data_1QO9
# 
_entry.id   1QO9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QO9         
PDBE  EBI-4331     
WWPDB D_1290004331 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QO9 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Silman, I.'    2 
'Sussman, J.L.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Three-dimensional structures of Drosophila melanogaster acetylcholinesterase and of its complexes with two potent inhibitors.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            9 
_citation.page_first                1063 
_citation.page_last                 1072 
_citation.year                      2000 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10892800 
_citation.pdbx_database_id_DOI      10.1110/ps.9.6.1063 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'        1 ? 
primary 'Kryger, G.'       2 ? 
primary 'Rosenberry, T.L.' 3 ? 
primary 'Mallender, W.D.'  4 ? 
primary 'Lewis, T.'        5 ? 
primary 'Fletcher, R.J.'   6 ? 
primary 'Guss, J.M.'       7 ? 
primary 'Silman, I.'       8 ? 
primary 'Sussman, J.L.'    9 ? 
# 
_cell.entry_id           1QO9 
_cell.length_a           94.340 
_cell.length_b           94.340 
_cell.length_c           159.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QO9 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 64956.562 1   3.1.1.7 ? ? ? 
2 branched    man 
;beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1   ?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ? ? 
4 water       nat water 18.015    131 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDSGSAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDSGSAS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ILE n 
1 3   ASP n 
1 4   ARG n 
1 5   LEU n 
1 6   VAL n 
1 7   VAL n 
1 8   GLN n 
1 9   THR n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  PRO n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  SER n 
1 19  VAL n 
1 20  THR n 
1 21  VAL n 
1 22  GLN n 
1 23  GLY n 
1 24  ARG n 
1 25  GLU n 
1 26  VAL n 
1 27  HIS n 
1 28  VAL n 
1 29  TYR n 
1 30  THR n 
1 31  GLY n 
1 32  ILE n 
1 33  PRO n 
1 34  TYR n 
1 35  ALA n 
1 36  LYS n 
1 37  PRO n 
1 38  PRO n 
1 39  VAL n 
1 40  GLU n 
1 41  ASP n 
1 42  LEU n 
1 43  ARG n 
1 44  PHE n 
1 45  ARG n 
1 46  LYS n 
1 47  PRO n 
1 48  VAL n 
1 49  PRO n 
1 50  ALA n 
1 51  GLU n 
1 52  PRO n 
1 53  TRP n 
1 54  HIS n 
1 55  GLY n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  ALA n 
1 60  THR n 
1 61  GLY n 
1 62  LEU n 
1 63  SER n 
1 64  ALA n 
1 65  THR n 
1 66  CYS n 
1 67  VAL n 
1 68  GLN n 
1 69  GLU n 
1 70  ARG n 
1 71  TYR n 
1 72  GLU n 
1 73  TYR n 
1 74  PHE n 
1 75  PRO n 
1 76  GLY n 
1 77  PHE n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  GLU n 
1 82  ILE n 
1 83  TRP n 
1 84  ASN n 
1 85  PRO n 
1 86  ASN n 
1 87  THR n 
1 88  ASN n 
1 89  VAL n 
1 90  SER n 
1 91  GLU n 
1 92  ASP n 
1 93  CYS n 
1 94  LEU n 
1 95  TYR n 
1 96  ILE n 
1 97  ASN n 
1 98  VAL n 
1 99  TRP n 
1 100 ALA n 
1 101 PRO n 
1 102 ALA n 
1 103 LYS n 
1 104 ALA n 
1 105 ARG n 
1 106 LEU n 
1 107 ARG n 
1 108 HIS n 
1 109 GLY n 
1 110 ARG n 
1 111 GLY n 
1 112 ALA n 
1 113 ASN n 
1 114 GLY n 
1 115 GLY n 
1 116 GLU n 
1 117 HIS n 
1 118 PRO n 
1 119 ASN n 
1 120 GLY n 
1 121 LYS n 
1 122 GLN n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 ASP n 
1 127 HIS n 
1 128 LEU n 
1 129 ILE n 
1 130 HIS n 
1 131 ASN n 
1 132 GLY n 
1 133 ASN n 
1 134 PRO n 
1 135 GLN n 
1 136 ASN n 
1 137 THR n 
1 138 THR n 
1 139 ASN n 
1 140 GLY n 
1 141 LEU n 
1 142 PRO n 
1 143 ILE n 
1 144 LEU n 
1 145 ILE n 
1 146 TRP n 
1 147 ILE n 
1 148 TYR n 
1 149 GLY n 
1 150 GLY n 
1 151 GLY n 
1 152 PHE n 
1 153 MET n 
1 154 THR n 
1 155 GLY n 
1 156 SER n 
1 157 ALA n 
1 158 THR n 
1 159 LEU n 
1 160 ASP n 
1 161 ILE n 
1 162 TYR n 
1 163 ASN n 
1 164 ALA n 
1 165 ASP n 
1 166 ILE n 
1 167 MET n 
1 168 ALA n 
1 169 ALA n 
1 170 VAL n 
1 171 GLY n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 VAL n 
1 176 ALA n 
1 177 SER n 
1 178 PHE n 
1 179 GLN n 
1 180 TYR n 
1 181 ARG n 
1 182 VAL n 
1 183 GLY n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 LEU n 
1 191 ALA n 
1 192 PRO n 
1 193 GLU n 
1 194 MET n 
1 195 PRO n 
1 196 SER n 
1 197 GLU n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 GLU n 
1 202 ALA n 
1 203 PRO n 
1 204 GLY n 
1 205 ASN n 
1 206 VAL n 
1 207 GLY n 
1 208 LEU n 
1 209 TRP n 
1 210 ASP n 
1 211 GLN n 
1 212 ALA n 
1 213 LEU n 
1 214 ALA n 
1 215 ILE n 
1 216 ARG n 
1 217 TRP n 
1 218 LEU n 
1 219 LYS n 
1 220 ASP n 
1 221 ASN n 
1 222 ALA n 
1 223 HIS n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 GLY n 
1 228 ASN n 
1 229 PRO n 
1 230 GLU n 
1 231 TRP n 
1 232 MET n 
1 233 THR n 
1 234 LEU n 
1 235 PHE n 
1 236 GLY n 
1 237 GLU n 
1 238 SER n 
1 239 ALA n 
1 240 GLY n 
1 241 SER n 
1 242 SER n 
1 243 SER n 
1 244 VAL n 
1 245 ASN n 
1 246 ALA n 
1 247 GLN n 
1 248 LEU n 
1 249 MET n 
1 250 SER n 
1 251 PRO n 
1 252 VAL n 
1 253 THR n 
1 254 ARG n 
1 255 GLY n 
1 256 LEU n 
1 257 VAL n 
1 258 LYS n 
1 259 ARG n 
1 260 GLY n 
1 261 MET n 
1 262 MET n 
1 263 GLN n 
1 264 SER n 
1 265 GLY n 
1 266 THR n 
1 267 MET n 
1 268 ASN n 
1 269 ALA n 
1 270 PRO n 
1 271 TRP n 
1 272 SER n 
1 273 HIS n 
1 274 MET n 
1 275 THR n 
1 276 SER n 
1 277 GLU n 
1 278 LYS n 
1 279 ALA n 
1 280 VAL n 
1 281 GLU n 
1 282 ILE n 
1 283 GLY n 
1 284 LYS n 
1 285 ALA n 
1 286 LEU n 
1 287 ILE n 
1 288 ASN n 
1 289 ASP n 
1 290 CYS n 
1 291 ASN n 
1 292 CYS n 
1 293 ASN n 
1 294 ALA n 
1 295 SER n 
1 296 MET n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 ASN n 
1 301 PRO n 
1 302 ALA n 
1 303 HIS n 
1 304 VAL n 
1 305 MET n 
1 306 SER n 
1 307 CYS n 
1 308 MET n 
1 309 ARG n 
1 310 SER n 
1 311 VAL n 
1 312 ASP n 
1 313 ALA n 
1 314 LYS n 
1 315 THR n 
1 316 ILE n 
1 317 SER n 
1 318 VAL n 
1 319 GLN n 
1 320 GLN n 
1 321 TRP n 
1 322 ASN n 
1 323 SER n 
1 324 TYR n 
1 325 SER n 
1 326 GLY n 
1 327 ILE n 
1 328 LEU n 
1 329 SER n 
1 330 PHE n 
1 331 PRO n 
1 332 SER n 
1 333 ALA n 
1 334 PRO n 
1 335 THR n 
1 336 ILE n 
1 337 ASP n 
1 338 GLY n 
1 339 ALA n 
1 340 PHE n 
1 341 LEU n 
1 342 PRO n 
1 343 ALA n 
1 344 ASP n 
1 345 PRO n 
1 346 MET n 
1 347 THR n 
1 348 LEU n 
1 349 MET n 
1 350 LYS n 
1 351 THR n 
1 352 ALA n 
1 353 ASP n 
1 354 LEU n 
1 355 LYS n 
1 356 ASP n 
1 357 TYR n 
1 358 ASP n 
1 359 ILE n 
1 360 LEU n 
1 361 MET n 
1 362 GLY n 
1 363 ASN n 
1 364 VAL n 
1 365 ARG n 
1 366 ASP n 
1 367 GLU n 
1 368 GLY n 
1 369 THR n 
1 370 TYR n 
1 371 PHE n 
1 372 LEU n 
1 373 LEU n 
1 374 TYR n 
1 375 ASP n 
1 376 PHE n 
1 377 ILE n 
1 378 ASP n 
1 379 TYR n 
1 380 PHE n 
1 381 ASP n 
1 382 LYS n 
1 383 ASP n 
1 384 ASP n 
1 385 ALA n 
1 386 THR n 
1 387 ALA n 
1 388 LEU n 
1 389 PRO n 
1 390 ARG n 
1 391 ASP n 
1 392 LYS n 
1 393 TYR n 
1 394 LEU n 
1 395 GLU n 
1 396 ILE n 
1 397 MET n 
1 398 ASN n 
1 399 ASN n 
1 400 ILE n 
1 401 PHE n 
1 402 GLY n 
1 403 LYS n 
1 404 ALA n 
1 405 THR n 
1 406 GLN n 
1 407 ALA n 
1 408 GLU n 
1 409 ARG n 
1 410 GLU n 
1 411 ALA n 
1 412 ILE n 
1 413 ILE n 
1 414 PHE n 
1 415 GLN n 
1 416 TYR n 
1 417 THR n 
1 418 SER n 
1 419 TRP n 
1 420 GLU n 
1 421 GLY n 
1 422 ASN n 
1 423 PRO n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 ASN n 
1 428 GLN n 
1 429 GLN n 
1 430 GLN n 
1 431 ILE n 
1 432 GLY n 
1 433 ARG n 
1 434 ALA n 
1 435 VAL n 
1 436 GLY n 
1 437 ASP n 
1 438 HIS n 
1 439 PHE n 
1 440 PHE n 
1 441 THR n 
1 442 CYS n 
1 443 PRO n 
1 444 THR n 
1 445 ASN n 
1 446 GLU n 
1 447 TYR n 
1 448 ALA n 
1 449 GLN n 
1 450 ALA n 
1 451 LEU n 
1 452 ALA n 
1 453 GLU n 
1 454 ARG n 
1 455 GLY n 
1 456 ALA n 
1 457 SER n 
1 458 VAL n 
1 459 HIS n 
1 460 TYR n 
1 461 TYR n 
1 462 TYR n 
1 463 PHE n 
1 464 THR n 
1 465 HIS n 
1 466 ARG n 
1 467 THR n 
1 468 SER n 
1 469 THR n 
1 470 SER n 
1 471 LEU n 
1 472 TRP n 
1 473 GLY n 
1 474 GLU n 
1 475 TRP n 
1 476 MET n 
1 477 GLY n 
1 478 VAL n 
1 479 LEU n 
1 480 HIS n 
1 481 GLY n 
1 482 ASP n 
1 483 GLU n 
1 484 ILE n 
1 485 GLU n 
1 486 TYR n 
1 487 PHE n 
1 488 PHE n 
1 489 GLY n 
1 490 GLN n 
1 491 PRO n 
1 492 LEU n 
1 493 ASN n 
1 494 ASN n 
1 495 SER n 
1 496 LEU n 
1 497 GLN n 
1 498 TYR n 
1 499 ARG n 
1 500 PRO n 
1 501 VAL n 
1 502 GLU n 
1 503 ARG n 
1 504 GLU n 
1 505 LEU n 
1 506 GLY n 
1 507 LYS n 
1 508 ARG n 
1 509 MET n 
1 510 LEU n 
1 511 SER n 
1 512 ALA n 
1 513 VAL n 
1 514 ILE n 
1 515 GLU n 
1 516 PHE n 
1 517 ALA n 
1 518 LYS n 
1 519 THR n 
1 520 GLY n 
1 521 ASN n 
1 522 PRO n 
1 523 ALA n 
1 524 GLN n 
1 525 ASP n 
1 526 GLY n 
1 527 GLU n 
1 528 GLU n 
1 529 TRP n 
1 530 PRO n 
1 531 ASN n 
1 532 PHE n 
1 533 SER n 
1 534 LYS n 
1 535 GLU n 
1 536 ASP n 
1 537 PRO n 
1 538 VAL n 
1 539 TYR n 
1 540 TYR n 
1 541 ILE n 
1 542 PHE n 
1 543 SER n 
1 544 THR n 
1 545 ASP n 
1 546 ASP n 
1 547 LYS n 
1 548 ILE n 
1 549 GLU n 
1 550 LYS n 
1 551 LEU n 
1 552 ALA n 
1 553 ARG n 
1 554 GLY n 
1 555 PRO n 
1 556 LEU n 
1 557 ALA n 
1 558 ALA n 
1 559 ARG n 
1 560 CYS n 
1 561 SER n 
1 562 PHE n 
1 563 TRP n 
1 564 ASN n 
1 565 ASP n 
1 566 TYR n 
1 567 LEU n 
1 568 PRO n 
1 569 LYS n 
1 570 VAL n 
1 571 ARG n 
1 572 SER n 
1 573 TRP n 
1 574 ALA n 
1 575 GLY n 
1 576 THR n 
1 577 CYS n 
1 578 ASP n 
1 579 GLY n 
1 580 ASP n 
1 581 SER n 
1 582 GLY n 
1 583 SER n 
1 584 ALA n 
1 585 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'FRUIT FLY' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 DMACHE 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'SCHNEIDER LINE 2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'SECRETED (EXTRACELLULAR)' 
_entity_src_gen.pdbx_host_org_vector_type          'PLASMID DNA' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'S2-SEC 1/3' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_DROME 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P07140 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QO9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 585 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07140 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  623 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       585 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                     'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6'      
180.156 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QO9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.83 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.60' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QO9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   20200 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05000 
_reflns.pdbx_netI_over_sigmaI        33.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.16000 
_reflns_shell.meanI_over_sigI_obs    5.800 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QO9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19343 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               0.0 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    95.7 
_refine.ls_R_factor_obs                          0.258 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.258 
_refine.ls_R_factor_R_free                       0.301 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2ACE 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4227 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         75 
_refine_hist.number_atoms_solvent             131 
_refine_hist.number_atoms_total               4433 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.67  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   32 
_refine_ls_shell.d_res_high                       2.7 
_refine_ls_shell.d_res_low                        2.713 
_refine_ls_shell.number_reflns_R_work             41 
_refine_ls_shell.R_factor_R_work                  0.44 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.458 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1QO9 
_struct.title                     'Native acetylcholinesterase from Drosophila Melanogaster' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QO9 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE (SERINE ESTERASE), HYDROLASE, SERINE ESTERASE, SYNAPSE, MEMBRANE, NERVE, MUSCLE, NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN, GPI-ANCHOR, ALTERNATIVE SPLICING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 39  ? ARG A 43  ? VAL A 39  ARG A 43  5 ? 5  
HELX_P HELX_P2  2  LEU A 159 ? ASN A 163 ? LEU A 159 ASN A 163 5 ? 5  
HELX_P HELX_P3  3  ALA A 164 ? ASN A 172 ? ALA A 164 ASN A 172 1 ? 9  
HELX_P HELX_P4  4  GLY A 183 ? LEU A 188 ? GLY A 183 LEU A 188 1 ? 6  
HELX_P HELX_P5  5  PRO A 195 ? ALA A 199 ? PRO A 195 ALA A 199 5 ? 5  
HELX_P HELX_P6  6  ASN A 205 ? ALA A 222 ? ASN A 205 ALA A 222 1 ? 18 
HELX_P HELX_P7  7  HIS A 223 ? PHE A 225 ? HIS A 223 PHE A 225 5 ? 3  
HELX_P HELX_P8  8  SER A 238 ? SER A 250 ? SER A 238 SER A 250 1 ? 13 
HELX_P HELX_P9  9  THR A 275 ? ASN A 288 ? THR A 275 ASN A 288 1 ? 14 
HELX_P HELX_P10 10 ASN A 300 ? ARG A 309 ? ASN A 300 ARG A 309 1 ? 10 
HELX_P HELX_P11 11 ASP A 312 ? TRP A 321 ? ASP A 312 TRP A 321 1 ? 10 
HELX_P HELX_P12 12 ASP A 344 ? THR A 351 ? ASP A 344 THR A 351 1 ? 8  
HELX_P HELX_P13 13 GLY A 368 ? LEU A 373 ? GLY A 368 LEU A 373 1 ? 6  
HELX_P HELX_P14 14 PRO A 389 ? PHE A 401 ? PRO A 389 PHE A 401 1 ? 13 
HELX_P HELX_P15 15 THR A 405 ? TYR A 416 ? THR A 405 TYR A 416 1 ? 12 
HELX_P HELX_P16 16 GLY A 424 ? PHE A 440 ? GLY A 424 PHE A 440 1 ? 17 
HELX_P HELX_P17 17 PHE A 440 ? ARG A 454 ? PHE A 440 ARG A 454 1 ? 15 
HELX_P HELX_P18 18 GLY A 473 ? GLY A 477 ? GLY A 473 GLY A 477 5 ? 5  
HELX_P HELX_P19 19 GLY A 481 ? PHE A 488 ? GLY A 481 PHE A 488 1 ? 8  
HELX_P HELX_P20 20 GLY A 489 ? ASN A 493 ? GLY A 489 ASN A 493 5 ? 5  
HELX_P HELX_P21 21 VAL A 501 ? GLY A 520 ? VAL A 501 GLY A 520 1 ? 20 
HELX_P HELX_P22 22 ARG A 553 ? ASP A 565 ? ARG A 553 ASP A 565 1 ? 13 
HELX_P HELX_P23 23 TYR A 566 ? SER A 572 ? TYR A 566 SER A 572 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 66  SG  ? ? ? 1_555 A CYS 93  SG ? ? A CYS 66  A CYS 93  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf2 disulf ?    ? A CYS 292 SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 292 A CYS 307 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf3 disulf ?    ? A CYS 442 SG  ? ? ? 1_555 A CYS 560 SG ? ? A CYS 442 A CYS 560 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
covale1 covale one  ? A ASN 88  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 88  A NAG 601 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale2 covale one  ? A ASN 493 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 493 B NAG 1   1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.380 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale5 covale both ? B BMA .   O3  ? ? ? 1_555 B BMA .   C1 ? ? B BMA 3   B BMA 4   1_555 ? ? ? ? ? ? ? 1.392 ? ?               
covale6 covale both ? B BMA .   O3  ? ? ? 1_555 B BMA .   C1 ? ? B BMA 4   B BMA 5   1_555 ? ? ? ? ? ? ? 1.409 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
B 8 9 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 6   ? THR A 9   ? VAL A 6   THR A 9   
A 2 GLY A 12  ? ARG A 15  ? GLY A 12  ARG A 15  
B 1 ARG A 17  ? VAL A 21  ? ARG A 17  VAL A 21  
B 2 ARG A 24  ? TYR A 29  ? ARG A 24  TYR A 29  
B 3 ILE A 96  ? PRO A 101 ? ILE A 96  PRO A 101 
B 4 ILE A 174 ? PHE A 178 ? ILE A 174 PHE A 178 
B 5 ILE A 143 ? ILE A 147 ? ILE A 143 ILE A 147 
B 6 MET A 232 ? GLU A 237 ? MET A 232 GLU A 237 
B 7 ARG A 259 ? GLN A 263 ? ARG A 259 GLN A 263 
B 8 ASP A 358 ? VAL A 364 ? ASP A 358 VAL A 364 
B 9 SER A 457 ? PHE A 463 ? SER A 457 PHE A 463 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 7   ? O VAL A 7   N VAL A 14  ? N VAL A 14  
B 1 2 O ARG A 17  ? O ARG A 17  N VAL A 28  ? N VAL A 28  
B 2 3 O HIS A 27  ? O HIS A 27  N ALA A 100 ? N ALA A 100 
B 3 4 O ASN A 97  ? O ASN A 97  N SER A 177 ? N SER A 177 
B 4 5 O ILE A 174 ? O ILE A 174 N LEU A 144 ? N LEU A 144 
B 5 6 O ILE A 143 ? O ILE A 143 N THR A 233 ? N THR A 233 
B 6 7 O LEU A 234 ? O LEU A 234 N MET A 261 ? N MET A 261 
B 7 8 O GLY A 260 ? O GLY A 260 N ASP A 358 ? N ASP A 358 
B 8 9 O ILE A 359 ? O ILE A 359 N SER A 457 ? N SER A 457 
# 
_database_PDB_matrix.entry_id          1QO9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QO9 
_atom_sites.fract_transf_matrix[1][1]   0.010600 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010600 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006289 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 3   ? 26.303 44.583 -22.136 1.00 81.76  ? 3   ASP A N   1 
ATOM   2    C CA  . ASP A 1 3   ? 27.194 43.856 -21.187 1.00 82.09  ? 3   ASP A CA  1 
ATOM   3    C C   . ASP A 1 3   ? 26.391 43.066 -20.154 1.00 81.48  ? 3   ASP A C   1 
ATOM   4    O O   . ASP A 1 3   ? 25.177 42.883 -20.264 1.00 81.41  ? 3   ASP A O   1 
ATOM   5    C CB  . ASP A 1 3   ? 28.100 44.825 -20.404 1.00 83.19  ? 3   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 3   ? 28.633 45.971 -21.247 1.00 85.58  ? 3   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 3   ? 27.829 46.816 -21.707 1.00 86.14  ? 3   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 3   ? 29.868 46.037 -21.435 1.00 86.91  ? 3   ASP A OD2 1 
ATOM   9    N N   . ARG A 1 4   ? 27.124 42.616 -19.141 1.00 80.42  ? 4   ARG A N   1 
ATOM   10   C CA  . ARG A 1 4   ? 26.617 41.863 -17.997 1.00 78.88  ? 4   ARG A CA  1 
ATOM   11   C C   . ARG A 1 4   ? 26.557 42.918 -16.890 1.00 78.07  ? 4   ARG A C   1 
ATOM   12   O O   . ARG A 1 4   ? 25.717 42.875 -15.985 1.00 77.16  ? 4   ARG A O   1 
ATOM   13   C CB  . ARG A 1 4   ? 27.629 40.776 -17.632 1.00 77.34  ? 4   ARG A CB  1 
ATOM   14   C CG  . ARG A 1 4   ? 29.056 41.155 -18.037 1.00 75.99  ? 4   ARG A CG  1 
ATOM   15   C CD  . ARG A 1 4   ? 30.088 40.162 -17.541 1.00 74.39  ? 4   ARG A CD  1 
ATOM   16   N N   . LEU A 1 5   ? 27.482 43.868 -17.004 1.00 75.81  ? 5   LEU A N   1 
ATOM   17   C CA  . LEU A 1 5   ? 27.614 44.995 -16.096 1.00 72.89  ? 5   LEU A CA  1 
ATOM   18   C C   . LEU A 1 5   ? 26.521 46.031 -16.331 1.00 71.62  ? 5   LEU A C   1 
ATOM   19   O O   . LEU A 1 5   ? 26.613 47.153 -15.832 1.00 72.33  ? 5   LEU A O   1 
ATOM   20   C CB  . LEU A 1 5   ? 28.951 45.681 -16.323 1.00 71.71  ? 5   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 5   ? 30.207 45.088 -15.719 1.00 71.51  ? 5   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 5   ? 31.419 45.822 -16.284 1.00 71.00  ? 5   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 5   ? 30.139 45.223 -14.207 1.00 72.54  ? 5   LEU A CD2 1 
ATOM   24   N N   . VAL A 1 6   ? 25.508 45.673 -17.111 1.00 68.61  ? 6   VAL A N   1 
ATOM   25   C CA  . VAL A 1 6   ? 24.418 46.594 -17.399 1.00 65.57  ? 6   VAL A CA  1 
ATOM   26   C C   . VAL A 1 6   ? 23.151 46.177 -16.679 1.00 64.74  ? 6   VAL A C   1 
ATOM   27   O O   . VAL A 1 6   ? 22.864 44.986 -16.548 1.00 64.06  ? 6   VAL A O   1 
ATOM   28   C CB  . VAL A 1 6   ? 24.118 46.655 -18.902 1.00 64.16  ? 6   VAL A CB  1 
ATOM   29   C CG1 . VAL A 1 6   ? 22.811 47.399 -19.138 1.00 63.80  ? 6   VAL A CG1 1 
ATOM   30   C CG2 . VAL A 1 6   ? 25.257 47.339 -19.628 1.00 61.58  ? 6   VAL A CG2 1 
ATOM   31   N N   . VAL A 1 7   ? 22.390 47.162 -16.215 1.00 63.22  ? 7   VAL A N   1 
ATOM   32   C CA  . VAL A 1 7   ? 21.149 46.873 -15.515 1.00 62.36  ? 7   VAL A CA  1 
ATOM   33   C C   . VAL A 1 7   ? 20.007 47.707 -16.052 1.00 61.19  ? 7   VAL A C   1 
ATOM   34   O O   . VAL A 1 7   ? 20.184 48.874 -16.395 1.00 60.36  ? 7   VAL A O   1 
ATOM   35   C CB  . VAL A 1 7   ? 21.268 47.158 -14.020 1.00 61.56  ? 7   VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 7   ? 21.658 48.611 -13.814 1.00 64.56  ? 7   VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 7   ? 19.941 46.853 -13.329 1.00 59.00  ? 7   VAL A CG2 1 
ATOM   38   N N   . GLN A 1 8   ? 18.832 47.091 -16.121 1.00 61.12  ? 8   GLN A N   1 
ATOM   39   C CA  . GLN A 1 8   ? 17.633 47.773 -16.595 1.00 60.69  ? 8   GLN A CA  1 
ATOM   40   C C   . GLN A 1 8   ? 16.908 48.436 -15.433 1.00 59.33  ? 8   GLN A C   1 
ATOM   41   O O   . GLN A 1 8   ? 16.057 47.812 -14.789 1.00 59.04  ? 8   GLN A O   1 
ATOM   42   C CB  . GLN A 1 8   ? 16.661 46.793 -17.257 1.00 61.04  ? 8   GLN A CB  1 
ATOM   43   C CG  . GLN A 1 8   ? 16.512 46.943 -18.770 1.00 62.83  ? 8   GLN A CG  1 
ATOM   44   C CD  . GLN A 1 8   ? 16.386 48.390 -19.242 1.00 63.86  ? 8   GLN A CD  1 
ATOM   45   O OE1 . GLN A 1 8   ? 15.371 49.061 -19.012 1.00 63.52  ? 8   GLN A OE1 1 
ATOM   46   N NE2 . GLN A 1 8   ? 17.428 48.874 -19.915 1.00 64.27  ? 8   GLN A NE2 1 
ATOM   47   N N   . THR A 1 9   ? 17.242 49.692 -15.159 1.00 56.61  ? 9   THR A N   1 
ATOM   48   C CA  . THR A 1 9   ? 16.572 50.399 -14.084 1.00 54.96  ? 9   THR A CA  1 
ATOM   49   C C   . THR A 1 9   ? 15.213 50.769 -14.654 1.00 54.00  ? 9   THR A C   1 
ATOM   50   O O   . THR A 1 9   ? 15.036 50.784 -15.869 1.00 54.23  ? 9   THR A O   1 
ATOM   51   C CB  . THR A 1 9   ? 17.333 51.673 -13.680 1.00 54.87  ? 9   THR A CB  1 
ATOM   52   O OG1 . THR A 1 9   ? 17.205 52.664 -14.707 1.00 53.61  ? 9   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 9   ? 18.798 51.355 -13.479 1.00 54.65  ? 9   THR A CG2 1 
ATOM   54   N N   . SER A 1 10  ? 14.248 51.048 -13.794 1.00 51.65  ? 10  SER A N   1 
ATOM   55   C CA  . SER A 1 10  ? 12.933 51.411 -14.282 1.00 52.72  ? 10  SER A CA  1 
ATOM   56   C C   . SER A 1 10  ? 12.980 52.735 -15.045 1.00 53.78  ? 10  SER A C   1 
ATOM   57   O O   . SER A 1 10  ? 11.943 53.312 -15.357 1.00 54.86  ? 10  SER A O   1 
ATOM   58   C CB  . SER A 1 10  ? 11.952 51.521 -13.114 1.00 53.16  ? 10  SER A CB  1 
ATOM   59   O OG  . SER A 1 10  ? 12.310 52.578 -12.241 1.00 51.63  ? 10  SER A OG  1 
ATOM   60   N N   . SER A 1 11  ? 14.182 53.217 -15.349 1.00 54.65  ? 11  SER A N   1 
ATOM   61   C CA  . SER A 1 11  ? 14.331 54.479 -16.067 1.00 55.22  ? 11  SER A CA  1 
ATOM   62   C C   . SER A 1 11  ? 15.323 54.348 -17.212 1.00 56.71  ? 11  SER A C   1 
ATOM   63   O O   . SER A 1 11  ? 15.629 55.333 -17.889 1.00 57.96  ? 11  SER A O   1 
ATOM   64   C CB  . SER A 1 11  ? 14.808 55.579 -15.118 1.00 54.59  ? 11  SER A CB  1 
ATOM   65   O OG  . SER A 1 11  ? 13.956 55.692 -13.992 1.00 55.54  ? 11  SER A OG  1 
ATOM   66   N N   . GLY A 1 12  ? 15.835 53.137 -17.419 1.00 56.53  ? 12  GLY A N   1 
ATOM   67   C CA  . GLY A 1 12  ? 16.787 52.918 -18.496 1.00 54.90  ? 12  GLY A CA  1 
ATOM   68   C C   . GLY A 1 12  ? 17.939 51.982 -18.173 1.00 53.45  ? 12  GLY A C   1 
ATOM   69   O O   . GLY A 1 12  ? 18.112 51.564 -17.030 1.00 52.58  ? 12  GLY A O   1 
ATOM   70   N N   . PRO A 1 13  ? 18.738 51.613 -19.184 1.00 53.19  ? 13  PRO A N   1 
ATOM   71   C CA  . PRO A 1 13  ? 19.867 50.721 -18.946 1.00 52.83  ? 13  PRO A CA  1 
ATOM   72   C C   . PRO A 1 13  ? 20.980 51.538 -18.309 1.00 53.12  ? 13  PRO A C   1 
ATOM   73   O O   . PRO A 1 13  ? 21.187 52.703 -18.660 1.00 53.83  ? 13  PRO A O   1 
ATOM   74   C CB  . PRO A 1 13  ? 20.216 50.236 -20.348 1.00 52.21  ? 13  PRO A CB  1 
ATOM   75   C CG  . PRO A 1 13  ? 19.936 51.449 -21.184 1.00 51.61  ? 13  PRO A CG  1 
ATOM   76   C CD  . PRO A 1 13  ? 18.605 51.914 -20.622 1.00 54.65  ? 13  PRO A CD  1 
ATOM   77   N N   . VAL A 1 14  ? 21.682 50.926 -17.366 1.00 52.06  ? 14  VAL A N   1 
ATOM   78   C CA  . VAL A 1 14  ? 22.764 51.588 -16.663 1.00 50.10  ? 14  VAL A CA  1 
ATOM   79   C C   . VAL A 1 14  ? 23.924 50.622 -16.596 1.00 49.71  ? 14  VAL A C   1 
ATOM   80   O O   . VAL A 1 14  ? 23.728 49.436 -16.314 1.00 47.47  ? 14  VAL A O   1 
ATOM   81   C CB  . VAL A 1 14  ? 22.334 51.950 -15.236 1.00 50.82  ? 14  VAL A CB  1 
ATOM   82   C CG1 . VAL A 1 14  ? 23.498 52.492 -14.464 1.00 51.64  ? 14  VAL A CG1 1 
ATOM   83   C CG2 . VAL A 1 14  ? 21.220 52.970 -15.279 1.00 51.26  ? 14  VAL A CG2 1 
ATOM   84   N N   . ARG A 1 15  ? 25.128 51.118 -16.864 1.00 49.49  ? 15  ARG A N   1 
ATOM   85   C CA  . ARG A 1 15  ? 26.298 50.255 -16.825 1.00 51.97  ? 15  ARG A CA  1 
ATOM   86   C C   . ARG A 1 15  ? 27.259 50.720 -15.765 1.00 52.23  ? 15  ARG A C   1 
ATOM   87   O O   . ARG A 1 15  ? 27.528 51.906 -15.635 1.00 52.15  ? 15  ARG A O   1 
ATOM   88   C CB  . ARG A 1 15  ? 27.020 50.216 -18.179 1.00 52.18  ? 15  ARG A CB  1 
ATOM   89   C CG  . ARG A 1 15  ? 27.874 51.426 -18.491 1.00 53.07  ? 15  ARG A CG  1 
ATOM   90   C CD  . ARG A 1 15  ? 28.929 51.089 -19.535 1.00 53.55  ? 15  ARG A CD  1 
ATOM   91   N NE  . ARG A 1 15  ? 29.834 52.213 -19.761 1.00 56.51  ? 15  ARG A NE  1 
ATOM   92   N N   . GLY A 1 16  ? 27.777 49.771 -15.004 1.00 54.33  ? 16  GLY A N   1 
ATOM   93   C CA  . GLY A 1 16  ? 28.709 50.113 -13.953 1.00 56.87  ? 16  GLY A CA  1 
ATOM   94   C C   . GLY A 1 16  ? 29.952 49.276 -14.117 1.00 59.03  ? 16  GLY A C   1 
ATOM   95   O O   . GLY A 1 16  ? 29.999 48.394 -14.980 1.00 60.16  ? 16  GLY A O   1 
ATOM   96   N N   . ARG A 1 17  ? 30.961 49.540 -13.295 1.00 59.23  ? 17  ARG A N   1 
ATOM   97   C CA  . ARG A 1 17  ? 32.192 48.788 -13.387 1.00 59.94  ? 17  ARG A CA  1 
ATOM   98   C C   . ARG A 1 17  ? 32.243 47.747 -12.299 1.00 59.11  ? 17  ARG A C   1 
ATOM   99   O O   . ARG A 1 17  ? 31.693 47.952 -11.220 1.00 58.97  ? 17  ARG A O   1 
ATOM   100  C CB  . ARG A 1 17  ? 33.405 49.713 -13.278 1.00 62.98  ? 17  ARG A CB  1 
ATOM   101  C CG  . ARG A 1 17  ? 33.631 50.308 -11.915 1.00 65.68  ? 17  ARG A CG  1 
ATOM   102  C CD  . ARG A 1 17  ? 33.522 51.816 -11.956 1.00 70.10  ? 17  ARG A CD  1 
ATOM   103  N NE  . ARG A 1 17  ? 34.173 52.426 -10.798 1.00 75.50  ? 17  ARG A NE  1 
ATOM   104  C CZ  . ARG A 1 17  ? 33.939 52.078 -9.536  1.00 75.70  ? 17  ARG A CZ  1 
ATOM   105  N NH1 . ARG A 1 17  ? 33.069 51.121 -9.260  1.00 77.40  ? 17  ARG A NH1 1 
ATOM   106  N NH2 . ARG A 1 17  ? 34.579 52.686 -8.549  1.00 77.51  ? 17  ARG A NH2 1 
ATOM   107  N N   . SER A 1 18  ? 32.900 46.629 -12.612 1.00 58.75  ? 18  SER A N   1 
ATOM   108  C CA  . SER A 1 18  ? 33.081 45.511 -11.696 1.00 56.51  ? 18  SER A CA  1 
ATOM   109  C C   . SER A 1 18  ? 34.337 45.731 -10.894 1.00 54.55  ? 18  SER A C   1 
ATOM   110  O O   . SER A 1 18  ? 35.358 46.134 -11.428 1.00 52.66  ? 18  SER A O   1 
ATOM   111  C CB  . SER A 1 18  ? 33.233 44.203 -12.455 1.00 58.52  ? 18  SER A CB  1 
ATOM   112  O OG  . SER A 1 18  ? 33.897 43.248 -11.647 1.00 59.92  ? 18  SER A OG  1 
ATOM   113  N N   . VAL A 1 19  ? 34.262 45.446 -9.606  1.00 54.38  ? 19  VAL A N   1 
ATOM   114  C CA  . VAL A 1 19  ? 35.401 45.633 -8.734  1.00 53.88  ? 19  VAL A CA  1 
ATOM   115  C C   . VAL A 1 19  ? 35.446 44.489 -7.752  1.00 54.32  ? 19  VAL A C   1 
ATOM   116  O O   . VAL A 1 19  ? 34.469 44.244 -7.041  1.00 54.91  ? 19  VAL A O   1 
ATOM   117  C CB  . VAL A 1 19  ? 35.286 46.957 -7.959  1.00 52.30  ? 19  VAL A CB  1 
ATOM   118  C CG1 . VAL A 1 19  ? 36.409 47.078 -6.959  1.00 53.39  ? 19  VAL A CG1 1 
ATOM   119  C CG2 . VAL A 1 19  ? 35.332 48.116 -8.926  1.00 52.15  ? 19  VAL A CG2 1 
ATOM   120  N N   . THR A 1 20  ? 36.577 43.788 -7.721  1.00 53.25  ? 20  THR A N   1 
ATOM   121  C CA  . THR A 1 20  ? 36.746 42.669 -6.811  1.00 52.52  ? 20  THR A CA  1 
ATOM   122  C C   . THR A 1 20  ? 37.411 43.107 -5.519  1.00 52.12  ? 20  THR A C   1 
ATOM   123  O O   . THR A 1 20  ? 38.384 43.857 -5.527  1.00 50.78  ? 20  THR A O   1 
ATOM   124  C CB  . THR A 1 20  ? 37.583 41.544 -7.438  1.00 52.72  ? 20  THR A CB  1 
ATOM   125  O OG1 . THR A 1 20  ? 36.866 40.970 -8.537  1.00 53.41  ? 20  THR A OG1 1 
ATOM   126  C CG2 . THR A 1 20  ? 37.857 40.457 -6.409  1.00 53.08  ? 20  THR A CG2 1 
ATOM   127  N N   . VAL A 1 21  ? 36.854 42.636 -4.408  1.00 52.85  ? 21  VAL A N   1 
ATOM   128  C CA  . VAL A 1 21  ? 37.362 42.932 -3.079  1.00 53.63  ? 21  VAL A CA  1 
ATOM   129  C C   . VAL A 1 21  ? 37.044 41.725 -2.224  1.00 55.42  ? 21  VAL A C   1 
ATOM   130  O O   . VAL A 1 21  ? 35.932 41.203 -2.252  1.00 54.59  ? 21  VAL A O   1 
ATOM   131  C CB  . VAL A 1 21  ? 36.696 44.172 -2.481  1.00 53.34  ? 21  VAL A CB  1 
ATOM   132  C CG1 . VAL A 1 21  ? 37.120 45.407 -3.256  1.00 54.88  ? 21  VAL A CG1 1 
ATOM   133  C CG2 . VAL A 1 21  ? 35.207 44.027 -2.536  1.00 51.02  ? 21  VAL A CG2 1 
ATOM   134  N N   . GLN A 1 22  ? 38.040 41.271 -1.479  1.00 57.87  ? 22  GLN A N   1 
ATOM   135  C CA  . GLN A 1 22  ? 37.894 40.105 -0.632  1.00 60.36  ? 22  GLN A CA  1 
ATOM   136  C C   . GLN A 1 22  ? 37.197 38.949 -1.338  1.00 61.94  ? 22  GLN A C   1 
ATOM   137  O O   . GLN A 1 22  ? 36.297 38.312 -0.797  1.00 62.61  ? 22  GLN A O   1 
ATOM   138  C CB  . GLN A 1 22  ? 37.174 40.479 0.656   1.00 60.55  ? 22  GLN A CB  1 
ATOM   139  C CG  . GLN A 1 22  ? 38.049 41.320 1.554   1.00 63.60  ? 22  GLN A CG  1 
ATOM   140  C CD  . GLN A 1 22  ? 37.431 41.585 2.897   1.00 65.10  ? 22  GLN A CD  1 
ATOM   141  O OE1 . GLN A 1 22  ? 37.203 40.666 3.684   1.00 64.71  ? 22  GLN A OE1 1 
ATOM   142  N NE2 . GLN A 1 22  ? 37.154 42.852 3.174   1.00 67.43  ? 22  GLN A NE2 1 
ATOM   143  N N   . GLY A 1 23  ? 37.636 38.692 -2.563  1.00 64.10  ? 23  GLY A N   1 
ATOM   144  C CA  . GLY A 1 23  ? 37.096 37.596 -3.345  1.00 66.68  ? 23  GLY A CA  1 
ATOM   145  C C   . GLY A 1 23  ? 35.710 37.763 -3.925  1.00 68.37  ? 23  GLY A C   1 
ATOM   146  O O   . GLY A 1 23  ? 35.225 36.881 -4.636  1.00 69.34  ? 23  GLY A O   1 
ATOM   147  N N   . ARG A 1 24  ? 35.067 38.888 -3.641  1.00 69.30  ? 24  ARG A N   1 
ATOM   148  C CA  . ARG A 1 24  ? 33.725 39.114 -4.144  1.00 69.79  ? 24  ARG A CA  1 
ATOM   149  C C   . ARG A 1 24  ? 33.723 40.196 -5.205  1.00 69.08  ? 24  ARG A C   1 
ATOM   150  O O   . ARG A 1 24  ? 34.355 41.234 -5.039  1.00 69.83  ? 24  ARG A O   1 
ATOM   151  C CB  . ARG A 1 24  ? 32.816 39.519 -2.993  1.00 72.46  ? 24  ARG A CB  1 
ATOM   152  C CG  . ARG A 1 24  ? 33.078 38.742 -1.712  1.00 77.01  ? 24  ARG A CG  1 
ATOM   153  C CD  . ARG A 1 24  ? 32.434 37.358 -1.698  1.00 79.55  ? 24  ARG A CD  1 
ATOM   154  N NE  . ARG A 1 24  ? 31.514 37.245 -0.566  1.00 80.73  ? 24  ARG A NE  1 
ATOM   155  C CZ  . ARG A 1 24  ? 30.187 37.274 -0.660  1.00 80.08  ? 24  ARG A CZ  1 
ATOM   156  N NH1 . ARG A 1 24  ? 29.592 37.411 -1.841  1.00 78.46  ? 24  ARG A NH1 1 
ATOM   157  N NH2 . ARG A 1 24  ? 29.456 37.194 0.441   1.00 80.31  ? 24  ARG A NH2 1 
ATOM   158  N N   . GLU A 1 25  ? 33.017 39.948 -6.300  1.00 68.26  ? 25  GLU A N   1 
ATOM   159  C CA  . GLU A 1 25  ? 32.937 40.924 -7.374  1.00 67.46  ? 25  GLU A CA  1 
ATOM   160  C C   . GLU A 1 25  ? 31.746 41.804 -7.047  1.00 65.67  ? 25  GLU A C   1 
ATOM   161  O O   . GLU A 1 25  ? 30.693 41.319 -6.634  1.00 63.82  ? 25  GLU A O   1 
ATOM   162  C CB  . GLU A 1 25  ? 32.720 40.235 -8.729  1.00 69.87  ? 25  GLU A CB  1 
ATOM   163  C CG  . GLU A 1 25  ? 33.001 41.115 -9.953  1.00 69.45  ? 25  GLU A CG  1 
ATOM   164  C CD  . GLU A 1 25  ? 32.568 40.461 -11.260 1.00 71.34  ? 25  GLU A CD  1 
ATOM   165  O OE1 . GLU A 1 25  ? 32.444 39.219 -11.293 1.00 72.52  ? 25  GLU A OE1 1 
ATOM   166  O OE2 . GLU A 1 25  ? 32.360 41.185 -12.259 1.00 71.93  ? 25  GLU A OE2 1 
ATOM   167  N N   . VAL A 1 26  ? 31.923 43.104 -7.218  1.00 64.02  ? 26  VAL A N   1 
ATOM   168  C CA  . VAL A 1 26  ? 30.854 44.035 -6.929  1.00 63.73  ? 26  VAL A CA  1 
ATOM   169  C C   . VAL A 1 26  ? 30.649 44.972 -8.098  1.00 63.77  ? 26  VAL A C   1 
ATOM   170  O O   . VAL A 1 26  ? 31.580 45.655 -8.529  1.00 64.40  ? 26  VAL A O   1 
ATOM   171  C CB  . VAL A 1 26  ? 31.159 44.892 -5.678  1.00 62.71  ? 26  VAL A CB  1 
ATOM   172  C CG1 . VAL A 1 26  ? 30.025 45.897 -5.457  1.00 61.33  ? 26  VAL A CG1 1 
ATOM   173  C CG2 . VAL A 1 26  ? 31.339 43.995 -4.454  1.00 60.25  ? 26  VAL A CG2 1 
ATOM   174  N N   . HIS A 1 27  ? 29.428 44.996 -8.615  1.00 62.35  ? 27  HIS A N   1 
ATOM   175  C CA  . HIS A 1 27  ? 29.112 45.878 -9.717  1.00 60.42  ? 27  HIS A CA  1 
ATOM   176  C C   . HIS A 1 27  ? 28.718 47.181 -9.076  1.00 57.39  ? 27  HIS A C   1 
ATOM   177  O O   . HIS A 1 27  ? 27.660 47.280 -8.473  1.00 57.39  ? 27  HIS A O   1 
ATOM   178  C CB  . HIS A 1 27  ? 27.973 45.300 -10.548 1.00 62.92  ? 27  HIS A CB  1 
ATOM   179  C CG  . HIS A 1 27  ? 28.355 44.028 -11.253 1.00 66.09  ? 27  HIS A CG  1 
ATOM   180  N ND1 . HIS A 1 27  ? 27.550 43.444 -12.211 1.00 65.76  ? 27  HIS A ND1 1 
ATOM   181  C CD2 . HIS A 1 27  ? 29.444 43.251 -11.133 1.00 66.59  ? 27  HIS A CD2 1 
ATOM   182  C CE1 . HIS A 1 27  ? 28.147 42.347 -12.650 1.00 68.52  ? 27  HIS A CE1 1 
ATOM   183  N NE2 . HIS A 1 27  ? 29.290 42.200 -12.020 1.00 68.31  ? 27  HIS A NE2 1 
ATOM   184  N N   . VAL A 1 28  ? 29.608 48.160 -9.192  1.00 54.26  ? 28  VAL A N   1 
ATOM   185  C CA  . VAL A 1 28  ? 29.428 49.479 -8.617  1.00 50.72  ? 28  VAL A CA  1 
ATOM   186  C C   . VAL A 1 28  ? 28.884 50.453 -9.626  1.00 49.95  ? 28  VAL A C   1 
ATOM   187  O O   . VAL A 1 28  ? 29.591 50.833 -10.548 1.00 52.40  ? 28  VAL A O   1 
ATOM   188  C CB  . VAL A 1 28  ? 30.762 50.056 -8.141  1.00 50.10  ? 28  VAL A CB  1 
ATOM   189  C CG1 . VAL A 1 28  ? 30.545 51.395 -7.483  1.00 51.93  ? 28  VAL A CG1 1 
ATOM   190  C CG2 . VAL A 1 28  ? 31.433 49.108 -7.198  1.00 52.38  ? 28  VAL A CG2 1 
ATOM   191  N N   . TYR A 1 29  ? 27.640 50.875 -9.437  1.00 48.78  ? 29  TYR A N   1 
ATOM   192  C CA  . TYR A 1 29  ? 27.002 51.842 -10.325 1.00 47.44  ? 29  TYR A CA  1 
ATOM   193  C C   . TYR A 1 29  ? 26.914 53.201 -9.628  1.00 45.64  ? 29  TYR A C   1 
ATOM   194  O O   . TYR A 1 29  ? 26.330 53.298 -8.550  1.00 44.71  ? 29  TYR A O   1 
ATOM   195  C CB  . TYR A 1 29  ? 25.590 51.381 -10.686 1.00 46.76  ? 29  TYR A CB  1 
ATOM   196  C CG  . TYR A 1 29  ? 25.535 49.970 -11.201 1.00 48.99  ? 29  TYR A CG  1 
ATOM   197  C CD1 . TYR A 1 29  ? 25.602 48.883 -10.331 1.00 48.32  ? 29  TYR A CD1 1 
ATOM   198  C CD2 . TYR A 1 29  ? 25.401 49.716 -12.564 1.00 49.63  ? 29  TYR A CD2 1 
ATOM   199  C CE1 . TYR A 1 29  ? 25.527 47.570 -10.809 1.00 49.29  ? 29  TYR A CE1 1 
ATOM   200  C CE2 . TYR A 1 29  ? 25.328 48.412 -13.052 1.00 50.82  ? 29  TYR A CE2 1 
ATOM   201  C CZ  . TYR A 1 29  ? 25.387 47.344 -12.174 1.00 50.41  ? 29  TYR A CZ  1 
ATOM   202  O OH  . TYR A 1 29  ? 25.277 46.062 -12.674 1.00 50.35  ? 29  TYR A OH  1 
ATOM   203  N N   . THR A 1 30  ? 27.489 54.239 -10.240 1.00 43.51  ? 30  THR A N   1 
ATOM   204  C CA  . THR A 1 30  ? 27.458 55.590 -9.676  1.00 42.80  ? 30  THR A CA  1 
ATOM   205  C C   . THR A 1 30  ? 26.953 56.609 -10.689 1.00 41.48  ? 30  THR A C   1 
ATOM   206  O O   . THR A 1 30  ? 27.204 56.493 -11.878 1.00 42.57  ? 30  THR A O   1 
ATOM   207  C CB  . THR A 1 30  ? 28.854 56.054 -9.216  1.00 44.06  ? 30  THR A CB  1 
ATOM   208  O OG1 . THR A 1 30  ? 29.792 55.823 -10.269 1.00 47.56  ? 30  THR A OG1 1 
ATOM   209  C CG2 . THR A 1 30  ? 29.299 55.317 -7.949  1.00 41.49  ? 30  THR A CG2 1 
ATOM   210  N N   . GLY A 1 31  ? 26.233 57.613 -10.218 1.00 40.66  ? 31  GLY A N   1 
ATOM   211  C CA  . GLY A 1 31  ? 25.736 58.623 -11.130 1.00 39.93  ? 31  GLY A CA  1 
ATOM   212  C C   . GLY A 1 31  ? 24.404 58.312 -11.782 1.00 40.56  ? 31  GLY A C   1 
ATOM   213  O O   . GLY A 1 31  ? 24.138 58.779 -12.897 1.00 42.21  ? 31  GLY A O   1 
ATOM   214  N N   . ILE A 1 32  ? 23.563 57.525 -11.116 1.00 38.16  ? 32  ILE A N   1 
ATOM   215  C CA  . ILE A 1 32  ? 22.256 57.201 -11.683 1.00 38.91  ? 32  ILE A CA  1 
ATOM   216  C C   . ILE A 1 32  ? 21.265 58.288 -11.277 1.00 39.53  ? 32  ILE A C   1 
ATOM   217  O O   . ILE A 1 32  ? 20.818 58.322 -10.141 1.00 41.36  ? 32  ILE A O   1 
ATOM   218  C CB  . ILE A 1 32  ? 21.742 55.828 -11.181 1.00 36.68  ? 32  ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 32  ? 22.753 54.739 -11.525 1.00 33.47  ? 32  ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 32  ? 20.413 55.501 -11.817 1.00 31.89  ? 32  ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 32  ? 22.302 53.366 -11.146 1.00 32.94  ? 32  ILE A CD1 1 
ATOM   222  N N   . PRO A 1 33  ? 20.914 59.196 -12.202 1.00 41.13  ? 33  PRO A N   1 
ATOM   223  C CA  . PRO A 1 33  ? 19.966 60.262 -11.852 1.00 41.86  ? 33  PRO A CA  1 
ATOM   224  C C   . PRO A 1 33  ? 18.692 59.663 -11.280 1.00 42.68  ? 33  PRO A C   1 
ATOM   225  O O   . PRO A 1 33  ? 18.162 58.695 -11.825 1.00 44.36  ? 33  PRO A O   1 
ATOM   226  C CB  . PRO A 1 33  ? 19.714 60.949 -13.188 1.00 41.72  ? 33  PRO A CB  1 
ATOM   227  C CG  . PRO A 1 33  ? 19.804 59.812 -14.148 1.00 40.98  ? 33  PRO A CG  1 
ATOM   228  C CD  . PRO A 1 33  ? 21.051 59.091 -13.665 1.00 40.39  ? 33  PRO A CD  1 
ATOM   229  N N   . TYR A 1 34  ? 18.196 60.222 -10.182 1.00 41.70  ? 34  TYR A N   1 
ATOM   230  C CA  . TYR A 1 34  ? 16.986 59.685 -9.591  1.00 41.15  ? 34  TYR A CA  1 
ATOM   231  C C   . TYR A 1 34  ? 15.911 60.736 -9.567  1.00 39.99  ? 34  TYR A C   1 
ATOM   232  O O   . TYR A 1 34  ? 14.884 60.576 -8.904  1.00 37.89  ? 34  TYR A O   1 
ATOM   233  C CB  . TYR A 1 34  ? 17.267 59.158 -8.181  1.00 41.83  ? 34  TYR A CB  1 
ATOM   234  C CG  . TYR A 1 34  ? 17.476 60.206 -7.111  1.00 41.87  ? 34  TYR A CG  1 
ATOM   235  C CD1 . TYR A 1 34  ? 16.391 60.806 -6.468  1.00 41.81  ? 34  TYR A CD1 1 
ATOM   236  C CD2 . TYR A 1 34  ? 18.757 60.553 -6.698  1.00 40.45  ? 34  TYR A CD2 1 
ATOM   237  C CE1 . TYR A 1 34  ? 16.584 61.722 -5.438  1.00 41.36  ? 34  TYR A CE1 1 
ATOM   238  C CE2 . TYR A 1 34  ? 18.960 61.465 -5.670  1.00 41.00  ? 34  TYR A CE2 1 
ATOM   239  C CZ  . TYR A 1 34  ? 17.877 62.047 -5.038  1.00 40.35  ? 34  TYR A CZ  1 
ATOM   240  O OH  . TYR A 1 34  ? 18.091 62.942 -4.000  1.00 39.11  ? 34  TYR A OH  1 
ATOM   241  N N   . ALA A 1 35  ? 16.164 61.802 -10.322 1.00 41.49  ? 35  ALA A N   1 
ATOM   242  C CA  . ALA A 1 35  ? 15.261 62.943 -10.446 1.00 42.28  ? 35  ALA A CA  1 
ATOM   243  C C   . ALA A 1 35  ? 15.853 63.970 -11.407 1.00 43.49  ? 35  ALA A C   1 
ATOM   244  O O   . ALA A 1 35  ? 17.035 63.892 -11.771 1.00 42.38  ? 35  ALA A O   1 
ATOM   245  C CB  . ALA A 1 35  ? 15.043 63.587 -9.081  1.00 40.51  ? 35  ALA A CB  1 
ATOM   246  N N   . LYS A 1 36  ? 15.027 64.930 -11.817 1.00 46.09  ? 36  LYS A N   1 
ATOM   247  C CA  . LYS A 1 36  ? 15.474 65.999 -12.702 1.00 49.05  ? 36  LYS A CA  1 
ATOM   248  C C   . LYS A 1 36  ? 16.410 66.929 -11.922 1.00 50.45  ? 36  LYS A C   1 
ATOM   249  O O   . LYS A 1 36  ? 16.130 67.266 -10.770 1.00 47.98  ? 36  LYS A O   1 
ATOM   250  C CB  . LYS A 1 36  ? 14.273 66.795 -13.216 1.00 49.92  ? 36  LYS A CB  1 
ATOM   251  C CG  . LYS A 1 36  ? 13.302 65.985 -14.076 1.00 50.41  ? 36  LYS A CG  1 
ATOM   252  C CD  . LYS A 1 36  ? 12.266 66.881 -14.780 1.00 48.59  ? 36  LYS A CD  1 
ATOM   253  C CE  . LYS A 1 36  ? 12.918 67.900 -15.699 1.00 46.69  ? 36  LYS A CE  1 
ATOM   254  N NZ  . LYS A 1 36  ? 11.920 68.718 -16.431 1.00 46.02  ? 36  LYS A NZ  1 
ATOM   255  N N   . PRO A 1 37  ? 17.537 67.345 -12.535 1.00 53.53  ? 37  PRO A N   1 
ATOM   256  C CA  . PRO A 1 37  ? 18.480 68.241 -11.846 1.00 55.86  ? 37  PRO A CA  1 
ATOM   257  C C   . PRO A 1 37  ? 17.671 69.436 -11.342 1.00 59.13  ? 37  PRO A C   1 
ATOM   258  O O   . PRO A 1 37  ? 17.096 70.169 -12.144 1.00 60.04  ? 37  PRO A O   1 
ATOM   259  C CB  . PRO A 1 37  ? 19.455 68.629 -12.952 1.00 53.96  ? 37  PRO A CB  1 
ATOM   260  C CG  . PRO A 1 37  ? 19.401 67.448 -13.897 1.00 52.35  ? 37  PRO A CG  1 
ATOM   261  C CD  . PRO A 1 37  ? 17.931 67.158 -13.943 1.00 52.84  ? 37  PRO A CD  1 
ATOM   262  N N   . PRO A 1 38  ? 17.621 69.676 -10.013 1.00 61.13  ? 38  PRO A N   1 
ATOM   263  C CA  . PRO A 1 38  ? 16.847 70.764 -9.440  1.00 63.52  ? 38  PRO A CA  1 
ATOM   264  C C   . PRO A 1 38  ? 17.427 72.084 -9.863  1.00 66.70  ? 38  PRO A C   1 
ATOM   265  O O   . PRO A 1 38  ? 18.031 72.816 -9.047  1.00 69.00  ? 38  PRO A O   1 
ATOM   266  C CB  . PRO A 1 38  ? 16.946 70.546 -7.952  1.00 62.78  ? 38  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 38  ? 17.791 69.306 -7.722  1.00 60.41  ? 38  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 38  ? 18.218 68.754 -9.050  1.00 60.18  ? 38  PRO A CD  1 
ATOM   269  N N   . VAL A 1 39  ? 17.207 72.465 -11.123 1.00 68.02  ? 39  VAL A N   1 
ATOM   270  C CA  . VAL A 1 39  ? 17.721 73.711 -11.677 1.00 67.54  ? 39  VAL A CA  1 
ATOM   271  C C   . VAL A 1 39  ? 16.624 74.580 -12.296 1.00 66.78  ? 39  VAL A C   1 
ATOM   272  O O   . VAL A 1 39  ? 15.593 74.078 -12.758 1.00 66.24  ? 39  VAL A O   1 
ATOM   273  C CB  . VAL A 1 39  ? 18.806 73.410 -12.731 1.00 66.49  ? 39  VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 39  ? 19.463 74.691 -13.194 1.00 69.16  ? 39  VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 39  ? 19.839 72.477 -12.135 1.00 66.67  ? 39  VAL A CG2 1 
ATOM   276  N N   . GLU A 1 40  ? 16.861 75.886 -12.299 1.00 65.68  ? 40  GLU A N   1 
ATOM   277  C CA  . GLU A 1 40  ? 15.907 76.843 -12.839 1.00 66.64  ? 40  GLU A CA  1 
ATOM   278  C C   . GLU A 1 40  ? 14.581 76.791 -12.098 1.00 65.18  ? 40  GLU A C   1 
ATOM   279  O O   . GLU A 1 40  ? 14.555 76.824 -10.864 1.00 64.29  ? 40  GLU A O   1 
ATOM   280  C CB  . GLU A 1 40  ? 15.676 76.609 -14.338 1.00 69.27  ? 40  GLU A CB  1 
ATOM   281  C CG  . GLU A 1 40  ? 16.813 77.112 -15.230 1.00 72.52  ? 40  GLU A CG  1 
ATOM   282  C CD  . GLU A 1 40  ? 16.476 77.021 -16.710 1.00 74.49  ? 40  GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 40  ? 15.557 76.252 -17.065 1.00 75.16  ? 40  GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 40  ? 17.139 77.708 -17.519 1.00 77.60  ? 40  GLU A OE2 1 
ATOM   285  N N   A ASP A 1 41  ? 13.481 76.710 -12.847 0.50 64.41  ? 41  ASP A N   1 
ATOM   286  N N   B ASP A 1 41  ? 13.484 76.706 -12.847 0.50 64.45  ? 41  ASP A N   1 
ATOM   287  C CA  A ASP A 1 41  ? 12.153 76.662 -12.245 0.50 63.75  ? 41  ASP A CA  1 
ATOM   288  C CA  B ASP A 1 41  ? 12.159 76.663 -12.243 0.50 63.80  ? 41  ASP A CA  1 
ATOM   289  C C   A ASP A 1 41  ? 12.084 75.668 -11.093 0.50 63.19  ? 41  ASP A C   1 
ATOM   290  C C   B ASP A 1 41  ? 12.080 75.663 -11.099 0.50 63.23  ? 41  ASP A C   1 
ATOM   291  O O   A ASP A 1 41  ? 11.169 75.734 -10.285 0.50 63.61  ? 41  ASP A O   1 
ATOM   292  O O   B ASP A 1 41  ? 11.158 75.724 -10.298 0.50 63.63  ? 41  ASP A O   1 
ATOM   293  C CB  A ASP A 1 41  ? 11.089 76.278 -13.281 0.50 63.28  ? 41  ASP A CB  1 
ATOM   294  C CB  B ASP A 1 41  ? 11.090 76.332 -13.297 0.50 63.43  ? 41  ASP A CB  1 
ATOM   295  C CG  A ASP A 1 41  ? 10.867 77.353 -14.321 0.50 63.81  ? 41  ASP A CG  1 
ATOM   296  C CG  B ASP A 1 41  ? 11.329 74.993 -13.988 0.50 63.95  ? 41  ASP A CG  1 
ATOM   297  O OD1 A ASP A 1 41  ? 11.483 78.432 -14.203 0.50 64.08  ? 41  ASP A OD1 1 
ATOM   298  O OD1 B ASP A 1 41  ? 12.332 74.317 -13.675 0.50 65.98  ? 41  ASP A OD1 1 
ATOM   299  O OD2 A ASP A 1 41  ? 10.071 77.122 -15.258 0.50 63.53  ? 41  ASP A OD2 1 
ATOM   300  O OD2 B ASP A 1 41  ? 10.511 74.617 -14.855 0.50 62.43  ? 41  ASP A OD2 1 
ATOM   301  N N   . LEU A 1 42  ? 13.052 74.755 -11.009 1.00 62.38  ? 42  LEU A N   1 
ATOM   302  C CA  . LEU A 1 42  ? 13.050 73.738 -9.953  1.00 61.54  ? 42  LEU A CA  1 
ATOM   303  C C   . LEU A 1 42  ? 13.737 74.010 -8.627  1.00 61.80  ? 42  LEU A C   1 
ATOM   304  O O   . LEU A 1 42  ? 13.202 73.622 -7.592  1.00 64.21  ? 42  LEU A O   1 
ATOM   305  C CB  . LEU A 1 42  ? 13.564 72.400 -10.486 1.00 59.71  ? 42  LEU A CB  1 
ATOM   306  C CG  . LEU A 1 42  ? 12.629 71.638 -11.430 1.00 57.53  ? 42  LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 42  ? 13.101 70.186 -11.512 1.00 57.33  ? 42  LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 42  ? 11.187 71.706 -10.937 1.00 52.69  ? 42  LEU A CD2 1 
ATOM   309  N N   . ARG A 1 43  ? 14.913 74.632 -8.636  1.00 60.11  ? 43  ARG A N   1 
ATOM   310  C CA  . ARG A 1 43  ? 15.611 74.931 -7.381  1.00 58.34  ? 43  ARG A CA  1 
ATOM   311  C C   . ARG A 1 43  ? 14.592 75.277 -6.277  1.00 55.77  ? 43  ARG A C   1 
ATOM   312  O O   . ARG A 1 43  ? 13.574 75.925 -6.547  1.00 54.47  ? 43  ARG A O   1 
ATOM   313  C CB  . ARG A 1 43  ? 16.581 76.103 -7.580  1.00 59.10  ? 43  ARG A CB  1 
ATOM   314  C CG  . ARG A 1 43  ? 17.411 76.430 -6.352  1.00 61.65  ? 43  ARG A CG  1 
ATOM   315  C CD  . ARG A 1 43  ? 18.179 77.746 -6.501  1.00 65.66  ? 43  ARG A CD  1 
ATOM   316  N NE  . ARG A 1 43  ? 19.410 77.656 -7.294  1.00 65.53  ? 43  ARG A NE  1 
ATOM   317  C CZ  . ARG A 1 43  ? 20.112 78.714 -7.698  1.00 64.61  ? 43  ARG A CZ  1 
ATOM   318  N NH1 . ARG A 1 43  ? 19.706 79.943 -7.394  1.00 63.19  ? 43  ARG A NH1 1 
ATOM   319  N NH2 . ARG A 1 43  ? 21.226 78.545 -8.390  1.00 62.76  ? 43  ARG A NH2 1 
ATOM   320  N N   . PHE A 1 44  ? 14.856 74.824 -5.049  1.00 53.09  ? 44  PHE A N   1 
ATOM   321  C CA  . PHE A 1 44  ? 13.974 75.069 -3.890  1.00 50.50  ? 44  PHE A CA  1 
ATOM   322  C C   . PHE A 1 44  ? 12.678 74.253 -3.897  1.00 47.10  ? 44  PHE A C   1 
ATOM   323  O O   . PHE A 1 44  ? 11.940 74.242 -2.915  1.00 45.45  ? 44  PHE A O   1 
ATOM   324  C CB  . PHE A 1 44  ? 13.609 76.564 -3.776  1.00 48.87  ? 44  PHE A CB  1 
ATOM   325  C CG  . PHE A 1 44  ? 14.796 77.471 -3.628  1.00 48.35  ? 44  PHE A CG  1 
ATOM   326  C CD1 . PHE A 1 44  ? 15.923 77.066 -2.925  1.00 50.12  ? 44  PHE A CD1 1 
ATOM   327  C CD2 . PHE A 1 44  ? 14.804 78.712 -4.237  1.00 48.65  ? 44  PHE A CD2 1 
ATOM   328  C CE1 . PHE A 1 44  ? 17.041 77.885 -2.840  1.00 51.38  ? 44  PHE A CE1 1 
ATOM   329  C CE2 . PHE A 1 44  ? 15.908 79.529 -4.160  1.00 49.88  ? 44  PHE A CE2 1 
ATOM   330  C CZ  . PHE A 1 44  ? 17.032 79.118 -3.462  1.00 51.00  ? 44  PHE A CZ  1 
ATOM   331  N N   . ARG A 1 45  ? 12.404 73.569 -4.997  1.00 45.34  ? 45  ARG A N   1 
ATOM   332  C CA  . ARG A 1 45  ? 11.183 72.786 -5.108  1.00 44.73  ? 45  ARG A CA  1 
ATOM   333  C C   . ARG A 1 45  ? 11.368 71.310 -4.815  1.00 43.91  ? 45  ARG A C   1 
ATOM   334  O O   . ARG A 1 45  ? 12.492 70.801 -4.787  1.00 42.76  ? 45  ARG A O   1 
ATOM   335  C CB  . ARG A 1 45  ? 10.598 72.949 -6.508  1.00 44.44  ? 45  ARG A CB  1 
ATOM   336  C CG  . ARG A 1 45  ? 10.200 74.366 -6.800  1.00 46.13  ? 45  ARG A CG  1 
ATOM   337  C CD  . ARG A 1 45  ? 9.902  74.551 -8.250  1.00 47.66  ? 45  ARG A CD  1 
ATOM   338  N NE  . ARG A 1 45  ? 9.280  75.846 -8.514  1.00 49.28  ? 45  ARG A NE  1 
ATOM   339  C CZ  . ARG A 1 45  ? 8.023  76.135 -8.203  1.00 49.07  ? 45  ARG A CZ  1 
ATOM   340  N NH1 . ARG A 1 45  ? 7.262  75.223 -7.620  1.00 54.11  ? 45  ARG A NH1 1 
ATOM   341  N NH2 . ARG A 1 45  ? 7.522  77.324 -8.481  1.00 48.57  ? 45  ARG A NH2 1 
ATOM   342  N N   . LYS A 1 46  ? 10.250 70.628 -4.589  1.00 43.04  ? 46  LYS A N   1 
ATOM   343  C CA  . LYS A 1 46  ? 10.278 69.195 -4.329  1.00 41.99  ? 46  LYS A CA  1 
ATOM   344  C C   . LYS A 1 46  ? 10.840 68.559 -5.586  1.00 41.90  ? 46  LYS A C   1 
ATOM   345  O O   . LYS A 1 46  ? 10.543 69.000 -6.693  1.00 43.60  ? 46  LYS A O   1 
ATOM   346  C CB  . LYS A 1 46  ? 8.868  68.655 -4.084  1.00 38.28  ? 46  LYS A CB  1 
ATOM   347  C CG  . LYS A 1 46  ? 8.235  69.033 -2.750  1.00 36.26  ? 46  LYS A CG  1 
ATOM   348  C CD  . LYS A 1 46  ? 6.782  68.571 -2.724  1.00 35.90  ? 46  LYS A CD  1 
ATOM   349  C CE  . LYS A 1 46  ? 6.064  68.986 -1.452  1.00 37.39  ? 46  LYS A CE  1 
ATOM   350  N NZ  . LYS A 1 46  ? 4.602  68.629 -1.459  1.00 36.64  ? 46  LYS A NZ  1 
ATOM   351  N N   . PRO A 1 47  ? 11.671 67.527 -5.432  1.00 41.56  ? 47  PRO A N   1 
ATOM   352  C CA  . PRO A 1 47  ? 12.268 66.834 -6.570  1.00 42.48  ? 47  PRO A CA  1 
ATOM   353  C C   . PRO A 1 47  ? 11.230 66.229 -7.511  1.00 45.17  ? 47  PRO A C   1 
ATOM   354  O O   . PRO A 1 47  ? 10.107 65.901 -7.102  1.00 45.53  ? 47  PRO A O   1 
ATOM   355  C CB  . PRO A 1 47  ? 13.122 65.762 -5.909  1.00 42.01  ? 47  PRO A CB  1 
ATOM   356  C CG  . PRO A 1 47  ? 12.361 65.462 -4.669  1.00 44.80  ? 47  PRO A CG  1 
ATOM   357  C CD  . PRO A 1 47  ? 12.025 66.854 -4.176  1.00 43.06  ? 47  PRO A CD  1 
ATOM   358  N N   . VAL A 1 48  ? 11.623 66.092 -8.775  1.00 46.49  ? 48  VAL A N   1 
ATOM   359  C CA  . VAL A 1 48  ? 10.765 65.523 -9.804  1.00 46.79  ? 48  VAL A CA  1 
ATOM   360  C C   . VAL A 1 48  ? 11.525 64.352 -10.419 1.00 46.81  ? 48  VAL A C   1 
ATOM   361  O O   . VAL A 1 48  ? 12.653 64.512 -10.881 1.00 49.16  ? 48  VAL A O   1 
ATOM   362  C CB  . VAL A 1 48  ? 10.463 66.541 -10.917 1.00 46.57  ? 48  VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 48  ? 9.172  66.163 -11.625 1.00 47.72  ? 48  VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 48  ? 10.375 67.939 -10.336 1.00 47.02  ? 48  VAL A CG2 1 
ATOM   365  N N   . PRO A 1 49  ? 10.905 63.166 -10.448 1.00 44.50  ? 49  PRO A N   1 
ATOM   366  C CA  . PRO A 1 49  ? 11.518 61.964 -11.002 1.00 43.88  ? 49  PRO A CA  1 
ATOM   367  C C   . PRO A 1 49  ? 12.232 62.244 -12.302 1.00 45.08  ? 49  PRO A C   1 
ATOM   368  O O   . PRO A 1 49  ? 11.693 62.899 -13.187 1.00 44.42  ? 49  PRO A O   1 
ATOM   369  C CB  . PRO A 1 49  ? 10.330 61.037 -11.207 1.00 43.23  ? 49  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 49  ? 9.411  61.437 -10.134 1.00 43.18  ? 49  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 49  ? 9.476  62.937 -10.185 1.00 42.80  ? 49  PRO A CD  1 
ATOM   372  N N   . ALA A 1 50  ? 13.448 61.732 -12.414 1.00 47.83  ? 50  ALA A N   1 
ATOM   373  C CA  . ALA A 1 50  ? 14.247 61.908 -13.617 1.00 50.34  ? 50  ALA A CA  1 
ATOM   374  C C   . ALA A 1 50  ? 13.515 61.332 -14.815 1.00 52.27  ? 50  ALA A C   1 
ATOM   375  O O   . ALA A 1 50  ? 12.822 60.321 -14.691 1.00 53.92  ? 50  ALA A O   1 
ATOM   376  C CB  . ALA A 1 50  ? 15.586 61.208 -13.453 1.00 49.97  ? 50  ALA A CB  1 
ATOM   377  N N   . GLU A 1 51  ? 13.652 61.979 -15.970 1.00 54.83  ? 51  GLU A N   1 
ATOM   378  C CA  . GLU A 1 51  ? 13.019 61.478 -17.185 1.00 55.53  ? 51  GLU A CA  1 
ATOM   379  C C   . GLU A 1 51  ? 13.817 60.247 -17.600 1.00 56.66  ? 51  GLU A C   1 
ATOM   380  O O   . GLU A 1 51  ? 15.030 60.176 -17.387 1.00 56.64  ? 51  GLU A O   1 
ATOM   381  C CB  . GLU A 1 51  ? 13.048 62.534 -18.292 1.00 55.16  ? 51  GLU A CB  1 
ATOM   382  C CG  . GLU A 1 51  ? 12.181 63.757 -18.013 1.00 55.44  ? 51  GLU A CG  1 
ATOM   383  N N   . PRO A 1 52  ? 13.146 59.248 -18.179 1.00 57.61  ? 52  PRO A N   1 
ATOM   384  C CA  . PRO A 1 52  ? 13.821 58.019 -18.607 1.00 58.37  ? 52  PRO A CA  1 
ATOM   385  C C   . PRO A 1 52  ? 14.815 58.181 -19.744 1.00 59.95  ? 52  PRO A C   1 
ATOM   386  O O   . PRO A 1 52  ? 14.751 59.146 -20.505 1.00 59.81  ? 52  PRO A O   1 
ATOM   387  C CB  . PRO A 1 52  ? 12.663 57.101 -18.964 1.00 57.81  ? 52  PRO A CB  1 
ATOM   388  C CG  . PRO A 1 52  ? 11.592 58.063 -19.398 1.00 57.67  ? 52  PRO A CG  1 
ATOM   389  C CD  . PRO A 1 52  ? 11.692 59.150 -18.373 1.00 58.28  ? 52  PRO A CD  1 
ATOM   390  N N   . TRP A 1 53  ? 15.743 57.231 -19.847 1.00 63.08  ? 53  TRP A N   1 
ATOM   391  C CA  . TRP A 1 53  ? 16.756 57.269 -20.896 1.00 65.37  ? 53  TRP A CA  1 
ATOM   392  C C   . TRP A 1 53  ? 16.803 56.073 -21.828 1.00 67.63  ? 53  TRP A C   1 
ATOM   393  O O   . TRP A 1 53  ? 16.232 55.013 -21.567 1.00 66.64  ? 53  TRP A O   1 
ATOM   394  C CB  . TRP A 1 53  ? 18.150 57.506 -20.310 1.00 63.49  ? 53  TRP A CB  1 
ATOM   395  C CG  . TRP A 1 53  ? 18.486 56.628 -19.155 1.00 63.09  ? 53  TRP A CG  1 
ATOM   396  C CD1 . TRP A 1 53  ? 19.126 55.422 -19.187 1.00 61.85  ? 53  TRP A CD1 1 
ATOM   397  C CD2 . TRP A 1 53  ? 18.206 56.901 -17.783 1.00 61.40  ? 53  TRP A CD2 1 
ATOM   398  N NE1 . TRP A 1 53  ? 19.264 54.930 -17.914 1.00 60.33  ? 53  TRP A NE1 1 
ATOM   399  C CE2 . TRP A 1 53  ? 18.705 55.820 -17.034 1.00 60.58  ? 53  TRP A CE2 1 
ATOM   400  C CE3 . TRP A 1 53  ? 17.574 57.959 -17.113 1.00 61.70  ? 53  TRP A CE3 1 
ATOM   401  C CZ2 . TRP A 1 53  ? 18.599 55.766 -15.641 1.00 62.44  ? 53  TRP A CZ2 1 
ATOM   402  C CZ3 . TRP A 1 53  ? 17.466 57.907 -15.731 1.00 61.96  ? 53  TRP A CZ3 1 
ATOM   403  C CH2 . TRP A 1 53  ? 17.977 56.816 -15.009 1.00 61.62  ? 53  TRP A CH2 1 
ATOM   404  N N   . HIS A 1 54  ? 17.521 56.306 -22.921 1.00 71.94  ? 54  HIS A N   1 
ATOM   405  C CA  . HIS A 1 54  ? 17.751 55.408 -24.051 1.00 75.80  ? 54  HIS A CA  1 
ATOM   406  C C   . HIS A 1 54  ? 18.765 54.271 -23.833 1.00 76.53  ? 54  HIS A C   1 
ATOM   407  O O   . HIS A 1 54  ? 18.467 53.220 -23.249 1.00 76.00  ? 54  HIS A O   1 
ATOM   408  C CB  . HIS A 1 54  ? 18.254 56.278 -25.193 1.00 79.40  ? 54  HIS A CB  1 
ATOM   409  C CG  . HIS A 1 54  ? 19.276 57.281 -24.744 1.00 83.01  ? 54  HIS A CG  1 
ATOM   410  N ND1 . HIS A 1 54  ? 18.951 58.594 -24.460 1.00 83.87  ? 54  HIS A ND1 1 
ATOM   411  C CD2 . HIS A 1 54  ? 20.580 57.135 -24.417 1.00 83.95  ? 54  HIS A CD2 1 
ATOM   412  C CE1 . HIS A 1 54  ? 20.019 59.205 -23.976 1.00 86.02  ? 54  HIS A CE1 1 
ATOM   413  N NE2 . HIS A 1 54  ? 21.016 58.353 -23.936 1.00 85.81  ? 54  HIS A NE2 1 
ATOM   414  N N   . GLY A 1 55  ? 19.962 54.504 -24.365 1.00 75.80  ? 55  GLY A N   1 
ATOM   415  C CA  . GLY A 1 55  ? 21.040 53.551 -24.269 1.00 75.21  ? 55  GLY A CA  1 
ATOM   416  C C   . GLY A 1 55  ? 21.687 53.615 -22.910 1.00 74.36  ? 55  GLY A C   1 
ATOM   417  O O   . GLY A 1 55  ? 21.411 54.513 -22.114 1.00 73.92  ? 55  GLY A O   1 
ATOM   418  N N   . VAL A 1 56  ? 22.554 52.645 -22.652 1.00 73.33  ? 56  VAL A N   1 
ATOM   419  C CA  . VAL A 1 56  ? 23.252 52.555 -21.386 1.00 71.71  ? 56  VAL A CA  1 
ATOM   420  C C   . VAL A 1 56  ? 23.679 53.901 -20.849 1.00 69.93  ? 56  VAL A C   1 
ATOM   421  O O   . VAL A 1 56  ? 24.021 54.807 -21.603 1.00 69.85  ? 56  VAL A O   1 
ATOM   422  C CB  . VAL A 1 56  ? 24.492 51.659 -21.493 1.00 71.66  ? 56  VAL A CB  1 
ATOM   423  C CG1 . VAL A 1 56  ? 24.132 50.245 -21.101 1.00 70.94  ? 56  VAL A CG1 1 
ATOM   424  C CG2 . VAL A 1 56  ? 25.038 51.694 -22.912 1.00 73.02  ? 56  VAL A CG2 1 
ATOM   425  N N   . LEU A 1 57  ? 23.643 54.009 -19.528 1.00 67.96  ? 57  LEU A N   1 
ATOM   426  C CA  . LEU A 1 57  ? 24.026 55.218 -18.828 1.00 65.57  ? 57  LEU A CA  1 
ATOM   427  C C   . LEU A 1 57  ? 25.412 54.991 -18.232 1.00 64.65  ? 57  LEU A C   1 
ATOM   428  O O   . LEU A 1 57  ? 25.709 53.909 -17.707 1.00 64.63  ? 57  LEU A O   1 
ATOM   429  C CB  . LEU A 1 57  ? 23.019 55.498 -17.718 1.00 65.46  ? 57  LEU A CB  1 
ATOM   430  C CG  . LEU A 1 57  ? 22.998 56.881 -17.082 1.00 65.74  ? 57  LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 57  ? 21.855 56.916 -16.094 1.00 67.00  ? 57  LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 57  ? 24.314 57.189 -16.394 1.00 66.96  ? 57  LEU A CD2 1 
ATOM   433  N N   . ASP A 1 58  ? 26.265 56.005 -18.315 1.00 62.04  ? 58  ASP A N   1 
ATOM   434  C CA  . ASP A 1 58  ? 27.604 55.887 -17.767 1.00 59.78  ? 58  ASP A CA  1 
ATOM   435  C C   . ASP A 1 58  ? 27.509 55.979 -16.255 1.00 57.72  ? 58  ASP A C   1 
ATOM   436  O O   . ASP A 1 58  ? 27.430 57.068 -15.693 1.00 56.48  ? 58  ASP A O   1 
ATOM   437  C CB  . ASP A 1 58  ? 28.498 57.005 -18.294 1.00 62.02  ? 58  ASP A CB  1 
ATOM   438  C CG  . ASP A 1 58  ? 29.962 56.785 -17.964 1.00 63.94  ? 58  ASP A CG  1 
ATOM   439  O OD1 . ASP A 1 58  ? 30.315 55.657 -17.549 1.00 64.94  ? 58  ASP A OD1 1 
ATOM   440  O OD2 . ASP A 1 58  ? 30.756 57.740 -18.127 1.00 65.18  ? 58  ASP A OD2 1 
ATOM   441  N N   . ALA A 1 59  ? 27.506 54.831 -15.596 1.00 56.29  ? 59  ALA A N   1 
ATOM   442  C CA  . ALA A 1 59  ? 27.413 54.806 -14.145 1.00 56.91  ? 59  ALA A CA  1 
ATOM   443  C C   . ALA A 1 59  ? 28.720 54.338 -13.537 1.00 56.51  ? 59  ALA A C   1 
ATOM   444  O O   . ALA A 1 59  ? 28.750 53.428 -12.709 1.00 56.85  ? 59  ALA A O   1 
ATOM   445  C CB  . ALA A 1 59  ? 26.272 53.897 -13.701 1.00 55.57  ? 59  ALA A CB  1 
ATOM   446  N N   . THR A 1 60  ? 29.806 54.972 -13.947 1.00 56.49  ? 60  THR A N   1 
ATOM   447  C CA  . THR A 1 60  ? 31.113 54.606 -13.438 1.00 56.73  ? 60  THR A CA  1 
ATOM   448  C C   . THR A 1 60  ? 31.784 55.854 -12.916 1.00 57.27  ? 60  THR A C   1 
ATOM   449  O O   . THR A 1 60  ? 32.751 55.787 -12.167 1.00 58.59  ? 60  THR A O   1 
ATOM   450  C CB  . THR A 1 60  ? 31.955 53.984 -14.536 1.00 57.08  ? 60  THR A CB  1 
ATOM   451  O OG1 . THR A 1 60  ? 32.064 54.903 -15.634 1.00 57.10  ? 60  THR A OG1 1 
ATOM   452  C CG2 . THR A 1 60  ? 31.303 52.686 -15.024 1.00 56.93  ? 60  THR A CG2 1 
ATOM   453  N N   . GLY A 1 61  ? 31.257 56.999 -13.322 1.00 57.93  ? 61  GLY A N   1 
ATOM   454  C CA  . GLY A 1 61  ? 31.799 58.252 -12.854 1.00 58.75  ? 61  GLY A CA  1 
ATOM   455  C C   . GLY A 1 61  ? 31.023 58.645 -11.610 1.00 59.56  ? 61  GLY A C   1 
ATOM   456  O O   . GLY A 1 61  ? 29.818 58.387 -11.521 1.00 57.90  ? 61  GLY A O   1 
ATOM   457  N N   . LEU A 1 62  ? 31.707 59.248 -10.642 1.00 59.08  ? 62  LEU A N   1 
ATOM   458  C CA  . LEU A 1 62  ? 31.058 59.689 -9.416  1.00 59.14  ? 62  LEU A CA  1 
ATOM   459  C C   . LEU A 1 62  ? 30.217 60.915 -9.740  1.00 60.30  ? 62  LEU A C   1 
ATOM   460  O O   . LEU A 1 62  ? 30.676 61.827 -10.428 1.00 58.85  ? 62  LEU A O   1 
ATOM   461  C CB  . LEU A 1 62  ? 32.098 60.045 -8.356  1.00 57.10  ? 62  LEU A CB  1 
ATOM   462  C CG  . LEU A 1 62  ? 33.059 58.921 -7.973  1.00 57.74  ? 62  LEU A CG  1 
ATOM   463  C CD1 . LEU A 1 62  ? 34.087 59.423 -6.974  1.00 54.95  ? 62  LEU A CD1 1 
ATOM   464  C CD2 . LEU A 1 62  ? 32.267 57.758 -7.396  1.00 59.85  ? 62  LEU A CD2 1 
ATOM   465  N N   . SER A 1 63  ? 28.981 60.927 -9.251  1.00 62.81  ? 63  SER A N   1 
ATOM   466  C CA  . SER A 1 63  ? 28.080 62.046 -9.495  1.00 64.70  ? 63  SER A CA  1 
ATOM   467  C C   . SER A 1 63  ? 28.671 63.306 -8.896  1.00 66.00  ? 63  SER A C   1 
ATOM   468  O O   . SER A 1 63  ? 29.709 63.264 -8.233  1.00 66.34  ? 63  SER A O   1 
ATOM   469  C CB  . SER A 1 63  ? 26.705 61.784 -8.870  1.00 65.83  ? 63  SER A CB  1 
ATOM   470  O OG  . SER A 1 63  ? 26.780 61.618 -7.461  1.00 68.75  ? 63  SER A OG  1 
ATOM   471  N N   . ALA A 1 64  ? 28.001 64.427 -9.130  1.00 66.64  ? 64  ALA A N   1 
ATOM   472  C CA  . ALA A 1 64  ? 28.456 65.708 -8.616  1.00 67.63  ? 64  ALA A CA  1 
ATOM   473  C C   . ALA A 1 64  ? 27.922 65.893 -7.211  1.00 68.32  ? 64  ALA A C   1 
ATOM   474  O O   . ALA A 1 64  ? 26.843 65.398 -6.892  1.00 68.28  ? 64  ALA A O   1 
ATOM   475  C CB  . ALA A 1 64  ? 27.952 66.834 -9.511  1.00 67.96  ? 64  ALA A CB  1 
ATOM   476  N N   . THR A 1 65  ? 28.673 66.598 -6.369  1.00 68.66  ? 65  THR A N   1 
ATOM   477  C CA  . THR A 1 65  ? 28.218 66.850 -5.005  1.00 68.64  ? 65  THR A CA  1 
ATOM   478  C C   . THR A 1 65  ? 27.350 68.102 -5.021  1.00 67.45  ? 65  THR A C   1 
ATOM   479  O O   . THR A 1 65  ? 27.640 69.055 -5.739  1.00 66.82  ? 65  THR A O   1 
ATOM   480  C CB  . THR A 1 65  ? 29.393 67.068 -4.043  1.00 70.00  ? 65  THR A CB  1 
ATOM   481  O OG1 . THR A 1 65  ? 30.138 68.215 -4.460  1.00 73.02  ? 65  THR A OG1 1 
ATOM   482  C CG2 . THR A 1 65  ? 30.310 65.847 -4.028  1.00 70.12  ? 65  THR A CG2 1 
ATOM   483  N N   . CYS A 1 66  ? 26.277 68.097 -4.240  1.00 66.96  ? 66  CYS A N   1 
ATOM   484  C CA  . CYS A 1 66  ? 25.382 69.241 -4.200  1.00 67.24  ? 66  CYS A CA  1 
ATOM   485  C C   . CYS A 1 66  ? 26.143 70.477 -3.767  1.00 68.86  ? 66  CYS A C   1 
ATOM   486  O O   . CYS A 1 66  ? 27.256 70.370 -3.255  1.00 69.06  ? 66  CYS A O   1 
ATOM   487  C CB  . CYS A 1 66  ? 24.221 68.956 -3.258  1.00 65.42  ? 66  CYS A CB  1 
ATOM   488  S SG  . CYS A 1 66  ? 23.304 67.463 -3.761  1.00 62.19  ? 66  CYS A SG  1 
ATOM   489  N N   . VAL A 1 67  ? 25.543 71.647 -3.969  1.00 70.98  ? 67  VAL A N   1 
ATOM   490  C CA  . VAL A 1 67  ? 26.197 72.912 -3.634  1.00 73.00  ? 67  VAL A CA  1 
ATOM   491  C C   . VAL A 1 67  ? 26.468 73.150 -2.149  1.00 74.65  ? 67  VAL A C   1 
ATOM   492  O O   . VAL A 1 67  ? 25.554 73.442 -1.381  1.00 76.30  ? 67  VAL A O   1 
ATOM   493  C CB  . VAL A 1 67  ? 25.390 74.105 -4.166  1.00 72.38  ? 67  VAL A CB  1 
ATOM   494  C CG1 . VAL A 1 67  ? 26.207 75.377 -4.012  1.00 72.90  ? 67  VAL A CG1 1 
ATOM   495  C CG2 . VAL A 1 67  ? 25.000 73.872 -5.618  1.00 70.09  ? 67  VAL A CG2 1 
ATOM   496  N N   . GLN A 1 68  ? 27.735 73.028 -1.760  1.00 75.70  ? 68  GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? 28.168 73.232 -0.379  1.00 76.78  ? 68  GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? 29.442 74.073 -0.427  1.00 78.49  ? 68  GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? 29.760 74.593 -1.496  1.00 79.61  ? 68  GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? 28.409 71.886 0.309   1.00 75.47  ? 68  GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? 29.362 70.965 -0.407  1.00 73.72  ? 68  GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? 29.275 69.551 0.117   1.00 73.18  ? 68  GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? 30.134 69.110 0.878   1.00 73.42  ? 68  GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? 28.240 68.826 -0.294  1.00 73.14  ? 68  GLN A NE2 1 
ATOM   505  N N   . GLU A 1 69  ? 30.188 74.189 0.678   1.00 79.35  ? 69  GLU A N   1 
ATOM   506  C CA  . GLU A 1 69  ? 31.373 75.064 0.683   1.00 80.06  ? 69  GLU A CA  1 
ATOM   507  C C   . GLU A 1 69  ? 32.798 74.557 0.885   1.00 80.32  ? 69  GLU A C   1 
ATOM   508  O O   . GLU A 1 69  ? 33.707 75.009 0.184   1.00 79.53  ? 69  GLU A O   1 
ATOM   509  C CB  . GLU A 1 69  ? 31.139 76.188 1.679   1.00 79.90  ? 69  GLU A CB  1 
ATOM   510  C CG  . GLU A 1 69  ? 29.764 76.793 1.559   1.00 81.67  ? 69  GLU A CG  1 
ATOM   511  C CD  . GLU A 1 69  ? 29.528 77.439 0.213   1.00 83.92  ? 69  GLU A CD  1 
ATOM   512  O OE1 . GLU A 1 69  ? 29.826 76.824 -0.825  1.00 87.53  ? 69  GLU A OE1 1 
ATOM   513  O OE2 . GLU A 1 69  ? 29.028 78.573 0.180   1.00 86.06  ? 69  GLU A OE2 1 
ATOM   514  N N   . ARG A 1 70  ? 33.001 73.666 1.851   1.00 81.43  ? 70  ARG A N   1 
ATOM   515  C CA  . ARG A 1 70  ? 34.327 73.111 2.149   1.00 83.16  ? 70  ARG A CA  1 
ATOM   516  C C   . ARG A 1 70  ? 35.023 73.899 3.272   1.00 83.22  ? 70  ARG A C   1 
ATOM   517  O O   . ARG A 1 70  ? 35.278 75.106 3.164   1.00 82.09  ? 70  ARG A O   1 
ATOM   518  C CB  . ARG A 1 70  ? 35.216 73.099 0.889   1.00 84.64  ? 70  ARG A CB  1 
ATOM   519  C CG  . ARG A 1 70  ? 36.514 72.308 1.004   1.00 85.45  ? 70  ARG A CG  1 
ATOM   520  C CD  . ARG A 1 70  ? 37.511 72.707 -0.086  1.00 87.60  ? 70  ARG A CD  1 
ATOM   521  N NE  . ARG A 1 70  ? 37.526 71.833 -1.262  1.00 88.72  ? 70  ARG A NE  1 
ATOM   522  C CZ  . ARG A 1 70  ? 38.035 70.603 -1.282  1.00 88.57  ? 70  ARG A CZ  1 
ATOM   523  N NH1 . ARG A 1 70  ? 38.565 70.091 -0.185  1.00 88.07  ? 70  ARG A NH1 1 
ATOM   524  N NH2 . ARG A 1 70  ? 38.037 69.894 -2.404  1.00 89.33  ? 70  ARG A NH2 1 
ATOM   525  N N   . TYR A 1 71  ? 35.318 73.186 4.352   1.00 83.20  ? 71  TYR A N   1 
ATOM   526  C CA  . TYR A 1 71  ? 35.979 73.750 5.520   1.00 82.57  ? 71  TYR A CA  1 
ATOM   527  C C   . TYR A 1 71  ? 37.488 73.595 5.390   1.00 80.59  ? 71  TYR A C   1 
ATOM   528  O O   . TYR A 1 71  ? 37.993 72.478 5.444   1.00 79.10  ? 71  TYR A O   1 
ATOM   529  C CB  . TYR A 1 71  ? 35.509 73.013 6.772   1.00 84.49  ? 71  TYR A CB  1 
ATOM   530  C CG  . TYR A 1 71  ? 34.020 73.082 7.012   1.00 85.65  ? 71  TYR A CG  1 
ATOM   531  C CD1 . TYR A 1 71  ? 33.359 74.309 7.064   1.00 87.32  ? 71  TYR A CD1 1 
ATOM   532  C CD2 . TYR A 1 71  ? 33.281 71.926 7.235   1.00 85.23  ? 71  TYR A CD2 1 
ATOM   533  C CE1 . TYR A 1 71  ? 32.000 74.383 7.339   1.00 87.83  ? 71  TYR A CE1 1 
ATOM   534  C CE2 . TYR A 1 71  ? 31.923 71.990 7.510   1.00 87.08  ? 71  TYR A CE2 1 
ATOM   535  C CZ  . TYR A 1 71  ? 31.289 73.222 7.564   1.00 87.26  ? 71  TYR A CZ  1 
ATOM   536  O OH  . TYR A 1 71  ? 29.950 73.295 7.869   1.00 87.88  ? 71  TYR A OH  1 
ATOM   537  N N   . GLU A 1 72  ? 38.198 74.708 5.227   1.00 79.49  ? 72  GLU A N   1 
ATOM   538  C CA  . GLU A 1 72  ? 39.653 74.675 5.081   1.00 78.78  ? 72  GLU A CA  1 
ATOM   539  C C   . GLU A 1 72  ? 40.366 75.182 6.340   1.00 78.45  ? 72  GLU A C   1 
ATOM   540  O O   . GLU A 1 72  ? 41.491 75.684 6.278   1.00 76.71  ? 72  GLU A O   1 
ATOM   541  C CB  . GLU A 1 72  ? 40.082 75.512 3.867   1.00 78.36  ? 72  GLU A CB  1 
ATOM   542  C CG  . GLU A 1 72  ? 41.036 74.794 2.916   1.00 76.38  ? 72  GLU A CG  1 
ATOM   543  C CD  . GLU A 1 72  ? 40.337 73.750 2.060   1.00 74.49  ? 72  GLU A CD  1 
ATOM   544  O OE1 . GLU A 1 72  ? 39.444 74.132 1.276   1.00 73.62  ? 72  GLU A OE1 1 
ATOM   545  O OE2 . GLU A 1 72  ? 40.680 72.554 2.167   1.00 72.48  ? 72  GLU A OE2 1 
ATOM   546  N N   . TYR A 1 73  ? 39.706 75.025 7.484   1.00 78.24  ? 73  TYR A N   1 
ATOM   547  C CA  . TYR A 1 73  ? 40.257 75.457 8.761   1.00 78.41  ? 73  TYR A CA  1 
ATOM   548  C C   . TYR A 1 73  ? 41.631 74.851 9.039   1.00 78.38  ? 73  TYR A C   1 
ATOM   549  O O   . TYR A 1 73  ? 42.223 75.100 10.087  1.00 78.52  ? 73  TYR A O   1 
ATOM   550  C CB  . TYR A 1 73  ? 39.279 75.118 9.896   1.00 76.77  ? 73  TYR A CB  1 
ATOM   551  C CG  . TYR A 1 73  ? 38.079 76.048 9.964   1.00 77.27  ? 73  TYR A CG  1 
ATOM   552  C CD1 . TYR A 1 73  ? 37.223 76.205 8.873   1.00 77.65  ? 73  TYR A CD1 1 
ATOM   553  C CD2 . TYR A 1 73  ? 37.805 76.781 11.117  1.00 77.53  ? 73  TYR A CD2 1 
ATOM   554  C CE1 . TYR A 1 73  ? 36.121 77.075 8.933   1.00 77.60  ? 73  TYR A CE1 1 
ATOM   555  C CE2 . TYR A 1 73  ? 36.704 77.654 11.185  1.00 77.53  ? 73  TYR A CE2 1 
ATOM   556  C CZ  . TYR A 1 73  ? 35.871 77.793 10.093  1.00 76.29  ? 73  TYR A CZ  1 
ATOM   557  O OH  . TYR A 1 73  ? 34.797 78.649 10.162  1.00 74.55  ? 73  TYR A OH  1 
ATOM   558  N N   . PHE A 1 74  ? 42.125 74.061 8.091   1.00 78.50  ? 74  PHE A N   1 
ATOM   559  C CA  . PHE A 1 74  ? 43.435 73.410 8.179   1.00 80.26  ? 74  PHE A CA  1 
ATOM   560  C C   . PHE A 1 74  ? 43.883 73.050 6.769   1.00 82.43  ? 74  PHE A C   1 
ATOM   561  O O   . PHE A 1 74  ? 43.804 71.883 6.375   1.00 82.43  ? 74  PHE A O   1 
ATOM   562  C CB  . PHE A 1 74  ? 43.370 72.111 8.999   1.00 78.96  ? 74  PHE A CB  1 
ATOM   563  C CG  . PHE A 1 74  ? 43.157 72.325 10.462  1.00 77.92  ? 74  PHE A CG  1 
ATOM   564  C CD1 . PHE A 1 74  ? 44.181 72.821 11.253  1.00 77.07  ? 74  PHE A CD1 1 
ATOM   565  C CD2 . PHE A 1 74  ? 41.918 72.070 11.048  1.00 77.28  ? 74  PHE A CD2 1 
ATOM   566  C CE1 . PHE A 1 74  ? 43.974 73.066 12.606  1.00 77.25  ? 74  PHE A CE1 1 
ATOM   567  C CE2 . PHE A 1 74  ? 41.704 72.311 12.404  1.00 75.31  ? 74  PHE A CE2 1 
ATOM   568  C CZ  . PHE A 1 74  ? 42.731 72.810 13.183  1.00 75.00  ? 74  PHE A CZ  1 
ATOM   569  N N   . PRO A 1 75  ? 44.364 74.035 5.989   1.00 84.14  ? 75  PRO A N   1 
ATOM   570  C CA  . PRO A 1 75  ? 44.794 73.708 4.627   1.00 85.52  ? 75  PRO A CA  1 
ATOM   571  C C   . PRO A 1 75  ? 45.597 72.412 4.550   1.00 86.89  ? 75  PRO A C   1 
ATOM   572  O O   . PRO A 1 75  ? 46.486 72.172 5.368   1.00 87.55  ? 75  PRO A O   1 
ATOM   573  C CB  . PRO A 1 75  ? 45.624 74.922 4.228   1.00 84.51  ? 75  PRO A CB  1 
ATOM   574  C CG  . PRO A 1 75  ? 44.938 76.027 4.938   1.00 85.06  ? 75  PRO A CG  1 
ATOM   575  C CD  . PRO A 1 75  ? 44.693 75.434 6.312   1.00 84.98  ? 75  PRO A CD  1 
ATOM   576  N N   . GLY A 1 76  ? 45.257 71.571 3.579   1.00 87.42  ? 76  GLY A N   1 
ATOM   577  C CA  . GLY A 1 76  ? 45.976 70.324 3.390   1.00 88.00  ? 76  GLY A CA  1 
ATOM   578  C C   . GLY A 1 76  ? 45.751 69.191 4.373   1.00 88.54  ? 76  GLY A C   1 
ATOM   579  O O   . GLY A 1 76  ? 45.831 68.029 3.982   1.00 89.46  ? 76  GLY A O   1 
ATOM   580  N N   . PHE A 1 77  ? 45.496 69.508 5.639   1.00 88.74  ? 77  PHE A N   1 
ATOM   581  C CA  . PHE A 1 77  ? 45.263 68.479 6.648   1.00 88.31  ? 77  PHE A CA  1 
ATOM   582  C C   . PHE A 1 77  ? 44.645 67.263 5.961   1.00 88.52  ? 77  PHE A C   1 
ATOM   583  O O   . PHE A 1 77  ? 43.544 67.346 5.418   1.00 87.58  ? 77  PHE A O   1 
ATOM   584  C CB  . PHE A 1 77  ? 44.310 69.015 7.730   1.00 88.24  ? 77  PHE A CB  1 
ATOM   585  C CG  . PHE A 1 77  ? 44.116 68.088 8.911   1.00 87.68  ? 77  PHE A CG  1 
ATOM   586  C CD1 . PHE A 1 77  ? 44.847 66.908 9.036   1.00 87.24  ? 77  PHE A CD1 1 
ATOM   587  C CD2 . PHE A 1 77  ? 43.189 68.399 9.903   1.00 88.40  ? 77  PHE A CD2 1 
ATOM   588  C CE1 . PHE A 1 77  ? 44.658 66.054 10.128  1.00 86.58  ? 77  PHE A CE1 1 
ATOM   589  C CE2 . PHE A 1 77  ? 42.994 67.548 11.001  1.00 89.13  ? 77  PHE A CE2 1 
ATOM   590  C CZ  . PHE A 1 77  ? 43.729 66.375 11.109  1.00 86.74  ? 77  PHE A CZ  1 
ATOM   591  N N   . SER A 1 78  ? 45.372 66.149 5.956   1.00 89.35  ? 78  SER A N   1 
ATOM   592  C CA  . SER A 1 78  ? 44.878 64.919 5.339   1.00 90.53  ? 78  SER A CA  1 
ATOM   593  C C   . SER A 1 78  ? 43.697 64.367 6.143   1.00 90.73  ? 78  SER A C   1 
ATOM   594  O O   . SER A 1 78  ? 43.082 63.369 5.761   1.00 90.77  ? 78  SER A O   1 
ATOM   595  C CB  . SER A 1 78  ? 45.992 63.865 5.263   1.00 91.49  ? 78  SER A CB  1 
ATOM   596  O OG  . SER A 1 78  ? 46.370 63.404 6.551   1.00 91.61  ? 78  SER A OG  1 
ATOM   597  N N   . GLY A 1 79  ? 43.406 65.023 7.267   1.00 90.61  ? 79  GLY A N   1 
ATOM   598  C CA  . GLY A 1 79  ? 42.295 64.638 8.123   1.00 90.37  ? 79  GLY A CA  1 
ATOM   599  C C   . GLY A 1 79  ? 41.067 65.377 7.620   1.00 90.24  ? 79  GLY A C   1 
ATOM   600  O O   . GLY A 1 79  ? 40.143 64.763 7.092   1.00 91.59  ? 79  GLY A O   1 
ATOM   601  N N   . GLU A 1 80  ? 41.042 66.695 7.796   1.00 88.57  ? 80  GLU A N   1 
ATOM   602  C CA  . GLU A 1 80  ? 39.939 67.479 7.270   1.00 85.89  ? 80  GLU A CA  1 
ATOM   603  C C   . GLU A 1 80  ? 40.131 67.221 5.789   1.00 86.09  ? 80  GLU A C   1 
ATOM   604  O O   . GLU A 1 80  ? 41.218 66.829 5.376   1.00 85.46  ? 80  GLU A O   1 
ATOM   605  C CB  . GLU A 1 80  ? 40.135 68.961 7.553   1.00 84.63  ? 80  GLU A CB  1 
ATOM   606  C CG  . GLU A 1 80  ? 39.273 69.862 6.697   1.00 82.41  ? 80  GLU A CG  1 
ATOM   607  C CD  . GLU A 1 80  ? 39.780 71.282 6.682   1.00 81.76  ? 80  GLU A CD  1 
ATOM   608  O OE1 . GLU A 1 80  ? 39.673 71.977 7.714   1.00 80.51  ? 80  GLU A OE1 1 
ATOM   609  O OE2 . GLU A 1 80  ? 40.296 71.701 5.630   1.00 81.69  ? 80  GLU A OE2 1 
ATOM   610  N N   . GLU A 1 81  ? 39.091 67.441 4.999   1.00 86.84  ? 81  GLU A N   1 
ATOM   611  C CA  . GLU A 1 81  ? 39.131 67.212 3.558   1.00 87.13  ? 81  GLU A CA  1 
ATOM   612  C C   . GLU A 1 81  ? 38.290 66.002 3.224   1.00 85.68  ? 81  GLU A C   1 
ATOM   613  O O   . GLU A 1 81  ? 37.446 66.055 2.328   1.00 85.35  ? 81  GLU A O   1 
ATOM   614  C CB  . GLU A 1 81  ? 40.559 66.999 3.041   1.00 89.58  ? 81  GLU A CB  1 
ATOM   615  C CG  . GLU A 1 81  ? 41.227 68.272 2.560   1.00 90.67  ? 81  GLU A CG  1 
ATOM   616  C CD  . GLU A 1 81  ? 40.297 69.086 1.692   1.00 91.79  ? 81  GLU A CD  1 
ATOM   617  O OE1 . GLU A 1 81  ? 39.429 69.792 2.253   1.00 92.56  ? 81  GLU A OE1 1 
ATOM   618  O OE2 . GLU A 1 81  ? 40.422 68.999 0.453   1.00 91.70  ? 81  GLU A OE2 1 
ATOM   619  N N   . ILE A 1 82  ? 38.514 64.913 3.952   1.00 83.74  ? 82  ILE A N   1 
ATOM   620  C CA  . ILE A 1 82  ? 37.757 63.701 3.710   1.00 83.07  ? 82  ILE A CA  1 
ATOM   621  C C   . ILE A 1 82  ? 36.262 63.930 3.941   1.00 82.97  ? 82  ILE A C   1 
ATOM   622  O O   . ILE A 1 82  ? 35.467 62.993 3.908   1.00 83.88  ? 82  ILE A O   1 
ATOM   623  C CB  . ILE A 1 82  ? 38.266 62.524 4.585   1.00 82.44  ? 82  ILE A CB  1 
ATOM   624  C CG1 . ILE A 1 82  ? 38.273 62.913 6.061   1.00 81.57  ? 82  ILE A CG1 1 
ATOM   625  C CG2 . ILE A 1 82  ? 39.653 62.102 4.118   1.00 80.89  ? 82  ILE A CG2 1 
ATOM   626  C CD1 . ILE A 1 82  ? 38.764 61.807 6.985   1.00 80.55  ? 82  ILE A CD1 1 
ATOM   627  N N   . TRP A 1 83  ? 35.891 65.188 4.162   1.00 82.12  ? 83  TRP A N   1 
ATOM   628  C CA  . TRP A 1 83  ? 34.500 65.574 4.370   1.00 81.88  ? 83  TRP A CA  1 
ATOM   629  C C   . TRP A 1 83  ? 34.177 66.719 3.424   1.00 81.24  ? 83  TRP A C   1 
ATOM   630  O O   . TRP A 1 83  ? 33.095 67.304 3.477   1.00 81.98  ? 83  TRP A O   1 
ATOM   631  C CB  . TRP A 1 83  ? 34.268 66.026 5.819   1.00 82.60  ? 83  TRP A CB  1 
ATOM   632  C CG  . TRP A 1 83  ? 33.864 64.916 6.742   1.00 83.06  ? 83  TRP A CG  1 
ATOM   633  C CD1 . TRP A 1 83  ? 32.653 64.278 6.783   1.00 83.30  ? 83  TRP A CD1 1 
ATOM   634  C CD2 . TRP A 1 83  ? 34.679 64.290 7.735   1.00 83.42  ? 83  TRP A CD2 1 
ATOM   635  N NE1 . TRP A 1 83  ? 32.669 63.291 7.740   1.00 82.72  ? 83  TRP A NE1 1 
ATOM   636  C CE2 . TRP A 1 83  ? 33.902 63.276 8.338   1.00 83.80  ? 83  TRP A CE2 1 
ATOM   637  C CE3 . TRP A 1 83  ? 35.995 64.482 8.172   1.00 83.99  ? 83  TRP A CE3 1 
ATOM   638  C CZ2 . TRP A 1 83  ? 34.400 62.458 9.361   1.00 83.90  ? 83  TRP A CZ2 1 
ATOM   639  C CZ3 . TRP A 1 83  ? 36.490 63.667 9.190   1.00 83.56  ? 83  TRP A CZ3 1 
ATOM   640  C CH2 . TRP A 1 83  ? 35.693 62.669 9.770   1.00 83.55  ? 83  TRP A CH2 1 
ATOM   641  N N   . ASN A 1 84  ? 35.125 67.024 2.547   1.00 80.18  ? 84  ASN A N   1 
ATOM   642  C CA  . ASN A 1 84  ? 34.966 68.113 1.593   1.00 78.82  ? 84  ASN A CA  1 
ATOM   643  C C   . ASN A 1 84  ? 34.642 67.610 0.179   1.00 77.99  ? 84  ASN A C   1 
ATOM   644  O O   . ASN A 1 84  ? 35.017 66.494 -0.187  1.00 76.92  ? 84  ASN A O   1 
ATOM   645  C CB  . ASN A 1 84  ? 36.249 68.945 1.593   1.00 78.01  ? 84  ASN A CB  1 
ATOM   646  C CG  . ASN A 1 84  ? 36.547 69.546 2.951   1.00 77.69  ? 84  ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 84  ? 36.333 70.733 3.178   1.00 77.57  ? 84  ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 84  ? 37.023 68.722 3.867   1.00 78.40  ? 84  ASN A ND2 1 
ATOM   649  N N   . PRO A 1 85  ? 33.936 68.430 -0.628  1.00 76.89  ? 85  PRO A N   1 
ATOM   650  C CA  . PRO A 1 85  ? 33.564 68.069 -1.996  1.00 76.70  ? 85  PRO A CA  1 
ATOM   651  C C   . PRO A 1 85  ? 34.623 67.251 -2.713  1.00 77.18  ? 85  PRO A C   1 
ATOM   652  O O   . PRO A 1 85  ? 35.546 67.794 -3.322  1.00 77.99  ? 85  PRO A O   1 
ATOM   653  C CB  . PRO A 1 85  ? 33.326 69.420 -2.648  1.00 76.00  ? 85  PRO A CB  1 
ATOM   654  C CG  . PRO A 1 85  ? 32.655 70.155 -1.554  1.00 75.95  ? 85  PRO A CG  1 
ATOM   655  C CD  . PRO A 1 85  ? 33.508 69.810 -0.337  1.00 76.85  ? 85  PRO A CD  1 
ATOM   656  N N   . ASN A 1 86  ? 34.467 65.935 -2.614  1.00 77.11  ? 86  ASN A N   1 
ATOM   657  C CA  . ASN A 1 86  ? 35.348 64.957 -3.233  1.00 75.22  ? 86  ASN A CA  1 
ATOM   658  C C   . ASN A 1 86  ? 35.164 64.982 -4.741  1.00 74.01  ? 86  ASN A C   1 
ATOM   659  O O   . ASN A 1 86  ? 35.907 64.348 -5.478  1.00 74.95  ? 86  ASN A O   1 
ATOM   660  C CB  . ASN A 1 86  ? 35.027 63.571 -2.661  1.00 77.41  ? 86  ASN A CB  1 
ATOM   661  C CG  . ASN A 1 86  ? 35.718 62.448 -3.399  1.00 79.10  ? 86  ASN A CG  1 
ATOM   662  O OD1 . ASN A 1 86  ? 35.264 62.024 -4.460  1.00 80.58  ? 86  ASN A OD1 1 
ATOM   663  N ND2 . ASN A 1 86  ? 36.821 61.955 -2.840  1.00 80.07  ? 86  ASN A ND2 1 
ATOM   664  N N   . THR A 1 87  ? 34.170 65.733 -5.197  1.00 71.85  ? 87  THR A N   1 
ATOM   665  C CA  . THR A 1 87  ? 33.907 65.855 -6.620  1.00 70.14  ? 87  THR A CA  1 
ATOM   666  C C   . THR A 1 87  ? 33.516 67.294 -6.930  1.00 69.29  ? 87  THR A C   1 
ATOM   667  O O   . THR A 1 87  ? 33.478 68.133 -6.023  1.00 69.00  ? 87  THR A O   1 
ATOM   668  C CB  . THR A 1 87  ? 32.790 64.906 -7.040  1.00 70.65  ? 87  THR A CB  1 
ATOM   669  O OG1 . THR A 1 87  ? 33.096 63.585 -6.580  1.00 70.30  ? 87  THR A OG1 1 
ATOM   670  C CG2 . THR A 1 87  ? 32.651 64.882 -8.549  1.00 72.86  ? 87  THR A CG2 1 
ATOM   671  N N   . ASN A 1 88  ? 33.246 67.588 -8.204  1.00 69.19  ? 88  ASN A N   1 
ATOM   672  C CA  . ASN A 1 88  ? 32.863 68.939 -8.594  1.00 67.25  ? 88  ASN A CA  1 
ATOM   673  C C   . ASN A 1 88  ? 31.461 69.178 -8.013  1.00 64.28  ? 88  ASN A C   1 
ATOM   674  O O   . ASN A 1 88  ? 30.652 68.247 -7.970  1.00 63.61  ? 88  ASN A O   1 
ATOM   675  C CB  . ASN A 1 88  ? 32.790 69.081 -10.129 1.00 70.11  ? 88  ASN A CB  1 
ATOM   676  C CG  . ASN A 1 88  ? 34.122 68.759 -10.885 1.00 72.49  ? 88  ASN A CG  1 
ATOM   677  O OD1 . ASN A 1 88  ? 35.241 68.823 -10.373 1.00 70.81  ? 88  ASN A OD1 1 
ATOM   678  N ND2 . ASN A 1 88  ? 33.918 68.469 -12.170 1.00 75.57  ? 88  ASN A ND2 1 
ATOM   679  N N   . VAL A 1 89  ? 31.174 70.403 -7.556  1.00 61.33  ? 89  VAL A N   1 
ATOM   680  C CA  . VAL A 1 89  ? 29.847 70.714 -7.010  1.00 59.35  ? 89  VAL A CA  1 
ATOM   681  C C   . VAL A 1 89  ? 29.034 71.427 -8.081  1.00 57.36  ? 89  VAL A C   1 
ATOM   682  O O   . VAL A 1 89  ? 29.578 72.211 -8.843  1.00 58.51  ? 89  VAL A O   1 
ATOM   683  C CB  . VAL A 1 89  ? 29.902 71.647 -5.760  1.00 58.89  ? 89  VAL A CB  1 
ATOM   684  C CG1 . VAL A 1 89  ? 31.053 71.251 -4.856  1.00 57.87  ? 89  VAL A CG1 1 
ATOM   685  C CG2 . VAL A 1 89  ? 29.993 73.110 -6.189  1.00 57.66  ? 89  VAL A CG2 1 
ATOM   686  N N   . SER A 1 90  ? 27.733 71.171 -8.111  1.00 54.65  ? 90  SER A N   1 
ATOM   687  C CA  . SER A 1 90  ? 26.841 71.767 -9.093  1.00 51.90  ? 90  SER A CA  1 
ATOM   688  C C   . SER A 1 90  ? 25.415 71.571 -8.618  1.00 52.58  ? 90  SER A C   1 
ATOM   689  O O   . SER A 1 90  ? 25.095 70.535 -8.035  1.00 53.25  ? 90  SER A O   1 
ATOM   690  C CB  . SER A 1 90  ? 27.024 71.071 -10.437 1.00 51.25  ? 90  SER A CB  1 
ATOM   691  O OG  . SER A 1 90  ? 25.773 70.748 -11.022 1.00 52.79  ? 90  SER A OG  1 
ATOM   692  N N   . GLU A 1 91  ? 24.549 72.546 -8.854  1.00 52.55  ? 91  GLU A N   1 
ATOM   693  C CA  . GLU A 1 91  ? 23.173 72.397 -8.414  1.00 52.62  ? 91  GLU A CA  1 
ATOM   694  C C   . GLU A 1 91  ? 22.689 71.014 -8.813  1.00 51.70  ? 91  GLU A C   1 
ATOM   695  O O   . GLU A 1 91  ? 22.054 70.319 -8.020  1.00 51.58  ? 91  GLU A O   1 
ATOM   696  C CB  . GLU A 1 91  ? 22.292 73.466 -9.044  1.00 55.65  ? 91  GLU A CB  1 
ATOM   697  C CG  . GLU A 1 91  ? 22.102 74.702 -8.191  1.00 61.39  ? 91  GLU A CG  1 
ATOM   698  C CD  . GLU A 1 91  ? 20.866 74.606 -7.313  1.00 66.84  ? 91  GLU A CD  1 
ATOM   699  O OE1 . GLU A 1 91  ? 20.883 73.852 -6.309  1.00 68.90  ? 91  GLU A OE1 1 
ATOM   700  O OE2 . GLU A 1 91  ? 19.865 75.282 -7.642  1.00 68.99  ? 91  GLU A OE2 1 
ATOM   701  N N   . ASP A 1 92  ? 23.009 70.615 -10.040 1.00 50.94  ? 92  ASP A N   1 
ATOM   702  C CA  . ASP A 1 92  ? 22.622 69.302 -10.548 1.00 51.71  ? 92  ASP A CA  1 
ATOM   703  C C   . ASP A 1 92  ? 23.430 68.226 -9.833  1.00 50.83  ? 92  ASP A C   1 
ATOM   704  O O   . ASP A 1 92  ? 24.551 67.905 -10.248 1.00 49.91  ? 92  ASP A O   1 
ATOM   705  C CB  . ASP A 1 92  ? 22.900 69.209 -12.041 1.00 53.79  ? 92  ASP A CB  1 
ATOM   706  C CG  . ASP A 1 92  ? 22.601 67.835 -12.594 1.00 54.78  ? 92  ASP A CG  1 
ATOM   707  O OD1 . ASP A 1 92  ? 22.416 66.903 -11.776 1.00 53.87  ? 92  ASP A OD1 1 
ATOM   708  O OD2 . ASP A 1 92  ? 22.555 67.692 -13.837 1.00 54.07  ? 92  ASP A OD2 1 
ATOM   709  N N   . CYS A 1 93  ? 22.846 67.650 -8.783  1.00 50.21  ? 93  CYS A N   1 
ATOM   710  C CA  . CYS A 1 93  ? 23.539 66.645 -7.982  1.00 48.37  ? 93  CYS A CA  1 
ATOM   711  C C   . CYS A 1 93  ? 22.697 65.431 -7.604  1.00 46.33  ? 93  CYS A C   1 
ATOM   712  O O   . CYS A 1 93  ? 23.190 64.539 -6.914  1.00 48.05  ? 93  CYS A O   1 
ATOM   713  C CB  . CYS A 1 93  ? 24.053 67.299 -6.701  1.00 48.14  ? 93  CYS A CB  1 
ATOM   714  S SG  . CYS A 1 93  ? 22.695 67.908 -5.648  1.00 53.48  ? 93  CYS A SG  1 
ATOM   715  N N   . LEU A 1 94  ? 21.443 65.379 -8.039  1.00 42.32  ? 94  LEU A N   1 
ATOM   716  C CA  . LEU A 1 94  ? 20.593 64.251 -7.684  1.00 41.17  ? 94  LEU A CA  1 
ATOM   717  C C   . LEU A 1 94  ? 20.938 62.963 -8.429  1.00 43.83  ? 94  LEU A C   1 
ATOM   718  O O   . LEU A 1 94  ? 20.389 62.683 -9.492  1.00 46.42  ? 94  LEU A O   1 
ATOM   719  C CB  . LEU A 1 94  ? 19.138 64.628 -7.911  1.00 36.03  ? 94  LEU A CB  1 
ATOM   720  C CG  . LEU A 1 94  ? 18.845 65.914 -7.146  1.00 32.87  ? 94  LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 94  ? 17.368 66.213 -7.172  1.00 30.95  ? 94  LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 94  ? 19.335 65.753 -5.713  1.00 30.66  ? 94  LEU A CD2 1 
ATOM   723  N N   . TYR A 1 95  ? 21.842 62.174 -7.858  1.00 45.63  ? 95  TYR A N   1 
ATOM   724  C CA  . TYR A 1 95  ? 22.269 60.932 -8.494  1.00 48.88  ? 95  TYR A CA  1 
ATOM   725  C C   . TYR A 1 95  ? 22.481 59.790 -7.508  1.00 50.55  ? 95  TYR A C   1 
ATOM   726  O O   . TYR A 1 95  ? 23.175 59.951 -6.496  1.00 53.45  ? 95  TYR A O   1 
ATOM   727  C CB  . TYR A 1 95  ? 23.568 61.157 -9.267  1.00 46.14  ? 95  TYR A CB  1 
ATOM   728  C CG  . TYR A 1 95  ? 23.473 62.238 -10.301 1.00 46.56  ? 95  TYR A CG  1 
ATOM   729  C CD1 . TYR A 1 95  ? 22.782 62.024 -11.499 1.00 46.94  ? 95  TYR A CD1 1 
ATOM   730  C CD2 . TYR A 1 95  ? 24.067 63.480 -10.091 1.00 46.21  ? 95  TYR A CD2 1 
ATOM   731  C CE1 . TYR A 1 95  ? 22.691 63.021 -12.463 1.00 46.44  ? 95  TYR A CE1 1 
ATOM   732  C CE2 . TYR A 1 95  ? 23.986 64.487 -11.053 1.00 46.13  ? 95  TYR A CE2 1 
ATOM   733  C CZ  . TYR A 1 95  ? 23.298 64.251 -12.233 1.00 45.79  ? 95  TYR A CZ  1 
ATOM   734  O OH  . TYR A 1 95  ? 23.241 65.233 -13.190 1.00 43.63  ? 95  TYR A OH  1 
ATOM   735  N N   . ILE A 1 96  ? 21.903 58.633 -7.824  1.00 49.34  ? 96  ILE A N   1 
ATOM   736  C CA  . ILE A 1 96  ? 22.021 57.468 -6.967  1.00 49.00  ? 96  ILE A CA  1 
ATOM   737  C C   . ILE A 1 96  ? 23.211 56.611 -7.307  1.00 47.87  ? 96  ILE A C   1 
ATOM   738  O O   . ILE A 1 96  ? 23.672 56.584 -8.443  1.00 48.79  ? 96  ILE A O   1 
ATOM   739  C CB  . ILE A 1 96  ? 20.774 56.586 -7.042  1.00 49.10  ? 96  ILE A CB  1 
ATOM   740  C CG1 . ILE A 1 96  ? 19.577 57.346 -6.484  1.00 54.50  ? 96  ILE A CG1 1 
ATOM   741  C CG2 . ILE A 1 96  ? 20.974 55.331 -6.224  1.00 49.55  ? 96  ILE A CG2 1 
ATOM   742  C CD1 . ILE A 1 96  ? 18.272 56.559 -6.488  1.00 57.18  ? 96  ILE A CD1 1 
ATOM   743  N N   . ASN A 1 97  ? 23.704 55.911 -6.297  1.00 47.22  ? 97  ASN A N   1 
ATOM   744  C CA  . ASN A 1 97  ? 24.824 55.006 -6.458  1.00 47.63  ? 97  ASN A CA  1 
ATOM   745  C C   . ASN A 1 97  ? 24.378 53.672 -5.861  1.00 48.28  ? 97  ASN A C   1 
ATOM   746  O O   . ASN A 1 97  ? 23.691 53.641 -4.831  1.00 48.82  ? 97  ASN A O   1 
ATOM   747  C CB  . ASN A 1 97  ? 26.041 55.534 -5.699  1.00 48.10  ? 97  ASN A CB  1 
ATOM   748  C CG  . ASN A 1 97  ? 26.337 56.991 -6.015  1.00 49.99  ? 97  ASN A CG  1 
ATOM   749  O OD1 . ASN A 1 97  ? 26.430 57.385 -7.187  1.00 47.42  ? 97  ASN A OD1 1 
ATOM   750  N ND2 . ASN A 1 97  ? 26.486 57.802 -4.972  1.00 48.81  ? 97  ASN A ND2 1 
ATOM   751  N N   . VAL A 1 98  ? 24.750 52.573 -6.509  1.00 46.69  ? 98  VAL A N   1 
ATOM   752  C CA  . VAL A 1 98  ? 24.395 51.257 -6.006  1.00 44.46  ? 98  VAL A CA  1 
ATOM   753  C C   . VAL A 1 98  ? 25.570 50.281 -6.072  1.00 45.07  ? 98  VAL A C   1 
ATOM   754  O O   . VAL A 1 98  ? 26.253 50.183 -7.084  1.00 43.23  ? 98  VAL A O   1 
ATOM   755  C CB  . VAL A 1 98  ? 23.218 50.673 -6.794  1.00 42.20  ? 98  VAL A CB  1 
ATOM   756  C CG1 . VAL A 1 98  ? 22.840 49.318 -6.227  1.00 45.35  ? 98  VAL A CG1 1 
ATOM   757  C CG2 . VAL A 1 98  ? 22.048 51.611 -6.733  1.00 40.54  ? 98  VAL A CG2 1 
ATOM   758  N N   . TRP A 1 99  ? 25.818 49.579 -4.973  1.00 46.71  ? 99  TRP A N   1 
ATOM   759  C CA  . TRP A 1 99  ? 26.886 48.585 -4.926  1.00 47.49  ? 99  TRP A CA  1 
ATOM   760  C C   . TRP A 1 99  ? 26.183 47.228 -4.870  1.00 47.94  ? 99  TRP A C   1 
ATOM   761  O O   . TRP A 1 99  ? 25.761 46.767 -3.805  1.00 46.77  ? 99  TRP A O   1 
ATOM   762  C CB  . TRP A 1 99  ? 27.766 48.766 -3.678  1.00 48.68  ? 99  TRP A CB  1 
ATOM   763  C CG  . TRP A 1 99  ? 28.788 49.875 -3.759  1.00 50.45  ? 99  TRP A CG  1 
ATOM   764  C CD1 . TRP A 1 99  ? 30.122 49.748 -4.046  1.00 49.85  ? 99  TRP A CD1 1 
ATOM   765  C CD2 . TRP A 1 99  ? 28.561 51.272 -3.527  1.00 51.15  ? 99  TRP A CD2 1 
ATOM   766  N NE1 . TRP A 1 99  ? 30.737 50.981 -4.003  1.00 49.44  ? 99  TRP A NE1 1 
ATOM   767  C CE2 . TRP A 1 99  ? 29.803 51.931 -3.686  1.00 49.53  ? 99  TRP A CE2 1 
ATOM   768  C CE3 . TRP A 1 99  ? 27.428 52.032 -3.196  1.00 50.55  ? 99  TRP A CE3 1 
ATOM   769  C CZ2 . TRP A 1 99  ? 29.940 53.311 -3.530  1.00 49.10  ? 99  TRP A CZ2 1 
ATOM   770  C CZ3 . TRP A 1 99  ? 27.568 53.406 -3.041  1.00 49.56  ? 99  TRP A CZ3 1 
ATOM   771  C CH2 . TRP A 1 99  ? 28.817 54.029 -3.207  1.00 48.45  ? 99  TRP A CH2 1 
ATOM   772  N N   . ALA A 1 100 ? 26.036 46.596 -6.026  1.00 48.16  ? 100 ALA A N   1 
ATOM   773  C CA  . ALA A 1 100 ? 25.374 45.310 -6.074  1.00 47.96  ? 100 ALA A CA  1 
ATOM   774  C C   . ALA A 1 100 ? 26.372 44.183 -6.168  1.00 48.70  ? 100 ALA A C   1 
ATOM   775  O O   . ALA A 1 100 ? 27.179 44.116 -7.092  1.00 48.48  ? 100 ALA A O   1 
ATOM   776  C CB  . ALA A 1 100 ? 24.416 45.254 -7.245  1.00 48.45  ? 100 ALA A CB  1 
ATOM   777  N N   . PRO A 1 101 ? 26.346 43.289 -5.183  1.00 50.04  ? 101 PRO A N   1 
ATOM   778  C CA  . PRO A 1 101 ? 27.260 42.149 -5.172  1.00 51.32  ? 101 PRO A CA  1 
ATOM   779  C C   . PRO A 1 101 ? 27.063 41.339 -6.459  1.00 51.94  ? 101 PRO A C   1 
ATOM   780  O O   . PRO A 1 101 ? 25.940 40.935 -6.785  1.00 51.52  ? 101 PRO A O   1 
ATOM   781  C CB  . PRO A 1 101 ? 26.830 41.387 -3.922  1.00 51.40  ? 101 PRO A CB  1 
ATOM   782  C CG  . PRO A 1 101 ? 26.379 42.493 -3.003  1.00 51.51  ? 101 PRO A CG  1 
ATOM   783  C CD  . PRO A 1 101 ? 25.571 43.364 -3.932  1.00 50.69  ? 101 PRO A CD  1 
ATOM   784  N N   . ALA A 1 102 ? 28.155 41.106 -7.183  1.00 52.27  ? 102 ALA A N   1 
ATOM   785  C CA  . ALA A 1 102 ? 28.105 40.365 -8.445  1.00 52.01  ? 102 ALA A CA  1 
ATOM   786  C C   . ALA A 1 102 ? 27.714 38.906 -8.283  1.00 51.04  ? 102 ALA A C   1 
ATOM   787  O O   . ALA A 1 102 ? 28.378 38.148 -7.570  1.00 49.93  ? 102 ALA A O   1 
ATOM   788  C CB  . ALA A 1 102 ? 29.448 40.462 -9.159  1.00 53.64  ? 102 ALA A CB  1 
ATOM   789  N N   . LYS A 1 103 ? 26.637 38.520 -8.963  0.50 49.39  ? 103 LYS A N   1 
ATOM   790  C CA  . LYS A 1 103 ? 26.143 37.153 -8.907  0.50 48.47  ? 103 LYS A CA  1 
ATOM   791  C C   . LYS A 1 103 ? 25.327 36.834 -10.149 0.50 48.27  ? 103 LYS A C   1 
ATOM   792  O O   . LYS A 1 103 ? 24.546 37.723 -10.545 0.50 47.61  ? 103 LYS A O   1 
ATOM   793  C CB  . LYS A 1 103 ? 25.284 36.961 -7.660  0.50 48.31  ? 103 LYS A CB  1 
ATOM   794  C CG  . LYS A 1 103 ? 25.808 35.907 -6.702  0.50 48.46  ? 103 LYS A CG  1 
ATOM   795  C CD  . LYS A 1 103 ? 25.823 34.544 -7.361  0.50 49.03  ? 103 LYS A CD  1 
ATOM   796  C CE  . LYS A 1 103 ? 26.172 33.443 -6.370  0.50 49.63  ? 103 LYS A CE  1 
ATOM   797  N NZ  . LYS A 1 103 ? 26.226 32.106 -7.043  0.50 48.52  ? 103 LYS A NZ  1 
ATOM   798  N N   . ASN A 1 136 ? 12.024 39.292 4.352   0.80 92.94  ? 136 ASN A N   1 
ATOM   799  C CA  . ASN A 1 136 ? 12.863 38.171 4.855   0.80 94.33  ? 136 ASN A CA  1 
ATOM   800  C C   . ASN A 1 136 ? 13.809 37.607 3.788   0.80 94.54  ? 136 ASN A C   1 
ATOM   801  O O   . ASN A 1 136 ? 13.652 37.860 2.592   0.80 94.70  ? 136 ASN A O   1 
ATOM   802  C CB  . ASN A 1 136 ? 11.979 37.049 5.413   0.80 95.12  ? 136 ASN A CB  1 
ATOM   803  C CG  . ASN A 1 136 ? 12.483 36.516 6.753   0.80 96.70  ? 136 ASN A CG  1 
ATOM   804  O OD1 . ASN A 1 136 ? 13.629 36.072 6.872   0.80 96.46  ? 136 ASN A OD1 1 
ATOM   805  N ND2 . ASN A 1 136 ? 11.622 36.559 7.769   0.80 96.88  ? 136 ASN A ND2 1 
ATOM   806  N N   . THR A 1 137 ? 14.562 36.541 3.573   0.80 94.69  ? 137 THR A N   1 
ATOM   807  C CA  . THR A 1 137 ? 15.936 36.019 3.592   0.80 93.85  ? 137 THR A CA  1 
ATOM   808  C C   . THR A 1 137 ? 16.345 35.579 2.183   0.80 91.91  ? 137 THR A C   1 
ATOM   809  O O   . THR A 1 137 ? 17.604 35.398 1.998   0.80 92.00  ? 137 THR A O   1 
ATOM   810  C CB  . THR A 1 137 ? 16.027 34.827 4.545   0.80 95.12  ? 137 THR A CB  1 
ATOM   811  O OG1 . THR A 1 137 ? 15.149 33.796 4.119   0.80 96.27  ? 137 THR A OG1 1 
ATOM   812  C CG2 . THR A 1 137 ? 15.652 35.184 5.984   0.80 96.30  ? 137 THR A CG2 1 
ATOM   813  N N   . THR A 1 138 ? 15.486 35.306 1.214   0.80 89.85  ? 138 THR A N   1 
ATOM   814  C CA  . THR A 1 138 ? 15.914 34.622 -0.014  0.80 87.77  ? 138 THR A CA  1 
ATOM   815  C C   . THR A 1 138 ? 15.589 35.381 -1.331  0.80 86.75  ? 138 THR A C   1 
ATOM   816  O O   . THR A 1 138 ? 16.298 35.262 -2.331  0.80 85.87  ? 138 THR A O   1 
ATOM   817  C CB  . THR A 1 138 ? 15.182 33.286 -0.148  0.80 87.68  ? 138 THR A CB  1 
ATOM   818  O OG1 . THR A 1 138 ? 13.780 33.504 -0.206  0.80 86.45  ? 138 THR A OG1 1 
ATOM   819  C CG2 . THR A 1 138 ? 15.449 32.338 1.022   0.80 87.41  ? 138 THR A CG2 1 
ATOM   820  N N   . ASN A 1 139 ? 14.530 36.162 -1.323  1.00 85.14  ? 139 ASN A N   1 
ATOM   821  C CA  . ASN A 1 139 ? 13.958 36.778 -2.561  1.00 81.70  ? 139 ASN A CA  1 
ATOM   822  C C   . ASN A 1 139 ? 14.823 37.835 -3.340  1.00 77.69  ? 139 ASN A C   1 
ATOM   823  O O   . ASN A 1 139 ? 14.456 38.301 -4.419  1.00 78.65  ? 139 ASN A O   1 
ATOM   824  C CB  . ASN A 1 139 ? 12.665 37.502 -2.208  1.00 84.16  ? 139 ASN A CB  1 
ATOM   825  C CG  . ASN A 1 139 ? 11.951 38.063 -3.433  1.00 86.51  ? 139 ASN A CG  1 
ATOM   826  O OD1 . ASN A 1 139 ? 12.464 37.949 -4.544  1.00 89.60  ? 139 ASN A OD1 1 
ATOM   827  N ND2 . ASN A 1 139 ? 10.789 38.672 -3.299  1.00 87.47  ? 139 ASN A ND2 1 
ATOM   828  N N   . GLY A 1 140 ? 15.955 38.197 -2.848  1.00 72.49  ? 140 GLY A N   1 
ATOM   829  C CA  . GLY A 1 140 ? 16.815 39.279 -3.388  1.00 66.73  ? 140 GLY A CA  1 
ATOM   830  C C   . GLY A 1 140 ? 17.642 39.580 -2.176  1.00 62.30  ? 140 GLY A C   1 
ATOM   831  O O   . GLY A 1 140 ? 17.340 39.060 -1.101  1.00 63.20  ? 140 GLY A O   1 
ATOM   832  N N   . LEU A 1 141 ? 18.661 40.375 -2.265  1.00 57.36  ? 141 LEU A N   1 
ATOM   833  C CA  . LEU A 1 141 ? 19.536 40.554 -1.082  1.00 54.51  ? 141 LEU A CA  1 
ATOM   834  C C   . LEU A 1 141 ? 19.126 41.727 -0.190  1.00 51.58  ? 141 LEU A C   1 
ATOM   835  O O   . LEU A 1 141 ? 18.303 42.566 -0.571  1.00 51.97  ? 141 LEU A O   1 
ATOM   836  C CB  . LEU A 1 141 ? 20.966 40.826 -1.514  1.00 54.93  ? 141 LEU A CB  1 
ATOM   837  C CG  . LEU A 1 141 ? 21.604 39.666 -2.268  1.00 55.94  ? 141 LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 141 ? 23.073 39.929 -2.605  1.00 55.67  ? 141 LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 141 ? 21.575 38.355 -1.482  1.00 57.81  ? 141 LEU A CD2 1 
ATOM   840  N N   . PRO A 1 142 ? 19.636 41.801 1.057   1.00 46.51  ? 142 PRO A N   1 
ATOM   841  C CA  . PRO A 1 142 ? 19.393 42.952 1.919   1.00 42.24  ? 142 PRO A CA  1 
ATOM   842  C C   . PRO A 1 142 ? 19.883 44.277 1.305   1.00 41.17  ? 142 PRO A C   1 
ATOM   843  O O   . PRO A 1 142 ? 20.958 44.333 0.710   1.00 38.33  ? 142 PRO A O   1 
ATOM   844  C CB  . PRO A 1 142 ? 20.041 42.571 3.228   1.00 41.93  ? 142 PRO A CB  1 
ATOM   845  C CG  . PRO A 1 142 ? 20.633 41.183 3.067   1.00 40.15  ? 142 PRO A CG  1 
ATOM   846  C CD  . PRO A 1 142 ? 20.445 40.735 1.652   1.00 41.08  ? 142 PRO A CD  1 
ATOM   847  N N   . ILE A 1 143 ? 19.100 45.341 1.434   1.00 39.72  ? 143 ILE A N   1 
ATOM   848  C CA  . ILE A 1 143 ? 19.503 46.626 0.869   1.00 38.87  ? 143 ILE A CA  1 
ATOM   849  C C   . ILE A 1 143 ? 19.776 47.663 1.950   1.00 38.87  ? 143 ILE A C   1 
ATOM   850  O O   . ILE A 1 143 ? 18.878 48.015 2.717   1.00 39.62  ? 143 ILE A O   1 
ATOM   851  C CB  . ILE A 1 143 ? 18.424 47.186 -0.070  1.00 38.50  ? 143 ILE A CB  1 
ATOM   852  C CG1 . ILE A 1 143 ? 18.028 46.114 -1.080  1.00 40.05  ? 143 ILE A CG1 1 
ATOM   853  C CG2 . ILE A 1 143 ? 18.952 48.413 -0.814  1.00 38.29  ? 143 ILE A CG2 1 
ATOM   854  C CD1 . ILE A 1 143 ? 17.018 46.564 -2.099  1.00 39.25  ? 143 ILE A CD1 1 
ATOM   855  N N   . LEU A 1 144 ? 21.015 48.143 2.021   1.00 36.35  ? 144 LEU A N   1 
ATOM   856  C CA  . LEU A 1 144 ? 21.362 49.154 3.004   1.00 34.79  ? 144 LEU A CA  1 
ATOM   857  C C   . LEU A 1 144 ? 21.531 50.484 2.318   1.00 32.96  ? 144 LEU A C   1 
ATOM   858  O O   . LEU A 1 144 ? 22.418 50.646 1.492   1.00 31.95  ? 144 LEU A O   1 
ATOM   859  C CB  . LEU A 1 144 ? 22.650 48.804 3.725   1.00 35.77  ? 144 LEU A CB  1 
ATOM   860  C CG  . LEU A 1 144 ? 22.621 47.586 4.636   1.00 36.67  ? 144 LEU A CG  1 
ATOM   861  C CD1 . LEU A 1 144 ? 22.769 46.312 3.820   1.00 33.48  ? 144 LEU A CD1 1 
ATOM   862  C CD2 . LEU A 1 144 ? 23.756 47.719 5.635   1.00 37.01  ? 144 LEU A CD2 1 
ATOM   863  N N   . ILE A 1 145 ? 20.674 51.433 2.667   1.00 32.02  ? 145 ILE A N   1 
ATOM   864  C CA  . ILE A 1 145 ? 20.722 52.757 2.077   1.00 30.93  ? 145 ILE A CA  1 
ATOM   865  C C   . ILE A 1 145 ? 21.405 53.724 3.034   1.00 30.51  ? 145 ILE A C   1 
ATOM   866  O O   . ILE A 1 145 ? 20.915 53.995 4.143   1.00 27.29  ? 145 ILE A O   1 
ATOM   867  C CB  . ILE A 1 145 ? 19.311 53.261 1.747   1.00 29.94  ? 145 ILE A CB  1 
ATOM   868  C CG1 . ILE A 1 145 ? 18.548 52.193 0.987   1.00 30.04  ? 145 ILE A CG1 1 
ATOM   869  C CG2 . ILE A 1 145 ? 19.378 54.454 0.837   1.00 30.46  ? 145 ILE A CG2 1 
ATOM   870  C CD1 . ILE A 1 145 ? 17.139 52.597 0.712   1.00 33.42  ? 145 ILE A CD1 1 
ATOM   871  N N   . TRP A 1 146 ? 22.541 54.245 2.579   1.00 30.51  ? 146 TRP A N   1 
ATOM   872  C CA  . TRP A 1 146 ? 23.360 55.166 3.362   1.00 32.00  ? 146 TRP A CA  1 
ATOM   873  C C   . TRP A 1 146 ? 23.128 56.635 3.095   1.00 30.38  ? 146 TRP A C   1 
ATOM   874  O O   . TRP A 1 146 ? 23.406 57.123 2.018   1.00 33.09  ? 146 TRP A O   1 
ATOM   875  C CB  . TRP A 1 146 ? 24.852 54.877 3.130   1.00 32.31  ? 146 TRP A CB  1 
ATOM   876  C CG  . TRP A 1 146 ? 25.729 55.943 3.685   1.00 28.40  ? 146 TRP A CG  1 
ATOM   877  C CD1 . TRP A 1 146 ? 26.208 57.037 3.031   1.00 27.16  ? 146 TRP A CD1 1 
ATOM   878  C CD2 . TRP A 1 146 ? 26.151 56.064 5.039   1.00 28.96  ? 146 TRP A CD2 1 
ATOM   879  N NE1 . TRP A 1 146 ? 26.902 57.842 3.898   1.00 26.32  ? 146 TRP A NE1 1 
ATOM   880  C CE2 . TRP A 1 146 ? 26.883 57.268 5.141   1.00 27.56  ? 146 TRP A CE2 1 
ATOM   881  C CE3 . TRP A 1 146 ? 25.974 55.271 6.187   1.00 29.87  ? 146 TRP A CE3 1 
ATOM   882  C CZ2 . TRP A 1 146 ? 27.446 57.701 6.345   1.00 26.90  ? 146 TRP A CZ2 1 
ATOM   883  C CZ3 . TRP A 1 146 ? 26.531 55.698 7.387   1.00 31.33  ? 146 TRP A CZ3 1 
ATOM   884  C CH2 . TRP A 1 146 ? 27.261 56.908 7.456   1.00 30.99  ? 146 TRP A CH2 1 
ATOM   885  N N   . ILE A 1 147 ? 22.630 57.349 4.088   1.00 31.62  ? 147 ILE A N   1 
ATOM   886  C CA  . ILE A 1 147 ? 22.422 58.776 3.921   1.00 30.06  ? 147 ILE A CA  1 
ATOM   887  C C   . ILE A 1 147 ? 23.598 59.436 4.619   1.00 32.07  ? 147 ILE A C   1 
ATOM   888  O O   . ILE A 1 147 ? 23.909 59.121 5.765   1.00 32.08  ? 147 ILE A O   1 
ATOM   889  C CB  . ILE A 1 147 ? 21.157 59.255 4.588   1.00 24.75  ? 147 ILE A CB  1 
ATOM   890  C CG1 . ILE A 1 147 ? 19.968 58.447 4.092   1.00 22.57  ? 147 ILE A CG1 1 
ATOM   891  C CG2 . ILE A 1 147 ? 20.977 60.721 4.295   1.00 25.13  ? 147 ILE A CG2 1 
ATOM   892  C CD1 . ILE A 1 147 ? 18.646 58.868 4.722   1.00 21.58  ? 147 ILE A CD1 1 
ATOM   893  N N   . TYR A 1 148 ? 24.259 60.344 3.920   1.00 34.58  ? 148 TYR A N   1 
ATOM   894  C CA  . TYR A 1 148 ? 25.415 61.029 4.480   1.00 35.73  ? 148 TYR A CA  1 
ATOM   895  C C   . TYR A 1 148 ? 24.988 62.154 5.394   1.00 35.46  ? 148 TYR A C   1 
ATOM   896  O O   . TYR A 1 148 ? 23.898 62.711 5.245   1.00 30.64  ? 148 TYR A O   1 
ATOM   897  C CB  . TYR A 1 148 ? 26.290 61.605 3.361   1.00 34.78  ? 148 TYR A CB  1 
ATOM   898  C CG  . TYR A 1 148 ? 25.578 62.620 2.500   1.00 32.52  ? 148 TYR A CG  1 
ATOM   899  C CD1 . TYR A 1 148 ? 25.477 63.956 2.894   1.00 32.70  ? 148 TYR A CD1 1 
ATOM   900  C CD2 . TYR A 1 148 ? 24.986 62.238 1.299   1.00 31.41  ? 148 TYR A CD2 1 
ATOM   901  C CE1 . TYR A 1 148 ? 24.803 64.884 2.106   1.00 33.74  ? 148 TYR A CE1 1 
ATOM   902  C CE2 . TYR A 1 148 ? 24.309 63.149 0.504   1.00 32.70  ? 148 TYR A CE2 1 
ATOM   903  C CZ  . TYR A 1 148 ? 24.218 64.471 0.906   1.00 34.52  ? 148 TYR A CZ  1 
ATOM   904  O OH  . TYR A 1 148 ? 23.542 65.370 0.102   1.00 33.59  ? 148 TYR A OH  1 
ATOM   905  N N   . GLY A 1 149 ? 25.877 62.477 6.330   1.00 37.39  ? 149 GLY A N   1 
ATOM   906  C CA  . GLY A 1 149 ? 25.630 63.555 7.268   1.00 39.80  ? 149 GLY A CA  1 
ATOM   907  C C   . GLY A 1 149 ? 26.317 64.848 6.843   1.00 40.50  ? 149 GLY A C   1 
ATOM   908  O O   . GLY A 1 149 ? 26.661 65.036 5.676   1.00 40.14  ? 149 GLY A O   1 
ATOM   909  N N   . GLY A 1 150 ? 26.526 65.736 7.806   1.00 42.60  ? 150 GLY A N   1 
ATOM   910  C CA  . GLY A 1 150 ? 27.152 67.015 7.525   1.00 44.95  ? 150 GLY A CA  1 
ATOM   911  C C   . GLY A 1 150 ? 26.223 68.160 7.891   1.00 44.63  ? 150 GLY A C   1 
ATOM   912  O O   . GLY A 1 150 ? 26.149 69.173 7.191   1.00 43.65  ? 150 GLY A O   1 
ATOM   913  N N   . GLY A 1 151 ? 25.501 67.989 8.992   1.00 44.63  ? 151 GLY A N   1 
ATOM   914  C CA  . GLY A 1 151 ? 24.581 69.021 9.439   1.00 45.20  ? 151 GLY A CA  1 
ATOM   915  C C   . GLY A 1 151 ? 23.678 69.667 8.400   1.00 42.64  ? 151 GLY A C   1 
ATOM   916  O O   . GLY A 1 151 ? 23.497 70.872 8.411   1.00 41.96  ? 151 GLY A O   1 
ATOM   917  N N   . PHE A 1 152 ? 23.108 68.876 7.503   1.00 45.03  ? 152 PHE A N   1 
ATOM   918  C CA  . PHE A 1 152 ? 22.208 69.401 6.477   1.00 47.12  ? 152 PHE A CA  1 
ATOM   919  C C   . PHE A 1 152 ? 22.816 70.564 5.718   1.00 49.18  ? 152 PHE A C   1 
ATOM   920  O O   . PHE A 1 152 ? 22.120 71.277 4.986   1.00 48.75  ? 152 PHE A O   1 
ATOM   921  C CB  . PHE A 1 152 ? 20.888 69.832 7.118   1.00 45.49  ? 152 PHE A CB  1 
ATOM   922  C CG  . PHE A 1 152 ? 20.215 68.727 7.857   1.00 45.11  ? 152 PHE A CG  1 
ATOM   923  C CD1 . PHE A 1 152 ? 19.677 67.655 7.171   1.00 43.38  ? 152 PHE A CD1 1 
ATOM   924  C CD2 . PHE A 1 152 ? 20.227 68.694 9.241   1.00 46.65  ? 152 PHE A CD2 1 
ATOM   925  C CE1 . PHE A 1 152 ? 19.174 66.568 7.848   1.00 43.75  ? 152 PHE A CE1 1 
ATOM   926  C CE2 . PHE A 1 152 ? 19.723 67.603 9.929   1.00 45.12  ? 152 PHE A CE2 1 
ATOM   927  C CZ  . PHE A 1 152 ? 19.199 66.539 9.231   1.00 44.40  ? 152 PHE A CZ  1 
ATOM   928  N N   . MET A 1 153 ? 24.123 70.740 5.890   1.00 50.64  ? 153 MET A N   1 
ATOM   929  C CA  . MET A 1 153 ? 24.844 71.819 5.234   1.00 52.04  ? 153 MET A CA  1 
ATOM   930  C C   . MET A 1 153 ? 25.849 71.312 4.208   1.00 51.48  ? 153 MET A C   1 
ATOM   931  O O   . MET A 1 153 ? 25.890 71.790 3.078   1.00 51.66  ? 153 MET A O   1 
ATOM   932  C CB  . MET A 1 153 ? 25.548 72.679 6.287   1.00 53.12  ? 153 MET A CB  1 
ATOM   933  C CG  . MET A 1 153 ? 24.640 73.704 6.971   1.00 52.11  ? 153 MET A CG  1 
ATOM   934  S SD  . MET A 1 153 ? 24.105 75.023 5.857   1.00 53.08  ? 153 MET A SD  1 
ATOM   935  C CE  . MET A 1 153 ? 22.356 75.139 6.227   1.00 49.48  ? 153 MET A CE  1 
ATOM   936  N N   . THR A 1 154 ? 26.649 70.337 4.611   1.00 51.75  ? 154 THR A N   1 
ATOM   937  C CA  . THR A 1 154 ? 27.652 69.761 3.737   1.00 52.68  ? 154 THR A CA  1 
ATOM   938  C C   . THR A 1 154 ? 27.412 68.255 3.585   1.00 53.17  ? 154 THR A C   1 
ATOM   939  O O   . THR A 1 154 ? 26.316 67.757 3.857   1.00 54.27  ? 154 THR A O   1 
ATOM   940  C CB  . THR A 1 154 ? 29.063 69.991 4.317   1.00 54.44  ? 154 THR A CB  1 
ATOM   941  O OG1 . THR A 1 154 ? 29.405 68.928 5.219   1.00 55.10  ? 154 THR A OG1 1 
ATOM   942  C CG2 . THR A 1 154 ? 29.097 71.290 5.085   1.00 55.42  ? 154 THR A CG2 1 
ATOM   943  N N   . GLY A 1 155 ? 28.444 67.534 3.153   1.00 52.96  ? 155 GLY A N   1 
ATOM   944  C CA  . GLY A 1 155 ? 28.334 66.098 2.982   1.00 51.27  ? 155 GLY A CA  1 
ATOM   945  C C   . GLY A 1 155 ? 28.085 65.688 1.547   1.00 51.26  ? 155 GLY A C   1 
ATOM   946  O O   . GLY A 1 155 ? 27.402 66.385 0.794   1.00 50.81  ? 155 GLY A O   1 
ATOM   947  N N   . SER A 1 156 ? 28.654 64.554 1.164   1.00 51.03  ? 156 SER A N   1 
ATOM   948  C CA  . SER A 1 156 ? 28.487 64.023 -0.184  1.00 53.46  ? 156 SER A CA  1 
ATOM   949  C C   . SER A 1 156 ? 28.409 62.506 -0.110  1.00 53.23  ? 156 SER A C   1 
ATOM   950  O O   . SER A 1 156 ? 28.868 61.906 0.858   1.00 54.06  ? 156 SER A O   1 
ATOM   951  C CB  . SER A 1 156 ? 29.678 64.426 -1.062  1.00 56.70  ? 156 SER A CB  1 
ATOM   952  O OG  . SER A 1 156 ? 29.788 63.600 -2.216  1.00 58.81  ? 156 SER A OG  1 
ATOM   953  N N   . ALA A 1 157 ? 27.822 61.874 -1.116  1.00 51.91  ? 157 ALA A N   1 
ATOM   954  C CA  . ALA A 1 157 ? 27.768 60.420 -1.101  1.00 52.26  ? 157 ALA A CA  1 
ATOM   955  C C   . ALA A 1 157 ? 29.059 59.883 -1.728  1.00 52.12  ? 157 ALA A C   1 
ATOM   956  O O   . ALA A 1 157 ? 29.372 58.694 -1.614  1.00 51.83  ? 157 ALA A O   1 
ATOM   957  C CB  . ALA A 1 157 ? 26.550 59.919 -1.879  1.00 50.38  ? 157 ALA A CB  1 
ATOM   958  N N   . THR A 1 158 ? 29.817 60.783 -2.356  1.00 52.21  ? 158 THR A N   1 
ATOM   959  C CA  . THR A 1 158 ? 31.053 60.425 -3.051  1.00 52.72  ? 158 THR A CA  1 
ATOM   960  C C   . THR A 1 158 ? 32.313 60.211 -2.219  1.00 53.26  ? 158 THR A C   1 
ATOM   961  O O   . THR A 1 158 ? 33.186 59.450 -2.626  1.00 54.18  ? 158 THR A O   1 
ATOM   962  C CB  . THR A 1 158 ? 31.406 61.471 -4.137  1.00 50.79  ? 158 THR A CB  1 
ATOM   963  O OG1 . THR A 1 158 ? 31.877 62.668 -3.513  1.00 48.12  ? 158 THR A OG1 1 
ATOM   964  C CG2 . THR A 1 158 ? 30.183 61.793 -4.990  1.00 48.63  ? 158 THR A CG2 1 
ATOM   965  N N   . LEU A 1 159 ? 32.417 60.882 -1.075  1.00 53.83  ? 159 LEU A N   1 
ATOM   966  C CA  . LEU A 1 159 ? 33.599 60.772 -0.218  1.00 54.13  ? 159 LEU A CA  1 
ATOM   967  C C   . LEU A 1 159 ? 34.092 59.346 -0.085  1.00 55.67  ? 159 LEU A C   1 
ATOM   968  O O   . LEU A 1 159 ? 33.338 58.465 0.316   1.00 57.83  ? 159 LEU A O   1 
ATOM   969  C CB  . LEU A 1 159 ? 33.288 61.315 1.165   1.00 53.19  ? 159 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 159 ? 32.445 62.586 1.177   1.00 52.89  ? 159 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 159 ? 32.336 63.059 2.606   1.00 54.19  ? 159 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 159 ? 33.054 63.666 0.294   1.00 51.12  ? 159 LEU A CD2 1 
ATOM   973  N N   . ASP A 1 160 ? 35.358 59.113 -0.415  1.00 56.38  ? 160 ASP A N   1 
ATOM   974  C CA  . ASP A 1 160 ? 35.914 57.765 -0.321  1.00 57.36  ? 160 ASP A CA  1 
ATOM   975  C C   . ASP A 1 160 ? 35.576 57.130 1.011   1.00 56.74  ? 160 ASP A C   1 
ATOM   976  O O   . ASP A 1 160 ? 35.525 55.906 1.133   1.00 56.96  ? 160 ASP A O   1 
ATOM   977  C CB  . ASP A 1 160 ? 37.433 57.784 -0.474  1.00 59.33  ? 160 ASP A CB  1 
ATOM   978  C CG  . ASP A 1 160 ? 37.874 58.431 -1.761  1.00 62.88  ? 160 ASP A CG  1 
ATOM   979  O OD1 . ASP A 1 160 ? 37.896 59.686 -1.840  1.00 65.33  ? 160 ASP A OD1 1 
ATOM   980  O OD2 . ASP A 1 160 ? 38.187 57.675 -2.700  1.00 63.68  ? 160 ASP A OD2 1 
ATOM   981  N N   . ILE A 1 161 ? 35.346 57.965 2.018   1.00 57.16  ? 161 ILE A N   1 
ATOM   982  C CA  . ILE A 1 161 ? 35.026 57.454 3.341   1.00 55.64  ? 161 ILE A CA  1 
ATOM   983  C C   . ILE A 1 161 ? 33.688 56.710 3.336   1.00 53.75  ? 161 ILE A C   1 
ATOM   984  O O   . ILE A 1 161 ? 33.423 55.877 4.202   1.00 54.25  ? 161 ILE A O   1 
ATOM   985  C CB  . ILE A 1 161 ? 35.022 58.596 4.387   1.00 55.90  ? 161 ILE A CB  1 
ATOM   986  C CG1 . ILE A 1 161 ? 34.817 58.003 5.781   1.00 56.24  ? 161 ILE A CG1 1 
ATOM   987  C CG2 . ILE A 1 161 ? 33.970 59.638 4.036   1.00 54.10  ? 161 ILE A CG2 1 
ATOM   988  C CD1 . ILE A 1 161 ? 35.799 56.891 6.126   1.00 54.53  ? 161 ILE A CD1 1 
ATOM   989  N N   . TYR A 1 162 ? 32.858 56.994 2.338   1.00 51.44  ? 162 TYR A N   1 
ATOM   990  C CA  . TYR A 1 162 ? 31.569 56.336 2.222   1.00 48.43  ? 162 TYR A CA  1 
ATOM   991  C C   . TYR A 1 162 ? 31.587 55.170 1.243   1.00 48.43  ? 162 TYR A C   1 
ATOM   992  O O   . TYR A 1 162 ? 30.558 54.532 1.014   1.00 50.07  ? 162 TYR A O   1 
ATOM   993  C CB  . TYR A 1 162 ? 30.488 57.339 1.817   1.00 45.14  ? 162 TYR A CB  1 
ATOM   994  C CG  . TYR A 1 162 ? 30.279 58.432 2.838   1.00 43.37  ? 162 TYR A CG  1 
ATOM   995  C CD1 . TYR A 1 162 ? 30.470 58.187 4.204   1.00 42.11  ? 162 TYR A CD1 1 
ATOM   996  C CD2 . TYR A 1 162 ? 29.903 59.712 2.448   1.00 42.63  ? 162 TYR A CD2 1 
ATOM   997  C CE1 . TYR A 1 162 ? 30.297 59.191 5.146   1.00 39.74  ? 162 TYR A CE1 1 
ATOM   998  C CE2 . TYR A 1 162 ? 29.720 60.722 3.389   1.00 41.76  ? 162 TYR A CE2 1 
ATOM   999  C CZ  . TYR A 1 162 ? 29.922 60.453 4.730   1.00 39.93  ? 162 TYR A CZ  1 
ATOM   1000 O OH  . TYR A 1 162 ? 29.734 61.447 5.653   1.00 42.04  ? 162 TYR A OH  1 
ATOM   1001 N N   . ASN A 1 163 ? 32.748 54.889 0.663   1.00 47.22  ? 163 ASN A N   1 
ATOM   1002 C CA  . ASN A 1 163 ? 32.856 53.781 -0.267  1.00 45.03  ? 163 ASN A CA  1 
ATOM   1003 C C   . ASN A 1 163 ? 32.208 52.575 0.383   1.00 44.61  ? 163 ASN A C   1 
ATOM   1004 O O   . ASN A 1 163 ? 32.573 52.185 1.498   1.00 42.49  ? 163 ASN A O   1 
ATOM   1005 C CB  . ASN A 1 163 ? 34.315 53.452 -0.569  1.00 46.25  ? 163 ASN A CB  1 
ATOM   1006 C CG  . ASN A 1 163 ? 34.466 52.156 -1.368  1.00 47.63  ? 163 ASN A CG  1 
ATOM   1007 O OD1 . ASN A 1 163 ? 34.634 52.172 -2.594  1.00 47.79  ? 163 ASN A OD1 1 
ATOM   1008 N ND2 . ASN A 1 163 ? 34.385 51.025 -0.672  1.00 46.90  ? 163 ASN A ND2 1 
ATOM   1009 N N   . ALA A 1 164 ? 31.253 51.980 -0.320  1.00 44.64  ? 164 ALA A N   1 
ATOM   1010 C CA  . ALA A 1 164 ? 30.548 50.824 0.200   1.00 46.76  ? 164 ALA A CA  1 
ATOM   1011 C C   . ALA A 1 164 ? 31.085 49.515 -0.348  1.00 47.94  ? 164 ALA A C   1 
ATOM   1012 O O   . ALA A 1 164 ? 30.608 48.450 0.041   1.00 49.59  ? 164 ALA A O   1 
ATOM   1013 C CB  . ALA A 1 164 ? 29.065 50.942 -0.113  1.00 46.74  ? 164 ALA A CB  1 
ATOM   1014 N N   . ASP A 1 165 ? 32.063 49.594 -1.250  1.00 48.34  ? 165 ASP A N   1 
ATOM   1015 C CA  . ASP A 1 165 ? 32.661 48.407 -1.864  1.00 48.94  ? 165 ASP A CA  1 
ATOM   1016 C C   . ASP A 1 165 ? 32.763 47.217 -0.912  1.00 49.33  ? 165 ASP A C   1 
ATOM   1017 O O   . ASP A 1 165 ? 32.122 46.179 -1.117  1.00 47.19  ? 165 ASP A O   1 
ATOM   1018 C CB  . ASP A 1 165 ? 34.065 48.726 -2.386  1.00 50.92  ? 165 ASP A CB  1 
ATOM   1019 C CG  . ASP A 1 165 ? 34.052 49.469 -3.704  1.00 52.29  ? 165 ASP A CG  1 
ATOM   1020 O OD1 . ASP A 1 165 ? 32.968 49.648 -4.299  1.00 53.19  ? 165 ASP A OD1 1 
ATOM   1021 O OD2 . ASP A 1 165 ? 35.142 49.872 -4.151  1.00 54.27  ? 165 ASP A OD2 1 
ATOM   1022 N N   . ILE A 1 166 ? 33.581 47.386 0.128   1.00 48.68  ? 166 ILE A N   1 
ATOM   1023 C CA  . ILE A 1 166 ? 33.821 46.350 1.130   1.00 47.77  ? 166 ILE A CA  1 
ATOM   1024 C C   . ILE A 1 166 ? 32.558 45.798 1.764   1.00 47.03  ? 166 ILE A C   1 
ATOM   1025 O O   . ILE A 1 166 ? 32.430 44.592 1.946   1.00 45.79  ? 166 ILE A O   1 
ATOM   1026 C CB  . ILE A 1 166 ? 34.697 46.868 2.275   1.00 48.22  ? 166 ILE A CB  1 
ATOM   1027 C CG1 . ILE A 1 166 ? 35.902 47.628 1.715   1.00 49.19  ? 166 ILE A CG1 1 
ATOM   1028 C CG2 . ILE A 1 166 ? 35.136 45.698 3.149   1.00 46.58  ? 166 ILE A CG2 1 
ATOM   1029 C CD1 . ILE A 1 166 ? 35.558 48.986 1.117   1.00 48.72  ? 166 ILE A CD1 1 
ATOM   1030 N N   . MET A 1 167 ? 31.642 46.694 2.121   1.00 47.25  ? 167 MET A N   1 
ATOM   1031 C CA  . MET A 1 167 ? 30.383 46.316 2.756   1.00 46.95  ? 167 MET A CA  1 
ATOM   1032 C C   . MET A 1 167 ? 29.575 45.398 1.861   1.00 47.78  ? 167 MET A C   1 
ATOM   1033 O O   . MET A 1 167 ? 29.165 44.309 2.263   1.00 48.27  ? 167 MET A O   1 
ATOM   1034 C CB  . MET A 1 167 ? 29.570 47.573 3.081   1.00 47.57  ? 167 MET A CB  1 
ATOM   1035 C CG  . MET A 1 167 ? 28.163 47.313 3.597   1.00 47.16  ? 167 MET A CG  1 
ATOM   1036 S SD  . MET A 1 167 ? 27.366 48.814 4.219   1.00 48.47  ? 167 MET A SD  1 
ATOM   1037 C CE  . MET A 1 167 ? 27.313 48.453 5.880   1.00 43.71  ? 167 MET A CE  1 
ATOM   1038 N N   . ALA A 1 168 ? 29.347 45.842 0.635   1.00 47.86  ? 168 ALA A N   1 
ATOM   1039 C CA  . ALA A 1 168 ? 28.582 45.049 -0.302  1.00 47.80  ? 168 ALA A CA  1 
ATOM   1040 C C   . ALA A 1 168 ? 29.244 43.690 -0.462  1.00 48.78  ? 168 ALA A C   1 
ATOM   1041 O O   . ALA A 1 168 ? 28.600 42.653 -0.365  1.00 48.62  ? 168 ALA A O   1 
ATOM   1042 C CB  . ALA A 1 168 ? 28.511 45.760 -1.632  1.00 45.46  ? 168 ALA A CB  1 
ATOM   1043 N N   . ALA A 1 169 ? 30.546 43.699 -0.693  1.00 50.25  ? 169 ALA A N   1 
ATOM   1044 C CA  . ALA A 1 169 ? 31.269 42.458 -0.886  1.00 51.93  ? 169 ALA A CA  1 
ATOM   1045 C C   . ALA A 1 169 ? 31.282 41.579 0.368   1.00 53.17  ? 169 ALA A C   1 
ATOM   1046 O O   . ALA A 1 169 ? 30.676 40.503 0.382   1.00 54.55  ? 169 ALA A O   1 
ATOM   1047 C CB  . ALA A 1 169 ? 32.672 42.764 -1.328  1.00 51.75  ? 169 ALA A CB  1 
ATOM   1048 N N   . VAL A 1 170 ? 31.981 42.036 1.407   1.00 51.72  ? 170 VAL A N   1 
ATOM   1049 C CA  . VAL A 1 170 ? 32.081 41.307 2.672   1.00 48.66  ? 170 VAL A CA  1 
ATOM   1050 C C   . VAL A 1 170 ? 30.699 40.950 3.179   1.00 47.37  ? 170 VAL A C   1 
ATOM   1051 O O   . VAL A 1 170 ? 30.403 39.787 3.446   1.00 46.45  ? 170 VAL A O   1 
ATOM   1052 C CB  . VAL A 1 170 ? 32.781 42.164 3.759   1.00 50.13  ? 170 VAL A CB  1 
ATOM   1053 C CG1 . VAL A 1 170 ? 32.807 41.429 5.092   1.00 45.52  ? 170 VAL A CG1 1 
ATOM   1054 C CG2 . VAL A 1 170 ? 34.187 42.507 3.315   1.00 51.84  ? 170 VAL A CG2 1 
ATOM   1055 N N   . GLY A 1 171 ? 29.858 41.972 3.300   1.00 46.00  ? 171 GLY A N   1 
ATOM   1056 C CA  . GLY A 1 171 ? 28.508 41.786 3.791   1.00 44.64  ? 171 GLY A CA  1 
ATOM   1057 C C   . GLY A 1 171 ? 27.584 41.097 2.815   1.00 44.33  ? 171 GLY A C   1 
ATOM   1058 O O   . GLY A 1 171 ? 26.603 40.479 3.232   1.00 44.40  ? 171 GLY A O   1 
ATOM   1059 N N   . ASN A 1 172 ? 27.903 41.190 1.525   1.00 43.29  ? 172 ASN A N   1 
ATOM   1060 C CA  . ASN A 1 172 ? 27.087 40.585 0.474   1.00 43.33  ? 172 ASN A CA  1 
ATOM   1061 C C   . ASN A 1 172 ? 25.681 41.141 0.603   1.00 42.76  ? 172 ASN A C   1 
ATOM   1062 O O   . ASN A 1 172 ? 24.735 40.420 0.909   1.00 43.65  ? 172 ASN A O   1 
ATOM   1063 C CB  . ASN A 1 172 ? 27.039 39.067 0.620   1.00 46.03  ? 172 ASN A CB  1 
ATOM   1064 C CG  . ASN A 1 172 ? 26.455 38.394 -0.597  1.00 48.26  ? 172 ASN A CG  1 
ATOM   1065 O OD1 . ASN A 1 172 ? 25.852 37.323 -0.502  1.00 50.75  ? 172 ASN A OD1 1 
ATOM   1066 N ND2 . ASN A 1 172 ? 26.636 39.017 -1.759  1.00 47.69  ? 172 ASN A ND2 1 
ATOM   1067 N N   . VAL A 1 173 ? 25.557 42.438 0.371   1.00 41.35  ? 173 VAL A N   1 
ATOM   1068 C CA  . VAL A 1 173 ? 24.293 43.123 0.493   1.00 40.16  ? 173 VAL A CA  1 
ATOM   1069 C C   . VAL A 1 173 ? 24.357 44.281 -0.450  1.00 41.56  ? 173 VAL A C   1 
ATOM   1070 O O   . VAL A 1 173 ? 25.437 44.709 -0.827  1.00 45.29  ? 173 VAL A O   1 
ATOM   1071 C CB  . VAL A 1 173 ? 24.112 43.693 1.898   1.00 38.82  ? 173 VAL A CB  1 
ATOM   1072 C CG1 . VAL A 1 173 ? 23.921 42.573 2.908   1.00 40.67  ? 173 VAL A CG1 1 
ATOM   1073 C CG2 . VAL A 1 173 ? 25.329 44.507 2.267   1.00 38.52  ? 173 VAL A CG2 1 
ATOM   1074 N N   . ILE A 1 174 ? 23.203 44.802 -0.829  1.00 43.28  ? 174 ILE A N   1 
ATOM   1075 C CA  . ILE A 1 174 ? 23.170 45.941 -1.730  1.00 42.96  ? 174 ILE A CA  1 
ATOM   1076 C C   . ILE A 1 174 ? 23.320 47.192 -0.894  1.00 41.98  ? 174 ILE A C   1 
ATOM   1077 O O   . ILE A 1 174 ? 22.521 47.436 0.007   1.00 43.09  ? 174 ILE A O   1 
ATOM   1078 C CB  . ILE A 1 174 ? 21.818 46.078 -2.481  1.00 43.68  ? 174 ILE A CB  1 
ATOM   1079 C CG1 . ILE A 1 174 ? 21.514 44.819 -3.299  1.00 44.43  ? 174 ILE A CG1 1 
ATOM   1080 C CG2 . ILE A 1 174 ? 21.863 47.299 -3.389  1.00 42.49  ? 174 ILE A CG2 1 
ATOM   1081 C CD1 . ILE A 1 174 ? 22.453 44.585 -4.440  1.00 46.23  ? 174 ILE A CD1 1 
ATOM   1082 N N   . VAL A 1 175 ? 24.352 47.976 -1.172  1.00 40.68  ? 175 VAL A N   1 
ATOM   1083 C CA  . VAL A 1 175 ? 24.519 49.232 -0.468  1.00 38.77  ? 175 VAL A CA  1 
ATOM   1084 C C   . VAL A 1 175 ? 24.238 50.339 -1.478  1.00 39.18  ? 175 VAL A C   1 
ATOM   1085 O O   . VAL A 1 175 ? 24.683 50.277 -2.634  1.00 40.63  ? 175 VAL A O   1 
ATOM   1086 C CB  . VAL A 1 175 ? 25.924 49.423 0.065   1.00 37.22  ? 175 VAL A CB  1 
ATOM   1087 C CG1 . VAL A 1 175 ? 25.923 50.617 0.988   1.00 36.38  ? 175 VAL A CG1 1 
ATOM   1088 C CG2 . VAL A 1 175 ? 26.394 48.167 0.776   1.00 34.50  ? 175 VAL A CG2 1 
ATOM   1089 N N   . ALA A 1 176 ? 23.495 51.349 -1.057  1.00 36.39  ? 176 ALA A N   1 
ATOM   1090 C CA  . ALA A 1 176 ? 23.189 52.430 -1.967  1.00 36.26  ? 176 ALA A CA  1 
ATOM   1091 C C   . ALA A 1 176 ? 23.237 53.767 -1.259  1.00 36.22  ? 176 ALA A C   1 
ATOM   1092 O O   . ALA A 1 176 ? 22.830 53.891 -0.104  1.00 36.29  ? 176 ALA A O   1 
ATOM   1093 C CB  . ALA A 1 176 ? 21.809 52.208 -2.597  1.00 35.23  ? 176 ALA A CB  1 
ATOM   1094 N N   . SER A 1 177 ? 23.761 54.768 -1.951  1.00 36.33  ? 177 SER A N   1 
ATOM   1095 C CA  . SER A 1 177 ? 23.823 56.104 -1.386  1.00 37.21  ? 177 SER A CA  1 
ATOM   1096 C C   . SER A 1 177 ? 23.277 57.045 -2.433  1.00 38.03  ? 177 SER A C   1 
ATOM   1097 O O   . SER A 1 177 ? 22.982 56.640 -3.558  1.00 38.42  ? 177 SER A O   1 
ATOM   1098 C CB  . SER A 1 177 ? 25.261 56.497 -1.014  1.00 37.77  ? 177 SER A CB  1 
ATOM   1099 O OG  . SER A 1 177 ? 26.105 56.585 -2.153  1.00 39.34  ? 177 SER A OG  1 
ATOM   1100 N N   . PHE A 1 178 ? 23.151 58.311 -2.068  1.00 39.03  ? 178 PHE A N   1 
ATOM   1101 C CA  . PHE A 1 178 ? 22.629 59.294 -2.994  1.00 37.64  ? 178 PHE A CA  1 
ATOM   1102 C C   . PHE A 1 178 ? 22.811 60.688 -2.427  1.00 37.35  ? 178 PHE A C   1 
ATOM   1103 O O   . PHE A 1 178 ? 22.959 60.872 -1.227  1.00 34.93  ? 178 PHE A O   1 
ATOM   1104 C CB  . PHE A 1 178 ? 21.156 59.016 -3.229  1.00 34.67  ? 178 PHE A CB  1 
ATOM   1105 C CG  . PHE A 1 178 ? 20.356 58.978 -1.971  1.00 35.55  ? 178 PHE A CG  1 
ATOM   1106 C CD1 . PHE A 1 178 ? 19.896 60.159 -1.387  1.00 35.57  ? 178 PHE A CD1 1 
ATOM   1107 C CD2 . PHE A 1 178 ? 20.102 57.763 -1.336  1.00 35.76  ? 178 PHE A CD2 1 
ATOM   1108 C CE1 . PHE A 1 178 ? 19.195 60.127 -0.185  1.00 34.20  ? 178 PHE A CE1 1 
ATOM   1109 C CE2 . PHE A 1 178 ? 19.406 57.715 -0.137  1.00 33.63  ? 178 PHE A CE2 1 
ATOM   1110 C CZ  . PHE A 1 178 ? 18.950 58.898 0.442   1.00 35.44  ? 178 PHE A CZ  1 
ATOM   1111 N N   . GLN A 1 179 ? 22.810 61.673 -3.303  1.00 39.97  ? 179 GLN A N   1 
ATOM   1112 C CA  . GLN A 1 179 ? 22.948 63.041 -2.849  1.00 43.74  ? 179 GLN A CA  1 
ATOM   1113 C C   . GLN A 1 179 ? 21.529 63.604 -2.669  1.00 44.60  ? 179 GLN A C   1 
ATOM   1114 O O   . GLN A 1 179 ? 20.625 63.318 -3.457  1.00 45.01  ? 179 GLN A O   1 
ATOM   1115 C CB  . GLN A 1 179 ? 23.726 63.893 -3.876  1.00 43.37  ? 179 GLN A CB  1 
ATOM   1116 C CG  . GLN A 1 179 ? 25.071 63.314 -4.351  1.00 46.26  ? 179 GLN A CG  1 
ATOM   1117 C CD  . GLN A 1 179 ? 26.114 63.165 -3.243  1.00 47.76  ? 179 GLN A CD  1 
ATOM   1118 O OE1 . GLN A 1 179 ? 27.270 62.861 -3.513  1.00 48.75  ? 179 GLN A OE1 1 
ATOM   1119 N NE2 . GLN A 1 179 ? 25.707 63.370 -2.000  1.00 48.83  ? 179 GLN A NE2 1 
ATOM   1120 N N   . TYR A 1 180 ? 21.340 64.367 -1.598  1.00 43.98  ? 180 TYR A N   1 
ATOM   1121 C CA  . TYR A 1 180 ? 20.071 65.020 -1.305  1.00 41.73  ? 180 TYR A CA  1 
ATOM   1122 C C   . TYR A 1 180 ? 20.448 66.485 -1.148  1.00 42.03  ? 180 TYR A C   1 
ATOM   1123 O O   . TYR A 1 180 ? 21.484 66.789 -0.562  1.00 43.71  ? 180 TYR A O   1 
ATOM   1124 C CB  . TYR A 1 180 ? 19.442 64.483 -0.001  1.00 38.17  ? 180 TYR A CB  1 
ATOM   1125 C CG  . TYR A 1 180 ? 20.272 64.622 1.265   1.00 32.94  ? 180 TYR A CG  1 
ATOM   1126 C CD1 . TYR A 1 180 ? 20.185 65.766 2.057   1.00 29.98  ? 180 TYR A CD1 1 
ATOM   1127 C CD2 . TYR A 1 180 ? 21.116 63.595 1.688   1.00 31.79  ? 180 TYR A CD2 1 
ATOM   1128 C CE1 . TYR A 1 180 ? 20.915 65.891 3.233   1.00 28.58  ? 180 TYR A CE1 1 
ATOM   1129 C CE2 . TYR A 1 180 ? 21.850 63.707 2.869   1.00 32.05  ? 180 TYR A CE2 1 
ATOM   1130 C CZ  . TYR A 1 180 ? 21.743 64.861 3.635   1.00 30.38  ? 180 TYR A CZ  1 
ATOM   1131 O OH  . TYR A 1 180 ? 22.483 64.990 4.790   1.00 29.70  ? 180 TYR A OH  1 
ATOM   1132 N N   . ARG A 1 181 ? 19.647 67.397 -1.676  1.00 41.29  ? 181 ARG A N   1 
ATOM   1133 C CA  . ARG A 1 181 ? 20.002 68.800 -1.545  1.00 42.07  ? 181 ARG A CA  1 
ATOM   1134 C C   . ARG A 1 181 ? 20.286 69.182 -0.088  1.00 44.98  ? 181 ARG A C   1 
ATOM   1135 O O   . ARG A 1 181 ? 19.606 68.735 0.835   1.00 46.67  ? 181 ARG A O   1 
ATOM   1136 C CB  . ARG A 1 181 ? 18.905 69.683 -2.147  1.00 40.14  ? 181 ARG A CB  1 
ATOM   1137 C CG  . ARG A 1 181 ? 19.018 69.837 -3.657  1.00 35.61  ? 181 ARG A CG  1 
ATOM   1138 C CD  . ARG A 1 181 ? 17.796 70.499 -4.254  1.00 35.69  ? 181 ARG A CD  1 
ATOM   1139 N NE  . ARG A 1 181 ? 16.634 69.611 -4.243  1.00 38.49  ? 181 ARG A NE  1 
ATOM   1140 C CZ  . ARG A 1 181 ? 15.391 70.006 -4.498  1.00 39.89  ? 181 ARG A CZ  1 
ATOM   1141 N NH1 . ARG A 1 181 ? 15.143 71.283 -4.782  1.00 40.35  ? 181 ARG A NH1 1 
ATOM   1142 N NH2 . ARG A 1 181 ? 14.396 69.126 -4.474  1.00 40.46  ? 181 ARG A NH2 1 
ATOM   1143 N N   . VAL A 1 182 ? 21.327 69.991 0.098   1.00 48.66  ? 182 VAL A N   1 
ATOM   1144 C CA  . VAL A 1 182 ? 21.766 70.475 1.407   1.00 48.72  ? 182 VAL A CA  1 
ATOM   1145 C C   . VAL A 1 182 ? 21.716 71.997 1.407   1.00 49.91  ? 182 VAL A C   1 
ATOM   1146 O O   . VAL A 1 182 ? 21.556 72.617 0.352   1.00 51.43  ? 182 VAL A O   1 
ATOM   1147 C CB  . VAL A 1 182 ? 23.208 70.082 1.681   1.00 48.96  ? 182 VAL A CB  1 
ATOM   1148 C CG1 . VAL A 1 182 ? 23.318 68.572 1.863   1.00 49.67  ? 182 VAL A CG1 1 
ATOM   1149 C CG2 . VAL A 1 182 ? 24.072 70.558 0.522   1.00 47.88  ? 182 VAL A CG2 1 
ATOM   1150 N N   . GLY A 1 183 ? 21.879 72.593 2.585   1.00 49.99  ? 183 GLY A N   1 
ATOM   1151 C CA  . GLY A 1 183 ? 21.836 74.040 2.693   1.00 47.94  ? 183 GLY A CA  1 
ATOM   1152 C C   . GLY A 1 183 ? 20.523 74.594 2.181   1.00 47.58  ? 183 GLY A C   1 
ATOM   1153 O O   . GLY A 1 183 ? 19.558 73.865 1.987   1.00 47.93  ? 183 GLY A O   1 
ATOM   1154 N N   . ALA A 1 184 ? 20.487 75.895 1.944   1.00 48.24  ? 184 ALA A N   1 
ATOM   1155 C CA  . ALA A 1 184 ? 19.280 76.544 1.466   1.00 48.98  ? 184 ALA A CA  1 
ATOM   1156 C C   . ALA A 1 184 ? 18.643 75.809 0.306   1.00 50.66  ? 184 ALA A C   1 
ATOM   1157 O O   . ALA A 1 184 ? 17.424 75.835 0.137   1.00 51.10  ? 184 ALA A O   1 
ATOM   1158 C CB  . ALA A 1 184 ? 19.598 77.950 1.055   1.00 50.10  ? 184 ALA A CB  1 
ATOM   1159 N N   . PHE A 1 185 ? 19.480 75.157 -0.491  1.00 52.48  ? 185 PHE A N   1 
ATOM   1160 C CA  . PHE A 1 185 ? 19.023 74.426 -1.667  1.00 55.29  ? 185 PHE A CA  1 
ATOM   1161 C C   . PHE A 1 185 ? 18.025 73.331 -1.319  1.00 56.01  ? 185 PHE A C   1 
ATOM   1162 O O   . PHE A 1 185 ? 17.158 72.986 -2.135  1.00 56.30  ? 185 PHE A O   1 
ATOM   1163 C CB  . PHE A 1 185 ? 20.219 73.806 -2.378  1.00 55.39  ? 185 PHE A CB  1 
ATOM   1164 C CG  . PHE A 1 185 ? 21.318 74.776 -2.653  1.00 56.38  ? 185 PHE A CG  1 
ATOM   1165 C CD1 . PHE A 1 185 ? 21.198 75.714 -3.670  1.00 56.57  ? 185 PHE A CD1 1 
ATOM   1166 C CD2 . PHE A 1 185 ? 22.472 74.764 -1.883  1.00 57.26  ? 185 PHE A CD2 1 
ATOM   1167 C CE1 . PHE A 1 185 ? 22.218 76.628 -3.917  1.00 58.37  ? 185 PHE A CE1 1 
ATOM   1168 C CE2 . PHE A 1 185 ? 23.496 75.670 -2.118  1.00 58.64  ? 185 PHE A CE2 1 
ATOM   1169 C CZ  . PHE A 1 185 ? 23.371 76.606 -3.139  1.00 58.49  ? 185 PHE A CZ  1 
ATOM   1170 N N   . GLY A 1 186 ? 18.152 72.797 -0.105  1.00 55.70  ? 186 GLY A N   1 
ATOM   1171 C CA  . GLY A 1 186 ? 17.272 71.728 0.331   1.00 54.82  ? 186 GLY A CA  1 
ATOM   1172 C C   . GLY A 1 186 ? 16.245 72.031 1.411   1.00 53.57  ? 186 GLY A C   1 
ATOM   1173 O O   . GLY A 1 186 ? 15.234 71.319 1.517   1.00 51.27  ? 186 GLY A O   1 
ATOM   1174 N N   . PHE A 1 187 ? 16.460 73.077 2.207   1.00 51.28  ? 187 PHE A N   1 
ATOM   1175 C CA  . PHE A 1 187 ? 15.500 73.345 3.261   1.00 50.17  ? 187 PHE A CA  1 
ATOM   1176 C C   . PHE A 1 187 ? 14.921 74.738 3.357   1.00 50.69  ? 187 PHE A C   1 
ATOM   1177 O O   . PHE A 1 187 ? 14.335 75.105 4.380   1.00 50.73  ? 187 PHE A O   1 
ATOM   1178 C CB  . PHE A 1 187 ? 16.101 72.938 4.589   1.00 48.32  ? 187 PHE A CB  1 
ATOM   1179 C CG  . PHE A 1 187 ? 16.655 71.550 4.580   1.00 46.08  ? 187 PHE A CG  1 
ATOM   1180 C CD1 . PHE A 1 187 ? 17.928 71.304 4.068   1.00 42.48  ? 187 PHE A CD1 1 
ATOM   1181 C CD2 . PHE A 1 187 ? 15.904 70.485 5.066   1.00 43.62  ? 187 PHE A CD2 1 
ATOM   1182 C CE1 . PHE A 1 187 ? 18.450 70.028 4.040   1.00 40.87  ? 187 PHE A CE1 1 
ATOM   1183 C CE2 . PHE A 1 187 ? 16.418 69.196 5.043   1.00 42.19  ? 187 PHE A CE2 1 
ATOM   1184 C CZ  . PHE A 1 187 ? 17.699 68.968 4.528   1.00 42.38  ? 187 PHE A CZ  1 
ATOM   1185 N N   . LEU A 1 188 ? 15.056 75.499 2.281   1.00 50.36  ? 188 LEU A N   1 
ATOM   1186 C CA  . LEU A 1 188 ? 14.528 76.845 2.241   1.00 48.71  ? 188 LEU A CA  1 
ATOM   1187 C C   . LEU A 1 188 ? 13.027 76.794 2.471   1.00 48.06  ? 188 LEU A C   1 
ATOM   1188 O O   . LEU A 1 188 ? 12.270 76.437 1.567   1.00 49.35  ? 188 LEU A O   1 
ATOM   1189 C CB  . LEU A 1 188 ? 14.816 77.464 0.886   1.00 48.37  ? 188 LEU A CB  1 
ATOM   1190 C CG  . LEU A 1 188 ? 14.495 78.948 0.795   1.00 49.87  ? 188 LEU A CG  1 
ATOM   1191 C CD1 . LEU A 1 188 ? 15.318 79.701 1.849   1.00 51.59  ? 188 LEU A CD1 1 
ATOM   1192 C CD2 . LEU A 1 188 ? 14.811 79.449 -0.613  1.00 50.43  ? 188 LEU A CD2 1 
ATOM   1193 N N   . HIS A 1 189 ? 12.601 77.152 3.680   1.00 47.15  ? 189 HIS A N   1 
ATOM   1194 C CA  . HIS A 1 189 ? 11.182 77.141 4.053   1.00 47.81  ? 189 HIS A CA  1 
ATOM   1195 C C   . HIS A 1 189 ? 10.656 78.565 3.939   1.00 46.74  ? 189 HIS A C   1 
ATOM   1196 O O   . HIS A 1 189 ? 11.143 79.453 4.618   1.00 46.89  ? 189 HIS A O   1 
ATOM   1197 C CB  . HIS A 1 189 ? 11.033 76.621 5.502   1.00 48.38  ? 189 HIS A CB  1 
ATOM   1198 C CG  . HIS A 1 189 ? 9.618  76.442 5.968   1.00 49.79  ? 189 HIS A CG  1 
ATOM   1199 N ND1 . HIS A 1 189 ? 8.772  75.473 5.469   1.00 49.76  ? 189 HIS A ND1 1 
ATOM   1200 C CD2 . HIS A 1 189 ? 8.903  77.088 6.932   1.00 49.44  ? 189 HIS A CD2 1 
ATOM   1201 C CE1 . HIS A 1 189 ? 7.611  75.526 6.097   1.00 47.28  ? 189 HIS A CE1 1 
ATOM   1202 N NE2 . HIS A 1 189 ? 7.669  76.501 6.991   1.00 46.49  ? 189 HIS A NE2 1 
ATOM   1203 N N   . LEU A 1 190 ? 9.665  78.784 3.082   1.00 46.66  ? 190 LEU A N   1 
ATOM   1204 C CA  . LEU A 1 190 ? 9.116  80.124 2.900   1.00 46.82  ? 190 LEU A CA  1 
ATOM   1205 C C   . LEU A 1 190 ? 7.623  80.052 2.608   1.00 47.11  ? 190 LEU A C   1 
ATOM   1206 O O   . LEU A 1 190 ? 6.969  81.070 2.408   1.00 46.49  ? 190 LEU A O   1 
ATOM   1207 C CB  . LEU A 1 190 ? 9.825  80.822 1.727   1.00 46.36  ? 190 LEU A CB  1 
ATOM   1208 C CG  . LEU A 1 190 ? 11.360 80.791 1.687   1.00 46.74  ? 190 LEU A CG  1 
ATOM   1209 C CD1 . LEU A 1 190 ? 11.856 81.194 0.325   1.00 45.73  ? 190 LEU A CD1 1 
ATOM   1210 C CD2 . LEU A 1 190 ? 11.926 81.721 2.733   1.00 47.90  ? 190 LEU A CD2 1 
ATOM   1211 N N   . ALA A 1 191 ? 7.084  78.842 2.591   1.00 47.94  ? 191 ALA A N   1 
ATOM   1212 C CA  . ALA A 1 191 ? 5.677  78.650 2.275   1.00 49.62  ? 191 ALA A CA  1 
ATOM   1213 C C   . ALA A 1 191 ? 4.718  79.471 3.116   1.00 50.94  ? 191 ALA A C   1 
ATOM   1214 O O   . ALA A 1 191 ? 3.811  80.094 2.588   1.00 51.56  ? 191 ALA A O   1 
ATOM   1215 C CB  . ALA A 1 191 ? 5.320  77.178 2.384   1.00 50.47  ? 191 ALA A CB  1 
ATOM   1216 N N   . PRO A 1 192 ? 4.901  79.477 4.440   1.00 53.12  ? 192 PRO A N   1 
ATOM   1217 C CA  . PRO A 1 192 ? 4.017  80.237 5.325   1.00 55.05  ? 192 PRO A CA  1 
ATOM   1218 C C   . PRO A 1 192 ? 3.863  81.719 4.965   1.00 56.60  ? 192 PRO A C   1 
ATOM   1219 O O   . PRO A 1 192 ? 2.813  82.310 5.225   1.00 56.42  ? 192 PRO A O   1 
ATOM   1220 C CB  . PRO A 1 192 ? 4.655  80.035 6.694   1.00 56.54  ? 192 PRO A CB  1 
ATOM   1221 C CG  . PRO A 1 192 ? 5.276  78.676 6.574   1.00 55.03  ? 192 PRO A CG  1 
ATOM   1222 C CD  . PRO A 1 192 ? 5.929  78.769 5.222   1.00 54.23  ? 192 PRO A CD  1 
ATOM   1223 N N   . GLU A 1 193 ? 4.900  82.310 4.369   1.00 57.75  ? 193 GLU A N   1 
ATOM   1224 C CA  . GLU A 1 193 ? 4.870  83.721 3.976   1.00 58.77  ? 193 GLU A CA  1 
ATOM   1225 C C   . GLU A 1 193 ? 3.998  83.986 2.759   1.00 58.87  ? 193 GLU A C   1 
ATOM   1226 O O   . GLU A 1 193 ? 3.135  84.861 2.776   1.00 60.38  ? 193 GLU A O   1 
ATOM   1227 C CB  . GLU A 1 193 ? 6.281  84.227 3.694   1.00 59.33  ? 193 GLU A CB  1 
ATOM   1228 C CG  . GLU A 1 193 ? 7.157  84.313 4.931   1.00 63.04  ? 193 GLU A CG  1 
ATOM   1229 C CD  . GLU A 1 193 ? 6.648  85.318 5.961   1.00 65.35  ? 193 GLU A CD  1 
ATOM   1230 O OE1 . GLU A 1 193 ? 6.549  86.525 5.635   1.00 64.20  ? 193 GLU A OE1 1 
ATOM   1231 O OE2 . GLU A 1 193 ? 6.350  84.897 7.102   1.00 67.49  ? 193 GLU A OE2 1 
ATOM   1232 N N   . MET A 1 194 ? 4.224  83.238 1.694   1.00 58.53  ? 194 MET A N   1 
ATOM   1233 C CA  . MET A 1 194 ? 3.431  83.415 0.488   1.00 58.31  ? 194 MET A CA  1 
ATOM   1234 C C   . MET A 1 194 ? 2.083  82.735 0.637   1.00 56.74  ? 194 MET A C   1 
ATOM   1235 O O   . MET A 1 194 ? 1.909  81.868 1.487   1.00 56.38  ? 194 MET A O   1 
ATOM   1236 C CB  . MET A 1 194 ? 4.183  82.834 -0.703  1.00 60.15  ? 194 MET A CB  1 
ATOM   1237 C CG  . MET A 1 194 ? 5.310  81.921 -0.282  1.00 62.68  ? 194 MET A CG  1 
ATOM   1238 S SD  . MET A 1 194 ? 6.138  81.181 -1.670  1.00 67.01  ? 194 MET A SD  1 
ATOM   1239 C CE  . MET A 1 194 ? 7.751  81.970 -1.579  1.00 64.28  ? 194 MET A CE  1 
ATOM   1240 N N   . PRO A 1 195 ? 1.096  83.146 -0.167  1.00 56.51  ? 195 PRO A N   1 
ATOM   1241 C CA  . PRO A 1 195 ? -0.234 82.532 -0.089  1.00 56.43  ? 195 PRO A CA  1 
ATOM   1242 C C   . PRO A 1 195 ? -0.155 81.057 -0.461  1.00 56.94  ? 195 PRO A C   1 
ATOM   1243 O O   . PRO A 1 195 ? 0.901  80.588 -0.900  1.00 57.63  ? 195 PRO A O   1 
ATOM   1244 C CB  . PRO A 1 195 ? -1.067 83.364 -1.068  1.00 57.01  ? 195 PRO A CB  1 
ATOM   1245 C CG  . PRO A 1 195 ? -0.052 84.002 -1.967  1.00 57.26  ? 195 PRO A CG  1 
ATOM   1246 C CD  . PRO A 1 195 ? 1.084  84.325 -1.044  1.00 56.54  ? 195 PRO A CD  1 
ATOM   1247 N N   . SER A 1 196 ? -1.260 80.331 -0.291  1.00 56.73  ? 196 SER A N   1 
ATOM   1248 C CA  . SER A 1 196 ? -1.287 78.889 -0.564  1.00 56.32  ? 196 SER A CA  1 
ATOM   1249 C C   . SER A 1 196 ? -0.912 78.494 -1.983  1.00 55.64  ? 196 SER A C   1 
ATOM   1250 O O   . SER A 1 196 ? -0.200 77.513 -2.197  1.00 55.21  ? 196 SER A O   1 
ATOM   1251 C CB  . SER A 1 196 ? -2.665 78.311 -0.247  1.00 55.52  ? 196 SER A CB  1 
ATOM   1252 O OG  . SER A 1 196 ? -3.586 78.672 -1.250  1.00 55.96  ? 196 SER A OG  1 
ATOM   1253 N N   A GLU A 1 197 ? -1.393 79.265 -2.955  0.50 55.28  ? 197 GLU A N   1 
ATOM   1254 N N   B GLU A 1 197 ? -1.395 79.268 -2.945  0.50 56.05  ? 197 GLU A N   1 
ATOM   1255 C CA  A GLU A 1 197 ? -1.124 78.982 -4.362  0.50 54.60  ? 197 GLU A CA  1 
ATOM   1256 C CA  B GLU A 1 197 ? -1.130 79.008 -4.350  0.50 56.01  ? 197 GLU A CA  1 
ATOM   1257 C C   A GLU A 1 197 ? 0.358  78.767 -4.638  0.50 54.81  ? 197 GLU A C   1 
ATOM   1258 C C   B GLU A 1 197 ? 0.350  78.793 -4.645  0.50 55.67  ? 197 GLU A C   1 
ATOM   1259 O O   A GLU A 1 197 ? 0.720  78.122 -5.620  0.50 55.86  ? 197 GLU A O   1 
ATOM   1260 O O   B GLU A 1 197 ? 0.702  78.169 -5.645  0.50 56.58  ? 197 GLU A O   1 
ATOM   1261 C CB  A GLU A 1 197 ? -1.644 80.120 -5.255  0.50 53.67  ? 197 GLU A CB  1 
ATOM   1262 C CB  B GLU A 1 197 ? -1.661 80.169 -5.188  0.50 56.61  ? 197 GLU A CB  1 
ATOM   1263 C CG  A GLU A 1 197 ? -0.643 81.245 -5.514  0.50 50.45  ? 197 GLU A CG  1 
ATOM   1264 C CG  B GLU A 1 197 ? -3.131 80.471 -4.947  0.50 56.35  ? 197 GLU A CG  1 
ATOM   1265 C CD  A GLU A 1 197 ? -1.119 82.234 -6.569  0.50 49.49  ? 197 GLU A CD  1 
ATOM   1266 C CD  B GLU A 1 197 ? -4.015 79.262 -5.166  0.50 56.18  ? 197 GLU A CD  1 
ATOM   1267 O OE1 A GLU A 1 197 ? -1.492 81.808 -7.683  0.50 48.45  ? 197 GLU A OE1 1 
ATOM   1268 O OE1 B GLU A 1 197 ? -3.543 78.266 -5.756  0.50 56.86  ? 197 GLU A OE1 1 
ATOM   1269 O OE2 A GLU A 1 197 ? -1.114 83.446 -6.288  0.50 49.56  ? 197 GLU A OE2 1 
ATOM   1270 O OE2 B GLU A 1 197 ? -5.190 79.312 -4.755  0.50 56.50  ? 197 GLU A OE2 1 
ATOM   1271 N N   . PHE A 1 198 ? 1.209  79.309 -3.773  1.00 54.75  ? 198 PHE A N   1 
ATOM   1272 C CA  . PHE A 1 198 ? 2.653  79.183 -3.945  1.00 54.95  ? 198 PHE A CA  1 
ATOM   1273 C C   . PHE A 1 198 ? 3.251  78.161 -2.993  1.00 53.80  ? 198 PHE A C   1 
ATOM   1274 O O   . PHE A 1 198 ? 4.476  78.074 -2.826  1.00 52.94  ? 198 PHE A O   1 
ATOM   1275 C CB  . PHE A 1 198 ? 3.315  80.536 -3.706  1.00 58.95  ? 198 PHE A CB  1 
ATOM   1276 C CG  . PHE A 1 198 ? 2.828  81.617 -4.624  1.00 62.94  ? 198 PHE A CG  1 
ATOM   1277 C CD1 . PHE A 1 198 ? 3.166  81.610 -5.976  1.00 63.81  ? 198 PHE A CD1 1 
ATOM   1278 C CD2 . PHE A 1 198 ? 2.040  82.649 -4.137  1.00 65.16  ? 198 PHE A CD2 1 
ATOM   1279 C CE1 . PHE A 1 198 ? 2.726  82.619 -6.826  1.00 65.18  ? 198 PHE A CE1 1 
ATOM   1280 C CE2 . PHE A 1 198 ? 1.594  83.662 -4.974  1.00 66.24  ? 198 PHE A CE2 1 
ATOM   1281 C CZ  . PHE A 1 198 ? 1.939  83.648 -6.323  1.00 67.73  ? 198 PHE A CZ  1 
ATOM   1282 N N   . ALA A 1 199 ? 2.377  77.389 -2.366  1.00 51.23  ? 199 ALA A N   1 
ATOM   1283 C CA  . ALA A 1 199 ? 2.819  76.383 -1.423  1.00 49.10  ? 199 ALA A CA  1 
ATOM   1284 C C   . ALA A 1 199 ? 3.985  75.573 -1.966  1.00 46.97  ? 199 ALA A C   1 
ATOM   1285 O O   . ALA A 1 199 ? 4.905  75.248 -1.226  1.00 47.54  ? 199 ALA A O   1 
ATOM   1286 C CB  . ALA A 1 199 ? 1.668  75.469 -1.069  1.00 49.67  ? 199 ALA A CB  1 
ATOM   1287 N N   . GLU A 1 200 ? 3.962  75.260 -3.256  1.00 45.13  ? 200 GLU A N   1 
ATOM   1288 C CA  . GLU A 1 200 ? 5.033  74.466 -3.832  1.00 45.53  ? 200 GLU A CA  1 
ATOM   1289 C C   . GLU A 1 200 ? 6.295  75.211 -4.206  1.00 45.37  ? 200 GLU A C   1 
ATOM   1290 O O   . GLU A 1 200 ? 7.259  74.596 -4.665  1.00 44.58  ? 200 GLU A O   1 
ATOM   1291 C CB  . GLU A 1 200 ? 4.521  73.689 -5.041  1.00 46.95  ? 200 GLU A CB  1 
ATOM   1292 C CG  . GLU A 1 200 ? 3.680  72.508 -4.634  1.00 50.42  ? 200 GLU A CG  1 
ATOM   1293 C CD  . GLU A 1 200 ? 4.380  71.675 -3.579  1.00 53.08  ? 200 GLU A CD  1 
ATOM   1294 O OE1 . GLU A 1 200 ? 5.630  71.610 -3.614  1.00 54.42  ? 200 GLU A OE1 1 
ATOM   1295 O OE2 . GLU A 1 200 ? 3.688  71.090 -2.717  1.00 54.20  ? 200 GLU A OE2 1 
ATOM   1296 N N   . GLU A 1 201 ? 6.309  76.522 -3.987  1.00 44.79  ? 201 GLU A N   1 
ATOM   1297 C CA  . GLU A 1 201 ? 7.475  77.310 -4.345  1.00 44.83  ? 201 GLU A CA  1 
ATOM   1298 C C   . GLU A 1 201 ? 8.639  77.076 -3.413  1.00 44.94  ? 201 GLU A C   1 
ATOM   1299 O O   . GLU A 1 201 ? 9.759  76.832 -3.852  1.00 43.96  ? 201 GLU A O   1 
ATOM   1300 C CB  . GLU A 1 201 ? 7.134  78.793 -4.367  1.00 46.35  ? 201 GLU A CB  1 
ATOM   1301 C CG  . GLU A 1 201 ? 8.194  79.630 -5.094  1.00 46.19  ? 201 GLU A CG  1 
ATOM   1302 C CD  . GLU A 1 201 ? 8.230  79.392 -6.609  1.00 45.10  ? 201 GLU A CD  1 
ATOM   1303 O OE1 . GLU A 1 201 ? 7.147  79.375 -7.252  1.00 39.59  ? 201 GLU A OE1 1 
ATOM   1304 O OE2 . GLU A 1 201 ? 9.348  79.236 -7.154  1.00 44.61  ? 201 GLU A OE2 1 
ATOM   1305 N N   . ALA A 1 202 ? 8.376  77.180 -2.120  1.00 46.59  ? 202 ALA A N   1 
ATOM   1306 C CA  . ALA A 1 202 ? 9.402  76.951 -1.108  1.00 49.63  ? 202 ALA A CA  1 
ATOM   1307 C C   . ALA A 1 202 ? 8.705  76.299 0.083   1.00 49.60  ? 202 ALA A C   1 
ATOM   1308 O O   . ALA A 1 202 ? 8.373  76.959 1.068   1.00 52.20  ? 202 ALA A O   1 
ATOM   1309 C CB  . ALA A 1 202 ? 10.047 78.268 -0.698  1.00 50.66  ? 202 ALA A CB  1 
ATOM   1310 N N   . PRO A 1 203 ? 8.471  74.980 -0.002  1.00 47.76  ? 203 PRO A N   1 
ATOM   1311 C CA  . PRO A 1 203 ? 7.805  74.195 1.041   1.00 44.38  ? 203 PRO A CA  1 
ATOM   1312 C C   . PRO A 1 203 ? 8.743  73.832 2.181   1.00 41.02  ? 203 PRO A C   1 
ATOM   1313 O O   . PRO A 1 203 ? 8.302  73.540 3.286   1.00 39.55  ? 203 PRO A O   1 
ATOM   1314 C CB  . PRO A 1 203 ? 7.352  72.963 0.277   1.00 45.62  ? 203 PRO A CB  1 
ATOM   1315 C CG  . PRO A 1 203 ? 8.554  72.720 -0.621  1.00 45.29  ? 203 PRO A CG  1 
ATOM   1316 C CD  . PRO A 1 203 ? 8.906  74.112 -1.116  1.00 46.47  ? 203 PRO A CD  1 
ATOM   1317 N N   . GLY A 1 204 ? 10.039 73.846 1.888   1.00 38.92  ? 204 GLY A N   1 
ATOM   1318 C CA  . GLY A 1 204 ? 11.035 73.489 2.875   1.00 36.68  ? 204 GLY A CA  1 
ATOM   1319 C C   . GLY A 1 204 ? 11.251 71.985 2.888   1.00 37.29  ? 204 GLY A C   1 
ATOM   1320 O O   . GLY A 1 204 ? 10.518 71.228 2.243   1.00 35.91  ? 204 GLY A O   1 
ATOM   1321 N N   . ASN A 1 205 ? 12.266 71.544 3.619   1.00 37.02  ? 205 ASN A N   1 
ATOM   1322 C CA  . ASN A 1 205 ? 12.557 70.122 3.720   1.00 36.52  ? 205 ASN A CA  1 
ATOM   1323 C C   . ASN A 1 205 ? 12.774 69.372 2.417   1.00 34.42  ? 205 ASN A C   1 
ATOM   1324 O O   . ASN A 1 205 ? 12.996 68.170 2.450   1.00 34.42  ? 205 ASN A O   1 
ATOM   1325 C CB  . ASN A 1 205 ? 11.434 69.407 4.461   1.00 38.55  ? 205 ASN A CB  1 
ATOM   1326 C CG  . ASN A 1 205 ? 11.427 69.704 5.924   1.00 40.14  ? 205 ASN A CG  1 
ATOM   1327 O OD1 . ASN A 1 205 ? 12.479 69.725 6.566   1.00 42.63  ? 205 ASN A OD1 1 
ATOM   1328 N ND2 . ASN A 1 205 ? 10.236 69.918 6.479   1.00 41.87  ? 205 ASN A ND2 1 
ATOM   1329 N N   . VAL A 1 206 ? 12.699 70.050 1.280   1.00 33.63  ? 206 VAL A N   1 
ATOM   1330 C CA  . VAL A 1 206 ? 12.860 69.363 0.002   1.00 33.92  ? 206 VAL A CA  1 
ATOM   1331 C C   . VAL A 1 206 ? 14.084 68.437 -0.100  1.00 33.75  ? 206 VAL A C   1 
ATOM   1332 O O   . VAL A 1 206 ? 14.089 67.495 -0.890  1.00 32.69  ? 206 VAL A O   1 
ATOM   1333 C CB  . VAL A 1 206 ? 12.880 70.362 -1.170  1.00 33.67  ? 206 VAL A CB  1 
ATOM   1334 C CG1 . VAL A 1 206 ? 11.605 71.180 -1.160  1.00 30.08  ? 206 VAL A CG1 1 
ATOM   1335 C CG2 . VAL A 1 206 ? 14.112 71.244 -1.086  1.00 33.60  ? 206 VAL A CG2 1 
ATOM   1336 N N   . GLY A 1 207 ? 15.115 68.702 0.694   1.00 34.58  ? 207 GLY A N   1 
ATOM   1337 C CA  . GLY A 1 207 ? 16.296 67.848 0.674   1.00 34.67  ? 207 GLY A CA  1 
ATOM   1338 C C   . GLY A 1 207 ? 15.965 66.471 1.227   1.00 34.11  ? 207 GLY A C   1 
ATOM   1339 O O   . GLY A 1 207 ? 16.640 65.486 0.942   1.00 34.45  ? 207 GLY A O   1 
ATOM   1340 N N   . LEU A 1 208 ? 14.915 66.422 2.039   1.00 34.37  ? 208 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 208 ? 14.431 65.189 2.637   1.00 33.28  ? 208 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 208 ? 13.601 64.468 1.575   1.00 33.65  ? 208 LEU A C   1 
ATOM   1343 O O   . LEU A 1 208 ? 13.716 63.248 1.409   1.00 34.45  ? 208 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 208 ? 13.573 65.501 3.862   1.00 30.39  ? 208 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 208 ? 14.300 66.287 4.955   1.00 28.59  ? 208 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 208 ? 13.389 66.489 6.147   1.00 26.27  ? 208 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 208 ? 15.545 65.538 5.373   1.00 26.85  ? 208 LEU A CD2 1 
ATOM   1348 N N   . TRP A 1 209 ? 12.767 65.222 0.860   1.00 31.46  ? 209 TRP A N   1 
ATOM   1349 C CA  . TRP A 1 209 ? 11.969 64.640 -0.211  1.00 33.20  ? 209 TRP A CA  1 
ATOM   1350 C C   . TRP A 1 209 ? 12.926 63.982 -1.222  1.00 35.59  ? 209 TRP A C   1 
ATOM   1351 O O   . TRP A 1 209 ? 12.569 62.992 -1.863  1.00 36.41  ? 209 TRP A O   1 
ATOM   1352 C CB  . TRP A 1 209 ? 11.136 65.703 -0.921  1.00 31.80  ? 209 TRP A CB  1 
ATOM   1353 C CG  . TRP A 1 209 ? 10.114 66.364 -0.053  1.00 32.63  ? 209 TRP A CG  1 
ATOM   1354 C CD1 . TRP A 1 209 ? 10.319 67.382 0.840   1.00 29.74  ? 209 TRP A CD1 1 
ATOM   1355 C CD2 . TRP A 1 209 ? 8.731  66.018 0.044   1.00 31.46  ? 209 TRP A CD2 1 
ATOM   1356 N NE1 . TRP A 1 209 ? 9.152  67.683 1.488   1.00 29.79  ? 209 TRP A NE1 1 
ATOM   1357 C CE2 . TRP A 1 209 ? 8.159  66.860 1.020   1.00 31.75  ? 209 TRP A CE2 1 
ATOM   1358 C CE3 . TRP A 1 209 ? 7.919  65.073 -0.596  1.00 31.60  ? 209 TRP A CE3 1 
ATOM   1359 C CZ2 . TRP A 1 209 ? 6.806  66.785 1.374   1.00 31.58  ? 209 TRP A CZ2 1 
ATOM   1360 C CZ3 . TRP A 1 209 ? 6.576  64.998 -0.245  1.00 31.88  ? 209 TRP A CZ3 1 
ATOM   1361 C CH2 . TRP A 1 209 ? 6.034  65.849 0.733   1.00 32.55  ? 209 TRP A CH2 1 
ATOM   1362 N N   . ASP A 1 210 ? 14.128 64.538 -1.377  1.00 34.77  ? 210 ASP A N   1 
ATOM   1363 C CA  . ASP A 1 210 ? 15.112 63.949 -2.279  1.00 36.64  ? 210 ASP A CA  1 
ATOM   1364 C C   . ASP A 1 210 ? 15.387 62.529 -1.796  1.00 36.48  ? 210 ASP A C   1 
ATOM   1365 O O   . ASP A 1 210 ? 15.319 61.566 -2.564  1.00 35.01  ? 210 ASP A O   1 
ATOM   1366 C CB  . ASP A 1 210 ? 16.445 64.709 -2.253  1.00 37.43  ? 210 ASP A CB  1 
ATOM   1367 C CG  . ASP A 1 210 ? 16.354 66.063 -2.883  1.00 41.20  ? 210 ASP A CG  1 
ATOM   1368 O OD1 . ASP A 1 210 ? 15.302 66.347 -3.494  1.00 43.85  ? 210 ASP A OD1 1 
ATOM   1369 O OD2 . ASP A 1 210 ? 17.332 66.839 -2.773  1.00 40.01  ? 210 ASP A OD2 1 
ATOM   1370 N N   . GLN A 1 211 ? 15.721 62.422 -0.511  1.00 36.67  ? 211 GLN A N   1 
ATOM   1371 C CA  . GLN A 1 211 ? 16.019 61.141 0.119   1.00 36.01  ? 211 GLN A CA  1 
ATOM   1372 C C   . GLN A 1 211 ? 14.832 60.217 -0.073  1.00 35.52  ? 211 GLN A C   1 
ATOM   1373 O O   . GLN A 1 211 ? 14.990 59.067 -0.479  1.00 35.15  ? 211 GLN A O   1 
ATOM   1374 C CB  . GLN A 1 211 ? 16.295 61.348 1.605   1.00 33.79  ? 211 GLN A CB  1 
ATOM   1375 C CG  . GLN A 1 211 ? 17.517 62.187 1.865   1.00 31.68  ? 211 GLN A CG  1 
ATOM   1376 C CD  . GLN A 1 211 ? 17.540 62.785 3.250   1.00 31.35  ? 211 GLN A CD  1 
ATOM   1377 O OE1 . GLN A 1 211 ? 16.555 62.720 3.972   1.00 34.12  ? 211 GLN A OE1 1 
ATOM   1378 N NE2 . GLN A 1 211 ? 18.669 63.359 3.634   1.00 33.04  ? 211 GLN A NE2 1 
ATOM   1379 N N   . ALA A 1 212 ? 13.643 60.744 0.208   1.00 34.57  ? 212 ALA A N   1 
ATOM   1380 C CA  . ALA A 1 212 ? 12.419 59.995 0.053   1.00 32.84  ? 212 ALA A CA  1 
ATOM   1381 C C   . ALA A 1 212 ? 12.395 59.429 -1.354  1.00 35.00  ? 212 ALA A C   1 
ATOM   1382 O O   . ALA A 1 212 ? 12.232 58.226 -1.538  1.00 40.22  ? 212 ALA A O   1 
ATOM   1383 C CB  . ALA A 1 212 ? 11.234 60.899 0.271   1.00 30.63  ? 212 ALA A CB  1 
ATOM   1384 N N   . LEU A 1 213 ? 12.580 60.298 -2.345  1.00 35.72  ? 213 LEU A N   1 
ATOM   1385 C CA  . LEU A 1 213 ? 12.563 59.910 -3.754  1.00 33.89  ? 213 LEU A CA  1 
ATOM   1386 C C   . LEU A 1 213 ? 13.646 58.891 -4.089  1.00 35.39  ? 213 LEU A C   1 
ATOM   1387 O O   . LEU A 1 213 ? 13.416 57.965 -4.864  1.00 37.04  ? 213 LEU A O   1 
ATOM   1388 C CB  . LEU A 1 213 ? 12.740 61.144 -4.641  1.00 31.39  ? 213 LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 213 ? 12.375 60.997 -6.123  1.00 29.00  ? 213 LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 213 ? 10.873 60.787 -6.252  1.00 29.84  ? 213 LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 213 ? 12.786 62.245 -6.884  1.00 25.88  ? 213 LEU A CD2 1 
ATOM   1392 N N   . ALA A 1 214 ? 14.829 59.073 -3.514  1.00 35.57  ? 214 ALA A N   1 
ATOM   1393 C CA  . ALA A 1 214 ? 15.941 58.161 -3.755  1.00 35.83  ? 214 ALA A CA  1 
ATOM   1394 C C   . ALA A 1 214 ? 15.576 56.801 -3.188  1.00 36.21  ? 214 ALA A C   1 
ATOM   1395 O O   . ALA A 1 214 ? 15.639 55.782 -3.882  1.00 36.23  ? 214 ALA A O   1 
ATOM   1396 C CB  . ALA A 1 214 ? 17.217 58.686 -3.078  1.00 32.29  ? 214 ALA A CB  1 
ATOM   1397 N N   . ILE A 1 215 ? 15.207 56.795 -1.914  1.00 36.02  ? 215 ILE A N   1 
ATOM   1398 C CA  . ILE A 1 215 ? 14.827 55.571 -1.254  1.00 36.89  ? 215 ILE A CA  1 
ATOM   1399 C C   . ILE A 1 215 ? 13.748 54.892 -2.080  1.00 38.20  ? 215 ILE A C   1 
ATOM   1400 O O   . ILE A 1 215 ? 13.847 53.704 -2.374  1.00 40.05  ? 215 ILE A O   1 
ATOM   1401 C CB  . ILE A 1 215 ? 14.301 55.851 0.157   1.00 37.39  ? 215 ILE A CB  1 
ATOM   1402 C CG1 . ILE A 1 215 ? 15.449 56.324 1.041   1.00 35.86  ? 215 ILE A CG1 1 
ATOM   1403 C CG2 . ILE A 1 215 ? 13.670 54.599 0.749   1.00 38.93  ? 215 ILE A CG2 1 
ATOM   1404 C CD1 . ILE A 1 215 ? 15.027 56.555 2.476   1.00 38.86  ? 215 ILE A CD1 1 
ATOM   1405 N N   . ARG A 1 216 ? 12.729 55.639 -2.483  1.00 37.28  ? 216 ARG A N   1 
ATOM   1406 C CA  . ARG A 1 216 ? 11.666 55.034 -3.275  1.00 38.56  ? 216 ARG A CA  1 
ATOM   1407 C C   . ARG A 1 216 ? 12.219 54.480 -4.573  1.00 37.61  ? 216 ARG A C   1 
ATOM   1408 O O   . ARG A 1 216 ? 11.878 53.367 -4.979  1.00 39.33  ? 216 ARG A O   1 
ATOM   1409 C CB  . ARG A 1 216 ? 10.571 56.045 -3.580  1.00 41.30  ? 216 ARG A CB  1 
ATOM   1410 C CG  . ARG A 1 216 ? 9.282  55.399 -4.022  1.00 42.27  ? 216 ARG A CG  1 
ATOM   1411 C CD  . ARG A 1 216 ? 8.148  56.408 -3.972  1.00 48.35  ? 216 ARG A CD  1 
ATOM   1412 N N   . TRP A 1 217 ? 13.069 55.261 -5.226  1.00 35.98  ? 217 TRP A N   1 
ATOM   1413 C CA  . TRP A 1 217 ? 13.688 54.829 -6.473  1.00 35.55  ? 217 TRP A CA  1 
ATOM   1414 C C   . TRP A 1 217 ? 14.385 53.495 -6.249  1.00 37.20  ? 217 TRP A C   1 
ATOM   1415 O O   . TRP A 1 217 ? 14.394 52.632 -7.127  1.00 37.67  ? 217 TRP A O   1 
ATOM   1416 C CB  . TRP A 1 217 ? 14.733 55.836 -6.944  1.00 32.92  ? 217 TRP A CB  1 
ATOM   1417 C CG  . TRP A 1 217 ? 15.302 55.502 -8.288  1.00 29.20  ? 217 TRP A CG  1 
ATOM   1418 C CD1 . TRP A 1 217 ? 14.870 55.964 -9.491  1.00 27.81  ? 217 TRP A CD1 1 
ATOM   1419 C CD2 . TRP A 1 217 ? 16.374 54.591 -8.568  1.00 29.09  ? 217 TRP A CD2 1 
ATOM   1420 N NE1 . TRP A 1 217 ? 15.600 55.398 -10.510 1.00 28.41  ? 217 TRP A NE1 1 
ATOM   1421 C CE2 . TRP A 1 217 ? 16.530 54.550 -9.971  1.00 29.10  ? 217 TRP A CE2 1 
ATOM   1422 C CE3 . TRP A 1 217 ? 17.216 53.806 -7.772  1.00 28.52  ? 217 TRP A CE3 1 
ATOM   1423 C CZ2 . TRP A 1 217 ? 17.494 53.754 -10.594 1.00 28.18  ? 217 TRP A CZ2 1 
ATOM   1424 C CZ3 . TRP A 1 217 ? 18.174 53.016 -8.393  1.00 28.79  ? 217 TRP A CZ3 1 
ATOM   1425 C CH2 . TRP A 1 217 ? 18.302 52.996 -9.789  1.00 28.30  ? 217 TRP A CH2 1 
ATOM   1426 N N   . LEU A 1 218 ? 14.991 53.335 -5.075  1.00 37.55  ? 218 LEU A N   1 
ATOM   1427 C CA  . LEU A 1 218 ? 15.679 52.094 -4.752  1.00 36.93  ? 218 LEU A CA  1 
ATOM   1428 C C   . LEU A 1 218 ? 14.664 50.964 -4.607  1.00 37.69  ? 218 LEU A C   1 
ATOM   1429 O O   . LEU A 1 218 ? 14.745 49.964 -5.308  1.00 39.46  ? 218 LEU A O   1 
ATOM   1430 C CB  . LEU A 1 218 ? 16.503 52.265 -3.480  1.00 33.94  ? 218 LEU A CB  1 
ATOM   1431 C CG  . LEU A 1 218 ? 17.716 53.155 -3.693  1.00 30.29  ? 218 LEU A CG  1 
ATOM   1432 C CD1 . LEU A 1 218 ? 18.339 53.495 -2.376  1.00 34.60  ? 218 LEU A CD1 1 
ATOM   1433 C CD2 . LEU A 1 218 ? 18.700 52.447 -4.581  1.00 29.84  ? 218 LEU A CD2 1 
ATOM   1434 N N   . LYS A 1 219 ? 13.696 51.121 -3.715  1.00 38.89  ? 219 LYS A N   1 
ATOM   1435 C CA  . LYS A 1 219 ? 12.685 50.089 -3.551  1.00 39.86  ? 219 LYS A CA  1 
ATOM   1436 C C   . LYS A 1 219 ? 12.190 49.696 -4.946  1.00 41.94  ? 219 LYS A C   1 
ATOM   1437 O O   . LYS A 1 219 ? 12.091 48.512 -5.283  1.00 42.56  ? 219 LYS A O   1 
ATOM   1438 C CB  . LYS A 1 219 ? 11.521 50.615 -2.713  1.00 38.18  ? 219 LYS A CB  1 
ATOM   1439 C CG  . LYS A 1 219 ? 11.252 49.776 -1.488  1.00 36.27  ? 219 LYS A CG  1 
ATOM   1440 C CD  . LYS A 1 219 ? 9.867  50.009 -0.974  1.00 38.91  ? 219 LYS A CD  1 
ATOM   1441 C CE  . LYS A 1 219 ? 9.525  48.991 0.092   1.00 41.60  ? 219 LYS A CE  1 
ATOM   1442 N NZ  . LYS A 1 219 ? 8.076  49.054 0.442   1.00 44.96  ? 219 LYS A NZ  1 
ATOM   1443 N N   . ASP A 1 220 ? 11.895 50.705 -5.756  1.00 43.08  ? 220 ASP A N   1 
ATOM   1444 C CA  . ASP A 1 220 ? 11.428 50.480 -7.113  1.00 44.88  ? 220 ASP A CA  1 
ATOM   1445 C C   . ASP A 1 220 ? 12.407 49.631 -7.933  1.00 44.62  ? 220 ASP A C   1 
ATOM   1446 O O   . ASP A 1 220 ? 11.982 48.828 -8.751  1.00 48.76  ? 220 ASP A O   1 
ATOM   1447 C CB  . ASP A 1 220 ? 11.201 51.827 -7.820  1.00 46.58  ? 220 ASP A CB  1 
ATOM   1448 C CG  . ASP A 1 220 ? 9.778  52.360 -7.649  1.00 50.55  ? 220 ASP A CG  1 
ATOM   1449 O OD1 . ASP A 1 220 ? 9.202  52.198 -6.546  1.00 51.59  ? 220 ASP A OD1 1 
ATOM   1450 O OD2 . ASP A 1 220 ? 9.241  52.956 -8.620  1.00 49.64  ? 220 ASP A OD2 1 
ATOM   1451 N N   . ASN A 1 221 ? 13.708 49.790 -7.717  1.00 42.27  ? 221 ASN A N   1 
ATOM   1452 C CA  . ASN A 1 221 ? 14.689 49.040 -8.498  1.00 42.16  ? 221 ASN A CA  1 
ATOM   1453 C C   . ASN A 1 221 ? 15.488 48.022 -7.716  1.00 42.55  ? 221 ASN A C   1 
ATOM   1454 O O   . ASN A 1 221 ? 16.523 47.560 -8.183  1.00 41.56  ? 221 ASN A O   1 
ATOM   1455 C CB  . ASN A 1 221 ? 15.680 49.993 -9.164  1.00 43.46  ? 221 ASN A CB  1 
ATOM   1456 C CG  . ASN A 1 221 ? 15.034 50.873 -10.197 1.00 45.43  ? 221 ASN A CG  1 
ATOM   1457 O OD1 . ASN A 1 221 ? 14.523 50.393 -11.212 1.00 47.34  ? 221 ASN A OD1 1 
ATOM   1458 N ND2 . ASN A 1 221 ? 15.045 52.174 -9.948  1.00 44.74  ? 221 ASN A ND2 1 
ATOM   1459 N N   . ALA A 1 222 ? 15.025 47.674 -6.527  1.00 44.10  ? 222 ALA A N   1 
ATOM   1460 C CA  . ALA A 1 222 ? 15.750 46.711 -5.714  1.00 46.82  ? 222 ALA A CA  1 
ATOM   1461 C C   . ALA A 1 222 ? 15.996 45.440 -6.525  1.00 48.58  ? 222 ALA A C   1 
ATOM   1462 O O   . ALA A 1 222 ? 17.129 45.122 -6.884  1.00 47.37  ? 222 ALA A O   1 
ATOM   1463 C CB  . ALA A 1 222 ? 14.952 46.403 -4.460  1.00 47.37  ? 222 ALA A CB  1 
ATOM   1464 N N   . HIS A 1 223 ? 14.907 44.728 -6.796  1.00 51.33  ? 223 HIS A N   1 
ATOM   1465 C CA  . HIS A 1 223 ? 14.892 43.493 -7.573  1.00 53.16  ? 223 HIS A CA  1 
ATOM   1466 C C   . HIS A 1 223 ? 15.879 43.468 -8.746  1.00 50.90  ? 223 HIS A C   1 
ATOM   1467 O O   . HIS A 1 223 ? 16.539 42.460 -8.990  1.00 50.58  ? 223 HIS A O   1 
ATOM   1468 C CB  . HIS A 1 223 ? 13.479 43.290 -8.125  1.00 60.20  ? 223 HIS A CB  1 
ATOM   1469 C CG  . HIS A 1 223 ? 12.980 44.482 -8.889  1.00 68.82  ? 223 HIS A CG  1 
ATOM   1470 N ND1 . HIS A 1 223 ? 11.775 44.468 -9.605  1.00 72.32  ? 223 HIS A ND1 1 
ATOM   1471 C CD2 . HIS A 1 223 ? 13.490 45.710 -9.070  1.00 70.57  ? 223 HIS A CD2 1 
ATOM   1472 C CE1 . HIS A 1 223 ? 11.605 45.632 -10.171 1.00 74.15  ? 223 HIS A CE1 1 
ATOM   1473 N NE2 . HIS A 1 223 ? 12.627 46.425 -9.874  1.00 72.63  ? 223 HIS A NE2 1 
ATOM   1474 N N   . ALA A 1 224 ? 15.966 44.583 -9.469  1.00 48.08  ? 224 ALA A N   1 
ATOM   1475 C CA  . ALA A 1 224 ? 16.817 44.698 -10.648 1.00 45.20  ? 224 ALA A CA  1 
ATOM   1476 C C   . ALA A 1 224 ? 18.311 44.819 -10.404 1.00 44.16  ? 224 ALA A C   1 
ATOM   1477 O O   . ALA A 1 224 ? 19.085 44.860 -11.359 1.00 46.47  ? 224 ALA A O   1 
ATOM   1478 C CB  . ALA A 1 224 ? 16.343 45.851 -11.516 1.00 45.00  ? 224 ALA A CB  1 
ATOM   1479 N N   . PHE A 1 225 ? 18.721 44.896 -9.147  1.00 41.11  ? 225 PHE A N   1 
ATOM   1480 C CA  . PHE A 1 225 ? 20.141 44.957 -8.831  1.00 40.20  ? 225 PHE A CA  1 
ATOM   1481 C C   . PHE A 1 225 ? 20.421 43.734 -7.976  1.00 40.96  ? 225 PHE A C   1 
ATOM   1482 O O   . PHE A 1 225 ? 21.545 43.519 -7.522  1.00 42.03  ? 225 PHE A O   1 
ATOM   1483 C CB  . PHE A 1 225 ? 20.509 46.228 -8.055  1.00 39.05  ? 225 PHE A CB  1 
ATOM   1484 C CG  . PHE A 1 225 ? 20.716 47.436 -8.923  1.00 38.05  ? 225 PHE A CG  1 
ATOM   1485 C CD1 . PHE A 1 225 ? 21.916 47.622 -9.597  1.00 35.91  ? 225 PHE A CD1 1 
ATOM   1486 C CD2 . PHE A 1 225 ? 19.706 48.384 -9.078  1.00 38.48  ? 225 PHE A CD2 1 
ATOM   1487 C CE1 . PHE A 1 225 ? 22.113 48.731 -10.413 1.00 35.31  ? 225 PHE A CE1 1 
ATOM   1488 C CE2 . PHE A 1 225 ? 19.895 49.502 -9.895  1.00 38.64  ? 225 PHE A CE2 1 
ATOM   1489 C CZ  . PHE A 1 225 ? 21.101 49.675 -10.564 1.00 35.74  ? 225 PHE A CZ  1 
ATOM   1490 N N   . GLY A 1 226 ? 19.381 42.939 -7.748  1.00 39.50  ? 226 GLY A N   1 
ATOM   1491 C CA  . GLY A 1 226 ? 19.540 41.735 -6.961  1.00 39.29  ? 226 GLY A CA  1 
ATOM   1492 C C   . GLY A 1 226 ? 19.055 41.814 -5.534  1.00 40.18  ? 226 GLY A C   1 
ATOM   1493 O O   . GLY A 1 226 ? 19.031 40.805 -4.831  1.00 42.02  ? 226 GLY A O   1 
ATOM   1494 N N   . GLY A 1 227 ? 18.661 43.000 -5.088  1.00 40.53  ? 227 GLY A N   1 
ATOM   1495 C CA  . GLY A 1 227 ? 18.196 43.138 -3.716  1.00 39.70  ? 227 GLY A CA  1 
ATOM   1496 C C   . GLY A 1 227 ? 16.724 42.837 -3.487  1.00 38.45  ? 227 GLY A C   1 
ATOM   1497 O O   . GLY A 1 227 ? 15.931 42.783 -4.422  1.00 38.53  ? 227 GLY A O   1 
ATOM   1498 N N   . ASN A 1 228 ? 16.358 42.633 -2.231  1.00 37.66  ? 228 ASN A N   1 
ATOM   1499 C CA  . ASN A 1 228 ? 14.980 42.360 -1.890  1.00 39.56  ? 228 ASN A CA  1 
ATOM   1500 C C   . ASN A 1 228 ? 14.368 43.669 -1.436  1.00 41.77  ? 228 ASN A C   1 
ATOM   1501 O O   . ASN A 1 228 ? 14.719 44.200 -0.381  1.00 43.21  ? 228 ASN A O   1 
ATOM   1502 C CB  . ASN A 1 228 ? 14.896 41.337 -0.770  1.00 39.78  ? 228 ASN A CB  1 
ATOM   1503 C CG  . ASN A 1 228 ? 13.481 41.049 -0.377  1.00 39.46  ? 228 ASN A CG  1 
ATOM   1504 O OD1 . ASN A 1 228 ? 12.553 41.694 -0.865  1.00 41.62  ? 228 ASN A OD1 1 
ATOM   1505 N ND2 . ASN A 1 228 ? 13.297 40.090 0.513   1.00 40.78  ? 228 ASN A ND2 1 
ATOM   1506 N N   . PRO A 1 229 ? 13.433 44.207 -2.225  1.00 43.33  ? 229 PRO A N   1 
ATOM   1507 C CA  . PRO A 1 229 ? 12.757 45.474 -1.930  1.00 44.47  ? 229 PRO A CA  1 
ATOM   1508 C C   . PRO A 1 229 ? 12.241 45.648 -0.492  1.00 45.21  ? 229 PRO A C   1 
ATOM   1509 O O   . PRO A 1 229 ? 12.146 46.773 0.020   1.00 45.93  ? 229 PRO A O   1 
ATOM   1510 C CB  . PRO A 1 229 ? 11.636 45.504 -2.964  1.00 44.49  ? 229 PRO A CB  1 
ATOM   1511 C CG  . PRO A 1 229 ? 12.245 44.793 -4.131  1.00 44.53  ? 229 PRO A CG  1 
ATOM   1512 C CD  . PRO A 1 229 ? 12.922 43.616 -3.474  1.00 43.01  ? 229 PRO A CD  1 
ATOM   1513 N N   . GLU A 1 230 ? 11.922 44.546 0.169   1.00 43.18  ? 230 GLU A N   1 
ATOM   1514 C CA  . GLU A 1 230 ? 11.401 44.646 1.521   1.00 42.94  ? 230 GLU A CA  1 
ATOM   1515 C C   . GLU A 1 230 ? 12.473 44.387 2.584   1.00 42.37  ? 230 GLU A C   1 
ATOM   1516 O O   . GLU A 1 230 ? 12.233 44.483 3.787   1.00 42.28  ? 230 GLU A O   1 
ATOM   1517 C CB  . GLU A 1 230 ? 10.216 43.692 1.657   1.00 42.54  ? 230 GLU A CB  1 
ATOM   1518 C CG  . GLU A 1 230 ? 9.195  43.884 0.541   1.00 41.46  ? 230 GLU A CG  1 
ATOM   1519 N N   . TRP A 1 231 ? 13.678 44.093 2.133   1.00 40.25  ? 231 TRP A N   1 
ATOM   1520 C CA  . TRP A 1 231 ? 14.755 43.844 3.060   1.00 38.90  ? 231 TRP A CA  1 
ATOM   1521 C C   . TRP A 1 231 ? 15.663 45.085 3.178   1.00 37.55  ? 231 TRP A C   1 
ATOM   1522 O O   . TRP A 1 231 ? 16.872 44.966 3.397   1.00 38.15  ? 231 TRP A O   1 
ATOM   1523 C CB  . TRP A 1 231 ? 15.539 42.634 2.571   1.00 37.85  ? 231 TRP A CB  1 
ATOM   1524 C CG  . TRP A 1 231 ? 16.137 41.831 3.654   1.00 39.95  ? 231 TRP A CG  1 
ATOM   1525 C CD1 . TRP A 1 231 ? 16.160 42.123 4.989   1.00 39.52  ? 231 TRP A CD1 1 
ATOM   1526 C CD2 . TRP A 1 231 ? 16.854 40.611 3.497   1.00 42.47  ? 231 TRP A CD2 1 
ATOM   1527 N NE1 . TRP A 1 231 ? 16.855 41.158 5.673   1.00 40.72  ? 231 TRP A NE1 1 
ATOM   1528 C CE2 . TRP A 1 231 ? 17.293 40.216 4.782   1.00 42.42  ? 231 TRP A CE2 1 
ATOM   1529 C CE3 . TRP A 1 231 ? 17.171 39.807 2.393   1.00 42.99  ? 231 TRP A CE3 1 
ATOM   1530 C CZ2 . TRP A 1 231 ? 18.037 39.057 4.994   1.00 44.75  ? 231 TRP A CZ2 1 
ATOM   1531 C CZ3 . TRP A 1 231 ? 17.910 38.654 2.601   1.00 45.27  ? 231 TRP A CZ3 1 
ATOM   1532 C CH2 . TRP A 1 231 ? 18.336 38.288 3.894   1.00 45.39  ? 231 TRP A CH2 1 
ATOM   1533 N N   . MET A 1 232 ? 15.067 46.272 3.054   1.00 34.93  ? 232 MET A N   1 
ATOM   1534 C CA  . MET A 1 232 ? 15.811 47.527 3.119   1.00 32.08  ? 232 MET A CA  1 
ATOM   1535 C C   . MET A 1 232 ? 15.949 48.112 4.500   1.00 31.27  ? 232 MET A C   1 
ATOM   1536 O O   . MET A 1 232 ? 15.007 48.125 5.290   1.00 31.68  ? 232 MET A O   1 
ATOM   1537 C CB  . MET A 1 232 ? 15.159 48.598 2.255   1.00 34.23  ? 232 MET A CB  1 
ATOM   1538 C CG  . MET A 1 232 ? 14.912 48.211 0.812   1.00 36.66  ? 232 MET A CG  1 
ATOM   1539 S SD  . MET A 1 232 ? 14.736 49.692 -0.196  1.00 35.55  ? 232 MET A SD  1 
ATOM   1540 C CE  . MET A 1 232 ? 13.961 50.781 1.030   1.00 32.42  ? 232 MET A CE  1 
ATOM   1541 N N   . THR A 1 233 ? 17.135 48.619 4.782   1.00 29.62  ? 233 THR A N   1 
ATOM   1542 C CA  . THR A 1 233 ? 17.390 49.243 6.059   1.00 30.51  ? 233 THR A CA  1 
ATOM   1543 C C   . THR A 1 233 ? 18.184 50.513 5.766   1.00 32.12  ? 233 THR A C   1 
ATOM   1544 O O   . THR A 1 233 ? 19.092 50.510 4.938   1.00 33.34  ? 233 THR A O   1 
ATOM   1545 C CB  . THR A 1 233 ? 18.191 48.306 7.006   1.00 30.90  ? 233 THR A CB  1 
ATOM   1546 O OG1 . THR A 1 233 ? 19.572 48.684 6.997   1.00 27.68  ? 233 THR A OG1 1 
ATOM   1547 C CG2 . THR A 1 233 ? 18.046 46.845 6.573   1.00 27.68  ? 233 THR A CG2 1 
ATOM   1548 N N   . LEU A 1 234 ? 17.822 51.607 6.417   1.00 32.80  ? 234 LEU A N   1 
ATOM   1549 C CA  . LEU A 1 234 ? 18.517 52.862 6.195   1.00 34.64  ? 234 LEU A CA  1 
ATOM   1550 C C   . LEU A 1 234 ? 19.573 53.026 7.269   1.00 35.98  ? 234 LEU A C   1 
ATOM   1551 O O   . LEU A 1 234 ? 19.512 52.373 8.307   1.00 34.89  ? 234 LEU A O   1 
ATOM   1552 C CB  . LEU A 1 234 ? 17.537 54.029 6.279   1.00 36.82  ? 234 LEU A CB  1 
ATOM   1553 C CG  . LEU A 1 234 ? 16.292 54.014 5.383   1.00 37.84  ? 234 LEU A CG  1 
ATOM   1554 C CD1 . LEU A 1 234 ? 15.407 55.191 5.749   1.00 37.14  ? 234 LEU A CD1 1 
ATOM   1555 C CD2 . LEU A 1 234 ? 16.691 54.069 3.913   1.00 37.28  ? 234 LEU A CD2 1 
ATOM   1556 N N   . PHE A 1 235 ? 20.550 53.889 7.011   1.00 37.42  ? 235 PHE A N   1 
ATOM   1557 C CA  . PHE A 1 235 ? 21.595 54.161 7.988   1.00 37.85  ? 235 PHE A CA  1 
ATOM   1558 C C   . PHE A 1 235 ? 22.436 55.371 7.602   1.00 39.22  ? 235 PHE A C   1 
ATOM   1559 O O   . PHE A 1 235 ? 22.932 55.466 6.477   1.00 41.99  ? 235 PHE A O   1 
ATOM   1560 C CB  . PHE A 1 235 ? 22.473 52.927 8.197   1.00 39.46  ? 235 PHE A CB  1 
ATOM   1561 C CG  . PHE A 1 235 ? 23.388 52.606 7.046   1.00 41.58  ? 235 PHE A CG  1 
ATOM   1562 C CD1 . PHE A 1 235 ? 22.912 52.546 5.744   1.00 43.27  ? 235 PHE A CD1 1 
ATOM   1563 C CD2 . PHE A 1 235 ? 24.724 52.303 7.281   1.00 40.61  ? 235 PHE A CD2 1 
ATOM   1564 C CE1 . PHE A 1 235 ? 23.751 52.185 4.697   1.00 42.32  ? 235 PHE A CE1 1 
ATOM   1565 C CE2 . PHE A 1 235 ? 25.565 51.941 6.240   1.00 42.06  ? 235 PHE A CE2 1 
ATOM   1566 C CZ  . PHE A 1 235 ? 25.080 51.880 4.947   1.00 42.40  ? 235 PHE A CZ  1 
ATOM   1567 N N   . GLY A 1 236 ? 22.561 56.305 8.546   1.00 39.07  ? 236 GLY A N   1 
ATOM   1568 C CA  . GLY A 1 236 ? 23.326 57.524 8.334   1.00 37.57  ? 236 GLY A CA  1 
ATOM   1569 C C   . GLY A 1 236 ? 24.120 57.974 9.554   1.00 36.94  ? 236 GLY A C   1 
ATOM   1570 O O   . GLY A 1 236 ? 24.092 57.326 10.600  1.00 33.85  ? 236 GLY A O   1 
ATOM   1571 N N   . GLU A 1 237 ? 24.819 59.102 9.421   1.00 37.11  ? 237 GLU A N   1 
ATOM   1572 C CA  . GLU A 1 237 ? 25.651 59.647 10.498  1.00 37.89  ? 237 GLU A CA  1 
ATOM   1573 C C   . GLU A 1 237 ? 25.371 61.145 10.655  1.00 39.01  ? 237 GLU A C   1 
ATOM   1574 O O   . GLU A 1 237 ? 25.248 61.853 9.653   1.00 40.95  ? 237 GLU A O   1 
ATOM   1575 C CB  . GLU A 1 237 ? 27.118 59.406 10.137  1.00 37.36  ? 237 GLU A CB  1 
ATOM   1576 C CG  . GLU A 1 237 ? 28.117 59.565 11.262  1.00 37.87  ? 237 GLU A CG  1 
ATOM   1577 C CD  . GLU A 1 237 ? 28.305 60.999 11.680  1.00 36.38  ? 237 GLU A CD  1 
ATOM   1578 O OE1 . GLU A 1 237 ? 28.337 61.872 10.783  1.00 34.84  ? 237 GLU A OE1 1 
ATOM   1579 O OE2 . GLU A 1 237 ? 28.434 61.242 12.902  1.00 35.43  ? 237 GLU A OE2 1 
ATOM   1580 N N   . SER A 1 238 ? 25.283 61.640 11.891  1.00 40.13  ? 238 SER A N   1 
ATOM   1581 C CA  . SER A 1 238 ? 24.985 63.067 12.116  1.00 42.17  ? 238 SER A CA  1 
ATOM   1582 C C   . SER A 1 238 ? 23.699 63.400 11.346  1.00 42.76  ? 238 SER A C   1 
ATOM   1583 O O   . SER A 1 238 ? 22.687 62.710 11.489  1.00 44.06  ? 238 SER A O   1 
ATOM   1584 C CB  . SER A 1 238 ? 26.143 63.961 11.617  1.00 43.58  ? 238 SER A CB  1 
ATOM   1585 O OG  . SER A 1 238 ? 25.863 65.359 11.725  1.00 44.49  ? 238 SER A OG  1 
ATOM   1586 N N   . ALA A 1 239 ? 23.741 64.445 10.522  1.00 42.64  ? 239 ALA A N   1 
ATOM   1587 C CA  . ALA A 1 239 ? 22.579 64.844 9.731   1.00 39.97  ? 239 ALA A CA  1 
ATOM   1588 C C   . ALA A 1 239 ? 21.952 63.615 9.078   1.00 39.04  ? 239 ALA A C   1 
ATOM   1589 O O   . ALA A 1 239 ? 20.746 63.390 9.184   1.00 39.46  ? 239 ALA A O   1 
ATOM   1590 C CB  . ALA A 1 239 ? 22.999 65.838 8.673   1.00 38.86  ? 239 ALA A CB  1 
ATOM   1591 N N   . GLY A 1 240 ? 22.791 62.822 8.413   1.00 37.98  ? 240 GLY A N   1 
ATOM   1592 C CA  . GLY A 1 240 ? 22.334 61.614 7.746   1.00 37.07  ? 240 GLY A CA  1 
ATOM   1593 C C   . GLY A 1 240 ? 21.666 60.641 8.698   1.00 37.48  ? 240 GLY A C   1 
ATOM   1594 O O   . GLY A 1 240 ? 20.806 59.858 8.304   1.00 36.44  ? 240 GLY A O   1 
ATOM   1595 N N   . SER A 1 241 ? 22.069 60.682 9.960   1.00 36.44  ? 241 SER A N   1 
ATOM   1596 C CA  . SER A 1 241 ? 21.475 59.812 10.939  1.00 36.95  ? 241 SER A CA  1 
ATOM   1597 C C   . SER A 1 241 ? 20.060 60.352 11.106  1.00 37.98  ? 241 SER A C   1 
ATOM   1598 O O   . SER A 1 241 ? 19.072 59.634 10.965  1.00 38.82  ? 241 SER A O   1 
ATOM   1599 C CB  . SER A 1 241 ? 22.253 59.898 12.246  1.00 36.48  ? 241 SER A CB  1 
ATOM   1600 O OG  . SER A 1 241 ? 21.895 58.850 13.126  1.00 38.10  ? 241 SER A OG  1 
ATOM   1601 N N   . SER A 1 242 ? 19.968 61.645 11.363  1.00 38.91  ? 242 SER A N   1 
ATOM   1602 C CA  . SER A 1 242 ? 18.678 62.284 11.542  1.00 40.82  ? 242 SER A CA  1 
ATOM   1603 C C   . SER A 1 242 ? 17.760 62.094 10.348  1.00 41.13  ? 242 SER A C   1 
ATOM   1604 O O   . SER A 1 242 ? 16.536 62.114 10.494  1.00 40.43  ? 242 SER A O   1 
ATOM   1605 C CB  . SER A 1 242 ? 18.874 63.770 11.796  1.00 42.10  ? 242 SER A CB  1 
ATOM   1606 O OG  . SER A 1 242 ? 19.605 63.960 12.989  1.00 46.78  ? 242 SER A OG  1 
ATOM   1607 N N   . SER A 1 243 ? 18.358 61.921 9.169   1.00 40.35  ? 243 SER A N   1 
ATOM   1608 C CA  . SER A 1 243 ? 17.600 61.740 7.939   1.00 39.41  ? 243 SER A CA  1 
ATOM   1609 C C   . SER A 1 243 ? 17.033 60.339 7.899   1.00 38.83  ? 243 SER A C   1 
ATOM   1610 O O   . SER A 1 243 ? 15.893 60.129 7.496   1.00 38.30  ? 243 SER A O   1 
ATOM   1611 C CB  . SER A 1 243 ? 18.501 61.955 6.742   1.00 39.32  ? 243 SER A CB  1 
ATOM   1612 O OG  . SER A 1 243 ? 19.274 63.117 6.932   1.00 42.54  ? 243 SER A OG  1 
ATOM   1613 N N   . VAL A 1 244 ? 17.840 59.373 8.304   1.00 37.23  ? 244 VAL A N   1 
ATOM   1614 C CA  . VAL A 1 244 ? 17.372 58.007 8.330   1.00 37.71  ? 244 VAL A CA  1 
ATOM   1615 C C   . VAL A 1 244 ? 16.145 58.065 9.215   1.00 36.53  ? 244 VAL A C   1 
ATOM   1616 O O   . VAL A 1 244 ? 15.112 57.444 8.943   1.00 34.99  ? 244 VAL A O   1 
ATOM   1617 C CB  . VAL A 1 244 ? 18.420 57.083 8.955   1.00 37.89  ? 244 VAL A CB  1 
ATOM   1618 C CG1 . VAL A 1 244 ? 17.841 55.696 9.165   1.00 39.11  ? 244 VAL A CG1 1 
ATOM   1619 C CG2 . VAL A 1 244 ? 19.629 57.009 8.042   1.00 38.71  ? 244 VAL A CG2 1 
ATOM   1620 N N   . ASN A 1 245 ? 16.271 58.860 10.266  1.00 36.25  ? 245 ASN A N   1 
ATOM   1621 C CA  . ASN A 1 245 ? 15.196 59.047 11.220  1.00 36.10  ? 245 ASN A CA  1 
ATOM   1622 C C   . ASN A 1 245 ? 13.984 59.670 10.550  1.00 34.57  ? 245 ASN A C   1 
ATOM   1623 O O   . ASN A 1 245 ? 12.892 59.145 10.626  1.00 35.51  ? 245 ASN A O   1 
ATOM   1624 C CB  . ASN A 1 245 ? 15.657 59.943 12.353  1.00 36.63  ? 245 ASN A CB  1 
ATOM   1625 C CG  . ASN A 1 245 ? 14.655 60.016 13.465  1.00 38.08  ? 245 ASN A CG  1 
ATOM   1626 O OD1 . ASN A 1 245 ? 14.839 60.758 14.424  1.00 36.77  ? 245 ASN A OD1 1 
ATOM   1627 N ND2 . ASN A 1 245 ? 13.578 59.250 13.345  1.00 39.27  ? 245 ASN A ND2 1 
ATOM   1628 N N   . ALA A 1 246 ? 14.176 60.797 9.889   1.00 33.88  ? 246 ALA A N   1 
ATOM   1629 C CA  . ALA A 1 246 ? 13.060 61.436 9.234   1.00 34.17  ? 246 ALA A CA  1 
ATOM   1630 C C   . ALA A 1 246 ? 12.425 60.463 8.245   1.00 35.68  ? 246 ALA A C   1 
ATOM   1631 O O   . ALA A 1 246 ? 11.201 60.404 8.111   1.00 38.14  ? 246 ALA A O   1 
ATOM   1632 C CB  . ALA A 1 246 ? 13.523 62.697 8.521   1.00 32.51  ? 246 ALA A CB  1 
ATOM   1633 N N   . GLN A 1 247 ? 13.251 59.684 7.559   1.00 35.95  ? 247 GLN A N   1 
ATOM   1634 C CA  . GLN A 1 247 ? 12.730 58.732 6.584   1.00 35.69  ? 247 GLN A CA  1 
ATOM   1635 C C   . GLN A 1 247 ? 11.890 57.629 7.221   1.00 35.50  ? 247 GLN A C   1 
ATOM   1636 O O   . GLN A 1 247 ? 11.041 57.033 6.563   1.00 36.46  ? 247 GLN A O   1 
ATOM   1637 C CB  . GLN A 1 247 ? 13.876 58.110 5.779   1.00 35.53  ? 247 GLN A CB  1 
ATOM   1638 C CG  . GLN A 1 247 ? 14.593 59.092 4.879   1.00 34.44  ? 247 GLN A CG  1 
ATOM   1639 C CD  . GLN A 1 247 ? 13.634 60.017 4.159   1.00 37.97  ? 247 GLN A CD  1 
ATOM   1640 O OE1 . GLN A 1 247 ? 12.584 59.588 3.651   1.00 37.97  ? 247 GLN A OE1 1 
ATOM   1641 N NE2 . GLN A 1 247 ? 13.988 61.298 4.104   1.00 36.89  ? 247 GLN A NE2 1 
ATOM   1642 N N   . LEU A 1 248 ? 12.119 57.369 8.501   1.00 34.81  ? 248 LEU A N   1 
ATOM   1643 C CA  . LEU A 1 248 ? 11.382 56.332 9.199   1.00 35.12  ? 248 LEU A CA  1 
ATOM   1644 C C   . LEU A 1 248 ? 10.089 56.826 9.861   1.00 37.69  ? 248 LEU A C   1 
ATOM   1645 O O   . LEU A 1 248 ? 9.055  56.159 9.794   1.00 39.59  ? 248 LEU A O   1 
ATOM   1646 C CB  . LEU A 1 248 ? 12.276 55.689 10.259  1.00 33.10  ? 248 LEU A CB  1 
ATOM   1647 C CG  . LEU A 1 248 ? 13.607 55.026 9.880   1.00 33.41  ? 248 LEU A CG  1 
ATOM   1648 C CD1 . LEU A 1 248 ? 14.266 54.494 11.150  1.00 34.74  ? 248 LEU A CD1 1 
ATOM   1649 C CD2 . LEU A 1 248 ? 13.402 53.894 8.906   1.00 30.00  ? 248 LEU A CD2 1 
ATOM   1650 N N   . MET A 1 249 ? 10.106 58.031 10.456  1.00 39.50  ? 249 MET A N   1 
ATOM   1651 C CA  . MET A 1 249 ? 8.976  58.545 11.242  1.00 40.67  ? 249 MET A CA  1 
ATOM   1652 C C   . MET A 1 249 ? 8.048  59.376 10.348  1.00 41.23  ? 249 MET A C   1 
ATOM   1653 O O   . MET A 1 249 ? 6.850  59.575 10.751  1.00 40.29  ? 249 MET A O   1 
ATOM   1654 C CB  . MET A 1 249 ? 9.491  59.423 12.382  1.00 43.04  ? 249 MET A CB  1 
ATOM   1655 C CG  . MET A 1 249 ? 10.721 58.829 13.065  1.00 44.77  ? 249 MET A CG  1 
ATOM   1656 S SD  . MET A 1 249 ? 10.433 57.224 13.774  1.00 44.98  ? 249 MET A SD  1 
ATOM   1657 C CE  . MET A 1 249 ? 8.741  57.101 14.320  1.00 45.21  ? 249 MET A CE  1 
ATOM   1658 N N   . SER A 1 250 ? 8.471  59.931 9.256   1.00 41.45  ? 250 SER A N   1 
ATOM   1659 C CA  . SER A 1 250 ? 7.606  60.773 8.465   1.00 42.40  ? 250 SER A CA  1 
ATOM   1660 C C   . SER A 1 250 ? 6.339  60.070 8.018   1.00 42.97  ? 250 SER A C   1 
ATOM   1661 O O   . SER A 1 250 ? 6.348  58.882 7.695   1.00 43.66  ? 250 SER A O   1 
ATOM   1662 C CB  . SER A 1 250 ? 8.355  61.309 7.249   1.00 44.74  ? 250 SER A CB  1 
ATOM   1663 O OG  . SER A 1 250 ? 7.510  62.140 6.465   1.00 48.10  ? 250 SER A OG  1 
ATOM   1664 N N   . PRO A 1 251 ? 5.216  60.798 8.028   1.00 42.87  ? 251 PRO A N   1 
ATOM   1665 C CA  . PRO A 1 251 ? 3.927  60.248 7.609   1.00 41.95  ? 251 PRO A CA  1 
ATOM   1666 C C   . PRO A 1 251 ? 3.814  60.404 6.105   1.00 42.09  ? 251 PRO A C   1 
ATOM   1667 O O   . PRO A 1 251 ? 2.730  60.258 5.538   1.00 42.90  ? 251 PRO A O   1 
ATOM   1668 C CB  . PRO A 1 251 ? 2.928  61.129 8.336   1.00 40.78  ? 251 PRO A CB  1 
ATOM   1669 C CG  . PRO A 1 251 ? 3.600  62.442 8.308   1.00 41.22  ? 251 PRO A CG  1 
ATOM   1670 C CD  . PRO A 1 251 ? 5.025  62.099 8.692   1.00 42.20  ? 251 PRO A CD  1 
ATOM   1671 N N   . VAL A 1 252 ? 4.945  60.717 5.472   1.00 38.89  ? 252 VAL A N   1 
ATOM   1672 C CA  . VAL A 1 252 ? 5.017  60.918 4.028   1.00 35.57  ? 252 VAL A CA  1 
ATOM   1673 C C   . VAL A 1 252 ? 5.682  59.722 3.385   1.00 37.10  ? 252 VAL A C   1 
ATOM   1674 O O   . VAL A 1 252 ? 5.422  59.392 2.229   1.00 37.89  ? 252 VAL A O   1 
ATOM   1675 C CB  . VAL A 1 252 ? 5.859  62.162 3.689   1.00 33.13  ? 252 VAL A CB  1 
ATOM   1676 C CG1 . VAL A 1 252 ? 6.141  62.233 2.199   1.00 27.82  ? 252 VAL A CG1 1 
ATOM   1677 C CG2 . VAL A 1 252 ? 5.153  63.390 4.155   1.00 30.83  ? 252 VAL A CG2 1 
ATOM   1678 N N   . THR A 1 253 ? 6.549  59.082 4.158   1.00 37.98  ? 253 THR A N   1 
ATOM   1679 C CA  . THR A 1 253 ? 7.305  57.926 3.711   1.00 38.32  ? 253 THR A CA  1 
ATOM   1680 C C   . THR A 1 253 ? 6.956  56.734 4.585   1.00 41.48  ? 253 THR A C   1 
ATOM   1681 O O   . THR A 1 253 ? 7.283  55.600 4.245   1.00 43.73  ? 253 THR A O   1 
ATOM   1682 C CB  . THR A 1 253 ? 8.830  58.174 3.851   1.00 36.28  ? 253 THR A CB  1 
ATOM   1683 O OG1 . THR A 1 253 ? 9.136  58.465 5.220   1.00 32.67  ? 253 THR A OG1 1 
ATOM   1684 C CG2 . THR A 1 253 ? 9.276  59.332 2.996   1.00 32.14  ? 253 THR A CG2 1 
ATOM   1685 N N   . ARG A 1 254 ? 6.311  57.002 5.721   1.00 43.44  ? 254 ARG A N   1 
ATOM   1686 C CA  . ARG A 1 254 ? 5.937  55.950 6.665   1.00 44.10  ? 254 ARG A CA  1 
ATOM   1687 C C   . ARG A 1 254 ? 5.521  54.682 5.955   1.00 42.01  ? 254 ARG A C   1 
ATOM   1688 O O   . ARG A 1 254 ? 4.662  54.692 5.074   1.00 37.95  ? 254 ARG A O   1 
ATOM   1689 C CB  . ARG A 1 254 ? 4.806  56.416 7.577   1.00 48.20  ? 254 ARG A CB  1 
ATOM   1690 C CG  . ARG A 1 254 ? 4.444  55.415 8.662   1.00 51.91  ? 254 ARG A CG  1 
ATOM   1691 C CD  . ARG A 1 254 ? 3.344  55.978 9.535   1.00 54.53  ? 254 ARG A CD  1 
ATOM   1692 N NE  . ARG A 1 254 ? 3.709  57.293 10.054  1.00 57.96  ? 254 ARG A NE  1 
ATOM   1693 C CZ  . ARG A 1 254 ? 2.843  58.160 10.569  1.00 60.11  ? 254 ARG A CZ  1 
ATOM   1694 N NH1 . ARG A 1 254 ? 1.554  57.855 10.636  1.00 59.57  ? 254 ARG A NH1 1 
ATOM   1695 N NH2 . ARG A 1 254 ? 3.264  59.339 11.007  1.00 61.31  ? 254 ARG A NH2 1 
ATOM   1696 N N   . GLY A 1 255 ? 6.141  53.583 6.356   1.00 42.51  ? 255 GLY A N   1 
ATOM   1697 C CA  . GLY A 1 255 ? 5.848  52.315 5.722   1.00 45.22  ? 255 GLY A CA  1 
ATOM   1698 C C   . GLY A 1 255 ? 7.098  51.830 5.024   1.00 46.05  ? 255 GLY A C   1 
ATOM   1699 O O   . GLY A 1 255 ? 7.795  50.976 5.550   1.00 47.94  ? 255 GLY A O   1 
ATOM   1700 N N   . LEU A 1 256 ? 7.390  52.387 3.852   1.00 47.17  ? 256 LEU A N   1 
ATOM   1701 C CA  . LEU A 1 256 ? 8.576  52.016 3.079   1.00 47.95  ? 256 LEU A CA  1 
ATOM   1702 C C   . LEU A 1 256 ? 9.648  51.234 3.846   1.00 47.42  ? 256 LEU A C   1 
ATOM   1703 O O   . LEU A 1 256 ? 9.843  50.030 3.610   1.00 48.02  ? 256 LEU A O   1 
ATOM   1704 C CB  . LEU A 1 256 ? 9.235  53.259 2.471   1.00 48.08  ? 256 LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 256 ? 8.649  53.807 1.170   1.00 50.76  ? 256 LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 256 ? 7.314  54.475 1.461   1.00 51.51  ? 256 LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 256 ? 9.626  54.806 0.526   1.00 52.32  ? 256 LEU A CD2 1 
ATOM   1708 N N   . VAL A 1 257 ? 10.339 51.920 4.757   1.00 42.91  ? 257 VAL A N   1 
ATOM   1709 C CA  . VAL A 1 257 ? 11.407 51.299 5.534   1.00 38.81  ? 257 VAL A CA  1 
ATOM   1710 C C   . VAL A 1 257 ? 11.249 51.442 7.037   1.00 37.56  ? 257 VAL A C   1 
ATOM   1711 O O   . VAL A 1 257 ? 11.197 52.555 7.558   1.00 36.98  ? 257 VAL A O   1 
ATOM   1712 C CB  . VAL A 1 257 ? 12.757 51.902 5.182   1.00 36.45  ? 257 VAL A CB  1 
ATOM   1713 C CG1 . VAL A 1 257 ? 13.851 50.978 5.641   1.00 35.23  ? 257 VAL A CG1 1 
ATOM   1714 C CG2 . VAL A 1 257 ? 12.828 52.174 3.705   1.00 34.93  ? 257 VAL A CG2 1 
ATOM   1715 N N   . LYS A 1 258 ? 11.193 50.313 7.733   1.00 37.08  ? 258 LYS A N   1 
ATOM   1716 C CA  . LYS A 1 258 ? 11.053 50.321 9.182   1.00 37.13  ? 258 LYS A CA  1 
ATOM   1717 C C   . LYS A 1 258 ? 12.305 49.751 9.851   1.00 36.11  ? 258 LYS A C   1 
ATOM   1718 O O   . LYS A 1 258 ? 12.228 49.132 10.908  1.00 37.25  ? 258 LYS A O   1 
ATOM   1719 C CB  . LYS A 1 258 ? 9.830  49.509 9.609   1.00 40.38  ? 258 LYS A CB  1 
ATOM   1720 C CG  . LYS A 1 258 ? 8.555  49.799 8.815   1.00 45.52  ? 258 LYS A CG  1 
ATOM   1721 C CD  . LYS A 1 258 ? 7.389  48.984 9.367   1.00 50.12  ? 258 LYS A CD  1 
ATOM   1722 C CE  . LYS A 1 258 ? 6.301  48.697 8.319   1.00 54.38  ? 258 LYS A CE  1 
ATOM   1723 N NZ  . LYS A 1 258 ? 5.573  49.892 7.782   1.00 54.27  ? 258 LYS A NZ  1 
ATOM   1724 N N   . ARG A 1 259 ? 13.460 49.951 9.231   1.00 33.68  ? 259 ARG A N   1 
ATOM   1725 C CA  . ARG A 1 259 ? 14.705 49.461 9.807   1.00 34.38  ? 259 ARG A CA  1 
ATOM   1726 C C   . ARG A 1 259 ? 15.828 50.429 9.495   1.00 34.21  ? 259 ARG A C   1 
ATOM   1727 O O   . ARG A 1 259 ? 16.183 50.646 8.339   1.00 33.52  ? 259 ARG A O   1 
ATOM   1728 C CB  . ARG A 1 259 ? 15.052 48.073 9.273   1.00 34.01  ? 259 ARG A CB  1 
ATOM   1729 C CG  . ARG A 1 259 ? 16.375 47.535 9.793   1.00 33.59  ? 259 ARG A CG  1 
ATOM   1730 C CD  . ARG A 1 259 ? 16.587 46.111 9.350   1.00 33.75  ? 259 ARG A CD  1 
ATOM   1731 N NE  . ARG A 1 259 ? 15.604 45.219 9.959   1.00 34.88  ? 259 ARG A NE  1 
ATOM   1732 C CZ  . ARG A 1 259 ? 15.368 43.978 9.548   1.00 35.34  ? 259 ARG A CZ  1 
ATOM   1733 N NH1 . ARG A 1 259 ? 16.043 43.477 8.522   1.00 36.01  ? 259 ARG A NH1 1 
ATOM   1734 N NH2 . ARG A 1 259 ? 14.458 43.237 10.160  1.00 35.33  ? 259 ARG A NH2 1 
ATOM   1735 N N   . GLY A 1 260 ? 16.387 51.029 10.533  1.00 34.19  ? 260 GLY A N   1 
ATOM   1736 C CA  . GLY A 1 260 ? 17.451 51.971 10.288  1.00 35.94  ? 260 GLY A CA  1 
ATOM   1737 C C   . GLY A 1 260 ? 18.494 52.006 11.372  1.00 35.40  ? 260 GLY A C   1 
ATOM   1738 O O   . GLY A 1 260 ? 18.251 51.600 12.508  1.00 35.48  ? 260 GLY A O   1 
ATOM   1739 N N   . MET A 1 261 ? 19.678 52.466 10.993  1.00 35.61  ? 261 MET A N   1 
ATOM   1740 C CA  . MET A 1 261 ? 20.773 52.616 11.932  1.00 36.19  ? 261 MET A CA  1 
ATOM   1741 C C   . MET A 1 261 ? 21.025 54.108 11.955  1.00 34.90  ? 261 MET A C   1 
ATOM   1742 O O   . MET A 1 261 ? 21.143 54.731 10.912  1.00 31.74  ? 261 MET A O   1 
ATOM   1743 C CB  . MET A 1 261 ? 22.026 51.889 11.453  1.00 34.81  ? 261 MET A CB  1 
ATOM   1744 C CG  . MET A 1 261 ? 23.253 52.279 12.234  1.00 36.38  ? 261 MET A CG  1 
ATOM   1745 S SD  . MET A 1 261 ? 24.746 51.527 11.622  1.00 38.49  ? 261 MET A SD  1 
ATOM   1746 C CE  . MET A 1 261 ? 25.590 51.224 13.097  1.00 38.47  ? 261 MET A CE  1 
ATOM   1747 N N   . MET A 1 262 ? 21.051 54.675 13.137  1.00 37.16  ? 262 MET A N   1 
ATOM   1748 C CA  . MET A 1 262 ? 21.314 56.122 13.257  1.00 40.03  ? 262 MET A CA  1 
ATOM   1749 C C   . MET A 1 262 ? 22.612 56.311 14.036  1.00 42.27  ? 262 MET A C   1 
ATOM   1750 O O   . MET A 1 262 ? 22.801 55.743 15.115  1.00 42.20  ? 262 MET A O   1 
ATOM   1751 C CB  . MET A 1 262 ? 20.173 56.839 13.991  1.00 36.42  ? 262 MET A CB  1 
ATOM   1752 C CG  . MET A 1 262 ? 18.788 56.322 13.572  1.00 35.34  ? 262 MET A CG  1 
ATOM   1753 S SD  . MET A 1 262 ? 17.476 56.825 14.668  1.00 35.30  ? 262 MET A SD  1 
ATOM   1754 C CE  . MET A 1 262 ? 16.505 58.114 13.907  1.00 32.97  ? 262 MET A CE  1 
ATOM   1755 N N   . GLN A 1 263 ? 23.502 57.092 13.457  1.00 44.31  ? 263 GLN A N   1 
ATOM   1756 C CA  . GLN A 1 263 ? 24.788 57.343 14.077  1.00 46.18  ? 263 GLN A CA  1 
ATOM   1757 C C   . GLN A 1 263 ? 24.888 58.770 14.525  1.00 45.50  ? 263 GLN A C   1 
ATOM   1758 O O   . GLN A 1 263 ? 24.924 59.678 13.700  1.00 47.20  ? 263 GLN A O   1 
ATOM   1759 C CB  . GLN A 1 263 ? 25.906 57.052 13.082  1.00 48.29  ? 263 GLN A CB  1 
ATOM   1760 C CG  . GLN A 1 263 ? 25.963 55.597 12.651  1.00 50.04  ? 263 GLN A CG  1 
ATOM   1761 C CD  . GLN A 1 263 ? 26.871 55.384 11.471  1.00 49.97  ? 263 GLN A CD  1 
ATOM   1762 O OE1 . GLN A 1 263 ? 27.109 54.250 11.068  1.00 51.59  ? 263 GLN A OE1 1 
ATOM   1763 N NE2 . GLN A 1 263 ? 27.375 56.477 10.897  1.00 48.65  ? 263 GLN A NE2 1 
ATOM   1764 N N   . SER A 1 264 ? 24.935 58.962 15.835  1.00 45.24  ? 264 SER A N   1 
ATOM   1765 C CA  . SER A 1 264 ? 25.053 60.293 16.409  1.00 44.56  ? 264 SER A CA  1 
ATOM   1766 C C   . SER A 1 264 ? 24.154 61.240 15.629  1.00 44.60  ? 264 SER A C   1 
ATOM   1767 O O   . SER A 1 264 ? 24.644 62.175 15.006  1.00 47.66  ? 264 SER A O   1 
ATOM   1768 C CB  . SER A 1 264 ? 26.505 60.763 16.303  1.00 44.28  ? 264 SER A CB  1 
ATOM   1769 O OG  . SER A 1 264 ? 27.410 59.706 16.579  1.00 44.19  ? 264 SER A OG  1 
ATOM   1770 N N   . GLY A 1 265 ? 22.850 60.990 15.640  1.00 43.02  ? 265 GLY A N   1 
ATOM   1771 C CA  . GLY A 1 265 ? 21.942 61.848 14.900  1.00 42.03  ? 265 GLY A CA  1 
ATOM   1772 C C   . GLY A 1 265 ? 20.480 61.494 15.078  1.00 42.44  ? 265 GLY A C   1 
ATOM   1773 O O   . GLY A 1 265 ? 20.033 60.421 14.667  1.00 42.06  ? 265 GLY A O   1 
ATOM   1774 N N   . THR A 1 266 ? 19.737 62.400 15.710  1.00 42.74  ? 266 THR A N   1 
ATOM   1775 C CA  . THR A 1 266 ? 18.307 62.203 15.955  1.00 41.36  ? 266 THR A CA  1 
ATOM   1776 C C   . THR A 1 266 ? 17.531 63.519 15.967  1.00 40.06  ? 266 THR A C   1 
ATOM   1777 O O   . THR A 1 266 ? 17.891 64.475 16.637  1.00 39.22  ? 266 THR A O   1 
ATOM   1778 C CB  . THR A 1 266 ? 18.033 61.427 17.293  1.00 38.63  ? 266 THR A CB  1 
ATOM   1779 O OG1 . THR A 1 266 ? 18.725 62.047 18.379  1.00 35.86  ? 266 THR A OG1 1 
ATOM   1780 C CG2 . THR A 1 266 ? 18.472 59.994 17.173  1.00 36.61  ? 266 THR A CG2 1 
ATOM   1781 N N   . MET A 1 267 ? 16.456 63.534 15.199  1.00 42.19  ? 267 MET A N   1 
ATOM   1782 C CA  . MET A 1 267 ? 15.576 64.683 15.045  1.00 44.10  ? 267 MET A CA  1 
ATOM   1783 C C   . MET A 1 267 ? 15.283 65.485 16.301  1.00 42.51  ? 267 MET A C   1 
ATOM   1784 O O   . MET A 1 267 ? 15.034 66.680 16.224  1.00 42.37  ? 267 MET A O   1 
ATOM   1785 C CB  . MET A 1 267 ? 14.257 64.207 14.449  1.00 49.41  ? 267 MET A CB  1 
ATOM   1786 C CG  . MET A 1 267 ? 14.409 63.495 13.133  1.00 51.98  ? 267 MET A CG  1 
ATOM   1787 S SD  . MET A 1 267 ? 13.760 64.548 11.877  1.00 58.36  ? 267 MET A SD  1 
ATOM   1788 C CE  . MET A 1 267 ? 12.045 64.089 11.949  1.00 54.65  ? 267 MET A CE  1 
ATOM   1789 N N   . ASN A 1 268 ? 15.279 64.834 17.453  1.00 41.47  ? 268 ASN A N   1 
ATOM   1790 C CA  . ASN A 1 268 ? 14.996 65.548 18.679  1.00 40.78  ? 268 ASN A CA  1 
ATOM   1791 C C   . ASN A 1 268 ? 16.120 66.503 18.994  1.00 41.58  ? 268 ASN A C   1 
ATOM   1792 O O   . ASN A 1 268 ? 15.879 67.578 19.533  1.00 42.98  ? 268 ASN A O   1 
ATOM   1793 C CB  . ASN A 1 268 ? 14.799 64.573 19.822  1.00 41.46  ? 268 ASN A CB  1 
ATOM   1794 C CG  . ASN A 1 268 ? 15.906 63.567 19.911  1.00 44.36  ? 268 ASN A CG  1 
ATOM   1795 O OD1 . ASN A 1 268 ? 16.254 62.926 18.922  1.00 45.93  ? 268 ASN A OD1 1 
ATOM   1796 N ND2 . ASN A 1 268 ? 16.464 63.406 21.102  1.00 44.77  ? 268 ASN A ND2 1 
ATOM   1797 N N   . ALA A 1 269 ? 17.346 66.118 18.643  1.00 43.14  ? 269 ALA A N   1 
ATOM   1798 C CA  . ALA A 1 269 ? 18.528 66.950 18.882  1.00 44.03  ? 269 ALA A CA  1 
ATOM   1799 C C   . ALA A 1 269 ? 18.283 68.405 18.463  1.00 45.66  ? 269 ALA A C   1 
ATOM   1800 O O   . ALA A 1 269 ? 17.526 68.676 17.545  1.00 44.32  ? 269 ALA A O   1 
ATOM   1801 C CB  . ALA A 1 269 ? 19.716 66.385 18.143  1.00 42.75  ? 269 ALA A CB  1 
ATOM   1802 N N   . PRO A 1 270 ? 18.946 69.356 19.127  1.00 48.84  ? 270 PRO A N   1 
ATOM   1803 C CA  . PRO A 1 270 ? 18.792 70.787 18.838  1.00 51.32  ? 270 PRO A CA  1 
ATOM   1804 C C   . PRO A 1 270 ? 19.076 71.201 17.400  1.00 52.84  ? 270 PRO A C   1 
ATOM   1805 O O   . PRO A 1 270 ? 18.437 72.117 16.871  1.00 52.48  ? 270 PRO A O   1 
ATOM   1806 C CB  . PRO A 1 270 ? 19.777 71.454 19.806  1.00 52.95  ? 270 PRO A CB  1 
ATOM   1807 C CG  . PRO A 1 270 ? 20.054 70.389 20.858  1.00 52.89  ? 270 PRO A CG  1 
ATOM   1808 C CD  . PRO A 1 270 ? 20.066 69.128 20.056  1.00 51.48  ? 270 PRO A CD  1 
ATOM   1809 N N   . TRP A 1 271 ? 20.047 70.533 16.781  1.00 52.76  ? 271 TRP A N   1 
ATOM   1810 C CA  . TRP A 1 271 ? 20.454 70.840 15.414  1.00 52.74  ? 271 TRP A CA  1 
ATOM   1811 C C   . TRP A 1 271 ? 19.725 70.066 14.315  1.00 52.81  ? 271 TRP A C   1 
ATOM   1812 O O   . TRP A 1 271 ? 19.749 70.471 13.160  1.00 54.84  ? 271 TRP A O   1 
ATOM   1813 C CB  . TRP A 1 271 ? 21.950 70.596 15.264  1.00 53.55  ? 271 TRP A CB  1 
ATOM   1814 C CG  . TRP A 1 271 ? 22.342 69.227 15.681  1.00 55.81  ? 271 TRP A CG  1 
ATOM   1815 C CD1 . TRP A 1 271 ? 22.707 68.821 16.930  1.00 56.47  ? 271 TRP A CD1 1 
ATOM   1816 C CD2 . TRP A 1 271 ? 22.356 68.062 14.861  1.00 57.06  ? 271 TRP A CD2 1 
ATOM   1817 N NE1 . TRP A 1 271 ? 22.955 67.473 16.938  1.00 56.66  ? 271 TRP A NE1 1 
ATOM   1818 C CE2 . TRP A 1 271 ? 22.752 66.982 15.677  1.00 57.25  ? 271 TRP A CE2 1 
ATOM   1819 C CE3 . TRP A 1 271 ? 22.087 67.826 13.510  1.00 58.16  ? 271 TRP A CE3 1 
ATOM   1820 C CZ2 . TRP A 1 271 ? 22.867 65.680 15.191  1.00 58.33  ? 271 TRP A CZ2 1 
ATOM   1821 C CZ3 . TRP A 1 271 ? 22.203 66.532 13.026  1.00 59.40  ? 271 TRP A CZ3 1 
ATOM   1822 C CH2 . TRP A 1 271 ? 22.597 65.477 13.864  1.00 58.82  ? 271 TRP A CH2 1 
ATOM   1823 N N   . SER A 1 272 ? 19.082 68.960 14.667  1.00 51.63  ? 272 SER A N   1 
ATOM   1824 C CA  . SER A 1 272 ? 18.371 68.140 13.690  1.00 48.94  ? 272 SER A CA  1 
ATOM   1825 C C   . SER A 1 272 ? 16.929 68.563 13.380  1.00 47.63  ? 272 SER A C   1 
ATOM   1826 O O   . SER A 1 272 ? 16.247 67.919 12.585  1.00 46.26  ? 272 SER A O   1 
ATOM   1827 C CB  . SER A 1 272 ? 18.392 66.678 14.140  1.00 48.86  ? 272 SER A CB  1 
ATOM   1828 O OG  . SER A 1 272 ? 17.581 65.879 13.301  1.00 51.10  ? 272 SER A OG  1 
ATOM   1829 N N   . HIS A 1 273 ? 16.445 69.627 14.004  1.00 47.25  ? 273 HIS A N   1 
ATOM   1830 C CA  . HIS A 1 273 ? 15.092 70.075 13.704  1.00 47.98  ? 273 HIS A CA  1 
ATOM   1831 C C   . HIS A 1 273 ? 14.948 71.557 13.926  1.00 49.03  ? 273 HIS A C   1 
ATOM   1832 O O   . HIS A 1 273 ? 15.747 72.173 14.624  1.00 50.12  ? 273 HIS A O   1 
ATOM   1833 C CB  . HIS A 1 273 ? 14.070 69.359 14.562  1.00 48.56  ? 273 HIS A CB  1 
ATOM   1834 C CG  . HIS A 1 273 ? 14.006 69.859 15.972  1.00 50.25  ? 273 HIS A CG  1 
ATOM   1835 N ND1 . HIS A 1 273 ? 15.097 69.825 16.815  1.00 51.24  ? 273 HIS A ND1 1 
ATOM   1836 C CD2 . HIS A 1 273 ? 12.983 70.359 16.685  1.00 52.27  ? 273 HIS A CD2 1 
ATOM   1837 C CE1 . HIS A 1 273 ? 14.733 70.284 17.999  1.00 52.39  ? 273 HIS A CE1 1 
ATOM   1838 N NE2 . HIS A 1 273 ? 13.462 70.616 17.957  1.00 53.21  ? 273 HIS A NE2 1 
ATOM   1839 N N   . MET A 1 274 ? 13.906 72.124 13.342  1.00 48.98  ? 274 MET A N   1 
ATOM   1840 C CA  . MET A 1 274 ? 13.658 73.544 13.464  1.00 47.25  ? 274 MET A CA  1 
ATOM   1841 C C   . MET A 1 274 ? 12.208 73.859 13.151  1.00 47.02  ? 274 MET A C   1 
ATOM   1842 O O   . MET A 1 274 ? 11.589 73.228 12.296  1.00 44.47  ? 274 MET A O   1 
ATOM   1843 C CB  . MET A 1 274 ? 14.572 74.284 12.503  1.00 49.00  ? 274 MET A CB  1 
ATOM   1844 C CG  . MET A 1 274 ? 14.321 75.760 12.376  1.00 50.21  ? 274 MET A CG  1 
ATOM   1845 S SD  . MET A 1 274 ? 15.149 76.335 10.879  1.00 54.46  ? 274 MET A SD  1 
ATOM   1846 C CE  . MET A 1 274 ? 16.836 75.762 11.171  1.00 46.93  ? 274 MET A CE  1 
ATOM   1847 N N   . THR A 1 275 ? 11.669 74.844 13.854  1.00 48.44  ? 275 THR A N   1 
ATOM   1848 C CA  . THR A 1 275 ? 10.286 75.258 13.661  1.00 49.09  ? 275 THR A CA  1 
ATOM   1849 C C   . THR A 1 275 ? 10.138 75.920 12.308  1.00 49.11  ? 275 THR A C   1 
ATOM   1850 O O   . THR A 1 275 ? 11.127 76.345 11.714  1.00 47.80  ? 275 THR A O   1 
ATOM   1851 C CB  . THR A 1 275 ? 9.879  76.272 14.719  1.00 48.66  ? 275 THR A CB  1 
ATOM   1852 O OG1 . THR A 1 275 ? 10.873 77.302 14.772  1.00 48.58  ? 275 THR A OG1 1 
ATOM   1853 C CG2 . THR A 1 275 ? 9.763  75.605 16.077  1.00 47.88  ? 275 THR A CG2 1 
ATOM   1854 N N   . SER A 1 276 ? 8.907  76.000 11.820  1.00 49.75  ? 276 SER A N   1 
ATOM   1855 C CA  . SER A 1 276 ? 8.661  76.652 10.542  1.00 52.39  ? 276 SER A CA  1 
ATOM   1856 C C   . SER A 1 276 ? 9.142  78.092 10.694  1.00 54.83  ? 276 SER A C   1 
ATOM   1857 O O   . SER A 1 276 ? 9.949  78.594 9.901   1.00 53.60  ? 276 SER A O   1 
ATOM   1858 C CB  . SER A 1 276 ? 7.165  76.634 10.215  1.00 50.07  ? 276 SER A CB  1 
ATOM   1859 O OG  . SER A 1 276 ? 6.868  77.466 9.110   1.00 47.85  ? 276 SER A OG  1 
ATOM   1860 N N   . GLU A 1 277 ? 8.634  78.726 11.748  1.00 57.79  ? 277 GLU A N   1 
ATOM   1861 C CA  . GLU A 1 277 ? 8.935  80.103 12.110  1.00 60.69  ? 277 GLU A CA  1 
ATOM   1862 C C   . GLU A 1 277 ? 10.379 80.497 11.845  1.00 60.94  ? 277 GLU A C   1 
ATOM   1863 O O   . GLU A 1 277 ? 10.656 81.386 11.043  1.00 60.47  ? 277 GLU A O   1 
ATOM   1864 C CB  . GLU A 1 277 ? 8.640  80.302 13.591  1.00 63.42  ? 277 GLU A CB  1 
ATOM   1865 C CG  . GLU A 1 277 ? 7.410  79.565 14.069  1.00 69.20  ? 277 GLU A CG  1 
ATOM   1866 C CD  . GLU A 1 277 ? 6.222  80.477 14.233  1.00 73.57  ? 277 GLU A CD  1 
ATOM   1867 O OE1 . GLU A 1 277 ? 5.863  81.150 13.244  1.00 75.89  ? 277 GLU A OE1 1 
ATOM   1868 O OE2 . GLU A 1 277 ? 5.648  80.525 15.348  1.00 76.48  ? 277 GLU A OE2 1 
ATOM   1869 N N   . LYS A 1 278 ? 11.298 79.833 12.534  1.00 63.15  ? 278 LYS A N   1 
ATOM   1870 C CA  . LYS A 1 278 ? 12.715 80.133 12.392  1.00 65.73  ? 278 LYS A CA  1 
ATOM   1871 C C   . LYS A 1 278 ? 13.240 79.811 10.999  1.00 66.20  ? 278 LYS A C   1 
ATOM   1872 O O   . LYS A 1 278 ? 14.258 80.352 10.575  1.00 68.73  ? 278 LYS A O   1 
ATOM   1873 C CB  . LYS A 1 278 ? 13.520 79.371 13.450  1.00 67.27  ? 278 LYS A CB  1 
ATOM   1874 C CG  . LYS A 1 278 ? 14.948 79.853 13.588  1.00 70.08  ? 278 LYS A CG  1 
ATOM   1875 C CD  . LYS A 1 278 ? 15.560 79.428 14.914  1.00 74.38  ? 278 LYS A CD  1 
ATOM   1876 C CE  . LYS A 1 278 ? 16.933 80.077 15.110  1.00 77.53  ? 278 LYS A CE  1 
ATOM   1877 N NZ  . LYS A 1 278 ? 17.575 79.739 16.417  1.00 78.82  ? 278 LYS A NZ  1 
ATOM   1878 N N   . ALA A 1 279 ? 12.545 78.935 10.284  1.00 65.61  ? 279 ALA A N   1 
ATOM   1879 C CA  . ALA A 1 279 ? 12.970 78.564 8.944   1.00 64.33  ? 279 ALA A CA  1 
ATOM   1880 C C   . ALA A 1 279 ? 12.718 79.729 7.991   1.00 64.10  ? 279 ALA A C   1 
ATOM   1881 O O   . ALA A 1 279 ? 13.505 79.970 7.067   1.00 62.91  ? 279 ALA A O   1 
ATOM   1882 C CB  . ALA A 1 279 ? 12.224 77.333 8.489   1.00 64.62  ? 279 ALA A CB  1 
ATOM   1883 N N   . VAL A 1 280 ? 11.621 80.446 8.226   1.00 63.13  ? 280 VAL A N   1 
ATOM   1884 C CA  . VAL A 1 280 ? 11.253 81.601 7.411   1.00 62.94  ? 280 VAL A CA  1 
ATOM   1885 C C   . VAL A 1 280 ? 12.216 82.746 7.707   1.00 63.93  ? 280 VAL A C   1 
ATOM   1886 O O   . VAL A 1 280 ? 12.762 83.381 6.798   1.00 63.65  ? 280 VAL A O   1 
ATOM   1887 C CB  . VAL A 1 280 ? 9.837  82.074 7.729   1.00 61.66  ? 280 VAL A CB  1 
ATOM   1888 C CG1 . VAL A 1 280 ? 9.511  83.299 6.903   1.00 61.13  ? 280 VAL A CG1 1 
ATOM   1889 C CG2 . VAL A 1 280 ? 8.850  80.961 7.468   1.00 60.53  ? 280 VAL A CG2 1 
ATOM   1890 N N   . GLU A 1 281 ? 12.393 83.015 8.994   1.00 64.27  ? 281 GLU A N   1 
ATOM   1891 C CA  . GLU A 1 281 ? 13.311 84.044 9.439   1.00 64.09  ? 281 GLU A CA  1 
ATOM   1892 C C   . GLU A 1 281 ? 14.589 83.783 8.670   1.00 61.76  ? 281 GLU A C   1 
ATOM   1893 O O   . GLU A 1 281 ? 15.010 84.592 7.852   1.00 61.68  ? 281 GLU A O   1 
ATOM   1894 C CB  . GLU A 1 281 ? 13.580 83.896 10.940  1.00 68.41  ? 281 GLU A CB  1 
ATOM   1895 C CG  . GLU A 1 281 ? 12.655 84.688 11.848  1.00 74.48  ? 281 GLU A CG  1 
ATOM   1896 C CD  . GLU A 1 281 ? 12.971 86.179 11.845  1.00 79.00  ? 281 GLU A CD  1 
ATOM   1897 O OE1 . GLU A 1 281 ? 13.884 86.601 11.101  1.00 81.70  ? 281 GLU A OE1 1 
ATOM   1898 O OE2 . GLU A 1 281 ? 12.307 86.932 12.587  1.00 81.25  ? 281 GLU A OE2 1 
ATOM   1899 N N   . ILE A 1 282 ? 15.182 82.622 8.927   1.00 59.69  ? 282 ILE A N   1 
ATOM   1900 C CA  . ILE A 1 282 ? 16.415 82.227 8.267   1.00 58.44  ? 282 ILE A CA  1 
ATOM   1901 C C   . ILE A 1 282 ? 16.208 82.182 6.761   1.00 58.19  ? 282 ILE A C   1 
ATOM   1902 O O   . ILE A 1 282 ? 17.163 82.227 5.990   1.00 57.46  ? 282 ILE A O   1 
ATOM   1903 C CB  . ILE A 1 282 ? 16.899 80.850 8.775   1.00 57.55  ? 282 ILE A CB  1 
ATOM   1904 C CG1 . ILE A 1 282 ? 17.056 80.908 10.294  1.00 56.26  ? 282 ILE A CG1 1 
ATOM   1905 C CG2 . ILE A 1 282 ? 18.237 80.481 8.124   1.00 55.98  ? 282 ILE A CG2 1 
ATOM   1906 C CD1 . ILE A 1 282 ? 17.645 79.678 10.915  1.00 57.00  ? 282 ILE A CD1 1 
ATOM   1907 N N   . GLY A 1 283 ? 14.951 82.105 6.344   1.00 58.12  ? 283 GLY A N   1 
ATOM   1908 C CA  . GLY A 1 283 ? 14.663 82.081 4.925   1.00 60.58  ? 283 GLY A CA  1 
ATOM   1909 C C   . GLY A 1 283 ? 14.910 83.449 4.326   1.00 61.91  ? 283 GLY A C   1 
ATOM   1910 O O   . GLY A 1 283 ? 15.687 83.601 3.374   1.00 61.53  ? 283 GLY A O   1 
ATOM   1911 N N   . LYS A 1 284 ? 14.247 84.451 4.895   1.00 62.82  ? 284 LYS A N   1 
ATOM   1912 C CA  . LYS A 1 284 ? 14.395 85.826 4.442   1.00 64.24  ? 284 LYS A CA  1 
ATOM   1913 C C   . LYS A 1 284 ? 15.857 86.253 4.547   1.00 64.75  ? 284 LYS A C   1 
ATOM   1914 O O   . LYS A 1 284 ? 16.365 86.973 3.687   1.00 63.80  ? 284 LYS A O   1 
ATOM   1915 C CB  . LYS A 1 284 ? 13.529 86.739 5.292   1.00 64.12  ? 284 LYS A CB  1 
ATOM   1916 C CG  . LYS A 1 284 ? 12.066 86.390 5.248   1.00 65.79  ? 284 LYS A CG  1 
ATOM   1917 C CD  . LYS A 1 284 ? 11.332 87.066 6.390   1.00 68.22  ? 284 LYS A CD  1 
ATOM   1918 C CE  . LYS A 1 284 ? 9.845  86.771 6.358   1.00 68.99  ? 284 LYS A CE  1 
ATOM   1919 N NZ  . LYS A 1 284 ? 9.169  87.267 7.593   1.00 69.70  ? 284 LYS A NZ  1 
ATOM   1920 N N   . ALA A 1 285 ? 16.528 85.800 5.603   1.00 66.56  ? 285 ALA A N   1 
ATOM   1921 C CA  . ALA A 1 285 ? 17.938 86.118 5.821   1.00 67.99  ? 285 ALA A CA  1 
ATOM   1922 C C   . ALA A 1 285 ? 18.797 85.622 4.663   1.00 69.90  ? 285 ALA A C   1 
ATOM   1923 O O   . ALA A 1 285 ? 19.957 85.996 4.554   1.00 69.89  ? 285 ALA A O   1 
ATOM   1924 C CB  . ALA A 1 285 ? 18.428 85.506 7.130   1.00 65.71  ? 285 ALA A CB  1 
ATOM   1925 N N   . LEU A 1 286 ? 18.236 84.761 3.816   1.00 72.36  ? 286 LEU A N   1 
ATOM   1926 C CA  . LEU A 1 286 ? 18.981 84.264 2.668   1.00 74.09  ? 286 LEU A CA  1 
ATOM   1927 C C   . LEU A 1 286 ? 18.520 85.033 1.444   1.00 74.57  ? 286 LEU A C   1 
ATOM   1928 O O   . LEU A 1 286 ? 19.250 85.135 0.465   1.00 74.12  ? 286 LEU A O   1 
ATOM   1929 C CB  . LEU A 1 286 ? 18.744 82.773 2.434   1.00 73.70  ? 286 LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 286 ? 19.670 82.234 1.339   1.00 73.39  ? 286 LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 286 ? 21.025 81.888 1.933   1.00 71.23  ? 286 LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 286 ? 19.053 81.019 0.704   1.00 74.09  ? 286 LEU A CD2 1 
ATOM   1933 N N   . ILE A 1 287 ? 17.298 85.559 1.501   1.00 75.31  ? 287 ILE A N   1 
ATOM   1934 C CA  . ILE A 1 287 ? 16.765 86.342 0.395   1.00 75.84  ? 287 ILE A CA  1 
ATOM   1935 C C   . ILE A 1 287 ? 17.405 87.720 0.454   1.00 77.82  ? 287 ILE A C   1 
ATOM   1936 O O   . ILE A 1 287 ? 18.083 88.138 -0.484  1.00 79.58  ? 287 ILE A O   1 
ATOM   1937 C CB  . ILE A 1 287 ? 15.240 86.512 0.476   1.00 74.58  ? 287 ILE A CB  1 
ATOM   1938 C CG1 . ILE A 1 287 ? 14.542 85.163 0.273   1.00 75.51  ? 287 ILE A CG1 1 
ATOM   1939 C CG2 . ILE A 1 287 ? 14.791 87.502 -0.572  1.00 73.46  ? 287 ILE A CG2 1 
ATOM   1940 C CD1 . ILE A 1 287 ? 13.014 85.217 0.337   1.00 74.15  ? 287 ILE A CD1 1 
ATOM   1941 N N   . ASN A 1 288 ? 17.196 88.430 1.557   1.00 78.66  ? 288 ASN A N   1 
ATOM   1942 C CA  . ASN A 1 288 ? 17.789 89.752 1.695   1.00 79.20  ? 288 ASN A CA  1 
ATOM   1943 C C   . ASN A 1 288 ? 19.304 89.632 1.683   1.00 80.17  ? 288 ASN A C   1 
ATOM   1944 O O   . ASN A 1 288 ? 19.994 90.479 1.119   1.00 80.92  ? 288 ASN A O   1 
ATOM   1945 C CB  . ASN A 1 288 ? 17.307 90.432 2.975   1.00 78.51  ? 288 ASN A CB  1 
ATOM   1946 C CG  . ASN A 1 288 ? 15.887 90.940 2.854   1.00 78.34  ? 288 ASN A CG  1 
ATOM   1947 O OD1 . ASN A 1 288 ? 15.520 91.540 1.844   1.00 78.39  ? 288 ASN A OD1 1 
ATOM   1948 N ND2 . ASN A 1 288 ? 15.083 90.713 3.885   1.00 78.56  ? 288 ASN A ND2 1 
ATOM   1949 N N   . ASP A 1 289 ? 19.826 88.579 2.302   1.00 81.29  ? 289 ASP A N   1 
ATOM   1950 C CA  . ASP A 1 289 ? 21.262 88.367 2.294   1.00 81.68  ? 289 ASP A CA  1 
ATOM   1951 C C   . ASP A 1 289 ? 21.610 88.188 0.825   1.00 83.14  ? 289 ASP A C   1 
ATOM   1952 O O   . ASP A 1 289 ? 22.735 88.427 0.426   1.00 83.23  ? 289 ASP A O   1 
ATOM   1953 C CB  . ASP A 1 289 ? 21.638 87.086 3.034   1.00 81.70  ? 289 ASP A CB  1 
ATOM   1954 C CG  . ASP A 1 289 ? 22.671 87.311 4.122   1.00 81.58  ? 289 ASP A CG  1 
ATOM   1955 O OD1 . ASP A 1 289 ? 22.281 87.647 5.262   1.00 81.31  ? 289 ASP A OD1 1 
ATOM   1956 O OD2 . ASP A 1 289 ? 23.876 87.153 3.835   1.00 81.62  ? 289 ASP A OD2 1 
ATOM   1957 N N   . CYS A 1 290 ? 20.626 87.772 0.024   1.00 85.39  ? 290 CYS A N   1 
ATOM   1958 C CA  . CYS A 1 290 ? 20.830 87.535 -1.410  1.00 87.40  ? 290 CYS A CA  1 
ATOM   1959 C C   . CYS A 1 290 ? 20.253 88.562 -2.369  1.00 87.92  ? 290 CYS A C   1 
ATOM   1960 O O   . CYS A 1 290 ? 19.627 88.200 -3.365  1.00 88.25  ? 290 CYS A O   1 
ATOM   1961 C CB  . CYS A 1 290 ? 20.283 86.165 -1.814  1.00 88.33  ? 290 CYS A CB  1 
ATOM   1962 S SG  . CYS A 1 290 ? 21.377 84.782 -1.455  1.00 92.70  ? 290 CYS A SG  1 
ATOM   1963 N N   . ASN A 1 291 ? 20.461 89.836 -2.074  1.00 88.44  ? 291 ASN A N   1 
ATOM   1964 C CA  . ASN A 1 291 ? 19.983 90.900 -2.944  1.00 88.76  ? 291 ASN A CA  1 
ATOM   1965 C C   . ASN A 1 291 ? 18.638 90.612 -3.614  1.00 87.88  ? 291 ASN A C   1 
ATOM   1966 O O   . ASN A 1 291 ? 18.500 90.802 -4.819  1.00 88.79  ? 291 ASN A O   1 
ATOM   1967 C CB  . ASN A 1 291 ? 21.036 91.177 -4.025  1.00 88.64  ? 291 ASN A CB  1 
ATOM   1968 N N   . CYS A 1 292 ? 17.648 90.159 -2.856  1.00 86.48  ? 292 CYS A N   1 
ATOM   1969 C CA  . CYS A 1 292 ? 16.356 89.889 -3.462  1.00 85.82  ? 292 CYS A CA  1 
ATOM   1970 C C   . CYS A 1 292 ? 15.207 90.503 -2.707  1.00 86.99  ? 292 CYS A C   1 
ATOM   1971 O O   . CYS A 1 292 ? 14.053 90.124 -2.898  1.00 87.04  ? 292 CYS A O   1 
ATOM   1972 C CB  . CYS A 1 292 ? 16.141 88.390 -3.614  1.00 84.14  ? 292 CYS A CB  1 
ATOM   1973 S SG  . CYS A 1 292 ? 17.060 87.697 -5.025  1.00 81.11  ? 292 CYS A SG  1 
ATOM   1974 N N   . ASN A 1 293 ? 15.533 91.471 -1.859  1.00 88.79  ? 293 ASN A N   1 
ATOM   1975 C CA  . ASN A 1 293 ? 14.532 92.166 -1.061  1.00 91.02  ? 293 ASN A CA  1 
ATOM   1976 C C   . ASN A 1 293 ? 13.450 91.197 -0.587  1.00 91.38  ? 293 ASN A C   1 
ATOM   1977 O O   . ASN A 1 293 ? 12.373 91.120 -1.175  1.00 91.17  ? 293 ASN A O   1 
ATOM   1978 C CB  . ASN A 1 293 ? 13.903 93.301 -1.878  1.00 91.95  ? 293 ASN A CB  1 
ATOM   1979 C CG  . ASN A 1 293 ? 14.938 94.286 -2.407  1.00 93.93  ? 293 ASN A CG  1 
ATOM   1980 O OD1 . ASN A 1 293 ? 15.716 94.862 -1.644  1.00 94.92  ? 293 ASN A OD1 1 
ATOM   1981 N ND2 . ASN A 1 293 ? 14.948 94.486 -3.720  1.00 95.79  ? 293 ASN A ND2 1 
ATOM   1982 N N   . ALA A 1 294 ? 13.754 90.452 0.474   1.00 90.97  ? 294 ALA A N   1 
ATOM   1983 C CA  . ALA A 1 294 ? 12.826 89.485 1.040   1.00 90.97  ? 294 ALA A CA  1 
ATOM   1984 C C   . ALA A 1 294 ? 11.630 90.196 1.641   1.00 91.70  ? 294 ALA A C   1 
ATOM   1985 O O   . ALA A 1 294 ? 11.187 89.840 2.725   1.00 92.66  ? 294 ALA A O   1 
ATOM   1986 C CB  . ALA A 1 294 ? 13.525 88.670 2.117   1.00 89.93  ? 294 ALA A CB  1 
ATOM   1987 N N   . SER A 1 295 ? 11.086 91.181 0.939   1.00 92.13  ? 295 SER A N   1 
ATOM   1988 C CA  . SER A 1 295 ? 9.967  91.928 1.486   1.00 92.00  ? 295 SER A CA  1 
ATOM   1989 C C   . SER A 1 295 ? 8.667  91.892 0.711   1.00 92.66  ? 295 SER A C   1 
ATOM   1990 O O   . SER A 1 295 ? 7.677  92.458 1.163   1.00 92.52  ? 295 SER A O   1 
ATOM   1991 C CB  . SER A 1 295 ? 10.379 93.385 1.684   1.00 91.72  ? 295 SER A CB  1 
ATOM   1992 O OG  . SER A 1 295 ? 11.479 93.477 2.569   1.00 90.74  ? 295 SER A OG  1 
ATOM   1993 N N   . MET A 1 296 ? 8.653  91.240 -0.445  1.00 93.78  ? 296 MET A N   1 
ATOM   1994 C CA  . MET A 1 296 ? 7.429  91.188 -1.239  1.00 95.56  ? 296 MET A CA  1 
ATOM   1995 C C   . MET A 1 296 ? 6.740  89.833 -1.162  1.00 95.88  ? 296 MET A C   1 
ATOM   1996 O O   . MET A 1 296 ? 5.556  89.724 -1.478  1.00 95.65  ? 296 MET A O   1 
ATOM   1997 C CB  . MET A 1 296 ? 7.715  91.537 -2.706  1.00 96.37  ? 296 MET A CB  1 
ATOM   1998 C CG  . MET A 1 296 ? 6.784  92.599 -3.284  1.00 97.75  ? 296 MET A CG  1 
ATOM   1999 S SD  . MET A 1 296 ? 5.038  92.242 -2.962  1.00 100.00 ? 296 MET A SD  1 
ATOM   2000 C CE  . MET A 1 296 ? 4.269  93.838 -3.345  1.00 100.00 ? 296 MET A CE  1 
ATOM   2001 N N   . LEU A 1 297 ? 7.488  88.812 -0.750  1.00 96.16  ? 297 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 297 ? 6.966  87.458 -0.604  1.00 96.36  ? 297 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 297 ? 5.446  87.438 -0.534  1.00 97.37  ? 297 LEU A C   1 
ATOM   2004 O O   . LEU A 1 297 ? 4.790  86.696 -1.260  1.00 98.68  ? 297 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 297 ? 7.532  86.831 0.669   1.00 96.77  ? 297 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 297 ? 8.729  85.879 0.596   1.00 97.87  ? 297 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 297 ? 8.223  84.460 0.448   1.00 100.00 ? 297 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 297 ? 9.650  86.255 -0.542  1.00 98.50  ? 297 LEU A CD2 1 
ATOM   2009 N N   . LYS A 1 298 ? 4.890  88.276 0.332   1.00 98.09  ? 298 LYS A N   1 
ATOM   2010 C CA  . LYS A 1 298 ? 3.449  88.343 0.522   1.00 98.09  ? 298 LYS A CA  1 
ATOM   2011 C C   . LYS A 1 298 ? 2.593  88.835 -0.663  1.00 98.52  ? 298 LYS A C   1 
ATOM   2012 O O   . LYS A 1 298 ? 1.379  88.629 -0.647  1.00 98.47  ? 298 LYS A O   1 
ATOM   2013 C CB  . LYS A 1 298 ? 3.149  89.163 1.786   1.00 98.13  ? 298 LYS A CB  1 
ATOM   2014 C CG  . LYS A 1 298 ? 3.842  88.615 3.042   1.00 97.67  ? 298 LYS A CG  1 
ATOM   2015 C CD  . LYS A 1 298 ? 2.854  88.153 4.117   1.00 97.87  ? 298 LYS A CD  1 
ATOM   2016 C CE  . LYS A 1 298 ? 3.577  87.417 5.248   1.00 99.15  ? 298 LYS A CE  1 
ATOM   2017 N NZ  . LYS A 1 298 ? 2.677  87.031 6.381   1.00 99.31  ? 298 LYS A NZ  1 
ATOM   2018 N N   . THR A 1 299 ? 3.185  89.467 -1.683  1.00 99.02  ? 299 THR A N   1 
ATOM   2019 C CA  . THR A 1 299 ? 2.379  89.921 -2.835  1.00 99.49  ? 299 THR A CA  1 
ATOM   2020 C C   . THR A 1 299 ? 3.036  89.927 -4.231  1.00 98.79  ? 299 THR A C   1 
ATOM   2021 O O   . THR A 1 299 ? 2.378  90.216 -5.232  1.00 99.79  ? 299 THR A O   1 
ATOM   2022 C CB  . THR A 1 299 ? 1.767  91.327 -2.588  1.00 100.00 ? 299 THR A CB  1 
ATOM   2023 O OG1 . THR A 1 299 ? 1.202  91.383 -1.272  1.00 100.00 ? 299 THR A OG1 1 
ATOM   2024 C CG2 . THR A 1 299 ? 0.648  91.606 -3.605  1.00 100.00 ? 299 THR A CG2 1 
ATOM   2025 N N   . ASN A 1 300 ? 4.326  89.628 -4.302  1.00 97.69  ? 300 ASN A N   1 
ATOM   2026 C CA  . ASN A 1 300 ? 5.035  89.558 -5.581  1.00 96.95  ? 300 ASN A CA  1 
ATOM   2027 C C   . ASN A 1 300 ? 6.080  88.487 -5.302  1.00 96.44  ? 300 ASN A C   1 
ATOM   2028 O O   . ASN A 1 300 ? 7.286  88.689 -5.481  1.00 96.38  ? 300 ASN A O   1 
ATOM   2029 C CB  . ASN A 1 300 ? 5.693  90.898 -5.920  1.00 97.38  ? 300 ASN A CB  1 
ATOM   2030 N N   . PRO A 1 301 ? 5.607  87.306 -4.867  1.00 95.42  ? 301 PRO A N   1 
ATOM   2031 C CA  . PRO A 1 301 ? 6.438  86.154 -4.526  1.00 93.28  ? 301 PRO A CA  1 
ATOM   2032 C C   . PRO A 1 301 ? 7.225  85.694 -5.717  1.00 90.95  ? 301 PRO A C   1 
ATOM   2033 O O   . PRO A 1 301 ? 8.381  85.285 -5.612  1.00 89.40  ? 301 PRO A O   1 
ATOM   2034 C CB  . PRO A 1 301 ? 5.439  85.120 -4.081  1.00 94.03  ? 301 PRO A CB  1 
ATOM   2035 C CG  . PRO A 1 301 ? 4.215  85.897 -3.685  1.00 94.08  ? 301 PRO A CG  1 
ATOM   2036 C CD  . PRO A 1 301 ? 4.186  87.094 -4.583  1.00 95.11  ? 301 PRO A CD  1 
ATOM   2037 N N   . ALA A 1 302 ? 6.593  85.756 -6.877  1.00 89.10  ? 302 ALA A N   1 
ATOM   2038 C CA  . ALA A 1 302 ? 7.248  85.323 -8.084  1.00 87.98  ? 302 ALA A CA  1 
ATOM   2039 C C   . ALA A 1 302 ? 8.605  85.997 -8.241  1.00 87.31  ? 302 ALA A C   1 
ATOM   2040 O O   . ALA A 1 302 ? 9.609  85.314 -8.427  1.00 87.06  ? 302 ALA A O   1 
ATOM   2041 C CB  . ALA A 1 302 ? 6.366  85.611 -9.278  1.00 87.59  ? 302 ALA A CB  1 
ATOM   2042 N N   . HIS A 1 303 ? 8.641  87.325 -8.138  1.00 86.77  ? 303 HIS A N   1 
ATOM   2043 C CA  . HIS A 1 303 ? 9.895  88.058 -8.312  1.00 86.10  ? 303 HIS A CA  1 
ATOM   2044 C C   . HIS A 1 303 ? 11.026 87.587 -7.409  1.00 84.46  ? 303 HIS A C   1 
ATOM   2045 O O   . HIS A 1 303 ? 12.123 87.298 -7.889  1.00 83.19  ? 303 HIS A O   1 
ATOM   2046 C CB  . HIS A 1 303 ? 9.696  89.563 -8.109  1.00 88.25  ? 303 HIS A CB  1 
ATOM   2047 C CG  . HIS A 1 303 ? 10.952 90.360 -8.300  1.00 91.29  ? 303 HIS A CG  1 
ATOM   2048 N ND1 . HIS A 1 303 ? 11.438 91.233 -7.349  1.00 92.48  ? 303 HIS A ND1 1 
ATOM   2049 C CD2 . HIS A 1 303 ? 11.845 90.385 -9.318  1.00 92.80  ? 303 HIS A CD2 1 
ATOM   2050 C CE1 . HIS A 1 303 ? 12.573 91.759 -7.768  1.00 93.39  ? 303 HIS A CE1 1 
ATOM   2051 N NE2 . HIS A 1 303 ? 12.845 91.258 -8.967  1.00 93.73  ? 303 HIS A NE2 1 
ATOM   2052 N N   . VAL A 1 304 ? 10.764 87.525 -6.106  1.00 82.83  ? 304 VAL A N   1 
ATOM   2053 C CA  . VAL A 1 304 ? 11.776 87.093 -5.143  1.00 81.08  ? 304 VAL A CA  1 
ATOM   2054 C C   . VAL A 1 304 ? 12.298 85.701 -5.471  1.00 78.86  ? 304 VAL A C   1 
ATOM   2055 O O   . VAL A 1 304 ? 13.505 85.480 -5.556  1.00 78.00  ? 304 VAL A O   1 
ATOM   2056 C CB  . VAL A 1 304 ? 11.219 87.092 -3.705  1.00 81.55  ? 304 VAL A CB  1 
ATOM   2057 C CG1 . VAL A 1 304 ? 11.373 88.465 -3.081  1.00 81.95  ? 304 VAL A CG1 1 
ATOM   2058 C CG2 . VAL A 1 304 ? 9.760  86.715 -3.729  1.00 83.05  ? 304 VAL A CG2 1 
ATOM   2059 N N   . MET A 1 305 ? 11.386 84.757 -5.650  1.00 77.38  ? 305 MET A N   1 
ATOM   2060 C CA  . MET A 1 305 ? 11.794 83.404 -5.983  1.00 76.09  ? 305 MET A CA  1 
ATOM   2061 C C   . MET A 1 305 ? 12.605 83.483 -7.267  1.00 75.97  ? 305 MET A C   1 
ATOM   2062 O O   . MET A 1 305 ? 13.799 83.186 -7.271  1.00 74.28  ? 305 MET A O   1 
ATOM   2063 C CB  . MET A 1 305 ? 10.572 82.500 -6.183  1.00 75.22  ? 305 MET A CB  1 
ATOM   2064 C CG  . MET A 1 305 ? 9.677  82.376 -4.966  1.00 71.48  ? 305 MET A CG  1 
ATOM   2065 S SD  . MET A 1 305 ? 10.609 82.275 -3.432  1.00 73.93  ? 305 MET A SD  1 
ATOM   2066 C CE  . MET A 1 305 ? 11.846 81.046 -3.791  1.00 66.47  ? 305 MET A CE  1 
ATOM   2067 N N   . SER A 1 306 ? 11.948 83.908 -8.346  1.00 76.44  ? 306 SER A N   1 
ATOM   2068 C CA  . SER A 1 306 ? 12.589 84.050 -9.649  1.00 76.73  ? 306 SER A CA  1 
ATOM   2069 C C   . SER A 1 306 ? 13.878 84.833 -9.488  1.00 76.43  ? 306 SER A C   1 
ATOM   2070 O O   . SER A 1 306 ? 14.730 84.828 -10.369 1.00 76.73  ? 306 SER A O   1 
ATOM   2071 C CB  . SER A 1 306 ? 11.679 84.796 -10.618 1.00 77.00  ? 306 SER A CB  1 
ATOM   2072 O OG  . SER A 1 306 ? 11.585 86.155 -10.245 1.00 80.50  ? 306 SER A OG  1 
ATOM   2073 N N   . CYS A 1 307 ? 13.994 85.524 -8.361  1.00 76.68  ? 307 CYS A N   1 
ATOM   2074 C CA  . CYS A 1 307 ? 15.174 86.305 -8.045  1.00 77.58  ? 307 CYS A CA  1 
ATOM   2075 C C   . CYS A 1 307 ? 16.181 85.356 -7.391  1.00 78.07  ? 307 CYS A C   1 
ATOM   2076 O O   . CYS A 1 307 ? 17.351 85.289 -7.795  1.00 77.61  ? 307 CYS A O   1 
ATOM   2077 C CB  . CYS A 1 307 ? 14.808 87.435 -7.079  1.00 78.95  ? 307 CYS A CB  1 
ATOM   2078 S SG  . CYS A 1 307 ? 16.246 88.544 -6.676  1.00 82.13  ? 307 CYS A SG  1 
ATOM   2079 N N   . MET A 1 308 ? 15.679 84.636 -6.386  1.00 78.28  ? 308 MET A N   1 
ATOM   2080 C CA  . MET A 1 308 ? 16.471 83.608 -5.692  1.00 77.97  ? 308 MET A CA  1 
ATOM   2081 C C   . MET A 1 308 ? 16.949 82.661 -6.774  1.00 78.24  ? 308 MET A C   1 
ATOM   2082 O O   . MET A 1 308 ? 18.087 82.172 -6.749  1.00 77.99  ? 308 MET A O   1 
ATOM   2083 C CB  . MET A 1 308 ? 15.627 82.923 -4.626  1.00 78.25  ? 308 MET A CB  1 
ATOM   2084 C CG  . MET A 1 308 ? 15.459 83.788 -3.371  1.00 78.08  ? 308 MET A CG  1 
ATOM   2085 S SD  . MET A 1 308 ? 16.959 84.619 -2.885  1.00 79.93  ? 308 MET A SD  1 
ATOM   2086 C CE  . MET A 1 308 ? 18.273 83.432 -2.698  1.00 77.60  ? 308 MET A CE  1 
ATOM   2087 N N   . ARG A 1 309 ? 16.038 82.424 -7.702  1.00 78.04  ? 309 ARG A N   1 
ATOM   2088 C CA  . ARG A 1 309 ? 16.404 81.748 -8.930  1.00 78.16  ? 309 ARG A CA  1 
ATOM   2089 C C   . ARG A 1 309 ? 17.146 82.820 -9.694  1.00 79.89  ? 309 ARG A C   1 
ATOM   2090 O O   . ARG A 1 309 ? 16.608 83.906 -9.943  1.00 81.26  ? 309 ARG A O   1 
ATOM   2091 C CB  . ARG A 1 309 ? 15.183 81.286 -9.736  1.00 75.21  ? 309 ARG A CB  1 
ATOM   2092 C CG  . ARG A 1 309 ? 13.913 81.085 -8.917  1.00 73.89  ? 309 ARG A CG  1 
ATOM   2093 C CD  . ARG A 1 309 ? 12.756 80.537 -9.762  1.00 72.41  ? 309 ARG A CD  1 
ATOM   2094 N NE  . ARG A 1 309 ? 12.093 79.382 -9.143  1.00 71.80  ? 309 ARG A NE  1 
ATOM   2095 C CZ  . ARG A 1 309 ? 12.737 78.416 -8.476  1.00 72.04  ? 309 ARG A CZ  1 
ATOM   2096 N NH1 . ARG A 1 309 ? 14.069 78.443 -8.336  1.00 70.26  ? 309 ARG A NH1 1 
ATOM   2097 N NH2 . ARG A 1 309 ? 12.127 77.370 -7.903  1.00 72.59  ? 309 ARG A NH2 1 
ATOM   2098 N N   . SER A 1 310 ? 18.366 82.543 -10.024 1.00 79.98  ? 310 SER A N   1 
ATOM   2099 C CA  . SER A 1 310 ? 19.201 83.533 -10.697 1.00 78.65  ? 310 SER A CA  1 
ATOM   2100 C C   . SER A 1 310 ? 20.520 83.629 -9.957  1.00 78.85  ? 310 SER A C   1 
ATOM   2101 O O   . SER A 1 310 ? 21.584 83.321 -10.509 1.00 80.01  ? 310 SER A O   1 
ATOM   2102 C CB  . SER A 1 310 ? 18.517 84.905 -10.665 1.00 75.74  ? 310 SER A CB  1 
ATOM   2103 O OG  . SER A 1 310 ? 17.374 84.904 -11.506 1.00 75.34  ? 310 SER A OG  1 
ATOM   2104 N N   . VAL A 1 311 ? 20.417 84.056 -8.710  1.00 77.66  ? 311 VAL A N   1 
ATOM   2105 C CA  . VAL A 1 311 ? 21.593 84.159 -7.852  1.00 77.48  ? 311 VAL A CA  1 
ATOM   2106 C C   . VAL A 1 311 ? 22.393 82.877 -8.016  1.00 78.03  ? 311 VAL A C   1 
ATOM   2107 O O   . VAL A 1 311 ? 21.868 81.784 -7.800  1.00 76.49  ? 311 VAL A O   1 
ATOM   2108 C CB  . VAL A 1 311 ? 21.194 84.328 -6.387  1.00 76.72  ? 311 VAL A CB  1 
ATOM   2109 C CG1 . VAL A 1 311 ? 22.403 84.531 -5.465  1.00 75.42  ? 311 VAL A CG1 1 
ATOM   2110 C CG2 . VAL A 1 311 ? 20.285 85.532 -6.149  1.00 75.80  ? 311 VAL A CG2 1 
ATOM   2111 N N   . ASP A 1 312 ? 23.656 83.012 -8.419  1.00 80.03  ? 312 ASP A N   1 
ATOM   2112 C CA  . ASP A 1 312 ? 24.522 81.848 -8.606  1.00 81.42  ? 312 ASP A CA  1 
ATOM   2113 C C   . ASP A 1 312 ? 24.532 81.018 -7.330  1.00 80.71  ? 312 ASP A C   1 
ATOM   2114 O O   . ASP A 1 312 ? 24.262 81.527 -6.241  1.00 80.32  ? 312 ASP A O   1 
ATOM   2115 C CB  . ASP A 1 312 ? 25.963 82.272 -8.953  1.00 83.80  ? 312 ASP A CB  1 
ATOM   2116 C CG  . ASP A 1 312 ? 26.078 82.919 -10.334 1.00 86.59  ? 312 ASP A CG  1 
ATOM   2117 O OD1 . ASP A 1 312 ? 25.488 84.007 -10.532 1.00 88.04  ? 312 ASP A OD1 1 
ATOM   2118 O OD2 . ASP A 1 312 ? 26.757 82.341 -11.218 1.00 85.80  ? 312 ASP A OD2 1 
ATOM   2119 N N   . ALA A 1 313 ? 24.839 79.737 -7.470  1.00 79.55  ? 313 ALA A N   1 
ATOM   2120 C CA  . ALA A 1 313 ? 24.879 78.851 -6.319  1.00 79.15  ? 313 ALA A CA  1 
ATOM   2121 C C   . ALA A 1 313 ? 25.847 79.373 -5.264  1.00 78.61  ? 313 ALA A C   1 
ATOM   2122 O O   . ALA A 1 313 ? 25.451 79.606 -4.121  1.00 79.82  ? 313 ALA A O   1 
ATOM   2123 C CB  . ALA A 1 313 ? 25.285 77.452 -6.751  1.00 79.88  ? 313 ALA A CB  1 
ATOM   2124 N N   . LYS A 1 314 ? 27.110 79.552 -5.651  1.00 76.43  ? 314 LYS A N   1 
ATOM   2125 C CA  . LYS A 1 314 ? 28.136 80.045 -4.737  1.00 73.70  ? 314 LYS A CA  1 
ATOM   2126 C C   . LYS A 1 314 ? 27.642 81.175 -3.849  1.00 73.03  ? 314 LYS A C   1 
ATOM   2127 O O   . LYS A 1 314 ? 27.913 81.175 -2.651  1.00 72.67  ? 314 LYS A O   1 
ATOM   2128 C CB  . LYS A 1 314 ? 29.365 80.507 -5.511  1.00 72.26  ? 314 LYS A CB  1 
ATOM   2129 C CG  . LYS A 1 314 ? 30.574 79.606 -5.336  1.00 72.50  ? 314 LYS A CG  1 
ATOM   2130 C CD  . LYS A 1 314 ? 31.122 79.657 -3.910  1.00 72.42  ? 314 LYS A CD  1 
ATOM   2131 C CE  . LYS A 1 314 ? 32.383 78.803 -3.758  1.00 72.32  ? 314 LYS A CE  1 
ATOM   2132 N NZ  . LYS A 1 314 ? 33.455 79.197 -4.720  1.00 71.77  ? 314 LYS A NZ  1 
ATOM   2133 N N   . THR A 1 315 ? 26.921 82.136 -4.427  1.00 73.31  ? 315 THR A N   1 
ATOM   2134 C CA  . THR A 1 315 ? 26.387 83.254 -3.646  1.00 73.47  ? 315 THR A CA  1 
ATOM   2135 C C   . THR A 1 315 ? 25.493 82.715 -2.523  1.00 74.39  ? 315 THR A C   1 
ATOM   2136 O O   . THR A 1 315 ? 25.773 82.931 -1.333  1.00 75.23  ? 315 THR A O   1 
ATOM   2137 C CB  . THR A 1 315 ? 25.554 84.240 -4.520  1.00 72.67  ? 315 THR A CB  1 
ATOM   2138 O OG1 . THR A 1 315 ? 26.403 84.899 -5.468  1.00 71.95  ? 315 THR A OG1 1 
ATOM   2139 C CG2 . THR A 1 315 ? 24.893 85.295 -3.647  1.00 71.27  ? 315 THR A CG2 1 
ATOM   2140 N N   . ILE A 1 316 ? 24.425 82.007 -2.901  1.00 74.17  ? 316 ILE A N   1 
ATOM   2141 C CA  . ILE A 1 316 ? 23.494 81.429 -1.928  1.00 71.84  ? 316 ILE A CA  1 
ATOM   2142 C C   . ILE A 1 316 ? 24.228 80.525 -0.960  1.00 71.00  ? 316 ILE A C   1 
ATOM   2143 O O   . ILE A 1 316 ? 24.017 80.581 0.244   1.00 70.89  ? 316 ILE A O   1 
ATOM   2144 C CB  . ILE A 1 316 ? 22.404 80.568 -2.594  1.00 70.25  ? 316 ILE A CB  1 
ATOM   2145 C CG1 . ILE A 1 316 ? 21.462 81.438 -3.414  1.00 67.90  ? 316 ILE A CG1 1 
ATOM   2146 C CG2 . ILE A 1 316 ? 21.613 79.832 -1.526  1.00 69.73  ? 316 ILE A CG2 1 
ATOM   2147 C CD1 . ILE A 1 316 ? 20.338 80.668 -4.036  1.00 65.62  ? 316 ILE A CD1 1 
ATOM   2148 N N   . SER A 1 317 ? 25.086 79.682 -1.504  1.00 70.42  ? 317 SER A N   1 
ATOM   2149 C CA  . SER A 1 317 ? 25.847 78.744 -0.706  1.00 72.54  ? 317 SER A CA  1 
ATOM   2150 C C   . SER A 1 317 ? 26.591 79.446 0.431   1.00 74.13  ? 317 SER A C   1 
ATOM   2151 O O   . SER A 1 317 ? 26.686 78.898 1.540   1.00 75.00  ? 317 SER A O   1 
ATOM   2152 C CB  . SER A 1 317 ? 26.839 77.993 -1.600  1.00 70.98  ? 317 SER A CB  1 
ATOM   2153 O OG  . SER A 1 317 ? 27.357 76.855 -0.936  1.00 72.40  ? 317 SER A OG  1 
ATOM   2154 N N   . VAL A 1 318 ? 27.120 80.640 0.173   1.00 76.09  ? 318 VAL A N   1 
ATOM   2155 C CA  . VAL A 1 318 ? 27.874 81.374 1.194   1.00 77.04  ? 318 VAL A CA  1 
ATOM   2156 C C   . VAL A 1 318 ? 27.020 82.272 2.081   1.00 78.66  ? 318 VAL A C   1 
ATOM   2157 O O   . VAL A 1 318 ? 27.205 82.299 3.299   1.00 78.51  ? 318 VAL A O   1 
ATOM   2158 C CB  . VAL A 1 318 ? 29.003 82.230 0.551   1.00 76.45  ? 318 VAL A CB  1 
ATOM   2159 C CG1 . VAL A 1 318 ? 29.637 83.148 1.597   1.00 75.79  ? 318 VAL A CG1 1 
ATOM   2160 C CG2 . VAL A 1 318 ? 30.072 81.313 -0.033  1.00 75.37  ? 318 VAL A CG2 1 
ATOM   2161 N N   . GLN A 1 319 ? 26.085 83.004 1.486   1.00 80.35  ? 319 GLN A N   1 
ATOM   2162 C CA  . GLN A 1 319 ? 25.243 83.887 2.276   1.00 81.57  ? 319 GLN A CA  1 
ATOM   2163 C C   . GLN A 1 319 ? 24.236 83.144 3.145   1.00 81.69  ? 319 GLN A C   1 
ATOM   2164 O O   . GLN A 1 319 ? 23.478 83.749 3.909   1.00 82.43  ? 319 GLN A O   1 
ATOM   2165 C CB  . GLN A 1 319 ? 24.558 84.893 1.363   1.00 82.34  ? 319 GLN A CB  1 
ATOM   2166 C CG  . GLN A 1 319 ? 25.570 85.823 0.743   1.00 86.40  ? 319 GLN A CG  1 
ATOM   2167 C CD  . GLN A 1 319 ? 24.948 87.059 0.163   1.00 88.45  ? 319 GLN A CD  1 
ATOM   2168 O OE1 . GLN A 1 319 ? 24.165 86.986 -0.783  1.00 90.87  ? 319 GLN A OE1 1 
ATOM   2169 N NE2 . GLN A 1 319 ? 25.288 88.212 0.728   1.00 88.61  ? 319 GLN A NE2 1 
ATOM   2170 N N   . GLN A 1 320 ? 24.230 81.824 3.032   1.00 81.08  ? 320 GLN A N   1 
ATOM   2171 C CA  . GLN A 1 320 ? 23.340 81.034 3.855   1.00 79.41  ? 320 GLN A CA  1 
ATOM   2172 C C   . GLN A 1 320 ? 24.071 80.940 5.173   1.00 79.14  ? 320 GLN A C   1 
ATOM   2173 O O   . GLN A 1 320 ? 23.511 81.252 6.220   1.00 80.33  ? 320 GLN A O   1 
ATOM   2174 C CB  . GLN A 1 320 ? 23.128 79.631 3.273   1.00 78.18  ? 320 GLN A CB  1 
ATOM   2175 C CG  . GLN A 1 320 ? 24.367 78.743 3.271   1.00 75.50  ? 320 GLN A CG  1 
ATOM   2176 C CD  . GLN A 1 320 ? 24.074 77.324 2.806   1.00 73.58  ? 320 GLN A CD  1 
ATOM   2177 O OE1 . GLN A 1 320 ? 22.930 76.980 2.504   1.00 68.90  ? 320 GLN A OE1 1 
ATOM   2178 N NE2 . GLN A 1 320 ? 25.111 76.495 2.746   1.00 71.58  ? 320 GLN A NE2 1 
ATOM   2179 N N   . TRP A 1 321 ? 25.340 80.547 5.096   1.00 77.92  ? 321 TRP A N   1 
ATOM   2180 C CA  . TRP A 1 321 ? 26.182 80.386 6.271   1.00 77.82  ? 321 TRP A CA  1 
ATOM   2181 C C   . TRP A 1 321 ? 26.138 81.516 7.280   1.00 79.43  ? 321 TRP A C   1 
ATOM   2182 O O   . TRP A 1 321 ? 26.602 81.355 8.408   1.00 80.01  ? 321 TRP A O   1 
ATOM   2183 C CB  . TRP A 1 321 ? 27.624 80.134 5.856   1.00 75.68  ? 321 TRP A CB  1 
ATOM   2184 C CG  . TRP A 1 321 ? 27.937 78.688 5.781   1.00 73.49  ? 321 TRP A CG  1 
ATOM   2185 C CD1 . TRP A 1 321 ? 28.398 78.008 4.700   1.00 72.73  ? 321 TRP A CD1 1 
ATOM   2186 C CD2 . TRP A 1 321 ? 27.809 77.731 6.836   1.00 72.66  ? 321 TRP A CD2 1 
ATOM   2187 N NE1 . TRP A 1 321 ? 28.566 76.683 5.010   1.00 72.73  ? 321 TRP A NE1 1 
ATOM   2188 C CE2 . TRP A 1 321 ? 28.210 76.484 6.317   1.00 73.04  ? 321 TRP A CE2 1 
ATOM   2189 C CE3 . TRP A 1 321 ? 27.394 77.805 8.169   1.00 72.15  ? 321 TRP A CE3 1 
ATOM   2190 C CZ2 . TRP A 1 321 ? 28.212 75.316 7.086   1.00 71.89  ? 321 TRP A CZ2 1 
ATOM   2191 C CZ3 . TRP A 1 321 ? 27.396 76.643 8.933   1.00 71.88  ? 321 TRP A CZ3 1 
ATOM   2192 C CH2 . TRP A 1 321 ? 27.802 75.416 8.386   1.00 71.18  ? 321 TRP A CH2 1 
ATOM   2193 N N   . ASN A 1 322 ? 25.584 82.657 6.889   1.00 80.92  ? 322 ASN A N   1 
ATOM   2194 C CA  . ASN A 1 322 ? 25.483 83.779 7.814   1.00 82.19  ? 322 ASN A CA  1 
ATOM   2195 C C   . ASN A 1 322 ? 24.503 83.425 8.932   1.00 82.12  ? 322 ASN A C   1 
ATOM   2196 O O   . ASN A 1 322 ? 24.822 83.545 10.111  1.00 82.12  ? 322 ASN A O   1 
ATOM   2197 C CB  . ASN A 1 322 ? 25.007 85.036 7.083   1.00 83.18  ? 322 ASN A CB  1 
ATOM   2198 C CG  . ASN A 1 322 ? 25.932 85.436 5.953   1.00 83.14  ? 322 ASN A CG  1 
ATOM   2199 O OD1 . ASN A 1 322 ? 27.131 85.628 6.152   1.00 83.52  ? 322 ASN A OD1 1 
ATOM   2200 N ND2 . ASN A 1 322 ? 25.379 85.561 4.757   1.00 83.57  ? 322 ASN A ND2 1 
ATOM   2201 N N   . SER A 1 323 ? 23.311 82.983 8.545   1.00 82.29  ? 323 SER A N   1 
ATOM   2202 C CA  . SER A 1 323 ? 22.274 82.603 9.495   1.00 81.95  ? 323 SER A CA  1 
ATOM   2203 C C   . SER A 1 323 ? 22.759 81.475 10.399  1.00 82.48  ? 323 SER A C   1 
ATOM   2204 O O   . SER A 1 323 ? 22.028 80.531 10.679  1.00 83.47  ? 323 SER A O   1 
ATOM   2205 C CB  . SER A 1 323 ? 21.020 82.149 8.748   1.00 82.76  ? 323 SER A CB  1 
ATOM   2206 O OG  . SER A 1 323 ? 20.521 83.175 7.913   1.00 84.73  ? 323 SER A OG  1 
ATOM   2207 N N   . TYR A 1 324 ? 23.997 81.576 10.856  1.00 82.72  ? 324 TYR A N   1 
ATOM   2208 C CA  . TYR A 1 324 ? 24.579 80.571 11.729  1.00 83.61  ? 324 TYR A CA  1 
ATOM   2209 C C   . TYR A 1 324 ? 24.799 81.216 13.105  1.00 85.09  ? 324 TYR A C   1 
ATOM   2210 O O   . TYR A 1 324 ? 25.909 81.651 13.432  1.00 86.62  ? 324 TYR A O   1 
ATOM   2211 C CB  . TYR A 1 324 ? 25.904 80.112 11.136  1.00 81.51  ? 324 TYR A CB  1 
ATOM   2212 C CG  . TYR A 1 324 ? 26.585 79.018 11.906  1.00 80.99  ? 324 TYR A CG  1 
ATOM   2213 C CD1 . TYR A 1 324 ? 26.204 77.690 11.752  1.00 81.41  ? 324 TYR A CD1 1 
ATOM   2214 C CD2 . TYR A 1 324 ? 27.631 79.308 12.778  1.00 81.80  ? 324 TYR A CD2 1 
ATOM   2215 C CE1 . TYR A 1 324 ? 26.857 76.670 12.442  1.00 81.78  ? 324 TYR A CE1 1 
ATOM   2216 C CE2 . TYR A 1 324 ? 28.290 78.300 13.476  1.00 81.61  ? 324 TYR A CE2 1 
ATOM   2217 C CZ  . TYR A 1 324 ? 27.898 76.983 13.300  1.00 81.83  ? 324 TYR A CZ  1 
ATOM   2218 O OH  . TYR A 1 324 ? 28.561 75.975 13.958  1.00 80.89  ? 324 TYR A OH  1 
ATOM   2219 N N   . SER A 1 325 ? 23.734 81.263 13.906  1.00 84.38  ? 325 SER A N   1 
ATOM   2220 C CA  . SER A 1 325 ? 23.767 81.885 15.228  1.00 82.08  ? 325 SER A CA  1 
ATOM   2221 C C   . SER A 1 325 ? 24.448 81.124 16.370  1.00 81.01  ? 325 SER A C   1 
ATOM   2222 O O   . SER A 1 325 ? 24.096 81.320 17.528  1.00 82.75  ? 325 SER A O   1 
ATOM   2223 C CB  . SER A 1 325 ? 22.335 82.251 15.654  1.00 80.76  ? 325 SER A CB  1 
ATOM   2224 O OG  . SER A 1 325 ? 21.769 83.216 14.784  1.00 77.31  ? 325 SER A OG  1 
ATOM   2225 N N   . GLY A 1 326 ? 25.422 80.272 16.079  1.00 78.63  ? 326 GLY A N   1 
ATOM   2226 C CA  . GLY A 1 326 ? 26.070 79.572 17.174  1.00 76.75  ? 326 GLY A CA  1 
ATOM   2227 C C   . GLY A 1 326 ? 26.492 78.153 16.877  1.00 75.62  ? 326 GLY A C   1 
ATOM   2228 O O   . GLY A 1 326 ? 26.226 77.632 15.797  1.00 77.08  ? 326 GLY A O   1 
ATOM   2229 N N   . ILE A 1 327 ? 27.133 77.508 17.844  1.00 72.97  ? 327 ILE A N   1 
ATOM   2230 C CA  . ILE A 1 327 ? 27.597 76.154 17.621  1.00 71.16  ? 327 ILE A CA  1 
ATOM   2231 C C   . ILE A 1 327 ? 26.498 75.137 17.329  1.00 69.70  ? 327 ILE A C   1 
ATOM   2232 O O   . ILE A 1 327 ? 25.445 75.139 17.961  1.00 71.51  ? 327 ILE A O   1 
ATOM   2233 C CB  . ILE A 1 327 ? 28.487 75.661 18.787  1.00 70.65  ? 327 ILE A CB  1 
ATOM   2234 C CG1 . ILE A 1 327 ? 29.074 74.287 18.437  1.00 71.79  ? 327 ILE A CG1 1 
ATOM   2235 C CG2 . ILE A 1 327 ? 27.689 75.620 20.066  1.00 70.98  ? 327 ILE A CG2 1 
ATOM   2236 C CD1 . ILE A 1 327 ? 30.249 73.866 19.292  1.00 72.41  ? 327 ILE A CD1 1 
ATOM   2237 N N   . LEU A 1 328 ? 26.755 74.284 16.339  1.00 66.44  ? 328 LEU A N   1 
ATOM   2238 C CA  . LEU A 1 328 ? 25.820 73.252 15.936  1.00 61.91  ? 328 LEU A CA  1 
ATOM   2239 C C   . LEU A 1 328 ? 24.421 73.780 15.713  1.00 61.53  ? 328 LEU A C   1 
ATOM   2240 O O   . LEU A 1 328 ? 23.451 73.044 15.813  1.00 60.98  ? 328 LEU A O   1 
ATOM   2241 C CB  . LEU A 1 328 ? 25.807 72.152 16.983  1.00 60.84  ? 328 LEU A CB  1 
ATOM   2242 C CG  . LEU A 1 328 ? 27.016 71.230 16.876  1.00 59.88  ? 328 LEU A CG  1 
ATOM   2243 C CD1 . LEU A 1 328 ? 27.239 70.469 18.163  1.00 59.11  ? 328 LEU A CD1 1 
ATOM   2244 C CD2 . LEU A 1 328 ? 26.781 70.280 15.724  1.00 61.05  ? 328 LEU A CD2 1 
ATOM   2245 N N   . SER A 1 329 ? 24.309 75.062 15.403  1.00 61.60  ? 329 SER A N   1 
ATOM   2246 C CA  . SER A 1 329 ? 22.998 75.634 15.168  1.00 62.66  ? 329 SER A CA  1 
ATOM   2247 C C   . SER A 1 329 ? 22.857 76.016 13.700  1.00 62.41  ? 329 SER A C   1 
ATOM   2248 O O   . SER A 1 329 ? 22.522 77.159 13.372  1.00 62.21  ? 329 SER A O   1 
ATOM   2249 C CB  . SER A 1 329 ? 22.798 76.861 16.050  1.00 65.00  ? 329 SER A CB  1 
ATOM   2250 O OG  . SER A 1 329 ? 21.503 77.406 15.850  1.00 69.10  ? 329 SER A OG  1 
ATOM   2251 N N   . PHE A 1 330 ? 23.103 75.047 12.825  1.00 61.40  ? 330 PHE A N   1 
ATOM   2252 C CA  . PHE A 1 330 ? 23.016 75.262 11.388  1.00 59.81  ? 330 PHE A CA  1 
ATOM   2253 C C   . PHE A 1 330 ? 21.719 75.945 10.977  1.00 58.27  ? 330 PHE A C   1 
ATOM   2254 O O   . PHE A 1 330 ? 20.693 75.778 11.626  1.00 58.04  ? 330 PHE A O   1 
ATOM   2255 C CB  . PHE A 1 330 ? 23.149 73.935 10.665  1.00 60.14  ? 330 PHE A CB  1 
ATOM   2256 C CG  . PHE A 1 330 ? 24.408 73.208 10.988  1.00 61.17  ? 330 PHE A CG  1 
ATOM   2257 C CD1 . PHE A 1 330 ? 25.614 73.624 10.447  1.00 62.49  ? 330 PHE A CD1 1 
ATOM   2258 C CD2 . PHE A 1 330 ? 24.394 72.099 11.830  1.00 62.42  ? 330 PHE A CD2 1 
ATOM   2259 C CE1 . PHE A 1 330 ? 26.797 72.941 10.734  1.00 63.44  ? 330 PHE A CE1 1 
ATOM   2260 C CE2 . PHE A 1 330 ? 25.571 71.405 12.125  1.00 62.15  ? 330 PHE A CE2 1 
ATOM   2261 C CZ  . PHE A 1 330 ? 26.774 71.828 11.575  1.00 62.79  ? 330 PHE A CZ  1 
ATOM   2262 N N   . PRO A 1 331 ? 21.759 76.723 9.881   1.00 57.63  ? 331 PRO A N   1 
ATOM   2263 C CA  . PRO A 1 331 ? 20.638 77.477 9.312   1.00 57.40  ? 331 PRO A CA  1 
ATOM   2264 C C   . PRO A 1 331 ? 19.634 76.695 8.479   1.00 56.63  ? 331 PRO A C   1 
ATOM   2265 O O   . PRO A 1 331 ? 18.718 77.281 7.912   1.00 56.35  ? 331 PRO A O   1 
ATOM   2266 C CB  . PRO A 1 331 ? 21.335 78.544 8.481   1.00 58.22  ? 331 PRO A CB  1 
ATOM   2267 C CG  . PRO A 1 331 ? 22.494 77.794 7.933   1.00 59.83  ? 331 PRO A CG  1 
ATOM   2268 C CD  . PRO A 1 331 ? 23.000 77.013 9.140   1.00 58.64  ? 331 PRO A CD  1 
ATOM   2269 N N   . SER A 1 332 ? 19.816 75.385 8.381   1.00 56.25  ? 332 SER A N   1 
ATOM   2270 C CA  . SER A 1 332 ? 18.888 74.546 7.626   1.00 54.58  ? 332 SER A CA  1 
ATOM   2271 C C   . SER A 1 332 ? 18.810 73.177 8.277   1.00 50.99  ? 332 SER A C   1 
ATOM   2272 O O   . SER A 1 332 ? 19.831 72.568 8.597   1.00 51.51  ? 332 SER A O   1 
ATOM   2273 C CB  . SER A 1 332 ? 19.337 74.408 6.162   1.00 56.88  ? 332 SER A CB  1 
ATOM   2274 O OG  . SER A 1 332 ? 18.408 75.016 5.269   1.00 58.49  ? 332 SER A OG  1 
ATOM   2275 N N   . ALA A 1 333 ? 17.594 72.695 8.479   1.00 47.36  ? 333 ALA A N   1 
ATOM   2276 C CA  . ALA A 1 333 ? 17.417 71.390 9.099   1.00 43.35  ? 333 ALA A CA  1 
ATOM   2277 C C   . ALA A 1 333 ? 15.973 70.936 8.972   1.00 39.91  ? 333 ALA A C   1 
ATOM   2278 O O   . ALA A 1 333 ? 15.107 71.707 8.522   1.00 38.84  ? 333 ALA A O   1 
ATOM   2279 C CB  . ALA A 1 333 ? 17.813 71.464 10.561  1.00 43.58  ? 333 ALA A CB  1 
ATOM   2280 N N   . PRO A 1 334 ? 15.703 69.665 9.325   1.00 35.87  ? 334 PRO A N   1 
ATOM   2281 C CA  . PRO A 1 334 ? 14.356 69.112 9.258   1.00 35.53  ? 334 PRO A CA  1 
ATOM   2282 C C   . PRO A 1 334 ? 13.465 70.162 9.880   1.00 37.09  ? 334 PRO A C   1 
ATOM   2283 O O   . PRO A 1 334 ? 13.543 70.418 11.085  1.00 39.73  ? 334 PRO A O   1 
ATOM   2284 C CB  . PRO A 1 334 ? 14.471 67.864 10.111  1.00 34.30  ? 334 PRO A CB  1 
ATOM   2285 C CG  . PRO A 1 334 ? 15.820 67.375 9.750   1.00 32.77  ? 334 PRO A CG  1 
ATOM   2286 C CD  . PRO A 1 334 ? 16.657 68.636 9.769   1.00 34.97  ? 334 PRO A CD  1 
ATOM   2287 N N   . THR A 1 335 ? 12.650 70.797 9.050   1.00 36.56  ? 335 THR A N   1 
ATOM   2288 C CA  . THR A 1 335 ? 11.776 71.861 9.508   1.00 36.87  ? 335 THR A CA  1 
ATOM   2289 C C   . THR A 1 335 ? 10.348 71.391 9.689   1.00 34.69  ? 335 THR A C   1 
ATOM   2290 O O   . THR A 1 335 ? 9.878  70.529 8.956   1.00 32.03  ? 335 THR A O   1 
ATOM   2291 C CB  . THR A 1 335 ? 11.838 73.047 8.531   1.00 37.45  ? 335 THR A CB  1 
ATOM   2292 O OG1 . THR A 1 335 ? 12.137 72.568 7.218   1.00 46.37  ? 335 THR A OG1 1 
ATOM   2293 C CG2 . THR A 1 335 ? 12.956 73.975 8.905   1.00 42.23  ? 335 THR A CG2 1 
ATOM   2294 N N   . ILE A 1 336 ? 9.670  71.939 10.691  1.00 33.69  ? 336 ILE A N   1 
ATOM   2295 C CA  . ILE A 1 336 ? 8.301  71.545 10.940  1.00 36.53  ? 336 ILE A CA  1 
ATOM   2296 C C   . ILE A 1 336 ? 7.432  72.188 9.881   1.00 36.70  ? 336 ILE A C   1 
ATOM   2297 O O   . ILE A 1 336 ? 7.002  73.326 10.031  1.00 37.67  ? 336 ILE A O   1 
ATOM   2298 C CB  . ILE A 1 336 ? 7.814  71.989 12.327  1.00 39.07  ? 336 ILE A CB  1 
ATOM   2299 C CG1 . ILE A 1 336 ? 8.831  71.591 13.399  1.00 39.59  ? 336 ILE A CG1 1 
ATOM   2300 C CG2 . ILE A 1 336 ? 6.479  71.309 12.638  1.00 39.68  ? 336 ILE A CG2 1 
ATOM   2301 C CD1 . ILE A 1 336 ? 8.426  71.988 14.797  1.00 38.57  ? 336 ILE A CD1 1 
ATOM   2302 N N   . ASP A 1 337 ? 7.182  71.437 8.812   1.00 36.50  ? 337 ASP A N   1 
ATOM   2303 C CA  . ASP A 1 337 ? 6.393  71.901 7.681   1.00 36.62  ? 337 ASP A CA  1 
ATOM   2304 C C   . ASP A 1 337 ? 4.948  71.412 7.702   1.00 36.24  ? 337 ASP A C   1 
ATOM   2305 O O   . ASP A 1 337 ? 4.159  71.763 6.835   1.00 36.25  ? 337 ASP A O   1 
ATOM   2306 C CB  . ASP A 1 337 ? 7.066  71.438 6.387   1.00 38.98  ? 337 ASP A CB  1 
ATOM   2307 C CG  . ASP A 1 337 ? 7.341  69.939 6.381   1.00 39.69  ? 337 ASP A CG  1 
ATOM   2308 O OD1 . ASP A 1 337 ? 6.866  69.248 7.307   1.00 40.87  ? 337 ASP A OD1 1 
ATOM   2309 O OD2 . ASP A 1 337 ? 8.025  69.451 5.455   1.00 38.11  ? 337 ASP A OD2 1 
ATOM   2310 N N   . GLY A 1 338 ? 4.600  70.602 8.690   1.00 37.51  ? 338 GLY A N   1 
ATOM   2311 C CA  . GLY A 1 338 ? 3.245  70.090 8.759   1.00 39.52  ? 338 GLY A CA  1 
ATOM   2312 C C   . GLY A 1 338 ? 3.046  69.081 7.651   1.00 40.68  ? 338 GLY A C   1 
ATOM   2313 O O   . GLY A 1 338 ? 1.971  68.511 7.485   1.00 40.62  ? 338 GLY A O   1 
ATOM   2314 N N   . ALA A 1 339 ? 4.112  68.869 6.888   1.00 41.91  ? 339 ALA A N   1 
ATOM   2315 C CA  . ALA A 1 339 ? 4.104  67.932 5.776   1.00 42.05  ? 339 ALA A CA  1 
ATOM   2316 C C   . ALA A 1 339 ? 4.988  66.715 6.078   1.00 40.75  ? 339 ALA A C   1 
ATOM   2317 O O   . ALA A 1 339 ? 4.550  65.762 6.726   1.00 40.09  ? 339 ALA A O   1 
ATOM   2318 C CB  . ALA A 1 339 ? 4.595  68.637 4.523   1.00 45.62  ? 339 ALA A CB  1 
ATOM   2319 N N   . PHE A 1 340 ? 6.228  66.759 5.602   1.00 38.07  ? 340 PHE A N   1 
ATOM   2320 C CA  . PHE A 1 340 ? 7.172  65.683 5.825   1.00 36.51  ? 340 PHE A CA  1 
ATOM   2321 C C   . PHE A 1 340 ? 7.433  65.531 7.317   1.00 36.84  ? 340 PHE A C   1 
ATOM   2322 O O   . PHE A 1 340 ? 7.676  64.435 7.802   1.00 36.82  ? 340 PHE A O   1 
ATOM   2323 C CB  . PHE A 1 340 ? 8.479  65.976 5.088   1.00 36.42  ? 340 PHE A CB  1 
ATOM   2324 C CG  . PHE A 1 340 ? 9.289  64.742 4.785   1.00 38.48  ? 340 PHE A CG  1 
ATOM   2325 C CD1 . PHE A 1 340 ? 10.145 64.192 5.742   1.00 35.82  ? 340 PHE A CD1 1 
ATOM   2326 C CD2 . PHE A 1 340 ? 9.162  64.103 3.552   1.00 36.59  ? 340 PHE A CD2 1 
ATOM   2327 C CE1 . PHE A 1 340 ? 10.853 63.041 5.481   1.00 32.84  ? 340 PHE A CE1 1 
ATOM   2328 C CE2 . PHE A 1 340 ? 9.867  62.950 3.285   1.00 36.12  ? 340 PHE A CE2 1 
ATOM   2329 C CZ  . PHE A 1 340 ? 10.716 62.416 4.255   1.00 35.50  ? 340 PHE A CZ  1 
ATOM   2330 N N   . LEU A 1 341 ? 7.371  66.641 8.043   1.00 39.18  ? 341 LEU A N   1 
ATOM   2331 C CA  . LEU A 1 341 ? 7.596  66.650 9.484   1.00 40.76  ? 341 LEU A CA  1 
ATOM   2332 C C   . LEU A 1 341 ? 6.413  67.391 10.120  1.00 44.10  ? 341 LEU A C   1 
ATOM   2333 O O   . LEU A 1 341 ? 6.491  68.598 10.394  1.00 45.51  ? 341 LEU A O   1 
ATOM   2334 C CB  . LEU A 1 341 ? 8.894  67.386 9.791   1.00 40.25  ? 341 LEU A CB  1 
ATOM   2335 C CG  . LEU A 1 341 ? 9.777  66.809 10.892  1.00 43.67  ? 341 LEU A CG  1 
ATOM   2336 C CD1 . LEU A 1 341 ? 10.953 67.758 11.128  1.00 45.11  ? 341 LEU A CD1 1 
ATOM   2337 C CD2 . LEU A 1 341 ? 8.977  66.610 12.167  1.00 43.17  ? 341 LEU A CD2 1 
ATOM   2338 N N   . PRO A 1 342 ? 5.300  66.709 10.426  1.00 44.02  ? 342 PRO A N   1 
ATOM   2339 C CA  . PRO A 1 342 ? 4.023  67.200 10.937  1.00 44.99  ? 342 PRO A CA  1 
ATOM   2340 C C   . PRO A 1 342 ? 4.211  67.918 12.241  1.00 45.73  ? 342 PRO A C   1 
ATOM   2341 O O   . PRO A 1 342 ? 3.467  68.933 12.468  1.00 47.13  ? 342 PRO A O   1 
ATOM   2342 C CB  . PRO A 1 342 ? 3.205  65.947 11.101  1.00 44.77  ? 342 PRO A CB  1 
ATOM   2343 C CG  . PRO A 1 342 ? 3.845  64.937 10.190  1.00 45.71  ? 342 PRO A CG  1 
ATOM   2344 C CD  . PRO A 1 342 ? 5.304  65.266 10.178  1.00 44.35  ? 342 PRO A CD  1 
ATOM   2345 N N   . ALA A 1 343 ? 4.990  67.479 13.197  1.00 46.90  ? 343 ALA A N   1 
ATOM   2346 C CA  . ALA A 1 343 ? 5.104  68.156 14.477  1.00 49.53  ? 343 ALA A CA  1 
ATOM   2347 C C   . ALA A 1 343 ? 6.510  68.057 15.031  1.00 51.77  ? 343 ALA A C   1 
ATOM   2348 O O   . ALA A 1 343 ? 7.426  67.594 14.348  1.00 51.87  ? 343 ALA A O   1 
ATOM   2349 C CB  . ALA A 1 343 ? 4.113  67.569 15.467  1.00 50.17  ? 343 ALA A CB  1 
ATOM   2350 N N   . ASP A 1 344 ? 6.685  68.511 16.269  1.00 53.18  ? 344 ASP A N   1 
ATOM   2351 C CA  . ASP A 1 344 ? 7.989  68.437 16.900  1.00 53.11  ? 344 ASP A CA  1 
ATOM   2352 C C   . ASP A 1 344 ? 8.378  66.975 16.917  1.00 52.44  ? 344 ASP A C   1 
ATOM   2353 O O   . ASP A 1 344 ? 7.551  66.102 17.202  1.00 50.12  ? 344 ASP A O   1 
ATOM   2354 C CB  . ASP A 1 344 ? 7.953  68.956 18.336  1.00 55.73  ? 344 ASP A CB  1 
ATOM   2355 C CG  . ASP A 1 344 ? 9.315  68.865 19.021  1.00 58.52  ? 344 ASP A CG  1 
ATOM   2356 O OD1 . ASP A 1 344 ? 10.277 69.527 18.564  1.00 60.77  ? 344 ASP A OD1 1 
ATOM   2357 O OD2 . ASP A 1 344 ? 9.428  68.124 20.018  1.00 59.64  ? 344 ASP A OD2 1 
ATOM   2358 N N   . PRO A 1 345 ? 9.645  66.687 16.607  1.00 51.95  ? 345 PRO A N   1 
ATOM   2359 C CA  . PRO A 1 345 ? 10.110 65.306 16.594  1.00 52.37  ? 345 PRO A CA  1 
ATOM   2360 C C   . PRO A 1 345 ? 9.571  64.522 17.788  1.00 54.19  ? 345 PRO A C   1 
ATOM   2361 O O   . PRO A 1 345 ? 9.012  63.430 17.625  1.00 55.39  ? 345 PRO A O   1 
ATOM   2362 C CB  . PRO A 1 345 ? 11.621 65.467 16.620  1.00 52.17  ? 345 PRO A CB  1 
ATOM   2363 C CG  . PRO A 1 345 ? 11.819 66.703 15.809  1.00 50.92  ? 345 PRO A CG  1 
ATOM   2364 C CD  . PRO A 1 345 ? 10.760 67.618 16.365  1.00 50.93  ? 345 PRO A CD  1 
ATOM   2365 N N   . MET A 1 346 ? 9.709  65.094 18.981  1.00 53.53  ? 346 MET A N   1 
ATOM   2366 C CA  . MET A 1 346 ? 9.254  64.431 20.192  1.00 53.11  ? 346 MET A CA  1 
ATOM   2367 C C   . MET A 1 346 ? 7.749  64.391 20.377  1.00 54.42  ? 346 MET A C   1 
ATOM   2368 O O   . MET A 1 346 ? 7.248  63.617 21.188  1.00 57.06  ? 346 MET A O   1 
ATOM   2369 C CB  . MET A 1 346 ? 9.901  65.069 21.417  1.00 51.52  ? 346 MET A CB  1 
ATOM   2370 C CG  . MET A 1 346 ? 11.415 64.884 21.481  1.00 52.10  ? 346 MET A CG  1 
ATOM   2371 S SD  . MET A 1 346 ? 11.936 63.165 21.261  1.00 52.36  ? 346 MET A SD  1 
ATOM   2372 C CE  . MET A 1 346 ? 11.486 62.475 22.844  1.00 50.67  ? 346 MET A CE  1 
ATOM   2373 N N   . THR A 1 347 ? 7.019  65.210 19.632  1.00 55.93  ? 347 THR A N   1 
ATOM   2374 C CA  . THR A 1 347 ? 5.567  65.216 19.759  1.00 57.68  ? 347 THR A CA  1 
ATOM   2375 C C   . THR A 1 347 ? 4.977  64.141 18.854  1.00 58.36  ? 347 THR A C   1 
ATOM   2376 O O   . THR A 1 347 ? 3.840  63.707 19.048  1.00 59.03  ? 347 THR A O   1 
ATOM   2377 C CB  . THR A 1 347 ? 4.958  66.600 19.386  1.00 58.98  ? 347 THR A CB  1 
ATOM   2378 O OG1 . THR A 1 347 ? 5.528  67.622 20.216  1.00 60.39  ? 347 THR A OG1 1 
ATOM   2379 C CG2 . THR A 1 347 ? 3.450  66.597 19.598  1.00 58.40  ? 347 THR A CG2 1 
ATOM   2380 N N   . LEU A 1 348 ? 5.748  63.715 17.858  1.00 58.53  ? 348 LEU A N   1 
ATOM   2381 C CA  . LEU A 1 348 ? 5.281  62.677 16.958  1.00 58.86  ? 348 LEU A CA  1 
ATOM   2382 C C   . LEU A 1 348 ? 5.439  61.380 17.709  1.00 58.73  ? 348 LEU A C   1 
ATOM   2383 O O   . LEU A 1 348 ? 4.608  60.485 17.614  1.00 59.34  ? 348 LEU A O   1 
ATOM   2384 C CB  . LEU A 1 348 ? 6.126  62.628 15.690  1.00 61.20  ? 348 LEU A CB  1 
ATOM   2385 C CG  . LEU A 1 348 ? 6.199  63.917 14.880  1.00 64.29  ? 348 LEU A CG  1 
ATOM   2386 C CD1 . LEU A 1 348 ? 6.955  63.659 13.576  1.00 65.69  ? 348 LEU A CD1 1 
ATOM   2387 C CD2 . LEU A 1 348 ? 4.791  64.414 14.598  1.00 65.64  ? 348 LEU A CD2 1 
ATOM   2388 N N   . MET A 1 349 ? 6.519  61.285 18.469  1.00 59.64  ? 349 MET A N   1 
ATOM   2389 C CA  . MET A 1 349 ? 6.776  60.083 19.237  1.00 60.82  ? 349 MET A CA  1 
ATOM   2390 C C   . MET A 1 349 ? 5.621  59.787 20.148  1.00 61.32  ? 349 MET A C   1 
ATOM   2391 O O   . MET A 1 349 ? 5.172  58.648 20.219  1.00 62.06  ? 349 MET A O   1 
ATOM   2392 C CB  . MET A 1 349 ? 8.048  60.222 20.067  1.00 60.59  ? 349 MET A CB  1 
ATOM   2393 C CG  . MET A 1 349 ? 9.289  59.872 19.297  1.00 59.94  ? 349 MET A CG  1 
ATOM   2394 S SD  . MET A 1 349 ? 9.007  58.368 18.389  1.00 59.12  ? 349 MET A SD  1 
ATOM   2395 C CE  . MET A 1 349 ? 9.170  57.199 19.655  1.00 55.92  ? 349 MET A CE  1 
ATOM   2396 N N   . LYS A 1 350 ? 5.150  60.816 20.846  1.00 62.55  ? 350 LYS A N   1 
ATOM   2397 C CA  . LYS A 1 350 ? 4.029  60.670 21.764  1.00 64.53  ? 350 LYS A CA  1 
ATOM   2398 C C   . LYS A 1 350 ? 3.000  59.739 21.153  1.00 65.83  ? 350 LYS A C   1 
ATOM   2399 O O   . LYS A 1 350 ? 2.682  58.698 21.722  1.00 66.59  ? 350 LYS A O   1 
ATOM   2400 C CB  . LYS A 1 350 ? 3.371  62.025 22.054  1.00 65.60  ? 350 LYS A CB  1 
ATOM   2401 C CG  . LYS A 1 350 ? 4.196  62.953 22.936  1.00 66.40  ? 350 LYS A CG  1 
ATOM   2402 C CD  . LYS A 1 350 ? 3.473  64.266 23.251  1.00 65.66  ? 350 LYS A CD  1 
ATOM   2403 C CE  . LYS A 1 350 ? 4.377  65.166 24.100  1.00 68.63  ? 350 LYS A CE  1 
ATOM   2404 N NZ  . LYS A 1 350 ? 3.840  66.534 24.347  1.00 69.81  ? 350 LYS A NZ  1 
ATOM   2405 N N   . THR A 1 351 ? 2.491  60.105 19.981  1.00 66.13  ? 351 THR A N   1 
ATOM   2406 C CA  . THR A 1 351 ? 1.490  59.279 19.324  1.00 67.00  ? 351 THR A CA  1 
ATOM   2407 C C   . THR A 1 351 ? 2.027  58.556 18.104  1.00 66.10  ? 351 THR A C   1 
ATOM   2408 O O   . THR A 1 351 ? 1.904  59.037 16.977  1.00 66.33  ? 351 THR A O   1 
ATOM   2409 C CB  . THR A 1 351 ? 0.279  60.116 18.907  1.00 67.85  ? 351 THR A CB  1 
ATOM   2410 O OG1 . THR A 1 351 ? -0.280 60.735 20.071  1.00 71.85  ? 351 THR A OG1 1 
ATOM   2411 C CG2 . THR A 1 351 ? -0.781 59.237 18.249  1.00 68.37  ? 351 THR A CG2 1 
ATOM   2412 N N   . ALA A 1 352 ? 2.615  57.389 18.333  1.00 64.78  ? 352 ALA A N   1 
ATOM   2413 C CA  . ALA A 1 352 ? 3.168  56.596 17.249  1.00 64.39  ? 352 ALA A CA  1 
ATOM   2414 C C   . ALA A 1 352 ? 3.442  55.182 17.725  1.00 64.93  ? 352 ALA A C   1 
ATOM   2415 O O   . ALA A 1 352 ? 3.611  54.941 18.923  1.00 65.42  ? 352 ALA A O   1 
ATOM   2416 C CB  . ALA A 1 352 ? 4.459  57.230 16.748  1.00 63.16  ? 352 ALA A CB  1 
ATOM   2417 N N   . ASP A 1 353 ? 3.458  54.238 16.788  1.00 64.17  ? 353 ASP A N   1 
ATOM   2418 C CA  . ASP A 1 353 ? 3.760  52.860 17.131  1.00 62.48  ? 353 ASP A CA  1 
ATOM   2419 C C   . ASP A 1 353 ? 4.864  52.388 16.239  1.00 59.56  ? 353 ASP A C   1 
ATOM   2420 O O   . ASP A 1 353 ? 4.674  52.238 15.040  1.00 57.78  ? 353 ASP A O   1 
ATOM   2421 C CB  . ASP A 1 353 ? 2.574  51.931 16.950  1.00 65.98  ? 353 ASP A CB  1 
ATOM   2422 C CG  . ASP A 1 353 ? 2.958  50.473 17.171  1.00 69.05  ? 353 ASP A CG  1 
ATOM   2423 O OD1 . ASP A 1 353 ? 3.503  50.153 18.257  1.00 69.37  ? 353 ASP A OD1 1 
ATOM   2424 O OD2 . ASP A 1 353 ? 2.724  49.653 16.256  1.00 69.51  ? 353 ASP A OD2 1 
ATOM   2425 N N   . LEU A 1 354 ? 6.015  52.139 16.844  1.00 59.12  ? 354 LEU A N   1 
ATOM   2426 C CA  . LEU A 1 354 ? 7.190  51.699 16.119  1.00 58.93  ? 354 LEU A CA  1 
ATOM   2427 C C   . LEU A 1 354 ? 7.469  50.215 16.363  1.00 59.28  ? 354 LEU A C   1 
ATOM   2428 O O   . LEU A 1 354 ? 8.596  49.739 16.198  1.00 59.99  ? 354 LEU A O   1 
ATOM   2429 C CB  . LEU A 1 354 ? 8.377  52.569 16.546  1.00 56.95  ? 354 LEU A CB  1 
ATOM   2430 C CG  . LEU A 1 354 ? 8.106  54.066 16.341  1.00 54.93  ? 354 LEU A CG  1 
ATOM   2431 C CD1 . LEU A 1 354 ? 9.279  54.890 16.802  1.00 53.66  ? 354 LEU A CD1 1 
ATOM   2432 C CD2 . LEU A 1 354 ? 7.824  54.329 14.875  1.00 53.50  ? 354 LEU A CD2 1 
ATOM   2433 N N   . LYS A 1 355 ? 6.420  49.484 16.725  1.00 58.44  ? 355 LYS A N   1 
ATOM   2434 C CA  . LYS A 1 355 ? 6.532  48.062 17.018  1.00 57.58  ? 355 LYS A CA  1 
ATOM   2435 C C   . LYS A 1 355 ? 7.395  47.246 16.058  1.00 54.46  ? 355 LYS A C   1 
ATOM   2436 O O   . LYS A 1 355 ? 8.267  46.488 16.483  1.00 54.81  ? 355 LYS A O   1 
ATOM   2437 C CB  . LYS A 1 355 ? 5.141  47.428 17.089  1.00 60.83  ? 355 LYS A CB  1 
ATOM   2438 C CG  . LYS A 1 355 ? 5.173  45.923 17.368  1.00 64.87  ? 355 LYS A CG  1 
ATOM   2439 C CD  . LYS A 1 355 ? 3.803  45.284 17.159  1.00 69.30  ? 355 LYS A CD  1 
ATOM   2440 C CE  . LYS A 1 355 ? 3.885  43.753 17.151  1.00 71.42  ? 355 LYS A CE  1 
ATOM   2441 N NZ  . LYS A 1 355 ? 2.554  43.098 16.911  1.00 73.05  ? 355 LYS A NZ  1 
ATOM   2442 N N   . ASP A 1 356 ? 7.150  47.381 14.768  1.00 50.12  ? 356 ASP A N   1 
ATOM   2443 C CA  . ASP A 1 356 ? 7.914  46.611 13.809  1.00 48.07  ? 356 ASP A CA  1 
ATOM   2444 C C   . ASP A 1 356 ? 9.151  47.348 13.345  1.00 45.87  ? 356 ASP A C   1 
ATOM   2445 O O   . ASP A 1 356 ? 9.725  47.025 12.311  1.00 47.81  ? 356 ASP A O   1 
ATOM   2446 C CB  . ASP A 1 356 ? 7.033  46.255 12.617  1.00 50.27  ? 356 ASP A CB  1 
ATOM   2447 C CG  . ASP A 1 356 ? 5.830  45.451 13.022  1.00 52.93  ? 356 ASP A CG  1 
ATOM   2448 O OD1 . ASP A 1 356 ? 5.907  44.773 14.070  1.00 55.23  ? 356 ASP A OD1 1 
ATOM   2449 O OD2 . ASP A 1 356 ? 4.812  45.492 12.298  1.00 54.72  ? 356 ASP A OD2 1 
ATOM   2450 N N   . TYR A 1 357 ? 9.570  48.343 14.107  1.00 41.27  ? 357 TYR A N   1 
ATOM   2451 C CA  . TYR A 1 357 ? 10.758 49.086 13.734  1.00 37.56  ? 357 TYR A CA  1 
ATOM   2452 C C   . TYR A 1 357 ? 12.003 48.553 14.442  1.00 34.19  ? 357 TYR A C   1 
ATOM   2453 O O   . TYR A 1 357 ? 11.942 48.190 15.610  1.00 31.93  ? 357 TYR A O   1 
ATOM   2454 C CB  . TYR A 1 357 ? 10.556 50.567 14.056  1.00 36.30  ? 357 TYR A CB  1 
ATOM   2455 C CG  . TYR A 1 357 ? 9.731  51.300 13.027  1.00 36.91  ? 357 TYR A CG  1 
ATOM   2456 C CD1 . TYR A 1 357 ? 8.410  50.941 12.771  1.00 38.83  ? 357 TYR A CD1 1 
ATOM   2457 C CD2 . TYR A 1 357 ? 10.283 52.339 12.284  1.00 38.33  ? 357 TYR A CD2 1 
ATOM   2458 C CE1 . TYR A 1 357 ? 7.664  51.594 11.787  1.00 39.07  ? 357 TYR A CE1 1 
ATOM   2459 C CE2 . TYR A 1 357 ? 9.547  52.997 11.304  1.00 40.00  ? 357 TYR A CE2 1 
ATOM   2460 C CZ  . TYR A 1 357 ? 8.242  52.622 11.060  1.00 39.94  ? 357 TYR A CZ  1 
ATOM   2461 O OH  . TYR A 1 357 ? 7.535  53.272 10.074  1.00 43.40  ? 357 TYR A OH  1 
ATOM   2462 N N   . ASP A 1 358 ? 13.125 48.489 13.731  1.00 32.63  ? 358 ASP A N   1 
ATOM   2463 C CA  . ASP A 1 358 ? 14.377 48.023 14.336  1.00 33.71  ? 358 ASP A CA  1 
ATOM   2464 C C   . ASP A 1 358 ? 15.407 49.134 14.292  1.00 35.02  ? 358 ASP A C   1 
ATOM   2465 O O   . ASP A 1 358 ? 15.932 49.470 13.229  1.00 38.09  ? 358 ASP A O   1 
ATOM   2466 C CB  . ASP A 1 358 ? 14.936 46.810 13.597  1.00 31.78  ? 358 ASP A CB  1 
ATOM   2467 C CG  . ASP A 1 358 ? 14.034 45.610 13.694  1.00 33.16  ? 358 ASP A CG  1 
ATOM   2468 O OD1 . ASP A 1 358 ? 13.869 45.090 14.819  1.00 33.38  ? 358 ASP A OD1 1 
ATOM   2469 O OD2 . ASP A 1 358 ? 13.486 45.192 12.650  1.00 34.19  ? 358 ASP A OD2 1 
ATOM   2470 N N   . ILE A 1 359 ? 15.698 49.730 15.434  1.00 33.48  ? 359 ILE A N   1 
ATOM   2471 C CA  . ILE A 1 359 ? 16.681 50.792 15.418  1.00 33.15  ? 359 ILE A CA  1 
ATOM   2472 C C   . ILE A 1 359 ? 17.982 50.374 16.068  1.00 32.51  ? 359 ILE A C   1 
ATOM   2473 O O   . ILE A 1 359 ? 18.000 49.804 17.159  1.00 31.03  ? 359 ILE A O   1 
ATOM   2474 C CB  . ILE A 1 359 ? 16.159 52.077 16.108  1.00 33.88  ? 359 ILE A CB  1 
ATOM   2475 C CG1 . ILE A 1 359 ? 15.138 52.768 15.204  1.00 32.78  ? 359 ILE A CG1 1 
ATOM   2476 C CG2 . ILE A 1 359 ? 17.318 53.040 16.389  1.00 31.70  ? 359 ILE A CG2 1 
ATOM   2477 C CD1 . ILE A 1 359 ? 13.959 51.917 14.852  1.00 29.67  ? 359 ILE A CD1 1 
ATOM   2478 N N   . LEU A 1 360 ? 19.066 50.636 15.354  1.00 32.13  ? 360 LEU A N   1 
ATOM   2479 C CA  . LEU A 1 360 ? 20.406 50.357 15.831  1.00 33.54  ? 360 LEU A CA  1 
ATOM   2480 C C   . LEU A 1 360 ? 21.061 51.721 15.799  1.00 33.52  ? 360 LEU A C   1 
ATOM   2481 O O   . LEU A 1 360 ? 21.351 52.238 14.719  1.00 34.42  ? 360 LEU A O   1 
ATOM   2482 C CB  . LEU A 1 360 ? 21.142 49.412 14.881  1.00 33.82  ? 360 LEU A CB  1 
ATOM   2483 C CG  . LEU A 1 360 ? 22.670 49.447 15.000  1.00 34.97  ? 360 LEU A CG  1 
ATOM   2484 C CD1 . LEU A 1 360 ? 23.125 49.127 16.425  1.00 31.73  ? 360 LEU A CD1 1 
ATOM   2485 C CD2 . LEU A 1 360 ? 23.240 48.462 14.008  1.00 36.01  ? 360 LEU A CD2 1 
ATOM   2486 N N   . MET A 1 361 ? 21.273 52.312 16.970  1.00 31.26  ? 361 MET A N   1 
ATOM   2487 C CA  . MET A 1 361 ? 21.878 53.628 17.035  1.00 32.27  ? 361 MET A CA  1 
ATOM   2488 C C   . MET A 1 361 ? 22.957 53.693 18.108  1.00 34.60  ? 361 MET A C   1 
ATOM   2489 O O   . MET A 1 361 ? 23.257 52.690 18.768  1.00 34.36  ? 361 MET A O   1 
ATOM   2490 C CB  . MET A 1 361 ? 20.798 54.674 17.312  1.00 30.18  ? 361 MET A CB  1 
ATOM   2491 C CG  . MET A 1 361 ? 20.126 54.494 18.655  1.00 30.79  ? 361 MET A CG  1 
ATOM   2492 S SD  . MET A 1 361 ? 18.453 55.145 18.750  1.00 31.95  ? 361 MET A SD  1 
ATOM   2493 C CE  . MET A 1 361 ? 18.729 56.915 18.841  1.00 26.13  ? 361 MET A CE  1 
ATOM   2494 N N   . GLY A 1 362 ? 23.536 54.879 18.279  1.00 35.68  ? 362 GLY A N   1 
ATOM   2495 C CA  . GLY A 1 362 ? 24.573 55.060 19.276  1.00 38.90  ? 362 GLY A CA  1 
ATOM   2496 C C   . GLY A 1 362 ? 25.380 56.332 19.101  1.00 40.83  ? 362 GLY A C   1 
ATOM   2497 O O   . GLY A 1 362 ? 24.995 57.223 18.354  1.00 41.98  ? 362 GLY A O   1 
ATOM   2498 N N   . ASN A 1 363 ? 26.506 56.421 19.797  1.00 42.00  ? 363 ASN A N   1 
ATOM   2499 C CA  . ASN A 1 363 ? 27.352 57.596 19.708  1.00 43.54  ? 363 ASN A CA  1 
ATOM   2500 C C   . ASN A 1 363 ? 28.819 57.220 19.839  1.00 44.97  ? 363 ASN A C   1 
ATOM   2501 O O   . ASN A 1 363 ? 29.166 56.067 20.101  1.00 45.15  ? 363 ASN A O   1 
ATOM   2502 C CB  . ASN A 1 363 ? 26.991 58.587 20.814  1.00 44.32  ? 363 ASN A CB  1 
ATOM   2503 C CG  . ASN A 1 363 ? 25.547 59.026 20.753  1.00 44.55  ? 363 ASN A CG  1 
ATOM   2504 O OD1 . ASN A 1 363 ? 25.235 60.071 20.207  1.00 45.80  ? 363 ASN A OD1 1 
ATOM   2505 N ND2 . ASN A 1 363 ? 24.657 58.218 21.309  1.00 45.19  ? 363 ASN A ND2 1 
ATOM   2506 N N   . VAL A 1 364 ? 29.674 58.215 19.646  1.00 47.10  ? 364 VAL A N   1 
ATOM   2507 C CA  . VAL A 1 364 ? 31.111 58.043 19.750  1.00 48.24  ? 364 VAL A CA  1 
ATOM   2508 C C   . VAL A 1 364 ? 31.561 58.741 21.029  1.00 48.48  ? 364 VAL A C   1 
ATOM   2509 O O   . VAL A 1 364 ? 31.116 59.851 21.329  1.00 48.37  ? 364 VAL A O   1 
ATOM   2510 C CB  . VAL A 1 364 ? 31.802 58.651 18.532  1.00 49.82  ? 364 VAL A CB  1 
ATOM   2511 C CG1 . VAL A 1 364 ? 31.440 57.838 17.295  1.00 49.80  ? 364 VAL A CG1 1 
ATOM   2512 C CG2 . VAL A 1 364 ? 31.371 60.099 18.358  1.00 48.49  ? 364 VAL A CG2 1 
ATOM   2513 N N   . ARG A 1 365 ? 32.451 58.083 21.768  1.00 49.31  ? 365 ARG A N   1 
ATOM   2514 C CA  . ARG A 1 365 ? 32.940 58.574 23.062  1.00 50.65  ? 365 ARG A CA  1 
ATOM   2515 C C   . ARG A 1 365 ? 33.111 60.073 23.265  1.00 48.55  ? 365 ARG A C   1 
ATOM   2516 O O   . ARG A 1 365 ? 32.847 60.586 24.353  1.00 48.14  ? 365 ARG A O   1 
ATOM   2517 C CB  . ARG A 1 365 ? 34.257 57.883 23.455  1.00 51.77  ? 365 ARG A CB  1 
ATOM   2518 C CG  . ARG A 1 365 ? 34.578 58.022 24.954  1.00 54.36  ? 365 ARG A CG  1 
ATOM   2519 C CD  . ARG A 1 365 ? 35.906 57.396 25.330  1.00 55.62  ? 365 ARG A CD  1 
ATOM   2520 N NE  . ARG A 1 365 ? 37.018 58.127 24.732  1.00 58.47  ? 365 ARG A NE  1 
ATOM   2521 C CZ  . ARG A 1 365 ? 38.280 57.714 24.745  1.00 57.89  ? 365 ARG A CZ  1 
ATOM   2522 N NH1 . ARG A 1 365 ? 38.594 56.565 25.328  1.00 58.87  ? 365 ARG A NH1 1 
ATOM   2523 N NH2 . ARG A 1 365 ? 39.224 58.454 24.175  1.00 55.97  ? 365 ARG A NH2 1 
ATOM   2524 N N   . ASP A 1 366 ? 33.552 60.780 22.241  1.00 46.93  ? 366 ASP A N   1 
ATOM   2525 C CA  . ASP A 1 366 ? 33.753 62.208 22.398  1.00 49.07  ? 366 ASP A CA  1 
ATOM   2526 C C   . ASP A 1 366 ? 33.153 62.898 21.182  1.00 48.92  ? 366 ASP A C   1 
ATOM   2527 O O   . ASP A 1 366 ? 33.846 63.417 20.314  1.00 49.41  ? 366 ASP A O   1 
ATOM   2528 C CB  . ASP A 1 366 ? 35.256 62.485 22.551  1.00 50.39  ? 366 ASP A CB  1 
ATOM   2529 C CG  . ASP A 1 366 ? 36.001 61.324 23.248  1.00 51.27  ? 366 ASP A CG  1 
ATOM   2530 O OD1 . ASP A 1 366 ? 35.835 61.113 24.472  1.00 49.84  ? 366 ASP A OD1 1 
ATOM   2531 O OD2 . ASP A 1 366 ? 36.748 60.605 22.557  1.00 50.59  ? 366 ASP A OD2 1 
ATOM   2532 N N   . GLU A 1 367 ? 31.832 62.881 21.135  1.00 50.39  ? 367 GLU A N   1 
ATOM   2533 C CA  . GLU A 1 367 ? 31.088 63.467 20.039  1.00 51.42  ? 367 GLU A CA  1 
ATOM   2534 C C   . GLU A 1 367 ? 31.484 64.883 19.644  1.00 52.01  ? 367 GLU A C   1 
ATOM   2535 O O   . GLU A 1 367 ? 32.152 65.092 18.641  1.00 53.97  ? 367 GLU A O   1 
ATOM   2536 C CB  . GLU A 1 367 ? 29.594 63.429 20.367  1.00 51.21  ? 367 GLU A CB  1 
ATOM   2537 C CG  . GLU A 1 367 ? 28.989 62.029 20.389  1.00 52.36  ? 367 GLU A CG  1 
ATOM   2538 C CD  . GLU A 1 367 ? 28.474 61.590 19.023  1.00 52.82  ? 367 GLU A CD  1 
ATOM   2539 O OE1 . GLU A 1 367 ? 28.404 62.442 18.104  1.00 49.66  ? 367 GLU A OE1 1 
ATOM   2540 O OE2 . GLU A 1 367 ? 28.132 60.393 18.876  1.00 52.40  ? 367 GLU A OE2 1 
ATOM   2541 N N   . GLY A 1 368 ? 31.078 65.846 20.454  1.00 54.39  ? 368 GLY A N   1 
ATOM   2542 C CA  . GLY A 1 368 ? 31.315 67.244 20.153  1.00 57.03  ? 368 GLY A CA  1 
ATOM   2543 C C   . GLY A 1 368 ? 32.699 67.847 20.126  1.00 59.45  ? 368 GLY A C   1 
ATOM   2544 O O   . GLY A 1 368 ? 32.816 69.035 19.798  1.00 58.06  ? 368 GLY A O   1 
ATOM   2545 N N   . THR A 1 369 ? 33.738 67.075 20.449  1.00 61.25  ? 369 THR A N   1 
ATOM   2546 C CA  . THR A 1 369 ? 35.093 67.630 20.447  1.00 63.05  ? 369 THR A CA  1 
ATOM   2547 C C   . THR A 1 369 ? 35.348 68.291 19.107  1.00 64.28  ? 369 THR A C   1 
ATOM   2548 O O   . THR A 1 369 ? 35.940 69.358 19.027  1.00 63.54  ? 369 THR A O   1 
ATOM   2549 C CB  . THR A 1 369 ? 36.179 66.557 20.652  1.00 63.08  ? 369 THR A CB  1 
ATOM   2550 O OG1 . THR A 1 369 ? 36.830 66.302 19.409  1.00 63.78  ? 369 THR A OG1 1 
ATOM   2551 C CG2 . THR A 1 369 ? 35.582 65.278 21.148  1.00 63.18  ? 369 THR A CG2 1 
ATOM   2552 N N   . TYR A 1 370 ? 34.878 67.639 18.053  1.00 67.25  ? 370 TYR A N   1 
ATOM   2553 C CA  . TYR A 1 370 ? 35.045 68.129 16.692  1.00 70.22  ? 370 TYR A CA  1 
ATOM   2554 C C   . TYR A 1 370 ? 34.436 69.512 16.461  1.00 68.83  ? 370 TYR A C   1 
ATOM   2555 O O   . TYR A 1 370 ? 35.105 70.435 15.993  1.00 66.91  ? 370 TYR A O   1 
ATOM   2556 C CB  . TYR A 1 370 ? 34.433 67.112 15.711  1.00 74.61  ? 370 TYR A CB  1 
ATOM   2557 C CG  . TYR A 1 370 ? 34.471 67.519 14.248  1.00 78.40  ? 370 TYR A CG  1 
ATOM   2558 C CD1 . TYR A 1 370 ? 33.653 68.548 13.760  1.00 80.23  ? 370 TYR A CD1 1 
ATOM   2559 C CD2 . TYR A 1 370 ? 35.339 66.892 13.356  1.00 79.27  ? 370 TYR A CD2 1 
ATOM   2560 C CE1 . TYR A 1 370 ? 33.700 68.937 12.419  1.00 81.35  ? 370 TYR A CE1 1 
ATOM   2561 C CE2 . TYR A 1 370 ? 35.394 67.274 12.012  1.00 81.06  ? 370 TYR A CE2 1 
ATOM   2562 C CZ  . TYR A 1 370 ? 34.575 68.296 11.554  1.00 81.38  ? 370 TYR A CZ  1 
ATOM   2563 O OH  . TYR A 1 370 ? 34.631 68.670 10.231  1.00 83.56  ? 370 TYR A OH  1 
ATOM   2564 N N   . PHE A 1 371 ? 33.158 69.646 16.777  1.00 68.43  ? 371 PHE A N   1 
ATOM   2565 C CA  . PHE A 1 371 ? 32.479 70.906 16.572  1.00 69.47  ? 371 PHE A CA  1 
ATOM   2566 C C   . PHE A 1 371 ? 33.021 71.899 17.573  1.00 70.31  ? 371 PHE A C   1 
ATOM   2567 O O   . PHE A 1 371 ? 32.668 73.083 17.552  1.00 71.00  ? 371 PHE A O   1 
ATOM   2568 C CB  . PHE A 1 371 ? 30.970 70.720 16.734  1.00 68.62  ? 371 PHE A CB  1 
ATOM   2569 C CG  . PHE A 1 371 ? 30.420 69.567 15.935  1.00 68.27  ? 371 PHE A CG  1 
ATOM   2570 C CD1 . PHE A 1 371 ? 30.617 68.251 16.363  1.00 68.02  ? 371 PHE A CD1 1 
ATOM   2571 C CD2 . PHE A 1 371 ? 29.748 69.788 14.737  1.00 66.38  ? 371 PHE A CD2 1 
ATOM   2572 C CE1 . PHE A 1 371 ? 30.155 67.174 15.609  1.00 66.68  ? 371 PHE A CE1 1 
ATOM   2573 C CE2 . PHE A 1 371 ? 29.282 68.715 13.975  1.00 67.39  ? 371 PHE A CE2 1 
ATOM   2574 C CZ  . PHE A 1 371 ? 29.488 67.404 14.412  1.00 66.05  ? 371 PHE A CZ  1 
ATOM   2575 N N   . LEU A 1 372 ? 33.891 71.413 18.451  1.00 69.71  ? 372 LEU A N   1 
ATOM   2576 C CA  . LEU A 1 372 ? 34.492 72.291 19.441  1.00 70.78  ? 372 LEU A CA  1 
ATOM   2577 C C   . LEU A 1 372 ? 35.654 73.032 18.781  1.00 71.68  ? 372 LEU A C   1 
ATOM   2578 O O   . LEU A 1 372 ? 35.539 74.229 18.500  1.00 73.49  ? 372 LEU A O   1 
ATOM   2579 C CB  . LEU A 1 372 ? 34.988 71.498 20.655  1.00 70.07  ? 372 LEU A CB  1 
ATOM   2580 C CG  . LEU A 1 372 ? 35.456 72.311 21.871  1.00 69.46  ? 372 LEU A CG  1 
ATOM   2581 C CD1 . LEU A 1 372 ? 34.343 73.257 22.320  1.00 67.52  ? 372 LEU A CD1 1 
ATOM   2582 C CD2 . LEU A 1 372 ? 35.858 71.367 23.004  1.00 67.23  ? 372 LEU A CD2 1 
ATOM   2583 N N   . LEU A 1 373 ? 36.754 72.320 18.513  1.00 70.50  ? 373 LEU A N   1 
ATOM   2584 C CA  . LEU A 1 373 ? 37.950 72.910 17.888  1.00 68.23  ? 373 LEU A CA  1 
ATOM   2585 C C   . LEU A 1 373 ? 37.640 73.520 16.524  1.00 68.18  ? 373 LEU A C   1 
ATOM   2586 O O   . LEU A 1 373 ? 38.539 73.841 15.751  1.00 67.59  ? 373 LEU A O   1 
ATOM   2587 C CB  . LEU A 1 373 ? 39.059 71.853 17.711  1.00 65.84  ? 373 LEU A CB  1 
ATOM   2588 C CG  . LEU A 1 373 ? 39.025 70.953 16.465  1.00 62.09  ? 373 LEU A CG  1 
ATOM   2589 C CD1 . LEU A 1 373 ? 40.352 71.009 15.742  1.00 60.54  ? 373 LEU A CD1 1 
ATOM   2590 C CD2 . LEU A 1 373 ? 38.704 69.550 16.854  1.00 59.00  ? 373 LEU A CD2 1 
ATOM   2591 N N   . TYR A 1 374 ? 36.358 73.659 16.228  1.00 69.31  ? 374 TYR A N   1 
ATOM   2592 C CA  . TYR A 1 374 ? 35.924 74.210 14.962  1.00 72.31  ? 374 TYR A CA  1 
ATOM   2593 C C   . TYR A 1 374 ? 35.085 75.371 15.321  1.00 73.90  ? 374 TYR A C   1 
ATOM   2594 O O   . TYR A 1 374 ? 35.393 76.507 14.932  1.00 71.48  ? 374 TYR A O   1 
ATOM   2595 C CB  . TYR A 1 374 ? 35.031 73.263 14.204  1.00 74.23  ? 374 TYR A CB  1 
ATOM   2596 C CG  . TYR A 1 374 ? 35.593 72.914 12.875  1.00 75.99  ? 374 TYR A CG  1 
ATOM   2597 C CD1 . TYR A 1 374 ? 35.387 73.734 11.767  1.00 76.24  ? 374 TYR A CD1 1 
ATOM   2598 C CD2 . TYR A 1 374 ? 36.404 71.795 12.738  1.00 77.40  ? 374 TYR A CD2 1 
ATOM   2599 C CE1 . TYR A 1 374 ? 35.983 73.444 10.553  1.00 78.02  ? 374 TYR A CE1 1 
ATOM   2600 C CE2 . TYR A 1 374 ? 37.003 71.491 11.538  1.00 78.01  ? 374 TYR A CE2 1 
ATOM   2601 C CZ  . TYR A 1 374 ? 36.794 72.319 10.450  1.00 79.79  ? 374 TYR A CZ  1 
ATOM   2602 O OH  . TYR A 1 374 ? 37.404 72.010 9.258   1.00 83.14  ? 374 TYR A OH  1 
ATOM   2603 N N   . ASP A 1 375 ? 33.976 75.026 15.982  1.00 77.07  ? 375 ASP A N   1 
ATOM   2604 C CA  . ASP A 1 375 ? 33.158 76.142 16.483  1.00 79.90  ? 375 ASP A CA  1 
ATOM   2605 C C   . ASP A 1 375 ? 33.955 76.893 17.545  1.00 80.68  ? 375 ASP A C   1 
ATOM   2606 O O   . ASP A 1 375 ? 33.640 77.042 18.634  1.00 82.05  ? 375 ASP A O   1 
ATOM   2607 C CB  . ASP A 1 375 ? 31.860 75.614 17.096  1.00 81.63  ? 375 ASP A CB  1 
ATOM   2608 C CG  . ASP A 1 375 ? 30.716 76.629 17.035  1.00 83.18  ? 375 ASP A CG  1 
ATOM   2609 O OD1 . ASP A 1 375 ? 30.895 77.830 17.471  1.00 83.33  ? 375 ASP A OD1 1 
ATOM   2610 O OD2 . ASP A 1 375 ? 29.572 76.283 16.549  1.00 85.58  ? 375 ASP A OD2 1 
ATOM   2611 N N   A PHE A 1 376 ? 35.214 77.075 17.010  0.50 80.57  ? 376 PHE A N   1 
ATOM   2612 N N   B PHE A 1 376 ? 35.172 77.060 17.063  0.50 80.65  ? 376 PHE A N   1 
ATOM   2613 C CA  A PHE A 1 376 ? 36.227 77.881 17.648  0.50 79.96  ? 376 PHE A CA  1 
ATOM   2614 C CA  B PHE A 1 376 ? 36.227 77.796 17.681  0.50 80.10  ? 376 PHE A CA  1 
ATOM   2615 C C   A PHE A 1 376 ? 37.302 77.391 18.624  0.50 80.57  ? 376 PHE A C   1 
ATOM   2616 C C   B PHE A 1 376 ? 37.323 77.359 18.625  0.50 80.66  ? 376 PHE A C   1 
ATOM   2617 O O   A PHE A 1 376 ? 37.106 76.793 19.740  0.50 79.71  ? 376 PHE A O   1 
ATOM   2618 O O   B PHE A 1 376 ? 37.109 76.809 19.715  0.50 79.77  ? 376 PHE A O   1 
ATOM   2619 C CB  A PHE A 1 376 ? 35.520 79.228 18.111  0.50 77.26  ? 376 PHE A CB  1 
ATOM   2620 C CB  B PHE A 1 376 ? 35.717 79.226 17.968  0.50 77.69  ? 376 PHE A CB  1 
ATOM   2621 C CG  A PHE A 1 376 ? 34.518 79.613 17.110  0.50 74.88  ? 376 PHE A CG  1 
ATOM   2622 C CG  B PHE A 1 376 ? 36.496 80.135 17.205  0.50 75.27  ? 376 PHE A CG  1 
ATOM   2623 C CD1 A PHE A 1 376 ? 34.834 79.677 15.732  0.50 74.23  ? 376 PHE A CD1 1 
ATOM   2624 C CD1 B PHE A 1 376 ? 37.794 80.270 17.604  0.50 74.46  ? 376 PHE A CD1 1 
ATOM   2625 C CD2 A PHE A 1 376 ? 33.175 79.473 17.455  0.50 73.72  ? 376 PHE A CD2 1 
ATOM   2626 C CD2 B PHE A 1 376 ? 36.193 80.372 15.870  0.50 74.80  ? 376 PHE A CD2 1 
ATOM   2627 C CE1 A PHE A 1 376 ? 33.879 79.485 14.784  0.50 72.78  ? 376 PHE A CE1 1 
ATOM   2628 C CE1 B PHE A 1 376 ? 38.759 80.606 16.741  0.50 74.08  ? 376 PHE A CE1 1 
ATOM   2629 C CE2 A PHE A 1 376 ? 32.243 79.290 16.459  0.50 72.86  ? 376 PHE A CE2 1 
ATOM   2630 C CE2 B PHE A 1 376 ? 37.174 80.722 14.997  0.50 73.84  ? 376 PHE A CE2 1 
ATOM   2631 C CZ  A PHE A 1 376 ? 32.599 79.280 15.134  0.50 72.10  ? 376 PHE A CZ  1 
ATOM   2632 C CZ  B PHE A 1 376 ? 38.457 80.829 15.430  0.50 73.72  ? 376 PHE A CZ  1 
ATOM   2633 N N   . ILE A 1 377 ? 38.426 77.663 18.068  1.00 81.66  ? 377 ILE A N   1 
ATOM   2634 C CA  . ILE A 1 377 ? 39.737 77.544 18.704  1.00 82.85  ? 377 ILE A CA  1 
ATOM   2635 C C   . ILE A 1 377 ? 40.081 78.898 19.316  1.00 83.77  ? 377 ILE A C   1 
ATOM   2636 O O   . ILE A 1 377 ? 39.579 79.078 20.392  1.00 85.18  ? 377 ILE A O   1 
ATOM   2637 C CB  . ILE A 1 377 ? 40.774 77.155 17.647  1.00 81.67  ? 377 ILE A CB  1 
ATOM   2638 C CG1 . ILE A 1 377 ? 40.196 76.316 16.508  1.00 81.86  ? 377 ILE A CG1 1 
ATOM   2639 C CG2 . ILE A 1 377 ? 41.929 76.330 18.219  1.00 81.95  ? 377 ILE A CG2 1 
ATOM   2640 C CD1 . ILE A 1 377 ? 40.382 76.968 15.135  1.00 78.03  ? 377 ILE A CD1 1 
ATOM   2641 N N   . ASP A 1 378 ? 40.656 79.761 18.489  1.00 83.85  ? 378 ASP A N   1 
ATOM   2642 C CA  . ASP A 1 378 ? 41.095 81.093 18.906  1.00 84.54  ? 378 ASP A CA  1 
ATOM   2643 C C   . ASP A 1 378 ? 41.939 80.682 20.119  1.00 85.05  ? 378 ASP A C   1 
ATOM   2644 O O   . ASP A 1 378 ? 43.093 80.931 20.173  1.00 85.37  ? 378 ASP A O   1 
ATOM   2645 C CB  . ASP A 1 378 ? 39.941 82.130 19.174  1.00 82.74  ? 378 ASP A CB  1 
ATOM   2646 C CG  . ASP A 1 378 ? 39.361 82.772 17.845  1.00 80.79  ? 378 ASP A CG  1 
ATOM   2647 O OD1 . ASP A 1 378 ? 40.103 82.831 16.842  1.00 79.99  ? 378 ASP A OD1 1 
ATOM   2648 O OD2 . ASP A 1 378 ? 38.184 83.196 17.827  1.00 79.61  ? 378 ASP A OD2 1 
ATOM   2649 N N   . TYR A 1 379 ? 41.230 79.811 20.909  1.00 84.66  ? 379 TYR A N   1 
ATOM   2650 C CA  . TYR A 1 379 ? 41.568 79.106 22.161  1.00 84.30  ? 379 TYR A CA  1 
ATOM   2651 C C   . TYR A 1 379 ? 42.224 77.655 21.964  1.00 83.03  ? 379 TYR A C   1 
ATOM   2652 O O   . TYR A 1 379 ? 43.276 77.314 22.534  1.00 82.08  ? 379 TYR A O   1 
ATOM   2653 C CB  . TYR A 1 379 ? 40.279 78.855 22.973  1.00 84.95  ? 379 TYR A CB  1 
ATOM   2654 C CG  . TYR A 1 379 ? 39.225 79.968 22.897  1.00 87.51  ? 379 TYR A CG  1 
ATOM   2655 C CD1 . TYR A 1 379 ? 38.279 80.026 21.854  1.00 89.14  ? 379 TYR A CD1 1 
ATOM   2656 C CD2 . TYR A 1 379 ? 39.175 80.979 23.851  1.00 88.22  ? 379 TYR A CD2 1 
ATOM   2657 C CE1 . TYR A 1 379 ? 37.333 81.056 21.767  1.00 90.04  ? 379 TYR A CE1 1 
ATOM   2658 C CE2 . TYR A 1 379 ? 38.218 82.018 23.775  1.00 88.83  ? 379 TYR A CE2 1 
ATOM   2659 C CZ  . TYR A 1 379 ? 37.312 82.042 22.731  1.00 89.72  ? 379 TYR A CZ  1 
ATOM   2660 O OH  . TYR A 1 379 ? 36.384 83.069 22.660  1.00 88.19  ? 379 TYR A OH  1 
ATOM   2661 N N   . PHE A 1 380 ? 41.621 76.753 21.191  1.00 81.70  ? 380 PHE A N   1 
ATOM   2662 C CA  . PHE A 1 380 ? 42.192 75.370 21.029  1.00 80.52  ? 380 PHE A CA  1 
ATOM   2663 C C   . PHE A 1 380 ? 43.194 75.056 19.897  1.00 81.52  ? 380 PHE A C   1 
ATOM   2664 O O   . PHE A 1 380 ? 43.339 75.829 18.949  1.00 82.52  ? 380 PHE A O   1 
ATOM   2665 C CB  . PHE A 1 380 ? 41.061 74.313 21.022  1.00 79.05  ? 380 PHE A CB  1 
ATOM   2666 C CG  . PHE A 1 380 ? 40.291 74.254 22.318  1.00 77.77  ? 380 PHE A CG  1 
ATOM   2667 C CD1 . PHE A 1 380 ? 39.193 75.079 22.534  1.00 77.47  ? 380 PHE A CD1 1 
ATOM   2668 C CD2 . PHE A 1 380 ? 40.686 73.401 23.340  1.00 76.72  ? 380 PHE A CD2 1 
ATOM   2669 C CE1 . PHE A 1 380 ? 38.510 75.045 23.755  1.00 77.40  ? 380 PHE A CE1 1 
ATOM   2670 C CE2 . PHE A 1 380 ? 40.003 73.373 24.551  1.00 75.90  ? 380 PHE A CE2 1 
ATOM   2671 C CZ  . PHE A 1 380 ? 38.922 74.190 24.760  1.00 76.25  ? 380 PHE A CZ  1 
ATOM   2672 N N   . ASP A 1 381 ? 43.916 73.941 20.014  1.00 81.63  ? 381 ASP A N   1 
ATOM   2673 C CA  . ASP A 1 381 ? 44.913 73.575 19.005  1.00 81.04  ? 381 ASP A CA  1 
ATOM   2674 C C   . ASP A 1 381 ? 44.588 72.210 18.386  1.00 82.56  ? 381 ASP A C   1 
ATOM   2675 O O   . ASP A 1 381 ? 44.302 71.249 19.102  1.00 83.07  ? 381 ASP A O   1 
ATOM   2676 C CB  . ASP A 1 381 ? 46.307 73.558 19.634  1.00 77.63  ? 381 ASP A CB  1 
ATOM   2677 C CG  . ASP A 1 381 ? 47.401 73.257 18.628  1.00 76.00  ? 381 ASP A CG  1 
ATOM   2678 O OD1 . ASP A 1 381 ? 47.479 72.100 18.164  1.00 75.27  ? 381 ASP A OD1 1 
ATOM   2679 O OD2 . ASP A 1 381 ? 48.184 74.177 18.299  1.00 74.09  ? 381 ASP A OD2 1 
ATOM   2680 N N   . LYS A 1 382 ? 44.632 72.140 17.056  1.00 82.46  ? 382 LYS A N   1 
ATOM   2681 C CA  . LYS A 1 382 ? 44.331 70.925 16.294  1.00 81.93  ? 382 LYS A CA  1 
ATOM   2682 C C   . LYS A 1 382 ? 44.939 69.609 16.776  1.00 81.58  ? 382 LYS A C   1 
ATOM   2683 O O   . LYS A 1 382 ? 44.230 68.617 16.952  1.00 80.00  ? 382 LYS A O   1 
ATOM   2684 C CB  . LYS A 1 382 ? 44.730 71.148 14.841  1.00 83.15  ? 382 LYS A CB  1 
ATOM   2685 C CG  . LYS A 1 382 ? 44.972 69.879 14.024  1.00 84.48  ? 382 LYS A CG  1 
ATOM   2686 C CD  . LYS A 1 382 ? 45.471 70.176 12.597  1.00 82.65  ? 382 LYS A CD  1 
ATOM   2687 C CE  . LYS A 1 382 ? 46.683 71.131 12.538  1.00 82.57  ? 382 LYS A CE  1 
ATOM   2688 N NZ  . LYS A 1 382 ? 47.176 71.648 13.851  1.00 81.58  ? 382 LYS A NZ  1 
ATOM   2689 N N   . ASP A 1 383 ? 46.255 69.592 16.955  1.00 82.59  ? 383 ASP A N   1 
ATOM   2690 C CA  . ASP A 1 383 ? 46.959 68.388 17.394  1.00 83.77  ? 383 ASP A CA  1 
ATOM   2691 C C   . ASP A 1 383 ? 47.165 68.332 18.907  1.00 84.39  ? 383 ASP A C   1 
ATOM   2692 O O   . ASP A 1 383 ? 46.536 67.530 19.605  1.00 84.78  ? 383 ASP A O   1 
ATOM   2693 C CB  . ASP A 1 383 ? 48.328 68.303 16.712  1.00 84.14  ? 383 ASP A CB  1 
ATOM   2694 C CG  . ASP A 1 383 ? 48.225 68.137 15.215  1.00 84.87  ? 383 ASP A CG  1 
ATOM   2695 O OD1 . ASP A 1 383 ? 47.465 68.895 14.583  1.00 85.01  ? 383 ASP A OD1 1 
ATOM   2696 O OD2 . ASP A 1 383 ? 48.912 67.252 14.667  1.00 86.60  ? 383 ASP A OD2 1 
ATOM   2697 N N   . ASP A 1 384 ? 48.061 69.185 19.404  1.00 85.04  ? 384 ASP A N   1 
ATOM   2698 C CA  . ASP A 1 384 ? 48.393 69.252 20.829  1.00 83.72  ? 384 ASP A CA  1 
ATOM   2699 C C   . ASP A 1 384 ? 47.191 69.677 21.664  1.00 81.45  ? 384 ASP A C   1 
ATOM   2700 O O   . ASP A 1 384 ? 46.342 70.460 21.213  1.00 80.11  ? 384 ASP A O   1 
ATOM   2701 C CB  . ASP A 1 384 ? 49.533 70.253 21.065  1.00 85.99  ? 384 ASP A CB  1 
ATOM   2702 C CG  . ASP A 1 384 ? 50.402 70.459 19.831  1.00 87.73  ? 384 ASP A CG  1 
ATOM   2703 O OD1 . ASP A 1 384 ? 50.999 69.474 19.335  1.00 89.38  ? 384 ASP A OD1 1 
ATOM   2704 O OD2 . ASP A 1 384 ? 50.491 71.613 19.353  1.00 88.87  ? 384 ASP A OD2 1 
ATOM   2705 N N   . ALA A 1 385 ? 47.119 69.169 22.887  1.00 78.78  ? 385 ALA A N   1 
ATOM   2706 C CA  . ALA A 1 385 ? 46.008 69.511 23.767  1.00 77.58  ? 385 ALA A CA  1 
ATOM   2707 C C   . ALA A 1 385 ? 46.186 70.913 24.312  1.00 76.46  ? 385 ALA A C   1 
ATOM   2708 O O   . ALA A 1 385 ? 47.204 71.207 24.942  1.00 76.36  ? 385 ALA A O   1 
ATOM   2709 C CB  . ALA A 1 385 ? 45.930 68.526 24.924  1.00 75.72  ? 385 ALA A CB  1 
ATOM   2710 N N   . THR A 1 386 ? 45.230 71.801 24.045  1.00 76.01  ? 386 THR A N   1 
ATOM   2711 C CA  . THR A 1 386 ? 45.317 73.137 24.620  1.00 73.96  ? 386 THR A CA  1 
ATOM   2712 C C   . THR A 1 386 ? 44.839 72.864 26.029  1.00 72.61  ? 386 THR A C   1 
ATOM   2713 O O   . THR A 1 386 ? 44.168 71.872 26.282  1.00 73.12  ? 386 THR A O   1 
ATOM   2714 C CB  . THR A 1 386 ? 44.376 74.154 23.977  1.00 73.07  ? 386 THR A CB  1 
ATOM   2715 O OG1 . THR A 1 386 ? 43.078 74.067 24.569  1.00 72.71  ? 386 THR A OG1 1 
ATOM   2716 C CG2 . THR A 1 386 ? 44.274 73.910 22.521  1.00 72.19  ? 386 THR A CG2 1 
ATOM   2717 N N   . ALA A 1 387 ? 45.177 73.729 26.949  1.00 70.19  ? 387 ALA A N   1 
ATOM   2718 C CA  . ALA A 1 387 ? 44.779 73.487 28.325  1.00 69.60  ? 387 ALA A CA  1 
ATOM   2719 C C   . ALA A 1 387 ? 44.109 74.667 28.997  1.00 69.48  ? 387 ALA A C   1 
ATOM   2720 O O   . ALA A 1 387 ? 44.736 75.442 29.707  1.00 68.16  ? 387 ALA A O   1 
ATOM   2721 C CB  . ALA A 1 387 ? 45.977 73.040 29.102  1.00 69.83  ? 387 ALA A CB  1 
ATOM   2722 N N   . LEU A 1 388 ? 42.811 74.741 28.769  1.00 68.99  ? 388 LEU A N   1 
ATOM   2723 C CA  . LEU A 1 388 ? 41.912 75.792 29.221  1.00 69.29  ? 388 LEU A CA  1 
ATOM   2724 C C   . LEU A 1 388 ? 41.913 76.235 30.691  1.00 71.36  ? 388 LEU A C   1 
ATOM   2725 O O   . LEU A 1 388 ? 41.877 75.416 31.609  1.00 71.06  ? 388 LEU A O   1 
ATOM   2726 C CB  . LEU A 1 388 ? 40.502 75.356 28.875  1.00 68.13  ? 388 LEU A CB  1 
ATOM   2727 C CG  . LEU A 1 388 ? 39.538 76.408 28.353  1.00 68.62  ? 388 LEU A CG  1 
ATOM   2728 C CD1 . LEU A 1 388 ? 40.134 77.155 27.166  1.00 67.35  ? 388 LEU A CD1 1 
ATOM   2729 C CD2 . LEU A 1 388 ? 38.254 75.731 27.947  1.00 67.33  ? 388 LEU A CD2 1 
ATOM   2730 N N   . PRO A 1 389 ? 41.945 77.559 30.928  1.00 73.25  ? 389 PRO A N   1 
ATOM   2731 C CA  . PRO A 1 389 ? 41.939 78.131 32.282  1.00 74.80  ? 389 PRO A CA  1 
ATOM   2732 C C   . PRO A 1 389 ? 40.493 78.126 32.773  1.00 76.62  ? 389 PRO A C   1 
ATOM   2733 O O   . PRO A 1 389 ? 39.575 77.830 32.005  1.00 76.97  ? 389 PRO A O   1 
ATOM   2734 C CB  . PRO A 1 389 ? 42.436 79.563 32.067  1.00 73.69  ? 389 PRO A CB  1 
ATOM   2735 C CG  . PRO A 1 389 ? 43.146 79.514 30.748  1.00 73.14  ? 389 PRO A CG  1 
ATOM   2736 C CD  . PRO A 1 389 ? 42.287 78.591 29.939  1.00 73.91  ? 389 PRO A CD  1 
ATOM   2737 N N   . ARG A 1 390 ? 40.284 78.446 34.046  1.00 78.44  ? 390 ARG A N   1 
ATOM   2738 C CA  . ARG A 1 390 ? 38.924 78.490 34.565  1.00 80.13  ? 390 ARG A CA  1 
ATOM   2739 C C   . ARG A 1 390 ? 38.323 79.788 34.028  1.00 81.52  ? 390 ARG A C   1 
ATOM   2740 O O   . ARG A 1 390 ? 37.121 80.042 34.162  1.00 81.38  ? 390 ARG A O   1 
ATOM   2741 C CB  . ARG A 1 390 ? 38.938 78.510 36.092  1.00 80.04  ? 390 ARG A CB  1 
ATOM   2742 C CG  . ARG A 1 390 ? 37.815 77.712 36.731  1.00 81.39  ? 390 ARG A CG  1 
ATOM   2743 C CD  . ARG A 1 390 ? 36.422 78.296 36.487  1.00 82.01  ? 390 ARG A CD  1 
ATOM   2744 N NE  . ARG A 1 390 ? 35.395 77.336 36.895  1.00 83.17  ? 390 ARG A NE  1 
ATOM   2745 C CZ  . ARG A 1 390 ? 34.119 77.631 37.120  1.00 83.18  ? 390 ARG A CZ  1 
ATOM   2746 N NH1 . ARG A 1 390 ? 33.687 78.876 36.982  1.00 83.33  ? 390 ARG A NH1 1 
ATOM   2747 N NH2 . ARG A 1 390 ? 33.275 76.671 37.485  1.00 82.76  ? 390 ARG A NH2 1 
ATOM   2748 N N   . ASP A 1 391 ? 39.175 80.605 33.409  1.00 81.97  ? 391 ASP A N   1 
ATOM   2749 C CA  . ASP A 1 391 ? 38.731 81.871 32.851  1.00 81.65  ? 391 ASP A CA  1 
ATOM   2750 C C   . ASP A 1 391 ? 38.104 81.640 31.478  1.00 80.38  ? 391 ASP A C   1 
ATOM   2751 O O   . ASP A 1 391 ? 36.957 82.038 31.255  1.00 79.13  ? 391 ASP A O   1 
ATOM   2752 C CB  . ASP A 1 391 ? 39.904 82.885 32.801  1.00 84.58  ? 391 ASP A CB  1 
ATOM   2753 C CG  . ASP A 1 391 ? 40.729 82.808 31.519  1.00 87.30  ? 391 ASP A CG  1 
ATOM   2754 O OD1 . ASP A 1 391 ? 40.214 83.215 30.457  1.00 89.35  ? 391 ASP A OD1 1 
ATOM   2755 O OD2 . ASP A 1 391 ? 41.895 82.358 31.573  1.00 88.40  ? 391 ASP A OD2 1 
ATOM   2756 N N   . LYS A 1 392 ? 38.830 80.974 30.575  1.00 79.30  ? 392 LYS A N   1 
ATOM   2757 C CA  . LYS A 1 392 ? 38.305 80.704 29.233  1.00 77.76  ? 392 LYS A CA  1 
ATOM   2758 C C   . LYS A 1 392 ? 37.094 79.785 29.356  1.00 76.15  ? 392 LYS A C   1 
ATOM   2759 O O   . LYS A 1 392 ? 36.028 80.083 28.828  1.00 75.62  ? 392 LYS A O   1 
ATOM   2760 C CB  . LYS A 1 392 ? 39.355 80.023 28.335  1.00 78.43  ? 392 LYS A CB  1 
ATOM   2761 C CG  . LYS A 1 392 ? 40.729 80.671 28.277  1.00 77.48  ? 392 LYS A CG  1 
ATOM   2762 C CD  . LYS A 1 392 ? 40.692 82.129 27.879  1.00 79.48  ? 392 LYS A CD  1 
ATOM   2763 C CE  . LYS A 1 392 ? 42.097 82.712 27.878  1.00 81.32  ? 392 LYS A CE  1 
ATOM   2764 N NZ  . LYS A 1 392 ? 42.882 82.261 29.071  1.00 83.94  ? 392 LYS A NZ  1 
ATOM   2765 N N   . TYR A 1 393 ? 37.279 78.671 30.063  1.00 75.73  ? 393 TYR A N   1 
ATOM   2766 C CA  . TYR A 1 393 ? 36.233 77.672 30.291  1.00 74.29  ? 393 TYR A CA  1 
ATOM   2767 C C   . TYR A 1 393 ? 34.842 78.265 30.446  1.00 74.18  ? 393 TYR A C   1 
ATOM   2768 O O   . TYR A 1 393 ? 33.867 77.701 29.964  1.00 74.92  ? 393 TYR A O   1 
ATOM   2769 C CB  . TYR A 1 393 ? 36.543 76.848 31.541  1.00 72.88  ? 393 TYR A CB  1 
ATOM   2770 C CG  . TYR A 1 393 ? 35.402 75.940 31.961  1.00 71.81  ? 393 TYR A CG  1 
ATOM   2771 C CD1 . TYR A 1 393 ? 34.404 76.397 32.827  1.00 71.52  ? 393 TYR A CD1 1 
ATOM   2772 C CD2 . TYR A 1 393 ? 35.305 74.633 31.480  1.00 70.60  ? 393 TYR A CD2 1 
ATOM   2773 C CE1 . TYR A 1 393 ? 33.341 75.569 33.212  1.00 70.12  ? 393 TYR A CE1 1 
ATOM   2774 C CE2 . TYR A 1 393 ? 34.247 73.796 31.859  1.00 68.73  ? 393 TYR A CE2 1 
ATOM   2775 C CZ  . TYR A 1 393 ? 33.267 74.273 32.724  1.00 68.57  ? 393 TYR A CZ  1 
ATOM   2776 O OH  . TYR A 1 393 ? 32.221 73.462 33.104  1.00 63.91  ? 393 TYR A OH  1 
ATOM   2777 N N   . LEU A 1 394 ? 34.746 79.388 31.142  1.00 74.11  ? 394 LEU A N   1 
ATOM   2778 C CA  . LEU A 1 394 ? 33.458 80.026 31.337  1.00 73.98  ? 394 LEU A CA  1 
ATOM   2779 C C   . LEU A 1 394 ? 33.116 80.852 30.111  1.00 74.47  ? 394 LEU A C   1 
ATOM   2780 O O   . LEU A 1 394 ? 31.952 80.944 29.729  1.00 74.58  ? 394 LEU A O   1 
ATOM   2781 C CB  . LEU A 1 394 ? 33.490 80.898 32.589  1.00 73.93  ? 394 LEU A CB  1 
ATOM   2782 C CG  . LEU A 1 394 ? 33.724 80.072 33.856  1.00 73.83  ? 394 LEU A CG  1 
ATOM   2783 C CD1 . LEU A 1 394 ? 33.999 80.976 35.040  1.00 73.08  ? 394 LEU A CD1 1 
ATOM   2784 C CD2 . LEU A 1 394 ? 32.513 79.197 34.105  1.00 71.89  ? 394 LEU A CD2 1 
ATOM   2785 N N   . GLU A 1 395 ? 34.132 81.451 29.498  1.00 75.31  ? 395 GLU A N   1 
ATOM   2786 C CA  . GLU A 1 395 ? 33.931 82.251 28.295  1.00 76.90  ? 395 GLU A CA  1 
ATOM   2787 C C   . GLU A 1 395 ? 33.168 81.397 27.296  1.00 77.29  ? 395 GLU A C   1 
ATOM   2788 O O   . GLU A 1 395 ? 32.191 81.838 26.679  1.00 78.14  ? 395 GLU A O   1 
ATOM   2789 C CB  . GLU A 1 395 ? 35.266 82.625 27.657  1.00 77.26  ? 395 GLU A CB  1 
ATOM   2790 C CG  . GLU A 1 395 ? 36.094 83.652 28.377  1.00 79.34  ? 395 GLU A CG  1 
ATOM   2791 C CD  . GLU A 1 395 ? 37.374 83.944 27.619  1.00 80.99  ? 395 GLU A CD  1 
ATOM   2792 O OE1 . GLU A 1 395 ? 37.307 84.273 26.415  1.00 80.36  ? 395 GLU A OE1 1 
ATOM   2793 O OE2 . GLU A 1 395 ? 38.455 83.840 28.227  1.00 84.50  ? 395 GLU A OE2 1 
ATOM   2794 N N   . ILE A 1 396 ? 33.649 80.166 27.143  1.00 76.54  ? 396 ILE A N   1 
ATOM   2795 C CA  . ILE A 1 396 ? 33.074 79.192 26.224  1.00 76.03  ? 396 ILE A CA  1 
ATOM   2796 C C   . ILE A 1 396 ? 31.705 78.699 26.672  1.00 75.36  ? 396 ILE A C   1 
ATOM   2797 O O   . ILE A 1 396 ? 30.689 79.090 26.106  1.00 75.00  ? 396 ILE A O   1 
ATOM   2798 C CB  . ILE A 1 396 ? 34.012 77.970 26.057  1.00 75.49  ? 396 ILE A CB  1 
ATOM   2799 C CG1 . ILE A 1 396 ? 35.286 78.396 25.326  1.00 76.29  ? 396 ILE A CG1 1 
ATOM   2800 C CG2 . ILE A 1 396 ? 33.308 76.863 25.293  1.00 74.65  ? 396 ILE A CG2 1 
ATOM   2801 C CD1 . ILE A 1 396 ? 36.330 77.308 25.206  1.00 76.25  ? 396 ILE A CD1 1 
ATOM   2802 N N   . MET A 1 397 ? 31.686 77.835 27.684  1.00 73.10  ? 397 MET A N   1 
ATOM   2803 C CA  . MET A 1 397 ? 30.437 77.282 28.190  1.00 71.18  ? 397 MET A CA  1 
ATOM   2804 C C   . MET A 1 397 ? 29.375 78.344 28.300  1.00 70.76  ? 397 MET A C   1 
ATOM   2805 O O   . MET A 1 397 ? 28.187 78.037 28.271  1.00 71.19  ? 397 MET A O   1 
ATOM   2806 C CB  . MET A 1 397 ? 30.636 76.650 29.565  1.00 71.91  ? 397 MET A CB  1 
ATOM   2807 C CG  . MET A 1 397 ? 31.504 75.427 29.559  1.00 71.90  ? 397 MET A CG  1 
ATOM   2808 S SD  . MET A 1 397 ? 30.697 74.185 28.641  1.00 71.99  ? 397 MET A SD  1 
ATOM   2809 C CE  . MET A 1 397 ? 29.685 73.445 29.882  1.00 71.44  ? 397 MET A CE  1 
ATOM   2810 N N   . ASN A 1 398 ? 29.784 79.597 28.438  1.00 69.37  ? 398 ASN A N   1 
ATOM   2811 C CA  . ASN A 1 398 ? 28.789 80.639 28.543  1.00 67.70  ? 398 ASN A CA  1 
ATOM   2812 C C   . ASN A 1 398 ? 28.367 81.040 27.149  1.00 66.12  ? 398 ASN A C   1 
ATOM   2813 O O   . ASN A 1 398 ? 27.244 81.492 26.938  1.00 66.34  ? 398 ASN A O   1 
ATOM   2814 C CB  . ASN A 1 398 ? 29.325 81.817 29.349  1.00 68.97  ? 398 ASN A CB  1 
ATOM   2815 C CG  . ASN A 1 398 ? 28.479 82.095 30.576  1.00 69.61  ? 398 ASN A CG  1 
ATOM   2816 O OD1 . ASN A 1 398 ? 27.495 82.837 30.513  1.00 69.82  ? 398 ASN A OD1 1 
ATOM   2817 N ND2 . ASN A 1 398 ? 28.836 81.472 31.693  1.00 69.13  ? 398 ASN A ND2 1 
ATOM   2818 N N   . ASN A 1 399 ? 29.271 80.851 26.194  1.00 65.05  ? 399 ASN A N   1 
ATOM   2819 C CA  . ASN A 1 399 ? 28.976 81.144 24.792  1.00 64.61  ? 399 ASN A CA  1 
ATOM   2820 C C   . ASN A 1 399 ? 28.005 80.076 24.290  1.00 63.59  ? 399 ASN A C   1 
ATOM   2821 O O   . ASN A 1 399 ? 26.870 80.381 23.913  1.00 63.90  ? 399 ASN A O   1 
ATOM   2822 C CB  . ASN A 1 399 ? 30.254 81.094 23.942  1.00 63.64  ? 399 ASN A CB  1 
ATOM   2823 C CG  . ASN A 1 399 ? 29.965 81.076 22.434  1.00 63.96  ? 399 ASN A CG  1 
ATOM   2824 O OD1 . ASN A 1 399 ? 30.863 80.836 21.622  1.00 63.96  ? 399 ASN A OD1 1 
ATOM   2825 N ND2 . ASN A 1 399 ? 28.712 81.336 22.060  1.00 63.66  ? 399 ASN A ND2 1 
ATOM   2826 N N   . ILE A 1 400 ? 28.473 78.825 24.297  1.00 61.06  ? 400 ILE A N   1 
ATOM   2827 C CA  . ILE A 1 400 ? 27.692 77.685 23.843  1.00 57.31  ? 400 ILE A CA  1 
ATOM   2828 C C   . ILE A 1 400 ? 26.241 77.691 24.303  1.00 56.25  ? 400 ILE A C   1 
ATOM   2829 O O   . ILE A 1 400 ? 25.343 77.516 23.484  1.00 55.35  ? 400 ILE A O   1 
ATOM   2830 C CB  . ILE A 1 400 ? 28.342 76.357 24.272  1.00 56.56  ? 400 ILE A CB  1 
ATOM   2831 C CG1 . ILE A 1 400 ? 29.683 76.184 23.565  1.00 54.97  ? 400 ILE A CG1 1 
ATOM   2832 C CG2 . ILE A 1 400 ? 27.445 75.196 23.909  1.00 55.62  ? 400 ILE A CG2 1 
ATOM   2833 C CD1 . ILE A 1 400 ? 30.394 74.894 23.921  1.00 55.99  ? 400 ILE A CD1 1 
ATOM   2834 N N   . PHE A 1 401 ? 26.002 77.896 25.598  1.00 56.07  ? 401 PHE A N   1 
ATOM   2835 C CA  . PHE A 1 401 ? 24.627 77.908 26.109  1.00 55.67  ? 401 PHE A CA  1 
ATOM   2836 C C   . PHE A 1 401 ? 24.115 79.277 26.507  1.00 56.90  ? 401 PHE A C   1 
ATOM   2837 O O   . PHE A 1 401 ? 23.461 79.415 27.533  1.00 55.90  ? 401 PHE A O   1 
ATOM   2838 C CB  . PHE A 1 401 ? 24.488 76.983 27.308  1.00 51.09  ? 401 PHE A CB  1 
ATOM   2839 C CG  . PHE A 1 401 ? 25.190 75.688 27.143  1.00 51.79  ? 401 PHE A CG  1 
ATOM   2840 C CD1 . PHE A 1 401 ? 24.543 74.603 26.573  1.00 51.63  ? 401 PHE A CD1 1 
ATOM   2841 C CD2 . PHE A 1 401 ? 26.513 75.553 27.548  1.00 53.61  ? 401 PHE A CD2 1 
ATOM   2842 C CE1 . PHE A 1 401 ? 25.208 73.391 26.408  1.00 53.78  ? 401 PHE A CE1 1 
ATOM   2843 C CE2 . PHE A 1 401 ? 27.190 74.351 27.393  1.00 55.22  ? 401 PHE A CE2 1 
ATOM   2844 C CZ  . PHE A 1 401 ? 26.537 73.261 26.820  1.00 55.31  ? 401 PHE A CZ  1 
ATOM   2845 N N   . GLY A 1 402 ? 24.407 80.287 25.696  1.00 60.80  ? 402 GLY A N   1 
ATOM   2846 C CA  . GLY A 1 402 ? 23.944 81.628 26.005  1.00 65.12  ? 402 GLY A CA  1 
ATOM   2847 C C   . GLY A 1 402 ? 22.457 81.757 25.726  1.00 68.99  ? 402 GLY A C   1 
ATOM   2848 O O   . GLY A 1 402 ? 21.829 82.763 26.074  1.00 69.28  ? 402 GLY A O   1 
ATOM   2849 N N   . LYS A 1 403 ? 21.887 80.723 25.110  1.00 71.77  ? 403 LYS A N   1 
ATOM   2850 C CA  . LYS A 1 403 ? 20.471 80.728 24.755  1.00 74.48  ? 403 LYS A CA  1 
ATOM   2851 C C   . LYS A 1 403 ? 19.540 80.342 25.895  1.00 75.51  ? 403 LYS A C   1 
ATOM   2852 O O   . LYS A 1 403 ? 18.365 80.718 25.895  1.00 74.26  ? 403 LYS A O   1 
ATOM   2853 C CB  . LYS A 1 403 ? 20.215 79.792 23.562  1.00 76.10  ? 403 LYS A CB  1 
ATOM   2854 C CG  . LYS A 1 403 ? 20.934 80.195 22.273  1.00 79.07  ? 403 LYS A CG  1 
ATOM   2855 C CD  . LYS A 1 403 ? 20.193 79.711 21.026  1.00 81.70  ? 403 LYS A CD  1 
ATOM   2856 C CE  . LYS A 1 403 ? 19.928 80.871 20.050  1.00 82.46  ? 403 LYS A CE  1 
ATOM   2857 N NZ  . LYS A 1 403 ? 19.046 81.937 20.634  1.00 80.99  ? 403 LYS A NZ  1 
ATOM   2858 N N   . ALA A 1 404 ? 20.067 79.597 26.863  1.00 76.93  ? 404 ALA A N   1 
ATOM   2859 C CA  . ALA A 1 404 ? 19.269 79.139 27.997  1.00 76.97  ? 404 ALA A CA  1 
ATOM   2860 C C   . ALA A 1 404 ? 19.371 80.062 29.200  1.00 77.14  ? 404 ALA A C   1 
ATOM   2861 O O   . ALA A 1 404 ? 20.315 80.852 29.312  1.00 77.45  ? 404 ALA A O   1 
ATOM   2862 C CB  . ALA A 1 404 ? 19.689 77.734 28.385  1.00 77.42  ? 404 ALA A CB  1 
ATOM   2863 N N   . THR A 1 405 ? 18.391 79.952 30.096  1.00 76.31  ? 405 THR A N   1 
ATOM   2864 C CA  . THR A 1 405 ? 18.344 80.770 31.307  1.00 76.35  ? 405 THR A CA  1 
ATOM   2865 C C   . THR A 1 405 ? 19.644 80.631 32.074  1.00 75.46  ? 405 THR A C   1 
ATOM   2866 O O   . THR A 1 405 ? 20.354 79.639 31.921  1.00 75.37  ? 405 THR A O   1 
ATOM   2867 C CB  . THR A 1 405 ? 17.206 80.335 32.243  1.00 76.96  ? 405 THR A CB  1 
ATOM   2868 O OG1 . THR A 1 405 ? 17.416 78.978 32.649  1.00 77.99  ? 405 THR A OG1 1 
ATOM   2869 C CG2 . THR A 1 405 ? 15.874 80.438 31.542  1.00 77.95  ? 405 THR A CG2 1 
ATOM   2870 N N   . GLN A 1 406 ? 19.952 81.615 32.910  1.00 74.32  ? 406 GLN A N   1 
ATOM   2871 C CA  . GLN A 1 406 ? 21.186 81.553 33.675  1.00 73.16  ? 406 GLN A CA  1 
ATOM   2872 C C   . GLN A 1 406 ? 21.157 80.380 34.643  1.00 70.25  ? 406 GLN A C   1 
ATOM   2873 O O   . GLN A 1 406 ? 22.196 79.795 34.948  1.00 70.42  ? 406 GLN A O   1 
ATOM   2874 C CB  . GLN A 1 406 ? 21.409 82.852 34.447  1.00 75.92  ? 406 GLN A CB  1 
ATOM   2875 C CG  . GLN A 1 406 ? 22.774 82.912 35.121  1.00 79.79  ? 406 GLN A CG  1 
ATOM   2876 C CD  . GLN A 1 406 ? 22.992 84.198 35.881  1.00 81.19  ? 406 GLN A CD  1 
ATOM   2877 O OE1 . GLN A 1 406 ? 22.122 85.068 35.905  1.00 82.09  ? 406 GLN A OE1 1 
ATOM   2878 N NE2 . GLN A 1 406 ? 24.158 84.329 36.508  1.00 81.61  ? 406 GLN A NE2 1 
ATOM   2879 N N   . ALA A 1 407 ? 19.960 80.039 35.113  1.00 67.00  ? 407 ALA A N   1 
ATOM   2880 C CA  . ALA A 1 407 ? 19.779 78.939 36.050  1.00 63.03  ? 407 ALA A CA  1 
ATOM   2881 C C   . ALA A 1 407 ? 20.368 77.633 35.520  1.00 61.81  ? 407 ALA A C   1 
ATOM   2882 O O   . ALA A 1 407 ? 21.065 76.922 36.238  1.00 61.66  ? 407 ALA A O   1 
ATOM   2883 C CB  . ALA A 1 407 ? 18.313 78.768 36.354  1.00 60.33  ? 407 ALA A CB  1 
ATOM   2884 N N   . GLU A 1 408 ? 20.088 77.307 34.268  1.00 61.38  ? 408 GLU A N   1 
ATOM   2885 C CA  . GLU A 1 408 ? 20.634 76.084 33.693  1.00 61.36  ? 408 GLU A CA  1 
ATOM   2886 C C   . GLU A 1 408 ? 22.051 76.344 33.196  1.00 60.03  ? 408 GLU A C   1 
ATOM   2887 O O   . GLU A 1 408 ? 22.867 75.432 33.103  1.00 60.35  ? 408 GLU A O   1 
ATOM   2888 C CB  . GLU A 1 408 ? 19.733 75.585 32.561  1.00 62.16  ? 408 GLU A CB  1 
ATOM   2889 C CG  . GLU A 1 408 ? 19.118 76.690 31.731  1.00 65.61  ? 408 GLU A CG  1 
ATOM   2890 C CD  . GLU A 1 408 ? 17.908 76.222 30.940  1.00 66.93  ? 408 GLU A CD  1 
ATOM   2891 O OE1 . GLU A 1 408 ? 18.053 75.296 30.108  1.00 67.86  ? 408 GLU A OE1 1 
ATOM   2892 O OE2 . GLU A 1 408 ? 16.811 76.786 31.157  1.00 66.37  ? 408 GLU A OE2 1 
ATOM   2893 N N   . ARG A 1 409 ? 22.345 77.601 32.889  1.00 59.17  ? 409 ARG A N   1 
ATOM   2894 C CA  . ARG A 1 409 ? 23.673 77.979 32.426  1.00 56.90  ? 409 ARG A CA  1 
ATOM   2895 C C   . ARG A 1 409 ? 24.636 77.645 33.560  1.00 56.55  ? 409 ARG A C   1 
ATOM   2896 O O   . ARG A 1 409 ? 25.662 76.992 33.354  1.00 56.01  ? 409 ARG A O   1 
ATOM   2897 C CB  . ARG A 1 409 ? 23.711 79.476 32.126  1.00 56.93  ? 409 ARG A CB  1 
ATOM   2898 C CG  . ARG A 1 409 ? 24.088 79.832 30.704  1.00 56.50  ? 409 ARG A CG  1 
ATOM   2899 C CD  . ARG A 1 409 ? 23.947 81.328 30.499  1.00 58.56  ? 409 ARG A CD  1 
ATOM   2900 N NE  . ARG A 1 409 ? 22.568 81.776 30.688  1.00 60.50  ? 409 ARG A NE  1 
ATOM   2901 C CZ  . ARG A 1 409 ? 22.232 83.022 31.008  1.00 64.08  ? 409 ARG A CZ  1 
ATOM   2902 N NH1 . ARG A 1 409 ? 23.178 83.937 31.180  1.00 65.50  ? 409 ARG A NH1 1 
ATOM   2903 N NH2 . ARG A 1 409 ? 20.956 83.360 31.154  1.00 64.64  ? 409 ARG A NH2 1 
ATOM   2904 N N   . GLU A 1 410 ? 24.288 78.096 34.760  1.00 54.90  ? 410 GLU A N   1 
ATOM   2905 C CA  . GLU A 1 410 ? 25.094 77.839 35.940  1.00 56.00  ? 410 GLU A CA  1 
ATOM   2906 C C   . GLU A 1 410 ? 25.157 76.333 36.206  1.00 55.96  ? 410 GLU A C   1 
ATOM   2907 O O   . GLU A 1 410 ? 26.232 75.765 36.442  1.00 56.31  ? 410 GLU A O   1 
ATOM   2908 C CB  . GLU A 1 410 ? 24.485 78.530 37.158  1.00 57.30  ? 410 GLU A CB  1 
ATOM   2909 C CG  . GLU A 1 410 ? 24.329 80.031 37.039  1.00 61.40  ? 410 GLU A CG  1 
ATOM   2910 C CD  . GLU A 1 410 ? 23.779 80.656 38.315  1.00 65.65  ? 410 GLU A CD  1 
ATOM   2911 O OE1 . GLU A 1 410 ? 22.646 80.310 38.723  1.00 65.99  ? 410 GLU A OE1 1 
ATOM   2912 O OE2 . GLU A 1 410 ? 24.486 81.494 38.916  1.00 68.36  ? 410 GLU A OE2 1 
ATOM   2913 N N   . ALA A 1 411 ? 23.995 75.692 36.164  1.00 53.87  ? 411 ALA A N   1 
ATOM   2914 C CA  . ALA A 1 411 ? 23.907 74.266 36.422  1.00 53.96  ? 411 ALA A CA  1 
ATOM   2915 C C   . ALA A 1 411 ? 24.825 73.457 35.530  1.00 53.99  ? 411 ALA A C   1 
ATOM   2916 O O   . ALA A 1 411 ? 25.560 72.588 36.009  1.00 53.84  ? 411 ALA A O   1 
ATOM   2917 C CB  . ALA A 1 411 ? 22.481 73.797 36.254  1.00 54.41  ? 411 ALA A CB  1 
ATOM   2918 N N   . ILE A 1 412 ? 24.781 73.740 34.232  1.00 53.98  ? 412 ILE A N   1 
ATOM   2919 C CA  . ILE A 1 412 ? 25.610 73.020 33.277  1.00 53.50  ? 412 ILE A CA  1 
ATOM   2920 C C   . ILE A 1 412 ? 27.070 73.282 33.589  1.00 54.02  ? 412 ILE A C   1 
ATOM   2921 O O   . ILE A 1 412 ? 27.866 72.346 33.646  1.00 54.73  ? 412 ILE A O   1 
ATOM   2922 C CB  . ILE A 1 412 ? 25.316 73.452 31.830  1.00 53.89  ? 412 ILE A CB  1 
ATOM   2923 C CG1 . ILE A 1 412 ? 23.825 73.276 31.525  1.00 51.30  ? 412 ILE A CG1 1 
ATOM   2924 C CG2 . ILE A 1 412 ? 26.145 72.611 30.862  1.00 53.33  ? 412 ILE A CG2 1 
ATOM   2925 C CD1 . ILE A 1 412 ? 23.372 74.020 30.297  1.00 47.77  ? 412 ILE A CD1 1 
ATOM   2926 N N   . ILE A 1 413 ? 27.422 74.551 33.802  1.00 54.47  ? 413 ILE A N   1 
ATOM   2927 C CA  . ILE A 1 413 ? 28.804 74.902 34.128  1.00 53.68  ? 413 ILE A CA  1 
ATOM   2928 C C   . ILE A 1 413 ? 29.271 74.127 35.354  1.00 53.07  ? 413 ILE A C   1 
ATOM   2929 O O   . ILE A 1 413 ? 30.275 73.423 35.306  1.00 53.78  ? 413 ILE A O   1 
ATOM   2930 C CB  . ILE A 1 413 ? 28.973 76.393 34.424  1.00 52.59  ? 413 ILE A CB  1 
ATOM   2931 C CG1 . ILE A 1 413 ? 28.630 77.213 33.186  1.00 53.66  ? 413 ILE A CG1 1 
ATOM   2932 C CG2 . ILE A 1 413 ? 30.409 76.672 34.816  1.00 52.32  ? 413 ILE A CG2 1 
ATOM   2933 C CD1 . ILE A 1 413 ? 28.827 78.695 33.376  1.00 53.89  ? 413 ILE A CD1 1 
ATOM   2934 N N   . PHE A 1 414 ? 28.546 74.255 36.455  1.00 51.51  ? 414 PHE A N   1 
ATOM   2935 C CA  . PHE A 1 414 ? 28.924 73.531 37.660  1.00 51.93  ? 414 PHE A CA  1 
ATOM   2936 C C   . PHE A 1 414 ? 29.041 72.046 37.357  1.00 51.40  ? 414 PHE A C   1 
ATOM   2937 O O   . PHE A 1 414 ? 29.962 71.368 37.819  1.00 50.83  ? 414 PHE A O   1 
ATOM   2938 C CB  . PHE A 1 414 ? 27.882 73.719 38.764  1.00 50.91  ? 414 PHE A CB  1 
ATOM   2939 C CG  . PHE A 1 414 ? 28.290 73.128 40.076  1.00 48.50  ? 414 PHE A CG  1 
ATOM   2940 C CD1 . PHE A 1 414 ? 29.275 73.740 40.851  1.00 47.77  ? 414 PHE A CD1 1 
ATOM   2941 C CD2 . PHE A 1 414 ? 27.709 71.952 40.533  1.00 48.96  ? 414 PHE A CD2 1 
ATOM   2942 C CE1 . PHE A 1 414 ? 29.679 73.190 42.070  1.00 46.08  ? 414 PHE A CE1 1 
ATOM   2943 C CE2 . PHE A 1 414 ? 28.105 71.387 41.753  1.00 49.25  ? 414 PHE A CE2 1 
ATOM   2944 C CZ  . PHE A 1 414 ? 29.094 72.012 42.522  1.00 48.21  ? 414 PHE A CZ  1 
ATOM   2945 N N   . GLN A 1 415 ? 28.086 71.553 36.578  1.00 52.36  ? 415 GLN A N   1 
ATOM   2946 C CA  . GLN A 1 415 ? 28.020 70.147 36.198  1.00 53.99  ? 415 GLN A CA  1 
ATOM   2947 C C   . GLN A 1 415 ? 29.257 69.648 35.440  1.00 56.44  ? 415 GLN A C   1 
ATOM   2948 O O   . GLN A 1 415 ? 29.751 68.540 35.681  1.00 54.85  ? 415 GLN A O   1 
ATOM   2949 C CB  . GLN A 1 415 ? 26.751 69.913 35.367  1.00 50.51  ? 415 GLN A CB  1 
ATOM   2950 C CG  . GLN A 1 415 ? 26.596 68.511 34.815  1.00 46.67  ? 415 GLN A CG  1 
ATOM   2951 C CD  . GLN A 1 415 ? 26.558 67.439 35.881  1.00 43.86  ? 415 GLN A CD  1 
ATOM   2952 O OE1 . GLN A 1 415 ? 26.449 66.265 35.564  1.00 45.29  ? 415 GLN A OE1 1 
ATOM   2953 N NE2 . GLN A 1 415 ? 26.651 67.834 37.148  1.00 42.84  ? 415 GLN A NE2 1 
ATOM   2954 N N   . TYR A 1 416 ? 29.755 70.475 34.527  1.00 59.69  ? 416 TYR A N   1 
ATOM   2955 C CA  . TYR A 1 416 ? 30.919 70.120 33.734  1.00 63.20  ? 416 TYR A CA  1 
ATOM   2956 C C   . TYR A 1 416 ? 32.222 70.712 34.243  1.00 65.76  ? 416 TYR A C   1 
ATOM   2957 O O   . TYR A 1 416 ? 33.177 70.865 33.488  1.00 67.76  ? 416 TYR A O   1 
ATOM   2958 C CB  . TYR A 1 416 ? 30.683 70.520 32.274  1.00 63.45  ? 416 TYR A CB  1 
ATOM   2959 C CG  . TYR A 1 416 ? 29.825 69.509 31.568  1.00 63.24  ? 416 TYR A CG  1 
ATOM   2960 C CD1 . TYR A 1 416 ? 30.345 68.266 31.217  1.00 62.97  ? 416 TYR A CD1 1 
ATOM   2961 C CD2 . TYR A 1 416 ? 28.468 69.739 31.358  1.00 63.64  ? 416 TYR A CD2 1 
ATOM   2962 C CE1 . TYR A 1 416 ? 29.534 67.267 30.692  1.00 63.56  ? 416 TYR A CE1 1 
ATOM   2963 C CE2 . TYR A 1 416 ? 27.646 68.746 30.837  1.00 63.97  ? 416 TYR A CE2 1 
ATOM   2964 C CZ  . TYR A 1 416 ? 28.185 67.512 30.506  1.00 63.83  ? 416 TYR A CZ  1 
ATOM   2965 O OH  . TYR A 1 416 ? 27.371 66.512 30.023  1.00 62.70  ? 416 TYR A OH  1 
ATOM   2966 N N   . THR A 1 417 ? 32.263 71.022 35.532  1.00 68.14  ? 417 THR A N   1 
ATOM   2967 C CA  . THR A 1 417 ? 33.450 71.595 36.155  1.00 71.34  ? 417 THR A CA  1 
ATOM   2968 C C   . THR A 1 417 ? 34.395 70.500 36.638  1.00 74.99  ? 417 THR A C   1 
ATOM   2969 O O   . THR A 1 417 ? 33.969 69.551 37.306  1.00 75.06  ? 417 THR A O   1 
ATOM   2970 C CB  . THR A 1 417 ? 33.070 72.475 37.349  1.00 70.83  ? 417 THR A CB  1 
ATOM   2971 O OG1 . THR A 1 417 ? 32.304 73.591 36.890  1.00 70.22  ? 417 THR A OG1 1 
ATOM   2972 C CG2 . THR A 1 417 ? 34.302 72.977 38.055  1.00 71.38  ? 417 THR A CG2 1 
ATOM   2973 N N   . SER A 1 418 ? 35.675 70.643 36.290  1.00 78.24  ? 418 SER A N   1 
ATOM   2974 C CA  . SER A 1 418 ? 36.715 69.685 36.662  1.00 80.65  ? 418 SER A CA  1 
ATOM   2975 C C   . SER A 1 418 ? 37.361 70.080 37.985  1.00 82.23  ? 418 SER A C   1 
ATOM   2976 O O   . SER A 1 418 ? 37.939 71.158 38.112  1.00 80.96  ? 418 SER A O   1 
ATOM   2977 C CB  . SER A 1 418 ? 37.783 69.625 35.568  1.00 81.81  ? 418 SER A CB  1 
ATOM   2978 O OG  . SER A 1 418 ? 38.346 70.907 35.331  1.00 81.41  ? 418 SER A OG  1 
ATOM   2979 N N   . TRP A 1 419 ? 37.259 69.203 38.973  1.00 85.58  ? 419 TRP A N   1 
ATOM   2980 C CA  . TRP A 1 419 ? 37.828 69.487 40.281  1.00 89.67  ? 419 TRP A CA  1 
ATOM   2981 C C   . TRP A 1 419 ? 39.055 68.648 40.566  1.00 91.40  ? 419 TRP A C   1 
ATOM   2982 O O   . TRP A 1 419 ? 39.498 68.544 41.713  1.00 91.16  ? 419 TRP A O   1 
ATOM   2983 C CB  . TRP A 1 419 ? 36.789 69.268 41.375  1.00 91.19  ? 419 TRP A CB  1 
ATOM   2984 C CG  . TRP A 1 419 ? 35.783 70.360 41.444  1.00 93.69  ? 419 TRP A CG  1 
ATOM   2985 C CD1 . TRP A 1 419 ? 36.022 71.679 41.704  1.00 93.79  ? 419 TRP A CD1 1 
ATOM   2986 C CD2 . TRP A 1 419 ? 34.368 70.237 41.252  1.00 95.32  ? 419 TRP A CD2 1 
ATOM   2987 N NE1 . TRP A 1 419 ? 34.847 72.386 41.684  1.00 95.37  ? 419 TRP A NE1 1 
ATOM   2988 C CE2 . TRP A 1 419 ? 33.814 71.525 41.405  1.00 96.34  ? 419 TRP A CE2 1 
ATOM   2989 C CE3 . TRP A 1 419 ? 33.515 69.161 40.956  1.00 95.31  ? 419 TRP A CE3 1 
ATOM   2990 C CZ2 . TRP A 1 419 ? 32.441 71.772 41.283  1.00 97.68  ? 419 TRP A CZ2 1 
ATOM   2991 C CZ3 . TRP A 1 419 ? 32.146 69.404 40.833  1.00 96.39  ? 419 TRP A CZ3 1 
ATOM   2992 C CH2 . TRP A 1 419 ? 31.627 70.700 40.993  1.00 97.60  ? 419 TRP A CH2 1 
ATOM   2993 N N   . GLU A 1 420 ? 39.586 68.029 39.518  1.00 93.48  ? 420 GLU A N   1 
ATOM   2994 C CA  . GLU A 1 420 ? 40.793 67.238 39.653  1.00 95.03  ? 420 GLU A CA  1 
ATOM   2995 C C   . GLU A 1 420 ? 41.356 66.708 38.348  1.00 95.80  ? 420 GLU A C   1 
ATOM   2996 O O   . GLU A 1 420 ? 40.628 66.412 37.402  1.00 95.34  ? 420 GLU A O   1 
ATOM   2997 C CB  . GLU A 1 420 ? 40.615 66.096 40.653  1.00 95.03  ? 420 GLU A CB  1 
ATOM   2998 C CG  . GLU A 1 420 ? 41.952 65.743 41.295  1.00 95.83  ? 420 GLU A CG  1 
ATOM   2999 C CD  . GLU A 1 420 ? 42.924 66.922 41.242  1.00 95.74  ? 420 GLU A CD  1 
ATOM   3000 O OE1 . GLU A 1 420 ? 42.502 68.050 41.583  1.00 95.73  ? 420 GLU A OE1 1 
ATOM   3001 O OE2 . GLU A 1 420 ? 44.098 66.729 40.857  1.00 94.90  ? 420 GLU A OE2 1 
ATOM   3002 N N   . GLY A 1 421 ? 42.678 66.580 38.330  1.00 96.77  ? 421 GLY A N   1 
ATOM   3003 C CA  . GLY A 1 421 ? 43.384 66.152 37.144  1.00 97.11  ? 421 GLY A CA  1 
ATOM   3004 C C   . GLY A 1 421 ? 43.979 67.458 36.661  1.00 97.65  ? 421 GLY A C   1 
ATOM   3005 O O   . GLY A 1 421 ? 43.698 68.501 37.254  1.00 98.25  ? 421 GLY A O   1 
ATOM   3006 N N   . ASN A 1 422 ? 44.786 67.429 35.607  1.00 97.28  ? 422 ASN A N   1 
ATOM   3007 C CA  . ASN A 1 422 ? 45.394 68.658 35.106  1.00 97.01  ? 422 ASN A CA  1 
ATOM   3008 C C   . ASN A 1 422 ? 44.357 69.625 34.542  1.00 96.23  ? 422 ASN A C   1 
ATOM   3009 O O   . ASN A 1 422 ? 43.996 69.530 33.367  1.00 97.27  ? 422 ASN A O   1 
ATOM   3010 C CB  . ASN A 1 422 ? 46.428 68.337 34.020  1.00 97.29  ? 422 ASN A CB  1 
ATOM   3011 N N   . PRO A 1 423 ? 43.859 70.567 35.367  1.00 94.63  ? 423 PRO A N   1 
ATOM   3012 C CA  . PRO A 1 423 ? 42.873 71.474 34.783  1.00 93.14  ? 423 PRO A CA  1 
ATOM   3013 C C   . PRO A 1 423 ? 43.534 72.119 33.574  1.00 92.08  ? 423 PRO A C   1 
ATOM   3014 O O   . PRO A 1 423 ? 44.754 72.303 33.546  1.00 91.47  ? 423 PRO A O   1 
ATOM   3015 C CB  . PRO A 1 423 ? 42.603 72.456 35.911  1.00 93.46  ? 423 PRO A CB  1 
ATOM   3016 C CG  . PRO A 1 423 ? 43.918 72.524 36.603  1.00 93.45  ? 423 PRO A CG  1 
ATOM   3017 C CD  . PRO A 1 423 ? 44.327 71.079 36.666  1.00 93.89  ? 423 PRO A CD  1 
ATOM   3018 N N   . GLY A 1 424 ? 42.730 72.453 32.577  1.00 90.98  ? 424 GLY A N   1 
ATOM   3019 C CA  . GLY A 1 424 ? 43.275 73.024 31.364  1.00 89.23  ? 424 GLY A CA  1 
ATOM   3020 C C   . GLY A 1 424 ? 43.197 71.899 30.357  1.00 86.82  ? 424 GLY A C   1 
ATOM   3021 O O   . GLY A 1 424 ? 42.658 72.064 29.258  1.00 87.55  ? 424 GLY A O   1 
ATOM   3022 N N   . TYR A 1 425 ? 43.750 70.749 30.743  1.00 83.24  ? 425 TYR A N   1 
ATOM   3023 C CA  . TYR A 1 425 ? 43.705 69.555 29.911  1.00 78.31  ? 425 TYR A CA  1 
ATOM   3024 C C   . TYR A 1 425 ? 42.345 68.953 30.227  1.00 76.07  ? 425 TYR A C   1 
ATOM   3025 O O   . TYR A 1 425 ? 41.624 68.507 29.333  1.00 76.62  ? 425 TYR A O   1 
ATOM   3026 C CB  . TYR A 1 425 ? 44.819 68.572 30.289  1.00 75.79  ? 425 TYR A CB  1 
ATOM   3027 C CG  . TYR A 1 425 ? 46.195 68.945 29.770  1.00 74.57  ? 425 TYR A CG  1 
ATOM   3028 C CD1 . TYR A 1 425 ? 46.381 70.056 28.948  1.00 73.34  ? 425 TYR A CD1 1 
ATOM   3029 C CD2 . TYR A 1 425 ? 47.316 68.191 30.110  1.00 72.98  ? 425 TYR A CD2 1 
ATOM   3030 C CE1 . TYR A 1 425 ? 47.650 70.409 28.481  1.00 71.48  ? 425 TYR A CE1 1 
ATOM   3031 C CE2 . TYR A 1 425 ? 48.586 68.538 29.647  1.00 71.09  ? 425 TYR A CE2 1 
ATOM   3032 C CZ  . TYR A 1 425 ? 48.744 69.645 28.838  1.00 69.92  ? 425 TYR A CZ  1 
ATOM   3033 O OH  . TYR A 1 425 ? 50.000 69.995 28.405  1.00 68.82  ? 425 TYR A OH  1 
ATOM   3034 N N   . GLN A 1 426 ? 41.993 68.972 31.509  1.00 72.66  ? 426 GLN A N   1 
ATOM   3035 C CA  . GLN A 1 426 ? 40.717 68.442 31.955  1.00 70.36  ? 426 GLN A CA  1 
ATOM   3036 C C   . GLN A 1 426 ? 39.649 69.480 31.707  1.00 69.06  ? 426 GLN A C   1 
ATOM   3037 O O   . GLN A 1 426 ? 38.494 69.152 31.464  1.00 66.24  ? 426 GLN A O   1 
ATOM   3038 C CB  . GLN A 1 426 ? 40.766 68.098 33.446  1.00 70.49  ? 426 GLN A CB  1 
ATOM   3039 C CG  . GLN A 1 426 ? 41.802 67.037 33.803  1.00 71.16  ? 426 GLN A CG  1 
ATOM   3040 C CD  . GLN A 1 426 ? 41.864 65.901 32.780  1.00 70.46  ? 426 GLN A CD  1 
ATOM   3041 O OE1 . GLN A 1 426 ? 40.874 65.203 32.543  1.00 67.91  ? 426 GLN A OE1 1 
ATOM   3042 N NE2 . GLN A 1 426 ? 43.034 65.717 32.170  1.00 69.47  ? 426 GLN A NE2 1 
ATOM   3043 N N   . ASN A 1 427 ? 40.054 70.741 31.768  1.00 70.08  ? 427 ASN A N   1 
ATOM   3044 C CA  . ASN A 1 427 ? 39.141 71.850 31.561  1.00 71.19  ? 427 ASN A CA  1 
ATOM   3045 C C   . ASN A 1 427 ? 38.582 71.818 30.150  1.00 71.14  ? 427 ASN A C   1 
ATOM   3046 O O   . ASN A 1 427 ? 37.374 71.802 29.944  1.00 70.69  ? 427 ASN A O   1 
ATOM   3047 C CB  . ASN A 1 427 ? 39.877 73.166 31.786  1.00 74.28  ? 427 ASN A CB  1 
ATOM   3048 C CG  . ASN A 1 427 ? 39.222 74.029 32.849  1.00 75.87  ? 427 ASN A CG  1 
ATOM   3049 O OD1 . ASN A 1 427 ? 39.812 74.309 33.892  1.00 75.36  ? 427 ASN A OD1 1 
ATOM   3050 N ND2 . ASN A 1 427 ? 37.995 74.455 32.585  1.00 77.01  ? 427 ASN A ND2 1 
ATOM   3051 N N   . GLN A 1 428 ? 39.485 71.814 29.182  1.00 71.54  ? 428 GLN A N   1 
ATOM   3052 C CA  . GLN A 1 428 ? 39.137 71.788 27.767  1.00 71.55  ? 428 GLN A CA  1 
ATOM   3053 C C   . GLN A 1 428 ? 38.234 70.619 27.415  1.00 71.04  ? 428 GLN A C   1 
ATOM   3054 O O   . GLN A 1 428 ? 37.199 70.784 26.767  1.00 71.26  ? 428 GLN A O   1 
ATOM   3055 C CB  . GLN A 1 428 ? 40.420 71.691 26.940  1.00 71.05  ? 428 GLN A CB  1 
ATOM   3056 C CG  . GLN A 1 428 ? 40.356 70.716 25.765  1.00 69.95  ? 428 GLN A CG  1 
ATOM   3057 C CD  . GLN A 1 428 ? 41.695 70.561 25.067  1.00 69.41  ? 428 GLN A CD  1 
ATOM   3058 O OE1 . GLN A 1 428 ? 41.924 71.142 24.005  1.00 69.60  ? 428 GLN A OE1 1 
ATOM   3059 N NE2 . GLN A 1 428 ? 42.587 69.775 25.659  1.00 68.26  ? 428 GLN A NE2 1 
ATOM   3060 N N   . GLN A 1 429 ? 38.650 69.432 27.834  1.00 71.54  ? 429 GLN A N   1 
ATOM   3061 C CA  . GLN A 1 429 ? 37.900 68.231 27.541  1.00 72.90  ? 429 GLN A CA  1 
ATOM   3062 C C   . GLN A 1 429 ? 36.510 68.235 28.165  1.00 72.77  ? 429 GLN A C   1 
ATOM   3063 O O   . GLN A 1 429 ? 35.634 67.487 27.726  1.00 72.02  ? 429 GLN A O   1 
ATOM   3064 C CB  . GLN A 1 429 ? 38.678 66.991 27.990  1.00 73.75  ? 429 GLN A CB  1 
ATOM   3065 C CG  . GLN A 1 429 ? 39.858 66.637 27.097  1.00 75.07  ? 429 GLN A CG  1 
ATOM   3066 C CD  . GLN A 1 429 ? 40.189 65.161 27.151  1.00 77.50  ? 429 GLN A CD  1 
ATOM   3067 O OE1 . GLN A 1 429 ? 39.441 64.327 26.631  1.00 78.66  ? 429 GLN A OE1 1 
ATOM   3068 N NE2 . GLN A 1 429 ? 41.308 64.826 27.789  1.00 79.01  ? 429 GLN A NE2 1 
ATOM   3069 N N   . GLN A 1 430 ? 36.300 69.074 29.181  1.00 72.11  ? 430 GLN A N   1 
ATOM   3070 C CA  . GLN A 1 430 ? 34.989 69.151 29.828  1.00 69.84  ? 430 GLN A CA  1 
ATOM   3071 C C   . GLN A 1 430 ? 33.965 69.861 28.932  1.00 68.89  ? 430 GLN A C   1 
ATOM   3072 O O   . GLN A 1 430 ? 32.787 69.492 28.926  1.00 68.74  ? 430 GLN A O   1 
ATOM   3073 C CB  . GLN A 1 430 ? 35.080 69.856 31.194  1.00 68.23  ? 430 GLN A CB  1 
ATOM   3074 C CG  . GLN A 1 430 ? 35.449 68.950 32.380  1.00 65.79  ? 430 GLN A CG  1 
ATOM   3075 C CD  . GLN A 1 430 ? 34.357 67.944 32.739  1.00 65.31  ? 430 GLN A CD  1 
ATOM   3076 O OE1 . GLN A 1 430 ? 34.558 66.737 32.659  1.00 64.38  ? 430 GLN A OE1 1 
ATOM   3077 N NE2 . GLN A 1 430 ? 33.202 68.443 33.138  1.00 64.53  ? 430 GLN A NE2 1 
ATOM   3078 N N   . ILE A 1 431 ? 34.390 70.869 28.174  1.00 66.48  ? 431 ILE A N   1 
ATOM   3079 C CA  . ILE A 1 431 ? 33.442 71.536 27.292  1.00 66.16  ? 431 ILE A CA  1 
ATOM   3080 C C   . ILE A 1 431 ? 33.151 70.600 26.120  1.00 67.31  ? 431 ILE A C   1 
ATOM   3081 O O   . ILE A 1 431 ? 32.059 70.617 25.553  1.00 67.47  ? 431 ILE A O   1 
ATOM   3082 C CB  . ILE A 1 431 ? 33.978 72.857 26.721  1.00 64.75  ? 431 ILE A CB  1 
ATOM   3083 C CG1 . ILE A 1 431 ? 34.459 73.766 27.845  1.00 64.69  ? 431 ILE A CG1 1 
ATOM   3084 C CG2 . ILE A 1 431 ? 32.881 73.553 25.933  1.00 63.21  ? 431 ILE A CG2 1 
ATOM   3085 C CD1 . ILE A 1 431 ? 35.919 73.620 28.131  1.00 65.20  ? 431 ILE A CD1 1 
ATOM   3086 N N   . GLY A 1 432 ? 34.141 69.784 25.763  1.00 67.05  ? 432 GLY A N   1 
ATOM   3087 C CA  . GLY A 1 432 ? 33.971 68.839 24.673  1.00 66.15  ? 432 GLY A CA  1 
ATOM   3088 C C   . GLY A 1 432 ? 33.031 67.728 25.095  1.00 65.70  ? 432 GLY A C   1 
ATOM   3089 O O   . GLY A 1 432 ? 32.138 67.335 24.345  1.00 66.19  ? 432 GLY A O   1 
ATOM   3090 N N   . ARG A 1 433 ? 33.242 67.219 26.306  1.00 64.68  ? 433 ARG A N   1 
ATOM   3091 C CA  . ARG A 1 433 ? 32.405 66.161 26.858  1.00 62.13  ? 433 ARG A CA  1 
ATOM   3092 C C   . ARG A 1 433 ? 30.999 66.698 27.062  1.00 59.34  ? 433 ARG A C   1 
ATOM   3093 O O   . ARG A 1 433 ? 30.044 65.932 27.171  1.00 58.71  ? 433 ARG A O   1 
ATOM   3094 C CB  . ARG A 1 433 ? 32.960 65.679 28.203  1.00 63.84  ? 433 ARG A CB  1 
ATOM   3095 C CG  . ARG A 1 433 ? 32.044 64.700 28.940  1.00 67.11  ? 433 ARG A CG  1 
ATOM   3096 C CD  . ARG A 1 433 ? 32.742 64.086 30.137  1.00 69.01  ? 433 ARG A CD  1 
ATOM   3097 N NE  . ARG A 1 433 ? 34.104 63.699 29.793  1.00 71.30  ? 433 ARG A NE  1 
ATOM   3098 C CZ  . ARG A 1 433 ? 34.900 62.998 30.590  1.00 73.89  ? 433 ARG A CZ  1 
ATOM   3099 N NH1 . ARG A 1 433 ? 34.460 62.607 31.776  1.00 75.80  ? 433 ARG A NH1 1 
ATOM   3100 N NH2 . ARG A 1 433 ? 36.137 62.700 30.208  1.00 75.67  ? 433 ARG A NH2 1 
ATOM   3101 N N   . ALA A 1 434 ? 30.882 68.021 27.114  1.00 55.67  ? 434 ALA A N   1 
ATOM   3102 C CA  . ALA A 1 434 ? 29.594 68.653 27.325  1.00 51.12  ? 434 ALA A CA  1 
ATOM   3103 C C   . ALA A 1 434 ? 28.918 68.938 26.012  1.00 48.36  ? 434 ALA A C   1 
ATOM   3104 O O   . ALA A 1 434 ? 27.699 68.922 25.931  1.00 48.09  ? 434 ALA A O   1 
ATOM   3105 C CB  . ALA A 1 434 ? 29.763 69.942 28.114  1.00 52.83  ? 434 ALA A CB  1 
ATOM   3106 N N   . VAL A 1 435 ? 29.705 69.202 24.978  1.00 47.29  ? 435 VAL A N   1 
ATOM   3107 C CA  . VAL A 1 435 ? 29.124 69.495 23.676  1.00 47.05  ? 435 VAL A CA  1 
ATOM   3108 C C   . VAL A 1 435 ? 28.573 68.223 23.074  1.00 45.94  ? 435 VAL A C   1 
ATOM   3109 O O   . VAL A 1 435 ? 27.430 68.173 22.620  1.00 44.34  ? 435 VAL A O   1 
ATOM   3110 C CB  . VAL A 1 435 ? 30.153 70.082 22.721  1.00 46.54  ? 435 VAL A CB  1 
ATOM   3111 C CG1 . VAL A 1 435 ? 29.548 70.208 21.335  1.00 48.85  ? 435 VAL A CG1 1 
ATOM   3112 C CG2 . VAL A 1 435 ? 30.584 71.443 23.218  1.00 48.56  ? 435 VAL A CG2 1 
ATOM   3113 N N   . GLY A 1 436 ? 29.405 67.193 23.073  1.00 46.10  ? 436 GLY A N   1 
ATOM   3114 C CA  . GLY A 1 436 ? 28.983 65.919 22.545  1.00 47.83  ? 436 GLY A CA  1 
ATOM   3115 C C   . GLY A 1 436 ? 27.737 65.517 23.289  1.00 48.02  ? 436 GLY A C   1 
ATOM   3116 O O   . GLY A 1 436 ? 26.736 65.130 22.691  1.00 50.06  ? 436 GLY A O   1 
ATOM   3117 N N   . ASP A 1 437 ? 27.805 65.639 24.608  1.00 47.65  ? 437 ASP A N   1 
ATOM   3118 C CA  . ASP A 1 437 ? 26.691 65.307 25.480  1.00 46.73  ? 437 ASP A CA  1 
ATOM   3119 C C   . ASP A 1 437 ? 25.393 66.047 25.164  1.00 45.51  ? 437 ASP A C   1 
ATOM   3120 O O   . ASP A 1 437 ? 24.359 65.425 24.969  1.00 44.21  ? 437 ASP A O   1 
ATOM   3121 C CB  . ASP A 1 437 ? 27.083 65.568 26.933  1.00 46.65  ? 437 ASP A CB  1 
ATOM   3122 C CG  . ASP A 1 437 ? 27.797 64.390 27.557  1.00 49.58  ? 437 ASP A CG  1 
ATOM   3123 O OD1 . ASP A 1 437 ? 28.167 63.454 26.809  1.00 49.43  ? 437 ASP A OD1 1 
ATOM   3124 O OD2 . ASP A 1 437 ? 27.990 64.400 28.792  1.00 50.37  ? 437 ASP A OD2 1 
ATOM   3125 N N   . HIS A 1 438 ? 25.439 67.369 25.101  1.00 45.49  ? 438 HIS A N   1 
ATOM   3126 C CA  . HIS A 1 438 ? 24.217 68.120 24.849  1.00 47.04  ? 438 HIS A CA  1 
ATOM   3127 C C   . HIS A 1 438 ? 23.594 67.976 23.479  1.00 47.83  ? 438 HIS A C   1 
ATOM   3128 O O   . HIS A 1 438 ? 22.378 67.851 23.357  1.00 49.34  ? 438 HIS A O   1 
ATOM   3129 C CB  . HIS A 1 438 ? 24.416 69.616 25.075  1.00 45.58  ? 438 HIS A CB  1 
ATOM   3130 C CG  . HIS A 1 438 ? 23.183 70.417 24.808  1.00 44.51  ? 438 HIS A CG  1 
ATOM   3131 N ND1 . HIS A 1 438 ? 23.201 71.628 24.155  1.00 46.93  ? 438 HIS A ND1 1 
ATOM   3132 C CD2 . HIS A 1 438 ? 21.882 70.180 25.114  1.00 46.44  ? 438 HIS A CD2 1 
ATOM   3133 C CE1 . HIS A 1 438 ? 21.972 72.105 24.071  1.00 46.63  ? 438 HIS A CE1 1 
ATOM   3134 N NE2 . HIS A 1 438 ? 21.153 71.242 24.647  1.00 44.42  ? 438 HIS A NE2 1 
ATOM   3135 N N   . PHE A 1 439 ? 24.418 68.019 22.443  1.00 48.41  ? 439 PHE A N   1 
ATOM   3136 C CA  . PHE A 1 439 ? 23.888 67.963 21.096  1.00 47.08  ? 439 PHE A CA  1 
ATOM   3137 C C   . PHE A 1 439 ? 23.722 66.601 20.472  1.00 47.26  ? 439 PHE A C   1 
ATOM   3138 O O   . PHE A 1 439 ? 22.888 66.430 19.589  1.00 47.18  ? 439 PHE A O   1 
ATOM   3139 C CB  . PHE A 1 439 ? 24.738 68.829 20.184  1.00 46.35  ? 439 PHE A CB  1 
ATOM   3140 C CG  . PHE A 1 439 ? 24.717 70.278 20.546  1.00 46.12  ? 439 PHE A CG  1 
ATOM   3141 C CD1 . PHE A 1 439 ? 23.763 71.123 19.997  1.00 41.90  ? 439 PHE A CD1 1 
ATOM   3142 C CD2 . PHE A 1 439 ? 25.646 70.799 21.438  1.00 45.42  ? 439 PHE A CD2 1 
ATOM   3143 C CE1 . PHE A 1 439 ? 23.732 72.453 20.321  1.00 41.88  ? 439 PHE A CE1 1 
ATOM   3144 C CE2 . PHE A 1 439 ? 25.617 72.136 21.766  1.00 45.35  ? 439 PHE A CE2 1 
ATOM   3145 C CZ  . PHE A 1 439 ? 24.657 72.965 21.205  1.00 43.65  ? 439 PHE A CZ  1 
ATOM   3146 N N   . PHE A 1 440 ? 24.496 65.626 20.919  1.00 45.90  ? 440 PHE A N   1 
ATOM   3147 C CA  . PHE A 1 440 ? 24.372 64.319 20.322  1.00 46.65  ? 440 PHE A CA  1 
ATOM   3148 C C   . PHE A 1 440 ? 24.106 63.163 21.274  1.00 47.85  ? 440 PHE A C   1 
ATOM   3149 O O   . PHE A 1 440 ? 22.987 62.665 21.334  1.00 50.51  ? 440 PHE A O   1 
ATOM   3150 C CB  . PHE A 1 440 ? 25.611 64.027 19.481  1.00 47.64  ? 440 PHE A CB  1 
ATOM   3151 C CG  . PHE A 1 440 ? 26.018 65.167 18.584  1.00 47.24  ? 440 PHE A CG  1 
ATOM   3152 C CD1 . PHE A 1 440 ? 26.843 66.177 19.057  1.00 46.96  ? 440 PHE A CD1 1 
ATOM   3153 C CD2 . PHE A 1 440 ? 25.581 65.225 17.268  1.00 45.87  ? 440 PHE A CD2 1 
ATOM   3154 C CE1 . PHE A 1 440 ? 27.229 67.223 18.236  1.00 46.17  ? 440 PHE A CE1 1 
ATOM   3155 C CE2 . PHE A 1 440 ? 25.963 66.270 16.442  1.00 47.54  ? 440 PHE A CE2 1 
ATOM   3156 C CZ  . PHE A 1 440 ? 26.790 67.269 16.929  1.00 46.47  ? 440 PHE A CZ  1 
ATOM   3157 N N   . THR A 1 441 ? 25.120 62.734 22.017  1.00 46.30  ? 441 THR A N   1 
ATOM   3158 C CA  . THR A 1 441 ? 24.963 61.609 22.922  1.00 46.62  ? 441 THR A CA  1 
ATOM   3159 C C   . THR A 1 441 ? 23.656 61.565 23.720  1.00 48.74  ? 441 THR A C   1 
ATOM   3160 O O   . THR A 1 441 ? 22.963 60.547 23.703  1.00 48.24  ? 441 THR A O   1 
ATOM   3161 C CB  . THR A 1 441 ? 26.150 61.499 23.918  1.00 47.03  ? 441 THR A CB  1 
ATOM   3162 O OG1 . THR A 1 441 ? 27.377 61.286 23.199  1.00 49.71  ? 441 THR A OG1 1 
ATOM   3163 C CG2 . THR A 1 441 ? 25.932 60.322 24.863  1.00 41.97  ? 441 THR A CG2 1 
ATOM   3164 N N   . CYS A 1 442 ? 23.304 62.650 24.408  1.00 49.59  ? 442 CYS A N   1 
ATOM   3165 C CA  . CYS A 1 442 ? 22.082 62.659 25.225  1.00 48.73  ? 442 CYS A CA  1 
ATOM   3166 C C   . CYS A 1 442 ? 20.774 62.808 24.477  1.00 48.56  ? 442 CYS A C   1 
ATOM   3167 O O   . CYS A 1 442 ? 19.760 62.222 24.880  1.00 47.37  ? 442 CYS A O   1 
ATOM   3168 C CB  . CYS A 1 442 ? 22.201 63.698 26.325  1.00 48.36  ? 442 CYS A CB  1 
ATOM   3169 S SG  . CYS A 1 442 ? 23.472 63.118 27.477  1.00 47.55  ? 442 CYS A SG  1 
ATOM   3170 N N   . PRO A 1 443 ? 20.758 63.631 23.414  1.00 48.09  ? 443 PRO A N   1 
ATOM   3171 C CA  . PRO A 1 443 ? 19.508 63.759 22.664  1.00 48.02  ? 443 PRO A CA  1 
ATOM   3172 C C   . PRO A 1 443 ? 19.207 62.349 22.101  1.00 46.49  ? 443 PRO A C   1 
ATOM   3173 O O   . PRO A 1 443 ? 18.125 61.796 22.310  1.00 45.83  ? 443 PRO A O   1 
ATOM   3174 C CB  . PRO A 1 443 ? 19.871 64.767 21.571  1.00 47.82  ? 443 PRO A CB  1 
ATOM   3175 C CG  . PRO A 1 443 ? 20.835 65.666 22.262  1.00 47.11  ? 443 PRO A CG  1 
ATOM   3176 C CD  . PRO A 1 443 ? 21.704 64.701 23.045  1.00 48.36  ? 443 PRO A CD  1 
ATOM   3177 N N   . THR A 1 444 ? 20.194 61.764 21.422  1.00 43.88  ? 444 THR A N   1 
ATOM   3178 C CA  . THR A 1 444 ? 20.044 60.435 20.859  1.00 43.10  ? 444 THR A CA  1 
ATOM   3179 C C   . THR A 1 444 ? 19.716 59.426 21.955  1.00 43.21  ? 444 THR A C   1 
ATOM   3180 O O   . THR A 1 444 ? 19.126 58.388 21.687  1.00 44.87  ? 444 THR A O   1 
ATOM   3181 C CB  . THR A 1 444 ? 21.328 59.965 20.105  1.00 43.64  ? 444 THR A CB  1 
ATOM   3182 O OG1 . THR A 1 444 ? 22.360 59.655 21.041  1.00 44.90  ? 444 THR A OG1 1 
ATOM   3183 C CG2 . THR A 1 444 ? 21.831 61.046 19.159  1.00 42.68  ? 444 THR A CG2 1 
ATOM   3184 N N   . ASN A 1 445 ? 20.093 59.729 23.192  1.00 44.75  ? 445 ASN A N   1 
ATOM   3185 C CA  . ASN A 1 445 ? 19.811 58.832 24.316  1.00 45.88  ? 445 ASN A CA  1 
ATOM   3186 C C   . ASN A 1 445 ? 18.331 58.984 24.641  1.00 46.64  ? 445 ASN A C   1 
ATOM   3187 O O   . ASN A 1 445 ? 17.630 58.014 24.938  1.00 47.33  ? 445 ASN A O   1 
ATOM   3188 C CB  . ASN A 1 445 ? 20.660 59.215 25.547  1.00 46.01  ? 445 ASN A CB  1 
ATOM   3189 C CG  . ASN A 1 445 ? 20.664 58.128 26.643  1.00 47.75  ? 445 ASN A CG  1 
ATOM   3190 O OD1 . ASN A 1 445 ? 20.971 56.954 26.389  1.00 46.22  ? 445 ASN A OD1 1 
ATOM   3191 N ND2 . ASN A 1 445 ? 20.339 58.529 27.870  1.00 47.83  ? 445 ASN A ND2 1 
ATOM   3192 N N   . GLU A 1 446 ? 17.855 60.217 24.563  1.00 46.27  ? 446 GLU A N   1 
ATOM   3193 C CA  . GLU A 1 446 ? 16.463 60.493 24.849  1.00 45.99  ? 446 GLU A CA  1 
ATOM   3194 C C   . GLU A 1 446 ? 15.587 59.852 23.779  1.00 42.91  ? 446 GLU A C   1 
ATOM   3195 O O   . GLU A 1 446 ? 14.588 59.203 24.089  1.00 39.54  ? 446 GLU A O   1 
ATOM   3196 C CB  . GLU A 1 446 ? 16.225 62.006 24.877  1.00 49.49  ? 446 GLU A CB  1 
ATOM   3197 C CG  . GLU A 1 446 ? 14.949 62.419 25.594  1.00 55.28  ? 446 GLU A CG  1 
ATOM   3198 C CD  . GLU A 1 446 ? 14.566 63.863 25.319  1.00 60.19  ? 446 GLU A CD  1 
ATOM   3199 O OE1 . GLU A 1 446 ? 14.858 64.373 24.212  1.00 60.66  ? 446 GLU A OE1 1 
ATOM   3200 O OE2 . GLU A 1 446 ? 13.960 64.486 26.215  1.00 64.62  ? 446 GLU A OE2 1 
ATOM   3201 N N   . TYR A 1 447 ? 15.975 60.033 22.519  1.00 41.85  ? 447 TYR A N   1 
ATOM   3202 C CA  . TYR A 1 447 ? 15.211 59.493 21.406  1.00 40.67  ? 447 TYR A CA  1 
ATOM   3203 C C   . TYR A 1 447 ? 15.193 57.975 21.472  1.00 42.07  ? 447 TYR A C   1 
ATOM   3204 O O   . TYR A 1 447 ? 14.143 57.341 21.318  1.00 40.00  ? 447 TYR A O   1 
ATOM   3205 C CB  . TYR A 1 447 ? 15.797 59.952 20.071  1.00 38.74  ? 447 TYR A CB  1 
ATOM   3206 C CG  . TYR A 1 447 ? 14.751 60.007 18.984  1.00 40.60  ? 447 TYR A CG  1 
ATOM   3207 C CD1 . TYR A 1 447 ? 13.600 60.777 19.150  1.00 42.88  ? 447 TYR A CD1 1 
ATOM   3208 C CD2 . TYR A 1 447 ? 14.876 59.259 17.817  1.00 38.94  ? 447 TYR A CD2 1 
ATOM   3209 C CE1 . TYR A 1 447 ? 12.594 60.793 18.190  1.00 42.45  ? 447 TYR A CE1 1 
ATOM   3210 C CE2 . TYR A 1 447 ? 13.875 59.274 16.844  1.00 39.68  ? 447 TYR A CE2 1 
ATOM   3211 C CZ  . TYR A 1 447 ? 12.732 60.039 17.044  1.00 41.22  ? 447 TYR A CZ  1 
ATOM   3212 O OH  . TYR A 1 447 ? 11.703 60.019 16.131  1.00 40.97  ? 447 TYR A OH  1 
ATOM   3213 N N   . ALA A 1 448 ? 16.362 57.387 21.703  1.00 42.41  ? 448 ALA A N   1 
ATOM   3214 C CA  . ALA A 1 448 ? 16.439 55.943 21.801  1.00 41.06  ? 448 ALA A CA  1 
ATOM   3215 C C   . ALA A 1 448 ? 15.374 55.505 22.803  1.00 39.68  ? 448 ALA A C   1 
ATOM   3216 O O   . ALA A 1 448 ? 14.554 54.647 22.507  1.00 38.48  ? 448 ALA A O   1 
ATOM   3217 C CB  . ALA A 1 448 ? 17.809 55.528 22.266  1.00 40.83  ? 448 ALA A CB  1 
ATOM   3218 N N   . GLN A 1 449 ? 15.377 56.120 23.982  1.00 39.59  ? 449 GLN A N   1 
ATOM   3219 C CA  . GLN A 1 449 ? 14.403 55.776 25.001  1.00 38.37  ? 449 GLN A CA  1 
ATOM   3220 C C   . GLN A 1 449 ? 12.980 55.913 24.462  1.00 38.61  ? 449 GLN A C   1 
ATOM   3221 O O   . GLN A 1 449 ? 12.200 54.954 24.495  1.00 38.56  ? 449 GLN A O   1 
ATOM   3222 C CB  . GLN A 1 449 ? 14.614 56.640 26.242  1.00 38.25  ? 449 GLN A CB  1 
ATOM   3223 C CG  . GLN A 1 449 ? 16.022 56.478 26.844  1.00 42.05  ? 449 GLN A CG  1 
ATOM   3224 C CD  . GLN A 1 449 ? 16.176 57.003 28.285  1.00 42.44  ? 449 GLN A CD  1 
ATOM   3225 O OE1 . GLN A 1 449 ? 15.284 56.810 29.121  1.00 45.44  ? 449 GLN A OE1 1 
ATOM   3226 N NE2 . GLN A 1 449 ? 17.288 57.681 28.568  1.00 38.67  ? 449 GLN A NE2 1 
ATOM   3227 N N   . ALA A 1 450 ? 12.644 57.087 23.940  1.00 36.52  ? 450 ALA A N   1 
ATOM   3228 C CA  . ALA A 1 450 ? 11.304 57.295 23.392  1.00 35.58  ? 450 ALA A CA  1 
ATOM   3229 C C   . ALA A 1 450 ? 10.947 56.199 22.386  1.00 35.83  ? 450 ALA A C   1 
ATOM   3230 O O   . ALA A 1 450 ? 9.823  55.684 22.391  1.00 37.00  ? 450 ALA A O   1 
ATOM   3231 C CB  . ALA A 1 450 ? 11.208 58.664 22.730  1.00 30.28  ? 450 ALA A CB  1 
ATOM   3232 N N   . LEU A 1 451 ? 11.908 55.849 21.531  1.00 34.67  ? 451 LEU A N   1 
ATOM   3233 C CA  . LEU A 1 451 ? 11.710 54.821 20.513  1.00 33.90  ? 451 LEU A CA  1 
ATOM   3234 C C   . LEU A 1 451 ? 11.306 53.494 21.104  1.00 36.06  ? 451 LEU A C   1 
ATOM   3235 O O   . LEU A 1 451 ? 10.326 52.876 20.670  1.00 36.89  ? 451 LEU A O   1 
ATOM   3236 C CB  . LEU A 1 451 ? 12.978 54.608 19.708  1.00 30.94  ? 451 LEU A CB  1 
ATOM   3237 C CG  . LEU A 1 451 ? 13.067 55.312 18.369  1.00 29.01  ? 451 LEU A CG  1 
ATOM   3238 C CD1 . LEU A 1 451 ? 12.531 56.709 18.483  1.00 30.44  ? 451 LEU A CD1 1 
ATOM   3239 C CD2 . LEU A 1 451 ? 14.505 55.311 17.926  1.00 27.58  ? 451 LEU A CD2 1 
ATOM   3240 N N   . ALA A 1 452 ? 12.077 53.048 22.086  1.00 36.00  ? 452 ALA A N   1 
ATOM   3241 C CA  . ALA A 1 452 ? 11.792 51.786 22.723  1.00 37.34  ? 452 ALA A CA  1 
ATOM   3242 C C   . ALA A 1 452 ? 10.403 51.854 23.367  1.00 38.61  ? 452 ALA A C   1 
ATOM   3243 O O   . ALA A 1 452 ? 9.589  50.938 23.211  1.00 39.70  ? 452 ALA A O   1 
ATOM   3244 C CB  . ALA A 1 452 ? 12.854 51.486 23.757  1.00 38.08  ? 452 ALA A CB  1 
ATOM   3245 N N   A GLU A 1 453 ? 10.133 52.938 24.082  0.50 37.66  ? 453 GLU A N   1 
ATOM   3246 N N   B GLU A 1 453 ? 10.133 52.937 24.082  0.50 39.00  ? 453 GLU A N   1 
ATOM   3247 C CA  A GLU A 1 453 ? 8.842  53.109 24.739  0.50 37.59  ? 453 GLU A CA  1 
ATOM   3248 C CA  B GLU A 1 453 ? 8.844  53.092 24.728  0.50 40.01  ? 453 GLU A CA  1 
ATOM   3249 C C   A GLU A 1 453 ? 7.714  52.871 23.747  0.50 38.35  ? 453 GLU A C   1 
ATOM   3250 C C   B GLU A 1 453 ? 7.710  52.864 23.742  0.50 39.82  ? 453 GLU A C   1 
ATOM   3251 O O   A GLU A 1 453 ? 6.716  52.221 24.075  0.50 39.25  ? 453 GLU A O   1 
ATOM   3252 O O   B GLU A 1 453 ? 6.715  52.214 24.067  0.50 40.56  ? 453 GLU A O   1 
ATOM   3253 C CB  A GLU A 1 453 ? 8.728  54.515 25.330  0.50 36.46  ? 453 GLU A CB  1 
ATOM   3254 C CB  B GLU A 1 453 ? 8.719  54.481 25.343  0.50 41.58  ? 453 GLU A CB  1 
ATOM   3255 C CG  A GLU A 1 453 ? 9.589  54.746 26.560  0.50 36.31  ? 453 GLU A CG  1 
ATOM   3256 C CG  B GLU A 1 453 ? 9.334  54.589 26.713  0.50 46.26  ? 453 GLU A CG  1 
ATOM   3257 C CD  A GLU A 1 453 ? 9.109  53.969 27.789  0.50 38.18  ? 453 GLU A CD  1 
ATOM   3258 C CD  B GLU A 1 453 ? 8.775  55.758 27.482  0.50 49.91  ? 453 GLU A CD  1 
ATOM   3259 O OE1 A GLU A 1 453 ? 8.110  53.218 27.686  0.50 37.68  ? 453 GLU A OE1 1 
ATOM   3260 O OE1 B GLU A 1 453 ? 7.595  56.089 27.238  0.50 52.70  ? 453 GLU A OE1 1 
ATOM   3261 O OE2 A GLU A 1 453 ? 9.734  54.110 28.867  0.50 36.87  ? 453 GLU A OE2 1 
ATOM   3262 O OE2 B GLU A 1 453 ? 9.495  56.330 28.328  0.50 51.63  ? 453 GLU A OE2 1 
ATOM   3263 N N   . ARG A 1 454 ? 7.864  53.393 22.536  1.00 38.51  ? 454 ARG A N   1 
ATOM   3264 C CA  . ARG A 1 454 ? 6.841  53.237 21.511  1.00 38.19  ? 454 ARG A CA  1 
ATOM   3265 C C   . ARG A 1 454 ? 6.889  51.875 20.843  1.00 36.78  ? 454 ARG A C   1 
ATOM   3266 O O   . ARG A 1 454 ? 6.291  51.660 19.792  1.00 34.64  ? 454 ARG A O   1 
ATOM   3267 C CB  . ARG A 1 454 ? 6.969  54.353 20.478  1.00 39.30  ? 454 ARG A CB  1 
ATOM   3268 C CG  . ARG A 1 454 ? 6.455  55.691 20.992  1.00 39.29  ? 454 ARG A CG  1 
ATOM   3269 C CD  . ARG A 1 454 ? 4.951  55.654 21.098  1.00 39.42  ? 454 ARG A CD  1 
ATOM   3270 N NE  . ARG A 1 454 ? 4.455  55.763 22.464  1.00 44.98  ? 454 ARG A NE  1 
ATOM   3271 C CZ  . ARG A 1 454 ? 3.163  55.710 22.787  1.00 45.37  ? 454 ARG A CZ  1 
ATOM   3272 N NH1 . ARG A 1 454 ? 2.257  55.548 21.834  1.00 46.79  ? 454 ARG A NH1 1 
ATOM   3273 N NH2 . ARG A 1 454 ? 2.772  55.819 24.053  1.00 43.67  ? 454 ARG A NH2 1 
ATOM   3274 N N   . GLY A 1 455 ? 7.618  50.957 21.462  1.00 37.37  ? 455 GLY A N   1 
ATOM   3275 C CA  . GLY A 1 455 ? 7.700  49.611 20.941  1.00 38.62  ? 455 GLY A CA  1 
ATOM   3276 C C   . GLY A 1 455 ? 8.823  49.255 19.992  1.00 39.42  ? 455 GLY A C   1 
ATOM   3277 O O   . GLY A 1 455 ? 9.012  48.072 19.704  1.00 42.15  ? 455 GLY A O   1 
ATOM   3278 N N   . ALA A 1 456 ? 9.570  50.238 19.500  1.00 36.74  ? 456 ALA A N   1 
ATOM   3279 C CA  . ALA A 1 456 ? 10.654 49.936 18.572  1.00 35.92  ? 456 ALA A CA  1 
ATOM   3280 C C   . ALA A 1 456 ? 11.716 49.051 19.218  1.00 35.19  ? 456 ALA A C   1 
ATOM   3281 O O   . ALA A 1 456 ? 12.039 49.223 20.385  1.00 37.32  ? 456 ALA A O   1 
ATOM   3282 C CB  . ALA A 1 456 ? 11.291 51.225 18.083  1.00 36.47  ? 456 ALA A CB  1 
ATOM   3283 N N   . SER A 1 457 ? 12.241 48.085 18.477  1.00 33.05  ? 457 SER A N   1 
ATOM   3284 C CA  . SER A 1 457 ? 13.301 47.244 19.025  1.00 33.20  ? 457 SER A CA  1 
ATOM   3285 C C   . SER A 1 457 ? 14.578 48.053 18.877  1.00 30.93  ? 457 SER A C   1 
ATOM   3286 O O   . SER A 1 457 ? 15.053 48.265 17.757  1.00 30.27  ? 457 SER A O   1 
ATOM   3287 C CB  . SER A 1 457 ? 13.457 45.954 18.234  1.00 31.93  ? 457 SER A CB  1 
ATOM   3288 O OG  . SER A 1 457 ? 14.797 45.516 18.339  1.00 32.25  ? 457 SER A OG  1 
ATOM   3289 N N   . VAL A 1 458 ? 15.147 48.491 19.991  1.00 27.82  ? 458 VAL A N   1 
ATOM   3290 C CA  . VAL A 1 458 ? 16.333 49.321 19.904  1.00 29.64  ? 458 VAL A CA  1 
ATOM   3291 C C   . VAL A 1 458 ? 17.630 48.774 20.440  1.00 29.27  ? 458 VAL A C   1 
ATOM   3292 O O   . VAL A 1 458 ? 17.712 48.284 21.561  1.00 32.37  ? 458 VAL A O   1 
ATOM   3293 C CB  . VAL A 1 458 ? 16.085 50.698 20.580  1.00 31.32  ? 458 VAL A CB  1 
ATOM   3294 C CG1 . VAL A 1 458 ? 17.406 51.422 20.830  1.00 31.66  ? 458 VAL A CG1 1 
ATOM   3295 C CG2 . VAL A 1 458 ? 15.188 51.558 19.694  1.00 32.56  ? 458 VAL A CG2 1 
ATOM   3296 N N   . HIS A 1 459 ? 18.659 48.859 19.619  1.00 29.88  ? 459 HIS A N   1 
ATOM   3297 C CA  . HIS A 1 459 ? 19.971 48.452 20.057  1.00 32.55  ? 459 HIS A CA  1 
ATOM   3298 C C   . HIS A 1 459 ? 20.865 49.667 20.047  1.00 33.67  ? 459 HIS A C   1 
ATOM   3299 O O   . HIS A 1 459 ? 21.042 50.340 19.030  1.00 35.87  ? 459 HIS A O   1 
ATOM   3300 C CB  . HIS A 1 459 ? 20.523 47.348 19.190  1.00 32.95  ? 459 HIS A CB  1 
ATOM   3301 C CG  . HIS A 1 459 ? 19.912 46.026 19.504  1.00 37.34  ? 459 HIS A CG  1 
ATOM   3302 N ND1 . HIS A 1 459 ? 18.701 45.636 18.980  1.00 42.82  ? 459 HIS A ND1 1 
ATOM   3303 C CD2 . HIS A 1 459 ? 20.301 45.053 20.349  1.00 39.74  ? 459 HIS A CD2 1 
ATOM   3304 C CE1 . HIS A 1 459 ? 18.369 44.463 19.494  1.00 43.28  ? 459 HIS A CE1 1 
ATOM   3305 N NE2 . HIS A 1 459 ? 19.316 44.086 20.326  1.00 43.90  ? 459 HIS A NE2 1 
ATOM   3306 N N   . TYR A 1 460 ? 21.403 49.958 21.215  1.00 33.98  ? 460 TYR A N   1 
ATOM   3307 C CA  . TYR A 1 460 ? 22.264 51.106 21.400  1.00 34.01  ? 460 TYR A CA  1 
ATOM   3308 C C   . TYR A 1 460 ? 23.724 50.664 21.406  1.00 33.14  ? 460 TYR A C   1 
ATOM   3309 O O   . TYR A 1 460 ? 24.043 49.595 21.928  1.00 31.64  ? 460 TYR A O   1 
ATOM   3310 C CB  . TYR A 1 460 ? 21.915 51.748 22.733  1.00 33.00  ? 460 TYR A CB  1 
ATOM   3311 C CG  . TYR A 1 460 ? 22.186 53.215 22.776  1.00 33.93  ? 460 TYR A CG  1 
ATOM   3312 C CD1 . TYR A 1 460 ? 23.485 53.701 22.727  1.00 32.13  ? 460 TYR A CD1 1 
ATOM   3313 C CD2 . TYR A 1 460 ? 21.138 54.124 22.847  1.00 32.38  ? 460 TYR A CD2 1 
ATOM   3314 C CE1 . TYR A 1 460 ? 23.725 55.053 22.735  1.00 35.92  ? 460 TYR A CE1 1 
ATOM   3315 C CE2 . TYR A 1 460 ? 21.370 55.468 22.858  1.00 35.26  ? 460 TYR A CE2 1 
ATOM   3316 C CZ  . TYR A 1 460 ? 22.660 55.931 22.799  1.00 35.38  ? 460 TYR A CZ  1 
ATOM   3317 O OH  . TYR A 1 460 ? 22.883 57.275 22.740  1.00 36.20  ? 460 TYR A OH  1 
ATOM   3318 N N   . TYR A 1 461 ? 24.599 51.488 20.838  1.00 33.43  ? 461 TYR A N   1 
ATOM   3319 C CA  . TYR A 1 461 ? 26.030 51.184 20.798  1.00 34.80  ? 461 TYR A CA  1 
ATOM   3320 C C   . TYR A 1 461 ? 26.801 52.445 21.177  1.00 37.62  ? 461 TYR A C   1 
ATOM   3321 O O   . TYR A 1 461 ? 26.346 53.551 20.898  1.00 36.20  ? 461 TYR A O   1 
ATOM   3322 C CB  . TYR A 1 461 ? 26.461 50.733 19.377  1.00 33.63  ? 461 TYR A CB  1 
ATOM   3323 C CG  . TYR A 1 461 ? 26.558 51.859 18.340  1.00 32.83  ? 461 TYR A CG  1 
ATOM   3324 C CD1 . TYR A 1 461 ? 27.455 52.916 18.517  1.00 33.89  ? 461 TYR A CD1 1 
ATOM   3325 C CD2 . TYR A 1 461 ? 25.690 51.926 17.250  1.00 30.66  ? 461 TYR A CD2 1 
ATOM   3326 C CE1 . TYR A 1 461 ? 27.480 54.009 17.665  1.00 31.05  ? 461 TYR A CE1 1 
ATOM   3327 C CE2 . TYR A 1 461 ? 25.711 53.035 16.377  1.00 29.97  ? 461 TYR A CE2 1 
ATOM   3328 C CZ  . TYR A 1 461 ? 26.610 54.074 16.607  1.00 29.85  ? 461 TYR A CZ  1 
ATOM   3329 O OH  . TYR A 1 461 ? 26.635 55.217 15.834  1.00 27.54  ? 461 TYR A OH  1 
ATOM   3330 N N   . TYR A 1 462 ? 27.959 52.286 21.816  1.00 42.02  ? 462 TYR A N   1 
ATOM   3331 C CA  . TYR A 1 462 ? 28.809 53.435 22.162  1.00 43.63  ? 462 TYR A CA  1 
ATOM   3332 C C   . TYR A 1 462 ? 30.209 53.133 21.612  1.00 46.03  ? 462 TYR A C   1 
ATOM   3333 O O   . TYR A 1 462 ? 30.834 52.129 21.985  1.00 46.84  ? 462 TYR A O   1 
ATOM   3334 C CB  . TYR A 1 462 ? 28.859 53.655 23.679  1.00 42.81  ? 462 TYR A CB  1 
ATOM   3335 C CG  . TYR A 1 462 ? 29.350 55.040 24.097  1.00 41.75  ? 462 TYR A CG  1 
ATOM   3336 C CD1 . TYR A 1 462 ? 28.948 56.182 23.407  1.00 39.28  ? 462 TYR A CD1 1 
ATOM   3337 C CD2 . TYR A 1 462 ? 30.187 55.209 25.200  1.00 40.36  ? 462 TYR A CD2 1 
ATOM   3338 C CE1 . TYR A 1 462 ? 29.366 57.450 23.799  1.00 37.15  ? 462 TYR A CE1 1 
ATOM   3339 C CE2 . TYR A 1 462 ? 30.606 56.474 25.600  1.00 38.28  ? 462 TYR A CE2 1 
ATOM   3340 C CZ  . TYR A 1 462 ? 30.193 57.587 24.894  1.00 38.11  ? 462 TYR A CZ  1 
ATOM   3341 O OH  . TYR A 1 462 ? 30.603 58.844 25.282  1.00 38.44  ? 462 TYR A OH  1 
ATOM   3342 N N   . PHE A 1 463 ? 30.674 54.001 20.714  1.00 47.31  ? 463 PHE A N   1 
ATOM   3343 C CA  . PHE A 1 463 ? 31.972 53.871 20.033  1.00 49.60  ? 463 PHE A CA  1 
ATOM   3344 C C   . PHE A 1 463 ? 33.070 54.718 20.678  1.00 51.77  ? 463 PHE A C   1 
ATOM   3345 O O   . PHE A 1 463 ? 33.154 55.921 20.439  1.00 48.50  ? 463 PHE A O   1 
ATOM   3346 C CB  . PHE A 1 463 ? 31.799 54.288 18.565  1.00 48.34  ? 463 PHE A CB  1 
ATOM   3347 C CG  . PHE A 1 463 ? 33.064 54.257 17.758  1.00 45.19  ? 463 PHE A CG  1 
ATOM   3348 C CD1 . PHE A 1 463 ? 33.725 53.055 17.502  1.00 43.02  ? 463 PHE A CD1 1 
ATOM   3349 C CD2 . PHE A 1 463 ? 33.595 55.432 17.242  1.00 44.36  ? 463 PHE A CD2 1 
ATOM   3350 C CE1 . PHE A 1 463 ? 34.892 53.031 16.745  1.00 38.96  ? 463 PHE A CE1 1 
ATOM   3351 C CE2 . PHE A 1 463 ? 34.766 55.412 16.484  1.00 41.29  ? 463 PHE A CE2 1 
ATOM   3352 C CZ  . PHE A 1 463 ? 35.411 54.214 16.238  1.00 38.90  ? 463 PHE A CZ  1 
ATOM   3353 N N   . THR A 1 464 ? 33.924 54.073 21.466  1.00 56.34  ? 464 THR A N   1 
ATOM   3354 C CA  . THR A 1 464 ? 35.011 54.750 22.187  1.00 62.40  ? 464 THR A CA  1 
ATOM   3355 C C   . THR A 1 464 ? 36.462 54.366 21.795  1.00 65.84  ? 464 THR A C   1 
ATOM   3356 O O   . THR A 1 464 ? 37.382 54.477 22.617  1.00 67.20  ? 464 THR A O   1 
ATOM   3357 C CB  . THR A 1 464 ? 34.831 54.537 23.728  1.00 62.21  ? 464 THR A CB  1 
ATOM   3358 O OG1 . THR A 1 464 ? 35.974 53.872 24.277  1.00 64.18  ? 464 THR A OG1 1 
ATOM   3359 C CG2 . THR A 1 464 ? 33.602 53.683 24.010  1.00 63.84  ? 464 THR A CG2 1 
ATOM   3360 N N   . HIS A 1 465 ? 36.679 53.941 20.547  1.00 68.12  ? 465 HIS A N   1 
ATOM   3361 C CA  . HIS A 1 465 ? 38.019 53.546 20.107  1.00 68.67  ? 465 HIS A CA  1 
ATOM   3362 C C   . HIS A 1 465 ? 38.628 54.552 19.155  1.00 69.15  ? 465 HIS A C   1 
ATOM   3363 O O   . HIS A 1 465 ? 38.026 54.914 18.146  1.00 69.35  ? 465 HIS A O   1 
ATOM   3364 C CB  . HIS A 1 465 ? 37.985 52.179 19.420  1.00 70.01  ? 465 HIS A CB  1 
ATOM   3365 C CG  . HIS A 1 465 ? 39.346 51.607 19.156  1.00 71.65  ? 465 HIS A CG  1 
ATOM   3366 N ND1 . HIS A 1 465 ? 40.230 52.179 18.277  1.00 72.27  ? 465 HIS A ND1 1 
ATOM   3367 C CD2 . HIS A 1 465 ? 39.981 50.545 19.708  1.00 71.95  ? 465 HIS A CD2 1 
ATOM   3368 C CE1 . HIS A 1 465 ? 41.368 51.494 18.295  1.00 72.16  ? 465 HIS A CE1 1 
ATOM   3369 N NE2 . HIS A 1 465 ? 41.238 50.504 19.154  1.00 72.28  ? 465 HIS A NE2 1 
ATOM   3370 N N   . ARG A 1 466 ? 39.832 55.004 19.471  1.00 69.87  ? 466 ARG A N   1 
ATOM   3371 C CA  . ARG A 1 466 ? 40.488 55.963 18.603  1.00 71.62  ? 466 ARG A CA  1 
ATOM   3372 C C   . ARG A 1 466 ? 41.251 55.209 17.512  1.00 72.16  ? 466 ARG A C   1 
ATOM   3373 O O   . ARG A 1 466 ? 42.089 54.354 17.809  1.00 70.55  ? 466 ARG A O   1 
ATOM   3374 C CB  . ARG A 1 466 ? 41.447 56.841 19.409  1.00 70.60  ? 466 ARG A CB  1 
ATOM   3375 C CG  . ARG A 1 466 ? 41.884 58.089 18.666  1.00 67.79  ? 466 ARG A CG  1 
ATOM   3376 C CD  . ARG A 1 466 ? 42.983 58.808 19.408  1.00 65.16  ? 466 ARG A CD  1 
ATOM   3377 N NE  . ARG A 1 466 ? 43.545 59.892 18.612  1.00 64.36  ? 466 ARG A NE  1 
ATOM   3378 C CZ  . ARG A 1 466 ? 43.030 61.114 18.534  1.00 65.53  ? 466 ARG A CZ  1 
ATOM   3379 N NH1 . ARG A 1 466 ? 41.935 61.427 19.209  1.00 64.65  ? 466 ARG A NH1 1 
ATOM   3380 N NH2 . ARG A 1 466 ? 43.612 62.029 17.774  1.00 67.17  ? 466 ARG A NH2 1 
ATOM   3381 N N   . THR A 1 467 ? 40.937 55.519 16.255  1.00 72.88  ? 467 THR A N   1 
ATOM   3382 C CA  . THR A 1 467 ? 41.590 54.887 15.108  1.00 72.62  ? 467 THR A CA  1 
ATOM   3383 C C   . THR A 1 467 ? 43.095 55.025 15.305  1.00 71.77  ? 467 THR A C   1 
ATOM   3384 O O   . THR A 1 467 ? 43.596 56.140 15.450  1.00 72.42  ? 467 THR A O   1 
ATOM   3385 C CB  . THR A 1 467 ? 41.195 55.587 13.769  1.00 73.72  ? 467 THR A CB  1 
ATOM   3386 O OG1 . THR A 1 467 ? 41.760 56.904 13.721  1.00 76.03  ? 467 THR A OG1 1 
ATOM   3387 C CG2 . THR A 1 467 ? 39.692 55.722 13.657  1.00 74.61  ? 467 THR A CG2 1 
ATOM   3388 N N   . SER A 1 468 ? 43.819 53.911 15.316  1.00 69.52  ? 468 SER A N   1 
ATOM   3389 C CA  . SER A 1 468 ? 45.263 53.979 15.514  1.00 69.38  ? 468 SER A CA  1 
ATOM   3390 C C   . SER A 1 468 ? 45.905 55.054 14.621  1.00 69.15  ? 468 SER A C   1 
ATOM   3391 O O   . SER A 1 468 ? 46.854 55.717 15.029  1.00 69.89  ? 468 SER A O   1 
ATOM   3392 C CB  . SER A 1 468 ? 45.911 52.609 15.265  1.00 70.13  ? 468 SER A CB  1 
ATOM   3393 O OG  . SER A 1 468 ? 45.693 52.155 13.940  1.00 70.53  ? 468 SER A OG  1 
ATOM   3394 N N   . THR A 1 469 ? 45.394 55.231 13.409  1.00 67.46  ? 469 THR A N   1 
ATOM   3395 C CA  . THR A 1 469 ? 45.930 56.256 12.522  1.00 68.59  ? 469 THR A CA  1 
ATOM   3396 C C   . THR A 1 469 ? 44.936 57.406 12.559  1.00 68.02  ? 469 THR A C   1 
ATOM   3397 O O   . THR A 1 469 ? 44.322 57.752 11.551  1.00 66.80  ? 469 THR A O   1 
ATOM   3398 C CB  . THR A 1 469 ? 46.073 55.743 11.063  1.00 71.28  ? 469 THR A CB  1 
ATOM   3399 O OG1 . THR A 1 469 ? 47.007 54.655 11.021  1.00 71.74  ? 469 THR A OG1 1 
ATOM   3400 C CG2 . THR A 1 469 ? 46.587 56.855 10.147  1.00 72.19  ? 469 THR A CG2 1 
ATOM   3401 N N   . SER A 1 470 ? 44.778 57.990 13.739  1.00 68.18  ? 470 SER A N   1 
ATOM   3402 C CA  . SER A 1 470 ? 43.834 59.078 13.924  1.00 70.17  ? 470 SER A CA  1 
ATOM   3403 C C   . SER A 1 470 ? 44.152 60.327 13.124  1.00 71.21  ? 470 SER A C   1 
ATOM   3404 O O   . SER A 1 470 ? 43.276 60.883 12.460  1.00 71.66  ? 470 SER A O   1 
ATOM   3405 C CB  . SER A 1 470 ? 43.729 59.434 15.405  1.00 70.91  ? 470 SER A CB  1 
ATOM   3406 O OG  . SER A 1 470 ? 43.175 58.356 16.136  1.00 73.53  ? 470 SER A OG  1 
ATOM   3407 N N   . LEU A 1 471 ? 45.404 60.767 13.184  1.00 71.55  ? 471 LEU A N   1 
ATOM   3408 C CA  . LEU A 1 471 ? 45.817 61.974 12.469  1.00 71.64  ? 471 LEU A CA  1 
ATOM   3409 C C   . LEU A 1 471 ? 44.938 63.143 12.907  1.00 70.74  ? 471 LEU A C   1 
ATOM   3410 O O   . LEU A 1 471 ? 44.658 64.053 12.132  1.00 70.97  ? 471 LEU A O   1 
ATOM   3411 C CB  . LEU A 1 471 ? 45.699 61.778 10.950  1.00 72.07  ? 471 LEU A CB  1 
ATOM   3412 C CG  . LEU A 1 471 ? 46.568 60.703 10.285  1.00 73.40  ? 471 LEU A CG  1 
ATOM   3413 C CD1 . LEU A 1 471 ? 46.224 60.619 8.799   1.00 72.26  ? 471 LEU A CD1 1 
ATOM   3414 C CD2 . LEU A 1 471 ? 48.050 61.021 10.484  1.00 72.04  ? 471 LEU A CD2 1 
ATOM   3415 N N   . TRP A 1 472 ? 44.490 63.089 14.156  1.00 70.03  ? 472 TRP A N   1 
ATOM   3416 C CA  . TRP A 1 472 ? 43.649 64.128 14.745  1.00 69.21  ? 472 TRP A CA  1 
ATOM   3417 C C   . TRP A 1 472 ? 44.233 64.434 16.125  1.00 69.98  ? 472 TRP A C   1 
ATOM   3418 O O   . TRP A 1 472 ? 45.127 63.721 16.589  1.00 69.93  ? 472 TRP A O   1 
ATOM   3419 C CB  . TRP A 1 472 ? 42.199 63.633 14.876  1.00 65.81  ? 472 TRP A CB  1 
ATOM   3420 C CG  . TRP A 1 472 ? 41.260 64.078 13.760  1.00 62.61  ? 472 TRP A CG  1 
ATOM   3421 C CD1 . TRP A 1 472 ? 40.586 63.274 12.880  1.00 60.76  ? 472 TRP A CD1 1 
ATOM   3422 C CD2 . TRP A 1 472 ? 40.863 65.426 13.452  1.00 58.94  ? 472 TRP A CD2 1 
ATOM   3423 N NE1 . TRP A 1 472 ? 39.795 64.036 12.050  1.00 60.03  ? 472 TRP A NE1 1 
ATOM   3424 C CE2 . TRP A 1 472 ? 39.946 65.359 12.375  1.00 58.02  ? 472 TRP A CE2 1 
ATOM   3425 C CE3 . TRP A 1 472 ? 41.194 66.679 13.977  1.00 56.32  ? 472 TRP A CE3 1 
ATOM   3426 C CZ2 . TRP A 1 472 ? 39.353 66.500 11.819  1.00 54.39  ? 472 TRP A CZ2 1 
ATOM   3427 C CZ3 . TRP A 1 472 ? 40.602 67.809 13.424  1.00 56.93  ? 472 TRP A CZ3 1 
ATOM   3428 C CH2 . TRP A 1 472 ? 39.692 67.709 12.351  1.00 54.53  ? 472 TRP A CH2 1 
ATOM   3429 N N   . GLY A 1 473 ? 43.751 65.498 16.766  1.00 71.20  ? 473 GLY A N   1 
ATOM   3430 C CA  . GLY A 1 473 ? 44.240 65.857 18.091  1.00 71.45  ? 473 GLY A CA  1 
ATOM   3431 C C   . GLY A 1 473 ? 44.068 64.702 19.064  1.00 72.32  ? 473 GLY A C   1 
ATOM   3432 O O   . GLY A 1 473 ? 43.030 64.036 19.076  1.00 72.72  ? 473 GLY A O   1 
ATOM   3433 N N   . GLU A 1 474 ? 45.060 64.478 19.906  1.00 71.84  ? 474 GLU A N   1 
ATOM   3434 C CA  . GLU A 1 474 ? 45.107 63.353 20.850  1.00 71.99  ? 474 GLU A CA  1 
ATOM   3435 C C   . GLU A 1 474 ? 43.957 63.464 21.855  1.00 70.27  ? 474 GLU A C   1 
ATOM   3436 O O   . GLU A 1 474 ? 43.509 62.402 22.371  1.00 70.05  ? 474 GLU A O   1 
ATOM   3437 C CB  . GLU A 1 474 ? 46.437 63.359 21.606  1.00 76.08  ? 474 GLU A CB  1 
ATOM   3438 C CG  . GLU A 1 474 ? 47.649 63.234 20.683  1.00 82.23  ? 474 GLU A CG  1 
ATOM   3439 C CD  . GLU A 1 474 ? 48.979 63.246 21.439  1.00 87.30  ? 474 GLU A CD  1 
ATOM   3440 O OE1 . GLU A 1 474 ? 48.988 63.355 22.724  1.00 90.84  ? 474 GLU A OE1 1 
ATOM   3441 O OE2 . GLU A 1 474 ? 50.090 63.146 20.792  1.00 90.15  ? 474 GLU A OE2 1 
ATOM   3442 N N   . TRP A 1 475 ? 43.500 64.650 22.189  1.00 67.21  ? 475 TRP A N   1 
ATOM   3443 C CA  . TRP A 1 475 ? 42.430 64.864 23.172  1.00 64.75  ? 475 TRP A CA  1 
ATOM   3444 C C   . TRP A 1 475 ? 41.001 64.576 22.711  1.00 62.62  ? 475 TRP A C   1 
ATOM   3445 O O   . TRP A 1 475 ? 40.147 64.205 23.522  1.00 61.85  ? 475 TRP A O   1 
ATOM   3446 C CB  . TRP A 1 475 ? 42.481 66.302 23.687  1.00 63.85  ? 475 TRP A CB  1 
ATOM   3447 C CG  . TRP A 1 475 ? 42.797 67.293 22.625  1.00 59.90  ? 475 TRP A CG  1 
ATOM   3448 C CD1 . TRP A 1 475 ? 44.019 67.527 22.080  1.00 58.98  ? 475 TRP A CD1 1 
ATOM   3449 C CD2 . TRP A 1 475 ? 41.894 68.221 22.012  1.00 58.07  ? 475 TRP A CD2 1 
ATOM   3450 N NE1 . TRP A 1 475 ? 43.943 68.551 21.173  1.00 59.62  ? 475 TRP A NE1 1 
ATOM   3451 C CE2 . TRP A 1 475 ? 42.650 69.000 21.111  1.00 59.42  ? 475 TRP A CE2 1 
ATOM   3452 C CE3 . TRP A 1 475 ? 40.524 68.475 22.139  1.00 57.20  ? 475 TRP A CE3 1 
ATOM   3453 C CZ2 . TRP A 1 475 ? 42.081 70.027 20.340  1.00 58.38  ? 475 TRP A CZ2 1 
ATOM   3454 C CZ3 . TRP A 1 475 ? 39.958 69.499 21.369  1.00 58.14  ? 475 TRP A CZ3 1 
ATOM   3455 C CH2 . TRP A 1 475 ? 40.740 70.259 20.484  1.00 56.60  ? 475 TRP A CH2 1 
ATOM   3456 N N   . MET A 1 476 ? 40.745 64.751 21.421  1.00 59.99  ? 476 MET A N   1 
ATOM   3457 C CA  . MET A 1 476 ? 39.404 64.565 20.835  1.00 57.56  ? 476 MET A CA  1 
ATOM   3458 C C   . MET A 1 476 ? 39.132 63.068 20.725  1.00 54.42  ? 476 MET A C   1 
ATOM   3459 O O   . MET A 1 476 ? 38.252 62.683 19.930  1.00 49.76  ? 476 MET A O   1 
ATOM   3460 C CB  . MET A 1 476 ? 39.309 65.201 19.442  1.00 60.32  ? 476 MET A CB  1 
ATOM   3461 C CG  . MET A 1 476 ? 40.239 66.414 19.285  1.00 65.03  ? 476 MET A CG  1 
ATOM   3462 S SD  . MET A 1 476 ? 40.153 67.176 17.676  1.00 69.87  ? 476 MET A SD  1 
ATOM   3463 C CE  . MET A 1 476 ? 41.766 67.179 16.915  1.00 66.25  ? 476 MET A CE  1 
ATOM   3464 N N   . GLY A 1 477 ? 39.849 62.269 21.493  1.00 53.25  ? 477 GLY A N   1 
ATOM   3465 C CA  . GLY A 1 477 ? 39.701 60.822 21.500  1.00 52.52  ? 477 GLY A CA  1 
ATOM   3466 C C   . GLY A 1 477 ? 38.991 60.228 20.300  1.00 50.86  ? 477 GLY A C   1 
ATOM   3467 O O   . GLY A 1 477 ? 39.506 60.242 19.183  1.00 50.34  ? 477 GLY A O   1 
ATOM   3468 N N   . VAL A 1 478 ? 37.799 59.698 20.544  1.00 49.41  ? 478 VAL A N   1 
ATOM   3469 C CA  . VAL A 1 478 ? 36.993 59.098 19.500  1.00 49.62  ? 478 VAL A CA  1 
ATOM   3470 C C   . VAL A 1 478 ? 35.919 60.116 19.191  1.00 50.19  ? 478 VAL A C   1 
ATOM   3471 O O   . VAL A 1 478 ? 34.916 60.154 19.882  1.00 52.36  ? 478 VAL A O   1 
ATOM   3472 C CB  . VAL A 1 478 ? 36.322 57.815 20.003  1.00 49.92  ? 478 VAL A CB  1 
ATOM   3473 C CG1 . VAL A 1 478 ? 36.092 56.879 18.856  1.00 49.83  ? 478 VAL A CG1 1 
ATOM   3474 C CG2 . VAL A 1 478 ? 37.171 57.158 21.067  1.00 47.58  ? 478 VAL A CG2 1 
ATOM   3475 N N   . LEU A 1 479 ? 36.129 60.938 18.163  1.00 51.62  ? 479 LEU A N   1 
ATOM   3476 C CA  . LEU A 1 479 ? 35.174 61.991 17.799  1.00 52.78  ? 479 LEU A CA  1 
ATOM   3477 C C   . LEU A 1 479 ? 34.205 61.634 16.675  1.00 56.53  ? 479 LEU A C   1 
ATOM   3478 O O   . LEU A 1 479 ? 34.238 60.537 16.107  1.00 58.32  ? 479 LEU A O   1 
ATOM   3479 C CB  . LEU A 1 479 ? 35.920 63.264 17.379  1.00 49.86  ? 479 LEU A CB  1 
ATOM   3480 C CG  . LEU A 1 479 ? 36.387 63.354 15.914  1.00 47.86  ? 479 LEU A CG  1 
ATOM   3481 C CD1 . LEU A 1 479 ? 37.220 64.601 15.715  1.00 44.20  ? 479 LEU A CD1 1 
ATOM   3482 C CD2 . LEU A 1 479 ? 37.194 62.119 15.536  1.00 46.69  ? 479 LEU A CD2 1 
ATOM   3483 N N   . HIS A 1 480 ? 33.344 62.600 16.370  1.00 57.52  ? 480 HIS A N   1 
ATOM   3484 C CA  . HIS A 1 480 ? 32.360 62.506 15.305  1.00 58.79  ? 480 HIS A CA  1 
ATOM   3485 C C   . HIS A 1 480 ? 32.962 61.731 14.114  1.00 58.57  ? 480 HIS A C   1 
ATOM   3486 O O   . HIS A 1 480 ? 34.166 61.831 13.851  1.00 60.47  ? 480 HIS A O   1 
ATOM   3487 C CB  . HIS A 1 480 ? 32.023 63.936 14.883  1.00 61.08  ? 480 HIS A CB  1 
ATOM   3488 C CG  . HIS A 1 480 ? 30.836 64.051 13.988  1.00 65.35  ? 480 HIS A CG  1 
ATOM   3489 N ND1 . HIS A 1 480 ? 29.547 63.955 14.448  1.00 67.08  ? 480 HIS A ND1 1 
ATOM   3490 C CD2 . HIS A 1 480 ? 30.749 64.296 12.652  1.00 66.17  ? 480 HIS A CD2 1 
ATOM   3491 C CE1 . HIS A 1 480 ? 28.701 64.139 13.441  1.00 68.41  ? 480 HIS A CE1 1 
ATOM   3492 N NE2 . HIS A 1 480 ? 29.415 64.347 12.346  1.00 69.24  ? 480 HIS A NE2 1 
ATOM   3493 N N   . GLY A 1 481 ? 32.142 60.952 13.410  1.00 56.50  ? 481 GLY A N   1 
ATOM   3494 C CA  . GLY A 1 481 ? 32.625 60.216 12.244  1.00 54.48  ? 481 GLY A CA  1 
ATOM   3495 C C   . GLY A 1 481 ? 33.684 59.115 12.369  1.00 52.60  ? 481 GLY A C   1 
ATOM   3496 O O   . GLY A 1 481 ? 33.875 58.343 11.428  1.00 51.80  ? 481 GLY A O   1 
ATOM   3497 N N   . ASP A 1 482 ? 34.387 59.029 13.494  1.00 50.15  ? 482 ASP A N   1 
ATOM   3498 C CA  . ASP A 1 482 ? 35.407 57.986 13.668  1.00 49.85  ? 482 ASP A CA  1 
ATOM   3499 C C   . ASP A 1 482 ? 34.754 56.610 13.621  1.00 49.57  ? 482 ASP A C   1 
ATOM   3500 O O   . ASP A 1 482 ? 35.417 55.565 13.630  1.00 48.79  ? 482 ASP A O   1 
ATOM   3501 C CB  . ASP A 1 482 ? 36.101 58.151 15.014  1.00 51.50  ? 482 ASP A CB  1 
ATOM   3502 C CG  . ASP A 1 482 ? 37.355 58.954 14.918  1.00 52.01  ? 482 ASP A CG  1 
ATOM   3503 O OD1 . ASP A 1 482 ? 37.446 59.778 13.989  1.00 53.14  ? 482 ASP A OD1 1 
ATOM   3504 O OD2 . ASP A 1 482 ? 38.241 58.762 15.780  1.00 53.96  ? 482 ASP A OD2 1 
ATOM   3505 N N   . GLU A 1 483 ? 33.431 56.651 13.575  1.00 48.05  ? 483 GLU A N   1 
ATOM   3506 C CA  . GLU A 1 483 ? 32.558 55.494 13.555  1.00 44.70  ? 483 GLU A CA  1 
ATOM   3507 C C   . GLU A 1 483 ? 32.403 54.998 12.127  1.00 44.87  ? 483 GLU A C   1 
ATOM   3508 O O   . GLU A 1 483 ? 32.646 53.832 11.823  1.00 44.04  ? 483 GLU A O   1 
ATOM   3509 C CB  . GLU A 1 483 ? 31.220 55.956 14.104  1.00 45.15  ? 483 GLU A CB  1 
ATOM   3510 C CG  . GLU A 1 483 ? 31.119 57.469 13.966  1.00 44.43  ? 483 GLU A CG  1 
ATOM   3511 C CD  . GLU A 1 483 ? 29.737 57.999 14.164  1.00 48.70  ? 483 GLU A CD  1 
ATOM   3512 O OE1 . GLU A 1 483 ? 28.824 57.493 13.499  1.00 53.86  ? 483 GLU A OE1 1 
ATOM   3513 O OE2 . GLU A 1 483 ? 29.553 58.933 14.969  1.00 53.35  ? 483 GLU A OE2 1 
ATOM   3514 N N   . ILE A 1 484 ? 32.001 55.913 11.253  1.00 45.13  ? 484 ILE A N   1 
ATOM   3515 C CA  . ILE A 1 484 ? 31.774 55.611 9.844   1.00 45.31  ? 484 ILE A CA  1 
ATOM   3516 C C   . ILE A 1 484 ? 32.750 54.566 9.290   1.00 48.48  ? 484 ILE A C   1 
ATOM   3517 O O   . ILE A 1 484 ? 32.344 53.456 8.910   1.00 46.74  ? 484 ILE A O   1 
ATOM   3518 C CB  . ILE A 1 484 ? 31.821 56.914 9.027   1.00 40.08  ? 484 ILE A CB  1 
ATOM   3519 C CG1 . ILE A 1 484 ? 30.692 57.834 9.493   1.00 35.87  ? 484 ILE A CG1 1 
ATOM   3520 C CG2 . ILE A 1 484 ? 31.665 56.627 7.563   1.00 39.44  ? 484 ILE A CG2 1 
ATOM   3521 C CD1 . ILE A 1 484 ? 30.743 59.223 8.893   1.00 34.97  ? 484 ILE A CD1 1 
ATOM   3522 N N   . GLU A 1 485 ? 34.031 54.925 9.260   1.00 51.76  ? 485 GLU A N   1 
ATOM   3523 C CA  . GLU A 1 485 ? 35.079 54.036 8.784   1.00 53.23  ? 485 GLU A CA  1 
ATOM   3524 C C   . GLU A 1 485 ? 34.819 52.587 9.169   1.00 53.05  ? 485 GLU A C   1 
ATOM   3525 O O   . GLU A 1 485 ? 34.689 51.716 8.318   1.00 54.04  ? 485 GLU A O   1 
ATOM   3526 C CB  . GLU A 1 485 ? 36.407 54.431 9.407   1.00 57.77  ? 485 GLU A CB  1 
ATOM   3527 C CG  . GLU A 1 485 ? 37.298 55.329 8.586   1.00 65.30  ? 485 GLU A CG  1 
ATOM   3528 C CD  . GLU A 1 485 ? 38.604 55.651 9.322   1.00 70.28  ? 485 GLU A CD  1 
ATOM   3529 O OE1 . GLU A 1 485 ? 38.768 55.209 10.491  1.00 70.02  ? 485 GLU A OE1 1 
ATOM   3530 O OE2 . GLU A 1 485 ? 39.465 56.346 8.731   1.00 73.18  ? 485 GLU A OE2 1 
ATOM   3531 N N   . TYR A 1 486 ? 34.750 52.349 10.472  1.00 51.77  ? 486 TYR A N   1 
ATOM   3532 C CA  . TYR A 1 486 ? 34.572 51.011 11.024  1.00 49.97  ? 486 TYR A CA  1 
ATOM   3533 C C   . TYR A 1 486 ? 33.295 50.265 10.700  1.00 49.05  ? 486 TYR A C   1 
ATOM   3534 O O   . TYR A 1 486 ? 33.297 49.040 10.599  1.00 48.83  ? 486 TYR A O   1 
ATOM   3535 C CB  . TYR A 1 486 ? 34.759 51.066 12.541  1.00 50.40  ? 486 TYR A CB  1 
ATOM   3536 C CG  . TYR A 1 486 ? 36.107 51.602 12.937  1.00 48.51  ? 486 TYR A CG  1 
ATOM   3537 C CD1 . TYR A 1 486 ? 36.437 52.944 12.731  1.00 47.75  ? 486 TYR A CD1 1 
ATOM   3538 C CD2 . TYR A 1 486 ? 37.087 50.747 13.448  1.00 50.72  ? 486 TYR A CD2 1 
ATOM   3539 C CE1 . TYR A 1 486 ? 37.714 53.421 13.022  1.00 48.19  ? 486 TYR A CE1 1 
ATOM   3540 C CE2 . TYR A 1 486 ? 38.371 51.214 13.745  1.00 50.07  ? 486 TYR A CE2 1 
ATOM   3541 C CZ  . TYR A 1 486 ? 38.674 52.546 13.526  1.00 49.61  ? 486 TYR A CZ  1 
ATOM   3542 O OH  . TYR A 1 486 ? 39.939 52.980 13.827  1.00 51.57  ? 486 TYR A OH  1 
ATOM   3543 N N   . PHE A 1 487 ? 32.198 50.990 10.562  1.00 49.25  ? 487 PHE A N   1 
ATOM   3544 C CA  . PHE A 1 487 ? 30.930 50.348 10.245  1.00 48.81  ? 487 PHE A CA  1 
ATOM   3545 C C   . PHE A 1 487 ? 30.911 50.007 8.767   1.00 48.36  ? 487 PHE A C   1 
ATOM   3546 O O   . PHE A 1 487 ? 30.131 49.164 8.328   1.00 47.74  ? 487 PHE A O   1 
ATOM   3547 C CB  . PHE A 1 487 ? 29.769 51.275 10.598  1.00 48.09  ? 487 PHE A CB  1 
ATOM   3548 C CG  . PHE A 1 487 ? 29.475 51.337 12.062  1.00 45.03  ? 487 PHE A CG  1 
ATOM   3549 C CD1 . PHE A 1 487 ? 29.469 50.175 12.830  1.00 45.57  ? 487 PHE A CD1 1 
ATOM   3550 C CD2 . PHE A 1 487 ? 29.179 52.547 12.674  1.00 43.63  ? 487 PHE A CD2 1 
ATOM   3551 C CE1 . PHE A 1 487 ? 29.169 50.216 14.187  1.00 42.90  ? 487 PHE A CE1 1 
ATOM   3552 C CE2 . PHE A 1 487 ? 28.878 52.596 14.030  1.00 43.57  ? 487 PHE A CE2 1 
ATOM   3553 C CZ  . PHE A 1 487 ? 28.873 51.428 14.786  1.00 43.22  ? 487 PHE A CZ  1 
ATOM   3554 N N   . PHE A 1 488 ? 31.774 50.684 8.008   1.00 48.20  ? 488 PHE A N   1 
ATOM   3555 C CA  . PHE A 1 488 ? 31.909 50.454 6.571   1.00 48.86  ? 488 PHE A CA  1 
ATOM   3556 C C   . PHE A 1 488 ? 33.031 49.434 6.325   1.00 50.94  ? 488 PHE A C   1 
ATOM   3557 O O   . PHE A 1 488 ? 33.575 49.340 5.216   1.00 52.57  ? 488 PHE A O   1 
ATOM   3558 C CB  . PHE A 1 488 ? 32.224 51.768 5.839   1.00 46.25  ? 488 PHE A CB  1 
ATOM   3559 C CG  . PHE A 1 488 ? 31.007 52.508 5.355   1.00 42.71  ? 488 PHE A CG  1 
ATOM   3560 C CD1 . PHE A 1 488 ? 30.098 51.899 4.495   1.00 41.01  ? 488 PHE A CD1 1 
ATOM   3561 C CD2 . PHE A 1 488 ? 30.774 53.817 5.747   1.00 42.32  ? 488 PHE A CD2 1 
ATOM   3562 C CE1 . PHE A 1 488 ? 28.979 52.584 4.033   1.00 39.99  ? 488 PHE A CE1 1 
ATOM   3563 C CE2 . PHE A 1 488 ? 29.649 54.514 5.289   1.00 41.57  ? 488 PHE A CE2 1 
ATOM   3564 C CZ  . PHE A 1 488 ? 28.755 53.897 4.434   1.00 39.80  ? 488 PHE A CZ  1 
ATOM   3565 N N   . GLY A 1 489 ? 33.369 48.683 7.375   1.00 50.81  ? 489 GLY A N   1 
ATOM   3566 C CA  . GLY A 1 489 ? 34.404 47.666 7.291   1.00 50.55  ? 489 GLY A CA  1 
ATOM   3567 C C   . GLY A 1 489 ? 35.729 48.088 6.682   1.00 50.40  ? 489 GLY A C   1 
ATOM   3568 O O   . GLY A 1 489 ? 36.593 47.246 6.447   1.00 49.59  ? 489 GLY A O   1 
ATOM   3569 N N   A GLN A 1 490 ? 35.891 49.389 6.462   0.50 49.97  ? 490 GLN A N   1 
ATOM   3570 N N   B GLN A 1 490 ? 35.901 49.383 6.419   0.50 50.10  ? 490 GLN A N   1 
ATOM   3571 C CA  A GLN A 1 490 ? 37.111 49.947 5.895   0.50 50.94  ? 490 GLN A CA  1 
ATOM   3572 C CA  B GLN A 1 490 ? 37.139 49.857 5.812   0.50 51.23  ? 490 GLN A CA  1 
ATOM   3573 C C   A GLN A 1 490 ? 38.409 49.384 6.484   0.50 52.63  ? 490 GLN A C   1 
ATOM   3574 C C   B GLN A 1 490 ? 38.423 49.315 6.461   0.50 52.74  ? 490 GLN A C   1 
ATOM   3575 O O   A GLN A 1 490 ? 39.426 49.309 5.800   0.50 52.92  ? 490 GLN A O   1 
ATOM   3576 O O   B GLN A 1 490 ? 39.451 49.206 5.797   0.50 52.93  ? 490 GLN A O   1 
ATOM   3577 C CB  A GLN A 1 490 ? 37.113 51.462 6.080   0.50 49.52  ? 490 GLN A CB  1 
ATOM   3578 C CB  B GLN A 1 490 ? 37.152 51.386 5.740   0.50 50.04  ? 490 GLN A CB  1 
ATOM   3579 C CG  A GLN A 1 490 ? 38.380 52.133 5.605   0.50 49.46  ? 490 GLN A CG  1 
ATOM   3580 C CG  B GLN A 1 490 ? 37.046 51.924 4.297   0.50 50.65  ? 490 GLN A CG  1 
ATOM   3581 C CD  A GLN A 1 490 ? 38.375 53.624 5.847   0.50 49.50  ? 490 GLN A CD  1 
ATOM   3582 C CD  B GLN A 1 490 ? 35.725 51.591 3.606   0.50 49.84  ? 490 GLN A CD  1 
ATOM   3583 O OE1 A GLN A 1 490 ? 37.349 54.286 5.703   0.50 50.43  ? 490 GLN A OE1 1 
ATOM   3584 O OE1 B GLN A 1 490 ? 35.323 50.431 3.525   0.50 49.83  ? 490 GLN A OE1 1 
ATOM   3585 N NE2 A GLN A 1 490 ? 39.528 54.165 6.199   0.50 50.36  ? 490 GLN A NE2 1 
ATOM   3586 N NE2 B GLN A 1 490 ? 35.052 52.617 3.094   0.50 49.39  ? 490 GLN A NE2 1 
ATOM   3587 N N   . PRO A 1 491 ? 38.396 48.997 7.769   1.00 53.41  ? 491 PRO A N   1 
ATOM   3588 C CA  . PRO A 1 491 ? 39.611 48.456 8.378   1.00 54.56  ? 491 PRO A CA  1 
ATOM   3589 C C   . PRO A 1 491 ? 39.966 47.128 7.738   1.00 55.40  ? 491 PRO A C   1 
ATOM   3590 O O   . PRO A 1 491 ? 41.071 46.616 7.909   1.00 56.67  ? 491 PRO A O   1 
ATOM   3591 C CB  . PRO A 1 491 ? 39.215 48.284 9.841   1.00 56.14  ? 491 PRO A CB  1 
ATOM   3592 C CG  . PRO A 1 491 ? 38.314 49.423 10.059  1.00 56.30  ? 491 PRO A CG  1 
ATOM   3593 C CD  . PRO A 1 491 ? 37.441 49.392 8.815   1.00 56.52  ? 491 PRO A CD  1 
ATOM   3594 N N   . LEU A 1 492 ? 39.016 46.559 7.011   1.00 55.04  ? 492 LEU A N   1 
ATOM   3595 C CA  . LEU A 1 492 ? 39.253 45.288 6.344   1.00 56.56  ? 492 LEU A CA  1 
ATOM   3596 C C   . LEU A 1 492 ? 40.048 45.494 5.049   1.00 58.35  ? 492 LEU A C   1 
ATOM   3597 O O   . LEU A 1 492 ? 40.380 44.542 4.337   1.00 58.31  ? 492 LEU A O   1 
ATOM   3598 C CB  . LEU A 1 492 ? 37.923 44.602 6.045   1.00 54.05  ? 492 LEU A CB  1 
ATOM   3599 C CG  . LEU A 1 492 ? 37.176 44.155 7.295   1.00 52.74  ? 492 LEU A CG  1 
ATOM   3600 C CD1 . LEU A 1 492 ? 35.833 43.563 6.925   1.00 53.21  ? 492 LEU A CD1 1 
ATOM   3601 C CD2 . LEU A 1 492 ? 38.017 43.150 8.027   1.00 51.22  ? 492 LEU A CD2 1 
ATOM   3602 N N   . ASN A 1 493 ? 40.352 46.748 4.752   1.00 58.68  ? 493 ASN A N   1 
ATOM   3603 C CA  . ASN A 1 493 ? 41.104 47.084 3.561   1.00 59.87  ? 493 ASN A CA  1 
ATOM   3604 C C   . ASN A 1 493 ? 42.569 47.159 3.962   1.00 59.73  ? 493 ASN A C   1 
ATOM   3605 O O   . ASN A 1 493 ? 43.013 48.159 4.511   1.00 60.91  ? 493 ASN A O   1 
ATOM   3606 C CB  . ASN A 1 493 ? 40.626 48.432 3.031   1.00 62.18  ? 493 ASN A CB  1 
ATOM   3607 C CG  . ASN A 1 493 ? 41.267 48.799 1.721   1.00 64.70  ? 493 ASN A CG  1 
ATOM   3608 O OD1 . ASN A 1 493 ? 42.045 48.026 1.156   1.00 65.65  ? 493 ASN A OD1 1 
ATOM   3609 N ND2 . ASN A 1 493 ? 40.932 49.983 1.230   1.00 65.73  ? 493 ASN A ND2 1 
ATOM   3610 N N   . ASN A 1 494 ? 43.316 46.097 3.688   1.00 59.07  ? 494 ASN A N   1 
ATOM   3611 C CA  . ASN A 1 494 ? 44.729 46.037 4.051   1.00 59.32  ? 494 ASN A CA  1 
ATOM   3612 C C   . ASN A 1 494 ? 45.602 47.141 3.448   1.00 58.64  ? 494 ASN A C   1 
ATOM   3613 O O   . ASN A 1 494 ? 46.676 47.454 3.964   1.00 56.91  ? 494 ASN A O   1 
ATOM   3614 C CB  . ASN A 1 494 ? 45.302 44.676 3.667   1.00 62.00  ? 494 ASN A CB  1 
ATOM   3615 C CG  . ASN A 1 494 ? 44.316 43.545 3.889   1.00 65.16  ? 494 ASN A CG  1 
ATOM   3616 O OD1 . ASN A 1 494 ? 43.400 43.333 3.078   1.00 66.68  ? 494 ASN A OD1 1 
ATOM   3617 N ND2 . ASN A 1 494 ? 44.492 42.810 4.991   1.00 64.97  ? 494 ASN A ND2 1 
ATOM   3618 N N   . SER A 1 495 ? 45.147 47.730 2.352   1.00 58.63  ? 495 SER A N   1 
ATOM   3619 C CA  . SER A 1 495 ? 45.904 48.795 1.719   1.00 59.07  ? 495 SER A CA  1 
ATOM   3620 C C   . SER A 1 495 ? 45.793 49.996 2.629   1.00 60.57  ? 495 SER A C   1 
ATOM   3621 O O   . SER A 1 495 ? 46.218 51.101 2.289   1.00 61.22  ? 495 SER A O   1 
ATOM   3622 C CB  . SER A 1 495 ? 45.316 49.104 0.350   1.00 59.18  ? 495 SER A CB  1 
ATOM   3623 O OG  . SER A 1 495 ? 45.204 47.910 -0.407  1.00 59.90  ? 495 SER A OG  1 
ATOM   3624 N N   . LEU A 1 496 ? 45.195 49.743 3.792   1.00 63.29  ? 496 LEU A N   1 
ATOM   3625 C CA  . LEU A 1 496 ? 44.969 50.722 4.860   1.00 64.37  ? 496 LEU A CA  1 
ATOM   3626 C C   . LEU A 1 496 ? 45.488 50.074 6.144   1.00 65.94  ? 496 LEU A C   1 
ATOM   3627 O O   . LEU A 1 496 ? 44.932 49.085 6.620   1.00 65.00  ? 496 LEU A O   1 
ATOM   3628 C CB  . LEU A 1 496 ? 43.474 51.018 5.002   1.00 61.59  ? 496 LEU A CB  1 
ATOM   3629 C CG  . LEU A 1 496 ? 42.802 51.742 3.839   1.00 59.68  ? 496 LEU A CG  1 
ATOM   3630 C CD1 . LEU A 1 496 ? 41.305 51.596 3.948   1.00 61.29  ? 496 LEU A CD1 1 
ATOM   3631 C CD2 . LEU A 1 496 ? 43.200 53.200 3.851   1.00 58.04  ? 496 LEU A CD2 1 
ATOM   3632 N N   . GLN A 1 497 ? 46.552 50.630 6.709   1.00 69.12  ? 497 GLN A N   1 
ATOM   3633 C CA  . GLN A 1 497 ? 47.133 50.048 7.906   1.00 71.25  ? 497 GLN A CA  1 
ATOM   3634 C C   . GLN A 1 497 ? 46.425 50.426 9.198   1.00 71.93  ? 497 GLN A C   1 
ATOM   3635 O O   . GLN A 1 497 ? 46.403 51.582 9.625   1.00 71.28  ? 497 GLN A O   1 
ATOM   3636 C CB  . GLN A 1 497 ? 48.634 50.375 7.961   1.00 73.12  ? 497 GLN A CB  1 
ATOM   3637 C CG  . GLN A 1 497 ? 49.107 51.269 9.093   1.00 75.71  ? 497 GLN A CG  1 
ATOM   3638 C CD  . GLN A 1 497 ? 49.962 52.427 8.596   1.00 76.55  ? 497 GLN A CD  1 
ATOM   3639 O OE1 . GLN A 1 497 ? 50.497 52.391 7.487   1.00 77.01  ? 497 GLN A OE1 1 
ATOM   3640 N NE2 . GLN A 1 497 ? 50.101 53.456 9.421   1.00 77.90  ? 497 GLN A NE2 1 
ATOM   3641 N N   . TYR A 1 498 ? 45.810 49.413 9.786   1.00 73.09  ? 498 TYR A N   1 
ATOM   3642 C CA  . TYR A 1 498 ? 45.095 49.524 11.042  1.00 74.14  ? 498 TYR A CA  1 
ATOM   3643 C C   . TYR A 1 498 ? 45.698 48.392 11.877  1.00 74.63  ? 498 TYR A C   1 
ATOM   3644 O O   . TYR A 1 498 ? 46.051 47.343 11.332  1.00 75.87  ? 498 TYR A O   1 
ATOM   3645 C CB  . TYR A 1 498 ? 43.590 49.291 10.822  1.00 74.12  ? 498 TYR A CB  1 
ATOM   3646 C CG  . TYR A 1 498 ? 42.828 50.453 10.197  1.00 74.10  ? 498 TYR A CG  1 
ATOM   3647 C CD1 . TYR A 1 498 ? 43.491 51.573 9.694   1.00 74.50  ? 498 TYR A CD1 1 
ATOM   3648 C CD2 . TYR A 1 498 ? 41.439 50.422 10.101  1.00 72.74  ? 498 TYR A CD2 1 
ATOM   3649 C CE1 . TYR A 1 498 ? 42.781 52.628 9.112   1.00 73.75  ? 498 TYR A CE1 1 
ATOM   3650 C CE2 . TYR A 1 498 ? 40.725 51.465 9.521   1.00 71.44  ? 498 TYR A CE2 1 
ATOM   3651 C CZ  . TYR A 1 498 ? 41.399 52.560 9.030   1.00 72.23  ? 498 TYR A CZ  1 
ATOM   3652 O OH  . TYR A 1 498 ? 40.695 53.580 8.448   1.00 70.60  ? 498 TYR A OH  1 
ATOM   3653 N N   . ARG A 1 499 ? 45.850 48.596 13.181  1.00 73.23  ? 499 ARG A N   1 
ATOM   3654 C CA  . ARG A 1 499 ? 46.418 47.544 14.004  1.00 72.26  ? 499 ARG A CA  1 
ATOM   3655 C C   . ARG A 1 499 ? 45.528 46.310 13.837  1.00 70.93  ? 499 ARG A C   1 
ATOM   3656 O O   . ARG A 1 499 ? 44.309 46.433 13.715  1.00 70.46  ? 499 ARG A O   1 
ATOM   3657 C CB  . ARG A 1 499 ? 46.468 47.985 15.467  1.00 74.71  ? 499 ARG A CB  1 
ATOM   3658 C CG  . ARG A 1 499 ? 47.439 47.171 16.283  1.00 79.44  ? 499 ARG A CG  1 
ATOM   3659 C CD  . ARG A 1 499 ? 47.455 47.548 17.754  1.00 83.72  ? 499 ARG A CD  1 
ATOM   3660 N NE  . ARG A 1 499 ? 48.310 46.635 18.512  1.00 87.58  ? 499 ARG A NE  1 
ATOM   3661 C CZ  . ARG A 1 499 ? 48.230 45.305 18.451  1.00 89.65  ? 499 ARG A CZ  1 
ATOM   3662 N NH1 . ARG A 1 499 ? 47.334 44.718 17.665  1.00 89.71  ? 499 ARG A NH1 1 
ATOM   3663 N NH2 . ARG A 1 499 ? 49.049 44.553 19.179  1.00 91.79  ? 499 ARG A NH2 1 
ATOM   3664 N N   . PRO A 1 500 ? 46.126 45.105 13.819  1.00 69.41  ? 500 PRO A N   1 
ATOM   3665 C CA  . PRO A 1 500 ? 45.375 43.853 13.660  1.00 68.22  ? 500 PRO A CA  1 
ATOM   3666 C C   . PRO A 1 500 ? 44.107 43.730 14.497  1.00 68.39  ? 500 PRO A C   1 
ATOM   3667 O O   . PRO A 1 500 ? 43.226 42.942 14.165  1.00 68.62  ? 500 PRO A O   1 
ATOM   3668 C CB  . PRO A 1 500 ? 46.409 42.778 14.003  1.00 66.98  ? 500 PRO A CB  1 
ATOM   3669 C CG  . PRO A 1 500 ? 47.383 43.489 14.874  1.00 67.51  ? 500 PRO A CG  1 
ATOM   3670 C CD  . PRO A 1 500 ? 47.522 44.814 14.174  1.00 68.70  ? 500 PRO A CD  1 
ATOM   3671 N N   . VAL A 1 501 ? 44.016 44.499 15.580  1.00 69.05  ? 501 VAL A N   1 
ATOM   3672 C CA  . VAL A 1 501 ? 42.837 44.471 16.445  1.00 68.40  ? 501 VAL A CA  1 
ATOM   3673 C C   . VAL A 1 501 ? 41.729 45.317 15.846  1.00 68.46  ? 501 VAL A C   1 
ATOM   3674 O O   . VAL A 1 501 ? 40.557 44.933 15.878  1.00 68.85  ? 501 VAL A O   1 
ATOM   3675 C CB  . VAL A 1 501 ? 43.139 45.022 17.850  1.00 68.76  ? 501 VAL A CB  1 
ATOM   3676 C CG1 . VAL A 1 501 ? 44.146 44.128 18.543  1.00 70.59  ? 501 VAL A CG1 1 
ATOM   3677 C CG2 . VAL A 1 501 ? 43.656 46.463 17.757  1.00 69.20  ? 501 VAL A CG2 1 
ATOM   3678 N N   . GLU A 1 502 ? 42.110 46.472 15.303  1.00 66.94  ? 502 GLU A N   1 
ATOM   3679 C CA  . GLU A 1 502 ? 41.149 47.375 14.695  1.00 66.05  ? 502 GLU A CA  1 
ATOM   3680 C C   . GLU A 1 502 ? 40.456 46.687 13.540  1.00 66.81  ? 502 GLU A C   1 
ATOM   3681 O O   . GLU A 1 502 ? 39.328 47.018 13.188  1.00 66.85  ? 502 GLU A O   1 
ATOM   3682 C CB  . GLU A 1 502 ? 41.849 48.637 14.218  1.00 62.21  ? 502 GLU A CB  1 
ATOM   3683 C CG  . GLU A 1 502 ? 42.493 49.390 15.338  1.00 58.53  ? 502 GLU A CG  1 
ATOM   3684 C CD  . GLU A 1 502 ? 43.097 50.668 14.863  1.00 57.47  ? 502 GLU A CD  1 
ATOM   3685 O OE1 . GLU A 1 502 ? 43.838 50.613 13.869  1.00 59.00  ? 502 GLU A OE1 1 
ATOM   3686 O OE2 . GLU A 1 502 ? 42.844 51.727 15.471  1.00 58.21  ? 502 GLU A OE2 1 
ATOM   3687 N N   . ARG A 1 503 ? 41.143 45.721 12.952  1.00 68.81  ? 503 ARG A N   1 
ATOM   3688 C CA  . ARG A 1 503 ? 40.574 44.973 11.851  1.00 72.29  ? 503 ARG A CA  1 
ATOM   3689 C C   . ARG A 1 503 ? 39.552 43.995 12.418  1.00 73.31  ? 503 ARG A C   1 
ATOM   3690 O O   . ARG A 1 503 ? 38.579 43.627 11.747  1.00 74.38  ? 503 ARG A O   1 
ATOM   3691 C CB  . ARG A 1 503 ? 41.671 44.218 11.100  1.00 73.36  ? 503 ARG A CB  1 
ATOM   3692 C CG  . ARG A 1 503 ? 42.504 45.100 10.197  1.00 75.66  ? 503 ARG A CG  1 
ATOM   3693 C CD  . ARG A 1 503 ? 43.559 44.300 9.446   1.00 77.32  ? 503 ARG A CD  1 
ATOM   3694 N NE  . ARG A 1 503 ? 43.898 44.940 8.178   1.00 78.29  ? 503 ARG A NE  1 
ATOM   3695 C CZ  . ARG A 1 503 ? 44.328 46.191 8.062   1.00 78.18  ? 503 ARG A CZ  1 
ATOM   3696 N NH1 . ARG A 1 503 ? 44.482 46.952 9.137   1.00 79.04  ? 503 ARG A NH1 1 
ATOM   3697 N NH2 . ARG A 1 503 ? 44.587 46.689 6.866   1.00 78.56  ? 503 ARG A NH2 1 
ATOM   3698 N N   . GLU A 1 504 ? 39.774 43.580 13.663  1.00 72.99  ? 504 GLU A N   1 
ATOM   3699 C CA  . GLU A 1 504 ? 38.863 42.648 14.309  1.00 72.23  ? 504 GLU A CA  1 
ATOM   3700 C C   . GLU A 1 504 ? 37.651 43.436 14.756  1.00 71.19  ? 504 GLU A C   1 
ATOM   3701 O O   . GLU A 1 504 ? 36.587 42.862 14.972  1.00 72.11  ? 504 GLU A O   1 
ATOM   3702 C CB  . GLU A 1 504 ? 39.532 41.969 15.505  1.00 73.07  ? 504 GLU A CB  1 
ATOM   3703 C CG  . GLU A 1 504 ? 38.962 40.599 15.850  1.00 74.99  ? 504 GLU A CG  1 
ATOM   3704 C CD  . GLU A 1 504 ? 38.942 39.643 14.662  1.00 77.27  ? 504 GLU A CD  1 
ATOM   3705 O OE1 . GLU A 1 504 ? 39.838 39.736 13.789  1.00 77.18  ? 504 GLU A OE1 1 
ATOM   3706 O OE2 . GLU A 1 504 ? 38.031 38.784 14.610  1.00 79.18  ? 504 GLU A OE2 1 
ATOM   3707 N N   . LEU A 1 505 ? 37.819 44.753 14.897  1.00 68.96  ? 505 LEU A N   1 
ATOM   3708 C CA  . LEU A 1 505 ? 36.716 45.625 15.279  1.00 66.96  ? 505 LEU A CA  1 
ATOM   3709 C C   . LEU A 1 505 ? 35.961 45.947 13.989  1.00 65.94  ? 505 LEU A C   1 
ATOM   3710 O O   . LEU A 1 505 ? 34.727 45.888 13.938  1.00 66.32  ? 505 LEU A O   1 
ATOM   3711 C CB  . LEU A 1 505 ? 37.227 46.912 15.931  1.00 67.00  ? 505 LEU A CB  1 
ATOM   3712 C CG  . LEU A 1 505 ? 36.123 47.880 16.386  1.00 67.28  ? 505 LEU A CG  1 
ATOM   3713 C CD1 . LEU A 1 505 ? 35.102 47.118 17.228  1.00 66.18  ? 505 LEU A CD1 1 
ATOM   3714 C CD2 . LEU A 1 505 ? 36.721 49.038 17.177  1.00 64.68  ? 505 LEU A CD2 1 
ATOM   3715 N N   . GLY A 1 506 ? 36.711 46.285 12.943  1.00 64.87  ? 506 GLY A N   1 
ATOM   3716 C CA  . GLY A 1 506 ? 36.095 46.564 11.660  1.00 59.86  ? 506 GLY A CA  1 
ATOM   3717 C C   . GLY A 1 506 ? 35.264 45.344 11.341  1.00 57.07  ? 506 GLY A C   1 
ATOM   3718 O O   . GLY A 1 506 ? 34.076 45.458 11.105  1.00 55.65  ? 506 GLY A O   1 
ATOM   3719 N N   . LYS A 1 507 ? 35.889 44.168 11.362  1.00 57.93  ? 507 LYS A N   1 
ATOM   3720 C CA  . LYS A 1 507 ? 35.175 42.925 11.093  1.00 59.08  ? 507 LYS A CA  1 
ATOM   3721 C C   . LYS A 1 507 ? 33.924 42.851 11.979  1.00 61.20  ? 507 LYS A C   1 
ATOM   3722 O O   . LYS A 1 507 ? 32.840 42.475 11.508  1.00 61.17  ? 507 LYS A O   1 
ATOM   3723 C CB  . LYS A 1 507 ? 36.062 41.710 11.366  1.00 57.30  ? 507 LYS A CB  1 
ATOM   3724 C CG  . LYS A 1 507 ? 35.451 40.395 10.869  1.00 60.00  ? 507 LYS A CG  1 
ATOM   3725 C CD  . LYS A 1 507 ? 36.011 39.192 11.621  1.00 62.39  ? 507 LYS A CD  1 
ATOM   3726 C CE  . LYS A 1 507 ? 35.028 38.010 11.659  1.00 65.79  ? 507 LYS A CE  1 
ATOM   3727 N NZ  . LYS A 1 507 ? 35.056 37.127 10.440  1.00 64.50  ? 507 LYS A NZ  1 
ATOM   3728 N N   . ARG A 1 508 ? 34.080 43.218 13.255  1.00 61.55  ? 508 ARG A N   1 
ATOM   3729 C CA  . ARG A 1 508 ? 32.969 43.209 14.215  1.00 60.14  ? 508 ARG A CA  1 
ATOM   3730 C C   . ARG A 1 508 ? 31.936 44.299 13.955  1.00 57.49  ? 508 ARG A C   1 
ATOM   3731 O O   . ARG A 1 508 ? 30.747 44.011 13.840  1.00 57.44  ? 508 ARG A O   1 
ATOM   3732 C CB  . ARG A 1 508 ? 33.471 43.358 15.660  1.00 62.23  ? 508 ARG A CB  1 
ATOM   3733 C CG  . ARG A 1 508 ? 34.068 42.100 16.259  1.00 64.01  ? 508 ARG A CG  1 
ATOM   3734 C CD  . ARG A 1 508 ? 33.849 42.034 17.760  1.00 67.64  ? 508 ARG A CD  1 
ATOM   3735 N NE  . ARG A 1 508 ? 34.025 43.322 18.428  1.00 71.09  ? 508 ARG A NE  1 
ATOM   3736 C CZ  . ARG A 1 508 ? 34.275 43.458 19.728  1.00 72.63  ? 508 ARG A CZ  1 
ATOM   3737 N NH1 . ARG A 1 508 ? 34.395 42.393 20.507  1.00 75.55  ? 508 ARG A NH1 1 
ATOM   3738 N NH2 . ARG A 1 508 ? 34.362 44.657 20.268  1.00 75.60  ? 508 ARG A NH2 1 
ATOM   3739 N N   . MET A 1 509 ? 32.379 45.547 13.874  1.00 53.32  ? 509 MET A N   1 
ATOM   3740 C CA  . MET A 1 509 ? 31.448 46.631 13.635  1.00 54.64  ? 509 MET A CA  1 
ATOM   3741 C C   . MET A 1 509 ? 30.689 46.485 12.311  1.00 56.38  ? 509 MET A C   1 
ATOM   3742 O O   . MET A 1 509 ? 29.492 46.767 12.250  1.00 59.69  ? 509 MET A O   1 
ATOM   3743 C CB  . MET A 1 509 ? 32.172 47.982 13.702  1.00 52.14  ? 509 MET A CB  1 
ATOM   3744 C CG  . MET A 1 509 ? 32.282 48.535 15.121  1.00 47.80  ? 509 MET A CG  1 
ATOM   3745 S SD  . MET A 1 509 ? 33.362 49.972 15.293  1.00 51.48  ? 509 MET A SD  1 
ATOM   3746 C CE  . MET A 1 509 ? 32.317 51.277 14.826  1.00 45.99  ? 509 MET A CE  1 
ATOM   3747 N N   . LEU A 1 510 ? 31.370 46.026 11.264  1.00 56.25  ? 510 LEU A N   1 
ATOM   3748 C CA  . LEU A 1 510 ? 30.750 45.849 9.950   1.00 54.54  ? 510 LEU A CA  1 
ATOM   3749 C C   . LEU A 1 510 ? 29.754 44.694 10.026  1.00 55.35  ? 510 LEU A C   1 
ATOM   3750 O O   . LEU A 1 510 ? 28.668 44.744 9.440   1.00 55.33  ? 510 LEU A O   1 
ATOM   3751 C CB  . LEU A 1 510 ? 31.843 45.567 8.906   1.00 53.33  ? 510 LEU A CB  1 
ATOM   3752 C CG  . LEU A 1 510 ? 31.628 45.588 7.384   1.00 52.75  ? 510 LEU A CG  1 
ATOM   3753 C CD1 . LEU A 1 510 ? 30.908 44.342 6.964   1.00 52.80  ? 510 LEU A CD1 1 
ATOM   3754 C CD2 . LEU A 1 510 ? 30.873 46.829 6.950   1.00 51.33  ? 510 LEU A CD2 1 
ATOM   3755 N N   . SER A 1 511 ? 30.125 43.658 10.769  1.00 56.48  ? 511 SER A N   1 
ATOM   3756 C CA  . SER A 1 511 ? 29.269 42.487 10.931  1.00 57.85  ? 511 SER A CA  1 
ATOM   3757 C C   . SER A 1 511 ? 28.056 42.821 11.783  1.00 57.79  ? 511 SER A C   1 
ATOM   3758 O O   . SER A 1 511 ? 27.050 42.100 11.775  1.00 58.28  ? 511 SER A O   1 
ATOM   3759 C CB  . SER A 1 511 ? 30.044 41.344 11.580  1.00 58.34  ? 511 SER A CB  1 
ATOM   3760 O OG  . SER A 1 511 ? 29.207 40.216 11.744  1.00 60.32  ? 511 SER A OG  1 
ATOM   3761 N N   . ALA A 1 512 ? 28.170 43.912 12.531  1.00 56.83  ? 512 ALA A N   1 
ATOM   3762 C CA  . ALA A 1 512 ? 27.084 44.386 13.380  1.00 53.94  ? 512 ALA A CA  1 
ATOM   3763 C C   . ALA A 1 512 ? 26.074 45.026 12.444  1.00 50.56  ? 512 ALA A C   1 
ATOM   3764 O O   . ALA A 1 512 ? 24.909 44.647 12.406  1.00 50.58  ? 512 ALA A O   1 
ATOM   3765 C CB  . ALA A 1 512 ? 27.602 45.424 14.380  1.00 54.35  ? 512 ALA A CB  1 
ATOM   3766 N N   . VAL A 1 513 ? 26.540 45.996 11.675  1.00 47.24  ? 513 VAL A N   1 
ATOM   3767 C CA  . VAL A 1 513 ? 25.670 46.677 10.744  1.00 45.43  ? 513 VAL A CA  1 
ATOM   3768 C C   . VAL A 1 513 ? 24.975 45.698 9.809   1.00 45.25  ? 513 VAL A C   1 
ATOM   3769 O O   . VAL A 1 513 ? 23.804 45.871 9.495   1.00 44.02  ? 513 VAL A O   1 
ATOM   3770 C CB  . VAL A 1 513 ? 26.448 47.693 9.920   1.00 41.89  ? 513 VAL A CB  1 
ATOM   3771 C CG1 . VAL A 1 513 ? 25.542 48.340 8.922   1.00 40.33  ? 513 VAL A CG1 1 
ATOM   3772 C CG2 . VAL A 1 513 ? 27.032 48.741 10.829  1.00 41.17  ? 513 VAL A CG2 1 
ATOM   3773 N N   . ILE A 1 514 ? 25.681 44.656 9.384   1.00 46.69  ? 514 ILE A N   1 
ATOM   3774 C CA  . ILE A 1 514 ? 25.091 43.685 8.461   1.00 47.40  ? 514 ILE A CA  1 
ATOM   3775 C C   . ILE A 1 514 ? 24.002 42.820 9.089   1.00 47.84  ? 514 ILE A C   1 
ATOM   3776 O O   . ILE A 1 514 ? 22.861 42.833 8.633   1.00 47.76  ? 514 ILE A O   1 
ATOM   3777 C CB  . ILE A 1 514 ? 26.174 42.777 7.827   1.00 46.08  ? 514 ILE A CB  1 
ATOM   3778 C CG1 . ILE A 1 514 ? 27.166 43.631 7.039   1.00 44.34  ? 514 ILE A CG1 1 
ATOM   3779 C CG2 . ILE A 1 514 ? 25.535 41.775 6.884   1.00 45.45  ? 514 ILE A CG2 1 
ATOM   3780 C CD1 . ILE A 1 514 ? 26.518 44.476 5.954   1.00 43.87  ? 514 ILE A CD1 1 
ATOM   3781 N N   . GLU A 1 515 ? 24.341 42.067 10.127  1.00 48.88  ? 515 GLU A N   1 
ATOM   3782 C CA  . GLU A 1 515 ? 23.334 41.234 10.771  1.00 50.43  ? 515 GLU A CA  1 
ATOM   3783 C C   . GLU A 1 515 ? 22.144 42.089 11.185  1.00 49.67  ? 515 GLU A C   1 
ATOM   3784 O O   . GLU A 1 515 ? 21.014 41.605 11.281  1.00 48.98  ? 515 GLU A O   1 
ATOM   3785 C CB  . GLU A 1 515 ? 23.908 40.519 11.999  1.00 52.74  ? 515 GLU A CB  1 
ATOM   3786 C CG  . GLU A 1 515 ? 24.629 39.222 11.678  1.00 58.36  ? 515 GLU A CG  1 
ATOM   3787 C CD  . GLU A 1 515 ? 23.843 38.351 10.714  1.00 60.55  ? 515 GLU A CD  1 
ATOM   3788 O OE1 . GLU A 1 515 ? 22.934 37.627 11.172  1.00 62.75  ? 515 GLU A OE1 1 
ATOM   3789 O OE2 . GLU A 1 515 ? 24.126 38.400 9.496   1.00 63.67  ? 515 GLU A OE2 1 
ATOM   3790 N N   . PHE A 1 516 ? 22.400 43.369 11.439  1.00 49.06  ? 516 PHE A N   1 
ATOM   3791 C CA  . PHE A 1 516 ? 21.320 44.251 11.825  1.00 45.10  ? 516 PHE A CA  1 
ATOM   3792 C C   . PHE A 1 516 ? 20.424 44.451 10.627  1.00 45.97  ? 516 PHE A C   1 
ATOM   3793 O O   . PHE A 1 516 ? 19.200 44.366 10.726  1.00 46.60  ? 516 PHE A O   1 
ATOM   3794 C CB  . PHE A 1 516 ? 21.820 45.605 12.277  1.00 39.09  ? 516 PHE A CB  1 
ATOM   3795 C CG  . PHE A 1 516 ? 20.715 46.588 12.468  1.00 39.00  ? 516 PHE A CG  1 
ATOM   3796 C CD1 . PHE A 1 516 ? 19.692 46.328 13.380  1.00 39.12  ? 516 PHE A CD1 1 
ATOM   3797 C CD2 . PHE A 1 516 ? 20.642 47.735 11.686  1.00 36.93  ? 516 PHE A CD2 1 
ATOM   3798 C CE1 . PHE A 1 516 ? 18.612 47.193 13.506  1.00 36.30  ? 516 PHE A CE1 1 
ATOM   3799 C CE2 . PHE A 1 516 ? 19.574 48.602 11.799  1.00 34.65  ? 516 PHE A CE2 1 
ATOM   3800 C CZ  . PHE A 1 516 ? 18.554 48.331 12.712  1.00 37.25  ? 516 PHE A CZ  1 
ATOM   3801 N N   . ALA A 1 517 ? 21.040 44.720 9.486   1.00 45.68  ? 517 ALA A N   1 
ATOM   3802 C CA  . ALA A 1 517 ? 20.270 44.928 8.279   1.00 46.53  ? 517 ALA A CA  1 
ATOM   3803 C C   . ALA A 1 517 ? 19.633 43.612 7.832   1.00 47.67  ? 517 ALA A C   1 
ATOM   3804 O O   . ALA A 1 517 ? 18.613 43.617 7.148   1.00 49.06  ? 517 ALA A O   1 
ATOM   3805 C CB  . ALA A 1 517 ? 21.159 45.495 7.183   1.00 45.23  ? 517 ALA A CB  1 
ATOM   3806 N N   . LYS A 1 518 ? 20.222 42.489 8.240   1.00 47.91  ? 518 LYS A N   1 
ATOM   3807 C CA  . LYS A 1 518 ? 19.710 41.173 7.862   1.00 47.88  ? 518 LYS A CA  1 
ATOM   3808 C C   . LYS A 1 518 ? 18.617 40.635 8.759   1.00 49.51  ? 518 LYS A C   1 
ATOM   3809 O O   . LYS A 1 518 ? 17.650 40.040 8.280   1.00 50.44  ? 518 LYS A O   1 
ATOM   3810 C CB  . LYS A 1 518 ? 20.832 40.142 7.847   1.00 47.41  ? 518 LYS A CB  1 
ATOM   3811 C CG  . LYS A 1 518 ? 21.716 40.172 6.622   1.00 49.21  ? 518 LYS A CG  1 
ATOM   3812 C CD  . LYS A 1 518 ? 22.675 38.999 6.632   1.00 46.71  ? 518 LYS A CD  1 
ATOM   3813 C CE  . LYS A 1 518 ? 23.542 38.989 5.400   1.00 47.25  ? 518 LYS A CE  1 
ATOM   3814 N NZ  . LYS A 1 518 ? 24.332 37.731 5.328   1.00 48.25  ? 518 LYS A NZ  1 
ATOM   3815 N N   . THR A 1 519 ? 18.780 40.836 10.063  1.00 51.07  ? 519 THR A N   1 
ATOM   3816 C CA  . THR A 1 519 ? 17.832 40.322 11.045  1.00 52.30  ? 519 THR A CA  1 
ATOM   3817 C C   . THR A 1 519 ? 17.233 41.382 11.953  1.00 53.79  ? 519 THR A C   1 
ATOM   3818 O O   . THR A 1 519 ? 16.351 41.080 12.757  1.00 54.01  ? 519 THR A O   1 
ATOM   3819 C CB  . THR A 1 519 ? 18.506 39.319 11.972  1.00 53.61  ? 519 THR A CB  1 
ATOM   3820 O OG1 . THR A 1 519 ? 19.237 40.036 12.977  1.00 54.01  ? 519 THR A OG1 1 
ATOM   3821 C CG2 . THR A 1 519 ? 19.479 38.436 11.193  1.00 54.20  ? 519 THR A CG2 1 
ATOM   3822 N N   . GLY A 1 520 ? 17.719 42.614 11.846  1.00 53.90  ? 520 GLY A N   1 
ATOM   3823 C CA  . GLY A 1 520 ? 17.209 43.671 12.699  1.00 54.46  ? 520 GLY A CA  1 
ATOM   3824 C C   . GLY A 1 520 ? 17.821 43.521 14.072  1.00 54.73  ? 520 GLY A C   1 
ATOM   3825 O O   . GLY A 1 520 ? 17.335 44.053 15.063  1.00 55.29  ? 520 GLY A O   1 
ATOM   3826 N N   . ASN A 1 521 ? 18.910 42.775 14.126  1.00 57.60  ? 521 ASN A N   1 
ATOM   3827 C CA  . ASN A 1 521 ? 19.593 42.541 15.378  1.00 60.01  ? 521 ASN A CA  1 
ATOM   3828 C C   . ASN A 1 521 ? 21.098 42.553 15.152  1.00 62.03  ? 521 ASN A C   1 
ATOM   3829 O O   . ASN A 1 521 ? 21.650 41.648 14.525  1.00 62.48  ? 521 ASN A O   1 
ATOM   3830 C CB  . ASN A 1 521 ? 19.155 41.209 15.949  1.00 60.19  ? 521 ASN A CB  1 
ATOM   3831 C CG  . ASN A 1 521 ? 19.134 41.222 17.434  1.00 61.70  ? 521 ASN A CG  1 
ATOM   3832 O OD1 . ASN A 1 521 ? 20.152 41.493 18.065  1.00 62.04  ? 521 ASN A OD1 1 
ATOM   3833 N ND2 . ASN A 1 521 ? 17.971 40.948 18.019  1.00 62.07  ? 521 ASN A ND2 1 
ATOM   3834 N N   . PRO A 1 522 ? 21.781 43.588 15.663  1.00 62.92  ? 522 PRO A N   1 
ATOM   3835 C CA  . PRO A 1 522 ? 23.227 43.759 15.528  1.00 64.44  ? 522 PRO A CA  1 
ATOM   3836 C C   . PRO A 1 522 ? 23.968 42.735 16.349  1.00 67.13  ? 522 PRO A C   1 
ATOM   3837 O O   . PRO A 1 522 ? 25.176 42.562 16.207  1.00 67.94  ? 522 PRO A O   1 
ATOM   3838 C CB  . PRO A 1 522 ? 23.445 45.169 16.056  1.00 61.70  ? 522 PRO A CB  1 
ATOM   3839 C CG  . PRO A 1 522 ? 22.481 45.218 17.177  1.00 59.55  ? 522 PRO A CG  1 
ATOM   3840 C CD  . PRO A 1 522 ? 21.229 44.616 16.563  1.00 60.68  ? 522 PRO A CD  1 
ATOM   3841 N N   . ALA A 1 523 ? 23.226 42.062 17.216  1.00 70.79  ? 523 ALA A N   1 
ATOM   3842 C CA  . ALA A 1 523 ? 23.815 41.075 18.100  1.00 74.75  ? 523 ALA A CA  1 
ATOM   3843 C C   . ALA A 1 523 ? 24.622 40.054 17.334  1.00 76.16  ? 523 ALA A C   1 
ATOM   3844 O O   . ALA A 1 523 ? 25.736 40.327 16.897  1.00 76.13  ? 523 ALA A O   1 
ATOM   3845 C CB  . ALA A 1 523 ? 22.722 40.378 18.920  1.00 75.43  ? 523 ALA A CB  1 
ATOM   3846 N N   . GLN A 1 524 ? 24.024 38.881 17.189  1.00 78.87  ? 524 GLN A N   1 
ATOM   3847 C CA  . GLN A 1 524 ? 24.599 37.736 16.514  1.00 82.60  ? 524 GLN A CA  1 
ATOM   3848 C C   . GLN A 1 524 ? 24.656 36.583 17.504  1.00 84.36  ? 524 GLN A C   1 
ATOM   3849 O O   . GLN A 1 524 ? 24.959 36.746 18.694  1.00 84.86  ? 524 GLN A O   1 
ATOM   3850 C CB  . GLN A 1 524 ? 26.003 38.021 15.969  1.00 84.94  ? 524 GLN A CB  1 
ATOM   3851 C CG  . GLN A 1 524 ? 27.119 38.087 17.013  1.00 88.94  ? 524 GLN A CG  1 
ATOM   3852 C CD  . GLN A 1 524 ? 28.387 38.703 16.444  1.00 91.91  ? 524 GLN A CD  1 
ATOM   3853 O OE1 . GLN A 1 524 ? 28.642 38.631 15.237  1.00 93.05  ? 524 GLN A OE1 1 
ATOM   3854 N NE2 . GLN A 1 524 ? 29.193 39.303 17.309  1.00 94.20  ? 524 GLN A NE2 1 
ATOM   3855 N N   . ASP A 1 525 ? 24.325 35.419 16.970  1.00 85.29  ? 525 ASP A N   1 
ATOM   3856 C CA  . ASP A 1 525 ? 24.296 34.144 17.660  1.00 84.39  ? 525 ASP A CA  1 
ATOM   3857 C C   . ASP A 1 525 ? 25.591 33.892 18.456  1.00 82.49  ? 525 ASP A C   1 
ATOM   3858 O O   . ASP A 1 525 ? 26.635 33.585 17.874  1.00 81.43  ? 525 ASP A O   1 
ATOM   3859 C CB  . ASP A 1 525 ? 24.083 33.046 16.601  1.00 86.06  ? 525 ASP A CB  1 
ATOM   3860 C CG  . ASP A 1 525 ? 23.985 33.609 15.152  1.00 86.78  ? 525 ASP A CG  1 
ATOM   3861 O OD1 . ASP A 1 525 ? 24.260 34.809 14.913  1.00 86.62  ? 525 ASP A OD1 1 
ATOM   3862 O OD2 . ASP A 1 525 ? 23.639 32.837 14.232  1.00 86.73  ? 525 ASP A OD2 1 
ATOM   3863 N N   . GLY A 1 526 ? 25.520 34.031 19.780  1.00 80.11  ? 526 GLY A N   1 
ATOM   3864 C CA  . GLY A 1 526 ? 26.694 33.805 20.612  1.00 76.97  ? 526 GLY A CA  1 
ATOM   3865 C C   . GLY A 1 526 ? 27.205 35.030 21.350  1.00 74.83  ? 526 GLY A C   1 
ATOM   3866 O O   . GLY A 1 526 ? 27.921 34.924 22.352  1.00 74.67  ? 526 GLY A O   1 
ATOM   3867 N N   . GLU A 1 527 ? 26.844 36.205 20.855  1.00 72.34  ? 527 GLU A N   1 
ATOM   3868 C CA  . GLU A 1 527 ? 27.272 37.433 21.489  1.00 69.61  ? 527 GLU A CA  1 
ATOM   3869 C C   . GLU A 1 527 ? 26.071 38.118 22.113  1.00 65.50  ? 527 GLU A C   1 
ATOM   3870 O O   . GLU A 1 527 ? 25.034 38.273 21.477  1.00 64.49  ? 527 GLU A O   1 
ATOM   3871 C CB  . GLU A 1 527 ? 27.913 38.341 20.456  1.00 73.22  ? 527 GLU A CB  1 
ATOM   3872 C CG  . GLU A 1 527 ? 28.595 39.555 21.036  1.00 80.17  ? 527 GLU A CG  1 
ATOM   3873 C CD  . GLU A 1 527 ? 29.113 40.451 19.939  1.00 84.25  ? 527 GLU A CD  1 
ATOM   3874 O OE1 . GLU A 1 527 ? 28.381 40.590 18.940  1.00 86.92  ? 527 GLU A OE1 1 
ATOM   3875 O OE2 . GLU A 1 527 ? 30.227 41.010 20.064  1.00 87.07  ? 527 GLU A OE2 1 
ATOM   3876 N N   . GLU A 1 528 ? 26.201 38.521 23.366  1.00 61.50  ? 528 GLU A N   1 
ATOM   3877 C CA  . GLU A 1 528 ? 25.097 39.187 24.019  1.00 57.28  ? 528 GLU A CA  1 
ATOM   3878 C C   . GLU A 1 528 ? 25.104 40.667 23.721  1.00 54.32  ? 528 GLU A C   1 
ATOM   3879 O O   . GLU A 1 528 ? 26.102 41.350 23.948  1.00 55.13  ? 528 GLU A O   1 
ATOM   3880 C CB  . GLU A 1 528 ? 25.157 38.989 25.531  1.00 58.35  ? 528 GLU A CB  1 
ATOM   3881 C CG  . GLU A 1 528 ? 24.700 37.620 26.004  1.00 60.26  ? 528 GLU A CG  1 
ATOM   3882 C CD  . GLU A 1 528 ? 23.271 37.314 25.613  1.00 61.17  ? 528 GLU A CD  1 
ATOM   3883 O OE1 . GLU A 1 528 ? 22.358 38.082 25.993  1.00 62.05  ? 528 GLU A OE1 1 
ATOM   3884 O OE2 . GLU A 1 528 ? 23.063 36.297 24.924  1.00 62.75  ? 528 GLU A OE2 1 
ATOM   3885 N N   . TRP A 1 529 ? 23.990 41.149 23.184  1.00 49.65  ? 529 TRP A N   1 
ATOM   3886 C CA  . TRP A 1 529 ? 23.811 42.561 22.896  1.00 46.23  ? 529 TRP A CA  1 
ATOM   3887 C C   . TRP A 1 529 ? 22.339 42.816 23.172  1.00 45.98  ? 529 TRP A C   1 
ATOM   3888 O O   . TRP A 1 529 ? 21.515 42.829 22.262  1.00 46.10  ? 529 TRP A O   1 
ATOM   3889 C CB  . TRP A 1 529 ? 24.130 42.901 21.443  1.00 42.24  ? 529 TRP A CB  1 
ATOM   3890 C CG  . TRP A 1 529 ? 24.198 44.381 21.230  1.00 41.02  ? 529 TRP A CG  1 
ATOM   3891 C CD1 . TRP A 1 529 ? 23.554 45.337 21.957  1.00 39.50  ? 529 TRP A CD1 1 
ATOM   3892 C CD2 . TRP A 1 529 ? 24.903 45.072 20.197  1.00 40.41  ? 529 TRP A CD2 1 
ATOM   3893 N NE1 . TRP A 1 529 ? 23.807 46.578 21.441  1.00 40.78  ? 529 TRP A NE1 1 
ATOM   3894 C CE2 . TRP A 1 529 ? 24.632 46.448 20.357  1.00 41.17  ? 529 TRP A CE2 1 
ATOM   3895 C CE3 . TRP A 1 529 ? 25.739 44.666 19.153  1.00 41.60  ? 529 TRP A CE3 1 
ATOM   3896 C CZ2 . TRP A 1 529 ? 25.168 47.426 19.510  1.00 42.85  ? 529 TRP A CZ2 1 
ATOM   3897 C CZ3 . TRP A 1 529 ? 26.276 45.636 18.308  1.00 44.00  ? 529 TRP A CZ3 1 
ATOM   3898 C CH2 . TRP A 1 529 ? 25.986 47.003 18.494  1.00 44.50  ? 529 TRP A CH2 1 
ATOM   3899 N N   . PRO A 1 530 ? 21.991 43.015 24.450  1.00 46.21  ? 530 PRO A N   1 
ATOM   3900 C CA  . PRO A 1 530 ? 20.620 43.267 24.904  1.00 44.72  ? 530 PRO A CA  1 
ATOM   3901 C C   . PRO A 1 530 ? 19.983 44.533 24.334  1.00 44.11  ? 530 PRO A C   1 
ATOM   3902 O O   . PRO A 1 530 ? 20.671 45.516 24.026  1.00 40.96  ? 530 PRO A O   1 
ATOM   3903 C CB  . PRO A 1 530 ? 20.770 43.354 26.420  1.00 44.57  ? 530 PRO A CB  1 
ATOM   3904 C CG  . PRO A 1 530 ? 22.046 42.609 26.701  1.00 44.76  ? 530 PRO A CG  1 
ATOM   3905 C CD  . PRO A 1 530 ? 22.923 43.052 25.589  1.00 45.00  ? 530 PRO A CD  1 
ATOM   3906 N N   . ASN A 1 531 ? 18.659 44.484 24.206  1.00 42.27  ? 531 ASN A N   1 
ATOM   3907 C CA  . ASN A 1 531 ? 17.871 45.599 23.717  1.00 41.32  ? 531 ASN A CA  1 
ATOM   3908 C C   . ASN A 1 531 ? 18.036 46.771 24.667  1.00 41.45  ? 531 ASN A C   1 
ATOM   3909 O O   . ASN A 1 531 ? 18.294 46.583 25.856  1.00 41.70  ? 531 ASN A O   1 
ATOM   3910 C CB  . ASN A 1 531 ? 16.404 45.196 23.665  1.00 41.27  ? 531 ASN A CB  1 
ATOM   3911 C CG  . ASN A 1 531 ? 15.970 44.792 22.286  1.00 44.05  ? 531 ASN A CG  1 
ATOM   3912 O OD1 . ASN A 1 531 ? 15.705 45.647 21.439  1.00 46.74  ? 531 ASN A OD1 1 
ATOM   3913 N ND2 . ASN A 1 531 ? 15.910 43.485 22.034  1.00 44.68  ? 531 ASN A ND2 1 
ATOM   3914 N N   . PHE A 1 532 ? 17.879 47.981 24.146  1.00 39.70  ? 532 PHE A N   1 
ATOM   3915 C CA  . PHE A 1 532 ? 17.992 49.179 24.967  1.00 39.78  ? 532 PHE A CA  1 
ATOM   3916 C C   . PHE A 1 532 ? 16.618 49.796 25.241  1.00 40.74  ? 532 PHE A C   1 
ATOM   3917 O O   . PHE A 1 532 ? 15.753 49.833 24.365  1.00 40.31  ? 532 PHE A O   1 
ATOM   3918 C CB  . PHE A 1 532 ? 18.883 50.193 24.269  1.00 39.24  ? 532 PHE A CB  1 
ATOM   3919 C CG  . PHE A 1 532 ? 18.828 51.559 24.865  1.00 38.12  ? 532 PHE A CG  1 
ATOM   3920 C CD1 . PHE A 1 532 ? 17.780 52.423 24.566  1.00 37.40  ? 532 PHE A CD1 1 
ATOM   3921 C CD2 . PHE A 1 532 ? 19.841 51.999 25.702  1.00 37.77  ? 532 PHE A CD2 1 
ATOM   3922 C CE1 . PHE A 1 532 ? 17.747 53.710 25.087  1.00 36.49  ? 532 PHE A CE1 1 
ATOM   3923 C CE2 . PHE A 1 532 ? 19.815 53.288 26.227  1.00 37.42  ? 532 PHE A CE2 1 
ATOM   3924 C CZ  . PHE A 1 532 ? 18.767 54.145 25.917  1.00 35.58  ? 532 PHE A CZ  1 
ATOM   3925 N N   . SER A 1 533 ? 16.427 50.293 26.456  1.00 39.77  ? 533 SER A N   1 
ATOM   3926 C CA  . SER A 1 533 ? 15.156 50.893 26.837  1.00 39.80  ? 533 SER A CA  1 
ATOM   3927 C C   . SER A 1 533 ? 15.376 51.636 28.129  1.00 39.92  ? 533 SER A C   1 
ATOM   3928 O O   . SER A 1 533 ? 16.295 51.314 28.865  1.00 42.51  ? 533 SER A O   1 
ATOM   3929 C CB  . SER A 1 533 ? 14.102 49.811 27.060  1.00 39.45  ? 533 SER A CB  1 
ATOM   3930 O OG  . SER A 1 533 ? 14.469 48.955 28.132  1.00 38.59  ? 533 SER A OG  1 
ATOM   3931 N N   . LYS A 1 534 ? 14.534 52.620 28.414  1.00 39.44  ? 534 LYS A N   1 
ATOM   3932 C CA  . LYS A 1 534 ? 14.681 53.386 29.636  1.00 39.06  ? 534 LYS A CA  1 
ATOM   3933 C C   . LYS A 1 534 ? 14.882 52.474 30.832  1.00 37.65  ? 534 LYS A C   1 
ATOM   3934 O O   . LYS A 1 534 ? 15.687 52.770 31.694  1.00 35.95  ? 534 LYS A O   1 
ATOM   3935 C CB  . LYS A 1 534 ? 13.458 54.281 29.866  1.00 40.61  ? 534 LYS A CB  1 
ATOM   3936 C CG  . LYS A 1 534 ? 13.510 55.074 31.171  1.00 40.97  ? 534 LYS A CG  1 
ATOM   3937 C CD  . LYS A 1 534 ? 12.294 55.985 31.361  1.00 42.63  ? 534 LYS A CD  1 
ATOM   3938 C CE  . LYS A 1 534 ? 12.408 57.293 30.566  1.00 43.60  ? 534 LYS A CE  1 
ATOM   3939 N NZ  . LYS A 1 534 ? 12.274 57.118 29.088  1.00 42.62  ? 534 LYS A NZ  1 
ATOM   3940 N N   . GLU A 1 535 ? 14.163 51.359 30.872  1.00 40.51  ? 535 GLU A N   1 
ATOM   3941 C CA  . GLU A 1 535 ? 14.255 50.407 31.993  1.00 44.02  ? 535 GLU A CA  1 
ATOM   3942 C C   . GLU A 1 535 ? 15.677 49.935 32.223  1.00 43.58  ? 535 GLU A C   1 
ATOM   3943 O O   . GLU A 1 535 ? 16.278 50.195 33.261  1.00 45.08  ? 535 GLU A O   1 
ATOM   3944 C CB  . GLU A 1 535 ? 13.372 49.176 31.738  1.00 46.94  ? 535 GLU A CB  1 
ATOM   3945 C CG  . GLU A 1 535 ? 11.899 49.491 31.438  1.00 52.46  ? 535 GLU A CG  1 
ATOM   3946 C CD  . GLU A 1 535 ? 11.715 50.373 30.201  1.00 53.76  ? 535 GLU A CD  1 
ATOM   3947 O OE1 . GLU A 1 535 ? 12.248 50.017 29.131  1.00 56.56  ? 535 GLU A OE1 1 
ATOM   3948 O OE2 . GLU A 1 535 ? 11.038 51.417 30.295  1.00 52.67  ? 535 GLU A OE2 1 
ATOM   3949 N N   . ASP A 1 536 ? 16.192 49.226 31.230  1.00 43.93  ? 536 ASP A N   1 
ATOM   3950 C CA  . ASP A 1 536 ? 17.539 48.677 31.229  1.00 42.45  ? 536 ASP A CA  1 
ATOM   3951 C C   . ASP A 1 536 ? 18.242 49.304 30.007  1.00 41.54  ? 536 ASP A C   1 
ATOM   3952 O O   . ASP A 1 536 ? 18.240 48.738 28.917  1.00 44.42  ? 536 ASP A O   1 
ATOM   3953 C CB  . ASP A 1 536 ? 17.416 47.150 31.124  1.00 42.51  ? 536 ASP A CB  1 
ATOM   3954 C CG  . ASP A 1 536 ? 18.710 46.474 30.774  1.00 42.92  ? 536 ASP A CG  1 
ATOM   3955 O OD1 . ASP A 1 536 ? 19.704 46.639 31.504  1.00 42.65  ? 536 ASP A OD1 1 
ATOM   3956 O OD2 . ASP A 1 536 ? 18.725 45.758 29.755  1.00 46.66  ? 536 ASP A OD2 1 
ATOM   3957 N N   . PRO A 1 537 ? 18.896 50.483 30.160  1.00 38.85  ? 537 PRO A N   1 
ATOM   3958 C CA  . PRO A 1 537 ? 19.536 51.218 29.084  1.00 39.55  ? 537 PRO A CA  1 
ATOM   3959 C C   . PRO A 1 537 ? 20.875 50.611 28.774  1.00 42.35  ? 537 PRO A C   1 
ATOM   3960 O O   . PRO A 1 537 ? 21.922 51.340 28.708  1.00 40.99  ? 537 PRO A O   1 
ATOM   3961 C CB  . PRO A 1 537 ? 19.655 52.624 29.614  1.00 37.72  ? 537 PRO A CB  1 
ATOM   3962 C CG  . PRO A 1 537 ? 19.057 52.643 31.010  1.00 35.00  ? 537 PRO A CG  1 
ATOM   3963 C CD  . PRO A 1 537 ? 18.571 51.265 31.351  1.00 36.37  ? 537 PRO A CD  1 
ATOM   3964 N N   . VAL A 1 538 ? 20.953 49.322 28.455  1.00 44.26  ? 538 VAL A N   1 
ATOM   3965 C CA  . VAL A 1 538 ? 22.189 48.640 28.094  1.00 45.92  ? 538 VAL A CA  1 
ATOM   3966 C C   . VAL A 1 538 ? 22.614 49.025 26.706  1.00 46.00  ? 538 VAL A C   1 
ATOM   3967 O O   . VAL A 1 538 ? 21.794 49.082 25.797  1.00 47.77  ? 538 VAL A O   1 
ATOM   3968 C CB  . VAL A 1 538 ? 22.012 47.118 28.062  1.00 47.58  ? 538 VAL A CB  1 
ATOM   3969 C CG1 . VAL A 1 538 ? 23.363 46.436 27.938  1.00 48.01  ? 538 VAL A CG1 1 
ATOM   3970 C CG2 . VAL A 1 538 ? 21.300 46.666 29.284  1.00 49.77  ? 538 VAL A CG2 1 
ATOM   3971 N N   . TYR A 1 539 ? 23.899 49.279 26.539  1.00 47.31  ? 539 TYR A N   1 
ATOM   3972 C CA  . TYR A 1 539 ? 24.435 49.614 25.233  1.00 50.55  ? 539 TYR A CA  1 
ATOM   3973 C C   . TYR A 1 539 ? 25.663 48.750 25.026  1.00 51.35  ? 539 TYR A C   1 
ATOM   3974 O O   . TYR A 1 539 ? 26.132 48.090 25.949  1.00 50.47  ? 539 TYR A O   1 
ATOM   3975 C CB  . TYR A 1 539 ? 24.793 51.095 25.160  1.00 52.49  ? 539 TYR A CB  1 
ATOM   3976 C CG  . TYR A 1 539 ? 25.615 51.586 26.320  1.00 55.43  ? 539 TYR A CG  1 
ATOM   3977 C CD1 . TYR A 1 539 ? 26.999 51.454 26.323  1.00 55.15  ? 539 TYR A CD1 1 
ATOM   3978 C CD2 . TYR A 1 539 ? 25.006 52.186 27.424  1.00 56.52  ? 539 TYR A CD2 1 
ATOM   3979 C CE1 . TYR A 1 539 ? 27.762 51.917 27.396  1.00 57.68  ? 539 TYR A CE1 1 
ATOM   3980 C CE2 . TYR A 1 539 ? 25.758 52.647 28.500  1.00 57.07  ? 539 TYR A CE2 1 
ATOM   3981 C CZ  . TYR A 1 539 ? 27.137 52.508 28.479  1.00 57.45  ? 539 TYR A CZ  1 
ATOM   3982 O OH  . TYR A 1 539 ? 27.900 52.967 29.526  1.00 57.29  ? 539 TYR A OH  1 
ATOM   3983 N N   . TYR A 1 540 ? 26.168 48.722 23.803  1.00 53.01  ? 540 TYR A N   1 
ATOM   3984 C CA  . TYR A 1 540 ? 27.340 47.920 23.512  1.00 52.87  ? 540 TYR A CA  1 
ATOM   3985 C C   . TYR A 1 540 ? 28.500 48.860 23.330  1.00 55.82  ? 540 TYR A C   1 
ATOM   3986 O O   . TYR A 1 540 ? 28.468 49.765 22.489  1.00 54.95  ? 540 TYR A O   1 
ATOM   3987 C CB  . TYR A 1 540 ? 27.131 47.118 22.237  1.00 49.88  ? 540 TYR A CB  1 
ATOM   3988 C CG  . TYR A 1 540 ? 28.126 46.002 22.017  1.00 48.01  ? 540 TYR A CG  1 
ATOM   3989 C CD1 . TYR A 1 540 ? 29.405 46.261 21.526  1.00 45.55  ? 540 TYR A CD1 1 
ATOM   3990 C CD2 . TYR A 1 540 ? 27.784 44.684 22.298  1.00 46.95  ? 540 TYR A CD2 1 
ATOM   3991 C CE1 . TYR A 1 540 ? 30.311 45.236 21.322  1.00 44.83  ? 540 TYR A CE1 1 
ATOM   3992 C CE2 . TYR A 1 540 ? 28.681 43.653 22.096  1.00 46.64  ? 540 TYR A CE2 1 
ATOM   3993 C CZ  . TYR A 1 540 ? 29.944 43.935 21.614  1.00 44.97  ? 540 TYR A CZ  1 
ATOM   3994 O OH  . TYR A 1 540 ? 30.845 42.912 21.467  1.00 41.68  ? 540 TYR A OH  1 
ATOM   3995 N N   . ILE A 1 541 ? 29.512 48.707 24.162  1.00 59.22  ? 541 ILE A N   1 
ATOM   3996 C CA  . ILE A 1 541 ? 30.670 49.547 23.964  1.00 64.65  ? 541 ILE A CA  1 
ATOM   3997 C C   . ILE A 1 541 ? 31.410 48.802 22.888  1.00 66.82  ? 541 ILE A C   1 
ATOM   3998 O O   . ILE A 1 541 ? 31.842 47.662 23.108  1.00 68.05  ? 541 ILE A O   1 
ATOM   3999 C CB  . ILE A 1 541 ? 31.543 49.652 25.214  1.00 65.74  ? 541 ILE A CB  1 
ATOM   4000 C CG1 . ILE A 1 541 ? 30.750 50.306 26.348  1.00 65.86  ? 541 ILE A CG1 1 
ATOM   4001 C CG2 . ILE A 1 541 ? 32.807 50.477 24.921  1.00 63.99  ? 541 ILE A CG2 1 
ATOM   4002 C CD1 . ILE A 1 541 ? 31.550 50.540 27.601  1.00 68.72  ? 541 ILE A CD1 1 
ATOM   4003 N N   . PHE A 1 542 ? 31.465 49.388 21.716  1.00 68.62  ? 542 PHE A N   1 
ATOM   4004 C CA  . PHE A 1 542 ? 32.167 48.724 20.654  1.00 69.92  ? 542 PHE A CA  1 
ATOM   4005 C C   . PHE A 1 542 ? 33.577 48.817 21.013  1.00 71.80  ? 542 PHE A C   1 
ATOM   4006 O O   . PHE A 1 542 ? 34.073 48.008 21.790  1.00 71.77  ? 542 PHE A O   1 
ATOM   4007 C CB  . PHE A 1 542 ? 31.959 49.395 19.315  1.00 67.41  ? 542 PHE A CB  1 
ATOM   4008 C CG  . PHE A 1 542 ? 31.050 48.634 18.454  1.00 65.24  ? 542 PHE A CG  1 
ATOM   4009 C CD1 . PHE A 1 542 ? 31.222 47.264 18.318  1.00 63.95  ? 542 PHE A CD1 1 
ATOM   4010 C CD2 . PHE A 1 542 ? 29.952 49.239 17.878  1.00 63.58  ? 542 PHE A CD2 1 
ATOM   4011 C CE1 . PHE A 1 542 ? 30.308 46.505 17.650  1.00 63.02  ? 542 PHE A CE1 1 
ATOM   4012 C CE2 . PHE A 1 542 ? 29.023 48.487 17.202  1.00 64.05  ? 542 PHE A CE2 1 
ATOM   4013 C CZ  . PHE A 1 542 ? 29.204 47.107 17.085  1.00 64.08  ? 542 PHE A CZ  1 
ATOM   4014 N N   . SER A 1 543 ? 34.189 49.845 20.450  1.00 75.70  ? 543 SER A N   1 
ATOM   4015 C CA  . SER A 1 543 ? 35.588 50.150 20.667  1.00 79.98  ? 543 SER A CA  1 
ATOM   4016 C C   . SER A 1 543 ? 36.217 48.919 21.194  1.00 82.27  ? 543 SER A C   1 
ATOM   4017 O O   . SER A 1 543 ? 35.840 48.376 22.222  1.00 83.75  ? 543 SER A O   1 
ATOM   4018 C CB  . SER A 1 543 ? 35.697 51.317 21.585  1.00 81.04  ? 543 SER A CB  1 
ATOM   4019 O OG  . SER A 1 543 ? 35.002 52.356 20.940  1.00 81.93  ? 543 SER A OG  1 
ATOM   4020 N N   . THR A 1 544 ? 37.212 48.505 20.485  1.00 84.66  ? 544 THR A N   1 
ATOM   4021 C CA  . THR A 1 544 ? 37.655 47.213 20.760  1.00 87.53  ? 544 THR A CA  1 
ATOM   4022 C C   . THR A 1 544 ? 39.139 47.185 20.920  1.00 87.82  ? 544 THR A C   1 
ATOM   4023 O O   . THR A 1 544 ? 39.897 46.506 20.227  1.00 87.08  ? 544 THR A O   1 
ATOM   4024 C CB  . THR A 1 544 ? 36.888 46.441 19.646  1.00 89.33  ? 544 THR A CB  1 
ATOM   4025 O OG1 . THR A 1 544 ? 35.569 46.179 20.136  1.00 89.10  ? 544 THR A OG1 1 
ATOM   4026 C CG2 . THR A 1 544 ? 37.534 45.183 19.187  1.00 91.27  ? 544 THR A CG2 1 
ATOM   4027 N N   . ASP A 1 545 ? 39.478 48.005 21.904  1.00 88.49  ? 545 ASP A N   1 
ATOM   4028 C CA  . ASP A 1 545 ? 40.791 48.225 22.398  1.00 89.25  ? 545 ASP A CA  1 
ATOM   4029 C C   . ASP A 1 545 ? 40.608 47.753 23.833  1.00 89.55  ? 545 ASP A C   1 
ATOM   4030 O O   . ASP A 1 545 ? 39.761 48.283 24.548  1.00 89.29  ? 545 ASP A O   1 
ATOM   4031 C CB  . ASP A 1 545 ? 41.062 49.731 22.373  1.00 90.62  ? 545 ASP A CB  1 
ATOM   4032 C CG  . ASP A 1 545 ? 42.516 50.079 22.605  1.00 92.65  ? 545 ASP A CG  1 
ATOM   4033 O OD1 . ASP A 1 545 ? 43.403 49.383 22.057  1.00 93.06  ? 545 ASP A OD1 1 
ATOM   4034 O OD2 . ASP A 1 545 ? 42.772 51.077 23.315  1.00 93.95  ? 545 ASP A OD2 1 
ATOM   4035 N N   . ASP A 1 546 ? 41.344 46.722 24.224  1.00 89.36  ? 546 ASP A N   1 
ATOM   4036 C CA  . ASP A 1 546 ? 41.268 46.242 25.582  1.00 88.24  ? 546 ASP A CA  1 
ATOM   4037 C C   . ASP A 1 546 ? 40.068 45.322 25.835  1.00 86.92  ? 546 ASP A C   1 
ATOM   4038 O O   . ASP A 1 546 ? 39.024 45.481 25.209  1.00 84.90  ? 546 ASP A O   1 
ATOM   4039 C CB  . ASP A 1 546 ? 41.157 47.465 26.502  1.00 89.39  ? 546 ASP A CB  1 
ATOM   4040 C CG  . ASP A 1 546 ? 41.458 47.154 27.962  1.00 91.14  ? 546 ASP A CG  1 
ATOM   4041 O OD1 . ASP A 1 546 ? 41.503 45.960 28.365  1.00 93.77  ? 546 ASP A OD1 1 
ATOM   4042 O OD2 . ASP A 1 546 ? 41.649 48.121 28.720  1.00 92.17  ? 546 ASP A OD2 1 
ATOM   4043 N N   . LYS A 1 547 ? 40.231 44.347 26.725  1.00 88.15  ? 547 LYS A N   1 
ATOM   4044 C CA  . LYS A 1 547 ? 39.130 43.485 27.117  1.00 88.40  ? 547 LYS A CA  1 
ATOM   4045 C C   . LYS A 1 547 ? 38.548 44.044 28.415  1.00 87.97  ? 547 LYS A C   1 
ATOM   4046 O O   . LYS A 1 547 ? 39.100 43.860 29.539  1.00 87.27  ? 547 LYS A O   1 
ATOM   4047 C CB  . LYS A 1 547 ? 39.546 42.014 27.233  1.00 89.73  ? 547 LYS A CB  1 
ATOM   4048 C CG  . LYS A 1 547 ? 39.010 41.197 26.072  1.00 93.29  ? 547 LYS A CG  1 
ATOM   4049 C CD  . LYS A 1 547 ? 38.673 39.781 26.474  1.00 96.70  ? 547 LYS A CD  1 
ATOM   4050 C CE  . LYS A 1 547 ? 38.419 38.913 25.241  1.00 98.55  ? 547 LYS A CE  1 
ATOM   4051 N NZ  . LYS A 1 547 ? 38.205 37.476 25.579  1.00 99.95  ? 547 LYS A NZ  1 
ATOM   4052 N N   . ILE A 1 548 ? 37.484 44.790 28.198  1.00 86.39  ? 548 ILE A N   1 
ATOM   4053 C CA  . ILE A 1 548 ? 36.687 45.497 29.181  1.00 82.34  ? 548 ILE A CA  1 
ATOM   4054 C C   . ILE A 1 548 ? 35.348 44.752 29.213  1.00 80.31  ? 548 ILE A C   1 
ATOM   4055 O O   . ILE A 1 548 ? 35.203 43.720 28.564  1.00 79.51  ? 548 ILE A O   1 
ATOM   4056 C CB  . ILE A 1 548 ? 36.432 46.937 28.630  1.00 80.47  ? 548 ILE A CB  1 
ATOM   4057 C CG1 . ILE A 1 548 ? 37.669 47.819 28.806  1.00 79.04  ? 548 ILE A CG1 1 
ATOM   4058 C CG2 . ILE A 1 548 ? 35.247 47.564 29.278  1.00 80.44  ? 548 ILE A CG2 1 
ATOM   4059 C CD1 . ILE A 1 548 ? 37.669 48.998 27.893  1.00 80.35  ? 548 ILE A CD1 1 
ATOM   4060 N N   . GLU A 1 549 ? 34.401 45.259 29.989  1.00 77.86  ? 549 GLU A N   1 
ATOM   4061 C CA  . GLU A 1 549 ? 33.076 44.666 30.032  1.00 74.48  ? 549 GLU A CA  1 
ATOM   4062 C C   . GLU A 1 549 ? 32.423 45.221 28.776  1.00 72.26  ? 549 GLU A C   1 
ATOM   4063 O O   . GLU A 1 549 ? 32.451 46.431 28.551  1.00 71.44  ? 549 GLU A O   1 
ATOM   4064 C CB  . GLU A 1 549 ? 32.293 45.090 31.268  1.00 72.33  ? 549 GLU A CB  1 
ATOM   4065 C CG  . GLU A 1 549 ? 30.980 44.353 31.462  1.00 70.25  ? 549 GLU A CG  1 
ATOM   4066 C CD  . GLU A 1 549 ? 31.182 42.855 31.740  1.00 70.51  ? 549 GLU A CD  1 
ATOM   4067 O OE1 . GLU A 1 549 ? 32.338 42.374 31.775  1.00 68.22  ? 549 GLU A OE1 1 
ATOM   4068 O OE2 . GLU A 1 549 ? 30.170 42.159 31.926  1.00 71.37  ? 549 GLU A OE2 1 
ATOM   4069 N N   . LYS A 1 550 ? 31.868 44.339 27.966  1.00 69.17  ? 550 LYS A N   1 
ATOM   4070 C CA  . LYS A 1 550 ? 31.237 44.745 26.719  1.00 67.32  ? 550 LYS A CA  1 
ATOM   4071 C C   . LYS A 1 550 ? 29.975 45.590 26.922  1.00 65.87  ? 550 LYS A C   1 
ATOM   4072 O O   . LYS A 1 550 ? 29.897 46.728 26.455  1.00 66.52  ? 550 LYS A O   1 
ATOM   4073 C CB  . LYS A 1 550 ? 30.887 43.517 25.868  1.00 66.26  ? 550 LYS A CB  1 
ATOM   4074 C CG  . LYS A 1 550 ? 32.100 42.826 25.275  1.00 63.40  ? 550 LYS A CG  1 
ATOM   4075 C CD  . LYS A 1 550 ? 32.764 43.701 24.245  1.00 62.44  ? 550 LYS A CD  1 
ATOM   4076 C CE  . LYS A 1 550 ? 34.017 43.036 23.711  1.00 62.65  ? 550 LYS A CE  1 
ATOM   4077 N NZ  . LYS A 1 550 ? 33.805 41.604 23.346  1.00 63.38  ? 550 LYS A NZ  1 
ATOM   4078 N N   . LEU A 1 551 ? 29.003 45.047 27.639  1.00 62.93  ? 551 LEU A N   1 
ATOM   4079 C CA  . LEU A 1 551 ? 27.727 45.730 27.823  1.00 61.78  ? 551 LEU A CA  1 
ATOM   4080 C C   . LEU A 1 551 ? 27.722 47.121 28.455  1.00 62.06  ? 551 LEU A C   1 
ATOM   4081 O O   . LEU A 1 551 ? 27.871 48.099 27.732  1.00 64.34  ? 551 LEU A O   1 
ATOM   4082 C CB  . LEU A 1 551 ? 26.759 44.793 28.528  1.00 60.14  ? 551 LEU A CB  1 
ATOM   4083 C CG  . LEU A 1 551 ? 26.436 43.621 27.586  1.00 58.05  ? 551 LEU A CG  1 
ATOM   4084 C CD1 . LEU A 1 551 ? 25.329 42.761 28.156  1.00 58.56  ? 551 LEU A CD1 1 
ATOM   4085 C CD2 . LEU A 1 551 ? 26.000 44.151 26.231  1.00 56.53  ? 551 LEU A CD2 1 
ATOM   4086 N N   . ALA A 1 552 ? 27.543 47.240 29.766  1.00 60.81  ? 552 ALA A N   1 
ATOM   4087 C CA  . ALA A 1 552 ? 27.510 48.574 30.402  1.00 62.28  ? 552 ALA A CA  1 
ATOM   4088 C C   . ALA A 1 552 ? 26.148 49.296 30.310  1.00 62.83  ? 552 ALA A C   1 
ATOM   4089 O O   . ALA A 1 552 ? 25.386 49.115 29.357  1.00 63.42  ? 552 ALA A O   1 
ATOM   4090 C CB  . ALA A 1 552 ? 28.594 49.481 29.810  1.00 59.38  ? 552 ALA A CB  1 
ATOM   4091 N N   . ARG A 1 553 ? 25.861 50.131 31.307  1.00 62.23  ? 553 ARG A N   1 
ATOM   4092 C CA  . ARG A 1 553 ? 24.610 50.883 31.355  1.00 58.92  ? 553 ARG A CA  1 
ATOM   4093 C C   . ARG A 1 553 ? 24.767 52.214 32.074  1.00 58.87  ? 553 ARG A C   1 
ATOM   4094 O O   . ARG A 1 553 ? 24.186 53.223 31.673  1.00 59.70  ? 553 ARG A O   1 
ATOM   4095 C CB  . ARG A 1 553 ? 23.539 50.083 32.085  1.00 54.57  ? 553 ARG A CB  1 
ATOM   4096 C CG  . ARG A 1 553 ? 23.256 48.743 31.479  1.00 55.19  ? 553 ARG A CG  1 
ATOM   4097 C CD  . ARG A 1 553 ? 22.393 47.916 32.407  1.00 54.57  ? 553 ARG A CD  1 
ATOM   4098 N NE  . ARG A 1 553 ? 22.298 46.524 31.979  1.00 54.94  ? 553 ARG A NE  1 
ATOM   4099 C CZ  . ARG A 1 553 ? 23.345 45.746 31.710  1.00 57.28  ? 553 ARG A CZ  1 
ATOM   4100 N NH1 . ARG A 1 553 ? 24.585 46.223 31.823  1.00 55.80  ? 553 ARG A NH1 1 
ATOM   4101 N NH2 . ARG A 1 553 ? 23.152 44.487 31.326  1.00 56.86  ? 553 ARG A NH2 1 
ATOM   4102 N N   . GLY A 1 554 ? 25.567 52.201 33.134  1.00 59.33  ? 554 GLY A N   1 
ATOM   4103 C CA  . GLY A 1 554 ? 25.768 53.376 33.967  1.00 58.62  ? 554 GLY A CA  1 
ATOM   4104 C C   . GLY A 1 554 ? 26.295 54.687 33.421  1.00 57.20  ? 554 GLY A C   1 
ATOM   4105 O O   . GLY A 1 554 ? 25.549 55.652 33.318  1.00 57.50  ? 554 GLY A O   1 
ATOM   4106 N N   . PRO A 1 555 ? 27.581 54.758 33.071  1.00 56.85  ? 555 PRO A N   1 
ATOM   4107 C CA  . PRO A 1 555 ? 28.179 55.984 32.547  1.00 57.03  ? 555 PRO A CA  1 
ATOM   4108 C C   . PRO A 1 555 ? 27.272 56.885 31.707  1.00 57.94  ? 555 PRO A C   1 
ATOM   4109 O O   . PRO A 1 555 ? 27.107 58.067 32.017  1.00 58.08  ? 555 PRO A O   1 
ATOM   4110 C CB  . PRO A 1 555 ? 29.385 55.460 31.780  1.00 57.06  ? 555 PRO A CB  1 
ATOM   4111 C CG  . PRO A 1 555 ? 29.829 54.333 32.657  1.00 56.07  ? 555 PRO A CG  1 
ATOM   4112 C CD  . PRO A 1 555 ? 28.525 53.631 32.959  1.00 56.44  ? 555 PRO A CD  1 
ATOM   4113 N N   . LEU A 1 556 ? 26.682 56.338 30.650  1.00 58.17  ? 556 LEU A N   1 
ATOM   4114 C CA  . LEU A 1 556 ? 25.810 57.130 29.785  1.00 58.10  ? 556 LEU A CA  1 
ATOM   4115 C C   . LEU A 1 556 ? 24.561 57.640 30.494  1.00 56.90  ? 556 LEU A C   1 
ATOM   4116 O O   . LEU A 1 556 ? 24.232 58.827 30.413  1.00 53.79  ? 556 LEU A O   1 
ATOM   4117 C CB  . LEU A 1 556 ? 25.417 56.313 28.550  1.00 59.55  ? 556 LEU A CB  1 
ATOM   4118 C CG  . LEU A 1 556 ? 26.529 56.245 27.496  1.00 62.14  ? 556 LEU A CG  1 
ATOM   4119 C CD1 . LEU A 1 556 ? 26.200 55.198 26.436  1.00 61.92  ? 556 LEU A CD1 1 
ATOM   4120 C CD2 . LEU A 1 556 ? 26.717 57.638 26.879  1.00 59.18  ? 556 LEU A CD2 1 
ATOM   4121 N N   . ALA A 1 557 ? 23.873 56.732 31.182  1.00 56.81  ? 557 ALA A N   1 
ATOM   4122 C CA  . ALA A 1 557 ? 22.656 57.067 31.912  1.00 57.67  ? 557 ALA A CA  1 
ATOM   4123 C C   . ALA A 1 557 ? 22.953 58.172 32.916  1.00 57.81  ? 557 ALA A C   1 
ATOM   4124 O O   . ALA A 1 557 ? 22.153 59.089 33.115  1.00 58.09  ? 557 ALA A O   1 
ATOM   4125 C CB  . ALA A 1 557 ? 22.127 55.836 32.630  1.00 56.54  ? 557 ALA A CB  1 
ATOM   4126 N N   . ALA A 1 558 ? 24.116 58.067 33.546  1.00 57.23  ? 558 ALA A N   1 
ATOM   4127 C CA  . ALA A 1 558 ? 24.552 59.044 34.526  1.00 55.93  ? 558 ALA A CA  1 
ATOM   4128 C C   . ALA A 1 558 ? 24.815 60.340 33.789  1.00 54.69  ? 558 ALA A C   1 
ATOM   4129 O O   . ALA A 1 558 ? 24.483 61.424 34.263  1.00 54.75  ? 558 ALA A O   1 
ATOM   4130 C CB  . ALA A 1 558 ? 25.810 58.562 35.186  1.00 57.00  ? 558 ALA A CB  1 
ATOM   4131 N N   . ARG A 1 559 ? 25.418 60.202 32.616  1.00 54.58  ? 559 ARG A N   1 
ATOM   4132 C CA  . ARG A 1 559 ? 25.750 61.328 31.755  1.00 54.27  ? 559 ARG A CA  1 
ATOM   4133 C C   . ARG A 1 559 ? 24.519 62.144 31.403  1.00 51.91  ? 559 ARG A C   1 
ATOM   4134 O O   . ARG A 1 559 ? 24.380 63.309 31.783  1.00 49.45  ? 559 ARG A O   1 
ATOM   4135 C CB  . ARG A 1 559 ? 26.368 60.809 30.457  1.00 56.96  ? 559 ARG A CB  1 
ATOM   4136 C CG  . ARG A 1 559 ? 27.827 60.423 30.533  1.00 59.32  ? 559 ARG A CG  1 
ATOM   4137 C CD  . ARG A 1 559 ? 28.651 61.433 29.756  1.00 62.22  ? 559 ARG A CD  1 
ATOM   4138 N NE  . ARG A 1 559 ? 29.762 60.807 29.052  1.00 62.92  ? 559 ARG A NE  1 
ATOM   4139 C CZ  . ARG A 1 559 ? 30.529 61.436 28.171  1.00 65.04  ? 559 ARG A CZ  1 
ATOM   4140 N NH1 . ARG A 1 559 ? 30.302 62.713 27.884  1.00 63.78  ? 559 ARG A NH1 1 
ATOM   4141 N NH2 . ARG A 1 559 ? 31.527 60.788 27.582  1.00 65.81  ? 559 ARG A NH2 1 
ATOM   4142 N N   . CYS A 1 560 ? 23.628 61.489 30.670  1.00 50.83  ? 560 CYS A N   1 
ATOM   4143 C CA  . CYS A 1 560 ? 22.395 62.079 30.180  1.00 50.10  ? 560 CYS A CA  1 
ATOM   4144 C C   . CYS A 1 560 ? 21.311 62.382 31.191  1.00 48.84  ? 560 CYS A C   1 
ATOM   4145 O O   . CYS A 1 560 ? 20.445 63.221 30.931  1.00 48.40  ? 560 CYS A O   1 
ATOM   4146 C CB  . CYS A 1 560 ? 21.843 61.194 29.073  1.00 50.38  ? 560 CYS A CB  1 
ATOM   4147 S SG  . CYS A 1 560 ? 23.025 61.144 27.704  1.00 51.28  ? 560 CYS A SG  1 
ATOM   4148 N N   . SER A 1 561 ? 21.346 61.700 32.332  1.00 47.98  ? 561 SER A N   1 
ATOM   4149 C CA  . SER A 1 561 ? 20.358 61.942 33.372  1.00 46.87  ? 561 SER A CA  1 
ATOM   4150 C C   . SER A 1 561 ? 20.374 63.427 33.708  1.00 44.28  ? 561 SER A C   1 
ATOM   4151 O O   . SER A 1 561 ? 19.376 63.978 34.146  1.00 44.80  ? 561 SER A O   1 
ATOM   4152 C CB  . SER A 1 561 ? 20.684 61.142 34.631  1.00 49.54  ? 561 SER A CB  1 
ATOM   4153 O OG  . SER A 1 561 ? 19.634 61.255 35.581  1.00 52.75  ? 561 SER A OG  1 
ATOM   4154 N N   . PHE A 1 562 ? 21.511 64.073 33.496  1.00 41.47  ? 562 PHE A N   1 
ATOM   4155 C CA  . PHE A 1 562 ? 21.625 65.491 33.775  1.00 40.43  ? 562 PHE A CA  1 
ATOM   4156 C C   . PHE A 1 562 ? 20.775 66.319 32.816  1.00 40.61  ? 562 PHE A C   1 
ATOM   4157 O O   . PHE A 1 562 ? 19.937 67.119 33.239  1.00 39.14  ? 562 PHE A O   1 
ATOM   4158 C CB  . PHE A 1 562 ? 23.085 65.934 33.665  1.00 40.42  ? 562 PHE A CB  1 
ATOM   4159 C CG  . PHE A 1 562 ? 23.263 67.420 33.674  1.00 40.01  ? 562 PHE A CG  1 
ATOM   4160 C CD1 . PHE A 1 562 ? 23.160 68.144 34.861  1.00 41.84  ? 562 PHE A CD1 1 
ATOM   4161 C CD2 . PHE A 1 562 ? 23.458 68.114 32.482  1.00 40.66  ? 562 PHE A CD2 1 
ATOM   4162 C CE1 . PHE A 1 562 ? 23.243 69.550 34.858  1.00 41.33  ? 562 PHE A CE1 1 
ATOM   4163 C CE2 . PHE A 1 562 ? 23.542 69.520 32.468  1.00 42.76  ? 562 PHE A CE2 1 
ATOM   4164 C CZ  . PHE A 1 562 ? 23.433 70.238 33.662  1.00 41.11  ? 562 PHE A CZ  1 
ATOM   4165 N N   . TRP A 1 563 ? 21.004 66.111 31.522  1.00 41.11  ? 563 TRP A N   1 
ATOM   4166 C CA  . TRP A 1 563 ? 20.316 66.844 30.466  1.00 40.66  ? 563 TRP A CA  1 
ATOM   4167 C C   . TRP A 1 563 ? 18.873 66.425 30.236  1.00 42.95  ? 563 TRP A C   1 
ATOM   4168 O O   . TRP A 1 563 ? 18.033 67.232 29.835  1.00 42.53  ? 563 TRP A O   1 
ATOM   4169 C CB  . TRP A 1 563 ? 21.065 66.684 29.141  1.00 40.04  ? 563 TRP A CB  1 
ATOM   4170 C CG  . TRP A 1 563 ? 22.487 67.189 29.123  1.00 40.59  ? 563 TRP A CG  1 
ATOM   4171 C CD1 . TRP A 1 563 ? 23.626 66.459 29.339  1.00 38.35  ? 563 TRP A CD1 1 
ATOM   4172 C CD2 . TRP A 1 563 ? 22.916 68.539 28.880  1.00 38.90  ? 563 TRP A CD2 1 
ATOM   4173 N NE1 . TRP A 1 563 ? 24.732 67.272 29.246  1.00 38.48  ? 563 TRP A NE1 1 
ATOM   4174 C CE2 . TRP A 1 563 ? 24.324 68.552 28.969  1.00 37.94  ? 563 TRP A CE2 1 
ATOM   4175 C CE3 . TRP A 1 563 ? 22.244 69.736 28.603  1.00 36.04  ? 563 TRP A CE3 1 
ATOM   4176 C CZ2 . TRP A 1 563 ? 25.073 69.720 28.786  1.00 36.44  ? 563 TRP A CZ2 1 
ATOM   4177 C CZ3 . TRP A 1 563 ? 22.988 70.895 28.423  1.00 36.16  ? 563 TRP A CZ3 1 
ATOM   4178 C CH2 . TRP A 1 563 ? 24.391 70.878 28.519  1.00 35.17  ? 563 TRP A CH2 1 
ATOM   4179 N N   . ASN A 1 564 ? 18.575 65.163 30.499  1.00 43.56  ? 564 ASN A N   1 
ATOM   4180 C CA  . ASN A 1 564 ? 17.243 64.672 30.245  1.00 46.03  ? 564 ASN A CA  1 
ATOM   4181 C C   . ASN A 1 564 ? 16.257 64.594 31.403  1.00 47.59  ? 564 ASN A C   1 
ATOM   4182 O O   . ASN A 1 564 ? 15.051 64.516 31.172  1.00 48.82  ? 564 ASN A O   1 
ATOM   4183 C CB  . ASN A 1 564 ? 17.347 63.303 29.583  1.00 49.93  ? 564 ASN A CB  1 
ATOM   4184 C CG  . ASN A 1 564 ? 18.218 63.325 28.353  1.00 50.78  ? 564 ASN A CG  1 
ATOM   4185 O OD1 . ASN A 1 564 ? 18.142 64.252 27.546  1.00 52.66  ? 564 ASN A OD1 1 
ATOM   4186 N ND2 . ASN A 1 564 ? 19.045 62.300 28.191  1.00 52.87  ? 564 ASN A ND2 1 
ATOM   4187 N N   . ASP A 1 565 ? 16.737 64.602 32.641  1.00 47.37  ? 565 ASP A N   1 
ATOM   4188 C CA  . ASP A 1 565 ? 15.810 64.519 33.758  1.00 48.25  ? 565 ASP A CA  1 
ATOM   4189 C C   . ASP A 1 565 ? 15.903 65.707 34.692  1.00 48.57  ? 565 ASP A C   1 
ATOM   4190 O O   . ASP A 1 565 ? 14.884 66.226 35.132  1.00 52.07  ? 565 ASP A O   1 
ATOM   4191 C CB  . ASP A 1 565 ? 16.035 63.235 34.570  1.00 50.08  ? 565 ASP A CB  1 
ATOM   4192 C CG  . ASP A 1 565 ? 16.281 62.022 33.696  1.00 52.00  ? 565 ASP A CG  1 
ATOM   4193 O OD1 . ASP A 1 565 ? 15.694 61.946 32.596  1.00 54.24  ? 565 ASP A OD1 1 
ATOM   4194 O OD2 . ASP A 1 565 ? 17.056 61.134 34.117  1.00 52.85  ? 565 ASP A OD2 1 
ATOM   4195 N N   . TYR A 1 566 ? 17.121 66.143 34.993  1.00 47.49  ? 566 TYR A N   1 
ATOM   4196 C CA  . TYR A 1 566 ? 17.314 67.258 35.914  1.00 46.13  ? 566 TYR A CA  1 
ATOM   4197 C C   . TYR A 1 566 ? 17.290 68.623 35.256  1.00 44.49  ? 566 TYR A C   1 
ATOM   4198 O O   . TYR A 1 566 ? 16.576 69.512 35.699  1.00 40.86  ? 566 TYR A O   1 
ATOM   4199 C CB  . TYR A 1 566 ? 18.628 67.081 36.687  1.00 46.13  ? 566 TYR A CB  1 
ATOM   4200 C CG  . TYR A 1 566 ? 19.053 68.281 37.508  1.00 45.66  ? 566 TYR A CG  1 
ATOM   4201 C CD1 . TYR A 1 566 ? 18.309 68.710 38.606  1.00 45.87  ? 566 TYR A CD1 1 
ATOM   4202 C CD2 . TYR A 1 566 ? 20.207 68.993 37.179  1.00 46.53  ? 566 TYR A CD2 1 
ATOM   4203 C CE1 . TYR A 1 566 ? 18.710 69.824 39.364  1.00 45.71  ? 566 TYR A CE1 1 
ATOM   4204 C CE2 . TYR A 1 566 ? 20.616 70.103 37.925  1.00 46.22  ? 566 TYR A CE2 1 
ATOM   4205 C CZ  . TYR A 1 566 ? 19.867 70.511 39.012  1.00 45.23  ? 566 TYR A CZ  1 
ATOM   4206 O OH  . TYR A 1 566 ? 20.293 71.593 39.745  1.00 42.86  ? 566 TYR A OH  1 
ATOM   4207 N N   . LEU A 1 567 ? 18.062 68.796 34.195  1.00 46.38  ? 567 LEU A N   1 
ATOM   4208 C CA  . LEU A 1 567 ? 18.098 70.096 33.544  1.00 49.82  ? 567 LEU A CA  1 
ATOM   4209 C C   . LEU A 1 567 ? 16.708 70.609 33.178  1.00 51.59  ? 567 LEU A C   1 
ATOM   4210 O O   . LEU A 1 567 ? 16.409 71.790 33.366  1.00 52.24  ? 567 LEU A O   1 
ATOM   4211 C CB  . LEU A 1 567 ? 18.997 70.067 32.309  1.00 48.65  ? 567 LEU A CB  1 
ATOM   4212 C CG  . LEU A 1 567 ? 19.496 71.467 31.966  1.00 46.57  ? 567 LEU A CG  1 
ATOM   4213 C CD1 . LEU A 1 567 ? 20.095 72.119 33.206  1.00 45.82  ? 567 LEU A CD1 1 
ATOM   4214 C CD2 . LEU A 1 567 ? 20.526 71.379 30.876  1.00 49.44  ? 567 LEU A CD2 1 
ATOM   4215 N N   . PRO A 1 568 ? 15.842 69.741 32.636  1.00 52.54  ? 568 PRO A N   1 
ATOM   4216 C CA  . PRO A 1 568 ? 14.518 70.258 32.308  1.00 54.24  ? 568 PRO A CA  1 
ATOM   4217 C C   . PRO A 1 568 ? 13.898 70.914 33.540  1.00 57.06  ? 568 PRO A C   1 
ATOM   4218 O O   . PRO A 1 568 ? 13.144 71.873 33.427  1.00 59.35  ? 568 PRO A O   1 
ATOM   4219 C CB  . PRO A 1 568 ? 13.773 69.008 31.863  1.00 53.08  ? 568 PRO A CB  1 
ATOM   4220 C CG  . PRO A 1 568 ? 14.832 68.263 31.145  1.00 52.75  ? 568 PRO A CG  1 
ATOM   4221 C CD  . PRO A 1 568 ? 16.019 68.386 32.090  1.00 52.70  ? 568 PRO A CD  1 
ATOM   4222 N N   . LYS A 1 569 ? 14.241 70.405 34.720  1.00 59.33  ? 569 LYS A N   1 
ATOM   4223 C CA  . LYS A 1 569 ? 13.713 70.941 35.969  1.00 61.63  ? 569 LYS A CA  1 
ATOM   4224 C C   . LYS A 1 569 ? 14.292 72.320 36.301  1.00 64.03  ? 569 LYS A C   1 
ATOM   4225 O O   . LYS A 1 569 ? 13.553 73.253 36.624  1.00 64.00  ? 569 LYS A O   1 
ATOM   4226 C CB  . LYS A 1 569 ? 13.991 69.959 37.112  1.00 61.84  ? 569 LYS A CB  1 
ATOM   4227 C CG  . LYS A 1 569 ? 13.427 68.577 36.863  1.00 60.55  ? 569 LYS A CG  1 
ATOM   4228 C CD  . LYS A 1 569 ? 13.697 67.651 38.019  1.00 61.91  ? 569 LYS A CD  1 
ATOM   4229 C CE  . LYS A 1 569 ? 13.054 66.302 37.769  1.00 63.93  ? 569 LYS A CE  1 
ATOM   4230 N NZ  . LYS A 1 569 ? 13.284 65.357 38.894  1.00 64.80  ? 569 LYS A NZ  1 
ATOM   4231 N N   . VAL A 1 570 ? 15.614 72.450 36.241  1.00 66.22  ? 570 VAL A N   1 
ATOM   4232 C CA  . VAL A 1 570 ? 16.229 73.736 36.520  1.00 68.35  ? 570 VAL A CA  1 
ATOM   4233 C C   . VAL A 1 570 ? 15.498 74.672 35.584  1.00 71.78  ? 570 VAL A C   1 
ATOM   4234 O O   . VAL A 1 570 ? 15.081 75.766 35.972  1.00 72.16  ? 570 VAL A O   1 
ATOM   4235 C CB  . VAL A 1 570 ? 17.723 73.733 36.176  1.00 66.85  ? 570 VAL A CB  1 
ATOM   4236 C CG1 . VAL A 1 570 ? 18.312 75.117 36.390  1.00 65.89  ? 570 VAL A CG1 1 
ATOM   4237 C CG2 . VAL A 1 570 ? 18.440 72.713 37.028  1.00 66.24  ? 570 VAL A CG2 1 
ATOM   4238 N N   . ARG A 1 571 ? 15.328 74.205 34.349  1.00 74.67  ? 571 ARG A N   1 
ATOM   4239 C CA  . ARG A 1 571 ? 14.633 74.959 33.324  1.00 78.41  ? 571 ARG A CA  1 
ATOM   4240 C C   . ARG A 1 571 ? 13.305 75.392 33.893  1.00 80.32  ? 571 ARG A C   1 
ATOM   4241 O O   . ARG A 1 571 ? 12.977 76.573 33.905  1.00 80.46  ? 571 ARG A O   1 
ATOM   4242 C CB  . ARG A 1 571 ? 14.363 74.093 32.097  1.00 80.59  ? 571 ARG A CB  1 
ATOM   4243 C CG  . ARG A 1 571 ? 15.553 73.814 31.200  1.00 85.18  ? 571 ARG A CG  1 
ATOM   4244 C CD  . ARG A 1 571 ? 15.113 72.925 30.046  1.00 88.30  ? 571 ARG A CD  1 
ATOM   4245 N NE  . ARG A 1 571 ? 16.190 72.594 29.121  1.00 90.82  ? 571 ARG A NE  1 
ATOM   4246 C CZ  . ARG A 1 571 ? 16.100 71.637 28.203  1.00 93.22  ? 571 ARG A CZ  1 
ATOM   4247 N NH1 . ARG A 1 571 ? 14.985 70.922 28.101  1.00 94.06  ? 571 ARG A NH1 1 
ATOM   4248 N NH2 . ARG A 1 571 ? 17.117 71.402 27.382  1.00 95.22  ? 571 ARG A NH2 1 
ATOM   4249 N N   . SER A 1 572 ? 12.551 74.409 34.370  1.00 83.05  ? 572 SER A N   1 
ATOM   4250 C CA  . SER A 1 572 ? 11.227 74.623 34.935  1.00 86.00  ? 572 SER A CA  1 
ATOM   4251 C C   . SER A 1 572 ? 11.083 75.829 35.856  1.00 87.72  ? 572 SER A C   1 
ATOM   4252 O O   . SER A 1 572 ? 10.864 75.678 37.059  1.00 86.89  ? 572 SER A O   1 
ATOM   4253 C CB  . SER A 1 572 ? 10.765 73.361 35.671  1.00 86.07  ? 572 SER A CB  1 
ATOM   4254 O OG  . SER A 1 572 ? 10.625 72.272 34.775  1.00 87.12  ? 572 SER A OG  1 
ATOM   4255 N N   . TRP A 1 573 ? 11.198 77.022 35.273  1.00 90.82  ? 573 TRP A N   1 
ATOM   4256 C CA  . TRP A 1 573 ? 11.048 78.285 35.992  1.00 93.77  ? 573 TRP A CA  1 
ATOM   4257 C C   . TRP A 1 573 ? 12.284 78.764 36.751  1.00 94.21  ? 573 TRP A C   1 
ATOM   4258 O O   . TRP A 1 573 ? 12.471 78.429 37.926  1.00 93.95  ? 573 TRP A O   1 
ATOM   4259 C CB  . TRP A 1 573 ? 9.870  78.185 36.960  1.00 96.63  ? 573 TRP A CB  1 
ATOM   4260 C CG  . TRP A 1 573 ? 8.868  79.264 36.788  1.00 98.82  ? 573 TRP A CG  1 
ATOM   4261 C CD1 . TRP A 1 573 ? 8.026  79.443 35.728  1.00 99.37  ? 573 TRP A CD1 1 
ATOM   4262 C CD2 . TRP A 1 573 ? 8.597  80.330 37.705  1.00 100.00 ? 573 TRP A CD2 1 
ATOM   4263 N NE1 . TRP A 1 573 ? 7.245  80.558 35.928  1.00 100.00 ? 573 TRP A NE1 1 
ATOM   4264 C CE2 . TRP A 1 573 ? 7.576  81.122 37.136  1.00 100.00 ? 573 TRP A CE2 1 
ATOM   4265 C CE3 . TRP A 1 573 ? 9.120  80.697 38.959  1.00 100.00 ? 573 TRP A CE3 1 
ATOM   4266 C CZ2 . TRP A 1 573 ? 7.061  82.262 37.775  1.00 100.00 ? 573 TRP A CZ2 1 
ATOM   4267 C CZ3 . TRP A 1 573 ? 8.608  81.833 39.597  1.00 99.65  ? 573 TRP A CZ3 1 
ATOM   4268 C CH2 . TRP A 1 573 ? 7.590  82.598 39.001  1.00 99.30  ? 573 TRP A CH2 1 
ATOM   4269 N N   . ALA A 1 574 ? 13.104 79.564 36.071  1.00 94.49  ? 574 ALA A N   1 
ATOM   4270 C CA  . ALA A 1 574 ? 14.336 80.132 36.624  1.00 95.19  ? 574 ALA A CA  1 
ATOM   4271 C C   . ALA A 1 574 ? 15.371 80.307 35.511  1.00 95.53  ? 574 ALA A C   1 
ATOM   4272 O O   . ALA A 1 574 ? 16.062 81.351 35.514  1.00 96.03  ? 574 ALA A O   1 
ATOM   4273 C CB  . ALA A 1 574 ? 14.905 79.234 37.726  1.00 94.90  ? 574 ALA A CB  1 
HETATM 4274 C C1  . NAG B 2 .   ? 41.469 50.407 -0.041  1.00 67.29  ? 1   NAG B C1  1 
HETATM 4275 C C2  . NAG B 2 .   ? 40.358 50.888 -0.962  1.00 69.56  ? 1   NAG B C2  1 
HETATM 4276 C C3  . NAG B 2 .   ? 40.989 51.115 -2.326  1.00 71.39  ? 1   NAG B C3  1 
HETATM 4277 C C4  . NAG B 2 .   ? 42.039 52.215 -2.177  1.00 72.80  ? 1   NAG B C4  1 
HETATM 4278 C C5  . NAG B 2 .   ? 43.060 51.876 -1.076  1.00 70.99  ? 1   NAG B C5  1 
HETATM 4279 C C6  . NAG B 2 .   ? 43.857 53.107 -0.719  1.00 71.82  ? 1   NAG B C6  1 
HETATM 4280 C C7  . NAG B 2 .   ? 39.375 48.700 -1.373  1.00 67.09  ? 1   NAG B C7  1 
HETATM 4281 C C8  . NAG B 2 .   ? 38.108 47.851 -1.390  1.00 65.32  ? 1   NAG B C8  1 
HETATM 4282 N N2  . NAG B 2 .   ? 39.229 49.972 -1.018  1.00 68.19  ? 1   NAG B N2  1 
HETATM 4283 O O3  . NAG B 2 .   ? 39.997 51.506 -3.262  1.00 72.89  ? 1   NAG B O3  1 
HETATM 4284 O O4  . NAG B 2 .   ? 42.728 52.415 -3.424  1.00 77.20  ? 1   NAG B O4  1 
HETATM 4285 O O5  . NAG B 2 .   ? 42.405 51.465 0.147   1.00 68.02  ? 1   NAG B O5  1 
HETATM 4286 O O6  . NAG B 2 .   ? 43.030 54.062 -0.068  1.00 72.22  ? 1   NAG B O6  1 
HETATM 4287 O O7  . NAG B 2 .   ? 40.461 48.203 -1.675  1.00 66.49  ? 1   NAG B O7  1 
HETATM 4288 C C1  . NAG B 2 .   ? 42.226 53.430 -4.212  1.00 82.40  ? 2   NAG B C1  1 
HETATM 4289 C C2  . NAG B 2 .   ? 43.359 54.249 -4.790  1.00 86.17  ? 2   NAG B C2  1 
HETATM 4290 C C3  . NAG B 2 .   ? 42.738 55.386 -5.612  1.00 88.39  ? 2   NAG B C3  1 
HETATM 4291 C C4  . NAG B 2 .   ? 41.740 54.862 -6.661  1.00 88.87  ? 2   NAG B C4  1 
HETATM 4292 C C5  . NAG B 2 .   ? 40.766 53.832 -6.054  1.00 87.06  ? 2   NAG B C5  1 
HETATM 4293 C C6  . NAG B 2 .   ? 39.971 53.075 -7.112  1.00 86.82  ? 2   NAG B C6  1 
HETATM 4294 C C7  . NAG B 2 .   ? 43.803 55.801 -2.980  1.00 90.98  ? 2   NAG B C7  1 
HETATM 4295 C C8  . NAG B 2 .   ? 44.745 56.275 -1.886  1.00 91.63  ? 2   NAG B C8  1 
HETATM 4296 N N2  . NAG B 2 .   ? 44.199 54.765 -3.721  1.00 88.45  ? 2   NAG B N2  1 
HETATM 4297 O O3  . NAG B 2 .   ? 43.758 56.132 -6.258  1.00 88.90  ? 2   NAG B O3  1 
HETATM 4298 O O4  . NAG B 2 .   ? 40.982 55.983 -7.169  1.00 92.33  ? 2   NAG B O4  1 
HETATM 4299 O O5  . NAG B 2 .   ? 41.480 52.846 -5.277  1.00 84.74  ? 2   NAG B O5  1 
HETATM 4300 O O6  . NAG B 2 .   ? 40.480 51.761 -7.315  1.00 87.71  ? 2   NAG B O6  1 
HETATM 4301 O O7  . NAG B 2 .   ? 42.727 56.376 -3.146  1.00 93.30  ? 2   NAG B O7  1 
HETATM 4302 C C1  . BMA B 2 .   ? 41.108 56.333 -8.509  1.00 95.70  ? 3   BMA B C1  1 
HETATM 4303 C C2  . BMA B 2 .   ? 40.244 55.439 -9.389  1.00 97.16  ? 3   BMA B C2  1 
HETATM 4304 C C3  . BMA B 2 .   ? 40.175 56.075 -10.772 1.00 97.64  ? 3   BMA B C3  1 
HETATM 4305 C C4  . BMA B 2 .   ? 41.493 56.800 -11.107 1.00 97.84  ? 3   BMA B C4  1 
HETATM 4306 C C5  . BMA B 2 .   ? 42.695 56.205 -10.349 1.00 97.26  ? 3   BMA B C5  1 
HETATM 4307 C C6  . BMA B 2 .   ? 43.995 56.948 -10.640 1.00 96.62  ? 3   BMA B C6  1 
HETATM 4308 O O2  . BMA B 2 .   ? 38.938 55.336 -8.837  1.00 99.31  ? 3   BMA B O2  1 
HETATM 4309 O O3  . BMA B 2 .   ? 39.103 57.034 -10.785 1.00 97.92  ? 3   BMA B O3  1 
HETATM 4310 O O4  . BMA B 2 .   ? 41.732 56.721 -12.501 1.00 98.77  ? 3   BMA B O4  1 
HETATM 4311 O O5  . BMA B 2 .   ? 42.492 56.250 -8.906  1.00 98.18  ? 3   BMA B O5  1 
HETATM 4312 O O6  . BMA B 2 .   ? 43.816 58.359 -10.604 1.00 95.24  ? 3   BMA B O6  1 
HETATM 4313 C C1  . BMA B 2 .   ? 37.990 56.697 -11.550 0.60 97.10  ? 4   BMA B C1  1 
HETATM 4314 C C2  . BMA B 2 .   ? 37.503 57.945 -12.305 0.60 96.98  ? 4   BMA B C2  1 
HETATM 4315 C C3  . BMA B 2 .   ? 36.052 57.838 -12.788 0.60 96.75  ? 4   BMA B C3  1 
HETATM 4316 C C4  . BMA B 2 .   ? 35.098 57.359 -11.680 0.60 97.35  ? 4   BMA B C4  1 
HETATM 4317 C C5  . BMA B 2 .   ? 35.871 56.962 -10.417 0.60 97.45  ? 4   BMA B C5  1 
HETATM 4318 C C6  . BMA B 2 .   ? 35.027 56.234 -9.387  0.60 97.79  ? 4   BMA B C6  1 
HETATM 4319 O O2  . BMA B 2 .   ? 38.346 58.186 -13.419 0.60 97.12  ? 4   BMA B O2  1 
HETATM 4320 O O3  . BMA B 2 .   ? 35.935 57.028 -13.990 0.60 95.88  ? 4   BMA B O3  1 
HETATM 4321 O O4  . BMA B 2 .   ? 34.195 58.408 -11.364 0.60 97.58  ? 4   BMA B O4  1 
HETATM 4322 O O5  . BMA B 2 .   ? 36.957 56.088 -10.771 0.60 96.80  ? 4   BMA B O5  1 
HETATM 4323 O O6  . BMA B 2 .   ? 33.647 56.267 -9.727  0.60 99.06  ? 4   BMA B O6  1 
HETATM 4324 C C1  . BMA B 2 .   ? 36.173 55.640 -13.955 0.70 94.70  ? 5   BMA B C1  1 
HETATM 4325 C C2  . BMA B 2 .   ? 37.593 55.342 -14.555 0.70 94.36  ? 5   BMA B C2  1 
HETATM 4326 C C3  . BMA B 2 .   ? 37.808 53.981 -15.251 0.70 94.23  ? 5   BMA B C3  1 
HETATM 4327 C C4  . BMA B 2 .   ? 36.526 53.227 -15.506 0.70 94.52  ? 5   BMA B C4  1 
HETATM 4328 C C5  . BMA B 2 .   ? 35.455 54.230 -15.819 0.70 94.08  ? 5   BMA B C5  1 
HETATM 4329 C C6  . BMA B 2 .   ? 34.226 53.528 -16.334 0.70 93.82  ? 5   BMA B C6  1 
HETATM 4330 O O2  . BMA B 2 .   ? 38.570 55.446 -13.535 0.70 93.18  ? 5   BMA B O2  1 
HETATM 4331 O O3  . BMA B 2 .   ? 38.672 53.176 -14.467 0.70 93.80  ? 5   BMA B O3  1 
HETATM 4332 O O4  . BMA B 2 .   ? 36.691 52.333 -16.598 0.70 95.29  ? 5   BMA B O4  1 
HETATM 4333 O O5  . BMA B 2 .   ? 35.108 54.919 -14.604 0.70 94.01  ? 5   BMA B O5  1 
HETATM 4334 O O6  . BMA B 2 .   ? 34.136 52.216 -15.799 0.70 94.75  ? 5   BMA B O6  1 
HETATM 4335 C C1  . NAG C 3 .   ? 34.889 67.815 -13.042 0.50 73.84  ? 601 NAG A C1  1 
HETATM 4336 C C2  . NAG C 3 .   ? 35.204 68.793 -14.168 0.50 74.03  ? 601 NAG A C2  1 
HETATM 4337 C C3  . NAG C 3 .   ? 33.853 69.350 -14.637 0.50 73.73  ? 601 NAG A C3  1 
HETATM 4338 C C4  . NAG C 3 .   ? 32.892 68.207 -15.065 0.50 72.66  ? 601 NAG A C4  1 
HETATM 4339 C C5  . NAG C 3 .   ? 32.882 67.065 -14.026 0.50 72.16  ? 601 NAG A C5  1 
HETATM 4340 C C6  . NAG C 3 .   ? 32.145 65.805 -14.431 0.50 71.28  ? 601 NAG A C6  1 
HETATM 4341 C C7  . NAG C 3 .   ? 37.291 69.993 -14.268 0.50 73.70  ? 601 NAG A C7  1 
HETATM 4342 C C8  . NAG C 3 .   ? 38.207 71.081 -13.728 0.50 74.14  ? 601 NAG A C8  1 
HETATM 4343 N N2  . NAG C 3 .   ? 36.098 69.838 -13.696 0.50 74.06  ? 601 NAG A N2  1 
HETATM 4344 O O3  . NAG C 3 .   ? 34.052 70.252 -15.711 0.50 75.72  ? 601 NAG A O3  1 
HETATM 4345 O O4  . NAG C 3 .   ? 31.575 68.731 -15.176 0.50 71.32  ? 601 NAG A O4  1 
HETATM 4346 O O5  . NAG C 3 .   ? 34.232 66.698 -13.653 0.50 72.67  ? 601 NAG A O5  1 
HETATM 4347 O O6  . NAG C 3 .   ? 32.080 65.653 -15.842 0.50 69.86  ? 601 NAG A O6  1 
HETATM 4348 O O7  . NAG C 3 .   ? 37.662 69.310 -15.222 0.50 73.00  ? 601 NAG A O7  1 
HETATM 4349 O O   . HOH D 4 .   ? 43.644 67.813 41.319  1.00 45.43  ? 701 HOH A O   1 
HETATM 4350 O O   . HOH D 4 .   ? 6.278  57.449 28.340  1.00 42.95  ? 702 HOH A O   1 
HETATM 4351 O O   . HOH D 4 .   ? 27.748 42.558 18.205  1.00 41.03  ? 703 HOH A O   1 
HETATM 4352 O O   . HOH D 4 .   ? 37.695 84.708 16.219  1.00 28.99  ? 704 HOH A O   1 
HETATM 4353 O O   . HOH D 4 .   ? 10.272 90.824 -2.035  1.00 61.24  ? 705 HOH A O   1 
HETATM 4354 O O   . HOH D 4 .   ? 30.570 79.353 19.158  1.00 38.19  ? 706 HOH A O   1 
HETATM 4355 O O   . HOH D 4 .   ? 29.427 63.338 4.378   1.00 22.44  ? 707 HOH A O   1 
HETATM 4356 O O   . HOH D 4 .   ? 42.461 77.590 5.298   1.00 35.11  ? 708 HOH A O   1 
HETATM 4357 O O   . HOH D 4 .   ? 41.492 55.358 6.945   1.00 36.40  ? 709 HOH A O   1 
HETATM 4358 O O   . HOH D 4 .   ? 16.559 76.608 7.039   1.00 21.72  ? 710 HOH A O   1 
HETATM 4359 O O   . HOH D 4 .   ? 8.128  71.817 -4.583  1.00 31.05  ? 711 HOH A O   1 
HETATM 4360 O O   . HOH D 4 .   ? 10.199 61.873 15.663  1.00 30.94  ? 712 HOH A O   1 
HETATM 4361 O O   . HOH D 4 .   ? 40.639 43.340 -6.289  1.00 42.99  ? 713 HOH A O   1 
HETATM 4362 O O   . HOH D 4 .   ? 19.485 82.727 5.416   1.00 47.88  ? 714 HOH A O   1 
HETATM 4363 O O   . HOH D 4 .   ? 20.456 79.923 39.756  1.00 19.00  ? 715 HOH A O   1 
HETATM 4364 O O   . HOH D 4 .   ? 18.300 69.493 28.405  1.00 36.14  ? 716 HOH A O   1 
HETATM 4365 O O   . HOH D 4 .   ? 40.439 41.699 -2.009  1.00 70.64  ? 717 HOH A O   1 
HETATM 4366 O O   . HOH D 4 .   ? 21.736 40.257 22.561  1.00 30.71  ? 718 HOH A O   1 
HETATM 4367 O O   . HOH D 4 .   ? 14.840 48.215 22.625  1.00 11.63  ? 719 HOH A O   1 
HETATM 4368 O O   . HOH D 4 .   ? 21.435 47.975 23.497  1.00 30.34  ? 720 HOH A O   1 
HETATM 4369 O O   . HOH D 4 .   ? 29.409 42.308 15.253  1.00 45.85  ? 721 HOH A O   1 
HETATM 4370 O O   . HOH D 4 .   ? 38.067 58.181 12.030  1.00 45.15  ? 722 HOH A O   1 
HETATM 4371 O O   . HOH D 4 .   ? 18.149 78.411 18.583  1.00 54.66  ? 723 HOH A O   1 
HETATM 4372 O O   . HOH D 4 .   ? 36.651 44.589 24.533  1.00 42.06  ? 724 HOH A O   1 
HETATM 4373 O O   . HOH D 4 .   ? 32.994 48.708 29.737  1.00 73.36  ? 725 HOH A O   1 
HETATM 4374 O O   . HOH D 4 .   ? 11.586 74.112 -0.217  1.00 42.26  ? 726 HOH A O   1 
HETATM 4375 O O   . HOH D 4 .   ? 28.755 64.615 9.784   1.00 52.29  ? 727 HOH A O   1 
HETATM 4376 O O   . HOH D 4 .   ? 28.933 66.710 11.149  1.00 53.65  ? 728 HOH A O   1 
HETATM 4377 O O   . HOH D 4 .   ? 9.217  44.760 -8.815  1.00 39.54  ? 729 HOH A O   1 
HETATM 4378 O O   . HOH D 4 .   ? 33.694 72.348 -14.048 1.00 45.17  ? 730 HOH A O   1 
HETATM 4379 O O   . HOH D 4 .   ? 2.110  78.620 1.075   1.00 25.57  ? 731 HOH A O   1 
HETATM 4380 O O   . HOH D 4 .   ? 9.912  62.809 -2.459  1.00 29.30  ? 732 HOH A O   1 
HETATM 4381 O O   . HOH D 4 .   ? 22.722 78.230 23.777  1.00 36.52  ? 733 HOH A O   1 
HETATM 4382 O O   . HOH D 4 .   ? -1.549 76.427 -6.152  1.00 35.82  ? 734 HOH A O   1 
HETATM 4383 O O   . HOH D 4 .   ? 12.762 49.501 -18.189 1.00 40.61  ? 735 HOH A O   1 
HETATM 4384 O O   . HOH D 4 .   ? 9.870  72.264 18.408  1.00 49.04  ? 736 HOH A O   1 
HETATM 4385 O O   . HOH D 4 .   ? 25.535 82.780 23.440  1.00 42.07  ? 737 HOH A O   1 
HETATM 4386 O O   . HOH D 4 .   ? 36.404 72.386 -12.525 1.00 49.26  ? 738 HOH A O   1 
HETATM 4387 O O   . HOH D 4 .   ? 9.562  87.464 13.098  1.00 43.26  ? 739 HOH A O   1 
HETATM 4388 O O   . HOH D 4 .   ? 7.246  65.796 -6.949  1.00 30.74  ? 740 HOH A O   1 
HETATM 4389 O O   . HOH D 4 .   ? 14.873 97.339 -3.428  1.00 68.58  ? 741 HOH A O   1 
HETATM 4390 O O   . HOH D 4 .   ? 32.334 66.986 9.788   1.00 30.08  ? 742 HOH A O   1 
HETATM 4391 O O   . HOH D 4 .   ? 28.306 84.216 22.075  1.00 36.70  ? 743 HOH A O   1 
HETATM 4392 O O   . HOH D 4 .   ? 4.951  48.971 13.705  1.00 29.41  ? 744 HOH A O   1 
HETATM 4393 O O   . HOH D 4 .   ? 11.419 47.217 29.059  1.00 35.49  ? 745 HOH A O   1 
HETATM 4394 O O   . HOH D 4 .   ? 48.428 65.460 6.262   1.00 35.99  ? 746 HOH A O   1 
HETATM 4395 O O   . HOH D 4 .   ? 21.079 76.983 39.177  1.00 18.14  ? 747 HOH A O   1 
HETATM 4396 O O   . HOH D 4 .   ? 18.243 73.876 26.262  1.00 36.18  ? 748 HOH A O   1 
HETATM 4397 O O   . HOH D 4 .   ? 38.100 77.643 5.538   1.00 35.40  ? 749 HOH A O   1 
HETATM 4398 O O   . HOH D 4 .   ? 4.636  83.143 8.778   1.00 18.80  ? 750 HOH A O   1 
HETATM 4399 O O   . HOH D 4 .   ? 8.718  53.166 -11.541 1.00 31.78  ? 751 HOH A O   1 
HETATM 4400 O O   . HOH D 4 .   ? 18.741 46.197 -19.827 1.00 39.55  ? 752 HOH A O   1 
HETATM 4401 O O   . HOH D 4 .   ? 14.755 69.453 25.438  1.00 32.10  ? 753 HOH A O   1 
HETATM 4402 O O   . HOH D 4 .   ? 1.031  67.234 13.259  1.00 24.04  ? 754 HOH A O   1 
HETATM 4403 O O   . HOH D 4 .   ? 40.813 54.182 22.277  1.00 30.85  ? 755 HOH A O   1 
HETATM 4404 O O   . HOH D 4 .   ? 13.349 43.677 -12.157 1.00 43.21  ? 756 HOH A O   1 
HETATM 4405 O O   . HOH D 4 .   ? 33.955 79.190 7.215   1.00 47.23  ? 757 HOH A O   1 
HETATM 4406 O O   . HOH D 4 .   ? 12.452 96.266 -3.155  1.00 51.37  ? 758 HOH A O   1 
HETATM 4407 O O   . HOH D 4 .   ? -3.565 81.581 -10.021 1.00 54.88  ? 759 HOH A O   1 
HETATM 4408 O O   . HOH D 4 .   ? 46.679 42.439 7.210   1.00 31.07  ? 760 HOH A O   1 
HETATM 4409 O O   . HOH D 4 .   ? 20.757 86.458 31.660  1.00 51.29  ? 761 HOH A O   1 
HETATM 4410 O O   . HOH D 4 .   ? 40.552 78.294 7.820   1.00 43.44  ? 762 HOH A O   1 
HETATM 4411 O O   . HOH D 4 .   ? 26.255 40.548 -11.728 1.00 40.94  ? 763 HOH A O   1 
HETATM 4412 O O   . HOH D 4 .   ? 12.186 79.460 16.801  1.00 26.35  ? 764 HOH A O   1 
HETATM 4413 O O   . HOH D 4 .   ? 40.840 69.396 -3.956  1.00 33.12  ? 765 HOH A O   1 
HETATM 4414 O O   . HOH D 4 .   ? 38.773 85.095 21.774  1.00 41.53  ? 766 HOH A O   1 
HETATM 4415 O O   . HOH D 4 .   ? 27.317 43.831 31.789  1.00 39.47  ? 767 HOH A O   1 
HETATM 4416 O O   . HOH D 4 .   ? 25.959 86.641 10.392  1.00 29.13  ? 768 HOH A O   1 
HETATM 4417 O O   . HOH D 4 .   ? 19.206 58.273 31.823  1.00 64.03  ? 769 HOH A O   1 
HETATM 4418 O O   . HOH D 4 .   ? 27.223 83.903 33.695  1.00 45.41  ? 770 HOH A O   1 
HETATM 4419 O O   . HOH D 4 .   ? 33.225 57.877 28.138  1.00 34.50  ? 771 HOH A O   1 
HETATM 4420 O O   . HOH D 4 .   ? 38.154 72.457 -16.494 1.00 34.95  ? 772 HOH A O   1 
HETATM 4421 O O   . HOH D 4 .   ? 45.822 76.094 16.590  1.00 24.44  ? 773 HOH A O   1 
HETATM 4422 O O   . HOH D 4 .   ? 5.908  53.570 -9.308  1.00 37.25  ? 774 HOH A O   1 
HETATM 4423 O O   . HOH D 4 .   ? 37.111 69.347 -6.025  1.00 60.64  ? 775 HOH A O   1 
HETATM 4424 O O   . HOH D 4 .   ? 12.280 41.314 -5.557  1.00 38.67  ? 776 HOH A O   1 
HETATM 4425 O O   . HOH D 4 .   ? 40.443 76.078 -1.483  1.00 75.01  ? 777 HOH A O   1 
HETATM 4426 O O   . HOH D 4 .   ? 16.510 38.726 -7.264  1.00 25.44  ? 778 HOH A O   1 
HETATM 4427 O O   . HOH D 4 .   ? -4.743 82.474 -6.447  1.00 27.92  ? 779 HOH A O   1 
HETATM 4428 O O   . HOH D 4 .   ? 7.866  61.330 23.837  1.00 23.33  ? 780 HOH A O   1 
HETATM 4429 O O   . HOH D 4 .   ? 29.847 65.569 37.639  1.00 25.05  ? 781 HOH A O   1 
HETATM 4430 O O   . HOH D 4 .   ? 24.395 85.616 14.989  1.00 53.98  ? 782 HOH A O   1 
HETATM 4431 O O   . HOH D 4 .   ? 7.115  49.780 27.076  1.00 50.46  ? 783 HOH A O   1 
HETATM 4432 O O   . HOH D 4 .   ? 48.933 61.716 12.919  1.00 32.92  ? 784 HOH A O   1 
HETATM 4433 O O   . HOH D 4 .   ? 37.685 77.441 1.613   1.00 48.82  ? 785 HOH A O   1 
HETATM 4434 O O   . HOH D 4 .   ? 38.431 63.125 34.415  1.00 45.65  ? 786 HOH A O   1 
HETATM 4435 O O   . HOH D 4 .   ? 37.529 66.409 -17.577 1.00 37.46  ? 787 HOH A O   1 
HETATM 4436 O O   . HOH D 4 .   ? 2.457  51.860 7.077   1.00 41.58  ? 788 HOH A O   1 
HETATM 4437 O O   . HOH D 4 .   ? 31.508 77.697 7.120   1.00 40.10  ? 789 HOH A O   1 
HETATM 4438 O O   . HOH D 4 .   ? 37.836 86.213 31.134  1.00 33.54  ? 790 HOH A O   1 
HETATM 4439 O O   . HOH D 4 .   ? 12.152 44.654 22.366  1.00 39.12  ? 791 HOH A O   1 
HETATM 4440 O O   . HOH D 4 .   ? 13.497 39.002 11.304  1.00 56.35  ? 792 HOH A O   1 
HETATM 4441 O O   . HOH D 4 .   ? 29.643 84.378 -12.697 1.00 43.75  ? 793 HOH A O   1 
HETATM 4442 O O   . HOH D 4 .   ? 28.947 69.922 9.724   1.00 35.96  ? 794 HOH A O   1 
HETATM 4443 O O   . HOH D 4 .   ? 7.684  48.008 24.907  1.00 53.77  ? 795 HOH A O   1 
HETATM 4444 O O   . HOH D 4 .   ? 37.651 81.330 9.454   1.00 26.88  ? 796 HOH A O   1 
HETATM 4445 O O   . HOH D 4 .   ? 4.991  48.664 23.402  1.00 35.01  ? 797 HOH A O   1 
HETATM 4446 O O   . HOH D 4 .   ? 30.606 76.609 -5.944  1.00 27.51  ? 798 HOH A O   1 
HETATM 4447 O O   . HOH D 4 .   ? 43.234 86.069 27.729  1.00 38.46  ? 799 HOH A O   1 
HETATM 4448 O O   . HOH D 4 .   ? 27.550 88.629 -6.605  1.00 32.03  ? 800 HOH A O   1 
HETATM 4449 O O   . HOH D 4 .   ? 13.036 58.681 33.152  1.00 33.57  ? 801 HOH A O   1 
HETATM 4450 O O   . HOH D 4 .   ? 27.602 33.428 -3.200  1.00 37.34  ? 802 HOH A O   1 
HETATM 4451 O O   . HOH D 4 .   ? 30.966 80.388 9.245   1.00 40.50  ? 803 HOH A O   1 
HETATM 4452 O O   . HOH D 4 .   ? 38.434 34.764 16.159  1.00 30.86  ? 804 HOH A O   1 
HETATM 4453 O O   . HOH D 4 .   ? 10.453 49.697 34.242  1.00 38.66  ? 805 HOH A O   1 
HETATM 4454 O O   . HOH D 4 .   ? 0.301  51.552 20.922  1.00 51.91  ? 806 HOH A O   1 
HETATM 4455 O O   . HOH D 4 .   ? 11.022 48.816 -15.940 1.00 26.36  ? 807 HOH A O   1 
HETATM 4456 O O   . HOH D 4 .   ? 18.837 42.557 33.163  1.00 43.80  ? 808 HOH A O   1 
HETATM 4457 O O   . HOH D 4 .   ? 34.610 60.216 35.596  1.00 40.26  ? 809 HOH A O   1 
HETATM 4458 O O   . HOH D 4 .   ? 15.083 72.646 23.507  1.00 45.65  ? 810 HOH A O   1 
HETATM 4459 O O   . HOH D 4 .   ? 32.430 61.737 -19.527 1.00 28.96  ? 811 HOH A O   1 
HETATM 4460 O O   . HOH D 4 .   ? 33.104 52.282 -22.938 1.00 37.92  ? 812 HOH A O   1 
HETATM 4461 O O   . HOH D 4 .   ? 22.360 87.272 -12.772 1.00 25.31  ? 813 HOH A O   1 
HETATM 4462 O O   . HOH D 4 .   ? 30.505 81.863 14.022  1.00 28.46  ? 814 HOH A O   1 
HETATM 4463 O O   . HOH D 4 .   ? 38.134 87.358 15.298  1.00 35.08  ? 815 HOH A O   1 
HETATM 4464 O O   . HOH D 4 .   ? 40.156 79.581 9.965   1.00 29.61  ? 816 HOH A O   1 
HETATM 4465 O O   . HOH D 4 .   ? 38.682 71.916 -8.162  1.00 49.26  ? 817 HOH A O   1 
HETATM 4466 O O   . HOH D 4 .   ? 44.000 56.880 5.641   1.00 33.47  ? 818 HOH A O   1 
HETATM 4467 O O   . HOH D 4 .   ? 5.837  62.773 -5.327  1.00 41.53  ? 819 HOH A O   1 
HETATM 4468 O O   . HOH D 4 .   ? -0.464 51.749 5.161   1.00 39.65  ? 820 HOH A O   1 
HETATM 4469 O O   . HOH D 4 .   ? 39.923 36.384 19.916  1.00 34.95  ? 821 HOH A O   1 
HETATM 4470 O O   . HOH D 4 .   ? 0.894  46.418 22.674  1.00 49.13  ? 822 HOH A O   1 
HETATM 4471 O O   . HOH D 4 .   ? 25.329 87.508 19.221  1.00 44.10  ? 823 HOH A O   1 
HETATM 4472 O O   . HOH D 4 .   ? 5.541  54.968 -13.631 1.00 42.36  ? 824 HOH A O   1 
HETATM 4473 O O   . HOH D 4 .   ? 40.853 61.669 -8.880  1.00 44.52  ? 825 HOH A O   1 
HETATM 4474 O O   . HOH D 4 .   ? 27.671 91.451 -5.316  1.00 45.79  ? 826 HOH A O   1 
HETATM 4475 O O   . HOH D 4 .   ? 39.352 59.247 -9.085  1.00 33.21  ? 827 HOH A O   1 
HETATM 4476 O O   . HOH D 4 .   ? -3.122 50.202 3.452   1.00 28.82  ? 828 HOH A O   1 
HETATM 4477 O O   . HOH D 4 .   ? 48.057 57.348 -7.547  1.00 39.93  ? 829 HOH A O   1 
HETATM 4478 O O   . HOH D 4 .   ? 46.152 61.414 -9.470  1.00 45.12  ? 830 HOH A O   1 
HETATM 4479 O O   . HOH D 4 .   ? 50.760 59.855 -9.091  1.00 55.07  ? 831 HOH A O   1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'BMA B 3 HAS WRONG CHIRALITY AT ATOM C1'   
2 'BMA B 4 HAS WRONG CHIRALITY AT ATOM C1'   
3 'BMA B 5 HAS WRONG CHIRALITY AT ATOM C1'   
4 'NAG A 601 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  TRP 53  53  53  TRP TRP A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  CYS 93  93  93  CYS CYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 ?   ?   ?   A . n 
A 1 105 ARG 105 105 ?   ?   ?   A . n 
A 1 106 LEU 106 106 ?   ?   ?   A . n 
A 1 107 ARG 107 107 ?   ?   ?   A . n 
A 1 108 HIS 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 ARG 110 110 ?   ?   ?   A . n 
A 1 111 GLY 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLY 114 114 ?   ?   ?   A . n 
A 1 115 GLY 115 115 ?   ?   ?   A . n 
A 1 116 GLU 116 116 ?   ?   ?   A . n 
A 1 117 HIS 117 117 ?   ?   ?   A . n 
A 1 118 PRO 118 118 ?   ?   ?   A . n 
A 1 119 ASN 119 119 ?   ?   ?   A . n 
A 1 120 GLY 120 120 ?   ?   ?   A . n 
A 1 121 LYS 121 121 ?   ?   ?   A . n 
A 1 122 GLN 122 122 ?   ?   ?   A . n 
A 1 123 ALA 123 123 ?   ?   ?   A . n 
A 1 124 ASP 124 124 ?   ?   ?   A . n 
A 1 125 THR 125 125 ?   ?   ?   A . n 
A 1 126 ASP 126 126 ?   ?   ?   A . n 
A 1 127 HIS 127 127 ?   ?   ?   A . n 
A 1 128 LEU 128 128 ?   ?   ?   A . n 
A 1 129 ILE 129 129 ?   ?   ?   A . n 
A 1 130 HIS 130 130 ?   ?   ?   A . n 
A 1 131 ASN 131 131 ?   ?   ?   A . n 
A 1 132 GLY 132 132 ?   ?   ?   A . n 
A 1 133 ASN 133 133 ?   ?   ?   A . n 
A 1 134 PRO 134 134 ?   ?   ?   A . n 
A 1 135 GLN 135 135 ?   ?   ?   A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 MET 267 267 267 MET MET A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TRP 271 271 271 TRP TRP A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 MET 305 305 305 MET MET A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 CYS 307 307 307 CYS CYS A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 TRP 321 321 321 TRP TRP A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ASP 337 337 337 ASP ASP A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 MET 346 346 346 MET MET A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 LEU 348 348 348 LEU LEU A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 ASP 353 353 353 ASP ASP A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 TYR 357 357 357 TYR TYR A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 MET 361 361 361 MET MET A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 VAL 364 364 364 VAL VAL A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 TYR 370 370 370 TYR TYR A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ARG 390 390 390 ARG ARG A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 LYS 392 392 392 LYS LYS A . n 
A 1 393 TYR 393 393 393 TYR TYR A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 MET 397 397 397 MET MET A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PHE 401 401 401 PHE PHE A . n 
A 1 402 GLY 402 402 402 GLY GLY A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 THR 405 405 405 THR THR A . n 
A 1 406 GLN 406 406 406 GLN GLN A . n 
A 1 407 ALA 407 407 407 ALA ALA A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 ARG 409 409 409 ARG ARG A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 THR 417 417 417 THR THR A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 TRP 419 419 419 TRP TRP A . n 
A 1 420 GLU 420 420 420 GLU GLU A . n 
A 1 421 GLY 421 421 421 GLY GLY A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 GLN 429 429 429 GLN GLN A . n 
A 1 430 GLN 430 430 430 GLN GLN A . n 
A 1 431 ILE 431 431 431 ILE ILE A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 THR 444 444 444 THR THR A . n 
A 1 445 ASN 445 445 445 ASN ASN A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 TYR 447 447 447 TYR TYR A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 ALA 452 452 452 ALA ALA A . n 
A 1 453 GLU 453 453 453 GLU GLU A . n 
A 1 454 ARG 454 454 454 ARG ARG A . n 
A 1 455 GLY 455 455 455 GLY GLY A . n 
A 1 456 ALA 456 456 456 ALA ALA A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 HIS 459 459 459 HIS HIS A . n 
A 1 460 TYR 460 460 460 TYR TYR A . n 
A 1 461 TYR 461 461 461 TYR TYR A . n 
A 1 462 TYR 462 462 462 TYR TYR A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 HIS 465 465 465 HIS HIS A . n 
A 1 466 ARG 466 466 466 ARG ARG A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 SER 468 468 468 SER SER A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 TRP 472 472 472 TRP TRP A . n 
A 1 473 GLY 473 473 473 GLY GLY A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 TRP 475 475 475 TRP TRP A . n 
A 1 476 MET 476 476 476 MET MET A . n 
A 1 477 GLY 477 477 477 GLY GLY A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 HIS 480 480 480 HIS HIS A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 TYR 486 486 486 TYR TYR A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 GLN 490 490 490 GLN GLN A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 ASN 493 493 493 ASN ASN A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 TYR 498 498 498 TYR TYR A . n 
A 1 499 ARG 499 499 499 ARG ARG A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 GLU 502 502 502 GLU GLU A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 ARG 508 508 508 ARG ARG A . n 
A 1 509 MET 509 509 509 MET MET A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 SER 511 511 511 SER SER A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 PHE 516 516 516 PHE PHE A . n 
A 1 517 ALA 517 517 517 ALA ALA A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 GLY 520 520 520 GLY GLY A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 ALA 523 523 523 ALA ALA A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 ASP 525 525 525 ASP ASP A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 TRP 529 529 529 TRP TRP A . n 
A 1 530 PRO 530 530 530 PRO PRO A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 LYS 534 534 534 LYS LYS A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 ASP 536 536 536 ASP ASP A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 VAL 538 538 538 VAL VAL A . n 
A 1 539 TYR 539 539 539 TYR TYR A . n 
A 1 540 TYR 540 540 540 TYR TYR A . n 
A 1 541 ILE 541 541 541 ILE ILE A . n 
A 1 542 PHE 542 542 542 PHE PHE A . n 
A 1 543 SER 543 543 543 SER SER A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 ASP 546 546 546 ASP ASP A . n 
A 1 547 LYS 547 547 547 LYS LYS A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 ALA 552 552 552 ALA ALA A . n 
A 1 553 ARG 553 553 553 ARG ARG A . n 
A 1 554 GLY 554 554 554 GLY GLY A . n 
A 1 555 PRO 555 555 555 PRO PRO A . n 
A 1 556 LEU 556 556 556 LEU LEU A . n 
A 1 557 ALA 557 557 557 ALA ALA A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 CYS 560 560 560 CYS CYS A . n 
A 1 561 SER 561 561 561 SER SER A . n 
A 1 562 PHE 562 562 562 PHE PHE A . n 
A 1 563 TRP 563 563 563 TRP TRP A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 LYS 569 569 569 LYS LYS A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 ARG 571 571 571 ARG ARG A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 TRP 573 573 573 TRP TRP A . n 
A 1 574 ALA 574 574 574 ALA ALA A . n 
A 1 575 GLY 575 575 ?   ?   ?   A . n 
A 1 576 THR 576 576 ?   ?   ?   A . n 
A 1 577 CYS 577 577 ?   ?   ?   A . n 
A 1 578 ASP 578 578 ?   ?   ?   A . n 
A 1 579 GLY 579 579 ?   ?   ?   A . n 
A 1 580 ASP 580 580 ?   ?   ?   A . n 
A 1 581 SER 581 581 ?   ?   ?   A . n 
A 1 582 GLY 582 582 ?   ?   ?   A . n 
A 1 583 SER 583 583 ?   ?   ?   A . n 
A 1 584 ALA 584 584 ?   ?   ?   A . n 
A 1 585 SER 585 585 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1   601 992  NAG NAG A . 
D 4 HOH 1   701 2093 HOH HOH A . 
D 4 HOH 2   702 2098 HOH HOH A . 
D 4 HOH 3   703 2109 HOH HOH A . 
D 4 HOH 4   704 2078 HOH HOH A . 
D 4 HOH 5   705 2062 HOH HOH A . 
D 4 HOH 6   706 2077 HOH HOH A . 
D 4 HOH 7   707 2037 HOH HOH A . 
D 4 HOH 8   708 2026 HOH HOH A . 
D 4 HOH 9   709 2104 HOH HOH A . 
D 4 HOH 10  710 2070 HOH HOH A . 
D 4 HOH 11  711 2018 HOH HOH A . 
D 4 HOH 12  712 2096 HOH HOH A . 
D 4 HOH 13  713 2007 HOH HOH A . 
D 4 HOH 14  714 2059 HOH HOH A . 
D 4 HOH 15  715 2091 HOH HOH A . 
D 4 HOH 16  716 2124 HOH HOH A . 
D 4 HOH 17  717 2010 HOH HOH A . 
D 4 HOH 18  718 2110 HOH HOH A . 
D 4 HOH 19  719 2112 HOH HOH A . 
D 4 HOH 20  720 2115 HOH HOH A . 
D 4 HOH 21  721 2107 HOH HOH A . 
D 4 HOH 22  722 2103 HOH HOH A . 
D 4 HOH 23  723 2057 HOH HOH A . 
D 4 HOH 24  724 2116 HOH HOH A . 
D 4 HOH 25  725 2118 HOH HOH A . 
D 4 HOH 26  726 2045 HOH HOH A . 
D 4 HOH 27  727 2101 HOH HOH A . 
D 4 HOH 28  728 2102 HOH HOH A . 
D 4 HOH 29  729 2052 HOH HOH A . 
D 4 HOH 30  730 2126 HOH HOH A . 
D 4 HOH 31  731 2039 HOH HOH A . 
D 4 HOH 32  732 2046 HOH HOH A . 
D 4 HOH 33  733 2088 HOH HOH A . 
D 4 HOH 34  734 2043 HOH HOH A . 
D 4 HOH 35  735 2003 HOH HOH A . 
D 4 HOH 36  736 2072 HOH HOH A . 
D 4 HOH 37  737 2087 HOH HOH A . 
D 4 HOH 38  738 2127 HOH HOH A . 
D 4 HOH 39  739 2058 HOH HOH A . 
D 4 HOH 40  740 2019 HOH HOH A . 
D 4 HOH 41  741 2061 HOH HOH A . 
D 4 HOH 42  742 2076 HOH HOH A . 
D 4 HOH 43  743 2086 HOH HOH A . 
D 4 HOH 44  744 2075 HOH HOH A . 
D 4 HOH 45  745 2113 HOH HOH A . 
D 4 HOH 46  746 2029 HOH HOH A . 
D 4 HOH 47  747 2089 HOH HOH A . 
D 4 HOH 48  748 2122 HOH HOH A . 
D 4 HOH 49  749 2025 HOH HOH A . 
D 4 HOH 50  750 2040 HOH HOH A . 
D 4 HOH 51  751 2050 HOH HOH A . 
D 4 HOH 52  752 2002 HOH HOH A . 
D 4 HOH 53  753 2123 HOH HOH A . 
D 4 HOH 54  754 2071 HOH HOH A . 
D 4 HOH 55  755 2099 HOH HOH A . 
D 4 HOH 56  756 2053 HOH HOH A . 
D 4 HOH 57  757 2027 HOH HOH A . 
D 4 HOH 58  758 2060 HOH HOH A . 
D 4 HOH 59  759 2042 HOH HOH A . 
D 4 HOH 60  760 2105 HOH HOH A . 
D 4 HOH 61  761 2090 HOH HOH A . 
D 4 HOH 62  762 2023 HOH HOH A . 
D 4 HOH 63  763 2012 HOH HOH A . 
D 4 HOH 64  764 2056 HOH HOH A . 
D 4 HOH 65  765 2021 HOH HOH A . 
D 4 HOH 66  766 2079 HOH HOH A . 
D 4 HOH 67  767 2117 HOH HOH A . 
D 4 HOH 68  768 2067 HOH HOH A . 
D 4 HOH 69  769 2119 HOH HOH A . 
D 4 HOH 70  770 2083 HOH HOH A . 
D 4 HOH 71  771 2120 HOH HOH A . 
D 4 HOH 72  772 2125 HOH HOH A . 
D 4 HOH 73  773 2080 HOH HOH A . 
D 4 HOH 74  774 2051 HOH HOH A . 
D 4 HOH 75  775 2031 HOH HOH A . 
D 4 HOH 76  776 2034 HOH HOH A . 
D 4 HOH 77  777 2024 HOH HOH A . 
D 4 HOH 78  778 2033 HOH HOH A . 
D 4 HOH 79  779 2041 HOH HOH A . 
D 4 HOH 80  780 2073 HOH HOH A . 
D 4 HOH 81  781 2092 HOH HOH A . 
D 4 HOH 82  782 2069 HOH HOH A . 
D 4 HOH 83  783 2097 HOH HOH A . 
D 4 HOH 84  784 2100 HOH HOH A . 
D 4 HOH 85  785 2022 HOH HOH A . 
D 4 HOH 86  786 2094 HOH HOH A . 
D 4 HOH 87  787 2128 HOH HOH A . 
D 4 HOH 88  788 2055 HOH HOH A . 
D 4 HOH 89  789 2014 HOH HOH A . 
D 4 HOH 90  790 2081 HOH HOH A . 
D 4 HOH 91  791 2111 HOH HOH A . 
D 4 HOH 92  792 2108 HOH HOH A . 
D 4 HOH 93  793 2064 HOH HOH A . 
D 4 HOH 94  794 2047 HOH HOH A . 
D 4 HOH 95  795 2044 HOH HOH A . 
D 4 HOH 96  796 2004 HOH HOH A . 
D 4 HOH 97  797 2028 HOH HOH A . 
D 4 HOH 98  798 2065 HOH HOH A . 
D 4 HOH 99  799 2082 HOH HOH A . 
D 4 HOH 100 800 2066 HOH HOH A . 
D 4 HOH 101 801 2121 HOH HOH A . 
D 4 HOH 102 802 2011 HOH HOH A . 
D 4 HOH 103 803 2005 HOH HOH A . 
D 4 HOH 104 804 2106 HOH HOH A . 
D 4 HOH 105 805 2114 HOH HOH A . 
D 4 HOH 106 806 2074 HOH HOH A . 
D 4 HOH 107 807 2001 HOH HOH A . 
D 4 HOH 108 808 2008 HOH HOH A . 
D 4 HOH 109 809 2095 HOH HOH A . 
D 4 HOH 110 810 2054 HOH HOH A . 
D 4 HOH 111 811 2020 HOH HOH A . 
D 4 HOH 112 812 2006 HOH HOH A . 
D 4 HOH 113 813 2063 HOH HOH A . 
D 4 HOH 114 814 2068 HOH HOH A . 
D 4 HOH 115 815 2038 HOH HOH A . 
D 4 HOH 116 816 2013 HOH HOH A . 
D 4 HOH 117 817 2016 HOH HOH A . 
D 4 HOH 118 818 2048 HOH HOH A . 
D 4 HOH 119 819 2009 HOH HOH A . 
D 4 HOH 120 820 2032 HOH HOH A . 
D 4 HOH 121 821 2049 HOH HOH A . 
D 4 HOH 122 822 2015 HOH HOH A . 
D 4 HOH 123 823 2036 HOH HOH A . 
D 4 HOH 124 824 2030 HOH HOH A . 
D 4 HOH 125 825 2084 HOH HOH A . 
D 4 HOH 126 826 2035 HOH HOH A . 
D 4 HOH 127 827 2130 HOH HOH A . 
D 4 HOH 128 828 2017 HOH HOH A . 
D 4 HOH 129 829 2129 HOH HOH A . 
D 4 HOH 130 830 2131 HOH HOH A . 
D 4 HOH 131 831 2085 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 88  A ASN 88  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 493 A ASN 493 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D 
1 2 A,C,D   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 94.3400000000 -1.0000000000 
0.0000000000 0.0000000000 94.3400000000 0.0000000000 0.0000000000 -1.0000000000 79.5000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-20 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-10-09 
5 'Structure model' 2 0 2020-07-29 
6 'Structure model' 3 0 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' Other                       
7  5 'Structure model' Advisory                    
8  5 'Structure model' 'Atomic model'              
9  5 'Structure model' 'Data collection'           
10 5 'Structure model' 'Derived calculations'      
11 5 'Structure model' 'Structure summary'         
12 6 'Structure model' Advisory                    
13 6 'Structure model' 'Atomic model'              
14 6 'Structure model' 'Data collection'           
15 6 'Structure model' 'Derived calculations'      
16 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                      
2  4 'Structure model' pdbx_database_status          
3  4 'Structure model' struct_conn                   
4  5 'Structure model' atom_site                     
5  5 'Structure model' chem_comp                     
6  5 'Structure model' database_PDB_caveat           
7  5 'Structure model' entity                        
8  5 'Structure model' pdbx_branch_scheme            
9  5 'Structure model' pdbx_chem_comp_identifier     
10 5 'Structure model' pdbx_entity_branch            
11 5 'Structure model' pdbx_entity_branch_descriptor 
12 5 'Structure model' pdbx_entity_branch_link       
13 5 'Structure model' pdbx_entity_branch_list       
14 5 'Structure model' pdbx_entity_nonpoly           
15 5 'Structure model' pdbx_nonpoly_scheme           
16 5 'Structure model' pdbx_struct_assembly_gen      
17 5 'Structure model' pdbx_validate_chiral          
18 5 'Structure model' struct_asym                   
19 5 'Structure model' struct_conn                   
20 5 'Structure model' struct_site                   
21 5 'Structure model' struct_site_gen               
22 6 'Structure model' atom_site                     
23 6 'Structure model' chem_comp                     
24 6 'Structure model' database_PDB_caveat           
25 6 'Structure model' pdbx_distant_solvent_atoms    
26 6 'Structure model' pdbx_nonpoly_scheme           
27 6 'Structure model' pdbx_struct_assembly          
28 6 'Structure model' pdbx_struct_assembly_gen      
29 6 'Structure model' pdbx_struct_oper_list         
30 6 'Structure model' pdbx_validate_chiral          
31 6 'Structure model' pdbx_validate_close_contact   
32 6 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.page_last'                                         
2  4 'Structure model' '_citation.pdbx_database_id_DOI'                              
3  4 'Structure model' '_citation.title'                                             
4  4 'Structure model' '_pdbx_database_status.status_code_sf'                        
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'                         
6  5 'Structure model' '_atom_site.auth_asym_id'                                     
7  5 'Structure model' '_atom_site.auth_seq_id'                                      
8  5 'Structure model' '_atom_site.label_asym_id'                                    
9  5 'Structure model' '_atom_site.label_entity_id'                                  
10 5 'Structure model' '_chem_comp.name'                                             
11 5 'Structure model' '_chem_comp.type'                                             
12 5 'Structure model' '_entity.formula_weight'                                      
13 5 'Structure model' '_entity.pdbx_description'                                    
14 5 'Structure model' '_entity.pdbx_number_of_molecules'                            
15 5 'Structure model' '_entity.type'                                                
16 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'                      
17 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id'                          
18 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id'                           
19 5 'Structure model' '_struct_conn.pdbx_role'                                      
20 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'                             
21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'                              
22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'                            
23 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'                             
24 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'                              
25 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'                            
26 6 'Structure model' '_atom_site.B_iso_or_equiv'                                   
27 6 'Structure model' '_atom_site.Cartn_x'                                          
28 6 'Structure model' '_atom_site.Cartn_y'                                          
29 6 'Structure model' '_atom_site.Cartn_z'                                          
30 6 'Structure model' '_atom_site.auth_seq_id'                                      
31 6 'Structure model' '_chem_comp.pdbx_synonyms'                                    
32 6 'Structure model' '_database_PDB_caveat.text'                                   
33 6 'Structure model' '_pdbx_distant_solvent_atoms.auth_seq_id'                     
34 6 'Structure model' '_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance' 
35 6 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num'                           
36 6 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'                            
37 6 'Structure model' '_pdbx_struct_assembly.details'                               
38 6 'Structure model' '_pdbx_struct_assembly.method_details'                        
39 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'                      
40 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'                    
41 6 'Structure model' '_pdbx_validate_chiral.auth_seq_id'                           
42 6 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'                  
43 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'                         
44 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id'                              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       3.8 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CCP4      phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CD  A GLU 420 ? ? O   A HOH 701 ? ? 1.15 
2  1 OE1 A GLU 420 ? ? O   A HOH 701 ? ? 1.20 
3  1 OE2 A GLU 420 ? ? O   A HOH 701 ? ? 1.26 
4  1 CG2 A ILE 377 ? ? O   A PHE 380 ? ? 1.66 
5  1 O   A ILE 377 ? ? N   A TYR 379 ? ? 1.88 
6  1 NH2 A ARG 508 ? ? OG1 A THR 544 ? ? 1.95 
7  1 N   A THR 464 ? ? OG  A SER 543 ? ? 2.09 
8  1 O   A SER 306 ? ? O   A ARG 309 ? ? 2.14 
9  1 O   A TYR 374 ? ? N   A PHE 376 ? A 2.16 
10 1 C   A ILE 377 ? ? N   A TYR 379 ? ? 2.17 
11 1 O   A ILE 377 ? ? CD1 A TYR 379 ? ? 2.17 
12 1 OE1 A GLU 453 ? B O   A HOH 702 ? ? 2.19 
13 1 OE1 A GLU 527 ? ? O   A HOH 703 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA A ASN 136 ? ? C  A ASN 136 ? ? N   A THR 137 ? ? 139.53 117.20 22.33  2.20 Y 
2  1 O  A ASN 136 ? ? C  A ASN 136 ? ? N   A THR 137 ? ? 94.60  122.70 -28.10 1.60 Y 
3  1 C  A ASN 136 ? ? N  A THR 137 ? ? CA  A THR 137 ? ? 144.71 121.70 23.01  2.50 Y 
4  1 CG A MET 262 ? ? SD A MET 262 ? ? CE  A MET 262 ? ? 110.02 100.20 9.82   1.60 N 
5  1 CG A MET 308 ? ? SD A MET 308 ? ? CE  A MET 308 ? ? 109.81 100.20 9.61   1.60 N 
6  1 NE A ARG 309 ? ? CZ A ARG 309 ? ? NH2 A ARG 309 ? ? 123.88 120.30 3.58   0.50 N 
7  1 C  A LEU 341 ? ? N  A PRO 342 ? ? CA  A PRO 342 ? ? 129.40 119.30 10.10  1.50 Y 
8  1 CB A PHE 376 ? B CG A PHE 376 ? B CD1 A PHE 376 ? B 115.35 120.80 -5.45  0.70 N 
9  1 N  A PHE 376 ? B CA A PHE 376 ? B C   A PHE 376 ? B 131.12 111.00 20.12  2.70 N 
10 1 CG A MET 476 ? ? SD A MET 476 ? ? CE  A MET 476 ? ? 110.01 100.20 9.81   1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 10  ? ? -65.10  11.38   
2  1 PRO A 38  ? ? -66.17  74.41   
3  1 GLU A 40  ? ? 60.65   -130.91 
4  1 GLU A 40  ? ? 60.65   -130.71 
5  1 ASP A 41  ? A -46.64  -17.25  
6  1 ASP A 41  ? B -47.54  -16.14  
7  1 ARG A 43  ? ? -35.24  141.59  
8  1 PHE A 44  ? ? 73.45   -8.71   
9  1 HIS A 54  ? ? -76.49  -101.36 
10 1 VAL A 56  ? ? -39.10  145.51  
11 1 ALA A 59  ? ? -110.84 51.68   
12 1 ARG A 70  ? ? 94.42   119.51  
13 1 TYR A 73  ? ? -55.25  1.30    
14 1 PHE A 74  ? ? -158.75 77.12   
15 1 PHE A 77  ? ? -29.63  115.06  
16 1 GLU A 81  ? ? 108.96  -49.30  
17 1 ILE A 82  ? ? -61.28  7.43    
18 1 PRO A 85  ? ? -35.84  92.69   
19 1 PHE A 152 ? ? 51.38   13.48   
20 1 THR A 154 ? ? -121.61 -160.86 
21 1 LEU A 188 ? ? -59.34  103.48  
22 1 ASN A 205 ? ? 55.53   0.61    
23 1 SER A 238 ? ? 53.70   -127.86 
24 1 ARG A 254 ? ? -36.72  127.81  
25 1 LEU A 256 ? ? -15.51  -71.10  
26 1 MET A 267 ? ? -39.80  -30.53  
27 1 ALA A 269 ? ? -46.14  150.26  
28 1 CYS A 290 ? ? -105.81 45.64   
29 1 ASN A 291 ? ? 35.87   47.77   
30 1 ASN A 293 ? ? 37.99   80.18   
31 1 ALA A 294 ? ? -66.79  44.08   
32 1 LEU A 297 ? ? -18.31  -49.96  
33 1 THR A 299 ? ? -147.49 -5.46   
34 1 ASN A 300 ? ? -148.44 55.35   
35 1 SER A 306 ? ? -49.53  -17.50  
36 1 SER A 310 ? ? 129.73  -63.10  
37 1 TRP A 321 ? ? -46.41  -14.16  
38 1 SER A 323 ? ? -59.51  42.44   
39 1 SER A 325 ? ? -75.92  27.75   
40 1 LEU A 328 ? ? 49.71   24.96   
41 1 SER A 329 ? ? -112.16 54.19   
42 1 PHE A 330 ? ? -49.21  150.22  
43 1 ALA A 339 ? ? -111.13 -96.15  
44 1 ARG A 365 ? ? -34.64  -37.37  
45 1 GLU A 367 ? ? -49.05  -75.39  
46 1 LEU A 372 ? ? -81.50  -72.10  
47 1 LEU A 373 ? ? -58.93  12.27   
48 1 TYR A 374 ? ? -122.66 -64.59  
49 1 ASP A 375 ? ? -65.41  46.64   
50 1 ASP A 375 ? ? -65.41  45.66   
51 1 PHE A 376 ? A 92.36   119.47  
52 1 PHE A 376 ? B 91.59   122.35  
53 1 ILE A 377 ? ? -92.61  -85.68  
54 1 ILE A 377 ? ? -94.32  -85.68  
55 1 ASP A 378 ? ? 52.18   -48.32  
56 1 ASP A 383 ? ? -94.43  -71.51  
57 1 TYR A 393 ? ? -35.19  -39.91  
58 1 ILE A 396 ? ? -69.46  -75.09  
59 1 PHE A 401 ? ? -108.13 42.20   
60 1 GLU A 420 ? ? -174.14 148.75  
61 1 ASN A 422 ? ? -65.98  93.36   
62 1 PHE A 440 ? ? -125.50 -74.67  
63 1 THR A 469 ? ? -103.26 62.85   
64 1 MET A 476 ? ? -75.72  20.50   
65 1 HIS A 480 ? ? -36.56  145.34  
66 1 ALA A 523 ? ? -53.07  -103.71 
67 1 GLN A 524 ? ? 121.33  139.28  
68 1 ASP A 525 ? ? -48.93  104.96  
69 1 PHE A 542 ? ? -71.11  -95.12  
70 1 SER A 543 ? ? 18.54   123.14  
71 1 ASP A 546 ? ? 81.26   147.19  
72 1 LEU A 551 ? ? -58.08  -93.63  
73 1 ALA A 552 ? ? 81.96   150.36  
74 1 ARG A 553 ? ? -150.06 -38.09  
75 1 SER A 572 ? ? -42.59  67.71   
76 1 TRP A 573 ? ? 82.02   91.24   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    136 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    137 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -101.90 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ASN 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              136 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -19.03 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    PHE 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     376 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    A 
_pdbx_validate_planes.rmsd            0.145 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? B BMA 3   ? 'WRONG HAND' . 
2 1 C1 ? B BMA 4   ? 'WRONG HAND' . 
3 1 C1 ? B BMA 5   ? 'WRONG HAND' . 
4 1 C1 ? A NAG 601 ? 'WRONG HAND' . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 820 ? 5.91 .    
2 1 O ? A HOH 821 ? 6.02 .    
3 1 O ? A HOH 822 ? 6.35 .    
4 1 O ? A HOH 823 ? 6.53 .    
5 1 O ? A HOH 824 ? 6.55 .    
6 1 O ? A HOH 826 ? 6.68 .    
7 1 O ? A HOH 828 ? 9.13 .    
8 1 O ? A HOH 831 ? .    7.26 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 4   ? NE  ? A ARG 4   NE  
2  1 Y 1 A ARG 4   ? CZ  ? A ARG 4   CZ  
3  1 Y 1 A ARG 4   ? NH1 ? A ARG 4   NH1 
4  1 Y 1 A ARG 4   ? NH2 ? A ARG 4   NH2 
5  1 Y 1 A ARG 15  ? CZ  ? A ARG 15  CZ  
6  1 Y 1 A ARG 15  ? NH1 ? A ARG 15  NH1 
7  1 Y 1 A ARG 15  ? NH2 ? A ARG 15  NH2 
8  1 Y 1 A GLU 51  ? CD  ? A GLU 51  CD  
9  1 Y 1 A GLU 51  ? OE1 ? A GLU 51  OE1 
10 1 Y 1 A GLU 51  ? OE2 ? A GLU 51  OE2 
11 1 Y 1 A ARG 216 ? NE  ? A ARG 216 NE  
12 1 Y 1 A ARG 216 ? CZ  ? A ARG 216 CZ  
13 1 Y 1 A ARG 216 ? NH1 ? A ARG 216 NH1 
14 1 Y 1 A ARG 216 ? NH2 ? A ARG 216 NH2 
15 1 Y 1 A GLU 230 ? CD  ? A GLU 230 CD  
16 1 Y 1 A GLU 230 ? OE1 ? A GLU 230 OE1 
17 1 Y 1 A GLU 230 ? OE2 ? A GLU 230 OE2 
18 1 Y 1 A ASN 291 ? CG  ? A ASN 291 CG  
19 1 Y 1 A ASN 291 ? OD1 ? A ASN 291 OD1 
20 1 Y 1 A ASN 291 ? ND2 ? A ASN 291 ND2 
21 1 Y 1 A ASN 300 ? CG  ? A ASN 300 CG  
22 1 Y 1 A ASN 300 ? OD1 ? A ASN 300 OD1 
23 1 Y 1 A ASN 300 ? ND2 ? A ASN 300 ND2 
24 1 Y 1 A ASN 422 ? CG  ? A ASN 422 CG  
25 1 Y 1 A ASN 422 ? OD1 ? A ASN 422 OD1 
26 1 Y 1 A ASN 422 ? ND2 ? A ASN 422 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A ALA 104 ? A ALA 104 
4  1 Y 1 A ARG 105 ? A ARG 105 
5  1 Y 1 A LEU 106 ? A LEU 106 
6  1 Y 1 A ARG 107 ? A ARG 107 
7  1 Y 1 A HIS 108 ? A HIS 108 
8  1 Y 1 A GLY 109 ? A GLY 109 
9  1 Y 1 A ARG 110 ? A ARG 110 
10 1 Y 1 A GLY 111 ? A GLY 111 
11 1 Y 1 A ALA 112 ? A ALA 112 
12 1 Y 1 A ASN 113 ? A ASN 113 
13 1 Y 1 A GLY 114 ? A GLY 114 
14 1 Y 1 A GLY 115 ? A GLY 115 
15 1 Y 1 A GLU 116 ? A GLU 116 
16 1 Y 1 A HIS 117 ? A HIS 117 
17 1 Y 1 A PRO 118 ? A PRO 118 
18 1 Y 1 A ASN 119 ? A ASN 119 
19 1 Y 1 A GLY 120 ? A GLY 120 
20 1 Y 1 A LYS 121 ? A LYS 121 
21 1 Y 1 A GLN 122 ? A GLN 122 
22 1 Y 1 A ALA 123 ? A ALA 123 
23 1 Y 1 A ASP 124 ? A ASP 124 
24 1 Y 1 A THR 125 ? A THR 125 
25 1 Y 1 A ASP 126 ? A ASP 126 
26 1 Y 1 A HIS 127 ? A HIS 127 
27 1 Y 1 A LEU 128 ? A LEU 128 
28 1 Y 1 A ILE 129 ? A ILE 129 
29 1 Y 1 A HIS 130 ? A HIS 130 
30 1 Y 1 A ASN 131 ? A ASN 131 
31 1 Y 1 A GLY 132 ? A GLY 132 
32 1 Y 1 A ASN 133 ? A ASN 133 
33 1 Y 1 A PRO 134 ? A PRO 134 
34 1 Y 1 A GLN 135 ? A GLN 135 
35 1 Y 1 A GLY 575 ? A GLY 575 
36 1 Y 1 A THR 576 ? A THR 576 
37 1 Y 1 A CYS 577 ? A CYS 577 
38 1 Y 1 A ASP 578 ? A ASP 578 
39 1 Y 1 A GLY 579 ? A GLY 579 
40 1 Y 1 A ASP 580 ? A ASP 580 
41 1 Y 1 A SER 581 ? A SER 581 
42 1 Y 1 A GLY 582 ? A GLY 582 
43 1 Y 1 A SER 583 ? A SER 583 
44 1 Y 1 A ALA 584 ? A ALA 584 
45 1 Y 1 A SER 585 ? A SER 585 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 991 n 
B 2 NAG 2 B NAG 2 A NAG 993 n 
B 2 BMA 3 B BMA 3 A BMA 994 n 
B 2 BMA 4 B BMA 4 A BMA 996 n 
B 2 BMA 5 B BMA 5 A BMA 997 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-3DManpb1-3DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                                          
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,5,4/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2-2-2/a4-b1_b4-c1_c3-d1_d3-e1'                WURCS PDB2Glycan 
1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-Manp]{[(3+1)][a-D-Manp]{[(3+1)][a-D-Manp]{}}}}}}' LINUCS PDB-CARE   
?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 2 4 BMA C1 O1 3 BMA O3 HO3 sing ? 
4 2 5 BMA C1 O1 4 BMA O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
2 BMA 4 n 
2 BMA 5 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 water                                    HOH 
#