ASN E N   1 
ATOM   7455 C CA  . ASN D 2 19  ? 34.550  -3.347  -14.580 1.00 22.99  ? 19   ASN E CA  1 
ATOM   7456 C C   . ASN D 2 19  ? 35.018  -4.537  -15.394 1.00 24.08  ? 19   ASN E C   1 
ATOM   7457 O O   . ASN D 2 19  ? 35.157  -5.628  -14.835 1.00 24.46  ? 19   ASN E O   1 
ATOM   7458 C CB  . ASN D 2 19  ? 35.764  -2.669  -13.902 1.00 22.93  ? 19   ASN E CB  1 
ATOM   7459 C CG  . ASN D 2 19  ? 36.525  -1.686  -14.729 1.00 21.70  ? 19   ASN E CG  1 
ATOM   7460 O OD1 . ASN D 2 19  ? 35.934  -0.696  -15.149 1.00 24.71  ? 19   ASN E OD1 1 
ATOM   7461 N ND2 . ASN D 2 19  ? 37.814  -1.890  -15.014 1.00 22.63  ? 19   ASN E ND2 1 
ATOM   7462 N N   . PRO D 2 20  ? 35.141  -4.360  -16.701 1.00 25.02  ? 20   PRO E N   1 
ATOM   7463 C CA  . PRO D 2 20  ? 35.585  -5.415  -17.602 1.00 26.00  ? 20   PRO E CA  1 
ATOM   7464 C C   . PRO D 2 20  ? 36.933  -5.942  -17.130 1.00 27.05  ? 20   PRO E C   1 
ATOM   7465 O O   . PRO D 2 20  ? 37.735  -5.210  -16.543 1.00 27.61  ? 20   PRO E O   1 
ATOM   7466 C CB  . PRO D 2 20  ? 35.689  -4.729  -18.953 1.00 25.74  ? 20   PRO E CB  1 
ATOM   7467 C CG  . PRO D 2 20  ? 34.896  -3.487  -18.854 1.00 24.08  ? 20   PRO E CG  1 
ATOM   7468 C CD  . PRO D 2 20  ? 34.888  -3.081  -17.404 1.00 24.37  ? 20   PRO E CD  1 
ATOM   7469 N N   . PRO D 2 21  ? 37.178  -7.220  -17.322 1.00 28.04  ? 21   PRO E N   1 
ATOM   7470 C CA  . PRO D 2 21  ? 38.425  -7.841  -16.859 1.00 29.37  ? 21   PRO E CA  1 
ATOM   7471 C C   . PRO D 2 21  ? 39.575  -7.251  -17.656 1.00 29.26  ? 21   PRO E C   1 
ATOM   7472 O O   . PRO D 2 21  ? 39.365  -6.864  -18.808 1.00 29.93  ? 21   PRO E O   1 
ATOM   7473 C CB  . PRO D 2 21  ? 38.218  -9.325  -17.064 1.00 29.08  ? 21   PRO E CB  1 
ATOM   7474 C CG  . PRO D 2 21  ? 37.103  -9.464  -18.039 1.00 28.12  ? 21   PRO E CG  1 
ATOM   7475 C CD  . PRO D 2 21  ? 36.302  -8.194  -17.992 1.00 28.58  ? 21   PRO E CD  1 
ATOM   7476 N N   . GLY D 2 22  ? 40.718  -7.064  -17.032 1.00 28.79  ? 22   GLY E N   1 
ATOM   7477 C CA  . GLY D 2 22  ? 41.874  -6.473  -17.669 1.00 29.04  ? 22   GLY E CA  1 
ATOM   7478 C C   . GLY D 2 22  ? 42.837  -5.942  -16.600 1.00 29.81  ? 22   GLY E C   1 
ATOM   7479 O O   . GLY D 2 22  ? 42.654  -6.211  -15.412 1.00 28.91  ? 22   GLY E O   1 
ATOM   7480 N N   . GLU D 2 23  ? 43.825  -5.193  -17.057 1.00 29.49  ? 23   GLU E N   1 
ATOM   7481 C CA  . GLU D 2 23  ? 44.856  -4.618  -16.222 1.00 30.90  ? 23   GLU E CA  1 
ATOM   7482 C C   . GLU D 2 23  ? 44.334  -3.691  -15.137 1.00 28.44  ? 23   GLU E C   1 
ATOM   7483 O O   . GLU D 2 23  ? 44.756  -3.766  -13.986 1.00 28.23  ? 23   GLU E O   1 
ATOM   7484 C CB  . GLU D 2 23  ? 45.850  -3.830  -17.096 1.00 38.71  ? 23   GLU E CB  1 
ATOM   7485 C CG  . GLU D 2 23  ? 46.983  -4.668  -17.655 1.00 47.94  ? 23   GLU E CG  1 
ATOM   7486 C CD  . GLU D 2 23  ? 48.128  -3.797  -18.168 1.00 55.17  ? 23   GLU E CD  1 
ATOM   7487 O OE1 . GLU D 2 23  ? 48.232  -2.599  -17.798 1.00 56.92  ? 23   GLU E OE1 1 
ATOM   7488 O OE2 . GLU D 2 23  ? 48.940  -4.335  -18.967 1.00 58.71  ? 23   GLU E OE2 1 
ATOM   7489 N N   . VAL D 2 24  ? 43.444  -2.776  -15.511 1.00 26.03  ? 24   VAL E N   1 
ATOM   7490 C CA  . VAL D 2 24  ? 42.840  -1.890  -14.520 1.00 25.05  ? 24   VAL E CA  1 
ATOM   7491 C C   . VAL D 2 24  ? 42.203  -2.741  -13.420 1.00 23.28  ? 24   VAL E C   1 
ATOM   7492 O O   . VAL D 2 24  ? 42.548  -2.646  -12.238 1.00 22.52  ? 24   VAL E O   1 
ATOM   7493 C CB  . VAL D 2 24  ? 41.832  -0.947  -15.166 1.00 24.45  ? 24   VAL E CB  1 
ATOM   7494 C CG1 . VAL D 2 24  ? 40.936  -0.282  -14.124 1.00 26.46  ? 24   VAL E CG1 1 
ATOM   7495 C CG2 . VAL D 2 24  ? 42.551  0.138   -15.965 1.00 27.28  ? 24   VAL E CG2 1 
ATOM   7496 N N   . SER D 2 25  ? 41.360  -3.684  -13.813 1.00 20.83  ? 25   SER E N   1 
ATOM   7497 C CA  . SER D 2 25  ? 40.673  -4.536  -12.857 1.00 19.93  ? 25   SER E CA  1 
ATOM   7498 C C   . SER D 2 25  ? 41.614  -5.357  -12.001 1.00 19.50  ? 25   SER E C   1 
ATOM   7499 O O   . SER D 2 25  ? 41.343  -5.523  -10.804 1.00 20.33  ? 25   SER E O   1 
ATOM   7500 C CB  . SER D 2 25  ? 39.651  -5.443  -13.537 1.00 17.43  ? 25   SER E CB  1 
ATOM   7501 O OG  . SER D 2 25  ? 38.466  -4.720  -13.844 1.00 17.44  ? 25   SER E OG  1 
ATOM   7502 N N   . ASP D 2 26  ? 42.658  -5.928  -12.571 1.00 19.34  ? 26   ASP E N   1 
ATOM   7503 C CA  . ASP D 2 26  ? 43.601  -6.748  -11.820 1.00 20.03  ? 26   ASP E CA  1 
ATOM   7504 C C   . ASP D 2 26  ? 44.284  -5.954  -10.715 1.00 19.24  ? 26   ASP E C   1 
ATOM   7505 O O   . ASP D 2 26  ? 44.289  -6.324  -9.542  1.00 20.55  ? 26   ASP E O   1 
ATOM   7506 C CB  . ASP D 2 26  ? 44.694  -7.320  -12.723 1.00 22.15  ? 26   ASP E CB  1 
ATOM   7507 C CG  . ASP D 2 26  ? 44.197  -8.380  -13.692 1.00 25.36  ? 26   ASP E CG  1 
ATOM   7508 O OD1 . ASP D 2 26  ? 43.092  -8.916  -13.548 1.00 21.47  ? 26   ASP E OD1 1 
ATOM   7509 O OD2 . ASP D 2 26  ? 44.973  -8.698  -14.640 1.00 30.19  ? 26   ASP E OD2 1 
ATOM   7510 N N   . ALA D 2 27  ? 44.809  -4.794  -11.082 1.00 17.90  ? 27   ALA E N   1 
ATOM   7511 C CA  . ALA D 2 27  ? 45.586  -3.965  -10.169 1.00 16.47  ? 27   ALA E CA  1 
ATOM   7512 C C   . ALA D 2 27  ? 44.718  -3.518  -9.003  1.00 15.13  ? 27   ALA E C   1 
ATOM   7513 O O   . ALA D 2 27  ? 45.134  -3.456  -7.847  1.00 12.93  ? 27   ALA E O   1 
ATOM   7514 C CB  . ALA D 2 27  ? 46.107  -2.795  -11.031 1.00 14.57  ? 27   ALA E CB  1 
ATOM   7515 N N   . LEU D 2 28  ? 43.477  -3.136  -9.370  1.00 15.13  ? 28   LEU E N   1 
ATOM   7516 C CA  . LEU D 2 28  ? 42.487  -2.654  -8.442  1.00 14.59  ? 28   LEU E CA  1 
ATOM   7517 C C   . LEU D 2 28  ? 42.134  -3.781  -7.491  1.00 13.27  ? 28   LEU E C   1 
ATOM   7518 O O   . LEU D 2 28  ? 42.296  -3.613  -6.295  1.00 15.15  ? 28   LEU E O   1 
ATOM   7519 C CB  . LEU D 2 28  ? 41.258  -2.056  -9.153  1.00 12.87  ? 28   LEU E CB  1 
ATOM   7520 C CG  . LEU D 2 28  ? 40.120  -1.572  -8.271  1.00 14.33  ? 28   LEU E CG  1 
ATOM   7521 C CD1 . LEU D 2 28  ? 40.676  -0.802  -7.075  1.00 13.39  ? 28   LEU E CD1 1 
ATOM   7522 C CD2 . LEU D 2 28  ? 39.074  -0.665  -8.952  1.00 12.12  ? 28   LEU E CD2 1 
ATOM   7523 N N   . VAL D 2 29  ? 41.843  -4.967  -7.986  1.00 13.20  ? 29   VAL E N   1 
ATOM   7524 C CA  . VAL D 2 29  ? 41.536  -6.092  -7.113  1.00 12.25  ? 29   VAL E CA  1 
ATOM   7525 C C   . VAL D 2 29  ? 42.756  -6.437  -6.262  1.00 13.84  ? 29   VAL E C   1 
ATOM   7526 O O   . VAL D 2 29  ? 42.575  -6.668  -5.060  1.00 11.98  ? 29   VAL E O   1 
ATOM   7527 C CB  . VAL D 2 29  ? 41.025  -7.288  -7.930  1.00 10.55  ? 29   VAL E CB  1 
ATOM   7528 C CG1 . VAL D 2 29  ? 40.884  -8.584  -7.108  1.00 8.03   ? 29   VAL E CG1 1 
ATOM   7529 C CG2 . VAL D 2 29  ? 39.656  -6.995  -8.567  1.00 9.97   ? 29   VAL E CG2 1 
ATOM   7530 N N   . LEU D 2 30  ? 43.979  -6.473  -6.846  1.00 13.12  ? 30   LEU E N   1 
ATOM   7531 C CA  . LEU D 2 30  ? 45.141  -6.857  -6.033  1.00 13.80  ? 30   LEU E CA  1 
ATOM   7532 C C   . LEU D 2 30  ? 45.460  -5.868  -4.922  1.00 13.50  ? 30   LEU E C   1 
ATOM   7533 O O   . LEU D 2 30  ? 45.766  -6.302  -3.812  1.00 12.12  ? 30   LEU E O   1 
ATOM   7534 C CB  . LEU D 2 30  ? 46.373  -7.145  -6.883  1.00 16.44  ? 30   LEU E CB  1 
ATOM   7535 C CG  . LEU D 2 30  ? 46.326  -8.288  -7.906  1.00 18.33  ? 30   LEU E CG  1 
ATOM   7536 C CD1 . LEU D 2 30  ? 47.599  -8.320  -8.753  1.00 19.24  ? 30   LEU E CD1 1 
ATOM   7537 C CD2 . LEU D 2 30  ? 46.160  -9.613  -7.196  1.00 18.05  ? 30   LEU E CD2 1 
ATOM   7538 N N   . GLN D 2 31  ? 45.281  -4.560  -5.175  1.00 13.08  ? 31   GLN E N   1 
ATOM   7539 C CA  . GLN D 2 31  ? 45.488  -3.584  -4.101  1.00 12.23  ? 31   GLN E CA  1 
ATOM   7540 C C   . GLN D 2 31  ? 44.453  -3.731  -3.013  1.00 12.43  ? 31   GLN E C   1 
ATOM   7541 O O   . GLN D 2 31  ? 44.830  -3.633  -1.847  1.00 10.85  ? 31   GLN E O   1 
ATOM   7542 C CB  . GLN D 2 31  ? 45.491  -2.140  -4.655  1.00 10.68  ? 31   GLN E CB  1 
ATOM   7543 C CG  . GLN D 2 31  ? 45.951  -1.082  -3.690  1.00 12.34  ? 31   GLN E CG  1 
ATOM   7544 C CD  . GLN D 2 31  ? 47.175  -1.320  -2.839  1.00 15.11  ? 31   GLN E CD  1 
ATOM   7545 O OE1 . GLN D 2 31  ? 47.959  -2.197  -3.186  1.00 14.28  ? 31   GLN E OE1 1 
ATOM   7546 N NE2 . GLN D 2 31  ? 47.315  -0.574  -1.727  1.00 13.15  ? 31   GLN E NE2 1 
ATOM   7547 N N   . LEU D 2 32  ? 43.174  -4.015  -3.359  1.00 12.00  ? 32   LEU E N   1 
ATOM   7548 C CA  . LEU D 2 32  ? 42.138  -4.201  -2.361  1.00 12.84  ? 32   LEU E CA  1 
ATOM   7549 C C   . LEU D 2 32  ? 42.397  -5.446  -1.491  1.00 14.07  ? 32   LEU E C   1 
ATOM   7550 O O   . LEU D 2 32  ? 42.106  -5.465  -0.278  1.00 12.93  ? 32   LEU E O   1 
ATOM   7551 C CB  . LEU D 2 32  ? 40.758  -4.270  -2.993  1.00 11.99  ? 32   LEU E CB  1 
ATOM   7552 C CG  . LEU D 2 32  ? 40.239  -2.951  -3.586  1.00 12.78  ? 32   LEU E CG  1 
ATOM   7553 C CD1 . LEU D 2 32  ? 39.041  -3.263  -4.485  1.00 12.86  ? 32   LEU E CD1 1 
ATOM   7554 C CD2 . LEU D 2 32  ? 39.845  -2.067  -2.392  1.00 8.82   ? 32   LEU E CD2 1 
ATOM   7555 N N   . ILE D 2 33  ? 42.967  -6.460  -2.121  1.00 12.97  ? 33   ILE E N   1 
ATOM   7556 C CA  . ILE D 2 33  ? 43.413  -7.678  -1.446  1.00 14.30  ? 33   ILE E CA  1 
ATOM   7557 C C   . ILE D 2 33  ? 44.616  -7.338  -0.575  1.00 14.79  ? 33   ILE E C   1 
ATOM   7558 O O   . ILE D 2 33  ? 44.610  -7.808  0.576   1.00 15.45  ? 33   ILE E O   1 
ATOM   7559 C CB  . ILE D 2 33  ? 43.757  -8.825  -2.434  1.00 14.12  ? 33   ILE E CB  1 
ATOM   7560 C CG1 . ILE D 2 33  ? 42.488  -9.374  -3.114  1.00 16.01  ? 33   ILE E CG1 1 
ATOM   7561 C CG2 . ILE D 2 33  ? 44.460  -9.955  -1.702  1.00 9.87   ? 33   ILE E CG2 1 
ATOM   7562 C CD1 . ILE D 2 33  ? 42.660  -10.406 -4.211  1.00 15.63  ? 33   ILE E CD1 1 
ATOM   7563 N N   . ARG D 2 34  ? 45.497  -6.386  -0.937  1.00 14.24  ? 34   ARG E N   1 
ATOM   7564 C CA  . ARG D 2 34  ? 46.600  -6.012  -0.039  1.00 14.98  ? 34   ARG E CA  1 
ATOM   7565 C C   . ARG D 2 34  ? 46.105  -5.222  1.167   1.00 15.94  ? 34   ARG E C   1 
ATOM   7566 O O   . ARG D 2 34  ? 46.449  -5.466  2.315   1.00 14.98  ? 34   ARG E O   1 
ATOM   7567 C CB  . ARG D 2 34  ? 47.695  -5.240  -0.757  1.00 16.10  ? 34   ARG E CB  1 
ATOM   7568 C CG  . ARG D 2 34  ? 48.504  -6.094  -1.726  1.00 15.53  ? 34   ARG E CG  1 
ATOM   7569 C CD  . ARG D 2 34  ? 49.514  -5.183  -2.441  1.00 17.88  ? 34   ARG E CD  1 
ATOM   7570 N NE  . ARG D 2 34  ? 49.862  -5.793  -3.723  1.00 19.59  ? 34   ARG E NE  1 
ATOM   7571 C CZ  . ARG D 2 34  ? 49.390  -5.355  -4.890  1.00 20.53  ? 34   ARG E CZ  1 
ATOM   7572 N NH1 . ARG D 2 34  ? 48.601  -4.281  -4.921  1.00 17.48  ? 34   ARG E NH1 1 
ATOM   7573 N NH2 . ARG D 2 34  ? 49.784  -6.003  -5.987  1.00 15.25  ? 34   ARG E NH2 1 
ATOM   7574 N N   . ILE D 2 35  ? 45.145  -4.327  0.930   1.00 16.05  ? 35   ILE E N   1 
ATOM   7575 C CA  . ILE D 2 35  ? 44.449  -3.619  2.001   1.00 16.87  ? 35   ILE E CA  1 
ATOM   7576 C C   . ILE D 2 35  ? 43.752  -4.665  2.880   1.00 17.47  ? 35   ILE E C   1 
ATOM   7577 O O   . ILE D 2 35  ? 43.758  -4.465  4.108   1.00 16.32  ? 35   ILE E O   1 
ATOM   7578 C CB  . ILE D 2 35  ? 43.468  -2.600  1.407   1.00 16.83  ? 35   ILE E CB  1 
ATOM   7579 C CG1 . ILE D 2 35  ? 44.250  -1.416  0.781   1.00 14.32  ? 35   ILE E CG1 1 
ATOM   7580 C CG2 . ILE D 2 35  ? 42.436  -2.080  2.393   1.00 16.25  ? 35   ILE E CG2 1 
ATOM   7581 C CD1 . ILE D 2 35  ? 43.487  -0.776  -0.355  1.00 11.26  ? 35   ILE E CD1 1 
ATOM   7582 N N   . GLY D 2 36  ? 43.234  -5.768  2.310   1.00 15.91  ? 36   GLY E N   1 
ATOM   7583 C CA  . GLY D 2 36  ? 42.671  -6.806  3.143   1.00 17.08  ? 36   GLY E CA  1 
ATOM   7584 C C   . GLY D 2 36  ? 41.146  -6.897  3.004   1.00 19.25  ? 36   GLY E C   1 
ATOM   7585 O O   . GLY D 2 36  ? 40.488  -7.553  3.817   1.00 18.28  ? 36   GLY E O   1 
ATOM   7586 N N   . CYS D 2 37  ? 40.585  -6.130  2.078   1.00 18.91  ? 37   CYS E N   1 
ATOM   7587 C CA  . CYS D 2 37  ? 39.136  -6.226  1.887   1.00 20.10  ? 37   CYS E CA  1 
ATOM   7588 C C   . CYS D 2 37  ? 38.809  -7.535  1.177   1.00 22.25  ? 37   CYS E C   1 
ATOM   7589 O O   . CYS D 2 37  ? 39.626  -8.084  0.430   1.00 22.47  ? 37   CYS E O   1 
ATOM   7590 C CB  . CYS D 2 37  ? 38.593  -5.132  0.961   1.00 10.22  ? 37   CYS E CB  1 
ATOM   7591 S SG  . CYS D 2 37  ? 38.979  -3.492  1.594   1.00 18.90  ? 37   CYS E SG  1 
ATOM   7592 N N   . SER D 2 38  ? 37.565  -7.950  1.386   1.00 23.46  ? 38   SER E N   1 
ATOM   7593 C CA  . SER D 2 38  ? 37.065  -9.145  0.676   1.00 24.37  ? 38   SER E CA  1 
ATOM   7594 C C   . SER D 2 38  ? 36.636  -8.594  -0.671  1.00 23.03  ? 38   SER E C   1 
ATOM   7595 O O   . SER D 2 38  ? 35.918  -7.602  -0.638  1.00 23.93  ? 38   SER E O   1 
ATOM   7596 C CB  . SER D 2 38  ? 35.954  -9.694  1.571   1.00 28.79  ? 38   SER E CB  1 
ATOM   7597 O OG  . SER D 2 38  ? 35.554  -10.971 1.178   1.00 32.33  ? 38   SER E OG  1 
ATOM   7598 N N   . VAL D 2 39  ? 37.101  -9.018  -1.818  1.00 23.87  ? 39   VAL E N   1 
ATOM   7599 C CA  . VAL D 2 39  ? 36.900  -8.397  -3.095  1.00 25.59  ? 39   VAL E CA  1 
ATOM   7600 C C   . VAL D 2 39  ? 36.493  -9.366  -4.215  1.00 27.19  ? 39   VAL E C   1 
ATOM   7601 O O   . VAL D 2 39  ? 37.041  -10.465 -4.264  1.00 25.77  ? 39   VAL E O   1 
ATOM   7602 C CB  . VAL D 2 39  ? 38.214  -7.859  -3.760  1.00 24.69  ? 39   VAL E CB  1 
ATOM   7603 C CG1 . VAL D 2 39  ? 37.899  -6.683  -4.692  1.00 20.33  ? 39   VAL E CG1 1 
ATOM   7604 C CG2 . VAL D 2 39  ? 39.347  -7.611  -2.828  1.00 22.00  ? 39   VAL E CG2 1 
ATOM   7605 N N   . ARG D 2 40  ? 35.740  -8.836  -5.162  1.00 27.75  ? 40   ARG E N   1 
ATOM   7606 C CA  . ARG D 2 40  ? 35.330  -9.632  -6.317  1.00 31.15  ? 40   ARG E CA  1 
ATOM   7607 C C   . ARG D 2 40  ? 35.150  -8.707  -7.512  1.00 29.92  ? 40   ARG E C   1 
ATOM   7608 O O   . ARG D 2 40  ? 34.754  -7.559  -7.313  1.00 29.88  ? 40   ARG E O   1 
ATOM   7609 C CB  . ARG D 2 40  ? 33.992  -10.349 -6.087  1.00 39.72  ? 40   ARG E CB  1 
ATOM   7610 C CG  . ARG D 2 40  ? 34.170  -11.833 -5.820  1.00 49.05  ? 40   ARG E CG  1 
ATOM   7611 C CD  . ARG D 2 40  ? 32.977  -12.452 -5.093  1.00 56.76  ? 40   ARG E CD  1 
ATOM   7612 N NE  . ARG D 2 40  ? 33.415  -13.665 -4.398  1.00 61.71  ? 40   ARG E NE  1 
ATOM   7613 C CZ  . ARG D 2 40  ? 32.710  -14.762 -4.147  1.00 63.64  ? 40   ARG E CZ  1 
ATOM   7614 N NH1 . ARG D 2 40  ? 31.452  -14.910 -4.535  1.00 62.80  ? 40   ARG E NH1 1 
ATOM   7615 N NH2 . ARG D 2 40  ? 33.365  -15.722 -3.486  1.00 64.33  ? 40   ARG E NH2 1 
ATOM   7616 N N   . GLN D 2 41  ? 35.480  -9.191  -8.697  1.00 29.72  ? 41   GLN E N   1 
ATOM   7617 C CA  . GLN D 2 41  ? 35.252  -8.363  -9.886  1.00 28.99  ? 41   GLN E CA  1 
ATOM   7618 C C   . GLN D 2 41  ? 34.034  -8.994  -10.571 1.00 28.71  ? 41   GLN E C   1 
ATOM   7619 O O   . GLN D 2 41  ? 33.698  -10.146 -10.327 1.00 28.28  ? 41   GLN E O   1 
ATOM   7620 C CB  . GLN D 2 41  ? 36.417  -8.229  -10.824 1.00 27.80  ? 41   GLN E CB  1 
ATOM   7621 C CG  . GLN D 2 41  ? 37.145  -9.569  -10.901 1.00 32.97  ? 41   GLN E CG  1 
ATOM   7622 C CD  . GLN D 2 41  ? 38.427  -9.441  -11.696 1.00 35.24  ? 41   GLN E CD  1 
ATOM   7623 O OE1 . GLN D 2 41  ? 38.405  -8.813  -12.763 1.00 36.80  ? 41   GLN E OE1 1 
ATOM   7624 N NE2 . GLN D 2 41  ? 39.455  -10.049 -11.111 1.00 38.36  ? 41   GLN E NE2 1 
ATOM   7625 N N   . CYS D 2 42  ? 33.401  -8.198  -11.378 1.00 27.28  ? 42   CYS E N   1 
ATOM   7626 C CA  . CYS D 2 42  ? 32.122  -8.527  -11.953 1.00 27.57  ? 42   CYS E CA  1 
ATOM   7627 C C   . CYS D 2 42  ? 31.906  -7.759  -13.252 1.00 27.48  ? 42   CYS E C   1 
ATOM   7628 O O   . CYS D 2 42  ? 31.968  -6.535  -13.211 1.00 26.40  ? 42   CYS E O   1 
ATOM   7629 C CB  . CYS D 2 42  ? 31.067  -8.108  -10.918 1.00 29.77  ? 42   CYS E CB  1 
ATOM   7630 S SG  . CYS D 2 42  ? 29.351  -8.228  -11.433 1.00 37.67  ? 42   CYS E SG  1 
ATOM   7631 N N   . TRP D 2 43  ? 31.724  -8.504  -14.331 1.00 26.93  ? 43   TRP E N   1 
ATOM   7632 C CA  . TRP D 2 43  ? 31.393  -7.976  -15.636 1.00 27.35  ? 43   TRP E CA  1 
ATOM   7633 C C   . TRP D 2 43  ? 30.446  -8.934  -16.345 1.00 28.83  ? 43   TRP E C   1 
ATOM   7634 O O   . TRP D 2 43  ? 31.104  -9.981  -16.246 1.00 27.15  ? 43   TRP E O   1 
ATOM   7635 C CB  . TRP D 2 43  ? 32.582  -7.590  -16.508 1.00 22.01  ? 43   TRP E CB  1 
ATOM   7636 C CG  . TRP D 2 43  ? 32.212  -6.591  -17.579 1.00 22.09  ? 43   TRP E CG  1 
ATOM   7637 C CD1 . TRP D 2 43  ? 32.257  -6.813  -18.937 1.00 15.69  ? 43   TRP E CD1 1 
ATOM   7638 C CD2 . TRP D 2 43  ? 31.702  -5.254  -17.385 1.00 18.74  ? 43   TRP E CD2 1 
ATOM   7639 N NE1 . TRP D 2 43  ? 31.848  -5.678  -19.575 1.00 19.04  ? 43   TRP E NE1 1 
ATOM   7640 C CE2 . TRP D 2 43  ? 31.472  -4.719  -18.659 1.00 18.55  ? 43   TRP E CE2 1 
ATOM   7641 C CE3 . TRP D 2 43  ? 31.497  -4.448  -16.270 1.00 17.54  ? 43   TRP E CE3 1 
ATOM   7642 C CZ2 . TRP D 2 43  ? 31.038  -3.409  -18.864 1.00 19.69  ? 43   TRP E CZ2 1 
ATOM   7643 C CZ3 . TRP D 2 43  ? 31.026  -3.155  -16.445 1.00 19.06  ? 43   TRP E CZ3 1 
ATOM   7644 C CH2 . TRP D 2 43  ? 30.804  -2.646  -17.746 1.00 21.15  ? 43   TRP E CH2 1 
ATOM   7645 N N   . PRO D 2 44  ? 29.873  -8.592  -17.488 1.00 29.03  ? 44   PRO E N   1 
ATOM   7646 C CA  . PRO D 2 44  ? 28.898  -7.571  -17.639 1.00 29.51  ? 44   PRO E CA  1 
ATOM   7647 C C   . PRO D 2 44  ? 28.080  -7.284  -16.393 1.00 29.42  ? 44   PRO E C   1 
ATOM   7648 O O   . PRO D 2 44  ? 27.857  -8.105  -15.514 1.00 29.81  ? 44   PRO E O   1 
ATOM   7649 C CB  . PRO D 2 44  ? 27.976  -7.887  -18.822 1.00 31.08  ? 44   PRO E CB  1 
ATOM   7650 C CG  . PRO D 2 44  ? 27.926  -9.368  -18.792 1.00 30.48  ? 44   PRO E CG  1 
ATOM   7651 C CD  . PRO D 2 44  ? 29.278  -9.703  -18.277 1.00 30.02  ? 44   PRO E CD  1 
ATOM   7652 N N   . PRO D 2 45  ? 27.593  -6.053  -16.272 1.00 29.82  ? 45   PRO E N   1 
ATOM   7653 C CA  . PRO D 2 45  ? 26.759  -5.656  -15.140 1.00 30.77  ? 45   PRO E CA  1 
ATOM   7654 C C   . PRO D 2 45  ? 25.549  -6.557  -14.975 1.00 32.04  ? 45   PRO E C   1 
ATOM   7655 O O   . PRO D 2 45  ? 24.723  -6.703  -15.875 1.00 31.13  ? 45   PRO E O   1 
ATOM   7656 C CB  . PRO D 2 45  ? 26.283  -4.255  -15.498 1.00 29.34  ? 45   PRO E CB  1 
ATOM   7657 C CG  . PRO D 2 45  ? 27.271  -3.754  -16.497 1.00 30.22  ? 45   PRO E CG  1 
ATOM   7658 C CD  . PRO D 2 45  ? 27.802  -4.947  -17.232 1.00 29.07  ? 45   PRO E CD  1 
ATOM   7659 N N   . PRO D 2 46  ? 25.390  -7.176  -13.820 1.00 34.13  ? 46   PRO E N   1 
ATOM   7660 C CA  . PRO D 2 46  ? 24.224  -7.993  -13.527 1.00 34.69  ? 46   PRO E CA  1 
ATOM   7661 C C   . PRO D 2 46  ? 23.010  -7.100  -13.299 1.00 35.76  ? 46   PRO E C   1 
ATOM   7662 O O   . PRO D 2 46  ? 23.079  -5.873  -13.150 1.00 35.65  ? 46   PRO E O   1 
ATOM   7663 C CB  . PRO D 2 46  ? 24.528  -8.666  -12.201 1.00 34.63  ? 46   PRO E CB  1 
ATOM   7664 C CG  . PRO D 2 46  ? 25.465  -7.702  -11.532 1.00 34.37  ? 46   PRO E CG  1 
ATOM   7665 C CD  . PRO D 2 46  ? 26.280  -7.084  -12.647 1.00 34.35  ? 46   PRO E CD  1 
ATOM   7666 N N   . GLU D 2 47  ? 21.889  -7.782  -13.140 1.00 36.16  ? 47   GLU E N   1 
ATOM   7667 C CA  . GLU D 2 47  ? 20.626  -7.087  -12.910 1.00 38.51  ? 47   GLU E CA  1 
ATOM   7668 C C   . GLU D 2 47  ? 20.480  -6.694  -11.450 1.00 37.06  ? 47   GLU E C   1 
ATOM   7669 O O   . GLU D 2 47  ? 19.872  -5.681  -11.099 1.00 37.20  ? 47   GLU E O   1 
ATOM   7670 C CB  . GLU D 2 47  ? 19.489  -8.036  -13.310 1.00 43.41  ? 47   GLU E CB  1 
ATOM   7671 C CG  . GLU D 2 47  ? 18.379  -7.264  -13.984 1.00 48.61  ? 47   GLU E CG  1 
ATOM   7672 C CD  . GLU D 2 47  ? 17.878  -7.970  -15.226 1.00 51.39  ? 47   GLU E CD  1 
ATOM   7673 O OE1 . GLU D 2 47  ? 18.246  -9.141  -15.466 1.00 55.24  ? 47   GLU E OE1 1 
ATOM   7674 O OE2 . GLU D 2 47  ? 17.114  -7.335  -15.974 1.00 51.71  ? 47   GLU E OE2 1 
ATOM   7675 N N   . ALA D 2 48  ? 21.010  -7.557  -10.607 1.00 35.70  ? 48   ALA E N   1 
ATOM   7676 C CA  . ALA D 2 48  ? 21.002  -7.365  -9.167  1.00 36.01  ? 48   ALA E CA  1 
ATOM   7677 C C   . ALA D 2 48  ? 22.272  -8.061  -8.666  1.00 36.29  ? 48   ALA E C   1 
ATOM   7678 O O   . ALA D 2 48  ? 22.747  -8.938  -9.398  1.00 34.99  ? 48   ALA E O   1 
ATOM   7679 C CB  . ALA D 2 48  ? 19.790  -7.955  -8.477  1.00 32.23  ? 48   ALA E CB  1 
ATOM   7680 N N   . PHE D 2 49  ? 22.739  -7.653  -7.496  1.00 36.96  ? 49   PHE E N   1 
ATOM   7681 C CA  . PHE D 2 49  ? 23.900  -8.376  -6.958  1.00 40.07  ? 49   PHE E CA  1 
ATOM   7682 C C   . PHE D 2 49  ? 23.313  -9.556  -6.186  1.00 41.39  ? 49   PHE E C   1 
ATOM   7683 O O   . PHE D 2 49  ? 22.354  -9.288  -5.460  1.00 40.46  ? 49   PHE E O   1 
ATOM   7684 C CB  . PHE D 2 49  ? 24.810  -7.530  -6.068  1.00 36.09  ? 49   PHE E CB  1 
ATOM   7685 C CG  . PHE D 2 49  ? 25.585  -6.495  -6.825  1.00 32.69  ? 49   PHE E CG  1 
ATOM   7686 C CD1 . PHE D 2 49  ? 26.356  -6.852  -7.912  1.00 32.41  ? 49   PHE E CD1 1 
ATOM   7687 C CD2 . PHE D 2 49  ? 25.523  -5.151  -6.463  1.00 32.85  ? 49   PHE E CD2 1 
ATOM   7688 C CE1 . PHE D 2 49  ? 27.076  -5.908  -8.640  1.00 29.99  ? 49   PHE E CE1 1 
ATOM   7689 C CE2 . PHE D 2 49  ? 26.228  -4.196  -7.164  1.00 30.18  ? 49   PHE E CE2 1 
ATOM   7690 C CZ  . PHE D 2 49  ? 27.002  -4.585  -8.248  1.00 31.82  ? 49   PHE E CZ  1 
ATOM   7691 N N   . ASP D 2 50  ? 23.871  -10.756 -6.327  1.00 44.48  ? 50   ASP E N   1 
ATOM   7692 C CA  . ASP D 2 50  ? 23.289  -11.862 -5.569  1.00 48.40  ? 50   ASP E CA  1 
ATOM   7693 C C   . ASP D 2 50  ? 23.863  -11.926 -4.159  1.00 48.73  ? 50   ASP E C   1 
ATOM   7694 O O   . ASP D 2 50  ? 23.242  -12.591 -3.330  1.00 51.16  ? 50   ASP E O   1 
ATOM   7695 C CB  . ASP D 2 50  ? 23.407  -13.252 -6.201  1.00 55.38  ? 50   ASP E CB  1 
ATOM   7696 C CG  . ASP D 2 50  ? 22.105  -14.022 -5.996  1.00 62.07  ? 50   ASP E CG  1 
ATOM   7697 O OD1 . ASP D 2 50  ? 21.082  -13.367 -5.643  1.00 64.93  ? 50   ASP E OD1 1 
ATOM   7698 O OD2 . ASP D 2 50  ? 22.034  -15.265 -6.184  1.00 64.21  ? 50   ASP E OD2 1 
ATOM   7699 N N   . VAL D 2 51  ? 24.968  -11.254 -3.890  1.00 47.88  ? 51   VAL E N   1 
ATOM   7700 C CA  . VAL D 2 51  ? 25.580  -11.273 -2.555  1.00 46.32  ? 51   VAL E CA  1 
ATOM   7701 C C   . VAL D 2 51  ? 25.725  -9.859  -2.010  1.00 44.66  ? 51   VAL E C   1 
ATOM   7702 O O   . VAL D 2 51  ? 25.915  -8.914  -2.767  1.00 44.10  ? 51   VAL E O   1 
ATOM   7703 C CB  . VAL D 2 51  ? 26.926  -11.998 -2.725  1.00 48.44  ? 51   VAL E CB  1 
ATOM   7704 C CG1 . VAL D 2 51  ? 28.028  -11.537 -1.800  1.00 50.30  ? 51   VAL E CG1 1 
ATOM   7705 C CG2 . VAL D 2 51  ? 26.754  -13.509 -2.550  1.00 48.51  ? 51   VAL E CG2 1 
ATOM   7706 N N   . PRO D 2 52  ? 25.595  -9.682  -0.698  1.00 43.24  ? 52   PRO E N   1 
ATOM   7707 C CA  . PRO D 2 52  ? 25.772  -8.408  -0.037  1.00 41.22  ? 52   PRO E CA  1 
ATOM   7708 C C   . PRO D 2 52  ? 27.047  -7.709  -0.520  1.00 38.21  ? 52   PRO E C   1 
ATOM   7709 O O   . PRO D 2 52  ? 28.059  -8.319  -0.846  1.00 35.01  ? 52   PRO E O   1 
ATOM   7710 C CB  . PRO D 2 52  ? 25.854  -8.723  1.445   1.00 42.89  ? 52   PRO E CB  1 
ATOM   7711 C CG  . PRO D 2 52  ? 25.764  -10.199 1.596   1.00 43.56  ? 52   PRO E CG  1 
ATOM   7712 C CD  . PRO D 2 52  ? 25.332  -10.770 0.285   1.00 43.76  ? 52   PRO E CD  1 
ATOM   7713 N N   . VAL D 2 53  ? 26.946  -6.393  -0.625  1.00 35.09  ? 53   VAL E N   1 
ATOM   7714 C CA  . VAL D 2 53  ? 27.985  -5.521  -1.119  1.00 33.15  ? 53   VAL E CA  1 
ATOM   7715 C C   . VAL D 2 53  ? 28.042  -4.252  -0.272  1.00 30.64  ? 53   VAL E C   1 
ATOM   7716 O O   . VAL D 2 53  ? 27.045  -3.569  -0.091  1.00 29.48  ? 53   VAL E O   1 
ATOM   7717 C CB  . VAL D 2 53  ? 27.716  -5.114  -2.581  1.00 36.66  ? 53   VAL E CB  1 
ATOM   7718 C CG1 . VAL D 2 53  ? 28.345  -3.783  -2.964  1.00 38.34  ? 53   VAL E CG1 1 
ATOM   7719 C CG2 . VAL D 2 53  ? 28.245  -6.163  -3.554  1.00 38.14  ? 53   VAL E CG2 1 
ATOM   7720 N N   . ASP D 2 54  ? 29.272  -3.913  0.127   1.00 27.99  ? 54   ASP E N   1 
ATOM   7721 C CA  . ASP D 2 54  ? 29.481  -2.707  0.891   1.00 24.06  ? 54   ASP E CA  1 
ATOM   7722 C C   . ASP D 2 54  ? 29.955  -1.537  0.065   1.00 22.18  ? 54   ASP E C   1 
ATOM   7723 O O   . ASP D 2 54  ? 29.609  -0.394  0.352   1.00 23.12  ? 54   ASP E O   1 
ATOM   7724 C CB  . ASP D 2 54  ? 30.521  -2.995  1.977   1.00 23.41  ? 54   ASP E CB  1 
ATOM   7725 C CG  . ASP D 2 54  ? 29.974  -3.997  2.977   1.00 27.14  ? 54   ASP E CG  1 
ATOM   7726 O OD1 . ASP D 2 54  ? 28.855  -3.713  3.470   1.00 27.75  ? 54   ASP E OD1 1 
ATOM   7727 O OD2 . ASP D 2 54  ? 30.650  -5.015  3.256   1.00 27.51  ? 54   ASP E OD2 1 
ATOM   7728 N N   . VAL D 2 55  ? 30.840  -1.779  -0.899  1.00 19.90  ? 55   VAL E N   1 
ATOM   7729 C CA  . VAL D 2 55  ? 31.484  -0.739  -1.684  1.00 17.85  ? 55   VAL E CA  1 
ATOM   7730 C C   . VAL D 2 55  ? 31.538  -1.168  -3.146  1.00 17.36  ? 55   VAL E C   1 
ATOM   7731 O O   . VAL D 2 55  ? 31.854  -2.332  -3.435  1.00 17.22  ? 55   VAL E O   1 
ATOM   7732 C CB  . VAL D 2 55  ? 32.935  -0.552  -1.164  1.00 14.28  ? 55   VAL E CB  1 
ATOM   7733 C CG1 . VAL D 2 55  ? 33.743  0.446   -1.980  1.00 12.57  ? 55   VAL E CG1 1 
ATOM   7734 C CG2 . VAL D 2 55  ? 33.053  -0.118  0.297   1.00 10.10  ? 55   VAL E CG2 1 
ATOM   7735 N N   . VAL D 2 56  ? 31.194  -0.275  -4.077  1.00 16.50  ? 56   VAL E N   1 
ATOM   7736 C CA  . VAL D 2 56  ? 31.309  -0.640  -5.495  1.00 15.01  ? 56   VAL E CA  1 
ATOM   7737 C C   . VAL D 2 56  ? 32.306  0.310   -6.166  1.00 14.57  ? 56   VAL E C   1 
ATOM   7738 O O   . VAL D 2 56  ? 32.283  1.533   -5.925  1.00 13.91  ? 56   VAL E O   1 
ATOM   7739 C CB  . VAL D 2 56  ? 29.970  -0.624  -6.247  1.00 17.75  ? 56   VAL E CB  1 
ATOM   7740 C CG1 . VAL D 2 56  ? 30.122  -0.613  -7.773  1.00 14.16  ? 56   VAL E CG1 1 
ATOM   7741 C CG2 . VAL D 2 56  ? 29.100  -1.839  -5.856  1.00 16.42  ? 56   VAL E CG2 1 
ATOM   7742 N N   . PHE D 2 57  ? 33.184  -0.262  -6.972  1.00 13.03  ? 57   PHE E N   1 
ATOM   7743 C CA  . PHE D 2 57  ? 34.120  0.520   -7.788  1.00 14.13  ? 57   PHE E CA  1 
ATOM   7744 C C   . PHE D 2 57  ? 33.560  0.336   -9.207  1.00 14.17  ? 57   PHE E C   1 
ATOM   7745 O O   . PHE D 2 57  ? 33.465  -0.828  -9.602  1.00 14.79  ? 57   PHE E O   1 
ATOM   7746 C CB  . PHE D 2 57  ? 35.583  0.074   -7.763  1.00 11.11  ? 57   PHE E CB  1 
ATOM   7747 C CG  . PHE D 2 57  ? 36.315  0.489   -6.501  1.00 12.49  ? 57   PHE E CG  1 
ATOM   7748 C CD1 . PHE D 2 57  ? 36.218  -0.269  -5.357  1.00 11.83  ? 57   PHE E CD1 1 
ATOM   7749 C CD2 . PHE D 2 57  ? 37.116  1.629   -6.462  1.00 10.28  ? 57   PHE E CD2 1 
ATOM   7750 C CE1 . PHE D 2 57  ? 36.845  0.091   -4.172  1.00 12.23  ? 57   PHE E CE1 1 
ATOM   7751 C CE2 . PHE D 2 57  ? 37.720  2.012   -5.293  1.00 9.51   ? 57   PHE E CE2 1 
ATOM   7752 C CZ  . PHE D 2 57  ? 37.620  1.239   -4.157  1.00 9.76   ? 57   PHE E CZ  1 
ATOM   7753 N N   . THR D 2 58  ? 33.196  1.379   -9.927  1.00 14.91  ? 58   THR E N   1 
ATOM   7754 C CA  . THR D 2 58  ? 32.697  1.230   -11.289 1.00 14.84  ? 58   THR E CA  1 
ATOM   7755 C C   . THR D 2 58  ? 33.357  2.173   -12.286 1.00 15.93  ? 58   THR E C   1 
ATOM   7756 O O   . THR D 2 58  ? 33.666  3.331   -12.025 1.00 13.78  ? 58   THR E O   1 
ATOM   7757 C CB  . THR D 2 58  ? 31.151  1.505   -11.275 1.00 13.11  ? 58   THR E CB  1 
ATOM   7758 O OG1 . THR D 2 58  ? 30.583  1.270   -12.559 1.00 15.55  ? 58   THR E OG1 1 
ATOM   7759 C CG2 . THR D 2 58  ? 30.831  2.969   -11.022 1.00 14.16  ? 58   THR E CG2 1 
ATOM   7760 N N   . SER D 2 59  ? 33.379  1.810   -13.562 1.00 19.33  ? 59   SER E N   1 
ATOM   7761 C CA  . SER D 2 59  ? 33.838  2.669   -14.646 1.00 21.52  ? 59   SER E CA  1 
ATOM   7762 C C   . SER D 2 59  ? 32.600  3.382   -15.195 1.00 22.36  ? 59   SER E C   1 
ATOM   7763 O O   . SER D 2 59  ? 31.483  3.022   -14.869 1.00 20.56  ? 59   SER E O   1 
ATOM   7764 C CB  . SER D 2 59  ? 34.585  1.949   -15.754 1.00 24.36  ? 59   SER E CB  1 
ATOM   7765 O OG  . SER D 2 59  ? 35.947  1.757   -15.379 1.00 27.26  ? 59   SER E OG  1 
ATOM   7766 N N   . ILE D 2 60  ? 32.854  4.429   -15.965 1.00 23.83  ? 60   ILE E N   1 
ATOM   7767 C CA  . ILE D 2 60  ? 31.781  5.275   -16.483 1.00 24.74  ? 60   ILE E CA  1 
ATOM   7768 C C   . ILE D 2 60  ? 31.571  5.112   -17.980 1.00 24.71  ? 60   ILE E C   1 
ATOM   7769 O O   . ILE D 2 60  ? 32.410  5.512   -18.775 1.00 24.76  ? 60   ILE E O   1 
ATOM   7770 C CB  . ILE D 2 60  ? 32.103  6.741   -16.093 1.00 21.54  ? 60   ILE E CB  1 
ATOM   7771 C CG1 . ILE D 2 60  ? 32.214  6.880   -14.563 1.00 19.85  ? 60   ILE E CG1 1 
ATOM   7772 C CG2 . ILE D 2 60  ? 31.029  7.640   -16.682 1.00 19.17  ? 60   ILE E CG2 1 
ATOM   7773 C CD1 . ILE D 2 60  ? 30.913  6.709   -13.769 1.00 16.71  ? 60   ILE E CD1 1 
ATOM   7774 N N   . PHE D 2 61  ? 30.455  4.511   -18.376 1.00 24.29  ? 61   PHE E N   1 
ATOM   7775 C CA  . PHE D 2 61  ? 30.146  4.199   -19.757 1.00 24.88  ? 61   PHE E CA  1 
ATOM   7776 C C   . PHE D 2 61  ? 29.092  5.090   -20.401 1.00 26.30  ? 61   PHE E C   1 
ATOM   7777 O O   . PHE D 2 61  ? 28.161  5.550   -19.730 1.00 26.78  ? 61   PHE E O   1 
ATOM   7778 C CB  . PHE D 2 61  ? 29.665  2.745   -19.873 1.00 22.55  ? 61   PHE E CB  1 
ATOM   7779 C CG  . PHE D 2 61  ? 30.763  1.745   -19.644 1.00 22.59  ? 61   PHE E CG  1 
ATOM   7780 C CD1 . PHE D 2 61  ? 31.172  1.408   -18.378 1.00 18.65  ? 61   PHE E CD1 1 
ATOM   7781 C CD2 . PHE D 2 61  ? 31.404  1.161   -20.736 1.00 21.92  ? 61   PHE E CD2 1 
ATOM   7782 C CE1 . PHE D 2 61  ? 32.177  0.494   -18.164 1.00 21.77  ? 61   PHE E CE1 1 
ATOM   7783 C CE2 . PHE D 2 61  ? 32.424  0.261   -20.530 1.00 21.71  ? 61   PHE E CE2 1 
ATOM   7784 C CZ  . PHE D 2 61  ? 32.819  -0.081  -19.252 1.00 21.96  ? 61   PHE E CZ  1 
ATOM   7785 N N   . GLN D 2 62  ? 29.250  5.282   -21.723 1.00 26.02  ? 62   GLN E N   1 
ATOM   7786 C CA  . GLN D 2 62  ? 28.257  6.064   -22.444 1.00 25.61  ? 62   GLN E CA  1 
ATOM   7787 C C   . GLN D 2 62  ? 27.373  5.119   -23.277 1.00 25.54  ? 62   GLN E C   1 
ATOM   7788 O O   . GLN D 2 62  ? 26.327  5.595   -23.737 1.00 25.83  ? 62   GLN E O   1 
ATOM   7789 C CB  . GLN D 2 62  ? 28.787  7.180   -23.320 1.00 22.68  ? 62   GLN E CB  1 
ATOM   7790 C CG  . GLN D 2 62  ? 29.415  8.401   -22.645 1.00 20.81  ? 62   GLN E CG  1 
ATOM   7791 C CD  . GLN D 2 62  ? 30.714  8.022   -21.967 1.00 20.36  ? 62   GLN E CD  1 
ATOM   7792 O OE1 . GLN D 2 62  ? 31.593  7.368   -22.530 1.00 19.18  ? 62   GLN E OE1 1 
ATOM   7793 N NE2 . GLN D 2 62  ? 30.793  8.413   -20.708 1.00 20.79  ? 62   GLN E NE2 1 
ATOM   7794 N N   . ASN D 2 63  ? 27.775  3.865   -23.457 1.00 24.08  ? 63   ASN E N   1 
ATOM   7795 C CA  . ASN D 2 63  ? 26.901  3.014   -24.304 1.00 23.27  ? 63   ASN E CA  1 
ATOM   7796 C C   . ASN D 2 63  ? 25.811  2.371   -23.465 1.00 21.90  ? 63   ASN E C   1 
ATOM   7797 O O   . ASN D 2 63  ? 25.432  2.890   -22.408 1.00 21.51  ? 63   ASN E O   1 
ATOM   7798 C CB  . ASN D 2 63  ? 27.776  2.048   -25.089 1.00 22.06  ? 63   ASN E CB  1 
ATOM   7799 C CG  . ASN D 2 63  ? 28.624  1.150   -24.230 1.00 25.41  ? 63   ASN E CG  1 
ATOM   7800 O OD1 . ASN D 2 63  ? 28.538  1.135   -23.002 1.00 26.76  ? 63   ASN E OD1 1 
ATOM   7801 N ND2 . ASN D 2 63  ? 29.462  0.335   -24.867 1.00 25.72  ? 63   ASN E ND2 1 
ATOM   7802 N N   . ARG D 2 64  ? 25.347  1.194   -23.784 1.00 21.89  ? 64   ARG E N   1 
ATOM   7803 C CA  . ARG D 2 64  ? 24.292  0.463   -23.083 1.00 22.27  ? 64   ARG E CA  1 
ATOM   7804 C C   . ARG D 2 64  ? 24.614  0.118   -21.644 1.00 22.79  ? 64   ARG E C   1 
ATOM   7805 O O   . ARG D 2 64  ? 23.713  -0.111  -20.814 1.00 22.63  ? 64   ARG E O   1 
ATOM   7806 C CB  . ARG D 2 64  ? 24.023  -0.837  -23.891 1.00 21.78  ? 64   ARG E CB  1 
ATOM   7807 C CG  . ARG D 2 64  ? 25.272  -1.736  -23.912 1.00 25.35  ? 64   ARG E CG  1 
ATOM   7808 C CD  . ARG D 2 64  ? 25.040  -3.043  -24.642 1.00 31.68  ? 64   ARG E CD  1 
ATOM   7809 N NE  . ARG D 2 64  ? 26.099  -4.042  -24.583 1.00 32.69  ? 64   ARG E NE  1 
ATOM   7810 C CZ  . ARG D 2 64  ? 27.330  -3.944  -25.084 1.00 35.94  ? 64   ARG E CZ  1 
ATOM   7811 N NH1 . ARG D 2 64  ? 27.698  -2.829  -25.719 1.00 33.68  ? 64   ARG E NH1 1 
ATOM   7812 N NH2 . ARG D 2 64  ? 28.228  -4.933  -24.981 1.00 36.14  ? 64   ARG E NH2 1 
ATOM   7813 N N   . HIS D 2 65  ? 25.911  0.033   -21.289 1.00 21.45  ? 65   HIS E N   1 
ATOM   7814 C CA  . HIS D 2 65  ? 26.306  -0.239  -19.923 1.00 20.73  ? 65   HIS E CA  1 
ATOM   7815 C C   . HIS D 2 65  ? 25.918  0.926   -19.010 1.00 19.54  ? 65   HIS E C   1 
ATOM   7816 O O   . HIS D 2 65  ? 25.852  0.696   -17.799 1.00 17.83  ? 65   HIS E O   1 
ATOM   7817 C CB  . HIS D 2 65  ? 27.812  -0.565  -19.807 1.00 23.41  ? 65   HIS E CB  1 
ATOM   7818 C CG  . HIS D 2 65  ? 28.219  -1.737  -20.670 1.00 26.81  ? 65   HIS E CG  1 
ATOM   7819 N ND1 . HIS D 2 65  ? 27.581  -2.970  -20.658 1.00 23.68  ? 65   HIS E ND1 1 
ATOM   7820 C CD2 . HIS D 2 65  ? 29.230  -1.833  -21.579 1.00 26.37  ? 65   HIS E CD2 1 
ATOM   7821 C CE1 . HIS D 2 65  ? 28.177  -3.753  -21.528 1.00 25.19  ? 65   HIS E CE1 1 
ATOM   7822 N NE2 . HIS D 2 65  ? 29.164  -3.101  -22.095 1.00 26.02  ? 65   HIS E NE2 1 
ATOM   7823 N N   . HIS D 2 66  ? 25.742  2.151   -19.529 1.00 19.46  ? 66   HIS E N   1 
ATOM   7824 C CA  . HIS D 2 66  ? 25.306  3.259   -18.696 1.00 21.09  ? 66   HIS E CA  1 
ATOM   7825 C C   . HIS D 2 66  ? 24.000  2.952   -17.960 1.00 23.20  ? 66   HIS E C   1 
ATOM   7826 O O   . HIS D 2 66  ? 23.924  2.972   -16.735 1.00 23.97  ? 66   HIS E O   1 
ATOM   7827 C CB  . HIS D 2 66  ? 24.952  4.474   -19.544 1.00 20.84  ? 66   HIS E CB  1 
ATOM   7828 C CG  . HIS D 2 66  ? 24.607  5.741   -18.838 1.00 18.75  ? 66   HIS E CG  1 
ATOM   7829 N ND1 . HIS D 2 66  ? 24.437  6.917   -19.557 1.00 17.82  ? 66   HIS E ND1 1 
ATOM   7830 C CD2 . HIS D 2 66  ? 24.487  6.050   -17.525 1.00 16.82  ? 66   HIS E CD2 1 
ATOM   7831 C CE1 . HIS D 2 66  ? 24.177  7.907   -18.707 1.00 18.33  ? 66   HIS E CE1 1 
ATOM   7832 N NE2 . HIS D 2 66  ? 24.205  7.398   -17.477 1.00 18.92  ? 66   HIS E NE2 1 
ATOM   7833 N N   . ASP D 2 67  ? 22.931  2.718   -18.738 1.00 24.01  ? 67   ASP E N   1 
ATOM   7834 C CA  . ASP D 2 67  ? 21.618  2.427   -18.139 1.00 24.77  ? 67   ASP E CA  1 
ATOM   7835 C C   . ASP D 2 67  ? 21.653  1.159   -17.309 1.00 24.30  ? 67   ASP E C   1 
ATOM   7836 O O   . ASP D 2 67  ? 21.012  1.102   -16.250 1.00 25.60  ? 67   ASP E O   1 
ATOM   7837 C CB  . ASP D 2 67  ? 20.549  2.434   -19.242 1.00 26.50  ? 67   ASP E CB  1 
ATOM   7838 C CG  . ASP D 2 67  ? 20.355  3.814   -19.846 1.00 26.39  ? 67   ASP E CG  1 
ATOM   7839 O OD1 . ASP D 2 67  ? 20.803  4.827   -19.261 1.00 28.96  ? 67   ASP E OD1 1 
ATOM   7840 O OD2 . ASP D 2 67  ? 19.739  3.969   -20.922 1.00 28.63  ? 67   ASP E OD2 1 
ATOM   7841 N N   . GLU D 2 68  ? 22.462  0.156   -17.652 1.00 24.29  ? 68   GLU E N   1 
ATOM   7842 C CA  . GLU D 2 68  ? 22.554  -1.042  -16.830 1.00 24.67  ? 68   GLU E CA  1 
ATOM   7843 C C   . GLU D 2 68  ? 23.148  -0.712  -15.467 1.00 24.98  ? 68   GLU E C   1 
ATOM   7844 O O   . GLU D 2 68  ? 22.569  -1.120  -14.470 1.00 26.14  ? 68   GLU E O   1 
ATOM   7845 C CB  . GLU D 2 68  ? 23.422  -2.105  -17.479 1.00 26.53  ? 68   GLU E CB  1 
ATOM   7846 C CG  . GLU D 2 68  ? 22.861  -2.726  -18.748 1.00 30.66  ? 68   GLU E CG  1 
ATOM   7847 C CD  . GLU D 2 68  ? 23.978  -3.372  -19.553 1.00 34.64  ? 68   GLU E CD  1 
ATOM   7848 O OE1 . GLU D 2 68  ? 25.110  -3.550  -19.065 1.00 34.21  ? 68   GLU E OE1 1 
ATOM   7849 O OE2 . GLU D 2 68  ? 23.721  -3.671  -20.734 1.00 39.60  ? 68   GLU E OE2 1 
ATOM   7850 N N   . ILE D 2 69  ? 24.279  -0.006  -15.438 1.00 23.76  ? 69   ILE E N   1 
ATOM   7851 C CA  . ILE D 2 69  ? 24.938  0.337   -14.183 1.00 22.89  ? 69   ILE E CA  1 
ATOM   7852 C C   . ILE D 2 69  ? 24.075  1.280   -13.339 1.00 21.95  ? 69   ILE E C   1 
ATOM   7853 O O   . ILE D 2 69  ? 23.972  1.159   -12.112 1.00 20.14  ? 69   ILE E O   1 
ATOM   7854 C CB  . ILE D 2 69  ? 26.315  0.990   -14.463 1.00 19.77  ? 69   ILE E CB  1 
ATOM   7855 C CG1 . ILE D 2 69  ? 27.289  -0.101  -14.932 1.00 23.11  ? 69   ILE E CG1 1 
ATOM   7856 C CG2 . ILE D 2 69  ? 26.890  1.700   -13.254 1.00 17.04  ? 69   ILE E CG2 1 
ATOM   7857 C CD1 . ILE D 2 69  ? 28.448  0.402   -15.774 1.00 21.69  ? 69   ILE E CD1 1 
ATOM   7858 N N   . ALA D 2 70  ? 23.451  2.258   -14.006 1.00 20.49  ? 70   ALA E N   1 
ATOM   7859 C CA  . ALA D 2 70  ? 22.618  3.191   -13.258 1.00 20.99  ? 70   ALA E CA  1 
ATOM   7860 C C   . ALA D 2 70  ? 21.415  2.462   -12.637 1.00 22.99  ? 70   ALA E C   1 
ATOM   7861 O O   . ALA D 2 70  ? 21.121  2.775   -11.461 1.00 22.07  ? 70   ALA E O   1 
ATOM   7862 C CB  . ALA D 2 70  ? 22.179  4.362   -14.085 1.00 21.28  ? 70   ALA E CB  1 
ATOM   7863 N N   . ALA D 2 71  ? 20.839  1.499   -13.361 1.00 21.42  ? 71   ALA E N   1 
ATOM   7864 C CA  . ALA D 2 71  ? 19.710  0.783   -12.770 1.00 23.90  ? 71   ALA E CA  1 
ATOM   7865 C C   . ALA D 2 71  ? 20.185  -0.121  -11.635 1.00 24.22  ? 71   ALA E C   1 
ATOM   7866 O O   . ALA D 2 71  ? 19.633  -0.105  -10.520 1.00 23.72  ? 71   ALA E O   1 
ATOM   7867 C CB  . ALA D 2 71  ? 18.918  -0.015  -13.811 1.00 16.86  ? 71   ALA E CB  1 
ATOM   7868 N N   . LEU D 2 72  ? 21.253  -0.896  -11.873 1.00 24.89  ? 72   LEU E N   1 
ATOM   7869 C CA  . LEU D 2 72  ? 21.745  -1.800  -10.823 1.00 24.21  ? 72   LEU E CA  1 
ATOM   7870 C C   . LEU D 2 72  ? 22.095  -1.081  -9.528  1.00 23.98  ? 72   LEU E C   1 
ATOM   7871 O O   . LEU D 2 72  ? 21.723  -1.438  -8.404  1.00 22.61  ? 72   LEU E O   1 
ATOM   7872 C CB  . LEU D 2 72  ? 22.928  -2.584  -11.384 1.00 23.83  ? 72   LEU E CB  1 
ATOM   7873 C CG  . LEU D 2 72  ? 23.814  -3.387  -10.431 1.00 23.56  ? 72   LEU E CG  1 
ATOM   7874 C CD1 . LEU D 2 72  ? 23.038  -4.563  -9.828  1.00 21.07  ? 72   LEU E CD1 1 
ATOM   7875 C CD2 . LEU D 2 72  ? 25.072  -3.890  -11.126 1.00 18.38  ? 72   LEU E CD2 1 
ATOM   7876 N N   . LEU D 2 73  ? 22.808  0.039   -9.629  1.00 24.65  ? 73   LEU E N   1 
ATOM   7877 C CA  . LEU D 2 73  ? 23.293  0.769   -8.455  1.00 25.36  ? 73   LEU E CA  1 
ATOM   7878 C C   . LEU D 2 73  ? 22.204  1.470   -7.673  1.00 27.44  ? 73   LEU E C   1 
ATOM   7879 O O   . LEU D 2 73  ? 22.264  1.559   -6.447  1.00 25.28  ? 73   LEU E O   1 
ATOM   7880 C CB  . LEU D 2 73  ? 24.377  1.753   -8.876  1.00 23.28  ? 73   LEU E CB  1 
ATOM   7881 C CG  . LEU D 2 73  ? 25.668  1.122   -9.419  1.00 22.50  ? 73   LEU E CG  1 
ATOM   7882 C CD1 . LEU D 2 73  ? 26.629  2.263   -9.740  1.00 22.67  ? 73   LEU E CD1 1 
ATOM   7883 C CD2 . LEU D 2 73  ? 26.266  0.153   -8.404  1.00 21.93  ? 73   LEU E CD2 1 
ATOM   7884 N N   . ALA D 2 74  ? 21.157  1.873   -8.396  1.00 28.68  ? 74   ALA E N   1 
ATOM   7885 C CA  . ALA D 2 74  ? 19.981  2.484   -7.795  1.00 30.99  ? 74   ALA E CA  1 
ATOM   7886 C C   . ALA D 2 74  ? 19.248  1.436   -6.971  1.00 31.38  ? 74   ALA E C   1 
ATOM   7887 O O   . ALA D 2 74  ? 18.636  1.796   -5.965  1.00 33.15  ? 74   ALA E O   1 
ATOM   7888 C CB  . ALA D 2 74  ? 19.064  3.071   -8.874  1.00 29.91  ? 74   ALA E CB  1 
ATOM   7889 N N   . ALA D 2 75  ? 19.340  0.174   -7.329  1.00 32.65  ? 75   ALA E N   1 
ATOM   7890 C CA  . ALA D 2 75  ? 18.733  -0.905  -6.572  1.00 35.14  ? 75   ALA E CA  1 
ATOM   7891 C C   . ALA D 2 75  ? 19.476  -1.238  -5.285  1.00 37.18  ? 75   ALA E C   1 
ATOM   7892 O O   . ALA D 2 75  ? 18.848  -1.811  -4.388  1.00 38.07  ? 75   ALA E O   1 
ATOM   7893 C CB  . ALA D 2 75  ? 18.712  -2.156  -7.453  1.00 33.13  ? 75   ALA E CB  1 
ATOM   7894 N N   . GLY D 2 76  ? 20.773  -0.946  -5.146  1.00 37.18  ? 76   GLY E N   1 
ATOM   7895 C CA  . GLY D 2 76  ? 21.560  -1.322  -3.993  1.00 36.67  ? 76   GLY E CA  1 
ATOM   7896 C C   . GLY D 2 76  ? 21.114  -0.898  -2.616  1.00 36.64  ? 76   GLY E C   1 
ATOM   7897 O O   . GLY D 2 76  ? 20.170  -0.145  -2.416  1.00 36.99  ? 76   GLY E O   1 
ATOM   7898 N N   . THR D 2 77  ? 21.807  -1.349  -1.565  1.00 36.66  ? 77   THR E N   1 
ATOM   7899 C CA  . THR D 2 77  ? 21.434  -1.002  -0.185  1.00 34.91  ? 77   THR E CA  1 
ATOM   7900 C C   . THR D 2 77  ? 21.912  0.398   0.153   1.00 34.09  ? 77   THR E C   1 
ATOM   7901 O O   . THR D 2 77  ? 22.853  0.933   -0.427  1.00 33.58  ? 77   THR E O   1 
ATOM   7902 C CB  . THR D 2 77  ? 21.885  -2.098  0.775   1.00 35.31  ? 77   THR E CB  1 
ATOM   7903 O OG1 . THR D 2 77  ? 23.288  -2.357  0.662   1.00 37.54  ? 77   THR E OG1 1 
ATOM   7904 C CG2 . THR D 2 77  ? 21.123  -3.357  0.393   1.00 32.99  ? 77   THR E CG2 1 
ATOM   7905 N N   . PRO D 2 78  ? 21.233  1.064   1.087   1.00 33.00  ? 78   PRO E N   1 
ATOM   7906 C CA  . PRO D 2 78  ? 21.482  2.436   1.444   1.00 31.87  ? 78   PRO E CA  1 
ATOM   7907 C C   . PRO D 2 78  ? 22.865  2.778   1.941   1.00 31.15  ? 78   PRO E C   1 
ATOM   7908 O O   . PRO D 2 78  ? 23.192  3.975   1.907   1.00 32.16  ? 78   PRO E O   1 
ATOM   7909 C CB  . PRO D 2 78  ? 20.374  2.802   2.434   1.00 31.57  ? 78   PRO E CB  1 
ATOM   7910 C CG  . PRO D 2 78  ? 19.788  1.531   2.901   1.00 31.50  ? 78   PRO E CG  1 
ATOM   7911 C CD  . PRO D 2 78  ? 20.051  0.508   1.822   1.00 32.79  ? 78   PRO E CD  1 
ATOM   7912 N N   . ARG D 2 79  ? 23.689  1.859   2.411   1.00 28.33  ? 79   ARG E N   1 
ATOM   7913 C CA  . ARG D 2 79  ? 25.035  2.221   2.832   1.00 26.88  ? 79   ARG E CA  1 
ATOM   7914 C C   . ARG D 2 79  ? 26.101  1.739   1.833   1.00 25.43  ? 79   ARG E C   1 
ATOM   7915 O O   . ARG D 2 79  ? 27.278  1.627   2.204   1.00 23.31  ? 79   ARG E O   1 
ATOM   7916 C CB  . ARG D 2 79  ? 25.359  1.648   4.196   1.00 25.91  ? 79   ARG E CB  1 
ATOM   7917 C CG  . ARG D 2 79  ? 24.315  1.914   5.250   1.00 29.42  ? 79   ARG E CG  1 
ATOM   7918 C CD  . ARG D 2 79  ? 24.632  0.970   6.405   1.00 33.82  ? 79   ARG E CD  1 
ATOM   7919 N NE  . ARG D 2 79  ? 25.211  1.737   7.477   1.00 39.37  ? 79   ARG E NE  1 
ATOM   7920 C CZ  . ARG D 2 79  ? 26.243  1.354   8.213   1.00 45.34  ? 79   ARG E CZ  1 
ATOM   7921 N NH1 . ARG D 2 79  ? 26.847  0.204   7.938   1.00 45.59  ? 79   ARG E NH1 1 
ATOM   7922 N NH2 . ARG D 2 79  ? 26.640  2.178   9.191   1.00 48.20  ? 79   ARG E NH2 1 
ATOM   7923 N N   . THR D 2 80  ? 25.671  1.456   0.604   1.00 23.26  ? 80   THR E N   1 
ATOM   7924 C CA  . THR D 2 80  ? 26.633  1.034   -0.411  1.00 23.48  ? 80   THR E CA  1 
ATOM   7925 C C   . THR D 2 80  ? 27.524  2.204   -0.813  1.00 21.78  ? 80   THR E C   1 
ATOM   7926 O O   . THR D 2 80  ? 27.089  3.248   -1.275  1.00 20.60  ? 80   THR E O   1 
ATOM   7927 C CB  . THR D 2 80  ? 25.904  0.402   -1.588  1.00 23.51  ? 80   THR E CB  1 
ATOM   7928 O OG1 . THR D 2 80  ? 25.139  -0.688  -1.058  1.00 28.32  ? 80   THR E OG1 1 
ATOM   7929 C CG2 . THR D 2 80  ? 26.827  -0.211  -2.631  1.00 24.69  ? 80   THR E CG2 1 
ATOM   7930 N N   . THR D 2 81  ? 28.813  2.119   -0.493  1.00 21.14  ? 81   THR E N   1 
ATOM   7931 C CA  . THR D 2 81  ? 29.766  3.173   -0.901  1.00 17.62  ? 81   THR E CA  1 
ATOM   7932 C C   . THR D 2 81  ? 29.999  3.064   -2.409  1.00 17.24  ? 81   THR E C   1 
ATOM   7933 O O   . THR D 2 81  ? 30.201  1.936   -2.897  1.00 17.00  ? 81   THR E O   1 
ATOM   7934 C CB  . THR D 2 81  ? 31.067  2.931   -0.141  1.00 14.11  ? 81   THR E CB  1 
ATOM   7935 O OG1 . THR D 2 81  ? 30.773  2.963   1.271   1.00 13.15  ? 81   THR E OG1 1 
ATOM   7936 C CG2 . THR D 2 81  ? 32.136  3.983   -0.420  1.00 12.12  ? 81   THR E CG2 1 
ATOM   7937 N N   . LEU D 2 82  ? 30.016  4.130   -3.184  1.00 15.64  ? 82   LEU E N   1 
ATOM   7938 C CA  . LEU D 2 82  ? 30.292  4.075   -4.611  1.00 16.24  ? 82   LEU E CA  1 
ATOM   7939 C C   . LEU D 2 82  ? 31.493  4.927   -4.996  1.00 15.74  ? 82   LEU E C   1 
ATOM   7940 O O   . LEU D 2 82  ? 31.496  6.138   -4.729  1.00 15.41  ? 82   LEU E O   1 
ATOM   7941 C CB  . LEU D 2 82  ? 29.114  4.636   -5.461  1.00 19.95  ? 82   LEU E CB  1 
ATOM   7942 C CG  . LEU D 2 82  ? 29.297  4.643   -6.982  1.00 24.63  ? 82   LEU E CG  1 
ATOM   7943 C CD1 . LEU D 2 82  ? 29.581  3.281   -7.593  1.00 24.24  ? 82   LEU E CD1 1 
ATOM   7944 C CD2 . LEU D 2 82  ? 28.042  5.192   -7.686  1.00 26.97  ? 82   LEU E CD2 1 
ATOM   7945 N N   . VAL D 2 83  ? 32.458  4.344   -5.686  1.00 16.03  ? 83   VAL E N   1 
ATOM   7946 C CA  . VAL D 2 83  ? 33.635  5.069   -6.148  1.00 14.07  ? 83   VAL E CA  1 
ATOM   7947 C C   . VAL D 2 83  ? 33.721  4.989   -7.672  1.00 16.06  ? 83   VAL E C   1 
ATOM   7948 O O   . VAL D 2 83  ? 33.654  3.883   -8.222  1.00 17.97  ? 83   VAL E O   1 
ATOM   7949 C CB  . VAL D 2 83  ? 34.914  4.506   -5.552  1.00 9.84   ? 83   VAL E CB  1 
ATOM   7950 C CG1 . VAL D 2 83  ? 36.199  5.003   -6.263  1.00 9.11   ? 83   VAL E CG1 1 
ATOM   7951 C CG2 . VAL D 2 83  ? 35.011  4.863   -4.080  1.00 7.07   ? 83   VAL E CG2 1 
ATOM   7952 N N   . ALA D 2 84  ? 33.877  6.104   -8.367  1.00 15.95  ? 84   ALA E N   1 
ATOM   7953 C CA  . ALA D 2 84  ? 33.993  6.027   -9.816  1.00 16.38  ? 84   ALA E CA  1 
ATOM   7954 C C   . ALA D 2 84  ? 35.427  6.093   -10.340 1.00 17.00  ? 84   ALA E C   1 
ATOM   7955 O O   . ALA D 2 84  ? 36.337  6.755   -9.851  1.00 16.28  ? 84   ALA E O   1 
ATOM   7956 C CB  . ALA D 2 84  ? 33.086  7.081   -10.420 1.00 14.08  ? 84   ALA E CB  1 
ATOM   7957 N N   . LEU D 2 85  ? 35.680  5.269   -11.353 1.00 17.63  ? 85   LEU E N   1 
ATOM   7958 C CA  . LEU D 2 85  ? 36.949  5.229   -12.083 1.00 19.03  ? 85   LEU E CA  1 
ATOM   7959 C C   . LEU D 2 85  ? 36.696  6.143   -13.296 1.00 20.42  ? 85   LEU E C   1 
ATOM   7960 O O   . LEU D 2 85  ? 35.805  5.888   -14.114 1.00 19.25  ? 85   LEU E O   1 
ATOM   7961 C CB  . LEU D 2 85  ? 37.351  3.803   -12.451 1.00 18.29  ? 85   LEU E CB  1 
ATOM   7962 C CG  . LEU D 2 85  ? 37.309  2.828   -11.255 1.00 20.07  ? 85   LEU E CG  1 
ATOM   7963 C CD1 . LEU D 2 85  ? 37.374  1.377   -11.727 1.00 22.10  ? 85   LEU E CD1 1 
ATOM   7964 C CD2 . LEU D 2 85  ? 38.406  3.173   -10.253 1.00 18.31  ? 85   LEU E CD2 1 
ATOM   7965 N N   . VAL D 2 86  ? 37.335  7.299   -13.280 1.00 18.80  ? 86   VAL E N   1 
ATOM   7966 C CA  . VAL D 2 86  ? 37.134  8.353   -14.249 1.00 20.22  ? 86   VAL E CA  1 
ATOM   7967 C C   . VAL D 2 86  ? 38.296  8.477   -15.240 1.00 21.31  ? 86   VAL E C   1 
ATOM   7968 O O   . VAL D 2 86  ? 39.484  8.537   -14.889 1.00 19.06  ? 86   VAL E O   1 
ATOM   7969 C CB  . VAL D 2 86  ? 37.024  9.682   -13.450 1.00 23.12  ? 86   VAL E CB  1 
ATOM   7970 C CG1 . VAL D 2 86  ? 36.713  10.893  -14.300 1.00 19.52  ? 86   VAL E CG1 1 
ATOM   7971 C CG2 . VAL D 2 86  ? 36.015  9.527   -12.307 1.00 21.80  ? 86   VAL E CG2 1 
ATOM   7972 N N   . GLU D 2 87  ? 37.951  8.618   -16.534 1.00 20.38  ? 87   GLU E N   1 
ATOM   7973 C CA  . GLU D 2 87  ? 39.020  8.755   -17.507 1.00 20.50  ? 87   GLU E CA  1 
ATOM   7974 C C   . GLU D 2 87  ? 38.978  10.094  -18.209 1.00 19.13  ? 87   GLU E C   1 
ATOM   7975 O O   . GLU D 2 87  ? 39.898  10.423  -18.938 1.00 20.20  ? 87   GLU E O   1 
ATOM   7976 C CB  . GLU D 2 87  ? 39.026  7.580   -18.458 1.00 25.95  ? 87   GLU E CB  1 
ATOM   7977 C CG  . GLU D 2 87  ? 37.781  6.942   -18.982 1.00 32.72  ? 87   GLU E CG  1 
ATOM   7978 C CD  . GLU D 2 87  ? 37.970  5.497   -19.433 1.00 32.83  ? 87   GLU E CD  1 
ATOM   7979 O OE1 . GLU D 2 87  ? 38.627  5.246   -20.449 1.00 31.52  ? 87   GLU E OE1 1 
ATOM   7980 O OE2 . GLU D 2 87  ? 37.475  4.539   -18.792 1.00 34.78  ? 87   GLU E OE2 1 
ATOM   7981 N N   . TYR D 2 88  ? 37.906  10.847  -18.069 1.00 17.89  ? 88   TYR E N   1 
ATOM   7982 C CA  . TYR D 2 88  ? 37.674  12.113  -18.733 1.00 16.17  ? 88   TYR E CA  1 
ATOM   7983 C C   . TYR D 2 88  ? 37.171  13.114  -17.704 1.00 15.63  ? 88   TYR E C   1 
ATOM   7984 O O   . TYR D 2 88  ? 36.554  12.736  -16.723 1.00 14.56  ? 88   TYR E O   1 
ATOM   7985 C CB  . TYR D 2 88  ? 36.602  11.950  -19.850 1.00 15.55  ? 88   TYR E CB  1 
ATOM   7986 C CG  . TYR D 2 88  ? 37.061  11.055  -20.978 1.00 15.59  ? 88   TYR E CG  1 
ATOM   7987 C CD1 . TYR D 2 88  ? 37.858  11.543  -22.001 1.00 15.83  ? 88   TYR E CD1 1 
ATOM   7988 C CD2 . TYR D 2 88  ? 36.760  9.704   -20.998 1.00 17.52  ? 88   TYR E CD2 1 
ATOM   7989 C CE1 . TYR D 2 88  ? 38.327  10.723  -23.008 1.00 18.29  ? 88   TYR E CE1 1 
ATOM   7990 C CE2 . TYR D 2 88  ? 37.211  8.856   -21.996 1.00 17.85  ? 88   TYR E CE2 1 
ATOM   7991 C CZ  . TYR D 2 88  ? 37.999  9.381   -22.994 1.00 19.12  ? 88   TYR E CZ  1 
ATOM   7992 O OH  . TYR D 2 88  ? 38.475  8.588   -24.000 1.00 19.94  ? 88   TYR E OH  1 
ATOM   7993 N N   . GLU D 2 89  ? 37.354  14.400  -17.896 1.00 15.65  ? 89   GLU E N   1 
ATOM   7994 C CA  . GLU D 2 89  ? 36.906  15.446  -17.007 1.00 15.02  ? 89   GLU E CA  1 
ATOM   7995 C C   . GLU D 2 89  ? 35.809  16.215  -17.753 1.00 14.25  ? 89   GLU E C   1 
ATOM   7996 O O   . GLU D 2 89  ? 35.523  17.332  -17.359 1.00 13.84  ? 89   GLU E O   1 
ATOM   7997 C CB  . GLU D 2 89  ? 38.033  16.431  -16.677 1.00 15.93  ? 89   GLU E CB  1 
ATOM   7998 C CG  . GLU D 2 89  ? 39.405  15.861  -16.422 1.00 19.80  ? 89   GLU E CG  1 
ATOM   7999 C CD  . GLU D 2 89  ? 40.488  16.916  -16.310 1.00 21.06  ? 89   GLU E CD  1 
ATOM   8000 O OE1 . GLU D 2 89  ? 40.314  18.051  -15.829 1.00 17.53  ? 89   GLU E OE1 1 
ATOM   8001 O OE2 . GLU D 2 89  ? 41.614  16.583  -16.735 1.00 22.99  ? 89   GLU E OE2 1 
ATOM   8002 N N   . SER D 2 90  ? 35.306  15.667  -18.835 1.00 15.25  ? 90   SER E N   1 
ATOM   8003 C CA  . SER D 2 90  ? 34.359  16.373  -19.700 1.00 16.83  ? 90   SER E CA  1 
ATOM   8004 C C   . SER D 2 90  ? 32.925  16.305  -19.209 1.00 16.92  ? 90   SER E C   1 
ATOM   8005 O O   . SER D 2 90  ? 32.563  15.429  -18.445 1.00 18.25  ? 90   SER E O   1 
ATOM   8006 C CB  . SER D 2 90  ? 34.563  15.925  -21.150 1.00 17.70  ? 90   SER E CB  1 
ATOM   8007 O OG  . SER D 2 90  ? 34.696  14.509  -21.285 1.00 15.68  ? 90   SER E OG  1 
ATOM   8008 N N   . PRO D 2 91  ? 32.098  17.294  -19.554 1.00 18.27  ? 91   PRO E N   1 
ATOM   8009 C CA  . PRO D 2 91  ? 30.726  17.425  -19.102 1.00 17.87  ? 91   PRO E CA  1 
ATOM   8010 C C   . PRO D 2 91  ? 29.874  16.182  -19.102 1.00 16.84  ? 91   PRO E C   1 
ATOM   8011 O O   . PRO D 2 91  ? 29.363  15.809  -18.041 1.00 17.38  ? 91   PRO E O   1 
ATOM   8012 C CB  . PRO D 2 91  ? 30.164  18.556  -19.968 1.00 17.56  ? 91   PRO E CB  1 
ATOM   8013 C CG  . PRO D 2 91  ? 31.375  19.435  -20.086 1.00 19.79  ? 91   PRO E CG  1 
ATOM   8014 C CD  . PRO D 2 91  ? 32.464  18.424  -20.444 1.00 17.82  ? 91   PRO E CD  1 
ATOM   8015 N N   . ALA D 2 92  ? 29.664  15.462  -20.195 1.00 17.90  ? 92   ALA E N   1 
ATOM   8016 C CA  . ALA D 2 92  ? 28.854  14.248  -20.193 1.00 17.09  ? 92   ALA E CA  1 
ATOM   8017 C C   . ALA D 2 92  ? 29.373  13.227  -19.189 1.00 16.79  ? 92   ALA E C   1 
ATOM   8018 O O   . ALA D 2 92  ? 28.605  12.440  -18.655 1.00 17.22  ? 92   ALA E O   1 
ATOM   8019 C CB  . ALA D 2 92  ? 28.818  13.586  -21.568 1.00 14.01  ? 92   ALA E CB  1 
ATOM   8020 N N   . VAL D 2 93  ? 30.689  13.088  -19.013 1.00 16.55  ? 93   VAL E N   1 
ATOM   8021 C CA  . VAL D 2 93  ? 31.240  12.122  -18.092 1.00 15.17  ? 93   VAL E CA  1 
ATOM   8022 C C   . VAL D 2 93  ? 31.068  12.605  -16.654 1.00 15.27  ? 93   VAL E C   1 
ATOM   8023 O O   . VAL D 2 93  ? 30.762  11.778  -15.797 1.00 15.03  ? 93   VAL E O   1 
ATOM   8024 C CB  . VAL D 2 93  ? 32.725  11.845  -18.359 1.00 17.08  ? 93   VAL E CB  1 
ATOM   8025 C CG1 . VAL D 2 93  ? 33.369  11.116  -17.173 1.00 11.74  ? 93   VAL E CG1 1 
ATOM   8026 C CG2 . VAL D 2 93  ? 32.842  11.025  -19.644 1.00 17.97  ? 93   VAL E CG2 1 
ATOM   8027 N N   . LEU D 2 94  ? 31.318  13.880  -16.378 1.00 14.25  ? 94   LEU E N   1 
ATOM   8028 C CA  . LEU D 2 94  ? 31.184  14.303  -14.981 1.00 14.67  ? 94   LEU E CA  1 
ATOM   8029 C C   . LEU D 2 94  ? 29.697  14.340  -14.596 1.00 14.94  ? 94   LEU E C   1 
ATOM   8030 O O   . LEU D 2 94  ? 29.351  14.224  -13.421 1.00 13.45  ? 94   LEU E O   1 
ATOM   8031 C CB  . LEU D 2 94  ? 31.855  15.651  -14.765 1.00 15.76  ? 94   LEU E CB  1 
ATOM   8032 C CG  . LEU D 2 94  ? 33.385  15.702  -14.925 1.00 19.47  ? 94   LEU E CG  1 
ATOM   8033 C CD1 . LEU D 2 94  ? 33.884  17.103  -14.634 1.00 18.73  ? 94   LEU E CD1 1 
ATOM   8034 C CD2 . LEU D 2 94  ? 34.052  14.669  -14.031 1.00 19.37  ? 94   LEU E CD2 1 
ATOM   8035 N N   . SER D 2 95  ? 28.818  14.613  -15.562 1.00 13.46  ? 95   SER E N   1 
ATOM   8036 C CA  . SER D 2 95  ? 27.400  14.649  -15.237 1.00 13.86  ? 95   SER E CA  1 
ATOM   8037 C C   . SER D 2 95  ? 26.936  13.261  -14.780 1.00 15.83  ? 95   SER E C   1 
ATOM   8038 O O   . SER D 2 95  ? 26.108  13.170  -13.871 1.00 14.19  ? 95   SER E O   1 
ATOM   8039 C CB  . SER D 2 95  ? 26.632  15.085  -16.485 1.00 14.51  ? 95   SER E CB  1 
ATOM   8040 O OG  . SER D 2 95  ? 26.869  16.476  -16.679 1.00 18.13  ? 95   SER E OG  1 
ATOM   8041 N N   . GLN D 2 96  ? 27.468  12.173  -15.392 1.00 14.32  ? 96   GLN E N   1 
ATOM   8042 C CA  . GLN D 2 96  ? 27.067  10.851  -15.025 1.00 16.41  ? 96   GLN E CA  1 
ATOM   8043 C C   . GLN D 2 96  ? 27.535  10.483  -13.615 1.00 18.24  ? 96   GLN E C   1 
ATOM   8044 O O   . GLN D 2 96  ? 26.900  9.753   -12.846 1.00 20.15  ? 96   GLN E O   1 
ATOM   8045 C CB  . GLN D 2 96  ? 27.561  9.803   -16.039 1.00 16.38  ? 96   GLN E CB  1 
ATOM   8046 C CG  . GLN D 2 96  ? 27.126  8.412   -15.618 1.00 16.27  ? 96   GLN E CG  1 
ATOM   8047 C CD  . GLN D 2 96  ? 27.374  7.260   -16.543 1.00 17.30  ? 96   GLN E CD  1 
ATOM   8048 O OE1 . GLN D 2 96  ? 27.513  7.415   -17.756 1.00 19.22  ? 96   GLN E OE1 1 
ATOM   8049 N NE2 . GLN D 2 96  ? 27.320  6.057   -15.956 1.00 14.49  ? 96   GLN E NE2 1 
ATOM   8050 N N   . ILE D 2 97  ? 28.695  10.972  -13.230 1.00 18.77  ? 97   ILE E N   1 
ATOM   8051 C CA  . ILE D 2 97  ? 29.218  10.732  -11.885 1.00 19.92  ? 97   ILE E CA  1 
ATOM   8052 C C   . ILE D 2 97  ? 28.349  11.434  -10.847 1.00 18.65  ? 97   ILE E C   1 
ATOM   8053 O O   . ILE D 2 97  ? 28.174  10.922  -9.757  1.00 15.63  ? 97   ILE E O   1 
ATOM   8054 C CB  . ILE D 2 97  ? 30.671  11.248  -11.889 1.00 21.77  ? 97   ILE E CB  1 
ATOM   8055 C CG1 . ILE D 2 97  ? 31.501  10.086  -12.463 1.00 23.67  ? 97   ILE E CG1 1 
ATOM   8056 C CG2 . ILE D 2 97  ? 31.130  11.719  -10.535 1.00 21.26  ? 97   ILE E CG2 1 
ATOM   8057 C CD1 . ILE D 2 97  ? 32.801  10.557  -13.096 1.00 29.31  ? 97   ILE E CD1 1 
ATOM   8058 N N   . ILE D 2 98  ? 27.885  12.638  -11.159 1.00 18.37  ? 98   ILE E N   1 
ATOM   8059 C CA  . ILE D 2 98  ? 26.979  13.421  -10.347 1.00 18.15  ? 98   ILE E CA  1 
ATOM   8060 C C   . ILE D 2 98  ? 25.662  12.660  -10.243 1.00 18.42  ? 98   ILE E C   1 
ATOM   8061 O O   . ILE D 2 98  ? 25.219  12.295  -9.147  1.00 18.74  ? 98   ILE E O   1 
ATOM   8062 C CB  . ILE D 2 98  ? 26.768  14.835  -10.939 1.00 17.71  ? 98   ILE E CB  1 
ATOM   8063 C CG1 . ILE D 2 98  ? 28.121  15.574  -10.849 1.00 17.02  ? 98   ILE E CG1 1 
ATOM   8064 C CG2 . ILE D 2 98  ? 25.658  15.609  -10.235 1.00 16.14  ? 98   ILE E CG2 1 
ATOM   8065 C CD1 . ILE D 2 98  ? 28.092  16.937  -11.505 1.00 17.86  ? 98   ILE E CD1 1 
ATOM   8066 N N   . GLU D 2 99  ? 25.126  12.210  -11.372 1.00 18.36  ? 99   GLU E N   1 
ATOM   8067 C CA  . GLU D 2 99  ? 23.867  11.462  -11.400 1.00 19.48  ? 99   GLU E CA  1 
ATOM   8068 C C   . GLU D 2 99  ? 23.917  10.142  -10.652 1.00 20.11  ? 99   GLU E C   1 
ATOM   8069 O O   . GLU D 2 99  ? 22.921  9.670   -10.071 1.00 21.84  ? 99   GLU E O   1 
ATOM   8070 C CB  . GLU D 2 99  ? 23.430  11.202  -12.848 1.00 16.13  ? 99   GLU E CB  1 
ATOM   8071 C CG  . GLU D 2 99  ? 23.003  12.506  -13.557 1.00 17.35  ? 99   GLU E CG  1 
ATOM   8072 C CD  . GLU D 2 99  ? 23.186  12.373  -15.061 1.00 21.63  ? 99   GLU E CD  1 
ATOM   8073 O OE1 . GLU D 2 99  ? 23.358  11.238  -15.600 1.00 21.49  ? 99   GLU E OE1 1 
ATOM   8074 O OE2 . GLU D 2 99  ? 23.187  13.414  -15.749 1.00 23.28  ? 99   GLU E OE2 1 
ATOM   8075 N N   . LEU D 2 100 ? 25.038  9.443   -10.643 1.00 19.79  ? 100  LEU E N   1 
ATOM   8076 C CA  . LEU D 2 100 ? 25.180  8.189   -9.912  1.00 18.56  ? 100  LEU E CA  1 
ATOM   8077 C C   . LEU D 2 100 ? 25.352  8.440   -8.415  1.00 18.15  ? 100  LEU E C   1 
ATOM   8078 O O   . LEU D 2 100 ? 25.177  7.521   -7.612  1.00 17.33  ? 100  LEU E O   1 
ATOM   8079 C CB  . LEU D 2 100 ? 26.431  7.442   -10.392 1.00 21.82  ? 100  LEU E CB  1 
ATOM   8080 C CG  . LEU D 2 100 ? 26.375  6.818   -11.790 1.00 22.04  ? 100  LEU E CG  1 
ATOM   8081 C CD1 . LEU D 2 100 ? 27.650  6.046   -12.064 1.00 21.42  ? 100  LEU E CD1 1 
ATOM   8082 C CD2 . LEU D 2 100 ? 25.153  5.920   -11.934 1.00 19.20  ? 100  LEU E CD2 1 
ATOM   8083 N N   . GLU D 2 101 ? 25.715  9.666   -8.030  1.00 15.56  ? 101  GLU E N   1 
ATOM   8084 C CA  . GLU D 2 101 ? 25.895  10.004  -6.630  1.00 17.10  ? 101  GLU E CA  1 
ATOM   8085 C C   . GLU D 2 101 ? 27.098  9.309   -6.007  1.00 16.34  ? 101  GLU E C   1 
ATOM   8086 O O   . GLU D 2 101 ? 27.020  8.807   -4.876  1.00 16.45  ? 101  GLU E O   1 
ATOM   8087 C CB  . GLU D 2 101 ? 24.605  9.759   -5.840  1.00 15.66  ? 101  GLU E CB  1 
ATOM   8088 C CG  . GLU D 2 101 ? 23.466  10.628  -6.352  1.00 21.18  ? 101  GLU E CG  1 
ATOM   8089 C CD  . GLU D 2 101 ? 22.142  10.472  -5.670  1.00 24.18  ? 101  GLU E CD  1 
ATOM   8090 O OE1 . GLU D 2 101 ? 22.023  10.155  -4.473  1.00 25.84  ? 101  GLU E OE1 1 
ATOM   8091 O OE2 . GLU D 2 101 ? 21.119  10.680  -6.358  1.00 30.99  ? 101  GLU E OE2 1 
ATOM   8092 N N   . CYS D 2 102 ? 28.207  9.328   -6.735  1.00 14.93  ? 102  CYS E N   1 
ATOM   8093 C CA  . CYS D 2 102 ? 29.448  8.720   -6.213  1.00 14.98  ? 102  CYS E CA  1 
ATOM   8094 C C   . CYS D 2 102 ? 29.855  9.353   -4.908  1.00 12.94  ? 102  CYS E C   1 
ATOM   8095 O O   . CYS D 2 102 ? 29.662  10.562  -4.670  1.00 13.70  ? 102  CYS E O   1 
ATOM   8096 C CB  . CYS D 2 102 ? 30.545  8.856   -7.297  1.00 15.84  ? 102  CYS E CB  1 
ATOM   8097 S SG  . CYS D 2 102 ? 30.040  7.869   -8.767  1.00 24.10  ? 102  CYS E SG  1 
ATOM   8098 N N   . HIS D 2 103 ? 30.583  8.628   -4.080  1.00 13.27  ? 103  HIS E N   1 
ATOM   8099 C CA  . HIS D 2 103 ? 31.124  9.145   -2.822  1.00 13.78  ? 103  HIS E CA  1 
ATOM   8100 C C   . HIS D 2 103 ? 32.621  9.432   -2.947  1.00 16.04  ? 103  HIS E C   1 
ATOM   8101 O O   . HIS D 2 103 ? 33.233  10.004  -2.052  1.00 15.17  ? 103  HIS E O   1 
ATOM   8102 C CB  . HIS D 2 103 ? 30.909  8.145   -1.649  1.00 11.30  ? 103  HIS E CB  1 
ATOM   8103 C CG  . HIS D 2 103 ? 29.459  7.791   -1.490  1.00 12.49  ? 103  HIS E CG  1 
ATOM   8104 N ND1 . HIS D 2 103 ? 28.925  6.587   -1.897  1.00 11.85  ? 103  HIS E ND1 1 
ATOM   8105 C CD2 . HIS D 2 103 ? 28.413  8.593   -1.081  1.00 10.96  ? 103  HIS E CD2 1 
ATOM   8106 C CE1 . HIS D 2 103 ? 27.605  6.619   -1.677  1.00 12.97  ? 103  HIS E CE1 1 
ATOM   8107 N NE2 . HIS D 2 103 ? 27.273  7.810   -1.158  1.00 12.92  ? 103  HIS E NE2 1 
ATOM   8108 N N   . GLY D 2 104 ? 33.248  9.024   -4.043  1.00 17.64  ? 104  GLY E N   1 
ATOM   8109 C CA  . GLY D 2 104 ? 34.684  9.280   -4.254  1.00 18.12  ? 104  GLY E CA  1 
ATOM   8110 C C   . GLY D 2 104 ? 35.007  9.000   -5.724  1.00 18.50  ? 104  GLY E C   1 
ATOM   8111 O O   . GLY D 2 104 ? 34.141  8.449   -6.407  1.00 18.48  ? 104  GLY E O   1 
ATOM   8112 N N   . VAL D 2 105 ? 36.144  9.454   -6.245  1.00 17.69  ? 105  VAL E N   1 
ATOM   8113 C CA  . VAL D 2 105 ? 36.540  9.179   -7.614  1.00 16.58  ? 105  VAL E CA  1 
ATOM   8114 C C   . VAL D 2 105 ? 38.021  8.751   -7.680  1.00 16.63  ? 105  VAL E C   1 
ATOM   8115 O O   . VAL D 2 105 ? 38.855  9.130   -6.846  1.00 13.06  ? 105  VAL E O   1 
ATOM   8116 C CB  . VAL D 2 105 ? 36.352  10.388  -8.563  1.00 17.21  ? 105  VAL E CB  1 
ATOM   8117 C CG1 . VAL D 2 105 ? 34.895  10.853  -8.636  1.00 14.37  ? 105  VAL E CG1 1 
ATOM   8118 C CG2 . VAL D 2 105 ? 37.246  11.552  -8.160  1.00 13.84  ? 105  VAL E CG2 1 
ATOM   8119 N N   . ILE D 2 106 ? 38.355  7.901   -8.664  1.00 16.26  ? 106  ILE E N   1 
ATOM   8120 C CA  . ILE D 2 106 ? 39.790  7.625   -8.866  1.00 16.82  ? 106  ILE E CA  1 
ATOM   8121 C C   . ILE D 2 106 ? 40.083  8.001   -10.315 1.00 16.32  ? 106  ILE E C   1 
ATOM   8122 O O   . ILE D 2 106 ? 39.442  7.456   -11.209 1.00 17.43  ? 106  ILE E O   1 
ATOM   8123 C CB  . ILE D 2 106 ? 40.311  6.251   -8.498  1.00 19.07  ? 106  ILE E CB  1 
ATOM   8124 C CG1 . ILE D 2 106 ? 40.252  5.962   -6.996  1.00 14.92  ? 106  ILE E CG1 1 
ATOM   8125 C CG2 . ILE D 2 106 ? 41.760  6.015   -8.984  1.00 15.38  ? 106  ILE E CG2 1 
ATOM   8126 C CD1 . ILE D 2 106 ? 40.474  4.481   -6.685  1.00 17.26  ? 106  ILE E CD1 1 
ATOM   8127 N N   . THR D 2 107 ? 40.994  8.931   -10.593 1.00 17.19  ? 107  THR E N   1 
ATOM   8128 C CA  . THR D 2 107 ? 41.273  9.266   -11.996 1.00 16.75  ? 107  THR E CA  1 
ATOM   8129 C C   . THR D 2 107 ? 42.240  8.266   -12.616 1.00 19.05  ? 107  THR E C   1 
ATOM   8130 O O   . THR D 2 107 ? 43.163  7.774   -11.983 1.00 18.63  ? 107  THR E O   1 
ATOM   8131 C CB  . THR D 2 107 ? 41.796  10.680  -12.213 1.00 14.78  ? 107  THR E CB  1 
ATOM   8132 O OG1 . THR D 2 107 ? 42.968  10.879  -11.397 1.00 16.74  ? 107  THR E OG1 1 
ATOM   8133 C CG2 . THR D 2 107 ? 40.762  11.732  -11.850 1.00 16.15  ? 107  THR E CG2 1 
ATOM   8134 N N   . GLN D 2 108 ? 42.004  7.881   -13.863 1.00 20.61  ? 108  GLN E N   1 
ATOM   8135 C CA  . GLN D 2 108 ? 42.815  6.889   -14.558 1.00 23.70  ? 108  GLN E CA  1 
ATOM   8136 C C   . GLN D 2 108 ? 44.006  7.558   -15.241 1.00 24.54  ? 108  GLN E C   1 
ATOM   8137 O O   . GLN D 2 108 ? 43.938  8.744   -15.565 1.00 23.72  ? 108  GLN E O   1 
ATOM   8138 C CB  . GLN D 2 108 ? 41.941  6.180   -15.599 1.00 23.03  ? 108  GLN E CB  1 
ATOM   8139 C CG  . GLN D 2 108 ? 40.703  5.461   -15.049 1.00 25.98  ? 108  GLN E CG  1 
ATOM   8140 C CD  . GLN D 2 108 ? 41.061  4.038   -14.636 1.00 28.96  ? 108  GLN E CD  1 
ATOM   8141 O OE1 . GLN D 2 108 ? 42.232  3.826   -14.267 1.00 29.99  ? 108  GLN E OE1 1 
ATOM   8142 N NE2 . GLN D 2 108 ? 40.123  3.098   -14.734 1.00 24.86  ? 108  GLN E NE2 1 
ATOM   8143 N N   . PRO D 2 109 ? 45.083  6.808   -15.444 1.00 25.24  ? 109  PRO E N   1 
ATOM   8144 C CA  . PRO D 2 109 ? 45.220  5.438   -15.047 1.00 24.77  ? 109  PRO E CA  1 
ATOM   8145 C C   . PRO D 2 109 ? 45.458  5.365   -13.541 1.00 24.84  ? 109  PRO E C   1 
ATOM   8146 O O   . PRO D 2 109 ? 46.214  6.162   -12.977 1.00 24.94  ? 109  PRO E O   1 
ATOM   8147 C CB  . PRO D 2 109 ? 46.500  4.946   -15.731 1.00 24.89  ? 109  PRO E CB  1 
ATOM   8148 C CG  . PRO D 2 109 ? 47.332  6.171   -15.897 1.00 24.85  ? 109  PRO E CG  1 
ATOM   8149 C CD  . PRO D 2 109 ? 46.356  7.294   -16.089 1.00 25.80  ? 109  PRO E CD  1 
ATOM   8150 N N   . LEU D 2 110 ? 44.846  4.350   -12.930 1.00 23.95  ? 110  LEU E N   1 
ATOM   8151 C CA  . LEU D 2 110 ? 44.972  4.210   -11.496 1.00 23.43  ? 110  LEU E CA  1 
ATOM   8152 C C   . LEU D 2 110 ? 46.276  3.481   -11.178 1.00 20.98  ? 110  LEU E C   1 
ATOM   8153 O O   . LEU D 2 110 ? 46.880  2.923   -12.089 1.00 21.08  ? 110  LEU E O   1 
ATOM   8154 C CB  . LEU D 2 110 ? 43.793  3.466   -10.902 1.00 26.66  ? 110  LEU E CB  1 
ATOM   8155 C CG  . LEU D 2 110 ? 43.702  1.974   -11.234 1.00 29.76  ? 110  LEU E CG  1 
ATOM   8156 C CD1 . LEU D 2 110 ? 44.262  1.174   -10.076 1.00 29.14  ? 110  LEU E CD1 1 
ATOM   8157 C CD2 . LEU D 2 110 ? 42.238  1.656   -11.541 1.00 31.41  ? 110  LEU E CD2 1 
ATOM   8158 N N   . ASP D 2 111 ? 46.689  3.659   -9.940  1.00 18.93  ? 111  ASP E N   1 
ATOM   8159 C CA  . ASP D 2 111 ? 47.869  2.947   -9.445  1.00 19.34  ? 111  ASP E CA  1 
ATOM   8160 C C   . ASP D 2 111 ? 47.495  2.642   -8.000  1.00 18.05  ? 111  ASP E C   1 
ATOM   8161 O O   . ASP D 2 111 ? 46.509  3.191   -7.519  1.00 15.83  ? 111  ASP E O   1 
ATOM   8162 C CB  . ASP D 2 111 ? 49.153  3.725   -9.653  1.00 20.48  ? 111  ASP E CB  1 
ATOM   8163 C CG  . ASP D 2 111 ? 49.279  5.003   -8.874  1.00 20.19  ? 111  ASP E CG  1 
ATOM   8164 O OD1 . ASP D 2 111 ? 48.809  5.149   -7.742  1.00 21.27  ? 111  ASP E OD1 1 
ATOM   8165 O OD2 . ASP D 2 111 ? 49.880  5.953   -9.415  1.00 26.34  ? 111  ASP E OD2 1 
ATOM   8166 N N   . ALA D 2 112 ? 48.256  1.797   -7.329  1.00 18.52  ? 112  ALA E N   1 
ATOM   8167 C CA  . ALA D 2 112 ? 47.988  1.347   -5.991  1.00 17.95  ? 112  ALA E CA  1 
ATOM   8168 C C   . ALA D 2 112 ? 47.807  2.428   -4.943  1.00 18.11  ? 112  ALA E C   1 
ATOM   8169 O O   . ALA D 2 112 ? 47.045  2.170   -4.006  1.00 17.31  ? 112  ALA E O   1 
ATOM   8170 C CB  . ALA D 2 112 ? 49.105  0.387   -5.553  1.00 19.19  ? 112  ALA E CB  1 
ATOM   8171 N N   . HIS D 2 113 ? 48.510  3.541   -5.029  1.00 17.81  ? 113  HIS E N   1 
ATOM   8172 C CA  . HIS D 2 113 ? 48.499  4.622   -4.062  1.00 17.13  ? 113  HIS E CA  1 
ATOM   8173 C C   . HIS D 2 113 ? 47.193  5.402   -3.929  1.00 15.80  ? 113  HIS E C   1 
ATOM   8174 O O   . HIS D 2 113 ? 46.951  6.143   -2.977  1.00 14.81  ? 113  HIS E O   1 
ATOM   8175 C CB  . HIS D 2 113 ? 49.628  5.631   -4.461  1.00 15.65  ? 113  HIS E CB  1 
ATOM   8176 C CG  . HIS D 2 113 ? 50.934  4.978   -4.792  1.00 17.40  ? 113  HIS E CG  1 
ATOM   8177 N ND1 . HIS D 2 113 ? 51.703  4.340   -3.832  1.00 17.02  ? 113  HIS E ND1 1 
ATOM   8178 C CD2 . HIS D 2 113 ? 51.623  4.843   -5.953  1.00 15.86  ? 113  HIS E CD2 1 
ATOM   8179 C CE1 . HIS D 2 113 ? 52.796  3.830   -4.392  1.00 16.13  ? 113  HIS E CE1 1 
ATOM   8180 N NE2 . HIS D 2 113 ? 52.763  4.114   -5.689  1.00 14.24  ? 113  HIS E NE2 1 
ATOM   8181 N N   . ARG D 2 114 ? 46.341  5.407   -4.936  1.00 15.52  ? 114  ARG E N   1 
ATOM   8182 C CA  . ARG D 2 114 ? 45.105  6.138   -4.952  1.00 14.94  ? 114  ARG E CA  1 
ATOM   8183 C C   . ARG D 2 114 ? 43.984  5.445   -4.148  1.00 14.32  ? 114  ARG E C   1 
ATOM   8184 O O   . ARG D 2 114 ? 42.990  6.097   -3.852  1.00 12.88  ? 114  ARG E O   1 
ATOM   8185 C CB  . ARG D 2 114 ? 44.499  6.157   -6.357  1.00 16.86  ? 114  ARG E CB  1 
ATOM   8186 C CG  . ARG D 2 114 ? 45.413  6.282   -7.523  1.00 24.38  ? 114  ARG E CG  1 
ATOM   8187 C CD  . ARG D 2 114 ? 46.131  7.654   -7.566  1.00 30.08  ? 114  ARG E CD  1 
ATOM   8188 N NE  . ARG D 2 114 ? 46.840  7.536   -8.843  1.00 38.63  ? 114  ARG E NE  1 
ATOM   8189 C CZ  . ARG D 2 114 ? 46.404  7.900   -10.043 1.00 40.56  ? 114  ARG E CZ  1 
ATOM   8190 N NH1 . ARG D 2 114 ? 45.261  8.532   -10.252 1.00 38.58  ? 114  ARG E NH1 1 
ATOM   8191 N NH2 . ARG D 2 114 ? 47.249  7.600   -11.029 1.00 41.40  ? 114  ARG E NH2 1 
ATOM   8192 N N   . VAL D 2 115 ? 44.121  4.126   -4.047  1.00 13.44  ? 115  VAL E N   1 
ATOM   8193 C CA  . VAL D 2 115 ? 43.086  3.277   -3.503  1.00 13.24  ? 115  VAL E CA  1 
ATOM   8194 C C   . VAL D 2 115 ? 42.680  3.507   -2.069  1.00 14.22  ? 115  VAL E C   1 
ATOM   8195 O O   . VAL D 2 115 ? 41.521  3.926   -1.925  1.00 12.36  ? 115  VAL E O   1 
ATOM   8196 C CB  . VAL D 2 115 ? 43.380  1.807   -3.870  1.00 15.28  ? 115  VAL E CB  1 
ATOM   8197 C CG1 . VAL D 2 115 ? 42.253  0.854   -3.458  1.00 16.19  ? 115  VAL E CG1 1 
ATOM   8198 C CG2 . VAL D 2 115 ? 43.530  1.694   -5.401  1.00 12.10  ? 115  VAL E CG2 1 
ATOM   8199 N N   . LEU D 2 116 ? 43.499  3.278   -1.051  1.00 12.78  ? 116  LEU E N   1 
ATOM   8200 C CA  . LEU D 2 116 ? 43.146  3.422   0.334   1.00 13.28  ? 116  LEU E CA  1 
ATOM   8201 C C   . LEU D 2 116 ? 42.612  4.786   0.736   1.00 14.80  ? 116  LEU E C   1 
ATOM   8202 O O   . LEU D 2 116 ? 41.518  4.875   1.298   1.00 12.67  ? 116  LEU E O   1 
ATOM   8203 C CB  . LEU D 2 116 ? 44.234  2.929   1.310   1.00 11.80  ? 116  LEU E CB  1 
ATOM   8204 C CG  . LEU D 2 116 ? 43.745  2.757   2.769   1.00 13.74  ? 116  LEU E CG  1 
ATOM   8205 C CD1 . LEU D 2 116 ? 42.471  1.907   2.894   1.00 9.25   ? 116  LEU E CD1 1 
ATOM   8206 C CD2 . LEU D 2 116 ? 44.843  2.172   3.648   1.00 7.05   ? 116  LEU E CD2 1 
ATOM   8207 N N   . PRO D 2 117 ? 43.307  5.888   0.436   1.00 14.04  ? 117  PRO E N   1 
ATOM   8208 C CA  . PRO D 2 117 ? 42.776  7.195   0.772   1.00 14.11  ? 117  PRO E CA  1 
ATOM   8209 C C   . PRO D 2 117 ? 41.396  7.398   0.174   1.00 13.09  ? 117  PRO E C   1 
ATOM   8210 O O   . PRO D 2 117 ? 40.553  7.951   0.921   1.00 11.95  ? 117  PRO E O   1 
ATOM   8211 C CB  . PRO D 2 117 ? 43.826  8.202   0.336   1.00 13.64  ? 117  PRO E CB  1 
ATOM   8212 C CG  . PRO D 2 117 ? 45.084  7.361   0.369   1.00 13.61  ? 117  PRO E CG  1 
ATOM   8213 C CD  . PRO D 2 117 ? 44.631  6.004   -0.194  1.00 13.42  ? 117  PRO E CD  1 
ATOM   8214 N N   . VAL D 2 118 ? 41.121  6.991   -1.046  1.00 11.49  ? 118  VAL E N   1 
ATOM   8215 C CA  . VAL D 2 118 ? 39.782  7.203   -1.604  1.00 11.86  ? 118  VAL E CA  1 
ATOM   8216 C C   . VAL D 2 118 ? 38.754  6.296   -0.932  1.00 12.72  ? 118  VAL E C   1 
ATOM   8217 O O   . VAL D 2 118 ? 37.673  6.756   -0.530  1.00 10.48  ? 118  VAL E O   1 
ATOM   8218 C CB  . VAL D 2 118 ? 39.779  7.049   -3.134  1.00 14.02  ? 118  VAL E CB  1 
ATOM   8219 C CG1 . VAL D 2 118 ? 38.359  7.098   -3.703  1.00 10.91  ? 118  VAL E CG1 1 
ATOM   8220 C CG2 . VAL D 2 118 ? 40.630  8.169   -3.758  1.00 9.70   ? 118  VAL E CG2 1 
ATOM   8221 N N   . LEU D 2 119 ? 39.120  5.031   -0.696  1.00 13.84  ? 119  LEU E N   1 
ATOM   8222 C CA  . LEU D 2 119 ? 38.238  4.089   -0.039  1.00 15.42  ? 119  LEU E CA  1 
ATOM   8223 C C   . LEU D 2 119 ? 37.785  4.547   1.354   1.00 16.93  ? 119  LEU E C   1 
ATOM   8224 O O   . LEU D 2 119 ? 36.574  4.636   1.630   1.00 16.48  ? 119  LEU E O   1 
ATOM   8225 C CB  . LEU D 2 119 ? 38.878  2.715   0.039   1.00 15.47  ? 119  LEU E CB  1 
ATOM   8226 C CG  . LEU D 2 119 ? 38.087  1.639   0.838   1.00 14.95  ? 119  LEU E CG  1 
ATOM   8227 C CD1 . LEU D 2 119 ? 36.750  1.360   0.169   1.00 10.67  ? 119  LEU E CD1 1 
ATOM   8228 C CD2 . LEU D 2 119 ? 38.948  0.405   0.865   1.00 13.57  ? 119  LEU E CD2 1 
ATOM   8229 N N   . VAL D 2 120 ? 38.722  4.945   2.217   1.00 16.00  ? 120  VAL E N   1 
ATOM   8230 C CA  . VAL D 2 120 ? 38.384  5.367   3.560   1.00 14.75  ? 120  VAL E CA  1 
ATOM   8231 C C   . VAL D 2 120 ? 37.475  6.593   3.548   1.00 15.79  ? 120  VAL E C   1 
ATOM   8232 O O   . VAL D 2 120 ? 36.512  6.748   4.300   1.00 14.72  ? 120  VAL E O   1 
ATOM   8233 C CB  . VAL D 2 120 ? 39.673  5.744   4.341   1.00 13.53  ? 120  VAL E CB  1 
ATOM   8234 C CG1 . VAL D 2 120 ? 39.290  6.398   5.663   1.00 16.10  ? 120  VAL E CG1 1 
ATOM   8235 C CG2 . VAL D 2 120 ? 40.539  4.528   4.626   1.00 13.24  ? 120  VAL E CG2 1 
ATOM   8236 N N   . SER D 2 121 ? 37.916  7.559   2.764   1.00 14.67  ? 121  SER E N   1 
ATOM   8237 C CA  . SER D 2 121 ? 37.306  8.838   2.541   1.00 17.53  ? 121  SER E CA  1 
ATOM   8238 C C   . SER D 2 121 ? 35.860  8.717   2.037   1.00 16.30  ? 121  SER E C   1 
ATOM   8239 O O   . SER D 2 121 ? 34.919  9.304   2.541   1.00 17.59  ? 121  SER E O   1 
ATOM   8240 C CB  . SER D 2 121 ? 38.109  9.432   1.342   1.00 20.29  ? 121  SER E CB  1 
ATOM   8241 O OG  . SER D 2 121 ? 38.160  10.816  1.580   1.00 31.12  ? 121  SER E OG  1 
ATOM   8242 N N   . ALA D 2 122 ? 35.672  7.947   0.985   1.00 15.29  ? 122  ALA E N   1 
ATOM   8243 C CA  . ALA D 2 122 ? 34.384  7.688   0.363   1.00 14.80  ? 122  ALA E CA  1 
ATOM   8244 C C   . ALA D 2 122 ? 33.485  6.965   1.358   1.00 16.55  ? 122  ALA E C   1 
ATOM   8245 O O   . ALA D 2 122 ? 32.273  7.188   1.372   1.00 17.27  ? 122  ALA E O   1 
ATOM   8246 C CB  . ALA D 2 122 ? 34.558  6.821   -0.872  1.00 11.24  ? 122  ALA E CB  1 
ATOM   8247 N N   . ARG D 2 123 ? 34.078  6.063   2.142   1.00 16.63  ? 123  ARG E N   1 
ATOM   8248 C CA  . ARG D 2 123 ? 33.344  5.325   3.144   1.00 17.65  ? 123  ARG E CA  1 
ATOM   8249 C C   . ARG D 2 123 ? 32.941  6.263   4.292   1.00 17.91  ? 123  ARG E C   1 
ATOM   8250 O O   . ARG D 2 123 ? 31.757  6.139   4.657   1.00 16.58  ? 123  ARG E O   1 
ATOM   8251 C CB  . ARG D 2 123 ? 34.096  4.113   3.671   1.00 16.96  ? 123  ARG E CB  1 
ATOM   8252 C CG  . ARG D 2 123 ? 33.281  3.183   4.549   1.00 17.54  ? 123  ARG E CG  1 
ATOM   8253 C CD  . ARG D 2 123 ? 32.320  2.269   3.828   1.00 18.37  ? 123  ARG E CD  1 
ATOM   8254 N NE  . ARG D 2 123 ? 31.557  1.381   4.724   1.00 19.62  ? 123  ARG E NE  1 
ATOM   8255 C CZ  . ARG D 2 123 ? 30.461  0.713   4.357   1.00 20.18  ? 123  ARG E CZ  1 
ATOM   8256 N NH1 . ARG D 2 123 ? 29.925  0.845   3.148   1.00 16.34  ? 123  ARG E NH1 1 
ATOM   8257 N NH2 . ARG D 2 123 ? 29.879  -0.123  5.215   1.00 20.65  ? 123  ARG E NH2 1 
ATOM   8258 N N   . ARG D 2 124 ? 33.758  7.224   4.771   1.00 16.35  ? 124  ARG E N   1 
ATOM   8259 C CA  . ARG D 2 124 ? 33.140  8.048   5.803   1.00 17.13  ? 124  ARG E CA  1 
ATOM   8260 C C   . ARG D 2 124 ? 32.011  8.889   5.146   1.00 17.22  ? 124  ARG E C   1 
ATOM   8261 O O   . ARG D 2 124 ? 31.046  9.134   5.857   1.00 13.47  ? 124  ARG E O   1 
ATOM   8262 C CB  . ARG D 2 124 ? 33.803  8.898   6.806   1.00 16.64  ? 124  ARG E CB  1 
ATOM   8263 C CG  . ARG D 2 124 ? 34.958  9.780   6.792   1.00 22.74  ? 124  ARG E CG  1 
ATOM   8264 C CD  . ARG D 2 124 ? 34.677  11.128  7.466   1.00 20.44  ? 124  ARG E CD  1 
ATOM   8265 N NE  . ARG D 2 124 ? 34.376  12.061  6.368   1.00 19.39  ? 124  ARG E NE  1 
ATOM   8266 C CZ  . ARG D 2 124 ? 33.324  12.850  6.304   1.00 16.16  ? 124  ARG E CZ  1 
ATOM   8267 N NH1 . ARG D 2 124 ? 32.466  12.835  7.313   1.00 20.45  ? 124  ARG E NH1 1 
ATOM   8268 N NH2 . ARG D 2 124 ? 33.182  13.635  5.256   1.00 15.01  ? 124  ARG E NH2 1 
ATOM   8269 N N   . ILE D 2 125 ? 32.223  9.323   3.900   1.00 16.82  ? 125  ILE E N   1 
ATOM   8270 C CA  . ILE D 2 125 ? 31.174  10.108  3.267   1.00 16.14  ? 125  ILE E CA  1 
ATOM   8271 C C   . ILE D 2 125 ? 29.900  9.294   3.138   1.00 16.14  ? 125  ILE E C   1 
ATOM   8272 O O   . ILE D 2 125 ? 28.858  9.737   3.582   1.00 14.35  ? 125  ILE E O   1 
ATOM   8273 C CB  . ILE D 2 125 ? 31.641  10.662  1.912   1.00 12.64  ? 125  ILE E CB  1 
ATOM   8274 C CG1 . ILE D 2 125 ? 32.738  11.697  2.212   1.00 12.88  ? 125  ILE E CG1 1 
ATOM   8275 C CG2 . ILE D 2 125 ? 30.514  11.223  1.055   1.00 6.07   ? 125  ILE E CG2 1 
ATOM   8276 C CD1 . ILE D 2 125 ? 33.704  11.802  1.024   1.00 9.40   ? 125  ILE E CD1 1 
ATOM   8277 N N   . SER D 2 126 ? 29.965  8.066   2.612   1.00 18.63  ? 126  SER E N   1 
ATOM   8278 C CA  . SER D 2 126 ? 28.711  7.318   2.431   1.00 19.98  ? 126  SER E CA  1 
ATOM   8279 C C   . SER D 2 126 ? 28.034  6.984   3.761   1.00 20.27  ? 126  SER E C   1 
ATOM   8280 O O   . SER D 2 126 ? 26.813  6.876   3.778   1.00 18.43  ? 126  SER E O   1 
ATOM   8281 C CB  . SER D 2 126 ? 28.902  6.089   1.552   1.00 18.89  ? 126  SER E CB  1 
ATOM   8282 O OG  . SER D 2 126 ? 29.733  5.158   2.244   1.00 21.53  ? 126  SER E OG  1 
ATOM   8283 N N   . GLU D 2 127 ? 28.776  6.823   4.853   1.00 20.78  ? 127  GLU E N   1 
ATOM   8284 C CA  . GLU D 2 127 ? 28.210  6.537   6.145   1.00 21.02  ? 127  GLU E CA  1 
ATOM   8285 C C   . GLU D 2 127 ? 27.486  7.782   6.683   1.00 21.75  ? 127  GLU E C   1 
ATOM   8286 O O   . GLU D 2 127 ? 26.385  7.666   7.221   1.00 20.19  ? 127  GLU E O   1 
ATOM   8287 C CB  . GLU D 2 127 ? 29.254  6.036   7.146   1.00 21.75  ? 127  GLU E CB  1 
ATOM   8288 C CG  . GLU D 2 127 ? 29.798  4.638   6.866   1.00 20.23  ? 127  GLU E CG  1 
ATOM   8289 C CD  . GLU D 2 127 ? 28.823  3.524   7.210   1.00 22.49  ? 127  GLU E CD  1 
ATOM   8290 O OE1 . GLU D 2 127 ? 27.898  3.142   6.454   1.00 23.12  ? 127  GLU E OE1 1 
ATOM   8291 O OE2 . GLU D 2 127 ? 29.005  2.901   8.275   1.00 25.56  ? 127  GLU E OE2 1 
ATOM   8292 N N   . GLU D 2 128 ? 28.097  8.956   6.556   1.00 20.30  ? 128  GLU E N   1 
ATOM   8293 C CA  . GLU D 2 128 ? 27.477  10.156  7.040   1.00 21.68  ? 128  GLU E CA  1 
ATOM   8294 C C   . GLU D 2 128 ? 26.191  10.450  6.235   1.00 23.63  ? 128  GLU E C   1 
ATOM   8295 O O   . GLU D 2 128 ? 25.175  10.718  6.866   1.00 22.22  ? 128  GLU E O   1 
ATOM   8296 C CB  . GLU D 2 128 ? 28.429  11.331  7.028   1.00 23.58  ? 128  GLU E CB  1 
ATOM   8297 C CG  . GLU D 2 128 ? 27.779  12.646  7.359   1.00 26.14  ? 128  GLU E CG  1 
ATOM   8298 C CD  . GLU D 2 128 ? 28.608  13.870  7.601   1.00 30.06  ? 128  GLU E CD  1 
ATOM   8299 O OE1 . GLU D 2 128 ? 29.839  14.013  7.431   1.00 29.85  ? 128  GLU E OE1 1 
ATOM   8300 O OE2 . GLU D 2 128 ? 27.922  14.847  8.018   1.00 34.06  ? 128  GLU E OE2 1 
ATOM   8301 N N   . MET D 2 129 ? 26.245  10.341  4.911   1.00 22.59  ? 129  MET E N   1 
ATOM   8302 C CA  . MET D 2 129 ? 25.144  10.688  4.048   1.00 23.60  ? 129  MET E CA  1 
ATOM   8303 C C   . MET D 2 129 ? 23.924  9.813   4.328   1.00 22.39  ? 129  MET E C   1 
ATOM   8304 O O   . MET D 2 129 ? 22.820  10.324  4.363   1.00 20.69  ? 129  MET E O   1 
ATOM   8305 C CB  . MET D 2 129 ? 25.491  10.653  2.544   1.00 23.84  ? 129  MET E CB  1 
ATOM   8306 C CG  . MET D 2 129 ? 26.813  11.337  2.237   1.00 30.90  ? 129  MET E CG  1 
ATOM   8307 S SD  . MET D 2 129 ? 26.907  12.329  0.725   1.00 32.78  ? 129  MET E SD  1 
ATOM   8308 C CE  . MET D 2 129 ? 25.356  13.228  0.975   1.00 29.53  ? 129  MET E CE  1 
ATOM   8309 N N   . ALA D 2 130 ? 24.186  8.520   4.422   1.00 21.83  ? 130  ALA E N   1 
ATOM   8310 C CA  . ALA D 2 130 ? 23.181  7.523   4.684   1.00 21.48  ? 130  ALA E CA  1 
ATOM   8311 C C   . ALA D 2 130 ? 22.523  7.783   6.041   1.00 22.72  ? 130  ALA E C   1 
ATOM   8312 O O   . ALA D 2 130 ? 21.297  7.695   6.069   1.00 21.56  ? 130  ALA E O   1 
ATOM   8313 C CB  . ALA D 2 130 ? 23.751  6.128   4.574   1.00 17.29  ? 130  ALA E CB  1 
ATOM   8314 N N   . LYS D 2 131 ? 23.240  8.141   7.098   1.00 22.27  ? 131  LYS E N   1 
ATOM   8315 C CA  . LYS D 2 131 ? 22.603  8.455   8.353   1.00 23.39  ? 131  LYS E CA  1 
ATOM   8316 C C   . LYS D 2 131 ? 21.752  9.709   8.189   1.00 24.78  ? 131  LYS E C   1 
ATOM   8317 O O   . LYS D 2 131 ? 20.599  9.727   8.643   1.00 25.13  ? 131  LYS E O   1 
ATOM   8318 C CB  . LYS D 2 131 ? 23.574  8.595   9.508   1.00 23.40  ? 131  LYS E CB  1 
ATOM   8319 N N   . LEU D 2 132 ? 22.260  10.733  7.502   1.00 25.74  ? 132  LEU E N   1 
ATOM   8320 C CA  . LEU D 2 132 ? 21.485  11.947  7.280   1.00 27.20  ? 132  LEU E CA  1 
ATOM   8321 C C   . LEU D 2 132 ? 20.193  11.676  6.486   1.00 28.17  ? 132  LEU E C   1 
ATOM   8322 O O   . LEU D 2 132 ? 19.108  12.205  6.754   1.00 27.32  ? 132  LEU E O   1 
ATOM   8323 C CB  . LEU D 2 132 ? 22.287  13.009  6.537   1.00 23.52  ? 132  LEU E CB  1 
ATOM   8324 C CG  . LEU D 2 132 ? 23.371  13.755  7.285   1.00 22.76  ? 132  LEU E CG  1 
ATOM   8325 C CD1 . LEU D 2 132 ? 24.173  14.624  6.301   1.00 18.88  ? 132  LEU E CD1 1 
ATOM   8326 C CD2 . LEU D 2 132 ? 22.795  14.568  8.445   1.00 18.18  ? 132  LEU E CD2 1 
ATOM   8327 N N   . LYS D 2 133 ? 20.314  10.864  5.441   1.00 29.39  ? 133  LYS E N   1 
ATOM   8328 C CA  . LYS D 2 133 ? 19.164  10.513  4.620   1.00 31.69  ? 133  LYS E CA  1 
ATOM   8329 C C   . LYS D 2 133 ? 18.069  9.824   5.440   1.00 33.48  ? 133  LYS E C   1 
ATOM   8330 O O   . LYS D 2 133 ? 16.901  10.191  5.486   1.00 32.27  ? 133  LYS E O   1 
ATOM   8331 C CB  . LYS D 2 133 ? 19.627  9.644   3.464   1.00 31.83  ? 133  LYS E CB  1 
ATOM   8332 C CG  . LYS D 2 133 ? 18.621  9.744   2.325   1.00 37.65  ? 133  LYS E CG  1 
ATOM   8333 C CD  . LYS D 2 133 ? 19.125  9.046   1.068   1.00 39.05  ? 133  LYS E CD  1 
ATOM   8334 C CE  . LYS D 2 133 ? 17.912  8.515   0.301   1.00 41.53  ? 133  LYS E CE  1 
ATOM   8335 N NZ  . LYS D 2 133 ? 18.274  8.262   -1.127  1.00 42.67  ? 133  LYS E NZ  1 
ATOM   8336 N N   . GLN D 2 134 ? 18.449  8.785   6.173   1.00 35.40  ? 134  GLN E N   1 
ATOM   8337 C CA  . GLN D 2 134 ? 17.639  8.006   7.065   1.00 35.89  ? 134  GLN E CA  1 
ATOM   8338 C C   . GLN D 2 134 ? 16.849  8.910   8.023   1.00 34.96  ? 134  GLN E C   1 
ATOM   8339 O O   . GLN D 2 134 ? 15.651  8.728   8.166   1.00 34.20  ? 134  GLN E O   1 
ATOM   8340 C CB  . GLN D 2 134 ? 18.514  7.036   7.874   1.00 39.15  ? 134  GLN E CB  1 
ATOM   8341 C CG  . GLN D 2 134 ? 17.686  6.027   8.673   1.00 47.25  ? 134  GLN E CG  1 
ATOM   8342 C CD  . GLN D 2 134 ? 18.543  5.072   9.481   1.00 50.93  ? 134  GLN E CD  1 
ATOM   8343 O OE1 . GLN D 2 134 ? 19.416  5.509   10.244  1.00 54.58  ? 134  GLN E OE1 1 
ATOM   8344 N NE2 . GLN D 2 134 ? 18.324  3.772   9.303   1.00 52.19  ? 134  GLN E NE2 1 
ATOM   8345 N N   . LYS D 2 135 ? 17.508  9.865   8.666   1.00 33.19  ? 135  LYS E N   1 
ATOM   8346 C CA  . LYS D 2 135 ? 16.845  10.775  9.575   1.00 33.34  ? 135  LYS E CA  1 
ATOM   8347 C C   . LYS D 2 135 ? 15.740  11.555  8.848   1.00 33.96  ? 135  LYS E C   1 
ATOM   8348 O O   . LYS D 2 135 ? 14.648  11.732  9.377   1.00 33.54  ? 135  LYS E O   1 
ATOM   8349 C CB  . LYS D 2 135 ? 17.814  11.703  10.283  1.00 27.47  ? 135  LYS E CB  1 
ATOM   8350 N N   . THR D 2 136 ? 16.011  12.017  7.633   1.00 33.61  ? 136  THR E N   1 
ATOM   8351 C CA  . THR D 2 136 ? 15.058  12.708  6.790   1.00 34.04  ? 136  THR E CA  1 
ATOM   8352 C C   . THR D 2 136 ? 13.833  11.813  6.571   1.00 33.96  ? 136  THR E C   1 
ATOM   8353 O O   . THR D 2 136 ? 12.686  12.273  6.658   1.00 31.65  ? 136  THR E O   1 
ATOM   8354 C CB  . THR D 2 136 ? 15.769  13.029  5.458   1.00 34.85  ? 136  THR E CB  1 
ATOM   8355 O OG1 . THR D 2 136 ? 16.416  14.318  5.553   1.00 36.75  ? 136  THR E OG1 1 
ATOM   8356 C CG2 . THR D 2 136 ? 14.885  13.003  4.250   1.00 33.86  ? 136  THR E CG2 1 
ATOM   8357 N N   . GLU D 2 137 ? 14.127  10.547  6.268   1.00 32.49  ? 137  GLU E N   1 
ATOM   8358 C CA  . GLU D 2 137 ? 13.090  9.572   5.976   1.00 34.05  ? 137  GLU E CA  1 
ATOM   8359 C C   . GLU D 2 137 ? 12.257  9.262   7.217   1.00 34.79  ? 137  GLU E C   1 
ATOM   8360 O O   . GLU D 2 137 ? 11.025  9.264   7.176   1.00 33.06  ? 137  GLU E O   1 
ATOM   8361 C CB  . GLU D 2 137 ? 13.665  8.322   5.317   1.00 33.94  ? 137  GLU E CB  1 
ATOM   8362 C CG  . GLU D 2 137 ? 14.158  8.638   3.911   1.00 36.69  ? 137  GLU E CG  1 
ATOM   8363 C CD  . GLU D 2 137 ? 15.090  7.631   3.293   1.00 37.14  ? 137  GLU E CD  1 
ATOM   8364 O OE1 . GLU D 2 137 ? 15.658  6.761   3.962   1.00 39.70  ? 137  GLU E OE1 1 
ATOM   8365 O OE2 . GLU D 2 137 ? 15.286  7.687   2.062   1.00 42.24  ? 137  GLU E OE2 1 
ATOM   8366 N N   . GLN D 2 138 ? 12.928  9.098   8.349   1.00 34.59  ? 138  GLN E N   1 
ATOM   8367 C CA  . GLN D 2 138 ? 12.236  8.915   9.610   1.00 35.82  ? 138  GLN E CA  1 
ATOM   8368 C C   . GLN D 2 138 ? 11.303  10.106  9.879   1.00 35.06  ? 138  GLN E C   1 
ATOM   8369 O O   . GLN D 2 138 ? 10.185  9.854   10.345  1.00 34.29  ? 138  GLN E O   1 
ATOM   8370 C CB  . GLN D 2 138 ? 13.208  8.745   10.766  1.00 38.70  ? 138  GLN E CB  1 
ATOM   8371 C CG  . GLN D 2 138 ? 14.133  7.549   10.558  1.00 45.48  ? 138  GLN E CG  1 
ATOM   8372 C CD  . GLN D 2 138 ? 15.136  7.361   11.679  1.00 48.63  ? 138  GLN E CD  1 
ATOM   8373 O OE1 . GLN D 2 138 ? 15.901  8.256   12.055  1.00 52.63  ? 138  GLN E OE1 1 
ATOM   8374 N NE2 . GLN D 2 138 ? 15.109  6.142   12.207  1.00 50.67  ? 138  GLN E NE2 1 
ATOM   8375 N N   . LEU D 2 139 ? 11.736  11.342  9.618   1.00 32.62  ? 139  LEU E N   1 
ATOM   8376 C CA  . LEU D 2 139 ? 10.844  12.462  9.856   1.00 32.40  ? 139  LEU E CA  1 
ATOM   8377 C C   . LEU D 2 139 ? 9.651   12.466  8.901   1.00 32.10  ? 139  LEU E C   1 
ATOM   8378 O O   . LEU D 2 139 ? 8.527   12.720  9.356   1.00 31.95  ? 139  LEU E O   1 
ATOM   8379 C CB  . LEU D 2 139 ? 11.609  13.785  9.815   1.00 29.52  ? 139  LEU E CB  1 
ATOM   8380 C CG  . LEU D 2 139 ? 12.541  13.968  11.016  1.00 27.59  ? 139  LEU E CG  1 
ATOM   8381 C CD1 . LEU D 2 139 ? 13.737  14.840  10.727  1.00 21.86  ? 139  LEU E CD1 1 
ATOM   8382 C CD2 . LEU D 2 139 ? 11.744  14.576  12.167  1.00 28.08  ? 139  LEU E CD2 1 
ATOM   8383 N N   . GLN D 2 140 ? 9.857   12.147  7.633   1.00 32.42  ? 140  GLN E N   1 
ATOM   8384 C CA  . GLN D 2 140 ? 8.817   12.114  6.621   1.00 32.58  ? 140  GLN E CA  1 
ATOM   8385 C C   . GLN D 2 140 ? 7.743   11.091  6.996   1.00 32.37  ? 140  GLN E C   1 
ATOM   8386 O O   . GLN D 2 140 ? 6.550   11.372  7.007   1.00 29.62  ? 140  GLN E O   1 
ATOM   8387 C CB  . GLN D 2 140 ? 9.344   11.833  5.213   1.00 33.20  ? 140  GLN E CB  1 
ATOM   8388 C CG  . GLN D 2 140 ? 10.006  13.049  4.603   1.00 38.65  ? 140  GLN E CG  1 
ATOM   8389 C CD  . GLN D 2 140 ? 10.917  12.791  3.421   1.00 41.65  ? 140  GLN E CD  1 
ATOM   8390 O OE1 . GLN D 2 140 ? 11.415  11.686  3.206   1.00 42.61  ? 140  GLN E OE1 1 
ATOM   8391 N NE2 . GLN D 2 140 ? 11.165  13.832  2.617   1.00 43.14  ? 140  GLN E NE2 1 
ATOM   8392 N N   . ASP D 2 141 ? 8.231   9.917   7.358   1.00 32.71  ? 141  ASP E N   1 
ATOM   8393 C CA  . ASP D 2 141 ? 7.395   8.826   7.811   1.00 34.25  ? 141  ASP E CA  1 
ATOM   8394 C C   . ASP D 2 141 ? 6.542   9.273   9.004   1.00 35.26  ? 141  ASP E C   1 
ATOM   8395 O O   . ASP D 2 141 ? 5.336   9.036   8.975   1.00 35.20  ? 141  ASP E O   1 
ATOM   8396 C CB  . ASP D 2 141 ? 8.249   7.621   8.160   1.00 34.84  ? 141  ASP E CB  1 
ATOM   8397 C CG  . ASP D 2 141 ? 8.800   6.906   6.942   1.00 38.29  ? 141  ASP E CG  1 
ATOM   8398 O OD1 . ASP D 2 141 ? 8.498   7.209   5.775   1.00 38.56  ? 141  ASP E OD1 1 
ATOM   8399 O OD2 . ASP D 2 141 ? 9.606   5.972   7.171   1.00 42.48  ? 141  ASP E OD2 1 
ATOM   8400 N N   . ARG D 2 142 ? 7.113   9.905   10.015  1.00 35.00  ? 142  ARG E N   1 
ATOM   8401 C CA  . ARG D 2 142 ? 6.408   10.383  11.173  1.00 37.13  ? 142  ARG E CA  1 
ATOM   8402 C C   . ARG D 2 142 ? 5.358   11.441  10.809  1.00 36.86  ? 142  ARG E C   1 
ATOM   8403 O O   . ARG D 2 142 ? 4.261   11.429  11.374  1.00 37.15  ? 142  ARG E O   1 
ATOM   8404 C CB  . ARG D 2 142 ? 7.327   10.998  12.227  1.00 41.76  ? 142  ARG E CB  1 
ATOM   8405 C CG  . ARG D 2 142 ? 6.714   11.005  13.621  1.00 47.87  ? 142  ARG E CG  1 
ATOM   8406 C CD  . ARG D 2 142 ? 7.192   9.754   14.345  1.00 55.40  ? 142  ARG E CD  1 
ATOM   8407 N NE  . ARG D 2 142 ? 6.898   9.717   15.772  1.00 59.33  ? 142  ARG E NE  1 
ATOM   8408 C CZ  . ARG D 2 142 ? 7.293   10.621  16.664  1.00 58.70  ? 142  ARG E CZ  1 
ATOM   8409 N NH1 . ARG D 2 142 ? 8.006   11.639  16.227  1.00 58.05  ? 142  ARG E NH1 1 
ATOM   8410 N NH2 . ARG D 2 142 ? 6.973   10.497  17.939  1.00 59.01  ? 142  ARG E NH2 1 
ATOM   8411 N N   . ILE D 2 143 ? 5.708   12.360  9.910   1.00 35.61  ? 143  ILE E N   1 
ATOM   8412 C CA  . ILE D 2 143 ? 4.746   13.369  9.507   1.00 34.74  ? 143  ILE E CA  1 
ATOM   8413 C C   . ILE D 2 143 ? 3.515   12.722  8.866   1.00 35.57  ? 143  ILE E C   1 
ATOM   8414 O O   . ILE D 2 143 ? 2.393   13.085  9.234   1.00 35.32  ? 143  ILE E O   1 
ATOM   8415 C CB  . ILE D 2 143 ? 5.302   14.420  8.543   1.00 30.30  ? 143  ILE E CB  1 
ATOM   8416 C CG1 . ILE D 2 143 ? 6.228   15.344  9.324   1.00 29.10  ? 143  ILE E CG1 1 
ATOM   8417 C CG2 . ILE D 2 143 ? 4.187   15.258  7.937   1.00 29.33  ? 143  ILE E CG2 1 
ATOM   8418 C CD1 . ILE D 2 143 ? 7.358   15.968  8.556   1.00 27.91  ? 143  ILE E CD1 1 
ATOM   8419 N N   . ALA D 2 144 ? 3.737   11.833  7.909   1.00 34.78  ? 144  ALA E N   1 
ATOM   8420 C CA  . ALA D 2 144 ? 2.631   11.209  7.190   1.00 35.92  ? 144  ALA E CA  1 
ATOM   8421 C C   . ALA D 2 144 ? 1.777   10.370  8.143   1.00 36.78  ? 144  ALA E C   1 
ATOM   8422 O O   . ALA D 2 144 ? 0.542   10.456  8.119   1.00 35.57  ? 144  ALA E O   1 
ATOM   8423 C CB  . ALA D 2 144 ? 3.107   10.397  6.004   1.00 32.58  ? 144  ALA E CB  1 
ATOM   8424 N N   . GLY D 2 145 ? 2.449   9.604   8.999   1.00 36.72  ? 145  GLY E N   1 
ATOM   8425 C CA  . GLY D 2 145 ? 1.762   8.755   9.955   1.00 37.93  ? 145  GLY E CA  1 
ATOM   8426 C C   . GLY D 2 145 ? 0.909   9.537   10.938  1.00 39.25  ? 145  GLY E C   1 
ATOM   8427 O O   . GLY D 2 145 ? -0.194  9.065   11.231  1.00 40.63  ? 145  GLY E O   1 
ATOM   8428 N N   . GLN D 2 146 ? 1.340   10.701  11.434  1.00 38.86  ? 146  GLN E N   1 
ATOM   8429 C CA  . GLN D 2 146 ? 0.539   11.454  12.383  1.00 38.49  ? 146  GLN E CA  1 
ATOM   8430 C C   . GLN D 2 146 ? -0.663  12.042  11.641  1.00 38.52  ? 146  GLN E C   1 
ATOM   8431 O O   . GLN D 2 146 ? -1.767  12.098  12.185  1.00 36.38  ? 146  GLN E O   1 
ATOM   8432 C CB  . GLN D 2 146 ? 1.345   12.453  13.210  1.00 40.72  ? 146  GLN E CB  1 
ATOM   8433 C CG  . GLN D 2 146 ? 2.216   11.795  14.297  1.00 44.53  ? 146  GLN E CG  1 
ATOM   8434 C CD  . GLN D 2 146 ? 3.253   12.605  15.030  1.00 46.74  ? 146  GLN E CD  1 
ATOM   8435 O OE1 . GLN D 2 146 ? 4.169   12.122  15.728  1.00 47.99  ? 146  GLN E OE1 1 
ATOM   8436 N NE2 . GLN D 2 146 ? 3.201   13.937  14.969  1.00 47.12  ? 146  GLN E NE2 1 
ATOM   8437 N N   . ALA D 2 147 ? -0.463  12.423  10.379  1.00 36.59  ? 147  ALA E N   1 
ATOM   8438 C CA  . ALA D 2 147 ? -1.536  12.947  9.565   1.00 35.31  ? 147  ALA E CA  1 
ATOM   8439 C C   . ALA D 2 147 ? -2.636  11.891  9.411   1.00 34.84  ? 147  ALA E C   1 
ATOM   8440 O O   . ALA D 2 147 ? -3.803  12.213  9.633   1.00 34.28  ? 147  ALA E O   1 
ATOM   8441 C CB  . ALA D 2 147 ? -1.054  13.391  8.197   1.00 30.85  ? 147  ALA E CB  1 
ATOM   8442 N N   . ARG D 2 148 ? -2.268  10.663  9.083   1.00 33.79  ? 148  ARG E N   1 
ATOM   8443 C CA  . ARG D 2 148 ? -3.217  9.579   8.894   1.00 34.46  ? 148  ARG E CA  1 
ATOM   8444 C C   . ARG D 2 148 ? -3.958  9.216   10.177  1.00 33.70  ? 148  ARG E C   1 
ATOM   8445 O O   . ARG D 2 148 ? -5.092  8.744   10.131  1.00 33.75  ? 148  ARG E O   1 
ATOM   8446 C CB  . ARG D 2 148 ? -2.589  8.257   8.404   1.00 30.62  ? 148  ARG E CB  1 
ATOM   8447 N N   . ILE D 2 149 ? -3.244  9.259   11.290  1.00 33.33  ? 149  ILE E N   1 
ATOM   8448 C CA  . ILE D 2 149 ? -3.901  8.957   12.569  1.00 33.47  ? 149  ILE E CA  1 
ATOM   8449 C C   . ILE D 2 149 ? -4.844  10.120  12.864  1.00 33.51  ? 149  ILE E C   1 
ATOM   8450 O O   . ILE D 2 149 ? -6.014  9.916   13.184  1.00 33.10  ? 149  ILE E O   1 
ATOM   8451 C CB  . ILE D 2 149 ? -2.884  8.646   13.656  1.00 33.96  ? 149  ILE E CB  1 
ATOM   8452 C CG1 . ILE D 2 149 ? -2.127  7.376   13.194  1.00 32.93  ? 149  ILE E CG1 1 
ATOM   8453 C CG2 . ILE D 2 149 ? -3.527  8.490   15.028  1.00 30.62  ? 149  ILE E CG2 1 
ATOM   8454 C CD1 . ILE D 2 149 ? -0.888  7.116   14.016  1.00 34.02  ? 149  ILE E CD1 1 
ATOM   8455 N N   . ASN D 2 150 ? -4.406  11.343  12.631  1.00 33.07  ? 150  ASN E N   1 
ATOM   8456 C CA  . ASN D 2 150 ? -5.234  12.504  12.827  1.00 35.38  ? 150  ASN E CA  1 
ATOM   8457 C C   . ASN D 2 150 ? -6.510  12.408  11.975  1.00 36.81  ? 150  ASN E C   1 
ATOM   8458 O O   . ASN D 2 150 ? -7.593  12.626  12.536  1.00 36.67  ? 150  ASN E O   1 
ATOM   8459 C CB  . ASN D 2 150 ? -4.536  13.840  12.574  1.00 32.85  ? 150  ASN E CB  1 
ATOM   8460 C CG  . ASN D 2 150 ? -5.538  14.955  12.840  1.00 34.72  ? 150  ASN E CG  1 
ATOM   8461 O OD1 . ASN D 2 150 ? -5.681  15.369  13.999  1.00 35.30  ? 150  ASN E OD1 1 
ATOM   8462 N ND2 . ASN D 2 150 ? -6.227  15.367  11.781  1.00 37.20  ? 150  ASN E ND2 1 
ATOM   8463 N N   . GLN D 2 151 ? -6.406  12.057  10.695  1.00 37.49  ? 151  GLN E N   1 
ATOM   8464 C CA  . GLN D 2 151 ? -7.620  11.988  9.893   1.00 38.68  ? 151  GLN E CA  1 
ATOM   8465 C C   . GLN D 2 151 ? -8.458  10.775  10.270  1.00 38.98  ? 151  GLN E C   1 
ATOM   8466 O O   . GLN D 2 151 ? -9.687  10.875  10.141  1.00 38.52  ? 151  GLN E O   1 
ATOM   8467 C CB  . GLN D 2 151 ? -7.361  12.201  8.425   1.00 42.19  ? 151  GLN E CB  1 
ATOM   8468 C CG  . GLN D 2 151 ? -7.173  11.122  7.402   1.00 47.63  ? 151  GLN E CG  1 
ATOM   8469 C CD  . GLN D 2 151 ? -6.172  11.574  6.331   1.00 52.03  ? 151  GLN E CD  1 
ATOM   8470 O OE1 . GLN D 2 151 ? -6.461  12.455  5.510   1.00 54.86  ? 151  GLN E OE1 1 
ATOM   8471 N NE2 . GLN D 2 151 ? -4.970  11.000  6.336   1.00 51.48  ? 151  GLN E NE2 1 
ATOM   8472 N N   . ALA D 2 152 ? -7.916  9.683   10.803  1.00 38.47  ? 152  ALA E N   1 
ATOM   8473 C CA  . ALA D 2 152 ? -8.805  8.595   11.201  1.00 38.74  ? 152  ALA E CA  1 
ATOM   8474 C C   . ALA D 2 152 ? -9.583  8.995   12.460  1.00 39.42  ? 152  ALA E C   1 
ATOM   8475 O O   . ALA D 2 152 ? -10.759 8.624   12.558  1.00 38.87  ? 152  ALA E O   1 
ATOM   8476 C CB  . ALA D 2 152 ? -8.042  7.297   11.329  1.00 39.33  ? 152  ALA E CB  1 
ATOM   8477 N N   . LYS D 2 153 ? -8.995  9.752   13.386  1.00 39.06  ? 153  LYS E N   1 
ATOM   8478 C CA  . LYS D 2 153 ? -9.679  10.201  14.588  1.00 39.96  ? 153  LYS E CA  1 
ATOM   8479 C C   . LYS D 2 153 ? -10.868 11.112  14.237  1.00 38.79  ? 153  LYS E C   1 
ATOM   8480 O O   . LYS D 2 153 ? -12.022 10.921  14.598  1.00 38.31  ? 153  LYS E O   1 
ATOM   8481 C CB  . LYS D 2 153 ? -8.754  10.970  15.502  1.00 42.93  ? 153  LYS E CB  1 
ATOM   8482 C CG  . LYS D 2 153 ? -8.076  10.204  16.614  1.00 47.98  ? 153  LYS E CG  1 
ATOM   8483 C CD  . LYS D 2 153 ? -7.472  11.222  17.585  1.00 52.34  ? 153  LYS E CD  1 
ATOM   8484 C CE  . LYS D 2 153 ? -6.445  12.116  16.900  1.00 54.49  ? 153  LYS E CE  1 
ATOM   8485 N NZ  . LYS D 2 153 ? -6.529  13.473  17.516  1.00 54.12  ? 153  LYS E NZ  1 
ATOM   8486 N N   . VAL D 2 154 ? -10.581 12.124  13.430  1.00 36.39  ? 154  VAL E N   1 
ATOM   8487 C CA  . VAL D 2 154 ? -11.622 12.984  12.914  1.00 37.12  ? 154  VAL E CA  1 
ATOM   8488 C C   . VAL D 2 154 ? -12.706 12.157  12.203  1.00 36.10  ? 154  VAL E C   1 
ATOM   8489 O O   . VAL D 2 154 ? -13.886 12.512  12.337  1.00 35.25  ? 154  VAL E O   1 
ATOM   8490 C CB  . VAL D 2 154 ? -11.010 14.035  11.979  1.00 39.06  ? 154  VAL E CB  1 
ATOM   8491 C CG1 . VAL D 2 154 ? -12.085 14.869  11.301  1.00 39.56  ? 154  VAL E CG1 1 
ATOM   8492 C CG2 . VAL D 2 154 ? -10.049 14.922  12.770  1.00 38.95  ? 154  VAL E CG2 1 
ATOM   8493 N N   . LEU D 2 155 ? -12.376 11.068  11.511  1.00 33.41  ? 155  LEU E N   1 
ATOM   8494 C CA  . LEU D 2 155 ? -13.349 10.245  10.845  1.00 33.20  ? 155  LEU E CA  1 
ATOM   8495 C C   . LEU D 2 155 ? -14.262 9.551   11.868  1.00 33.01  ? 155  LEU E C   1 
ATOM   8496 O O   . LEU D 2 155 ? -15.466 9.444   11.664  1.00 32.56  ? 155  LEU E O   1 
ATOM   8497 C CB  . LEU D 2 155 ? -12.732 9.206   9.906   1.00 32.52  ? 155  LEU E CB  1 
ATOM   8498 C CG  . LEU D 2 155 ? -13.685 8.141   9.358   1.00 34.96  ? 155  LEU E CG  1 
ATOM   8499 C CD1 . LEU D 2 155 ? -14.761 8.766   8.476   1.00 33.72  ? 155  LEU E CD1 1 
ATOM   8500 C CD2 . LEU D 2 155 ? -12.972 7.026   8.606   1.00 35.04  ? 155  LEU E CD2 1 
ATOM   8501 N N   . LEU D 2 156 ? -13.680 9.105   12.978  1.00 31.78  ? 156  LEU E N   1 
ATOM   8502 C CA  . LEU D 2 156 ? -14.382 8.437   14.045  1.00 29.87  ? 156  LEU E CA  1 
ATOM   8503 C C   . LEU D 2 156 ? -15.279 9.415   14.811  1.00 30.01  ? 156  LEU E C   1 
ATOM   8504 O O   . LEU D 2 156 ? -16.385 9.040   15.231  1.00 30.96  ? 156  LEU E O   1 
ATOM   8505 C CB  . LEU D 2 156 ? -13.395 7.769   14.991  1.00 26.45  ? 156  LEU E CB  1 
ATOM   8506 C CG  . LEU D 2 156 ? -12.522 6.615   14.509  1.00 25.78  ? 156  LEU E CG  1 
ATOM   8507 C CD1 . LEU D 2 156 ? -11.587 6.162   15.644  1.00 25.89  ? 156  LEU E CD1 1 
ATOM   8508 C CD2 . LEU D 2 156 ? -13.328 5.396   14.093  1.00 27.16  ? 156  LEU E CD2 1 
ATOM   8509 N N   . MET D 2 157 ? -14.832 10.648  14.978  1.00 28.25  ? 157  MET E N   1 
ATOM   8510 C CA  . MET D 2 157 ? -15.584 11.670  15.690  1.00 27.88  ? 157  MET E CA  1 
ATOM   8511 C C   . MET D 2 157 ? -16.931 11.874  14.987  1.00 28.78  ? 157  MET E C   1 
ATOM   8512 O O   . MET D 2 157 ? -17.984 11.658  15.566  1.00 26.16  ? 157  MET E O   1 
ATOM   8513 C CB  . MET D 2 157 ? -14.766 12.940  15.876  1.00 25.07  ? 157  MET E CB  1 
ATOM   8514 C CG  . MET D 2 157 ? -13.521 12.719  16.767  1.00 28.64  ? 157  MET E CG  1 
ATOM   8515 S SD  . MET D 2 157 ? -12.412 14.145  16.820  1.00 25.99  ? 157  MET E SD  1 
ATOM   8516 C CE  . MET D 2 157 ? -13.516 15.400  17.431  1.00 21.92  ? 157  MET E CE  1 
ATOM   8517 N N   . GLN D 2 158 ? -16.892 12.209  13.714  1.00 29.62  ? 158  GLN E N   1 
ATOM   8518 C CA  . GLN D 2 158 ? -18.022 12.402  12.852  1.00 31.40  ? 158  GLN E CA  1 
ATOM   8519 C C   . GLN D 2 158 ? -18.944 11.192  12.809  1.00 30.00  ? 158  GLN E C   1 
ATOM   8520 O O   . GLN D 2 158 ? -20.139 11.261  13.077  1.00 29.46  ? 158  GLN E O   1 
ATOM   8521 C CB  . GLN D 2 158 ? -17.485 12.689  11.440  1.00 37.68  ? 158  GLN E CB  1 
ATOM   8522 C CG  . GLN D 2 158 ? -18.627 12.873  10.452  1.00 46.80  ? 158  GLN E CG  1 
ATOM   8523 C CD  . GLN D 2 158 ? -18.415 14.050  9.518   1.00 50.68  ? 158  GLN E CD  1 
ATOM   8524 O OE1 . GLN D 2 158 ? -19.407 14.683  9.173   1.00 52.35  ? 158  GLN E OE1 1 
ATOM   8525 N NE2 . GLN D 2 158 ? -17.167 14.332  9.130   1.00 53.52  ? 158  GLN E NE2 1 
ATOM   8526 N N   . ARG D 2 159 ? -18.376 10.024  12.537  1.00 28.36  ? 159  ARG E N   1 
ATOM   8527 C CA  . ARG D 2 159 ? -19.156 8.807   12.439  1.00 26.68  ? 159  ARG E CA  1 
ATOM   8528 C C   . ARG D 2 159 ? -19.984 8.476   13.683  1.00 26.59  ? 159  ARG E C   1 
ATOM   8529 O O   . ARG D 2 159 ? -21.161 8.098   13.657  1.00 23.36  ? 159  ARG E O   1 
ATOM   8530 C CB  . ARG D 2 159 ? -18.183 7.673   12.149  1.00 27.21  ? 159  ARG E CB  1 
ATOM   8531 C CG  . ARG D 2 159 ? -18.814 6.295   12.024  1.00 24.56  ? 159  ARG E CG  1 
ATOM   8532 C CD  . ARG D 2 159 ? -17.676 5.299   11.822  1.00 26.32  ? 159  ARG E CD  1 
ATOM   8533 N NE  . ARG D 2 159 ? -17.110 5.446   10.470  1.00 27.50  ? 159  ARG E NE  1 
ATOM   8534 C CZ  . ARG D 2 159 ? -16.198 4.584   9.994   1.00 25.33  ? 159  ARG E CZ  1 
ATOM   8535 N NH1 . ARG D 2 159 ? -15.750 3.565   10.706  1.00 25.00  ? 159  ARG E NH1 1 
ATOM   8536 N NH2 . ARG D 2 159 ? -15.761 4.760   8.770   1.00 27.07  ? 159  ARG E NH2 1 
ATOM   8537 N N   . HIS D 2 160 ? -19.290 8.508   14.823  1.00 26.08  ? 160  HIS E N   1 
ATOM   8538 C CA  . HIS D 2 160 ? -19.871 8.130   16.094  1.00 24.82  ? 160  HIS E CA  1 
ATOM   8539 C C   . HIS D 2 160 ? -20.395 9.248   16.963  1.00 24.07  ? 160  HIS E C   1 
ATOM   8540 O O   . HIS D 2 160 ? -21.030 8.933   17.959  1.00 23.47  ? 160  HIS E O   1 
ATOM   8541 C CB  . HIS D 2 160 ? -18.826 7.327   16.886  1.00 22.74  ? 160  HIS E CB  1 
ATOM   8542 C CG  . HIS D 2 160 ? -18.507 5.986   16.287  1.00 23.68  ? 160  HIS E CG  1 
ATOM   8543 N ND1 . HIS D 2 160 ? -19.151 4.828   16.657  1.00 23.86  ? 160  HIS E ND1 1 
ATOM   8544 C CD2 . HIS D 2 160 ? -17.600 5.603   15.353  1.00 22.97  ? 160  HIS E CD2 1 
ATOM   8545 C CE1 . HIS D 2 160 ? -18.682 3.794   15.987  1.00 20.23  ? 160  HIS E CE1 1 
ATOM   8546 N NE2 . HIS D 2 160 ? -17.735 4.249   15.199  1.00 21.20  ? 160  HIS E NE2 1 
ATOM   8547 N N   . GLY D 2 161 ? -20.172 10.527  16.671  1.00 25.09  ? 161  GLY E N   1 
ATOM   8548 C CA  . GLY D 2 161 ? -20.535 11.591  17.604  1.00 24.81  ? 161  GLY E CA  1 
ATOM   8549 C C   . GLY D 2 161 ? -19.561 11.605  18.791  1.00 26.15  ? 161  GLY E C   1 
ATOM   8550 O O   . GLY D 2 161 ? -19.841 12.190  19.847  1.00 26.91  ? 161  GLY E O   1 
ATOM   8551 N N   . TRP D 2 162 ? -18.376 11.022  18.692  1.00 25.63  ? 162  TRP E N   1 
ATOM   8552 C CA  . TRP D 2 162 ? -17.373 10.997  19.748  1.00 25.74  ? 162  TRP E CA  1 
ATOM   8553 C C   . TRP D 2 162 ? -16.485 12.213  19.842  1.00 25.58  ? 162  TRP E C   1 
ATOM   8554 O O   . TRP D 2 162 ? -16.112 12.706  18.782  1.00 25.98  ? 162  TRP E O   1 
ATOM   8555 C CB  . TRP D 2 162 ? -16.374 9.870   19.411  1.00 23.36  ? 162  TRP E CB  1 
ATOM   8556 C CG  . TRP D 2 162 ? -16.912 8.506   19.649  1.00 21.50  ? 162  TRP E CG  1 
ATOM   8557 C CD1 . TRP D 2 162 ? -18.025 8.150   20.368  1.00 21.04  ? 162  TRP E CD1 1 
ATOM   8558 C CD2 . TRP D 2 162 ? -16.310 7.287   19.181  1.00 23.74  ? 162  TRP E CD2 1 
ATOM   8559 N NE1 . TRP D 2 162 ? -18.145 6.782   20.355  1.00 24.84  ? 162  TRP E NE1 1 
ATOM   8560 C CE2 . TRP D 2 162 ? -17.113 6.227   19.638  1.00 22.54  ? 162  TRP E CE2 1 
ATOM   8561 C CE3 . TRP D 2 162 ? -15.170 7.003   18.407  1.00 22.20  ? 162  TRP E CE3 1 
ATOM   8562 C CZ2 . TRP D 2 162 ? -16.813 4.903   19.346  1.00 24.58  ? 162  TRP E CZ2 1 
ATOM   8563 C CZ3 . TRP D 2 162 ? -14.879 5.694   18.120  1.00 22.29  ? 162  TRP E CZ3 1 
ATOM   8564 C CH2 . TRP D 2 162 ? -15.697 4.649   18.599  1.00 22.92  ? 162  TRP E CH2 1 
ATOM   8565 N N   . ASP D 2 163 ? -16.047 12.649  21.010  1.00 28.25  ? 163  ASP E N   1 
ATOM   8566 C CA  . ASP D 2 163 ? -15.032 13.732  21.048  1.00 29.26  ? 163  ASP E CA  1 
ATOM   8567 C C   . ASP D 2 163 ? -13.651 13.130  20.744  1.00 28.22  ? 163  ASP E C   1 
ATOM   8568 O O   . ASP D 2 163 ? -13.526 11.914  20.543  1.00 25.29  ? 163  ASP E O   1 
ATOM   8569 C CB  . ASP D 2 163 ? -15.034 14.408  22.413  1.00 33.90  ? 163  ASP E CB  1 
ATOM   8570 C CG  . ASP D 2 163 ? -14.771 13.437  23.557  1.00 37.08  ? 163  ASP E CG  1 
ATOM   8571 O OD1 . ASP D 2 163 ? -14.146 12.369  23.417  1.00 35.66  ? 163  ASP E OD1 1 
ATOM   8572 O OD2 . ASP D 2 163 ? -15.216 13.722  24.687  1.00 38.51  ? 163  ASP E OD2 1 
ATOM   8573 N N   . GLU D 2 164 ? -12.595 13.928  20.745  1.00 29.56  ? 164  GLU E N   1 
ATOM   8574 C CA  . GLU D 2 164 ? -11.248 13.431  20.483  1.00 32.04  ? 164  GLU E CA  1 
ATOM   8575 C C   . GLU D 2 164 ? -10.756 12.350  21.436  1.00 31.70  ? 164  GLU E C   1 
ATOM   8576 O O   . GLU D 2 164 ? -9.996  11.476  20.987  1.00 30.87  ? 164  GLU E O   1 
ATOM   8577 C CB  . GLU D 2 164 ? -10.196 14.544  20.404  1.00 39.06  ? 164  GLU E CB  1 
ATOM   8578 C CG  . GLU D 2 164 ? -8.996  14.286  21.315  1.00 47.66  ? 164  GLU E CG  1 
ATOM   8579 C CD  . GLU D 2 164 ? -7.652  14.640  20.752  1.00 51.13  ? 164  GLU E CD  1 
ATOM   8580 O OE1 . GLU D 2 164 ? -7.087  13.865  19.956  1.00 53.93  ? 164  GLU E OE1 1 
ATOM   8581 O OE2 . GLU D 2 164 ? -7.186  15.726  21.145  1.00 54.83  ? 164  GLU E OE2 1 
ATOM   8582 N N   . ARG D 2 165 ? -11.087 12.428  22.719  1.00 31.82  ? 165  ARG E N   1 
ATOM   8583 C CA  . ARG D 2 165 ? -10.573 11.471  23.689  1.00 32.82  ? 165  ARG E CA  1 
ATOM   8584 C C   . ARG D 2 165 ? -11.122 10.089  23.416  1.00 32.04  ? 165  ARG E C   1 
ATOM   8585 O O   . ARG D 2 165 ? -10.395 9.092   23.424  1.00 30.55  ? 165  ARG E O   1 
ATOM   8586 C CB  . ARG D 2 165 ? -10.855 11.928  25.121  1.00 38.53  ? 165  ARG E CB  1 
ATOM   8587 C CG  . ARG D 2 165 ? -10.553 13.435  25.166  1.00 47.94  ? 165  ARG E CG  1 
ATOM   8588 C CD  . ARG D 2 165 ? -9.037  13.609  25.355  1.00 56.41  ? 165  ARG E CD  1 
ATOM   8589 N NE  . ARG D 2 165 ? -8.490  12.790  26.420  1.00 62.15  ? 165  ARG E NE  1 
ATOM   8590 C CZ  . ARG D 2 165 ? -7.693  13.052  27.459  1.00 63.15  ? 165  ARG E CZ  1 
ATOM   8591 N NH1 . ARG D 2 165 ? -7.311  14.302  27.617  1.00 64.51  ? 165  ARG E NH1 1 
ATOM   8592 N NH2 . ARG D 2 165 ? -7.515  12.154  28.417  1.00 63.86  ? 165  ARG E NH2 1 
ATOM   8593 N N   . GLU D 2 166 ? -12.418 10.071  23.110  1.00 31.36  ? 166  GLU E N   1 
ATOM   8594 C CA  . GLU D 2 166 ? -13.087 8.832   22.768  1.00 30.75  ? 166  GLU E CA  1 
ATOM   8595 C C   . GLU D 2 166 ? -12.446 8.285   21.505  1.00 29.69  ? 166  GLU E C   1 
ATOM   8596 O O   . GLU D 2 166 ? -12.075 7.124   21.481  1.00 28.61  ? 166  GLU E O   1 
ATOM   8597 C CB  . GLU D 2 166 ? -14.593 9.045   22.573  1.00 33.13  ? 166  GLU E CB  1 
ATOM   8598 C CG  . GLU D 2 166 ? -15.301 9.351   23.896  1.00 35.35  ? 166  GLU E CG  1 
ATOM   8599 C CD  . GLU D 2 166 ? -16.690 9.935   23.694  1.00 36.43  ? 166  GLU E CD  1 
ATOM   8600 O OE1 . GLU D 2 166 ? -16.872 11.040  23.129  1.00 37.73  ? 166  GLU E OE1 1 
ATOM   8601 O OE2 . GLU D 2 166 ? -17.648 9.262   24.116  1.00 38.14  ? 166  GLU E OE2 1 
ATOM   8602 N N   . ALA D 2 167 ? -12.344 9.143   20.489  1.00 30.61  ? 167  ALA E N   1 
ATOM   8603 C CA  . ALA D 2 167 ? -11.765 8.684   19.218  1.00 31.70  ? 167  ALA E CA  1 
ATOM   8604 C C   . ALA D 2 167 ? -10.364 8.102   19.471  1.00 32.09  ? 167  ALA E C   1 
ATOM   8605 O O   . ALA D 2 167 ? -10.117 6.943   19.095  1.00 31.53  ? 167  ALA E O   1 
ATOM   8606 C CB  . ALA D 2 167 ? -11.802 9.795   18.195  1.00 27.80  ? 167  ALA E CB  1 
ATOM   8607 N N   . HIS D 2 168 ? -9.500  8.857   20.131  1.00 31.88  ? 168  HIS E N   1 
ATOM   8608 C CA  . HIS D 2 168 ? -8.168  8.369   20.485  1.00 34.70  ? 168  HIS E CA  1 
ATOM   8609 C C   . HIS D 2 168 ? -8.252  7.093   21.310  1.00 34.44  ? 168  HIS E C   1 
ATOM   8610 O O   . HIS D 2 168 ? -7.557  6.146   20.952  1.00 34.36  ? 168  HIS E O   1 
ATOM   8611 C CB  . HIS D 2 168 ? -7.332  9.395   21.230  1.00 35.63  ? 168  HIS E CB  1 
ATOM   8612 C CG  . HIS D 2 168 ? -5.930  8.978   21.533  1.00 40.70  ? 168  HIS E CG  1 
ATOM   8613 N ND1 . HIS D 2 168 ? -5.008  8.642   20.565  1.00 42.96  ? 168  HIS E ND1 1 
ATOM   8614 C CD2 . HIS D 2 168 ? -5.271  8.876   22.716  1.00 41.04  ? 168  HIS E CD2 1 
ATOM   8615 C CE1 . HIS D 2 168 ? -3.847  8.342   21.124  1.00 43.71  ? 168  HIS E CE1 1 
ATOM   8616 N NE2 . HIS D 2 168 ? -3.988  8.474   22.433  1.00 42.80  ? 168  HIS E NE2 1 
ATOM   8617 N N   . GLN D 2 169 ? -9.076  7.026   22.344  1.00 35.76  ? 169  GLN E N   1 
ATOM   8618 C CA  . GLN D 2 169 ? -9.212  5.816   23.136  1.00 37.28  ? 169  GLN E CA  1 
ATOM   8619 C C   . GLN D 2 169 ? -9.541  4.606   22.240  1.00 38.37  ? 169  GLN E C   1 
ATOM   8620 O O   . GLN D 2 169 ? -9.008  3.530   22.525  1.00 37.39  ? 169  GLN E O   1 
ATOM   8621 C CB  . GLN D 2 169 ? -10.317 5.828   24.175  1.00 40.41  ? 169  GLN E CB  1 
ATOM   8622 C CG  . GLN D 2 169 ? -10.396 6.721   25.365  1.00 43.81  ? 169  GLN E CG  1 
ATOM   8623 C CD  . GLN D 2 169 ? -9.090  7.157   25.978  1.00 45.91  ? 169  GLN E CD  1 
ATOM   8624 O OE1 . GLN D 2 169 ? -8.081  6.434   25.950  1.00 48.39  ? 169  GLN E OE1 1 
ATOM   8625 N NE2 . GLN D 2 169 ? -9.126  8.363   26.540  1.00 46.02  ? 169  GLN E NE2 1 
ATOM   8626 N N   . HIS D 2 170 ? -10.508 4.766   21.324  1.00 37.49  ? 170  HIS E N   1 
ATOM   8627 C CA  . HIS D 2 170 ? -10.889 3.663   20.468  1.00 39.44  ? 170  HIS E CA  1 
ATOM   8628 C C   . HIS D 2 170 ? -9.747  3.116   19.602  1.00 39.77  ? 170  HIS E C   1 
ATOM   8629 O O   . HIS D 2 170 ? -9.543  1.905   19.514  1.00 37.21  ? 170  HIS E O   1 
ATOM   8630 C CB  . HIS D 2 170 ? -12.080 4.028   19.570  1.00 42.11  ? 170  HIS E CB  1 
ATOM   8631 C CG  . HIS D 2 170 ? -12.491 2.895   18.674  1.00 45.98  ? 170  HIS E CG  1 
ATOM   8632 N ND1 . HIS D 2 170 ? -13.217 1.811   19.131  1.00 46.63  ? 170  HIS E ND1 1 
ATOM   8633 C CD2 . HIS D 2 170 ? -12.260 2.673   17.352  1.00 47.16  ? 170  HIS E CD2 1 
ATOM   8634 C CE1 . HIS D 2 170 ? -13.414 0.972   18.129  1.00 46.93  ? 170  HIS E CE1 1 
ATOM   8635 N NE2 . HIS D 2 170 ? -12.849 1.467   17.039  1.00 46.63  ? 170  HIS E NE2 1 
ATOM   8636 N N   . LEU D 2 171 ? -9.023  4.006   18.947  1.00 41.23  ? 171  LEU E N   1 
ATOM   8637 C CA  . LEU D 2 171 ? -7.912  3.637   18.095  1.00 45.19  ? 171  LEU E CA  1 
ATOM   8638 C C   . LEU D 2 171 ? -6.856  2.845   18.872  1.00 47.50  ? 171  LEU E C   1 
ATOM   8639 O O   . LEU D 2 171 ? -6.431  1.786   18.414  1.00 46.70  ? 171  LEU E O   1 
ATOM   8640 C CB  . LEU D 2 171 ? -7.237  4.881   17.510  1.00 44.41  ? 171  LEU E CB  1 
ATOM   8641 C CG  . LEU D 2 171 ? -7.859  5.442   16.236  1.00 45.19  ? 171  LEU E CG  1 
ATOM   8642 C CD1 . LEU D 2 171 ? -7.203  6.770   15.880  1.00 44.93  ? 171  LEU E CD1 1 
ATOM   8643 C CD2 . LEU D 2 171 ? -7.747  4.438   15.100  1.00 44.92  ? 171  LEU E CD2 1 
ATOM   8644 N N   . SER D 2 172 ? -6.463  3.397   20.017  1.00 49.49  ? 172  SER E N   1 
ATOM   8645 C CA  . SER D 2 172 ? -5.476  2.728   20.850  1.00 54.17  ? 172  SER E CA  1 
ATOM   8646 C C   . SER D 2 172 ? -5.993  1.350   21.252  1.00 57.38  ? 172  SER E C   1 
ATOM   8647 O O   . SER D 2 172 ? -5.347  0.335   20.976  1.00 56.97  ? 172  SER E O   1 
ATOM   8648 C CB  . SER D 2 172 ? -5.131  3.557   22.079  1.00 52.42  ? 172  SER E CB  1 
ATOM   8649 O OG  . SER D 2 172 ? -4.809  4.885   21.703  1.00 52.76  ? 172  SER E OG  1 
ATOM   8650 N N   . ARG D 2 173 ? -7.178  1.307   21.866  1.00 60.38  ? 173  ARG E N   1 
ATOM   8651 C CA  . ARG D 2 173 ? -7.748  0.023   22.260  1.00 64.44  ? 173  ARG E CA  1 
ATOM   8652 C C   . ARG D 2 173 ? -7.774  -0.922  21.061  1.00 67.18  ? 173  ARG E C   1 
ATOM   8653 O O   . ARG D 2 173 ? -7.258  -2.039  21.145  1.00 67.05  ? 173  ARG E O   1 
ATOM   8654 C CB  . ARG D 2 173 ? -9.114  0.195   22.893  1.00 63.67  ? 173  ARG E CB  1 
ATOM   8655 N N   . GLU D 2 174 ? -8.290  -0.478  19.918  1.00 70.13  ? 174  GLU E N   1 
ATOM   8656 C CA  . GLU D 2 174 ? -8.311  -1.335  18.744  1.00 74.20  ? 174  GLU E CA  1 
ATOM   8657 C C   . GLU D 2 174 ? -6.903  -1.737  18.325  1.00 76.63  ? 174  GLU E C   1 
ATOM   8658 O O   . GLU D 2 174 ? -6.669  -2.923  18.071  1.00 76.57  ? 174  GLU E O   1 
ATOM   8659 C CB  . GLU D 2 174 ? -9.106  -0.708  17.610  1.00 75.61  ? 174  GLU E CB  1 
ATOM   8660 C CG  . GLU D 2 174 ? -9.541  -1.688  16.539  1.00 78.44  ? 174  GLU E CG  1 
ATOM   8661 C CD  . GLU D 2 174 ? -10.482 -2.785  16.995  1.00 80.02  ? 174  GLU E CD  1 
ATOM   8662 O OE1 . GLU D 2 174 ? -10.701 -3.010  18.208  1.00 79.30  ? 174  GLU E OE1 1 
ATOM   8663 O OE2 . GLU D 2 174 ? -11.022 -3.465  16.087  1.00 80.89  ? 174  GLU E OE2 1 
ATOM   8664 N N   . ALA D 2 175 ? -5.963  -0.805  18.270  1.00 79.03  ? 175  ALA E N   1 
ATOM   8665 C CA  . ALA D 2 175 ? -4.589  -1.129  17.910  1.00 82.21  ? 175  ALA E CA  1 
ATOM   8666 C C   . ALA D 2 175 ? -3.956  -2.068  18.933  1.00 84.44  ? 175  ALA E C   1 
ATOM   8667 O O   . ALA D 2 175 ? -3.481  -3.151  18.595  1.00 84.63  ? 175  ALA E O   1 
ATOM   8668 C CB  . ALA D 2 175 ? -3.752  0.132   17.805  1.00 81.70  ? 175  ALA E CB  1 
ATOM   8669 N N   . MET D 2 176 ? -3.941  -1.668  20.197  1.00 86.72  ? 176  MET E N   1 
ATOM   8670 C CA  . MET D 2 176 ? -3.363  -2.446  21.281  1.00 89.27  ? 176  MET E CA  1 
ATOM   8671 C C   . MET D 2 176 ? -3.803  -3.907  21.252  1.00 90.89  ? 176  MET E C   1 
ATOM   8672 O O   . MET D 2 176 ? -2.963  -4.811  21.293  1.00 91.36  ? 176  MET E O   1 
ATOM   8673 C CB  . MET D 2 176 ? -3.726  -1.836  22.636  1.00 89.37  ? 176  MET E CB  1 
ATOM   8674 C CG  . MET D 2 176 ? -3.219  -2.632  23.828  1.00 90.28  ? 176  MET E CG  1 
ATOM   8675 S SD  . MET D 2 176 ? -4.382  -2.602  25.201  1.00 90.73  ? 176  MET E SD  1 
ATOM   8676 C CE  . MET D 2 176 ? -5.469  -3.959  24.766  1.00 91.17  ? 176  MET E CE  1 
ATOM   8677 N N   . LYS D 2 177 ? -5.108  -4.148  21.215  1.00 92.05  ? 177  LYS E N   1 
ATOM   8678 C CA  . LYS D 2 177 ? -5.643  -5.499  21.173  1.00 93.25  ? 177  LYS E CA  1 
ATOM   8679 C C   . LYS D 2 177 ? -5.965  -5.910  19.741  1.00 93.90  ? 177  LYS E C   1 
ATOM   8680 O O   . LYS D 2 177 ? -7.115  -5.909  19.310  1.00 93.92  ? 177  LYS E O   1 
ATOM   8681 C CB  . LYS D 2 177 ? -6.890  -5.597  22.040  1.00 94.14  ? 177  LYS E CB  1 
ATOM   8682 N N   . ARG D 2 178 ? -4.929  -6.250  18.998  1.00 94.43  ? 178  ARG E N   1 
ATOM   8683 C CA  . ARG D 2 178 ? -4.987  -6.685  17.613  1.00 94.80  ? 178  ARG E CA  1 
ATOM   8684 C C   . ARG D 2 178 ? -3.548  -6.970  17.164  1.00 94.95  ? 178  ARG E C   1 
ATOM   8685 O O   . ARG D 2 178 ? -3.273  -7.635  16.174  1.00 94.96  ? 178  ARG E O   1 
ATOM   8686 C CB  . ARG D 2 178 ? -5.641  -5.681  16.685  1.00 94.17  ? 178  ARG E CB  1 
ATOM   8687 N N   . ARG D 2 179 ? -2.614  -6.435  17.950  1.00 94.80  ? 179  ARG E N   1 
ATOM   8688 C CA  . ARG D 2 179 ? -1.190  -6.606  17.699  1.00 94.37  ? 179  ARG E CA  1 
ATOM   8689 C C   . ARG D 2 179 ? -0.789  -6.005  16.360  1.00 93.69  ? 179  ARG E C   1 
ATOM   8690 O O   . ARG D 2 179 ? -0.048  -6.570  15.563  1.00 93.89  ? 179  ARG E O   1 
ATOM   8691 C CB  . ARG D 2 179 ? -0.822  -8.080  17.782  1.00 95.18  ? 179  ARG E CB  1 
ATOM   8692 N N   . GLU D 2 180 ? -1.293  -4.806  16.112  1.00 92.77  ? 180  GLU E N   1 
ATOM   8693 C CA  . GLU D 2 180 ? -1.019  -4.042  14.903  1.00 91.01  ? 180  GLU E CA  1 
ATOM   8694 C C   . GLU D 2 180 ? -0.871  -2.584  15.321  1.00 89.27  ? 180  GLU E C   1 
ATOM   8695 O O   . GLU D 2 180 ? -1.670  -2.109  16.119  1.00 89.25  ? 180  GLU E O   1 
ATOM   8696 C CB  . GLU D 2 180 ? -2.149  -4.226  13.906  1.00 91.73  ? 180  GLU E CB  1 
ATOM   8697 N N   . PRO D 2 181 ? 0.152   -1.910  14.823  1.00 87.90  ? 181  PRO E N   1 
ATOM   8698 C CA  . PRO D 2 181 ? 0.378   -0.513  15.153  1.00 86.19  ? 181  PRO E CA  1 
ATOM   8699 C C   . PRO D 2 181 ? -0.919  0.273   15.064  1.00 83.99  ? 181  PRO E C   1 
ATOM   8700 O O   . PRO D 2 181 ? -1.825  -0.027  14.287  1.00 83.27  ? 181  PRO E O   1 
ATOM   8701 C CB  . PRO D 2 181 ? 1.434   -0.047  14.168  1.00 86.67  ? 181  PRO E CB  1 
ATOM   8702 C CG  . PRO D 2 181 ? 1.761   -1.186  13.280  1.00 87.15  ? 181  PRO E CG  1 
ATOM   8703 C CD  . PRO D 2 181 ? 1.156   -2.429  13.867  1.00 87.58  ? 181  PRO E CD  1 
ATOM   8704 N N   . ILE D 2 182 ? -0.998  1.378   15.794  1.00 81.77  ? 182  ILE E N   1 
ATOM   8705 C CA  . ILE D 2 182 ? -2.180  2.244   15.818  1.00 78.98  ? 182  ILE E CA  1 
ATOM   8706 C C   . ILE D 2 182 ? -2.394  2.912   14.472  1.00 76.87  ? 182  ILE E C   1 
ATOM   8707 O O   . ILE D 2 182 ? -3.511  3.211   14.054  1.00 75.90  ? 182  ILE E O   1 
ATOM   8708 C CB  . ILE D 2 182 ? -2.105  3.203   17.014  1.00 78.50  ? 182  ILE E CB  1 
ATOM   8709 C CG1 . ILE D 2 182 ? -3.343  4.088   17.128  1.00 78.14  ? 182  ILE E CG1 1 
ATOM   8710 C CG2 . ILE D 2 182 ? -0.834  4.033   16.941  1.00 79.49  ? 182  ILE E CG2 1 
ATOM   8711 C CD1 . ILE D 2 182 ? -3.390  4.930   18.381  1.00 76.64  ? 182  ILE E CD1 1 
ATOM   8712 N N   . LEU D 2 183 ? -1.324  3.039   13.690  1.00 74.93  ? 183  LEU E N   1 
ATOM   8713 C CA  . LEU D 2 183 ? -1.336  3.551   12.335  1.00 72.20  ? 183  LEU E CA  1 
ATOM   8714 C C   . LEU D 2 183 ? -1.927  2.531   11.373  1.00 70.66  ? 183  LEU E C   1 
ATOM   8715 O O   . LEU D 2 183 ? -2.511  2.887   10.351  1.00 70.36  ? 183  LEU E O   1 
ATOM   8716 C CB  . LEU D 2 183 ? 0.067   3.969   11.906  1.00 70.26  ? 183  LEU E CB  1 
ATOM   8717 C CG  . LEU D 2 183 ? 0.320   4.304   10.440  1.00 69.18  ? 183  LEU E CG  1 
ATOM   8718 C CD1 . LEU D 2 183 ? -0.578  5.430   9.945   1.00 68.18  ? 183  LEU E CD1 1 
ATOM   8719 C CD2 . LEU D 2 183 ? 1.778   4.673   10.215  1.00 69.13  ? 183  LEU E CD2 1 
ATOM   8720 N N   . LYS D 2 184 ? -1.839  1.250   11.686  1.00 69.74  ? 184  LYS E N   1 
ATOM   8721 C CA  . LYS D 2 184 ? -2.440  0.204   10.863  1.00 68.33  ? 184  LYS E CA  1 
ATOM   8722 C C   . LYS D 2 184 ? -3.961  0.290   10.918  1.00 66.80  ? 184  LYS E C   1 
ATOM   8723 O O   . LYS D 2 184 ? -4.628  0.206   9.893   1.00 66.31  ? 184  LYS E O   1 
ATOM   8724 C CB  . LYS D 2 184 ? -1.933  -1.165  11.294  1.00 68.54  ? 184  LYS E CB  1 
ATOM   8725 N N   . ILE D 2 185 ? -4.524  0.504   12.101  1.00 66.32  ? 185  ILE E N   1 
ATOM   8726 C CA  . ILE D 2 185 ? -5.958  0.648   12.330  1.00 65.12  ? 185  ILE E CA  1 
ATOM   8727 C C   . ILE D 2 185 ? -6.512  1.848   11.566  1.00 64.17  ? 185  ILE E C   1 
ATOM   8728 O O   . ILE D 2 185 ? -7.495  1.753   10.838  1.00 63.80  ? 185  ILE E O   1 
ATOM   8729 C CB  . ILE D 2 185 ? -6.279  0.847   13.804  1.00 64.49  ? 185  ILE E CB  1 
ATOM   8730 N N   . ALA D 2 186 ? -5.792  2.962   11.670  1.00 63.08  ? 186  ALA E N   1 
ATOM   8731 C CA  . ALA D 2 186 ? -6.153  4.172   10.954  1.00 62.79  ? 186  ALA E CA  1 
ATOM   8732 C C   . ALA D 2 186 ? -6.219  3.923   9.454   1.00 62.87  ? 186  ALA E C   1 
ATOM   8733 O O   . ALA D 2 186 ? -7.153  4.383   8.808   1.00 61.55  ? 186  ALA E O   1 
ATOM   8734 C CB  . ALA D 2 186 ? -5.184  5.299   11.275  1.00 61.53  ? 186  ALA E CB  1 
ATOM   8735 N N   . GLN D 2 187 ? -5.239  3.216   8.900   1.00 63.75  ? 187  GLN E N   1 
ATOM   8736 C CA  . GLN D 2 187 ? -5.170  2.924   7.475   1.00 64.90  ? 187  GLN E CA  1 
ATOM   8737 C C   . GLN D 2 187 ? -6.250  1.942   7.042   1.00 64.69  ? 187  GLN E C   1 
ATOM   8738 O O   . GLN D 2 187 ? -6.856  2.060   5.984   1.00 64.08  ? 187  GLN E O   1 
ATOM   8739 C CB  . GLN D 2 187 ? -3.792  2.385   7.084   1.00 67.87  ? 187  GLN E CB  1 
ATOM   8740 C CG  . GLN D 2 187 ? -2.685  3.429   7.138   1.00 71.46  ? 187  GLN E CG  1 
ATOM   8741 C CD  . GLN D 2 187 ? -1.315  2.835   6.870   1.00 73.59  ? 187  GLN E CD  1 
ATOM   8742 O OE1 . GLN D 2 187 ? -1.207  1.762   6.270   1.00 75.05  ? 187  GLN E OE1 1 
ATOM   8743 N NE2 . GLN D 2 187 ? -0.273  3.525   7.321   1.00 73.79  ? 187  GLN E NE2 1 
ATOM   8744 N N   . GLU D 2 188 ? -6.538  0.984   7.908   1.00 65.17  ? 188  GLU E N   1 
ATOM   8745 C CA  . GLU D 2 188 ? -7.588  0.004   7.675   1.00 65.90  ? 188  GLU E CA  1 
ATOM   8746 C C   . GLU D 2 188 ? -8.965  0.641   7.815   1.00 65.81  ? 188  GLU E C   1 
ATOM   8747 O O   . GLU D 2 188 ? -9.933  0.215   7.193   1.00 65.95  ? 188  GLU E O   1 
ATOM   8748 C CB  . GLU D 2 188 ? -7.411  -1.113  8.697   1.00 67.62  ? 188  GLU E CB  1 
ATOM   8749 C CG  . GLU D 2 188 ? -7.328  -2.497  8.076   1.00 70.32  ? 188  GLU E CG  1 
ATOM   8750 C CD  . GLU D 2 188 ? -6.885  -3.509  9.119   1.00 72.12  ? 188  GLU E CD  1 
ATOM   8751 O OE1 . GLU D 2 188 ? -7.271  -3.332  10.298  1.00 72.73  ? 188  GLU E OE1 1 
ATOM   8752 O OE2 . GLU D 2 188 ? -6.161  -4.461  8.763   1.00 73.22  ? 188  GLU E OE2 1 
ATOM   8753 N N   . LEU D 2 189 ? -9.072  1.652   8.671   1.00 65.65  ? 189  LEU E N   1 
ATOM   8754 C CA  . LEU D 2 189 ? -10.296 2.395   8.888   1.00 65.34  ? 189  LEU E CA  1 
ATOM   8755 C C   . LEU D 2 189 ? -10.477 3.355   7.711   1.00 65.59  ? 189  LEU E C   1 
ATOM   8756 O O   . LEU D 2 189 ? -11.514 3.540   7.109   1.00 65.39  ? 189  LEU E O   1 
ATOM   8757 C CB  . LEU D 2 189 ? -10.160 3.340   10.085  1.00 63.44  ? 189  LEU E CB  1 
ATOM   8758 C CG  . LEU D 2 189 ? -10.850 2.929   11.375  1.00 64.02  ? 189  LEU E CG  1 
ATOM   8759 C CD1 . LEU D 2 189 ? -10.358 3.774   12.537  1.00 62.69  ? 189  LEU E CD1 1 
ATOM   8760 C CD2 . LEU D 2 189 ? -12.363 3.059   11.211  1.00 63.00  ? 189  LEU E CD2 1 
ATOM   8761 N N   . LEU D 2 190 ? -9.330  4.039   7.549   1.00 66.23  ? 190  LEU E N   1 
ATOM   8762 C CA  . LEU D 2 190 ? -9.292  5.052   6.518   1.00 66.37  ? 190  LEU E CA  1 
ATOM   8763 C C   . LEU D 2 190 ? -9.422  4.334   5.178   1.00 67.32  ? 190  LEU E C   1 
ATOM   8764 O O   . LEU D 2 190 ? -9.570  3.140   4.989   1.00 67.52  ? 190  LEU E O   1 
ATOM   8765 C CB  . LEU D 2 190 ? -8.076  5.957   6.497   1.00 64.39  ? 190  LEU E CB  1 
ATOM   8766 C CG  . LEU D 2 190 ? -8.212  7.234   7.327   1.00 62.93  ? 190  LEU E CG  1 
ATOM   8767 C CD1 . LEU D 2 190 ? -6.849  7.880   7.508   1.00 60.96  ? 190  LEU E CD1 1 
ATOM   8768 C CD2 . LEU D 2 190 ? -9.204  8.187   6.689   1.00 60.73  ? 190  LEU E CD2 1 
ATOM   8769 N N   . GLY D 2 191 ? -9.296  5.224   4.215   1.00 68.47  ? 191  GLY E N   1 
ATOM   8770 C CA  . GLY D 2 191 ? -9.428  4.822   2.820   1.00 70.36  ? 191  GLY E CA  1 
ATOM   8771 C C   . GLY D 2 191 ? -10.417 5.861   2.297   1.00 71.83  ? 191  GLY E C   1 
ATOM   8772 O O   . GLY D 2 191 ? -11.220 5.551   1.406   1.00 72.52  ? 191  GLY E O   1 
ATOM   8773 N N   . ASN D 2 192 ? -10.164 7.131   2.651   1.00 72.30  ? 192  ASN E N   1 
ATOM   8774 C CA  . ASN D 2 192 ? -10.965 8.203   2.049   1.00 73.28  ? 192  ASN E CA  1 
ATOM   8775 C C   . ASN D 2 192 ? -10.653 8.279   0.541   1.00 73.21  ? 192  ASN E C   1 
ATOM   8776 O O   . ASN D 2 192 ? -11.185 9.128   -0.183  1.00 73.85  ? 192  ASN E O   1 
ATOM   8777 C CB  . ASN D 2 192 ? -10.613 9.528   2.603   1.00 76.01  ? 192  ASN E CB  1 
ATOM   8778 C CG  . ASN D 2 192 ? -10.896 10.548  3.597   1.00 78.85  ? 192  ASN E CG  1 
ATOM   8779 O OD1 . ASN D 2 192 ? -12.060 10.815  3.929   1.00 81.14  ? 192  ASN E OD1 1 
ATOM   8780 N ND2 . ASN D 2 192 ? -9.890  11.244  4.138   1.00 80.60  ? 192  ASN E ND2 1 
ATOM   8781 N N   . GLU D 2 193 ? -9.611  7.564   0.102   1.00 72.39  ? 193  GLU E N   1 
ATOM   8782 C CA  . GLU D 2 193 ? -9.008  7.645   -1.215  1.00 72.00  ? 193  GLU E CA  1 
ATOM   8783 C C   . GLU D 2 193 ? -8.519  9.096   -1.084  1.00 71.63  ? 193  GLU E C   1 
ATOM   8784 O O   . GLU D 2 193 ? -9.062  9.982   -1.741  1.00 71.84  ? 193  GLU E O   1 
ATOM   8785 C CB  . GLU D 2 193 ? -10.025 7.492   -2.331  1.00 73.51  ? 193  GLU E CB  1 
ATOM   8786 N N   . PRO D 2 194 ? -7.812  9.367   0.016   1.00 71.17  ? 194  PRO E N   1 
ATOM   8787 C CA  . PRO D 2 194 ? -7.655  10.722  0.485   1.00 71.03  ? 194  PRO E CA  1 
ATOM   8788 C C   . PRO D 2 194 ? -6.299  11.375  0.407   1.00 71.12  ? 194  PRO E C   1 
ATOM   8789 O O   . PRO D 2 194 ? -5.589  11.271  -0.581  1.00 71.89  ? 194  PRO E O   1 
ATOM   8790 C CB  . PRO D 2 194 ? -7.849  10.502  2.005   1.00 71.02  ? 194  PRO E CB  1 
ATOM   8791 C CG  . PRO D 2 194 ? -7.111  9.236   2.249   1.00 70.88  ? 194  PRO E CG  1 
ATOM   8792 C CD  . PRO D 2 194 ? -7.246  8.405   1.000   1.00 70.93  ? 194  PRO E CD  1 
ATOM   8793 N N   . SER D 2 195 ? -5.952  12.036  1.523   1.00 70.75  ? 195  SER E N   1 
ATOM   8794 C CA  . SER D 2 195 ? -4.659  12.683  1.643   1.00 70.37  ? 195  SER E CA  1 
ATOM   8795 C C   . SER D 2 195 ? -3.571  11.631  1.458   1.00 70.45  ? 195  SER E C   1 
ATOM   8796 O O   . SER D 2 195 ? -2.840  11.321  2.419   1.00 70.54  ? 195  SER E O   1 
ATOM   8797 C CB  . SER D 2 195 ? -4.496  13.403  2.979   1.00 70.29  ? 195  SER E CB  1 
ATOM   8798 O OG  . SER D 2 195 ? -5.079  14.695  2.917   1.00 71.13  ? 195  SER E OG  1 
HETATM 8799 C C3  . BMD E 3 .   ? 63.798  3.878   11.627  1.00 16.06  ? 400  BMD A C3  1 
HETATM 8800 C C2  . BMD E 3 .   ? 63.445  4.693   10.357  1.00 13.25  ? 400  BMD A C2  1 
HETATM 8801 C C1  . BMD E 3 .   ? 62.221  4.263   9.667   1.00 9.95   ? 400  BMD A C1  1 
HETATM 8802 C CA  . BMD E 3 .   ? 61.730  5.178   8.533   1.00 10.38  ? 400  BMD A CA  1 
HETATM 8803 O OA  . BMD E 3 .   ? 61.638  6.403   8.701   1.00 6.91   ? 400  BMD A OA  1 
HETATM 8804 N NA  . BMD E 3 .   ? 60.933  4.484   7.698   1.00 8.01   ? 400  BMD A NA  1 
HETATM 8805 C C3  . BMD F 3 .   ? 37.217  14.651  -35.241 1.00 20.42  ? 500  BMD B C3  1 
HETATM 8806 C C2  . BMD F 3 .   ? 37.579  13.673  -34.090 1.00 22.49  ? 500  BMD B C2  1 
HETATM 8807 C C1  . BMD F 3 .   ? 38.312  14.299  -32.941 1.00 20.35  ? 500  BMD B C1  1 
HETATM 8808 C CA  . BMD F 3 .   ? 38.513  13.543  -31.616 1.00 19.14  ? 500  BMD B CA  1 
HETATM 8809 O OA  . BMD F 3 .   ? 38.193  12.360  -31.412 1.00 18.26  ? 500  BMD B OA  1 
HETATM 8810 N NA  . BMD F 3 .   ? 39.263  14.178  -30.710 1.00 16.66  ? 500  BMD B NA  1 
HETATM 8811 O O   . HOH G 4 .   ? 71.015  0.404   -13.768 1.00 26.71  ? 2001 HOH A O   1 
HETATM 8812 O O   . HOH G 4 .   ? 75.047  6.563   -1.634  1.00 31.47  ? 2002 HOH A O   1 
HETATM 8813 O O   . HOH G 4 .   ? 76.431  8.248   -0.231  1.00 24.56  ? 2003 HOH A O   1 
HETATM 8814 O O   . HOH G 4 .   ? 71.173  11.965  6.565   1.00 14.17  ? 2004 HOH A O   1 
HETATM 8815 O O   . HOH G 4 .   ? 80.747  9.504   -12.055 1.00 57.09  ? 2005 HOH A O   1 
HETATM 8816 O O   . HOH G 4 .   ? 76.575  15.763  8.571   1.00 18.19  ? 2006 HOH A O   1 
HETATM 8817 O O   . HOH G 4 .   ? 75.134  13.394  11.340  1.00 29.54  ? 2007 HOH A O   1 
HETATM 8818 O O   . HOH G 4 .   ? 80.649  9.134   -2.349  1.00 47.77  ? 2008 HOH A O   1 
HETATM 8819 O O   . HOH G 4 .   ? 73.402  9.553   12.057  1.00 22.83  ? 2009 HOH A O   1 
HETATM 8820 O O   . HOH G 4 .   ? 77.959  3.588   10.744  1.00 22.23  ? 2010 HOH A O   1 
HETATM 8821 O O   . HOH G 4 .   ? 78.800  5.327   12.600  1.00 23.48  ? 2011 HOH A O   1 
HETATM 8822 O O   . HOH G 4 .   ? 73.314  8.704   15.061  1.00 29.68  ? 2012 HOH A O   1 
HETATM 8823 O O   . HOH G 4 .   ? 80.902  7.806   12.504  1.00 53.69  ? 2013 HOH A O   1 
HETATM 8824 O O   . HOH G 4 .   ? 81.061  -13.886 3.692   1.00 28.22  ? 2014 HOH A O   1 
HETATM 8825 O O   . HOH G 4 .   ? 83.560  -11.432 -1.131  1.00 38.78  ? 2015 HOH A O   1 
HETATM 8826 O O   . HOH G 4 .   ? 84.149  -11.139 1.913   1.00 53.31  ? 2016 HOH A O   1 
HETATM 8827 O O   . HOH G 4 .   ? 72.094  7.193   11.882  1.00 17.81  ? 2017 HOH A O   1 
HETATM 8828 O O   . HOH G 4 .   ? 87.487  -12.892 3.300   1.00 41.98  ? 2018 HOH A O   1 
HETATM 8829 O O   . HOH G 4 .   ? 78.856  10.825  10.404  1.00 43.10  ? 2019 HOH A O   1 
HETATM 8830 O O   . HOH G 4 .   ? 80.425  11.027  -9.182  1.00 30.84  ? 2020 HOH A O   1 
HETATM 8831 O O   . HOH G 4 .   ? 77.811  13.212  -5.860  1.00 35.92  ? 2021 HOH A O   1 
HETATM 8832 O O   . HOH G 4 .   ? 81.959  11.228  -5.477  1.00 52.49  ? 2022 HOH A O   1 
HETATM 8833 O O   . HOH G 4 .   ? 79.988  14.640  -4.455  1.00 33.43  ? 2023 HOH A O   1 
HETATM 8834 O O   . HOH G 4 .   ? 82.297  7.021   -4.167  1.00 46.81  ? 2024 HOH A O   1 
HETATM 8835 O O   . HOH G 4 .   ? 70.726  17.048  -5.459  1.00 18.40  ? 2025 HOH A O   1 
HETATM 8836 O O   . HOH G 4 .   ? 81.799  -2.596  -4.079  1.00 10.69  ? 2026 HOH A O   1 
HETATM 8837 O O   . HOH G 4 .   ? 78.009  10.588  -18.170 1.00 60.84  ? 2027 HOH A O   1 
HETATM 8838 O O   . HOH G 4 .   ? 81.551  -12.058 1.494   1.00 30.51  ? 2028 HOH A O   1 
HETATM 8839 O O   . HOH G 4 .   ? 84.242  -17.676 -7.489  1.00 23.07  ? 2029 HOH A O   1 
HETATM 8840 O O   . HOH G 4 .   ? 87.069  -12.562 0.650   1.00 32.71  ? 2030 HOH A O   1 
HETATM 8841 O O   . HOH G 4 .   ? 53.759  8.600   -10.023 1.00 54.63  ? 2031 HOH A O   1 
HETATM 8842 O O   . HOH G 4 .   ? 79.747  -15.535 -2.911  1.00 21.45  ? 2032 HOH A O   1 
HETATM 8843 O O   . HOH G 4 .   ? 69.670  -20.494 10.253  1.00 31.68  ? 2033 HOH A O   1 
HETATM 8844 O O   . HOH G 4 .   ? 75.662  -14.226 -15.576 1.00 47.66  ? 2034 HOH A O   1 
HETATM 8845 O O   . HOH G 4 .   ? 78.336  -13.374 -15.586 1.00 37.82  ? 2035 HOH A O   1 
HETATM 8846 O O   . HOH G 4 .   ? 84.478  -10.937 -15.845 1.00 57.71  ? 2036 HOH A O   1 
HETATM 8847 O O   . HOH G 4 .   ? 53.380  1.167   13.483  1.00 29.67  ? 2037 HOH A O   1 
HETATM 8848 O O   . HOH G 4 .   ? 59.397  -3.193  -15.848 1.00 41.50  ? 2038 HOH A O   1 
HETATM 8849 O O   . HOH G 4 .   ? 82.048  -2.175  -8.395  1.00 35.17  ? 2039 HOH A O   1 
HETATM 8850 O O   . HOH G 4 .   ? 78.583  2.150   -16.549 1.00 41.06  ? 2040 HOH A O   1 
HETATM 8851 O O   . HOH G 4 .   ? 70.364  -21.439 12.772  1.00 41.53  ? 2041 HOH A O   1 
HETATM 8852 O O   . HOH G 4 .   ? 61.927  -20.653 6.502   1.00 38.16  ? 2042 HOH A O   1 
HETATM 8853 O O   . HOH G 4 .   ? 81.845  0.422   -9.498  1.00 25.51  ? 2043 HOH A O   1 
HETATM 8854 O O   . HOH G 4 .   ? 80.406  4.332   -11.191 1.00 41.67  ? 2044 HOH A O   1 
HETATM 8855 O O   . HOH G 4 .   ? 81.209  -1.078  -6.227  1.00 14.55  ? 2045 HOH A O   1 
HETATM 8856 O O   . HOH G 4 .   ? 79.758  3.651   -5.396  1.00 20.04  ? 2046 HOH A O   1 
HETATM 8857 O O   . HOH G 4 .   ? 49.185  -9.211  12.136  1.00 35.80  ? 2047 HOH A O   1 
HETATM 8858 O O   . HOH G 4 .   ? 80.250  6.509   -6.459  1.00 33.44  ? 2048 HOH A O   1 
HETATM 8859 O O   . HOH G 4 .   ? 78.386  10.969  -7.236  1.00 28.58  ? 2049 HOH A O   1 
HETATM 8860 O O   . HOH G 4 .   ? 79.931  9.314   -4.692  1.00 50.14  ? 2050 HOH A O   1 
HETATM 8861 O O   . HOH G 4 .   ? 75.493  14.011  -6.242  1.00 17.27  ? 2051 HOH A O   1 
HETATM 8862 O O   . HOH G 4 .   ? 78.285  9.839   -2.408  1.00 39.42  ? 2052 HOH A O   1 
HETATM 8863 O O   . HOH G 4 .   ? 77.721  12.506  -3.491  1.00 16.14  ? 2053 HOH A O   1 
HETATM 8864 O O   . HOH G 4 .   ? 74.713  15.140  -3.859  1.00 28.29  ? 2054 HOH A O   1 
HETATM 8865 O O   . HOH G 4 .   ? 79.245  13.914  0.845   1.00 47.40  ? 2055 HOH A O   1 
HETATM 8866 O O   . HOH G 4 .   ? 65.490  15.349  6.783   1.00 43.76  ? 2056 HOH A O   1 
HETATM 8867 O O   . HOH G 4 .   ? 70.398  19.827  2.172   1.00 15.09  ? 2057 HOH A O   1 
HETATM 8868 O O   . HOH G 4 .   ? 63.596  19.885  1.771   1.00 46.38  ? 2058 HOH A O   1 
HETATM 8869 O O   . HOH G 4 .   ? 60.700  16.322  -1.713  1.00 40.68  ? 2059 HOH A O   1 
HETATM 8870 O O   . HOH G 4 .   ? 76.325  16.487  1.195   1.00 28.07  ? 2060 HOH A O   1 
HETATM 8871 O O   . HOH G 4 .   ? 72.525  16.614  -3.584  1.00 13.51  ? 2061 HOH A O   1 
HETATM 8872 O O   . HOH G 4 .   ? 71.033  16.129  -8.293  1.00 19.50  ? 2062 HOH A O   1 
HETATM 8873 O O   . HOH G 4 .   ? 60.659  15.240  -9.497  1.00 37.25  ? 2063 HOH A O   1 
HETATM 8874 O O   . HOH G 4 .   ? 60.565  21.555  19.344  1.00 64.75  ? 2064 HOH A O   1 
HETATM 8875 O O   . HOH G 4 .   ? 70.856  16.068  -12.524 1.00 40.38  ? 2065 HOH A O   1 
HETATM 8876 O O   . HOH G 4 .   ? 75.606  16.740  13.979  1.00 42.78  ? 2066 HOH A O   1 
HETATM 8877 O O   . HOH G 4 .   ? 73.238  16.505  18.992  1.00 41.91  ? 2067 HOH A O   1 
HETATM 8878 O O   . HOH G 4 .   ? 65.994  25.595  18.355  1.00 47.97  ? 2068 HOH A O   1 
HETATM 8879 O O   . HOH G 4 .   ? 67.300  11.239  -20.064 1.00 37.61  ? 2069 HOH A O   1 
HETATM 8880 O O   . HOH G 4 .   ? 70.970  8.373   -18.986 1.00 47.90  ? 2070 HOH A O   1 
HETATM 8881 O O   . HOH G 4 .   ? 61.840  17.721  -12.783 1.00 49.58  ? 2071 HOH A O   1 
HETATM 8882 O O   . HOH G 4 .   ? 72.913  17.441  25.385  1.00 45.75  ? 2072 HOH A O   1 
HETATM 8883 O O   . HOH G 4 .   ? 75.122  11.724  -19.000 1.00 35.61  ? 2073 HOH A O   1 
HETATM 8884 O O   . HOH G 4 .   ? 76.105  7.892   -18.361 1.00 57.50  ? 2074 HOH A O   1 
HETATM 8885 O O   . HOH G 4 .   ? 76.327  5.949   -16.136 1.00 35.35  ? 2075 HOH A O   1 
HETATM 8886 O O   . HOH G 4 .   ? 77.802  10.034  -15.593 1.00 38.43  ? 2076 HOH A O   1 
HETATM 8887 O O   . HOH G 4 .   ? 69.603  2.230   -19.214 1.00 64.74  ? 2077 HOH A O   1 
HETATM 8888 O O   . HOH G 4 .   ? 63.784  2.211   -18.431 1.00 36.90  ? 2078 HOH A O   1 
HETATM 8889 O O   . HOH G 4 .   ? 66.898  4.732   13.260  1.00 14.00  ? 2079 HOH A O   1 
HETATM 8890 O O   . HOH G 4 .   ? 67.026  8.996   5.470   1.00 19.57  ? 2080 HOH A O   1 
HETATM 8891 O O   . HOH G 4 .   ? 58.555  13.540  0.870   1.00 17.52  ? 2081 HOH A O   1 
HETATM 8892 O O   . HOH G 4 .   ? 55.307  10.299  -2.926  1.00 19.88  ? 2082 HOH A O   1 
HETATM 8893 O O   . HOH G 4 .   ? 52.274  7.756   -1.788  1.00 18.32  ? 2083 HOH A O   1 
HETATM 8894 O O   . HOH G 4 .   ? 59.004  12.947  -5.902  1.00 25.92  ? 2084 HOH A O   1 
HETATM 8895 O O   . HOH G 4 .   ? 61.624  9.166   -13.686 1.00 14.52  ? 2085 HOH A O   1 
HETATM 8896 O O   . HOH G 4 .   ? 54.774  3.407   -13.323 1.00 23.31  ? 2086 HOH A O   1 
HETATM 8897 O O   . HOH G 4 .   ? 52.464  4.719   -9.841  1.00 32.93  ? 2087 HOH A O   1 
HETATM 8898 O O   . HOH G 4 .   ? 53.783  7.931   -6.907  1.00 41.67  ? 2088 HOH A O   1 
HETATM 8899 O O   . HOH G 4 .   ? 60.703  12.328  -12.582 1.00 39.20  ? 2089 HOH A O   1 
HETATM 8900 O O   . HOH G 4 .   ? 59.044  6.385   -18.587 1.00 31.48  ? 2090 HOH A O   1 
HETATM 8901 O O   . HOH G 4 .   ? 56.786  14.571  -13.121 1.00 39.75  ? 2091 HOH A O   1 
HETATM 8902 O O   . HOH G 4 .   ? 58.836  13.654  -8.445  1.00 23.01  ? 2092 HOH A O   1 
HETATM 8903 O O   . HOH G 4 .   ? 56.352  14.208  -8.659  1.00 33.25  ? 2093 HOH A O   1 
HETATM 8904 O O   . HOH G 4 .   ? 52.951  13.139  -11.748 1.00 48.69  ? 2094 HOH A O   1 
HETATM 8905 O O   . HOH G 4 .   ? 71.119  -18.452 17.860  1.00 41.62  ? 2095 HOH A O   1 
HETATM 8906 O O   . HOH G 4 .   ? 71.268  -14.917 19.546  1.00 32.82  ? 2096 HOH A O   1 
HETATM 8907 O O   . HOH G 4 .   ? 71.587  -18.731 9.329   1.00 21.42  ? 2097 HOH A O   1 
HETATM 8908 O O   . HOH G 4 .   ? 56.812  4.188   -16.923 1.00 30.21  ? 2098 HOH A O   1 
HETATM 8909 O O   . HOH G 4 .   ? 63.429  -0.119  -16.783 1.00 24.93  ? 2099 HOH A O   1 
HETATM 8910 O O   . HOH G 4 .   ? 56.870  0.492   -13.730 1.00 35.51  ? 2100 HOH A O   1 
HETATM 8911 O O   . HOH G 4 .   ? 59.899  3.939   -19.298 1.00 40.28  ? 2101 HOH A O   1 
HETATM 8912 O O   . HOH G 4 .   ? 79.052  -10.151 19.607  1.00 49.91  ? 2102 HOH A O   1 
HETATM 8913 O O   . HOH G 4 .   ? 85.134  -12.244 4.157   1.00 22.38  ? 2103 HOH A O   1 
HETATM 8914 O O   . HOH G 4 .   ? 60.072  -2.095  -11.360 1.00 34.78  ? 2104 HOH A O   1 
HETATM 8915 O O   . HOH G 4 .   ? 61.044  -2.062  3.956   1.00 11.28  ? 2105 HOH A O   1 
HETATM 8916 O O   . HOH G 4 .   ? 58.075  -0.385  11.367  1.00 19.25  ? 2106 HOH A O   1 
HETATM 8917 O O   . HOH G 4 .   ? 51.713  1.594   11.381  1.00 9.93   ? 2107 HOH A O   1 
HETATM 8918 O O   . HOH G 4 .   ? 53.482  4.748   4.266   1.00 8.00   ? 2108 HOH A O   1 
HETATM 8919 O O   . HOH G 4 .   ? 51.626  5.423   2.532   1.00 9.65   ? 2109 HOH A O   1 
HETATM 8920 O O   . HOH G 4 .   ? 51.818  -4.154  0.042   1.00 23.55  ? 2110 HOH A O   1 
HETATM 8921 O O   . HOH G 4 .   ? 54.674  1.277   -11.540 1.00 18.62  ? 2111 HOH A O   1 
HETATM 8922 O O   . HOH G 4 .   ? 57.979  -1.662  -13.226 1.00 32.35  ? 2112 HOH A O   1 
HETATM 8923 O O   . HOH G 4 .   ? 68.087  -21.651 7.461   1.00 36.33  ? 2113 HOH A O   1 
HETATM 8924 O O   . HOH G 4 .   ? 66.199  -7.452  6.561   1.00 12.28  ? 2114 HOH A O   1 
HETATM 8925 O O   . HOH G 4 .   ? 68.881  -19.184 13.907  1.00 39.98  ? 2115 HOH A O   1 
HETATM 8926 O O   . HOH G 4 .   ? 60.180  -18.339 5.657   1.00 40.58  ? 2116 HOH A O   1 
HETATM 8927 O O   . HOH G 4 .   ? 54.946  -8.635  -9.607  1.00 51.05  ? 2117 HOH A O   1 
HETATM 8928 O O   . HOH G 4 .   ? 52.317  -4.230  9.453   1.00 22.73  ? 2118 HOH A O   1 
HETATM 8929 O O   . HOH G 4 .   ? 52.733  -9.373  14.440  1.00 23.61  ? 2119 HOH A O   1 
HETATM 8930 O O   . HOH G 4 .   ? 51.739  -11.018 11.517  1.00 23.29  ? 2120 HOH A O   1 
HETATM 8931 O O   . HOH G 4 .   ? 63.052  -2.972  13.312  1.00 26.60  ? 2121 HOH A O   1 
HETATM 8932 O O   . HOH G 4 .   ? 63.278  -11.780 28.493  1.00 45.43  ? 2122 HOH A O   1 
HETATM 8933 O O   . HOH G 4 .   ? 64.538  -7.273  28.182  1.00 22.57  ? 2123 HOH A O   1 
HETATM 8934 O O   . HOH G 4 .   ? 54.548  -14.898 12.349  1.00 26.84  ? 2124 HOH A O   1 
HETATM 8935 O O   . HOH G 4 .   ? 51.960  -13.347 26.679  1.00 51.55  ? 2125 HOH A O   1 
HETATM 8936 O O   . HOH G 4 .   ? 46.645  1.802   14.274  1.00 29.86  ? 2126 HOH A O   1 
HETATM 8937 O O   . HOH G 4 .   ? 59.377  -13.226 26.381  1.00 25.72  ? 2127 HOH A O   1 
HETATM 8938 O O   . HOH G 4 .   ? 42.162  -9.393  15.784  1.00 59.39  ? 2128 HOH A O   1 
HETATM 8939 O O   . HOH G 4 .   ? 52.930  -4.087  31.133  1.00 30.42  ? 2129 HOH A O   1 
HETATM 8940 O O   . HOH G 4 .   ? 52.502  -14.509 13.826  1.00 26.61  ? 2130 HOH A O   1 
HETATM 8941 O O   . HOH G 4 .   ? 54.904  -18.190 16.141  1.00 48.42  ? 2131 HOH A O   1 
HETATM 8942 O O   . HOH G 4 .   ? 63.145  -7.766  32.100  1.00 70.23  ? 2132 HOH A O   1 
HETATM 8943 O O   . HOH G 4 .   ? 55.512  -1.984  29.279  1.00 21.70  ? 2133 HOH A O   1 
HETATM 8944 O O   . HOH G 4 .   ? 65.589  13.767  16.831  1.00 12.90  ? 2134 HOH A O   1 
HETATM 8945 O O   . HOH G 4 .   ? 61.852  17.268  12.656  1.00 30.18  ? 2135 HOH A O   1 
HETATM 8946 O O   . HOH G 4 .   ? 56.021  16.571  11.621  1.00 35.84  ? 2136 HOH A O   1 
HETATM 8947 O O   . HOH G 4 .   ? 57.332  13.798  7.945   1.00 20.52  ? 2137 HOH A O   1 
HETATM 8948 O O   . HOH G 4 .   ? 50.798  10.011  16.365  1.00 24.22  ? 2138 HOH A O   1 
HETATM 8949 O O   . HOH G 4 .   ? 51.105  12.480  15.258  1.00 31.16  ? 2139 HOH A O   1 
HETATM 8950 O O   . HOH G 4 .   ? 52.359  16.269  18.567  1.00 55.26  ? 2140 HOH A O   1 
HETATM 8951 O O   . HOH G 4 .   ? 50.503  3.936   12.150  1.00 13.71  ? 2141 HOH A O   1 
HETATM 8952 O O   . HOH G 4 .   ? 56.042  1.276   12.818  1.00 24.19  ? 2142 HOH A O   1 
HETATM 8953 O O   . HOH G 4 .   ? 54.512  1.023   16.146  1.00 30.94  ? 2143 HOH A O   1 
HETATM 8954 O O   . HOH G 4 .   ? 48.093  9.858   15.834  1.00 30.84  ? 2144 HOH A O   1 
HETATM 8955 O O   . HOH G 4 .   ? 42.470  7.061   16.354  1.00 48.21  ? 2145 HOH A O   1 
HETATM 8956 O O   . HOH G 4 .   ? 46.028  -7.241  20.937  1.00 42.51  ? 2146 HOH A O   1 
HETATM 8957 O O   . HOH G 4 .   ? 42.794  -3.048  28.871  1.00 53.87  ? 2147 HOH A O   1 
HETATM 8958 O O   . HOH G 4 .   ? 47.209  6.527   27.687  1.00 47.12  ? 2148 HOH A O   1 
HETATM 8959 O O   . HOH G 4 .   ? 49.398  9.337   23.247  1.00 54.65  ? 2149 HOH A O   1 
HETATM 8960 O O   . HOH G 4 .   ? 59.360  19.583  17.626  1.00 54.24  ? 2150 HOH A O   1 
HETATM 8961 O O   . HOH G 4 .   ? 56.332  17.447  21.777  1.00 31.74  ? 2151 HOH A O   1 
HETATM 8962 O O   . HOH G 4 .   ? 60.531  19.715  21.603  1.00 50.91  ? 2152 HOH A O   1 
HETATM 8963 O O   . HOH G 4 .   ? 76.287  15.698  11.630  1.00 33.20  ? 2153 HOH A O   1 
HETATM 8964 O O   . HOH G 4 .   ? 71.614  17.532  17.315  1.00 44.60  ? 2154 HOH A O   1 
HETATM 8965 O O   . HOH G 4 .   ? 72.794  18.916  19.921  1.00 66.12  ? 2155 HOH A O   1 
HETATM 8966 O O   . HOH G 4 .   ? 61.892  19.609  23.800  1.00 50.33  ? 2156 HOH A O   1 
HETATM 8967 O O   . HOH G 4 .   ? 66.179  22.736  17.247  1.00 38.00  ? 2157 HOH A O   1 
HETATM 8968 O O   . HOH G 4 .   ? 70.951  18.917  26.733  1.00 59.25  ? 2158 HOH A O   1 
HETATM 8969 O O   . HOH G 4 .   ? 66.590  18.021  31.604  1.00 55.31  ? 2159 HOH A O   1 
HETATM 8970 O O   . HOH G 4 .   ? 56.134  15.015  32.559  1.00 37.46  ? 2160 HOH A O   1 
HETATM 8971 O O   . HOH G 4 .   ? 58.332  18.944  22.767  1.00 45.43  ? 2161 HOH A O   1 
HETATM 8972 O O   . HOH G 4 .   ? 59.593  19.369  25.161  1.00 46.13  ? 2162 HOH A O   1 
HETATM 8973 O O   . HOH G 4 .   ? 60.264  8.578   32.984  1.00 31.57  ? 2163 HOH A O   1 
HETATM 8974 O O   . HOH G 4 .   ? 60.550  6.727   35.845  1.00 52.25  ? 2164 HOH A O   1 
HETATM 8975 O O   . HOH G 4 .   ? 58.228  7.190   20.657  1.00 16.13  ? 2165 HOH A O   1 
HETATM 8976 O O   . HOH G 4 .   ? 68.025  6.184   16.774  1.00 13.80  ? 2166 HOH A O   1 
HETATM 8977 O O   . HOH G 4 .   ? 75.914  11.469  14.951  1.00 36.60  ? 2167 HOH A O   1 
HETATM 8978 O O   . HOH G 4 .   ? 67.918  13.311  15.468  1.00 10.05  ? 2168 HOH A O   1 
HETATM 8979 O O   . HOH G 4 .   ? 73.354  9.257   17.970  1.00 30.49  ? 2169 HOH A O   1 
HETATM 8980 O O   . HOH G 4 .   ? 74.800  11.612  18.011  1.00 19.69  ? 2170 HOH A O   1 
HETATM 8981 O O   . HOH G 4 .   ? 73.744  14.333  26.611  1.00 43.38  ? 2171 HOH A O   1 
HETATM 8982 O O   . HOH G 4 .   ? 78.107  12.166  19.757  1.00 47.30  ? 2172 HOH A O   1 
HETATM 8983 O O   . HOH G 4 .   ? 69.927  5.865   29.115  1.00 39.22  ? 2173 HOH A O   1 
HETATM 8984 O O   . HOH G 4 .   ? 66.757  1.308   23.047  1.00 16.80  ? 2174 HOH A O   1 
HETATM 8985 O O   . HOH G 4 .   ? 75.931  8.559   24.447  1.00 41.98  ? 2175 HOH A O   1 
HETATM 8986 O O   . HOH G 4 .   ? 70.582  15.098  31.870  1.00 23.63  ? 2176 HOH A O   1 
HETATM 8987 O O   . HOH G 4 .   ? 77.851  6.969   35.183  1.00 47.36  ? 2177 HOH A O   1 
HETATM 8988 O O   . HOH G 4 .   ? 66.920  9.243   40.305  1.00 50.91  ? 2178 HOH A O   1 
HETATM 8989 O O   . HOH G 4 .   ? 62.401  4.784   37.799  1.00 53.49  ? 2179 HOH A O   1 
HETATM 8990 O O   . HOH G 4 .   ? 67.560  4.190   30.660  1.00 36.71  ? 2180 HOH A O   1 
HETATM 8991 O O   . HOH G 4 .   ? 65.717  -0.684  17.766  1.00 29.78  ? 2181 HOH A O   1 
HETATM 8992 O O   . HOH G 4 .   ? 64.811  -1.245  14.523  1.00 30.59  ? 2182 HOH A O   1 
HETATM 8993 O O   . HOH G 4 .   ? 66.865  0.345   14.046  1.00 23.00  ? 2183 HOH A O   1 
HETATM 8994 O O   . HOH G 4 .   ? 66.103  6.104   19.699  1.00 18.91  ? 2184 HOH A O   1 
HETATM 8995 O O   . HOH G 4 .   ? 68.020  -2.351  16.972  1.00 50.50  ? 2185 HOH A O   1 
HETATM 8996 O O   . HOH G 4 .   ? 68.603  -1.742  14.490  1.00 15.76  ? 2186 HOH A O   1 
HETATM 8997 O O   . HOH G 4 .   ? 77.115  -0.920  18.972  1.00 27.98  ? 2187 HOH A O   1 
HETATM 8998 O O   . HOH G 4 .   ? 78.426  -2.590  17.420  1.00 41.97  ? 2188 HOH A O   1 
HETATM 8999 O O   . HOH G 4 .   ? 68.924  6.097   14.213  1.00 13.53  ? 2189 HOH A O   1 
HETATM 9000 O O   . HOH G 4 .   ? 78.210  0.886   23.691  1.00 38.28  ? 2190 HOH A O   1 
HETATM 9001 O O   . HOH G 4 .   ? 78.100  12.008  13.630  1.00 56.07  ? 2191 HOH A O   1 
HETATM 9002 O O   . HOH G 4 .   ? 77.340  8.081   26.588  1.00 36.12  ? 2192 HOH A O   1 
HETATM 9003 O O   . HOH G 4 .   ? 82.050  2.786   27.524  1.00 39.77  ? 2193 HOH A O   1 
HETATM 9004 O O   . HOH G 4 .   ? 76.462  -1.385  27.730  1.00 39.54  ? 2194 HOH A O   1 
HETATM 9005 O O   . HOH G 4 .   ? 65.933  -3.802  30.416  1.00 46.20  ? 2195 HOH A O   1 
HETATM 9006 O O   . HOH G 4 .   ? 62.692  -6.468  13.552  1.00 13.30  ? 2196 HOH A O   1 
HETATM 9007 O O   . HOH G 4 .   ? 71.738  -4.803  14.333  1.00 19.96  ? 2197 HOH A O   1 
HETATM 9008 O O   . HOH G 4 .   ? 78.482  -7.400  18.469  1.00 49.19  ? 2198 HOH A O   1 
HETATM 9009 O O   . HOH G 4 .   ? 72.984  -16.613 18.513  1.00 30.60  ? 2199 HOH A O   1 
HETATM 9010 O O   . HOH G 4 .   ? 71.631  -16.563 11.012  1.00 10.99  ? 2200 HOH A O   1 
HETATM 9011 O O   . HOH G 4 .   ? 81.063  -18.782 9.065   1.00 16.59  ? 2201 HOH A O   1 
HETATM 9012 O O   . HOH G 4 .   ? 73.916  -19.982 9.523   1.00 17.83  ? 2202 HOH A O   1 
HETATM 9013 O O   . HOH G 4 .   ? 76.703  -14.532 5.583   1.00 15.74  ? 2203 HOH A O   1 
HETATM 9014 O O   . HOH G 4 .   ? 81.215  -16.879 17.126  1.00 64.98  ? 2204 HOH A O   1 
HETATM 9015 O O   . HOH G 4 .   ? 80.363  -10.158 16.981  1.00 41.06  ? 2205 HOH A O   1 
HETATM 9016 O O   . HOH G 4 .   ? 83.289  -13.779 5.436   1.00 10.43  ? 2206 HOH A O   1 
HETATM 9017 O O   . HOH G 4 .   ? 86.965  -10.678 5.400   1.00 55.67  ? 2207 HOH A O   1 
HETATM 9018 O O   . HOH G 4 .   ? 85.144  -17.524 10.726  1.00 35.82  ? 2208 HOH A O   1 
HETATM 9019 O O   . HOH G 4 .   ? 87.185  -11.735 10.802  1.00 51.62  ? 2209 HOH A O   1 
HETATM 9020 O O   . HOH G 4 .   ? 85.762  -8.299  3.977   1.00 37.88  ? 2210 HOH A O   1 
HETATM 9021 O O   . HOH G 4 .   ? 89.273  -1.928  3.528   1.00 49.53  ? 2211 HOH A O   1 
HETATM 9022 O O   . HOH G 4 .   ? 85.843  -0.113  1.916   1.00 46.44  ? 2212 HOH A O   1 
HETATM 9023 O O   . HOH G 4 .   ? 88.745  0.228   5.155   1.00 49.73  ? 2213 HOH A O   1 
HETATM 9024 O O   . HOH G 4 .   ? 83.271  6.754   4.961   1.00 49.34  ? 2214 HOH A O   1 
HETATM 9025 O O   . HOH G 4 .   ? 83.370  -1.186  11.713  1.00 48.99  ? 2215 HOH A O   1 
HETATM 9026 O O   . HOH G 4 .   ? 78.640  4.139   15.006  1.00 27.79  ? 2216 HOH A O   1 
HETATM 9027 O O   . HOH G 4 .   ? 81.467  0.628   15.989  1.00 31.17  ? 2217 HOH A O   1 
HETATM 9028 O O   . HOH G 4 .   ? 81.095  -2.797  12.997  1.00 36.35  ? 2218 HOH A O   1 
HETATM 9029 O O   . HOH G 4 .   ? 71.064  -2.343  14.177  1.00 21.09  ? 2219 HOH A O   1 
HETATM 9030 O O   . HOH G 4 .   ? 67.963  -6.782  8.530   1.00 7.53   ? 2220 HOH A O   1 
HETATM 9031 O O   . HOH G 4 .   ? 76.304  -14.810 1.329   1.00 28.52  ? 2221 HOH A O   1 
HETATM 9032 O O   . HOH G 4 .   ? 78.578  -12.953 4.501   1.00 14.22  ? 2222 HOH A O   1 
HETATM 9033 O O   . HOH G 4 .   ? 66.379  -7.186  -3.538  1.00 31.11  ? 2223 HOH A O   1 
HETATM 9034 O O   . HOH G 4 .   ? 71.053  -17.091 -9.742  1.00 35.16  ? 2224 HOH A O   1 
HETATM 9035 O O   . HOH G 4 .   ? 75.061  -16.280 -0.339  1.00 43.78  ? 2225 HOH A O   1 
HETATM 9036 O O   . HOH G 4 .   ? 65.697  -13.516 -18.559 1.00 32.40  ? 2226 HOH A O   1 
HETATM 9037 O O   . HOH G 4 .   ? 68.347  -1.333  -17.226 1.00 44.84  ? 2227 HOH A O   1 
HETATM 9038 O O   . HOH G 4 .   ? 71.201  -6.163  -20.442 1.00 43.90  ? 2228 HOH A O   1 
HETATM 9039 O O   . HOH G 4 .   ? 65.372  -1.895  -17.548 1.00 31.63  ? 2229 HOH A O   1 
HETATM 9040 O O   . HOH G 4 .   ? 58.642  -8.114  -14.427 1.00 45.27  ? 2230 HOH A O   1 
HETATM 9041 O O   . HOH G 4 .   ? 59.553  -5.566  -13.598 1.00 32.39  ? 2231 HOH A O   1 
HETATM 9042 O O   . HOH G 4 .   ? 59.899  -18.065 -4.000  1.00 36.83  ? 2232 HOH A O   1 
HETATM 9043 O O   . HOH G 4 .   ? 61.689  -17.051 -12.072 1.00 46.80  ? 2233 HOH A O   1 
HETATM 9044 O O   . HOH G 4 .   ? 58.776  -16.468 -12.822 1.00 49.97  ? 2234 HOH A O   1 
HETATM 9045 O O   . HOH G 4 .   ? 62.693  -13.884 -2.897  1.00 23.87  ? 2235 HOH A O   1 
HETATM 9046 O O   . HOH G 4 .   ? 62.988  -18.849 2.267   1.00 34.42  ? 2236 HOH A O   1 
HETATM 9047 O O   . HOH G 4 .   ? 61.993  -17.469 -3.267  1.00 42.23  ? 2237 HOH A O   1 
HETATM 9048 O O   . HOH G 4 .   ? 68.303  -21.209 -1.439  1.00 57.16  ? 2238 HOH A O   1 
HETATM 9049 O O   . HOH G 4 .   ? 70.764  -17.216 -3.135  1.00 35.80  ? 2239 HOH A O   1 
HETATM 9050 O O   . HOH G 4 .   ? 71.121  -18.701 -0.858  1.00 47.86  ? 2240 HOH A O   1 
HETATM 9051 O O   . HOH G 4 .   ? 74.318  -20.682 2.090   1.00 35.78  ? 2241 HOH A O   1 
HETATM 9052 O O   . HOH G 4 .   ? 69.045  -19.418 5.765   1.00 19.57  ? 2242 HOH A O   1 
HETATM 9053 O O   . HOH G 4 .   ? 74.472  -14.386 3.521   1.00 19.88  ? 2243 HOH A O   1 
HETATM 9054 O O   . HOH G 4 .   ? 71.171  -17.951 6.663   1.00 13.55  ? 2244 HOH A O   1 
HETATM 9055 O O   . HOH G 4 .   ? 69.243  -17.203 11.957  1.00 16.78  ? 2245 HOH A O   1 
HETATM 9056 O O   . HOH G 4 .   ? 61.945  -16.389 4.840   1.00 21.08  ? 2246 HOH A O   1 
HETATM 9057 O O   . HOH G 4 .   ? 56.174  -20.137 -3.332  1.00 58.99  ? 2247 HOH A O   1 
HETATM 9058 O O   . HOH G 4 .   ? 52.307  -12.009 3.432   1.00 19.76  ? 2248 HOH A O   1 
HETATM 9059 O O   . HOH G 4 .   ? 56.666  -14.731 -4.102  1.00 30.08  ? 2249 HOH A O   1 
HETATM 9060 O O   . HOH G 4 .   ? 54.770  -7.223  -6.522  1.00 30.74  ? 2250 HOH A O   1 
HETATM 9061 O O   . HOH G 4 .   ? 56.833  -11.590 -11.058 1.00 39.23  ? 2251 HOH A O   1 
HETATM 9062 O O   . HOH G 4 .   ? 49.345  -10.008 3.134   1.00 42.54  ? 2252 HOH A O   1 
HETATM 9063 O O   . HOH G 4 .   ? 48.567  -14.154 1.716   1.00 40.62  ? 2253 HOH A O   1 
HETATM 9064 O O   . HOH G 4 .   ? 53.210  -13.572 -2.251  1.00 36.46  ? 2254 HOH A O   1 
HETATM 9065 O O   . HOH G 4 .   ? 48.226  -10.259 -1.344  1.00 41.61  ? 2255 HOH A O   1 
HETATM 9066 O O   . HOH G 4 .   ? 50.299  -6.212  1.273   1.00 19.33  ? 2256 HOH A O   1 
HETATM 9067 O O   . HOH G 4 .   ? 49.936  -8.895  0.807   1.00 22.37  ? 2257 HOH A O   1 
HETATM 9068 O O   . HOH G 4 .   ? 58.893  -6.596  4.598   1.00 9.99   ? 2258 HOH A O   1 
HETATM 9069 O O   . HOH G 4 .   ? 53.621  -15.726 -0.246  1.00 59.33  ? 2259 HOH A O   1 
HETATM 9070 O O   . HOH G 4 .   ? 65.179  -14.575 8.323   1.00 18.69  ? 2260 HOH A O   1 
HETATM 9071 O O   . HOH G 4 .   ? 66.642  -16.713 11.662  1.00 34.61  ? 2261 HOH A O   1 
HETATM 9072 O O   . HOH G 4 .   ? 61.641  -7.878  11.640  1.00 11.74  ? 2262 HOH A O   1 
HETATM 9073 O O   . HOH G 4 .   ? 63.057  -16.701 12.347  1.00 30.11  ? 2263 HOH A O   1 
HETATM 9074 O O   . HOH G 4 .   ? 69.578  -17.422 15.857  1.00 35.16  ? 2264 HOH A O   1 
HETATM 9075 O O   . HOH G 4 .   ? 71.305  -5.831  30.630  1.00 42.68  ? 2265 HOH A O   1 
HETATM 9076 O O   . HOH G 4 .   ? 75.124  -6.852  31.900  1.00 42.59  ? 2266 HOH A O   1 
HETATM 9077 O O   . HOH G 4 .   ? 79.749  -3.979  20.164  1.00 54.77  ? 2267 HOH A O   1 
HETATM 9078 O O   . HOH G 4 .   ? 77.936  -1.247  21.611  1.00 42.22  ? 2268 HOH A O   1 
HETATM 9079 O O   . HOH G 4 .   ? 74.957  -13.367 22.174  1.00 50.79  ? 2269 HOH A O   1 
HETATM 9080 O O   . HOH G 4 .   ? 72.454  -12.946 20.926  1.00 29.14  ? 2270 HOH A O   1 
HETATM 9081 O O   . HOH G 4 .   ? 70.017  -15.712 22.098  1.00 44.64  ? 2271 HOH A O   1 
HETATM 9082 O O   . HOH G 4 .   ? 68.247  -15.719 27.290  1.00 56.97  ? 2272 HOH A O   1 
HETATM 9083 O O   . HOH G 4 .   ? 61.558  -13.962 25.314  1.00 39.66  ? 2273 HOH A O   1 
HETATM 9084 O O   . HOH G 4 .   ? 69.110  -14.880 17.750  1.00 42.26  ? 2274 HOH A O   1 
HETATM 9085 O O   . HOH G 4 .   ? 62.787  -16.876 21.543  1.00 22.39  ? 2275 HOH A O   1 
HETATM 9086 O O   . HOH G 4 .   ? 65.181  -16.739 14.283  1.00 57.18  ? 2276 HOH A O   1 
HETATM 9087 O O   . HOH G 4 .   ? 63.079  -14.638 13.768  1.00 32.73  ? 2277 HOH A O   1 
HETATM 9088 O O   . HOH G 4 .   ? 56.978  -16.066 13.318  1.00 31.52  ? 2278 HOH A O   1 
HETATM 9089 O O   . HOH G 4 .   ? 50.507  -13.494 5.319   1.00 44.91  ? 2279 HOH A O   1 
HETATM 9090 O O   . HOH G 4 .   ? 54.092  -14.816 9.504   1.00 23.01  ? 2280 HOH A O   1 
HETATM 9091 O O   . HOH G 4 .   ? 48.903  -16.834 1.642   1.00 57.81  ? 2281 HOH A O   1 
HETATM 9092 O O   . HOH G 4 .   ? 51.923  -12.727 9.295   1.00 39.47  ? 2282 HOH A O   1 
HETATM 9093 O O   . HOH G 4 .   ? 48.849  -6.004  3.714   1.00 17.45  ? 2283 HOH A O   1 
HETATM 9094 O O   . HOH G 4 .   ? 48.128  -10.098 9.691   1.00 23.43  ? 2284 HOH A O   1 
HETATM 9095 O O   . HOH G 4 .   ? 43.628  -2.713  6.237   1.00 22.90  ? 2285 HOH A O   1 
HETATM 9096 O O   . HOH G 4 .   ? 50.332  -2.364  9.399   1.00 10.11  ? 2286 HOH A O   1 
HETATM 9097 O O   . HOH G 4 .   ? 47.682  0.044   12.558  1.00 14.86  ? 2287 HOH A O   1 
HETATM 9098 O O   . HOH G 4 .   ? 43.198  -5.016  10.446  1.00 19.55  ? 2288 HOH A O   1 
HETATM 9099 O O   . HOH G 4 .   ? 43.962  -8.647  13.237  1.00 35.85  ? 2289 HOH A O   1 
HETATM 9100 O O   . HOH G 4 .   ? 50.264  -0.647  11.780  1.00 13.29  ? 2290 HOH A O   1 
HETATM 9101 O O   . HOH G 4 .   ? 50.505  -7.891  13.908  1.00 16.39  ? 2291 HOH A O   1 
HETATM 9102 O O   . HOH G 4 .   ? 46.282  -2.457  16.578  1.00 34.36  ? 2292 HOH A O   1 
HETATM 9103 O O   . HOH G 4 .   ? 45.059  -4.880  19.165  1.00 39.96  ? 2293 HOH A O   1 
HETATM 9104 O O   . HOH G 4 .   ? 50.579  -9.025  16.722  1.00 22.59  ? 2294 HOH A O   1 
HETATM 9105 O O   . HOH G 4 .   ? 41.825  -10.717 19.750  1.00 58.57  ? 2295 HOH A O   1 
HETATM 9106 O O   . HOH G 4 .   ? 51.308  -11.669 23.779  1.00 35.88  ? 2296 HOH A O   1 
HETATM 9107 O O   . HOH G 4 .   ? 47.191  -15.053 24.330  1.00 51.83  ? 2297 HOH A O   1 
HETATM 9108 O O   . HOH G 4 .   ? 53.084  -16.000 15.862  1.00 52.33  ? 2298 HOH A O   1 
HETATM 9109 O O   . HOH G 4 .   ? 48.206  -9.927  14.668  1.00 20.88  ? 2299 HOH A O   1 
HETATM 9110 O O   . HOH G 4 .   ? 51.537  -11.980 14.056  1.00 19.29  ? 2300 HOH A O   1 
HETATM 9111 O O   . HOH G 4 .   ? 50.129  -18.773 25.196  1.00 43.67  ? 2301 HOH A O   1 
HETATM 9112 O O   . HOH G 4 .   ? 48.986  -19.040 22.522  1.00 58.79  ? 2302 HOH A O   1 
HETATM 9113 O O   . HOH G 4 .   ? 52.226  -17.933 27.704  1.00 47.57  ? 2303 HOH A O   1 
HETATM 9114 O O   . HOH G 4 .   ? 54.218  -17.221 19.525  1.00 44.65  ? 2304 HOH A O   1 
HETATM 9115 O O   . HOH H 4 .   ? 72.117  11.842  -28.643 1.00 51.50  ? 2001 HOH B O   1 
HETATM 9116 O O   . HOH H 4 .   ? 63.259  12.359  -29.620 1.00 20.40  ? 2002 HOH B O   1 
HETATM 9117 O O   . HOH H 4 .   ? 52.610  7.031   -38.066 1.00 37.32  ? 2003 HOH B O   1 
HETATM 9118 O O   . HOH H 4 .   ? 51.358  6.122   -40.247 1.00 54.15  ? 2004 HOH B O   1 
HETATM 9119 O O   . HOH H 4 .   ? 39.337  0.726   -43.392 1.00 41.53  ? 2005 HOH B O   1 
HETATM 9120 O O   . HOH H 4 .   ? 42.198  -0.075  -43.261 1.00 59.41  ? 2006 HOH B O   1 
HETATM 9121 O O   . HOH H 4 .   ? 39.261  6.706   -42.782 1.00 36.18  ? 2007 HOH B O   1 
HETATM 9122 O O   . HOH H 4 .   ? 42.545  4.515   -37.926 1.00 32.85  ? 2008 HOH B O   1 
HETATM 9123 O O   . HOH H 4 .   ? 42.450  9.665   -48.684 1.00 48.52  ? 2009 HOH B O   1 
HETATM 9124 O O   . HOH H 4 .   ? 37.519  8.049   -44.418 1.00 48.10  ? 2010 HOH B O   1 
HETATM 9125 O O   . HOH H 4 .   ? 60.128  13.888  -43.770 1.00 24.81  ? 2011 HOH B O   1 
HETATM 9126 O O   . HOH H 4 .   ? 58.773  20.545  -47.019 1.00 33.11  ? 2012 HOH B O   1 
HETATM 9127 O O   . HOH H 4 .   ? 62.912  14.513  -44.662 1.00 42.09  ? 2013 HOH B O   1 
HETATM 9128 O O   . HOH H 4 .   ? 57.523  23.228  -47.329 1.00 56.89  ? 2014 HOH B O   1 
HETATM 9129 O O   . HOH H 4 .   ? 43.848  4.152   -22.043 1.00 33.71  ? 2015 HOH B O   1 
HETATM 9130 O O   . HOH H 4 .   ? 69.823  18.546  -43.536 1.00 48.40  ? 2016 HOH B O   1 
HETATM 9131 O O   . HOH H 4 .   ? 59.693  26.160  -48.196 1.00 41.87  ? 2017 HOH B O   1 
HETATM 9132 O O   . HOH H 4 .   ? 53.424  11.833  -14.398 1.00 46.65  ? 2018 HOH B O   1 
HETATM 9133 O O   . HOH H 4 .   ? 56.138  18.123  -16.303 1.00 53.48  ? 2019 HOH B O   1 
HETATM 9134 O O   . HOH H 4 .   ? 71.209  17.636  -31.771 1.00 47.86  ? 2020 HOH B O   1 
HETATM 9135 O O   . HOH H 4 .   ? 74.138  17.549  -42.290 1.00 45.25  ? 2021 HOH B O   1 
HETATM 9136 O O   . HOH H 4 .   ? 31.858  20.297  -27.254 1.00 17.33  ? 2022 HOH B O   1 
HETATM 9137 O O   . HOH H 4 .   ? 69.568  12.371  -37.582 1.00 57.01  ? 2023 HOH B O   1 
HETATM 9138 O O   . HOH H 4 .   ? 42.995  26.061  -19.840 1.00 32.33  ? 2024 HOH B O   1 
HETATM 9139 O O   . HOH H 4 .   ? 60.681  18.044  -19.672 1.00 51.15  ? 2025 HOH B O   1 
HETATM 9140 O O   . HOH H 4 .   ? 64.207  12.717  -42.304 1.00 31.65  ? 2026 HOH B O   1 
HETATM 9141 O O   . HOH H 4 .   ? 47.207  36.425  -42.765 1.00 64.05  ? 2027 HOH B O   1 
HETATM 9142 O O   . HOH H 4 .   ? 61.261  11.881  -41.958 1.00 37.60  ? 2028 HOH B O   1 
HETATM 9143 O O   . HOH H 4 .   ? 58.689  8.115   -40.837 1.00 38.05  ? 2029 HOH B O   1 
HETATM 9144 O O   . HOH H 4 .   ? 62.105  8.059   -41.604 1.00 44.18  ? 2030 HOH B O   1 
HETATM 9145 O O   . HOH H 4 .   ? 64.499  9.223   -40.931 1.00 39.41  ? 2031 HOH B O   1 
HETATM 9146 O O   . HOH H 4 .   ? 34.153  31.115  -24.601 1.00 43.37  ? 2032 HOH B O   1 
HETATM 9147 O O   . HOH H 4 .   ? 48.560  33.034  -12.895 1.00 42.73  ? 2033 HOH B O   1 
HETATM 9148 O O   . HOH H 4 .   ? 59.443  4.659   -39.734 1.00 40.08  ? 2034 HOH B O   1 
HETATM 9149 O O   . HOH H 4 .   ? 53.759  3.422   -40.917 1.00 41.47  ? 2035 HOH B O   1 
HETATM 9150 O O   . HOH H 4 .   ? 21.158  33.451  -31.527 1.00 60.09  ? 2036 HOH B O   1 
HETATM 9151 O O   . HOH H 4 .   ? 39.144  2.611   -31.906 1.00 41.61  ? 2037 HOH B O   1 
HETATM 9152 O O   . HOH H 4 .   ? 43.815  -3.193  -34.124 1.00 48.60  ? 2038 HOH B O   1 
HETATM 9153 O O   . HOH H 4 .   ? 42.592  7.873   -34.432 1.00 27.62  ? 2039 HOH B O   1 
HETATM 9154 O O   . HOH H 4 .   ? 45.295  -3.349  -21.126 1.00 46.41  ? 2040 HOH B O   1 
HETATM 9155 O O   . HOH H 4 .   ? 13.920  22.646  -24.888 1.00 45.16  ? 2041 HOH B O   1 
HETATM 9156 O O   . HOH H 4 .   ? 39.893  -1.344  -34.165 1.00 59.98  ? 2042 HOH B O   1 
HETATM 9157 O O   . HOH H 4 .   ? 63.823  5.209   -22.106 1.00 48.54  ? 2043 HOH B O   1 
HETATM 9158 O O   . HOH H 4 .   ? 66.163  4.730   -32.255 1.00 56.34  ? 2044 HOH B O   1 
HETATM 9159 O O   . HOH H 4 .   ? 63.341  1.728   -37.744 1.00 60.89  ? 2045 HOH B O   1 
HETATM 9160 O O   . HOH H 4 .   ? 63.529  12.248  -21.286 1.00 43.99  ? 2046 HOH B O   1 
HETATM 9161 O O   . HOH H 4 .   ? 36.918  13.454  -38.458 1.00 37.03  ? 2047 HOH B O   1 
HETATM 9162 O O   . HOH H 4 .   ? 8.325   16.066  -50.154 1.00 37.58  ? 2048 HOH B O   1 
HETATM 9163 O O   . HOH H 4 .   ? 41.791  5.110   -23.794 1.00 23.51  ? 2049 HOH B O   1 
HETATM 9164 O O   . HOH H 4 .   ? 44.645  5.974   -19.266 1.00 44.93  ? 2050 HOH B O   1 
HETATM 9165 O O   . HOH H 4 .   ? 44.474  8.550   -19.613 1.00 14.95  ? 2051 HOH B O   1 
HETATM 9166 O O   . HOH H 4 .   ? 42.912  11.582  -18.239 1.00 24.76  ? 2052 HOH B O   1 
HETATM 9167 O O   . HOH H 4 .   ? 47.917  4.666   -20.968 1.00 39.28  ? 2053 HOH B O   1 
HETATM 9168 O O   . HOH H 4 .   ? 56.998  6.202   -20.187 1.00 31.10  ? 2054 HOH B O   1 
HETATM 9169 O O   . HOH H 4 .   ? 50.674  13.210  -15.026 1.00 32.47  ? 2055 HOH B O   1 
HETATM 9170 O O   . HOH H 4 .   ? 55.400  13.744  -15.355 1.00 32.40  ? 2056 HOH B O   1 
HETATM 9171 O O   . HOH H 4 .   ? 47.915  10.965  -16.868 1.00 31.32  ? 2057 HOH B O   1 
HETATM 9172 O O   . HOH H 4 .   ? 49.768  4.193   -18.606 1.00 39.33  ? 2058 HOH B O   1 
HETATM 9173 O O   . HOH H 4 .   ? 61.277  8.363   -17.060 1.00 46.29  ? 2059 HOH B O   1 
HETATM 9174 O O   . HOH H 4 .   ? 53.580  2.116   -15.652 1.00 50.52  ? 2060 HOH B O   1 
HETATM 9175 O O   . HOH H 4 .   ? 54.231  30.371  -46.985 1.00 31.81  ? 2061 HOH B O   1 
HETATM 9176 O O   . HOH H 4 .   ? 59.410  14.478  -14.099 1.00 33.70  ? 2062 HOH B O   1 
HETATM 9177 O O   . HOH H 4 .   ? 59.601  11.459  -15.554 1.00 50.92  ? 2063 HOH B O   1 
HETATM 9178 O O   . HOH H 4 .   ? 62.604  14.638  -21.747 1.00 31.02  ? 2064 HOH B O   1 
HETATM 9179 O O   . HOH H 4 .   ? 63.451  12.459  -18.624 1.00 50.02  ? 2065 HOH B O   1 
HETATM 9180 O O   . HOH H 4 .   ? 57.051  15.623  -17.513 1.00 20.67  ? 2066 HOH B O   1 
HETATM 9181 O O   . HOH H 4 .   ? 62.758  10.495  -17.226 1.00 47.85  ? 2067 HOH B O   1 
HETATM 9182 O O   . HOH H 4 .   ? 56.766  17.745  -21.974 1.00 34.06  ? 2068 HOH B O   1 
HETATM 9183 O O   . HOH H 4 .   ? 44.248  19.930  -29.963 1.00 13.88  ? 2069 HOH B O   1 
HETATM 9184 O O   . HOH H 4 .   ? 35.896  20.330  -30.613 1.00 17.82  ? 2070 HOH B O   1 
HETATM 9185 O O   . HOH H 4 .   ? 38.903  15.490  -22.520 1.00 18.02  ? 2071 HOH B O   1 
HETATM 9186 O O   . HOH H 4 .   ? 32.690  19.862  -24.543 1.00 14.05  ? 2072 HOH B O   1 
HETATM 9187 O O   . HOH H 4 .   ? 39.433  14.883  -19.815 1.00 14.11  ? 2073 HOH B O   1 
HETATM 9188 O O   . HOH H 4 .   ? 44.247  23.339  -20.664 1.00 28.58  ? 2074 HOH B O   1 
HETATM 9189 O O   . HOH H 4 .   ? 71.792  28.973  -30.940 1.00 75.68  ? 2075 HOH B O   1 
HETATM 9190 O O   . HOH H 4 .   ? 54.194  15.796  -16.407 1.00 19.81  ? 2076 HOH B O   1 
HETATM 9191 O O   . HOH H 4 .   ? 57.521  18.099  -18.902 1.00 47.01  ? 2077 HOH B O   1 
HETATM 9192 O O   . HOH H 4 .   ? 49.445  37.214  -40.823 1.00 47.77  ? 2078 HOH B O   1 
HETATM 9193 O O   . HOH H 4 .   ? 45.337  24.187  -36.268 1.00 11.37  ? 2079 HOH B O   1 
HETATM 9194 O O   . HOH H 4 .   ? 48.315  34.122  -43.895 1.00 29.73  ? 2080 HOH B O   1 
HETATM 9195 O O   . HOH H 4 .   ? 43.810  24.520  -29.248 1.00 12.76  ? 2081 HOH B O   1 
HETATM 9196 O O   . HOH H 4 .   ? 46.203  35.885  -32.500 1.00 37.24  ? 2082 HOH B O   1 
HETATM 9197 O O   . HOH H 4 .   ? 54.787  24.192  -19.447 1.00 44.09  ? 2083 HOH B O   1 
HETATM 9198 O O   . HOH H 4 .   ? 36.004  31.918  -26.528 1.00 21.49  ? 2084 HOH B O   1 
HETATM 9199 O O   . HOH H 4 .   ? 33.393  30.622  -28.544 1.00 17.85  ? 2085 HOH B O   1 
HETATM 9200 O O   . HOH H 4 .   ? 47.404  31.459  -14.885 1.00 43.47  ? 2086 HOH B O   1 
HETATM 9201 O O   . HOH H 4 .   ? 39.113  26.591  -34.887 1.00 29.00  ? 2087 HOH B O   1 
HETATM 9202 O O   . HOH H 4 .   ? 37.085  21.549  -36.201 1.00 20.82  ? 2088 HOH B O   1 
HETATM 9203 O O   . HOH H 4 .   ? 30.051  20.495  -29.434 1.00 30.73  ? 2089 HOH B O   1 
HETATM 9204 O O   . HOH H 4 .   ? 23.005  32.003  -33.014 1.00 40.23  ? 2090 HOH B O   1 
HETATM 9205 O O   . HOH H 4 .   ? 26.162  28.015  -45.266 1.00 30.68  ? 2091 HOH B O   1 
HETATM 9206 O O   . HOH H 4 .   ? 37.481  35.253  -30.345 1.00 34.27  ? 2092 HOH B O   1 
HETATM 9207 O O   . HOH H 4 .   ? 17.339  28.174  -35.351 1.00 49.17  ? 2093 HOH B O   1 
HETATM 9208 O O   . HOH H 4 .   ? 38.140  33.544  -23.713 1.00 58.06  ? 2094 HOH B O   1 
HETATM 9209 O O   . HOH H 4 .   ? 19.590  31.110  -44.039 1.00 62.79  ? 2095 HOH B O   1 
HETATM 9210 O O   . HOH H 4 .   ? 31.781  33.109  -22.056 1.00 25.23  ? 2096 HOH B O   1 
HETATM 9211 O O   . HOH H 4 .   ? 35.034  35.243  -28.757 1.00 37.54  ? 2097 HOH B O   1 
HETATM 9212 O O   . HOH H 4 .   ? 35.950  36.878  -26.756 1.00 50.40  ? 2098 HOH B O   1 
HETATM 9213 O O   . HOH H 4 .   ? 19.646  24.998  -36.972 1.00 17.71  ? 2099 HOH B O   1 
HETATM 9214 O O   . HOH H 4 .   ? 10.211  24.758  -37.105 1.00 90.11  ? 2100 HOH B O   1 
HETATM 9215 O O   . HOH H 4 .   ? 30.807  6.030   -37.485 1.00 22.38  ? 2101 HOH B O   1 
HETATM 9216 O O   . HOH H 4 .   ? 30.434  4.809   -26.030 1.00 46.08  ? 2102 HOH B O   1 
HETATM 9217 O O   . HOH H 4 .   ? 32.209  2.514   -31.565 1.00 44.10  ? 2103 HOH B O   1 
HETATM 9218 O O   . HOH H 4 .   ? 34.762  6.645   -25.976 1.00 27.40  ? 2104 HOH B O   1 
HETATM 9219 O O   . HOH H 4 .   ? 26.078  12.745  -25.134 1.00 32.29  ? 2105 HOH B O   1 
HETATM 9220 O O   . HOH H 4 .   ? 30.821  18.172  -23.547 1.00 21.05  ? 2106 HOH B O   1 
HETATM 9221 O O   . HOH H 4 .   ? 33.291  19.268  -29.264 1.00 24.93  ? 2107 HOH B O   1 
HETATM 9222 O O   . HOH H 4 .   ? 28.232  21.100  -21.190 1.00 18.06  ? 2108 HOH B O   1 
HETATM 9223 O O   . HOH H 4 .   ? 24.935  13.673  -22.655 1.00 13.57  ? 2109 HOH B O   1 
HETATM 9224 O O   . HOH H 4 .   ? 19.861  18.815  -23.077 1.00 62.51  ? 2110 HOH B O   1 
HETATM 9225 O O   . HOH H 4 .   ? 14.927  19.287  -27.419 1.00 30.37  ? 2111 HOH B O   1 
HETATM 9226 O O   . HOH H 4 .   ? 14.779  30.712  -25.447 1.00 47.80  ? 2112 HOH B O   1 
HETATM 9227 O O   . HOH H 4 .   ? 24.376  31.001  -25.496 1.00 27.19  ? 2113 HOH B O   1 
HETATM 9228 O O   . HOH H 4 .   ? 13.130  21.274  -27.083 1.00 41.48  ? 2114 HOH B O   1 
HETATM 9229 O O   . HOH H 4 .   ? 14.266  24.801  -27.023 1.00 51.99  ? 2115 HOH B O   1 
HETATM 9230 O O   . HOH H 4 .   ? 11.993  24.160  -31.241 1.00 34.34  ? 2116 HOH B O   1 
HETATM 9231 O O   . HOH H 4 .   ? 33.103  5.519   -38.640 1.00 25.11  ? 2117 HOH B O   1 
HETATM 9232 O O   . HOH H 4 .   ? 40.482  0.891   -35.728 1.00 46.27  ? 2118 HOH B O   1 
HETATM 9233 O O   . HOH H 4 .   ? 31.187  -2.718  -36.559 1.00 54.52  ? 2119 HOH B O   1 
HETATM 9234 O O   . HOH H 4 .   ? 32.302  0.867   -42.230 1.00 46.33  ? 2120 HOH B O   1 
HETATM 9235 O O   . HOH H 4 .   ? 21.341  2.280   -36.552 1.00 31.24  ? 2121 HOH B O   1 
HETATM 9236 O O   . HOH H 4 .   ? 28.511  -2.886  -36.873 1.00 53.60  ? 2122 HOH B O   1 
HETATM 9237 O O   . HOH H 4 .   ? 21.020  -0.380  -36.168 1.00 61.01  ? 2123 HOH B O   1 
HETATM 9238 O O   . HOH H 4 .   ? 12.949  9.085   -36.493 1.00 29.90  ? 2124 HOH B O   1 
HETATM 9239 O O   . HOH H 4 .   ? 14.031  6.772   -30.497 1.00 53.32  ? 2125 HOH B O   1 
HETATM 9240 O O   . HOH H 4 .   ? 15.754  14.674  -41.001 1.00 33.99  ? 2126 HOH B O   1 
HETATM 9241 O O   . HOH H 4 .   ? 5.042   11.329  -45.065 1.00 46.53  ? 2127 HOH B O   1 
HETATM 9242 O O   . HOH H 4 .   ? 4.710   14.561  -46.344 1.00 35.53  ? 2128 HOH B O   1 
HETATM 9243 O O   . HOH H 4 .   ? 30.235  13.417  -40.322 1.00 31.20  ? 2129 HOH B O   1 
HETATM 9244 O O   . HOH H 4 .   ? 26.166  14.609  -33.733 1.00 25.08  ? 2130 HOH B O   1 
HETATM 9245 O O   . HOH H 4 .   ? 33.683  12.431  -40.736 1.00 43.88  ? 2131 HOH B O   1 
HETATM 9246 O O   . HOH H 4 .   ? 36.235  11.610  -40.306 1.00 35.44  ? 2132 HOH B O   1 
HETATM 9247 O O   . HOH H 4 .   ? 34.157  8.280   -45.404 1.00 46.81  ? 2133 HOH B O   1 
HETATM 9248 O O   . HOH H 4 .   ? 34.253  5.390   -46.390 1.00 44.88  ? 2134 HOH B O   1 
HETATM 9249 O O   . HOH H 4 .   ? 28.610  18.300  -43.366 1.00 43.26  ? 2135 HOH B O   1 
HETATM 9250 O O   . HOH H 4 .   ? 19.530  5.248   -48.614 1.00 51.76  ? 2136 HOH B O   1 
HETATM 9251 O O   . HOH H 4 .   ? 13.715  16.344  -43.234 1.00 38.56  ? 2137 HOH B O   1 
HETATM 9252 O O   . HOH H 4 .   ? 21.369  11.096  -54.593 1.00 53.99  ? 2138 HOH B O   1 
HETATM 9253 O O   . HOH H 4 .   ? 11.367  17.903  -50.414 1.00 49.61  ? 2139 HOH B O   1 
HETATM 9254 O O   . HOH H 4 .   ? 21.811  15.967  -47.050 1.00 35.97  ? 2140 HOH B O   1 
HETATM 9255 O O   . HOH H 4 .   ? 36.147  19.988  -37.821 1.00 24.56  ? 2141 HOH B O   1 
HETATM 9256 O O   . HOH H 4 .   ? 37.365  17.599  -39.316 1.00 49.92  ? 2142 HOH B O   1 
HETATM 9257 O O   . HOH H 4 .   ? 36.122  20.141  -42.016 1.00 40.27  ? 2143 HOH B O   1 
HETATM 9258 O O   . HOH H 4 .   ? 37.945  17.027  -50.698 1.00 30.96  ? 2144 HOH B O   1 
HETATM 9259 O O   . HOH H 4 .   ? 39.749  18.974  -43.954 1.00 34.06  ? 2145 HOH B O   1 
HETATM 9260 O O   . HOH H 4 .   ? 40.329  21.340  -44.498 1.00 24.25  ? 2146 HOH B O   1 
HETATM 9261 O O   . HOH H 4 .   ? 39.411  9.277   -41.811 1.00 38.17  ? 2147 HOH B O   1 
HETATM 9262 O O   . HOH H 4 .   ? 33.509  15.775  -54.008 1.00 43.43  ? 2148 HOH B O   1 
HETATM 9263 O O   . HOH H 4 .   ? 32.909  15.486  -56.859 1.00 47.82  ? 2149 HOH B O   1 
HETATM 9264 O O   . HOH H 4 .   ? 27.627  18.605  -58.441 1.00 22.41  ? 2150 HOH B O   1 
HETATM 9265 O O   . HOH H 4 .   ? 21.590  13.774  -54.676 1.00 37.04  ? 2151 HOH B O   1 
HETATM 9266 O O   . HOH H 4 .   ? 26.043  25.323  -52.342 1.00 32.50  ? 2152 HOH B O   1 
HETATM 9267 O O   . HOH H 4 .   ? 23.630  14.320  -48.557 1.00 52.82  ? 2153 HOH B O   1 
HETATM 9268 O O   . HOH H 4 .   ? 33.833  19.834  -40.358 1.00 44.65  ? 2154 HOH B O   1 
HETATM 9269 O O   . HOH H 4 .   ? 37.608  24.625  -36.425 1.00 31.05  ? 2155 HOH B O   1 
HETATM 9270 O O   . HOH H 4 .   ? 44.551  27.972  -50.899 1.00 38.69  ? 2156 HOH B O   1 
HETATM 9271 O O   . HOH H 4 .   ? 42.532  36.949  -48.743 1.00 55.76  ? 2157 HOH B O   1 
HETATM 9272 O O   . HOH H 4 .   ? 45.319  37.102  -48.673 1.00 51.41  ? 2158 HOH B O   1 
HETATM 9273 O O   . HOH H 4 .   ? 52.693  28.123  -46.200 1.00 25.94  ? 2159 HOH B O   1 
HETATM 9274 O O   . HOH H 4 .   ? 49.497  34.420  -46.411 1.00 32.38  ? 2160 HOH B O   1 
HETATM 9275 O O   . HOH H 4 .   ? 53.418  32.904  -47.862 1.00 38.89  ? 2161 HOH B O   1 
HETATM 9276 O O   . HOH H 4 .   ? 44.653  35.819  -52.589 1.00 117.82 ? 2162 HOH B O   1 
HETATM 9277 O O   . HOH H 4 .   ? 55.309  25.854  -51.798 1.00 31.79  ? 2163 HOH B O   1 
HETATM 9278 O O   . HOH H 4 .   ? 49.644  18.280  -57.780 1.00 53.47  ? 2164 HOH B O   1 
HETATM 9279 O O   . HOH H 4 .   ? 46.924  15.809  -52.554 1.00 52.55  ? 2165 HOH B O   1 
HETATM 9280 O O   . HOH H 4 .   ? 44.760  17.216  -51.830 1.00 50.45  ? 2166 HOH B O   1 
HETATM 9281 O O   . HOH H 4 .   ? 38.591  19.340  -41.698 1.00 45.87  ? 2167 HOH B O   1 
HETATM 9282 O O   . HOH H 4 .   ? 44.315  23.333  -38.815 1.00 12.65  ? 2168 HOH B O   1 
HETATM 9283 O O   . HOH H 4 .   ? 53.570  25.757  -46.982 1.00 39.90  ? 2169 HOH B O   1 
HETATM 9284 O O   . HOH H 4 .   ? 58.668  29.675  -39.286 1.00 36.09  ? 2170 HOH B O   1 
HETATM 9285 O O   . HOH H 4 .   ? 70.677  26.855  -32.380 1.00 44.61  ? 2171 HOH B O   1 
HETATM 9286 O O   . HOH H 4 .   ? 65.065  28.801  -35.690 1.00 43.98  ? 2172 HOH B O   1 
HETATM 9287 O O   . HOH H 4 .   ? 73.162  19.783  -29.098 1.00 51.21  ? 2173 HOH B O   1 
HETATM 9288 O O   . HOH H 4 .   ? 64.522  15.467  -23.646 1.00 26.15  ? 2174 HOH B O   1 
HETATM 9289 O O   . HOH H 4 .   ? 60.803  23.376  -20.265 1.00 40.95  ? 2175 HOH B O   1 
HETATM 9290 O O   . HOH H 4 .   ? 64.781  18.019  -20.721 1.00 34.41  ? 2176 HOH B O   1 
HETATM 9291 O O   . HOH H 4 .   ? 59.468  20.925  -20.563 1.00 34.02  ? 2177 HOH B O   1 
HETATM 9292 O O   . HOH H 4 .   ? 61.744  31.489  -28.818 1.00 49.45  ? 2178 HOH B O   1 
HETATM 9293 O O   . HOH H 4 .   ? 53.925  29.409  -29.947 1.00 27.16  ? 2179 HOH B O   1 
HETATM 9294 O O   . HOH H 4 .   ? 54.579  33.551  -28.932 1.00 55.89  ? 2180 HOH B O   1 
HETATM 9295 O O   . HOH H 4 .   ? 52.516  32.118  -26.406 1.00 49.70  ? 2181 HOH B O   1 
HETATM 9296 O O   . HOH H 4 .   ? 62.224  31.173  -25.747 1.00 70.72  ? 2182 HOH B O   1 
HETATM 9297 O O   . HOH H 4 .   ? 57.544  31.758  -35.860 1.00 58.98  ? 2183 HOH B O   1 
HETATM 9298 O O   . HOH H 4 .   ? 56.526  35.095  -38.141 1.00 56.33  ? 2184 HOH B O   1 
HETATM 9299 O O   . HOH H 4 .   ? 50.342  34.698  -40.322 1.00 30.86  ? 2185 HOH B O   1 
HETATM 9300 O O   . HOH H 4 .   ? 56.353  30.045  -40.487 1.00 41.36  ? 2186 HOH B O   1 
HETATM 9301 O O   . HOH H 4 .   ? 53.158  28.197  -43.349 1.00 26.57  ? 2187 HOH B O   1 
HETATM 9302 O O   . HOH H 4 .   ? 56.679  32.303  -38.814 1.00 45.41  ? 2188 HOH B O   1 
HETATM 9303 O O   . HOH H 4 .   ? 50.284  32.833  -42.109 1.00 27.31  ? 2189 HOH B O   1 
HETATM 9304 O O   . HOH H 4 .   ? 46.389  31.944  -44.475 1.00 27.86  ? 2190 HOH B O   1 
HETATM 9305 O O   . HOH H 4 .   ? 43.403  33.154  -40.700 1.00 47.26  ? 2191 HOH B O   1 
HETATM 9306 O O   . HOH H 4 .   ? 47.554  33.653  -33.354 1.00 31.28  ? 2192 HOH B O   1 
HETATM 9307 O O   . HOH H 4 .   ? 50.788  33.380  -25.047 1.00 35.87  ? 2193 HOH B O   1 
HETATM 9308 O O   . HOH H 4 .   ? 43.336  31.424  -23.664 1.00 29.49  ? 2194 HOH B O   1 
HETATM 9309 O O   . HOH H 4 .   ? 52.133  24.682  -20.307 1.00 25.39  ? 2195 HOH B O   1 
HETATM 9310 O O   . HOH H 4 .   ? 52.705  32.116  -23.920 1.00 34.59  ? 2196 HOH B O   1 
HETATM 9311 O O   . HOH H 4 .   ? 58.156  26.658  -20.236 1.00 38.98  ? 2197 HOH B O   1 
HETATM 9312 O O   . HOH H 4 .   ? 48.510  34.151  -18.119 1.00 61.96  ? 2198 HOH B O   1 
HETATM 9313 O O   . HOH H 4 .   ? 49.715  31.903  -21.757 1.00 39.95  ? 2199 HOH B O   1 
HETATM 9314 O O   . HOH H 4 .   ? 43.576  28.548  -19.720 1.00 30.58  ? 2200 HOH B O   1 
HETATM 9315 O O   . HOH H 4 .   ? 45.567  31.209  -37.626 1.00 29.71  ? 2201 HOH B O   1 
HETATM 9316 O O   . HOH H 4 .   ? 35.599  26.223  -37.167 1.00 49.93  ? 2202 HOH B O   1 
HETATM 9317 O O   . HOH H 4 .   ? 40.558  33.619  -41.080 1.00 53.05  ? 2203 HOH B O   1 
HETATM 9318 O O   . HOH H 4 .   ? 44.669  33.632  -43.151 1.00 33.86  ? 2204 HOH B O   1 
HETATM 9319 O O   . HOH H 4 .   ? 30.241  19.252  -54.444 1.00 28.94  ? 2205 HOH B O   1 
HETATM 9320 O O   . HOH H 4 .   ? 27.602  25.400  -56.090 1.00 52.28  ? 2206 HOH B O   1 
HETATM 9321 O O   . HOH H 4 .   ? 38.337  20.715  -52.531 1.00 44.06  ? 2207 HOH B O   1 
HETATM 9322 O O   . HOH H 4 .   ? 31.858  17.375  -54.987 1.00 46.48  ? 2208 HOH B O   1 
HETATM 9323 O O   . HOH H 4 .   ? 29.601  34.752  -47.125 1.00 36.07  ? 2209 HOH B O   1 
HETATM 9324 O O   . HOH H 4 .   ? 35.615  37.746  -40.049 1.00 52.01  ? 2210 HOH B O   1 
HETATM 9325 O O   . HOH H 4 .   ? 33.185  36.060  -41.780 1.00 28.02  ? 2211 HOH B O   1 
HETATM 9326 O O   . HOH H 4 .   ? 40.445  35.969  -39.842 1.00 59.92  ? 2212 HOH B O   1 
HETATM 9327 O O   . HOH H 4 .   ? 39.639  32.869  -38.021 1.00 38.97  ? 2213 HOH B O   1 
HETATM 9328 O O   . HOH H 4 .   ? 37.870  35.850  -32.813 1.00 27.49  ? 2214 HOH B O   1 
HETATM 9329 O O   . HOH H 4 .   ? 43.634  36.260  -31.091 1.00 40.54  ? 2215 HOH B O   1 
HETATM 9330 O O   . HOH H 4 .   ? 41.722  35.038  -37.857 1.00 38.62  ? 2216 HOH B O   1 
HETATM 9331 O O   . HOH H 4 .   ? 38.676  32.927  -26.337 1.00 40.51  ? 2217 HOH B O   1 
HETATM 9332 O O   . HOH H 4 .   ? 39.449  34.710  -28.483 1.00 37.21  ? 2218 HOH B O   1 
HETATM 9333 O O   . HOH H 4 .   ? 36.305  25.251  -25.145 1.00 14.85  ? 2219 HOH B O   1 
HETATM 9334 O O   . HOH H 4 .   ? 41.252  30.724  -20.349 1.00 44.09  ? 2220 HOH B O   1 
HETATM 9335 O O   . HOH H 4 .   ? 35.854  31.692  -22.461 1.00 27.67  ? 2221 HOH B O   1 
HETATM 9336 O O   . HOH H 4 .   ? 34.829  23.562  -23.036 1.00 15.54  ? 2222 HOH B O   1 
HETATM 9337 O O   . HOH H 4 .   ? 30.324  22.569  -21.830 1.00 15.10  ? 2223 HOH B O   1 
HETATM 9338 O O   . HOH H 4 .   ? 27.095  25.363  -23.401 1.00 20.81  ? 2224 HOH B O   1 
HETATM 9339 O O   . HOH H 4 .   ? 31.616  28.136  -17.911 1.00 27.55  ? 2225 HOH B O   1 
HETATM 9340 O O   . HOH H 4 .   ? 30.303  31.643  -20.118 1.00 45.73  ? 2226 HOH B O   1 
HETATM 9341 O O   . HOH H 4 .   ? 32.542  22.374  -23.938 1.00 18.58  ? 2227 HOH B O   1 
HETATM 9342 O O   . HOH H 4 .   ? 32.401  29.501  -26.141 1.00 17.33  ? 2228 HOH B O   1 
HETATM 9343 O O   . HOH H 4 .   ? 25.125  28.868  -23.163 1.00 35.98  ? 2229 HOH B O   1 
HETATM 9344 O O   . HOH H 4 .   ? 28.388  33.554  -20.450 1.00 43.32  ? 2230 HOH B O   1 
HETATM 9345 O O   . HOH H 4 .   ? 23.700  33.571  -24.597 1.00 46.33  ? 2231 HOH B O   1 
HETATM 9346 O O   . HOH H 4 .   ? 30.372  30.688  -27.964 1.00 25.09  ? 2232 HOH B O   1 
HETATM 9347 O O   . HOH H 4 .   ? 34.400  35.349  -25.109 1.00 47.93  ? 2233 HOH B O   1 
HETATM 9348 O O   . HOH H 4 .   ? 33.809  33.126  -27.841 1.00 22.34  ? 2234 HOH B O   1 
HETATM 9349 O O   . HOH H 4 .   ? 31.290  35.779  -22.918 1.00 40.07  ? 2235 HOH B O   1 
HETATM 9350 O O   . HOH H 4 .   ? 31.105  38.435  -32.845 1.00 28.83  ? 2236 HOH B O   1 
HETATM 9351 O O   . HOH H 4 .   ? 31.697  32.203  -24.546 1.00 27.39  ? 2237 HOH B O   1 
HETATM 9352 O O   . HOH H 4 .   ? 26.800  34.208  -40.540 1.00 42.62  ? 2238 HOH B O   1 
HETATM 9353 O O   . HOH I 4 .   ? 22.780  17.740  -8.117  1.00 60.23  ? 2001 HOH D O   1 
HETATM 9354 O O   . HOH I 4 .   ? 21.361  16.058  -12.740 1.00 35.83  ? 2002 HOH D O   1 
HETATM 9355 O O   . HOH I 4 .   ? 27.098  20.896  -18.794 1.00 27.83  ? 2003 HOH D O   1 
HETATM 9356 O O   . HOH I 4 .   ? 26.022  22.564  -21.063 1.00 42.19  ? 2004 HOH D O   1 
HETATM 9357 O O   . HOH I 4 .   ? 22.013  17.605  -15.820 1.00 22.05  ? 2005 HOH D O   1 
HETATM 9358 O O   . HOH I 4 .   ? 25.092  27.342  -13.128 1.00 39.83  ? 2006 HOH D O   1 
HETATM 9359 O O   . HOH I 4 .   ? 24.123  23.398  -8.748  1.00 37.24  ? 2007 HOH D O   1 
HETATM 9360 O O   . HOH I 4 .   ? 32.093  26.424  -15.114 1.00 29.59  ? 2008 HOH D O   1 
HETATM 9361 O O   . HOH I 4 .   ? 18.665  16.635  -12.463 1.00 43.35  ? 2009 HOH D O   1 
HETATM 9362 O O   . HOH I 4 .   ? 24.998  25.947  -21.729 1.00 58.47  ? 2010 HOH D O   1 
HETATM 9363 O O   . HOH I 4 .   ? 29.391  24.974  -9.033  1.00 41.57  ? 2011 HOH D O   1 
HETATM 9364 O O   . HOH I 4 .   ? 36.137  33.532  -12.266 1.00 56.92  ? 2012 HOH D O   1 
HETATM 9365 O O   . HOH I 4 .   ? 33.948  32.066  -18.458 1.00 24.41  ? 2013 HOH D O   1 
HETATM 9366 O O   . HOH I 4 .   ? 34.250  32.977  -20.974 1.00 25.77  ? 2014 HOH D O   1 
HETATM 9367 O O   . HOH I 4 .   ? 34.339  33.267  -16.208 1.00 45.13  ? 2015 HOH D O   1 
HETATM 9368 O O   . HOH I 4 .   ? 31.625  30.743  -18.055 1.00 33.01  ? 2016 HOH D O   1 
HETATM 9369 O O   . HOH I 4 .   ? 34.166  33.645  -7.006  1.00 35.07  ? 2017 HOH D O   1 
HETATM 9370 O O   . HOH I 4 .   ? 32.473  36.609  -2.898  1.00 38.19  ? 2018 HOH D O   1 
HETATM 9371 O O   . HOH I 4 .   ? 49.405  31.836  -10.635 1.00 47.53  ? 2019 HOH D O   1 
HETATM 9372 O O   . HOH I 4 .   ? 39.189  32.882  -3.535  1.00 35.39  ? 2020 HOH D O   1 
HETATM 9373 O O   . HOH I 4 .   ? 52.900  30.625  -10.751 1.00 50.01  ? 2021 HOH D O   1 
HETATM 9374 O O   . HOH I 4 .   ? 54.497  27.377  -11.883 1.00 41.36  ? 2022 HOH D O   1 
HETATM 9375 O O   . HOH I 4 .   ? 52.371  20.726  0.268   1.00 43.83  ? 2023 HOH D O   1 
HETATM 9376 O O   . HOH I 4 .   ? 53.335  24.117  -2.142  1.00 22.89  ? 2024 HOH D O   1 
HETATM 9377 O O   . HOH I 4 .   ? 50.427  20.303  -13.551 1.00 32.72  ? 2025 HOH D O   1 
HETATM 9378 O O   . HOH I 4 .   ? 44.258  34.732  -9.807  1.00 48.90  ? 2026 HOH D O   1 
HETATM 9379 O O   . HOH I 4 .   ? 54.381  23.521  -9.758  1.00 32.82  ? 2027 HOH D O   1 
HETATM 9380 O O   . HOH I 4 .   ? 55.717  21.833  -3.237  1.00 42.41  ? 2028 HOH D O   1 
HETATM 9381 O O   . HOH I 4 .   ? 52.152  35.915  1.475   1.00 49.61  ? 2029 HOH D O   1 
HETATM 9382 O O   . HOH I 4 .   ? 56.999  28.019  -5.720  1.00 55.45  ? 2030 HOH D O   1 
HETATM 9383 O O   . HOH I 4 .   ? 56.136  26.728  -9.812  1.00 38.92  ? 2031 HOH D O   1 
HETATM 9384 O O   . HOH I 4 .   ? 24.748  23.098  9.173   1.00 36.66  ? 2032 HOH D O   1 
HETATM 9385 O O   . HOH I 4 .   ? 53.093  24.617  -11.796 1.00 40.00  ? 2033 HOH D O   1 
HETATM 9386 O O   . HOH I 4 .   ? 47.140  17.468  14.661  1.00 48.26  ? 2034 HOH D O   1 
HETATM 9387 O O   . HOH I 4 .   ? 51.337  23.896  -14.233 1.00 38.54  ? 2035 HOH D O   1 
HETATM 9388 O O   . HOH I 4 .   ? 49.116  22.819  -13.142 1.00 27.13  ? 2036 HOH D O   1 
HETATM 9389 O O   . HOH I 4 .   ? 40.284  26.496  -19.729 1.00 22.63  ? 2037 HOH D O   1 
HETATM 9390 O O   . HOH I 4 .   ? 34.796  25.262  -15.691 1.00 33.80  ? 2038 HOH D O   1 
HETATM 9391 O O   . HOH I 4 .   ? 37.021  32.332  -14.915 1.00 32.69  ? 2039 HOH D O   1 
HETATM 9392 O O   . HOH I 4 .   ? 56.857  13.198  -4.547  1.00 46.92  ? 2040 HOH D O   1 
HETATM 9393 O O   . HOH I 4 .   ? 58.892  14.941  -4.350  1.00 41.98  ? 2041 HOH D O   1 
HETATM 9394 O O   . HOH I 4 .   ? 41.685  33.542  -9.610  1.00 33.60  ? 2042 HOH D O   1 
HETATM 9395 O O   . HOH I 4 .   ? 40.070  35.495  -5.379  1.00 55.54  ? 2043 HOH D O   1 
HETATM 9396 O O   . HOH I 4 .   ? 53.069  28.846  -4.267  1.00 28.20  ? 2044 HOH D O   1 
HETATM 9397 O O   . HOH I 4 .   ? 50.370  29.802  -0.263  1.00 28.95  ? 2045 HOH D O   1 
HETATM 9398 O O   . HOH I 4 .   ? 45.738  15.241  15.216  1.00 37.54  ? 2046 HOH D O   1 
HETATM 9399 O O   . HOH I 4 .   ? 34.540  21.232  7.053   1.00 54.61  ? 2047 HOH D O   1 
HETATM 9400 O O   . HOH I 4 .   ? 52.371  32.220  2.222   1.00 49.47  ? 2048 HOH D O   1 
HETATM 9401 O O   . HOH I 4 .   ? 49.491  33.919  2.004   1.00 50.02  ? 2049 HOH D O   1 
HETATM 9402 O O   . HOH I 4 .   ? 44.946  29.738  12.637  1.00 44.79  ? 2050 HOH D O   1 
HETATM 9403 O O   . HOH I 4 .   ? 51.666  15.851  -15.310 1.00 31.25  ? 2051 HOH D O   1 
HETATM 9404 O O   . HOH I 4 .   ? 42.528  33.851  4.084   1.00 79.87  ? 2052 HOH D O   1 
HETATM 9405 O O   . HOH I 4 .   ? 22.344  25.603  3.804   1.00 45.09  ? 2053 HOH D O   1 
HETATM 9406 O O   . HOH I 4 .   ? 24.779  23.407  6.419   1.00 30.62  ? 2054 HOH D O   1 
HETATM 9407 O O   . HOH I 4 .   ? 30.435  31.095  1.252   1.00 59.27  ? 2055 HOH D O   1 
HETATM 9408 O O   . HOH I 4 .   ? 28.111  29.522  -3.433  1.00 55.77  ? 2056 HOH D O   1 
HETATM 9409 O O   . HOH I 4 .   ? 29.676  27.573  -0.890  1.00 19.28  ? 2057 HOH D O   1 
HETATM 9410 O O   . HOH I 4 .   ? 50.799  18.643  -0.103  1.00 37.59  ? 2058 HOH D O   1 
HETATM 9411 O O   . HOH I 4 .   ? 50.992  14.066  6.073   1.00 16.71  ? 2059 HOH D O   1 
HETATM 9412 O O   . HOH I 4 .   ? 46.625  19.236  8.581   1.00 15.42  ? 2060 HOH D O   1 
HETATM 9413 O O   . HOH I 4 .   ? -0.832  20.771  8.927   1.00 60.30  ? 2061 HOH D O   1 
HETATM 9414 O O   . HOH I 4 .   ? 53.470  14.283  6.647   1.00 25.67  ? 2062 HOH D O   1 
HETATM 9415 O O   . HOH I 4 .   ? 53.713  17.944  9.473   1.00 27.18  ? 2063 HOH D O   1 
HETATM 9416 O O   . HOH I 4 .   ? 55.241  14.224  10.340  1.00 24.80  ? 2064 HOH D O   1 
HETATM 9417 O O   . HOH I 4 .   ? -22.456 24.986  21.178  1.00 56.08  ? 2065 HOH D O   1 
HETATM 9418 O O   . HOH I 4 .   ? 53.294  23.366  15.658  1.00 45.33  ? 2066 HOH D O   1 
HETATM 9419 O O   . HOH I 4 .   ? 42.239  16.233  13.951  1.00 39.97  ? 2067 HOH D O   1 
HETATM 9420 O O   . HOH I 4 .   ? 41.668  19.935  16.096  1.00 48.72  ? 2068 HOH D O   1 
HETATM 9421 O O   . HOH I 4 .   ? 47.237  20.396  14.963  1.00 34.02  ? 2069 HOH D O   1 
HETATM 9422 O O   . HOH I 4 .   ? 41.334  22.750  16.411  1.00 35.26  ? 2070 HOH D O   1 
HETATM 9423 O O   . HOH I 4 .   ? 48.154  27.857  17.098  1.00 57.74  ? 2071 HOH D O   1 
HETATM 9424 O O   . HOH I 4 .   ? 42.556  28.852  13.377  1.00 41.57  ? 2072 HOH D O   1 
HETATM 9425 O O   . HOH I 4 .   ? 33.837  25.328  6.954   1.00 46.99  ? 2073 HOH D O   1 
HETATM 9426 O O   . HOH I 4 .   ? 31.495  24.038  9.614   1.00 50.26  ? 2074 HOH D O   1 
HETATM 9427 O O   . HOH I 4 .   ? 32.252  31.182  3.210   1.00 35.69  ? 2075 HOH D O   1 
HETATM 9428 O O   . HOH I 4 .   ? 30.512  28.324  1.671   1.00 29.11  ? 2076 HOH D O   1 
HETATM 9429 O O   . HOH I 4 .   ? 30.557  21.277  6.559   1.00 47.19  ? 2077 HOH D O   1 
HETATM 9430 O O   . HOH I 4 .   ? 27.161  27.302  4.766   1.00 40.36  ? 2078 HOH D O   1 
HETATM 9431 O O   . HOH I 4 .   ? 49.185  16.069  3.066   1.00 11.14  ? 2079 HOH D O   1 
HETATM 9432 O O   . HOH I 4 .   ? 57.507  13.909  -2.007  1.00 36.64  ? 2080 HOH D O   1 
HETATM 9433 O O   . HOH I 4 .   ? 54.518  12.895  -4.089  1.00 37.20  ? 2081 HOH D O   1 
HETATM 9434 O O   . HOH I 4 .   ? 53.138  15.320  2.146   1.00 20.31  ? 2082 HOH D O   1 
HETATM 9435 O O   . HOH I 4 .   ? 56.482  13.134  2.707   1.00 22.55  ? 2083 HOH D O   1 
HETATM 9436 O O   . HOH I 4 .   ? 49.494  13.443  3.983   1.00 22.73  ? 2084 HOH D O   1 
HETATM 9437 O O   . HOH I 4 .   ? 56.155  13.901  5.566   1.00 22.92  ? 2085 HOH D O   1 
HETATM 9438 O O   . HOH I 4 .   ? 46.163  2.174   -1.331  1.00 7.23   ? 2086 HOH D O   1 
HETATM 9439 O O   . HOH I 4 .   ? 50.506  2.215   -2.371  1.00 15.49  ? 2087 HOH D O   1 
HETATM 9440 O O   . HOH I 4 .   ? 51.177  5.369   -1.329  1.00 27.86  ? 2088 HOH D O   1 
HETATM 9441 O O   . HOH I 4 .   ? 46.333  11.356  13.650  1.00 34.47  ? 2089 HOH D O   1 
HETATM 9442 O O   . HOH I 4 .   ? 48.621  12.820  13.645  1.00 31.66  ? 2090 HOH D O   1 
HETATM 9443 O O   . HOH I 4 .   ? 34.922  12.516  11.900  1.00 23.11  ? 2091 HOH D O   1 
HETATM 9444 O O   . HOH I 4 .   ? 44.546  13.020  14.447  1.00 39.97  ? 2092 HOH D O   1 
HETATM 9445 O O   . HOH I 4 .   ? 35.248  15.072  12.846  1.00 57.87  ? 2093 HOH D O   1 
HETATM 9446 O O   . HOH I 4 .   ? 36.555  20.387  9.101   1.00 28.54  ? 2094 HOH D O   1 
HETATM 9447 O O   . HOH I 4 .   ? 33.319  18.996  6.709   1.00 36.77  ? 2095 HOH D O   1 
HETATM 9448 O O   . HOH I 4 .   ? 29.630  18.849  5.290   1.00 22.68  ? 2096 HOH D O   1 
HETATM 9449 O O   . HOH I 4 .   ? 34.902  12.282  -2.194  1.00 17.52  ? 2097 HOH D O   1 
HETATM 9450 O O   . HOH I 4 .   ? 40.574  11.113  -5.568  1.00 12.93  ? 2098 HOH D O   1 
HETATM 9451 O O   . HOH I 4 .   ? 43.114  10.382  -5.583  1.00 16.71  ? 2099 HOH D O   1 
HETATM 9452 O O   . HOH I 4 .   ? 49.009  9.003   -5.727  1.00 24.89  ? 2100 HOH D O   1 
HETATM 9453 O O   . HOH I 4 .   ? 51.134  16.753  1.515   1.00 37.82  ? 2101 HOH D O   1 
HETATM 9454 O O   . HOH I 4 .   ? 53.225  8.760   -4.184  1.00 23.07  ? 2102 HOH D O   1 
HETATM 9455 O O   . HOH I 4 .   ? 52.712  16.331  -12.258 1.00 38.79  ? 2103 HOH D O   1 
HETATM 9456 O O   . HOH I 4 .   ? 51.491  16.675  -5.116  1.00 37.56  ? 2104 HOH D O   1 
HETATM 9457 O O   . HOH I 4 .   ? 50.593  12.483  -10.678 1.00 23.64  ? 2105 HOH D O   1 
HETATM 9458 O O   . HOH I 4 .   ? 49.810  18.009  -14.280 1.00 16.83  ? 2106 HOH D O   1 
HETATM 9459 O O   . HOH I 4 .   ? 41.129  13.073  -15.540 1.00 21.55  ? 2107 HOH D O   1 
HETATM 9460 O O   . HOH I 4 .   ? 35.923  13.231  -4.518  1.00 29.43  ? 2108 HOH D O   1 
HETATM 9461 O O   . HOH I 4 .   ? 27.559  26.803  -5.747  1.00 44.88  ? 2109 HOH D O   1 
HETATM 9462 O O   . HOH I 4 .   ? 28.223  24.285  -6.634  1.00 21.13  ? 2110 HOH D O   1 
HETATM 9463 O O   . HOH I 4 .   ? 23.165  15.050  -5.017  1.00 23.73  ? 2111 HOH D O   1 
HETATM 9464 O O   . HOH I 4 .   ? 24.400  18.371  -4.989  1.00 39.54  ? 2112 HOH D O   1 
HETATM 9465 O O   . HOH I 4 .   ? 28.782  22.776  -0.345  1.00 26.17  ? 2113 HOH D O   1 
HETATM 9466 O O   . HOH I 4 .   ? 28.031  20.377  3.758   1.00 27.18  ? 2114 HOH D O   1 
HETATM 9467 O O   . HOH I 4 .   ? 24.946  26.050  -5.933  1.00 55.70  ? 2115 HOH D O   1 
HETATM 9468 O O   . HOH I 4 .   ? 25.693  22.876  -6.735  1.00 37.36  ? 2116 HOH D O   1 
HETATM 9469 O O   . HOH I 4 .   ? 20.754  12.180  -0.716  1.00 38.13  ? 2117 HOH D O   1 
HETATM 9470 O O   . HOH I 4 .   ? 22.412  18.655  -3.449  1.00 34.59  ? 2118 HOH D O   1 
HETATM 9471 O O   . HOH I 4 .   ? 22.267  23.138  5.603   1.00 30.48  ? 2119 HOH D O   1 
HETATM 9472 O O   . HOH I 4 .   ? 26.234  20.602  5.737   1.00 39.09  ? 2120 HOH D O   1 
HETATM 9473 O O   . HOH I 4 .   ? 25.810  19.995  10.976  1.00 56.46  ? 2121 HOH D O   1 
HETATM 9474 O O   . HOH I 4 .   ? 19.351  19.447  10.683  1.00 36.12  ? 2122 HOH D O   1 
HETATM 9475 O O   . HOH I 4 .   ? 16.210  26.100  9.007   1.00 50.73  ? 2123 HOH D O   1 
HETATM 9476 O O   . HOH I 4 .   ? 18.695  17.343  14.125  1.00 41.74  ? 2124 HOH D O   1 
HETATM 9477 O O   . HOH I 4 .   ? 18.122  19.880  13.139  1.00 35.21  ? 2125 HOH D O   1 
HETATM 9478 O O   . HOH I 4 .   ? 10.941  25.807  8.525   1.00 46.11  ? 2126 HOH D O   1 
HETATM 9479 O O   . HOH I 4 .   ? 7.398   24.649  13.879  1.00 48.15  ? 2127 HOH D O   1 
HETATM 9480 O O   . HOH I 4 .   ? 10.851  19.524  3.109   1.00 58.89  ? 2128 HOH D O   1 
HETATM 9481 O O   . HOH I 4 .   ? 4.244   21.017  25.523  1.00 43.27  ? 2129 HOH D O   1 
HETATM 9482 O O   . HOH I 4 .   ? -5.031  16.578  17.682  1.00 48.95  ? 2130 HOH D O   1 
HETATM 9483 O O   . HOH I 4 .   ? -6.371  19.891  21.347  1.00 27.30  ? 2131 HOH D O   1 
HETATM 9484 O O   . HOH I 4 .   ? -3.962  21.238  8.609   1.00 48.28  ? 2132 HOH D O   1 
HETATM 9485 O O   . HOH I 4 .   ? -11.999 23.629  23.229  1.00 45.70  ? 2133 HOH D O   1 
HETATM 9486 O O   . HOH I 4 .   ? -13.379 16.924  27.301  1.00 38.58  ? 2134 HOH D O   1 
HETATM 9487 O O   . HOH I 4 .   ? -9.090  20.870  23.100  1.00 49.37  ? 2135 HOH D O   1 
HETATM 9488 O O   . HOH I 4 .   ? -9.065  18.566  24.304  1.00 59.02  ? 2136 HOH D O   1 
HETATM 9489 O O   . HOH I 4 .   ? -19.262 21.251  21.789  1.00 29.50  ? 2137 HOH D O   1 
HETATM 9490 O O   . HOH I 4 .   ? -20.070 23.734  22.005  1.00 33.44  ? 2138 HOH D O   1 
HETATM 9491 O O   . HOH I 4 .   ? -16.831 18.156  16.113  1.00 33.08  ? 2139 HOH D O   1 
HETATM 9492 O O   . HOH I 4 .   ? -9.261  20.902  5.742   1.00 46.91  ? 2140 HOH D O   1 
HETATM 9493 O O   . HOH I 4 .   ? 1.256   28.239  23.057  1.00 45.71  ? 2141 HOH D O   1 
HETATM 9494 O O   . HOH I 4 .   ? 0.774   31.056  23.215  1.00 46.31  ? 2142 HOH D O   1 
HETATM 9495 O O   . HOH I 4 .   ? 0.217   25.430  24.611  1.00 55.26  ? 2143 HOH D O   1 
HETATM 9496 O O   . HOH J 4 .   ? 31.417  6.587   12.940  1.00 57.11  ? 2001 HOH E O   1 
HETATM 9497 O O   . HOH J 4 .   ? 33.728  7.935   11.791  1.00 40.60  ? 2002 HOH E O   1 
HETATM 9498 O O   . HOH J 4 .   ? 39.564  7.252   16.435  1.00 37.89  ? 2003 HOH E O   1 
HETATM 9499 O O   . HOH J 4 .   ? 33.204  2.903   11.750  1.00 33.41  ? 2004 HOH E O   1 
HETATM 9500 O O   . HOH J 4 .   ? 41.636  -3.241  8.578   1.00 30.60  ? 2005 HOH E O   1 
HETATM 9501 O O   . HOH J 4 .   ? 32.012  6.667   9.712   1.00 31.52  ? 2006 HOH E O   1 
HETATM 9502 O O   . HOH J 4 .   ? 33.725  10.423  11.448  1.00 27.65  ? 2007 HOH E O   1 
HETATM 9503 O O   . HOH J 4 .   ? 38.686  -5.415  9.761   1.00 44.15  ? 2008 HOH E O   1 
HETATM 9504 O O   . HOH J 4 .   ? 43.790  -9.376  9.443   1.00 22.68  ? 2009 HOH E O   1 
HETATM 9505 O O   . HOH J 4 .   ? 30.967  -5.232  6.443   1.00 58.67  ? 2010 HOH E O   1 
HETATM 9506 O O   . HOH J 4 .   ? 45.600  -11.115 9.585   1.00 50.87  ? 2011 HOH E O   1 
HETATM 9507 O O   . HOH J 4 .   ? 42.785  -7.609  11.141  1.00 28.00  ? 2012 HOH E O   1 
HETATM 9508 O O   . HOH J 4 .   ? 28.734  -10.681 -9.746  1.00 58.24  ? 2013 HOH E O   1 
HETATM 9509 O O   . HOH J 4 .   ? 41.723  -11.548 -17.058 1.00 59.83  ? 2014 HOH E O   1 
HETATM 9510 O O   . HOH J 4 .   ? 47.931  -9.354  -12.061 1.00 43.65  ? 2015 HOH E O   1 
HETATM 9511 O O   . HOH J 4 .   ? 33.488  -0.231  -24.302 1.00 43.39  ? 2016 HOH E O   1 
HETATM 9512 O O   . HOH J 4 .   ? 38.518  0.413   -16.457 1.00 47.19  ? 2017 HOH E O   1 
HETATM 9513 O O   . HOH J 4 .   ? 46.899  -11.654 -4.162  1.00 45.91  ? 2018 HOH E O   1 
HETATM 9514 O O   . HOH J 4 .   ? 40.268  -3.920  -16.562 1.00 24.18  ? 2019 HOH E O   1 
HETATM 9515 O O   . HOH J 4 .   ? 51.743  -8.074  -8.730  1.00 60.89  ? 2020 HOH E O   1 
HETATM 9516 O O   . HOH J 4 .   ? 40.622  -8.681  -14.788 1.00 28.68  ? 2021 HOH E O   1 
HETATM 9517 O O   . HOH J 4 .   ? 41.011  -13.044 -1.691  1.00 60.77  ? 2022 HOH E O   1 
HETATM 9518 O O   . HOH J 4 .   ? 47.648  -5.227  -13.632 1.00 36.49  ? 2023 HOH E O   1 
HETATM 9519 O O   . HOH J 4 .   ? 30.103  -10.994 -6.485  1.00 54.14  ? 2024 HOH E O   1 
HETATM 9520 O O   . HOH J 4 .   ? 25.383  -7.387  -21.105 1.00 42.59  ? 2025 HOH E O   1 
HETATM 9521 O O   . HOH J 4 .   ? 19.220  -5.755  -5.488  1.00 42.92  ? 2026 HOH E O   1 
HETATM 9522 O O   . HOH J 4 .   ? 44.061  -9.345  -17.416 1.00 39.10  ? 2027 HOH E O   1 
HETATM 9523 O O   . HOH J 4 .   ? 22.434  -6.471  2.667   1.00 45.19  ? 2028 HOH E O   1 
HETATM 9524 O O   . HOH J 4 .   ? 20.635  1.317   6.590   1.00 50.70  ? 2029 HOH E O   1 
HETATM 9525 O O   . HOH J 4 .   ? 48.018  -6.303  -11.110 1.00 42.75  ? 2030 HOH E O   1 
HETATM 9526 O O   . HOH J 4 .   ? 47.897  -3.314  -7.689  1.00 16.23  ? 2031 HOH E O   1 
HETATM 9527 O O   . HOH J 4 .   ? 32.898  2.467   -23.489 1.00 46.74  ? 2032 HOH E O   1 
HETATM 9528 O O   . HOH J 4 .   ? 26.385  9.799   -21.223 1.00 22.71  ? 2033 HOH E O   1 
HETATM 9529 O O   . HOH J 4 .   ? 46.975  -8.631  -3.518  1.00 25.87  ? 2034 HOH E O   1 
HETATM 9530 O O   . HOH J 4 .   ? 24.803  -1.628  -4.864  1.00 26.90  ? 2035 HOH E O   1 
HETATM 9531 O O   . HOH J 4 .   ? 49.381  -5.464  -8.924  1.00 23.51  ? 2036 HOH E O   1 
HETATM 9532 O O   . HOH J 4 .   ? 24.184  4.562   -5.160  1.00 51.79  ? 2037 HOH E O   1 
HETATM 9533 O O   . HOH J 4 .   ? 41.073  -10.702 0.135   1.00 38.59  ? 2038 HOH E O   1 
HETATM 9534 O O   . HOH J 4 .   ? 38.875  -11.378 -1.611  1.00 35.94  ? 2039 HOH E O   1 
HETATM 9535 O O   . HOH J 4 .   ? 29.597  -13.594 -5.958  1.00 48.04  ? 2040 HOH E O   1 
HETATM 9536 O O   . HOH J 4 .   ? 36.310  -11.904 -8.257  1.00 51.07  ? 2041 HOH E O   1 
HETATM 9537 O O   . HOH J 4 .   ? 35.874  -8.210  -13.788 1.00 45.90  ? 2042 HOH E O   1 
HETATM 9538 O O   . HOH J 4 .   ? 24.872  12.039  -20.663 1.00 30.03  ? 2043 HOH E O   1 
HETATM 9539 O O   . HOH J 4 .   ? 34.259  -10.822 -15.778 1.00 48.33  ? 2044 HOH E O   1 
HETATM 9540 O O   . HOH J 4 .   ? 25.156  -6.685  -18.479 1.00 35.95  ? 2045 HOH E O   1 
HETATM 9541 O O   . HOH J 4 .   ? 50.488  1.475   -12.139 1.00 33.96  ? 2046 HOH E O   1 
HETATM 9542 O O   . HOH J 4 .   ? 19.420  -3.513  -12.538 1.00 44.39  ? 2047 HOH E O   1 
HETATM 9543 O O   . HOH J 4 .   ? 22.001  -10.827 -14.688 1.00 37.58  ? 2048 HOH E O   1 
HETATM 9544 O O   . HOH J 4 .   ? 41.994  11.617  -7.788  1.00 46.76  ? 2049 HOH E O   1 
HETATM 9545 O O   . HOH J 4 .   ? 53.083  5.405   -12.562 1.00 30.29  ? 2050 HOH E O   1 
HETATM 9546 O O   . HOH J 4 .   ? 52.370  2.104   -10.224 1.00 21.66  ? 2051 HOH E O   1 
HETATM 9547 O O   . HOH J 4 .   ? 21.666  -5.667  -6.157  1.00 36.81  ? 2052 HOH E O   1 
HETATM 9548 O O   . HOH J 4 .   ? 28.440  9.319   10.296  1.00 36.80  ? 2053 HOH E O   1 
HETATM 9549 O O   . HOH J 4 .   ? 29.105  -10.301 0.613   1.00 37.23  ? 2054 HOH E O   1 
HETATM 9550 O O   . HOH J 4 .   ? 22.401  4.539   8.043   1.00 39.51  ? 2055 HOH E O   1 
HETATM 9551 O O   . HOH J 4 .   ? 25.999  -1.636  1.544   1.00 30.16  ? 2056 HOH E O   1 
HETATM 9552 O O   . HOH J 4 .   ? 24.294  -5.440  0.382   1.00 36.87  ? 2057 HOH E O   1 
HETATM 9553 O O   . HOH J 4 .   ? 20.988  3.852   5.996   1.00 34.60  ? 2058 HOH E O   1 
HETATM 9554 O O   . HOH J 4 .   ? 27.600  -1.278  3.674   1.00 21.01  ? 2059 HOH E O   1 
HETATM 9555 O O   . HOH J 4 .   ? 37.887  3.371   -16.330 1.00 41.13  ? 2060 HOH E O   1 
HETATM 9556 O O   . HOH J 4 .   ? 36.402  0.576   -18.284 1.00 41.17  ? 2061 HOH E O   1 
HETATM 9557 O O   . HOH J 4 .   ? 33.788  7.754   -19.579 1.00 23.22  ? 2062 HOH E O   1 
HETATM 9558 O O   . HOH J 4 .   ? -8.861  15.378  8.875   1.00 48.81  ? 2063 HOH E O   1 
HETATM 9559 O O   . HOH J 4 .   ? 28.640  3.716   -16.570 1.00 13.92  ? 2064 HOH E O   1 
HETATM 9560 O O   . HOH J 4 .   ? 25.038  7.602   -22.370 1.00 27.53  ? 2065 HOH E O   1 
HETATM 9561 O O   . HOH J 4 .   ? 30.589  3.597   -23.537 1.00 20.92  ? 2066 HOH E O   1 
HETATM 9562 O O   . HOH J 4 .   ? 34.174  6.678   -22.055 1.00 33.45  ? 2067 HOH E O   1 
HETATM 9563 O O   . HOH J 4 .   ? 32.019  6.979   -25.210 1.00 15.95  ? 2068 HOH E O   1 
HETATM 9564 O O   . HOH J 4 .   ? -17.172 15.994  14.751  1.00 26.81  ? 2069 HOH E O   1 
HETATM 9565 O O   . HOH J 4 .   ? -14.912 0.296   13.101  1.00 52.11  ? 2070 HOH E O   1 
HETATM 9566 O O   . HOH J 4 .   ? 22.703  3.246   -21.579 1.00 34.00  ? 2071 HOH E O   1 
HETATM 9567 O O   . HOH J 4 .   ? 32.312  0.722   -27.586 1.00 66.28  ? 2072 HOH E O   1 
HETATM 9568 O O   . HOH J 4 .   ? 24.921  -5.305  -22.579 1.00 43.33  ? 2073 HOH E O   1 
HETATM 9569 O O   . HOH J 4 .   ? 21.141  -0.135  -21.621 1.00 32.32  ? 2074 HOH E O   1 
HETATM 9570 O O   . HOH J 4 .   ? 26.159  -0.431  -26.377 1.00 46.85  ? 2075 HOH E O   1 
HETATM 9571 O O   . HOH J 4 .   ? 30.803  -4.681  -23.208 1.00 45.06  ? 2076 HOH E O   1 
HETATM 9572 O O   . HOH J 4 .   ? 21.367  7.188   -20.214 1.00 31.03  ? 2077 HOH E O   1 
HETATM 9573 O O   . HOH J 4 .   ? 20.946  -3.581  -14.678 1.00 23.84  ? 2078 HOH E O   1 
HETATM 9574 O O   . HOH J 4 .   ? 22.099  4.889   -9.950  1.00 16.43  ? 2079 HOH E O   1 
HETATM 9575 O O   . HOH J 4 .   ? 22.715  -3.019  -6.419  1.00 25.72  ? 2080 HOH E O   1 
HETATM 9576 O O   . HOH J 4 .   ? 24.420  0.894   -4.963  1.00 17.43  ? 2081 HOH E O   1 
HETATM 9577 O O   . HOH J 4 .   ? 17.568  0.852   -3.427  1.00 42.41  ? 2082 HOH E O   1 
HETATM 9578 O O   . HOH J 4 .   ? 24.830  -2.890  3.600   1.00 34.08  ? 2083 HOH E O   1 
HETATM 9579 O O   . HOH J 4 .   ? 22.760  2.568   -2.468  1.00 42.05  ? 2084 HOH E O   1 
HETATM 9580 O O   . HOH J 4 .   ? 21.447  6.113   1.914   1.00 38.89  ? 2085 HOH E O   1 
HETATM 9581 O O   . HOH J 4 .   ? 24.938  4.849   -0.029  1.00 32.14  ? 2086 HOH E O   1 
HETATM 9582 O O   . HOH J 4 .   ? 28.170  3.483   3.778   1.00 20.21  ? 2087 HOH E O   1 
HETATM 9583 O O   . HOH J 4 .   ? 22.852  -0.772  3.288   1.00 42.08  ? 2088 HOH E O   1 
HETATM 9584 O O   . HOH J 4 .   ? 24.197  -2.624  -2.640  1.00 25.62  ? 2089 HOH E O   1 
HETATM 9585 O O   . HOH J 4 .   ? 35.301  5.545   -16.682 1.00 11.08  ? 2090 HOH E O   1 
HETATM 9586 O O   . HOH J 4 .   ? 35.786  2.555   -20.232 1.00 41.39  ? 2091 HOH E O   1 
HETATM 9587 O O   . HOH J 4 .   ? 35.396  8.092   -17.375 1.00 13.62  ? 2092 HOH E O   1 
HETATM 9588 O O   . HOH J 4 .   ? 41.733  8.346   -19.421 1.00 20.21  ? 2093 HOH E O   1 
HETATM 9589 O O   . HOH J 4 .   ? 40.618  6.596   -21.102 1.00 26.86  ? 2094 HOH E O   1 
HETATM 9590 O O   . HOH J 4 .   ? 36.678  6.349   -24.174 1.00 30.41  ? 2095 HOH E O   1 
HETATM 9591 O O   . HOH J 4 .   ? 44.041  17.562  -17.039 1.00 11.34  ? 2096 HOH E O   1 
HETATM 9592 O O   . HOH J 4 .   ? 42.360  14.452  -17.656 1.00 25.68  ? 2097 HOH E O   1 
HETATM 9593 O O   . HOH J 4 .   ? 41.475  18.941  -13.666 1.00 10.26  ? 2098 HOH E O   1 
HETATM 9594 O O   . HOH J 4 .   ? 32.783  19.284  -17.168 1.00 33.26  ? 2099 HOH E O   1 
HETATM 9595 O O   . HOH J 4 .   ? 24.660  18.211  -17.563 1.00 46.07  ? 2100 HOH E O   1 
HETATM 9596 O O   . HOH J 4 .   ? 28.556  9.470   -19.357 1.00 19.16  ? 2101 HOH E O   1 
HETATM 9597 O O   . HOH J 4 .   ? 22.470  13.726  -8.337  1.00 35.38  ? 2102 HOH E O   1 
HETATM 9598 O O   . HOH J 4 .   ? 22.007  7.215   -11.113 1.00 24.53  ? 2103 HOH E O   1 
HETATM 9599 O O   . HOH J 4 .   ? 23.236  8.702   -15.241 1.00 15.81  ? 2104 HOH E O   1 
HETATM 9600 O O   . HOH J 4 .   ? 23.647  14.070  -18.499 1.00 26.00  ? 2105 HOH E O   1 
HETATM 9601 O O   . HOH J 4 .   ? 21.342  15.117  -15.194 1.00 26.58  ? 2106 HOH E O   1 
HETATM 9602 O O   . HOH J 4 .   ? 24.427  11.237  -18.175 1.00 25.93  ? 2107 HOH E O   1 
HETATM 9603 O O   . HOH J 4 .   ? 20.726  10.844  -9.205  1.00 44.08  ? 2108 HOH E O   1 
HETATM 9604 O O   . HOH J 4 .   ? 24.337  4.979   -7.889  1.00 39.43  ? 2109 HOH E O   1 
HETATM 9605 O O   . HOH J 4 .   ? 25.325  6.602   -4.130  1.00 26.91  ? 2110 HOH E O   1 
HETATM 9606 O O   . HOH J 4 .   ? 30.025  13.009  -5.783  1.00 16.74  ? 2111 HOH E O   1 
HETATM 9607 O O   . HOH J 4 .   ? 25.821  10.024  -2.100  1.00 38.97  ? 2112 HOH E O   1 
HETATM 9608 O O   . HOH J 4 .   ? 37.770  11.321  -4.165  1.00 15.00  ? 2113 HOH E O   1 
HETATM 9609 O O   . HOH J 4 .   ? 45.035  11.127  -13.081 1.00 31.71  ? 2114 HOH E O   1 
HETATM 9610 O O   . HOH J 4 .   ? 40.592  2.634   -18.118 1.00 43.91  ? 2115 HOH E O   1 
HETATM 9611 O O   . HOH J 4 .   ? 45.302  10.157  -17.564 1.00 19.87  ? 2116 HOH E O   1 
HETATM 9612 O O   . HOH J 4 .   ? 41.565  10.577  -16.198 1.00 34.21  ? 2117 HOH E O   1 
HETATM 9613 O O   . HOH J 4 .   ? 46.255  0.189   -14.005 1.00 41.09  ? 2118 HOH E O   1 
HETATM 9614 O O   . HOH J 4 .   ? 48.073  0.057   -11.662 1.00 33.70  ? 2119 HOH E O   1 
HETATM 9615 O O   . HOH J 4 .   ? 50.262  7.989   -7.799  1.00 18.34  ? 2120 HOH E O   1 
HETATM 9616 O O   . HOH J 4 .   ? 50.237  5.979   -13.027 1.00 37.38  ? 2121 HOH E O   1 
HETATM 9617 O O   . HOH J 4 .   ? 50.651  0.827   -8.605  1.00 12.09  ? 2122 HOH E O   1 
HETATM 9618 O O   . HOH J 4 .   ? 48.719  7.209   -1.202  1.00 24.28  ? 2123 HOH E O   1 
HETATM 9619 O O   . HOH J 4 .   ? 43.691  9.932   -8.680  1.00 30.99  ? 2124 HOH E O   1 
HETATM 9620 O O   . HOH J 4 .   ? 37.411  10.535  -1.906  1.00 22.15  ? 2125 HOH E O   1 
HETATM 9621 O O   . HOH J 4 .   ? 30.837  -0.466  8.275   1.00 30.04  ? 2126 HOH E O   1 
HETATM 9622 O O   . HOH J 4 .   ? 32.496  1.169   7.531   1.00 19.63  ? 2127 HOH E O   1 
HETATM 9623 O O   . HOH J 4 .   ? 35.953  11.692  4.102   1.00 18.30  ? 2128 HOH E O   1 
HETATM 9624 O O   . HOH J 4 .   ? 31.926  11.009  9.715   1.00 26.10  ? 2129 HOH E O   1 
HETATM 9625 O O   . HOH J 4 .   ? 30.919  8.906   8.718   1.00 24.99  ? 2130 HOH E O   1 
HETATM 9626 O O   . HOH J 4 .   ? 25.328  7.111   1.232   1.00 26.21  ? 2131 HOH E O   1 
HETATM 9627 O O   . HOH J 4 .   ? 25.286  4.987   8.141   1.00 37.59  ? 2132 HOH E O   1 
HETATM 9628 O O   . HOH J 4 .   ? 28.512  17.069  6.966   1.00 39.77  ? 2133 HOH E O   1 
HETATM 9629 O O   . HOH J 4 .   ? 26.199  14.842  9.909   1.00 34.85  ? 2134 HOH E O   1 
HETATM 9630 O O   . HOH J 4 .   ? 31.301  15.765  5.818   1.00 16.01  ? 2135 HOH E O   1 
HETATM 9631 O O   . HOH J 4 .   ? 22.984  8.277   1.058   1.00 49.17  ? 2136 HOH E O   1 
HETATM 9632 O O   . HOH J 4 .   ? 20.296  6.416   4.237   1.00 30.93  ? 2137 HOH E O   1 
HETATM 9633 O O   . HOH J 4 .   ? 19.371  5.395   -0.476  1.00 30.61  ? 2138 HOH E O   1 
HETATM 9634 O O   . HOH J 4 .   ? 9.576   6.719   11.642  1.00 50.34  ? 2139 HOH E O   1 
HETATM 9635 O O   . HOH J 4 .   ? 5.289   8.977   19.516  1.00 44.90  ? 2140 HOH E O   1 
HETATM 9636 O O   . HOH J 4 .   ? 2.591   16.101  13.506  1.00 37.03  ? 2141 HOH E O   1 
HETATM 9637 O O   . HOH J 4 .   ? -4.371  14.888  9.235   1.00 31.48  ? 2142 HOH E O   1 
HETATM 9638 O O   . HOH J 4 .   ? -7.836  17.529  11.125  1.00 51.20  ? 2143 HOH E O   1 
HETATM 9639 O O   . HOH J 4 .   ? -7.335  17.245  14.612  1.00 60.71  ? 2144 HOH E O   1 
HETATM 9640 O O   . HOH J 4 .   ? -5.476  7.994   4.290   1.00 52.76  ? 2145 HOH E O   1 
HETATM 9641 O O   . HOH J 4 .   ? -8.749  14.045  16.231  1.00 99.11  ? 2146 HOH E O   1 
HETATM 9642 O O   . HOH J 4 .   ? -18.918 14.371  15.809  1.00 35.45  ? 2147 HOH E O   1 
HETATM 9643 O O   . HOH J 4 .   ? -15.381 16.124  10.251  1.00 43.74  ? 2148 HOH E O   1 
HETATM 9644 O O   . HOH J 4 .   ? -18.369 6.950   8.394   1.00 47.71  ? 2149 HOH E O   1 
HETATM 9645 O O   . HOH J 4 .   ? -16.388 2.666   13.297  1.00 38.23  ? 2150 HOH E O   1 
HETATM 9646 O O   . HOH J 4 .   ? -14.439 0.739   8.577   1.00 53.03  ? 2151 HOH E O   1 
HETATM 9647 O O   . HOH J 4 .   ? -19.015 14.341  21.442  1.00 39.90  ? 2152 HOH E O   1 
HETATM 9648 O O   . HOH J 4 .   ? -22.226 10.450  20.997  1.00 38.34  ? 2153 HOH E O   1 
HETATM 9649 O O   . HOH J 4 .   ? -14.209 12.901  27.182  1.00 48.14  ? 2154 HOH E O   1 
HETATM 9650 O O   . HOH J 4 .   ? -5.448  17.375  20.345  1.00 35.92  ? 2155 HOH E O   1 
HETATM 9651 O O   . HOH J 4 .   ? -5.650  15.505  23.062  1.00 42.97  ? 2156 HOH E O   1 
HETATM 9652 O O   . HOH J 4 .   ? -13.316 16.562  20.842  1.00 49.78  ? 2157 HOH E O   1 
HETATM 9653 O O   . HOH J 4 .   ? -10.092 13.197  27.895  1.00 50.13  ? 2158 HOH E O   1 
HETATM 9654 O O   . HOH J 4 .   ? -6.900  12.214  23.921  1.00 40.86  ? 2159 HOH E O   1 
HETATM 9655 O O   . HOH J 4 .   ? -6.612  16.686  27.022  1.00 56.06  ? 2160 HOH E O   1 
HETATM 9656 O O   . HOH J 4 .   ? -19.512 12.528  23.277  1.00 47.15  ? 2161 HOH E O   1 
HETATM 9657 O O   . HOH J 4 .   ? -4.774  9.965   18.298  1.00 43.90  ? 2162 HOH E O   1 
HETATM 9658 O O   . HOH J 4 .   ? -14.543 2.832   21.596  1.00 55.99  ? 2163 HOH E O   1 
HETATM 9659 O O   . HOH J 4 .   ? -2.504  5.695   23.297  1.00 52.24  ? 2164 HOH E O   1 
HETATM 9660 O O   . HOH J 4 .   ? -0.528  -1.803  18.752  1.00 49.95  ? 2165 HOH E O   1 
HETATM 9661 O O   . HOH J 4 .   ? -11.357 -1.800  6.118   1.00 53.06  ? 2166 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   HIS 4   4   ?   ?   ?   A . n 
A 1 5   GLN 5   5   ?   ?   ?   A . n 
A 1 6   GLU 6   6   ?   ?   ?   A . n 
A 1 7   ARG 7   7   7   ARG ARG A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  CYS 82  82  82  CYS CYS A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  MET 84  84  84  MET MET A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 ARG 161 161 161 ARG ARG A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLN 166 166 166 GLN GLN A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 TYR 194 194 194 TYR TYR A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ASP 199 199 199 ASP ASP A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 TYR 214 214 214 TYR TYR A . n 
A 1 215 ARG 215 215 215 ARG ARG A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 PRO 227 227 227 PRO PRO A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 ILE 229 229 229 ILE ILE A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 GLN 250 250 250 GLN GLN A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 PRO 255 255 255 PRO PRO A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 ALA 264 264 264 ALA ALA A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 PHE 268 268 268 PHE PHE A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 ASN 279 279 279 ASN ASN A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 THR 281 281 281 THR THR A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 TRP 285 285 285 TRP TRP A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ALA 289 289 289 ALA ALA A . n 
A 1 290 TYR 290 290 290 TYR TYR A . n 
A 1 291 TRP 291 291 291 TRP TRP A . n 
A 1 292 GLN 292 292 292 GLN GLN A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 GLN 301 301 301 GLN GLN A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 TRP 306 306 306 TRP TRP A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 HIS 314 314 314 HIS HIS A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 TYR 316 316 316 TYR TYR A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 ASP 319 319 319 ASP ASP A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 PRO 323 323 323 PRO PRO A . n 
A 1 324 GLN 324 324 324 GLN GLN A . n 
A 1 325 GLY 325 325 325 GLY GLY A . n 
A 1 326 PRO 326 326 326 PRO PRO A . n 
A 1 327 VAL 327 327 327 VAL VAL A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 VAL 329 329 329 VAL VAL A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 ARG 331 331 331 ARG ARG A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 ASN 334 334 334 ASN ASN A . n 
A 1 335 HIS 335 335 335 HIS HIS A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 SER 339 339 339 SER SER A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 GLY 349 349 349 GLY GLY A . n 
A 1 350 VAL 350 350 350 VAL VAL A . n 
A 1 351 PHE 351 351 351 PHE PHE A . n 
A 1 352 GLN 352 352 352 GLN GLN A . n 
A 1 353 VAL 353 353 353 VAL VAL A . n 
A 1 354 ARG 354 354 354 ARG ARG A . n 
A 1 355 TRP 355 355 355 TRP TRP A . n 
A 1 356 GLN 356 356 356 GLN GLN A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 GLU 359 359 359 GLU GLU A . n 
A 1 360 PRO 360 360 360 PRO PRO A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 ARG 362 362 362 ARG ARG A . n 
A 1 363 PRO 363 363 363 PRO PRO A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 PRO 365 365 365 PRO PRO A . n 
A 1 366 TYR 366 366 366 TYR TYR A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 VAL 369 369 369 VAL VAL A . n 
A 1 370 HIS 370 370 370 HIS HIS A . n 
A 1 371 ASN 371 371 371 ASN ASN A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 ASP 373 373 373 ASP ASP A . n 
A 1 374 ASP 374 374 374 ASP ASP A . n 
A 1 375 TRP 375 375 375 TRP TRP A . n 
A 1 376 SER 376 376 376 SER SER A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 SER 378 378 378 SER SER A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 GLY 380 380 ?   ?   ?   A . n 
A 1 381 GLY 381 381 ?   ?   ?   A . n 
A 1 382 GLY 382 382 ?   ?   ?   A . n 
A 1 383 PRO 383 383 ?   ?   ?   A . n 
A 1 384 LEU 384 384 ?   ?   ?   A . n 
A 1 385 PRO 385 385 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   ?   ?   ?   B . n 
B 1 4   HIS 4   4   ?   ?   ?   B . n 
B 1 5   GLN 5   5   ?   ?   ?   B . n 
B 1 6   GLU 6   6   ?   ?   ?   B . n 
B 1 7   ARG 7   7   7   ARG ARG B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  GLY 11  11  11  GLY GLY B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  PHE 14  14  14  PHE PHE B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  THR 20  20  20  THR THR B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  ASP 22  22  22  ASP ASP B . n 
B 1 23  ILE 23  23  23  ILE ILE B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ARG 25  25  25  ARG ARG B . n 
B 1 26  SER 26  26  26  SER SER B . n 
B 1 27  GLN 27  27  27  GLN GLN B . n 
B 1 28  ARG 28  28  28  ARG ARG B . n 
B 1 29  TYR 29  29  29  TYR TYR B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  GLN 37  37  37  GLN GLN B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ARG 40  40  40  ARG ARG B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  GLY 45  45  45  GLY GLY B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  ARG 47  47  47  ARG ARG B . n 
B 1 48  PRO 48  48  48  PRO PRO B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  GLU 50  50  50  GLU GLU B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  PRO 60  60  60  PRO PRO B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ARG 62  62  62  ARG ARG B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  ARG 64  64  64  ARG ARG B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  CYS 66  66  66  CYS CYS B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  ILE 71  71  71  ILE ILE B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  ARG 77  77  77  ARG ARG B . n 
B 1 78  PHE 78  78  78  PHE PHE B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  CYS 82  82  82  CYS CYS B . n 
B 1 83  TYR 83  83  83  TYR TYR B . n 
B 1 84  MET 84  84  84  MET MET B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  HIS 86  86  86  HIS HIS B . n 
B 1 87  THR 87  87  87  THR THR B . n 
B 1 88  ARG 88  88  88  ARG ARG B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  MET 92  92  92  MET MET B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  ARG 97  97  97  ARG ARG B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ASP 99  99  99  ASP ASP B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 CYS 103 103 103 CYS CYS B . n 
B 1 104 TYR 104 104 104 TYR TYR B . n 
B 1 105 PRO 105 105 105 PRO PRO B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 TYR 108 108 108 TYR TYR B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 TYR 113 113 113 TYR TYR B . n 
B 1 114 SER 114 114 114 SER SER B . n 
B 1 115 PRO 115 115 115 PRO PRO B . n 
B 1 116 ASN 116 116 116 ASN ASN B . n 
B 1 117 ILE 117 117 117 ILE ILE B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 PRO 122 122 122 PRO PRO B . n 
B 1 123 ALA 123 123 123 ALA ALA B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 ASN 125 125 125 ASN ASN B . n 
B 1 126 GLN 126 126 126 GLN GLN B . n 
B 1 127 ASN 127 127 127 ASN ASN B . n 
B 1 128 SER 128 128 128 SER SER B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 HIS 138 138 138 HIS HIS B . n 
B 1 139 TYR 139 139 139 TYR TYR B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 VAL 143 143 143 VAL VAL B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 PHE 145 145 145 PHE PHE B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 GLY 147 147 147 GLY GLY B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 TYR 150 150 150 TYR TYR B . n 
B 1 151 ILE 151 151 151 ILE ILE B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 ASN 157 157 157 ASN ASN B . n 
B 1 158 HIS 158 158 158 HIS HIS B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 MET 160 160 160 MET MET B . n 
B 1 161 ARG 161 161 161 ARG ARG B . n 
B 1 162 HIS 162 162 162 HIS HIS B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 TYR 164 164 164 TYR TYR B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLN 166 166 166 GLN GLN B . n 
B 1 167 HIS 167 167 167 HIS HIS B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 THR 170 170 170 THR THR B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 GLU 173 173 173 GLU GLU B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 TYR 176 176 176 TYR TYR B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 TYR 180 180 180 TYR TYR B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 ASP 185 185 185 ASP ASP B . n 
B 1 186 LEU 186 186 186 LEU LEU B . n 
B 1 187 GLN 187 187 187 GLN GLN B . n 
B 1 188 ARG 188 188 188 ARG ARG B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 ILE 193 193 193 ILE ILE B . n 
B 1 194 TYR 194 194 194 TYR TYR B . n 
B 1 195 GLN 195 195 195 GLN GLN B . n 
B 1 196 ALA 196 196 196 ALA ALA B . n 
B 1 197 ARG 197 197 197 ARG ARG B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ASP 199 199 199 ASP ASP B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 PHE 202 202 202 PHE PHE B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 THR 204 204 204 THR THR B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 THR 208 208 208 THR THR B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 THR 210 210 210 THR THR B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 GLU 212 212 212 GLU GLU B . n 
B 1 213 LEU 213 213 213 LEU LEU B . n 
B 1 214 TYR 214 214 214 TYR TYR B . n 
B 1 215 ARG 215 215 215 ARG ARG B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 ILE 217 217 217 ILE ILE B . n 
B 1 218 ALA 218 218 218 ALA ALA B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 TYR 221 221 221 TYR TYR B . n 
B 1 222 GLY 222 222 222 GLY GLY B . n 
B 1 223 ASP 223 223 223 ASP ASP B . n 
B 1 224 GLY 224 224 224 GLY GLY B . n 
B 1 225 ARG 225 225 225 ARG ARG B . n 
B 1 226 ARG 226 226 226 ARG ARG B . n 
B 1 227 PRO 227 227 227 PRO PRO B . n 
B 1 228 PRO 228 228 228 PRO PRO B . n 
B 1 229 ILE 229 229 229 ILE ILE B . n 
B 1 230 ALA 230 230 230 ALA ALA B . n 
B 1 231 SER 231 231 231 SER SER B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 THR 233 233 233 THR THR B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 GLU 236 236 236 GLU GLU B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 GLU 238 238 238 GLU GLU B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 ALA 240 240 240 ALA ALA B . n 
B 1 241 LYS 241 241 241 LYS LYS B . n 
B 1 242 MET 242 242 242 MET MET B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 SER 244 244 244 SER SER B . n 
B 1 245 ASP 245 245 245 ASP ASP B . n 
B 1 246 VAL 246 246 246 VAL VAL B . n 
B 1 247 ALA 247 247 247 ALA ALA B . n 
B 1 248 GLU 248 248 248 GLU GLU B . n 
B 1 249 GLY 249 249 249 GLY GLY B . n 
B 1 250 GLN 250 250 250 GLN GLN B . n 
B 1 251 VAL 251 251 251 VAL VAL B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 VAL 253 253 253 VAL VAL B . n 
B 1 254 ALA 254 254 254 ALA ALA B . n 
B 1 255 PRO 255 255 255 PRO PRO B . n 
B 1 256 TYR 256 256 256 TYR TYR B . n 
B 1 257 PHE 257 257 257 PHE PHE B . n 
B 1 258 SER 258 258 258 SER SER B . n 
B 1 259 SER 259 259 259 SER SER B . n 
B 1 260 ILE 260 260 260 ILE ILE B . n 
B 1 261 ASP 261 261 261 ASP ASP B . n 
B 1 262 THR 262 262 262 THR THR B . n 
B 1 263 PRO 263 263 263 PRO PRO B . n 
B 1 264 ALA 264 264 264 ALA ALA B . n 
B 1 265 SER 265 265 265 SER SER B . n 
B 1 266 ARG 266 266 266 ARG ARG B . n 
B 1 267 ALA 267 267 267 ALA ALA B . n 
B 1 268 PHE 268 268 268 PHE PHE B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 GLN 270 270 270 GLN GLN B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 HIS 273 273 273 HIS HIS B . n 
B 1 274 GLY 274 274 274 GLY GLY B . n 
B 1 275 PHE 275 275 275 PHE PHE B . n 
B 1 276 PHE 276 276 276 PHE PHE B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 GLU 278 278 278 GLU GLU B . n 
B 1 279 ASN 279 279 279 ASN ASN B . n 
B 1 280 ALA 280 280 280 ALA ALA B . n 
B 1 281 THR 281 281 281 THR THR B . n 
B 1 282 ILE 282 282 282 ILE ILE B . n 
B 1 283 THR 283 283 283 THR THR B . n 
B 1 284 ALA 284 284 284 ALA ALA B . n 
B 1 285 TRP 285 285 285 TRP TRP B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 ALA 288 288 288 ALA ALA B . n 
B 1 289 ALA 289 289 289 ALA ALA B . n 
B 1 290 TYR 290 290 290 TYR TYR B . n 
B 1 291 TRP 291 291 291 TRP TRP B . n 
B 1 292 GLN 292 292 292 GLN GLN B . n 
B 1 293 THR 293 293 293 THR THR B . n 
B 1 294 LEU 294 294 294 LEU LEU B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 GLY 297 297 297 GLY GLY B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 ALA 300 300 300 ALA ALA B . n 
B 1 301 GLN 301 301 301 GLN GLN B . n 
B 1 302 ALA 302 302 302 ALA ALA B . n 
B 1 303 ALA 303 303 303 ALA ALA B . n 
B 1 304 GLY 304 304 304 GLY GLY B . n 
B 1 305 ASN 305 305 305 ASN ASN B . n 
B 1 306 TRP 306 306 306 TRP TRP B . n 
B 1 307 ARG 307 307 307 ARG ARG B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 GLU 309 309 309 GLU GLU B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 VAL 311 311 311 VAL VAL B . n 
B 1 312 GLN 312 312 312 GLN GLN B . n 
B 1 313 ARG 313 313 313 ARG ARG B . n 
B 1 314 HIS 314 314 314 HIS HIS B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 TYR 316 316 316 TYR TYR B . n 
B 1 317 ASP 317 317 317 ASP ASP B . n 
B 1 318 ILE 318 318 318 ILE ILE B . n 
B 1 319 ASP 319 319 319 ASP ASP B . n 
B 1 320 ILE 320 320 320 ILE ILE B . n 
B 1 321 ASP 321 321 321 ASP ASP B . n 
B 1 322 ALA 322 322 322 ALA ALA B . n 
B 1 323 PRO 323 323 323 PRO PRO B . n 
B 1 324 GLN 324 324 324 GLN GLN B . n 
B 1 325 GLY 325 325 325 GLY GLY B . n 
B 1 326 PRO 326 326 326 PRO PRO B . n 
B 1 327 VAL 327 327 327 VAL VAL B . n 
B 1 328 ARG 328 328 328 ARG ARG B . n 
B 1 329 VAL 329 329 329 VAL VAL B . n 
B 1 330 GLU 330 330 330 GLU GLU B . n 
B 1 331 ARG 331 331 331 ARG ARG B . n 
B 1 332 GLN 332 332 332 GLN GLN B . n 
B 1 333 ASN 333 333 333 ASN ASN B . n 
B 1 334 ASN 334 334 334 ASN ASN B . n 
B 1 335 HIS 335 335 335 HIS HIS B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 ARG 337 337 337 ARG ARG B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 SER 339 339 339 SER SER B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 ARG 341 341 341 ARG ARG B . n 
B 1 342 ILE 342 342 342 ILE ILE B . n 
B 1 343 ALA 343 343 343 ALA ALA B . n 
B 1 344 GLU 344 344 344 GLU GLU B . n 
B 1 345 ILE 345 345 345 ILE ILE B . n 
B 1 346 ASP 346 346 346 ASP ASP B . n 
B 1 347 ALA 347 347 347 ALA ALA B . n 
B 1 348 ARG 348 348 348 ARG ARG B . n 
B 1 349 GLY 349 349 349 GLY GLY B . n 
B 1 350 VAL 350 350 350 VAL VAL B . n 
B 1 351 PHE 351 351 351 PHE PHE B . n 
B 1 352 GLN 352 352 352 GLN GLN B . n 
B 1 353 VAL 353 353 353 VAL VAL B . n 
B 1 354 ARG 354 354 354 ARG ARG B . n 
B 1 355 TRP 355 355 355 TRP TRP B . n 
B 1 356 GLN 356 356 356 GLN GLN B . n 
B 1 357 SER 357 357 357 SER SER B . n 
B 1 358 PRO 358 358 358 PRO PRO B . n 
B 1 359 GLU 359 359 359 GLU GLU B . n 
B 1 360 PRO 360 360 360 PRO PRO B . n 
B 1 361 ILE 361 361 361 ILE ILE B . n 
B 1 362 ARG 362 362 362 ARG ARG B . n 
B 1 363 PRO 363 363 363 PRO PRO B . n 
B 1 364 ASP 364 364 364 ASP ASP B . n 
B 1 365 PRO 365 365 365 PRO PRO B . n 
B 1 366 TYR 366 366 366 TYR TYR B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 VAL 368 368 368 VAL VAL B . n 
B 1 369 VAL 369 369 369 VAL VAL B . n 
B 1 370 HIS 370 370 370 HIS HIS B . n 
B 1 371 ASN 371 371 371 ASN ASN B . n 
B 1 372 LEU 372 372 372 LEU LEU B . n 
B 1 373 ASP 373 373 373 ASP ASP B . n 
B 1 374 ASP 374 374 374 ASP ASP B . n 
B 1 375 TRP 375 375 375 TRP TRP B . n 
B 1 376 SER 376 376 376 SER SER B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 SER 378 378 378 SER SER B . n 
B 1 379 MET 379 379 379 MET MET B . n 
B 1 380 GLY 380 380 380 GLY GLY B . n 
B 1 381 GLY 381 381 ?   ?   ?   B . n 
B 1 382 GLY 382 382 ?   ?   ?   B . n 
B 1 383 PRO 383 383 ?   ?   ?   B . n 
B 1 384 LEU 384 384 ?   ?   ?   B . n 
B 1 385 PRO 385 385 ?   ?   ?   B . n 
C 2 1   MET 1   1   ?   ?   ?   D . n 
C 2 2   SER 2   2   2   SER SER D . n 
C 2 3   ALA 3   3   3   ALA ALA D . n 
C 2 4   ASN 4   4   4   ASN ASN D . n 
C 2 5   SER 5   5   5   SER SER D . n 
C 2 6   LEU 6   6   6   LEU LEU D . n 
C 2 7   LEU 7   7   7   LEU LEU D . n 
C 2 8   GLY 8   8   8   GLY GLY D . n 
C 2 9   SER 9   9   9   SER SER D . n 
C 2 10  LEU 10  10  10  LEU LEU D . n 
C 2 11  ARG 11  11  11  ARG ARG D . n 
C 2 12  GLU 12  12  12  GLU GLU D . n 
C 2 13  LEU 13  13  13  LEU LEU D . n 
C 2 14  GLN 14  14  14  GLN GLN D . n 
C 2 15  VAL 15  15  15  VAL VAL D . n 
C 2 16  LEU 16  16  16  LEU LEU D . n 
C 2 17  VAL 17  17  17  VAL VAL D . n 
C 2 18  LEU 18  18  18  LEU LEU D . n 
C 2 19  ASN 19  19  19  ASN ASN D . n 
C 2 20  PRO 20  20  20  PRO PRO D . n 
C 2 21  PRO 21  21  21  PRO PRO D . n 
C 2 22  GLY 22  22  22  GLY GLY D . n 
C 2 23  GLU 23  23  23  GLU GLU D . n 
C 2 24  VAL 24  24  24  VAL VAL D . n 
C 2 25  SER 25  25  25  SER SER D . n 
C 2 26  ASP 26  26  26  ASP ASP D . n 
C 2 27  ALA 27  27  27  ALA ALA D . n 
C 2 28  LEU 28  28  28  LEU LEU D . n 
C 2 29  VAL 29  29  29  VAL VAL D . n 
C 2 30  LEU 30  30  30  LEU LEU D . n 
C 2 31  GLN 31  31  31  GLN GLN D . n 
C 2 32  LEU 32  32  32  LEU LEU D . n 
C 2 33  ILE 33  33  33  ILE ILE D . n 
C 2 34  ARG 34  34  34  ARG ARG D . n 
C 2 35  ILE 35  35  35  ILE ILE D . n 
C 2 36  GLY 36  36  36  GLY GLY D . n 
C 2 37  CYS 37  37  37  CYS CYS D . n 
C 2 38  SER 38  38  38  SER SER D . n 
C 2 39  VAL 39  39  39  VAL VAL D . n 
C 2 40  ARG 40  40  40  ARG ARG D . n 
C 2 41  GLN 41  41  41  GLN GLN D . n 
C 2 42  CYS 42  42  42  CYS CYS D . n 
C 2 43  TRP 43  43  43  TRP TRP D . n 
C 2 44  PRO 44  44  44  PRO PRO D . n 
C 2 45  PRO 45  45  45  PRO PRO D . n 
C 2 46  PRO 46  46  46  PRO PRO D . n 
C 2 47  GLU 47  47  47  GLU GLU D . n 
C 2 48  ALA 48  48  48  ALA ALA D . n 
C 2 49  PHE 49  49  49  PHE PHE D . n 
C 2 50  ASP 50  50  50  ASP ASP D . n 
C 2 51  VAL 51  51  51  VAL VAL D . n 
C 2 52  PRO 52  52  52  PRO PRO D . n 
C 2 53  VAL 53  53  53  VAL VAL D . n 
C 2 54  ASP 54  54  54  ASP ASP D . n 
C 2 55  VAL 55  55  55  VAL VAL D . n 
C 2 56  VAL 56  56  56  VAL VAL D . n 
C 2 57  PHE 57  57  57  PHE PHE D . n 
C 2 58  THR 58  58  58  THR THR D . n 
C 2 59  SER 59  59  59  SER SER D . n 
C 2 60  ILE 60  60  60  ILE ILE D . n 
C 2 61  PHE 61  61  61  PHE PHE D . n 
C 2 62  GLN 62  62  62  GLN GLN D . n 
C 2 63  ASN 63  63  63  ASN ASN D . n 
C 2 64  ARG 64  64  64  ARG ARG D . n 
C 2 65  HIS 65  65  65  HIS HIS D . n 
C 2 66  HIS 66  66  66  HIS HIS D . n 
C 2 67  ASP 67  67  67  ASP ASP D . n 
C 2 68  GLU 68  68  68  GLU GLU D . n 
C 2 69  ILE 69  69  69  ILE ILE D . n 
C 2 70  ALA 70  70  70  ALA ALA D . n 
C 2 71  ALA 71  71  71  ALA ALA D . n 
C 2 72  LEU 72  72  72  LEU LEU D . n 
C 2 73  LEU 73  73  73  LEU LEU D . n 
C 2 74  ALA 74  74  74  ALA ALA D . n 
C 2 75  ALA 75  75  75  ALA ALA D . n 
C 2 76  GLY 76  76  76  GLY GLY D . n 
C 2 77  THR 77  77  77  THR THR D . n 
C 2 78  PRO 78  78  78  PRO PRO D . n 
C 2 79  ARG 79  79  79  ARG ARG D . n 
C 2 80  THR 80  80  80  THR THR D . n 
C 2 81  THR 81  81  81  THR THR D . n 
C 2 82  LEU 82  82  82  LEU LEU D . n 
C 2 83  VAL 83  83  83  VAL VAL D . n 
C 2 84  ALA 84  84  84  ALA ALA D . n 
C 2 85  LEU 85  85  85  LEU LEU D . n 
C 2 86  VAL 86  86  86  VAL VAL D . n 
C 2 87  GLU 87  87  87  GLU GLU D . n 
C 2 88  TYR 88  88  88  TYR TYR D . n 
C 2 89  GLU 89  89  89  GLU GLU D . n 
C 2 90  SER 90  90  90  SER SER D . n 
C 2 91  PRO 91  91  91  PRO PRO D . n 
C 2 92  ALA 92  92  92  ALA ALA D . n 
C 2 93  VAL 93  93  93  VAL VAL D . n 
C 2 94  LEU 94  94  94  LEU LEU D . n 
C 2 95  SER 95  95  95  SER SER D . n 
C 2 96  GLN 96  96  96  GLN GLN D . n 
C 2 97  ILE 97  97  97  ILE ILE D . n 
C 2 98  ILE 98  98  98  ILE ILE D . n 
C 2 99  GLU 99  99  99  GLU GLU D . n 
C 2 100 LEU 100 100 100 LEU LEU D . n 
C 2 101 GLU 101 101 101 GLU GLU D . n 
C 2 102 CYS 102 102 102 CYS CYS D . n 
C 2 103 HIS 103 103 103 HIS HIS D . n 
C 2 104 GLY 104 104 104 GLY GLY D . n 
C 2 105 VAL 105 105 105 VAL VAL D . n 
C 2 106 ILE 106 106 106 ILE ILE D . n 
C 2 107 THR 107 107 107 THR THR D . n 
C 2 108 GLN 108 108 108 GLN GLN D . n 
C 2 109 PRO 109 109 109 PRO PRO D . n 
C 2 110 LEU 110 110 110 LEU LEU D . n 
C 2 111 ASP 111 111 111 ASP ASP D . n 
C 2 112 ALA 112 112 112 ALA ALA D . n 
C 2 113 HIS 113 113 113 HIS HIS D . n 
C 2 114 ARG 114 114 114 ARG ARG D . n 
C 2 115 VAL 115 115 115 VAL VAL D . n 
C 2 116 LEU 116 116 116 LEU LEU D . n 
C 2 117 PRO 117 117 117 PRO PRO D . n 
C 2 118 VAL 118 118 118 VAL VAL D . n 
C 2 119 LEU 119 119 119 LEU LEU D . n 
C 2 120 VAL 120 120 120 VAL VAL D . n 
C 2 121 SER 121 121 121 SER SER D . n 
C 2 122 ALA 122 122 122 ALA ALA D . n 
C 2 123 ARG 123 123 123 ARG ARG D . n 
C 2 124 ARG 124 124 124 ARG ARG D . n 
C 2 125 ILE 125 125 125 ILE ILE D . n 
C 2 126 SER 126 126 126 SER SER D . n 
C 2 127 GLU 127 127 127 GLU GLU D . n 
C 2 128 GLU 128 128 128 GLU GLU D . n 
C 2 129 MET 129 129 129 MET MET D . n 
C 2 130 ALA 130 130 130 ALA ALA D . n 
C 2 131 LYS 131 131 131 LYS LYS D . n 
C 2 132 LEU 132 132 132 LEU LEU D . n 
C 2 133 LYS 133 133 133 LYS LYS D . n 
C 2 134 GLN 134 134 134 GLN GLN D . n 
C 2 135 LYS 135 135 135 LYS LYS D . n 
C 2 136 THR 136 136 136 THR THR D . n 
C 2 137 GLU 137 137 137 GLU GLU D . n 
C 2 138 GLN 138 138 138 GLN GLN D . n 
C 2 139 LEU 139 139 139 LEU LEU D . n 
C 2 140 GLN 140 140 140 GLN GLN D . n 
C 2 141 ASP 141 141 141 ASP ASP D . n 
C 2 142 ARG 142 142 142 ARG ARG D . n 
C 2 143 ILE 143 143 143 ILE ILE D . n 
C 2 144 ALA 144 144 144 ALA ALA D . n 
C 2 145 GLY 145 145 145 GLY GLY D . n 
C 2 146 GLN 146 146 146 GLN GLN D . n 
C 2 147 ALA 147 147 147 ALA ALA D . n 
C 2 148 ARG 148 148 148 ARG ARG D . n 
C 2 149 ILE 149 149 149 ILE ILE D . n 
C 2 150 ASN 150 150 150 ASN ASN D . n 
C 2 151 GLN 151 151 151 GLN GLN D . n 
C 2 152 ALA 152 152 152 ALA ALA D . n 
C 2 153 LYS 153 153 153 LYS LYS D . n 
C 2 154 VAL 154 154 154 VAL VAL D . n 
C 2 155 LEU 155 155 155 LEU LEU D . n 
C 2 156 LEU 156 156 156 LEU LEU D . n 
C 2 157 MET 157 157 157 MET MET D . n 
C 2 158 GLN 158 158 158 GLN GLN D . n 
C 2 159 ARG 159 159 159 ARG ARG D . n 
C 2 160 HIS 160 160 160 HIS HIS D . n 
C 2 161 GLY 161 161 161 GLY GLY D . n 
C 2 162 TRP 162 162 162 TRP TRP D . n 
C 2 163 ASP 163 163 163 ASP ASP D . n 
C 2 164 GLU 164 164 164 GLU GLU D . n 
C 2 165 ARG 165 165 165 ARG ARG D . n 
C 2 166 GLU 166 166 166 GLU GLU D . n 
C 2 167 ALA 167 167 167 ALA ALA D . n 
C 2 168 HIS 168 168 168 HIS HIS D . n 
C 2 169 GLN 169 169 169 GLN GLN D . n 
C 2 170 HIS 170 170 170 HIS HIS D . n 
C 2 171 LEU 171 171 171 LEU LEU D . n 
C 2 172 SER 172 172 172 SER SER D . n 
C 2 173 ARG 173 173 173 ARG ARG D . n 
C 2 174 GLU 174 174 174 GLU GLU D . n 
C 2 175 ALA 175 175 175 ALA ALA D . n 
C 2 176 MET 176 176 176 MET MET D . n 
C 2 177 LYS 177 177 177 LYS LYS D . n 
C 2 178 ARG 178 178 178 ARG ARG D . n 
C 2 179 ARG 179 179 179 ARG ARG D . n 
C 2 180 GLU 180 180 180 GLU GLU D . n 
C 2 181 PRO 181 181 181 PRO PRO D . n 
C 2 182 ILE 182 182 182 ILE ILE D . n 
C 2 183 LEU 183 183 183 LEU LEU D . n 
C 2 184 LYS 184 184 184 LYS LYS D . n 
C 2 185 ILE 185 185 185 ILE ILE D . n 
C 2 186 ALA 186 186 186 ALA ALA D . n 
C 2 187 GLN 187 187 187 GLN GLN D . n 
C 2 188 GLU 188 188 188 GLU GLU D . n 
C 2 189 LEU 189 189 189 LEU LEU D . n 
C 2 190 LEU 190 190 190 LEU LEU D . n 
C 2 191 GLY 191 191 ?   ?   ?   D . n 
C 2 192 ASN 192 192 ?   ?   ?   D . n 
C 2 193 GLU 193 193 ?   ?   ?   D . n 
C 2 194 PRO 194 194 ?   ?   ?   D . n 
C 2 195 SER 195 195 ?   ?   ?   D . n 
C 2 196 ALA 196 196 ?   ?   ?   D . n 
D 2 1   MET 1   1   ?   ?   ?   E . n 
D 2 2   SER 2   2   2   SER SER E . n 
D 2 3   ALA 3   3   3   ALA ALA E . n 
D 2 4   ASN 4   4   4   ASN ASN E . n 
D 2 5   SER 5   5   5   SER SER E . n 
D 2 6   LEU 6   6   6   LEU LEU E . n 
D 2 7   LEU 7   7   7   LEU LEU E . n 
D 2 8   GLY 8   8   8   GLY GLY E . n 
D 2 9   SER 9   9   9   SER SER E . n 
D 2 10  LEU 10  10  10  LEU LEU E . n 
D 2 11  ARG 11  11  11  ARG ARG E . n 
D 2 12  GLU 12  12  12  GLU GLU E . n 
D 2 13  LEU 13  13  13  LEU LEU E . n 
D 2 14  GLN 14  14  14  GLN GLN E . n 
D 2 15  VAL 15  15  15  VAL VAL E . n 
D 2 16  LEU 16  16  16  LEU LEU E . n 
D 2 17  VAL 17  17  17  VAL VAL E . n 
D 2 18  LEU 18  18  18  LEU LEU E . n 
D 2 19  ASN 19  19  19  ASN ASN E . n 
D 2 20  PRO 20  20  20  PRO PRO E . n 
D 2 21  PRO 21  21  21  PRO PRO E . n 
D 2 22  GLY 22  22  22  GLY GLY E . n 
D 2 23  GLU 23  23  23  GLU GLU E . n 
D 2 24  VAL 24  24  24  VAL VAL E . n 
D 2 25  SER 25  25  25  SER SER E . n 
D 2 26  ASP 26  26  26  ASP ASP E . n 
D 2 27  ALA 27  27  27  ALA ALA E . n 
D 2 28  LEU 28  28  28  LEU LEU E . n 
D 2 29  VAL 29  29  29  VAL VAL E . n 
D 2 30  LEU 30  30  30  LEU LEU E . n 
D 2 31  GLN 31  31  31  GLN GLN E . n 
D 2 32  LEU 32  32  32  LEU LEU E . n 
D 2 33  ILE 33  33  33  ILE ILE E . n 
D 2 34  ARG 34  34  34  ARG ARG E . n 
D 2 35  ILE 35  35  35  ILE ILE E . n 
D 2 36  GLY 36  36  36  GLY GLY E . n 
D 2 37  CYS 37  37  37  CYS CYS E . n 
D 2 38  SER 38  38  38  SER SER E . n 
D 2 39  VAL 39  39  39  VAL VAL E . n 
D 2 40  ARG 40  40  40  ARG ARG E . n 
D 2 41  GLN 41  41  41  GLN GLN E . n 
D 2 42  CYS 42  42  42  CYS CYS E . n 
D 2 43  TRP 43  43  43  TRP TRP E . n 
D 2 44  PRO 44  44  44  PRO PRO E . n 
D 2 45  PRO 45  45  45  PRO PRO E . n 
D 2 46  PRO 46  46  46  PRO PRO E . n 
D 2 47  GLU 47  47  47  GLU GLU E . n 
D 2 48  ALA 48  48  48  ALA ALA E . n 
D 2 49  PHE 49  49  49  PHE PHE E . n 
D 2 50  ASP 50  50  50  ASP ASP E . n 
D 2 51  VAL 51  51  51  VAL VAL E . n 
D 2 52  PRO 52  52  52  PRO PRO E . n 
D 2 53  VAL 53  53  53  VAL VAL E . n 
D 2 54  ASP 54  54  54  ASP ASP E . n 
D 2 55  VAL 55  55  55  VAL VAL E . n 
D 2 56  VAL 56  56  56  VAL VAL E . n 
D 2 57  PHE 57  57  57  PHE PHE E . n 
D 2 58  THR 58  58  58  THR THR E . n 
D 2 59  SER 59  59  59  SER SER E . n 
D 2 60  ILE 60  60  60  ILE ILE E . n 
D 2 61  PHE 61  61  61  PHE PHE E . n 
D 2 62  GLN 62  62  62  GLN GLN E . n 
D 2 63  ASN 63  63  63  ASN ASN E . n 
D 2 64  ARG 64  64  64  ARG ARG E . n 
D 2 65  HIS 65  65  65  HIS HIS E . n 
D 2 66  HIS 66  66  66  HIS HIS E . n 
D 2 67  ASP 67  67  67  ASP ASP E . n 
D 2 68  GLU 68  68  68  GLU GLU E . n 
D 2 69  ILE 69  69  69  ILE ILE E . n 
D 2 70  ALA 70  70  70  ALA ALA E . n 
D 2 71  ALA 71  71  71  ALA ALA E . n 
D 2 72  LEU 72  72  72  LEU LEU E . n 
D 2 73  LEU 73  73  73  LEU LEU E . n 
D 2 74  ALA 74  74  74  ALA ALA E . n 
D 2 75  ALA 75  75  75  ALA ALA E . n 
D 2 76  GLY 76  76  76  GLY GLY E . n 
D 2 77  THR 77  77  77  THR THR E . n 
D 2 78  PRO 78  78  78  PRO PRO E . n 
D 2 79  ARG 79  79  79  ARG ARG E . n 
D 2 80  THR 80  80  80  THR THR E . n 
D 2 81  THR 81  81  81  THR THR E . n 
D 2 82  LEU 82  82  82  LEU LEU E . n 
D 2 83  VAL 83  83  83  VAL VAL E . n 
D 2 84  ALA 84  84  84  ALA ALA E . n 
D 2 85  LEU 85  85  85  LEU LEU E . n 
D 2 86  VAL 86  86  86  VAL VAL E . n 
D 2 87  GLU 87  87  87  GLU GLU E . n 
D 2 88  TYR 88  88  88  TYR TYR E . n 
D 2 89  GLU 89  89  89  GLU GLU E . n 
D 2 90  SER 90  90  90  SER SER E . n 
D 2 91  PRO 91  91  91  PRO PRO E . n 
D 2 92  ALA 92  92  92  ALA ALA E . n 
D 2 93  VAL 93  93  93  VAL VAL E . n 
D 2 94  LEU 94  94  94  LEU LEU E . n 
D 2 95  SER 95  95  95  SER SER E . n 
D 2 96  GLN 96  96  96  GLN GLN E . n 
D 2 97  ILE 97  97  97  ILE ILE E . n 
D 2 98  ILE 98  98  98  ILE ILE E . n 
D 2 99  GLU 99  99  99  GLU GLU E . n 
D 2 100 LEU 100 100 100 LEU LEU E . n 
D 2 101 GLU 101 101 101 GLU GLU E . n 
D 2 102 CYS 102 102 102 CYS CYS E . n 
D 2 103 HIS 103 103 103 HIS HIS E . n 
D 2 104 GLY 104 104 104 GLY GLY E . n 
D 2 105 VAL 105 105 105 VAL VAL E . n 
D 2 106 ILE 106 106 106 ILE ILE E . n 
D 2 107 THR 107 107 107 THR THR E . n 
D 2 108 GLN 108 108 108 GLN GLN E . n 
D 2 109 PRO 109 109 109 PRO PRO E . n 
D 2 110 LEU 110 110 110 LEU LEU E . n 
D 2 111 ASP 111 111 111 ASP ASP E . n 
D 2 112 ALA 112 112 112 ALA ALA E . n 
D 2 113 HIS 113 113 113 HIS HIS E . n 
D 2 114 ARG 114 114 114 ARG ARG E . n 
D 2 115 VAL 115 115 115 VAL VAL E . n 
D 2 116 LEU 116 116 116 LEU LEU E . n 
D 2 117 PRO 117 117 117 PRO PRO E . n 
D 2 118 VAL 118 118 118 VAL VAL E . n 
D 2 119 LEU 119 119 119 LEU LEU E . n 
D 2 120 VAL 120 120 120 VAL VAL E . n 
D 2 121 SER 121 121 121 SER SER E . n 
D 2 122 ALA 122 122 122 ALA ALA E . n 
D 2 123 ARG 123 123 123 ARG ARG E . n 
D 2 124 ARG 124 124 124 ARG ARG E . n 
D 2 125 ILE 125 125 125 ILE ILE E . n 
D 2 126 SER 126 126 126 SER SER E . n 
D 2 127 GLU 127 127 127 GLU GLU E . n 
D 2 128 GLU 128 128 128 GLU GLU E . n 
D 2 129 MET 129 129 129 MET MET E . n 
D 2 130 ALA 130 130 130 ALA ALA E . n 
D 2 131 LYS 131 131 131 LYS LYS E . n 
D 2 132 LEU 132 132 132 LEU LEU E . n 
D 2 133 LYS 133 133 133 LYS LYS E . n 
D 2 134 GLN 134 134 134 GLN GLN E . n 
D 2 135 LYS 135 135 135 LYS LYS E . n 
D 2 136 THR 136 136 136 THR THR E . n 
D 2 137 GLU 137 137 137 GLU GLU E . n 
D 2 138 GLN 138 138 138 GLN GLN E . n 
D 2 139 LEU 139 139 139 LEU LEU E . n 
D 2 140 GLN 140 140 140 GLN GLN E . n 
D 2 141 ASP 141 141 141 ASP ASP E . n 
D 2 142 ARG 142 142 142 ARG ARG E . n 
D 2 143 ILE 143 143 143 ILE ILE E . n 
D 2 144 ALA 144 144 144 ALA ALA E . n 
D 2 145 GLY 145 145 145 GLY GLY E . n 
D 2 146 GLN 146 146 146 GLN GLN E . n 
D 2 147 ALA 147 147 147 ALA ALA E . n 
D 2 148 ARG 148 148 148 ARG ARG E . n 
D 2 149 ILE 149 149 149 ILE ILE E . n 
D 2 150 ASN 150 150 150 ASN ASN E . n 
D 2 151 GLN 151 151 151 GLN GLN E . n 
D 2 152 ALA 152 152 152 ALA ALA E . n 
D 2 153 LYS 153 153 153 LYS LYS E . n 
D 2 154 VAL 154 154 154 VAL VAL E . n 
D 2 155 LEU 155 155 155 LEU LEU E . n 
D 2 156 LEU 156 156 156 LEU LEU E . n 
D 2 157 MET 157 157 157 MET MET E . n 
D 2 158 GLN 158 158 158 GLN GLN E . n 
D 2 159 ARG 159 159 159 ARG ARG E . n 
D 2 160 HIS 160 160 160 HIS HIS E . n 
D 2 161 GLY 161 161 161 GLY GLY E . n 
D 2 162 TRP 162 162 162 TRP TRP E . n 
D 2 163 ASP 163 163 163 ASP ASP E . n 
D 2 164 GLU 164 164 164 GLU GLU E . n 
D 2 165 ARG 165 165 165 ARG ARG E . n 
D 2 166 GLU 166 166 166 GLU GLU E . n 
D 2 167 ALA 167 167 167 ALA ALA E . n 
D 2 168 HIS 168 168 168 HIS HIS E . n 
D 2 169 GLN 169 169 169 GLN GLN E . n 
D 2 170 HIS 170 170 170 HIS HIS E . n 
D 2 171 LEU 171 171 171 LEU LEU E . n 
D 2 172 SER 172 172 172 SER SER E . n 
D 2 173 ARG 173 173 173 ARG ARG E . n 
D 2 174 GLU 174 174 174 GLU GLU E . n 
D 2 175 ALA 175 175 175 ALA ALA E . n 
D 2 176 MET 176 176 176 MET MET E . n 
D 2 177 LYS 177 177 177 LYS LYS E . n 
D 2 178 ARG 178 178 178 ARG ARG E . n 
D 2 179 ARG 179 179 179 ARG ARG E . n 
D 2 180 GLU 180 180 180 GLU GLU E . n 
D 2 181 PRO 181 181 181 PRO PRO E . n 
D 2 182 ILE 182 182 182 ILE ILE E . n 
D 2 183 LEU 183 183 183 LEU LEU E . n 
D 2 184 LYS 184 184 184 LYS LYS E . n 
D 2 185 ILE 185 185 185 ILE ILE E . n 
D 2 186 ALA 186 186 186 ALA ALA E . n 
D 2 187 GLN 187 187 187 GLN GLN E . n 
D 2 188 GLU 188 188 188 GLU GLU E . n 
D 2 189 LEU 189 189 189 LEU LEU E . n 
D 2 190 LEU 190 190 190 LEU LEU E . n 
D 2 191 GLY 191 191 191 GLY GLY E . n 
D 2 192 ASN 192 192 192 ASN ASN E . n 
D 2 193 GLU 193 193 193 GLU GLU E . n 
D 2 194 PRO 194 194 194 PRO PRO E . n 
D 2 195 SER 195 195 195 SER SER E . n 
D 2 196 ALA 196 196 ?   ?   ?   E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 BMD 1   400  400  BMD BMD A . 
F 3 BMD 1   500  500  BMD BMD B . 
G 4 HOH 1   2001 2001 HOH HOH A . 
G 4 HOH 2   2002 2002 HOH HOH A . 
G 4 HOH 3   2003 2003 HOH HOH A . 
G 4 HOH 4   2004 2004 HOH HOH A . 
G 4 HOH 5   2005 2005 HOH HOH A . 
G 4 HOH 6   2006 2006 HOH HOH A . 
G 4 HOH 7   2007 2007 HOH HOH A . 
G 4 HOH 8   2008 2008 HOH HOH A . 
G 4 HOH 9   2009 2009 HOH HOH A . 
G 4 HOH 10  2010 2010 HOH HOH A . 
G 4 HOH 11  2011 2011 HOH HOH A . 
G 4 HOH 12  2012 2012 HOH HOH A . 
G 4 HOH 13  2013 2013 HOH HOH A . 
G 4 HOH 14  2014 2014 HOH HOH A . 
G 4 HOH 15  2015 2015 HOH HOH A . 
G 4 HOH 16  2016 2016 HOH HOH A . 
G 4 HOH 17  2017 2017 HOH HOH A . 
G 4 HOH 18  2018 2018 HOH HOH A . 
G 4 HOH 19  2019 2019 HOH HOH A . 
G 4 HOH 20  2020 2020 HOH HOH A . 
G 4 HOH 21  2021 2021 HOH HOH A . 
G 4 HOH 22  2022 2022 HOH HOH A . 
G 4 HOH 23  2023 2023 HOH HOH A . 
G 4 HOH 24  2024 2024 HOH HOH A . 
G 4 HOH 25  2025 2025 HOH HOH A . 
G 4 HOH 26  2026 2026 HOH HOH A . 
G 4 HOH 27  2027 2027 HOH HOH A . 
G 4 HOH 28  2028 2028 HOH HOH A . 
G 4 HOH 29  2029 2029 HOH HOH A . 
G 4 HOH 30  2030 2030 HOH HOH A . 
G 4 HOH 31  2031 2031 HOH HOH A . 
G 4 HOH 32  2032 2032 HOH HOH A . 
G 4 HOH 33  2033 2033 HOH HOH A . 
G 4 HOH 34  2034 2034 HOH HOH A . 
G 4 HOH 35  2035 2035 HOH HOH A . 
G 4 HOH 36  2036 2036 HOH HOH A . 
G 4 HOH 37  2037 2037 HOH HOH A . 
G 4 HOH 38  2038 2038 HOH HOH A . 
G 4 HOH 39  2039 2039 HOH HOH A . 
G 4 HOH 40  2040 2040 HOH HOH A . 
G 4 HOH 41  2041 2041 HOH HOH A . 
G 4 HOH 42  2042 2042 HOH HOH A . 
G 4 HOH 43  2043 2043 HOH HOH A . 
G 4 HOH 44  2044 2044 HOH HOH A . 
G 4 HOH 45  2045 2045 HOH HOH A . 
G 4 HOH 46  2046 2046 HOH HOH A . 
G 4 HOH 47  2047 2047 HOH HOH A . 
G 4 HOH 48  2048 2048 HOH HOH A . 
G 4 HOH 49  2049 2049 HOH HOH A . 
G 4 HOH 50  2050 2050 HOH HOH A . 
G 4 HOH 51  2051 2051 HOH HOH A . 
G 4 HOH 52  2052 2052 HOH HOH A . 
G 4 HOH 53  2053 2053 HOH HOH A . 
G 4 HOH 54  2054 2054 HOH HOH A . 
G 4 HOH 55  2055 2055 HOH HOH A . 
G 4 HOH 56  2056 2056 HOH HOH A . 
G 4 HOH 57  2057 2057 HOH HOH A . 
G 4 HOH 58  2058 2058 HOH HOH A . 
G 4 HOH 59  2059 2059 HOH HOH A . 
G 4 HOH 60  2060 2060 HOH HOH A . 
G 4 HOH 61  2061 2061 HOH HOH A . 
G 4 HOH 62  2062 2062 HOH HOH A . 
G 4 HOH 63  2063 2063 HOH HOH A . 
G 4 HOH 64  2064 2064 HOH HOH A . 
G 4 HOH 65  2065 2065 HOH HOH A . 
G 4 HOH 66  2066 2066 HOH HOH A . 
G 4 HOH 67  2067 2067 HOH HOH A . 
G 4 HOH 68  2068 2068 HOH HOH A . 
G 4 HOH 69  2069 2069 HOH HOH A . 
G 4 HOH 70  2070 2070 HOH HOH A . 
G 4 HOH 71  2071 2071 HOH HOH A . 
G 4 HOH 72  2072 2072 HOH HOH A . 
G 4 HOH 73  2073 2073 HOH HOH A . 
G 4 HOH 74  2074 2074 HOH HOH A . 
G 4 HOH 75  2075 2075 HOH HOH A . 
G 4 HOH 76  2076 2076 HOH HOH A . 
G 4 HOH 77  2077 2077 HOH HOH A . 
G 4 HOH 78  2078 2078 HOH HOH A . 
G 4 HOH 79  2079 2079 HOH HOH A . 
G 4 HOH 80  2080 2080 HOH HOH A . 
G 4 HOH 81  2081 2081 HOH HOH A . 
G 4 HOH 82  2082 2082 HOH HOH A . 
G 4 HOH 83  2083 2083 HOH HOH A . 
G 4 HOH 84  2084 2084 HOH HOH A . 
G 4 HOH 85  2085 2085 HOH HOH A . 
G 4 HOH 86  2086 2086 HOH HOH A . 
G 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 88  2088 2088 HOH HOH A . 
G 4 HOH 89  2089 2089 HOH HOH A . 
G 4 HOH 90  2090 2090 HOH HOH A . 
G 4 HOH 91  2091 2091 HOH HOH A . 
G 4 HOH 92  2092 2092 HOH HOH A . 
G 4 HOH 93  2093 2093 HOH HOH A . 
G 4 HOH 94  2094 2094 HOH HOH A . 
G 4 HOH 95  2095 2095 HOH HOH A . 
G 4 HOH 96  2096 2096 HOH HOH A . 
G 4 HOH 97  2097 2097 HOH HOH A . 
G 4 HOH 98  2098 2098 HOH HOH A . 
G 4 HOH 99  2099 2099 HOH HOH A . 
G 4 HOH 100 2100 2100 HOH HOH A . 
G 4 HOH 101 2101 2101 HOH HOH A . 
G 4 HOH 102 2102 2102 HOH HOH A . 
G 4 HOH 103 2103 2103 HOH HOH A . 
G 4 HOH 104 2104 2104 HOH HOH A . 
G 4 HOH 105 2105 2105 HOH HOH A . 
G 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 107 2107 2107 HOH HOH A . 
G 4 HOH 108 2108 2108 HOH HOH A . 
G 4 HOH 109 2109 2109 HOH HOH A . 
G 4 HOH 110 2110 2110 HOH HOH A . 
G 4 HOH 111 2111 2111 HOH HOH A . 
G 4 HOH 112 2112 2112 HOH HOH A . 
G 4 HOH 113 2113 2113 HOH HOH A . 
G 4 HOH 114 2114 2114 HOH HOH A . 
G 4 HOH 115 2115 2115 HOH HOH A . 
G 4 HOH 116 2116 2116 HOH HOH A . 
G 4 HOH 117 2117 2117 HOH HOH A . 
G 4 HOH 118 2118 2118 HOH HOH A . 
G 4 HOH 119 2119 2119 HOH HOH A . 
G 4 HOH 120 2120 2120 HOH HOH A . 
G 4 HOH 121 2121 2121 HOH HOH A . 
G 4 HOH 122 2122 2122 HOH HOH A . 
G 4 HOH 123 2123 2123 HOH HOH A . 
G 4 HOH 124 2124 2124 HOH HOH A . 
G 4 HOH 125 2125 2125 HOH HOH A . 
G 4 HOH 126 2126 2126 HOH HOH A . 
G 4 HOH 127 2127 2127 HOH HOH A . 
G 4 HOH 128 2128 2128 HOH HOH A . 
G 4 HOH 129 2129 2129 HOH HOH A . 
G 4 HOH 130 2130 2130 HOH HOH A . 
G 4 HOH 131 2131 2131 HOH HOH A . 
G 4 HOH 132 2132 2132 HOH HOH A . 
G 4 HOH 133 2133 2133 HOH HOH A . 
G 4 HOH 134 2134 2134 HOH HOH A . 
G 4 HOH 135 2135 2135 HOH HOH A . 
G 4 HOH 136 2136 2136 HOH HOH A . 
G 4 HOH 137 2137 2137 HOH HOH A . 
G 4 HOH 138 2138 2138 HOH HOH A . 
G 4 HOH 139 2139 2139 HOH HOH A . 
G 4 HOH 140 2140 2140 HOH HOH A . 
G 4 HOH 141 2141 2141 HOH HOH A . 
G 4 HOH 142 2142 2142 HOH HOH A . 
G 4 HOH 143 2143 2143 HOH HOH A . 
G 4 HOH 144 2144 2144 HOH HOH A . 
G 4 HOH 145 2145 2145 HOH HOH A . 
G 4 HOH 146 2146 2146 HOH HOH A . 
G 4 HOH 147 2147 2147 HOH HOH A . 
G 4 HOH 148 2148 2148 HOH HOH A . 
G 4 HOH 149 2149 2149 HOH HOH A . 
G 4 HOH 150 2150 2150 HOH HOH A . 
G 4 HOH 151 2151 2151 HOH HOH A . 
G 4 HOH 152 2152 2152 HOH HOH A . 
G 4 HOH 153 2153 2153 HOH HOH A . 
G 4 HOH 154 2154 2154 HOH HOH A . 
G 4 HOH 155 2155 2155 HOH HOH A . 
G 4 HOH 156 2156 2156 HOH HOH A . 
G 4 HOH 157 2157 2157 HOH HOH A . 
G 4 HOH 158 2158 2158 HOH HOH A . 
G 4 HOH 159 2159 2159 HOH HOH A . 
G 4 HOH 160 2160 2160 HOH HOH A . 
G 4 HOH 161 2161 2161 HOH HOH A . 
G 4 HOH 162 2162 2162 HOH HOH A . 
G 4 HOH 163 2163 2163 HOH HOH A . 
G 4 HOH 164 2164 2164 HOH HOH A . 
G 4 HOH 165 2165 2165 HOH HOH A . 
G 4 HOH 166 2166 2166 HOH HOH A . 
G 4 HOH 167 2167 2167 HOH HOH A . 
G 4 HOH 168 2168 2168 HOH HOH A . 
G 4 HOH 169 2169 2169 HOH HOH A . 
G 4 HOH 170 2170 2170 HOH HOH A . 
G 4 HOH 171 2171 2171 HOH HOH A . 
G 4 HOH 172 2172 2172 HOH HOH A . 
G 4 HOH 173 2173 2173 HOH HOH A . 
G 4 HOH 174 2174 2174 HOH HOH A . 
G 4 HOH 175 2175 2175 HOH HOH A . 
G 4 HOH 176 2176 2176 HOH HOH A . 
G 4 HOH 177 2177 2177 HOH HOH A . 
G 4 HOH 178 2178 2178 HOH HOH A . 
G 4 HOH 179 2179 2179 HOH HOH A . 
G 4 HOH 180 2180 2180 HOH HOH A . 
G 4 HOH 181 2181 2181 HOH HOH A . 
G 4 HOH 182 2182 2182 HOH HOH A . 
G 4 HOH 183 2183 2183 HOH HOH A . 
G 4 HOH 184 2184 2184 HOH HOH A . 
G 4 HOH 185 2185 2185 HOH HOH A . 
G 4 HOH 186 2186 2186 HOH HOH A . 
G 4 HOH 187 2187 2187 HOH HOH A . 
G 4 HOH 188 2188 2188 HOH HOH A . 
G 4 HOH 189 2189 2189 HOH HOH A . 
G 4 HOH 190 2190 2190 HOH HOH A . 
G 4 HOH 191 2191 2191 HOH HOH A . 
G 4 HOH 192 2192 2192 HOH HOH A . 
G 4 HOH 193 2193 2193 HOH HOH A . 
G 4 HOH 194 2194 2194 HOH HOH A . 
G 4 HOH 195 2195 2195 HOH HOH A . 
G 4 HOH 196 2196 2196 HOH HOH A . 
G 4 HOH 197 2197 2197 HOH HOH A . 
G 4 HOH 198 2198 2198 HOH HOH A . 
G 4 HOH 199 2199 2199 HOH HOH A . 
G 4 HOH 200 2200 2200 HOH HOH A . 
G 4 HOH 201 2201 2201 HOH HOH A . 
G 4 HOH 202 2202 2202 HOH HOH A . 
G 4 HOH 203 2203 2203 HOH HOH A . 
G 4 HOH 204 2204 2204 HOH HOH A . 
G 4 HOH 205 2205 2205 HOH HOH A . 
G 4 HOH 206 2206 2206 HOH HOH A . 
G 4 HOH 207 2207 2207 HOH HOH A . 
G 4 HOH 208 2208 2208 HOH HOH A . 
G 4 HOH 209 2209 2209 HOH HOH A . 
G 4 HOH 210 2210 2210 HOH HOH A . 
G 4 HOH 211 2211 2211 HOH HOH A . 
G 4 HOH 212 2212 2212 HOH HOH A . 
G 4 HOH 213 2213 2213 HOH HOH A . 
G 4 HOH 214 2214 2214 HOH HOH A . 
G 4 HOH 215 2215 2215 HOH HOH A . 
G 4 HOH 216 2216 2216 HOH HOH A . 
G 4 HOH 217 2217 2217 HOH HOH A . 
G 4 HOH 218 2218 2218 HOH HOH A . 
G 4 HOH 219 2219 2219 HOH HOH A . 
G 4 HOH 220 2220 2220 HOH HOH A . 
G 4 HOH 221 2221 2221 HOH HOH A . 
G 4 HOH 222 2222 2222 HOH HOH A . 
G 4 HOH 223 2223 2223 HOH HOH A . 
G 4 HOH 224 2224 2224 HOH HOH A . 
G 4 HOH 225 2225 2225 HOH HOH A . 
G 4 HOH 226 2226 2226 HOH HOH A . 
G 4 HOH 227 2227 2227 HOH HOH A . 
G 4 HOH 228 2228 2228 HOH HOH A . 
G 4 HOH 229 2229 2229 HOH HOH A . 
G 4 HOH 230 2230 2230 HOH HOH A . 
G 4 HOH 231 2231 2231 HOH HOH A . 
G 4 HOH 232 2232 2232 HOH HOH A . 
G 4 HOH 233 2233 2233 HOH HOH A . 
G 4 HOH 234 2234 2234 HOH HOH A . 
G 4 HOH 235 2235 2235 HOH HOH A . 
G 4 HOH 236 2236 2236 HOH HOH A . 
G 4 HOH 237 2237 2237 HOH HOH A . 
G 4 HOH 238 2238 2238 HOH HOH A . 
G 4 HOH 239 2239 2239 HOH HOH A . 
G 4 HOH 240 2240 2240 HOH HOH A . 
G 4 HOH 241 2241 2241 HOH HOH A . 
G 4 HOH 242 2242 2242 HOH HOH A . 
G 4 HOH 243 2243 2243 HOH HOH A . 
G 4 HOH 244 2244 2244 HOH HOH A . 
G 4 HOH 245 2245 2245 HOH HOH A . 
G 4 HOH 246 2246 2246 HOH HOH A . 
G 4 HOH 247 2247 2247 HOH HOH A . 
G 4 HOH 248 2248 2248 HOH HOH A . 
G 4 HOH 249 2249 2249 HOH HOH A . 
G 4 HOH 250 2250 2250 HOH HOH A . 
G 4 HOH 251 2251 2251 HOH HOH A . 
G 4 HOH 252 2252 2252 HOH HOH A . 
G 4 HOH 253 2253 2253 HOH HOH A . 
G 4 HOH 254 2254 2254 HOH HOH A . 
G 4 HOH 255 2255 2255 HOH HOH A . 
G 4 HOH 256 2256 2256 HOH HOH A . 
G 4 HOH 257 2257 2257 HOH HOH A . 
G 4 HOH 258 2258 2258 HOH HOH A . 
G 4 HOH 259 2259 2259 HOH HOH A . 
G 4 HOH 260 2260 2260 HOH HOH A . 
G 4 HOH 261 2261 2261 HOH HOH A . 
G 4 HOH 262 2262 2262 HOH HOH A . 
G 4 HOH 263 2263 2263 HOH HOH A . 
G 4 HOH 264 2264 2264 HOH HOH A . 
G 4 HOH 265 2265 2265 HOH HOH A . 
G 4 HOH 266 2266 2266 HOH HOH A . 
G 4 HOH 267 2267 2267 HOH HOH A . 
G 4 HOH 268 2268 2268 HOH HOH A . 
G 4 HOH 269 2269 2269 HOH HOH A . 
G 4 HOH 270 2270 2270 HOH HOH A . 
G 4 HOH 271 2271 2271 HOH HOH A . 
G 4 HOH 272 2272 2272 HOH HOH A . 
G 4 HOH 273 2273 2273 HOH HOH A . 
G 4 HOH 274 2274 2274 HOH HOH A . 
G 4 HOH 275 2275 2275 HOH HOH A . 
G 4 HOH 276 2276 2276 HOH HOH A . 
G 4 HOH 277 2277 2277 HOH HOH A . 
G 4 HOH 278 2278 2278 HOH HOH A . 
G 4 HOH 279 2279 2279 HOH HOH A . 
G 4 HOH 280 2280 2280 HOH HOH A . 
G 4 HOH 281 2281 2281 HOH HOH A . 
G 4 HOH 282 2282 2282 HOH HOH A . 
G 4 HOH 283 2283 2283 HOH HOH A . 
G 4 HOH 284 2284 2284 HOH HOH A . 
G 4 HOH 285 2285 2285 HOH HOH A . 
G 4 HOH 286 2286 2286 HOH HOH A . 
G 4 HOH 287 2287 2287 HOH HOH A . 
G 4 HOH 288 2288 2288 HOH HOH A . 
G 4 HOH 289 2289 2289 HOH HOH A . 
G 4 HOH 290 2290 2290 HOH HOH A . 
G 4 HOH 291 2291 2291 HOH HOH A . 
G 4 HOH 292 2292 2292 HOH HOH A . 
G 4 HOH 293 2293 2293 HOH HOH A . 
G 4 HOH 294 2294 2294 HOH HOH A . 
G 4 HOH 295 2295 2295 HOH HOH A . 
G 4 HOH 296 2296 2296 HOH HOH A . 
G 4 HOH 297 2297 2297 HOH HOH A . 
G 4 HOH 298 2298 2298 HOH HOH A . 
G 4 HOH 299 2299 2299 HOH HOH A . 
G 4 HOH 300 2300 2300 HOH HOH A . 
G 4 HOH 301 2301 2301 HOH HOH A . 
G 4 HOH 302 2302 2302 HOH HOH A . 
G 4 HOH 303 2303 2303 HOH HOH A . 
G 4 HOH 304 2304 2304 HOH HOH A . 
H 4 HOH 1   2001 2001 HOH HOH B . 
H 4 HOH 2   2002 2002 HOH HOH B . 
H 4 HOH 3   2003 2003 HOH HOH B . 
H 4 HOH 4   2004 2004 HOH HOH B . 
H 4 HOH 5   2005 2005 HOH HOH B . 
H 4 HOH 6   2006 2006 HOH HOH B . 
H 4 HOH 7   2007 2007 HOH HOH B . 
H 4 HOH 8   2008 2008 HOH HOH B . 
H 4 HOH 9   2009 2009 HOH HOH B . 
H 4 HOH 10  2010 2010 HOH HOH B . 
H 4 HOH 11  2011 2011 HOH HOH B . 
H 4 HOH 12  2012 2012 HOH HOH B . 
H 4 HOH 13  2013 2013 HOH HOH B . 
H 4 HOH 14  2014 2014 HOH HOH B . 
H 4 HOH 15  2015 2015 HOH HOH B . 
H 4 HOH 16  2016 2016 HOH HOH B . 
H 4 HOH 17  2017 2017 HOH HOH B . 
H 4 HOH 18  2018 2018 HOH HOH B . 
H 4 HOH 19  2019 2019 HOH HOH B . 
H 4 HOH 20  2020 2020 HOH HOH B . 
H 4 HOH 21  2021 2021 HOH HOH B . 
H 4 HOH 22  2022 2022 HOH HOH B . 
H 4 HOH 23  2023 2023 HOH HOH B . 
H 4 HOH 24  2024 2024 HOH HOH B . 
H 4 HOH 25  2025 2025 HOH HOH B . 
H 4 HOH 26  2026 2026 HOH HOH B . 
H 4 HOH 27  2027 2027 HOH HOH B . 
H 4 HOH 28  2028 2028 HOH HOH B . 
H 4 HOH 29  2029 2029 HOH HOH B . 
H 4 HOH 30  2030 2030 HOH HOH B . 
H 4 HOH 31  2031 2031 HOH HOH B . 
H 4 HOH 32  2032 2032 HOH HOH B . 
H 4 HOH 33  2033 2033 HOH HOH B . 
H 4 HOH 34  2034 2034 HOH HOH B . 
H 4 HOH 35  2035 2035 HOH HOH B . 
H 4 HOH 36  2036 2036 HOH HOH B . 
H 4 HOH 37  2037 2037 HOH HOH B . 
H 4 HOH 38  2038 2038 HOH HOH B . 
H 4 HOH 39  2039 2039 HOH HOH B . 
H 4 HOH 40  2040 2040 HOH HOH B . 
H 4 HOH 41  2041 2041 HOH HOH B . 
H 4 HOH 42  2042 2042 HOH HOH B . 
H 4 HOH 43  2043 2043 HOH HOH B . 
H 4 HOH 44  2044 2044 HOH HOH B . 
H 4 HOH 45  2045 2045 HOH HOH B . 
H 4 HOH 46  2046 2046 HOH HOH B . 
H 4 HOH 47  2047 2047 HOH HOH B . 
H 4 HOH 48  2048 2048 HOH HOH B . 
H 4 HOH 49  2049 2049 HOH HOH B . 
H 4 HOH 50  2050 2050 HOH HOH B . 
H 4 HOH 51  2051 2051 HOH HOH B . 
H 4 HOH 52  2052 2052 HOH HOH B . 
H 4 HOH 53  2053 2053 HOH HOH B . 
H 4 HOH 54  2054 2054 HOH HOH B . 
H 4 HOH 55  2055 2055 HOH HOH B . 
H 4 HOH 56  2056 2056 HOH HOH B . 
H 4 HOH 57  2057 2057 HOH HOH B . 
H 4 HOH 58  2058 2058 HOH HOH B . 
H 4 HOH 59  2059 2059 HOH HOH B . 
H 4 HOH 60  2060 2060 HOH HOH B . 
H 4 HOH 61  2061 2061 HOH HOH B . 
H 4 HOH 62  2062 2062 HOH HOH B . 
H 4 HOH 63  2063 2063 HOH HOH B . 
H 4 HOH 64  2064 2064 HOH HOH B . 
H 4 HOH 65  2065 2065 HOH HOH B . 
H 4 HOH 66  2066 2066 HOH HOH B . 
H 4 HOH 67  2067 2067 HOH HOH B . 
H 4 HOH 68  2068 2068 HOH HOH B . 
H 4 HOH 69  2069 2069 HOH HOH B . 
H 4 HOH 70  2070 2070 HOH HOH B . 
H 4 HOH 71  2071 2071 HOH HOH B . 
H 4 HOH 72  2072 2072 HOH HOH B . 
H 4 HOH 73  2073 2073 HOH HOH B . 
H 4 HOH 74  2074 2074 HOH HOH B . 
H 4 HOH 75  2075 2075 HOH HOH B . 
H 4 HOH 76  2076 2076 HOH HOH B . 
H 4 HOH 77  2077 2077 HOH HOH B . 
H 4 HOH 78  2078 2078 HOH HOH B . 
H 4 HOH 79  2079 2079 HOH HOH B . 
H 4 HOH 80  2080 2080 HOH HOH B . 
H 4 HOH 81  2081 2081 HOH HOH B . 
H 4 HOH 82  2082 2082 HOH HOH B . 
H 4 HOH 83  2083 2083 HOH HOH B . 
H 4 HOH 84  2084 2084 HOH HOH B . 
H 4 HOH 85  2085 2085 HOH HOH B . 
H 4 HOH 86  2086 2086 HOH HOH B . 
H 4 HOH 87  2087 2087 HOH HOH B . 
H 4 HOH 88  2088 2088 HOH HOH B . 
H 4 HOH 89  2089 2089 HOH HOH B . 
H 4 HOH 90  2090 2090 HOH HOH B . 
H 4 HOH 91  2091 2091 HOH HOH B . 
H 4 HOH 92  2092 2092 HOH HOH B . 
H 4 HOH 93  2093 2093 HOH HOH B . 
H 4 HOH 94  2094 2094 HOH HOH B . 
H 4 HOH 95  2095 2095 HOH HOH B . 
H 4 HOH 96  2096 2096 HOH HOH B . 
H 4 HOH 97  2097 2097 HOH HOH B . 
H 4 HOH 98  2098 2098 HOH HOH B . 
H 4 HOH 99  2099 2099 HOH HOH B . 
H 4 HOH 100 2100 2100 HOH HOH B . 
H 4 HOH 101 2101 2101 HOH HOH B . 
H 4 HOH 102 2102 2102 HOH HOH B . 
H 4 HOH 103 2103 2103 HOH HOH B . 
H 4 HOH 104 2104 2104 HOH HOH B . 
H 4 HOH 105 2105 2105 HOH HOH B . 
H 4 HOH 106 2106 2106 HOH HOH B . 
H 4 HOH 107 2107 2107 HOH HOH B . 
H 4 HOH 108 2108 2108 HOH HOH B . 
H 4 HOH 109 2109 2109 HOH HOH B . 
H 4 HOH 110 2110 2110 HOH HOH B . 
H 4 HOH 111 2111 2111 HOH HOH B . 
H 4 HOH 112 2112 2112 HOH HOH B . 
H 4 HOH 113 2113 2113 HOH HOH B . 
H 4 HOH 114 2114 2114 HOH HOH B . 
H 4 HOH 115 2115 2115 HOH HOH B . 
H 4 HOH 116 2116 2116 HOH HOH B . 
H 4 HOH 117 2117 2117 HOH HOH B . 
H 4 HOH 118 2118 2118 HOH HOH B . 
H 4 HOH 119 2119 2119 HOH HOH B . 
H 4 HOH 120 2120 2120 HOH HOH B . 
H 4 HOH 121 2121 2121 HOH HOH B . 
H 4 HOH 122 2122 2122 HOH HOH B . 
H 4 HOH 123 2123 2123 HOH HOH B . 
H 4 HOH 124 2124 2124 HOH HOH B . 
H 4 HOH 125 2125 2125 HOH HOH B . 
H 4 HOH 126 2126 2126 HOH HOH B . 
H 4 HOH 127 2127 2127 HOH HOH B . 
H 4 HOH 128 2128 2128 HOH HOH B . 
H 4 HOH 129 2129 2129 HOH HOH B . 
H 4 HOH 130 2130 2130 HOH HOH B . 
H 4 HOH 131 2131 2131 HOH HOH B . 
H 4 HOH 132 2132 2132 HOH HOH B . 
H 4 HOH 133 2133 2133 HOH HOH B . 
H 4 HOH 134 2134 2134 HOH HOH B . 
H 4 HOH 135 2135 2135 HOH HOH B . 
H 4 HOH 136 2136 2136 HOH HOH B . 
H 4 HOH 137 2137 2137 HOH HOH B . 
H 4 HOH 138 2138 2138 HOH HOH B . 
H 4 HOH 139 2139 2139 HOH HOH B . 
H 4 HOH 140 2140 2140 HOH HOH B . 
H 4 HOH 141 2141 2141 HOH HOH B . 
H 4 HOH 142 2142 2142 HOH HOH B . 
H 4 HOH 143 2143 2143 HOH HOH B . 
H 4 HOH 144 2144 2144 HOH HOH B . 
H 4 HOH 145 2145 2145 HOH HOH B . 
H 4 HOH 146 2146 2146 HOH HOH B . 
H 4 HOH 147 2147 2147 HOH HOH B . 
H 4 HOH 148 2148 2148 HOH HOH B . 
H 4 HOH 149 2149 2149 HOH HOH B . 
H 4 HOH 150 2150 2150 HOH HOH B . 
H 4 HOH 151 2151 2151 HOH HOH B . 
H 4 HOH 152 2152 2152 HOH HOH B . 
H 4 HOH 153 2153 2153 HOH HOH B . 
H 4 HOH 154 2154 2154 HOH HOH B . 
H 4 HOH 155 2155 2155 HOH HOH B . 
H 4 HOH 156 2156 2156 HOH HOH B . 
H 4 HOH 157 2157 2157 HOH HOH B . 
H 4 HOH 158 2158 2158 HOH HOH B . 
H 4 HOH 159 2159 2159 HOH HOH B . 
H 4 HOH 160 2160 2160 HOH HOH B . 
H 4 HOH 161 2161 2161 HOH HOH B . 
H 4 HOH 162 2162 2162 HOH HOH B . 
H 4 HOH 163 2163 2163 HOH HOH B . 
H 4 HOH 164 2164 2164 HOH HOH B . 
H 4 HOH 165 2165 2165 HOH HOH B . 
H 4 HOH 166 2166 2166 HOH HOH B . 
H 4 HOH 167 2167 2167 HOH HOH B . 
H 4 HOH 168 2168 2168 HOH HOH B . 
H 4 HOH 169 2169 2169 HOH HOH B . 
H 4 HOH 170 2170 2170 HOH HOH B . 
H 4 HOH 171 2171 2171 HOH HOH B . 
H 4 HOH 172 2172 2172 HOH HOH B . 
H 4 HOH 173 2173 2173 HOH HOH B . 
H 4 HOH 174 2174 2174 HOH HOH B . 
H 4 HOH 175 2175 2175 HOH HOH B . 
H 4 HOH 176 2176 2176 HOH HOH B . 
H 4 HOH 177 2177 2177 HOH HOH B . 
H 4 HOH 178 2178 2178 HOH HOH B . 
H 4 HOH 179 2179 2179 HOH HOH B . 
H 4 HOH 180 2180 2180 HOH HOH B . 
H 4 HOH 181 2181 2181 HOH HOH B . 
H 4 HOH 182 2182 2182 HOH HOH B . 
H 4 HOH 183 2183 2183 HOH HOH B . 
H 4 HOH 184 2184 2184 HOH HOH B . 
H 4 HOH 185 2185 2185 HOH HOH B . 
H 4 HOH 186 2186 2186 HOH HOH B . 
H 4 HOH 187 2187 2187 HOH HOH B . 
H 4 HOH 188 2188 2188 HOH HOH B . 
H 4 HOH 189 2189 2189 HOH HOH B . 
H 4 HOH 190 2190 2190 HOH HOH B . 
H 4 HOH 191 2191 2191 HOH HOH B . 
H 4 HOH 192 2192 2192 HOH HOH B . 
H 4 HOH 193 2193 2193 HOH HOH B . 
H 4 HOH 194 2194 2194 HOH HOH B . 
H 4 HOH 195 2195 2195 HOH HOH B . 
H 4 HOH 196 2196 2196 HOH HOH B . 
H 4 HOH 197 2197 2197 HOH HOH B . 
H 4 HOH 198 2198 2198 HOH HOH B . 
H 4 HOH 199 2199 2199 HOH HOH B . 
H 4 HOH 200 2200 2200 HOH HOH B . 
H 4 HOH 201 2201 2201 HOH HOH B . 
H 4 HOH 202 2202 2202 HOH HOH B . 
H 4 HOH 203 2203 2203 HOH HOH B . 
H 4 HOH 204 2204 2204 HOH HOH B . 
H 4 HOH 205 2205 2205 HOH HOH B . 
H 4 HOH 206 2206 2206 HOH HOH B . 
H 4 HOH 207 2207 2207 HOH HOH B . 
H 4 HOH 208 2208 2208 HOH HOH B . 
H 4 HOH 209 2209 2209 HOH HOH B . 
H 4 HOH 210 2210 2210 HOH HOH B . 
H 4 HOH 211 2211 2211 HOH HOH B . 
H 4 HOH 212 2212 2212 HOH HOH B . 
H 4 HOH 213 2213 2213 HOH HOH B . 
H 4 HOH 214 2214 2214 HOH HOH B . 
H 4 HOH 215 2215 2215 HOH HOH B . 
H 4 HOH 216 2216 2216 HOH HOH B . 
H 4 HOH 217 2217 2217 HOH HOH B . 
H 4 HOH 218 2218 2218 HOH HOH B . 
H 4 HOH 219 2219 2219 HOH HOH B . 
H 4 HOH 220 2220 2220 HOH HOH B . 
H 4 HOH 221 2221 2221 HOH HOH B . 
H 4 HOH 222 2222 2222 HOH HOH B . 
H 4 HOH 223 2223 2223 HOH HOH B . 
H 4 HOH 224 2224 2224 HOH HOH B . 
H 4 HOH 225 2225 2225 HOH HOH B . 
H 4 HOH 226 2226 2226 HOH HOH B . 
H 4 HOH 227 2227 2227 HOH HOH B . 
H 4 HOH 228 2228 2228 HOH HOH B . 
H 4 HOH 229 2229 2229 HOH HOH B . 
H 4 HOH 230 2230 2230 HOH HOH B . 
H 4 HOH 231 2231 2231 HOH HOH B . 
H 4 HOH 232 2232 2232 HOH HOH B . 
H 4 HOH 233 2233 2233 HOH HOH B . 
H 4 HOH 234 2234 2234 HOH HOH B . 
H 4 HOH 235 2235 2235 HOH HOH B . 
H 4 HOH 236 2236 2236 HOH HOH B . 
H 4 HOH 237 2237 2237 HOH HOH B . 
H 4 HOH 238 2238 2238 HOH HOH B . 
I 4 HOH 1   2001 2001 HOH HOH D . 
I 4 HOH 2   2002 2002 HOH HOH D . 
I 4 HOH 3   2003 2003 HOH HOH D . 
I 4 HOH 4   2004 2004 HOH HOH D . 
I 4 HOH 5   2005 2005 HOH HOH D . 
I 4 HOH 6   2006 2006 HOH HOH D . 
I 4 HOH 7   2007 2007 HOH HOH D . 
I 4 HOH 8   2008 2008 HOH HOH D . 
I 4 HOH 9   2009 2009 HOH HOH D . 
I 4 HOH 10  2010 2010 HOH HOH D . 
I 4 HOH 11  2011 2011 HOH HOH D . 
I 4 HOH 12  2012 2012 HOH HOH D . 
I 4 HOH 13  2013 2013 HOH HOH D . 
I 4 HOH 14  2014 2014 HOH HOH D . 
I 4 HOH 15  2015 2015 HOH HOH D . 
I 4 HOH 16  2016 2016 HOH HOH D . 
I 4 HOH 17  2017 2017 HOH HOH D . 
I 4 HOH 18  2018 2018 HOH HOH D . 
I 4 HOH 19  2019 2019 HOH HOH D . 
I 4 HOH 20  2020 2020 HOH HOH D . 
I 4 HOH 21  2021 2021 HOH HOH D . 
I 4 HOH 22  2022 2022 HOH HOH D . 
I 4 HOH 23  2023 2023 HOH HOH D . 
I 4 HOH 24  2024 2024 HOH HOH D . 
I 4 HOH 25  2025 2025 HOH HOH D . 
I 4 HOH 26  2026 2026 HOH HOH D . 
I 4 HOH 27  2027 2027 HOH HOH D . 
I 4 HOH 28  2028 2028 HOH HOH D . 
I 4 HOH 29  2029 2029 HOH HOH D . 
I 4 HOH 30  2030 2030 HOH HOH D . 
I 4 HOH 31  2031 2031 HOH HOH D . 
I 4 HOH 32  2032 2032 HOH HOH D . 
I 4 HOH 33  2033 2033 HOH HOH D . 
I 4 HOH 34  2034 2034 HOH HOH D . 
I 4 HOH 35  2035 2035 HOH HOH D . 
I 4 HOH 36  2036 2036 HOH HOH D . 
I 4 HOH 37  2037 2037 HOH HOH D . 
I 4 HOH 38  2038 2038 HOH HOH D . 
I 4 HOH 39  2039 2039 HOH HOH D . 
I 4 HOH 40  2040 2040 HOH HOH D . 
I 4 HOH 41  2041 2041 HOH HOH D . 
I 4 HOH 42  2042 2042 HOH HOH D . 
I 4 HOH 43  2043 2043 HOH HOH D . 
I 4 HOH 44  2044 2044 HOH HOH D . 
I 4 HOH 45  2045 2045 HOH HOH D . 
I 4 HOH 46  2046 2046 HOH HOH D . 
I 4 HOH 47  2047 2047 HOH HOH D . 
I 4 HOH 48  2048 2048 HOH HOH D . 
I 4 HOH 49  2049 2049 HOH HOH D . 
I 4 HOH 50  2050 2050 HOH HOH D . 
I 4 HOH 51  2051 2051 HOH HOH D . 
I 4 HOH 52  2052 2052 HOH HOH D . 
I 4 HOH 53  2053 2053 HOH HOH D . 
I 4 HOH 54  2054 2054 HOH HOH D . 
I 4 HOH 55  2055 2055 HOH HOH D . 
I 4 HOH 56  2056 2056 HOH HOH D . 
I 4 HOH 57  2057 2057 HOH HOH D . 
I 4 HOH 58  2058 2058 HOH HOH D . 
I 4 HOH 59  2059 2059 HOH HOH D . 
I 4 HOH 60  2060 2060 HOH HOH D . 
I 4 HOH 61  2061 2061 HOH HOH D . 
I 4 HOH 62  2062 2062 HOH HOH D . 
I 4 HOH 63  2063 2063 HOH HOH D . 
I 4 HOH 64  2064 2064 HOH HOH D . 
I 4 HOH 65  2065 2065 HOH HOH D . 
I 4 HOH 66  2066 2066 HOH HOH D . 
I 4 HOH 67  2067 2067 HOH HOH D . 
I 4 HOH 68  2068 2068 HOH HOH D . 
I 4 HOH 69  2069 2069 HOH HOH D . 
I 4 HOH 70  2070 2070 HOH HOH D . 
I 4 HOH 71  2071 2071 HOH HOH D . 
I 4 HOH 72  2072 2072 HOH HOH D . 
I 4 HOH 73  2073 2073 HOH HOH D . 
I 4 HOH 74  2074 2074 HOH HOH D . 
I 4 HOH 75  2075 2075 HOH HOH D . 
I 4 HOH 76  2076 2076 HOH HOH D . 
I 4 HOH 77  2077 2077 HOH HOH D . 
I 4 HOH 78  2078 2078 HOH HOH D . 
I 4 HOH 79  2079 2079 HOH HOH D . 
I 4 HOH 80  2080 2080 HOH HOH D . 
I 4 HOH 81  2081 2081 HOH HOH D . 
I 4 HOH 82  2082 2082 HOH HOH D . 
I 4 HOH 83  2083 2083 HOH HOH D . 
I 4 HOH 84  2084 2084 HOH HOH D . 
I 4 HOH 85  2085 2085 HOH HOH D . 
I 4 HOH 86  2086 2086 HOH HOH D . 
I 4 HOH 87  2087 2087 HOH HOH D . 
I 4 HOH 88  2088 2088 HOH HOH D . 
I 4 HOH 89  2089 2089 HOH HOH D . 
I 4 HOH 90  2090 2090 HOH HOH D . 
I 4 HOH 91  2091 2091 HOH HOH D . 
I 4 HOH 92  2092 2092 HOH HOH D . 
I 4 HOH 93  2093 2093 HOH HOH D . 
I 4 HOH 94  2094 2094 HOH HOH D . 
I 4 HOH 95  2095 2095 HOH HOH D . 
I 4 HOH 96  2096 2096 HOH HOH D . 
I 4 HOH 97  2097 2097 HOH HOH D . 
I 4 HOH 98  2098 2098 HOH HOH D . 
I 4 HOH 99  2099 2099 HOH HOH D . 
I 4 HOH 100 2100 2100 HOH HOH D . 
I 4 HOH 101 2101 2101 HOH HOH D . 
I 4 HOH 102 2102 2102 HOH HOH D . 
I 4 HOH 103 2103 2103 HOH HOH D . 
I 4 HOH 104 2104 2104 HOH HOH D . 
I 4 HOH 105 2105 2105 HOH HOH D . 
I 4 HOH 106 2106 2106 HOH HOH D . 
I 4 HOH 107 2107 2107 HOH HOH D . 
I 4 HOH 108 2108 2108 HOH HOH D . 
I 4 HOH 109 2109 2109 HOH HOH D . 
I 4 HOH 110 2110 2110 HOH HOH D . 
I 4 HOH 111 2111 2111 HOH HOH D . 
I 4 HOH 112 2112 2112 HOH HOH D . 
I 4 HOH 113 2113 2113 HOH HOH D . 
I 4 HOH 114 2114 2114 HOH HOH D . 
I 4 HOH 115 2115 2115 HOH HOH D . 
I 4 HOH 116 2116 2116 HOH HOH D . 
I 4 HOH 117 2117 2117 HOH HOH D . 
I 4 HOH 118 2118 2118 HOH HOH D . 
I 4 HOH 119 2119 2119 HOH HOH D . 
I 4 HOH 120 2120 2120 HOH HOH D . 
I 4 HOH 121 2121 2121 HOH HOH D . 
I 4 HOH 122 2122 2122 HOH HOH D . 
I 4 HOH 123 2123 2123 HOH HOH D . 
I 4 HOH 124 2124 2124 HOH HOH D . 
I 4 HOH 125 2125 2125 HOH HOH D . 
I 4 HOH 126 2126 2126 HOH HOH D . 
I 4 HOH 127 2127 2127 HOH HOH D . 
I 4 HOH 128 2128 2128 HOH HOH D . 
I 4 HOH 129 2129 2129 HOH HOH D . 
I 4 HOH 130 2130 2130 HOH HOH D . 
I 4 HOH 131 2131 2131 HOH HOH D . 
I 4 HOH 132 2132 2132 HOH HOH D . 
I 4 HOH 133 2133 2133 HOH HOH D . 
I 4 HOH 134 2134 2134 HOH HOH D . 
I 4 HOH 135 2135 2135 HOH HOH D . 
I 4 HOH 136 2136 2136 HOH HOH D . 
I 4 HOH 137 2137 2137 HOH HOH D . 
I 4 HOH 138 2138 2138 HOH HOH D . 
I 4 HOH 139 2139 2139 HOH HOH D . 
I 4 HOH 140 2140 2140 HOH HOH D . 
I 4 HOH 141 2141 2141 HOH HOH D . 
I 4 HOH 142 2142 2142 HOH HOH D . 
I 4 HOH 143 2143 2143 HOH HOH D . 
J 4 HOH 1   2001 2001 HOH HOH E . 
J 4 HOH 2   2002 2002 HOH HOH E . 
J 4 HOH 3   2003 2003 HOH HOH E . 
J 4 HOH 4   2004 2004 HOH HOH E . 
J 4 HOH 5   2005 2005 HOH HOH E . 
J 4 HOH 6   2006 2006 HOH HOH E . 
J 4 HOH 7   2007 2007 HOH HOH E . 
J 4 HOH 8   2008 2008 HOH HOH E . 
J 4 HOH 9   2009 2009 HOH HOH E . 
J 4 HOH 10  2010 2010 HOH HOH E . 
J 4 HOH 11  2011 2011 HOH HOH E . 
J 4 HOH 12  2012 2012 HOH HOH E . 
J 4 HOH 13  2013 2013 HOH HOH E . 
J 4 HOH 14  2014 2014 HOH HOH E . 
J 4 HOH 15  2015 2015 HOH HOH E . 
J 4 HOH 16  2016 2016 HOH HOH E . 
J 4 HOH 17  2017 2017 HOH HOH E . 
J 4 HOH 18  2018 2018 HOH HOH E . 
J 4 HOH 19  2019 2019 HOH HOH E . 
J 4 HOH 20  2020 2020 HOH HOH E . 
J 4 HOH 21  2021 2021 HOH HOH E . 
J 4 HOH 22  2022 2022 HOH HOH E . 
J 4 HOH 23  2023 2023 HOH HOH E . 
J 4 HOH 24  2024 2024 HOH HOH E . 
J 4 HOH 25  2025 2025 HOH HOH E . 
J 4 HOH 26  2026 2026 HOH HOH E . 
J 4 HOH 27  2027 2027 HOH HOH E . 
J 4 HOH 28  2028 2028 HOH HOH E . 
J 4 HOH 29  2029 2029 HOH HOH E . 
J 4 HOH 30  2030 2030 HOH HOH E . 
J 4 HOH 31  2031 2031 HOH HOH E . 
J 4 HOH 32  2032 2032 HOH HOH E . 
J 4 HOH 33  2033 2033 HOH HOH E . 
J 4 HOH 34  2034 2034 HOH HOH E . 
J 4 HOH 35  2035 2035 HOH HOH E . 
J 4 HOH 36  2036 2036 HOH HOH E . 
J 4 HOH 37  2037 2037 HOH HOH E . 
J 4 HOH 38  2038 2038 HOH HOH E . 
J 4 HOH 39  2039 2039 HOH HOH E . 
J 4 HOH 40  2040 2040 HOH HOH E . 
J 4 HOH 41  2041 2041 HOH HOH E . 
J 4 HOH 42  2042 2042 HOH HOH E . 
J 4 HOH 43  2043 2043 HOH HOH E . 
J 4 HOH 44  2044 2044 HOH HOH E . 
J 4 HOH 45  2045 2045 HOH HOH E . 
J 4 HOH 46  2046 2046 HOH HOH E . 
J 4 HOH 47  2047 2047 HOH HOH E . 
J 4 HOH 48  2048 2048 HOH HOH E . 
J 4 HOH 49  2049 2049 HOH HOH E . 
J 4 HOH 50  2050 2050 HOH HOH E . 
J 4 HOH 51  2051 2051 HOH HOH E . 
J 4 HOH 52  2052 2052 HOH HOH E . 
J 4 HOH 53  2053 2053 HOH HOH E . 
J 4 HOH 54  2054 2054 HOH HOH E . 
J 4 HOH 55  2055 2055 HOH HOH E . 
J 4 HOH 56  2056 2056 HOH HOH E . 
J 4 HOH 57  2057 2057 HOH HOH E . 
J 4 HOH 58  2058 2058 HOH HOH E . 
J 4 HOH 59  2059 2059 HOH HOH E . 
J 4 HOH 60  2060 2060 HOH HOH E . 
J 4 HOH 61  2061 2061 HOH HOH E . 
J 4 HOH 62  2062 2062 HOH HOH E . 
J 4 HOH 63  2063 2063 HOH HOH E . 
J 4 HOH 64  2064 2064 HOH HOH E . 
J 4 HOH 65  2065 2065 HOH HOH E . 
J 4 HOH 66  2066 2066 HOH HOH E . 
J 4 HOH 67  2067 2067 HOH HOH E . 
J 4 HOH 68  2068 2068 HOH HOH E . 
J 4 HOH 69  2069 2069 HOH HOH E . 
J 4 HOH 70  2070 2070 HOH HOH E . 
J 4 HOH 71  2071 2071 HOH HOH E . 
J 4 HOH 72  2072 2072 HOH HOH E . 
J 4 HOH 73  2073 2073 HOH HOH E . 
J 4 HOH 74  2074 2074 HOH HOH E . 
J 4 HOH 75  2075 2075 HOH HOH E . 
J 4 HOH 76  2076 2076 HOH HOH E . 
J 4 HOH 77  2077 2077 HOH HOH E . 
J 4 HOH 78  2078 2078 HOH HOH E . 
J 4 HOH 79  2079 2079 HOH HOH E . 
J 4 HOH 80  2080 2080 HOH HOH E . 
J 4 HOH 81  2081 2081 HOH HOH E . 
J 4 HOH 82  2082 2082 HOH HOH E . 
J 4 HOH 83  2083 2083 HOH HOH E . 
J 4 HOH 84  2084 2084 HOH HOH E . 
J 4 HOH 85  2085 2085 HOH HOH E . 
J 4 HOH 86  2086 2086 HOH HOH E . 
J 4 HOH 87  2087 2087 HOH HOH E . 
J 4 HOH 88  2088 2088 HOH HOH E . 
J 4 HOH 89  2089 2089 HOH HOH E . 
J 4 HOH 90  2090 2090 HOH HOH E . 
J 4 HOH 91  2091 2091 HOH HOH E . 
J 4 HOH 92  2092 2092 HOH HOH E . 
J 4 HOH 93  2093 2093 HOH HOH E . 
J 4 HOH 94  2094 2094 HOH HOH E . 
J 4 HOH 95  2095 2095 HOH HOH E . 
J 4 HOH 96  2096 2096 HOH HOH E . 
J 4 HOH 97  2097 2097 HOH HOH E . 
J 4 HOH 98  2098 2098 HOH HOH E . 
J 4 HOH 99  2099 2099 HOH HOH E . 
J 4 HOH 100 2100 2100 HOH HOH E . 
J 4 HOH 101 2101 2101 HOH HOH E . 
J 4 HOH 102 2102 2102 HOH HOH E . 
J 4 HOH 103 2103 2103 HOH HOH E . 
J 4 HOH 104 2104 2104 HOH HOH E . 
J 4 HOH 105 2105 2105 HOH HOH E . 
J 4 HOH 106 2106 2106 HOH HOH E . 
J 4 HOH 107 2107 2107 HOH HOH E . 
J 4 HOH 108 2108 2108 HOH HOH E . 
J 4 HOH 109 2109 2109 HOH HOH E . 
J 4 HOH 110 2110 2110 HOH HOH E . 
J 4 HOH 111 2111 2111 HOH HOH E . 
J 4 HOH 112 2112 2112 HOH HOH E . 
J 4 HOH 113 2113 2113 HOH HOH E . 
J 4 HOH 114 2114 2114 HOH HOH E . 
J 4 HOH 115 2115 2115 HOH HOH E . 
J 4 HOH 116 2116 2116 HOH HOH E . 
J 4 HOH 117 2117 2117 HOH HOH E . 
J 4 HOH 118 2118 2118 HOH HOH E . 
J 4 HOH 119 2119 2119 HOH HOH E . 
J 4 HOH 120 2120 2120 HOH HOH E . 
J 4 HOH 121 2121 2121 HOH HOH E . 
J 4 HOH 122 2122 2122 HOH HOH E . 
J 4 HOH 123 2123 2123 HOH HOH E . 
J 4 HOH 124 2124 2124 HOH HOH E . 
J 4 HOH 125 2125 2125 HOH HOH E . 
J 4 HOH 126 2126 2126 HOH HOH E . 
J 4 HOH 127 2127 2127 HOH HOH E . 
J 4 HOH 128 2128 2128 HOH HOH E . 
J 4 HOH 129 2129 2129 HOH HOH E . 
J 4 HOH 130 2130 2130 HOH HOH E . 
J 4 HOH 131 2131 2131 HOH HOH E . 
J 4 HOH 132 2132 2132 HOH HOH E . 
J 4 HOH 133 2133 2133 HOH HOH E . 
J 4 HOH 134 2134 2134 HOH HOH E . 
J 4 HOH 135 2135 2135 HOH HOH E . 
J 4 HOH 136 2136 2136 HOH HOH E . 
J 4 HOH 137 2137 2137 HOH HOH E . 
J 4 HOH 138 2138 2138 HOH HOH E . 
J 4 HOH 139 2139 2139 HOH HOH E . 
J 4 HOH 140 2140 2140 HOH HOH E . 
J 4 HOH 141 2141 2141 HOH HOH E . 
J 4 HOH 142 2142 2142 HOH HOH E . 
J 4 HOH 143 2143 2143 HOH HOH E . 
J 4 HOH 144 2144 2144 HOH HOH E . 
J 4 HOH 145 2145 2145 HOH HOH E . 
J 4 HOH 146 2146 2146 HOH HOH E . 
J 4 HOH 147 2147 2147 HOH HOH E . 
J 4 HOH 148 2148 2148 HOH HOH E . 
J 4 HOH 149 2149 2149 HOH HOH E . 
J 4 HOH 150 2150 2150 HOH HOH E . 
J 4 HOH 151 2151 2151 HOH HOH E . 
J 4 HOH 152 2152 2152 HOH HOH E . 
J 4 HOH 153 2153 2153 HOH HOH E . 
J 4 HOH 154 2154 2154 HOH HOH E . 
J 4 HOH 155 2155 2155 HOH HOH E . 
J 4 HOH 156 2156 2156 HOH HOH E . 
J 4 HOH 157 2157 2157 HOH HOH E . 
J 4 HOH 158 2158 2158 HOH HOH E . 
J 4 HOH 159 2159 2159 HOH HOH E . 
J 4 HOH 160 2160 2160 HOH HOH E . 
J 4 HOH 161 2161 2161 HOH HOH E . 
J 4 HOH 162 2162 2162 HOH HOH E . 
J 4 HOH 163 2163 2163 HOH HOH E . 
J 4 HOH 164 2164 2164 HOH HOH E . 
J 4 HOH 165 2165 2165 HOH HOH E . 
J 4 HOH 166 2166 2166 HOH HOH E . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 21060  ? 
1 MORE         -124.2 ? 
1 'SSA (A^2)'  104380 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-12-23 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Experimental preparation'  
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow   
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_biol          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       . ? 1 ? ? ? ? 
MOSFLM 'data reduction' . ? 2 ? ? ? ? 
SCALA  'data scaling'   . ? 3 ? ? ? ? 
AMoRE  phasing          . ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             1QO0 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;SWISSPROT HAS THE WRONG SEQUENCE, STRUCTURE IS CORRECT.

CHAINS A AND B

GLN     27  SWS  P27017    HIS    26
ARG     28  SWS  P27017    ALA    27

CHAINS D AND E

ARG     64  SWS  P10932    GLY    27
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA  A ARG 7   ? ? C  A ARG 7   ? ? O   A ARG 7   ? ? 95.43  120.10 -24.67 2.10 N 
2  1 CA  A PRO 8   ? ? N  A PRO 8   ? ? CD  A PRO 8   ? ? 99.39  111.50 -12.11 1.40 N 
3  1 N   A PRO 8   ? ? CA A PRO 8   ? ? CB  A PRO 8   ? ? 109.80 102.60 7.20   1.10 N 
4  1 NE  A ARG 25  ? ? CZ A ARG 25  ? ? NH2 A ARG 25  ? ? 116.96 120.30 -3.34  0.50 N 
5  1 CD  A ARG 47  ? ? NE A ARG 47  ? ? CZ  A ARG 47  ? ? 136.83 123.60 13.23  1.40 N 
6  1 CB  A ASP 61  ? ? CG A ASP 61  ? ? OD1 A ASP 61  ? ? 123.71 118.30 5.41   0.90 N 
7  1 CB  A ASP 69  ? ? CG A ASP 69  ? ? OD2 A ASP 69  ? ? 123.99 118.30 5.69   0.90 N 
8  1 CG  A ARG 72  ? ? CD A ARG 72  ? ? NE  A ARG 72  ? ? 125.05 111.80 13.25  2.10 N 
9  1 CD  A ARG 72  ? ? NE A ARG 72  ? ? CZ  A ARG 72  ? ? 158.91 123.60 35.31  1.40 N 
10 1 NE  A ARG 72  ? ? CZ A ARG 72  ? ? NH1 A ARG 72  ? ? 125.96 120.30 5.66   0.50 N 
11 1 CD  A ARG 74  ? ? NE A ARG 74  ? ? CZ  A ARG 74  ? ? 133.02 123.60 9.42   1.40 N 
12 1 NE  A ARG 74  ? ? CZ A ARG 74  ? ? NH1 A ARG 74  ? ? 117.14 120.30 -3.16  0.50 N 
13 1 CD  A ARG 97  ? ? NE A ARG 97  ? ? CZ  A ARG 97  ? ? 152.30 123.60 28.70  1.40 N 
14 1 NE  A ARG 97  ? ? CZ A ARG 97  ? ? NH1 A ARG 97  ? ? 123.91 120.30 3.61   0.50 N 
15 1 NE  A ARG 97  ? ? CZ A ARG 97  ? ? NH2 A ARG 97  ? ? 114.07 120.30 -6.23  0.50 N 
16 1 NE  A ARG 137 ? ? CZ A ARG 137 ? ? NH2 A ARG 137 ? ? 123.36 120.30 3.06   0.50 N 
17 1 CB  A ASP 149 ? ? CG A ASP 149 ? ? OD1 A ASP 149 ? ? 124.01 118.30 5.71   0.90 N 
18 1 NH1 A ARG 161 ? ? CZ A ARG 161 ? ? NH2 A ARG 161 ? ? 128.24 119.40 8.84   1.10 N 
19 1 NE  A ARG 161 ? ? CZ A ARG 161 ? ? NH1 A ARG 161 ? ? 116.27 120.30 -4.03  0.50 N 
20 1 NE  A ARG 161 ? ? CZ A ARG 161 ? ? NH2 A ARG 161 ? ? 115.48 120.30 -4.82  0.50 N 
21 1 CB  A ASP 184 ? ? CG A ASP 184 ? ? OD1 A ASP 184 ? ? 124.07 118.30 5.77   0.90 N 
22 1 CD  A ARG 188 ? ? NE A ARG 188 ? ? CZ  A ARG 188 ? ? 134.24 123.60 10.64  1.40 N 
23 1 NE  A ARG 192 ? ? CZ A ARG 192 ? ? NH2 A ARG 192 ? ? 115.99 120.30 -4.31  0.50 N 
24 1 CD  A ARG 215 ? ? NE A ARG 215 ? ? CZ  A ARG 215 ? ? 144.40 123.60 20.80  1.40 N 
25 1 CB  A ASP 261 ? ? CG A ASP 261 ? ? OD2 A ASP 261 ? ? 112.74 118.30 -5.56  0.90 N 
26 1 NE  A ARG 266 ? ? CZ A ARG 266 ? ? NH2 A ARG 266 ? ? 116.59 120.30 -3.71  0.50 N 
27 1 NE  A ARG 298 ? ? CZ A ARG 298 ? ? NH1 A ARG 298 ? ? 115.77 120.30 -4.53  0.50 N 
28 1 CA  A LEU 315 ? ? CB A LEU 315 ? ? CG  A LEU 315 ? ? 140.35 115.30 25.05  2.30 N 
29 1 NE  A ARG 328 ? ? CZ A ARG 328 ? ? NH2 A ARG 328 ? ? 116.75 120.30 -3.55  0.50 N 
30 1 NE  A ARG 331 ? ? CZ A ARG 331 ? ? NH1 A ARG 331 ? ? 117.17 120.30 -3.13  0.50 N 
31 1 NE  A ARG 331 ? ? CZ A ARG 331 ? ? NH2 A ARG 331 ? ? 126.46 120.30 6.16   0.50 N 
32 1 NE  A ARG 337 ? ? CZ A ARG 337 ? ? NH1 A ARG 337 ? ? 116.81 120.30 -3.49  0.50 N 
33 1 CD  A ARG 341 ? ? NE A ARG 341 ? ? CZ  A ARG 341 ? ? 134.79 123.60 11.19  1.40 N 
34 1 CB  A ASP 374 ? ? CG A ASP 374 ? ? OD1 A ASP 374 ? ? 123.78 118.30 5.48   0.90 N 
35 1 NE  B ARG 25  ? ? CZ B ARG 25  ? ? NH1 B ARG 25  ? ? 124.17 120.30 3.87   0.50 N 
36 1 NE  B ARG 28  ? ? CZ B ARG 28  ? ? NH2 B ARG 28  ? ? 114.86 120.30 -5.44  0.50 N 
37 1 CD  B ARG 47  ? ? NE B ARG 47  ? ? CZ  B ARG 47  ? ? 135.92 123.60 12.32  1.40 N 
38 1 NE  B ARG 47  ? ? CZ B ARG 47  ? ? NH1 B ARG 47  ? ? 124.21 120.30 3.91   0.50 N 
39 1 NE  B ARG 62  ? ? CZ B ARG 62  ? ? NH1 B ARG 62  ? ? 123.62 120.30 3.32   0.50 N 
40 1 CD  B ARG 64  ? ? NE B ARG 64  ? ? CZ  B ARG 64  ? ? 133.72 123.60 10.12  1.40 N 
41 1 NE  B ARG 64  ? ? CZ B ARG 64  ? ? NH1 B ARG 64  ? ? 125.03 120.30 4.73   0.50 N 
42 1 NE  B ARG 64  ? ? CZ B ARG 64  ? ? NH2 B ARG 64  ? ? 115.32 120.30 -4.98  0.50 N 
43 1 CD  B ARG 77  ? ? NE B ARG 77  ? ? CZ  B ARG 77  ? ? 132.66 123.60 9.06   1.40 N 
44 1 NE  B ARG 77  ? ? CZ B ARG 77  ? ? NH1 B ARG 77  ? ? 123.47 120.30 3.17   0.50 N 
45 1 N   B TYR 113 ? ? CA B TYR 113 ? ? CB  B TYR 113 ? ? 121.59 110.60 10.99  1.80 N 
46 1 CD  B ARG 154 ? ? NE B ARG 154 ? ? CZ  B ARG 154 ? ? 138.96 123.60 15.36  1.40 N 
47 1 NE  B ARG 197 ? ? CZ B ARG 197 ? ? NH2 B ARG 197 ? ? 117.16 120.30 -3.14  0.50 N 
48 1 CA  B GLY 224 ? ? C  B GLY 224 ? ? O   B GLY 224 ? ? 131.89 120.60 11.29  1.80 N 
49 1 CD  B ARG 225 ? ? NE B ARG 225 ? ? CZ  B ARG 225 ? ? 133.37 123.60 9.77   1.40 N 
50 1 NE  B ARG 225 ? ? CZ B ARG 225 ? ? NH1 B ARG 225 ? ? 125.27 120.30 4.97   0.50 N 
51 1 NE  B ARG 225 ? ? CZ B ARG 225 ? ? NH2 B ARG 225 ? ? 117.29 120.30 -3.01  0.50 N 
52 1 N   B VAL 252 ? ? CA B VAL 252 ? ? CB  B VAL 252 ? ? 97.95  111.50 -13.55 2.20 N 
53 1 CD  B ARG 331 ? ? NE B ARG 331 ? ? CZ  B ARG 331 ? ? 139.09 123.60 15.49  1.40 N 
54 1 NE  B ARG 331 ? ? CZ B ARG 331 ? ? NH1 B ARG 331 ? ? 124.46 120.30 4.16   0.50 N 
55 1 NE  B ARG 331 ? ? CZ B ARG 331 ? ? NH2 B ARG 331 ? ? 116.36 120.30 -3.94  0.50 N 
56 1 NE  D ARG 11  ? ? CZ D ARG 11  ? ? NH2 D ARG 11  ? ? 116.43 120.30 -3.87  0.50 N 
57 1 CD  D ARG 34  ? ? NE D ARG 34  ? ? CZ  D ARG 34  ? ? 135.11 123.60 11.51  1.40 N 
58 1 NE  D ARG 34  ? ? CZ D ARG 34  ? ? NH1 D ARG 34  ? ? 124.02 120.30 3.72   0.50 N 
59 1 CB  D VAL 39  ? ? CA D VAL 39  ? ? C   D VAL 39  ? ? 99.90  111.40 -11.50 1.90 N 
60 1 CA  D TRP 43  ? ? C  D TRP 43  ? ? O   D TRP 43  ? ? 98.67  120.10 -21.43 2.10 N 
61 1 CA  D PRO 44  ? ? N  D PRO 44  ? ? CD  D PRO 44  ? ? 100.93 111.50 -10.57 1.40 N 
62 1 N   D PRO 44  ? ? CA D PRO 44  ? ? CB  D PRO 44  ? ? 113.66 102.60 11.06  1.10 N 
63 1 N   D PRO 44  ? ? CD D PRO 44  ? ? CG  D PRO 44  ? ? 112.79 103.80 8.99   1.20 N 
64 1 CD  D ARG 79  ? ? NE D ARG 79  ? ? CZ  D ARG 79  ? ? 133.94 123.60 10.34  1.40 N 
65 1 NE  D ARG 79  ? ? CZ D ARG 79  ? ? NH1 D ARG 79  ? ? 125.04 120.30 4.74   0.50 N 
66 1 OE1 D GLU 89  ? ? CD D GLU 89  ? ? OE2 D GLU 89  ? ? 115.50 123.30 -7.80  1.20 N 
67 1 NE  E ARG 11  ? ? CZ E ARG 11  ? ? NH2 E ARG 11  ? ? 117.08 120.30 -3.22  0.50 N 
68 1 NE  E ARG 34  ? ? CZ E ARG 34  ? ? NH2 E ARG 34  ? ? 117.12 120.30 -3.18  0.50 N 
69 1 CB  E VAL 39  ? ? CA E VAL 39  ? ? C   E VAL 39  ? ? 97.43  111.40 -13.97 1.90 N 
70 1 NE  E ARG 40  ? ? CZ E ARG 40  ? ? NH2 E ARG 40  ? ? 115.25 120.30 -5.05  0.50 N 
71 1 CA  E TRP 43  ? ? C  E TRP 43  ? ? O   E TRP 43  ? ? 99.44  120.10 -20.66 2.10 N 
72 1 CA  E PRO 44  ? ? N  E PRO 44  ? ? CD  E PRO 44  ? ? 101.89 111.50 -9.61  1.40 N 
73 1 N   E PRO 44  ? ? CA E PRO 44  ? ? CB  E PRO 44  ? ? 110.30 102.60 7.70   1.10 N 
74 1 N   E PRO 44  ? ? CD E PRO 44  ? ? CG  E PRO 44  ? ? 112.32 103.80 8.52   1.20 N 
75 1 NE  E ARG 114 ? ? CZ E ARG 114 ? ? NH1 E ARG 114 ? ? 123.89 120.30 3.59   0.50 N 
76 1 NE  E ARG 114 ? ? CZ E ARG 114 ? ? NH2 E ARG 114 ? ? 113.50 120.30 -6.80  0.50 N 
77 1 N   E ARG 124 ? ? CA E ARG 124 ? ? CB  E ARG 124 ? ? 128.14 110.60 17.54  1.80 N 
78 1 CA  E ARG 124 ? ? CB E ARG 124 ? ? CG  E ARG 124 ? ? 134.56 113.40 21.16  2.20 N 
79 1 CD  E ARG 165 ? ? NE E ARG 165 ? ? CZ  E ARG 165 ? ? 133.27 123.60 9.67   1.40 N 
80 1 NE  E ARG 165 ? ? CZ E ARG 165 ? ? NH1 E ARG 165 ? ? 116.92 120.30 -3.38  0.50 N 
81 1 CA  E ASN 192 ? ? CB E ASN 192 ? ? CG  E ASN 192 ? ? 147.09 113.40 33.69  2.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 8   ? ? -45.09  104.59  
2  1 LEU A 13  ? ? -111.22 73.30   
3  1 CYS A 82  ? ? 83.02   147.43  
4  1 TYR A 83  ? ? -135.03 -79.27  
5  1 ASN A 127 ? ? -146.67 -48.86  
6  1 GLU A 173 ? ? 178.05  142.38  
7  1 ASP A 261 ? ? -110.18 75.48   
8  1 LEU B 13  ? ? -104.64 74.93   
9  1 CYS B 82  ? ? 77.25   143.04  
10 1 TYR B 83  ? ? -132.21 -78.16  
11 1 PRO B 105 ? ? -92.21  54.01   
12 1 ASN B 127 ? ? -134.17 -57.85  
13 1 ASP B 223 ? ? 23.68   55.47   
14 1 ARG B 225 ? ? 29.49   66.38   
15 1 PHE B 275 ? ? 173.45  -45.31  
16 1 TRP D 43  ? ? -173.66 100.05  
17 1 PRO D 46  ? ? -78.43  -169.54 
18 1 ASP D 50  ? ? 102.84  -59.23  
19 1 GLN D 62  ? ? -100.42 77.64   
20 1 ASN D 63  ? ? 176.62  -173.34 
21 1 PRO E 44  ? ? -26.05  152.51  
22 1 ASN E 63  ? ? -86.84  -148.39 
23 1 ARG E 178 ? ? 179.94  -17.12  
24 1 PRO E 181 ? ? -45.46  155.08  
25 1 LEU E 190 ? ? -66.10  -175.64 
26 1 PRO E 194 ? ? -111.15 -134.93 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ARG A 7  ? ? PRO A 8  ? ? -64.81 
2 1 TRP D 43 ? ? PRO D 44 ? ? 55.16  
3 1 TRP E 43 ? ? PRO E 44 ? ? -67.60 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 ARG A 7   ? ? -27.41 
2 1 TRP D 43  ? ? 27.74  
3 1 TRP E 43  ? ? -28.99 
4 1 GLU E 193 ? ? 10.33  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2005 ? 6.07 . 
2 1 O ? A HOH 2023 ? 6.09 . 
3 1 O ? B HOH 2033 ? 6.76 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 7   ? CG  ? A ARG 7   CG  
2   1 Y 1 A ARG 7   ? CD  ? A ARG 7   CD  
3   1 Y 1 A ARG 7   ? NE  ? A ARG 7   NE  
4   1 Y 1 A ARG 7   ? CZ  ? A ARG 7   CZ  
5   1 Y 1 A ARG 7   ? NH1 ? A ARG 7   NH1 
6   1 Y 1 A ARG 7   ? NH2 ? A ARG 7   NH2 
7   1 Y 1 B ARG 7   ? CG  ? B ARG 7   CG  
8   1 Y 1 B ARG 7   ? CD  ? B ARG 7   CD  
9   1 Y 1 B ARG 7   ? NE  ? B ARG 7   NE  
10  1 Y 1 B ARG 7   ? CZ  ? B ARG 7   CZ  
11  1 Y 1 B ARG 7   ? NH1 ? B ARG 7   NH1 
12  1 Y 1 B ARG 7   ? NH2 ? B ARG 7   NH2 
13  1 Y 1 B ASP 184 ? CG  ? B ASP 184 CG  
14  1 Y 1 B ASP 184 ? OD1 ? B ASP 184 OD1 
15  1 Y 1 B ASP 184 ? OD2 ? B ASP 184 OD2 
16  1 Y 1 D ASP 50  ? CG  ? C ASP 50  CG  
17  1 Y 1 D ASP 50  ? OD1 ? C ASP 50  OD1 
18  1 Y 1 D ASP 50  ? OD2 ? C ASP 50  OD2 
19  1 Y 1 D LYS 135 ? CG  ? C LYS 135 CG  
20  1 Y 1 D LYS 135 ? CD  ? C LYS 135 CD  
21  1 Y 1 D LYS 135 ? CE  ? C LYS 135 CE  
22  1 Y 1 D LYS 135 ? NZ  ? C LYS 135 NZ  
23  1 Y 1 D ARG 173 ? CG  ? C ARG 173 CG  
24  1 Y 1 D ARG 173 ? CD  ? C ARG 173 CD  
25  1 Y 1 D ARG 173 ? NE  ? C ARG 173 NE  
26  1 Y 1 D ARG 173 ? CZ  ? C ARG 173 CZ  
27  1 Y 1 D ARG 173 ? NH1 ? C ARG 173 NH1 
28  1 Y 1 D ARG 173 ? NH2 ? C ARG 173 NH2 
29  1 Y 1 D GLU 174 ? CG  ? C GLU 174 CG  
30  1 Y 1 D GLU 174 ? CD  ? C GLU 174 CD  
31  1 Y 1 D GLU 174 ? OE1 ? C GLU 174 OE1 
32  1 Y 1 D GLU 174 ? OE2 ? C GLU 174 OE2 
33  1 Y 1 D MET 176 ? CG  ? C MET 176 CG  
34  1 Y 1 D MET 176 ? SD  ? C MET 176 SD  
35  1 Y 1 D MET 176 ? CE  ? C MET 176 CE  
36  1 Y 1 D LYS 177 ? CG  ? C LYS 177 CG  
37  1 Y 1 D LYS 177 ? CD  ? C LYS 177 CD  
38  1 Y 1 D LYS 177 ? CE  ? C LYS 177 CE  
39  1 Y 1 D LYS 177 ? NZ  ? C LYS 177 NZ  
40  1 Y 1 D ARG 178 ? CG  ? C ARG 178 CG  
41  1 Y 1 D ARG 178 ? CD  ? C ARG 178 CD  
42  1 Y 1 D ARG 178 ? NE  ? C ARG 178 NE  
43  1 Y 1 D ARG 178 ? CZ  ? C ARG 178 CZ  
44  1 Y 1 D ARG 178 ? NH1 ? C ARG 178 NH1 
45  1 Y 1 D ARG 178 ? NH2 ? C ARG 178 NH2 
46  1 Y 1 D ARG 179 ? CG  ? C ARG 179 CG  
47  1 Y 1 D ARG 179 ? CD  ? C ARG 179 CD  
48  1 Y 1 D ARG 179 ? NE  ? C ARG 179 NE  
49  1 Y 1 D ARG 179 ? CZ  ? C ARG 179 CZ  
50  1 Y 1 D ARG 179 ? NH1 ? C ARG 179 NH1 
51  1 Y 1 D ARG 179 ? NH2 ? C ARG 179 NH2 
52  1 Y 1 D GLU 180 ? CG  ? C GLU 180 CG  
53  1 Y 1 D GLU 180 ? CD  ? C GLU 180 CD  
54  1 Y 1 D GLU 180 ? OE1 ? C GLU 180 OE1 
55  1 Y 1 D GLU 180 ? OE2 ? C GLU 180 OE2 
56  1 Y 1 D LYS 184 ? CG  ? C LYS 184 CG  
57  1 Y 1 D LYS 184 ? CD  ? C LYS 184 CD  
58  1 Y 1 D LYS 184 ? CE  ? C LYS 184 CE  
59  1 Y 1 D LYS 184 ? NZ  ? C LYS 184 NZ  
60  1 Y 1 D GLU 188 ? CG  ? C GLU 188 CG  
61  1 Y 1 D GLU 188 ? CD  ? C GLU 188 CD  
62  1 Y 1 D GLU 188 ? OE1 ? C GLU 188 OE1 
63  1 Y 1 D GLU 188 ? OE2 ? C GLU 188 OE2 
64  1 Y 1 E LYS 131 ? CG  ? D LYS 131 CG  
65  1 Y 1 E LYS 131 ? CD  ? D LYS 131 CD  
66  1 Y 1 E LYS 131 ? CE  ? D LYS 131 CE  
67  1 Y 1 E LYS 131 ? NZ  ? D LYS 131 NZ  
68  1 Y 1 E LYS 135 ? CG  ? D LYS 135 CG  
69  1 Y 1 E LYS 135 ? CD  ? D LYS 135 CD  
70  1 Y 1 E LYS 135 ? CE  ? D LYS 135 CE  
71  1 Y 1 E LYS 135 ? NZ  ? D LYS 135 NZ  
72  1 Y 1 E ARG 148 ? CG  ? D ARG 148 CG  
73  1 Y 1 E ARG 148 ? CD  ? D ARG 148 CD  
74  1 Y 1 E ARG 148 ? NE  ? D ARG 148 NE  
75  1 Y 1 E ARG 148 ? CZ  ? D ARG 148 CZ  
76  1 Y 1 E ARG 148 ? NH1 ? D ARG 148 NH1 
77  1 Y 1 E ARG 148 ? NH2 ? D ARG 148 NH2 
78  1 Y 1 E ARG 173 ? CG  ? D ARG 173 CG  
79  1 Y 1 E ARG 173 ? CD  ? D ARG 173 CD  
80  1 Y 1 E ARG 173 ? NE  ? D ARG 173 NE  
81  1 Y 1 E ARG 173 ? CZ  ? D ARG 173 CZ  
82  1 Y 1 E ARG 173 ? NH1 ? D ARG 173 NH1 
83  1 Y 1 E ARG 173 ? NH2 ? D ARG 173 NH2 
84  1 Y 1 E LYS 177 ? CG  ? D LYS 177 CG  
85  1 Y 1 E LYS 177 ? CD  ? D LYS 177 CD  
86  1 Y 1 E LYS 177 ? CE  ? D LYS 177 CE  
87  1 Y 1 E LYS 177 ? NZ  ? D LYS 177 NZ  
88  1 Y 1 E ARG 178 ? CG  ? D ARG 178 CG  
89  1 Y 1 E ARG 178 ? CD  ? D ARG 178 CD  
90  1 Y 1 E ARG 178 ? NE  ? D ARG 178 NE  
91  1 Y 1 E ARG 178 ? CZ  ? D ARG 178 CZ  
92  1 Y 1 E ARG 178 ? NH1 ? D ARG 178 NH1 
93  1 Y 1 E ARG 178 ? NH2 ? D ARG 178 NH2 
94  1 Y 1 E ARG 179 ? CG  ? D ARG 179 CG  
95  1 Y 1 E ARG 179 ? CD  ? D ARG 179 CD  
96  1 Y 1 E ARG 179 ? NE  ? D ARG 179 NE  
97  1 Y 1 E ARG 179 ? CZ  ? D ARG 179 CZ  
98  1 Y 1 E ARG 179 ? NH1 ? D ARG 179 NH1 
99  1 Y 1 E ARG 179 ? NH2 ? D ARG 179 NH2 
100 1 Y 1 E GLU 180 ? CG  ? D GLU 180 CG  
101 1 Y 1 E GLU 180 ? CD  ? D GLU 180 CD  
102 1 Y 1 E GLU 180 ? OE1 ? D GLU 180 OE1 
103 1 Y 1 E GLU 180 ? OE2 ? D GLU 180 OE2 
104 1 Y 1 E LYS 184 ? CG  ? D LYS 184 CG  
105 1 Y 1 E LYS 184 ? CD  ? D LYS 184 CD  
106 1 Y 1 E LYS 184 ? CE  ? D LYS 184 CE  
107 1 Y 1 E LYS 184 ? NZ  ? D LYS 184 NZ  
108 1 Y 1 E ILE 185 ? CG1 ? D ILE 185 CG1 
109 1 Y 1 E ILE 185 ? CG2 ? D ILE 185 CG2 
110 1 Y 1 E ILE 185 ? CD1 ? D ILE 185 CD1 
111 1 Y 1 E GLU 193 ? CG  ? D GLU 193 CG  
112 1 Y 1 E GLU 193 ? CD  ? D GLU 193 CD  
113 1 Y 1 E GLU 193 ? OE1 ? D GLU 193 OE1 
114 1 Y 1 E GLU 193 ? OE2 ? D GLU 193 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A HIS 4   ? A HIS 4   
5  1 Y 1 A GLN 5   ? A GLN 5   
6  1 Y 1 A GLU 6   ? A GLU 6   
7  1 Y 1 A GLY 380 ? A GLY 380 
8  1 Y 1 A GLY 381 ? A GLY 381 
9  1 Y 1 A GLY 382 ? A GLY 382 
10 1 Y 1 A PRO 383 ? A PRO 383 
11 1 Y 1 A LEU 384 ? A LEU 384 
12 1 Y 1 A PRO 385 ? A PRO 385 
13 1 Y 1 B MET 1   ? B MET 1   
14 1 Y 1 B GLY 2   ? B GLY 2   
15 1 Y 1 B SER 3   ? B SER 3   
16 1 Y 1 B HIS 4   ? B HIS 4   
17 1 Y 1 B GLN 5   ? B GLN 5   
18 1 Y 1 B GLU 6   ? B GLU 6   
19 1 Y 1 B GLY 381 ? B GLY 381 
20 1 Y 1 B GLY 382 ? B GLY 382 
21 1 Y 1 B PRO 383 ? B PRO 383 
22 1 Y 1 B LEU 384 ? B LEU 384 
23 1 Y 1 B PRO 385 ? B PRO 385 
24 1 Y 1 D MET 1   ? C MET 1   
25 1 Y 1 D GLY 191 ? C GLY 191 
26 1 Y 1 D ASN 192 ? C ASN 192 
27 1 Y 1 D GLU 193 ? C GLU 193 
28 1 Y 1 D PRO 194 ? C PRO 194 
29 1 Y 1 D SER 195 ? C SER 195 
30 1 Y 1 D ALA 196 ? C ALA 196 
31 1 Y 1 E MET 1   ? D MET 1   
32 1 Y 1 E ALA 196 ? D ALA 196 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 BUTYRAMIDE BMD 
4 water      HOH 
#