data_1QON
# 
_entry.id   1QON 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QON         
PDBE  EBI-4374     
WWPDB D_1290004374 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QON 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Silman, I.'    2 
'Sussman, J.L.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Three-dimensional structures of Drosophila melanogaster acetylcholinesterase and of its complexes with two potent inhibitors.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            9 
_citation.page_first                1063 
_citation.page_last                 1072 
_citation.year                      2000 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10892800 
_citation.pdbx_database_id_DOI      10.1110/ps.9.6.1063 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'        1 ? 
primary 'Kryger, G.'       2 ? 
primary 'Rosenberry, T.L.' 3 ? 
primary 'Mallender, W.D.'  4 ? 
primary 'Lewis, T.'        5 ? 
primary 'Fletcher, R.J.'   6 ? 
primary 'Guss, J.M.'       7 ? 
primary 'Silman, I.'       8 ? 
primary 'Sussman, J.L.'    9 ? 
# 
_cell.entry_id           1QON 
_cell.length_a           94.930 
_cell.length_b           94.930 
_cell.length_c           160.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QON 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 64956.562 1   3.1.1.7 ? ? ? 
2 branched    man 
;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1   ?       ? ? ? 
3 non-polymer syn 'SULFATE ION' 96.063    1   ?       ? ? ? 
4 non-polymer syn '9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 414.283   1   ?       ? ? ? 
5 water       nat water 18.015    139 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDSGSAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDSGSAS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ILE n 
1 3   ASP n 
1 4   ARG n 
1 5   LEU n 
1 6   VAL n 
1 7   VAL n 
1 8   GLN n 
1 9   THR n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  PRO n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  SER n 
1 19  VAL n 
1 20  THR n 
1 21  VAL n 
1 22  GLN n 
1 23  GLY n 
1 24  ARG n 
1 25  GLU n 
1 26  VAL n 
1 27  HIS n 
1 28  VAL n 
1 29  TYR n 
1 30  THR n 
1 31  GLY n 
1 32  ILE n 
1 33  PRO n 
1 34  TYR n 
1 35  ALA n 
1 36  LYS n 
1 37  PRO n 
1 38  PRO n 
1 39  VAL n 
1 40  GLU n 
1 41  ASP n 
1 42  LEU n 
1 43  ARG n 
1 44  PHE n 
1 45  ARG n 
1 46  LYS n 
1 47  PRO n 
1 48  VAL n 
1 49  PRO n 
1 50  ALA n 
1 51  GLU n 
1 52  PRO n 
1 53  TRP n 
1 54  HIS n 
1 55  GLY n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  ALA n 
1 60  THR n 
1 61  GLY n 
1 62  LEU n 
1 63  SER n 
1 64  ALA n 
1 65  THR n 
1 66  CYS n 
1 67  VAL n 
1 68  GLN n 
1 69  GLU n 
1 70  ARG n 
1 71  TYR n 
1 72  GLU n 
1 73  TYR n 
1 74  PHE n 
1 75  PRO n 
1 76  GLY n 
1 77  PHE n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  GLU n 
1 82  ILE n 
1 83  TRP n 
1 84  ASN n 
1 85  PRO n 
1 86  ASN n 
1 87  THR n 
1 88  ASN n 
1 89  VAL n 
1 90  SER n 
1 91  GLU n 
1 92  ASP n 
1 93  CYS n 
1 94  LEU n 
1 95  TYR n 
1 96  ILE n 
1 97  ASN n 
1 98  VAL n 
1 99  TRP n 
1 100 ALA n 
1 101 PRO n 
1 102 ALA n 
1 103 LYS n 
1 104 ALA n 
1 105 ARG n 
1 106 LEU n 
1 107 ARG n 
1 108 HIS n 
1 109 GLY n 
1 110 ARG n 
1 111 GLY n 
1 112 ALA n 
1 113 ASN n 
1 114 GLY n 
1 115 GLY n 
1 116 GLU n 
1 117 HIS n 
1 118 PRO n 
1 119 ASN n 
1 120 GLY n 
1 121 LYS n 
1 122 GLN n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 ASP n 
1 127 HIS n 
1 128 LEU n 
1 129 ILE n 
1 130 HIS n 
1 131 ASN n 
1 132 GLY n 
1 133 ASN n 
1 134 PRO n 
1 135 GLN n 
1 136 ASN n 
1 137 THR n 
1 138 THR n 
1 139 ASN n 
1 140 GLY n 
1 141 LEU n 
1 142 PRO n 
1 143 ILE n 
1 144 LEU n 
1 145 ILE n 
1 146 TRP n 
1 147 ILE n 
1 148 TYR n 
1 149 GLY n 
1 150 GLY n 
1 151 GLY n 
1 152 PHE n 
1 153 MET n 
1 154 THR n 
1 155 GLY n 
1 156 SER n 
1 157 ALA n 
1 158 THR n 
1 159 LEU n 
1 160 ASP n 
1 161 ILE n 
1 162 TYR n 
1 163 ASN n 
1 164 ALA n 
1 165 ASP n 
1 166 ILE n 
1 167 MET n 
1 168 ALA n 
1 169 ALA n 
1 170 VAL n 
1 171 GLY n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 VAL n 
1 176 ALA n 
1 177 SER n 
1 178 PHE n 
1 179 GLN n 
1 180 TYR n 
1 181 ARG n 
1 182 VAL n 
1 183 GLY n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 LEU n 
1 191 ALA n 
1 192 PRO n 
1 193 GLU n 
1 194 MET n 
1 195 PRO n 
1 196 SER n 
1 197 GLU n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 GLU n 
1 202 ALA n 
1 203 PRO n 
1 204 GLY n 
1 205 ASN n 
1 206 VAL n 
1 207 GLY n 
1 208 LEU n 
1 209 TRP n 
1 210 ASP n 
1 211 GLN n 
1 212 ALA n 
1 213 LEU n 
1 214 ALA n 
1 215 ILE n 
1 216 ARG n 
1 217 TRP n 
1 218 LEU n 
1 219 LYS n 
1 220 ASP n 
1 221 ASN n 
1 222 ALA n 
1 223 HIS n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 GLY n 
1 228 ASN n 
1 229 PRO n 
1 230 GLU n 
1 231 TRP n 
1 232 MET n 
1 233 THR n 
1 234 LEU n 
1 235 PHE n 
1 236 GLY n 
1 237 GLU n 
1 238 SER n 
1 239 ALA n 
1 240 GLY n 
1 241 SER n 
1 242 SER n 
1 243 SER n 
1 244 VAL n 
1 245 ASN n 
1 246 ALA n 
1 247 GLN n 
1 248 LEU n 
1 249 MET n 
1 250 SER n 
1 251 PRO n 
1 252 VAL n 
1 253 THR n 
1 254 ARG n 
1 255 GLY n 
1 256 LEU n 
1 257 VAL n 
1 258 LYS n 
1 259 ARG n 
1 260 GLY n 
1 261 MET n 
1 262 MET n 
1 263 GLN n 
1 264 SER n 
1 265 GLY n 
1 266 THR n 
1 267 MET n 
1 268 ASN n 
1 269 ALA n 
1 270 PRO n 
1 271 TRP n 
1 272 SER n 
1 273 HIS n 
1 274 MET n 
1 275 THR n 
1 276 SER n 
1 277 GLU n 
1 278 LYS n 
1 279 ALA n 
1 280 VAL n 
1 281 GLU n 
1 282 ILE n 
1 283 GLY n 
1 284 LYS n 
1 285 ALA n 
1 286 LEU n 
1 287 ILE n 
1 288 ASN n 
1 289 ASP n 
1 290 CYS n 
1 291 ASN n 
1 292 CYS n 
1 293 ASN n 
1 294 ALA n 
1 295 SER n 
1 296 MET n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 ASN n 
1 301 PRO n 
1 302 ALA n 
1 303 HIS n 
1 304 VAL n 
1 305 MET n 
1 306 SER n 
1 307 CYS n 
1 308 MET n 
1 309 ARG n 
1 310 SER n 
1 311 VAL n 
1 312 ASP n 
1 313 ALA n 
1 314 LYS n 
1 315 THR n 
1 316 ILE n 
1 317 SER n 
1 318 VAL n 
1 319 GLN n 
1 320 GLN n 
1 321 TRP n 
1 322 ASN n 
1 323 SER n 
1 324 TYR n 
1 325 SER n 
1 326 GLY n 
1 327 ILE n 
1 328 LEU n 
1 329 SER n 
1 330 PHE n 
1 331 PRO n 
1 332 SER n 
1 333 ALA n 
1 334 PRO n 
1 335 THR n 
1 336 ILE n 
1 337 ASP n 
1 338 GLY n 
1 339 ALA n 
1 340 PHE n 
1 341 LEU n 
1 342 PRO n 
1 343 ALA n 
1 344 ASP n 
1 345 PRO n 
1 346 MET n 
1 347 THR n 
1 348 LEU n 
1 349 MET n 
1 350 LYS n 
1 351 THR n 
1 352 ALA n 
1 353 ASP n 
1 354 LEU n 
1 355 LYS n 
1 356 ASP n 
1 357 TYR n 
1 358 ASP n 
1 359 ILE n 
1 360 LEU n 
1 361 MET n 
1 362 GLY n 
1 363 ASN n 
1 364 VAL n 
1 365 ARG n 
1 366 ASP n 
1 367 GLU n 
1 368 GLY n 
1 369 THR n 
1 370 TYR n 
1 371 PHE n 
1 372 LEU n 
1 373 LEU n 
1 374 TYR n 
1 375 ASP n 
1 376 PHE n 
1 377 ILE n 
1 378 ASP n 
1 379 TYR n 
1 380 PHE n 
1 381 ASP n 
1 382 LYS n 
1 383 ASP n 
1 384 ASP n 
1 385 ALA n 
1 386 THR n 
1 387 ALA n 
1 388 LEU n 
1 389 PRO n 
1 390 ARG n 
1 391 ASP n 
1 392 LYS n 
1 393 TYR n 
1 394 LEU n 
1 395 GLU n 
1 396 ILE n 
1 397 MET n 
1 398 ASN n 
1 399 ASN n 
1 400 ILE n 
1 401 PHE n 
1 402 GLY n 
1 403 LYS n 
1 404 ALA n 
1 405 THR n 
1 406 GLN n 
1 407 ALA n 
1 408 GLU n 
1 409 ARG n 
1 410 GLU n 
1 411 ALA n 
1 412 ILE n 
1 413 ILE n 
1 414 PHE n 
1 415 GLN n 
1 416 TYR n 
1 417 THR n 
1 418 SER n 
1 419 TRP n 
1 420 GLU n 
1 421 GLY n 
1 422 ASN n 
1 423 PRO n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 ASN n 
1 428 GLN n 
1 429 GLN n 
1 430 GLN n 
1 431 ILE n 
1 432 GLY n 
1 433 ARG n 
1 434 ALA n 
1 435 VAL n 
1 436 GLY n 
1 437 ASP n 
1 438 HIS n 
1 439 PHE n 
1 440 PHE n 
1 441 THR n 
1 442 CYS n 
1 443 PRO n 
1 444 THR n 
1 445 ASN n 
1 446 GLU n 
1 447 TYR n 
1 448 ALA n 
1 449 GLN n 
1 450 ALA n 
1 451 LEU n 
1 452 ALA n 
1 453 GLU n 
1 454 ARG n 
1 455 GLY n 
1 456 ALA n 
1 457 SER n 
1 458 VAL n 
1 459 HIS n 
1 460 TYR n 
1 461 TYR n 
1 462 TYR n 
1 463 PHE n 
1 464 THR n 
1 465 HIS n 
1 466 ARG n 
1 467 THR n 
1 468 SER n 
1 469 THR n 
1 470 SER n 
1 471 LEU n 
1 472 TRP n 
1 473 GLY n 
1 474 GLU n 
1 475 TRP n 
1 476 MET n 
1 477 GLY n 
1 478 VAL n 
1 479 LEU n 
1 480 HIS n 
1 481 GLY n 
1 482 ASP n 
1 483 GLU n 
1 484 ILE n 
1 485 GLU n 
1 486 TYR n 
1 487 PHE n 
1 488 PHE n 
1 489 GLY n 
1 490 GLN n 
1 491 PRO n 
1 492 LEU n 
1 493 ASN n 
1 494 ASN n 
1 495 SER n 
1 496 LEU n 
1 497 GLN n 
1 498 TYR n 
1 499 ARG n 
1 500 PRO n 
1 501 VAL n 
1 502 GLU n 
1 503 ARG n 
1 504 GLU n 
1 505 LEU n 
1 506 GLY n 
1 507 LYS n 
1 508 ARG n 
1 509 MET n 
1 510 LEU n 
1 511 SER n 
1 512 ALA n 
1 513 VAL n 
1 514 ILE n 
1 515 GLU n 
1 516 PHE n 
1 517 ALA n 
1 518 LYS n 
1 519 THR n 
1 520 GLY n 
1 521 ASN n 
1 522 PRO n 
1 523 ALA n 
1 524 GLN n 
1 525 ASP n 
1 526 GLY n 
1 527 GLU n 
1 528 GLU n 
1 529 TRP n 
1 530 PRO n 
1 531 ASN n 
1 532 PHE n 
1 533 SER n 
1 534 LYS n 
1 535 GLU n 
1 536 ASP n 
1 537 PRO n 
1 538 VAL n 
1 539 TYR n 
1 540 TYR n 
1 541 ILE n 
1 542 PHE n 
1 543 SER n 
1 544 THR n 
1 545 ASP n 
1 546 ASP n 
1 547 LYS n 
1 548 ILE n 
1 549 GLU n 
1 550 LYS n 
1 551 LEU n 
1 552 ALA n 
1 553 ARG n 
1 554 GLY n 
1 555 PRO n 
1 556 LEU n 
1 557 ALA n 
1 558 ALA n 
1 559 ARG n 
1 560 CYS n 
1 561 SER n 
1 562 PHE n 
1 563 TRP n 
1 564 ASN n 
1 565 ASP n 
1 566 TYR n 
1 567 LEU n 
1 568 PRO n 
1 569 LYS n 
1 570 VAL n 
1 571 ARG n 
1 572 SER n 
1 573 TRP n 
1 574 ALA n 
1 575 GLY n 
1 576 THR n 
1 577 CYS n 
1 578 ASP n 
1 579 GLY n 
1 580 ASP n 
1 581 SER n 
1 582 GLY n 
1 583 SER n 
1 584 ALA n 
1 585 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'FRUIT FLY' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 DMACHE 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'SCHNEIDER LINE 2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'SECRETED (EXTRACELLULAR)' 
_entity_src_gen.pdbx_host_org_vector_type          'PLASMID DNA' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'S2-SEC 1/3' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_DROME 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P07140 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QON 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 585 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07140 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  623 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       585 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                               'beta-D-mannose; D-mannose; mannose' 
'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE                                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                              ? 'H2 O'           18.015  
I40 non-polymer                  . '9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' ? 'C20 H19 I N2'   414.283 
ILE 'L-peptide linking'          y ISOLEUCINE                                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                         ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose           
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                             ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                                      ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QON 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_percent_sol   55.68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.60' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QON 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.720 
_reflns.number_obs                   19982 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06000 
_reflns.pdbx_netI_over_sigmaI        15.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.72 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.25000 
_reflns_shell.meanI_over_sigI_obs    2.400 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QON 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19693 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               0.0 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30. 
_refine.ls_d_res_high                            2.72 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_obs                          0.220 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.220 
_refine.ls_R_factor_R_free                       0.265 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.3 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'THE FOLLOWING RESIDUES WERE ASSIGNED PARTIAL OCCUPANCY: VAL 1, ILE 2, ASN 136, THR 137, THR 138, BMA 995, BMA 996' 
_refine.pdbx_starting_model                      2ACE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4235 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         89 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               4463 
_refine_hist.d_res_high                       2.72 
_refine_hist.d_res_low                        30. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.42  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   32 
_refine_ls_shell.d_res_high                       2.72 
_refine_ls_shell.d_res_low                        2.75 
_refine_ls_shell.number_reflns_R_work             554 
_refine_ls_shell.R_factor_R_work                  0.33 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.37 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1QON 
_struct.title                     
'AChE from Drosophila Melanogaster complex with tacrine derivative 9-(3-iodobenzylamino)-1,2,3,4-tetrahydroacridine' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QON 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE (SERINE ESTERASE), HYDROLASE, SERINE ESTERASE, SYNAPSE, MEMBRANE, NERVE, MUSCLE, NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN, GPI-ANCHOR, ALTERNATIVE SPLICING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 39  ? ARG A 43  ? VAL A 39  ARG A 43  5 ? 5  
HELX_P HELX_P2  2  PHE A 77  ? ILE A 82  ? PHE A 77  ILE A 82  1 ? 6  
HELX_P HELX_P3  3  LEU A 159 ? ASN A 163 ? LEU A 159 ASN A 163 5 ? 5  
HELX_P HELX_P4  4  ALA A 164 ? ASN A 172 ? ALA A 164 ASN A 172 1 ? 9  
HELX_P HELX_P5  5  GLY A 183 ? LEU A 188 ? GLY A 183 LEU A 188 1 ? 6  
HELX_P HELX_P6  6  LEU A 190 ? MET A 194 ? LEU A 190 MET A 194 5 ? 5  
HELX_P HELX_P7  7  PRO A 195 ? ALA A 202 ? PRO A 195 ALA A 202 5 ? 8  
HELX_P HELX_P8  8  ASN A 205 ? ALA A 222 ? ASN A 205 ALA A 222 1 ? 18 
HELX_P HELX_P9  9  HIS A 223 ? PHE A 225 ? HIS A 223 PHE A 225 5 ? 3  
HELX_P HELX_P10 10 SER A 238 ? SER A 250 ? SER A 238 SER A 250 1 ? 13 
HELX_P HELX_P11 11 THR A 275 ? CYS A 290 ? THR A 275 CYS A 290 1 ? 16 
HELX_P HELX_P12 12 ASN A 293 ? LEU A 297 ? ASN A 293 LEU A 297 5 ? 5  
HELX_P HELX_P13 13 ASN A 300 ? ARG A 309 ? ASN A 300 ARG A 309 1 ? 10 
HELX_P HELX_P14 14 ASP A 312 ? GLN A 320 ? ASP A 312 GLN A 320 1 ? 9  
HELX_P HELX_P15 15 TRP A 321 ? TYR A 324 ? TRP A 321 TYR A 324 5 ? 4  
HELX_P HELX_P16 16 LEU A 348 ? ALA A 352 ? LEU A 348 ALA A 352 5 ? 5  
HELX_P HELX_P17 17 GLY A 368 ? PHE A 376 ? GLY A 368 PHE A 376 1 ? 9  
HELX_P HELX_P18 18 PRO A 389 ? PHE A 401 ? PRO A 389 PHE A 401 1 ? 13 
HELX_P HELX_P19 19 THR A 405 ? TYR A 416 ? THR A 405 TYR A 416 1 ? 12 
HELX_P HELX_P20 20 GLY A 424 ? PHE A 440 ? GLY A 424 PHE A 440 1 ? 17 
HELX_P HELX_P21 21 PHE A 440 ? ARG A 454 ? PHE A 440 ARG A 454 1 ? 15 
HELX_P HELX_P22 22 GLY A 473 ? GLY A 477 ? GLY A 473 GLY A 477 5 ? 5  
HELX_P HELX_P23 23 ASP A 482 ? PHE A 488 ? ASP A 482 PHE A 488 1 ? 7  
HELX_P HELX_P24 24 GLY A 489 ? ASN A 493 ? GLY A 489 ASN A 493 5 ? 5  
HELX_P HELX_P25 25 ARG A 499 ? GLY A 520 ? ARG A 499 GLY A 520 1 ? 22 
HELX_P HELX_P26 26 ARG A 553 ? ASP A 565 ? ARG A 553 ASP A 565 1 ? 13 
HELX_P HELX_P27 27 TYR A 566 ? ARG A 571 ? TYR A 566 ARG A 571 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 66  SG  ? ? ? 1_555 A CYS 93  SG ? ? A CYS 66  A CYS 93  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf2 disulf ?    ? A CYS 292 SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 292 A CYS 307 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf3 disulf ?    ? A CYS 442 SG  ? ? ? 1_555 A CYS 560 SG ? ? A CYS 442 A CYS 560 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
covale1 covale none ? A SER 238 OG  ? ? ? 1_555 C SO4 .   O3 ? ? A SER 238 A SO4 601 1_555 ? ? ? ? ? ? ? 1.965 ? ?               
covale2 covale one  ? A ASN 493 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 493 B NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.383 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3   1_555 ? ? ? ? ? ? ? 1.393 ? ?               
covale5 covale both ? B BMA .   O3  ? ? ? 1_555 B BMA .   C1 ? ? B BMA 3   B BMA 4   1_555 ? ? ? ? ? ? ? 1.404 ? ?               
covale6 covale both ? B BMA .   O6  ? ? ? 1_555 B BMA .   C1 ? ? B BMA 3   B BMA 5   1_555 ? ? ? ? ? ? ? 1.401 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 8 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
C 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 6   ? THR A 9   ? VAL A 6   THR A 9   
A 2 GLY A 12  ? ARG A 15  ? GLY A 12  ARG A 15  
B 1 SER A 18  ? VAL A 21  ? SER A 18  VAL A 21  
B 2 ARG A 24  ? PRO A 33  ? ARG A 24  PRO A 33  
B 3 TYR A 95  ? PRO A 101 ? TYR A 95  PRO A 101 
B 4 ILE A 174 ? PHE A 178 ? ILE A 174 PHE A 178 
B 5 ILE A 143 ? ILE A 147 ? ILE A 143 ILE A 147 
B 6 MET A 232 ? GLU A 237 ? MET A 232 GLU A 237 
B 7 ARG A 259 ? GLN A 263 ? ARG A 259 GLN A 263 
B 8 ASP A 358 ? GLY A 362 ? ASP A 358 GLY A 362 
C 1 TYR A 460 ? PHE A 463 ? TYR A 460 PHE A 463 
C 2 TYR A 539 ? PHE A 542 ? TYR A 539 PHE A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 7   ? O VAL A 7   N VAL A 14  ? N VAL A 14  
B 1 2 O VAL A 19  ? O VAL A 19  N VAL A 26  ? N VAL A 26  
B 2 3 O HIS A 27  ? O HIS A 27  N ALA A 100 ? N ALA A 100 
B 3 4 O ASN A 97  ? O ASN A 97  N SER A 177 ? N SER A 177 
B 4 5 O ILE A 174 ? O ILE A 174 N LEU A 144 ? N LEU A 144 
B 5 6 O ILE A 143 ? O ILE A 143 N THR A 233 ? N THR A 233 
B 6 7 O LEU A 234 ? O LEU A 234 N MET A 261 ? N MET A 261 
B 7 8 O GLY A 260 ? O GLY A 260 N ASP A 358 ? N ASP A 358 
C 1 2 O TYR A 460 ? O TYR A 460 N TYR A 540 ? N TYR A 540 
# 
_database_PDB_matrix.entry_id          1QON 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QON 
_atom_sites.fract_transf_matrix[1][1]   0.010534 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010534 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006249 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 1   ? 23.476 45.328 -26.828 0.50 83.84  ? 1   VAL A N   1 
ATOM   2    C CA  . VAL A 1 1   ? 24.698 46.137 -27.110 0.50 84.18  ? 1   VAL A CA  1 
ATOM   3    C C   . VAL A 1 1   ? 25.958 45.334 -26.826 0.50 85.34  ? 1   VAL A C   1 
ATOM   4    O O   . VAL A 1 1   ? 27.006 45.571 -27.427 0.50 85.03  ? 1   VAL A O   1 
ATOM   5    C CB  . VAL A 1 1   ? 24.738 47.406 -26.235 0.50 83.32  ? 1   VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 1   ? 23.517 48.245 -26.499 0.50 83.19  ? 1   VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 1   ? 24.806 47.029 -24.763 0.50 82.56  ? 1   VAL A CG2 1 
ATOM   8    N N   . ILE A 1 2   ? 25.825 44.381 -25.906 0.50 87.05  ? 2   ILE A N   1 
ATOM   9    C CA  . ILE A 1 2   ? 26.909 43.511 -25.453 0.50 88.70  ? 2   ILE A CA  1 
ATOM   10   C C   . ILE A 1 2   ? 27.474 44.114 -24.165 0.50 90.08  ? 2   ILE A C   1 
ATOM   11   O O   . ILE A 1 2   ? 28.567 44.684 -24.150 0.50 90.21  ? 2   ILE A O   1 
ATOM   12   C CB  . ILE A 1 2   ? 28.034 43.362 -26.519 0.50 88.26  ? 2   ILE A CB  1 
ATOM   13   C CG1 . ILE A 1 2   ? 27.488 42.628 -27.750 0.50 87.45  ? 2   ILE A CG1 1 
ATOM   14   C CG2 . ILE A 1 2   ? 29.213 42.595 -25.939 0.50 88.15  ? 2   ILE A CG2 1 
ATOM   15   C CD1 . ILE A 1 2   ? 28.517 42.389 -28.835 0.50 86.66  ? 2   ILE A CD1 1 
ATOM   16   N N   . ASP A 1 3   ? 26.696 43.987 -23.091 1.00 91.96  ? 3   ASP A N   1 
ATOM   17   C CA  . ASP A 1 3   ? 27.055 44.510 -21.771 1.00 92.71  ? 3   ASP A CA  1 
ATOM   18   C C   . ASP A 1 3   ? 26.348 43.673 -20.688 1.00 92.13  ? 3   ASP A C   1 
ATOM   19   O O   . ASP A 1 3   ? 25.120 43.525 -20.708 1.00 91.80  ? 3   ASP A O   1 
ATOM   20   C CB  . ASP A 1 3   ? 26.619 45.978 -21.672 1.00 95.43  ? 3   ASP A CB  1 
ATOM   21   C CG  . ASP A 1 3   ? 27.727 46.895 -21.173 1.00 97.21  ? 3   ASP A CG  1 
ATOM   22   O OD1 . ASP A 1 3   ? 28.796 46.948 -21.814 1.00 98.55  ? 3   ASP A OD1 1 
ATOM   23   O OD2 . ASP A 1 3   ? 27.527 47.573 -20.144 1.00 99.61  ? 3   ASP A OD2 1 
ATOM   24   N N   . ARG A 1 4   ? 27.118 43.121 -19.752 1.00 90.93  ? 4   ARG A N   1 
ATOM   25   C CA  . ARG A 1 4   ? 26.549 42.297 -18.684 1.00 89.56  ? 4   ARG A CA  1 
ATOM   26   C C   . ARG A 1 4   ? 26.662 42.980 -17.330 1.00 87.33  ? 4   ARG A C   1 
ATOM   27   O O   . ARG A 1 4   ? 26.286 42.420 -16.297 1.00 86.90  ? 4   ARG A O   1 
ATOM   28   C CB  . ARG A 1 4   ? 27.235 40.931 -18.641 1.00 91.62  ? 4   ARG A CB  1 
ATOM   29   C CG  . ARG A 1 4   ? 28.734 40.976 -18.412 1.00 93.76  ? 4   ARG A CG  1 
ATOM   30   C CD  . ARG A 1 4   ? 29.368 39.685 -18.915 1.00 96.31  ? 4   ARG A CD  1 
ATOM   31   N NE  . ARG A 1 4   ? 30.790 39.593 -18.603 1.00 98.58  ? 4   ARG A NE  1 
ATOM   32   C CZ  . ARG A 1 4   ? 31.578 38.591 -18.989 1.00 99.17  ? 4   ARG A CZ  1 
ATOM   33   N NH1 . ARG A 1 4   ? 31.083 37.593 -19.710 1.00 99.33  ? 4   ARG A NH1 1 
ATOM   34   N NH2 . ARG A 1 4   ? 32.859 38.581 -18.645 1.00 99.89  ? 4   ARG A NH2 1 
ATOM   35   N N   . LEU A 1 5   ? 27.201 44.193 -17.352 1.00 83.56  ? 5   LEU A N   1 
ATOM   36   C CA  . LEU A 1 5   ? 27.335 44.994 -16.150 1.00 79.42  ? 5   LEU A CA  1 
ATOM   37   C C   . LEU A 1 5   ? 26.171 45.969 -16.184 1.00 77.30  ? 5   LEU A C   1 
ATOM   38   O O   . LEU A 1 5   ? 26.089 46.891 -15.379 1.00 77.91  ? 5   LEU A O   1 
ATOM   39   C CB  . LEU A 1 5   ? 28.647 45.770 -16.165 1.00 78.46  ? 5   LEU A CB  1 
ATOM   40   C CG  . LEU A 1 5   ? 29.917 44.933 -16.086 1.00 77.32  ? 5   LEU A CG  1 
ATOM   41   C CD1 . LEU A 1 5   ? 31.131 45.851 -16.029 1.00 76.52  ? 5   LEU A CD1 1 
ATOM   42   C CD2 . LEU A 1 5   ? 29.849 44.047 -14.856 1.00 76.57  ? 5   LEU A CD2 1 
ATOM   43   N N   . VAL A 1 6   ? 25.278 45.751 -17.142 1.00 74.04  ? 6   VAL A N   1 
ATOM   44   C CA  . VAL A 1 6   ? 24.112 46.598 -17.323 1.00 70.20  ? 6   VAL A CA  1 
ATOM   45   C C   . VAL A 1 6   ? 22.933 46.120 -16.513 1.00 68.26  ? 6   VAL A C   1 
ATOM   46   O O   . VAL A 1 6   ? 22.748 44.926 -16.301 1.00 67.08  ? 6   VAL A O   1 
ATOM   47   C CB  . VAL A 1 6   ? 23.694 46.659 -18.806 1.00 70.04  ? 6   VAL A CB  1 
ATOM   48   C CG1 . VAL A 1 6   ? 22.254 47.138 -18.933 1.00 69.18  ? 6   VAL A CG1 1 
ATOM   49   C CG2 . VAL A 1 6   ? 24.617 47.599 -19.556 1.00 69.85  ? 6   VAL A CG2 1 
ATOM   50   N N   . VAL A 1 7   ? 22.130 47.075 -16.066 1.00 66.72  ? 7   VAL A N   1 
ATOM   51   C CA  . VAL A 1 7   ? 20.953 46.773 -15.285 1.00 65.60  ? 7   VAL A CA  1 
ATOM   52   C C   . VAL A 1 7   ? 19.788 47.564 -15.852 1.00 65.56  ? 7   VAL A C   1 
ATOM   53   O O   . VAL A 1 7   ? 19.965 48.676 -16.354 1.00 64.18  ? 7   VAL A O   1 
ATOM   54   C CB  . VAL A 1 7   ? 21.161 47.154 -13.815 1.00 64.82  ? 7   VAL A CB  1 
ATOM   55   C CG1 . VAL A 1 7   ? 21.518 48.625 -13.716 1.00 66.48  ? 7   VAL A CG1 1 
ATOM   56   C CG2 . VAL A 1 7   ? 19.909 46.845 -13.014 1.00 63.91  ? 7   VAL A CG2 1 
ATOM   57   N N   . GLN A 1 8   ? 18.598 46.978 -15.787 1.00 65.74  ? 8   GLN A N   1 
ATOM   58   C CA  . GLN A 1 8   ? 17.410 47.643 -16.287 1.00 65.89  ? 8   GLN A CA  1 
ATOM   59   C C   . GLN A 1 8   ? 16.617 48.282 -15.162 1.00 65.08  ? 8   GLN A C   1 
ATOM   60   O O   . GLN A 1 8   ? 15.785 47.630 -14.529 1.00 64.94  ? 8   GLN A O   1 
ATOM   61   C CB  . GLN A 1 8   ? 16.517 46.665 -17.055 1.00 66.03  ? 8   GLN A CB  1 
ATOM   62   C CG  . GLN A 1 8   ? 16.596 46.857 -18.566 1.00 68.82  ? 8   GLN A CG  1 
ATOM   63   C CD  . GLN A 1 8   ? 16.458 48.325 -18.987 1.00 69.58  ? 8   GLN A CD  1 
ATOM   64   O OE1 . GLN A 1 8   ? 15.463 48.985 -18.673 1.00 69.65  ? 8   GLN A OE1 1 
ATOM   65   N NE2 . GLN A 1 8   ? 17.461 48.836 -19.700 1.00 68.27  ? 8   GLN A NE2 1 
ATOM   66   N N   . THR A 1 9   ? 16.879 49.563 -14.921 1.00 63.45  ? 9   THR A N   1 
ATOM   67   C CA  . THR A 1 9   ? 16.186 50.298 -13.874 1.00 61.35  ? 9   THR A CA  1 
ATOM   68   C C   . THR A 1 9   ? 14.891 50.871 -14.417 1.00 60.10  ? 9   THR A C   1 
ATOM   69   O O   . THR A 1 9   ? 14.747 51.097 -15.617 1.00 59.96  ? 9   THR A O   1 
ATOM   70   C CB  . THR A 1 9   ? 17.030 51.464 -13.347 1.00 61.24  ? 9   THR A CB  1 
ATOM   71   O OG1 . THR A 1 9   ? 16.944 52.567 -14.255 1.00 61.79  ? 9   THR A OG1 1 
ATOM   72   C CG2 . THR A 1 9   ? 18.483 51.047 -13.216 1.00 62.33  ? 9   THR A CG2 1 
ATOM   73   N N   . SER A 1 10  ? 13.953 51.109 -13.515 1.00 59.93  ? 10  SER A N   1 
ATOM   74   C CA  . SER A 1 10  ? 12.660 51.664 -13.872 1.00 60.64  ? 10  SER A CA  1 
ATOM   75   C C   . SER A 1 10  ? 12.804 52.876 -14.781 1.00 60.90  ? 10  SER A C   1 
ATOM   76   O O   . SER A 1 10  ? 11.844 53.284 -15.423 1.00 61.66  ? 10  SER A O   1 
ATOM   77   C CB  . SER A 1 10  ? 11.910 52.088 -12.607 1.00 60.13  ? 10  SER A CB  1 
ATOM   78   O OG  . SER A 1 10  ? 12.528 53.217 -12.003 1.00 58.13  ? 10  SER A OG  1 
ATOM   79   N N   . SER A 1 11  ? 14.001 53.450 -14.830 1.00 62.07  ? 11  SER A N   1 
ATOM   80   C CA  . SER A 1 11  ? 14.239 54.639 -15.637 1.00 62.84  ? 11  SER A CA  1 
ATOM   81   C C   . SER A 1 11  ? 15.247 54.461 -16.758 1.00 63.35  ? 11  SER A C   1 
ATOM   82   O O   . SER A 1 11  ? 15.807 55.443 -17.247 1.00 62.84  ? 11  SER A O   1 
ATOM   83   C CB  . SER A 1 11  ? 14.697 55.790 -14.738 1.00 63.27  ? 11  SER A CB  1 
ATOM   84   O OG  . SER A 1 11  ? 13.682 56.150 -13.819 1.00 64.60  ? 11  SER A OG  1 
ATOM   85   N N   . GLY A 1 12  ? 15.483 53.217 -17.164 1.00 64.02  ? 12  GLY A N   1 
ATOM   86   C CA  . GLY A 1 12  ? 16.430 52.973 -18.238 1.00 64.33  ? 12  GLY A CA  1 
ATOM   87   C C   . GLY A 1 12  ? 17.552 52.009 -17.901 1.00 64.67  ? 12  GLY A C   1 
ATOM   88   O O   . GLY A 1 12  ? 17.619 51.493 -16.786 1.00 63.72  ? 12  GLY A O   1 
ATOM   89   N N   . PRO A 1 13  ? 18.448 51.735 -18.866 1.00 64.84  ? 13  PRO A N   1 
ATOM   90   C CA  . PRO A 1 13  ? 19.590 50.834 -18.714 1.00 63.70  ? 13  PRO A CA  1 
ATOM   91   C C   . PRO A 1 13  ? 20.785 51.539 -18.094 1.00 62.29  ? 13  PRO A C   1 
ATOM   92   O O   . PRO A 1 13  ? 21.103 52.682 -18.436 1.00 60.34  ? 13  PRO A O   1 
ATOM   93   C CB  . PRO A 1 13  ? 19.867 50.401 -20.144 1.00 64.90  ? 13  PRO A CB  1 
ATOM   94   C CG  . PRO A 1 13  ? 19.619 51.661 -20.892 1.00 65.45  ? 13  PRO A CG  1 
ATOM   95   C CD  . PRO A 1 13  ? 18.315 52.153 -20.274 1.00 66.27  ? 13  PRO A CD  1 
ATOM   96   N N   . VAL A 1 14  ? 21.453 50.835 -17.192 1.00 61.72  ? 14  VAL A N   1 
ATOM   97   C CA  . VAL A 1 14  ? 22.605 51.378 -16.503 1.00 61.70  ? 14  VAL A CA  1 
ATOM   98   C C   . VAL A 1 14  ? 23.726 50.359 -16.484 1.00 61.50  ? 14  VAL A C   1 
ATOM   99   O O   . VAL A 1 14  ? 23.483 49.177 -16.264 1.00 60.21  ? 14  VAL A O   1 
ATOM   100  C CB  . VAL A 1 14  ? 22.250 51.718 -15.054 1.00 62.99  ? 14  VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 14  ? 23.456 52.275 -14.353 1.00 64.25  ? 14  VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 14  ? 21.097 52.708 -15.012 1.00 63.67  ? 14  VAL A CG2 1 
ATOM   103  N N   . ARG A 1 15  ? 24.950 50.819 -16.712 1.00 62.69  ? 15  ARG A N   1 
ATOM   104  C CA  . ARG A 1 15  ? 26.105 49.930 -16.694 1.00 65.56  ? 15  ARG A CA  1 
ATOM   105  C C   . ARG A 1 15  ? 27.137 50.437 -15.705 1.00 66.31  ? 15  ARG A C   1 
ATOM   106  O O   . ARG A 1 15  ? 27.623 51.560 -15.817 1.00 66.39  ? 15  ARG A O   1 
ATOM   107  C CB  . ARG A 1 15  ? 26.746 49.831 -18.078 1.00 67.37  ? 15  ARG A CB  1 
ATOM   108  C CG  . ARG A 1 15  ? 27.121 51.164 -18.695 1.00 69.24  ? 15  ARG A CG  1 
ATOM   109  C CD  . ARG A 1 15  ? 27.997 50.950 -19.910 1.00 72.14  ? 15  ARG A CD  1 
ATOM   110  N NE  . ARG A 1 15  ? 29.400 50.834 -19.538 1.00 73.82  ? 15  ARG A NE  1 
ATOM   111  C CZ  . ARG A 1 15  ? 30.181 51.875 -19.260 1.00 75.96  ? 15  ARG A CZ  1 
ATOM   112  N NH1 . ARG A 1 15  ? 29.689 53.109 -19.321 1.00 75.71  ? 15  ARG A NH1 1 
ATOM   113  N NH2 . ARG A 1 15  ? 31.453 51.684 -18.922 1.00 75.94  ? 15  ARG A NH2 1 
ATOM   114  N N   . GLY A 1 16  ? 27.470 49.605 -14.730 1.00 67.10  ? 16  GLY A N   1 
ATOM   115  C CA  . GLY A 1 16  ? 28.443 50.018 -13.743 1.00 68.97  ? 16  GLY A CA  1 
ATOM   116  C C   . GLY A 1 16  ? 29.822 49.526 -14.106 1.00 70.30  ? 16  GLY A C   1 
ATOM   117  O O   . GLY A 1 16  ? 30.256 49.641 -15.255 1.00 71.98  ? 16  GLY A O   1 
ATOM   118  N N   . ARG A 1 17  ? 30.510 48.981 -13.110 1.00 70.22  ? 17  ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? 31.846 48.436 -13.277 1.00 69.91  ? 17  ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? 32.015 47.380 -12.197 1.00 69.88  ? 17  ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? 31.546 47.562 -11.074 1.00 69.49  ? 17  ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? 32.891 49.539 -13.127 1.00 68.49  ? 17  ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? 32.722 50.358 -11.884 1.00 69.12  ? 17  ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? 33.585 51.593 -11.934 1.00 69.74  ? 17  ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? 33.249 52.525 -10.860 1.00 72.36  ? 17  ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? 33.492 52.309 -9.571  1.00 71.70  ? 17  ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? 34.081 51.187 -9.177  1.00 70.82  ? 17  ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? 33.144 53.221 -8.673  1.00 72.19  ? 17  ARG A NH2 1 
ATOM   129  N N   . SER A 1 18  ? 32.663 46.272 -12.548 1.00 70.10  ? 18  SER A N   1 
ATOM   130  C CA  . SER A 1 18  ? 32.879 45.179 -11.607 1.00 69.49  ? 18  SER A CA  1 
ATOM   131  C C   . SER A 1 18  ? 34.118 45.427 -10.765 1.00 67.68  ? 18  SER A C   1 
ATOM   132  O O   . SER A 1 18  ? 35.103 45.990 -11.242 1.00 66.21  ? 18  SER A O   1 
ATOM   133  C CB  . SER A 1 18  ? 33.022 43.849 -12.356 1.00 71.37  ? 18  SER A CB  1 
ATOM   134  O OG  . SER A 1 18  ? 33.151 42.762 -11.454 1.00 72.83  ? 18  SER A OG  1 
ATOM   135  N N   . VAL A 1 19  ? 34.051 45.013 -9.504  1.00 66.85  ? 19  VAL A N   1 
ATOM   136  C CA  . VAL A 1 19  ? 35.159 45.182 -8.570  1.00 65.87  ? 19  VAL A CA  1 
ATOM   137  C C   . VAL A 1 19  ? 35.359 43.913 -7.750  1.00 65.31  ? 19  VAL A C   1 
ATOM   138  O O   . VAL A 1 19  ? 34.414 43.161 -7.514  1.00 65.95  ? 19  VAL A O   1 
ATOM   139  C CB  . VAL A 1 19  ? 34.904 46.359 -7.598  1.00 63.57  ? 19  VAL A CB  1 
ATOM   140  C CG1 . VAL A 1 19  ? 36.007 46.429 -6.572  1.00 63.77  ? 19  VAL A CG1 1 
ATOM   141  C CG2 . VAL A 1 19  ? 34.841 47.661 -8.365  1.00 63.53  ? 19  VAL A CG2 1 
ATOM   142  N N   . THR A 1 20  ? 36.598 43.667 -7.341  1.00 64.12  ? 20  THR A N   1 
ATOM   143  C CA  . THR A 1 20  ? 36.904 42.507 -6.523  1.00 63.06  ? 20  THR A CA  1 
ATOM   144  C C   . THR A 1 20  ? 37.593 42.991 -5.267  1.00 62.12  ? 20  THR A C   1 
ATOM   145  O O   . THR A 1 20  ? 38.677 43.574 -5.317  1.00 61.56  ? 20  THR A O   1 
ATOM   146  C CB  . THR A 1 20  ? 37.817 41.504 -7.254  1.00 64.11  ? 20  THR A CB  1 
ATOM   147  O OG1 . THR A 1 20  ? 37.042 40.776 -8.213  1.00 64.48  ? 20  THR A OG1 1 
ATOM   148  C CG2 . THR A 1 20  ? 38.434 40.517 -6.272  1.00 63.95  ? 20  THR A CG2 1 
ATOM   149  N N   . VAL A 1 21  ? 36.932 42.764 -4.142  1.00 61.39  ? 21  VAL A N   1 
ATOM   150  C CA  . VAL A 1 21  ? 37.452 43.159 -2.843  1.00 60.71  ? 21  VAL A CA  1 
ATOM   151  C C   . VAL A 1 21  ? 37.098 42.050 -1.872  1.00 60.41  ? 21  VAL A C   1 
ATOM   152  O O   . VAL A 1 21  ? 36.028 41.448 -1.978  1.00 59.74  ? 21  VAL A O   1 
ATOM   153  C CB  . VAL A 1 21  ? 36.812 44.478 -2.361  1.00 61.47  ? 21  VAL A CB  1 
ATOM   154  C CG1 . VAL A 1 21  ? 37.280 45.630 -3.239  1.00 61.35  ? 21  VAL A CG1 1 
ATOM   155  C CG2 . VAL A 1 21  ? 35.290 44.362 -2.392  1.00 58.17  ? 21  VAL A CG2 1 
ATOM   156  N N   . GLN A 1 22  ? 37.989 41.775 -0.930  1.00 60.40  ? 22  GLN A N   1 
ATOM   157  C CA  . GLN A 1 22  ? 37.728 40.718 0.035   1.00 61.31  ? 22  GLN A CA  1 
ATOM   158  C C   . GLN A 1 22  ? 37.282 39.478 -0.731  1.00 61.03  ? 22  GLN A C   1 
ATOM   159  O O   . GLN A 1 22  ? 36.382 38.760 -0.303  1.00 60.44  ? 22  GLN A O   1 
ATOM   160  C CB  . GLN A 1 22  ? 36.626 41.144 1.016   1.00 61.74  ? 22  GLN A CB  1 
ATOM   161  C CG  . GLN A 1 22  ? 36.922 42.421 1.791   1.00 59.27  ? 22  GLN A CG  1 
ATOM   162  C CD  . GLN A 1 22  ? 38.081 42.264 2.750   1.00 58.31  ? 22  GLN A CD  1 
ATOM   163  O OE1 . GLN A 1 22  ? 38.037 41.440 3.663   1.00 57.09  ? 22  GLN A OE1 1 
ATOM   164  N NE2 . GLN A 1 22  ? 39.128 43.056 2.548   1.00 57.37  ? 22  GLN A NE2 1 
ATOM   165  N N   . GLY A 1 23  ? 37.912 39.247 -1.877  1.00 62.71  ? 23  GLY A N   1 
ATOM   166  C CA  . GLY A 1 23  ? 37.587 38.093 -2.692  1.00 65.35  ? 23  GLY A CA  1 
ATOM   167  C C   . GLY A 1 23  ? 36.117 37.992 -3.034  1.00 67.33  ? 23  GLY A C   1 
ATOM   168  O O   . GLY A 1 23  ? 35.511 36.929 -2.916  1.00 67.79  ? 23  GLY A O   1 
ATOM   169  N N   . ARG A 1 24  ? 35.541 39.106 -3.464  1.00 70.05  ? 24  ARG A N   1 
ATOM   170  C CA  . ARG A 1 24  ? 34.132 39.150 -3.823  1.00 71.04  ? 24  ARG A CA  1 
ATOM   171  C C   . ARG A 1 24  ? 33.896 40.129 -4.956  1.00 69.70  ? 24  ARG A C   1 
ATOM   172  O O   . ARG A 1 24  ? 34.487 41.209 -4.993  1.00 68.13  ? 24  ARG A O   1 
ATOM   173  C CB  . ARG A 1 24  ? 33.302 39.561 -2.613  1.00 75.57  ? 24  ARG A CB  1 
ATOM   174  C CG  . ARG A 1 24  ? 32.696 38.404 -1.850  1.00 80.68  ? 24  ARG A CG  1 
ATOM   175  C CD  . ARG A 1 24  ? 31.561 37.829 -2.649  1.00 85.21  ? 24  ARG A CD  1 
ATOM   176  N NE  . ARG A 1 24  ? 30.436 37.466 -1.800  1.00 89.00  ? 24  ARG A NE  1 
ATOM   177  C CZ  . ARG A 1 24  ? 29.199 37.302 -2.250  1.00 90.52  ? 24  ARG A CZ  1 
ATOM   178  N NH1 . ARG A 1 24  ? 28.930 37.474 -3.540  1.00 90.76  ? 24  ARG A NH1 1 
ATOM   179  N NH2 . ARG A 1 24  ? 28.233 36.964 -1.410  1.00 91.85  ? 24  ARG A NH2 1 
ATOM   180  N N   . GLU A 1 25  ? 33.031 39.739 -5.885  1.00 68.63  ? 25  GLU A N   1 
ATOM   181  C CA  . GLU A 1 25  ? 32.718 40.595 -7.012  1.00 67.79  ? 25  GLU A CA  1 
ATOM   182  C C   . GLU A 1 25  ? 31.508 41.447 -6.683  1.00 66.09  ? 25  GLU A C   1 
ATOM   183  O O   . GLU A 1 25  ? 30.443 40.936 -6.332  1.00 66.37  ? 25  GLU A O   1 
ATOM   184  C CB  . GLU A 1 25  ? 32.442 39.769 -8.272  1.00 69.30  ? 25  GLU A CB  1 
ATOM   185  C CG  . GLU A 1 25  ? 32.221 40.632 -9.509  1.00 70.44  ? 25  GLU A CG  1 
ATOM   186  C CD  . GLU A 1 25  ? 32.227 39.842 -10.803 1.00 70.48  ? 25  GLU A CD  1 
ATOM   187  O OE1 . GLU A 1 25  ? 31.368 38.945 -10.965 1.00 70.43  ? 25  GLU A OE1 1 
ATOM   188  O OE2 . GLU A 1 25  ? 33.093 40.125 -11.657 1.00 69.27  ? 25  GLU A OE2 1 
ATOM   189  N N   . VAL A 1 26  ? 31.688 42.755 -6.796  1.00 63.29  ? 26  VAL A N   1 
ATOM   190  C CA  . VAL A 1 26  ? 30.632 43.706 -6.516  1.00 60.79  ? 26  VAL A CA  1 
ATOM   191  C C   . VAL A 1 26  ? 30.467 44.629 -7.711  1.00 59.09  ? 26  VAL A C   1 
ATOM   192  O O   . VAL A 1 26  ? 31.440 45.200 -8.195  1.00 59.26  ? 26  VAL A O   1 
ATOM   193  C CB  . VAL A 1 26  ? 30.973 44.556 -5.267  1.00 60.52  ? 26  VAL A CB  1 
ATOM   194  C CG1 . VAL A 1 26  ? 30.044 45.754 -5.180  1.00 60.76  ? 26  VAL A CG1 1 
ATOM   195  C CG2 . VAL A 1 26  ? 30.852 43.709 -4.011  1.00 59.51  ? 26  VAL A CG2 1 
ATOM   196  N N   . HIS A 1 27  ? 29.237 44.759 -8.192  1.00 56.99  ? 27  HIS A N   1 
ATOM   197  C CA  . HIS A 1 27  ? 28.949 45.638 -9.315  1.00 55.80  ? 27  HIS A CA  1 
ATOM   198  C C   . HIS A 1 27  ? 28.612 47.007 -8.737  1.00 54.44  ? 27  HIS A C   1 
ATOM   199  O O   . HIS A 1 27  ? 27.653 47.144 -7.987  1.00 54.43  ? 27  HIS A O   1 
ATOM   200  C CB  . HIS A 1 27  ? 27.793 45.061 -10.129 1.00 56.72  ? 27  HIS A CB  1 
ATOM   201  C CG  . HIS A 1 27  ? 28.178 43.857 -10.935 1.00 58.77  ? 27  HIS A CG  1 
ATOM   202  N ND1 . HIS A 1 27  ? 27.254 43.034 -11.542 1.00 58.61  ? 27  HIS A ND1 1 
ATOM   203  C CD2 . HIS A 1 27  ? 29.395 43.353 -11.256 1.00 58.24  ? 27  HIS A CD2 1 
ATOM   204  C CE1 . HIS A 1 27  ? 27.883 42.079 -12.202 1.00 58.64  ? 27  HIS A CE1 1 
ATOM   205  N NE2 . HIS A 1 27  ? 29.182 42.250 -12.045 1.00 58.71  ? 27  HIS A NE2 1 
ATOM   206  N N   . VAL A 1 28  ? 29.418 48.008 -9.087  1.00 53.04  ? 28  VAL A N   1 
ATOM   207  C CA  . VAL A 1 28  ? 29.270 49.372 -8.575  1.00 50.91  ? 28  VAL A CA  1 
ATOM   208  C C   . VAL A 1 28  ? 28.703 50.409 -9.533  1.00 49.31  ? 28  VAL A C   1 
ATOM   209  O O   . VAL A 1 28  ? 29.400 50.893 -10.420 1.00 48.72  ? 28  VAL A O   1 
ATOM   210  C CB  . VAL A 1 28  ? 30.635 49.928 -8.075  1.00 51.09  ? 28  VAL A CB  1 
ATOM   211  C CG1 . VAL A 1 28  ? 30.460 51.339 -7.543  1.00 49.57  ? 28  VAL A CG1 1 
ATOM   212  C CG2 . VAL A 1 28  ? 31.215 49.023 -7.004  1.00 50.66  ? 28  VAL A CG2 1 
ATOM   213  N N   . TYR A 1 29  ? 27.449 50.781 -9.314  1.00 48.94  ? 29  TYR A N   1 
ATOM   214  C CA  . TYR A 1 29  ? 26.789 51.785 -10.138 1.00 48.71  ? 29  TYR A CA  1 
ATOM   215  C C   . TYR A 1 29  ? 26.774 53.130 -9.411  1.00 48.16  ? 29  TYR A C   1 
ATOM   216  O O   . TYR A 1 29  ? 26.117 53.281 -8.378  1.00 46.72  ? 29  TYR A O   1 
ATOM   217  C CB  . TYR A 1 29  ? 25.356 51.358 -10.443 1.00 48.57  ? 29  TYR A CB  1 
ATOM   218  C CG  . TYR A 1 29  ? 25.243 49.936 -10.923 1.00 51.57  ? 29  TYR A CG  1 
ATOM   219  C CD1 . TYR A 1 29  ? 25.365 48.871 -10.041 1.00 51.90  ? 29  TYR A CD1 1 
ATOM   220  C CD2 . TYR A 1 29  ? 25.015 49.653 -12.268 1.00 53.58  ? 29  TYR A CD2 1 
ATOM   221  C CE1 . TYR A 1 29  ? 25.262 47.553 -10.484 1.00 54.62  ? 29  TYR A CE1 1 
ATOM   222  C CE2 . TYR A 1 29  ? 24.910 48.339 -12.722 1.00 54.18  ? 29  TYR A CE2 1 
ATOM   223  C CZ  . TYR A 1 29  ? 25.032 47.296 -11.826 1.00 54.64  ? 29  TYR A CZ  1 
ATOM   224  O OH  . TYR A 1 29  ? 24.913 45.999 -12.272 1.00 55.43  ? 29  TYR A OH  1 
ATOM   225  N N   . THR A 1 30  ? 27.499 54.099 -9.967  1.00 47.71  ? 30  THR A N   1 
ATOM   226  C CA  . THR A 1 30  ? 27.604 55.444 -9.412  1.00 46.80  ? 30  THR A CA  1 
ATOM   227  C C   . THR A 1 30  ? 27.184 56.528 -10.418 1.00 47.74  ? 30  THR A C   1 
ATOM   228  O O   . THR A 1 30  ? 27.573 56.488 -11.591 1.00 49.20  ? 30  THR A O   1 
ATOM   229  C CB  . THR A 1 30  ? 29.048 55.732 -8.970  1.00 46.50  ? 30  THR A CB  1 
ATOM   230  O OG1 . THR A 1 30  ? 29.950 55.297 -9.995  1.00 46.98  ? 30  THR A OG1 1 
ATOM   231  C CG2 . THR A 1 30  ? 29.370 55.011 -7.671  1.00 46.22  ? 30  THR A CG2 1 
ATOM   232  N N   . GLY A 1 31  ? 26.390 57.494 -9.958  1.00 46.71  ? 31  GLY A N   1 
ATOM   233  C CA  . GLY A 1 31  ? 25.952 58.569 -10.834 1.00 44.25  ? 31  GLY A CA  1 
ATOM   234  C C   . GLY A 1 31  ? 24.595 58.404 -11.501 1.00 43.26  ? 31  GLY A C   1 
ATOM   235  O O   . GLY A 1 31  ? 24.315 59.077 -12.491 1.00 45.80  ? 31  GLY A O   1 
ATOM   236  N N   . ILE A 1 32  ? 23.751 57.516 -10.982 1.00 40.98  ? 32  ILE A N   1 
ATOM   237  C CA  . ILE A 1 32  ? 22.421 57.309 -11.551 1.00 39.78  ? 32  ILE A CA  1 
ATOM   238  C C   . ILE A 1 32  ? 21.535 58.476 -11.122 1.00 40.51  ? 32  ILE A C   1 
ATOM   239  O O   . ILE A 1 32  ? 21.425 58.763 -9.932  1.00 41.19  ? 32  ILE A O   1 
ATOM   240  C CB  . ILE A 1 32  ? 21.774 56.002 -11.027 1.00 39.87  ? 32  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 32  ? 22.632 54.798 -11.414 1.00 38.28  ? 32  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 32  ? 20.343 55.869 -11.554 1.00 36.69  ? 32  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 32  ? 22.117 53.476 -10.851 1.00 39.25  ? 32  ILE A CD1 1 
ATOM   244  N N   . PRO A 1 33  ? 20.896 59.171 -12.077 1.00 40.69  ? 33  PRO A N   1 
ATOM   245  C CA  . PRO A 1 33  ? 20.049 60.285 -11.649 1.00 39.57  ? 33  PRO A CA  1 
ATOM   246  C C   . PRO A 1 33  ? 18.765 59.741 -11.066 1.00 37.77  ? 33  PRO A C   1 
ATOM   247  O O   . PRO A 1 33  ? 18.188 58.796 -11.610 1.00 38.40  ? 33  PRO A O   1 
ATOM   248  C CB  . PRO A 1 33  ? 19.809 61.049 -12.945 1.00 39.68  ? 33  PRO A CB  1 
ATOM   249  C CG  . PRO A 1 33  ? 19.737 59.951 -13.938 1.00 40.34  ? 33  PRO A CG  1 
ATOM   250  C CD  . PRO A 1 33  ? 20.909 59.066 -13.546 1.00 40.97  ? 33  PRO A CD  1 
ATOM   251  N N   . TYR A 1 34  ? 18.320 60.315 -9.955  1.00 35.85  ? 34  TYR A N   1 
ATOM   252  C CA  . TYR A 1 34  ? 17.079 59.853 -9.358  1.00 33.80  ? 34  TYR A CA  1 
ATOM   253  C C   . TYR A 1 34  ? 16.040 60.959 -9.405  1.00 31.39  ? 34  TYR A C   1 
ATOM   254  O O   . TYR A 1 34  ? 14.930 60.802 -8.926  1.00 31.44  ? 34  TYR A O   1 
ATOM   255  C CB  . TYR A 1 34  ? 17.317 59.334 -7.919  1.00 34.89  ? 34  TYR A CB  1 
ATOM   256  C CG  . TYR A 1 34  ? 17.549 60.372 -6.835  1.00 33.53  ? 34  TYR A CG  1 
ATOM   257  C CD1 . TYR A 1 34  ? 16.476 60.990 -6.187  1.00 32.56  ? 34  TYR A CD1 1 
ATOM   258  C CD2 . TYR A 1 34  ? 18.833 60.702 -6.428  1.00 32.70  ? 34  TYR A CD2 1 
ATOM   259  C CE1 . TYR A 1 34  ? 16.679 61.910 -5.161  1.00 33.04  ? 34  TYR A CE1 1 
ATOM   260  C CE2 . TYR A 1 34  ? 19.050 61.623 -5.397  1.00 35.38  ? 34  TYR A CE2 1 
ATOM   261  C CZ  . TYR A 1 34  ? 17.968 62.223 -4.767  1.00 33.84  ? 34  TYR A CZ  1 
ATOM   262  O OH  . TYR A 1 34  ? 18.180 63.134 -3.753  1.00 31.92  ? 34  TYR A OH  1 
ATOM   263  N N   . ALA A 1 35  ? 16.404 62.074 -10.020 1.00 32.12  ? 35  ALA A N   1 
ATOM   264  C CA  . ALA A 1 35  ? 15.492 63.204 -10.152 1.00 34.73  ? 35  ALA A CA  1 
ATOM   265  C C   . ALA A 1 35  ? 16.019 64.215 -11.177 1.00 35.90  ? 35  ALA A C   1 
ATOM   266  O O   . ALA A 1 35  ? 17.180 64.138 -11.605 1.00 31.82  ? 35  ALA A O   1 
ATOM   267  C CB  . ALA A 1 35  ? 15.298 63.888 -8.787  1.00 33.08  ? 35  ALA A CB  1 
ATOM   268  N N   . LYS A 1 36  ? 15.153 65.145 -11.582 1.00 37.47  ? 36  LYS A N   1 
ATOM   269  C CA  . LYS A 1 36  ? 15.553 66.182 -12.520 1.00 39.80  ? 36  LYS A CA  1 
ATOM   270  C C   . LYS A 1 36  ? 16.463 67.120 -11.745 1.00 41.64  ? 36  LYS A C   1 
ATOM   271  O O   . LYS A 1 36  ? 16.220 67.400 -10.567 1.00 40.73  ? 36  LYS A O   1 
ATOM   272  C CB  . LYS A 1 36  ? 14.346 66.975 -13.031 1.00 40.83  ? 36  LYS A CB  1 
ATOM   273  C CG  . LYS A 1 36  ? 13.359 66.192 -13.895 1.00 45.53  ? 36  LYS A CG  1 
ATOM   274  C CD  . LYS A 1 36  ? 12.290 67.101 -14.549 1.00 47.09  ? 36  LYS A CD  1 
ATOM   275  C CE  . LYS A 1 36  ? 12.904 68.157 -15.477 1.00 49.71  ? 36  LYS A CE  1 
ATOM   276  N NZ  . LYS A 1 36  ? 11.886 68.854 -16.318 1.00 51.13  ? 36  LYS A NZ  1 
ATOM   277  N N   . PRO A 1 37  ? 17.529 67.612 -12.389 1.00 44.11  ? 37  PRO A N   1 
ATOM   278  C CA  . PRO A 1 37  ? 18.438 68.523 -11.695 1.00 46.20  ? 37  PRO A CA  1 
ATOM   279  C C   . PRO A 1 37  ? 17.610 69.663 -11.103 1.00 49.56  ? 37  PRO A C   1 
ATOM   280  O O   . PRO A 1 37  ? 16.846 70.310 -11.820 1.00 49.94  ? 37  PRO A O   1 
ATOM   281  C CB  . PRO A 1 37  ? 19.361 69.003 -12.813 1.00 44.02  ? 37  PRO A CB  1 
ATOM   282  C CG  . PRO A 1 37  ? 19.369 67.856 -13.769 1.00 42.61  ? 37  PRO A CG  1 
ATOM   283  C CD  . PRO A 1 37  ? 17.928 67.437 -13.796 1.00 44.27  ? 37  PRO A CD  1 
ATOM   284  N N   . PRO A 1 38  ? 17.733 69.911 -9.787  1.00 51.78  ? 38  PRO A N   1 
ATOM   285  C CA  . PRO A 1 38  ? 16.972 70.989 -9.145  1.00 52.69  ? 38  PRO A CA  1 
ATOM   286  C C   . PRO A 1 38  ? 17.623 72.316 -9.520  1.00 55.30  ? 38  PRO A C   1 
ATOM   287  O O   . PRO A 1 38  ? 17.961 73.133 -8.651  1.00 56.45  ? 38  PRO A O   1 
ATOM   288  C CB  . PRO A 1 38  ? 17.123 70.668 -7.672  1.00 52.30  ? 38  PRO A CB  1 
ATOM   289  C CG  . PRO A 1 38  ? 18.540 70.167 -7.611  1.00 51.87  ? 38  PRO A CG  1 
ATOM   290  C CD  . PRO A 1 38  ? 18.643 69.263 -8.823  1.00 50.98  ? 38  PRO A CD  1 
ATOM   291  N N   . VAL A 1 39  ? 17.791 72.505 -10.827 1.00 55.76  ? 39  VAL A N   1 
ATOM   292  C CA  . VAL A 1 39  ? 18.431 73.683 -11.388 1.00 56.03  ? 39  VAL A CA  1 
ATOM   293  C C   . VAL A 1 39  ? 17.473 74.749 -11.884 1.00 55.61  ? 39  VAL A C   1 
ATOM   294  O O   . VAL A 1 39  ? 16.358 74.453 -12.318 1.00 54.71  ? 39  VAL A O   1 
ATOM   295  C CB  . VAL A 1 39  ? 19.352 73.273 -12.540 1.00 55.92  ? 39  VAL A CB  1 
ATOM   296  C CG1 . VAL A 1 39  ? 20.024 74.489 -13.145 1.00 57.68  ? 39  VAL A CG1 1 
ATOM   297  C CG2 . VAL A 1 39  ? 20.380 72.297 -12.026 1.00 57.04  ? 39  VAL A CG2 1 
ATOM   298  N N   . GLU A 1 40  ? 17.936 75.994 -11.812 1.00 56.17  ? 40  GLU A N   1 
ATOM   299  C CA  . GLU A 1 40  ? 17.168 77.151 -12.237 1.00 56.73  ? 40  GLU A CA  1 
ATOM   300  C C   . GLU A 1 40  ? 15.786 77.253 -11.613 1.00 55.07  ? 40  GLU A C   1 
ATOM   301  O O   . GLU A 1 40  ? 15.621 77.581 -10.435 1.00 54.09  ? 40  GLU A O   1 
ATOM   302  C CB  . GLU A 1 40  ? 17.015 77.144 -13.750 1.00 59.90  ? 40  GLU A CB  1 
ATOM   303  C CG  . GLU A 1 40  ? 18.114 77.842 -14.500 1.00 65.07  ? 40  GLU A CG  1 
ATOM   304  C CD  . GLU A 1 40  ? 17.976 77.644 -15.996 1.00 69.48  ? 40  GLU A CD  1 
ATOM   305  O OE1 . GLU A 1 40  ? 16.836 77.747 -16.512 1.00 70.01  ? 40  GLU A OE1 1 
ATOM   306  O OE2 . GLU A 1 40  ? 19.007 77.385 -16.655 1.00 73.21  ? 40  GLU A OE2 1 
ATOM   307  N N   . ASP A 1 41  ? 14.792 76.972 -12.438 1.00 53.84  ? 41  ASP A N   1 
ATOM   308  C CA  . ASP A 1 41  ? 13.410 77.044 -12.029 1.00 53.48  ? 41  ASP A CA  1 
ATOM   309  C C   . ASP A 1 41  ? 13.063 76.019 -10.961 1.00 51.03  ? 41  ASP A C   1 
ATOM   310  O O   . ASP A 1 41  ? 12.103 76.188 -10.216 1.00 50.20  ? 41  ASP A O   1 
ATOM   311  C CB  . ASP A 1 41  ? 12.530 76.875 -13.264 1.00 56.68  ? 41  ASP A CB  1 
ATOM   312  C CG  . ASP A 1 41  ? 11.070 76.809 -12.931 1.00 59.93  ? 41  ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 41  ? 10.643 77.475 -11.960 1.00 62.52  ? 41  ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 41  ? 10.347 76.096 -13.656 1.00 63.37  ? 41  ASP A OD2 1 
ATOM   315  N N   . LEU A 1 42  ? 13.859 74.962 -10.873 1.00 49.77  ? 42  LEU A N   1 
ATOM   316  C CA  . LEU A 1 42  ? 13.608 73.920 -9.884  1.00 47.83  ? 42  LEU A CA  1 
ATOM   317  C C   . LEU A 1 42  ? 14.376 74.081 -8.581  1.00 46.81  ? 42  LEU A C   1 
ATOM   318  O O   . LEU A 1 42  ? 14.288 73.217 -7.713  1.00 47.81  ? 42  LEU A O   1 
ATOM   319  C CB  . LEU A 1 42  ? 13.896 72.539 -10.477 1.00 45.92  ? 42  LEU A CB  1 
ATOM   320  C CG  . LEU A 1 42  ? 12.846 71.987 -11.437 1.00 41.31  ? 42  LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 42  ? 13.362 70.698 -12.010 1.00 43.50  ? 42  LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 42  ? 11.534 71.748 -10.722 1.00 39.37  ? 42  LEU A CD2 1 
ATOM   323  N N   . ARG A 1 43  ? 15.129 75.172 -8.447  1.00 45.63  ? 43  ARG A N   1 
ATOM   324  C CA  . ARG A 1 43  ? 15.878 75.452 -7.223  1.00 44.99  ? 43  ARG A CA  1 
ATOM   325  C C   . ARG A 1 43  ? 14.881 75.713 -6.083  1.00 44.91  ? 43  ARG A C   1 
ATOM   326  O O   . ARG A 1 43  ? 13.819 76.300 -6.306  1.00 45.00  ? 43  ARG A O   1 
ATOM   327  C CB  . ARG A 1 43  ? 16.762 76.682 -7.419  1.00 45.35  ? 43  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 43  ? 17.506 77.107 -6.165  1.00 45.04  ? 43  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 43  ? 18.321 78.371 -6.395  1.00 45.29  ? 43  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 43  ? 19.485 78.190 -7.264  1.00 43.37  ? 43  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 43  ? 20.255 79.196 -7.679  1.00 43.29  ? 43  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 43  ? 19.979 80.437 -7.313  1.00 42.83  ? 43  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 43  ? 21.311 78.974 -8.441  1.00 43.11  ? 43  ARG A NH2 1 
ATOM   334  N N   . PHE A 1 44  ? 15.214 75.265 -4.872  1.00 43.36  ? 44  PHE A N   1 
ATOM   335  C CA  . PHE A 1 44  ? 14.341 75.441 -3.706  1.00 41.85  ? 44  PHE A CA  1 
ATOM   336  C C   . PHE A 1 44  ? 13.041 74.610 -3.742  1.00 40.10  ? 44  PHE A C   1 
ATOM   337  O O   . PHE A 1 44  ? 12.349 74.491 -2.734  1.00 40.45  ? 44  PHE A O   1 
ATOM   338  C CB  . PHE A 1 44  ? 13.969 76.923 -3.539  1.00 43.23  ? 44  PHE A CB  1 
ATOM   339  C CG  . PHE A 1 44  ? 15.152 77.850 -3.476  1.00 44.76  ? 44  PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 44  ? 16.270 77.533 -2.720  1.00 47.52  ? 44  PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 44  ? 15.150 79.037 -4.193  1.00 46.14  ? 44  PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 44  ? 17.377 78.391 -2.685  1.00 49.09  ? 44  PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 44  ? 16.243 79.894 -4.165  1.00 47.43  ? 44  PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 44  ? 17.359 79.572 -3.412  1.00 47.74  ? 44  PHE A CZ  1 
ATOM   345  N N   . ARG A 1 45  ? 12.712 74.032 -4.892  1.00 38.06  ? 45  ARG A N   1 
ATOM   346  C CA  . ARG A 1 45  ? 11.481 73.255 -5.034  1.00 37.72  ? 45  ARG A CA  1 
ATOM   347  C C   . ARG A 1 45  ? 11.634 71.765 -4.735  1.00 38.07  ? 45  ARG A C   1 
ATOM   348  O O   . ARG A 1 45  ? 12.749 71.234 -4.715  1.00 37.78  ? 45  ARG A O   1 
ATOM   349  C CB  . ARG A 1 45  ? 10.941 73.416 -6.455  1.00 37.97  ? 45  ARG A CB  1 
ATOM   350  C CG  . ARG A 1 45  ? 10.666 74.838 -6.865  1.00 37.31  ? 45  ARG A CG  1 
ATOM   351  C CD  . ARG A 1 45  ? 10.340 74.894 -8.333  1.00 39.46  ? 45  ARG A CD  1 
ATOM   352  N NE  . ARG A 1 45  ? 9.860  76.208 -8.760  1.00 42.57  ? 45  ARG A NE  1 
ATOM   353  C CZ  . ARG A 1 45  ? 8.707  76.753 -8.374  1.00 41.42  ? 45  ARG A CZ  1 
ATOM   354  N NH1 . ARG A 1 45  ? 7.897  76.107 -7.548  1.00 42.78  ? 45  ARG A NH1 1 
ATOM   355  N NH2 . ARG A 1 45  ? 8.362  77.950 -8.820  1.00 40.44  ? 45  ARG A NH2 1 
ATOM   356  N N   . LYS A 1 46  ? 10.510 71.088 -4.502  1.00 36.82  ? 46  LYS A N   1 
ATOM   357  C CA  . LYS A 1 46  ? 10.550 69.656 -4.240  1.00 37.01  ? 46  LYS A CA  1 
ATOM   358  C C   . LYS A 1 46  ? 11.120 69.016 -5.496  1.00 37.38  ? 46  LYS A C   1 
ATOM   359  O O   . LYS A 1 46  ? 10.849 69.469 -6.599  1.00 38.35  ? 46  LYS A O   1 
ATOM   360  C CB  . LYS A 1 46  ? 9.152  69.110 -3.973  1.00 36.24  ? 46  LYS A CB  1 
ATOM   361  C CG  . LYS A 1 46  ? 8.546  69.577 -2.676  1.00 37.10  ? 46  LYS A CG  1 
ATOM   362  C CD  . LYS A 1 46  ? 7.149  69.017 -2.492  1.00 38.50  ? 46  LYS A CD  1 
ATOM   363  C CE  . LYS A 1 46  ? 6.537  69.524 -1.191  1.00 40.91  ? 46  LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 46  ? 5.087  69.192 -1.039  1.00 42.79  ? 46  LYS A NZ  1 
ATOM   365  N N   . PRO A 1 47  ? 11.926 67.960 -5.349  1.00 37.84  ? 47  PRO A N   1 
ATOM   366  C CA  . PRO A 1 47  ? 12.506 67.307 -6.523  1.00 38.05  ? 47  PRO A CA  1 
ATOM   367  C C   . PRO A 1 47  ? 11.474 66.607 -7.393  1.00 40.50  ? 47  PRO A C   1 
ATOM   368  O O   . PRO A 1 47  ? 10.403 66.204 -6.914  1.00 40.56  ? 47  PRO A O   1 
ATOM   369  C CB  . PRO A 1 47  ? 13.489 66.324 -5.909  1.00 37.11  ? 47  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 47  ? 12.770 65.906 -4.656  1.00 38.40  ? 47  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 47  ? 12.287 67.240 -4.116  1.00 37.88  ? 47  PRO A CD  1 
ATOM   372  N N   . VAL A 1 48  ? 11.788 66.476 -8.679  1.00 41.48  ? 48  VAL A N   1 
ATOM   373  C CA  . VAL A 1 48  ? 10.888 65.791 -9.593  1.00 42.08  ? 48  VAL A CA  1 
ATOM   374  C C   . VAL A 1 48  ? 11.605 64.578 -10.165 1.00 44.14  ? 48  VAL A C   1 
ATOM   375  O O   . VAL A 1 48  ? 12.783 64.649 -10.527 1.00 44.27  ? 48  VAL A O   1 
ATOM   376  C CB  . VAL A 1 48  ? 10.404 66.710 -10.740 1.00 40.08  ? 48  VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 48  ? 9.454  67.763 -10.198 1.00 37.83  ? 48  VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 48  ? 11.571 67.366 -11.396 1.00 40.04  ? 48  VAL A CG2 1 
ATOM   379  N N   . PRO A 1 49  ? 10.909 63.433 -10.215 1.00 45.63  ? 49  PRO A N   1 
ATOM   380  C CA  . PRO A 1 49  ? 11.502 62.210 -10.749 1.00 47.44  ? 49  PRO A CA  1 
ATOM   381  C C   . PRO A 1 49  ? 12.194 62.550 -12.045 1.00 50.71  ? 49  PRO A C   1 
ATOM   382  O O   . PRO A 1 49  ? 11.718 63.402 -12.785 1.00 51.85  ? 49  PRO A O   1 
ATOM   383  C CB  . PRO A 1 49  ? 10.294 61.313 -10.954 1.00 45.68  ? 49  PRO A CB  1 
ATOM   384  C CG  . PRO A 1 49  ? 9.432  61.682 -9.789  1.00 44.64  ? 49  PRO A CG  1 
ATOM   385  C CD  . PRO A 1 49  ? 9.515  63.195 -9.795  1.00 44.02  ? 49  PRO A CD  1 
ATOM   386  N N   . ALA A 1 50  ? 13.321 61.901 -12.313 1.00 55.34  ? 50  ALA A N   1 
ATOM   387  C CA  . ALA A 1 50  ? 14.067 62.156 -13.539 1.00 58.57  ? 50  ALA A CA  1 
ATOM   388  C C   . ALA A 1 50  ? 13.369 61.568 -14.757 1.00 62.27  ? 50  ALA A C   1 
ATOM   389  O O   . ALA A 1 50  ? 12.617 60.588 -14.667 1.00 61.68  ? 50  ALA A O   1 
ATOM   390  C CB  . ALA A 1 50  ? 15.473 61.588 -13.429 1.00 57.97  ? 50  ALA A CB  1 
ATOM   391  N N   . GLU A 1 51  ? 13.616 62.186 -15.903 1.00 66.27  ? 51  GLU A N   1 
ATOM   392  C CA  . GLU A 1 51  ? 13.031 61.719 -17.140 1.00 69.86  ? 51  GLU A CA  1 
ATOM   393  C C   . GLU A 1 51  ? 13.781 60.455 -17.507 1.00 70.93  ? 51  GLU A C   1 
ATOM   394  O O   . GLU A 1 51  ? 15.009 60.411 -17.420 1.00 70.49  ? 51  GLU A O   1 
ATOM   395  C CB  . GLU A 1 51  ? 13.224 62.766 -18.221 1.00 72.39  ? 51  GLU A CB  1 
ATOM   396  C CG  . GLU A 1 51  ? 12.651 64.112 -17.854 1.00 77.97  ? 51  GLU A CG  1 
ATOM   397  C CD  . GLU A 1 51  ? 13.196 65.216 -18.729 1.00 81.26  ? 51  GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 51  ? 13.111 65.077 -19.969 1.00 84.01  ? 51  GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 51  ? 13.708 66.218 -18.178 1.00 82.22  ? 51  GLU A OE2 1 
ATOM   400  N N   . PRO A 1 52  ? 13.053 59.405 -17.913 1.00 71.94  ? 52  PRO A N   1 
ATOM   401  C CA  . PRO A 1 52  ? 13.672 58.134 -18.293 1.00 72.99  ? 52  PRO A CA  1 
ATOM   402  C C   . PRO A 1 52  ? 14.612 58.323 -19.476 1.00 73.65  ? 52  PRO A C   1 
ATOM   403  O O   . PRO A 1 52  ? 14.455 59.262 -20.259 1.00 72.77  ? 52  PRO A O   1 
ATOM   404  C CB  . PRO A 1 52  ? 12.473 57.252 -18.622 1.00 72.41  ? 52  PRO A CB  1 
ATOM   405  C CG  . PRO A 1 52  ? 11.479 58.238 -19.144 1.00 73.18  ? 52  PRO A CG  1 
ATOM   406  C CD  . PRO A 1 52  ? 11.604 59.379 -18.167 1.00 73.07  ? 52  PRO A CD  1 
ATOM   407  N N   . TRP A 1 53  ? 15.592 57.435 -19.600 1.00 74.91  ? 53  TRP A N   1 
ATOM   408  C CA  . TRP A 1 53  ? 16.551 57.543 -20.684 1.00 76.34  ? 53  TRP A CA  1 
ATOM   409  C C   . TRP A 1 53  ? 16.578 56.390 -21.679 1.00 77.01  ? 53  TRP A C   1 
ATOM   410  O O   . TRP A 1 53  ? 16.022 55.315 -21.456 1.00 75.89  ? 53  TRP A O   1 
ATOM   411  C CB  . TRP A 1 53  ? 17.955 57.792 -20.119 1.00 76.49  ? 53  TRP A CB  1 
ATOM   412  C CG  . TRP A 1 53  ? 18.344 56.868 -19.013 1.00 77.23  ? 53  TRP A CG  1 
ATOM   413  C CD1 . TRP A 1 53  ? 18.923 55.636 -19.134 1.00 76.93  ? 53  TRP A CD1 1 
ATOM   414  C CD2 . TRP A 1 53  ? 18.170 57.094 -17.612 1.00 76.57  ? 53  TRP A CD2 1 
ATOM   415  N NE1 . TRP A 1 53  ? 19.121 55.085 -17.894 1.00 75.81  ? 53  TRP A NE1 1 
ATOM   416  C CE2 . TRP A 1 53  ? 18.668 55.959 -16.940 1.00 76.72  ? 53  TRP A CE2 1 
ATOM   417  C CE3 . TRP A 1 53  ? 17.638 58.147 -16.855 1.00 77.31  ? 53  TRP A CE3 1 
ATOM   418  C CZ2 . TRP A 1 53  ? 18.653 55.846 -15.543 1.00 76.95  ? 53  TRP A CZ2 1 
ATOM   419  C CZ3 . TRP A 1 53  ? 17.621 58.033 -15.465 1.00 76.77  ? 53  TRP A CZ3 1 
ATOM   420  C CH2 . TRP A 1 53  ? 18.127 56.891 -14.826 1.00 76.19  ? 53  TRP A CH2 1 
ATOM   421  N N   . HIS A 1 54  ? 17.250 56.671 -22.787 1.00 79.34  ? 54  HIS A N   1 
ATOM   422  C CA  . HIS A 1 54  ? 17.428 55.787 -23.931 1.00 80.86  ? 54  HIS A CA  1 
ATOM   423  C C   . HIS A 1 54  ? 18.380 54.601 -23.752 1.00 79.47  ? 54  HIS A C   1 
ATOM   424  O O   . HIS A 1 54  ? 17.954 53.476 -23.471 1.00 78.59  ? 54  HIS A O   1 
ATOM   425  C CB  . HIS A 1 54  ? 17.922 56.644 -25.092 1.00 85.26  ? 54  HIS A CB  1 
ATOM   426  C CG  . HIS A 1 54  ? 18.909 57.693 -24.672 1.00 88.78  ? 54  HIS A CG  1 
ATOM   427  N ND1 . HIS A 1 54  ? 18.546 58.798 -23.929 1.00 89.69  ? 54  HIS A ND1 1 
ATOM   428  C CD2 . HIS A 1 54  ? 20.251 57.779 -24.842 1.00 90.04  ? 54  HIS A CD2 1 
ATOM   429  C CE1 . HIS A 1 54  ? 19.621 59.518 -23.660 1.00 90.95  ? 54  HIS A CE1 1 
ATOM   430  N NE2 . HIS A 1 54  ? 20.669 58.921 -24.202 1.00 91.48  ? 54  HIS A NE2 1 
ATOM   431  N N   . GLY A 1 55  ? 19.670 54.870 -23.941 1.00 77.79  ? 55  GLY A N   1 
ATOM   432  C CA  . GLY A 1 55  ? 20.680 53.834 -23.845 1.00 77.23  ? 55  GLY A CA  1 
ATOM   433  C C   . GLY A 1 55  ? 21.442 53.778 -22.542 1.00 76.84  ? 55  GLY A C   1 
ATOM   434  O O   . GLY A 1 55  ? 21.212 54.575 -21.637 1.00 77.26  ? 55  GLY A O   1 
ATOM   435  N N   . VAL A 1 56  ? 22.359 52.820 -22.459 1.00 76.07  ? 56  VAL A N   1 
ATOM   436  C CA  . VAL A 1 56  ? 23.169 52.611 -21.270 1.00 74.60  ? 56  VAL A CA  1 
ATOM   437  C C   . VAL A 1 56  ? 23.663 53.923 -20.686 1.00 73.04  ? 56  VAL A C   1 
ATOM   438  O O   . VAL A 1 56  ? 24.174 54.780 -21.405 1.00 71.74  ? 56  VAL A O   1 
ATOM   439  C CB  . VAL A 1 56  ? 24.384 51.711 -21.587 1.00 75.89  ? 56  VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 56  ? 23.920 50.463 -22.325 1.00 76.23  ? 56  VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 56  ? 25.412 52.471 -22.418 1.00 76.83  ? 56  VAL A CG2 1 
ATOM   442  N N   . LEU A 1 57  ? 23.491 54.078 -19.377 1.00 71.65  ? 57  LEU A N   1 
ATOM   443  C CA  . LEU A 1 57  ? 23.936 55.284 -18.692 1.00 69.70  ? 57  LEU A CA  1 
ATOM   444  C C   . LEU A 1 57  ? 25.282 54.988 -18.049 1.00 68.65  ? 57  LEU A C   1 
ATOM   445  O O   . LEU A 1 57  ? 25.441 53.977 -17.360 1.00 67.10  ? 57  LEU A O   1 
ATOM   446  C CB  . LEU A 1 57  ? 22.924 55.695 -17.623 1.00 70.11  ? 57  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 57  ? 23.052 57.117 -17.068 1.00 70.12  ? 57  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 57  ? 21.838 57.429 -16.218 1.00 70.24  ? 57  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 57  ? 24.329 57.263 -16.259 1.00 70.92  ? 57  LEU A CD2 1 
ATOM   450  N N   . ASP A 1 58  ? 26.247 55.871 -18.283 1.00 67.86  ? 58  ASP A N   1 
ATOM   451  C CA  . ASP A 1 58  ? 27.584 55.698 -17.738 1.00 67.67  ? 58  ASP A CA  1 
ATOM   452  C C   . ASP A 1 58  ? 27.578 55.770 -16.220 1.00 67.52  ? 58  ASP A C   1 
ATOM   453  O O   . ASP A 1 58  ? 27.785 56.834 -15.637 1.00 67.38  ? 58  ASP A O   1 
ATOM   454  C CB  . ASP A 1 58  ? 28.533 56.759 -18.295 1.00 67.92  ? 58  ASP A CB  1 
ATOM   455  C CG  . ASP A 1 58  ? 29.979 56.501 -17.909 1.00 68.75  ? 58  ASP A CG  1 
ATOM   456  O OD1 . ASP A 1 58  ? 30.233 55.495 -17.218 1.00 69.80  ? 58  ASP A OD1 1 
ATOM   457  O OD2 . ASP A 1 58  ? 30.864 57.294 -18.294 1.00 69.31  ? 58  ASP A OD2 1 
ATOM   458  N N   . ALA A 1 59  ? 27.342 54.627 -15.585 1.00 67.34  ? 59  ALA A N   1 
ATOM   459  C CA  . ALA A 1 59  ? 27.314 54.550 -14.131 1.00 67.52  ? 59  ALA A CA  1 
ATOM   460  C C   . ALA A 1 59  ? 28.620 53.979 -13.600 1.00 67.57  ? 59  ALA A C   1 
ATOM   461  O O   . ALA A 1 59  ? 28.652 52.880 -13.047 1.00 67.83  ? 59  ALA A O   1 
ATOM   462  C CB  . ALA A 1 59  ? 26.161 53.689 -13.682 1.00 66.89  ? 59  ALA A CB  1 
ATOM   463  N N   . THR A 1 60  ? 29.700 54.731 -13.773 1.00 67.06  ? 60  THR A N   1 
ATOM   464  C CA  . THR A 1 60  ? 31.003 54.294 -13.306 1.00 66.39  ? 60  THR A CA  1 
ATOM   465  C C   . THR A 1 60  ? 31.702 55.475 -12.655 1.00 66.23  ? 60  THR A C   1 
ATOM   466  O O   . THR A 1 60  ? 32.565 55.298 -11.797 1.00 67.91  ? 60  THR A O   1 
ATOM   467  C CB  . THR A 1 60  ? 31.870 53.759 -14.472 1.00 67.14  ? 60  THR A CB  1 
ATOM   468  O OG1 . THR A 1 60  ? 32.253 54.841 -15.332 1.00 66.42  ? 60  THR A OG1 1 
ATOM   469  C CG2 . THR A 1 60  ? 31.088 52.720 -15.281 1.00 65.83  ? 60  THR A CG2 1 
ATOM   470  N N   . GLY A 1 61  ? 31.309 56.679 -13.059 1.00 64.38  ? 61  GLY A N   1 
ATOM   471  C CA  . GLY A 1 61  ? 31.900 57.878 -12.502 1.00 62.00  ? 61  GLY A CA  1 
ATOM   472  C C   . GLY A 1 61  ? 31.132 58.440 -11.319 1.00 61.09  ? 61  GLY A C   1 
ATOM   473  O O   . GLY A 1 61  ? 29.913 58.298 -11.234 1.00 59.51  ? 61  GLY A O   1 
ATOM   474  N N   . LEU A 1 62  ? 31.855 59.078 -10.400 1.00 60.88  ? 62  LEU A N   1 
ATOM   475  C CA  . LEU A 1 62  ? 31.251 59.695 -9.221  1.00 59.54  ? 62  LEU A CA  1 
ATOM   476  C C   . LEU A 1 62  ? 30.484 60.940 -9.648  1.00 57.85  ? 62  LEU A C   1 
ATOM   477  O O   . LEU A 1 62  ? 30.958 61.710 -10.477 1.00 56.70  ? 62  LEU A O   1 
ATOM   478  C CB  . LEU A 1 62  ? 32.331 60.091 -8.214  1.00 60.66  ? 62  LEU A CB  1 
ATOM   479  C CG  . LEU A 1 62  ? 33.196 58.961 -7.645  1.00 61.63  ? 62  LEU A CG  1 
ATOM   480  C CD1 . LEU A 1 62  ? 34.208 59.544 -6.675  1.00 61.14  ? 62  LEU A CD1 1 
ATOM   481  C CD2 . LEU A 1 62  ? 32.316 57.930 -6.947  1.00 62.73  ? 62  LEU A CD2 1 
ATOM   482  N N   . SER A 1 63  ? 29.301 61.139 -9.081  1.00 56.53  ? 63  SER A N   1 
ATOM   483  C CA  . SER A 1 63  ? 28.492 62.296 -9.434  1.00 54.17  ? 63  SER A CA  1 
ATOM   484  C C   . SER A 1 63  ? 28.969 63.535 -8.699  1.00 53.25  ? 63  SER A C   1 
ATOM   485  O O   . SER A 1 63  ? 29.720 63.445 -7.725  1.00 53.23  ? 63  SER A O   1 
ATOM   486  C CB  . SER A 1 63  ? 27.026 62.046 -9.096  1.00 55.14  ? 63  SER A CB  1 
ATOM   487  O OG  . SER A 1 63  ? 26.804 62.168 -7.705  1.00 55.85  ? 63  SER A OG  1 
ATOM   488  N N   . ALA A 1 64  ? 28.522 64.694 -9.169  1.00 52.07  ? 64  ALA A N   1 
ATOM   489  C CA  . ALA A 1 64  ? 28.898 65.969 -8.570  1.00 51.43  ? 64  ALA A CA  1 
ATOM   490  C C   . ALA A 1 64  ? 28.390 66.018 -7.141  1.00 50.66  ? 64  ALA A C   1 
ATOM   491  O O   . ALA A 1 64  ? 27.476 65.278 -6.794  1.00 50.73  ? 64  ALA A O   1 
ATOM   492  C CB  . ALA A 1 64  ? 28.299 67.111 -9.368  1.00 50.39  ? 64  ALA A CB  1 
ATOM   493  N N   . THR A 1 65  ? 28.987 66.868 -6.307  1.00 49.00  ? 65  THR A N   1 
ATOM   494  C CA  . THR A 1 65  ? 28.517 66.989 -4.933  1.00 47.99  ? 65  THR A CA  1 
ATOM   495  C C   . THR A 1 65  ? 27.645 68.230 -4.928  1.00 45.28  ? 65  THR A C   1 
ATOM   496  O O   . THR A 1 65  ? 27.888 69.153 -5.690  1.00 45.15  ? 65  THR A O   1 
ATOM   497  C CB  . THR A 1 65  ? 29.682 67.138 -3.904  1.00 49.32  ? 65  THR A CB  1 
ATOM   498  O OG1 . THR A 1 65  ? 29.942 68.522 -3.658  1.00 50.76  ? 65  THR A OG1 1 
ATOM   499  C CG2 . THR A 1 65  ? 30.949 66.465 -4.416  1.00 48.95  ? 65  THR A CG2 1 
ATOM   500  N N   . CYS A 1 66  ? 26.617 68.246 -4.091  1.00 44.86  ? 66  CYS A N   1 
ATOM   501  C CA  . CYS A 1 66  ? 25.716 69.379 -4.043  1.00 44.63  ? 66  CYS A CA  1 
ATOM   502  C C   . CYS A 1 66  ? 26.435 70.633 -3.580  1.00 46.97  ? 66  CYS A C   1 
ATOM   503  O O   . CYS A 1 66  ? 27.434 70.555 -2.869  1.00 47.41  ? 66  CYS A O   1 
ATOM   504  C CB  . CYS A 1 66  ? 24.527 69.058 -3.143  1.00 43.88  ? 66  CYS A CB  1 
ATOM   505  S SG  . CYS A 1 66  ? 23.497 67.670 -3.748  1.00 44.99  ? 66  CYS A SG  1 
ATOM   506  N N   . VAL A 1 67  ? 25.937 71.793 -4.001  1.00 49.56  ? 67  VAL A N   1 
ATOM   507  C CA  . VAL A 1 67  ? 26.565 73.057 -3.642  1.00 51.85  ? 67  VAL A CA  1 
ATOM   508  C C   . VAL A 1 67  ? 26.691 73.189 -2.142  1.00 53.73  ? 67  VAL A C   1 
ATOM   509  O O   . VAL A 1 67  ? 25.717 73.035 -1.406  1.00 54.43  ? 67  VAL A O   1 
ATOM   510  C CB  . VAL A 1 67  ? 25.782 74.273 -4.191  1.00 51.88  ? 67  VAL A CB  1 
ATOM   511  C CG1 . VAL A 1 67  ? 26.464 75.574 -3.760  1.00 50.66  ? 67  VAL A CG1 1 
ATOM   512  C CG2 . VAL A 1 67  ? 25.714 74.196 -5.710  1.00 50.92  ? 67  VAL A CG2 1 
ATOM   513  N N   . GLN A 1 68  ? 27.912 73.471 -1.705  1.00 56.17  ? 68  GLN A N   1 
ATOM   514  C CA  . GLN A 1 68  ? 28.226 73.624 -0.296  1.00 58.61  ? 68  GLN A CA  1 
ATOM   515  C C   . GLN A 1 68  ? 29.628 74.217 -0.221  1.00 61.49  ? 68  GLN A C   1 
ATOM   516  O O   . GLN A 1 68  ? 30.355 74.209 -1.211  1.00 61.43  ? 68  GLN A O   1 
ATOM   517  C CB  . GLN A 1 68  ? 28.204 72.258 0.384   1.00 57.32  ? 68  GLN A CB  1 
ATOM   518  C CG  . GLN A 1 68  ? 29.326 71.348 -0.073  1.00 55.63  ? 68  GLN A CG  1 
ATOM   519  C CD  . GLN A 1 68  ? 29.130 69.910 0.354   1.00 55.02  ? 68  GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 68  ? 28.267 69.209 -0.176  1.00 53.82  ? 68  GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 68  ? 29.932 69.459 1.317   1.00 53.27  ? 68  GLN A NE2 1 
ATOM   522  N N   . GLU A 1 69  ? 30.006 74.720 0.951   1.00 65.59  ? 69  GLU A N   1 
ATOM   523  C CA  . GLU A 1 69  ? 31.324 75.322 1.146   1.00 68.73  ? 69  GLU A CA  1 
ATOM   524  C C   . GLU A 1 69  ? 32.328 74.383 1.814   1.00 69.15  ? 69  GLU A C   1 
ATOM   525  O O   . GLU A 1 69  ? 31.980 73.630 2.723   1.00 68.75  ? 69  GLU A O   1 
ATOM   526  C CB  . GLU A 1 69  ? 31.193 76.599 1.980   1.00 71.09  ? 69  GLU A CB  1 
ATOM   527  C CG  . GLU A 1 69  ? 30.516 77.766 1.268   1.00 75.56  ? 69  GLU A CG  1 
ATOM   528  C CD  . GLU A 1 69  ? 31.347 78.320 0.117   1.00 78.51  ? 69  GLU A CD  1 
ATOM   529  O OE1 . GLU A 1 69  ? 31.330 77.724 -0.984  1.00 79.06  ? 69  GLU A OE1 1 
ATOM   530  O OE2 . GLU A 1 69  ? 32.029 79.351 0.320   1.00 79.99  ? 69  GLU A OE2 1 
ATOM   531  N N   . ARG A 1 70  ? 33.576 74.442 1.358   1.00 70.15  ? 70  ARG A N   1 
ATOM   532  C CA  . ARG A 1 70  ? 34.644 73.610 1.903   1.00 72.59  ? 70  ARG A CA  1 
ATOM   533  C C   . ARG A 1 70  ? 35.234 74.231 3.163   1.00 72.75  ? 70  ARG A C   1 
ATOM   534  O O   . ARG A 1 70  ? 35.310 75.453 3.295   1.00 72.49  ? 70  ARG A O   1 
ATOM   535  C CB  . ARG A 1 70  ? 35.769 73.426 0.873   1.00 75.49  ? 70  ARG A CB  1 
ATOM   536  C CG  . ARG A 1 70  ? 35.371 72.661 -0.393  1.00 79.60  ? 70  ARG A CG  1 
ATOM   537  C CD  . ARG A 1 70  ? 36.461 72.721 -1.462  1.00 80.18  ? 70  ARG A CD  1 
ATOM   538  N NE  . ARG A 1 70  ? 37.596 71.846 -1.179  1.00 81.75  ? 70  ARG A NE  1 
ATOM   539  C CZ  . ARG A 1 70  ? 37.578 70.526 -1.338  1.00 82.66  ? 70  ARG A CZ  1 
ATOM   540  N NH1 . ARG A 1 70  ? 36.480 69.922 -1.778  1.00 82.59  ? 70  ARG A NH1 1 
ATOM   541  N NH2 . ARG A 1 70  ? 38.660 69.808 -1.067  1.00 83.74  ? 70  ARG A NH2 1 
ATOM   542  N N   . TYR A 1 71  ? 35.648 73.379 4.093   1.00 72.94  ? 71  TYR A N   1 
ATOM   543  C CA  . TYR A 1 71  ? 36.257 73.848 5.328   1.00 72.71  ? 71  TYR A CA  1 
ATOM   544  C C   . TYR A 1 71  ? 37.769 73.776 5.152   1.00 71.86  ? 71  TYR A C   1 
ATOM   545  O O   . TYR A 1 71  ? 38.338 72.691 5.018   1.00 71.36  ? 71  TYR A O   1 
ATOM   546  C CB  . TYR A 1 71  ? 35.817 72.985 6.519   1.00 73.34  ? 71  TYR A CB  1 
ATOM   547  C CG  . TYR A 1 71  ? 34.391 73.225 6.975   1.00 73.19  ? 71  TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 71  ? 33.321 72.574 6.367   1.00 72.81  ? 71  TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 71  ? 34.112 74.115 8.015   1.00 74.46  ? 71  TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 71  ? 32.007 72.803 6.784   1.00 72.96  ? 71  TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 71  ? 32.803 74.350 8.440   1.00 73.69  ? 71  TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 71  ? 31.759 73.689 7.820   1.00 73.30  ? 71  TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 71  ? 30.467 73.911 8.236   1.00 74.81  ? 71  TYR A OH  1 
ATOM   554  N N   . GLU A 1 72  ? 38.410 74.941 5.145   1.00 71.63  ? 72  GLU A N   1 
ATOM   555  C CA  . GLU A 1 72  ? 39.853 75.034 4.961   1.00 70.99  ? 72  GLU A CA  1 
ATOM   556  C C   . GLU A 1 72  ? 40.562 75.620 6.188   1.00 70.47  ? 72  GLU A C   1 
ATOM   557  O O   . GLU A 1 72  ? 41.570 76.315 6.058   1.00 70.80  ? 72  GLU A O   1 
ATOM   558  C CB  . GLU A 1 72  ? 40.156 75.896 3.728   1.00 71.42  ? 72  GLU A CB  1 
ATOM   559  C CG  . GLU A 1 72  ? 41.025 75.221 2.673   1.00 72.90  ? 72  GLU A CG  1 
ATOM   560  C CD  . GLU A 1 72  ? 40.272 74.191 1.838   1.00 73.20  ? 72  GLU A CD  1 
ATOM   561  O OE1 . GLU A 1 72  ? 39.437 74.587 0.989   1.00 71.93  ? 72  GLU A OE1 1 
ATOM   562  O OE2 . GLU A 1 72  ? 40.521 72.982 2.035   1.00 73.21  ? 72  GLU A OE2 1 
ATOM   563  N N   . TYR A 1 73  ? 40.043 75.337 7.373   1.00 68.81  ? 73  TYR A N   1 
ATOM   564  C CA  . TYR A 1 73  ? 40.635 75.854 8.615   1.00 66.94  ? 73  TYR A CA  1 
ATOM   565  C C   . TYR A 1 73  ? 42.052 75.302 8.789   1.00 66.33  ? 73  TYR A C   1 
ATOM   566  O O   . TYR A 1 73  ? 42.864 75.914 9.490   1.00 65.40  ? 73  TYR A O   1 
ATOM   567  C CB  . TYR A 1 73  ? 39.789 75.431 9.813   1.00 66.48  ? 73  TYR A CB  1 
ATOM   568  C CG  . TYR A 1 73  ? 38.452 76.160 9.868   1.00 64.16  ? 73  TYR A CG  1 
ATOM   569  C CD1 . TYR A 1 73  ? 37.337 75.618 9.221   1.00 63.09  ? 73  TYR A CD1 1 
ATOM   570  C CD2 . TYR A 1 73  ? 38.345 77.369 10.562  1.00 63.26  ? 73  TYR A CD2 1 
ATOM   571  C CE1 . TYR A 1 73  ? 36.111 76.286 9.265   1.00 63.87  ? 73  TYR A CE1 1 
ATOM   572  C CE2 . TYR A 1 73  ? 37.117 78.039 10.606  1.00 63.23  ? 73  TYR A CE2 1 
ATOM   573  C CZ  . TYR A 1 73  ? 36.001 77.498 9.958   1.00 63.05  ? 73  TYR A CZ  1 
ATOM   574  O OH  . TYR A 1 73  ? 34.809 78.150 10.000  1.00 62.79  ? 73  TYR A OH  1 
ATOM   575  N N   . PHE A 1 74  ? 42.340 74.156 8.196   1.00 66.50  ? 74  PHE A N   1 
ATOM   576  C CA  . PHE A 1 74  ? 43.656 73.538 8.301   1.00 67.75  ? 74  PHE A CA  1 
ATOM   577  C C   . PHE A 1 74  ? 44.179 73.229 6.912   1.00 68.36  ? 74  PHE A C   1 
ATOM   578  O O   . PHE A 1 74  ? 44.266 72.068 6.506   1.00 67.51  ? 74  PHE A O   1 
ATOM   579  C CB  . PHE A 1 74  ? 43.582 72.257 9.129   1.00 68.88  ? 74  PHE A CB  1 
ATOM   580  C CG  . PHE A 1 74  ? 43.085 72.482 10.520  1.00 71.38  ? 74  PHE A CG  1 
ATOM   581  C CD1 . PHE A 1 74  ? 41.720 72.595 10.774  1.00 71.99  ? 74  PHE A CD1 1 
ATOM   582  C CD2 . PHE A 1 74  ? 43.979 72.661 11.567  1.00 70.83  ? 74  PHE A CD2 1 
ATOM   583  C CE1 . PHE A 1 74  ? 41.256 72.889 12.046  1.00 72.09  ? 74  PHE A CE1 1 
ATOM   584  C CE2 . PHE A 1 74  ? 43.525 72.957 12.843  1.00 71.64  ? 74  PHE A CE2 1 
ATOM   585  C CZ  . PHE A 1 74  ? 42.163 73.073 13.084  1.00 72.53  ? 74  PHE A CZ  1 
ATOM   586  N N   . PRO A 1 75  ? 44.548 74.278 6.167   1.00 69.02  ? 75  PRO A N   1 
ATOM   587  C CA  . PRO A 1 75  ? 45.067 74.175 4.806   1.00 69.59  ? 75  PRO A CA  1 
ATOM   588  C C   . PRO A 1 75  ? 46.093 73.065 4.623   1.00 70.60  ? 75  PRO A C   1 
ATOM   589  O O   . PRO A 1 75  ? 47.142 73.065 5.274   1.00 71.15  ? 75  PRO A O   1 
ATOM   590  C CB  . PRO A 1 75  ? 45.660 75.556 4.569   1.00 69.72  ? 75  PRO A CB  1 
ATOM   591  C CG  . PRO A 1 75  ? 44.749 76.434 5.352   1.00 69.80  ? 75  PRO A CG  1 
ATOM   592  C CD  . PRO A 1 75  ? 44.635 75.668 6.644   1.00 69.69  ? 75  PRO A CD  1 
ATOM   593  N N   . GLY A 1 76  ? 45.771 72.119 3.740   1.00 69.86  ? 76  GLY A N   1 
ATOM   594  C CA  . GLY A 1 76  ? 46.670 71.019 3.446   1.00 69.13  ? 76  GLY A CA  1 
ATOM   595  C C   . GLY A 1 76  ? 46.622 69.837 4.394   1.00 68.94  ? 76  GLY A C   1 
ATOM   596  O O   . GLY A 1 76  ? 47.362 68.868 4.224   1.00 70.24  ? 76  GLY A O   1 
ATOM   597  N N   . PHE A 1 77  ? 45.756 69.898 5.395   1.00 67.56  ? 77  PHE A N   1 
ATOM   598  C CA  . PHE A 1 77  ? 45.659 68.803 6.343   1.00 65.81  ? 77  PHE A CA  1 
ATOM   599  C C   . PHE A 1 77  ? 44.676 67.730 5.874   1.00 66.21  ? 77  PHE A C   1 
ATOM   600  O O   . PHE A 1 77  ? 43.503 68.007 5.618   1.00 65.11  ? 77  PHE A O   1 
ATOM   601  C CB  . PHE A 1 77  ? 45.269 69.355 7.713   1.00 63.19  ? 77  PHE A CB  1 
ATOM   602  C CG  . PHE A 1 77  ? 45.035 68.305 8.744   1.00 59.87  ? 77  PHE A CG  1 
ATOM   603  C CD1 . PHE A 1 77  ? 45.850 67.183 8.813   1.00 59.54  ? 77  PHE A CD1 1 
ATOM   604  C CD2 . PHE A 1 77  ? 44.004 68.443 9.660   1.00 59.05  ? 77  PHE A CD2 1 
ATOM   605  C CE1 . PHE A 1 77  ? 45.637 66.212 9.783   1.00 59.68  ? 77  PHE A CE1 1 
ATOM   606  C CE2 . PHE A 1 77  ? 43.784 67.480 10.632  1.00 58.94  ? 77  PHE A CE2 1 
ATOM   607  C CZ  . PHE A 1 77  ? 44.599 66.363 10.696  1.00 58.97  ? 77  PHE A CZ  1 
ATOM   608  N N   . SER A 1 78  ? 45.179 66.503 5.759   1.00 68.03  ? 78  SER A N   1 
ATOM   609  C CA  . SER A 1 78  ? 44.392 65.362 5.301   1.00 69.85  ? 78  SER A CA  1 
ATOM   610  C C   . SER A 1 78  ? 43.216 65.024 6.206   1.00 70.83  ? 78  SER A C   1 
ATOM   611  O O   . SER A 1 78  ? 42.253 64.395 5.767   1.00 72.10  ? 78  SER A O   1 
ATOM   612  C CB  . SER A 1 78  ? 45.285 64.127 5.164   1.00 70.68  ? 78  SER A CB  1 
ATOM   613  O OG  . SER A 1 78  ? 45.810 63.732 6.422   1.00 72.45  ? 78  SER A OG  1 
ATOM   614  N N   . GLY A 1 79  ? 43.297 65.428 7.469   1.00 70.62  ? 79  GLY A N   1 
ATOM   615  C CA  . GLY A 1 79  ? 42.215 65.149 8.395   1.00 70.11  ? 79  GLY A CA  1 
ATOM   616  C C   . GLY A 1 79  ? 40.946 65.904 8.040   1.00 70.41  ? 79  GLY A C   1 
ATOM   617  O O   . GLY A 1 79  ? 39.868 65.321 7.945   1.00 70.27  ? 79  GLY A O   1 
ATOM   618  N N   . GLU A 1 80  ? 41.076 67.210 7.839   1.00 70.45  ? 80  GLU A N   1 
ATOM   619  C CA  . GLU A 1 80  ? 39.937 68.039 7.489   1.00 71.23  ? 80  GLU A CA  1 
ATOM   620  C C   . GLU A 1 80  ? 39.477 67.813 6.055   1.00 72.22  ? 80  GLU A C   1 
ATOM   621  O O   . GLU A 1 80  ? 38.277 67.801 5.770   1.00 73.35  ? 80  GLU A O   1 
ATOM   622  C CB  . GLU A 1 80  ? 40.289 69.510 7.656   1.00 70.40  ? 80  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 80  ? 39.190 70.441 7.201   1.00 69.30  ? 80  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 80  ? 39.631 71.878 7.194   1.00 69.48  ? 80  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 80  ? 40.585 72.191 6.456   1.00 69.90  ? 80  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 80  ? 39.029 72.695 7.920   1.00 69.24  ? 80  GLU A OE2 1 
ATOM   627  N N   . GLU A 1 81  ? 40.435 67.639 5.154   1.00 72.27  ? 81  GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 40.127 67.447 3.744   1.00 72.15  ? 81  GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 39.319 66.209 3.361   1.00 69.38  ? 81  GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 38.470 66.281 2.478   1.00 69.43  ? 81  GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 41.419 67.491 2.919   1.00 75.35  ? 81  GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 41.786 68.887 2.430   1.00 79.37  ? 81  GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 40.677 69.514 1.596   1.00 82.38  ? 81  GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 39.768 68.773 1.164   1.00 84.55  ? 81  GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 40.717 70.741 1.363   1.00 83.58  ? 81  GLU A OE2 1 
ATOM   636  N N   . ILE A 1 82  ? 39.569 65.078 4.008   1.00 66.45  ? 82  ILE A N   1 
ATOM   637  C CA  . ILE A 1 82  ? 38.836 63.860 3.677   1.00 63.18  ? 82  ILE A CA  1 
ATOM   638  C C   . ILE A 1 82  ? 37.327 64.055 3.753   1.00 61.38  ? 82  ILE A C   1 
ATOM   639  O O   . ILE A 1 82  ? 36.566 63.230 3.244   1.00 61.39  ? 82  ILE A O   1 
ATOM   640  C CB  . ILE A 1 82  ? 39.222 62.684 4.606   1.00 63.10  ? 82  ILE A CB  1 
ATOM   641  C CG1 . ILE A 1 82  ? 39.089 63.110 6.070   1.00 63.05  ? 82  ILE A CG1 1 
ATOM   642  C CG2 . ILE A 1 82  ? 40.626 62.213 4.292   1.00 62.85  ? 82  ILE A CG2 1 
ATOM   643  C CD1 . ILE A 1 82  ? 39.479 62.046 7.066   1.00 62.47  ? 82  ILE A CD1 1 
ATOM   644  N N   . TRP A 1 83  ? 36.895 65.150 4.371   1.00 59.15  ? 83  TRP A N   1 
ATOM   645  C CA  . TRP A 1 83  ? 35.469 65.421 4.517   1.00 57.30  ? 83  TRP A CA  1 
ATOM   646  C C   . TRP A 1 83  ? 34.907 66.451 3.550   1.00 56.45  ? 83  TRP A C   1 
ATOM   647  O O   . TRP A 1 83  ? 33.694 66.640 3.479   1.00 56.16  ? 83  TRP A O   1 
ATOM   648  C CB  . TRP A 1 83  ? 35.164 65.858 5.951   1.00 56.27  ? 83  TRP A CB  1 
ATOM   649  C CG  . TRP A 1 83  ? 35.573 64.846 6.954   1.00 54.80  ? 83  TRP A CG  1 
ATOM   650  C CD1 . TRP A 1 83  ? 36.688 64.869 7.739   1.00 55.60  ? 83  TRP A CD1 1 
ATOM   651  C CD2 . TRP A 1 83  ? 34.901 63.621 7.245   1.00 54.44  ? 83  TRP A CD2 1 
ATOM   652  N NE1 . TRP A 1 83  ? 36.753 63.730 8.508   1.00 53.86  ? 83  TRP A NE1 1 
ATOM   653  C CE2 . TRP A 1 83  ? 35.667 62.946 8.223   1.00 53.82  ? 83  TRP A CE2 1 
ATOM   654  C CE3 . TRP A 1 83  ? 33.724 63.023 6.774   1.00 54.26  ? 83  TRP A CE3 1 
ATOM   655  C CZ2 . TRP A 1 83  ? 35.293 61.703 8.740   1.00 54.33  ? 83  TRP A CZ2 1 
ATOM   656  C CZ3 . TRP A 1 83  ? 33.351 61.783 7.287   1.00 53.93  ? 83  TRP A CZ3 1 
ATOM   657  C CH2 . TRP A 1 83  ? 34.135 61.138 8.262   1.00 54.49  ? 83  TRP A CH2 1 
ATOM   658  N N   . ASN A 1 84  ? 35.785 67.118 2.813   1.00 56.61  ? 84  ASN A N   1 
ATOM   659  C CA  . ASN A 1 84  ? 35.360 68.124 1.849   1.00 57.05  ? 84  ASN A CA  1 
ATOM   660  C C   . ASN A 1 84  ? 34.954 67.479 0.518   1.00 57.14  ? 84  ASN A C   1 
ATOM   661  O O   . ASN A 1 84  ? 35.273 66.316 0.259   1.00 56.46  ? 84  ASN A O   1 
ATOM   662  C CB  . ASN A 1 84  ? 36.484 69.144 1.635   1.00 57.28  ? 84  ASN A CB  1 
ATOM   663  C CG  . ASN A 1 84  ? 36.552 70.186 2.743   1.00 57.78  ? 84  ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 84  ? 35.605 70.937 2.959   1.00 57.49  ? 84  ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 84  ? 37.677 70.238 3.445   1.00 59.35  ? 84  ASN A ND2 1 
ATOM   666  N N   . PRO A 1 85  ? 34.223 68.221 -0.334  1.00 57.49  ? 85  PRO A N   1 
ATOM   667  C CA  . PRO A 1 85  ? 33.790 67.691 -1.629  1.00 58.86  ? 85  PRO A CA  1 
ATOM   668  C C   . PRO A 1 85  ? 34.853 66.907 -2.394  1.00 59.54  ? 85  PRO A C   1 
ATOM   669  O O   . PRO A 1 85  ? 35.978 67.368 -2.586  1.00 59.01  ? 85  PRO A O   1 
ATOM   670  C CB  . PRO A 1 85  ? 33.328 68.942 -2.364  1.00 58.28  ? 85  PRO A CB  1 
ATOM   671  C CG  . PRO A 1 85  ? 32.643 69.688 -1.264  1.00 57.46  ? 85  PRO A CG  1 
ATOM   672  C CD  . PRO A 1 85  ? 33.628 69.552 -0.103  1.00 57.61  ? 85  PRO A CD  1 
ATOM   673  N N   . ASN A 1 86  ? 34.470 65.708 -2.819  1.00 60.52  ? 86  ASN A N   1 
ATOM   674  C CA  . ASN A 1 86  ? 35.347 64.820 -3.566  1.00 60.67  ? 86  ASN A CA  1 
ATOM   675  C C   . ASN A 1 86  ? 35.266 65.167 -5.028  1.00 60.36  ? 86  ASN A C   1 
ATOM   676  O O   . ASN A 1 86  ? 36.268 65.168 -5.733  1.00 60.20  ? 86  ASN A O   1 
ATOM   677  C CB  . ASN A 1 86  ? 34.893 63.380 -3.411  1.00 61.59  ? 86  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 86  ? 36.003 62.475 -2.994  1.00 63.77  ? 86  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 86  ? 35.958 61.278 -3.253  1.00 66.76  ? 86  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 86  ? 37.014 63.034 -2.327  1.00 64.87  ? 86  ASN A ND2 1 
ATOM   681  N N   . THR A 1 87  ? 34.045 65.445 -5.471  1.00 60.39  ? 87  THR A N   1 
ATOM   682  C CA  . THR A 1 87  ? 33.765 65.779 -6.856  1.00 59.89  ? 87  THR A CA  1 
ATOM   683  C C   . THR A 1 87  ? 33.448 67.264 -7.020  1.00 60.08  ? 87  THR A C   1 
ATOM   684  O O   . THR A 1 87  ? 33.460 68.026 -6.053  1.00 60.64  ? 87  THR A O   1 
ATOM   685  C CB  . THR A 1 87  ? 32.563 64.971 -7.369  1.00 59.71  ? 87  THR A CB  1 
ATOM   686  O OG1 . THR A 1 87  ? 32.523 63.701 -6.708  1.00 58.20  ? 87  THR A OG1 1 
ATOM   687  C CG2 . THR A 1 87  ? 32.681 64.751 -8.872  1.00 62.23  ? 87  THR A CG2 1 
ATOM   688  N N   . ASN A 1 88  ? 33.165 67.667 -8.254  1.00 60.20  ? 88  ASN A N   1 
ATOM   689  C CA  . ASN A 1 88  ? 32.838 69.052 -8.540  1.00 60.31  ? 88  ASN A CA  1 
ATOM   690  C C   . ASN A 1 88  ? 31.493 69.356 -7.914  1.00 59.89  ? 88  ASN A C   1 
ATOM   691  O O   . ASN A 1 88  ? 30.601 68.503 -7.903  1.00 60.04  ? 88  ASN A O   1 
ATOM   692  C CB  . ASN A 1 88  ? 32.759 69.287 -10.051 1.00 63.13  ? 88  ASN A CB  1 
ATOM   693  C CG  . ASN A 1 88  ? 34.082 69.054 -10.752 1.00 66.00  ? 88  ASN A CG  1 
ATOM   694  O OD1 . ASN A 1 88  ? 35.104 69.639 -10.386 1.00 66.98  ? 88  ASN A OD1 1 
ATOM   695  N ND2 . ASN A 1 88  ? 34.071 68.199 -11.772 1.00 67.98  ? 88  ASN A ND2 1 
ATOM   696  N N   . VAL A 1 89  ? 31.348 70.569 -7.389  1.00 58.46  ? 89  VAL A N   1 
ATOM   697  C CA  . VAL A 1 89  ? 30.100 70.981 -6.767  1.00 55.87  ? 89  VAL A CA  1 
ATOM   698  C C   . VAL A 1 89  ? 29.222 71.640 -7.818  1.00 56.26  ? 89  VAL A C   1 
ATOM   699  O O   . VAL A 1 89  ? 29.700 72.472 -8.579  1.00 59.22  ? 89  VAL A O   1 
ATOM   700  C CB  . VAL A 1 89  ? 30.353 71.991 -5.639  1.00 53.44  ? 89  VAL A CB  1 
ATOM   701  C CG1 . VAL A 1 89  ? 31.407 71.455 -4.694  1.00 52.81  ? 89  VAL A CG1 1 
ATOM   702  C CG2 . VAL A 1 89  ? 30.793 73.312 -6.217  1.00 52.22  ? 89  VAL A CG2 1 
ATOM   703  N N   . SER A 1 90  ? 27.950 71.260 -7.876  1.00 55.24  ? 90  SER A N   1 
ATOM   704  C CA  . SER A 1 90  ? 27.013 71.857 -8.831  1.00 53.10  ? 90  SER A CA  1 
ATOM   705  C C   . SER A 1 90  ? 25.598 71.598 -8.332  1.00 51.67  ? 90  SER A C   1 
ATOM   706  O O   . SER A 1 90  ? 25.360 70.608 -7.637  1.00 49.58  ? 90  SER A O   1 
ATOM   707  C CB  . SER A 1 90  ? 27.188 71.250 -10.226 1.00 52.60  ? 90  SER A CB  1 
ATOM   708  O OG  . SER A 1 90  ? 26.338 70.132 -10.412 1.00 53.76  ? 90  SER A OG  1 
ATOM   709  N N   . GLU A 1 91  ? 24.660 72.478 -8.669  1.00 49.51  ? 91  GLU A N   1 
ATOM   710  C CA  . GLU A 1 91  ? 23.299 72.267 -8.209  1.00 49.02  ? 91  GLU A CA  1 
ATOM   711  C C   . GLU A 1 91  ? 22.770 70.965 -8.762  1.00 49.35  ? 91  GLU A C   1 
ATOM   712  O O   . GLU A 1 91  ? 21.875 70.352 -8.177  1.00 50.56  ? 91  GLU A O   1 
ATOM   713  C CB  . GLU A 1 91  ? 22.387 73.407 -8.621  1.00 47.74  ? 91  GLU A CB  1 
ATOM   714  C CG  . GLU A 1 91  ? 22.669 74.674 -7.884  1.00 48.78  ? 91  GLU A CG  1 
ATOM   715  C CD  . GLU A 1 91  ? 21.468 75.579 -7.856  1.00 51.26  ? 91  GLU A CD  1 
ATOM   716  O OE1 . GLU A 1 91  ? 20.518 75.281 -7.100  1.00 51.30  ? 91  GLU A OE1 1 
ATOM   717  O OE2 . GLU A 1 91  ? 21.470 76.579 -8.603  1.00 53.98  ? 91  GLU A OE2 1 
ATOM   718  N N   . ASP A 1 92  ? 23.319 70.546 -9.896  1.00 47.87  ? 92  ASP A N   1 
ATOM   719  C CA  . ASP A 1 92  ? 22.909 69.289 -10.501 1.00 46.04  ? 92  ASP A CA  1 
ATOM   720  C C   . ASP A 1 92  ? 23.694 68.236 -9.742  1.00 44.58  ? 92  ASP A C   1 
ATOM   721  O O   . ASP A 1 92  ? 24.842 67.946 -10.093 1.00 44.67  ? 92  ASP A O   1 
ATOM   722  C CB  . ASP A 1 92  ? 23.300 69.248 -11.975 1.00 46.99  ? 92  ASP A CB  1 
ATOM   723  C CG  . ASP A 1 92  ? 22.612 68.125 -12.724 1.00 47.01  ? 92  ASP A CG  1 
ATOM   724  O OD1 . ASP A 1 92  ? 22.353 67.068 -12.106 1.00 45.65  ? 92  ASP A OD1 1 
ATOM   725  O OD2 . ASP A 1 92  ? 22.339 68.301 -13.931 1.00 47.87  ? 92  ASP A OD2 1 
ATOM   726  N N   . CYS A 1 93  ? 23.082 67.664 -8.707  1.00 42.64  ? 93  CYS A N   1 
ATOM   727  C CA  . CYS A 1 93  ? 23.771 66.675 -7.882  1.00 40.74  ? 93  CYS A CA  1 
ATOM   728  C C   . CYS A 1 93  ? 22.921 65.489 -7.432  1.00 39.25  ? 93  CYS A C   1 
ATOM   729  O O   . CYS A 1 93  ? 23.435 64.555 -6.807  1.00 38.10  ? 93  CYS A O   1 
ATOM   730  C CB  . CYS A 1 93  ? 24.343 67.377 -6.653  1.00 40.21  ? 93  CYS A CB  1 
ATOM   731  S SG  . CYS A 1 93  ? 23.044 68.173 -5.660  1.00 41.27  ? 93  CYS A SG  1 
ATOM   732  N N   . LEU A 1 94  ? 21.635 65.508 -7.759  1.00 37.99  ? 94  LEU A N   1 
ATOM   733  C CA  . LEU A 1 94  ? 20.741 64.433 -7.346  1.00 38.47  ? 94  LEU A CA  1 
ATOM   734  C C   . LEU A 1 94  ? 20.967 63.065 -8.008  1.00 39.60  ? 94  LEU A C   1 
ATOM   735  O O   . LEU A 1 94  ? 20.222 62.661 -8.905  1.00 40.00  ? 94  LEU A O   1 
ATOM   736  C CB  . LEU A 1 94  ? 19.294 64.897 -7.532  1.00 36.92  ? 94  LEU A CB  1 
ATOM   737  C CG  . LEU A 1 94  ? 19.078 66.238 -6.816  1.00 35.37  ? 94  LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 94  ? 17.611 66.600 -6.821  1.00 34.83  ? 94  LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 94  ? 19.583 66.147 -5.391  1.00 33.27  ? 94  LEU A CD2 1 
ATOM   740  N N   . TYR A 1 95  ? 21.988 62.314 -7.509  1.00 41.15  ? 95  TYR A N   1 
ATOM   741  C CA  . TYR A 1 95  ? 22.326 61.023 -8.125  1.00 41.42  ? 95  TYR A CA  1 
ATOM   742  C C   . TYR A 1 95  ? 22.467 59.948 -7.044  1.00 41.11  ? 95  TYR A C   1 
ATOM   743  O O   . TYR A 1 95  ? 22.932 60.158 -5.944  1.00 40.95  ? 95  TYR A O   1 
ATOM   744  C CB  . TYR A 1 95  ? 23.645 61.135 -8.885  1.00 39.48  ? 95  TYR A CB  1 
ATOM   745  C CG  . TYR A 1 95  ? 23.592 62.185 -9.990  1.00 41.11  ? 95  TYR A CG  1 
ATOM   746  C CD1 . TYR A 1 95  ? 23.943 63.509 -9.707  1.00 41.03  ? 95  TYR A CD1 1 
ATOM   747  C CD2 . TYR A 1 95  ? 23.191 61.821 -11.279 1.00 41.78  ? 95  TYR A CD2 1 
ATOM   748  C CE1 . TYR A 1 95  ? 23.891 64.474 -10.717 1.00 41.88  ? 95  TYR A CE1 1 
ATOM   749  C CE2 . TYR A 1 95  ? 23.139 62.787 -12.289 1.00 41.18  ? 95  TYR A CE2 1 
ATOM   750  C CZ  . TYR A 1 95  ? 23.488 64.114 -12.008 1.00 42.64  ? 95  TYR A CZ  1 
ATOM   751  O OH  . TYR A 1 95  ? 23.436 65.052 -12.989 1.00 45.50  ? 95  TYR A OH  1 
ATOM   752  N N   . ILE A 1 96  ? 22.110 58.702 -7.461  1.00 41.62  ? 96  ILE A N   1 
ATOM   753  C CA  . ILE A 1 96  ? 22.196 57.539 -6.592  1.00 42.71  ? 96  ILE A CA  1 
ATOM   754  C C   . ILE A 1 96  ? 23.402 56.664 -6.887  1.00 43.49  ? 96  ILE A C   1 
ATOM   755  O O   . ILE A 1 96  ? 23.974 56.713 -7.974  1.00 43.51  ? 96  ILE A O   1 
ATOM   756  C CB  . ILE A 1 96  ? 20.921 56.670 -6.694  1.00 42.60  ? 96  ILE A CB  1 
ATOM   757  C CG1 . ILE A 1 96  ? 19.839 57.245 -5.781  1.00 44.50  ? 96  ILE A CG1 1 
ATOM   758  C CG2 . ILE A 1 96  ? 21.219 55.226 -6.303  1.00 42.71  ? 96  ILE A CG2 1 
ATOM   759  C CD1 . ILE A 1 96  ? 18.583 56.383 -5.671  1.00 46.94  ? 96  ILE A CD1 1 
ATOM   760  N N   . ASN A 1 97  ? 23.787 55.877 -5.888  1.00 44.80  ? 97  ASN A N   1 
ATOM   761  C CA  . ASN A 1 97  ? 24.895 54.946 -5.999  1.00 45.35  ? 97  ASN A CA  1 
ATOM   762  C C   . ASN A 1 97  ? 24.407 53.612 -5.444  1.00 46.97  ? 97  ASN A C   1 
ATOM   763  O O   . ASN A 1 97  ? 23.791 53.559 -4.378  1.00 45.85  ? 97  ASN A O   1 
ATOM   764  C CB  . ASN A 1 97  ? 26.094 55.420 -5.181  1.00 45.64  ? 97  ASN A CB  1 
ATOM   765  C CG  . ASN A 1 97  ? 26.476 56.841 -5.487  1.00 46.88  ? 97  ASN A CG  1 
ATOM   766  O OD1 . ASN A 1 97  ? 26.239 57.751 -4.689  1.00 49.44  ? 97  ASN A OD1 1 
ATOM   767  N ND2 . ASN A 1 97  ? 27.064 57.049 -6.653  1.00 48.03  ? 97  ASN A ND2 1 
ATOM   768  N N   . VAL A 1 98  ? 24.667 52.538 -6.178  1.00 47.41  ? 98  VAL A N   1 
ATOM   769  C CA  . VAL A 1 98  ? 24.273 51.214 -5.733  1.00 47.04  ? 98  VAL A CA  1 
ATOM   770  C C   . VAL A 1 98  ? 25.492 50.309 -5.798  1.00 48.53  ? 98  VAL A C   1 
ATOM   771  O O   . VAL A 1 98  ? 26.276 50.383 -6.742  1.00 47.59  ? 98  VAL A O   1 
ATOM   772  C CB  . VAL A 1 98  ? 23.175 50.630 -6.628  1.00 45.97  ? 98  VAL A CB  1 
ATOM   773  C CG1 . VAL A 1 98  ? 22.713 49.268 -6.078  1.00 44.62  ? 98  VAL A CG1 1 
ATOM   774  C CG2 . VAL A 1 98  ? 22.027 51.613 -6.722  1.00 43.69  ? 98  VAL A CG2 1 
ATOM   775  N N   . TRP A 1 99  ? 25.659 49.476 -4.775  1.00 49.91  ? 99  TRP A N   1 
ATOM   776  C CA  . TRP A 1 99  ? 26.766 48.521 -4.696  1.00 49.39  ? 99  TRP A CA  1 
ATOM   777  C C   . TRP A 1 99  ? 26.088 47.176 -4.609  1.00 50.38  ? 99  TRP A C   1 
ATOM   778  O O   . TRP A 1 99  ? 25.592 46.798 -3.552  1.00 51.08  ? 99  TRP A O   1 
ATOM   779  C CB  . TRP A 1 99  ? 27.603 48.743 -3.433  1.00 47.60  ? 99  TRP A CB  1 
ATOM   780  C CG  . TRP A 1 99  ? 28.585 49.869 -3.520  1.00 47.49  ? 99  TRP A CG  1 
ATOM   781  C CD1 . TRP A 1 99  ? 29.890 49.788 -3.905  1.00 47.15  ? 99  TRP A CD1 1 
ATOM   782  C CD2 . TRP A 1 99  ? 28.342 51.248 -3.214  1.00 47.66  ? 99  TRP A CD2 1 
ATOM   783  N NE1 . TRP A 1 99  ? 30.479 51.030 -3.855  1.00 46.73  ? 99  TRP A NE1 1 
ATOM   784  C CE2 . TRP A 1 99  ? 29.549 51.944 -3.434  1.00 46.94  ? 99  TRP A CE2 1 
ATOM   785  C CE3 . TRP A 1 99  ? 27.222 51.963 -2.775  1.00 47.93  ? 99  TRP A CE3 1 
ATOM   786  C CZ2 . TRP A 1 99  ? 29.668 53.320 -3.230  1.00 48.17  ? 99  TRP A CZ2 1 
ATOM   787  C CZ3 . TRP A 1 99  ? 27.339 53.332 -2.571  1.00 48.82  ? 99  TRP A CZ3 1 
ATOM   788  C CH2 . TRP A 1 99  ? 28.554 53.995 -2.799  1.00 49.34  ? 99  TRP A CH2 1 
ATOM   789  N N   . ALA A 1 100 ? 26.043 46.460 -5.725  1.00 52.62  ? 100 ALA A N   1 
ATOM   790  C CA  . ALA A 1 100 ? 25.395 45.164 -5.740  1.00 54.59  ? 100 ALA A CA  1 
ATOM   791  C C   . ALA A 1 100 ? 26.372 44.020 -5.924  1.00 56.03  ? 100 ALA A C   1 
ATOM   792  O O   . ALA A 1 100 ? 27.254 44.067 -6.781  1.00 56.03  ? 100 ALA A O   1 
ATOM   793  C CB  . ALA A 1 100 ? 24.339 45.125 -6.834  1.00 53.99  ? 100 ALA A CB  1 
ATOM   794  N N   . PRO A 1 101 ? 26.242 42.980 -5.092  1.00 57.98  ? 101 PRO A N   1 
ATOM   795  C CA  . PRO A 1 101 ? 27.124 41.815 -5.188  1.00 59.80  ? 101 PRO A CA  1 
ATOM   796  C C   . PRO A 1 101 ? 26.683 41.025 -6.428  1.00 60.32  ? 101 PRO A C   1 
ATOM   797  O O   . PRO A 1 101 ? 25.497 41.024 -6.770  1.00 61.03  ? 101 PRO A O   1 
ATOM   798  C CB  . PRO A 1 101 ? 26.839 41.055 -3.886  1.00 60.02  ? 101 PRO A CB  1 
ATOM   799  C CG  . PRO A 1 101 ? 26.336 42.127 -2.947  1.00 59.69  ? 101 PRO A CG  1 
ATOM   800  C CD  . PRO A 1 101 ? 25.448 42.933 -3.852  1.00 59.03  ? 101 PRO A CD  1 
ATOM   801  N N   . ALA A 1 102 ? 27.619 40.364 -7.101  1.00 59.92  ? 102 ALA A N   1 
ATOM   802  C CA  . ALA A 1 102 ? 27.278 39.597 -8.289  1.00 59.96  ? 102 ALA A CA  1 
ATOM   803  C C   . ALA A 1 102 ? 27.323 38.110 -7.982  1.00 61.05  ? 102 ALA A C   1 
ATOM   804  O O   . ALA A 1 102 ? 28.247 37.739 -7.226  1.00 62.11  ? 102 ALA A O   1 
ATOM   805  C CB  . ALA A 1 102 ? 28.241 39.934 -9.410  1.00 60.65  ? 102 ALA A CB  1 
ATOM   806  N N   . ASN A 1 136 ? 12.457 39.555 4.602   0.80 99.04  ? 136 ASN A N   1 
ATOM   807  C CA  . ASN A 1 136 ? 12.718 38.097 4.763   0.80 99.00  ? 136 ASN A CA  1 
ATOM   808  C C   . ASN A 1 136 ? 14.088 37.708 4.236   0.80 98.51  ? 136 ASN A C   1 
ATOM   809  O O   . ASN A 1 136 ? 14.877 38.565 3.844   0.80 98.55  ? 136 ASN A O   1 
ATOM   810  C CB  . ASN A 1 136 ? 11.638 37.290 4.047   0.80 99.60  ? 136 ASN A CB  1 
ATOM   811  C CG  . ASN A 1 136 ? 10.878 38.113 3.034   0.80 100.00 ? 136 ASN A CG  1 
ATOM   812  O OD1 . ASN A 1 136 ? 11.433 38.550 2.025   0.80 99.99  ? 136 ASN A OD1 1 
ATOM   813  N ND2 . ASN A 1 136 ? 9.599  38.340 3.304   0.80 100.00 ? 136 ASN A ND2 1 
ATOM   814  N N   . THR A 1 137 ? 14.362 36.408 4.224   0.80 97.78  ? 137 THR A N   1 
ATOM   815  C CA  . THR A 1 137 ? 15.649 35.898 3.766   0.80 96.77  ? 137 THR A CA  1 
ATOM   816  C C   . THR A 1 137 ? 15.498 34.882 2.635   0.80 94.94  ? 137 THR A C   1 
ATOM   817  O O   . THR A 1 137 ? 15.682 33.686 2.840   0.80 94.96  ? 137 THR A O   1 
ATOM   818  C CB  . THR A 1 137 ? 16.415 35.233 4.937   0.80 97.57  ? 137 THR A CB  1 
ATOM   819  O OG1 . THR A 1 137 ? 15.607 34.196 5.509   0.80 98.79  ? 137 THR A OG1 1 
ATOM   820  C CG2 . THR A 1 137 ? 16.729 36.253 6.024   0.80 97.74  ? 137 THR A CG2 1 
ATOM   821  N N   . THR A 1 138 ? 15.170 35.357 1.439   0.80 93.24  ? 138 THR A N   1 
ATOM   822  C CA  . THR A 1 138 ? 14.998 34.458 0.304   0.80 91.09  ? 138 THR A CA  1 
ATOM   823  C C   . THR A 1 138 ? 15.048 35.189 -1.035  0.80 89.99  ? 138 THR A C   1 
ATOM   824  O O   . THR A 1 138 ? 16.014 35.052 -1.782  0.80 90.18  ? 138 THR A O   1 
ATOM   825  C CB  . THR A 1 138 ? 13.650 33.711 0.383   0.80 90.71  ? 138 THR A CB  1 
ATOM   826  O OG1 . THR A 1 138 ? 13.489 33.139 1.685   0.80 90.17  ? 138 THR A OG1 1 
ATOM   827  C CG2 . THR A 1 138 ? 13.599 32.605 -0.656  0.80 89.82  ? 138 THR A CG2 1 
ATOM   828  N N   . ASN A 1 139 ? 13.997 35.960 -1.321  1.00 88.01  ? 139 ASN A N   1 
ATOM   829  C CA  . ASN A 1 139 ? 13.860 36.714 -2.570  1.00 84.90  ? 139 ASN A CA  1 
ATOM   830  C C   . ASN A 1 139 ? 15.119 37.460 -2.954  1.00 82.35  ? 139 ASN A C   1 
ATOM   831  O O   . ASN A 1 139 ? 15.988 36.930 -3.640  1.00 83.96  ? 139 ASN A O   1 
ATOM   832  C CB  . ASN A 1 139 ? 12.718 37.721 -2.462  1.00 85.80  ? 139 ASN A CB  1 
ATOM   833  C CG  . ASN A 1 139 ? 11.514 37.151 -1.754  1.00 88.12  ? 139 ASN A CG  1 
ATOM   834  O OD1 . ASN A 1 139 ? 11.577 36.810 -0.569  1.00 89.41  ? 139 ASN A OD1 1 
ATOM   835  N ND2 . ASN A 1 139 ? 10.406 37.037 -2.475  1.00 89.77  ? 139 ASN A ND2 1 
ATOM   836  N N   . GLY A 1 140 ? 15.210 38.707 -2.519  1.00 78.72  ? 140 GLY A N   1 
ATOM   837  C CA  . GLY A 1 140 ? 16.379 39.494 -2.840  1.00 73.30  ? 140 GLY A CA  1 
ATOM   838  C C   . GLY A 1 140 ? 17.340 39.598 -1.676  1.00 69.19  ? 140 GLY A C   1 
ATOM   839  O O   . GLY A 1 140 ? 17.150 38.963 -0.634  1.00 68.89  ? 140 GLY A O   1 
ATOM   840  N N   . LEU A 1 141 ? 18.381 40.401 -1.866  1.00 64.46  ? 141 LEU A N   1 
ATOM   841  C CA  . LEU A 1 141 ? 19.382 40.617 -0.837  1.00 60.15  ? 141 LEU A CA  1 
ATOM   842  C C   . LEU A 1 141 ? 18.983 41.806 0.036   1.00 57.68  ? 141 LEU A C   1 
ATOM   843  O O   . LEU A 1 141 ? 18.110 42.595 -0.324  1.00 57.73  ? 141 LEU A O   1 
ATOM   844  C CB  . LEU A 1 141 ? 20.750 40.891 -1.473  1.00 58.17  ? 141 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 141 ? 21.536 39.727 -2.079  1.00 56.80  ? 141 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 141 ? 22.908 40.215 -2.501  1.00 56.36  ? 141 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 141 ? 21.686 38.613 -1.066  1.00 57.54  ? 141 LEU A CD2 1 
ATOM   848  N N   . PRO A 1 142 ? 19.602 41.931 1.215   1.00 54.02  ? 142 PRO A N   1 
ATOM   849  C CA  . PRO A 1 142 ? 19.276 43.053 2.094   1.00 51.89  ? 142 PRO A CA  1 
ATOM   850  C C   . PRO A 1 142 ? 19.767 44.349 1.441   1.00 48.96  ? 142 PRO A C   1 
ATOM   851  O O   . PRO A 1 142 ? 20.791 44.357 0.749   1.00 47.48  ? 142 PRO A O   1 
ATOM   852  C CB  . PRO A 1 142 ? 20.057 42.726 3.366   1.00 53.72  ? 142 PRO A CB  1 
ATOM   853  C CG  . PRO A 1 142 ? 20.154 41.224 3.339   1.00 52.00  ? 142 PRO A CG  1 
ATOM   854  C CD  . PRO A 1 142 ? 20.460 40.953 1.901   1.00 52.18  ? 142 PRO A CD  1 
ATOM   855  N N   . ILE A 1 143 ? 19.043 45.441 1.656   1.00 45.73  ? 143 ILE A N   1 
ATOM   856  C CA  . ILE A 1 143 ? 19.443 46.718 1.078   1.00 42.40  ? 143 ILE A CA  1 
ATOM   857  C C   . ILE A 1 143 ? 19.683 47.735 2.169   1.00 40.08  ? 143 ILE A C   1 
ATOM   858  O O   . ILE A 1 143 ? 18.764 48.072 2.910   1.00 40.90  ? 143 ILE A O   1 
ATOM   859  C CB  . ILE A 1 143 ? 18.356 47.306 0.147   1.00 42.23  ? 143 ILE A CB  1 
ATOM   860  C CG1 . ILE A 1 143 ? 17.844 46.235 -0.817  1.00 42.46  ? 143 ILE A CG1 1 
ATOM   861  C CG2 . ILE A 1 143 ? 18.929 48.481 -0.631  1.00 40.30  ? 143 ILE A CG2 1 
ATOM   862  C CD1 . ILE A 1 143 ? 16.728 46.706 -1.723  1.00 43.75  ? 143 ILE A CD1 1 
ATOM   863  N N   . LEU A 1 144 ? 20.917 48.211 2.284   1.00 38.43  ? 144 LEU A N   1 
ATOM   864  C CA  . LEU A 1 144 ? 21.238 49.234 3.269   1.00 36.11  ? 144 LEU A CA  1 
ATOM   865  C C   . LEU A 1 144 ? 21.499 50.523 2.509   1.00 35.88  ? 144 LEU A C   1 
ATOM   866  O O   . LEU A 1 144 ? 22.349 50.573 1.617   1.00 34.50  ? 144 LEU A O   1 
ATOM   867  C CB  . LEU A 1 144 ? 22.475 48.871 4.080   1.00 36.16  ? 144 LEU A CB  1 
ATOM   868  C CG  . LEU A 1 144 ? 22.359 47.665 4.999   1.00 36.62  ? 144 LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 144 ? 22.412 46.397 4.166   1.00 37.54  ? 144 LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 144 ? 23.494 47.687 5.997   1.00 36.54  ? 144 LEU A CD2 1 
ATOM   871  N N   . ILE A 1 145 ? 20.754 51.562 2.866   1.00 34.21  ? 145 ILE A N   1 
ATOM   872  C CA  . ILE A 1 145 ? 20.880 52.855 2.224   1.00 32.24  ? 145 ILE A CA  1 
ATOM   873  C C   . ILE A 1 145 ? 21.585 53.802 3.188   1.00 30.42  ? 145 ILE A C   1 
ATOM   874  O O   . ILE A 1 145 ? 21.206 53.909 4.352   1.00 28.57  ? 145 ILE A O   1 
ATOM   875  C CB  . ILE A 1 145 ? 19.479 53.417 1.880   1.00 34.09  ? 145 ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 145 ? 18.688 52.389 1.075   1.00 33.10  ? 145 ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 145 ? 19.601 54.703 1.080   1.00 33.93  ? 145 ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 145 ? 17.257 52.810 0.837   1.00 34.34  ? 145 ILE A CD1 1 
ATOM   879  N N   . TRP A 1 146 ? 22.602 54.503 2.695   1.00 30.44  ? 146 TRP A N   1 
ATOM   880  C CA  . TRP A 1 146 ? 23.366 55.441 3.522   1.00 28.88  ? 146 TRP A CA  1 
ATOM   881  C C   . TRP A 1 146 ? 23.135 56.926 3.251   1.00 29.12  ? 146 TRP A C   1 
ATOM   882  O O   . TRP A 1 146 ? 23.259 57.402 2.123   1.00 31.64  ? 146 TRP A O   1 
ATOM   883  C CB  . TRP A 1 146 ? 24.859 55.144 3.397   1.00 23.23  ? 146 TRP A CB  1 
ATOM   884  C CG  . TRP A 1 146 ? 25.753 56.212 3.943   1.00 20.44  ? 146 TRP A CG  1 
ATOM   885  C CD1 . TRP A 1 146 ? 26.360 57.216 3.240   1.00 20.72  ? 146 TRP A CD1 1 
ATOM   886  C CD2 . TRP A 1 146 ? 26.222 56.330 5.292   1.00 19.48  ? 146 TRP A CD2 1 
ATOM   887  N NE1 . TRP A 1 146 ? 27.191 57.943 4.060   1.00 18.86  ? 146 TRP A NE1 1 
ATOM   888  C CE2 . TRP A 1 146 ? 27.127 57.423 5.325   1.00 18.28  ? 146 TRP A CE2 1 
ATOM   889  C CE3 . TRP A 1 146 ? 25.967 55.616 6.476   1.00 18.49  ? 146 TRP A CE3 1 
ATOM   890  C CZ2 . TRP A 1 146 ? 27.785 57.818 6.498   1.00 17.87  ? 146 TRP A CZ2 1 
ATOM   891  C CZ3 . TRP A 1 146 ? 26.621 56.007 7.653   1.00 17.62  ? 146 TRP A CZ3 1 
ATOM   892  C CH2 . TRP A 1 146 ? 27.522 57.101 7.651   1.00 20.18  ? 146 TRP A CH2 1 
ATOM   893  N N   . ILE A 1 147 ? 22.803 57.658 4.306   1.00 27.84  ? 147 ILE A N   1 
ATOM   894  C CA  . ILE A 1 147 ? 22.601 59.090 4.195   1.00 25.65  ? 147 ILE A CA  1 
ATOM   895  C C   . ILE A 1 147 ? 23.771 59.786 4.901   1.00 25.54  ? 147 ILE A C   1 
ATOM   896  O O   . ILE A 1 147 ? 23.980 59.589 6.089   1.00 26.18  ? 147 ILE A O   1 
ATOM   897  C CB  . ILE A 1 147 ? 21.305 59.503 4.871   1.00 24.31  ? 147 ILE A CB  1 
ATOM   898  C CG1 . ILE A 1 147 ? 20.145 58.691 4.292   1.00 20.56  ? 147 ILE A CG1 1 
ATOM   899  C CG2 . ILE A 1 147 ? 21.102 60.993 4.707   1.00 21.77  ? 147 ILE A CG2 1 
ATOM   900  C CD1 . ILE A 1 147 ? 18.776 59.106 4.824   1.00 16.56  ? 147 ILE A CD1 1 
ATOM   901  N N   . TYR A 1 148 ? 24.537 60.590 4.173   1.00 25.59  ? 148 TYR A N   1 
ATOM   902  C CA  . TYR A 1 148 ? 25.680 61.281 4.769   1.00 25.18  ? 148 TYR A CA  1 
ATOM   903  C C   . TYR A 1 148 ? 25.284 62.457 5.620   1.00 25.49  ? 148 TYR A C   1 
ATOM   904  O O   . TYR A 1 148 ? 24.238 63.079 5.414   1.00 24.79  ? 148 TYR A O   1 
ATOM   905  C CB  . TYR A 1 148 ? 26.647 61.785 3.697   1.00 26.25  ? 148 TYR A CB  1 
ATOM   906  C CG  . TYR A 1 148 ? 26.022 62.741 2.717   1.00 25.36  ? 148 TYR A CG  1 
ATOM   907  C CD1 . TYR A 1 148 ? 25.802 64.066 3.051   1.00 25.86  ? 148 TYR A CD1 1 
ATOM   908  C CD2 . TYR A 1 148 ? 25.604 62.298 1.464   1.00 28.92  ? 148 TYR A CD2 1 
ATOM   909  C CE1 . TYR A 1 148 ? 25.174 64.931 2.159   1.00 27.85  ? 148 TYR A CE1 1 
ATOM   910  C CE2 . TYR A 1 148 ? 24.976 63.148 0.567   1.00 28.29  ? 148 TYR A CE2 1 
ATOM   911  C CZ  . TYR A 1 148 ? 24.760 64.460 0.917   1.00 27.65  ? 148 TYR A CZ  1 
ATOM   912  O OH  . TYR A 1 148 ? 24.097 65.284 0.034   1.00 29.38  ? 148 TYR A OH  1 
ATOM   913  N N   . GLY A 1 149 ? 26.151 62.759 6.575   1.00 26.03  ? 149 GLY A N   1 
ATOM   914  C CA  . GLY A 1 149 ? 25.920 63.879 7.459   1.00 26.13  ? 149 GLY A CA  1 
ATOM   915  C C   . GLY A 1 149 ? 26.738 65.079 7.019   1.00 26.34  ? 149 GLY A C   1 
ATOM   916  O O   . GLY A 1 149 ? 27.477 65.038 6.035   1.00 22.63  ? 149 GLY A O   1 
ATOM   917  N N   . GLY A 1 150 ? 26.598 66.160 7.769   1.00 29.04  ? 150 GLY A N   1 
ATOM   918  C CA  . GLY A 1 150 ? 27.310 67.380 7.457   1.00 30.71  ? 150 GLY A CA  1 
ATOM   919  C C   . GLY A 1 150 ? 26.475 68.552 7.909   1.00 30.07  ? 150 GLY A C   1 
ATOM   920  O O   . GLY A 1 150 ? 26.527 69.627 7.315   1.00 28.75  ? 150 GLY A O   1 
ATOM   921  N N   . GLY A 1 151 ? 25.687 68.318 8.955   1.00 30.16  ? 151 GLY A N   1 
ATOM   922  C CA  . GLY A 1 151 ? 24.840 69.351 9.525   1.00 32.54  ? 151 GLY A CA  1 
ATOM   923  C C   . GLY A 1 151 ? 23.872 70.011 8.570   1.00 34.20  ? 151 GLY A C   1 
ATOM   924  O O   . GLY A 1 151 ? 23.599 71.205 8.695   1.00 35.05  ? 151 GLY A O   1 
ATOM   925  N N   . PHE A 1 152 ? 23.153 69.732 7.886   1.00 36.38  ? 152 PHE A N   1 
ATOM   926  C CA  . PHE A 1 152 ? 22.479 69.631 6.583   1.00 36.16  ? 152 PHE A CA  1 
ATOM   927  C C   . PHE A 1 152 ? 23.174 70.535 5.560   1.00 37.17  ? 152 PHE A C   1 
ATOM   928  O O   . PHE A 1 152 ? 22.884 70.441 4.346   1.00 39.21  ? 152 PHE A O   1 
ATOM   929  C CB  . PHE A 1 152 ? 21.025 70.072 6.710   1.00 33.38  ? 152 PHE A CB  1 
ATOM   930  C CG  . PHE A 1 152 ? 20.202 69.077 7.514   1.00 31.62  ? 152 PHE A CG  1 
ATOM   931  C CD1 . PHE A 1 152 ? 20.114 69.219 8.901   1.00 29.02  ? 152 PHE A CD1 1 
ATOM   932  C CD2 . PHE A 1 152 ? 19.546 68.029 6.866   1.00 30.81  ? 152 PHE A CD2 1 
ATOM   933  C CE1 . PHE A 1 152 ? 19.374 68.301 9.648   1.00 27.16  ? 152 PHE A CE1 1 
ATOM   934  C CE2 . PHE A 1 152 ? 18.807 67.107 7.614   1.00 30.64  ? 152 PHE A CE2 1 
ATOM   935  C CZ  . PHE A 1 152 ? 18.722 67.242 9.006   1.00 29.87  ? 152 PHE A CZ  1 
ATOM   936  N N   . MET A 1 153 ? 24.157 71.354 5.934   1.00 36.36  ? 153 MET A N   1 
ATOM   937  C CA  . MET A 1 153 ? 24.802 72.319 5.033   1.00 37.00  ? 153 MET A CA  1 
ATOM   938  C C   . MET A 1 153 ? 26.039 71.688 4.384   1.00 36.54  ? 153 MET A C   1 
ATOM   939  O O   . MET A 1 153 ? 26.657 72.404 3.527   1.00 39.09  ? 153 MET A O   1 
ATOM   940  C CB  . MET A 1 153 ? 25.226 73.561 5.816   1.00 38.35  ? 153 MET A CB  1 
ATOM   941  C CG  . MET A 1 153 ? 24.044 74.262 6.481   1.00 38.00  ? 153 MET A CG  1 
ATOM   942  S SD  . MET A 1 153 ? 22.804 74.809 5.329   1.00 39.57  ? 153 MET A SD  1 
ATOM   943  C CE  . MET A 1 153 ? 22.253 76.445 5.769   1.00 39.14  ? 153 MET A CE  1 
ATOM   944  N N   . THR A 1 154 ? 26.443 70.477 4.757   1.00 37.77  ? 154 THR A N   1 
ATOM   945  C CA  . THR A 1 154 ? 27.623 69.880 4.113   1.00 36.96  ? 154 THR A CA  1 
ATOM   946  C C   . THR A 1 154 ? 27.375 68.385 3.931   1.00 36.55  ? 154 THR A C   1 
ATOM   947  O O   . THR A 1 154 ? 26.393 67.823 4.438   1.00 35.90  ? 154 THR A O   1 
ATOM   948  C CB  . THR A 1 154 ? 28.862 70.094 4.983   1.00 38.98  ? 154 THR A CB  1 
ATOM   949  O OG1 . THR A 1 154 ? 29.099 71.483 5.158   1.00 38.30  ? 154 THR A OG1 1 
ATOM   950  C CG2 . THR A 1 154 ? 30.129 69.487 4.378   1.00 38.24  ? 154 THR A CG2 1 
ATOM   951  N N   . GLY A 1 155 ? 28.359 67.726 3.035   1.00 36.86  ? 155 GLY A N   1 
ATOM   952  C CA  . GLY A 1 155 ? 28.358 66.283 2.958   1.00 36.81  ? 155 GLY A CA  1 
ATOM   953  C C   . GLY A 1 155 ? 28.187 65.805 1.539   1.00 36.89  ? 155 GLY A C   1 
ATOM   954  O O   . GLY A 1 155 ? 27.554 66.460 0.718   1.00 36.03  ? 155 GLY A O   1 
ATOM   955  N N   . SER A 1 156 ? 28.761 64.649 1.252   1.00 38.70  ? 156 SER A N   1 
ATOM   956  C CA  . SER A 1 156 ? 28.672 64.056 -0.069  1.00 41.56  ? 156 SER A CA  1 
ATOM   957  C C   . SER A 1 156 ? 28.770 62.544 0.069   1.00 42.88  ? 156 SER A C   1 
ATOM   958  O O   . SER A 1 156 ? 29.489 62.042 0.933   1.00 44.82  ? 156 SER A O   1 
ATOM   959  C CB  . SER A 1 156 ? 29.810 64.571 -0.950  1.00 43.35  ? 156 SER A CB  1 
ATOM   960  O OG  . SER A 1 156 ? 29.932 63.807 -2.139  1.00 47.12  ? 156 SER A OG  1 
ATOM   961  N N   . ALA A 1 157 ? 28.042 61.817 -0.768  1.00 42.67  ? 157 ALA A N   1 
ATOM   962  C CA  . ALA A 1 157 ? 28.095 60.361 -0.719  1.00 43.48  ? 157 ALA A CA  1 
ATOM   963  C C   . ALA A 1 157 ? 29.338 59.883 -1.472  1.00 44.36  ? 157 ALA A C   1 
ATOM   964  O O   . ALA A 1 157 ? 29.665 58.689 -1.450  1.00 45.67  ? 157 ALA A O   1 
ATOM   965  C CB  . ALA A 1 157 ? 26.832 59.759 -1.360  1.00 41.47  ? 157 ALA A CB  1 
ATOM   966  N N   . THR A 1 158 ? 30.033 60.815 -2.129  1.00 43.60  ? 158 THR A N   1 
ATOM   967  C CA  . THR A 1 158 ? 31.211 60.475 -2.925  1.00 42.78  ? 158 THR A CA  1 
ATOM   968  C C   . THR A 1 158 ? 32.464 60.239 -2.109  1.00 43.37  ? 158 THR A C   1 
ATOM   969  O O   . THR A 1 158 ? 33.368 59.533 -2.550  1.00 42.68  ? 158 THR A O   1 
ATOM   970  C CB  . THR A 1 158 ? 31.518 61.569 -3.997  1.00 42.34  ? 158 THR A CB  1 
ATOM   971  O OG1 . THR A 1 158 ? 31.951 62.785 -3.368  1.00 38.68  ? 158 THR A OG1 1 
ATOM   972  C CG2 . THR A 1 158 ? 30.274 61.848 -4.834  1.00 41.24  ? 158 THR A CG2 1 
ATOM   973  N N   . LEU A 1 159 ? 32.509 60.826 -0.918  1.00 44.69  ? 159 LEU A N   1 
ATOM   974  C CA  . LEU A 1 159 ? 33.666 60.702 -0.041  1.00 44.86  ? 159 LEU A CA  1 
ATOM   975  C C   . LEU A 1 159 ? 34.136 59.260 0.011   1.00 44.77  ? 159 LEU A C   1 
ATOM   976  O O   . LEU A 1 159 ? 33.323 58.344 0.053   1.00 45.17  ? 159 LEU A O   1 
ATOM   977  C CB  . LEU A 1 159 ? 33.313 61.199 1.364   1.00 45.60  ? 159 LEU A CB  1 
ATOM   978  C CG  . LEU A 1 159 ? 32.572 62.546 1.479   1.00 45.49  ? 159 LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 159 ? 32.555 62.963 2.942   1.00 44.19  ? 159 LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 159 ? 33.242 63.630 0.632   1.00 43.75  ? 159 LEU A CD2 1 
ATOM   981  N N   . ASP A 1 160 ? 35.448 59.061 -0.016  1.00 44.99  ? 160 ASP A N   1 
ATOM   982  C CA  . ASP A 1 160 ? 36.012 57.717 0.027   1.00 46.42  ? 160 ASP A CA  1 
ATOM   983  C C   . ASP A 1 160 ? 35.612 56.988 1.288   1.00 45.44  ? 160 ASP A C   1 
ATOM   984  O O   . ASP A 1 160 ? 35.467 55.764 1.296   1.00 46.11  ? 160 ASP A O   1 
ATOM   985  C CB  . ASP A 1 160 ? 37.536 57.768 -0.020  1.00 50.04  ? 160 ASP A CB  1 
ATOM   986  C CG  . ASP A 1 160 ? 38.053 58.242 -1.343  1.00 54.27  ? 160 ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 160 ? 37.839 59.426 -1.686  1.00 58.61  ? 160 ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 160 ? 38.674 57.423 -2.045  1.00 56.53  ? 160 ASP A OD2 1 
ATOM   989  N N   . ILE A 1 161 ? 35.448 57.755 2.358   1.00 43.53  ? 161 ILE A N   1 
ATOM   990  C CA  . ILE A 1 161 ? 35.089 57.210 3.651   1.00 42.48  ? 161 ILE A CA  1 
ATOM   991  C C   . ILE A 1 161 ? 33.721 56.513 3.629   1.00 41.83  ? 161 ILE A C   1 
ATOM   992  O O   . ILE A 1 161 ? 33.442 55.647 4.465   1.00 42.37  ? 161 ILE A O   1 
ATOM   993  C CB  . ILE A 1 161 ? 35.124 58.328 4.709   1.00 42.82  ? 161 ILE A CB  1 
ATOM   994  C CG1 . ILE A 1 161 ? 35.070 57.726 6.104   1.00 42.71  ? 161 ILE A CG1 1 
ATOM   995  C CG2 . ILE A 1 161 ? 34.013 59.316 4.449   1.00 45.35  ? 161 ILE A CG2 1 
ATOM   996  C CD1 . ILE A 1 161 ? 36.191 56.771 6.361   1.00 43.23  ? 161 ILE A CD1 1 
ATOM   997  N N   . TYR A 1 162 ? 32.885 56.878 2.657   1.00 40.77  ? 162 TYR A N   1 
ATOM   998  C CA  . TYR A 1 162 ? 31.558 56.278 2.492   1.00 39.31  ? 162 TYR A CA  1 
ATOM   999  C C   . TYR A 1 162 ? 31.564 55.180 1.431   1.00 40.41  ? 162 TYR A C   1 
ATOM   1000 O O   . TYR A 1 162 ? 30.519 54.633 1.077   1.00 40.34  ? 162 TYR A O   1 
ATOM   1001 C CB  . TYR A 1 162 ? 30.520 57.342 2.120   1.00 34.00  ? 162 TYR A CB  1 
ATOM   1002 C CG  . TYR A 1 162 ? 30.431 58.462 3.119   1.00 33.10  ? 162 TYR A CG  1 
ATOM   1003 C CD1 . TYR A 1 162 ? 30.905 58.300 4.429   1.00 33.82  ? 162 TYR A CD1 1 
ATOM   1004 C CD2 . TYR A 1 162 ? 29.876 59.686 2.772   1.00 32.38  ? 162 TYR A CD2 1 
ATOM   1005 C CE1 . TYR A 1 162 ? 30.832 59.332 5.364   1.00 30.82  ? 162 TYR A CE1 1 
ATOM   1006 C CE2 . TYR A 1 162 ? 29.795 60.724 3.697   1.00 31.42  ? 162 TYR A CE2 1 
ATOM   1007 C CZ  . TYR A 1 162 ? 30.277 60.539 4.988   1.00 32.21  ? 162 TYR A CZ  1 
ATOM   1008 O OH  . TYR A 1 162 ? 30.217 61.571 5.895   1.00 32.05  ? 162 TYR A OH  1 
ATOM   1009 N N   . ASN A 1 163 ? 32.747 54.858 0.922   1.00 41.88  ? 163 ASN A N   1 
ATOM   1010 C CA  . ASN A 1 163 ? 32.866 53.819 -0.079  1.00 41.91  ? 163 ASN A CA  1 
ATOM   1011 C C   . ASN A 1 163 ? 32.295 52.536 0.502   1.00 42.11  ? 163 ASN A C   1 
ATOM   1012 O O   . ASN A 1 163 ? 32.794 52.028 1.505   1.00 42.42  ? 163 ASN A O   1 
ATOM   1013 C CB  . ASN A 1 163 ? 34.329 53.623 -0.444  1.00 44.87  ? 163 ASN A CB  1 
ATOM   1014 C CG  . ASN A 1 163 ? 34.569 52.332 -1.191  1.00 47.87  ? 163 ASN A CG  1 
ATOM   1015 O OD1 . ASN A 1 163 ? 33.994 52.101 -2.259  1.00 47.10  ? 163 ASN A OD1 1 
ATOM   1016 N ND2 . ASN A 1 163 ? 35.420 51.470 -0.628  1.00 49.55  ? 163 ASN A ND2 1 
ATOM   1017 N N   . ALA A 1 164 ? 31.247 52.013 -0.126  1.00 41.85  ? 164 ALA A N   1 
ATOM   1018 C CA  . ALA A 1 164 ? 30.607 50.792 0.353   1.00 41.92  ? 164 ALA A CA  1 
ATOM   1019 C C   . ALA A 1 164 ? 31.073 49.503 -0.318  1.00 42.69  ? 164 ALA A C   1 
ATOM   1020 O O   . ALA A 1 164 ? 30.376 48.487 -0.230  1.00 42.63  ? 164 ALA A O   1 
ATOM   1021 C CB  . ALA A 1 164 ? 29.103 50.914 0.205   1.00 41.37  ? 164 ALA A CB  1 
ATOM   1022 N N   . ASP A 1 165 ? 32.224 49.524 -0.993  1.00 42.27  ? 165 ASP A N   1 
ATOM   1023 C CA  . ASP A 1 165 ? 32.712 48.307 -1.651  1.00 43.51  ? 165 ASP A CA  1 
ATOM   1024 C C   . ASP A 1 165 ? 32.796 47.176 -0.635  1.00 42.91  ? 165 ASP A C   1 
ATOM   1025 O O   . ASP A 1 165 ? 32.011 46.220 -0.682  1.00 42.32  ? 165 ASP A O   1 
ATOM   1026 C CB  . ASP A 1 165 ? 34.100 48.510 -2.265  1.00 46.47  ? 165 ASP A CB  1 
ATOM   1027 C CG  . ASP A 1 165 ? 34.063 49.241 -3.603  1.00 49.83  ? 165 ASP A CG  1 
ATOM   1028 O OD1 . ASP A 1 165 ? 32.956 49.483 -4.143  1.00 51.64  ? 165 ASP A OD1 1 
ATOM   1029 O OD2 . ASP A 1 165 ? 35.156 49.573 -4.116  1.00 49.58  ? 165 ASP A OD2 1 
ATOM   1030 N N   . ILE A 1 166 ? 33.747 47.297 0.287   1.00 40.77  ? 166 ILE A N   1 
ATOM   1031 C CA  . ILE A 1 166 ? 33.944 46.283 1.320   1.00 39.63  ? 166 ILE A CA  1 
ATOM   1032 C C   . ILE A 1 166 ? 32.649 45.809 1.975   1.00 39.47  ? 166 ILE A C   1 
ATOM   1033 O O   . ILE A 1 166 ? 32.424 44.604 2.087   1.00 39.47  ? 166 ILE A O   1 
ATOM   1034 C CB  . ILE A 1 166 ? 34.902 46.787 2.422   1.00 38.13  ? 166 ILE A CB  1 
ATOM   1035 C CG1 . ILE A 1 166 ? 36.309 46.910 1.842   1.00 37.33  ? 166 ILE A CG1 1 
ATOM   1036 C CG2 . ILE A 1 166 ? 34.876 45.844 3.630   1.00 35.68  ? 166 ILE A CG2 1 
ATOM   1037 C CD1 . ILE A 1 166 ? 37.298 47.572 2.755   1.00 36.77  ? 166 ILE A CD1 1 
ATOM   1038 N N   . MET A 1 167 ? 31.806 46.747 2.403   1.00 38.66  ? 167 MET A N   1 
ATOM   1039 C CA  . MET A 1 167 ? 30.553 46.390 3.054   1.00 38.22  ? 167 MET A CA  1 
ATOM   1040 C C   . MET A 1 167 ? 29.711 45.481 2.192   1.00 40.19  ? 167 MET A C   1 
ATOM   1041 O O   . MET A 1 167 ? 29.304 44.410 2.626   1.00 41.64  ? 167 MET A O   1 
ATOM   1042 C CB  . MET A 1 167 ? 29.740 47.639 3.396   1.00 39.33  ? 167 MET A CB  1 
ATOM   1043 C CG  . MET A 1 167 ? 28.343 47.331 3.949   1.00 38.09  ? 167 MET A CG  1 
ATOM   1044 S SD  . MET A 1 167 ? 27.418 48.795 4.468   1.00 35.47  ? 167 MET A SD  1 
ATOM   1045 C CE  . MET A 1 167 ? 28.057 49.013 6.114   1.00 34.19  ? 167 MET A CE  1 
ATOM   1046 N N   . ALA A 1 168 ? 29.444 45.915 0.966   1.00 42.92  ? 168 ALA A N   1 
ATOM   1047 C CA  . ALA A 1 168 ? 28.627 45.138 0.045   1.00 43.49  ? 168 ALA A CA  1 
ATOM   1048 C C   . ALA A 1 168 ? 29.212 43.752 -0.173  1.00 43.62  ? 168 ALA A C   1 
ATOM   1049 O O   . ALA A 1 168 ? 28.501 42.759 -0.111  1.00 44.18  ? 168 ALA A O   1 
ATOM   1050 C CB  . ALA A 1 168 ? 28.502 45.867 -1.283  1.00 41.65  ? 168 ALA A CB  1 
ATOM   1051 N N   . ALA A 1 169 ? 30.515 43.693 -0.413  1.00 44.63  ? 169 ALA A N   1 
ATOM   1052 C CA  . ALA A 1 169 ? 31.197 42.428 -0.661  1.00 45.41  ? 169 ALA A CA  1 
ATOM   1053 C C   . ALA A 1 169 ? 31.216 41.504 0.555   1.00 45.16  ? 169 ALA A C   1 
ATOM   1054 O O   . ALA A 1 169 ? 30.682 40.390 0.506   1.00 45.13  ? 169 ALA A O   1 
ATOM   1055 C CB  . ALA A 1 169 ? 32.627 42.698 -1.139  1.00 46.27  ? 169 ALA A CB  1 
ATOM   1056 N N   . VAL A 1 170 ? 31.836 41.972 1.638   1.00 44.26  ? 170 VAL A N   1 
ATOM   1057 C CA  . VAL A 1 170 ? 31.936 41.201 2.873   1.00 42.36  ? 170 VAL A CA  1 
ATOM   1058 C C   . VAL A 1 170 ? 30.581 40.850 3.472   1.00 42.61  ? 170 VAL A C   1 
ATOM   1059 O O   . VAL A 1 170 ? 30.347 39.711 3.874   1.00 41.38  ? 170 VAL A O   1 
ATOM   1060 C CB  . VAL A 1 170 ? 32.739 41.962 3.934   1.00 41.72  ? 170 VAL A CB  1 
ATOM   1061 C CG1 . VAL A 1 170 ? 32.730 41.190 5.232   1.00 41.57  ? 170 VAL A CG1 1 
ATOM   1062 C CG2 . VAL A 1 170 ? 34.160 42.174 3.458   1.00 41.77  ? 170 VAL A CG2 1 
ATOM   1063 N N   . GLY A 1 171 ? 29.696 41.840 3.541   1.00 43.85  ? 171 GLY A N   1 
ATOM   1064 C CA  . GLY A 1 171 ? 28.375 41.621 4.102   1.00 43.92  ? 171 GLY A CA  1 
ATOM   1065 C C   . GLY A 1 171 ? 27.466 40.917 3.121   1.00 44.50  ? 171 GLY A C   1 
ATOM   1066 O O   . GLY A 1 171 ? 26.543 40.186 3.509   1.00 43.84  ? 171 GLY A O   1 
ATOM   1067 N N   . ASN A 1 172 ? 27.746 41.133 1.840   1.00 44.36  ? 172 ASN A N   1 
ATOM   1068 C CA  . ASN A 1 172 ? 26.969 40.544 0.756   1.00 44.04  ? 172 ASN A CA  1 
ATOM   1069 C C   . ASN A 1 172 ? 25.560 41.085 0.813   1.00 43.64  ? 172 ASN A C   1 
ATOM   1070 O O   . ASN A 1 172 ? 24.583 40.345 0.954   1.00 42.97  ? 172 ASN A O   1 
ATOM   1071 C CB  . ASN A 1 172 ? 26.917 39.028 0.859   1.00 43.93  ? 172 ASN A CB  1 
ATOM   1072 C CG  . ASN A 1 172 ? 26.149 38.422 -0.274  1.00 44.19  ? 172 ASN A CG  1 
ATOM   1073 O OD1 . ASN A 1 172 ? 25.334 37.520 -0.080  1.00 45.87  ? 172 ASN A OD1 1 
ATOM   1074 N ND2 . ASN A 1 172 ? 26.395 38.923 -1.479  1.00 43.31  ? 172 ASN A ND2 1 
ATOM   1075 N N   . VAL A 1 173 ? 25.470 42.395 0.707   1.00 43.73  ? 173 VAL A N   1 
ATOM   1076 C CA  . VAL A 1 173 ? 24.196 43.062 0.755   1.00 43.85  ? 173 VAL A CA  1 
ATOM   1077 C C   . VAL A 1 173 ? 24.277 44.206 -0.213  1.00 43.43  ? 173 VAL A C   1 
ATOM   1078 O O   . VAL A 1 173 ? 25.367 44.657 -0.565  1.00 43.44  ? 173 VAL A O   1 
ATOM   1079 C CB  . VAL A 1 173 ? 23.926 43.646 2.146   1.00 44.77  ? 173 VAL A CB  1 
ATOM   1080 C CG1 . VAL A 1 173 ? 23.646 42.530 3.150   1.00 43.44  ? 173 VAL A CG1 1 
ATOM   1081 C CG2 . VAL A 1 173 ? 25.127 44.485 2.579   1.00 43.19  ? 173 VAL A CG2 1 
ATOM   1082 N N   . ILE A 1 174 ? 23.113 44.669 -0.638  1.00 42.66  ? 174 ILE A N   1 
ATOM   1083 C CA  . ILE A 1 174 ? 23.028 45.787 -1.548  1.00 41.43  ? 174 ILE A CA  1 
ATOM   1084 C C   . ILE A 1 174 ? 23.200 47.030 -0.687  1.00 41.35  ? 174 ILE A C   1 
ATOM   1085 O O   . ILE A 1 174 ? 22.490 47.189 0.306   1.00 42.31  ? 174 ILE A O   1 
ATOM   1086 C CB  . ILE A 1 174 ? 21.645 45.846 -2.203  1.00 41.14  ? 174 ILE A CB  1 
ATOM   1087 C CG1 . ILE A 1 174 ? 21.370 44.546 -2.956  1.00 40.62  ? 174 ILE A CG1 1 
ATOM   1088 C CG2 . ILE A 1 174 ? 21.560 47.045 -3.116  1.00 41.35  ? 174 ILE A CG2 1 
ATOM   1089 C CD1 . ILE A 1 174 ? 22.318 44.305 -4.088  1.00 42.02  ? 174 ILE A CD1 1 
ATOM   1090 N N   . VAL A 1 175 ? 24.156 47.888 -1.036  1.00 39.60  ? 175 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 175 ? 24.361 49.128 -0.293  1.00 37.77  ? 175 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 175 ? 24.212 50.292 -1.273  1.00 37.01  ? 175 VAL A C   1 
ATOM   1093 O O   . VAL A 1 175 ? 24.818 50.297 -2.341  1.00 38.41  ? 175 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 175 ? 25.764 49.224 0.339   1.00 37.34  ? 175 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 175 ? 25.828 50.461 1.218   1.00 37.15  ? 175 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 175 ? 26.078 47.991 1.150   1.00 36.03  ? 175 VAL A CG2 1 
ATOM   1097 N N   . ALA A 1 176 ? 23.407 51.279 -0.915  1.00 34.91  ? 176 ALA A N   1 
ATOM   1098 C CA  . ALA A 1 176 ? 23.209 52.416 -1.789  1.00 33.25  ? 176 ALA A CA  1 
ATOM   1099 C C   . ALA A 1 176 ? 23.357 53.716 -1.015  1.00 33.92  ? 176 ALA A C   1 
ATOM   1100 O O   . ALA A 1 176 ? 23.025 53.784 0.163   1.00 35.84  ? 176 ALA A O   1 
ATOM   1101 C CB  . ALA A 1 176 ? 21.837 52.336 -2.429  1.00 31.02  ? 176 ALA A CB  1 
ATOM   1102 N N   . SER A 1 177 ? 23.887 54.739 -1.677  1.00 35.35  ? 177 SER A N   1 
ATOM   1103 C CA  . SER A 1 177 ? 24.059 56.061 -1.077  1.00 35.75  ? 177 SER A CA  1 
ATOM   1104 C C   . SER A 1 177 ? 23.571 57.028 -2.141  1.00 34.28  ? 177 SER A C   1 
ATOM   1105 O O   . SER A 1 177 ? 23.310 56.617 -3.265  1.00 33.97  ? 177 SER A O   1 
ATOM   1106 C CB  . SER A 1 177 ? 25.529 56.342 -0.732  1.00 35.76  ? 177 SER A CB  1 
ATOM   1107 O OG  . SER A 1 177 ? 26.340 56.373 -1.892  1.00 40.03  ? 177 SER A OG  1 
ATOM   1108 N N   . PHE A 1 178 ? 23.449 58.307 -1.800  1.00 34.34  ? 178 PHE A N   1 
ATOM   1109 C CA  . PHE A 1 178 ? 22.949 59.288 -2.762  1.00 30.53  ? 178 PHE A CA  1 
ATOM   1110 C C   . PHE A 1 178 ? 23.118 60.711 -2.269  1.00 29.93  ? 178 PHE A C   1 
ATOM   1111 O O   . PHE A 1 178 ? 23.223 60.947 -1.070  1.00 33.72  ? 178 PHE A O   1 
ATOM   1112 C CB  . PHE A 1 178 ? 21.474 59.030 -2.997  1.00 26.88  ? 178 PHE A CB  1 
ATOM   1113 C CG  . PHE A 1 178 ? 20.644 59.174 -1.763  1.00 24.82  ? 178 PHE A CG  1 
ATOM   1114 C CD1 . PHE A 1 178 ? 20.374 60.433 -1.232  1.00 24.92  ? 178 PHE A CD1 1 
ATOM   1115 C CD2 . PHE A 1 178 ? 20.158 58.052 -1.107  1.00 23.89  ? 178 PHE A CD2 1 
ATOM   1116 C CE1 . PHE A 1 178 ? 19.636 60.573 -0.064  1.00 23.38  ? 178 PHE A CE1 1 
ATOM   1117 C CE2 . PHE A 1 178 ? 19.419 58.183 0.065   1.00 24.73  ? 178 PHE A CE2 1 
ATOM   1118 C CZ  . PHE A 1 178 ? 19.158 59.450 0.587   1.00 22.33  ? 178 PHE A CZ  1 
ATOM   1119 N N   . GLN A 1 179 ? 23.141 61.663 -3.191  1.00 29.57  ? 179 GLN A N   1 
ATOM   1120 C CA  . GLN A 1 179 ? 23.260 63.061 -2.805  1.00 30.18  ? 179 GLN A CA  1 
ATOM   1121 C C   . GLN A 1 179 ? 21.860 63.596 -2.552  1.00 29.87  ? 179 GLN A C   1 
ATOM   1122 O O   . GLN A 1 179 ? 20.901 63.193 -3.222  1.00 29.89  ? 179 GLN A O   1 
ATOM   1123 C CB  . GLN A 1 179 ? 23.876 63.904 -3.924  1.00 31.19  ? 179 GLN A CB  1 
ATOM   1124 C CG  . GLN A 1 179 ? 25.219 63.448 -4.425  1.00 31.91  ? 179 GLN A CG  1 
ATOM   1125 C CD  . GLN A 1 179 ? 26.289 63.551 -3.374  1.00 31.95  ? 179 GLN A CD  1 
ATOM   1126 O OE1 . GLN A 1 179 ? 27.470 63.372 -3.663  1.00 31.97  ? 179 GLN A OE1 1 
ATOM   1127 N NE2 . GLN A 1 179 ? 25.888 63.831 -2.144  1.00 34.49  ? 179 GLN A NE2 1 
ATOM   1128 N N   . TYR A 1 180 ? 21.740 64.482 -1.571  1.00 28.77  ? 180 TYR A N   1 
ATOM   1129 C CA  . TYR A 1 180 ? 20.471 65.127 -1.275  1.00 27.08  ? 180 TYR A CA  1 
ATOM   1130 C C   . TYR A 1 180 ? 20.851 66.576 -1.055  1.00 28.08  ? 180 TYR A C   1 
ATOM   1131 O O   . TYR A 1 180 ? 21.929 66.861 -0.534  1.00 28.61  ? 180 TYR A O   1 
ATOM   1132 C CB  . TYR A 1 180 ? 19.779 64.532 -0.035  1.00 24.86  ? 180 TYR A CB  1 
ATOM   1133 C CG  . TYR A 1 180 ? 20.494 64.702 1.282   1.00 22.20  ? 180 TYR A CG  1 
ATOM   1134 C CD1 . TYR A 1 180 ? 21.476 63.807 1.681   1.00 22.68  ? 180 TYR A CD1 1 
ATOM   1135 C CD2 . TYR A 1 180 ? 20.190 65.763 2.127   1.00 23.65  ? 180 TYR A CD2 1 
ATOM   1136 C CE1 . TYR A 1 180 ? 22.143 63.962 2.896   1.00 23.52  ? 180 TYR A CE1 1 
ATOM   1137 C CE2 . TYR A 1 180 ? 20.850 65.931 3.341   1.00 24.81  ? 180 TYR A CE2 1 
ATOM   1138 C CZ  . TYR A 1 180 ? 21.829 65.026 3.717   1.00 24.00  ? 180 TYR A CZ  1 
ATOM   1139 O OH  . TYR A 1 180 ? 22.515 65.201 4.893   1.00 24.30  ? 180 TYR A OH  1 
ATOM   1140 N N   . ARG A 1 181 ? 19.990 67.493 -1.479  1.00 28.98  ? 181 ARG A N   1 
ATOM   1141 C CA  . ARG A 1 181 ? 20.275 68.912 -1.332  1.00 30.75  ? 181 ARG A CA  1 
ATOM   1142 C C   . ARG A 1 181 ? 20.512 69.380 0.112   1.00 32.19  ? 181 ARG A C   1 
ATOM   1143 O O   . ARG A 1 181 ? 19.702 69.143 1.005   1.00 32.98  ? 181 ARG A O   1 
ATOM   1144 C CB  . ARG A 1 181 ? 19.153 69.728 -1.978  1.00 30.78  ? 181 ARG A CB  1 
ATOM   1145 C CG  . ARG A 1 181 ? 19.365 69.996 -3.460  1.00 32.08  ? 181 ARG A CG  1 
ATOM   1146 C CD  . ARG A 1 181 ? 18.158 70.658 -4.093  1.00 31.55  ? 181 ARG A CD  1 
ATOM   1147 N NE  . ARG A 1 181 ? 16.996 69.781 -4.039  1.00 37.20  ? 181 ARG A NE  1 
ATOM   1148 C CZ  . ARG A 1 181 ? 15.753 70.175 -4.295  1.00 39.03  ? 181 ARG A CZ  1 
ATOM   1149 N NH1 . ARG A 1 181 ? 15.526 71.444 -4.623  1.00 37.59  ? 181 ARG A NH1 1 
ATOM   1150 N NH2 . ARG A 1 181 ? 14.744 69.305 -4.211  1.00 34.58  ? 181 ARG A NH2 1 
ATOM   1151 N N   . VAL A 1 182 ? 21.647 70.036 0.329   1.00 34.61  ? 182 VAL A N   1 
ATOM   1152 C CA  . VAL A 1 182 ? 22.004 70.562 1.643   1.00 35.18  ? 182 VAL A CA  1 
ATOM   1153 C C   . VAL A 1 182 ? 22.025 72.079 1.556   1.00 36.36  ? 182 VAL A C   1 
ATOM   1154 O O   . VAL A 1 182 ? 22.039 72.648 0.464   1.00 37.41  ? 182 VAL A O   1 
ATOM   1155 C CB  . VAL A 1 182 ? 23.398 70.083 2.089   1.00 33.66  ? 182 VAL A CB  1 
ATOM   1156 C CG1 . VAL A 1 182 ? 23.383 68.592 2.355   1.00 34.95  ? 182 VAL A CG1 1 
ATOM   1157 C CG2 . VAL A 1 182 ? 24.412 70.410 1.025   1.00 33.07  ? 182 VAL A CG2 1 
ATOM   1158 N N   . GLY A 1 183 ? 22.030 72.732 2.710   1.00 38.68  ? 183 GLY A N   1 
ATOM   1159 C CA  . GLY A 1 183 ? 22.047 74.184 2.742   1.00 39.33  ? 183 GLY A CA  1 
ATOM   1160 C C   . GLY A 1 183 ? 20.753 74.835 2.278   1.00 39.40  ? 183 GLY A C   1 
ATOM   1161 O O   . GLY A 1 183 ? 19.693 74.202 2.206   1.00 38.27  ? 183 GLY A O   1 
ATOM   1162 N N   . ALA A 1 184 ? 20.847 76.119 1.959   1.00 39.69  ? 184 ALA A N   1 
ATOM   1163 C CA  . ALA A 1 184 ? 19.695 76.878 1.500   1.00 40.04  ? 184 ALA A CA  1 
ATOM   1164 C C   . ALA A 1 184 ? 18.975 76.145 0.376   1.00 40.49  ? 184 ALA A C   1 
ATOM   1165 O O   . ALA A 1 184 ? 17.754 76.204 0.269   1.00 41.51  ? 184 ALA A O   1 
ATOM   1166 C CB  . ALA A 1 184 ? 20.147 78.241 1.023   1.00 40.09  ? 184 ALA A CB  1 
ATOM   1167 N N   . PHE A 1 185 ? 19.752 75.448 -0.448  1.00 40.76  ? 185 PHE A N   1 
ATOM   1168 C CA  . PHE A 1 185 ? 19.245 74.701 -1.594  1.00 39.34  ? 185 PHE A CA  1 
ATOM   1169 C C   . PHE A 1 185 ? 18.249 73.627 -1.217  1.00 38.18  ? 185 PHE A C   1 
ATOM   1170 O O   . PHE A 1 185 ? 17.270 73.404 -1.930  1.00 38.04  ? 185 PHE A O   1 
ATOM   1171 C CB  . PHE A 1 185 ? 20.404 74.048 -2.323  1.00 38.74  ? 185 PHE A CB  1 
ATOM   1172 C CG  . PHE A 1 185 ? 21.505 74.990 -2.642  1.00 40.65  ? 185 PHE A CG  1 
ATOM   1173 C CD1 . PHE A 1 185 ? 21.435 75.800 -3.769  1.00 41.74  ? 185 PHE A CD1 1 
ATOM   1174 C CD2 . PHE A 1 185 ? 22.613 75.085 -1.805  1.00 42.08  ? 185 PHE A CD2 1 
ATOM   1175 C CE1 . PHE A 1 185 ? 22.460 76.698 -4.068  1.00 43.66  ? 185 PHE A CE1 1 
ATOM   1176 C CE2 . PHE A 1 185 ? 23.643 75.976 -2.090  1.00 44.07  ? 185 PHE A CE2 1 
ATOM   1177 C CZ  . PHE A 1 185 ? 23.569 76.787 -3.227  1.00 43.88  ? 185 PHE A CZ  1 
ATOM   1178 N N   . GLY A 1 186 ? 18.513 72.953 -0.103  1.00 36.82  ? 186 GLY A N   1 
ATOM   1179 C CA  . GLY A 1 186 ? 17.626 71.894 0.331   1.00 35.03  ? 186 GLY A CA  1 
ATOM   1180 C C   . GLY A 1 186 ? 16.688 72.312 1.439   1.00 35.50  ? 186 GLY A C   1 
ATOM   1181 O O   . GLY A 1 186 ? 15.687 71.629 1.695   1.00 33.78  ? 186 GLY A O   1 
ATOM   1182 N N   . PHE A 1 187 ? 16.974 73.444 2.085   1.00 34.60  ? 187 PHE A N   1 
ATOM   1183 C CA  . PHE A 1 187 ? 16.123 73.860 3.191   1.00 34.19  ? 187 PHE A CA  1 
ATOM   1184 C C   . PHE A 1 187 ? 15.514 75.249 3.235   1.00 34.16  ? 187 PHE A C   1 
ATOM   1185 O O   . PHE A 1 187 ? 14.927 75.621 4.252   1.00 33.59  ? 187 PHE A O   1 
ATOM   1186 C CB  . PHE A 1 187 ? 16.850 73.568 4.501   1.00 32.66  ? 187 PHE A CB  1 
ATOM   1187 C CG  . PHE A 1 187 ? 17.159 72.114 4.675   1.00 31.64  ? 187 PHE A CG  1 
ATOM   1188 C CD1 . PHE A 1 187 ? 16.207 71.252 5.217   1.00 30.97  ? 187 PHE A CD1 1 
ATOM   1189 C CD2 . PHE A 1 187 ? 18.358 71.584 4.209   1.00 30.94  ? 187 PHE A CD2 1 
ATOM   1190 C CE1 . PHE A 1 187 ? 16.443 69.882 5.288   1.00 31.53  ? 187 PHE A CE1 1 
ATOM   1191 C CE2 . PHE A 1 187 ? 18.611 70.218 4.275   1.00 30.32  ? 187 PHE A CE2 1 
ATOM   1192 C CZ  . PHE A 1 187 ? 17.647 69.361 4.815   1.00 31.72  ? 187 PHE A CZ  1 
ATOM   1193 N N   . LEU A 1 188 ? 15.616 76.004 2.144   1.00 34.06  ? 188 LEU A N   1 
ATOM   1194 C CA  . LEU A 1 188 ? 15.029 77.337 2.122   1.00 34.98  ? 188 LEU A CA  1 
ATOM   1195 C C   . LEU A 1 188 ? 13.539 77.200 2.390   1.00 34.05  ? 188 LEU A C   1 
ATOM   1196 O O   . LEU A 1 188 ? 12.842 76.517 1.653   1.00 33.28  ? 188 LEU A O   1 
ATOM   1197 C CB  . LEU A 1 188 ? 15.259 78.013 0.771   1.00 36.58  ? 188 LEU A CB  1 
ATOM   1198 C CG  . LEU A 1 188 ? 14.591 79.383 0.591   1.00 38.99  ? 188 LEU A CG  1 
ATOM   1199 C CD1 . LEU A 1 188 ? 14.923 80.312 1.762   1.00 39.10  ? 188 LEU A CD1 1 
ATOM   1200 C CD2 . LEU A 1 188 ? 15.050 79.991 -0.730  1.00 40.09  ? 188 LEU A CD2 1 
ATOM   1201 N N   . HIS A 1 189 ? 13.066 77.858 3.448   1.00 35.87  ? 189 HIS A N   1 
ATOM   1202 C CA  . HIS A 1 189 ? 11.659 77.805 3.874   1.00 36.94  ? 189 HIS A CA  1 
ATOM   1203 C C   . HIS A 1 189 ? 10.982 79.185 3.841   1.00 37.06  ? 189 HIS A C   1 
ATOM   1204 O O   . HIS A 1 189 ? 11.213 80.002 4.723   1.00 37.89  ? 189 HIS A O   1 
ATOM   1205 C CB  . HIS A 1 189 ? 11.605 77.247 5.297   1.00 35.55  ? 189 HIS A CB  1 
ATOM   1206 C CG  . HIS A 1 189 ? 10.223 77.045 5.829   1.00 37.77  ? 189 HIS A CG  1 
ATOM   1207 N ND1 . HIS A 1 189 ? 9.369  76.077 5.341   1.00 38.06  ? 189 HIS A ND1 1 
ATOM   1208 C CD2 . HIS A 1 189 ? 9.568  77.641 6.854   1.00 38.26  ? 189 HIS A CD2 1 
ATOM   1209 C CE1 . HIS A 1 189 ? 8.252  76.084 6.047   1.00 37.41  ? 189 HIS A CE1 1 
ATOM   1210 N NE2 . HIS A 1 189 ? 8.346  77.022 6.971   1.00 36.19  ? 189 HIS A NE2 1 
ATOM   1211 N N   . LEU A 1 190 ? 10.136 79.439 2.845   1.00 36.99  ? 190 LEU A N   1 
ATOM   1212 C CA  . LEU A 1 190 ? 9.476  80.738 2.742   1.00 36.28  ? 190 LEU A CA  1 
ATOM   1213 C C   . LEU A 1 190 ? 7.962  80.627 2.572   1.00 38.49  ? 190 LEU A C   1 
ATOM   1214 O O   . LEU A 1 190 ? 7.242  81.618 2.687   1.00 39.52  ? 190 LEU A O   1 
ATOM   1215 C CB  . LEU A 1 190 ? 10.091 81.523 1.580   1.00 33.69  ? 190 LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 190 ? 11.629 81.565 1.632   1.00 33.34  ? 190 LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 190 ? 12.193 82.031 0.313   1.00 33.23  ? 190 LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 190 ? 12.092 82.464 2.757   1.00 32.55  ? 190 LEU A CD2 1 
ATOM   1219 N N   . ALA A 1 191 ? 7.481  79.412 2.326   1.00 40.37  ? 191 ALA A N   1 
ATOM   1220 C CA  . ALA A 1 191 ? 6.057  79.143 2.133   1.00 41.26  ? 191 ALA A CA  1 
ATOM   1221 C C   . ALA A 1 191 ? 5.108  79.935 3.041   1.00 42.83  ? 191 ALA A C   1 
ATOM   1222 O O   . ALA A 1 191 ? 4.048  80.371 2.603   1.00 42.52  ? 191 ALA A O   1 
ATOM   1223 C CB  . ALA A 1 191 ? 5.794  77.650 2.291   1.00 40.97  ? 191 ALA A CB  1 
ATOM   1224 N N   . PRO A 1 192 ? 5.459  80.094 4.327   1.00 45.35  ? 192 PRO A N   1 
ATOM   1225 C CA  . PRO A 1 192 ? 4.599  80.844 5.251   1.00 46.44  ? 192 PRO A CA  1 
ATOM   1226 C C   . PRO A 1 192 ? 4.438  82.343 4.941   1.00 48.63  ? 192 PRO A C   1 
ATOM   1227 O O   . PRO A 1 192 ? 3.381  82.910 5.203   1.00 50.34  ? 192 PRO A O   1 
ATOM   1228 C CB  . PRO A 1 192 ? 5.258  80.591 6.605   1.00 45.13  ? 192 PRO A CB  1 
ATOM   1229 C CG  . PRO A 1 192 ? 5.775  79.198 6.455   1.00 44.48  ? 192 PRO A CG  1 
ATOM   1230 C CD  . PRO A 1 192 ? 6.410  79.253 5.082   1.00 45.67  ? 192 PRO A CD  1 
ATOM   1231 N N   . GLU A 1 193 ? 5.476  82.978 4.394   1.00 49.25  ? 193 GLU A N   1 
ATOM   1232 C CA  . GLU A 1 193 ? 5.426  84.405 4.049   1.00 49.45  ? 193 GLU A CA  1 
ATOM   1233 C C   . GLU A 1 193 ? 4.725  84.627 2.722   1.00 49.48  ? 193 GLU A C   1 
ATOM   1234 O O   . GLU A 1 193 ? 4.751  85.734 2.187   1.00 50.56  ? 193 GLU A O   1 
ATOM   1235 C CB  . GLU A 1 193 ? 6.836  84.986 3.909   1.00 50.88  ? 193 GLU A CB  1 
ATOM   1236 C CG  . GLU A 1 193 ? 7.552  85.314 5.200   1.00 54.93  ? 193 GLU A CG  1 
ATOM   1237 C CD  . GLU A 1 193 ? 6.992  86.539 5.895   1.00 56.00  ? 193 GLU A CD  1 
ATOM   1238 O OE1 . GLU A 1 193 ? 6.905  87.607 5.250   1.00 55.57  ? 193 GLU A OE1 1 
ATOM   1239 O OE2 . GLU A 1 193 ? 6.650  86.433 7.094   1.00 59.28  ? 193 GLU A OE2 1 
ATOM   1240 N N   . MET A 1 194 ? 4.106  83.582 2.186   1.00 49.29  ? 194 MET A N   1 
ATOM   1241 C CA  . MET A 1 194 ? 3.457  83.680 0.887   1.00 48.65  ? 194 MET A CA  1 
ATOM   1242 C C   . MET A 1 194 ? 2.048  83.126 0.806   1.00 49.39  ? 194 MET A C   1 
ATOM   1243 O O   . MET A 1 194 ? 1.645  82.267 1.594   1.00 50.61  ? 194 MET A O   1 
ATOM   1244 C CB  . MET A 1 194 ? 4.294  82.955 -0.158  1.00 48.56  ? 194 MET A CB  1 
ATOM   1245 C CG  . MET A 1 194 ? 5.662  83.516 -0.376  1.00 47.59  ? 194 MET A CG  1 
ATOM   1246 S SD  . MET A 1 194 ? 6.549  82.458 -1.506  1.00 47.22  ? 194 MET A SD  1 
ATOM   1247 C CE  . MET A 1 194 ? 8.202  82.739 -0.954  1.00 50.73  ? 194 MET A CE  1 
ATOM   1248 N N   . PRO A 1 195 ? 1.275  83.615 -0.169  1.00 49.27  ? 195 PRO A N   1 
ATOM   1249 C CA  . PRO A 1 195 ? -0.096 83.135 -0.329  1.00 48.68  ? 195 PRO A CA  1 
ATOM   1250 C C   . PRO A 1 195 ? -0.060 81.659 -0.683  1.00 48.06  ? 195 PRO A C   1 
ATOM   1251 O O   . PRO A 1 195 ? 0.918  81.187 -1.251  1.00 47.19  ? 195 PRO A O   1 
ATOM   1252 C CB  . PRO A 1 195 ? -0.626 84.001 -1.463  1.00 49.71  ? 195 PRO A CB  1 
ATOM   1253 C CG  . PRO A 1 195 ? 0.104  85.308 -1.235  1.00 49.60  ? 195 PRO A CG  1 
ATOM   1254 C CD  . PRO A 1 195 ? 1.511  84.823 -0.984  1.00 49.45  ? 195 PRO A CD  1 
ATOM   1255 N N   . SER A 1 196 ? -1.123 80.940 -0.339  1.00 49.35  ? 196 SER A N   1 
ATOM   1256 C CA  . SER A 1 196 ? -1.233 79.509 -0.610  1.00 50.26  ? 196 SER A CA  1 
ATOM   1257 C C   . SER A 1 196 ? -0.826 79.188 -2.034  1.00 50.43  ? 196 SER A C   1 
ATOM   1258 O O   . SER A 1 196 ? -0.297 78.119 -2.319  1.00 50.53  ? 196 SER A O   1 
ATOM   1259 C CB  . SER A 1 196 ? -2.668 79.051 -0.410  1.00 51.67  ? 196 SER A CB  1 
ATOM   1260 O OG  . SER A 1 196 ? -3.501 79.670 -1.373  1.00 54.65  ? 196 SER A OG  1 
ATOM   1261 N N   . GLU A 1 197 ? -1.098 80.122 -2.933  1.00 52.02  ? 197 GLU A N   1 
ATOM   1262 C CA  . GLU A 1 197 ? -0.764 79.949 -4.335  1.00 51.83  ? 197 GLU A CA  1 
ATOM   1263 C C   . GLU A 1 197 ? 0.705  79.585 -4.542  1.00 51.17  ? 197 GLU A C   1 
ATOM   1264 O O   . GLU A 1 197 ? 1.018  78.681 -5.313  1.00 51.36  ? 197 GLU A O   1 
ATOM   1265 C CB  . GLU A 1 197 ? -1.116 81.227 -5.107  1.00 52.59  ? 197 GLU A CB  1 
ATOM   1266 C CG  . GLU A 1 197 ? -0.373 81.393 -6.423  1.00 55.86  ? 197 GLU A CG  1 
ATOM   1267 C CD  . GLU A 1 197 ? -0.863 82.576 -7.240  1.00 57.39  ? 197 GLU A CD  1 
ATOM   1268 O OE1 . GLU A 1 197 ? -1.262 83.591 -6.627  1.00 59.38  ? 197 GLU A OE1 1 
ATOM   1269 O OE2 . GLU A 1 197 ? -0.836 82.494 -8.493  1.00 57.45  ? 197 GLU A OE2 1 
ATOM   1270 N N   . PHE A 1 198 ? 1.603  80.273 -3.843  1.00 50.99  ? 198 PHE A N   1 
ATOM   1271 C CA  . PHE A 1 198 ? 3.036  80.021 -4.000  1.00 50.66  ? 198 PHE A CA  1 
ATOM   1272 C C   . PHE A 1 198 ? 3.626  79.081 -2.961  1.00 49.07  ? 198 PHE A C   1 
ATOM   1273 O O   . PHE A 1 198 ? 4.797  79.194 -2.610  1.00 48.40  ? 198 PHE A O   1 
ATOM   1274 C CB  . PHE A 1 198 ? 3.811  81.339 -3.970  1.00 52.15  ? 198 PHE A CB  1 
ATOM   1275 C CG  . PHE A 1 198 ? 3.209  82.415 -4.825  1.00 53.62  ? 198 PHE A CG  1 
ATOM   1276 C CD1 . PHE A 1 198 ? 2.140  83.176 -4.356  1.00 54.75  ? 198 PHE A CD1 1 
ATOM   1277 C CD2 . PHE A 1 198 ? 3.695  82.655 -6.107  1.00 54.37  ? 198 PHE A CD2 1 
ATOM   1278 C CE1 . PHE A 1 198 ? 1.563  84.159 -5.150  1.00 55.52  ? 198 PHE A CE1 1 
ATOM   1279 C CE2 . PHE A 1 198 ? 3.127  83.635 -6.916  1.00 55.19  ? 198 PHE A CE2 1 
ATOM   1280 C CZ  . PHE A 1 198 ? 2.058  84.391 -6.437  1.00 56.40  ? 198 PHE A CZ  1 
ATOM   1281 N N   . ALA A 1 199 ? 2.817  78.143 -2.487  1.00 47.70  ? 199 ALA A N   1 
ATOM   1282 C CA  . ALA A 1 199 ? 3.261  77.190 -1.481  1.00 47.26  ? 199 ALA A CA  1 
ATOM   1283 C C   . ALA A 1 199 ? 4.467  76.386 -1.940  1.00 46.57  ? 199 ALA A C   1 
ATOM   1284 O O   . ALA A 1 199 ? 5.500  76.353 -1.269  1.00 46.71  ? 199 ALA A O   1 
ATOM   1285 C CB  . ALA A 1 199 ? 2.120  76.248 -1.128  1.00 47.21  ? 199 ALA A CB  1 
ATOM   1286 N N   . GLU A 1 200 ? 4.323  75.746 -3.093  1.00 46.07  ? 200 GLU A N   1 
ATOM   1287 C CA  . GLU A 1 200 ? 5.369  74.904 -3.658  1.00 45.25  ? 200 GLU A CA  1 
ATOM   1288 C C   . GLU A 1 200 ? 6.607  75.666 -4.144  1.00 43.97  ? 200 GLU A C   1 
ATOM   1289 O O   . GLU A 1 200 ? 7.507  75.079 -4.749  1.00 43.69  ? 200 GLU A O   1 
ATOM   1290 C CB  . GLU A 1 200 ? 4.772  74.080 -4.803  1.00 44.95  ? 200 GLU A CB  1 
ATOM   1291 C CG  . GLU A 1 200 ? 5.190  72.640 -4.781  1.00 47.86  ? 200 GLU A CG  1 
ATOM   1292 C CD  . GLU A 1 200 ? 4.987  72.020 -3.415  1.00 50.26  ? 200 GLU A CD  1 
ATOM   1293 O OE1 . GLU A 1 200 ? 3.822  71.833 -2.997  1.00 50.69  ? 200 GLU A OE1 1 
ATOM   1294 O OE2 . GLU A 1 200 ? 6.001  71.731 -2.750  1.00 51.32  ? 200 GLU A OE2 1 
ATOM   1295 N N   . GLU A 1 201 ? 6.661  76.962 -3.862  1.00 42.53  ? 201 GLU A N   1 
ATOM   1296 C CA  . GLU A 1 201 ? 7.784  77.778 -4.296  1.00 43.56  ? 201 GLU A CA  1 
ATOM   1297 C C   . GLU A 1 201 ? 9.056  77.544 -3.467  1.00 43.86  ? 201 GLU A C   1 
ATOM   1298 O O   . GLU A 1 201 ? 10.169 77.483 -4.012  1.00 44.78  ? 201 GLU A O   1 
ATOM   1299 C CB  . GLU A 1 201 ? 7.384  79.258 -4.268  1.00 44.17  ? 201 GLU A CB  1 
ATOM   1300 C CG  . GLU A 1 201 ? 8.357  80.177 -5.002  1.00 45.15  ? 201 GLU A CG  1 
ATOM   1301 C CD  . GLU A 1 201 ? 8.300  80.047 -6.525  1.00 44.58  ? 201 GLU A CD  1 
ATOM   1302 O OE1 . GLU A 1 201 ? 7.182  79.955 -7.091  1.00 42.30  ? 201 GLU A OE1 1 
ATOM   1303 O OE2 . GLU A 1 201 ? 9.386  80.053 -7.153  1.00 43.37  ? 201 GLU A OE2 1 
ATOM   1304 N N   . ALA A 1 202 ? 8.888  77.418 -2.154  1.00 43.04  ? 202 ALA A N   1 
ATOM   1305 C CA  . ALA A 1 202 ? 9.998  77.165 -1.230  1.00 42.21  ? 202 ALA A CA  1 
ATOM   1306 C C   . ALA A 1 202 ? 9.348  76.570 0.015   1.00 41.44  ? 202 ALA A C   1 
ATOM   1307 O O   . ALA A 1 202 ? 9.262  77.217 1.051   1.00 42.64  ? 202 ALA A O   1 
ATOM   1308 C CB  . ALA A 1 202 ? 10.720 78.469 -0.881  1.00 40.28  ? 202 ALA A CB  1 
ATOM   1309 N N   . PRO A 1 203 ? 8.902  75.311 -0.077  1.00 39.83  ? 203 PRO A N   1 
ATOM   1310 C CA  . PRO A 1 203 ? 8.242  74.590 1.012   1.00 38.49  ? 203 PRO A CA  1 
ATOM   1311 C C   . PRO A 1 203 ? 9.176  74.289 2.175   1.00 36.88  ? 203 PRO A C   1 
ATOM   1312 O O   . PRO A 1 203 ? 8.743  74.176 3.326   1.00 34.79  ? 203 PRO A O   1 
ATOM   1313 C CB  . PRO A 1 203 ? 7.757  73.294 0.343   1.00 38.47  ? 203 PRO A CB  1 
ATOM   1314 C CG  . PRO A 1 203 ? 8.246  73.370 -1.101  1.00 39.67  ? 203 PRO A CG  1 
ATOM   1315 C CD  . PRO A 1 203 ? 9.367  74.360 -1.094  1.00 40.11  ? 203 PRO A CD  1 
ATOM   1316 N N   . GLY A 1 204 ? 10.459 74.157 1.855   1.00 35.14  ? 204 GLY A N   1 
ATOM   1317 C CA  . GLY A 1 204 ? 11.443 73.837 2.864   1.00 33.93  ? 204 GLY A CA  1 
ATOM   1318 C C   . GLY A 1 204 ? 11.549 72.330 2.990   1.00 33.41  ? 204 GLY A C   1 
ATOM   1319 O O   . GLY A 1 204 ? 10.611 71.596 2.652   1.00 32.03  ? 204 GLY A O   1 
ATOM   1320 N N   . ASN A 1 205 ? 12.696 71.869 3.475   1.00 33.89  ? 205 ASN A N   1 
ATOM   1321 C CA  . ASN A 1 205 ? 12.946 70.446 3.652   1.00 32.38  ? 205 ASN A CA  1 
ATOM   1322 C C   . ASN A 1 205 ? 12.980 69.669 2.342   1.00 31.24  ? 205 ASN A C   1 
ATOM   1323 O O   . ASN A 1 205 ? 12.841 68.447 2.357   1.00 31.99  ? 205 ASN A O   1 
ATOM   1324 C CB  . ASN A 1 205 ? 11.882 69.818 4.565   1.00 34.64  ? 205 ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 205 ? 11.414 70.754 5.659   1.00 34.37  ? 205 ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 205 ? 12.200 71.500 6.244   1.00 36.44  ? 205 ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 205 ? 10.129 70.708 5.952   1.00 35.04  ? 205 ASN A ND2 1 
ATOM   1328 N N   . VAL A 1 206 ? 13.146 70.348 1.209   1.00 30.20  ? 206 VAL A N   1 
ATOM   1329 C CA  . VAL A 1 206 ? 13.190 69.628 -0.057  1.00 29.78  ? 206 VAL A CA  1 
ATOM   1330 C C   . VAL A 1 206 ? 14.381 68.657 -0.036  1.00 30.14  ? 206 VAL A C   1 
ATOM   1331 O O   . VAL A 1 206 ? 14.388 67.641 -0.735  1.00 27.32  ? 206 VAL A O   1 
ATOM   1332 C CB  . VAL A 1 206 ? 13.287 70.589 -1.281  1.00 30.25  ? 206 VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 206 ? 12.003 71.365 -1.411  1.00 28.04  ? 206 VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 206 ? 14.488 71.530 -1.151  1.00 28.12  ? 206 VAL A CG2 1 
ATOM   1335 N N   . GLY A 1 207 ? 15.375 68.974 0.790   1.00 31.53  ? 207 GLY A N   1 
ATOM   1336 C CA  . GLY A 1 207 ? 16.536 68.111 0.929   1.00 32.10  ? 207 GLY A CA  1 
ATOM   1337 C C   . GLY A 1 207 ? 16.083 66.757 1.434   1.00 32.33  ? 207 GLY A C   1 
ATOM   1338 O O   . GLY A 1 207 ? 16.589 65.722 1.003   1.00 33.82  ? 207 GLY A O   1 
ATOM   1339 N N   . LEU A 1 208 ? 15.116 66.766 2.347   1.00 32.11  ? 208 LEU A N   1 
ATOM   1340 C CA  . LEU A 1 208 ? 14.562 65.536 2.900   1.00 32.25  ? 208 LEU A CA  1 
ATOM   1341 C C   . LEU A 1 208 ? 13.593 64.902 1.894   1.00 32.65  ? 208 LEU A C   1 
ATOM   1342 O O   . LEU A 1 208 ? 13.371 63.696 1.925   1.00 31.79  ? 208 LEU A O   1 
ATOM   1343 C CB  . LEU A 1 208 ? 13.849 65.831 4.212   1.00 31.77  ? 208 LEU A CB  1 
ATOM   1344 C CG  . LEU A 1 208 ? 14.710 66.614 5.205   1.00 33.49  ? 208 LEU A CG  1 
ATOM   1345 C CD1 . LEU A 1 208 ? 13.857 66.994 6.413   1.00 32.26  ? 208 LEU A CD1 1 
ATOM   1346 C CD2 . LEU A 1 208 ? 15.936 65.785 5.615   1.00 31.74  ? 208 LEU A CD2 1 
ATOM   1347 N N   . TRP A 1 209 ? 13.005 65.716 1.015   1.00 32.83  ? 209 TRP A N   1 
ATOM   1348 C CA  . TRP A 1 209 ? 12.117 65.184 -0.015  1.00 34.21  ? 209 TRP A CA  1 
ATOM   1349 C C   . TRP A 1 209 ? 13.007 64.453 -1.019  1.00 35.39  ? 209 TRP A C   1 
ATOM   1350 O O   . TRP A 1 209 ? 12.588 63.471 -1.637  1.00 35.87  ? 209 TRP A O   1 
ATOM   1351 C CB  . TRP A 1 209 ? 11.345 66.293 -0.735  1.00 33.52  ? 209 TRP A CB  1 
ATOM   1352 C CG  . TRP A 1 209 ? 10.225 66.873 0.066   1.00 33.57  ? 209 TRP A CG  1 
ATOM   1353 C CD1 . TRP A 1 209 ? 10.257 68.008 0.820   1.00 33.41  ? 209 TRP A CD1 1 
ATOM   1354 C CD2 . TRP A 1 209 ? 8.927  66.308 0.247   1.00 32.43  ? 209 TRP A CD2 1 
ATOM   1355 N NE1 . TRP A 1 209 ? 9.061  68.186 1.467   1.00 32.01  ? 209 TRP A NE1 1 
ATOM   1356 C CE2 . TRP A 1 209 ? 8.223  67.156 1.136   1.00 32.12  ? 209 TRP A CE2 1 
ATOM   1357 C CE3 . TRP A 1 209 ? 8.288  65.166 -0.253  1.00 33.58  ? 209 TRP A CE3 1 
ATOM   1358 C CZ2 . TRP A 1 209 ? 6.908  66.900 1.540   1.00 30.40  ? 209 TRP A CZ2 1 
ATOM   1359 C CZ3 . TRP A 1 209 ? 6.977  64.905 0.145   1.00 32.76  ? 209 TRP A CZ3 1 
ATOM   1360 C CH2 . TRP A 1 209 ? 6.301  65.774 1.037   1.00 33.75  ? 209 TRP A CH2 1 
ATOM   1361 N N   . ASP A 1 210 ? 14.237 64.943 -1.177  1.00 35.82  ? 210 ASP A N   1 
ATOM   1362 C CA  . ASP A 1 210 ? 15.203 64.316 -2.069  1.00 35.92  ? 210 ASP A CA  1 
ATOM   1363 C C   . ASP A 1 210 ? 15.442 62.897 -1.568  1.00 36.29  ? 210 ASP A C   1 
ATOM   1364 O O   . ASP A 1 210 ? 15.241 61.927 -2.298  1.00 35.50  ? 210 ASP A O   1 
ATOM   1365 C CB  . ASP A 1 210 ? 16.540 65.057 -2.050  1.00 33.96  ? 210 ASP A CB  1 
ATOM   1366 C CG  . ASP A 1 210 ? 16.490 66.356 -2.788  1.00 34.08  ? 210 ASP A CG  1 
ATOM   1367 O OD1 . ASP A 1 210 ? 15.566 66.530 -3.603  1.00 31.68  ? 210 ASP A OD1 1 
ATOM   1368 O OD2 . ASP A 1 210 ? 17.389 67.199 -2.562  1.00 36.00  ? 210 ASP A OD2 1 
ATOM   1369 N N   . GLN A 1 211 ? 15.884 62.797 -0.314  1.00 36.78  ? 211 GLN A N   1 
ATOM   1370 C CA  . GLN A 1 211 ? 16.161 61.513 0.323   1.00 37.91  ? 211 GLN A CA  1 
ATOM   1371 C C   . GLN A 1 211 ? 14.973 60.579 0.155   1.00 37.47  ? 211 GLN A C   1 
ATOM   1372 O O   . GLN A 1 211 ? 15.130 59.428 -0.234  1.00 39.20  ? 211 GLN A O   1 
ATOM   1373 C CB  . GLN A 1 211 ? 16.447 61.734 1.799   1.00 36.85  ? 211 GLN A CB  1 
ATOM   1374 C CG  . GLN A 1 211 ? 17.642 62.622 2.018   1.00 37.85  ? 211 GLN A CG  1 
ATOM   1375 C CD  . GLN A 1 211 ? 17.764 63.087 3.447   1.00 38.80  ? 211 GLN A CD  1 
ATOM   1376 O OE1 . GLN A 1 211 ? 18.785 63.654 3.840   1.00 38.83  ? 211 GLN A OE1 1 
ATOM   1377 N NE2 . GLN A 1 211 ? 16.718 62.862 4.234   1.00 39.37  ? 211 GLN A NE2 1 
ATOM   1378 N N   . ALA A 1 212 ? 13.787 61.098 0.457   1.00 36.40  ? 212 ALA A N   1 
ATOM   1379 C CA  . ALA A 1 212 ? 12.549 60.356 0.323   1.00 33.41  ? 212 ALA A CA  1 
ATOM   1380 C C   . ALA A 1 212 ? 12.475 59.842 -1.100  1.00 33.51  ? 212 ALA A C   1 
ATOM   1381 O O   . ALA A 1 212 ? 12.208 58.669 -1.321  1.00 34.47  ? 212 ALA A O   1 
ATOM   1382 C CB  . ALA A 1 212 ? 11.355 61.264 0.613   1.00 31.43  ? 212 ALA A CB  1 
ATOM   1383 N N   . LEU A 1 213 ? 12.725 60.720 -2.069  1.00 34.59  ? 213 LEU A N   1 
ATOM   1384 C CA  . LEU A 1 213 ? 12.675 60.321 -3.475  1.00 35.41  ? 213 LEU A CA  1 
ATOM   1385 C C   . LEU A 1 213 ? 13.714 59.258 -3.803  1.00 36.46  ? 213 LEU A C   1 
ATOM   1386 O O   . LEU A 1 213 ? 13.424 58.314 -4.527  1.00 37.57  ? 213 LEU A O   1 
ATOM   1387 C CB  . LEU A 1 213 ? 12.889 61.518 -4.411  1.00 33.49  ? 213 LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 213 ? 12.538 61.181 -5.872  1.00 33.17  ? 213 LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 213 ? 11.025 60.938 -5.973  1.00 29.82  ? 213 LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 213 ? 12.969 62.305 -6.810  1.00 27.91  ? 213 LEU A CD2 1 
ATOM   1391 N N   . ALA A 1 214 ? 14.925 59.421 -3.275  1.00 38.38  ? 214 ALA A N   1 
ATOM   1392 C CA  . ALA A 1 214 ? 16.011 58.471 -3.515  1.00 38.11  ? 214 ALA A CA  1 
ATOM   1393 C C   . ALA A 1 214 ? 15.608 57.107 -3.001  1.00 38.40  ? 214 ALA A C   1 
ATOM   1394 O O   . ALA A 1 214 ? 15.635 56.121 -3.735  1.00 38.63  ? 214 ALA A O   1 
ATOM   1395 C CB  . ALA A 1 214 ? 17.289 58.929 -2.815  1.00 36.47  ? 214 ALA A CB  1 
ATOM   1396 N N   . ILE A 1 215 ? 15.239 57.052 -1.729  1.00 39.18  ? 215 ILE A N   1 
ATOM   1397 C CA  . ILE A 1 215 ? 14.834 55.799 -1.130  1.00 40.02  ? 215 ILE A CA  1 
ATOM   1398 C C   . ILE A 1 215 ? 13.684 55.189 -1.923  1.00 41.71  ? 215 ILE A C   1 
ATOM   1399 O O   . ILE A 1 215 ? 13.608 53.974 -2.078  1.00 43.42  ? 215 ILE A O   1 
ATOM   1400 C CB  . ILE A 1 215 ? 14.429 56.002 0.334   1.00 38.62  ? 215 ILE A CB  1 
ATOM   1401 C CG1 . ILE A 1 215 ? 15.623 56.552 1.111   1.00 35.44  ? 215 ILE A CG1 1 
ATOM   1402 C CG2 . ILE A 1 215 ? 13.962 54.684 0.942   1.00 37.42  ? 215 ILE A CG2 1 
ATOM   1403 C CD1 . ILE A 1 215 ? 15.329 56.821 2.562   1.00 35.85  ? 215 ILE A CD1 1 
ATOM   1404 N N   . ARG A 1 216 ? 12.793 56.022 -2.440  1.00 43.31  ? 216 ARG A N   1 
ATOM   1405 C CA  . ARG A 1 216 ? 11.677 55.505 -3.229  1.00 45.52  ? 216 ARG A CA  1 
ATOM   1406 C C   . ARG A 1 216 ? 12.268 54.885 -4.489  1.00 44.40  ? 216 ARG A C   1 
ATOM   1407 O O   . ARG A 1 216 ? 11.991 53.735 -4.819  1.00 45.64  ? 216 ARG A O   1 
ATOM   1408 C CB  . ARG A 1 216 ? 10.725 56.631 -3.612  1.00 49.96  ? 216 ARG A CB  1 
ATOM   1409 C CG  . ARG A 1 216 ? 9.391  56.190 -4.195  1.00 55.60  ? 216 ARG A CG  1 
ATOM   1410 C CD  . ARG A 1 216 ? 8.614  57.412 -4.728  1.00 63.07  ? 216 ARG A CD  1 
ATOM   1411 N NE  . ARG A 1 216 ? 8.477  58.494 -3.737  1.00 65.16  ? 216 ARG A NE  1 
ATOM   1412 C CZ  . ARG A 1 216 ? 8.144  59.753 -4.030  1.00 64.18  ? 216 ARG A CZ  1 
ATOM   1413 N NH1 . ARG A 1 216 ? 7.911  60.103 -5.292  1.00 63.99  ? 216 ARG A NH1 1 
ATOM   1414 N NH2 . ARG A 1 216 ? 8.053  60.664 -3.063  1.00 61.33  ? 216 ARG A NH2 1 
ATOM   1415 N N   . TRP A 1 217 ? 13.098 55.650 -5.184  1.00 42.08  ? 217 TRP A N   1 
ATOM   1416 C CA  . TRP A 1 217 ? 13.725 55.161 -6.394  1.00 40.53  ? 217 TRP A CA  1 
ATOM   1417 C C   . TRP A 1 217 ? 14.335 53.807 -6.119  1.00 41.45  ? 217 TRP A C   1 
ATOM   1418 O O   . TRP A 1 217 ? 14.241 52.904 -6.940  1.00 42.88  ? 217 TRP A O   1 
ATOM   1419 C CB  . TRP A 1 217 ? 14.838 56.095 -6.855  1.00 40.95  ? 217 TRP A CB  1 
ATOM   1420 C CG  . TRP A 1 217 ? 15.352 55.750 -8.212  1.00 39.77  ? 217 TRP A CG  1 
ATOM   1421 C CD1 . TRP A 1 217 ? 14.908 56.249 -9.401  1.00 39.06  ? 217 TRP A CD1 1 
ATOM   1422 C CD2 . TRP A 1 217 ? 16.343 54.769 -8.534  1.00 39.89  ? 217 TRP A CD2 1 
ATOM   1423 N NE1 . TRP A 1 217 ? 15.556 55.639 -10.444 1.00 40.10  ? 217 TRP A NE1 1 
ATOM   1424 C CE2 . TRP A 1 217 ? 16.444 54.722 -9.942  1.00 40.86  ? 217 TRP A CE2 1 
ATOM   1425 C CE3 . TRP A 1 217 ? 17.156 53.918 -7.772  1.00 40.81  ? 217 TRP A CE3 1 
ATOM   1426 C CZ2 . TRP A 1 217 ? 17.328 53.856 -10.608 1.00 39.19  ? 217 TRP A CZ2 1 
ATOM   1427 C CZ3 . TRP A 1 217 ? 18.036 53.052 -8.439  1.00 39.70  ? 217 TRP A CZ3 1 
ATOM   1428 C CH2 . TRP A 1 217 ? 18.110 53.032 -9.839  1.00 38.13  ? 217 TRP A CH2 1 
ATOM   1429 N N   . LEU A 1 218 ? 14.968 53.660 -4.960  1.00 42.88  ? 218 LEU A N   1 
ATOM   1430 C CA  . LEU A 1 218 ? 15.610 52.393 -4.618  1.00 42.50  ? 218 LEU A CA  1 
ATOM   1431 C C   . LEU A 1 218 ? 14.618 51.294 -4.305  1.00 43.30  ? 218 LEU A C   1 
ATOM   1432 O O   . LEU A 1 218 ? 14.860 50.140 -4.638  1.00 44.49  ? 218 LEU A O   1 
ATOM   1433 C CB  . LEU A 1 218 ? 16.586 52.575 -3.453  1.00 37.94  ? 218 LEU A CB  1 
ATOM   1434 C CG  . LEU A 1 218 ? 17.907 53.206 -3.882  1.00 35.64  ? 218 LEU A CG  1 
ATOM   1435 C CD1 . LEU A 1 218 ? 18.645 53.789 -2.698  1.00 35.69  ? 218 LEU A CD1 1 
ATOM   1436 C CD2 . LEU A 1 218 ? 18.730 52.160 -4.584  1.00 32.08  ? 218 LEU A CD2 1 
ATOM   1437 N N   . LYS A 1 219 ? 13.497 51.634 -3.685  1.00 44.56  ? 219 LYS A N   1 
ATOM   1438 C CA  . LYS A 1 219 ? 12.526 50.600 -3.381  1.00 47.98  ? 219 LYS A CA  1 
ATOM   1439 C C   . LYS A 1 219 ? 11.884 50.099 -4.679  1.00 50.08  ? 219 LYS A C   1 
ATOM   1440 O O   . LYS A 1 219 ? 11.432 48.954 -4.763  1.00 50.59  ? 219 LYS A O   1 
ATOM   1441 C CB  . LYS A 1 219 ? 11.458 51.118 -2.420  1.00 48.17  ? 219 LYS A CB  1 
ATOM   1442 C CG  . LYS A 1 219 ? 10.655 49.988 -1.828  1.00 49.76  ? 219 LYS A CG  1 
ATOM   1443 C CD  . LYS A 1 219 ? 10.044 50.340 -0.496  1.00 52.42  ? 219 LYS A CD  1 
ATOM   1444 C CE  . LYS A 1 219 ? 9.406  49.098 0.113   1.00 54.89  ? 219 LYS A CE  1 
ATOM   1445 N NZ  . LYS A 1 219 ? 8.775  49.340 1.439   1.00 57.39  ? 219 LYS A NZ  1 
ATOM   1446 N N   . ASP A 1 220 ? 11.863 50.959 -5.695  1.00 51.00  ? 220 ASP A N   1 
ATOM   1447 C CA  . ASP A 1 220 ? 11.295 50.600 -6.991  1.00 51.52  ? 220 ASP A CA  1 
ATOM   1448 C C   . ASP A 1 220 ? 12.260 49.747 -7.819  1.00 52.35  ? 220 ASP A C   1 
ATOM   1449 O O   . ASP A 1 220 ? 11.830 49.012 -8.709  1.00 53.67  ? 220 ASP A O   1 
ATOM   1450 C CB  . ASP A 1 220 ? 10.939 51.854 -7.809  1.00 50.81  ? 220 ASP A CB  1 
ATOM   1451 C CG  . ASP A 1 220 ? 9.773  52.636 -7.226  1.00 52.03  ? 220 ASP A CG  1 
ATOM   1452 O OD1 . ASP A 1 220 ? 8.945  52.040 -6.492  1.00 52.30  ? 220 ASP A OD1 1 
ATOM   1453 O OD2 . ASP A 1 220 ? 9.678  53.848 -7.523  1.00 50.29  ? 220 ASP A OD2 1 
ATOM   1454 N N   . ASN A 1 221 ? 13.556 49.843 -7.533  1.00 51.29  ? 221 ASN A N   1 
ATOM   1455 C CA  . ASN A 1 221 ? 14.547 49.088 -8.289  1.00 50.01  ? 221 ASN A CA  1 
ATOM   1456 C C   . ASN A 1 221 ? 15.319 48.072 -7.482  1.00 50.00  ? 221 ASN A C   1 
ATOM   1457 O O   . ASN A 1 221 ? 16.313 47.525 -7.957  1.00 47.37  ? 221 ASN A O   1 
ATOM   1458 C CB  . ASN A 1 221 ? 15.528 50.042 -8.953  1.00 51.04  ? 221 ASN A CB  1 
ATOM   1459 C CG  . ASN A 1 221 ? 14.847 50.967 -9.912  1.00 53.30  ? 221 ASN A CG  1 
ATOM   1460 O OD1 . ASN A 1 221 ? 14.187 50.520 -10.852 1.00 56.27  ? 221 ASN A OD1 1 
ATOM   1461 N ND2 . ASN A 1 221 ? 14.985 52.265 -9.683  1.00 53.05  ? 221 ASN A ND2 1 
ATOM   1462 N N   . ALA A 1 222 ? 14.865 47.818 -6.264  1.00 50.83  ? 222 ALA A N   1 
ATOM   1463 C CA  . ALA A 1 222 ? 15.543 46.849 -5.423  1.00 53.61  ? 222 ALA A CA  1 
ATOM   1464 C C   . ALA A 1 222 ? 15.812 45.573 -6.228  1.00 54.66  ? 222 ALA A C   1 
ATOM   1465 O O   . ALA A 1 222 ? 16.966 45.183 -6.413  1.00 54.82  ? 222 ALA A O   1 
ATOM   1466 C CB  . ALA A 1 222 ? 14.697 46.540 -4.186  1.00 53.86  ? 222 ALA A CB  1 
ATOM   1467 N N   . HIS A 1 223 ? 14.751 44.939 -6.723  1.00 55.96  ? 223 HIS A N   1 
ATOM   1468 C CA  . HIS A 1 223 ? 14.904 43.715 -7.495  1.00 57.83  ? 223 HIS A CA  1 
ATOM   1469 C C   . HIS A 1 223 ? 15.917 43.873 -8.617  1.00 57.05  ? 223 HIS A C   1 
ATOM   1470 O O   . HIS A 1 223 ? 16.767 43.010 -8.823  1.00 56.57  ? 223 HIS A O   1 
ATOM   1471 C CB  . HIS A 1 223 ? 13.559 43.275 -8.075  1.00 62.72  ? 223 HIS A CB  1 
ATOM   1472 C CG  . HIS A 1 223 ? 12.640 42.655 -7.067  1.00 68.05  ? 223 HIS A CG  1 
ATOM   1473 N ND1 . HIS A 1 223 ? 12.984 41.540 -6.329  1.00 69.96  ? 223 HIS A ND1 1 
ATOM   1474 C CD2 . HIS A 1 223 ? 11.386 42.990 -6.676  1.00 69.69  ? 223 HIS A CD2 1 
ATOM   1475 C CE1 . HIS A 1 223 ? 11.984 41.216 -5.528  1.00 70.61  ? 223 HIS A CE1 1 
ATOM   1476 N NE2 . HIS A 1 223 ? 11.002 42.080 -5.719  1.00 71.13  ? 223 HIS A NE2 1 
ATOM   1477 N N   . ALA A 1 224 ? 15.838 44.987 -9.330  1.00 56.19  ? 224 ALA A N   1 
ATOM   1478 C CA  . ALA A 1 224 ? 16.753 45.244 -10.439 1.00 55.70  ? 224 ALA A CA  1 
ATOM   1479 C C   . ALA A 1 224 ? 18.237 45.031 -10.124 1.00 54.86  ? 224 ALA A C   1 
ATOM   1480 O O   . ALA A 1 224 ? 19.022 44.743 -11.027 1.00 54.27  ? 224 ALA A O   1 
ATOM   1481 C CB  . ALA A 1 224 ? 16.541 46.657 -10.964 1.00 57.94  ? 224 ALA A CB  1 
ATOM   1482 N N   . PHE A 1 225 ? 18.631 45.184 -8.860  1.00 53.29  ? 225 PHE A N   1 
ATOM   1483 C CA  . PHE A 1 225 ? 20.033 45.003 -8.491  1.00 51.60  ? 225 PHE A CA  1 
ATOM   1484 C C   . PHE A 1 225 ? 20.249 43.756 -7.635  1.00 51.36  ? 225 PHE A C   1 
ATOM   1485 O O   . PHE A 1 225 ? 21.355 43.504 -7.149  1.00 48.75  ? 225 PHE A O   1 
ATOM   1486 C CB  . PHE A 1 225 ? 20.561 46.241 -7.754  1.00 49.84  ? 225 PHE A CB  1 
ATOM   1487 C CG  . PHE A 1 225 ? 20.544 47.497 -8.582  1.00 47.55  ? 225 PHE A CG  1 
ATOM   1488 C CD1 . PHE A 1 225 ? 19.386 48.270 -8.680  1.00 46.70  ? 225 PHE A CD1 1 
ATOM   1489 C CD2 . PHE A 1 225 ? 21.678 47.898 -9.282  1.00 46.80  ? 225 PHE A CD2 1 
ATOM   1490 C CE1 . PHE A 1 225 ? 19.354 49.424 -9.461  1.00 46.01  ? 225 PHE A CE1 1 
ATOM   1491 C CE2 . PHE A 1 225 ? 21.659 49.055 -10.071 1.00 48.02  ? 225 PHE A CE2 1 
ATOM   1492 C CZ  . PHE A 1 225 ? 20.493 49.820 -10.161 1.00 46.89  ? 225 PHE A CZ  1 
ATOM   1493 N N   . GLY A 1 226 ? 19.182 42.977 -7.472  1.00 52.19  ? 226 GLY A N   1 
ATOM   1494 C CA  . GLY A 1 226 ? 19.249 41.761 -6.679  1.00 52.65  ? 226 GLY A CA  1 
ATOM   1495 C C   . GLY A 1 226 ? 18.832 42.006 -5.242  1.00 53.66  ? 226 GLY A C   1 
ATOM   1496 O O   . GLY A 1 226 ? 19.156 41.228 -4.345  1.00 54.55  ? 226 GLY A O   1 
ATOM   1497 N N   . GLY A 1 227 ? 18.101 43.091 -5.014  1.00 53.54  ? 227 GLY A N   1 
ATOM   1498 C CA  . GLY A 1 227 ? 17.681 43.405 -3.664  1.00 53.05  ? 227 GLY A CA  1 
ATOM   1499 C C   . GLY A 1 227 ? 16.233 43.102 -3.354  1.00 52.27  ? 227 GLY A C   1 
ATOM   1500 O O   . GLY A 1 227 ? 15.400 42.978 -4.241  1.00 53.03  ? 227 GLY A O   1 
ATOM   1501 N N   . ASN A 1 228 ? 15.938 42.971 -2.072  1.00 52.17  ? 228 ASN A N   1 
ATOM   1502 C CA  . ASN A 1 228 ? 14.587 42.707 -1.633  1.00 52.41  ? 228 ASN A CA  1 
ATOM   1503 C C   . ASN A 1 228 ? 14.055 44.033 -1.110  1.00 54.50  ? 228 ASN A C   1 
ATOM   1504 O O   . ASN A 1 228 ? 14.496 44.519 -0.074  1.00 54.23  ? 228 ASN A O   1 
ATOM   1505 C CB  . ASN A 1 228 ? 14.592 41.669 -0.517  1.00 49.92  ? 228 ASN A CB  1 
ATOM   1506 C CG  . ASN A 1 228 ? 13.205 41.264 -0.099  1.00 47.58  ? 228 ASN A CG  1 
ATOM   1507 O OD1 . ASN A 1 228 ? 12.252 42.029 -0.233  1.00 48.87  ? 228 ASN A OD1 1 
ATOM   1508 N ND2 . ASN A 1 228 ? 13.083 40.061 0.430   1.00 47.13  ? 228 ASN A ND2 1 
ATOM   1509 N N   . PRO A 1 229 ? 13.104 44.640 -1.832  1.00 57.00  ? 229 PRO A N   1 
ATOM   1510 C CA  . PRO A 1 229 ? 12.469 45.916 -1.497  1.00 59.34  ? 229 PRO A CA  1 
ATOM   1511 C C   . PRO A 1 229 ? 12.067 46.088 -0.036  1.00 61.08  ? 229 PRO A C   1 
ATOM   1512 O O   . PRO A 1 229 ? 12.170 47.184 0.519   1.00 61.51  ? 229 PRO A O   1 
ATOM   1513 C CB  . PRO A 1 229 ? 11.262 45.941 -2.420  1.00 59.09  ? 229 PRO A CB  1 
ATOM   1514 C CG  . PRO A 1 229 ? 11.792 45.292 -3.638  1.00 59.07  ? 229 PRO A CG  1 
ATOM   1515 C CD  . PRO A 1 229 ? 12.546 44.105 -3.085  1.00 58.33  ? 229 PRO A CD  1 
ATOM   1516 N N   . GLU A 1 230 ? 11.611 45.011 0.588   1.00 62.96  ? 230 GLU A N   1 
ATOM   1517 C CA  . GLU A 1 230 ? 11.185 45.096 1.976   1.00 65.44  ? 230 GLU A CA  1 
ATOM   1518 C C   . GLU A 1 230 ? 12.221 44.659 3.001   1.00 63.59  ? 230 GLU A C   1 
ATOM   1519 O O   . GLU A 1 230 ? 11.896 44.398 4.157   1.00 63.47  ? 230 GLU A O   1 
ATOM   1520 C CB  . GLU A 1 230 ? 9.897  44.304 2.155   1.00 70.96  ? 230 GLU A CB  1 
ATOM   1521 C CG  . GLU A 1 230 ? 8.701  44.984 1.516   1.00 77.26  ? 230 GLU A CG  1 
ATOM   1522 C CD  . GLU A 1 230 ? 7.427  44.191 1.694   1.00 81.25  ? 230 GLU A CD  1 
ATOM   1523 O OE1 . GLU A 1 230 ? 7.386  43.324 2.597   1.00 82.84  ? 230 GLU A OE1 1 
ATOM   1524 O OE2 . GLU A 1 230 ? 6.465  44.446 0.936   1.00 84.58  ? 230 GLU A OE2 1 
ATOM   1525 N N   . TRP A 1 231 ? 13.474 44.596 2.577   1.00 61.80  ? 231 TRP A N   1 
ATOM   1526 C CA  . TRP A 1 231 ? 14.548 44.208 3.468   1.00 59.77  ? 231 TRP A CA  1 
ATOM   1527 C C   . TRP A 1 231 ? 15.525 45.383 3.608   1.00 57.24  ? 231 TRP A C   1 
ATOM   1528 O O   . TRP A 1 231 ? 16.710 45.201 3.902   1.00 58.05  ? 231 TRP A O   1 
ATOM   1529 C CB  . TRP A 1 231 ? 15.254 42.979 2.901   1.00 62.00  ? 231 TRP A CB  1 
ATOM   1530 C CG  . TRP A 1 231 ? 15.886 42.123 3.944   1.00 65.03  ? 231 TRP A CG  1 
ATOM   1531 C CD1 . TRP A 1 231 ? 15.873 42.322 5.298   1.00 65.35  ? 231 TRP A CD1 1 
ATOM   1532 C CD2 . TRP A 1 231 ? 16.623 40.921 3.724   1.00 66.47  ? 231 TRP A CD2 1 
ATOM   1533 N NE1 . TRP A 1 231 ? 16.558 41.315 5.933   1.00 65.35  ? 231 TRP A NE1 1 
ATOM   1534 C CE2 . TRP A 1 231 ? 17.029 40.441 4.990   1.00 66.42  ? 231 TRP A CE2 1 
ATOM   1535 C CE3 . TRP A 1 231 ? 16.981 40.199 2.577   1.00 67.89  ? 231 TRP A CE3 1 
ATOM   1536 C CZ2 . TRP A 1 231 ? 17.777 39.270 5.142   1.00 67.84  ? 231 TRP A CZ2 1 
ATOM   1537 C CZ3 . TRP A 1 231 ? 17.727 39.032 2.728   1.00 68.59  ? 231 TRP A CZ3 1 
ATOM   1538 C CH2 . TRP A 1 231 ? 18.117 38.581 4.002   1.00 68.08  ? 231 TRP A CH2 1 
ATOM   1539 N N   . MET A 1 232 ? 15.003 46.591 3.411   1.00 52.95  ? 232 MET A N   1 
ATOM   1540 C CA  . MET A 1 232 ? 15.795 47.815 3.492   1.00 49.26  ? 232 MET A CA  1 
ATOM   1541 C C   . MET A 1 232 ? 15.974 48.372 4.893   1.00 45.72  ? 232 MET A C   1 
ATOM   1542 O O   . MET A 1 232 ? 15.046 48.393 5.695   1.00 45.74  ? 232 MET A O   1 
ATOM   1543 C CB  . MET A 1 232 ? 15.162 48.911 2.643   1.00 50.32  ? 232 MET A CB  1 
ATOM   1544 C CG  . MET A 1 232 ? 15.141 48.632 1.158   1.00 53.39  ? 232 MET A CG  1 
ATOM   1545 S SD  . MET A 1 232 ? 14.485 50.024 0.236   1.00 53.91  ? 232 MET A SD  1 
ATOM   1546 C CE  . MET A 1 232 ? 14.456 51.296 1.526   1.00 53.01  ? 232 MET A CE  1 
ATOM   1547 N N   . THR A 1 233 ? 17.182 48.832 5.178   1.00 41.53  ? 233 THR A N   1 
ATOM   1548 C CA  . THR A 1 233 ? 17.469 49.434 6.468   1.00 39.27  ? 233 THR A CA  1 
ATOM   1549 C C   . THR A 1 233 ? 18.278 50.701 6.161   1.00 38.57  ? 233 THR A C   1 
ATOM   1550 O O   . THR A 1 233 ? 19.251 50.665 5.396   1.00 38.90  ? 233 THR A O   1 
ATOM   1551 C CB  . THR A 1 233 ? 18.273 48.466 7.418   1.00 37.06  ? 233 THR A CB  1 
ATOM   1552 O OG1 . THR A 1 233 ? 19.668 48.777 7.367   1.00 32.93  ? 233 THR A OG1 1 
ATOM   1553 C CG2 . THR A 1 233 ? 18.065 47.011 7.011   1.00 33.71  ? 233 THR A CG2 1 
ATOM   1554 N N   . LEU A 1 234 ? 17.845 51.824 6.719   1.00 35.26  ? 234 LEU A N   1 
ATOM   1555 C CA  . LEU A 1 234 ? 18.536 53.077 6.492   1.00 34.93  ? 234 LEU A CA  1 
ATOM   1556 C C   . LEU A 1 234 ? 19.585 53.276 7.573   1.00 34.17  ? 234 LEU A C   1 
ATOM   1557 O O   . LEU A 1 234 ? 19.402 52.861 8.722   1.00 31.59  ? 234 LEU A O   1 
ATOM   1558 C CB  . LEU A 1 234 ? 17.555 54.251 6.533   1.00 37.38  ? 234 LEU A CB  1 
ATOM   1559 C CG  . LEU A 1 234 ? 16.338 54.232 5.605   1.00 38.93  ? 234 LEU A CG  1 
ATOM   1560 C CD1 . LEU A 1 234 ? 15.479 55.452 5.882   1.00 37.85  ? 234 LEU A CD1 1 
ATOM   1561 C CD2 . LEU A 1 234 ? 16.782 54.219 4.163   1.00 40.38  ? 234 LEU A CD2 1 
ATOM   1562 N N   . PHE A 1 235 ? 20.698 53.893 7.196   1.00 32.05  ? 235 PHE A N   1 
ATOM   1563 C CA  . PHE A 1 235 ? 21.734 54.175 8.159   1.00 31.40  ? 235 PHE A CA  1 
ATOM   1564 C C   . PHE A 1 235 ? 22.492 55.402 7.736   1.00 31.18  ? 235 PHE A C   1 
ATOM   1565 O O   . PHE A 1 235 ? 22.799 55.611 6.566   1.00 33.11  ? 235 PHE A O   1 
ATOM   1566 C CB  . PHE A 1 235 ? 22.680 52.982 8.371   1.00 31.07  ? 235 PHE A CB  1 
ATOM   1567 C CG  . PHE A 1 235 ? 23.598 52.695 7.222   1.00 30.97  ? 235 PHE A CG  1 
ATOM   1568 C CD1 . PHE A 1 235 ? 23.093 52.429 5.956   1.00 30.78  ? 235 PHE A CD1 1 
ATOM   1569 C CD2 . PHE A 1 235 ? 24.973 52.631 7.423   1.00 30.95  ? 235 PHE A CD2 1 
ATOM   1570 C CE1 . PHE A 1 235 ? 23.942 52.099 4.906   1.00 31.28  ? 235 PHE A CE1 1 
ATOM   1571 C CE2 . PHE A 1 235 ? 25.837 52.299 6.377   1.00 32.25  ? 235 PHE A CE2 1 
ATOM   1572 C CZ  . PHE A 1 235 ? 25.321 52.033 5.116   1.00 31.45  ? 235 PHE A CZ  1 
ATOM   1573 N N   . GLY A 1 236 ? 22.747 56.250 8.713   1.00 30.73  ? 236 GLY A N   1 
ATOM   1574 C CA  . GLY A 1 236 ? 23.467 57.481 8.465   1.00 31.40  ? 236 GLY A CA  1 
ATOM   1575 C C   . GLY A 1 236 ? 24.120 57.949 9.752   1.00 31.37  ? 236 GLY A C   1 
ATOM   1576 O O   . GLY A 1 236 ? 23.856 57.378 10.806  1.00 30.01  ? 236 GLY A O   1 
ATOM   1577 N N   . GLU A 1 237 ? 24.949 58.985 9.680   1.00 32.00  ? 237 GLU A N   1 
ATOM   1578 C CA  . GLU A 1 237 ? 25.657 59.522 10.837  1.00 34.69  ? 237 GLU A CA  1 
ATOM   1579 C C   . GLU A 1 237 ? 25.432 61.044 10.830  1.00 35.38  ? 237 GLU A C   1 
ATOM   1580 O O   . GLU A 1 237 ? 25.327 61.629 9.777   1.00 36.96  ? 237 GLU A O   1 
ATOM   1581 C CB  . GLU A 1 237 ? 27.127 59.164 10.702  1.00 32.98  ? 237 GLU A CB  1 
ATOM   1582 C CG  . GLU A 1 237 ? 27.956 59.650 11.835  1.00 36.31  ? 237 GLU A CG  1 
ATOM   1583 C CD  . GLU A 1 237 ? 28.361 61.118 11.713  1.00 35.95  ? 237 GLU A CD  1 
ATOM   1584 O OE1 . GLU A 1 237 ? 28.449 61.668 10.590  1.00 38.53  ? 237 GLU A OE1 1 
ATOM   1585 O OE2 . GLU A 1 237 ? 28.627 61.725 12.760  1.00 34.66  ? 237 GLU A OE2 1 
ATOM   1586 N N   . SER A 1 238 ? 25.357 61.675 11.999  1.00 36.74  ? 238 SER A N   1 
ATOM   1587 C CA  . SER A 1 238 ? 25.077 63.120 12.142  1.00 38.62  ? 238 SER A CA  1 
ATOM   1588 C C   . SER A 1 238 ? 23.707 63.470 11.579  1.00 39.34  ? 238 SER A C   1 
ATOM   1589 O O   . SER A 1 238 ? 22.703 62.829 11.866  1.00 41.82  ? 238 SER A O   1 
ATOM   1590 C CB  . SER A 1 238 ? 26.099 63.980 11.405  1.00 39.49  ? 238 SER A CB  1 
ATOM   1591 O OG  . SER A 1 238 ? 26.979 64.565 12.351  1.00 39.55  ? 238 SER A OG  1 
ATOM   1592 N N   . ALA A 1 239 ? 23.711 64.501 10.745  1.00 39.50  ? 239 ALA A N   1 
ATOM   1593 C CA  . ALA A 1 239 ? 22.516 64.957 10.047  1.00 39.90  ? 239 ALA A CA  1 
ATOM   1594 C C   . ALA A 1 239 ? 21.965 63.800 9.210   1.00 39.86  ? 239 ALA A C   1 
ATOM   1595 O O   . ALA A 1 239 ? 20.746 63.677 9.025   1.00 37.65  ? 239 ALA A O   1 
ATOM   1596 C CB  . ALA A 1 239 ? 22.891 66.114 9.166   1.00 41.79  ? 239 ALA A CB  1 
ATOM   1597 N N   . GLY A 1 240 ? 22.873 62.960 8.712   1.00 39.38  ? 240 GLY A N   1 
ATOM   1598 C CA  . GLY A 1 240 ? 22.475 61.807 7.927   1.00 39.67  ? 240 GLY A CA  1 
ATOM   1599 C C   . GLY A 1 240 ? 21.743 60.839 8.842   1.00 40.31  ? 240 GLY A C   1 
ATOM   1600 O O   . GLY A 1 240 ? 20.836 60.117 8.425   1.00 40.24  ? 240 GLY A O   1 
ATOM   1601 N N   . SER A 1 241 ? 22.141 60.824 10.108  1.00 39.93  ? 241 SER A N   1 
ATOM   1602 C CA  . SER A 1 241 ? 21.502 59.966 11.083  1.00 39.12  ? 241 SER A CA  1 
ATOM   1603 C C   . SER A 1 241 ? 20.121 60.563 11.311  1.00 39.71  ? 241 SER A C   1 
ATOM   1604 O O   . SER A 1 241 ? 19.106 59.874 11.214  1.00 40.68  ? 241 SER A O   1 
ATOM   1605 C CB  . SER A 1 241 ? 22.307 59.951 12.381  1.00 38.62  ? 241 SER A CB  1 
ATOM   1606 O OG  . SER A 1 241 ? 21.714 59.089 13.331  1.00 36.07  ? 241 SER A OG  1 
ATOM   1607 N N   . SER A 1 242 ? 20.083 61.858 11.597  1.00 39.47  ? 242 SER A N   1 
ATOM   1608 C CA  . SER A 1 242 ? 18.814 62.536 11.812  1.00 38.85  ? 242 SER A CA  1 
ATOM   1609 C C   . SER A 1 242 ? 17.895 62.303 10.613  1.00 38.29  ? 242 SER A C   1 
ATOM   1610 O O   . SER A 1 242 ? 16.676 62.178 10.768  1.00 38.82  ? 242 SER A O   1 
ATOM   1611 C CB  . SER A 1 242 ? 19.041 64.035 12.004  1.00 38.14  ? 242 SER A CB  1 
ATOM   1612 O OG  . SER A 1 242 ? 19.657 64.293 13.249  1.00 38.73  ? 242 SER A OG  1 
ATOM   1613 N N   . SER A 1 243 ? 18.482 62.250 9.419   1.00 35.79  ? 243 SER A N   1 
ATOM   1614 C CA  . SER A 1 243 ? 17.703 62.024 8.212   1.00 34.49  ? 243 SER A CA  1 
ATOM   1615 C C   . SER A 1 243 ? 17.065 60.634 8.269   1.00 35.54  ? 243 SER A C   1 
ATOM   1616 O O   . SER A 1 243 ? 15.871 60.470 7.997   1.00 35.70  ? 243 SER A O   1 
ATOM   1617 C CB  . SER A 1 243 ? 18.593 62.154 6.983   1.00 32.62  ? 243 SER A CB  1 
ATOM   1618 O OG  . SER A 1 243 ? 19.214 63.423 6.961   1.00 33.10  ? 243 SER A OG  1 
ATOM   1619 N N   . VAL A 1 244 ? 17.863 59.632 8.616   1.00 34.10  ? 244 VAL A N   1 
ATOM   1620 C CA  . VAL A 1 244 ? 17.342 58.282 8.738   1.00 34.34  ? 244 VAL A CA  1 
ATOM   1621 C C   . VAL A 1 244 ? 16.118 58.368 9.655   1.00 34.08  ? 244 VAL A C   1 
ATOM   1622 O O   . VAL A 1 244 ? 15.068 57.789 9.384   1.00 34.77  ? 244 VAL A O   1 
ATOM   1623 C CB  . VAL A 1 244 ? 18.399 57.336 9.381   1.00 34.50  ? 244 VAL A CB  1 
ATOM   1624 C CG1 . VAL A 1 244 ? 17.758 56.015 9.777   1.00 33.25  ? 244 VAL A CG1 1 
ATOM   1625 C CG2 . VAL A 1 244 ? 19.533 57.093 8.411   1.00 32.97  ? 244 VAL A CG2 1 
ATOM   1626 N N   . ASN A 1 245 ? 16.274 59.110 10.742  1.00 34.31  ? 245 ASN A N   1 
ATOM   1627 C CA  . ASN A 1 245 ? 15.216 59.313 11.721  1.00 34.14  ? 245 ASN A CA  1 
ATOM   1628 C C   . ASN A 1 245 ? 14.001 59.969 11.064  1.00 34.25  ? 245 ASN A C   1 
ATOM   1629 O O   . ASN A 1 245 ? 12.865 59.540 11.248  1.00 32.70  ? 245 ASN A O   1 
ATOM   1630 C CB  . ASN A 1 245 ? 15.751 60.207 12.831  1.00 35.20  ? 245 ASN A CB  1 
ATOM   1631 C CG  . ASN A 1 245 ? 14.777 60.379 13.964  1.00 36.06  ? 245 ASN A CG  1 
ATOM   1632 O OD1 . ASN A 1 245 ? 13.703 59.775 13.975  1.00 34.70  ? 245 ASN A OD1 1 
ATOM   1633 N ND2 . ASN A 1 245 ? 15.151 61.208 14.941  1.00 36.22  ? 245 ASN A ND2 1 
ATOM   1634 N N   . ALA A 1 246 ? 14.251 61.020 10.297  1.00 33.91  ? 246 ALA A N   1 
ATOM   1635 C CA  . ALA A 1 246 ? 13.183 61.722 9.616   1.00 34.17  ? 246 ALA A CA  1 
ATOM   1636 C C   . ALA A 1 246 ? 12.450 60.780 8.668   1.00 35.39  ? 246 ALA A C   1 
ATOM   1637 O O   . ALA A 1 246 ? 11.228 60.686 8.698   1.00 38.12  ? 246 ALA A O   1 
ATOM   1638 C CB  . ALA A 1 246 ? 13.754 62.884 8.843   1.00 34.79  ? 246 ALA A CB  1 
ATOM   1639 N N   . GLN A 1 247 ? 13.207 60.083 7.827   1.00 34.36  ? 247 GLN A N   1 
ATOM   1640 C CA  . GLN A 1 247 ? 12.633 59.159 6.861   1.00 32.88  ? 247 GLN A CA  1 
ATOM   1641 C C   . GLN A 1 247 ? 11.844 58.031 7.518   1.00 33.60  ? 247 GLN A C   1 
ATOM   1642 O O   . GLN A 1 247 ? 10.927 57.482 6.914   1.00 32.40  ? 247 GLN A O   1 
ATOM   1643 C CB  . GLN A 1 247 ? 13.732 58.545 5.990   1.00 33.44  ? 247 GLN A CB  1 
ATOM   1644 C CG  . GLN A 1 247 ? 14.559 59.529 5.203   1.00 35.27  ? 247 GLN A CG  1 
ATOM   1645 C CD  . GLN A 1 247 ? 13.711 60.486 4.394   1.00 38.89  ? 247 GLN A CD  1 
ATOM   1646 O OE1 . GLN A 1 247 ? 12.741 60.084 3.737   1.00 39.33  ? 247 GLN A OE1 1 
ATOM   1647 N NE2 . GLN A 1 247 ? 14.079 61.767 4.423   1.00 39.31  ? 247 GLN A NE2 1 
ATOM   1648 N N   . LEU A 1 248 ? 12.208 57.666 8.742   1.00 35.13  ? 248 LEU A N   1 
ATOM   1649 C CA  . LEU A 1 248 ? 11.509 56.591 9.431   1.00 37.12  ? 248 LEU A CA  1 
ATOM   1650 C C   . LEU A 1 248 ? 10.188 57.068 10.008  1.00 38.86  ? 248 LEU A C   1 
ATOM   1651 O O   . LEU A 1 248 ? 9.171  56.382 9.893   1.00 40.31  ? 248 LEU A O   1 
ATOM   1652 C CB  . LEU A 1 248 ? 12.354 56.028 10.575  1.00 36.51  ? 248 LEU A CB  1 
ATOM   1653 C CG  . LEU A 1 248 ? 13.583 55.167 10.307  1.00 37.63  ? 248 LEU A CG  1 
ATOM   1654 C CD1 . LEU A 1 248 ? 14.177 54.730 11.642  1.00 39.42  ? 248 LEU A CD1 1 
ATOM   1655 C CD2 . LEU A 1 248 ? 13.211 53.953 9.491   1.00 38.22  ? 248 LEU A CD2 1 
ATOM   1656 N N   . MET A 1 249 ? 10.216 58.253 10.613  1.00 40.28  ? 249 MET A N   1 
ATOM   1657 C CA  . MET A 1 249 ? 9.049  58.847 11.270  1.00 41.87  ? 249 MET A CA  1 
ATOM   1658 C C   . MET A 1 249 ? 8.115  59.735 10.438  1.00 42.51  ? 249 MET A C   1 
ATOM   1659 O O   . MET A 1 249 ? 6.901  59.715 10.653  1.00 43.10  ? 249 MET A O   1 
ATOM   1660 C CB  . MET A 1 249 ? 9.507  59.654 12.487  1.00 43.02  ? 249 MET A CB  1 
ATOM   1661 C CG  . MET A 1 249 ? 10.443 58.911 13.415  1.00 42.51  ? 249 MET A CG  1 
ATOM   1662 S SD  . MET A 1 249 ? 9.701  57.408 13.982  1.00 43.11  ? 249 MET A SD  1 
ATOM   1663 C CE  . MET A 1 249 ? 8.454  58.102 15.065  1.00 47.26  ? 249 MET A CE  1 
ATOM   1664 N N   . SER A 1 250 ? 8.658  60.522 9.511   1.00 41.45  ? 250 SER A N   1 
ATOM   1665 C CA  . SER A 1 250 ? 7.815  61.399 8.699   1.00 42.07  ? 250 SER A CA  1 
ATOM   1666 C C   . SER A 1 250 ? 6.547  60.731 8.180   1.00 41.87  ? 250 SER A C   1 
ATOM   1667 O O   . SER A 1 250 ? 6.578  59.611 7.669   1.00 41.57  ? 250 SER A O   1 
ATOM   1668 C CB  . SER A 1 250 ? 8.582  61.947 7.505   1.00 42.75  ? 250 SER A CB  1 
ATOM   1669 O OG  . SER A 1 250 ? 7.691  62.640 6.649   1.00 42.24  ? 250 SER A OG  1 
ATOM   1670 N N   . PRO A 1 251 ? 5.407  61.425 8.295   1.00 41.91  ? 251 PRO A N   1 
ATOM   1671 C CA  . PRO A 1 251 ? 4.137  60.871 7.825   1.00 41.61  ? 251 PRO A CA  1 
ATOM   1672 C C   . PRO A 1 251 ? 4.151  60.667 6.314   1.00 41.92  ? 251 PRO A C   1 
ATOM   1673 O O   . PRO A 1 251 ? 3.401  59.845 5.787   1.00 44.26  ? 251 PRO A O   1 
ATOM   1674 C CB  . PRO A 1 251 ? 3.125  61.920 8.266   1.00 40.99  ? 251 PRO A CB  1 
ATOM   1675 C CG  . PRO A 1 251 ? 3.898  63.184 8.145   1.00 42.46  ? 251 PRO A CG  1 
ATOM   1676 C CD  . PRO A 1 251 ? 5.225  62.804 8.777   1.00 41.32  ? 251 PRO A CD  1 
ATOM   1677 N N   . VAL A 1 252 ? 5.015  61.413 5.630   1.00 39.91  ? 252 VAL A N   1 
ATOM   1678 C CA  . VAL A 1 252 ? 5.151  61.345 4.179   1.00 38.57  ? 252 VAL A CA  1 
ATOM   1679 C C   . VAL A 1 252 ? 5.796  60.050 3.707   1.00 40.69  ? 252 VAL A C   1 
ATOM   1680 O O   . VAL A 1 252 ? 5.512  59.574 2.606   1.00 40.36  ? 252 VAL A O   1 
ATOM   1681 C CB  . VAL A 1 252 ? 6.021  62.503 3.660   1.00 37.60  ? 252 VAL A CB  1 
ATOM   1682 C CG1 . VAL A 1 252 ? 6.354  62.303 2.196   1.00 37.57  ? 252 VAL A CG1 1 
ATOM   1683 C CG2 . VAL A 1 252 ? 5.308  63.811 3.861   1.00 37.46  ? 252 VAL A CG2 1 
ATOM   1684 N N   . THR A 1 253 ? 6.664  59.483 4.541   1.00 43.20  ? 253 THR A N   1 
ATOM   1685 C CA  . THR A 1 253 ? 7.383  58.262 4.190   1.00 44.68  ? 253 THR A CA  1 
ATOM   1686 C C   . THR A 1 253 ? 7.069  57.065 5.079   1.00 47.85  ? 253 THR A C   1 
ATOM   1687 O O   . THR A 1 253 ? 7.475  55.948 4.760   1.00 47.95  ? 253 THR A O   1 
ATOM   1688 C CB  . THR A 1 253 ? 8.907  58.487 4.252   1.00 43.43  ? 253 THR A CB  1 
ATOM   1689 O OG1 . THR A 1 253 ? 9.273  58.816 5.596   1.00 39.82  ? 253 THR A OG1 1 
ATOM   1690 C CG2 . THR A 1 253 ? 9.335  59.623 3.318   1.00 41.65  ? 253 THR A CG2 1 
ATOM   1691 N N   . ARG A 1 254 ? 6.368  57.294 6.190   1.00 50.96  ? 254 ARG A N   1 
ATOM   1692 C CA  . ARG A 1 254 ? 6.021  56.213 7.116   1.00 54.74  ? 254 ARG A CA  1 
ATOM   1693 C C   . ARG A 1 254 ? 5.635  54.926 6.408   1.00 56.02  ? 254 ARG A C   1 
ATOM   1694 O O   . ARG A 1 254 ? 4.831  54.929 5.476   1.00 55.61  ? 254 ARG A O   1 
ATOM   1695 C CB  . ARG A 1 254 ? 4.875  56.624 8.035   1.00 56.10  ? 254 ARG A CB  1 
ATOM   1696 C CG  . ARG A 1 254 ? 5.321  57.168 9.373   1.00 58.89  ? 254 ARG A CG  1 
ATOM   1697 C CD  . ARG A 1 254 ? 4.123  57.537 10.240  1.00 60.43  ? 254 ARG A CD  1 
ATOM   1698 N NE  . ARG A 1 254 ? 4.530  57.970 11.574  1.00 61.81  ? 254 ARG A NE  1 
ATOM   1699 N N   . GLY A 1 255 ? 6.208  53.821 6.867   1.00 57.63  ? 255 GLY A N   1 
ATOM   1700 C CA  . GLY A 1 255 ? 5.915  52.543 6.252   1.00 59.39  ? 255 GLY A CA  1 
ATOM   1701 C C   . GLY A 1 255 ? 7.125  52.034 5.501   1.00 59.94  ? 255 GLY A C   1 
ATOM   1702 O O   . GLY A 1 255 ? 7.770  51.081 5.936   1.00 61.60  ? 255 GLY A O   1 
ATOM   1703 N N   . LEU A 1 256 ? 7.430  52.678 4.378   1.00 59.79  ? 256 LEU A N   1 
ATOM   1704 C CA  . LEU A 1 256 ? 8.571  52.328 3.534   1.00 59.30  ? 256 LEU A CA  1 
ATOM   1705 C C   . LEU A 1 256 ? 9.700  51.575 4.251   1.00 57.90  ? 256 LEU A C   1 
ATOM   1706 O O   . LEU A 1 256 ? 9.976  50.417 3.932   1.00 58.95  ? 256 LEU A O   1 
ATOM   1707 C CB  . LEU A 1 256 ? 9.129  53.598 2.881   1.00 60.48  ? 256 LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 256 ? 8.392  54.119 1.640   1.00 63.23  ? 256 LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 256 ? 8.593  55.620 1.507   1.00 65.04  ? 256 LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 256 ? 8.897  53.386 0.392   1.00 63.88  ? 256 LEU A CD2 1 
ATOM   1711 N N   . VAL A 1 257 ? 10.349 52.230 5.209   1.00 54.62  ? 257 VAL A N   1 
ATOM   1712 C CA  . VAL A 1 257 ? 11.441 51.613 5.955   1.00 51.46  ? 257 VAL A CA  1 
ATOM   1713 C C   . VAL A 1 257 ? 11.122 51.668 7.444   1.00 50.20  ? 257 VAL A C   1 
ATOM   1714 O O   . VAL A 1 257 ? 10.652 52.685 7.948   1.00 49.77  ? 257 VAL A O   1 
ATOM   1715 C CB  . VAL A 1 257 ? 12.774 52.348 5.711   1.00 50.72  ? 257 VAL A CB  1 
ATOM   1716 C CG1 . VAL A 1 257 ? 13.928 51.484 6.159   1.00 49.20  ? 257 VAL A CG1 1 
ATOM   1717 C CG2 . VAL A 1 257 ? 12.904 52.717 4.250   1.00 47.98  ? 257 VAL A CG2 1 
ATOM   1718 N N   . LYS A 1 258 ? 11.372 50.569 8.144   1.00 49.10  ? 258 LYS A N   1 
ATOM   1719 C CA  . LYS A 1 258 ? 11.094 50.496 9.573   1.00 48.29  ? 258 LYS A CA  1 
ATOM   1720 C C   . LYS A 1 258 ? 12.315 49.954 10.318  1.00 46.90  ? 258 LYS A C   1 
ATOM   1721 O O   . LYS A 1 258 ? 12.199 49.485 11.452  1.00 46.65  ? 258 LYS A O   1 
ATOM   1722 C CB  . LYS A 1 258 ? 9.891  49.576 9.843   1.00 49.76  ? 258 LYS A CB  1 
ATOM   1723 C CG  . LYS A 1 258 ? 8.605  49.932 9.099   1.00 52.86  ? 258 LYS A CG  1 
ATOM   1724 C CD  . LYS A 1 258 ? 7.591  48.793 9.203   1.00 55.73  ? 258 LYS A CD  1 
ATOM   1725 C CE  . LYS A 1 258 ? 6.353  49.019 8.336   1.00 57.32  ? 258 LYS A CE  1 
ATOM   1726 N NZ  . LYS A 1 258 ? 5.499  50.149 8.811   1.00 58.61  ? 258 LYS A NZ  1 
ATOM   1727 N N   . ARG A 1 259 ? 13.478 50.002 9.673   1.00 44.49  ? 259 ARG A N   1 
ATOM   1728 C CA  . ARG A 1 259 ? 14.717 49.515 10.280  1.00 41.64  ? 259 ARG A CA  1 
ATOM   1729 C C   . ARG A 1 259 ? 15.844 50.499 9.974   1.00 39.84  ? 259 ARG A C   1 
ATOM   1730 O O   . ARG A 1 259 ? 16.095 50.813 8.806   1.00 40.14  ? 259 ARG A O   1 
ATOM   1731 C CB  . ARG A 1 259 ? 15.062 48.129 9.734   1.00 41.18  ? 259 ARG A CB  1 
ATOM   1732 C CG  . ARG A 1 259 ? 16.369 47.575 10.267  1.00 43.05  ? 259 ARG A CG  1 
ATOM   1733 C CD  . ARG A 1 259 ? 16.584 46.142 9.825   1.00 44.53  ? 259 ARG A CD  1 
ATOM   1734 N NE  . ARG A 1 259 ? 15.640 45.226 10.461  1.00 44.05  ? 259 ARG A NE  1 
ATOM   1735 C CZ  . ARG A 1 259 ? 15.478 43.960 10.095  1.00 45.30  ? 259 ARG A CZ  1 
ATOM   1736 N NH1 . ARG A 1 259 ? 16.193 43.453 9.098   1.00 45.78  ? 259 ARG A NH1 1 
ATOM   1737 N NH2 . ARG A 1 259 ? 14.597 43.199 10.725  1.00 46.05  ? 259 ARG A NH2 1 
ATOM   1738 N N   . GLY A 1 260 ? 16.528 50.985 11.008  1.00 35.40  ? 260 GLY A N   1 
ATOM   1739 C CA  . GLY A 1 260 ? 17.585 51.950 10.759  1.00 32.51  ? 260 GLY A CA  1 
ATOM   1740 C C   . GLY A 1 260 ? 18.655 52.178 11.812  1.00 30.33  ? 260 GLY A C   1 
ATOM   1741 O O   . GLY A 1 260 ? 18.480 51.905 13.003  1.00 28.42  ? 260 GLY A O   1 
ATOM   1742 N N   . MET A 1 261 ? 19.782 52.701 11.353  1.00 29.17  ? 261 MET A N   1 
ATOM   1743 C CA  . MET A 1 261 ? 20.895 52.964 12.237  1.00 30.69  ? 261 MET A CA  1 
ATOM   1744 C C   . MET A 1 261 ? 21.184 54.444 12.270  1.00 31.73  ? 261 MET A C   1 
ATOM   1745 O O   . MET A 1 261 ? 21.422 55.076 11.246  1.00 31.11  ? 261 MET A O   1 
ATOM   1746 C CB  . MET A 1 261 ? 22.131 52.203 11.775  1.00 29.35  ? 261 MET A CB  1 
ATOM   1747 C CG  . MET A 1 261 ? 23.346 52.421 12.627  1.00 25.77  ? 261 MET A CG  1 
ATOM   1748 S SD  . MET A 1 261 ? 24.704 51.431 12.000  1.00 27.73  ? 261 MET A SD  1 
ATOM   1749 C CE  . MET A 1 261 ? 25.914 51.731 13.252  1.00 25.09  ? 261 MET A CE  1 
ATOM   1750 N N   . MET A 1 262 ? 21.145 54.995 13.470  1.00 32.80  ? 262 MET A N   1 
ATOM   1751 C CA  . MET A 1 262 ? 21.398 56.403 13.659  1.00 33.27  ? 262 MET A CA  1 
ATOM   1752 C C   . MET A 1 262 ? 22.665 56.540 14.493  1.00 33.28  ? 262 MET A C   1 
ATOM   1753 O O   . MET A 1 262 ? 22.689 56.226 15.688  1.00 33.04  ? 262 MET A O   1 
ATOM   1754 C CB  . MET A 1 262 ? 20.188 57.045 14.349  1.00 32.49  ? 262 MET A CB  1 
ATOM   1755 C CG  . MET A 1 262 ? 18.944 57.022 13.479  1.00 31.35  ? 262 MET A CG  1 
ATOM   1756 S SD  . MET A 1 262 ? 17.386 57.050 14.376  1.00 35.05  ? 262 MET A SD  1 
ATOM   1757 C CE  . MET A 1 262 ? 17.412 58.692 15.067  1.00 34.50  ? 262 MET A CE  1 
ATOM   1758 N N   . GLN A 1 263 ? 23.728 56.989 13.841  1.00 33.03  ? 263 GLN A N   1 
ATOM   1759 C CA  . GLN A 1 263 ? 25.008 57.177 14.507  1.00 33.84  ? 263 GLN A CA  1 
ATOM   1760 C C   . GLN A 1 263 ? 25.186 58.643 14.873  1.00 34.12  ? 263 GLN A C   1 
ATOM   1761 O O   . GLN A 1 263 ? 25.463 59.470 14.002  1.00 34.53  ? 263 GLN A O   1 
ATOM   1762 C CB  . GLN A 1 263 ? 26.150 56.755 13.584  1.00 33.60  ? 263 GLN A CB  1 
ATOM   1763 C CG  . GLN A 1 263 ? 25.917 55.436 12.872  1.00 30.34  ? 263 GLN A CG  1 
ATOM   1764 C CD  . GLN A 1 263 ? 27.000 55.137 11.852  1.00 28.30  ? 263 GLN A CD  1 
ATOM   1765 O OE1 . GLN A 1 263 ? 26.955 54.111 11.175  1.00 26.31  ? 263 GLN A OE1 1 
ATOM   1766 N NE2 . GLN A 1 263 ? 27.985 56.029 11.746  1.00 23.37  ? 263 GLN A NE2 1 
ATOM   1767 N N   . SER A 1 264 ? 25.029 58.951 16.159  1.00 35.47  ? 264 SER A N   1 
ATOM   1768 C CA  . SER A 1 264 ? 25.177 60.309 16.677  1.00 36.40  ? 264 SER A CA  1 
ATOM   1769 C C   . SER A 1 264 ? 24.303 61.319 15.943  1.00 38.54  ? 264 SER A C   1 
ATOM   1770 O O   . SER A 1 264 ? 24.806 62.305 15.408  1.00 42.67  ? 264 SER A O   1 
ATOM   1771 C CB  . SER A 1 264 ? 26.637 60.749 16.585  1.00 34.61  ? 264 SER A CB  1 
ATOM   1772 O OG  . SER A 1 264 ? 27.490 59.723 17.052  1.00 35.96  ? 264 SER A OG  1 
ATOM   1773 N N   . GLY A 1 265 ? 22.999 61.085 15.912  1.00 39.08  ? 265 GLY A N   1 
ATOM   1774 C CA  . GLY A 1 265 ? 22.125 62.025 15.240  1.00 39.97  ? 265 GLY A CA  1 
ATOM   1775 C C   . GLY A 1 265 ? 20.664 61.685 15.427  1.00 41.74  ? 265 GLY A C   1 
ATOM   1776 O O   . GLY A 1 265 ? 20.204 60.630 14.994  1.00 42.96  ? 265 GLY A O   1 
ATOM   1777 N N   . THR A 1 266 ? 19.931 62.569 16.091  1.00 42.14  ? 266 THR A N   1 
ATOM   1778 C CA  . THR A 1 266 ? 18.510 62.347 16.318  1.00 42.66  ? 266 THR A CA  1 
ATOM   1779 C C   . THR A 1 266 ? 17.766 63.670 16.192  1.00 43.29  ? 266 THR A C   1 
ATOM   1780 O O   . THR A 1 266 ? 18.258 64.719 16.612  1.00 43.07  ? 266 THR A O   1 
ATOM   1781 C CB  . THR A 1 266 ? 18.237 61.720 17.711  1.00 40.71  ? 266 THR A CB  1 
ATOM   1782 O OG1 . THR A 1 266 ? 18.894 62.487 18.718  1.00 40.83  ? 266 THR A OG1 1 
ATOM   1783 C CG2 . THR A 1 266 ? 18.749 60.297 17.773  1.00 37.74  ? 266 THR A CG2 1 
ATOM   1784 N N   . MET A 1 267 ? 16.581 63.607 15.597  1.00 43.62  ? 267 MET A N   1 
ATOM   1785 C CA  . MET A 1 267 ? 15.758 64.790 15.385  1.00 44.21  ? 267 MET A CA  1 
ATOM   1786 C C   . MET A 1 267 ? 15.631 65.694 16.606  1.00 43.41  ? 267 MET A C   1 
ATOM   1787 O O   . MET A 1 267 ? 15.745 66.909 16.487  1.00 44.85  ? 267 MET A O   1 
ATOM   1788 C CB  . MET A 1 267 ? 14.368 64.370 14.905  1.00 47.74  ? 267 MET A CB  1 
ATOM   1789 C CG  . MET A 1 267 ? 14.348 63.756 13.512  1.00 48.25  ? 267 MET A CG  1 
ATOM   1790 S SD  . MET A 1 267 ? 14.732 64.983 12.270  1.00 51.98  ? 267 MET A SD  1 
ATOM   1791 C CE  . MET A 1 267 ? 13.081 65.492 11.867  1.00 50.79  ? 267 MET A CE  1 
ATOM   1792 N N   . ASN A 1 268 ? 15.397 65.112 17.775  1.00 42.31  ? 268 ASN A N   1 
ATOM   1793 C CA  . ASN A 1 268 ? 15.255 65.911 18.988  1.00 42.06  ? 268 ASN A CA  1 
ATOM   1794 C C   . ASN A 1 268 ? 16.496 66.740 19.310  1.00 41.26  ? 268 ASN A C   1 
ATOM   1795 O O   . ASN A 1 268 ? 16.405 67.730 20.035  1.00 39.92  ? 268 ASN A O   1 
ATOM   1796 C CB  . ASN A 1 268 ? 14.907 65.014 20.180  1.00 43.44  ? 268 ASN A CB  1 
ATOM   1797 C CG  . ASN A 1 268 ? 16.012 64.036 20.522  1.00 42.95  ? 268 ASN A CG  1 
ATOM   1798 O OD1 . ASN A 1 268 ? 16.572 63.384 19.643  1.00 46.78  ? 268 ASN A OD1 1 
ATOM   1799 N ND2 . ASN A 1 268 ? 16.322 63.921 21.803  1.00 42.68  ? 268 ASN A ND2 1 
ATOM   1800 N N   . ALA A 1 269 ? 17.649 66.342 18.776  1.00 41.11  ? 269 ALA A N   1 
ATOM   1801 C CA  . ALA A 1 269 ? 18.883 67.085 19.019  1.00 42.40  ? 269 ALA A CA  1 
ATOM   1802 C C   . ALA A 1 269 ? 18.618 68.555 18.699  1.00 43.41  ? 269 ALA A C   1 
ATOM   1803 O O   . ALA A 1 269 ? 17.852 68.868 17.789  1.00 44.82  ? 269 ALA A O   1 
ATOM   1804 C CB  . ALA A 1 269 ? 20.005 66.547 18.151  1.00 39.37  ? 269 ALA A CB  1 
ATOM   1805 N N   . PRO A 1 270 ? 19.241 69.478 19.443  1.00 43.71  ? 270 PRO A N   1 
ATOM   1806 C CA  . PRO A 1 270 ? 19.044 70.917 19.214  1.00 44.05  ? 270 PRO A CA  1 
ATOM   1807 C C   . PRO A 1 270 ? 19.320 71.426 17.800  1.00 43.92  ? 270 PRO A C   1 
ATOM   1808 O O   . PRO A 1 270 ? 18.613 72.310 17.311  1.00 47.06  ? 270 PRO A O   1 
ATOM   1809 C CB  . PRO A 1 270 ? 19.950 71.569 20.266  1.00 42.99  ? 270 PRO A CB  1 
ATOM   1810 C CG  . PRO A 1 270 ? 21.021 70.542 20.493  1.00 45.26  ? 270 PRO A CG  1 
ATOM   1811 C CD  . PRO A 1 270 ? 20.233 69.244 20.506  1.00 45.00  ? 270 PRO A CD  1 
ATOM   1812 N N   . TRP A 1 271 ? 20.333 70.863 17.148  1.00 42.27  ? 271 TRP A N   1 
ATOM   1813 C CA  . TRP A 1 271 ? 20.721 71.258 15.792  1.00 40.77  ? 271 TRP A CA  1 
ATOM   1814 C C   . TRP A 1 271 ? 19.998 70.492 14.683  1.00 39.69  ? 271 TRP A C   1 
ATOM   1815 O O   . TRP A 1 271 ? 20.119 70.833 13.516  1.00 40.46  ? 271 TRP A O   1 
ATOM   1816 C CB  . TRP A 1 271 ? 22.215 71.029 15.597  1.00 41.02  ? 271 TRP A CB  1 
ATOM   1817 C CG  . TRP A 1 271 ? 22.600 69.607 15.912  1.00 41.98  ? 271 TRP A CG  1 
ATOM   1818 C CD1 . TRP A 1 271 ? 22.968 69.108 17.131  1.00 41.43  ? 271 TRP A CD1 1 
ATOM   1819 C CD2 . TRP A 1 271 ? 22.549 68.482 15.021  1.00 41.64  ? 271 TRP A CD2 1 
ATOM   1820 N NE1 . TRP A 1 271 ? 23.144 67.748 17.053  1.00 41.58  ? 271 TRP A NE1 1 
ATOM   1821 C CE2 . TRP A 1 271 ? 22.893 67.337 15.771  1.00 39.72  ? 271 TRP A CE2 1 
ATOM   1822 C CE3 . TRP A 1 271 ? 22.237 68.330 13.662  1.00 41.45  ? 271 TRP A CE3 1 
ATOM   1823 C CZ2 . TRP A 1 271 ? 22.935 66.061 15.212  1.00 40.12  ? 271 TRP A CZ2 1 
ATOM   1824 C CZ3 . TRP A 1 271 ? 22.278 67.059 13.106  1.00 39.00  ? 271 TRP A CZ3 1 
ATOM   1825 C CH2 . TRP A 1 271 ? 22.624 65.941 13.880  1.00 39.47  ? 271 TRP A CH2 1 
ATOM   1826 N N   . SER A 1 272 ? 19.254 69.458 15.044  1.00 39.48  ? 272 SER A N   1 
ATOM   1827 C CA  . SER A 1 272 ? 18.578 68.634 14.055  1.00 40.16  ? 272 SER A CA  1 
ATOM   1828 C C   . SER A 1 272 ? 17.169 69.060 13.659  1.00 41.35  ? 272 SER A C   1 
ATOM   1829 O O   . SER A 1 272 ? 16.539 68.428 12.812  1.00 42.54  ? 272 SER A O   1 
ATOM   1830 C CB  . SER A 1 272 ? 18.561 67.182 14.531  1.00 39.69  ? 272 SER A CB  1 
ATOM   1831 O OG  . SER A 1 272 ? 18.006 66.342 13.543  1.00 43.07  ? 272 SER A OG  1 
ATOM   1832 N N   . HIS A 1 273 ? 16.650 70.113 14.270  1.00 42.68  ? 273 HIS A N   1 
ATOM   1833 C CA  . HIS A 1 273 ? 15.321 70.570 13.895  1.00 43.71  ? 273 HIS A CA  1 
ATOM   1834 C C   . HIS A 1 273 ? 15.229 72.073 14.036  1.00 43.32  ? 273 HIS A C   1 
ATOM   1835 O O   . HIS A 1 273 ? 16.089 72.702 14.641  1.00 42.84  ? 273 HIS A O   1 
ATOM   1836 C CB  . HIS A 1 273 ? 14.246 69.898 14.737  1.00 43.42  ? 273 HIS A CB  1 
ATOM   1837 C CG  . HIS A 1 273 ? 14.346 70.199 16.194  1.00 44.98  ? 273 HIS A CG  1 
ATOM   1838 N ND1 . HIS A 1 273 ? 15.198 69.518 17.036  1.00 45.12  ? 273 HIS A ND1 1 
ATOM   1839 C CD2 . HIS A 1 273 ? 13.703 71.109 16.960  1.00 45.02  ? 273 HIS A CD2 1 
ATOM   1840 C CE1 . HIS A 1 273 ? 15.072 69.993 18.262  1.00 43.95  ? 273 HIS A CE1 1 
ATOM   1841 N NE2 . HIS A 1 273 ? 14.172 70.959 18.243  1.00 44.60  ? 273 HIS A NE2 1 
ATOM   1842 N N   . MET A 1 274 ? 14.185 72.647 13.461  1.00 44.62  ? 274 MET A N   1 
ATOM   1843 C CA  . MET A 1 274 ? 13.999 74.083 13.505  1.00 44.96  ? 274 MET A CA  1 
ATOM   1844 C C   . MET A 1 274 ? 12.539 74.433 13.254  1.00 46.89  ? 274 MET A C   1 
ATOM   1845 O O   . MET A 1 274 ? 11.844 73.763 12.469  1.00 46.73  ? 274 MET A O   1 
ATOM   1846 C CB  . MET A 1 274 ? 14.881 74.729 12.443  1.00 44.52  ? 274 MET A CB  1 
ATOM   1847 C CG  . MET A 1 274 ? 14.887 76.235 12.439  1.00 45.84  ? 274 MET A CG  1 
ATOM   1848 S SD  . MET A 1 274 ? 15.886 76.872 11.075  1.00 46.33  ? 274 MET A SD  1 
ATOM   1849 C CE  . MET A 1 274 ? 17.531 76.564 11.710  1.00 48.57  ? 274 MET A CE  1 
ATOM   1850 N N   . THR A 1 275 ? 12.070 75.475 13.934  1.00 47.96  ? 275 THR A N   1 
ATOM   1851 C CA  . THR A 1 275 ? 10.694 75.934 13.779  1.00 47.71  ? 275 THR A CA  1 
ATOM   1852 C C   . THR A 1 275 ? 10.539 76.575 12.418  1.00 48.21  ? 275 THR A C   1 
ATOM   1853 O O   . THR A 1 275 ? 11.528 76.981 11.801  1.00 47.04  ? 275 THR A O   1 
ATOM   1854 C CB  . THR A 1 275 ? 10.330 77.000 14.811  1.00 45.95  ? 275 THR A CB  1 
ATOM   1855 O OG1 . THR A 1 275 ? 11.418 77.925 14.939  1.00 46.79  ? 275 THR A OG1 1 
ATOM   1856 C CG2 . THR A 1 275 ? 10.020 76.371 16.131  1.00 45.00  ? 275 THR A CG2 1 
ATOM   1857 N N   . SER A 1 276 ? 9.297  76.669 11.954  1.00 49.13  ? 276 SER A N   1 
ATOM   1858 C CA  . SER A 1 276 ? 9.027  77.302 10.674  1.00 49.51  ? 276 SER A CA  1 
ATOM   1859 C C   . SER A 1 276 ? 9.388  78.785 10.812  1.00 50.63  ? 276 SER A C   1 
ATOM   1860 O O   . SER A 1 276 ? 9.913  79.400 9.883   1.00 49.98  ? 276 SER A O   1 
ATOM   1861 C CB  . SER A 1 276 ? 7.551  77.151 10.313  1.00 47.20  ? 276 SER A CB  1 
ATOM   1862 O OG  . SER A 1 276 ? 7.278  77.766 9.069   1.00 45.48  ? 276 SER A OG  1 
ATOM   1863 N N   . GLU A 1 277 ? 9.126  79.340 11.994  1.00 52.61  ? 277 GLU A N   1 
ATOM   1864 C CA  . GLU A 1 277 ? 9.404  80.744 12.289  1.00 54.14  ? 277 GLU A CA  1 
ATOM   1865 C C   . GLU A 1 277 ? 10.870 81.120 12.119  1.00 54.20  ? 277 GLU A C   1 
ATOM   1866 O O   . GLU A 1 277 ? 11.195 82.083 11.424  1.00 53.43  ? 277 GLU A O   1 
ATOM   1867 C CB  . GLU A 1 277 ? 8.972  81.089 13.721  1.00 57.49  ? 277 GLU A CB  1 
ATOM   1868 C CG  . GLU A 1 277 ? 7.470  80.992 14.017  1.00 60.67  ? 277 GLU A CG  1 
ATOM   1869 C CD  . GLU A 1 277 ? 6.939  79.558 14.041  1.00 64.31  ? 277 GLU A CD  1 
ATOM   1870 O OE1 . GLU A 1 277 ? 7.743  78.612 14.245  1.00 66.24  ? 277 GLU A OE1 1 
ATOM   1871 O OE2 . GLU A 1 277 ? 5.709  79.382 13.872  1.00 64.73  ? 277 GLU A OE2 1 
ATOM   1872 N N   . LYS A 1 278 ? 11.756 80.372 12.768  1.00 55.93  ? 278 LYS A N   1 
ATOM   1873 C CA  . LYS A 1 278 ? 13.185 80.656 12.674  1.00 56.98  ? 278 LYS A CA  1 
ATOM   1874 C C   . LYS A 1 278 ? 13.714 80.350 11.284  1.00 56.39  ? 278 LYS A C   1 
ATOM   1875 O O   . LYS A 1 278 ? 14.754 80.864 10.887  1.00 57.54  ? 278 LYS A O   1 
ATOM   1876 C CB  . LYS A 1 278 ? 13.975 79.842 13.706  1.00 58.82  ? 278 LYS A CB  1 
ATOM   1877 C CG  . LYS A 1 278 ? 13.724 80.230 15.161  1.00 62.43  ? 278 LYS A CG  1 
ATOM   1878 C CD  . LYS A 1 278 ? 14.627 79.431 16.099  1.00 64.05  ? 278 LYS A CD  1 
ATOM   1879 C CE  . LYS A 1 278 ? 14.493 79.890 17.543  1.00 65.04  ? 278 LYS A CE  1 
ATOM   1880 N NZ  . LYS A 1 278 ? 15.442 79.183 18.457  1.00 65.25  ? 278 LYS A NZ  1 
ATOM   1881 N N   . ALA A 1 279 ? 12.998 79.505 10.547  1.00 56.02  ? 279 ALA A N   1 
ATOM   1882 C CA  . ALA A 1 279 ? 13.408 79.125 9.198   1.00 54.73  ? 279 ALA A CA  1 
ATOM   1883 C C   . ALA A 1 279 ? 13.174 80.266 8.220   1.00 53.70  ? 279 ALA A C   1 
ATOM   1884 O O   . ALA A 1 279 ? 14.007 80.532 7.353   1.00 53.06  ? 279 ALA A O   1 
ATOM   1885 C CB  . ALA A 1 279 ? 12.642 77.882 8.748   1.00 55.17  ? 279 ALA A CB  1 
ATOM   1886 N N   . VAL A 1 280 ? 12.029 80.928 8.362   1.00 52.71  ? 280 VAL A N   1 
ATOM   1887 C CA  . VAL A 1 280 ? 11.681 82.049 7.503   1.00 51.73  ? 280 VAL A CA  1 
ATOM   1888 C C   . VAL A 1 280 ? 12.626 83.192 7.801   1.00 52.03  ? 280 VAL A C   1 
ATOM   1889 O O   . VAL A 1 280 ? 13.151 83.837 6.897   1.00 51.51  ? 280 VAL A O   1 
ATOM   1890 C CB  . VAL A 1 280 ? 10.252 82.532 7.764   1.00 51.19  ? 280 VAL A CB  1 
ATOM   1891 C CG1 . VAL A 1 280 ? 9.958  83.753 6.916   1.00 50.62  ? 280 VAL A CG1 1 
ATOM   1892 C CG2 . VAL A 1 280 ? 9.274  81.430 7.463   1.00 49.52  ? 280 VAL A CG2 1 
ATOM   1893 N N   . GLU A 1 281 ? 12.835 83.438 9.087   1.00 53.24  ? 281 GLU A N   1 
ATOM   1894 C CA  . GLU A 1 281 ? 13.723 84.501 9.510   1.00 53.83  ? 281 GLU A CA  1 
ATOM   1895 C C   . GLU A 1 281 ? 15.083 84.260 8.880   1.00 52.41  ? 281 GLU A C   1 
ATOM   1896 O O   . GLU A 1 281 ? 15.706 85.192 8.388   1.00 53.92  ? 281 GLU A O   1 
ATOM   1897 C CB  . GLU A 1 281 ? 13.809 84.541 11.040  1.00 57.22  ? 281 GLU A CB  1 
ATOM   1898 C CG  . GLU A 1 281 ? 12.476 84.912 11.711  1.00 64.11  ? 281 GLU A CG  1 
ATOM   1899 C CD  . GLU A 1 281 ? 12.525 84.908 13.244  1.00 68.15  ? 281 GLU A CD  1 
ATOM   1900 O OE1 . GLU A 1 281 ? 13.570 84.524 13.821  1.00 71.09  ? 281 GLU A OE1 1 
ATOM   1901 O OE2 . GLU A 1 281 ? 11.510 85.288 13.875  1.00 69.56  ? 281 GLU A OE2 1 
ATOM   1902 N N   . ILE A 1 282 ? 15.536 83.009 8.868   1.00 50.82  ? 282 ILE A N   1 
ATOM   1903 C CA  . ILE A 1 282 ? 16.827 82.686 8.270   1.00 49.74  ? 282 ILE A CA  1 
ATOM   1904 C C   . ILE A 1 282 ? 16.716 82.758 6.757   1.00 50.33  ? 282 ILE A C   1 
ATOM   1905 O O   . ILE A 1 282 ? 17.683 83.086 6.067   1.00 50.44  ? 282 ILE A O   1 
ATOM   1906 C CB  . ILE A 1 282 ? 17.296 81.279 8.652   1.00 48.67  ? 282 ILE A CB  1 
ATOM   1907 C CG1 . ILE A 1 282 ? 17.526 81.210 10.160  1.00 48.14  ? 282 ILE A CG1 1 
ATOM   1908 C CG2 . ILE A 1 282 ? 18.585 80.945 7.907   1.00 47.53  ? 282 ILE A CG2 1 
ATOM   1909 C CD1 . ILE A 1 282 ? 17.727 79.818 10.691  1.00 47.35  ? 282 ILE A CD1 1 
ATOM   1910 N N   . GLY A 1 283 ? 15.524 82.449 6.255   1.00 51.04  ? 283 GLY A N   1 
ATOM   1911 C CA  . GLY A 1 283 ? 15.278 82.491 4.826   1.00 52.21  ? 283 GLY A CA  1 
ATOM   1912 C C   . GLY A 1 283 ? 15.404 83.902 4.281   1.00 52.79  ? 283 GLY A C   1 
ATOM   1913 O O   . GLY A 1 283 ? 16.210 84.158 3.378   1.00 51.25  ? 283 GLY A O   1 
ATOM   1914 N N   . LYS A 1 284 ? 14.608 84.820 4.828   1.00 52.90  ? 284 LYS A N   1 
ATOM   1915 C CA  . LYS A 1 284 ? 14.646 86.216 4.396   1.00 53.78  ? 284 LYS A CA  1 
ATOM   1916 C C   . LYS A 1 284 ? 16.081 86.739 4.485   1.00 54.17  ? 284 LYS A C   1 
ATOM   1917 O O   . LYS A 1 284 ? 16.557 87.443 3.588   1.00 53.67  ? 284 LYS A O   1 
ATOM   1918 C CB  . LYS A 1 284 ? 13.743 87.073 5.273   1.00 53.88  ? 284 LYS A CB  1 
ATOM   1919 C CG  . LYS A 1 284 ? 12.290 86.662 5.294   1.00 55.20  ? 284 LYS A CG  1 
ATOM   1920 C CD  . LYS A 1 284 ? 11.556 87.542 6.277   1.00 59.89  ? 284 LYS A CD  1 
ATOM   1921 C CE  . LYS A 1 284 ? 10.140 87.076 6.546   1.00 63.21  ? 284 LYS A CE  1 
ATOM   1922 N NZ  . LYS A 1 284 ? 9.565  87.752 7.762   1.00 63.65  ? 284 LYS A NZ  1 
ATOM   1923 N N   . ALA A 1 285 ? 16.760 86.391 5.577   1.00 54.37  ? 285 ALA A N   1 
ATOM   1924 C CA  . ALA A 1 285 ? 18.142 86.800 5.786   1.00 52.91  ? 285 ALA A CA  1 
ATOM   1925 C C   . ALA A 1 285 ? 18.911 86.442 4.523   1.00 52.72  ? 285 ALA A C   1 
ATOM   1926 O O   . ALA A 1 285 ? 19.576 87.289 3.937   1.00 52.73  ? 285 ALA A O   1 
ATOM   1927 C CB  . ALA A 1 285 ? 18.730 86.076 6.995   1.00 53.26  ? 285 ALA A CB  1 
ATOM   1928 N N   . LEU A 1 286 ? 18.806 85.186 4.101   1.00 52.12  ? 286 LEU A N   1 
ATOM   1929 C CA  . LEU A 1 286 ? 19.478 84.743 2.887   1.00 52.22  ? 286 LEU A CA  1 
ATOM   1930 C C   . LEU A 1 286 ? 19.035 85.621 1.707   1.00 52.92  ? 286 LEU A C   1 
ATOM   1931 O O   . LEU A 1 286 ? 19.869 86.114 0.945   1.00 50.65  ? 286 LEU A O   1 
ATOM   1932 C CB  . LEU A 1 286 ? 19.138 83.274 2.601   1.00 50.11  ? 286 LEU A CB  1 
ATOM   1933 C CG  . LEU A 1 286 ? 19.685 82.614 1.326   1.00 47.87  ? 286 LEU A CG  1 
ATOM   1934 C CD1 . LEU A 1 286 ? 21.207 82.439 1.392   1.00 46.07  ? 286 LEU A CD1 1 
ATOM   1935 C CD2 . LEU A 1 286 ? 18.999 81.270 1.152   1.00 45.60  ? 286 LEU A CD2 1 
ATOM   1936 N N   . ILE A 1 287 ? 17.722 85.815 1.565   1.00 55.23  ? 287 ILE A N   1 
ATOM   1937 C CA  . ILE A 1 287 ? 17.168 86.640 0.485   1.00 57.25  ? 287 ILE A CA  1 
ATOM   1938 C C   . ILE A 1 287 ? 17.909 87.971 0.393   1.00 59.00  ? 287 ILE A C   1 
ATOM   1939 O O   . ILE A 1 287 ? 18.599 88.239 -0.590  1.00 58.23  ? 287 ILE A O   1 
ATOM   1940 C CB  . ILE A 1 287 ? 15.683 86.975 0.715   1.00 56.64  ? 287 ILE A CB  1 
ATOM   1941 C CG1 . ILE A 1 287 ? 14.833 85.698 0.762   1.00 56.10  ? 287 ILE A CG1 1 
ATOM   1942 C CG2 . ILE A 1 287 ? 15.215 87.918 -0.375  1.00 57.43  ? 287 ILE A CG2 1 
ATOM   1943 C CD1 . ILE A 1 287 ? 14.491 85.112 -0.578  1.00 55.15  ? 287 ILE A CD1 1 
ATOM   1944 N N   . ASN A 1 288 ? 17.749 88.807 1.417   1.00 61.74  ? 288 ASN A N   1 
ATOM   1945 C CA  . ASN A 1 288 ? 18.413 90.104 1.449   1.00 65.45  ? 288 ASN A CA  1 
ATOM   1946 C C   . ASN A 1 288 ? 19.906 89.907 1.256   1.00 68.27  ? 288 ASN A C   1 
ATOM   1947 O O   . ASN A 1 288 ? 20.521 90.551 0.409   1.00 69.26  ? 288 ASN A O   1 
ATOM   1948 C CB  . ASN A 1 288 ? 18.168 90.806 2.781   1.00 65.51  ? 288 ASN A CB  1 
ATOM   1949 C CG  . ASN A 1 288 ? 16.721 91.191 2.980   1.00 67.17  ? 288 ASN A CG  1 
ATOM   1950 O OD1 . ASN A 1 288 ? 16.084 91.739 2.077   1.00 68.17  ? 288 ASN A OD1 1 
ATOM   1951 N ND2 . ASN A 1 288 ? 16.193 90.924 4.173   1.00 68.14  ? 288 ASN A ND2 1 
ATOM   1952 N N   . ASP A 1 289 ? 20.482 89.016 2.059   1.00 71.06  ? 289 ASP A N   1 
ATOM   1953 C CA  . ASP A 1 289 ? 21.901 88.700 1.980   1.00 73.56  ? 289 ASP A CA  1 
ATOM   1954 C C   . ASP A 1 289 ? 22.318 88.482 0.522   1.00 76.00  ? 289 ASP A C   1 
ATOM   1955 O O   . ASP A 1 289 ? 23.450 88.777 0.145   1.00 75.89  ? 289 ASP A O   1 
ATOM   1956 C CB  . ASP A 1 289 ? 22.196 87.435 2.796   1.00 74.05  ? 289 ASP A CB  1 
ATOM   1957 C CG  . ASP A 1 289 ? 22.675 87.739 4.206   1.00 74.20  ? 289 ASP A CG  1 
ATOM   1958 O OD1 . ASP A 1 289 ? 23.896 87.915 4.390   1.00 74.74  ? 289 ASP A OD1 1 
ATOM   1959 O OD2 . ASP A 1 289 ? 21.840 87.806 5.131   1.00 74.45  ? 289 ASP A OD2 1 
ATOM   1960 N N   . CYS A 1 290 ? 21.397 87.973 -0.295  1.00 78.46  ? 290 CYS A N   1 
ATOM   1961 C CA  . CYS A 1 290 ? 21.684 87.710 -1.703  1.00 81.07  ? 290 CYS A CA  1 
ATOM   1962 C C   . CYS A 1 290 ? 21.210 88.805 -2.655  1.00 82.43  ? 290 CYS A C   1 
ATOM   1963 O O   . CYS A 1 290 ? 21.247 88.626 -3.875  1.00 83.03  ? 290 CYS A O   1 
ATOM   1964 C CB  . CYS A 1 290 ? 21.063 86.377 -2.129  1.00 81.38  ? 290 CYS A CB  1 
ATOM   1965 S SG  . CYS A 1 290 ? 21.866 84.904 -1.460  1.00 83.69  ? 290 CYS A SG  1 
ATOM   1966 N N   . ASN A 1 291 ? 20.773 89.932 -2.102  1.00 83.24  ? 291 ASN A N   1 
ATOM   1967 C CA  . ASN A 1 291 ? 20.295 91.051 -2.909  1.00 83.62  ? 291 ASN A CA  1 
ATOM   1968 C C   . ASN A 1 291 ? 19.004 90.700 -3.616  1.00 82.74  ? 291 ASN A C   1 
ATOM   1969 O O   . ASN A 1 291 ? 19.019 90.378 -4.801  1.00 83.56  ? 291 ASN A O   1 
ATOM   1970 C CB  . ASN A 1 291 ? 21.329 91.447 -3.971  1.00 86.21  ? 291 ASN A CB  1 
ATOM   1971 C CG  . ASN A 1 291 ? 22.383 92.392 -3.444  1.00 87.64  ? 291 ASN A CG  1 
ATOM   1972 O OD1 . ASN A 1 291 ? 23.169 92.042 -2.563  1.00 88.39  ? 291 ASN A OD1 1 
ATOM   1973 N ND2 . ASN A 1 291 ? 22.408 93.606 -3.987  1.00 89.08  ? 291 ASN A ND2 1 
ATOM   1974 N N   . CYS A 1 292 ? 17.888 90.766 -2.900  1.00 81.62  ? 292 CYS A N   1 
ATOM   1975 C CA  . CYS A 1 292 ? 16.599 90.454 -3.500  1.00 80.17  ? 292 CYS A CA  1 
ATOM   1976 C C   . CYS A 1 292 ? 15.425 90.984 -2.687  1.00 81.15  ? 292 CYS A C   1 
ATOM   1977 O O   . CYS A 1 292 ? 14.321 90.465 -2.794  1.00 81.14  ? 292 CYS A O   1 
ATOM   1978 C CB  . CYS A 1 292 ? 16.437 88.941 -3.677  1.00 78.81  ? 292 CYS A CB  1 
ATOM   1979 S SG  . CYS A 1 292 ? 17.431 88.125 -4.979  1.00 73.88  ? 292 CYS A SG  1 
ATOM   1980 N N   . ASN A 1 293 ? 15.665 92.024 -1.894  1.00 82.42  ? 293 ASN A N   1 
ATOM   1981 C CA  . ASN A 1 293 ? 14.631 92.635 -1.049  1.00 84.22  ? 293 ASN A CA  1 
ATOM   1982 C C   . ASN A 1 293 ? 13.577 91.645 -0.569  1.00 84.29  ? 293 ASN A C   1 
ATOM   1983 O O   . ASN A 1 293 ? 12.547 91.462 -1.221  1.00 83.96  ? 293 ASN A O   1 
ATOM   1984 C CB  . ASN A 1 293 ? 13.898 93.772 -1.772  1.00 85.14  ? 293 ASN A CB  1 
ATOM   1985 C CG  . ASN A 1 293 ? 14.698 94.369 -2.901  1.00 86.93  ? 293 ASN A CG  1 
ATOM   1986 O OD1 . ASN A 1 293 ? 15.870 94.711 -2.740  1.00 87.71  ? 293 ASN A OD1 1 
ATOM   1987 N ND2 . ASN A 1 293 ? 14.060 94.513 -4.059  1.00 88.35  ? 293 ASN A ND2 1 
ATOM   1988 N N   . ALA A 1 294 ? 13.823 91.023 0.578   1.00 84.00  ? 294 ALA A N   1 
ATOM   1989 C CA  . ALA A 1 294 ? 12.876 90.069 1.125   1.00 84.63  ? 294 ALA A CA  1 
ATOM   1990 C C   . ALA A 1 294 ? 11.566 90.765 1.482   1.00 85.71  ? 294 ALA A C   1 
ATOM   1991 O O   . ALA A 1 294 ? 10.601 90.118 1.884   1.00 85.55  ? 294 ALA A O   1 
ATOM   1992 C CB  . ALA A 1 294 ? 13.465 89.401 2.354   1.00 83.73  ? 294 ALA A CB  1 
ATOM   1993 N N   . SER A 1 295 ? 11.530 92.085 1.323   1.00 87.15  ? 295 SER A N   1 
ATOM   1994 C CA  . SER A 1 295 ? 10.338 92.860 1.650   1.00 88.25  ? 295 SER A CA  1 
ATOM   1995 C C   . SER A 1 295 ? 9.187  92.653 0.670   1.00 89.26  ? 295 SER A C   1 
ATOM   1996 O O   . SER A 1 295 ? 8.044  92.984 0.977   1.00 89.24  ? 295 SER A O   1 
ATOM   1997 C CB  . SER A 1 295 ? 10.675 94.355 1.719   1.00 87.45  ? 295 SER A CB  1 
ATOM   1998 O OG  . SER A 1 295 ? 10.976 94.883 0.436   1.00 86.77  ? 295 SER A OG  1 
ATOM   1999 N N   . MET A 1 296 ? 9.480  92.103 -0.502  1.00 90.24  ? 296 MET A N   1 
ATOM   2000 C CA  . MET A 1 296 ? 8.442  91.895 -1.500  1.00 92.60  ? 296 MET A CA  1 
ATOM   2001 C C   . MET A 1 296 ? 7.738  90.539 -1.451  1.00 93.64  ? 296 MET A C   1 
ATOM   2002 O O   . MET A 1 296 ? 6.798  90.302 -2.209  1.00 93.89  ? 296 MET A O   1 
ATOM   2003 C CB  . MET A 1 296 ? 9.023  92.136 -2.895  1.00 93.68  ? 296 MET A CB  1 
ATOM   2004 C CG  . MET A 1 296 ? 8.630  93.478 -3.491  1.00 95.30  ? 296 MET A CG  1 
ATOM   2005 S SD  . MET A 1 296 ? 9.787  94.074 -4.742  1.00 97.27  ? 296 MET A SD  1 
ATOM   2006 C CE  . MET A 1 296 ? 9.130  95.710 -5.028  1.00 97.91  ? 296 MET A CE  1 
ATOM   2007 N N   . LEU A 1 297 ? 8.175  89.663 -0.549  1.00 94.79  ? 297 LEU A N   1 
ATOM   2008 C CA  . LEU A 1 297 ? 7.593  88.325 -0.414  1.00 95.43  ? 297 LEU A CA  1 
ATOM   2009 C C   . LEU A 1 297 ? 6.073  88.223 -0.459  1.00 96.35  ? 297 LEU A C   1 
ATOM   2010 O O   . LEU A 1 297 ? 5.543  87.309 -1.081  1.00 97.21  ? 297 LEU A O   1 
ATOM   2011 C CB  . LEU A 1 297 ? 8.093  87.661 0.864   1.00 95.13  ? 297 LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 297 ? 9.532  87.161 0.793   1.00 94.97  ? 297 LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 297 ? 9.949  86.652 2.149   1.00 96.19  ? 297 LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 297 ? 9.646  86.060 -0.239  1.00 95.32  ? 297 LEU A CD2 1 
ATOM   2015 N N   . LYS A 1 298 ? 5.364  89.129 0.205   1.00 97.53  ? 298 LYS A N   1 
ATOM   2016 C CA  . LYS A 1 298 ? 3.906  89.077 0.174   1.00 98.25  ? 298 LYS A CA  1 
ATOM   2017 C C   . LYS A 1 298 ? 3.349  89.800 -1.048  1.00 98.17  ? 298 LYS A C   1 
ATOM   2018 O O   . LYS A 1 298 ? 2.466  89.283 -1.735  1.00 98.79  ? 298 LYS A O   1 
ATOM   2019 C CB  . LYS A 1 298 ? 3.304  89.680 1.450   1.00 98.89  ? 298 LYS A CB  1 
ATOM   2020 C CG  . LYS A 1 298 ? 1.817  90.057 1.319   1.00 99.88  ? 298 LYS A CG  1 
ATOM   2021 C CD  . LYS A 1 298 ? 0.962  88.924 0.734   1.00 98.54  ? 298 LYS A CD  1 
ATOM   2022 C CE  . LYS A 1 298 ? -0.412 89.428 0.313   1.00 97.29  ? 298 LYS A CE  1 
ATOM   2023 N NZ  . LYS A 1 298 ? -1.170 88.401 -0.447  1.00 96.85  ? 298 LYS A NZ  1 
ATOM   2024 N N   . THR A 1 299 ? 3.862  90.995 -1.320  1.00 97.64  ? 299 THR A N   1 
ATOM   2025 C CA  . THR A 1 299 ? 3.394  91.759 -2.465  1.00 97.11  ? 299 THR A CA  1 
ATOM   2026 C C   . THR A 1 299 ? 3.673  91.001 -3.760  1.00 96.46  ? 299 THR A C   1 
ATOM   2027 O O   . THR A 1 299 ? 2.757  90.462 -4.379  1.00 96.63  ? 299 THR A O   1 
ATOM   2028 C CB  . THR A 1 299 ? 4.063  93.152 -2.529  1.00 97.02  ? 299 THR A CB  1 
ATOM   2029 O OG1 . THR A 1 299 ? 5.471  93.009 -2.753  1.00 97.33  ? 299 THR A OG1 1 
ATOM   2030 C CG2 . THR A 1 299 ? 3.841  93.896 -1.229  1.00 96.78  ? 299 THR A CG2 1 
ATOM   2031 N N   . ASN A 1 300 ? 4.940  90.946 -4.157  1.00 95.57  ? 300 ASN A N   1 
ATOM   2032 C CA  . ASN A 1 300 ? 5.317  90.258 -5.384  1.00 93.99  ? 300 ASN A CA  1 
ATOM   2033 C C   . ASN A 1 300 ? 6.247  89.073 -5.119  1.00 91.80  ? 300 ASN A C   1 
ATOM   2034 O O   . ASN A 1 300 ? 7.469  89.193 -5.227  1.00 90.83  ? 300 ASN A O   1 
ATOM   2035 C CB  . ASN A 1 300 ? 5.996  91.237 -6.340  1.00 95.93  ? 300 ASN A CB  1 
ATOM   2036 C CG  . ASN A 1 300 ? 5.905  90.790 -7.780  1.00 97.49  ? 300 ASN A CG  1 
ATOM   2037 O OD1 . ASN A 1 300 ? 6.167  89.630 -8.100  1.00 98.75  ? 300 ASN A OD1 1 
ATOM   2038 N ND2 . ASN A 1 300 ? 5.533  91.712 -8.663  1.00 99.03  ? 300 ASN A ND2 1 
ATOM   2039 N N   . PRO A 1 301 ? 5.675  87.908 -4.770  1.00 90.06  ? 301 PRO A N   1 
ATOM   2040 C CA  . PRO A 1 301 ? 6.461  86.702 -4.491  1.00 88.16  ? 301 PRO A CA  1 
ATOM   2041 C C   . PRO A 1 301 ? 7.285  86.263 -5.694  1.00 86.92  ? 301 PRO A C   1 
ATOM   2042 O O   . PRO A 1 301 ? 8.507  86.183 -5.630  1.00 86.38  ? 301 PRO A O   1 
ATOM   2043 C CB  . PRO A 1 301 ? 5.395  85.670 -4.132  1.00 87.88  ? 301 PRO A CB  1 
ATOM   2044 C CG  . PRO A 1 301 ? 4.283  86.500 -3.573  1.00 88.44  ? 301 PRO A CG  1 
ATOM   2045 C CD  . PRO A 1 301 ? 4.243  87.665 -4.524  1.00 89.68  ? 301 PRO A CD  1 
ATOM   2046 N N   . ALA A 1 302 ? 6.596  85.990 -6.795  1.00 86.45  ? 302 ALA A N   1 
ATOM   2047 C CA  . ALA A 1 302 ? 7.236  85.536 -8.020  1.00 85.87  ? 302 ALA A CA  1 
ATOM   2048 C C   . ALA A 1 302 ? 8.521  86.281 -8.359  1.00 85.47  ? 302 ALA A C   1 
ATOM   2049 O O   . ALA A 1 302 ? 9.462  85.696 -8.894  1.00 85.07  ? 302 ALA A O   1 
ATOM   2050 C CB  . ALA A 1 302 ? 6.255  85.638 -9.179  1.00 84.88  ? 302 ALA A CB  1 
ATOM   2051 N N   . HIS A 1 303 ? 8.565  87.568 -8.035  1.00 85.69  ? 303 HIS A N   1 
ATOM   2052 C CA  . HIS A 1 303 ? 9.734  88.384 -8.345  1.00 85.72  ? 303 HIS A CA  1 
ATOM   2053 C C   . HIS A 1 303 ? 10.966 88.087 -7.494  1.00 83.93  ? 303 HIS A C   1 
ATOM   2054 O O   . HIS A 1 303 ? 12.074 87.936 -8.025  1.00 82.63  ? 303 HIS A O   1 
ATOM   2055 C CB  . HIS A 1 303 ? 9.387  89.867 -8.220  1.00 88.99  ? 303 HIS A CB  1 
ATOM   2056 C CG  . HIS A 1 303 ? 10.487 90.774 -8.671  1.00 92.13  ? 303 HIS A CG  1 
ATOM   2057 N ND1 . HIS A 1 303 ? 10.933 91.836 -7.915  1.00 93.94  ? 303 HIS A ND1 1 
ATOM   2058 C CD2 . HIS A 1 303 ? 11.239 90.769 -9.796  1.00 92.79  ? 303 HIS A CD2 1 
ATOM   2059 C CE1 . HIS A 1 303 ? 11.916 92.447 -8.554  1.00 95.37  ? 303 HIS A CE1 1 
ATOM   2060 N NE2 . HIS A 1 303 ? 12.119 91.816 -9.700  1.00 95.18  ? 303 HIS A NE2 1 
ATOM   2061 N N   . VAL A 1 304 ? 10.779 88.021 -6.177  1.00 81.37  ? 304 VAL A N   1 
ATOM   2062 C CA  . VAL A 1 304 ? 11.888 87.747 -5.271  1.00 78.15  ? 304 VAL A CA  1 
ATOM   2063 C C   . VAL A 1 304 ? 12.447 86.355 -5.551  1.00 75.67  ? 304 VAL A C   1 
ATOM   2064 O O   . VAL A 1 304 ? 13.654 86.172 -5.693  1.00 74.70  ? 304 VAL A O   1 
ATOM   2065 C CB  . VAL A 1 304 ? 11.450 87.853 -3.783  1.00 78.16  ? 304 VAL A CB  1 
ATOM   2066 C CG1 . VAL A 1 304 ? 10.864 89.227 -3.510  1.00 78.22  ? 304 VAL A CG1 1 
ATOM   2067 C CG2 . VAL A 1 304 ? 10.439 86.789 -3.453  1.00 78.72  ? 304 VAL A CG2 1 
ATOM   2068 N N   . MET A 1 305 ? 11.559 85.375 -5.650  1.00 73.05  ? 305 MET A N   1 
ATOM   2069 C CA  . MET A 1 305 ? 11.983 84.015 -5.923  1.00 71.19  ? 305 MET A CA  1 
ATOM   2070 C C   . MET A 1 305 ? 12.751 83.964 -7.238  1.00 71.18  ? 305 MET A C   1 
ATOM   2071 O O   . MET A 1 305 ? 13.844 83.402 -7.301  1.00 72.13  ? 305 MET A O   1 
ATOM   2072 C CB  . MET A 1 305 ? 10.772 83.080 -5.977  1.00 68.95  ? 305 MET A CB  1 
ATOM   2073 C CG  . MET A 1 305 ? 10.070 82.883 -4.636  1.00 64.24  ? 305 MET A CG  1 
ATOM   2074 S SD  . MET A 1 305 ? 11.173 82.299 -3.331  1.00 58.82  ? 305 MET A SD  1 
ATOM   2075 C CE  . MET A 1 305 ? 12.059 80.988 -4.165  1.00 58.90  ? 305 MET A CE  1 
ATOM   2076 N N   . SER A 1 306 ? 12.181 84.555 -8.285  1.00 70.98  ? 306 SER A N   1 
ATOM   2077 C CA  . SER A 1 306 ? 12.830 84.576 -9.593  1.00 70.97  ? 306 SER A CA  1 
ATOM   2078 C C   . SER A 1 306 ? 14.197 85.229 -9.454  1.00 69.18  ? 306 SER A C   1 
ATOM   2079 O O   . SER A 1 306 ? 15.117 84.945 -10.215 1.00 68.66  ? 306 SER A O   1 
ATOM   2080 C CB  . SER A 1 306 ? 11.988 85.363 -10.587 1.00 72.26  ? 306 SER A CB  1 
ATOM   2081 O OG  . SER A 1 306 ? 11.822 86.690 -10.130 1.00 76.13  ? 306 SER A OG  1 
ATOM   2082 N N   . CYS A 1 307 ? 14.313 86.110 -8.471  1.00 68.27  ? 307 CYS A N   1 
ATOM   2083 C CA  . CYS A 1 307 ? 15.564 86.802 -8.197  1.00 68.25  ? 307 CYS A CA  1 
ATOM   2084 C C   . CYS A 1 307 ? 16.552 85.806 -7.601  1.00 66.15  ? 307 CYS A C   1 
ATOM   2085 O O   . CYS A 1 307 ? 17.733 85.794 -7.960  1.00 65.33  ? 307 CYS A O   1 
ATOM   2086 C CB  . CYS A 1 307 ? 15.308 87.934 -7.199  1.00 71.29  ? 307 CYS A CB  1 
ATOM   2087 S SG  . CYS A 1 307 ? 16.748 88.943 -6.713  1.00 75.98  ? 307 CYS A SG  1 
ATOM   2088 N N   . MET A 1 308 ? 16.042 84.976 -6.688  1.00 63.60  ? 308 MET A N   1 
ATOM   2089 C CA  . MET A 1 308 ? 16.822 83.960 -5.989  1.00 60.79  ? 308 MET A CA  1 
ATOM   2090 C C   . MET A 1 308 ? 17.332 82.832 -6.878  1.00 60.80  ? 308 MET A C   1 
ATOM   2091 O O   . MET A 1 308 ? 18.345 82.204 -6.574  1.00 59.60  ? 308 MET A O   1 
ATOM   2092 C CB  . MET A 1 308 ? 15.996 83.378 -4.845  1.00 59.03  ? 308 MET A CB  1 
ATOM   2093 C CG  . MET A 1 308 ? 15.821 84.327 -3.681  1.00 58.39  ? 308 MET A CG  1 
ATOM   2094 S SD  . MET A 1 308 ? 17.259 84.365 -2.593  1.00 58.65  ? 308 MET A SD  1 
ATOM   2095 C CE  . MET A 1 308 ? 18.358 85.387 -3.498  1.00 60.71  ? 308 MET A CE  1 
ATOM   2096 N N   . ARG A 1 309 ? 16.629 82.561 -7.969  1.00 60.45  ? 309 ARG A N   1 
ATOM   2097 C CA  . ARG A 1 309 ? 17.058 81.521 -8.885  1.00 60.62  ? 309 ARG A CA  1 
ATOM   2098 C C   . ARG A 1 309 ? 18.053 82.162 -9.841  1.00 62.51  ? 309 ARG A C   1 
ATOM   2099 O O   . ARG A 1 309 ? 18.736 81.475 -10.602 1.00 63.67  ? 309 ARG A O   1 
ATOM   2100 C CB  . ARG A 1 309 ? 15.864 80.981 -9.653  1.00 58.78  ? 309 ARG A CB  1 
ATOM   2101 C CG  . ARG A 1 309 ? 14.776 80.493 -8.748  1.00 57.94  ? 309 ARG A CG  1 
ATOM   2102 C CD  . ARG A 1 309 ? 13.448 80.432 -9.464  1.00 59.17  ? 309 ARG A CD  1 
ATOM   2103 N NE  . ARG A 1 309 ? 12.408 79.957 -8.563  1.00 58.35  ? 309 ARG A NE  1 
ATOM   2104 C CZ  . ARG A 1 309 ? 12.470 78.794 -7.931  1.00 57.88  ? 309 ARG A CZ  1 
ATOM   2105 N NH1 . ARG A 1 309 ? 13.522 78.009 -8.122  1.00 58.01  ? 309 ARG A NH1 1 
ATOM   2106 N NH2 . ARG A 1 309 ? 11.498 78.424 -7.109  1.00 57.46  ? 309 ARG A NH2 1 
ATOM   2107 N N   . SER A 1 310 ? 18.132 83.488 -9.788  1.00 63.11  ? 310 SER A N   1 
ATOM   2108 C CA  . SER A 1 310 ? 19.041 84.244 -10.641 1.00 64.45  ? 310 SER A CA  1 
ATOM   2109 C C   . SER A 1 310 ? 20.433 84.311 -10.033 1.00 64.86  ? 310 SER A C   1 
ATOM   2110 O O   . SER A 1 310 ? 21.435 84.185 -10.738 1.00 63.84  ? 310 SER A O   1 
ATOM   2111 C CB  . SER A 1 310 ? 18.518 85.666 -10.845 1.00 65.47  ? 310 SER A CB  1 
ATOM   2112 O OG  . SER A 1 310 ? 17.263 85.656 -11.496 1.00 67.86  ? 310 SER A OG  1 
ATOM   2113 N N   . VAL A 1 311 ? 20.487 84.519 -8.721  1.00 65.11  ? 311 VAL A N   1 
ATOM   2114 C CA  . VAL A 1 311 ? 21.757 84.609 -8.023  1.00 67.03  ? 311 VAL A CA  1 
ATOM   2115 C C   . VAL A 1 311 ? 22.550 83.318 -8.187  1.00 68.05  ? 311 VAL A C   1 
ATOM   2116 O O   . VAL A 1 311 ? 21.987 82.225 -8.157  1.00 68.84  ? 311 VAL A O   1 
ATOM   2117 C CB  . VAL A 1 311 ? 21.544 84.885 -6.527  1.00 67.17  ? 311 VAL A CB  1 
ATOM   2118 C CG1 . VAL A 1 311 ? 20.615 86.068 -6.349  1.00 68.77  ? 311 VAL A CG1 1 
ATOM   2119 C CG2 . VAL A 1 311 ? 20.964 83.676 -5.852  1.00 68.84  ? 311 VAL A CG2 1 
ATOM   2120 N N   . ASP A 1 312 ? 23.861 83.447 -8.372  1.00 69.43  ? 312 ASP A N   1 
ATOM   2121 C CA  . ASP A 1 312 ? 24.721 82.282 -8.542  1.00 69.13  ? 312 ASP A CA  1 
ATOM   2122 C C   . ASP A 1 312 ? 24.722 81.440 -7.273  1.00 67.11  ? 312 ASP A C   1 
ATOM   2123 O O   . ASP A 1 312 ? 24.548 81.957 -6.164  1.00 65.39  ? 312 ASP A O   1 
ATOM   2124 C CB  . ASP A 1 312 ? 26.157 82.711 -8.883  1.00 72.57  ? 312 ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 312 ? 26.234 83.582 -10.135 1.00 74.85  ? 312 ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 312 ? 25.789 84.752 -10.079 1.00 76.49  ? 312 ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 312 ? 26.735 83.095 -11.174 1.00 75.22  ? 312 ASP A OD2 1 
ATOM   2128 N N   . ALA A 1 313 ? 24.921 80.140 -7.451  1.00 65.41  ? 313 ALA A N   1 
ATOM   2129 C CA  . ALA A 1 313 ? 24.940 79.202 -6.340  1.00 64.67  ? 313 ALA A CA  1 
ATOM   2130 C C   . ALA A 1 313 ? 26.014 79.539 -5.310  1.00 63.63  ? 313 ALA A C   1 
ATOM   2131 O O   . ALA A 1 313 ? 25.809 79.348 -4.112  1.00 64.14  ? 313 ALA A O   1 
ATOM   2132 C CB  . ALA A 1 313 ? 25.140 77.777 -6.862  1.00 63.34  ? 313 ALA A CB  1 
ATOM   2133 N N   . LYS A 1 314 ? 27.158 80.035 -5.765  1.00 62.45  ? 314 LYS A N   1 
ATOM   2134 C CA  . LYS A 1 314 ? 28.231 80.378 -4.836  1.00 61.42  ? 314 LYS A CA  1 
ATOM   2135 C C   . LYS A 1 314 ? 27.783 81.499 -3.916  1.00 60.22  ? 314 LYS A C   1 
ATOM   2136 O O   . LYS A 1 314 ? 28.117 81.518 -2.731  1.00 59.27  ? 314 LYS A O   1 
ATOM   2137 C CB  . LYS A 1 314 ? 29.494 80.795 -5.593  1.00 61.52  ? 314 LYS A CB  1 
ATOM   2138 C CG  . LYS A 1 314 ? 30.697 79.904 -5.307  1.00 62.14  ? 314 LYS A CG  1 
ATOM   2139 C CD  . LYS A 1 314 ? 31.110 79.984 -3.841  1.00 62.49  ? 314 LYS A CD  1 
ATOM   2140 C CE  . LYS A 1 314 ? 32.194 78.969 -3.509  1.00 62.69  ? 314 LYS A CE  1 
ATOM   2141 N NZ  . LYS A 1 314 ? 33.418 79.155 -4.335  1.00 62.14  ? 314 LYS A NZ  1 
ATOM   2142 N N   . THR A 1 315 ? 27.017 82.430 -4.471  1.00 60.04  ? 315 THR A N   1 
ATOM   2143 C CA  . THR A 1 315 ? 26.515 83.551 -3.696  1.00 58.46  ? 315 THR A CA  1 
ATOM   2144 C C   . THR A 1 315 ? 25.651 83.002 -2.579  1.00 56.58  ? 315 THR A C   1 
ATOM   2145 O O   . THR A 1 315 ? 25.830 83.366 -1.419  1.00 57.31  ? 315 THR A O   1 
ATOM   2146 C CB  . THR A 1 315 ? 25.687 84.504 -4.568  1.00 59.86  ? 315 THR A CB  1 
ATOM   2147 O OG1 . THR A 1 315 ? 26.519 85.029 -5.608  1.00 60.75  ? 315 THR A OG1 1 
ATOM   2148 C CG2 . THR A 1 315 ? 25.146 85.655 -3.737  1.00 60.07  ? 315 THR A CG2 1 
ATOM   2149 N N   . ILE A 1 316 ? 24.719 82.120 -2.931  1.00 54.53  ? 316 ILE A N   1 
ATOM   2150 C CA  . ILE A 1 316 ? 23.839 81.506 -1.939  1.00 51.34  ? 316 ILE A CA  1 
ATOM   2151 C C   . ILE A 1 316 ? 24.652 80.645 -0.980  1.00 51.67  ? 316 ILE A C   1 
ATOM   2152 O O   . ILE A 1 316 ? 24.417 80.658 0.231   1.00 52.70  ? 316 ILE A O   1 
ATOM   2153 C CB  . ILE A 1 316 ? 22.787 80.595 -2.589  1.00 48.96  ? 316 ILE A CB  1 
ATOM   2154 C CG1 . ILE A 1 316 ? 21.844 81.411 -3.463  1.00 44.66  ? 316 ILE A CG1 1 
ATOM   2155 C CG2 . ILE A 1 316 ? 22.001 79.873 -1.506  1.00 48.61  ? 316 ILE A CG2 1 
ATOM   2156 C CD1 . ILE A 1 316 ? 20.871 80.551 -4.214  1.00 45.11  ? 316 ILE A CD1 1 
ATOM   2157 N N   . SER A 1 317 ? 25.604 79.899 -1.537  1.00 50.58  ? 317 SER A N   1 
ATOM   2158 C CA  . SER A 1 317 ? 26.465 79.011 -0.771  1.00 49.61  ? 317 SER A CA  1 
ATOM   2159 C C   . SER A 1 317 ? 27.181 79.737 0.349   1.00 51.13  ? 317 SER A C   1 
ATOM   2160 O O   . SER A 1 317 ? 27.400 79.181 1.428   1.00 51.21  ? 317 SER A O   1 
ATOM   2161 C CB  . SER A 1 317 ? 27.497 78.365 -1.694  1.00 49.44  ? 317 SER A CB  1 
ATOM   2162 O OG  . SER A 1 317 ? 28.406 77.562 -0.959  1.00 50.04  ? 317 SER A OG  1 
ATOM   2163 N N   . VAL A 1 318 ? 27.550 80.983 0.085   1.00 52.80  ? 318 VAL A N   1 
ATOM   2164 C CA  . VAL A 1 318 ? 28.251 81.795 1.066   1.00 53.99  ? 318 VAL A CA  1 
ATOM   2165 C C   . VAL A 1 318 ? 27.317 82.588 1.975   1.00 55.81  ? 318 VAL A C   1 
ATOM   2166 O O   . VAL A 1 318 ? 27.423 82.516 3.198   1.00 56.27  ? 318 VAL A O   1 
ATOM   2167 C CB  . VAL A 1 318 ? 29.207 82.773 0.368   1.00 53.37  ? 318 VAL A CB  1 
ATOM   2168 C CG1 . VAL A 1 318 ? 29.716 83.803 1.364   1.00 53.85  ? 318 VAL A CG1 1 
ATOM   2169 C CG2 . VAL A 1 318 ? 30.369 82.004 -0.244  1.00 51.75  ? 318 VAL A CG2 1 
ATOM   2170 N N   . GLN A 1 319 ? 26.399 83.339 1.375   1.00 57.59  ? 319 GLN A N   1 
ATOM   2171 C CA  . GLN A 1 319 ? 25.468 84.163 2.142   1.00 58.80  ? 319 GLN A CA  1 
ATOM   2172 C C   . GLN A 1 319 ? 24.610 83.395 3.141   1.00 58.79  ? 319 GLN A C   1 
ATOM   2173 O O   . GLN A 1 319 ? 24.159 83.965 4.137   1.00 58.65  ? 319 GLN A O   1 
ATOM   2174 C CB  . GLN A 1 319 ? 24.571 84.964 1.194   1.00 60.14  ? 319 GLN A CB  1 
ATOM   2175 C CG  . GLN A 1 319 ? 25.352 85.863 0.241   1.00 63.42  ? 319 GLN A CG  1 
ATOM   2176 C CD  . GLN A 1 319 ? 26.358 86.754 0.962   1.00 65.59  ? 319 GLN A CD  1 
ATOM   2177 O OE1 . GLN A 1 319 ? 27.553 86.735 0.656   1.00 64.65  ? 319 GLN A OE1 1 
ATOM   2178 N NE2 . GLN A 1 319 ? 25.876 87.541 1.923   1.00 66.66  ? 319 GLN A NE2 1 
ATOM   2179 N N   . GLN A 1 320 ? 24.377 82.111 2.885   1.00 58.18  ? 320 GLN A N   1 
ATOM   2180 C CA  . GLN A 1 320 ? 23.574 81.318 3.807   1.00 56.67  ? 320 GLN A CA  1 
ATOM   2181 C C   . GLN A 1 320 ? 24.304 81.192 5.136   1.00 57.08  ? 320 GLN A C   1 
ATOM   2182 O O   . GLN A 1 320 ? 23.679 81.126 6.190   1.00 57.36  ? 320 GLN A O   1 
ATOM   2183 C CB  . GLN A 1 320 ? 23.313 79.920 3.250   1.00 54.54  ? 320 GLN A CB  1 
ATOM   2184 C CG  . GLN A 1 320 ? 24.576 79.099 3.016   1.00 52.05  ? 320 GLN A CG  1 
ATOM   2185 C CD  . GLN A 1 320 ? 24.284 77.633 2.766   1.00 48.89  ? 320 GLN A CD  1 
ATOM   2186 O OE1 . GLN A 1 320 ? 25.096 76.918 2.179   1.00 44.49  ? 320 GLN A OE1 1 
ATOM   2187 N NE2 . GLN A 1 320 ? 23.125 77.175 3.222   1.00 49.19  ? 320 GLN A NE2 1 
ATOM   2188 N N   . TRP A 1 321 ? 25.629 81.176 5.090   1.00 57.23  ? 321 TRP A N   1 
ATOM   2189 C CA  . TRP A 1 321 ? 26.399 81.028 6.307   1.00 59.81  ? 321 TRP A CA  1 
ATOM   2190 C C   . TRP A 1 321 ? 26.357 82.190 7.278   1.00 63.10  ? 321 TRP A C   1 
ATOM   2191 O O   . TRP A 1 321 ? 26.814 82.068 8.411   1.00 63.61  ? 321 TRP A O   1 
ATOM   2192 C CB  . TRP A 1 321 ? 27.837 80.672 5.973   1.00 59.40  ? 321 TRP A CB  1 
ATOM   2193 C CG  . TRP A 1 321 ? 27.990 79.211 5.708   1.00 59.48  ? 321 TRP A CG  1 
ATOM   2194 C CD1 . TRP A 1 321 ? 28.215 78.613 4.504   1.00 59.48  ? 321 TRP A CD1 1 
ATOM   2195 C CD2 . TRP A 1 321 ? 27.888 78.154 6.672   1.00 59.60  ? 321 TRP A CD2 1 
ATOM   2196 N NE1 . TRP A 1 321 ? 28.261 77.245 4.655   1.00 60.46  ? 321 TRP A NE1 1 
ATOM   2197 C CE2 . TRP A 1 321 ? 28.063 76.936 5.975   1.00 60.89  ? 321 TRP A CE2 1 
ATOM   2198 C CE3 . TRP A 1 321 ? 27.667 78.117 8.056   1.00 58.13  ? 321 TRP A CE3 1 
ATOM   2199 C CZ2 . TRP A 1 321 ? 28.025 75.693 6.618   1.00 60.66  ? 321 TRP A CZ2 1 
ATOM   2200 C CZ3 . TRP A 1 321 ? 27.629 76.886 8.693   1.00 58.03  ? 321 TRP A CZ3 1 
ATOM   2201 C CH2 . TRP A 1 321 ? 27.807 75.689 7.973   1.00 59.85  ? 321 TRP A CH2 1 
ATOM   2202 N N   . ASN A 1 322 ? 25.802 83.316 6.851   1.00 66.69  ? 322 ASN A N   1 
ATOM   2203 C CA  . ASN A 1 322 ? 25.701 84.472 7.730   1.00 69.35  ? 322 ASN A CA  1 
ATOM   2204 C C   . ASN A 1 322 ? 24.779 84.137 8.898   1.00 71.05  ? 322 ASN A C   1 
ATOM   2205 O O   . ASN A 1 322 ? 24.995 84.589 10.020  1.00 71.98  ? 322 ASN A O   1 
ATOM   2206 C CB  . ASN A 1 322 ? 25.143 85.677 6.965   1.00 70.64  ? 322 ASN A CB  1 
ATOM   2207 C CG  . ASN A 1 322 ? 26.147 86.267 5.991   1.00 71.23  ? 322 ASN A CG  1 
ATOM   2208 O OD1 . ASN A 1 322 ? 26.797 85.545 5.237   1.00 71.54  ? 322 ASN A OD1 1 
ATOM   2209 N ND2 . ASN A 1 322 ? 26.270 87.591 5.998   1.00 72.34  ? 322 ASN A ND2 1 
ATOM   2210 N N   . SER A 1 323 ? 23.761 83.329 8.625   1.00 73.28  ? 323 SER A N   1 
ATOM   2211 C CA  . SER A 1 323 ? 22.780 82.936 9.632   1.00 75.80  ? 323 SER A CA  1 
ATOM   2212 C C   . SER A 1 323 ? 23.310 81.949 10.683  1.00 76.96  ? 323 SER A C   1 
ATOM   2213 O O   . SER A 1 323 ? 22.553 81.434 11.513  1.00 76.75  ? 323 SER A O   1 
ATOM   2214 C CB  . SER A 1 323 ? 21.551 82.349 8.932   1.00 77.43  ? 323 SER A CB  1 
ATOM   2215 O OG  . SER A 1 323 ? 21.017 83.262 7.981   1.00 79.64  ? 323 SER A OG  1 
ATOM   2216 N N   . TYR A 1 324 ? 24.613 81.692 10.646  1.00 78.44  ? 324 TYR A N   1 
ATOM   2217 C CA  . TYR A 1 324 ? 25.249 80.784 11.595  1.00 80.18  ? 324 TYR A CA  1 
ATOM   2218 C C   . TYR A 1 324 ? 25.700 81.593 12.815  1.00 80.49  ? 324 TYR A C   1 
ATOM   2219 O O   . TYR A 1 324 ? 26.793 82.169 12.812  1.00 80.68  ? 324 TYR A O   1 
ATOM   2220 C CB  . TYR A 1 324 ? 26.454 80.118 10.933  1.00 81.63  ? 324 TYR A CB  1 
ATOM   2221 C CG  . TYR A 1 324 ? 27.188 79.130 11.808  1.00 84.60  ? 324 TYR A CG  1 
ATOM   2222 C CD1 . TYR A 1 324 ? 26.627 77.894 12.124  1.00 85.56  ? 324 TYR A CD1 1 
ATOM   2223 C CD2 . TYR A 1 324 ? 28.458 79.424 12.307  1.00 86.53  ? 324 TYR A CD2 1 
ATOM   2224 C CE1 . TYR A 1 324 ? 27.316 76.971 12.914  1.00 87.20  ? 324 TYR A CE1 1 
ATOM   2225 C CE2 . TYR A 1 324 ? 29.156 78.510 13.098  1.00 87.31  ? 324 TYR A CE2 1 
ATOM   2226 C CZ  . TYR A 1 324 ? 28.581 77.286 13.395  1.00 87.55  ? 324 TYR A CZ  1 
ATOM   2227 O OH  . TYR A 1 324 ? 29.278 76.375 14.153  1.00 88.39  ? 324 TYR A OH  1 
ATOM   2228 N N   . SER A 1 325 ? 24.861 81.634 13.851  1.00 79.81  ? 325 SER A N   1 
ATOM   2229 C CA  . SER A 1 325 ? 25.159 82.393 15.071  1.00 78.09  ? 325 SER A CA  1 
ATOM   2230 C C   . SER A 1 325 ? 26.091 81.676 16.050  1.00 75.97  ? 325 SER A C   1 
ATOM   2231 O O   . SER A 1 325 ? 27.266 82.031 16.175  1.00 75.12  ? 325 SER A O   1 
ATOM   2232 C CB  . SER A 1 325 ? 23.855 82.754 15.788  1.00 78.83  ? 325 SER A CB  1 
ATOM   2233 O OG  . SER A 1 325 ? 23.135 81.586 16.140  1.00 79.24  ? 325 SER A OG  1 
ATOM   2234 N N   . GLY A 1 326 ? 25.556 80.677 16.749  1.00 73.16  ? 326 GLY A N   1 
ATOM   2235 C CA  . GLY A 1 326 ? 26.355 79.932 17.708  1.00 70.22  ? 326 GLY A CA  1 
ATOM   2236 C C   . GLY A 1 326 ? 26.879 78.628 17.143  1.00 67.70  ? 326 GLY A C   1 
ATOM   2237 O O   . GLY A 1 326 ? 26.573 78.276 16.003  1.00 68.21  ? 326 GLY A O   1 
ATOM   2238 N N   . ILE A 1 327 ? 27.660 77.900 17.935  1.00 64.93  ? 327 ILE A N   1 
ATOM   2239 C CA  . ILE A 1 327 ? 28.214 76.636 17.467  1.00 62.29  ? 327 ILE A CA  1 
ATOM   2240 C C   . ILE A 1 327 ? 27.155 75.529 17.450  1.00 60.40  ? 327 ILE A C   1 
ATOM   2241 O O   . ILE A 1 327 ? 26.339 75.420 18.367  1.00 59.78  ? 327 ILE A O   1 
ATOM   2242 C CB  . ILE A 1 327 ? 29.448 76.216 18.318  1.00 61.79  ? 327 ILE A CB  1 
ATOM   2243 C CG1 . ILE A 1 327 ? 29.159 74.951 19.120  1.00 61.78  ? 327 ILE A CG1 1 
ATOM   2244 C CG2 . ILE A 1 327 ? 29.838 77.348 19.251  1.00 61.52  ? 327 ILE A CG2 1 
ATOM   2245 C CD1 . ILE A 1 327 ? 30.412 74.246 19.583  1.00 62.15  ? 327 ILE A CD1 1 
ATOM   2246 N N   . LEU A 1 328 ? 27.179 74.720 16.391  1.00 57.56  ? 328 LEU A N   1 
ATOM   2247 C CA  . LEU A 1 328 ? 26.231 73.626 16.196  1.00 54.51  ? 328 LEU A CA  1 
ATOM   2248 C C   . LEU A 1 328 ? 24.797 74.118 16.082  1.00 53.84  ? 328 LEU A C   1 
ATOM   2249 O O   . LEU A 1 328 ? 23.865 73.472 16.552  1.00 52.70  ? 328 LEU A O   1 
ATOM   2250 C CB  . LEU A 1 328 ? 26.342 72.594 17.319  1.00 54.06  ? 328 LEU A CB  1 
ATOM   2251 C CG  . LEU A 1 328 ? 27.494 71.593 17.173  1.00 54.28  ? 328 LEU A CG  1 
ATOM   2252 C CD1 . LEU A 1 328 ? 27.457 70.597 18.314  1.00 55.76  ? 328 LEU A CD1 1 
ATOM   2253 C CD2 . LEU A 1 328 ? 27.377 70.856 15.846  1.00 54.92  ? 328 LEU A CD2 1 
ATOM   2254 N N   . SER A 1 329 ? 24.633 75.275 15.450  1.00 54.06  ? 329 SER A N   1 
ATOM   2255 C CA  . SER A 1 329 ? 23.319 75.871 15.234  1.00 54.05  ? 329 SER A CA  1 
ATOM   2256 C C   . SER A 1 329 ? 23.252 76.346 13.792  1.00 54.14  ? 329 SER A C   1 
ATOM   2257 O O   . SER A 1 329 ? 23.266 77.547 13.521  1.00 53.97  ? 329 SER A O   1 
ATOM   2258 C CB  . SER A 1 329 ? 23.109 77.058 16.157  1.00 54.69  ? 329 SER A CB  1 
ATOM   2259 O OG  . SER A 1 329 ? 21.917 77.729 15.799  1.00 57.47  ? 329 SER A OG  1 
ATOM   2260 N N   . PHE A 1 330 ? 23.179 75.383 12.877  1.00 53.79  ? 330 PHE A N   1 
ATOM   2261 C CA  . PHE A 1 330 ? 23.142 75.632 11.442  1.00 51.70  ? 330 PHE A CA  1 
ATOM   2262 C C   . PHE A 1 330 ? 21.868 76.308 10.964  1.00 50.10  ? 330 PHE A C   1 
ATOM   2263 O O   . PHE A 1 330 ? 20.794 76.087 11.522  1.00 50.42  ? 330 PHE A O   1 
ATOM   2264 C CB  . PHE A 1 330 ? 23.324 74.313 10.708  1.00 53.44  ? 330 PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 330 ? 24.420 73.471 11.269  1.00 54.52  ? 330 PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 330 ? 25.742 73.908 11.211  1.00 53.83  ? 330 PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 330 ? 24.133 72.264 11.898  1.00 55.30  ? 330 PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 330 ? 26.766 73.156 11.773  1.00 53.83  ? 330 PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 330 ? 25.152 71.499 12.467  1.00 56.27  ? 330 PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 330 ? 26.475 71.949 12.403  1.00 54.97  ? 330 PHE A CZ  1 
ATOM   2271 N N   . PRO A 1 331 ? 21.975 77.143 9.911   1.00 48.77  ? 331 PRO A N   1 
ATOM   2272 C CA  . PRO A 1 331 ? 20.831 77.865 9.339   1.00 46.41  ? 331 PRO A CA  1 
ATOM   2273 C C   . PRO A 1 331 ? 19.826 76.949 8.630   1.00 44.39  ? 331 PRO A C   1 
ATOM   2274 O O   . PRO A 1 331 ? 18.695 77.345 8.366   1.00 43.30  ? 331 PRO A O   1 
ATOM   2275 C CB  . PRO A 1 331 ? 21.493 78.863 8.388   1.00 46.30  ? 331 PRO A CB  1 
ATOM   2276 C CG  . PRO A 1 331 ? 22.690 78.116 7.906   1.00 47.94  ? 331 PRO A CG  1 
ATOM   2277 C CD  . PRO A 1 331 ? 23.214 77.450 9.167   1.00 47.26  ? 331 PRO A CD  1 
ATOM   2278 N N   . SER A 1 332 ? 20.222 75.724 8.167   1.00 42.61  ? 332 SER A N   1 
ATOM   2279 C CA  . SER A 1 332 ? 19.370 74.702 7.542   1.00 41.88  ? 332 SER A CA  1 
ATOM   2280 C C   . SER A 1 332 ? 19.243 73.448 8.428   1.00 38.86  ? 332 SER A C   1 
ATOM   2281 O O   . SER A 1 332 ? 20.247 72.813 8.784   1.00 40.16  ? 332 SER A O   1 
ATOM   2282 C CB  . SER A 1 332 ? 19.977 74.259 6.210   1.00 44.51  ? 332 SER A CB  1 
ATOM   2283 O OG  . SER A 1 332 ? 21.271 73.715 6.423   1.00 47.36  ? 332 SER A OG  1 
ATOM   2284 N N   . ALA A 1 333 ? 17.992 73.131 8.746   1.00 36.90  ? 333 ALA A N   1 
ATOM   2285 C CA  . ALA A 1 333 ? 17.625 71.947 9.556   1.00 34.09  ? 333 ALA A CA  1 
ATOM   2286 C C   . ALA A 1 333 ? 16.412 71.243 8.915   1.00 32.46  ? 333 ALA A C   1 
ATOM   2287 O O   . ALA A 1 333 ? 15.959 71.622 7.829   1.00 31.78  ? 333 ALA A O   1 
ATOM   2288 C CB  . ALA A 1 333 ? 17.277 72.366 10.987  1.00 35.91  ? 333 ALA A CB  1 
ATOM   2289 N N   . PRO A 1 334 ? 15.851 70.187 9.534   1.00 31.52  ? 334 PRO A N   1 
ATOM   2290 C CA  . PRO A 1 334 ? 14.682 69.464 8.977   1.00 31.24  ? 334 PRO A CA  1 
ATOM   2291 C C   . PRO A 1 334 ? 13.394 70.330 8.786   1.00 33.04  ? 334 PRO A C   1 
ATOM   2292 O O   . PRO A 1 334 ? 12.576 70.016 7.855   1.00 32.10  ? 334 PRO A O   1 
ATOM   2293 C CB  . PRO A 1 334 ? 14.452 68.352 9.976   1.00 29.97  ? 334 PRO A CB  1 
ATOM   2294 C CG  . PRO A 1 334 ? 15.502 68.476 11.080  1.00 28.14  ? 334 PRO A CG  1 
ATOM   2295 C CD  . PRO A 1 334 ? 16.376 69.655 10.796  1.00 29.95  ? 334 PRO A CD  1 
ATOM   2296 N N   . THR A 1 335 ? 13.232 71.350 9.647   1.00 34.87  ? 335 THR A N   1 
ATOM   2297 C CA  . THR A 1 335 ? 12.078 72.353 9.704   1.00 34.90  ? 335 THR A CA  1 
ATOM   2298 C C   . THR A 1 335 ? 10.663 71.738 9.807   1.00 35.02  ? 335 THR A C   1 
ATOM   2299 O O   . THR A 1 335 ? 10.274 70.868 9.008   1.00 33.87  ? 335 THR A O   1 
ATOM   2300 C CB  . THR A 1 335 ? 11.997 73.291 8.490   1.00 33.27  ? 335 THR A CB  1 
ATOM   2301 O OG1 . THR A 1 335 ? 13.282 73.785 8.166   1.00 33.03  ? 335 THR A OG1 1 
ATOM   2302 C CG2 . THR A 1 335 ? 11.099 74.517 8.757   1.00 33.16  ? 335 THR A CG2 1 
ATOM   2303 N N   . ILE A 1 336 ? 9.945  72.266 10.805  1.00 37.22  ? 336 ILE A N   1 
ATOM   2304 C CA  . ILE A 1 336 ? 8.554  71.888 11.117  1.00 39.36  ? 336 ILE A CA  1 
ATOM   2305 C C   . ILE A 1 336 ? 7.624  72.563 10.112  1.00 39.83  ? 336 ILE A C   1 
ATOM   2306 O O   . ILE A 1 336 ? 7.145  73.670 10.340  1.00 40.05  ? 336 ILE A O   1 
ATOM   2307 C CB  . ILE A 1 336 ? 8.209  72.276 12.548  1.00 40.24  ? 336 ILE A CB  1 
ATOM   2308 C CG1 . ILE A 1 336 ? 9.074  71.533 13.567  1.00 41.22  ? 336 ILE A CG1 1 
ATOM   2309 C CG2 . ILE A 1 336 ? 6.755  71.961 12.912  1.00 39.89  ? 336 ILE A CG2 1 
ATOM   2310 C CD1 . ILE A 1 336 ? 8.867  72.018 14.999  1.00 43.78  ? 336 ILE A CD1 1 
ATOM   2311 N N   . ASP A 1 337 ? 7.395  71.875 8.995   1.00 40.46  ? 337 ASP A N   1 
ATOM   2312 C CA  . ASP A 1 337 ? 6.564  72.359 7.899   1.00 39.74  ? 337 ASP A CA  1 
ATOM   2313 C C   . ASP A 1 337 ? 5.150  71.797 7.888   1.00 41.05  ? 337 ASP A C   1 
ATOM   2314 O O   . ASP A 1 337 ? 4.396  72.045 6.952   1.00 39.90  ? 337 ASP A O   1 
ATOM   2315 C CB  . ASP A 1 337 ? 7.218  72.012 6.569   1.00 39.63  ? 337 ASP A CB  1 
ATOM   2316 C CG  . ASP A 1 337 ? 7.504  70.524 6.434   1.00 39.64  ? 337 ASP A CG  1 
ATOM   2317 O OD1 . ASP A 1 337 ? 6.795  69.721 7.069   1.00 38.51  ? 337 ASP A OD1 1 
ATOM   2318 O OD2 . ASP A 1 337 ? 8.430  70.150 5.681   1.00 42.88  ? 337 ASP A OD2 1 
ATOM   2319 N N   . GLY A 1 338 ? 4.797  71.023 8.910   1.00 43.55  ? 338 GLY A N   1 
ATOM   2320 C CA  . GLY A 1 338 ? 3.459  70.458 8.980   1.00 45.94  ? 338 GLY A CA  1 
ATOM   2321 C C   . GLY A 1 338 ? 3.157  69.437 7.901   1.00 47.45  ? 338 GLY A C   1 
ATOM   2322 O O   . GLY A 1 338 ? 2.058  68.886 7.840   1.00 48.58  ? 338 GLY A O   1 
ATOM   2323 N N   . ALA A 1 339 ? 4.141  69.187 7.046   1.00 48.68  ? 339 ALA A N   1 
ATOM   2324 C CA  . ALA A 1 339 ? 4.007  68.224 5.963   1.00 46.43  ? 339 ALA A CA  1 
ATOM   2325 C C   . ALA A 1 339 ? 4.950  67.058 6.219   1.00 46.30  ? 339 ALA A C   1 
ATOM   2326 O O   . ALA A 1 339 ? 4.530  66.003 6.704   1.00 47.43  ? 339 ALA A O   1 
ATOM   2327 C CB  . ALA A 1 339 ? 4.343  68.884 4.644   1.00 46.92  ? 339 ALA A CB  1 
ATOM   2328 N N   . PHE A 1 340 ? 6.224  67.249 5.887   1.00 45.23  ? 340 PHE A N   1 
ATOM   2329 C CA  . PHE A 1 340 ? 7.210  66.204 6.095   1.00 44.04  ? 340 PHE A CA  1 
ATOM   2330 C C   . PHE A 1 340 ? 7.422  66.062 7.605   1.00 46.27  ? 340 PHE A C   1 
ATOM   2331 O O   . PHE A 1 340 ? 7.423  64.953 8.146   1.00 46.10  ? 340 PHE A O   1 
ATOM   2332 C CB  . PHE A 1 340 ? 8.528  66.556 5.401   1.00 38.86  ? 340 PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 340 ? 9.359  65.354 5.066   1.00 36.55  ? 340 PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 340 ? 9.135  64.651 3.887   1.00 35.71  ? 340 PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 340 ? 10.305 64.871 5.965   1.00 33.17  ? 340 PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 340 ? 9.837  63.481 3.611   1.00 36.51  ? 340 PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 340 ? 11.008 63.706 5.701   1.00 33.28  ? 340 PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 340 ? 10.775 63.008 4.524   1.00 35.51  ? 340 PHE A CZ  1 
ATOM   2339 N N   . LEU A 1 341 ? 7.595  67.195 8.279   1.00 48.85  ? 341 LEU A N   1 
ATOM   2340 C CA  . LEU A 1 341 ? 7.776  67.216 9.725   1.00 52.62  ? 341 LEU A CA  1 
ATOM   2341 C C   . LEU A 1 341 ? 6.553  67.932 10.302  1.00 55.83  ? 341 LEU A C   1 
ATOM   2342 O O   . LEU A 1 341 ? 6.566  69.151 10.484  1.00 55.52  ? 341 LEU A O   1 
ATOM   2343 C CB  . LEU A 1 341 ? 9.048  67.981 10.086  1.00 52.55  ? 341 LEU A CB  1 
ATOM   2344 C CG  . LEU A 1 341 ? 10.066 67.350 11.045  1.00 54.68  ? 341 LEU A CG  1 
ATOM   2345 C CD1 . LEU A 1 341 ? 11.230 68.325 11.191  1.00 54.61  ? 341 LEU A CD1 1 
ATOM   2346 C CD2 . LEU A 1 341 ? 9.450  67.033 12.421  1.00 52.78  ? 341 LEU A CD2 1 
ATOM   2347 N N   . PRO A 1 342 ? 5.472  67.182 10.587  1.00 58.69  ? 342 PRO A N   1 
ATOM   2348 C CA  . PRO A 1 342 ? 4.228  67.729 11.138  1.00 61.77  ? 342 PRO A CA  1 
ATOM   2349 C C   . PRO A 1 342 ? 4.384  68.449 12.476  1.00 64.46  ? 342 PRO A C   1 
ATOM   2350 O O   . PRO A 1 342 ? 4.023  69.618 12.605  1.00 65.42  ? 342 PRO A O   1 
ATOM   2351 C CB  . PRO A 1 342 ? 3.336  66.496 11.258  1.00 60.81  ? 342 PRO A CB  1 
ATOM   2352 C CG  . PRO A 1 342 ? 3.829  65.621 10.174  1.00 58.99  ? 342 PRO A CG  1 
ATOM   2353 C CD  . PRO A 1 342 ? 5.317  65.743 10.327  1.00 58.51  ? 342 PRO A CD  1 
ATOM   2354 N N   . ALA A 1 343 ? 4.915  67.746 13.470  1.00 67.25  ? 343 ALA A N   1 
ATOM   2355 C CA  . ALA A 1 343 ? 5.098  68.327 14.791  1.00 70.87  ? 343 ALA A CA  1 
ATOM   2356 C C   . ALA A 1 343 ? 6.568  68.326 15.217  1.00 74.14  ? 343 ALA A C   1 
ATOM   2357 O O   . ALA A 1 343 ? 7.458  68.035 14.412  1.00 74.02  ? 343 ALA A O   1 
ATOM   2358 C CB  . ALA A 1 343 ? 4.247  67.570 15.807  1.00 68.91  ? 343 ALA A CB  1 
ATOM   2359 N N   . ASP A 1 344 ? 6.808  68.669 16.479  1.00 78.26  ? 344 ASP A N   1 
ATOM   2360 C CA  . ASP A 1 344 ? 8.173  68.703 17.031  1.00 81.59  ? 344 ASP A CA  1 
ATOM   2361 C C   . ASP A 1 344 ? 8.689  67.272 17.141  1.00 84.06  ? 344 ASP A C   1 
ATOM   2362 O O   . ASP A 1 344 ? 7.912  66.349 17.374  1.00 84.83  ? 344 ASP A O   1 
ATOM   2363 C CB  . ASP A 1 344 ? 8.169  69.354 18.414  1.00 82.89  ? 344 ASP A CB  1 
ATOM   2364 C CG  . ASP A 1 344 ? 9.562  69.420 19.046  1.00 85.04  ? 344 ASP A CG  1 
ATOM   2365 O OD1 . ASP A 1 344 ? 10.581 68.947 18.411  1.00 85.31  ? 344 ASP A OD1 1 
ATOM   2366 O OD2 . ASP A 1 344 ? 9.717  69.948 20.213  1.00 86.19  ? 344 ASP A OD2 1 
ATOM   2367 N N   . PRO A 1 345 ? 10.003 67.075 16.976  1.00 86.17  ? 345 PRO A N   1 
ATOM   2368 C CA  . PRO A 1 345 ? 10.565 65.725 17.069  1.00 88.20  ? 345 PRO A CA  1 
ATOM   2369 C C   . PRO A 1 345 ? 10.106 64.904 18.283  1.00 90.85  ? 345 PRO A C   1 
ATOM   2370 O O   . PRO A 1 345 ? 10.097 63.670 18.230  1.00 92.16  ? 345 PRO A O   1 
ATOM   2371 C CB  . PRO A 1 345 ? 12.066 65.990 17.071  1.00 87.85  ? 345 PRO A CB  1 
ATOM   2372 C CG  . PRO A 1 345 ? 12.180 67.160 16.145  1.00 86.86  ? 345 PRO A CG  1 
ATOM   2373 C CD  . PRO A 1 345 ? 11.044 68.051 16.609  1.00 86.52  ? 345 PRO A CD  1 
ATOM   2374 N N   . MET A 1 346 ? 9.714  65.578 19.364  1.00 92.42  ? 346 MET A N   1 
ATOM   2375 C CA  . MET A 1 346 ? 9.273  64.879 20.574  1.00 93.44  ? 346 MET A CA  1 
ATOM   2376 C C   . MET A 1 346 ? 7.752  64.749 20.718  1.00 94.14  ? 346 MET A C   1 
ATOM   2377 O O   . MET A 1 346 ? 7.259  63.860 21.415  1.00 93.76  ? 346 MET A O   1 
ATOM   2378 C CB  . MET A 1 346 ? 9.859  65.562 21.818  1.00 93.66  ? 346 MET A CB  1 
ATOM   2379 C CG  . MET A 1 346 ? 11.395 65.508 21.910  1.00 93.69  ? 346 MET A CG  1 
ATOM   2380 S SD  . MET A 1 346 ? 12.112 63.829 21.843  1.00 92.59  ? 346 MET A SD  1 
ATOM   2381 C CE  . MET A 1 346 ? 12.095 63.355 23.586  1.00 92.30  ? 346 MET A CE  1 
ATOM   2382 N N   . THR A 1 347 ? 7.009  65.633 20.060  1.00 95.81  ? 347 THR A N   1 
ATOM   2383 C CA  . THR A 1 347 ? 5.552  65.596 20.118  1.00 97.00  ? 347 THR A CA  1 
ATOM   2384 C C   . THR A 1 347 ? 4.997  64.606 19.091  1.00 97.43  ? 347 THR A C   1 
ATOM   2385 O O   . THR A 1 347 ? 3.816  64.268 19.114  1.00 97.57  ? 347 THR A O   1 
ATOM   2386 C CB  . THR A 1 347 ? 4.942  67.006 19.880  1.00 97.69  ? 347 THR A CB  1 
ATOM   2387 O OG1 . THR A 1 347 ? 5.502  67.582 18.693  1.00 98.38  ? 347 THR A OG1 1 
ATOM   2388 C CG2 . THR A 1 347 ? 5.230  67.924 21.070  1.00 97.50  ? 347 THR A CG2 1 
ATOM   2389 N N   . LEU A 1 348 ? 5.860  64.148 18.189  1.00 98.15  ? 348 LEU A N   1 
ATOM   2390 C CA  . LEU A 1 348 ? 5.480  63.176 17.166  1.00 98.62  ? 348 LEU A CA  1 
ATOM   2391 C C   . LEU A 1 348 ? 5.438  61.809 17.837  1.00 99.28  ? 348 LEU A C   1 
ATOM   2392 O O   . LEU A 1 348 ? 4.566  60.978 17.565  1.00 99.16  ? 348 LEU A O   1 
ATOM   2393 C CB  . LEU A 1 348 ? 6.525  63.144 16.050  1.00 98.60  ? 348 LEU A CB  1 
ATOM   2394 C CG  . LEU A 1 348 ? 6.753  64.413 15.230  1.00 99.37  ? 348 LEU A CG  1 
ATOM   2395 C CD1 . LEU A 1 348 ? 8.020  64.266 14.394  1.00 100.00 ? 348 LEU A CD1 1 
ATOM   2396 C CD2 . LEU A 1 348 ? 5.543  64.670 14.343  1.00 100.00 ? 348 LEU A CD2 1 
ATOM   2397 N N   . MET A 1 349 ? 6.407  61.596 18.721  1.00 99.83  ? 349 MET A N   1 
ATOM   2398 C CA  . MET A 1 349 ? 6.552  60.355 19.465  1.00 99.97  ? 349 MET A CA  1 
ATOM   2399 C C   . MET A 1 349 ? 5.473  60.178 20.524  1.00 99.68  ? 349 MET A C   1 
ATOM   2400 O O   . MET A 1 349 ? 5.012  59.063 20.759  1.00 99.88  ? 349 MET A O   1 
ATOM   2401 C CB  . MET A 1 349 ? 7.934  60.311 20.128  1.00 100.00 ? 349 MET A CB  1 
ATOM   2402 C CG  . MET A 1 349 ? 9.084  60.123 19.156  1.00 99.90  ? 349 MET A CG  1 
ATOM   2403 S SD  . MET A 1 349 ? 8.974  58.529 18.338  1.00 99.33  ? 349 MET A SD  1 
ATOM   2404 C CE  . MET A 1 349 ? 9.452  57.469 19.675  1.00 99.40  ? 349 MET A CE  1 
ATOM   2405 N N   . LYS A 1 350 ? 4.985  61.030 21.060  1.00 99.76  ? 350 LYS A N   1 
ATOM   2406 C CA  . LYS A 1 350 ? 4.096  60.789 22.205  1.00 100.00 ? 350 LYS A CA  1 
ATOM   2407 C C   . LYS A 1 350 ? 3.051  59.731 21.844  1.00 100.00 ? 350 LYS A C   1 
ATOM   2408 O O   . LYS A 1 350 ? 2.643  58.928 22.790  1.00 100.00 ? 350 LYS A O   1 
ATOM   2409 C CB  . LYS A 1 350 ? 3.380  62.086 22.594  1.00 100.00 ? 350 LYS A CB  1 
ATOM   2410 C CG  . LYS A 1 350 ? 4.339  63.261 22.799  1.00 100.00 ? 350 LYS A CG  1 
ATOM   2411 C CD  . LYS A 1 350 ? 3.645  64.513 23.342  1.00 99.22  ? 350 LYS A CD  1 
ATOM   2412 C CE  . LYS A 1 350 ? 3.453  65.598 22.281  1.00 98.45  ? 350 LYS A CE  1 
ATOM   2413 N NZ  . LYS A 1 350 ? 2.786  66.800 22.801  1.00 98.28  ? 350 LYS A NZ  1 
ATOM   2414 N N   . THR A 1 351 ? 2.501  59.711 20.661  1.00 100.00 ? 351 THR A N   1 
ATOM   2415 C CA  . THR A 1 351 ? 1.431  58.774 20.292  1.00 99.85  ? 351 THR A CA  1 
ATOM   2416 C C   . THR A 1 351 ? 1.908  57.857 19.161  1.00 98.94  ? 351 THR A C   1 
ATOM   2417 O O   . THR A 1 351 ? 1.148  57.579 18.204  1.00 99.38  ? 351 THR A O   1 
ATOM   2418 C CB  . THR A 1 351 ? 0.196  59.551 19.832  1.00 100.00 ? 351 THR A CB  1 
ATOM   2419 O OG1 . THR A 1 351 ? 0.517  60.351 18.704  1.00 99.73  ? 351 THR A OG1 1 
ATOM   2420 C CG2 . THR A 1 351 ? -0.361 60.480 20.911  1.00 100.00 ? 351 THR A CG2 1 
ATOM   2421 N N   . ALA A 1 352 ? 3.124  57.380 19.290  1.00 97.55  ? 352 ALA A N   1 
ATOM   2422 C CA  . ALA A 1 352 ? 3.694  56.482 18.267  1.00 95.34  ? 352 ALA A CA  1 
ATOM   2423 C C   . ALA A 1 352 ? 3.804  55.059 18.836  1.00 93.55  ? 352 ALA A C   1 
ATOM   2424 O O   . ALA A 1 352 ? 4.181  54.859 20.004  1.00 93.17  ? 352 ALA A O   1 
ATOM   2425 C CB  . ALA A 1 352 ? 4.959  57.124 17.761  1.00 95.17  ? 352 ALA A CB  1 
ATOM   2426 N N   . ASP A 1 353 ? 3.420  53.873 17.814  1.00 90.98  ? 353 ASP A N   1 
ATOM   2427 C CA  . ASP A 1 353 ? 3.772  52.522 18.199  1.00 88.39  ? 353 ASP A CA  1 
ATOM   2428 C C   . ASP A 1 353 ? 4.660  51.917 17.141  1.00 84.61  ? 353 ASP A C   1 
ATOM   2429 O O   . ASP A 1 353 ? 4.200  51.366 16.144  1.00 82.92  ? 353 ASP A O   1 
ATOM   2430 C CB  . ASP A 1 353 ? 2.537  51.659 18.434  1.00 90.68  ? 353 ASP A CB  1 
ATOM   2431 C CG  . ASP A 1 353 ? 2.727  50.693 19.599  1.00 93.00  ? 353 ASP A CG  1 
ATOM   2432 O OD1 . ASP A 1 353 ? 3.330  51.105 20.616  1.00 92.96  ? 353 ASP A OD1 1 
ATOM   2433 O OD2 . ASP A 1 353 ? 2.268  49.534 19.508  1.00 95.06  ? 353 ASP A OD2 1 
ATOM   2434 N N   . LEU A 1 354 ? 5.953  52.055 17.396  1.00 81.52  ? 354 LEU A N   1 
ATOM   2435 C CA  . LEU A 1 354 ? 7.012  51.574 16.538  1.00 78.39  ? 354 LEU A CA  1 
ATOM   2436 C C   . LEU A 1 354 ? 7.326  50.129 16.896  1.00 76.75  ? 354 LEU A C   1 
ATOM   2437 O O   . LEU A 1 354 ? 8.489  49.752 17.006  1.00 76.55  ? 354 LEU A O   1 
ATOM   2438 C CB  . LEU A 1 354 ? 8.243  52.447 16.760  1.00 76.89  ? 354 LEU A CB  1 
ATOM   2439 C CG  . LEU A 1 354 ? 7.906  53.936 16.863  1.00 74.38  ? 354 LEU A CG  1 
ATOM   2440 C CD1 . LEU A 1 354 ? 9.024  54.678 17.543  1.00 72.69  ? 354 LEU A CD1 1 
ATOM   2441 C CD2 . LEU A 1 354 ? 7.643  54.493 15.485  1.00 73.93  ? 354 LEU A CD2 1 
ATOM   2442 N N   . LYS A 1 355 ? 6.286  49.322 17.077  1.00 74.99  ? 355 LYS A N   1 
ATOM   2443 C CA  . LYS A 1 355 ? 6.485  47.927 17.436  1.00 73.85  ? 355 LYS A CA  1 
ATOM   2444 C C   . LYS A 1 355 ? 7.306  47.160 16.404  1.00 71.00  ? 355 LYS A C   1 
ATOM   2445 O O   . LYS A 1 355 ? 8.111  46.301 16.759  1.00 70.75  ? 355 LYS A O   1 
ATOM   2446 C CB  . LYS A 1 355 ? 5.144  47.216 17.634  1.00 76.31  ? 355 LYS A CB  1 
ATOM   2447 C CG  . LYS A 1 355 ? 5.310  45.768 18.076  1.00 79.92  ? 355 LYS A CG  1 
ATOM   2448 C CD  . LYS A 1 355 ? 4.013  44.982 17.990  1.00 83.73  ? 355 LYS A CD  1 
ATOM   2449 C CE  . LYS A 1 355 ? 4.242  43.515 18.358  1.00 85.59  ? 355 LYS A CE  1 
ATOM   2450 N NZ  . LYS A 1 355 ? 2.986  42.705 18.305  1.00 85.97  ? 355 LYS A NZ  1 
ATOM   2451 N N   . ASP A 1 356 ? 7.109  47.462 15.128  1.00 67.17  ? 356 ASP A N   1 
ATOM   2452 C CA  . ASP A 1 356 ? 7.851  46.759 14.093  1.00 64.65  ? 356 ASP A CA  1 
ATOM   2453 C C   . ASP A 1 356 ? 9.101  47.519 13.663  1.00 60.94  ? 356 ASP A C   1 
ATOM   2454 O O   . ASP A 1 356 ? 9.661  47.269 12.594  1.00 59.77  ? 356 ASP A O   1 
ATOM   2455 C CB  . ASP A 1 356 ? 6.958  46.508 12.875  1.00 69.63  ? 356 ASP A CB  1 
ATOM   2456 C CG  . ASP A 1 356 ? 5.617  45.905 13.249  1.00 72.40  ? 356 ASP A CG  1 
ATOM   2457 O OD1 . ASP A 1 356 ? 5.595  44.982 14.098  1.00 74.61  ? 356 ASP A OD1 1 
ATOM   2458 O OD2 . ASP A 1 356 ? 4.588  46.350 12.686  1.00 73.54  ? 356 ASP A OD2 1 
ATOM   2459 N N   . TYR A 1 357 ? 9.545  48.448 14.499  1.00 56.18  ? 357 TYR A N   1 
ATOM   2460 C CA  . TYR A 1 357 ? 10.726 49.221 14.177  1.00 51.23  ? 357 TYR A CA  1 
ATOM   2461 C C   . TYR A 1 357 ? 11.969 48.704 14.884  1.00 48.40  ? 357 TYR A C   1 
ATOM   2462 O O   . TYR A 1 357 ? 11.936 48.372 16.066  1.00 46.88  ? 357 TYR A O   1 
ATOM   2463 C CB  . TYR A 1 357 ? 10.484 50.692 14.506  1.00 51.22  ? 357 TYR A CB  1 
ATOM   2464 C CG  . TYR A 1 357 ? 9.664  51.404 13.455  1.00 52.44  ? 357 TYR A CG  1 
ATOM   2465 C CD1 . TYR A 1 357 ? 8.375  50.979 13.137  1.00 54.09  ? 357 TYR A CD1 1 
ATOM   2466 C CD2 . TYR A 1 357 ? 10.191 52.482 12.749  1.00 53.66  ? 357 TYR A CD2 1 
ATOM   2467 C CE1 . TYR A 1 357 ? 7.631  51.611 12.135  1.00 56.29  ? 357 TYR A CE1 1 
ATOM   2468 C CE2 . TYR A 1 357 ? 9.459  53.122 11.745  1.00 56.12  ? 357 TYR A CE2 1 
ATOM   2469 C CZ  . TYR A 1 357 ? 8.181  52.682 11.443  1.00 57.05  ? 357 TYR A CZ  1 
ATOM   2470 O OH  . TYR A 1 357 ? 7.463  53.309 10.447  1.00 59.39  ? 357 TYR A OH  1 
ATOM   2471 N N   . ASP A 1 358 ? 13.063 48.619 14.133  1.00 46.30  ? 358 ASP A N   1 
ATOM   2472 C CA  . ASP A 1 358 ? 14.342 48.152 14.659  1.00 43.72  ? 358 ASP A CA  1 
ATOM   2473 C C   . ASP A 1 358 ? 15.348 49.282 14.560  1.00 42.52  ? 358 ASP A C   1 
ATOM   2474 O O   . ASP A 1 358 ? 15.681 49.737 13.461  1.00 42.89  ? 358 ASP A O   1 
ATOM   2475 C CB  . ASP A 1 358 ? 14.852 46.968 13.851  1.00 42.45  ? 358 ASP A CB  1 
ATOM   2476 C CG  . ASP A 1 358 ? 13.931 45.786 13.922  1.00 45.24  ? 358 ASP A CG  1 
ATOM   2477 O OD1 . ASP A 1 358 ? 13.559 45.392 15.050  1.00 45.00  ? 358 ASP A OD1 1 
ATOM   2478 O OD2 . ASP A 1 358 ? 13.584 45.248 12.845  1.00 47.93  ? 358 ASP A OD2 1 
ATOM   2479 N N   . ILE A 1 359 ? 15.838 49.738 15.703  1.00 39.39  ? 359 ILE A N   1 
ATOM   2480 C CA  . ILE A 1 359 ? 16.798 50.821 15.688  1.00 37.00  ? 359 ILE A CA  1 
ATOM   2481 C C   . ILE A 1 359 ? 18.123 50.419 16.312  1.00 35.27  ? 359 ILE A C   1 
ATOM   2482 O O   . ILE A 1 359 ? 18.153 49.785 17.367  1.00 33.28  ? 359 ILE A O   1 
ATOM   2483 C CB  . ILE A 1 359 ? 16.253 52.070 16.429  1.00 36.71  ? 359 ILE A CB  1 
ATOM   2484 C CG1 . ILE A 1 359 ? 15.141 52.727 15.612  1.00 37.49  ? 359 ILE A CG1 1 
ATOM   2485 C CG2 . ILE A 1 359 ? 17.357 53.089 16.623  1.00 37.67  ? 359 ILE A CG2 1 
ATOM   2486 C CD1 . ILE A 1 359 ? 13.862 51.974 15.600  1.00 36.80  ? 359 ILE A CD1 1 
ATOM   2487 N N   . LEU A 1 360 ? 19.209 50.774 15.625  1.00 32.84  ? 360 LEU A N   1 
ATOM   2488 C CA  . LEU A 1 360 ? 20.565 50.531 16.098  1.00 31.45  ? 360 LEU A CA  1 
ATOM   2489 C C   . LEU A 1 360 ? 21.168 51.920 16.144  1.00 32.08  ? 360 LEU A C   1 
ATOM   2490 O O   . LEU A 1 360 ? 21.330 52.550 15.103  1.00 34.45  ? 360 LEU A O   1 
ATOM   2491 C CB  . LEU A 1 360 ? 21.360 49.667 15.121  1.00 29.30  ? 360 LEU A CB  1 
ATOM   2492 C CG  . LEU A 1 360 ? 22.872 49.609 15.390  1.00 27.08  ? 360 LEU A CG  1 
ATOM   2493 C CD1 . LEU A 1 360 ? 23.133 49.224 16.834  1.00 24.31  ? 360 LEU A CD1 1 
ATOM   2494 C CD2 . LEU A 1 360 ? 23.524 48.617 14.446  1.00 26.19  ? 360 LEU A CD2 1 
ATOM   2495 N N   . MET A 1 361 ? 21.495 52.409 17.336  1.00 30.72  ? 361 MET A N   1 
ATOM   2496 C CA  . MET A 1 361 ? 22.040 53.745 17.444  1.00 30.87  ? 361 MET A CA  1 
ATOM   2497 C C   . MET A 1 361 ? 23.103 53.843 18.512  1.00 32.00  ? 361 MET A C   1 
ATOM   2498 O O   . MET A 1 361 ? 23.260 52.941 19.337  1.00 32.61  ? 361 MET A O   1 
ATOM   2499 C CB  . MET A 1 361 ? 20.915 54.725 17.757  1.00 32.85  ? 361 MET A CB  1 
ATOM   2500 C CG  . MET A 1 361 ? 20.250 54.464 19.093  1.00 34.97  ? 361 MET A CG  1 
ATOM   2501 S SD  . MET A 1 361 ? 18.535 55.024 19.143  1.00 38.20  ? 361 MET A SD  1 
ATOM   2502 C CE  . MET A 1 361 ? 18.732 56.854 19.146  1.00 33.39  ? 361 MET A CE  1 
ATOM   2503 N N   . GLY A 1 362 ? 23.833 54.954 18.494  1.00 31.84  ? 362 GLY A N   1 
ATOM   2504 C CA  . GLY A 1 362 ? 24.875 55.149 19.479  1.00 31.21  ? 362 GLY A CA  1 
ATOM   2505 C C   . GLY A 1 362 ? 25.597 56.468 19.328  1.00 31.53  ? 362 GLY A C   1 
ATOM   2506 O O   . GLY A 1 362 ? 25.171 57.344 18.581  1.00 31.53  ? 362 GLY A O   1 
ATOM   2507 N N   . ASN A 1 363 ? 26.708 56.593 20.046  1.00 30.46  ? 363 ASN A N   1 
ATOM   2508 C CA  . ASN A 1 363 ? 27.530 57.791 20.038  1.00 28.67  ? 363 ASN A CA  1 
ATOM   2509 C C   . ASN A 1 363 ? 29.001 57.395 20.146  1.00 27.43  ? 363 ASN A C   1 
ATOM   2510 O O   . ASN A 1 363 ? 29.318 56.240 20.398  1.00 27.21  ? 363 ASN A O   1 
ATOM   2511 C CB  . ASN A 1 363 ? 27.152 58.666 21.228  1.00 28.98  ? 363 ASN A CB  1 
ATOM   2512 C CG  . ASN A 1 363 ? 25.703 59.065 21.209  1.00 29.14  ? 363 ASN A CG  1 
ATOM   2513 O OD1 . ASN A 1 363 ? 25.297 59.931 20.447  1.00 33.80  ? 363 ASN A OD1 1 
ATOM   2514 N ND2 . ASN A 1 363 ? 24.909 58.426 22.036  1.00 29.45  ? 363 ASN A ND2 1 
ATOM   2515 N N   . VAL A 1 364 ? 29.900 58.346 19.936  1.00 28.36  ? 364 VAL A N   1 
ATOM   2516 C CA  . VAL A 1 364 ? 31.318 58.052 20.065  1.00 30.87  ? 364 VAL A CA  1 
ATOM   2517 C C   . VAL A 1 364 ? 31.732 58.717 21.361  1.00 31.71  ? 364 VAL A C   1 
ATOM   2518 O O   . VAL A 1 364 ? 31.019 59.589 21.859  1.00 32.76  ? 364 VAL A O   1 
ATOM   2519 C CB  . VAL A 1 364 ? 32.147 58.614 18.889  1.00 31.71  ? 364 VAL A CB  1 
ATOM   2520 C CG1 . VAL A 1 364 ? 31.630 58.034 17.578  1.00 27.74  ? 364 VAL A CG1 1 
ATOM   2521 C CG2 . VAL A 1 364 ? 32.109 60.143 18.889  1.00 30.26  ? 364 VAL A CG2 1 
ATOM   2522 N N   . ARG A 1 365 ? 32.877 58.326 21.906  1.00 32.85  ? 365 ARG A N   1 
ATOM   2523 C CA  . ARG A 1 365 ? 33.305 58.890 23.181  1.00 36.05  ? 365 ARG A CA  1 
ATOM   2524 C C   . ARG A 1 365 ? 33.489 60.393 23.274  1.00 34.59  ? 365 ARG A C   1 
ATOM   2525 O O   . ARG A 1 365 ? 33.298 60.971 24.341  1.00 35.49  ? 365 ARG A O   1 
ATOM   2526 C CB  . ARG A 1 365 ? 34.592 58.226 23.665  1.00 39.09  ? 365 ARG A CB  1 
ATOM   2527 C CG  . ARG A 1 365 ? 34.875 58.510 25.137  1.00 42.08  ? 365 ARG A CG  1 
ATOM   2528 C CD  . ARG A 1 365 ? 36.202 57.945 25.544  1.00 45.60  ? 365 ARG A CD  1 
ATOM   2529 N NE  . ARG A 1 365 ? 37.293 58.663 24.895  1.00 50.52  ? 365 ARG A NE  1 
ATOM   2530 C CZ  . ARG A 1 365 ? 38.518 58.174 24.748  1.00 52.06  ? 365 ARG A CZ  1 
ATOM   2531 N NH1 . ARG A 1 365 ? 38.809 56.961 25.201  1.00 53.21  ? 365 ARG A NH1 1 
ATOM   2532 N NH2 . ARG A 1 365 ? 39.455 58.902 24.157  1.00 54.15  ? 365 ARG A NH2 1 
ATOM   2533 N N   . ASP A 1 366 ? 33.849 61.040 22.176  1.00 35.47  ? 366 ASP A N   1 
ATOM   2534 C CA  . ASP A 1 366 ? 34.075 62.474 22.230  1.00 37.48  ? 366 ASP A CA  1 
ATOM   2535 C C   . ASP A 1 366 ? 33.440 63.231 21.069  1.00 38.25  ? 366 ASP A C   1 
ATOM   2536 O O   . ASP A 1 366 ? 34.113 63.845 20.245  1.00 38.51  ? 366 ASP A O   1 
ATOM   2537 C CB  . ASP A 1 366 ? 35.582 62.728 22.318  1.00 37.31  ? 366 ASP A CB  1 
ATOM   2538 C CG  . ASP A 1 366 ? 36.241 61.922 23.437  1.00 38.99  ? 366 ASP A CG  1 
ATOM   2539 O OD1 . ASP A 1 366 ? 35.921 62.161 24.623  1.00 39.25  ? 366 ASP A OD1 1 
ATOM   2540 O OD2 . ASP A 1 366 ? 37.071 61.038 23.135  1.00 38.18  ? 366 ASP A OD2 1 
ATOM   2541 N N   . GLU A 1 367 ? 32.116 63.188 21.036  1.00 39.34  ? 367 GLU A N   1 
ATOM   2542 C CA  . GLU A 1 367 ? 31.334 63.841 20.005  1.00 39.71  ? 367 GLU A CA  1 
ATOM   2543 C C   . GLU A 1 367 ? 31.749 65.287 19.736  1.00 40.67  ? 367 GLU A C   1 
ATOM   2544 O O   . GLU A 1 367 ? 32.178 65.623 18.637  1.00 44.11  ? 367 GLU A O   1 
ATOM   2545 C CB  . GLU A 1 367 ? 29.852 63.807 20.390  1.00 38.09  ? 367 GLU A CB  1 
ATOM   2546 C CG  . GLU A 1 367 ? 29.254 62.403 20.519  1.00 40.04  ? 367 GLU A CG  1 
ATOM   2547 C CD  . GLU A 1 367 ? 28.799 61.792 19.181  1.00 38.95  ? 367 GLU A CD  1 
ATOM   2548 O OE1 . GLU A 1 367 ? 28.892 62.459 18.127  1.00 36.54  ? 367 GLU A OE1 1 
ATOM   2549 O OE2 . GLU A 1 367 ? 28.336 60.633 19.192  1.00 37.73  ? 367 GLU A OE2 1 
ATOM   2550 N N   . GLY A 1 368 ? 31.642 66.132 20.750  1.00 40.11  ? 368 GLY A N   1 
ATOM   2551 C CA  . GLY A 1 368 ? 31.947 67.534 20.572  1.00 39.86  ? 368 GLY A CA  1 
ATOM   2552 C C   . GLY A 1 368 ? 33.357 68.058 20.408  1.00 41.00  ? 368 GLY A C   1 
ATOM   2553 O O   . GLY A 1 368 ? 33.494 69.241 20.103  1.00 41.74  ? 368 GLY A O   1 
ATOM   2554 N N   . THR A 1 369 ? 34.401 67.247 20.578  1.00 42.03  ? 369 THR A N   1 
ATOM   2555 C CA  . THR A 1 369 ? 35.751 67.804 20.446  1.00 44.31  ? 369 THR A CA  1 
ATOM   2556 C C   . THR A 1 369 ? 35.980 68.675 19.214  1.00 47.25  ? 369 THR A C   1 
ATOM   2557 O O   . THR A 1 369 ? 36.147 69.887 19.345  1.00 49.86  ? 369 THR A O   1 
ATOM   2558 C CB  . THR A 1 369 ? 36.888 66.731 20.489  1.00 43.65  ? 369 THR A CB  1 
ATOM   2559 O OG1 . THR A 1 369 ? 36.521 65.588 19.717  1.00 43.00  ? 369 THR A OG1 1 
ATOM   2560 C CG2 . THR A 1 369 ? 37.181 66.317 21.914  1.00 43.83  ? 369 THR A CG2 1 
ATOM   2561 N N   . TYR A 1 370 ? 35.965 68.102 18.014  1.00 49.73  ? 370 TYR A N   1 
ATOM   2562 C CA  . TYR A 1 370 ? 36.237 68.940 16.853  1.00 51.39  ? 370 TYR A CA  1 
ATOM   2563 C C   . TYR A 1 370 ? 35.260 70.103 16.640  1.00 51.32  ? 370 TYR A C   1 
ATOM   2564 O O   . TYR A 1 370 ? 35.632 71.122 16.048  1.00 51.78  ? 370 TYR A O   1 
ATOM   2565 C CB  . TYR A 1 370 ? 36.417 68.087 15.577  1.00 51.85  ? 370 TYR A CB  1 
ATOM   2566 C CG  . TYR A 1 370 ? 35.189 67.760 14.754  1.00 53.46  ? 370 TYR A CG  1 
ATOM   2567 C CD1 . TYR A 1 370 ? 34.497 68.755 14.048  1.00 53.41  ? 370 TYR A CD1 1 
ATOM   2568 C CD2 . TYR A 1 370 ? 34.761 66.442 14.623  1.00 54.39  ? 370 TYR A CD2 1 
ATOM   2569 C CE1 . TYR A 1 370 ? 33.414 68.438 13.231  1.00 52.12  ? 370 TYR A CE1 1 
ATOM   2570 C CE2 . TYR A 1 370 ? 33.683 66.113 13.809  1.00 54.35  ? 370 TYR A CE2 1 
ATOM   2571 C CZ  . TYR A 1 370 ? 33.016 67.111 13.117  1.00 54.17  ? 370 TYR A CZ  1 
ATOM   2572 O OH  . TYR A 1 370 ? 31.966 66.757 12.303  1.00 56.05  ? 370 TYR A OH  1 
ATOM   2573 N N   . PHE A 1 371 ? 34.030 69.979 17.131  1.00 49.72  ? 371 PHE A N   1 
ATOM   2574 C CA  . PHE A 1 371 ? 33.080 71.077 16.978  1.00 49.39  ? 371 PHE A CA  1 
ATOM   2575 C C   . PHE A 1 371 ? 33.528 72.226 17.874  1.00 50.47  ? 371 PHE A C   1 
ATOM   2576 O O   . PHE A 1 371 ? 33.235 73.397 17.616  1.00 50.73  ? 371 PHE A O   1 
ATOM   2577 C CB  . PHE A 1 371 ? 31.667 70.642 17.370  1.00 46.33  ? 371 PHE A CB  1 
ATOM   2578 C CG  . PHE A 1 371 ? 30.991 69.766 16.352  1.00 43.61  ? 371 PHE A CG  1 
ATOM   2579 C CD1 . PHE A 1 371 ? 30.600 70.282 15.118  1.00 42.10  ? 371 PHE A CD1 1 
ATOM   2580 C CD2 . PHE A 1 371 ? 30.724 68.430 16.631  1.00 41.46  ? 371 PHE A CD2 1 
ATOM   2581 C CE1 . PHE A 1 371 ? 29.953 69.480 14.180  1.00 39.99  ? 371 PHE A CE1 1 
ATOM   2582 C CE2 . PHE A 1 371 ? 30.079 67.625 15.699  1.00 39.36  ? 371 PHE A CE2 1 
ATOM   2583 C CZ  . PHE A 1 371 ? 29.691 68.152 14.474  1.00 39.83  ? 371 PHE A CZ  1 
ATOM   2584 N N   . LEU A 1 372 ? 34.242 71.876 18.937  1.00 51.29  ? 372 LEU A N   1 
ATOM   2585 C CA  . LEU A 1 372 ? 34.742 72.867 19.874  1.00 53.17  ? 372 LEU A CA  1 
ATOM   2586 C C   . LEU A 1 372 ? 36.008 73.475 19.292  1.00 54.91  ? 372 LEU A C   1 
ATOM   2587 O O   . LEU A 1 372 ? 36.203 74.692 19.338  1.00 57.11  ? 372 LEU A O   1 
ATOM   2588 C CB  . LEU A 1 372 ? 35.056 72.212 21.217  1.00 53.98  ? 372 LEU A CB  1 
ATOM   2589 C CG  . LEU A 1 372 ? 35.683 73.094 22.303  1.00 54.53  ? 372 LEU A CG  1 
ATOM   2590 C CD1 . LEU A 1 372 ? 34.691 74.166 22.729  1.00 52.91  ? 372 LEU A CD1 1 
ATOM   2591 C CD2 . LEU A 1 372 ? 36.088 72.223 23.496  1.00 53.84  ? 372 LEU A CD2 1 
ATOM   2592 N N   . LEU A 1 373 ? 36.870 72.625 18.742  1.00 54.49  ? 373 LEU A N   1 
ATOM   2593 C CA  . LEU A 1 373 ? 38.103 73.107 18.141  1.00 54.90  ? 373 LEU A CA  1 
ATOM   2594 C C   . LEU A 1 373 ? 37.779 74.120 17.053  1.00 54.56  ? 373 LEU A C   1 
ATOM   2595 O O   . LEU A 1 373 ? 38.375 75.191 17.013  1.00 55.26  ? 373 LEU A O   1 
ATOM   2596 C CB  . LEU A 1 373 ? 38.914 71.946 17.543  1.00 54.98  ? 373 LEU A CB  1 
ATOM   2597 C CG  . LEU A 1 373 ? 40.213 72.305 16.804  1.00 53.61  ? 373 LEU A CG  1 
ATOM   2598 C CD1 . LEU A 1 373 ? 41.104 71.093 16.658  1.00 54.18  ? 373 LEU A CD1 1 
ATOM   2599 C CD2 . LEU A 1 373 ? 39.878 72.861 15.449  1.00 53.39  ? 373 LEU A CD2 1 
ATOM   2600 N N   . TYR A 1 374 ? 36.828 73.785 16.183  1.00 54.34  ? 374 TYR A N   1 
ATOM   2601 C CA  . TYR A 1 374 ? 36.454 74.675 15.085  1.00 54.24  ? 374 TYR A CA  1 
ATOM   2602 C C   . TYR A 1 374 ? 35.803 75.984 15.473  1.00 55.81  ? 374 TYR A C   1 
ATOM   2603 O O   . TYR A 1 374 ? 36.181 77.028 14.958  1.00 56.33  ? 374 TYR A O   1 
ATOM   2604 C CB  . TYR A 1 374 ? 35.549 73.962 14.068  1.00 50.25  ? 374 TYR A CB  1 
ATOM   2605 C CG  . TYR A 1 374 ? 36.311 73.156 13.040  1.00 47.04  ? 374 TYR A CG  1 
ATOM   2606 C CD1 . TYR A 1 374 ? 36.896 71.937 13.380  1.00 46.99  ? 374 TYR A CD1 1 
ATOM   2607 C CD2 . TYR A 1 374 ? 36.481 73.626 11.740  1.00 44.86  ? 374 TYR A CD2 1 
ATOM   2608 C CE1 . TYR A 1 374 ? 37.637 71.209 12.456  1.00 45.37  ? 374 TYR A CE1 1 
ATOM   2609 C CE2 . TYR A 1 374 ? 37.219 72.906 10.808  1.00 44.87  ? 374 TYR A CE2 1 
ATOM   2610 C CZ  . TYR A 1 374 ? 37.796 71.695 11.173  1.00 45.90  ? 374 TYR A CZ  1 
ATOM   2611 O OH  . TYR A 1 374 ? 38.530 70.962 10.262  1.00 46.47  ? 374 TYR A OH  1 
ATOM   2612 N N   . ASP A 1 375 ? 34.830 75.959 16.369  1.00 58.97  ? 375 ASP A N   1 
ATOM   2613 C CA  . ASP A 1 375 ? 34.180 77.210 16.721  1.00 63.85  ? 375 ASP A CA  1 
ATOM   2614 C C   . ASP A 1 375 ? 34.994 78.112 17.638  1.00 65.55  ? 375 ASP A C   1 
ATOM   2615 O O   . ASP A 1 375 ? 34.612 79.255 17.901  1.00 64.98  ? 375 ASP A O   1 
ATOM   2616 C CB  . ASP A 1 375 ? 32.806 76.931 17.315  1.00 66.98  ? 375 ASP A CB  1 
ATOM   2617 C CG  . ASP A 1 375 ? 31.832 76.408 16.279  1.00 68.65  ? 375 ASP A CG  1 
ATOM   2618 O OD1 . ASP A 1 375 ? 32.042 75.281 15.781  1.00 68.95  ? 375 ASP A OD1 1 
ATOM   2619 O OD2 . ASP A 1 375 ? 30.867 77.133 15.954  1.00 68.92  ? 375 ASP A OD2 1 
ATOM   2620 N N   . PHE A 1 376 ? 36.125 77.600 18.110  1.00 67.68  ? 376 PHE A N   1 
ATOM   2621 C CA  . PHE A 1 376 ? 36.992 78.372 18.987  1.00 69.71  ? 376 PHE A CA  1 
ATOM   2622 C C   . PHE A 1 376 ? 38.460 78.075 18.699  1.00 70.55  ? 376 PHE A C   1 
ATOM   2623 O O   . PHE A 1 376 ? 39.225 77.815 19.629  1.00 70.60  ? 376 PHE A O   1 
ATOM   2624 C CB  . PHE A 1 376 ? 36.699 78.045 20.454  1.00 70.80  ? 376 PHE A CB  1 
ATOM   2625 C CG  . PHE A 1 376 ? 35.259 78.230 20.847  1.00 72.04  ? 376 PHE A CG  1 
ATOM   2626 C CD1 . PHE A 1 376 ? 34.279 77.343 20.406  1.00 72.63  ? 376 PHE A CD1 1 
ATOM   2627 C CD2 . PHE A 1 376 ? 34.879 79.289 21.663  1.00 72.39  ? 376 PHE A CD2 1 
ATOM   2628 C CE1 . PHE A 1 376 ? 32.942 77.511 20.772  1.00 72.46  ? 376 PHE A CE1 1 
ATOM   2629 C CE2 . PHE A 1 376 ? 33.545 79.463 22.035  1.00 72.51  ? 376 PHE A CE2 1 
ATOM   2630 C CZ  . PHE A 1 376 ? 32.577 78.573 21.588  1.00 72.15  ? 376 PHE A CZ  1 
ATOM   2631 N N   . ILE A 1 377 ? 38.853 78.116 17.424  1.00 71.48  ? 377 ILE A N   1 
ATOM   2632 C CA  . ILE A 1 377 ? 40.243 77.837 17.053  1.00 72.28  ? 377 ILE A CA  1 
ATOM   2633 C C   . ILE A 1 377 ? 41.223 78.728 17.799  1.00 72.51  ? 377 ILE A C   1 
ATOM   2634 O O   . ILE A 1 377 ? 42.299 78.281 18.199  1.00 72.79  ? 377 ILE A O   1 
ATOM   2635 C CB  . ILE A 1 377 ? 40.507 78.011 15.534  1.00 71.93  ? 377 ILE A CB  1 
ATOM   2636 C CG1 . ILE A 1 377 ? 39.990 76.792 14.770  1.00 72.66  ? 377 ILE A CG1 1 
ATOM   2637 C CG2 . ILE A 1 377 ? 42.007 78.163 15.276  1.00 73.81  ? 377 ILE A CG2 1 
ATOM   2638 C CD1 . ILE A 1 377 ? 40.667 76.563 13.422  1.00 73.16  ? 377 ILE A CD1 1 
ATOM   2639 N N   . ASP A 1 378 ? 40.845 79.990 17.969  1.00 72.24  ? 378 ASP A N   1 
ATOM   2640 C CA  . ASP A 1 378 ? 41.671 80.964 18.673  1.00 71.19  ? 378 ASP A CA  1 
ATOM   2641 C C   . ASP A 1 378 ? 42.202 80.328 19.947  1.00 70.16  ? 378 ASP A C   1 
ATOM   2642 O O   . ASP A 1 378 ? 43.410 80.326 20.202  1.00 68.96  ? 378 ASP A O   1 
ATOM   2643 C CB  . ASP A 1 378 ? 40.827 82.180 19.047  1.00 72.10  ? 378 ASP A CB  1 
ATOM   2644 C CG  . ASP A 1 378 ? 39.939 82.642 17.913  1.00 71.93  ? 378 ASP A CG  1 
ATOM   2645 O OD1 . ASP A 1 378 ? 40.476 83.182 16.919  1.00 70.06  ? 378 ASP A OD1 1 
ATOM   2646 O OD2 . ASP A 1 378 ? 38.705 82.455 18.018  1.00 71.25  ? 378 ASP A OD2 1 
ATOM   2647 N N   . TYR A 1 379 ? 41.269 79.778 20.723  1.00 69.13  ? 379 TYR A N   1 
ATOM   2648 C CA  . TYR A 1 379 ? 41.549 79.136 22.004  1.00 68.49  ? 379 TYR A CA  1 
ATOM   2649 C C   . TYR A 1 379 ? 42.300 77.802 21.947  1.00 67.91  ? 379 TYR A C   1 
ATOM   2650 O O   . TYR A 1 379 ? 43.204 77.561 22.752  1.00 66.17  ? 379 TYR A O   1 
ATOM   2651 C CB  . TYR A 1 379 ? 40.241 78.901 22.755  1.00 68.48  ? 379 TYR A CB  1 
ATOM   2652 C CG  . TYR A 1 379 ? 39.423 80.137 23.066  1.00 69.76  ? 379 TYR A CG  1 
ATOM   2653 C CD1 . TYR A 1 379 ? 39.772 80.994 24.117  1.00 69.81  ? 379 TYR A CD1 1 
ATOM   2654 C CD2 . TYR A 1 379 ? 38.255 80.412 22.354  1.00 70.02  ? 379 TYR A CD2 1 
ATOM   2655 C CE1 . TYR A 1 379 ? 38.971 82.094 24.449  1.00 69.13  ? 379 TYR A CE1 1 
ATOM   2656 C CE2 . TYR A 1 379 ? 37.452 81.504 22.674  1.00 69.83  ? 379 TYR A CE2 1 
ATOM   2657 C CZ  . TYR A 1 379 ? 37.809 82.337 23.723  1.00 69.85  ? 379 TYR A CZ  1 
ATOM   2658 O OH  . TYR A 1 379 ? 36.989 83.396 24.038  1.00 68.15  ? 379 TYR A OH  1 
ATOM   2659 N N   . PHE A 1 380 ? 41.934 76.935 21.009  1.00 67.68  ? 380 PHE A N   1 
ATOM   2660 C CA  . PHE A 1 380 ? 42.568 75.622 20.937  1.00 67.64  ? 380 PHE A CA  1 
ATOM   2661 C C   . PHE A 1 380 ? 43.436 75.345 19.718  1.00 67.62  ? 380 PHE A C   1 
ATOM   2662 O O   . PHE A 1 380 ? 43.528 76.157 18.803  1.00 66.98  ? 380 PHE A O   1 
ATOM   2663 C CB  . PHE A 1 380 ? 41.496 74.542 21.066  1.00 66.81  ? 380 PHE A CB  1 
ATOM   2664 C CG  . PHE A 1 380 ? 40.433 74.871 22.076  1.00 65.55  ? 380 PHE A CG  1 
ATOM   2665 C CD1 . PHE A 1 380 ? 39.350 75.674 21.729  1.00 64.78  ? 380 PHE A CD1 1 
ATOM   2666 C CD2 . PHE A 1 380 ? 40.529 74.407 23.383  1.00 64.28  ? 380 PHE A CD2 1 
ATOM   2667 C CE1 . PHE A 1 380 ? 38.385 76.008 22.664  1.00 63.86  ? 380 PHE A CE1 1 
ATOM   2668 C CE2 . PHE A 1 380 ? 39.567 74.737 24.327  1.00 64.55  ? 380 PHE A CE2 1 
ATOM   2669 C CZ  . PHE A 1 380 ? 38.494 75.539 23.967  1.00 64.67  ? 380 PHE A CZ  1 
ATOM   2670 N N   . ASP A 1 381 ? 44.075 74.180 19.727  1.00 68.59  ? 381 ASP A N   1 
ATOM   2671 C CA  . ASP A 1 381 ? 44.959 73.763 18.647  1.00 69.97  ? 381 ASP A CA  1 
ATOM   2672 C C   . ASP A 1 381 ? 44.632 72.348 18.161  1.00 70.41  ? 381 ASP A C   1 
ATOM   2673 O O   . ASP A 1 381 ? 44.166 71.505 18.924  1.00 71.09  ? 381 ASP A O   1 
ATOM   2674 C CB  . ASP A 1 381 ? 46.421 73.862 19.113  1.00 70.59  ? 381 ASP A CB  1 
ATOM   2675 C CG  . ASP A 1 381 ? 47.389 73.132 18.192  1.00 73.18  ? 381 ASP A CG  1 
ATOM   2676 O OD1 . ASP A 1 381 ? 47.419 71.885 18.247  1.00 74.37  ? 381 ASP A OD1 1 
ATOM   2677 O OD2 . ASP A 1 381 ? 48.116 73.796 17.415  1.00 72.54  ? 381 ASP A OD2 1 
ATOM   2678 N N   . LYS A 1 382 ? 44.878 72.104 16.879  1.00 70.44  ? 382 LYS A N   1 
ATOM   2679 C CA  . LYS A 1 382 ? 44.609 70.819 16.258  1.00 69.88  ? 382 LYS A CA  1 
ATOM   2680 C C   . LYS A 1 382 ? 45.451 69.660 16.768  1.00 69.84  ? 382 LYS A C   1 
ATOM   2681 O O   . LYS A 1 382 ? 44.958 68.546 16.904  1.00 68.84  ? 382 LYS A O   1 
ATOM   2682 C CB  . LYS A 1 382 ? 44.815 70.932 14.755  1.00 70.88  ? 382 LYS A CB  1 
ATOM   2683 C CG  . LYS A 1 382 ? 44.839 69.597 14.032  1.00 74.29  ? 382 LYS A CG  1 
ATOM   2684 C CD  . LYS A 1 382 ? 45.232 69.755 12.575  1.00 75.73  ? 382 LYS A CD  1 
ATOM   2685 C CE  . LYS A 1 382 ? 46.615 70.360 12.443  1.00 78.16  ? 382 LYS A CE  1 
ATOM   2686 N NZ  . LYS A 1 382 ? 47.022 70.496 11.020  1.00 80.36  ? 382 LYS A NZ  1 
ATOM   2687 N N   . ASP A 1 383 ? 46.725 69.917 17.034  1.00 70.57  ? 383 ASP A N   1 
ATOM   2688 C CA  . ASP A 1 383 ? 47.629 68.863 17.477  1.00 71.61  ? 383 ASP A CA  1 
ATOM   2689 C C   . ASP A 1 383 ? 47.803 68.653 18.978  1.00 71.81  ? 383 ASP A C   1 
ATOM   2690 O O   . ASP A 1 383 ? 47.588 67.545 19.472  1.00 72.35  ? 383 ASP A O   1 
ATOM   2691 C CB  . ASP A 1 383 ? 49.005 69.060 16.833  1.00 71.80  ? 383 ASP A CB  1 
ATOM   2692 C CG  . ASP A 1 383 ? 49.018 68.693 15.364  1.00 72.28  ? 383 ASP A CG  1 
ATOM   2693 O OD1 . ASP A 1 383 ? 48.261 69.307 14.586  1.00 71.79  ? 383 ASP A OD1 1 
ATOM   2694 O OD2 . ASP A 1 383 ? 49.789 67.784 14.987  1.00 73.83  ? 383 ASP A OD2 1 
ATOM   2695 N N   . ASP A 1 384 ? 48.198 69.698 19.704  1.00 72.12  ? 384 ASP A N   1 
ATOM   2696 C CA  . ASP A 1 384 ? 48.415 69.569 21.146  1.00 71.62  ? 384 ASP A CA  1 
ATOM   2697 C C   . ASP A 1 384 ? 47.242 70.041 21.990  1.00 68.81  ? 384 ASP A C   1 
ATOM   2698 O O   . ASP A 1 384 ? 46.446 70.876 21.566  1.00 67.71  ? 384 ASP A O   1 
ATOM   2699 C CB  . ASP A 1 384 ? 49.650 70.365 21.601  1.00 75.37  ? 384 ASP A CB  1 
ATOM   2700 C CG  . ASP A 1 384 ? 50.628 70.646 20.477  1.00 77.82  ? 384 ASP A CG  1 
ATOM   2701 O OD1 . ASP A 1 384 ? 51.178 69.679 19.906  1.00 79.92  ? 384 ASP A OD1 1 
ATOM   2702 O OD2 . ASP A 1 384 ? 50.848 71.844 20.177  1.00 79.24  ? 384 ASP A OD2 1 
ATOM   2703 N N   . ALA A 1 385 ? 47.150 69.507 23.199  1.00 66.39  ? 385 ALA A N   1 
ATOM   2704 C CA  . ALA A 1 385 ? 46.098 69.917 24.108  1.00 65.00  ? 385 ALA A CA  1 
ATOM   2705 C C   . ALA A 1 385 ? 46.485 71.328 24.525  1.00 64.55  ? 385 ALA A C   1 
ATOM   2706 O O   . ALA A 1 385 ? 47.640 71.734 24.365  1.00 65.43  ? 385 ALA A O   1 
ATOM   2707 C CB  . ALA A 1 385 ? 46.054 69.000 25.322  1.00 62.50  ? 385 ALA A CB  1 
ATOM   2708 N N   . THR A 1 386 ? 45.527 72.079 25.049  1.00 63.30  ? 386 THR A N   1 
ATOM   2709 C CA  . THR A 1 386 ? 45.809 73.434 25.488  1.00 61.45  ? 386 THR A CA  1 
ATOM   2710 C C   . THR A 1 386 ? 45.319 73.623 26.926  1.00 62.05  ? 386 THR A C   1 
ATOM   2711 O O   . THR A 1 386 ? 44.190 73.280 27.258  1.00 61.02  ? 386 THR A O   1 
ATOM   2712 C CB  . THR A 1 386 ? 45.128 74.471 24.569  1.00 59.73  ? 386 THR A CB  1 
ATOM   2713 O OG1 . THR A 1 386 ? 43.933 74.953 25.191  1.00 57.25  ? 386 THR A OG1 1 
ATOM   2714 C CG2 . THR A 1 386 ? 44.774 73.844 23.224  1.00 58.31  ? 386 THR A CG2 1 
ATOM   2715 N N   . ALA A 1 387 ? 46.186 74.150 27.783  1.00 62.71  ? 387 ALA A N   1 
ATOM   2716 C CA  . ALA A 1 387 ? 45.825 74.393 29.172  1.00 63.79  ? 387 ALA A CA  1 
ATOM   2717 C C   . ALA A 1 387 ? 44.924 75.630 29.242  1.00 63.98  ? 387 ALA A C   1 
ATOM   2718 O O   . ALA A 1 387 ? 45.403 76.761 29.206  1.00 64.74  ? 387 ALA A O   1 
ATOM   2719 C CB  . ALA A 1 387 ? 47.086 74.599 30.013  1.00 64.43  ? 387 ALA A CB  1 
ATOM   2720 N N   . LEU A 1 388 ? 43.618 75.401 29.344  1.00 63.99  ? 388 LEU A N   1 
ATOM   2721 C CA  . LEU A 1 388 ? 42.623 76.469 29.391  1.00 64.34  ? 388 LEU A CA  1 
ATOM   2722 C C   . LEU A 1 388 ? 42.400 77.011 30.805  1.00 65.66  ? 388 LEU A C   1 
ATOM   2723 O O   . LEU A 1 388 ? 42.038 76.261 31.712  1.00 65.76  ? 388 LEU A O   1 
ATOM   2724 C CB  . LEU A 1 388 ? 41.301 75.935 28.831  1.00 64.43  ? 388 LEU A CB  1 
ATOM   2725 C CG  . LEU A 1 388 ? 40.167 76.885 28.450  1.00 64.60  ? 388 LEU A CG  1 
ATOM   2726 C CD1 . LEU A 1 388 ? 40.602 77.774 27.299  1.00 64.22  ? 388 LEU A CD1 1 
ATOM   2727 C CD2 . LEU A 1 388 ? 38.951 76.073 28.049  1.00 64.17  ? 388 LEU A CD2 1 
ATOM   2728 N N   . PRO A 1 389 ? 42.617 78.327 31.010  1.00 66.90  ? 389 PRO A N   1 
ATOM   2729 C CA  . PRO A 1 389 ? 42.444 78.995 32.308  1.00 67.32  ? 389 PRO A CA  1 
ATOM   2730 C C   . PRO A 1 389 ? 41.026 78.842 32.848  1.00 67.89  ? 389 PRO A C   1 
ATOM   2731 O O   . PRO A 1 389 ? 40.163 78.274 32.186  1.00 68.95  ? 389 PRO A O   1 
ATOM   2732 C CB  . PRO A 1 389 ? 42.780 80.449 31.992  1.00 66.98  ? 389 PRO A CB  1 
ATOM   2733 C CG  . PRO A 1 389 ? 43.799 80.325 30.925  1.00 66.35  ? 389 PRO A CG  1 
ATOM   2734 C CD  . PRO A 1 389 ? 43.199 79.262 30.030  1.00 67.22  ? 389 PRO A CD  1 
ATOM   2735 N N   . ARG A 1 390 ? 40.775 79.350 34.047  1.00 68.33  ? 390 ARG A N   1 
ATOM   2736 C CA  . ARG A 1 390 ? 39.445 79.225 34.615  1.00 69.69  ? 390 ARG A CA  1 
ATOM   2737 C C   . ARG A 1 390 ? 38.550 80.334 34.090  1.00 70.49  ? 390 ARG A C   1 
ATOM   2738 O O   . ARG A 1 390 ? 37.329 80.192 34.056  1.00 72.34  ? 390 ARG A O   1 
ATOM   2739 C CB  . ARG A 1 390 ? 39.499 79.282 36.141  1.00 69.53  ? 390 ARG A CB  1 
ATOM   2740 C CG  . ARG A 1 390 ? 38.409 78.467 36.829  1.00 70.16  ? 390 ARG A CG  1 
ATOM   2741 C CD  . ARG A 1 390 ? 36.998 79.013 36.610  1.00 69.02  ? 390 ARG A CD  1 
ATOM   2742 N NE  . ARG A 1 390 ? 35.996 77.964 36.801  1.00 68.87  ? 390 ARG A NE  1 
ATOM   2743 C CZ  . ARG A 1 390 ? 34.783 78.163 37.303  1.00 69.32  ? 390 ARG A CZ  1 
ATOM   2744 N NH1 . ARG A 1 390 ? 34.403 79.377 37.672  1.00 69.91  ? 390 ARG A NH1 1 
ATOM   2745 N NH2 . ARG A 1 390 ? 33.948 77.142 37.445  1.00 69.75  ? 390 ARG A NH2 1 
ATOM   2746 N N   . ASP A 1 391 ? 39.156 81.439 33.675  1.00 70.22  ? 391 ASP A N   1 
ATOM   2747 C CA  . ASP A 1 391 ? 38.381 82.556 33.155  1.00 70.12  ? 391 ASP A CA  1 
ATOM   2748 C C   . ASP A 1 391 ? 38.013 82.260 31.709  1.00 69.12  ? 391 ASP A C   1 
ATOM   2749 O O   . ASP A 1 391 ? 36.949 82.664 31.232  1.00 67.95  ? 391 ASP A O   1 
ATOM   2750 C CB  . ASP A 1 391 ? 39.196 83.846 33.240  1.00 72.94  ? 391 ASP A CB  1 
ATOM   2751 C CG  . ASP A 1 391 ? 40.422 83.819 32.353  1.00 75.23  ? 391 ASP A CG  1 
ATOM   2752 O OD1 . ASP A 1 391 ? 41.173 82.817 32.396  1.00 75.56  ? 391 ASP A OD1 1 
ATOM   2753 O OD2 . ASP A 1 391 ? 40.635 84.806 31.615  1.00 76.63  ? 391 ASP A OD2 1 
ATOM   2754 N N   . LYS A 1 392 ? 38.909 81.551 31.023  1.00 68.44  ? 392 LYS A N   1 
ATOM   2755 C CA  . LYS A 1 392 ? 38.702 81.163 29.628  1.00 66.68  ? 392 LYS A CA  1 
ATOM   2756 C C   . LYS A 1 392 ? 37.618 80.096 29.585  1.00 64.46  ? 392 LYS A C   1 
ATOM   2757 O O   . LYS A 1 392 ? 36.729 80.134 28.737  1.00 64.60  ? 392 LYS A O   1 
ATOM   2758 C CB  . LYS A 1 392 ? 39.995 80.599 29.028  1.00 67.90  ? 392 LYS A CB  1 
ATOM   2759 C CG  . LYS A 1 392 ? 41.035 81.639 28.648  1.00 69.37  ? 392 LYS A CG  1 
ATOM   2760 C CD  . LYS A 1 392 ? 40.593 82.435 27.433  1.00 71.13  ? 392 LYS A CD  1 
ATOM   2761 C CE  . LYS A 1 392 ? 41.676 83.404 26.982  1.00 72.45  ? 392 LYS A CE  1 
ATOM   2762 N NZ  . LYS A 1 392 ? 42.050 84.345 28.074  1.00 72.32  ? 392 LYS A NZ  1 
ATOM   2763 N N   . TYR A 1 393 ? 37.705 79.145 30.511  1.00 61.84  ? 393 TYR A N   1 
ATOM   2764 C CA  . TYR A 1 393 ? 36.735 78.066 30.610  1.00 58.37  ? 393 TYR A CA  1 
ATOM   2765 C C   . TYR A 1 393 ? 35.341 78.668 30.706  1.00 57.98  ? 393 TYR A C   1 
ATOM   2766 O O   . TYR A 1 393 ? 34.434 78.274 29.978  1.00 59.02  ? 393 TYR A O   1 
ATOM   2767 C CB  . TYR A 1 393 ? 37.012 77.212 31.850  1.00 55.01  ? 393 TYR A CB  1 
ATOM   2768 C CG  . TYR A 1 393 ? 35.854 76.319 32.239  1.00 51.97  ? 393 TYR A CG  1 
ATOM   2769 C CD1 . TYR A 1 393 ? 35.676 75.071 31.648  1.00 49.42  ? 393 TYR A CD1 1 
ATOM   2770 C CD2 . TYR A 1 393 ? 34.907 76.747 33.172  1.00 51.27  ? 393 TYR A CD2 1 
ATOM   2771 C CE1 . TYR A 1 393 ? 34.583 74.269 31.976  1.00 48.03  ? 393 TYR A CE1 1 
ATOM   2772 C CE2 . TYR A 1 393 ? 33.812 75.954 33.506  1.00 49.18  ? 393 TYR A CE2 1 
ATOM   2773 C CZ  . TYR A 1 393 ? 33.656 74.718 32.906  1.00 48.29  ? 393 TYR A CZ  1 
ATOM   2774 O OH  . TYR A 1 393 ? 32.578 73.932 33.244  1.00 47.64  ? 393 TYR A OH  1 
ATOM   2775 N N   . LEU A 1 394 ? 35.177 79.621 31.614  1.00 57.88  ? 394 LEU A N   1 
ATOM   2776 C CA  . LEU A 1 394 ? 33.893 80.291 31.809  1.00 57.64  ? 394 LEU A CA  1 
ATOM   2777 C C   . LEU A 1 394 ? 33.492 81.068 30.565  1.00 57.23  ? 394 LEU A C   1 
ATOM   2778 O O   . LEU A 1 394 ? 32.333 81.051 30.144  1.00 55.90  ? 394 LEU A O   1 
ATOM   2779 C CB  . LEU A 1 394 ? 33.981 81.249 32.995  1.00 56.88  ? 394 LEU A CB  1 
ATOM   2780 C CG  . LEU A 1 394 ? 33.989 80.560 34.353  1.00 57.96  ? 394 LEU A CG  1 
ATOM   2781 C CD1 . LEU A 1 394 ? 34.590 81.471 35.406  1.00 56.88  ? 394 LEU A CD1 1 
ATOM   2782 C CD2 . LEU A 1 394 ? 32.562 80.154 34.702  1.00 58.31  ? 394 LEU A CD2 1 
ATOM   2783 N N   . GLU A 1 395 ? 34.469 81.751 29.983  1.00 56.58  ? 395 GLU A N   1 
ATOM   2784 C CA  . GLU A 1 395 ? 34.236 82.553 28.799  1.00 56.58  ? 395 GLU A CA  1 
ATOM   2785 C C   . GLU A 1 395 ? 33.576 81.756 27.684  1.00 54.36  ? 395 GLU A C   1 
ATOM   2786 O O   . GLU A 1 395 ? 32.653 82.235 27.025  1.00 53.77  ? 395 GLU A O   1 
ATOM   2787 C CB  . GLU A 1 395 ? 35.555 83.135 28.317  1.00 59.44  ? 395 GLU A CB  1 
ATOM   2788 C CG  . GLU A 1 395 ? 35.406 84.037 27.124  1.00 64.91  ? 395 GLU A CG  1 
ATOM   2789 C CD  . GLU A 1 395 ? 36.646 84.859 26.879  1.00 67.41  ? 395 GLU A CD  1 
ATOM   2790 O OE1 . GLU A 1 395 ? 37.732 84.262 26.688  1.00 68.15  ? 395 GLU A OE1 1 
ATOM   2791 O OE2 . GLU A 1 395 ? 36.528 86.104 26.878  1.00 69.42  ? 395 GLU A OE2 1 
ATOM   2792 N N   . ILE A 1 396 ? 34.058 80.538 27.477  1.00 52.74  ? 396 ILE A N   1 
ATOM   2793 C CA  . ILE A 1 396 ? 33.522 79.660 26.446  1.00 51.33  ? 396 ILE A CA  1 
ATOM   2794 C C   . ILE A 1 396 ? 32.180 79.075 26.856  1.00 51.32  ? 396 ILE A C   1 
ATOM   2795 O O   . ILE A 1 396 ? 31.178 79.276 26.178  1.00 51.07  ? 396 ILE A O   1 
ATOM   2796 C CB  . ILE A 1 396 ? 34.490 78.511 26.149  1.00 49.64  ? 396 ILE A CB  1 
ATOM   2797 C CG1 . ILE A 1 396 ? 35.749 79.070 25.481  1.00 50.21  ? 396 ILE A CG1 1 
ATOM   2798 C CG2 . ILE A 1 396 ? 33.817 77.479 25.281  1.00 47.65  ? 396 ILE A CG2 1 
ATOM   2799 C CD1 . ILE A 1 396 ? 36.851 78.055 25.295  1.00 50.80  ? 396 ILE A CD1 1 
ATOM   2800 N N   . MET A 1 397 ? 32.164 78.347 27.966  1.00 51.48  ? 397 MET A N   1 
ATOM   2801 C CA  . MET A 1 397 ? 30.934 77.737 28.451  1.00 51.30  ? 397 MET A CA  1 
ATOM   2802 C C   . MET A 1 397 ? 29.775 78.718 28.398  1.00 53.32  ? 397 MET A C   1 
ATOM   2803 O O   . MET A 1 397 ? 28.651 78.339 28.081  1.00 53.77  ? 397 MET A O   1 
ATOM   2804 C CB  . MET A 1 397 ? 31.111 77.256 29.886  1.00 49.71  ? 397 MET A CB  1 
ATOM   2805 C CG  . MET A 1 397 ? 31.973 76.032 30.031  1.00 47.33  ? 397 MET A CG  1 
ATOM   2806 S SD  . MET A 1 397 ? 31.215 74.625 29.223  1.00 44.31  ? 397 MET A SD  1 
ATOM   2807 C CE  . MET A 1 397 ? 29.941 74.203 30.392  1.00 42.27  ? 397 MET A CE  1 
ATOM   2808 N N   . ASN A 1 398 ? 30.051 79.979 28.717  1.00 55.04  ? 398 ASN A N   1 
ATOM   2809 C CA  . ASN A 1 398 ? 29.014 81.001 28.713  1.00 56.35  ? 398 ASN A CA  1 
ATOM   2810 C C   . ASN A 1 398 ? 28.620 81.326 27.300  1.00 57.55  ? 398 ASN A C   1 
ATOM   2811 O O   . ASN A 1 398 ? 27.477 81.701 27.043  1.00 58.62  ? 398 ASN A O   1 
ATOM   2812 C CB  . ASN A 1 398 ? 29.491 82.266 29.420  1.00 57.52  ? 398 ASN A CB  1 
ATOM   2813 C CG  . ASN A 1 398 ? 29.470 82.131 30.931  1.00 57.79  ? 398 ASN A CG  1 
ATOM   2814 O OD1 . ASN A 1 398 ? 28.418 81.882 31.532  1.00 57.83  ? 398 ASN A OD1 1 
ATOM   2815 N ND2 . ASN A 1 398 ? 30.630 82.297 31.554  1.00 57.58  ? 398 ASN A ND2 1 
ATOM   2816 N N   . ASN A 1 399 ? 29.573 81.189 26.383  1.00 58.19  ? 399 ASN A N   1 
ATOM   2817 C CA  . ASN A 1 399 ? 29.312 81.441 24.967  1.00 58.00  ? 399 ASN A CA  1 
ATOM   2818 C C   . ASN A 1 399 ? 28.434 80.298 24.451  1.00 57.04  ? 399 ASN A C   1 
ATOM   2819 O O   . ASN A 1 399 ? 27.279 80.504 24.054  1.00 56.63  ? 399 ASN A O   1 
ATOM   2820 C CB  . ASN A 1 399 ? 30.630 81.479 24.183  1.00 58.76  ? 399 ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 399 ? 30.421 81.586 22.675  1.00 60.07  ? 399 ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 399 ? 31.372 81.470 21.896  1.00 59.59  ? 399 ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 399 ? 29.177 81.812 22.260  1.00 60.94  ? 399 ASN A ND2 1 
ATOM   2824 N N   . ILE A 1 400 ? 28.993 79.091 24.480  1.00 54.92  ? 400 ILE A N   1 
ATOM   2825 C CA  . ILE A 1 400 ? 28.293 77.908 24.021  1.00 51.95  ? 400 ILE A CA  1 
ATOM   2826 C C   . ILE A 1 400 ? 26.856 77.874 24.515  1.00 51.38  ? 400 ILE A C   1 
ATOM   2827 O O   . ILE A 1 400 ? 25.936 77.778 23.711  1.00 51.76  ? 400 ILE A O   1 
ATOM   2828 C CB  . ILE A 1 400 ? 29.022 76.628 24.462  1.00 50.51  ? 400 ILE A CB  1 
ATOM   2829 C CG1 . ILE A 1 400 ? 30.378 76.543 23.769  1.00 48.33  ? 400 ILE A CG1 1 
ATOM   2830 C CG2 . ILE A 1 400 ? 28.206 75.409 24.090  1.00 51.24  ? 400 ILE A CG2 1 
ATOM   2831 C CD1 . ILE A 1 400 ? 31.146 75.295 24.110  1.00 46.69  ? 400 ILE A CD1 1 
ATOM   2832 N N   . PHE A 1 401 ? 26.654 77.975 25.824  1.00 51.44  ? 401 PHE A N   1 
ATOM   2833 C CA  . PHE A 1 401 ? 25.298 77.935 26.370  1.00 53.31  ? 401 PHE A CA  1 
ATOM   2834 C C   . PHE A 1 401 ? 24.737 79.298 26.743  1.00 56.12  ? 401 PHE A C   1 
ATOM   2835 O O   . PHE A 1 401 ? 23.940 79.412 27.676  1.00 56.01  ? 401 PHE A O   1 
ATOM   2836 C CB  . PHE A 1 401 ? 25.248 77.025 27.590  1.00 49.56  ? 401 PHE A CB  1 
ATOM   2837 C CG  . PHE A 1 401 ? 25.857 75.692 27.355  1.00 50.05  ? 401 PHE A CG  1 
ATOM   2838 C CD1 . PHE A 1 401 ? 27.225 75.508 27.483  1.00 50.32  ? 401 PHE A CD1 1 
ATOM   2839 C CD2 . PHE A 1 401 ? 25.072 74.619 26.963  1.00 51.22  ? 401 PHE A CD2 1 
ATOM   2840 C CE1 . PHE A 1 401 ? 27.806 74.273 27.225  1.00 50.75  ? 401 PHE A CE1 1 
ATOM   2841 C CE2 . PHE A 1 401 ? 25.645 73.377 26.700  1.00 51.74  ? 401 PHE A CE2 1 
ATOM   2842 C CZ  . PHE A 1 401 ? 27.016 73.203 26.831  1.00 50.75  ? 401 PHE A CZ  1 
ATOM   2843 N N   . GLY A 1 402 ? 25.146 80.326 26.005  1.00 59.04  ? 402 GLY A N   1 
ATOM   2844 C CA  . GLY A 1 402 ? 24.677 81.670 26.285  1.00 61.99  ? 402 GLY A CA  1 
ATOM   2845 C C   . GLY A 1 402 ? 23.193 81.861 26.054  1.00 63.52  ? 402 GLY A C   1 
ATOM   2846 O O   . GLY A 1 402 ? 22.605 82.843 26.505  1.00 64.17  ? 402 GLY A O   1 
ATOM   2847 N N   . LYS A 1 403 ? 22.582 80.912 25.357  1.00 65.52  ? 403 LYS A N   1 
ATOM   2848 C CA  . LYS A 1 403 ? 21.161 80.986 25.050  1.00 67.73  ? 403 LYS A CA  1 
ATOM   2849 C C   . LYS A 1 403 ? 20.261 80.388 26.131  1.00 67.82  ? 403 LYS A C   1 
ATOM   2850 O O   . LYS A 1 403 ? 19.038 80.431 26.015  1.00 68.41  ? 403 LYS A O   1 
ATOM   2851 C CB  . LYS A 1 403 ? 20.884 80.302 23.702  1.00 68.85  ? 403 LYS A CB  1 
ATOM   2852 C CG  . LYS A 1 403 ? 21.278 78.832 23.641  1.00 72.26  ? 403 LYS A CG  1 
ATOM   2853 C CD  . LYS A 1 403 ? 22.779 78.614 23.857  1.00 73.67  ? 403 LYS A CD  1 
ATOM   2854 C CE  . LYS A 1 403 ? 23.130 77.132 23.808  1.00 75.10  ? 403 LYS A CE  1 
ATOM   2855 N NZ  . LYS A 1 403 ? 22.353 76.323 24.799  1.00 76.09  ? 403 LYS A NZ  1 
ATOM   2856 N N   . ALA A 1 404 ? 20.855 79.841 27.186  1.00 67.52  ? 404 ALA A N   1 
ATOM   2857 C CA  . ALA A 1 404 ? 20.060 79.243 28.255  1.00 67.64  ? 404 ALA A CA  1 
ATOM   2858 C C   . ALA A 1 404 ? 19.991 80.159 29.478  1.00 67.09  ? 404 ALA A C   1 
ATOM   2859 O O   . ALA A 1 404 ? 20.893 80.969 29.699  1.00 66.42  ? 404 ALA A O   1 
ATOM   2860 C CB  . ALA A 1 404 ? 20.643 77.883 28.634  1.00 66.80  ? 404 ALA A CB  1 
ATOM   2861 N N   . THR A 1 405 ? 18.919 80.038 30.262  1.00 66.82  ? 405 THR A N   1 
ATOM   2862 C CA  . THR A 1 405 ? 18.744 80.860 31.462  1.00 68.24  ? 405 THR A CA  1 
ATOM   2863 C C   . THR A 1 405 ? 20.024 80.759 32.278  1.00 68.89  ? 405 THR A C   1 
ATOM   2864 O O   . THR A 1 405 ? 20.681 79.719 32.249  1.00 70.80  ? 405 THR A O   1 
ATOM   2865 C CB  . THR A 1 405 ? 17.568 80.363 32.334  1.00 68.28  ? 405 THR A CB  1 
ATOM   2866 O OG1 . THR A 1 405 ? 17.831 79.028 32.776  1.00 68.59  ? 405 THR A OG1 1 
ATOM   2867 C CG2 . THR A 1 405 ? 16.265 80.378 31.546  1.00 68.06  ? 405 THR A CG2 1 
ATOM   2868 N N   . GLN A 1 406 ? 20.389 81.813 33.007  1.00 68.22  ? 406 GLN A N   1 
ATOM   2869 C CA  . GLN A 1 406 ? 21.628 81.747 33.779  1.00 67.02  ? 406 GLN A CA  1 
ATOM   2870 C C   . GLN A 1 406 ? 21.573 80.604 34.773  1.00 63.80  ? 406 GLN A C   1 
ATOM   2871 O O   . GLN A 1 406 ? 22.598 80.023 35.106  1.00 62.76  ? 406 GLN A O   1 
ATOM   2872 C CB  . GLN A 1 406 ? 21.911 83.050 34.527  1.00 70.40  ? 406 GLN A CB  1 
ATOM   2873 C CG  . GLN A 1 406 ? 23.380 83.159 34.950  1.00 74.77  ? 406 GLN A CG  1 
ATOM   2874 C CD  . GLN A 1 406 ? 23.669 84.333 35.874  1.00 76.85  ? 406 GLN A CD  1 
ATOM   2875 O OE1 . GLN A 1 406 ? 23.342 85.480 35.565  1.00 78.77  ? 406 GLN A OE1 1 
ATOM   2876 N NE2 . GLN A 1 406 ? 24.301 84.050 37.011  1.00 77.57  ? 406 GLN A NE2 1 
ATOM   2877 N N   . ALA A 1 407 ? 20.368 80.281 35.233  1.00 61.55  ? 407 ALA A N   1 
ATOM   2878 C CA  . ALA A 1 407 ? 20.176 79.194 36.188  1.00 59.93  ? 407 ALA A CA  1 
ATOM   2879 C C   . ALA A 1 407 ? 20.709 77.873 35.637  1.00 59.56  ? 407 ALA A C   1 
ATOM   2880 O O   . ALA A 1 407 ? 21.432 77.153 36.321  1.00 60.12  ? 407 ALA A O   1 
ATOM   2881 C CB  . ALA A 1 407 ? 18.701 79.058 36.545  1.00 57.95  ? 407 ALA A CB  1 
ATOM   2882 N N   . GLU A 1 408 ? 20.354 77.539 34.404  1.00 58.90  ? 408 GLU A N   1 
ATOM   2883 C CA  . GLU A 1 408 ? 20.857 76.306 33.842  1.00 58.98  ? 408 GLU A CA  1 
ATOM   2884 C C   . GLU A 1 408 ? 22.258 76.544 33.296  1.00 57.45  ? 408 GLU A C   1 
ATOM   2885 O O   . GLU A 1 408 ? 23.023 75.608 33.093  1.00 58.55  ? 408 GLU A O   1 
ATOM   2886 C CB  . GLU A 1 408 ? 19.905 75.751 32.767  1.00 61.15  ? 408 GLU A CB  1 
ATOM   2887 C CG  . GLU A 1 408 ? 19.350 76.755 31.765  1.00 65.00  ? 408 GLU A CG  1 
ATOM   2888 C CD  . GLU A 1 408 ? 18.241 76.160 30.889  1.00 66.54  ? 408 GLU A CD  1 
ATOM   2889 O OE1 . GLU A 1 408 ? 18.484 75.111 30.245  1.00 66.90  ? 408 GLU A OE1 1 
ATOM   2890 O OE2 . GLU A 1 408 ? 17.130 76.742 30.846  1.00 65.47  ? 408 GLU A OE2 1 
ATOM   2891 N N   . ARG A 1 409 ? 22.612 77.803 33.086  1.00 55.18  ? 409 ARG A N   1 
ATOM   2892 C CA  . ARG A 1 409 ? 23.941 78.101 32.586  1.00 53.92  ? 409 ARG A CA  1 
ATOM   2893 C C   . ARG A 1 409 ? 24.912 77.889 33.734  1.00 52.21  ? 409 ARG A C   1 
ATOM   2894 O O   . ARG A 1 409 ? 26.041 77.456 33.518  1.00 50.31  ? 409 ARG A O   1 
ATOM   2895 C CB  . ARG A 1 409 ? 24.027 79.544 32.085  1.00 56.16  ? 409 ARG A CB  1 
ATOM   2896 C CG  . ARG A 1 409 ? 25.206 79.802 31.142  1.00 58.56  ? 409 ARG A CG  1 
ATOM   2897 C CD  . ARG A 1 409 ? 25.284 81.268 30.731  1.00 61.17  ? 409 ARG A CD  1 
ATOM   2898 N NE  . ARG A 1 409 ? 23.975 81.793 30.343  1.00 62.44  ? 409 ARG A NE  1 
ATOM   2899 C CZ  . ARG A 1 409 ? 23.371 82.814 30.942  1.00 63.06  ? 409 ARG A CZ  1 
ATOM   2900 N NH1 . ARG A 1 409 ? 23.955 83.435 31.962  1.00 64.78  ? 409 ARG A NH1 1 
ATOM   2901 N NH2 . ARG A 1 409 ? 22.176 83.210 30.528  1.00 63.03  ? 409 ARG A NH2 1 
ATOM   2902 N N   . GLU A 1 410 ? 24.464 78.200 34.953  1.00 51.87  ? 410 GLU A N   1 
ATOM   2903 C CA  . GLU A 1 410 ? 25.285 78.031 36.157  1.00 51.55  ? 410 GLU A CA  1 
ATOM   2904 C C   . GLU A 1 410 ? 25.380 76.546 36.472  1.00 50.31  ? 410 GLU A C   1 
ATOM   2905 O O   . GLU A 1 410 ? 26.464 76.038 36.772  1.00 51.52  ? 410 GLU A O   1 
ATOM   2906 C CB  . GLU A 1 410 ? 24.670 78.738 37.376  1.00 52.30  ? 410 GLU A CB  1 
ATOM   2907 C CG  . GLU A 1 410 ? 24.535 80.254 37.280  1.00 55.44  ? 410 GLU A CG  1 
ATOM   2908 C CD  . GLU A 1 410 ? 23.906 80.882 38.536  1.00 57.83  ? 410 GLU A CD  1 
ATOM   2909 O OE1 . GLU A 1 410 ? 22.874 80.365 39.036  1.00 57.82  ? 410 GLU A OE1 1 
ATOM   2910 O OE2 . GLU A 1 410 ? 24.440 81.907 39.021  1.00 59.35  ? 410 GLU A OE2 1 
ATOM   2911 N N   . ALA A 1 411 ? 24.239 75.862 36.403  1.00 47.55  ? 411 ALA A N   1 
ATOM   2912 C CA  . ALA A 1 411 ? 24.169 74.429 36.678  1.00 46.80  ? 411 ALA A CA  1 
ATOM   2913 C C   . ALA A 1 411 ? 25.097 73.654 35.747  1.00 47.44  ? 411 ALA A C   1 
ATOM   2914 O O   . ALA A 1 411 ? 25.843 72.773 36.181  1.00 48.82  ? 411 ALA A O   1 
ATOM   2915 C CB  . ALA A 1 411 ? 22.736 73.932 36.525  1.00 44.00  ? 411 ALA A CB  1 
ATOM   2916 N N   . ILE A 1 412 ? 25.047 73.992 34.464  1.00 46.69  ? 412 ILE A N   1 
ATOM   2917 C CA  . ILE A 1 412 ? 25.883 73.348 33.466  1.00 45.40  ? 412 ILE A CA  1 
ATOM   2918 C C   . ILE A 1 412 ? 27.354 73.546 33.799  1.00 45.42  ? 412 ILE A C   1 
ATOM   2919 O O   . ILE A 1 412 ? 28.099 72.571 33.934  1.00 45.70  ? 412 ILE A O   1 
ATOM   2920 C CB  . ILE A 1 412 ? 25.621 73.932 32.059  1.00 44.48  ? 412 ILE A CB  1 
ATOM   2921 C CG1 . ILE A 1 412 ? 24.246 73.483 31.551  1.00 44.49  ? 412 ILE A CG1 1 
ATOM   2922 C CG2 . ILE A 1 412 ? 26.727 73.511 31.115  1.00 43.54  ? 412 ILE A CG2 1 
ATOM   2923 C CD1 . ILE A 1 412 ? 23.793 74.181 30.288  1.00 41.26  ? 412 ILE A CD1 1 
ATOM   2924 N N   . ILE A 1 413 ? 27.767 74.808 33.922  1.00 44.59  ? 413 ILE A N   1 
ATOM   2925 C CA  . ILE A 1 413 ? 29.160 75.137 34.221  1.00 44.27  ? 413 ILE A CA  1 
ATOM   2926 C C   . ILE A 1 413 ? 29.645 74.384 35.450  1.00 43.57  ? 413 ILE A C   1 
ATOM   2927 O O   . ILE A 1 413 ? 30.774 73.889 35.480  1.00 42.39  ? 413 ILE A O   1 
ATOM   2928 C CB  . ILE A 1 413 ? 29.364 76.664 34.442  1.00 44.94  ? 413 ILE A CB  1 
ATOM   2929 C CG1 . ILE A 1 413 ? 29.033 77.424 33.155  1.00 44.77  ? 413 ILE A CG1 1 
ATOM   2930 C CG2 . ILE A 1 413 ? 30.814 76.957 34.823  1.00 42.77  ? 413 ILE A CG2 1 
ATOM   2931 C CD1 . ILE A 1 413 ? 29.194 78.916 33.271  1.00 45.71  ? 413 ILE A CD1 1 
ATOM   2932 N N   . PHE A 1 414 ? 28.790 74.284 36.459  1.00 41.64  ? 414 PHE A N   1 
ATOM   2933 C CA  . PHE A 1 414 ? 29.173 73.567 37.657  1.00 40.54  ? 414 PHE A CA  1 
ATOM   2934 C C   . PHE A 1 414 ? 29.345 72.089 37.348  1.00 41.64  ? 414 PHE A C   1 
ATOM   2935 O O   . PHE A 1 414 ? 30.383 71.499 37.649  1.00 43.00  ? 414 PHE A O   1 
ATOM   2936 C CB  . PHE A 1 414 ? 28.125 73.715 38.747  1.00 38.88  ? 414 PHE A CB  1 
ATOM   2937 C CG  . PHE A 1 414 ? 28.574 73.176 40.069  1.00 36.91  ? 414 PHE A CG  1 
ATOM   2938 C CD1 . PHE A 1 414 ? 29.554 73.839 40.798  1.00 35.52  ? 414 PHE A CD1 1 
ATOM   2939 C CD2 . PHE A 1 414 ? 28.048 71.984 40.568  1.00 36.11  ? 414 PHE A CD2 1 
ATOM   2940 C CE1 . PHE A 1 414 ? 30.010 73.325 42.008  1.00 37.10  ? 414 PHE A CE1 1 
ATOM   2941 C CE2 . PHE A 1 414 ? 28.496 71.455 41.780  1.00 35.60  ? 414 PHE A CE2 1 
ATOM   2942 C CZ  . PHE A 1 414 ? 29.479 72.128 42.502  1.00 37.18  ? 414 PHE A CZ  1 
ATOM   2943 N N   . GLN A 1 415 ? 28.314 71.492 36.759  1.00 41.35  ? 415 GLN A N   1 
ATOM   2944 C CA  . GLN A 1 415 ? 28.345 70.083 36.405  1.00 42.68  ? 415 GLN A CA  1 
ATOM   2945 C C   . GLN A 1 415 ? 29.583 69.749 35.566  1.00 45.32  ? 415 GLN A C   1 
ATOM   2946 O O   . GLN A 1 415 ? 30.032 68.603 35.545  1.00 44.59  ? 415 GLN A O   1 
ATOM   2947 C CB  . GLN A 1 415 ? 27.073 69.724 35.629  1.00 42.00  ? 415 GLN A CB  1 
ATOM   2948 C CG  . GLN A 1 415 ? 27.074 68.348 34.983  1.00 41.31  ? 415 GLN A CG  1 
ATOM   2949 C CD  . GLN A 1 415 ? 26.876 67.225 35.972  1.00 41.86  ? 415 GLN A CD  1 
ATOM   2950 O OE1 . GLN A 1 415 ? 26.891 66.050 35.598  1.00 41.07  ? 415 GLN A OE1 1 
ATOM   2951 N NE2 . GLN A 1 415 ? 26.682 67.575 37.244  1.00 40.77  ? 415 GLN A NE2 1 
ATOM   2952 N N   . TYR A 1 416 ? 30.147 70.749 34.893  1.00 47.96  ? 416 TYR A N   1 
ATOM   2953 C CA  . TYR A 1 416 ? 31.313 70.522 34.040  1.00 49.48  ? 416 TYR A CA  1 
ATOM   2954 C C   . TYR A 1 416 ? 32.614 71.191 34.441  1.00 52.52  ? 416 TYR A C   1 
ATOM   2955 O O   . TYR A 1 416 ? 33.445 71.472 33.575  1.00 54.16  ? 416 TYR A O   1 
ATOM   2956 C CB  . TYR A 1 416 ? 30.988 70.910 32.598  1.00 45.57  ? 416 TYR A CB  1 
ATOM   2957 C CG  . TYR A 1 416 ? 30.142 69.880 31.898  1.00 42.79  ? 416 TYR A CG  1 
ATOM   2958 C CD1 . TYR A 1 416 ? 30.722 68.758 31.311  1.00 41.31  ? 416 TYR A CD1 1 
ATOM   2959 C CD2 . TYR A 1 416 ? 28.761 69.997 31.866  1.00 41.36  ? 416 TYR A CD2 1 
ATOM   2960 C CE1 . TYR A 1 416 ? 29.939 67.773 30.707  1.00 39.10  ? 416 TYR A CE1 1 
ATOM   2961 C CE2 . TYR A 1 416 ? 27.971 69.019 31.271  1.00 40.55  ? 416 TYR A CE2 1 
ATOM   2962 C CZ  . TYR A 1 416 ? 28.563 67.908 30.696  1.00 39.21  ? 416 TYR A CZ  1 
ATOM   2963 O OH  . TYR A 1 416 ? 27.770 66.922 30.141  1.00 38.30  ? 416 TYR A OH  1 
ATOM   2964 N N   . THR A 1 417 ? 32.782 71.459 35.736  1.00 56.17  ? 417 THR A N   1 
ATOM   2965 C CA  . THR A 1 417 ? 34.016 72.058 36.258  1.00 60.73  ? 417 THR A CA  1 
ATOM   2966 C C   . THR A 1 417 ? 34.715 70.947 37.030  1.00 63.43  ? 417 THR A C   1 
ATOM   2967 O O   . THR A 1 417 ? 34.059 70.143 37.693  1.00 63.51  ? 417 THR A O   1 
ATOM   2968 C CB  . THR A 1 417 ? 33.761 73.245 37.236  1.00 60.19  ? 417 THR A CB  1 
ATOM   2969 O OG1 . THR A 1 417 ? 32.789 72.864 38.212  1.00 62.03  ? 417 THR A OG1 1 
ATOM   2970 C CG2 . THR A 1 417 ? 33.283 74.478 36.493  1.00 61.09  ? 417 THR A CG2 1 
ATOM   2971 N N   . SER A 1 418 ? 36.040 70.900 36.948  1.00 67.89  ? 418 SER A N   1 
ATOM   2972 C CA  . SER A 1 418 ? 36.776 69.852 37.633  1.00 73.26  ? 418 SER A CA  1 
ATOM   2973 C C   . SER A 1 418 ? 37.880 70.294 38.557  1.00 76.34  ? 418 SER A C   1 
ATOM   2974 O O   . SER A 1 418 ? 38.560 71.284 38.304  1.00 76.99  ? 418 SER A O   1 
ATOM   2975 C CB  . SER A 1 418 ? 37.383 68.888 36.628  1.00 72.44  ? 418 SER A CB  1 
ATOM   2976 O OG  . SER A 1 418 ? 38.218 69.581 35.711  1.00 72.01  ? 418 SER A OG  1 
ATOM   2977 N N   A TRP A 1 419 ? 38.060 69.544 39.639  0.50 79.23  ? 419 TRP A N   1 
ATOM   2978 N N   B TRP A 1 419 ? 38.053 69.529 39.629  0.50 79.15  ? 419 TRP A N   1 
ATOM   2979 C CA  A TRP A 1 419 ? 39.113 69.831 40.612  0.50 82.16  ? 419 TRP A CA  1 
ATOM   2980 C CA  B TRP A 1 419 ? 39.078 69.792 40.640  0.50 82.00  ? 419 TRP A CA  1 
ATOM   2981 C C   A TRP A 1 419 ? 40.018 68.605 40.691  0.50 84.30  ? 419 TRP A C   1 
ATOM   2982 C C   B TRP A 1 419 ? 39.983 68.569 40.707  0.50 84.21  ? 419 TRP A C   1 
ATOM   2983 O O   A TRP A 1 419 ? 40.598 68.315 41.746  0.50 84.66  ? 419 TRP A O   1 
ATOM   2984 O O   B TRP A 1 419 ? 40.537 68.247 41.768  0.50 84.57  ? 419 TRP A O   1 
ATOM   2985 C CB  A TRP A 1 419 ? 38.538 70.107 42.013  0.50 81.66  ? 419 TRP A CB  1 
ATOM   2986 C CB  B TRP A 1 419 ? 38.438 70.002 42.021  0.50 81.30  ? 419 TRP A CB  1 
ATOM   2987 C CG  A TRP A 1 419 ? 37.485 71.182 42.109  0.50 81.52  ? 419 TRP A CG  1 
ATOM   2988 C CG  B TRP A 1 419 ? 37.337 71.026 42.078  0.50 80.81  ? 419 TRP A CG  1 
ATOM   2989 C CD1 A TRP A 1 419 ? 36.158 71.073 41.787  0.50 81.44  ? 419 TRP A CD1 1 
ATOM   2990 C CD1 B TRP A 1 419 ? 37.447 72.339 42.434  0.50 81.05  ? 419 TRP A CD1 1 
ATOM   2991 C CD2 A TRP A 1 419 ? 37.662 72.508 42.630  0.50 81.22  ? 419 TRP A CD2 1 
ATOM   2992 C CD2 B TRP A 1 419 ? 35.951 70.801 41.796  0.50 80.03  ? 419 TRP A CD2 1 
ATOM   2993 N NE1 A TRP A 1 419 ? 35.500 72.245 42.085  0.50 81.15  ? 419 TRP A NE1 1 
ATOM   2994 N NE1 B TRP A 1 419 ? 36.213 72.947 42.397  0.50 80.82  ? 419 TRP A NE1 1 
ATOM   2995 C CE2 A TRP A 1 419 ? 36.400 73.141 42.601  0.50 81.17  ? 419 TRP A CE2 1 
ATOM   2996 C CE2 B TRP A 1 419 ? 35.277 72.026 42.005  0.50 79.86  ? 419 TRP A CE2 1 
ATOM   2997 C CE3 A TRP A 1 419 ? 38.767 73.220 43.121  0.50 80.69  ? 419 TRP A CE3 1 
ATOM   2998 C CE3 B TRP A 1 419 ? 35.213 69.683 41.387  0.50 79.06  ? 419 TRP A CE3 1 
ATOM   2999 C CZ2 A TRP A 1 419 ? 36.212 74.458 43.042  0.50 80.49  ? 419 TRP A CZ2 1 
ATOM   3000 C CZ2 B TRP A 1 419 ? 33.898 72.163 41.814  0.50 79.04  ? 419 TRP A CZ2 1 
ATOM   3001 C CZ3 A TRP A 1 419 ? 38.576 74.531 43.564  0.50 79.71  ? 419 TRP A CZ3 1 
ATOM   3002 C CZ3 B TRP A 1 419 ? 33.843 69.817 41.201  0.50 78.38  ? 419 TRP A CZ3 1 
ATOM   3003 C CH2 A TRP A 1 419 ? 37.308 75.134 43.520  0.50 79.29  ? 419 TRP A CH2 1 
ATOM   3004 C CH2 B TRP A 1 419 ? 33.200 71.051 41.414  0.50 78.59  ? 419 TRP A CH2 1 
ATOM   3005 N N   . GLU A 1 420 ? 40.103 67.879 39.587  1.00 86.75  ? 420 GLU A N   1 
ATOM   3006 C CA  . GLU A 1 420 ? 40.895 66.673 39.513  1.00 90.64  ? 420 GLU A CA  1 
ATOM   3007 C C   . GLU A 1 420 ? 41.972 66.630 38.440  1.00 92.85  ? 420 GLU A C   1 
ATOM   3008 O O   . GLU A 1 420 ? 41.812 67.191 37.350  1.00 92.26  ? 420 GLU A O   1 
ATOM   3009 C CB  . GLU A 1 420 ? 39.969 65.482 39.295  1.00 93.40  ? 420 GLU A CB  1 
ATOM   3010 C CG  . GLU A 1 420 ? 39.755 65.068 37.806  1.00 97.18  ? 420 GLU A CG  1 
ATOM   3011 C CD  . GLU A 1 420 ? 38.327 64.622 37.468  1.00 99.52  ? 420 GLU A CD  1 
ATOM   3012 O OE1 . GLU A 1 420 ? 37.456 65.512 37.325  1.00 100.00 ? 420 GLU A OE1 1 
ATOM   3013 O OE2 . GLU A 1 420 ? 38.077 63.400 37.328  1.00 100.00 ? 420 GLU A OE2 1 
ATOM   3014 N N   . GLY A 1 421 ? 43.062 65.949 38.784  1.00 95.24  ? 421 GLY A N   1 
ATOM   3015 C CA  . GLY A 1 421 ? 44.168 65.786 37.869  1.00 97.85  ? 421 GLY A CA  1 
ATOM   3016 C C   . GLY A 1 421 ? 44.621 67.025 37.118  1.00 99.30  ? 421 GLY A C   1 
ATOM   3017 O O   . GLY A 1 421 ? 45.154 66.900 36.017  1.00 100.00 ? 421 GLY A O   1 
ATOM   3018 N N   . ASN A 1 422 ? 44.427 68.209 37.712  1.00 99.97  ? 422 ASN A N   1 
ATOM   3019 C CA  . ASN A 1 422 ? 44.841 69.492 37.122  1.00 100.00 ? 422 ASN A CA  1 
ATOM   3020 C C   . ASN A 1 422 ? 43.853 70.256 36.266  1.00 99.93  ? 422 ASN A C   1 
ATOM   3021 O O   . ASN A 1 422 ? 42.879 69.706 35.713  1.00 100.00 ? 422 ASN A O   1 
ATOM   3022 C CB  . ASN A 1 422 ? 46.103 69.347 36.243  1.00 100.00 ? 422 ASN A CB  1 
ATOM   3023 C CG  . ASN A 1 422 ? 45.774 68.926 34.771  1.00 100.00 ? 422 ASN A CG  1 
ATOM   3024 O OD1 . ASN A 1 422 ? 44.588 68.948 34.356  1.00 100.00 ? 422 ASN A OD1 1 
ATOM   3025 N ND2 . ASN A 1 422 ? 46.702 68.582 34.008  1.00 100.00 ? 422 ASN A ND2 1 
ATOM   3026 N N   . PRO A 1 423 ? 44.096 71.565 36.149  1.00 99.29  ? 423 PRO A N   1 
ATOM   3027 C CA  . PRO A 1 423 ? 43.209 72.382 35.310  1.00 97.82  ? 423 PRO A CA  1 
ATOM   3028 C C   . PRO A 1 423 ? 43.926 72.271 33.949  1.00 95.54  ? 423 PRO A C   1 
ATOM   3029 O O   . PRO A 1 423 ? 44.518 71.235 33.638  1.00 95.30  ? 423 PRO A O   1 
ATOM   3030 C CB  . PRO A 1 423 ? 43.270 73.765 35.979  1.00 99.05  ? 423 PRO A CB  1 
ATOM   3031 C CG  . PRO A 1 423 ? 44.670 73.783 36.625  1.00 99.92  ? 423 PRO A CG  1 
ATOM   3032 C CD  . PRO A 1 423 ? 44.834 72.372 37.138  1.00 99.39  ? 423 PRO A CD  1 
ATOM   3033 N N   . GLY A 1 424 ? 43.901 73.327 33.143  1.00 92.99  ? 424 GLY A N   1 
ATOM   3034 C CA  . GLY A 1 424 ? 44.568 73.255 31.850  1.00 89.07  ? 424 GLY A CA  1 
ATOM   3035 C C   . GLY A 1 424 ? 43.953 72.272 30.862  1.00 85.46  ? 424 GLY A C   1 
ATOM   3036 O O   . GLY A 1 424 ? 43.006 72.606 30.150  1.00 84.82  ? 424 GLY A O   1 
ATOM   3037 N N   . TYR A 1 425 ? 44.480 71.052 30.830  1.00 81.75  ? 425 TYR A N   1 
ATOM   3038 C CA  . TYR A 1 425 ? 43.993 70.027 29.908  1.00 78.13  ? 425 TYR A CA  1 
ATOM   3039 C C   . TYR A 1 425 ? 42.621 69.468 30.258  1.00 76.27  ? 425 TYR A C   1 
ATOM   3040 O O   . TYR A 1 425 ? 41.883 69.012 29.377  1.00 76.40  ? 425 TYR A O   1 
ATOM   3041 C CB  . TYR A 1 425 ? 45.004 68.879 29.840  1.00 77.35  ? 425 TYR A CB  1 
ATOM   3042 C CG  . TYR A 1 425 ? 46.402 69.327 29.477  1.00 75.27  ? 425 TYR A CG  1 
ATOM   3043 C CD1 . TYR A 1 425 ? 46.637 70.599 28.949  1.00 74.49  ? 425 TYR A CD1 1 
ATOM   3044 C CD2 . TYR A 1 425 ? 47.495 68.484 29.665  1.00 74.64  ? 425 TYR A CD2 1 
ATOM   3045 C CE1 . TYR A 1 425 ? 47.911 71.018 28.626  1.00 73.35  ? 425 TYR A CE1 1 
ATOM   3046 C CE2 . TYR A 1 425 ? 48.780 68.897 29.346  1.00 73.49  ? 425 TYR A CE2 1 
ATOM   3047 C CZ  . TYR A 1 425 ? 48.980 70.162 28.826  1.00 73.17  ? 425 TYR A CZ  1 
ATOM   3048 O OH  . TYR A 1 425 ? 50.253 70.573 28.508  1.00 73.04  ? 425 TYR A OH  1 
ATOM   3049 N N   A GLN A 1 426 ? 42.284 69.508 31.543  0.50 74.73  ? 426 GLN A N   1 
ATOM   3050 N N   B GLN A 1 426 ? 42.279 69.498 31.541  0.50 75.06  ? 426 GLN A N   1 
ATOM   3051 C CA  A GLN A 1 426 ? 41.009 68.994 32.017  0.50 73.00  ? 426 GLN A CA  1 
ATOM   3052 C CA  B GLN A 1 426 ? 40.995 68.983 31.984  0.50 73.58  ? 426 GLN A CA  1 
ATOM   3053 C C   A GLN A 1 426 ? 39.879 69.983 31.764  0.50 71.34  ? 426 GLN A C   1 
ATOM   3054 C C   B GLN A 1 426 ? 39.872 69.984 31.756  0.50 71.70  ? 426 GLN A C   1 
ATOM   3055 O O   A GLN A 1 426 ? 38.725 69.588 31.626  0.50 71.17  ? 426 GLN A O   1 
ATOM   3056 O O   B GLN A 1 426 ? 38.713 69.600 31.626  0.50 71.52  ? 426 GLN A O   1 
ATOM   3057 C CB  A GLN A 1 426 ? 41.101 68.675 33.509  0.50 73.16  ? 426 GLN A CB  1 
ATOM   3058 C CB  B GLN A 1 426 ? 41.071 68.582 33.457  0.50 74.40  ? 426 GLN A CB  1 
ATOM   3059 C CG  A GLN A 1 426 ? 40.359 67.415 33.917  0.50 73.49  ? 426 GLN A CG  1 
ATOM   3060 C CG  B GLN A 1 426 ? 40.749 67.116 33.691  0.50 75.70  ? 426 GLN A CG  1 
ATOM   3061 C CD  A GLN A 1 426 ? 40.818 66.198 33.134  0.50 73.08  ? 426 GLN A CD  1 
ATOM   3062 C CD  B GLN A 1 426 ? 39.345 66.902 34.216  0.50 76.17  ? 426 GLN A CD  1 
ATOM   3063 O OE1 A GLN A 1 426 ? 42.016 65.983 32.948  0.50 72.77  ? 426 GLN A OE1 1 
ATOM   3064 O OE1 B GLN A 1 426 ? 39.062 67.185 35.375  0.50 76.29  ? 426 GLN A OE1 1 
ATOM   3065 N NE2 A GLN A 1 426 ? 39.866 65.391 32.680  0.50 72.67  ? 426 GLN A NE2 1 
ATOM   3066 N NE2 B GLN A 1 426 ? 38.457 66.404 33.364  0.50 76.25  ? 426 GLN A NE2 1 
ATOM   3067 N N   . ASN A 1 427 ? 40.214 71.266 31.701  1.00 69.68  ? 427 ASN A N   1 
ATOM   3068 C CA  . ASN A 1 427 ? 39.214 72.300 31.461  1.00 67.94  ? 427 ASN A CA  1 
ATOM   3069 C C   . ASN A 1 427 ? 38.772 72.270 30.015  1.00 66.25  ? 427 ASN A C   1 
ATOM   3070 O O   . ASN A 1 427 ? 37.603 72.478 29.700  1.00 64.68  ? 427 ASN A O   1 
ATOM   3071 C CB  . ASN A 1 427 ? 39.774 73.684 31.752  1.00 68.71  ? 427 ASN A CB  1 
ATOM   3072 C CG  . ASN A 1 427 ? 39.444 74.153 33.134  1.00 68.87  ? 427 ASN A CG  1 
ATOM   3073 O OD1 . ASN A 1 427 ? 38.339 73.930 33.623  1.00 68.63  ? 427 ASN A OD1 1 
ATOM   3074 N ND2 . ASN A 1 427 ? 40.391 74.824 33.775  1.00 69.51  ? 427 ASN A ND2 1 
ATOM   3075 N N   . GLN A 1 428 ? 39.736 72.029 29.135  1.00 65.35  ? 428 GLN A N   1 
ATOM   3076 C CA  . GLN A 1 428 ? 39.481 71.972 27.704  1.00 63.40  ? 428 GLN A CA  1 
ATOM   3077 C C   . GLN A 1 428 ? 38.584 70.793 27.364  1.00 63.25  ? 428 GLN A C   1 
ATOM   3078 O O   . GLN A 1 428 ? 37.708 70.895 26.510  1.00 65.05  ? 428 GLN A O   1 
ATOM   3079 C CB  . GLN A 1 428 ? 40.800 71.852 26.938  1.00 60.86  ? 428 GLN A CB  1 
ATOM   3080 C CG  . GLN A 1 428 ? 40.634 71.603 25.452  1.00 58.04  ? 428 GLN A CG  1 
ATOM   3081 C CD  . GLN A 1 428 ? 41.952 71.365 24.757  1.00 56.82  ? 428 GLN A CD  1 
ATOM   3082 O OE1 . GLN A 1 428 ? 42.816 70.652 25.273  1.00 56.45  ? 428 GLN A OE1 1 
ATOM   3083 N NE2 . GLN A 1 428 ? 42.115 71.947 23.574  1.00 56.33  ? 428 GLN A NE2 1 
ATOM   3084 N N   . GLN A 1 429 ? 38.793 69.668 28.031  1.00 62.17  ? 429 GLN A N   1 
ATOM   3085 C CA  . GLN A 1 429 ? 37.974 68.516 27.737  1.00 61.58  ? 429 GLN A CA  1 
ATOM   3086 C C   . GLN A 1 429 ? 36.615 68.507 28.421  1.00 59.10  ? 429 GLN A C   1 
ATOM   3087 O O   . GLN A 1 429 ? 35.706 67.804 27.985  1.00 58.00  ? 429 GLN A O   1 
ATOM   3088 C CB  . GLN A 1 429 ? 38.770 67.240 27.994  1.00 64.79  ? 429 GLN A CB  1 
ATOM   3089 C CG  . GLN A 1 429 ? 39.471 66.803 26.709  1.00 68.93  ? 429 GLN A CG  1 
ATOM   3090 C CD  . GLN A 1 429 ? 40.591 65.821 26.924  1.00 72.00  ? 429 GLN A CD  1 
ATOM   3091 O OE1 . GLN A 1 429 ? 40.393 64.735 27.474  1.00 75.01  ? 429 GLN A OE1 1 
ATOM   3092 N NE2 . GLN A 1 429 ? 41.787 66.193 26.481  1.00 74.50  ? 429 GLN A NE2 1 
ATOM   3093 N N   . GLN A 1 430 ? 36.458 69.302 29.473  1.00 57.03  ? 430 GLN A N   1 
ATOM   3094 C CA  . GLN A 1 430 ? 35.166 69.390 30.142  1.00 54.76  ? 430 GLN A CA  1 
ATOM   3095 C C   . GLN A 1 430 ? 34.209 70.117 29.193  1.00 54.05  ? 430 GLN A C   1 
ATOM   3096 O O   . GLN A 1 430 ? 33.051 69.723 29.046  1.00 55.04  ? 430 GLN A O   1 
ATOM   3097 C CB  . GLN A 1 430 ? 35.274 70.158 31.461  1.00 53.95  ? 430 GLN A CB  1 
ATOM   3098 C CG  . GLN A 1 430 ? 35.770 69.333 32.640  1.00 52.97  ? 430 GLN A CG  1 
ATOM   3099 C CD  . GLN A 1 430 ? 34.789 68.251 33.057  1.00 53.05  ? 430 GLN A CD  1 
ATOM   3100 O OE1 . GLN A 1 430 ? 34.644 67.231 32.393  1.00 54.70  ? 430 GLN A OE1 1 
ATOM   3101 N NE2 . GLN A 1 430 ? 34.104 68.478 34.163  1.00 54.13  ? 430 GLN A NE2 1 
ATOM   3102 N N   . ILE A 1 431 ? 34.693 71.175 28.545  1.00 51.60  ? 431 ILE A N   1 
ATOM   3103 C CA  . ILE A 1 431 ? 33.860 71.917 27.604  1.00 49.78  ? 431 ILE A CA  1 
ATOM   3104 C C   . ILE A 1 431 ? 33.578 71.021 26.405  1.00 49.61  ? 431 ILE A C   1 
ATOM   3105 O O   . ILE A 1 431 ? 32.540 71.143 25.760  1.00 49.27  ? 431 ILE A O   1 
ATOM   3106 C CB  . ILE A 1 431 ? 34.549 73.214 27.123  1.00 48.73  ? 431 ILE A CB  1 
ATOM   3107 C CG1 . ILE A 1 431 ? 34.760 74.155 28.311  1.00 47.64  ? 431 ILE A CG1 1 
ATOM   3108 C CG2 . ILE A 1 431 ? 33.689 73.903 26.071  1.00 47.05  ? 431 ILE A CG2 1 
ATOM   3109 C CD1 . ILE A 1 431 ? 35.560 75.389 27.995  1.00 46.18  ? 431 ILE A CD1 1 
ATOM   3110 N N   . GLY A 1 432 ? 34.512 70.120 26.111  1.00 49.26  ? 432 GLY A N   1 
ATOM   3111 C CA  . GLY A 1 432 ? 34.324 69.200 25.006  1.00 47.74  ? 432 GLY A CA  1 
ATOM   3112 C C   . GLY A 1 432 ? 33.226 68.215 25.367  1.00 47.34  ? 432 GLY A C   1 
ATOM   3113 O O   . GLY A 1 432 ? 32.302 67.987 24.594  1.00 45.74  ? 432 GLY A O   1 
ATOM   3114 N N   . ARG A 1 433 ? 33.327 67.633 26.557  1.00 47.93  ? 433 ARG A N   1 
ATOM   3115 C CA  . ARG A 1 433 ? 32.333 66.679 27.024  1.00 47.90  ? 433 ARG A CA  1 
ATOM   3116 C C   . ARG A 1 433 ? 30.951 67.318 27.065  1.00 45.74  ? 433 ARG A C   1 
ATOM   3117 O O   . ARG A 1 433 ? 29.962 66.681 26.715  1.00 46.57  ? 433 ARG A O   1 
ATOM   3118 C CB  . ARG A 1 433 ? 32.701 66.162 28.420  1.00 51.55  ? 433 ARG A CB  1 
ATOM   3119 C CG  . ARG A 1 433 ? 33.914 65.217 28.460  1.00 57.70  ? 433 ARG A CG  1 
ATOM   3120 C CD  . ARG A 1 433 ? 34.649 65.292 29.812  1.00 63.41  ? 433 ARG A CD  1 
ATOM   3121 N NE  . ARG A 1 433 ? 34.674 64.035 30.561  1.00 67.67  ? 433 ARG A NE  1 
ATOM   3122 C CZ  . ARG A 1 433 ? 33.592 63.383 30.984  1.00 70.65  ? 433 ARG A CZ  1 
ATOM   3123 N NH1 . ARG A 1 433 ? 32.372 63.858 30.733  1.00 71.57  ? 433 ARG A NH1 1 
ATOM   3124 N NH2 . ARG A 1 433 ? 33.729 62.254 31.667  1.00 72.60  ? 433 ARG A NH2 1 
ATOM   3125 N N   . ALA A 1 434 ? 30.878 68.579 27.483  1.00 42.25  ? 434 ALA A N   1 
ATOM   3126 C CA  . ALA A 1 434 ? 29.591 69.255 27.572  1.00 39.32  ? 434 ALA A CA  1 
ATOM   3127 C C   . ALA A 1 434 ? 28.961 69.404 26.197  1.00 38.61  ? 434 ALA A C   1 
ATOM   3128 O O   . ALA A 1 434 ? 27.778 69.143 26.031  1.00 40.51  ? 434 ALA A O   1 
ATOM   3129 C CB  . ALA A 1 434 ? 29.746 70.619 28.237  1.00 36.46  ? 434 ALA A CB  1 
ATOM   3130 N N   . VAL A 1 435 ? 29.753 69.816 25.211  1.00 36.85  ? 435 VAL A N   1 
ATOM   3131 C CA  . VAL A 1 435 ? 29.257 69.992 23.860  1.00 33.71  ? 435 VAL A CA  1 
ATOM   3132 C C   . VAL A 1 435 ? 28.726 68.665 23.350  1.00 34.99  ? 435 VAL A C   1 
ATOM   3133 O O   . VAL A 1 435 ? 27.581 68.564 22.925  1.00 34.91  ? 435 VAL A O   1 
ATOM   3134 C CB  . VAL A 1 435 ? 30.374 70.485 22.929  1.00 33.73  ? 435 VAL A CB  1 
ATOM   3135 C CG1 . VAL A 1 435 ? 29.891 70.525 21.485  1.00 33.60  ? 435 VAL A CG1 1 
ATOM   3136 C CG2 . VAL A 1 435 ? 30.817 71.860 23.362  1.00 34.58  ? 435 VAL A CG2 1 
ATOM   3137 N N   . GLY A 1 436 ? 29.567 67.642 23.409  1.00 37.13  ? 436 GLY A N   1 
ATOM   3138 C CA  . GLY A 1 436 ? 29.176 66.327 22.943  1.00 38.49  ? 436 GLY A CA  1 
ATOM   3139 C C   . GLY A 1 436 ? 27.922 65.784 23.598  1.00 39.86  ? 436 GLY A C   1 
ATOM   3140 O O   . GLY A 1 436 ? 27.026 65.276 22.918  1.00 40.78  ? 436 GLY A O   1 
ATOM   3141 N N   . ASP A 1 437 ? 27.856 65.891 24.920  1.00 40.13  ? 437 ASP A N   1 
ATOM   3142 C CA  . ASP A 1 437 ? 26.715 65.398 25.680  1.00 39.44  ? 437 ASP A CA  1 
ATOM   3143 C C   . ASP A 1 437 ? 25.423 66.156 25.383  1.00 37.87  ? 437 ASP A C   1 
ATOM   3144 O O   . ASP A 1 437 ? 24.353 65.565 25.232  1.00 35.54  ? 437 ASP A O   1 
ATOM   3145 C CB  . ASP A 1 437 ? 27.006 65.488 27.183  1.00 42.51  ? 437 ASP A CB  1 
ATOM   3146 C CG  . ASP A 1 437 ? 28.136 64.578 27.622  1.00 44.88  ? 437 ASP A CG  1 
ATOM   3147 O OD1 . ASP A 1 437 ? 28.363 63.544 26.954  1.00 46.21  ? 437 ASP A OD1 1 
ATOM   3148 O OD2 . ASP A 1 437 ? 28.785 64.889 28.648  1.00 47.38  ? 437 ASP A OD2 1 
ATOM   3149 N N   . HIS A 1 438 ? 25.530 67.473 25.311  1.00 36.90  ? 438 HIS A N   1 
ATOM   3150 C CA  . HIS A 1 438 ? 24.369 68.315 25.061  1.00 37.71  ? 438 HIS A CA  1 
ATOM   3151 C C   . HIS A 1 438 ? 23.841 68.216 23.634  1.00 37.69  ? 438 HIS A C   1 
ATOM   3152 O O   . HIS A 1 438 ? 22.629 68.150 23.420  1.00 38.63  ? 438 HIS A O   1 
ATOM   3153 C CB  . HIS A 1 438 ? 24.708 69.776 25.376  1.00 36.62  ? 438 HIS A CB  1 
ATOM   3154 C CG  . HIS A 1 438 ? 23.634 70.746 24.995  1.00 37.44  ? 438 HIS A CG  1 
ATOM   3155 N ND1 . HIS A 1 438 ? 22.307 70.551 25.317  1.00 40.62  ? 438 HIS A ND1 1 
ATOM   3156 C CD2 . HIS A 1 438 ? 23.692 71.933 24.351  1.00 37.57  ? 438 HIS A CD2 1 
ATOM   3157 C CE1 . HIS A 1 438 ? 21.597 71.580 24.889  1.00 37.98  ? 438 HIS A CE1 1 
ATOM   3158 N NE2 . HIS A 1 438 ? 22.413 72.433 24.300  1.00 37.31  ? 438 HIS A NE2 1 
ATOM   3159 N N   . PHE A 1 439 ? 24.754 68.193 22.667  1.00 35.83  ? 439 PHE A N   1 
ATOM   3160 C CA  . PHE A 1 439 ? 24.371 68.160 21.271  1.00 32.73  ? 439 PHE A CA  1 
ATOM   3161 C C   . PHE A 1 439 ? 24.255 66.816 20.620  1.00 31.73  ? 439 PHE A C   1 
ATOM   3162 O O   . PHE A 1 439 ? 23.674 66.714 19.544  1.00 30.04  ? 439 PHE A O   1 
ATOM   3163 C CB  . PHE A 1 439 ? 25.326 69.018 20.448  1.00 33.24  ? 439 PHE A CB  1 
ATOM   3164 C CG  . PHE A 1 439 ? 25.253 70.467 20.787  1.00 31.95  ? 439 PHE A CG  1 
ATOM   3165 C CD1 . PHE A 1 439 ? 24.288 71.275 20.199  1.00 29.49  ? 439 PHE A CD1 1 
ATOM   3166 C CD2 . PHE A 1 439 ? 26.099 71.011 21.738  1.00 30.39  ? 439 PHE A CD2 1 
ATOM   3167 C CE1 . PHE A 1 439 ? 24.160 72.591 20.554  1.00 28.68  ? 439 PHE A CE1 1 
ATOM   3168 C CE2 . PHE A 1 439 ? 25.978 72.334 22.102  1.00 32.53  ? 439 PHE A CE2 1 
ATOM   3169 C CZ  . PHE A 1 439 ? 25.004 73.130 21.509  1.00 31.17  ? 439 PHE A CZ  1 
ATOM   3170 N N   . PHE A 1 440 ? 24.795 65.780 21.244  1.00 30.93  ? 440 PHE A N   1 
ATOM   3171 C CA  . PHE A 1 440 ? 24.711 64.476 20.625  1.00 29.77  ? 440 PHE A CA  1 
ATOM   3172 C C   . PHE A 1 440 ? 24.359 63.320 21.528  1.00 30.67  ? 440 PHE A C   1 
ATOM   3173 O O   . PHE A 1 440 ? 23.241 62.828 21.493  1.00 32.54  ? 440 PHE A O   1 
ATOM   3174 C CB  . PHE A 1 440 ? 26.012 64.158 19.897  1.00 28.42  ? 440 PHE A CB  1 
ATOM   3175 C CG  . PHE A 1 440 ? 26.362 65.145 18.820  1.00 29.99  ? 440 PHE A CG  1 
ATOM   3176 C CD1 . PHE A 1 440 ? 25.793 65.039 17.547  1.00 30.06  ? 440 PHE A CD1 1 
ATOM   3177 C CD2 . PHE A 1 440 ? 27.269 66.166 19.066  1.00 27.45  ? 440 PHE A CD2 1 
ATOM   3178 C CE1 . PHE A 1 440 ? 26.130 65.931 16.541  1.00 31.44  ? 440 PHE A CE1 1 
ATOM   3179 C CE2 . PHE A 1 440 ? 27.614 67.065 18.072  1.00 30.34  ? 440 PHE A CE2 1 
ATOM   3180 C CZ  . PHE A 1 440 ? 27.045 66.950 16.800  1.00 32.51  ? 440 PHE A CZ  1 
ATOM   3181 N N   . THR A 1 441 ? 25.312 62.884 22.341  1.00 30.60  ? 441 THR A N   1 
ATOM   3182 C CA  . THR A 1 441 ? 25.090 61.740 23.198  1.00 29.00  ? 441 THR A CA  1 
ATOM   3183 C C   . THR A 1 441 ? 23.779 61.760 23.956  1.00 32.02  ? 441 THR A C   1 
ATOM   3184 O O   . THR A 1 441 ? 22.985 60.839 23.824  1.00 33.62  ? 441 THR A O   1 
ATOM   3185 C CB  . THR A 1 441 ? 26.227 61.566 24.204  1.00 27.35  ? 441 THR A CB  1 
ATOM   3186 O OG1 . THR A 1 441 ? 27.477 61.575 23.506  1.00 29.53  ? 441 THR A OG1 1 
ATOM   3187 C CG2 . THR A 1 441 ? 26.080 60.249 24.948  1.00 19.66  ? 441 THR A CG2 1 
ATOM   3188 N N   . CYS A 1 442 ? 23.537 62.805 24.739  1.00 33.95  ? 442 CYS A N   1 
ATOM   3189 C CA  . CYS A 1 442 ? 22.316 62.855 25.538  1.00 35.61  ? 442 CYS A CA  1 
ATOM   3190 C C   . CYS A 1 442 ? 21.015 62.974 24.762  1.00 37.76  ? 442 CYS A C   1 
ATOM   3191 O O   . CYS A 1 442 ? 19.999 62.384 25.159  1.00 39.77  ? 442 CYS A O   1 
ATOM   3192 C CB  . CYS A 1 442 ? 22.450 63.930 26.607  1.00 35.11  ? 442 CYS A CB  1 
ATOM   3193 S SG  . CYS A 1 442 ? 23.744 63.430 27.800  1.00 32.74  ? 442 CYS A SG  1 
ATOM   3194 N N   . PRO A 1 443 ? 21.012 63.742 23.659  1.00 37.43  ? 443 PRO A N   1 
ATOM   3195 C CA  . PRO A 1 443 ? 19.775 63.848 22.884  1.00 37.25  ? 443 PRO A CA  1 
ATOM   3196 C C   . PRO A 1 443 ? 19.436 62.471 22.291  1.00 37.26  ? 443 PRO A C   1 
ATOM   3197 O O   . PRO A 1 443 ? 18.299 62.019 22.391  1.00 36.28  ? 443 PRO A O   1 
ATOM   3198 C CB  . PRO A 1 443 ? 20.135 64.865 21.811  1.00 36.12  ? 443 PRO A CB  1 
ATOM   3199 C CG  . PRO A 1 443 ? 21.044 65.778 22.533  1.00 36.25  ? 443 PRO A CG  1 
ATOM   3200 C CD  . PRO A 1 443 ? 21.946 64.815 23.278  1.00 37.95  ? 443 PRO A CD  1 
ATOM   3201 N N   . THR A 1 444 ? 20.426 61.801 21.693  1.00 37.23  ? 444 THR A N   1 
ATOM   3202 C CA  . THR A 1 444 ? 20.188 60.486 21.106  1.00 39.02  ? 444 THR A CA  1 
ATOM   3203 C C   . THR A 1 444 ? 19.879 59.500 22.212  1.00 38.51  ? 444 THR A C   1 
ATOM   3204 O O   . THR A 1 444 ? 19.181 58.514 22.000  1.00 37.17  ? 444 THR A O   1 
ATOM   3205 C CB  . THR A 1 444 ? 21.396 59.941 20.273  1.00 40.96  ? 444 THR A CB  1 
ATOM   3206 O OG1 . THR A 1 444 ? 22.260 59.159 21.103  1.00 42.93  ? 444 THR A OG1 1 
ATOM   3207 C CG2 . THR A 1 444 ? 22.186 61.080 19.650  1.00 43.74  ? 444 THR A CG2 1 
ATOM   3208 N N   . ASN A 1 445 ? 20.398 59.761 23.401  1.00 39.99  ? 445 ASN A N   1 
ATOM   3209 C CA  . ASN A 1 445 ? 20.113 58.874 24.516  1.00 42.62  ? 445 ASN A CA  1 
ATOM   3210 C C   . ASN A 1 445 ? 18.631 59.060 24.820  1.00 43.99  ? 445 ASN A C   1 
ATOM   3211 O O   . ASN A 1 445 ? 17.890 58.088 24.991  1.00 44.64  ? 445 ASN A O   1 
ATOM   3212 C CB  . ASN A 1 445 ? 20.936 59.246 25.755  1.00 43.89  ? 445 ASN A CB  1 
ATOM   3213 C CG  . ASN A 1 445 ? 20.810 58.216 26.870  1.00 43.38  ? 445 ASN A CG  1 
ATOM   3214 O OD1 . ASN A 1 445 ? 21.272 57.086 26.740  1.00 43.42  ? 445 ASN A OD1 1 
ATOM   3215 N ND2 . ASN A 1 445 ? 20.179 58.606 27.967  1.00 45.97  ? 445 ASN A ND2 1 
ATOM   3216 N N   . GLU A 1 446 ? 18.194 60.316 24.860  1.00 42.86  ? 446 GLU A N   1 
ATOM   3217 C CA  . GLU A 1 446 ? 16.800 60.587 25.157  1.00 42.97  ? 446 GLU A CA  1 
ATOM   3218 C C   . GLU A 1 446 ? 15.885 59.947 24.124  1.00 39.96  ? 446 GLU A C   1 
ATOM   3219 O O   . GLU A 1 446 ? 14.923 59.268 24.468  1.00 37.40  ? 446 GLU A O   1 
ATOM   3220 C CB  . GLU A 1 446 ? 16.542 62.091 25.218  1.00 46.16  ? 446 GLU A CB  1 
ATOM   3221 C CG  . GLU A 1 446 ? 15.288 62.443 26.004  1.00 52.54  ? 446 GLU A CG  1 
ATOM   3222 C CD  . GLU A 1 446 ? 14.959 63.925 25.972  1.00 58.33  ? 446 GLU A CD  1 
ATOM   3223 O OE1 . GLU A 1 446 ? 15.609 64.669 25.205  1.00 61.11  ? 446 GLU A OE1 1 
ATOM   3224 O OE2 . GLU A 1 446 ? 14.043 64.347 26.714  1.00 60.78  ? 446 GLU A OE2 1 
ATOM   3225 N N   . TYR A 1 447 ? 16.194 60.153 22.854  1.00 39.49  ? 447 TYR A N   1 
ATOM   3226 C CA  . TYR A 1 447 ? 15.369 59.597 21.794  1.00 39.05  ? 447 TYR A CA  1 
ATOM   3227 C C   . TYR A 1 447 ? 15.367 58.081 21.871  1.00 38.02  ? 447 TYR A C   1 
ATOM   3228 O O   . TYR A 1 447 ? 14.355 57.441 21.620  1.00 37.54  ? 447 TYR A O   1 
ATOM   3229 C CB  . TYR A 1 447 ? 15.884 60.036 20.428  1.00 39.72  ? 447 TYR A CB  1 
ATOM   3230 C CG  . TYR A 1 447 ? 14.832 59.952 19.359  1.00 42.34  ? 447 TYR A CG  1 
ATOM   3231 C CD1 . TYR A 1 447 ? 13.720 60.779 19.400  1.00 46.00  ? 447 TYR A CD1 1 
ATOM   3232 C CD2 . TYR A 1 447 ? 14.936 59.037 18.313  1.00 42.31  ? 447 TYR A CD2 1 
ATOM   3233 C CE1 . TYR A 1 447 ? 12.728 60.701 18.428  1.00 47.74  ? 447 TYR A CE1 1 
ATOM   3234 C CE2 . TYR A 1 447 ? 13.955 58.950 17.336  1.00 43.57  ? 447 TYR A CE2 1 
ATOM   3235 C CZ  . TYR A 1 447 ? 12.853 59.788 17.396  1.00 47.07  ? 447 TYR A CZ  1 
ATOM   3236 O OH  . TYR A 1 447 ? 11.879 59.741 16.420  1.00 49.96  ? 447 TYR A OH  1 
ATOM   3237 N N   . ALA A 1 448 ? 16.512 57.508 22.210  1.00 38.65  ? 448 ALA A N   1 
ATOM   3238 C CA  . ALA A 1 448 ? 16.627 56.064 22.319  1.00 38.89  ? 448 ALA A CA  1 
ATOM   3239 C C   . ALA A 1 448 ? 15.613 55.564 23.331  1.00 39.54  ? 448 ALA A C   1 
ATOM   3240 O O   . ALA A 1 448 ? 14.858 54.630 23.058  1.00 39.16  ? 448 ALA A O   1 
ATOM   3241 C CB  . ALA A 1 448 ? 18.030 55.683 22.753  1.00 40.70  ? 448 ALA A CB  1 
ATOM   3242 N N   . GLN A 1 449 ? 15.598 56.187 24.507  1.00 40.51  ? 449 GLN A N   1 
ATOM   3243 C CA  . GLN A 1 449 ? 14.652 55.802 25.546  1.00 40.62  ? 449 GLN A CA  1 
ATOM   3244 C C   . GLN A 1 449 ? 13.225 56.003 25.046  1.00 40.79  ? 449 GLN A C   1 
ATOM   3245 O O   . GLN A 1 449 ? 12.388 55.111 25.175  1.00 43.20  ? 449 GLN A O   1 
ATOM   3246 C CB  . GLN A 1 449 ? 14.878 56.627 26.809  1.00 40.45  ? 449 GLN A CB  1 
ATOM   3247 C CG  . GLN A 1 449 ? 16.188 56.339 27.497  1.00 40.18  ? 449 GLN A CG  1 
ATOM   3248 C CD  . GLN A 1 449 ? 16.382 57.187 28.725  1.00 39.82  ? 449 GLN A CD  1 
ATOM   3249 O OE1 . GLN A 1 449 ? 17.326 57.981 28.808  1.00 40.71  ? 449 GLN A OE1 1 
ATOM   3250 N NE2 . GLN A 1 449 ? 15.486 57.033 29.693  1.00 40.53  ? 449 GLN A NE2 1 
ATOM   3251 N N   . ALA A 1 450 ? 12.950 57.169 24.470  1.00 39.97  ? 450 ALA A N   1 
ATOM   3252 C CA  . ALA A 1 450 ? 11.622 57.449 23.951  1.00 40.01  ? 450 ALA A CA  1 
ATOM   3253 C C   . ALA A 1 450 ? 11.239 56.409 22.903  1.00 42.48  ? 450 ALA A C   1 
ATOM   3254 O O   . ALA A 1 450 ? 10.103 55.951 22.865  1.00 43.77  ? 450 ALA A O   1 
ATOM   3255 C CB  . ALA A 1 450 ? 11.578 58.840 23.351  1.00 37.80  ? 450 ALA A CB  1 
ATOM   3256 N N   . LEU A 1 451 ? 12.197 56.028 22.062  1.00 44.69  ? 451 LEU A N   1 
ATOM   3257 C CA  . LEU A 1 451 ? 11.971 55.046 21.004  1.00 44.66  ? 451 LEU A CA  1 
ATOM   3258 C C   . LEU A 1 451 ? 11.576 53.686 21.562  1.00 46.04  ? 451 LEU A C   1 
ATOM   3259 O O   . LEU A 1 451 ? 10.715 53.000 21.019  1.00 45.49  ? 451 LEU A O   1 
ATOM   3260 C CB  . LEU A 1 451 ? 13.236 54.913 20.171  1.00 44.01  ? 451 LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 451 ? 13.145 55.258 18.693  1.00 45.27  ? 451 LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 451 ? 12.223 56.422 18.465  1.00 46.55  ? 451 LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 451 ? 14.537 55.571 18.191  1.00 46.55  ? 451 LEU A CD2 1 
ATOM   3264 N N   . ALA A 1 452 ? 12.219 53.292 22.650  1.00 48.19  ? 452 ALA A N   1 
ATOM   3265 C CA  . ALA A 1 452 ? 11.921 52.018 23.279  1.00 50.55  ? 452 ALA A CA  1 
ATOM   3266 C C   . ALA A 1 452 ? 10.500 52.038 23.834  1.00 51.81  ? 452 ALA A C   1 
ATOM   3267 O O   . ALA A 1 452 ? 9.705  51.143 23.557  1.00 51.95  ? 452 ALA A O   1 
ATOM   3268 C CB  . ALA A 1 452 ? 12.918 51.749 24.399  1.00 51.26  ? 452 ALA A CB  1 
ATOM   3269 N N   . GLU A 1 453 ? 10.194 53.065 24.622  1.00 53.65  ? 453 GLU A N   1 
ATOM   3270 C CA  . GLU A 1 453 ? 8.873  53.218 25.228  1.00 54.69  ? 453 GLU A CA  1 
ATOM   3271 C C   . GLU A 1 453 ? 7.787  53.014 24.186  1.00 53.01  ? 453 GLU A C   1 
ATOM   3272 O O   . GLU A 1 453 ? 6.803  52.329 24.433  1.00 54.47  ? 453 GLU A O   1 
ATOM   3273 C CB  . GLU A 1 453 ? 8.725  54.614 25.846  1.00 58.02  ? 453 GLU A CB  1 
ATOM   3274 C CG  . GLU A 1 453 ? 9.702  54.921 26.975  1.00 65.12  ? 453 GLU A CG  1 
ATOM   3275 C CD  . GLU A 1 453 ? 9.413  54.130 28.249  1.00 70.16  ? 453 GLU A CD  1 
ATOM   3276 O OE1 . GLU A 1 453 ? 9.370  52.878 28.188  1.00 71.15  ? 453 GLU A OE1 1 
ATOM   3277 O OE2 . GLU A 1 453 ? 9.234  54.766 29.315  1.00 72.55  ? 453 GLU A OE2 1 
ATOM   3278 N N   . ARG A 1 454 ? 7.974  53.606 23.016  1.00 51.51  ? 454 ARG A N   1 
ATOM   3279 C CA  . ARG A 1 454 ? 7.000  53.487 21.946  1.00 50.36  ? 454 ARG A CA  1 
ATOM   3280 C C   . ARG A 1 454 ? 7.006  52.097 21.313  1.00 50.06  ? 454 ARG A C   1 
ATOM   3281 O O   . ARG A 1 454 ? 6.349  51.862 20.301  1.00 48.60  ? 454 ARG A O   1 
ATOM   3282 C CB  . ARG A 1 454 ? 7.257  54.557 20.880  1.00 50.79  ? 454 ARG A CB  1 
ATOM   3283 C CG  . ARG A 1 454 ? 7.009  55.994 21.345  1.00 48.84  ? 454 ARG A CG  1 
ATOM   3284 C CD  . ARG A 1 454 ? 5.570  56.204 21.770  1.00 48.64  ? 454 ARG A CD  1 
ATOM   3285 N N   . GLY A 1 455 ? 7.757  51.175 21.908  1.00 50.76  ? 455 GLY A N   1 
ATOM   3286 C CA  . GLY A 1 455 ? 7.798  49.813 21.397  1.00 50.54  ? 455 GLY A CA  1 
ATOM   3287 C C   . GLY A 1 455 ? 8.864  49.393 20.391  1.00 49.73  ? 455 GLY A C   1 
ATOM   3288 O O   . GLY A 1 455 ? 8.945  48.207 20.062  1.00 48.84  ? 455 GLY A O   1 
ATOM   3289 N N   . ALA A 1 456 ? 9.678  50.326 19.897  1.00 48.17  ? 456 ALA A N   1 
ATOM   3290 C CA  . ALA A 1 456 ? 10.715 49.977 18.928  1.00 46.16  ? 456 ALA A CA  1 
ATOM   3291 C C   . ALA A 1 456 ? 11.779 49.083 19.561  1.00 45.14  ? 456 ALA A C   1 
ATOM   3292 O O   . ALA A 1 456 ? 11.987 49.120 20.768  1.00 46.03  ? 456 ALA A O   1 
ATOM   3293 C CB  . ALA A 1 456 ? 11.351 51.239 18.370  1.00 45.81  ? 456 ALA A CB  1 
ATOM   3294 N N   . SER A 1 457 ? 12.437 48.260 18.751  1.00 45.51  ? 457 SER A N   1 
ATOM   3295 C CA  . SER A 1 457 ? 13.488 47.379 19.260  1.00 45.46  ? 457 SER A CA  1 
ATOM   3296 C C   . SER A 1 457 ? 14.821 48.114 19.112  1.00 45.04  ? 457 SER A C   1 
ATOM   3297 O O   . SER A 1 457 ? 15.420 48.136 18.033  1.00 44.52  ? 457 SER A O   1 
ATOM   3298 C CB  . SER A 1 457 ? 13.521 46.074 18.472  1.00 44.91  ? 457 SER A CB  1 
ATOM   3299 O OG  . SER A 1 457 ? 14.607 45.272 18.898  1.00 46.53  ? 457 SER A OG  1 
ATOM   3300 N N   . VAL A 1 458 ? 15.274 48.718 20.207  1.00 43.47  ? 458 VAL A N   1 
ATOM   3301 C CA  . VAL A 1 458 ? 16.502 49.499 20.211  1.00 40.92  ? 458 VAL A CA  1 
ATOM   3302 C C   . VAL A 1 458 ? 17.745 48.790 20.723  1.00 39.43  ? 458 VAL A C   1 
ATOM   3303 O O   . VAL A 1 458 ? 17.706 48.032 21.692  1.00 41.25  ? 458 VAL A O   1 
ATOM   3304 C CB  . VAL A 1 458 ? 16.330 50.784 21.052  1.00 40.85  ? 458 VAL A CB  1 
ATOM   3305 C CG1 . VAL A 1 458 ? 17.651 51.517 21.163  1.00 42.31  ? 458 VAL A CG1 1 
ATOM   3306 C CG2 . VAL A 1 458 ? 15.276 51.684 20.429  1.00 42.33  ? 458 VAL A CG2 1 
ATOM   3307 N N   . HIS A 1 459 ? 18.851 49.051 20.050  1.00 36.50  ? 459 HIS A N   1 
ATOM   3308 C CA  . HIS A 1 459 ? 20.134 48.509 20.437  1.00 34.18  ? 459 HIS A CA  1 
ATOM   3309 C C   . HIS A 1 459 ? 21.089 49.684 20.396  1.00 33.52  ? 459 HIS A C   1 
ATOM   3310 O O   . HIS A 1 459 ? 21.332 50.269 19.343  1.00 36.38  ? 459 HIS A O   1 
ATOM   3311 C CB  . HIS A 1 459 ? 20.552 47.394 19.492  1.00 32.46  ? 459 HIS A CB  1 
ATOM   3312 C CG  . HIS A 1 459 ? 19.959 46.073 19.854  1.00 33.06  ? 459 HIS A CG  1 
ATOM   3313 N ND1 . HIS A 1 459 ? 18.775 45.615 19.320  1.00 34.35  ? 459 HIS A ND1 1 
ATOM   3314 C CD2 . HIS A 1 459 ? 20.342 45.150 20.768  1.00 33.06  ? 459 HIS A CD2 1 
ATOM   3315 C CE1 . HIS A 1 459 ? 18.453 44.466 19.887  1.00 32.46  ? 459 HIS A CE1 1 
ATOM   3316 N NE2 . HIS A 1 459 ? 19.387 44.163 20.769  1.00 35.13  ? 459 HIS A NE2 1 
ATOM   3317 N N   . TYR A 1 460 ? 21.604 50.040 21.562  1.00 31.17  ? 460 TYR A N   1 
ATOM   3318 C CA  . TYR A 1 460 ? 22.491 51.188 21.720  1.00 29.00  ? 460 TYR A CA  1 
ATOM   3319 C C   . TYR A 1 460 ? 23.952 50.765 21.793  1.00 29.15  ? 460 TYR A C   1 
ATOM   3320 O O   . TYR A 1 460 ? 24.276 49.735 22.386  1.00 29.07  ? 460 TYR A O   1 
ATOM   3321 C CB  . TYR A 1 460 ? 22.105 51.899 23.014  1.00 28.19  ? 460 TYR A CB  1 
ATOM   3322 C CG  . TYR A 1 460 ? 22.452 53.349 23.082  1.00 25.65  ? 460 TYR A CG  1 
ATOM   3323 C CD1 . TYR A 1 460 ? 23.766 53.764 23.242  1.00 25.00  ? 460 TYR A CD1 1 
ATOM   3324 C CD2 . TYR A 1 460 ? 21.454 54.318 23.005  1.00 27.79  ? 460 TYR A CD2 1 
ATOM   3325 C CE1 . TYR A 1 460 ? 24.078 55.108 23.326  1.00 25.01  ? 460 TYR A CE1 1 
ATOM   3326 C CE2 . TYR A 1 460 ? 21.753 55.657 23.089  1.00 25.82  ? 460 TYR A CE2 1 
ATOM   3327 C CZ  . TYR A 1 460 ? 23.061 56.041 23.250  1.00 25.80  ? 460 TYR A CZ  1 
ATOM   3328 O OH  . TYR A 1 460 ? 23.341 57.364 23.346  1.00 28.38  ? 460 TYR A OH  1 
ATOM   3329 N N   . TYR A 1 461 ? 24.840 51.555 21.199  1.00 29.28  ? 461 TYR A N   1 
ATOM   3330 C CA  . TYR A 1 461 ? 26.267 51.236 21.250  1.00 30.16  ? 461 TYR A CA  1 
ATOM   3331 C C   . TYR A 1 461 ? 27.041 52.500 21.563  1.00 32.00  ? 461 TYR A C   1 
ATOM   3332 O O   . TYR A 1 461 ? 26.546 53.605 21.333  1.00 34.02  ? 461 TYR A O   1 
ATOM   3333 C CB  . TYR A 1 461 ? 26.769 50.672 19.911  1.00 27.16  ? 461 TYR A CB  1 
ATOM   3334 C CG  . TYR A 1 461 ? 26.786 51.699 18.808  1.00 24.89  ? 461 TYR A CG  1 
ATOM   3335 C CD1 . TYR A 1 461 ? 27.725 52.735 18.809  1.00 23.48  ? 461 TYR A CD1 1 
ATOM   3336 C CD2 . TYR A 1 461 ? 25.805 51.701 17.822  1.00 21.38  ? 461 TYR A CD2 1 
ATOM   3337 C CE1 . TYR A 1 461 ? 27.670 53.759 17.861  1.00 22.97  ? 461 TYR A CE1 1 
ATOM   3338 C CE2 . TYR A 1 461 ? 25.746 52.713 16.871  1.00 20.69  ? 461 TYR A CE2 1 
ATOM   3339 C CZ  . TYR A 1 461 ? 26.675 53.743 16.898  1.00 20.41  ? 461 TYR A CZ  1 
ATOM   3340 O OH  . TYR A 1 461 ? 26.588 54.775 15.992  1.00 19.15  ? 461 TYR A OH  1 
ATOM   3341 N N   . TYR A 1 462 ? 28.260 52.337 22.068  1.00 33.64  ? 462 TYR A N   1 
ATOM   3342 C CA  . TYR A 1 462 ? 29.125 53.470 22.390  1.00 33.61  ? 462 TYR A CA  1 
ATOM   3343 C C   . TYR A 1 462 ? 30.502 53.172 21.795  1.00 34.66  ? 462 TYR A C   1 
ATOM   3344 O O   . TYR A 1 462 ? 31.114 52.157 22.129  1.00 34.37  ? 462 TYR A O   1 
ATOM   3345 C CB  . TYR A 1 462 ? 29.230 53.632 23.906  1.00 33.28  ? 462 TYR A CB  1 
ATOM   3346 C CG  . TYR A 1 462 ? 29.726 54.990 24.351  1.00 33.25  ? 462 TYR A CG  1 
ATOM   3347 C CD1 . TYR A 1 462 ? 29.162 56.152 23.844  1.00 32.71  ? 462 TYR A CD1 1 
ATOM   3348 C CD2 . TYR A 1 462 ? 30.730 55.114 25.304  1.00 33.29  ? 462 TYR A CD2 1 
ATOM   3349 C CE1 . TYR A 1 462 ? 29.580 57.393 24.270  1.00 32.88  ? 462 TYR A CE1 1 
ATOM   3350 C CE2 . TYR A 1 462 ? 31.159 56.363 25.740  1.00 33.32  ? 462 TYR A CE2 1 
ATOM   3351 C CZ  . TYR A 1 462 ? 30.578 57.497 25.215  1.00 33.92  ? 462 TYR A CZ  1 
ATOM   3352 O OH  . TYR A 1 462 ? 30.989 58.751 25.617  1.00 35.78  ? 462 TYR A OH  1 
ATOM   3353 N N   . PHE A 1 463 ? 30.976 54.049 20.910  1.00 35.14  ? 463 PHE A N   1 
ATOM   3354 C CA  . PHE A 1 463 ? 32.270 53.875 20.245  1.00 37.75  ? 463 PHE A CA  1 
ATOM   3355 C C   . PHE A 1 463 ? 33.361 54.653 20.984  1.00 39.56  ? 463 PHE A C   1 
ATOM   3356 O O   . PHE A 1 463 ? 33.374 55.882 20.964  1.00 39.24  ? 463 PHE A O   1 
ATOM   3357 C CB  . PHE A 1 463 ? 32.163 54.359 18.789  1.00 38.39  ? 463 PHE A CB  1 
ATOM   3358 C CG  . PHE A 1 463 ? 33.417 54.146 17.972  1.00 39.50  ? 463 PHE A CG  1 
ATOM   3359 C CD1 . PHE A 1 463 ? 33.823 52.862 17.612  1.00 40.05  ? 463 PHE A CD1 1 
ATOM   3360 C CD2 . PHE A 1 463 ? 34.207 55.230 17.591  1.00 38.13  ? 463 PHE A CD2 1 
ATOM   3361 C CE1 . PHE A 1 463 ? 34.995 52.661 16.888  1.00 39.14  ? 463 PHE A CE1 1 
ATOM   3362 C CE2 . PHE A 1 463 ? 35.377 55.040 16.873  1.00 36.79  ? 463 PHE A CE2 1 
ATOM   3363 C CZ  . PHE A 1 463 ? 35.772 53.756 16.522  1.00 39.44  ? 463 PHE A CZ  1 
ATOM   3364 N N   . THR A 1 464 ? 34.287 53.940 21.619  1.00 43.24  ? 464 THR A N   1 
ATOM   3365 C CA  . THR A 1 464 ? 35.343 54.596 22.396  1.00 48.08  ? 464 THR A CA  1 
ATOM   3366 C C   . THR A 1 464 ? 36.785 54.321 21.977  1.00 51.09  ? 464 THR A C   1 
ATOM   3367 O O   . THR A 1 464 ? 37.697 54.399 22.810  1.00 52.17  ? 464 THR A O   1 
ATOM   3368 C CB  . THR A 1 464 ? 35.230 54.234 23.908  1.00 46.62  ? 464 THR A CB  1 
ATOM   3369 O OG1 . THR A 1 464 ? 35.172 52.810 24.063  1.00 45.53  ? 464 THR A OG1 1 
ATOM   3370 C CG2 . THR A 1 464 ? 33.989 54.845 24.516  1.00 46.50  ? 464 THR A CG2 1 
ATOM   3371 N N   . HIS A 1 465 ? 37.008 54.016 20.701  1.00 53.30  ? 465 HIS A N   1 
ATOM   3372 C CA  . HIS A 1 465 ? 38.362 53.725 20.244  1.00 53.78  ? 465 HIS A CA  1 
ATOM   3373 C C   . HIS A 1 465 ? 38.968 54.764 19.325  1.00 53.09  ? 465 HIS A C   1 
ATOM   3374 O O   . HIS A 1 465 ? 38.403 55.087 18.280  1.00 52.86  ? 465 HIS A O   1 
ATOM   3375 C CB  . HIS A 1 465 ? 38.410 52.369 19.545  1.00 56.71  ? 465 HIS A CB  1 
ATOM   3376 C CG  . HIS A 1 465 ? 39.774 51.999 19.055  1.00 59.49  ? 465 HIS A CG  1 
ATOM   3377 N ND1 . HIS A 1 465 ? 40.336 52.552 17.925  1.00 60.28  ? 465 HIS A ND1 1 
ATOM   3378 C CD2 . HIS A 1 465 ? 40.708 51.163 19.566  1.00 61.16  ? 465 HIS A CD2 1 
ATOM   3379 C CE1 . HIS A 1 465 ? 41.556 52.073 17.761  1.00 60.30  ? 465 HIS A CE1 1 
ATOM   3380 N NE2 . HIS A 1 465 ? 41.807 51.229 18.743  1.00 60.87  ? 465 HIS A NE2 1 
ATOM   3381 N N   . ARG A 1 466 ? 40.130 55.280 19.720  1.00 52.75  ? 466 ARG A N   1 
ATOM   3382 C CA  . ARG A 1 466 ? 40.845 56.266 18.917  1.00 53.64  ? 466 ARG A CA  1 
ATOM   3383 C C   . ARG A 1 466 ? 41.730 55.524 17.927  1.00 55.32  ? 466 ARG A C   1 
ATOM   3384 O O   . ARG A 1 466 ? 42.708 54.882 18.322  1.00 54.22  ? 466 ARG A O   1 
ATOM   3385 C CB  . ARG A 1 466 ? 41.732 57.152 19.781  1.00 50.75  ? 466 ARG A CB  1 
ATOM   3386 C CG  . ARG A 1 466 ? 42.447 58.206 18.972  1.00 49.01  ? 466 ARG A CG  1 
ATOM   3387 C CD  . ARG A 1 466 ? 43.608 58.771 19.739  1.00 48.72  ? 466 ARG A CD  1 
ATOM   3388 N NE  . ARG A 1 466 ? 44.390 59.690 18.924  1.00 46.52  ? 466 ARG A NE  1 
ATOM   3389 C CZ  . ARG A 1 466 ? 44.000 60.916 18.599  1.00 48.26  ? 466 ARG A CZ  1 
ATOM   3390 N NH1 . ARG A 1 466 ? 42.832 61.393 19.017  1.00 47.32  ? 466 ARG A NH1 1 
ATOM   3391 N NH2 . ARG A 1 466 ? 44.787 61.671 17.852  1.00 50.14  ? 466 ARG A NH2 1 
ATOM   3392 N N   . THR A 1 467 ? 41.386 55.613 16.645  1.00 56.65  ? 467 THR A N   1 
ATOM   3393 C CA  . THR A 1 467 ? 42.156 54.932 15.618  1.00 57.02  ? 467 THR A CA  1 
ATOM   3394 C C   . THR A 1 467 ? 43.621 55.261 15.800  1.00 56.02  ? 467 THR A C   1 
ATOM   3395 O O   . THR A 1 467 ? 43.993 56.427 15.951  1.00 54.77  ? 467 THR A O   1 
ATOM   3396 C CB  . THR A 1 467 ? 41.709 55.340 14.211  1.00 58.09  ? 467 THR A CB  1 
ATOM   3397 O OG1 . THR A 1 467 ? 40.350 54.932 14.006  1.00 58.63  ? 467 THR A OG1 1 
ATOM   3398 C CG2 . THR A 1 467 ? 42.590 54.671 13.171  1.00 59.60  ? 467 THR A CG2 1 
ATOM   3399 N N   . SER A 1 468 ? 44.439 54.217 15.793  1.00 56.07  ? 468 SER A N   1 
ATOM   3400 C CA  . SER A 1 468 ? 45.872 54.350 15.988  1.00 58.91  ? 468 SER A CA  1 
ATOM   3401 C C   . SER A 1 468 ? 46.514 55.352 15.047  1.00 60.33  ? 468 SER A C   1 
ATOM   3402 O O   . SER A 1 468 ? 47.495 56.002 15.404  1.00 62.54  ? 468 SER A O   1 
ATOM   3403 C CB  . SER A 1 468 ? 46.551 52.994 15.816  1.00 60.31  ? 468 SER A CB  1 
ATOM   3404 O OG  . SER A 1 468 ? 46.334 52.491 14.509  1.00 63.65  ? 468 SER A OG  1 
ATOM   3405 N N   . THR A 1 469 ? 45.969 55.489 13.846  1.00 59.68  ? 469 THR A N   1 
ATOM   3406 C CA  . THR A 1 469 ? 46.550 56.418 12.900  1.00 58.76  ? 469 THR A CA  1 
ATOM   3407 C C   . THR A 1 469 ? 45.782 57.719 12.785  1.00 59.10  ? 469 THR A C   1 
ATOM   3408 O O   . THR A 1 469 ? 45.881 58.390 11.765  1.00 59.63  ? 469 THR A O   1 
ATOM   3409 C CB  . THR A 1 469 ? 46.648 55.801 11.497  1.00 58.67  ? 469 THR A CB  1 
ATOM   3410 O OG1 . THR A 1 469 ? 45.331 55.537 11.004  1.00 59.17  ? 469 THR A OG1 1 
ATOM   3411 C CG2 . THR A 1 469 ? 47.455 54.508 11.531  1.00 57.39  ? 469 THR A CG2 1 
ATOM   3412 N N   . SER A 1 470 ? 45.024 58.093 13.810  1.00 58.97  ? 470 SER A N   1 
ATOM   3413 C CA  . SER A 1 470 ? 44.278 59.342 13.717  1.00 59.26  ? 470 SER A CA  1 
ATOM   3414 C C   . SER A 1 470 ? 45.226 60.513 13.724  1.00 59.84  ? 470 SER A C   1 
ATOM   3415 O O   . SER A 1 470 ? 46.045 60.651 14.627  1.00 60.32  ? 470 SER A O   1 
ATOM   3416 C CB  . SER A 1 470 ? 43.301 59.510 14.871  1.00 60.35  ? 470 SER A CB  1 
ATOM   3417 O OG  . SER A 1 470 ? 42.602 60.740 14.727  1.00 59.82  ? 470 SER A OG  1 
ATOM   3418 N N   . LEU A 1 471 ? 45.116 61.369 12.721  1.00 60.31  ? 471 LEU A N   1 
ATOM   3419 C CA  . LEU A 1 471 ? 45.997 62.515 12.664  1.00 60.81  ? 471 LEU A CA  1 
ATOM   3420 C C   . LEU A 1 471 ? 45.322 63.739 13.268  1.00 59.15  ? 471 LEU A C   1 
ATOM   3421 O O   . LEU A 1 471 ? 45.398 64.836 12.726  1.00 59.49  ? 471 LEU A O   1 
ATOM   3422 C CB  . LEU A 1 471 ? 46.434 62.782 11.219  1.00 62.67  ? 471 LEU A CB  1 
ATOM   3423 C CG  . LEU A 1 471 ? 47.855 63.358 11.104  1.00 64.27  ? 471 LEU A CG  1 
ATOM   3424 C CD1 . LEU A 1 471 ? 48.855 62.418 11.794  1.00 63.76  ? 471 LEU A CD1 1 
ATOM   3425 C CD2 . LEU A 1 471 ? 48.219 63.550 9.637   1.00 64.75  ? 471 LEU A CD2 1 
ATOM   3426 N N   . TRP A 1 472 ? 44.646 63.535 14.393  1.00 56.88  ? 472 TRP A N   1 
ATOM   3427 C CA  . TRP A 1 472 ? 43.979 64.626 15.099  1.00 55.79  ? 472 TRP A CA  1 
ATOM   3428 C C   . TRP A 1 472 ? 44.618 64.742 16.476  1.00 55.27  ? 472 TRP A C   1 
ATOM   3429 O O   . TRP A 1 472 ? 45.430 63.904 16.847  1.00 55.47  ? 472 TRP A O   1 
ATOM   3430 C CB  . TRP A 1 472 ? 42.468 64.366 15.231  1.00 53.96  ? 472 TRP A CB  1 
ATOM   3431 C CG  . TRP A 1 472 ? 41.670 64.802 14.030  1.00 50.30  ? 472 TRP A CG  1 
ATOM   3432 C CD1 . TRP A 1 472 ? 41.008 64.002 13.145  1.00 47.94  ? 472 TRP A CD1 1 
ATOM   3433 C CD2 . TRP A 1 472 ? 41.503 66.143 13.563  1.00 48.47  ? 472 TRP A CD2 1 
ATOM   3434 N NE1 . TRP A 1 472 ? 40.445 64.764 12.148  1.00 45.91  ? 472 TRP A NE1 1 
ATOM   3435 C CE2 . TRP A 1 472 ? 40.734 66.084 12.381  1.00 46.48  ? 472 TRP A CE2 1 
ATOM   3436 C CE3 . TRP A 1 472 ? 41.931 67.394 14.023  1.00 48.18  ? 472 TRP A CE3 1 
ATOM   3437 C CZ2 . TRP A 1 472 ? 40.385 67.222 11.657  1.00 46.06  ? 472 TRP A CZ2 1 
ATOM   3438 C CZ3 . TRP A 1 472 ? 41.581 68.526 13.303  1.00 47.25  ? 472 TRP A CZ3 1 
ATOM   3439 C CH2 . TRP A 1 472 ? 40.816 68.431 12.131  1.00 46.89  ? 472 TRP A CH2 1 
ATOM   3440 N N   . GLY A 1 473 ? 44.265 65.782 17.224  1.00 55.70  ? 473 GLY A N   1 
ATOM   3441 C CA  . GLY A 1 473 ? 44.839 65.960 18.548  1.00 55.30  ? 473 GLY A CA  1 
ATOM   3442 C C   . GLY A 1 473 ? 44.515 64.816 19.487  1.00 55.26  ? 473 GLY A C   1 
ATOM   3443 O O   . GLY A 1 473 ? 43.419 64.249 19.429  1.00 56.08  ? 473 GLY A O   1 
ATOM   3444 N N   . GLU A 1 474 ? 45.464 64.453 20.347  1.00 54.12  ? 474 GLU A N   1 
ATOM   3445 C CA  . GLU A 1 474 ? 45.222 63.370 21.292  1.00 52.51  ? 474 GLU A CA  1 
ATOM   3446 C C   . GLU A 1 474 ? 44.071 63.779 22.196  1.00 51.56  ? 474 GLU A C   1 
ATOM   3447 O O   . GLU A 1 474 ? 43.246 62.957 22.585  1.00 51.51  ? 474 GLU A O   1 
ATOM   3448 C CB  . GLU A 1 474 ? 46.469 63.086 22.141  1.00 50.93  ? 474 GLU A CB  1 
ATOM   3449 C CG  . GLU A 1 474 ? 47.414 62.071 21.539  1.00 49.66  ? 474 GLU A CG  1 
ATOM   3450 N N   . TRP A 1 475 ? 44.016 65.068 22.507  1.00 51.46  ? 475 TRP A N   1 
ATOM   3451 C CA  . TRP A 1 475 ? 42.981 65.605 23.378  1.00 50.52  ? 475 TRP A CA  1 
ATOM   3452 C C   . TRP A 1 475 ? 41.598 65.584 22.762  1.00 49.06  ? 475 TRP A C   1 
ATOM   3453 O O   . TRP A 1 475 ? 40.607 65.697 23.483  1.00 49.88  ? 475 TRP A O   1 
ATOM   3454 C CB  . TRP A 1 475 ? 43.302 67.044 23.761  1.00 51.00  ? 475 TRP A CB  1 
ATOM   3455 C CG  . TRP A 1 475 ? 43.243 67.987 22.606  1.00 50.00  ? 475 TRP A CG  1 
ATOM   3456 C CD1 . TRP A 1 475 ? 44.255 68.286 21.752  1.00 51.18  ? 475 TRP A CD1 1 
ATOM   3457 C CD2 . TRP A 1 475 ? 42.125 68.795 22.207  1.00 49.66  ? 475 TRP A CD2 1 
ATOM   3458 N NE1 . TRP A 1 475 ? 43.845 69.241 20.849  1.00 51.88  ? 475 TRP A NE1 1 
ATOM   3459 C CE2 . TRP A 1 475 ? 42.541 69.570 21.108  1.00 50.14  ? 475 TRP A CE2 1 
ATOM   3460 C CE3 . TRP A 1 475 ? 40.814 68.939 22.674  1.00 52.13  ? 475 TRP A CE3 1 
ATOM   3461 C CZ2 . TRP A 1 475 ? 41.696 70.480 20.466  1.00 50.88  ? 475 TRP A CZ2 1 
ATOM   3462 C CZ3 . TRP A 1 475 ? 39.968 69.848 22.034  1.00 53.23  ? 475 TRP A CZ3 1 
ATOM   3463 C CH2 . TRP A 1 475 ? 40.417 70.605 20.942  1.00 51.93  ? 475 TRP A CH2 1 
ATOM   3464 N N   . MET A 1 476 ? 41.531 65.472 21.438  1.00 47.14  ? 476 MET A N   1 
ATOM   3465 C CA  . MET A 1 476 ? 40.247 65.445 20.741  1.00 45.93  ? 476 MET A CA  1 
ATOM   3466 C C   . MET A 1 476 ? 39.607 64.062 20.831  1.00 44.44  ? 476 MET A C   1 
ATOM   3467 O O   . MET A 1 476 ? 38.503 63.849 20.337  1.00 44.13  ? 476 MET A O   1 
ATOM   3468 C CB  . MET A 1 476 ? 40.428 65.843 19.275  1.00 46.50  ? 476 MET A CB  1 
ATOM   3469 C CG  . MET A 1 476 ? 40.796 67.304 19.064  1.00 48.33  ? 476 MET A CG  1 
ATOM   3470 S SD  . MET A 1 476 ? 41.142 67.731 17.326  1.00 50.68  ? 476 MET A SD  1 
ATOM   3471 C CE  . MET A 1 476 ? 39.517 68.291 16.753  1.00 49.54  ? 476 MET A CE  1 
ATOM   3472 N N   . GLY A 1 477 ? 40.327 63.133 21.461  1.00 42.74  ? 477 GLY A N   1 
ATOM   3473 C CA  . GLY A 1 477 ? 39.861 61.768 21.660  1.00 41.27  ? 477 GLY A CA  1 
ATOM   3474 C C   . GLY A 1 477 ? 39.260 61.048 20.467  1.00 39.57  ? 477 GLY A C   1 
ATOM   3475 O O   . GLY A 1 477 ? 39.752 61.183 19.354  1.00 39.80  ? 477 GLY A O   1 
ATOM   3476 N N   . VAL A 1 478 ? 38.209 60.264 20.716  1.00 36.59  ? 478 VAL A N   1 
ATOM   3477 C CA  . VAL A 1 478 ? 37.509 59.524 19.671  1.00 33.81  ? 478 VAL A CA  1 
ATOM   3478 C C   . VAL A 1 478 ? 36.432 60.460 19.135  1.00 35.47  ? 478 VAL A C   1 
ATOM   3479 O O   . VAL A 1 478 ? 35.308 60.443 19.630  1.00 35.86  ? 478 VAL A O   1 
ATOM   3480 C CB  . VAL A 1 478 ? 36.807 58.294 20.246  1.00 31.45  ? 478 VAL A CB  1 
ATOM   3481 C CG1 . VAL A 1 478 ? 36.352 57.380 19.122  1.00 29.68  ? 478 VAL A CG1 1 
ATOM   3482 C CG2 . VAL A 1 478 ? 37.723 57.574 21.205  1.00 30.62  ? 478 VAL A CG2 1 
ATOM   3483 N N   . LEU A 1 479 ? 36.748 61.254 18.115  1.00 35.71  ? 479 LEU A N   1 
ATOM   3484 C CA  . LEU A 1 479 ? 35.772 62.215 17.614  1.00 38.25  ? 479 LEU A CA  1 
ATOM   3485 C C   . LEU A 1 479 ? 34.598 61.795 16.758  1.00 38.76  ? 479 LEU A C   1 
ATOM   3486 O O   . LEU A 1 479 ? 34.525 60.687 16.234  1.00 39.12  ? 479 LEU A O   1 
ATOM   3487 C CB  . LEU A 1 479 ? 36.461 63.383 16.904  1.00 39.16  ? 479 LEU A CB  1 
ATOM   3488 C CG  . LEU A 1 479 ? 37.440 63.136 15.773  1.00 39.70  ? 479 LEU A CG  1 
ATOM   3489 C CD1 . LEU A 1 479 ? 37.537 64.387 14.919  1.00 40.80  ? 479 LEU A CD1 1 
ATOM   3490 C CD2 . LEU A 1 479 ? 38.794 62.776 16.357  1.00 41.68  ? 479 LEU A CD2 1 
ATOM   3491 N N   . HIS A 1 480 ? 33.670 62.741 16.662  1.00 38.67  ? 480 HIS A N   1 
ATOM   3492 C CA  . HIS A 1 480 ? 32.445 62.640 15.894  1.00 38.46  ? 480 HIS A CA  1 
ATOM   3493 C C   . HIS A 1 480 ? 32.819 62.154 14.498  1.00 38.80  ? 480 HIS A C   1 
ATOM   3494 O O   . HIS A 1 480 ? 33.591 62.809 13.803  1.00 40.35  ? 480 HIS A O   1 
ATOM   3495 C CB  . HIS A 1 480 ? 31.839 64.044 15.841  1.00 39.02  ? 480 HIS A CB  1 
ATOM   3496 C CG  . HIS A 1 480 ? 30.546 64.147 15.092  1.00 41.46  ? 480 HIS A CG  1 
ATOM   3497 N ND1 . HIS A 1 480 ? 29.333 63.792 15.645  1.00 42.08  ? 480 HIS A ND1 1 
ATOM   3498 C CD2 . HIS A 1 480 ? 30.267 64.665 13.874  1.00 41.40  ? 480 HIS A CD2 1 
ATOM   3499 C CE1 . HIS A 1 480 ? 28.363 64.098 14.804  1.00 41.85  ? 480 HIS A CE1 1 
ATOM   3500 N NE2 . HIS A 1 480 ? 28.904 64.631 13.721  1.00 43.45  ? 480 HIS A NE2 1 
ATOM   3501 N N   . GLY A 1 481 ? 32.301 61.000 14.092  1.00 38.69  ? 481 GLY A N   1 
ATOM   3502 C CA  . GLY A 1 481 ? 32.608 60.502 12.762  1.00 38.29  ? 481 GLY A CA  1 
ATOM   3503 C C   . GLY A 1 481 ? 33.576 59.332 12.650  1.00 38.79  ? 481 GLY A C   1 
ATOM   3504 O O   . GLY A 1 481 ? 33.496 58.556 11.697  1.00 38.06  ? 481 GLY A O   1 
ATOM   3505 N N   . ASP A 1 482 ? 34.490 59.192 13.607  1.00 38.25  ? 482 ASP A N   1 
ATOM   3506 C CA  . ASP A 1 482 ? 35.461 58.105 13.552  1.00 37.79  ? 482 ASP A CA  1 
ATOM   3507 C C   . ASP A 1 482 ? 34.840 56.727 13.522  1.00 37.84  ? 482 ASP A C   1 
ATOM   3508 O O   . ASP A 1 482 ? 35.518 55.757 13.210  1.00 39.45  ? 482 ASP A O   1 
ATOM   3509 C CB  . ASP A 1 482 ? 36.435 58.170 14.726  1.00 39.58  ? 482 ASP A CB  1 
ATOM   3510 C CG  . ASP A 1 482 ? 37.376 59.350 14.639  1.00 42.80  ? 482 ASP A CG  1 
ATOM   3511 O OD1 . ASP A 1 482 ? 37.690 59.769 13.500  1.00 44.02  ? 482 ASP A OD1 1 
ATOM   3512 O OD2 . ASP A 1 482 ? 37.815 59.843 15.705  1.00 43.94  ? 482 ASP A OD2 1 
ATOM   3513 N N   . GLU A 1 483 ? 33.556 56.618 13.843  1.00 37.83  ? 483 GLU A N   1 
ATOM   3514 C CA  . GLU A 1 483 ? 32.928 55.306 13.828  1.00 36.18  ? 483 GLU A CA  1 
ATOM   3515 C C   . GLU A 1 483 ? 32.606 54.888 12.392  1.00 36.38  ? 483 GLU A C   1 
ATOM   3516 O O   . GLU A 1 483 ? 32.684 53.710 12.060  1.00 36.40  ? 483 GLU A O   1 
ATOM   3517 C CB  . GLU A 1 483 ? 31.657 55.291 14.694  1.00 33.93  ? 483 GLU A CB  1 
ATOM   3518 C CG  . GLU A 1 483 ? 30.427 55.938 14.079  1.00 35.23  ? 483 GLU A CG  1 
ATOM   3519 C CD  . GLU A 1 483 ? 30.353 57.439 14.298  1.00 35.87  ? 483 GLU A CD  1 
ATOM   3520 O OE1 . GLU A 1 483 ? 31.333 58.135 13.974  1.00 34.81  ? 483 GLU A OE1 1 
ATOM   3521 O OE2 . GLU A 1 483 ? 29.304 57.921 14.787  1.00 36.27  ? 483 GLU A OE2 1 
ATOM   3522 N N   . ILE A 1 484 ? 32.281 55.860 11.539  1.00 36.05  ? 484 ILE A N   1 
ATOM   3523 C CA  . ILE A 1 484 ? 31.923 55.585 10.148  1.00 36.18  ? 484 ILE A CA  1 
ATOM   3524 C C   . ILE A 1 484 ? 32.863 54.585 9.475   1.00 37.93  ? 484 ILE A C   1 
ATOM   3525 O O   . ILE A 1 484 ? 32.409 53.555 8.976   1.00 36.62  ? 484 ILE A O   1 
ATOM   3526 C CB  . ILE A 1 484 ? 31.856 56.895 9.307   1.00 35.37  ? 484 ILE A CB  1 
ATOM   3527 C CG1 . ILE A 1 484 ? 30.809 57.843 9.894   1.00 32.82  ? 484 ILE A CG1 1 
ATOM   3528 C CG2 . ILE A 1 484 ? 31.447 56.589 7.877   1.00 33.81  ? 484 ILE A CG2 1 
ATOM   3529 C CD1 . ILE A 1 484 ? 30.803 59.206 9.241   1.00 31.53  ? 484 ILE A CD1 1 
ATOM   3530 N N   . GLU A 1 485 ? 34.161 54.879 9.453   1.00 40.25  ? 485 GLU A N   1 
ATOM   3531 C CA  . GLU A 1 485 ? 35.132 53.959 8.848   1.00 42.42  ? 485 GLU A CA  1 
ATOM   3532 C C   . GLU A 1 485 ? 34.825 52.524 9.257   1.00 41.09  ? 485 GLU A C   1 
ATOM   3533 O O   . GLU A 1 485 ? 34.539 51.676 8.420   1.00 43.27  ? 485 GLU A O   1 
ATOM   3534 C CB  . GLU A 1 485 ? 36.552 54.249 9.328   1.00 45.56  ? 485 GLU A CB  1 
ATOM   3535 C CG  . GLU A 1 485 ? 37.017 55.644 9.114   1.00 51.79  ? 485 GLU A CG  1 
ATOM   3536 C CD  . GLU A 1 485 ? 38.307 55.930 9.840   1.00 55.21  ? 485 GLU A CD  1 
ATOM   3537 O OE1 . GLU A 1 485 ? 38.990 54.962 10.260  1.00 54.61  ? 485 GLU A OE1 1 
ATOM   3538 O OE2 . GLU A 1 485 ? 38.632 57.131 9.985   1.00 58.45  ? 485 GLU A OE2 1 
ATOM   3539 N N   . TYR A 1 486 ? 34.905 52.265 10.558  1.00 37.23  ? 486 TYR A N   1 
ATOM   3540 C CA  . TYR A 1 486 ? 34.676 50.937 11.095  1.00 36.07  ? 486 TYR A CA  1 
ATOM   3541 C C   . TYR A 1 486 ? 33.355 50.280 10.707  1.00 35.39  ? 486 TYR A C   1 
ATOM   3542 O O   . TYR A 1 486 ? 33.332 49.115 10.328  1.00 34.12  ? 486 TYR A O   1 
ATOM   3543 C CB  . TYR A 1 486 ? 34.831 50.966 12.616  1.00 36.14  ? 486 TYR A CB  1 
ATOM   3544 C CG  . TYR A 1 486 ? 36.240 51.305 13.074  1.00 35.10  ? 486 TYR A CG  1 
ATOM   3545 C CD1 . TYR A 1 486 ? 36.708 52.619 13.056  1.00 34.56  ? 486 TYR A CD1 1 
ATOM   3546 C CD2 . TYR A 1 486 ? 37.113 50.306 13.493  1.00 34.65  ? 486 TYR A CD2 1 
ATOM   3547 C CE1 . TYR A 1 486 ? 38.014 52.930 13.447  1.00 32.04  ? 486 TYR A CE1 1 
ATOM   3548 C CE2 . TYR A 1 486 ? 38.419 50.609 13.886  1.00 34.95  ? 486 TYR A CE2 1 
ATOM   3549 C CZ  . TYR A 1 486 ? 38.861 51.920 13.857  1.00 32.98  ? 486 TYR A CZ  1 
ATOM   3550 O OH  . TYR A 1 486 ? 40.146 52.210 14.244  1.00 31.49  ? 486 TYR A OH  1 
ATOM   3551 N N   . PHE A 1 487 ? 32.255 51.014 10.798  1.00 35.73  ? 487 PHE A N   1 
ATOM   3552 C CA  . PHE A 1 487 ? 30.962 50.453 10.427  1.00 35.90  ? 487 PHE A CA  1 
ATOM   3553 C C   . PHE A 1 487 ? 30.900 50.148 8.936   1.00 35.96  ? 487 PHE A C   1 
ATOM   3554 O O   . PHE A 1 487 ? 30.063 49.364 8.497   1.00 35.28  ? 487 PHE A O   1 
ATOM   3555 C CB  . PHE A 1 487 ? 29.837 51.412 10.811  1.00 36.33  ? 487 PHE A CB  1 
ATOM   3556 C CG  . PHE A 1 487 ? 29.481 51.372 12.268  1.00 35.65  ? 487 PHE A CG  1 
ATOM   3557 C CD1 . PHE A 1 487 ? 29.326 50.157 12.923  1.00 35.39  ? 487 PHE A CD1 1 
ATOM   3558 C CD2 . PHE A 1 487 ? 29.274 52.547 12.975  1.00 34.10  ? 487 PHE A CD2 1 
ATOM   3559 C CE1 . PHE A 1 487 ? 28.970 50.111 14.257  1.00 34.85  ? 487 PHE A CE1 1 
ATOM   3560 C CE2 . PHE A 1 487 ? 28.920 52.514 14.307  1.00 35.44  ? 487 PHE A CE2 1 
ATOM   3561 C CZ  . PHE A 1 487 ? 28.766 51.290 14.952  1.00 36.88  ? 487 PHE A CZ  1 
ATOM   3562 N N   . PHE A 1 488 ? 31.778 50.783 8.161   1.00 37.50  ? 488 PHE A N   1 
ATOM   3563 C CA  . PHE A 1 488 ? 31.853 50.550 6.720   1.00 40.46  ? 488 PHE A CA  1 
ATOM   3564 C C   . PHE A 1 488 ? 32.898 49.477 6.424   1.00 42.69  ? 488 PHE A C   1 
ATOM   3565 O O   . PHE A 1 488 ? 33.023 49.011 5.289   1.00 44.31  ? 488 PHE A O   1 
ATOM   3566 C CB  . PHE A 1 488 ? 32.207 51.833 5.958   1.00 38.17  ? 488 PHE A CB  1 
ATOM   3567 C CG  . PHE A 1 488 ? 31.012 52.584 5.464   1.00 36.69  ? 488 PHE A CG  1 
ATOM   3568 C CD1 . PHE A 1 488 ? 30.282 52.105 4.387   1.00 35.94  ? 488 PHE A CD1 1 
ATOM   3569 C CD2 . PHE A 1 488 ? 30.573 53.735 6.116   1.00 37.54  ? 488 PHE A CD2 1 
ATOM   3570 C CE1 . PHE A 1 488 ? 29.124 52.755 3.967   1.00 36.28  ? 488 PHE A CE1 1 
ATOM   3571 C CE2 . PHE A 1 488 ? 29.420 54.392 5.706   1.00 35.34  ? 488 PHE A CE2 1 
ATOM   3572 C CZ  . PHE A 1 488 ? 28.693 53.899 4.630   1.00 36.89  ? 488 PHE A CZ  1 
ATOM   3573 N N   . GLY A 1 489 ? 33.647 49.097 7.456   1.00 44.80  ? 489 GLY A N   1 
ATOM   3574 C CA  . GLY A 1 489 ? 34.661 48.069 7.307   1.00 46.56  ? 489 GLY A CA  1 
ATOM   3575 C C   . GLY A 1 489 ? 35.972 48.506 6.688   1.00 47.12  ? 489 GLY A C   1 
ATOM   3576 O O   . GLY A 1 489 ? 36.751 47.667 6.262   1.00 47.29  ? 489 GLY A O   1 
ATOM   3577 N N   . GLN A 1 490 ? 36.234 49.804 6.635   1.00 48.19  ? 490 GLN A N   1 
ATOM   3578 C CA  . GLN A 1 490 ? 37.478 50.264 6.050   1.00 50.45  ? 490 GLN A CA  1 
ATOM   3579 C C   . GLN A 1 490 ? 38.670 49.544 6.672   1.00 51.97  ? 490 GLN A C   1 
ATOM   3580 O O   . GLN A 1 490 ? 39.659 49.283 5.995   1.00 52.42  ? 490 GLN A O   1 
ATOM   3581 C CB  . GLN A 1 490 ? 37.624 51.775 6.215   1.00 51.87  ? 490 GLN A CB  1 
ATOM   3582 C CG  . GLN A 1 490 ? 36.420 52.546 5.697   1.00 59.08  ? 490 GLN A CG  1 
ATOM   3583 C CD  . GLN A 1 490 ? 36.055 52.184 4.262   1.00 61.62  ? 490 GLN A CD  1 
ATOM   3584 O OE1 . GLN A 1 490 ? 36.845 52.391 3.342   1.00 64.79  ? 490 GLN A OE1 1 
ATOM   3585 N NE2 . GLN A 1 490 ? 34.853 51.642 4.068   1.00 61.11  ? 490 GLN A NE2 1 
ATOM   3586 N N   . PRO A 1 491 ? 38.600 49.213 7.972   1.00 52.98  ? 491 PRO A N   1 
ATOM   3587 C CA  . PRO A 1 491 ? 39.742 48.518 8.576   1.00 53.00  ? 491 PRO A CA  1 
ATOM   3588 C C   . PRO A 1 491 ? 40.031 47.178 7.905   1.00 53.12  ? 491 PRO A C   1 
ATOM   3589 O O   . PRO A 1 491 ? 41.117 46.626 8.054   1.00 52.04  ? 491 PRO A O   1 
ATOM   3590 C CB  . PRO A 1 491 ? 39.317 48.357 10.032  1.00 52.72  ? 491 PRO A CB  1 
ATOM   3591 C CG  . PRO A 1 491 ? 38.508 49.588 10.266  1.00 53.32  ? 491 PRO A CG  1 
ATOM   3592 C CD  . PRO A 1 491 ? 37.663 49.674 9.012   1.00 53.09  ? 491 PRO A CD  1 
ATOM   3593 N N   . LEU A 1 492 ? 39.049 46.659 7.175   1.00 53.32  ? 492 LEU A N   1 
ATOM   3594 C CA  . LEU A 1 492 ? 39.195 45.392 6.467   1.00 54.41  ? 492 LEU A CA  1 
ATOM   3595 C C   . LEU A 1 492 ? 39.973 45.589 5.164   1.00 56.84  ? 492 LEU A C   1 
ATOM   3596 O O   . LEU A 1 492 ? 40.284 44.628 4.459   1.00 58.63  ? 492 LEU A O   1 
ATOM   3597 C CB  . LEU A 1 492 ? 37.819 44.805 6.154   1.00 53.53  ? 492 LEU A CB  1 
ATOM   3598 C CG  . LEU A 1 492 ? 37.194 43.830 7.145   1.00 52.32  ? 492 LEU A CG  1 
ATOM   3599 C CD1 . LEU A 1 492 ? 37.849 42.480 6.986   1.00 55.14  ? 492 LEU A CD1 1 
ATOM   3600 C CD2 . LEU A 1 492 ? 37.353 44.340 8.550   1.00 53.84  ? 492 LEU A CD2 1 
ATOM   3601 N N   . ASN A 1 493 ? 40.275 46.845 4.853   1.00 58.25  ? 493 ASN A N   1 
ATOM   3602 C CA  . ASN A 1 493 ? 41.015 47.215 3.650   1.00 58.15  ? 493 ASN A CA  1 
ATOM   3603 C C   . ASN A 1 493 ? 42.498 47.151 3.983   1.00 57.55  ? 493 ASN A C   1 
ATOM   3604 O O   . ASN A 1 493 ? 43.021 48.034 4.657   1.00 57.35  ? 493 ASN A O   1 
ATOM   3605 C CB  . ASN A 1 493 ? 40.637 48.641 3.244   1.00 60.78  ? 493 ASN A CB  1 
ATOM   3606 C CG  . ASN A 1 493 ? 41.331 49.095 1.986   1.00 62.58  ? 493 ASN A CG  1 
ATOM   3607 O OD1 . ASN A 1 493 ? 42.320 48.493 1.575   1.00 63.75  ? 493 ASN A OD1 1 
ATOM   3608 N ND2 . ASN A 1 493 ? 40.822 50.167 1.381   1.00 64.11  ? 493 ASN A ND2 1 
ATOM   3609 N N   . ASN A 1 494 ? 43.182 46.117 3.506   1.00 57.54  ? 494 ASN A N   1 
ATOM   3610 C CA  . ASN A 1 494 ? 44.605 45.965 3.796   1.00 57.42  ? 494 ASN A CA  1 
ATOM   3611 C C   . ASN A 1 494 ? 45.540 47.030 3.242   1.00 56.72  ? 494 ASN A C   1 
ATOM   3612 O O   . ASN A 1 494 ? 46.645 47.200 3.745   1.00 56.97  ? 494 ASN A O   1 
ATOM   3613 C CB  . ASN A 1 494 ? 45.099 44.601 3.337   1.00 58.46  ? 494 ASN A CB  1 
ATOM   3614 C CG  . ASN A 1 494 ? 44.689 43.492 4.279   1.00 61.69  ? 494 ASN A CG  1 
ATOM   3615 O OD1 . ASN A 1 494 ? 43.746 42.740 4.007   1.00 63.10  ? 494 ASN A OD1 1 
ATOM   3616 N ND2 . ASN A 1 494 ? 45.390 43.389 5.408   1.00 61.27  ? 494 ASN A ND2 1 
ATOM   3617 N N   . SER A 1 495 ? 45.115 47.746 2.211   1.00 55.25  ? 495 SER A N   1 
ATOM   3618 C CA  . SER A 1 495 ? 45.970 48.766 1.637   1.00 54.81  ? 495 SER A CA  1 
ATOM   3619 C C   . SER A 1 495 ? 46.086 49.916 2.620   1.00 55.74  ? 495 SER A C   1 
ATOM   3620 O O   . SER A 1 495 ? 46.977 50.754 2.501   1.00 56.03  ? 495 SER A O   1 
ATOM   3621 C CB  . SER A 1 495 ? 45.382 49.253 0.316   1.00 55.50  ? 495 SER A CB  1 
ATOM   3622 O OG  . SER A 1 495 ? 45.077 48.154 -0.531  1.00 54.82  ? 495 SER A OG  1 
ATOM   3623 N N   . LEU A 1 496 ? 45.173 49.940 3.589   1.00 56.73  ? 496 LEU A N   1 
ATOM   3624 C CA  . LEU A 1 496 ? 45.130 50.973 4.629   1.00 56.64  ? 496 LEU A CA  1 
ATOM   3625 C C   . LEU A 1 496 ? 45.779 50.481 5.922   1.00 56.91  ? 496 LEU A C   1 
ATOM   3626 O O   . LEU A 1 496 ? 45.629 49.317 6.303   1.00 55.95  ? 496 LEU A O   1 
ATOM   3627 C CB  . LEU A 1 496 ? 43.683 51.377 4.910   1.00 55.36  ? 496 LEU A CB  1 
ATOM   3628 C CG  . LEU A 1 496 ? 43.008 52.273 3.877   1.00 54.81  ? 496 LEU A CG  1 
ATOM   3629 C CD1 . LEU A 1 496 ? 41.509 52.325 4.123   1.00 53.71  ? 496 LEU A CD1 1 
ATOM   3630 C CD2 . LEU A 1 496 ? 43.623 53.658 3.957   1.00 54.29  ? 496 LEU A CD2 1 
ATOM   3631 N N   . GLN A 1 497 ? 46.479 51.381 6.603   1.00 56.63  ? 497 GLN A N   1 
ATOM   3632 C CA  . GLN A 1 497 ? 47.176 51.035 7.831   1.00 57.43  ? 497 GLN A CA  1 
ATOM   3633 C C   . GLN A 1 497 ? 46.316 51.063 9.098   1.00 58.05  ? 497 GLN A C   1 
ATOM   3634 O O   . GLN A 1 497 ? 45.849 52.117 9.526   1.00 57.70  ? 497 GLN A O   1 
ATOM   3635 C CB  . GLN A 1 497 ? 48.363 51.971 8.013   1.00 58.47  ? 497 GLN A CB  1 
ATOM   3636 C CG  . GLN A 1 497 ? 49.357 51.514 9.055   1.00 61.36  ? 497 GLN A CG  1 
ATOM   3637 C CD  . GLN A 1 497 ? 50.267 52.642 9.489   1.00 63.98  ? 497 GLN A CD  1 
ATOM   3638 O OE1 . GLN A 1 497 ? 50.680 53.463 8.671   1.00 65.67  ? 497 GLN A OE1 1 
ATOM   3639 N NE2 . GLN A 1 497 ? 50.590 52.688 10.780  1.00 64.72  ? 497 GLN A NE2 1 
ATOM   3640 N N   . TYR A 1 498 ? 46.126 49.892 9.696   1.00 58.32  ? 498 TYR A N   1 
ATOM   3641 C CA  . TYR A 1 498 ? 45.352 49.747 10.926  1.00 58.54  ? 498 TYR A CA  1 
ATOM   3642 C C   . TYR A 1 498 ? 45.982 48.611 11.745  1.00 58.83  ? 498 TYR A C   1 
ATOM   3643 O O   . TYR A 1 498 ? 46.514 47.664 11.167  1.00 60.05  ? 498 TYR A O   1 
ATOM   3644 C CB  . TYR A 1 498 ? 43.890 49.367 10.627  1.00 59.35  ? 498 TYR A CB  1 
ATOM   3645 C CG  . TYR A 1 498 ? 42.986 50.449 10.054  1.00 59.19  ? 498 TYR A CG  1 
ATOM   3646 C CD1 . TYR A 1 498 ? 42.947 50.706 8.686   1.00 60.29  ? 498 TYR A CD1 1 
ATOM   3647 C CD2 . TYR A 1 498 ? 42.127 51.170 10.875  1.00 57.21  ? 498 TYR A CD2 1 
ATOM   3648 C CE1 . TYR A 1 498 ? 42.068 51.652 8.152   1.00 59.24  ? 498 TYR A CE1 1 
ATOM   3649 C CE2 . TYR A 1 498 ? 41.249 52.117 10.349  1.00 58.34  ? 498 TYR A CE2 1 
ATOM   3650 C CZ  . TYR A 1 498 ? 41.224 52.350 8.989   1.00 58.50  ? 498 TYR A CZ  1 
ATOM   3651 O OH  . TYR A 1 498 ? 40.355 53.282 8.466   1.00 60.14  ? 498 TYR A OH  1 
ATOM   3652 N N   . ARG A 1 499 ? 45.924 48.700 13.075  1.00 57.83  ? 499 ARG A N   1 
ATOM   3653 C CA  . ARG A 1 499 ? 46.466 47.647 13.935  1.00 57.60  ? 499 ARG A CA  1 
ATOM   3654 C C   . ARG A 1 499 ? 45.568 46.419 13.779  1.00 56.62  ? 499 ARG A C   1 
ATOM   3655 O O   . ARG A 1 499 ? 44.391 46.546 13.438  1.00 57.04  ? 499 ARG A O   1 
ATOM   3656 C CB  . ARG A 1 499 ? 46.453 48.080 15.404  1.00 61.69  ? 499 ARG A CB  1 
ATOM   3657 C CG  . ARG A 1 499 ? 47.465 49.133 15.797  1.00 66.76  ? 499 ARG A CG  1 
ATOM   3658 C CD  . ARG A 1 499 ? 47.177 49.616 17.208  1.00 73.05  ? 499 ARG A CD  1 
ATOM   3659 N NE  . ARG A 1 499 ? 48.180 50.568 17.685  1.00 81.01  ? 499 ARG A NE  1 
ATOM   3660 C CZ  . ARG A 1 499 ? 48.051 51.300 18.792  1.00 83.89  ? 499 ARG A CZ  1 
ATOM   3661 N NH1 . ARG A 1 499 ? 46.956 51.195 19.539  1.00 85.03  ? 499 ARG A NH1 1 
ATOM   3662 N NH2 . ARG A 1 499 ? 49.019 52.137 19.158  1.00 84.24  ? 499 ARG A NH2 1 
ATOM   3663 N N   . PRO A 1 500 ? 46.106 45.215 14.038  1.00 54.64  ? 500 PRO A N   1 
ATOM   3664 C CA  . PRO A 1 500 ? 45.339 43.968 13.921  1.00 53.22  ? 500 PRO A CA  1 
ATOM   3665 C C   . PRO A 1 500 ? 44.003 43.968 14.662  1.00 52.66  ? 500 PRO A C   1 
ATOM   3666 O O   . PRO A 1 500 ? 43.022 43.384 14.190  1.00 52.34  ? 500 PRO A O   1 
ATOM   3667 C CB  . PRO A 1 500 ? 46.304 42.920 14.464  1.00 52.38  ? 500 PRO A CB  1 
ATOM   3668 C CG  . PRO A 1 500 ? 47.619 43.455 14.036  1.00 53.54  ? 500 PRO A CG  1 
ATOM   3669 C CD  . PRO A 1 500 ? 47.509 44.926 14.379  1.00 53.80  ? 500 PRO A CD  1 
ATOM   3670 N N   . VAL A 1 501 ? 43.964 44.612 15.825  1.00 52.30  ? 501 VAL A N   1 
ATOM   3671 C CA  . VAL A 1 501 ? 42.732 44.676 16.605  1.00 51.11  ? 501 VAL A CA  1 
ATOM   3672 C C   . VAL A 1 501 ? 41.762 45.671 16.004  1.00 50.66  ? 501 VAL A C   1 
ATOM   3673 O O   . VAL A 1 501 ? 40.554 45.548 16.195  1.00 51.43  ? 501 VAL A O   1 
ATOM   3674 C CB  . VAL A 1 501 ? 42.986 45.078 18.070  1.00 49.71  ? 501 VAL A CB  1 
ATOM   3675 C CG1 . VAL A 1 501 ? 43.731 43.972 18.772  1.00 52.14  ? 501 VAL A CG1 1 
ATOM   3676 C CG2 . VAL A 1 501 ? 43.765 46.382 18.136  1.00 48.58  ? 501 VAL A CG2 1 
ATOM   3677 N N   . GLU A 1 502 ? 42.285 46.661 15.284  1.00 49.85  ? 502 GLU A N   1 
ATOM   3678 C CA  . GLU A 1 502 ? 41.424 47.654 14.658  1.00 49.32  ? 502 GLU A CA  1 
ATOM   3679 C C   . GLU A 1 502 ? 40.737 47.047 13.444  1.00 50.22  ? 502 GLU A C   1 
ATOM   3680 O O   . GLU A 1 502 ? 39.677 47.511 13.023  1.00 50.07  ? 502 GLU A O   1 
ATOM   3681 C CB  . GLU A 1 502 ? 42.223 48.883 14.245  1.00 46.38  ? 502 GLU A CB  1 
ATOM   3682 C CG  . GLU A 1 502 ? 42.775 49.663 15.400  1.00 42.94  ? 502 GLU A CG  1 
ATOM   3683 C CD  . GLU A 1 502 ? 43.538 50.855 14.923  1.00 41.82  ? 502 GLU A CD  1 
ATOM   3684 O OE1 . GLU A 1 502 ? 44.262 50.701 13.929  1.00 45.55  ? 502 GLU A OE1 1 
ATOM   3685 O OE2 . GLU A 1 502 ? 43.435 51.939 15.522  1.00 41.70  ? 502 GLU A OE2 1 
ATOM   3686 N N   . ARG A 1 503 ? 41.349 46.012 12.876  1.00 51.74  ? 503 ARG A N   1 
ATOM   3687 C CA  . ARG A 1 503 ? 40.751 45.340 11.731  1.00 54.08  ? 503 ARG A CA  1 
ATOM   3688 C C   . ARG A 1 503 ? 39.754 44.368 12.329  1.00 53.54  ? 503 ARG A C   1 
ATOM   3689 O O   . ARG A 1 503 ? 38.766 44.000 11.701  1.00 54.02  ? 503 ARG A O   1 
ATOM   3690 C CB  . ARG A 1 503 ? 41.803 44.581 10.921  1.00 55.70  ? 503 ARG A CB  1 
ATOM   3691 C CG  . ARG A 1 503 ? 42.844 45.466 10.260  1.00 58.67  ? 503 ARG A CG  1 
ATOM   3692 C CD  . ARG A 1 503 ? 43.796 44.647 9.398   1.00 60.83  ? 503 ARG A CD  1 
ATOM   3693 N NE  . ARG A 1 503 ? 44.889 45.464 8.878   1.00 63.50  ? 503 ARG A NE  1 
ATOM   3694 C CZ  . ARG A 1 503 ? 44.753 46.419 7.964   1.00 64.31  ? 503 ARG A CZ  1 
ATOM   3695 N NH1 . ARG A 1 503 ? 43.562 46.689 7.446   1.00 65.10  ? 503 ARG A NH1 1 
ATOM   3696 N NH2 . ARG A 1 503 ? 45.810 47.122 7.580   1.00 65.51  ? 503 ARG A NH2 1 
ATOM   3697 N N   . GLU A 1 504 ? 40.025 43.967 13.564  1.00 53.60  ? 504 GLU A N   1 
ATOM   3698 C CA  . GLU A 1 504 ? 39.154 43.048 14.274  1.00 53.81  ? 504 GLU A CA  1 
ATOM   3699 C C   . GLU A 1 504 ? 37.905 43.803 14.722  1.00 51.66  ? 504 GLU A C   1 
ATOM   3700 O O   . GLU A 1 504 ? 36.836 43.219 14.842  1.00 51.38  ? 504 GLU A O   1 
ATOM   3701 C CB  . GLU A 1 504 ? 39.881 42.472 15.490  1.00 56.44  ? 504 GLU A CB  1 
ATOM   3702 C CG  . GLU A 1 504 ? 39.798 40.955 15.611  1.00 61.37  ? 504 GLU A CG  1 
ATOM   3703 C CD  . GLU A 1 504 ? 38.381 40.449 15.844  1.00 64.13  ? 504 GLU A CD  1 
ATOM   3704 O OE1 . GLU A 1 504 ? 37.772 40.826 16.874  1.00 63.66  ? 504 GLU A OE1 1 
ATOM   3705 O OE2 . GLU A 1 504 ? 37.881 39.668 14.998  1.00 65.89  ? 504 GLU A OE2 1 
ATOM   3706 N N   . LEU A 1 505 ? 38.049 45.103 14.966  1.00 50.08  ? 505 LEU A N   1 
ATOM   3707 C CA  . LEU A 1 505 ? 36.928 45.935 15.398  1.00 48.24  ? 505 LEU A CA  1 
ATOM   3708 C C   . LEU A 1 505 ? 36.097 46.309 14.180  1.00 48.75  ? 505 LEU A C   1 
ATOM   3709 O O   . LEU A 1 505 ? 34.860 46.330 14.238  1.00 47.52  ? 505 LEU A O   1 
ATOM   3710 C CB  . LEU A 1 505 ? 37.432 47.208 16.098  1.00 45.55  ? 505 LEU A CB  1 
ATOM   3711 C CG  . LEU A 1 505 ? 36.354 48.097 16.733  1.00 44.04  ? 505 LEU A CG  1 
ATOM   3712 C CD1 . LEU A 1 505 ? 35.505 47.248 17.667  1.00 41.10  ? 505 LEU A CD1 1 
ATOM   3713 C CD2 . LEU A 1 505 ? 36.980 49.266 17.482  1.00 40.95  ? 505 LEU A CD2 1 
ATOM   3714 N N   . GLY A 1 506 ? 36.787 46.610 13.079  1.00 49.20  ? 506 GLY A N   1 
ATOM   3715 C CA  . GLY A 1 506 ? 36.107 46.958 11.847  1.00 47.58  ? 506 GLY A CA  1 
ATOM   3716 C C   . GLY A 1 506 ? 35.312 45.745 11.413  1.00 47.83  ? 506 GLY A C   1 
ATOM   3717 O O   . GLY A 1 506 ? 34.247 45.866 10.819  1.00 47.99  ? 506 GLY A O   1 
ATOM   3718 N N   . LYS A 1 507 ? 35.833 44.562 11.723  1.00 47.92  ? 507 LYS A N   1 
ATOM   3719 C CA  . LYS A 1 507 ? 35.159 43.326 11.368  1.00 48.70  ? 507 LYS A CA  1 
ATOM   3720 C C   . LYS A 1 507 ? 33.947 43.144 12.272  1.00 48.76  ? 507 LYS A C   1 
ATOM   3721 O O   . LYS A 1 507 ? 32.913 42.639 11.841  1.00 49.39  ? 507 LYS A O   1 
ATOM   3722 C CB  . LYS A 1 507 ? 36.105 42.130 11.519  1.00 49.63  ? 507 LYS A CB  1 
ATOM   3723 C CG  . LYS A 1 507 ? 35.457 40.788 11.206  1.00 50.57  ? 507 LYS A CG  1 
ATOM   3724 C CD  . LYS A 1 507 ? 36.306 39.653 11.738  1.00 54.32  ? 507 LYS A CD  1 
ATOM   3725 C CE  . LYS A 1 507 ? 35.477 38.394 11.985  1.00 56.37  ? 507 LYS A CE  1 
ATOM   3726 N NZ  . LYS A 1 507 ? 36.169 37.441 12.919  1.00 56.15  ? 507 LYS A NZ  1 
ATOM   3727 N N   . ARG A 1 508 ? 34.075 43.555 13.530  1.00 48.57  ? 508 ARG A N   1 
ATOM   3728 C CA  . ARG A 1 508 ? 32.969 43.434 14.477  1.00 47.55  ? 508 ARG A CA  1 
ATOM   3729 C C   . ARG A 1 508 ? 31.902 44.471 14.172  1.00 45.98  ? 508 ARG A C   1 
ATOM   3730 O O   . ARG A 1 508 ? 30.713 44.164 14.117  1.00 44.65  ? 508 ARG A O   1 
ATOM   3731 C CB  . ARG A 1 508 ? 33.442 43.642 15.922  1.00 49.36  ? 508 ARG A CB  1 
ATOM   3732 C CG  . ARG A 1 508 ? 33.990 42.409 16.624  1.00 50.73  ? 508 ARG A CG  1 
ATOM   3733 C CD  . ARG A 1 508 ? 34.040 42.646 18.131  1.00 53.67  ? 508 ARG A CD  1 
ATOM   3734 N NE  . ARG A 1 508 ? 34.950 43.733 18.498  1.00 54.94  ? 508 ARG A NE  1 
ATOM   3735 C CZ  . ARG A 1 508 ? 34.916 44.380 19.662  1.00 54.54  ? 508 ARG A CZ  1 
ATOM   3736 N NH1 . ARG A 1 508 ? 34.015 44.062 20.578  1.00 55.47  ? 508 ARG A NH1 1 
ATOM   3737 N NH2 . ARG A 1 508 ? 35.783 45.346 19.915  1.00 54.13  ? 508 ARG A NH2 1 
ATOM   3738 N N   . MET A 1 509 ? 32.341 45.704 13.969  1.00 44.40  ? 509 MET A N   1 
ATOM   3739 C CA  . MET A 1 509 ? 31.423 46.783 13.701  1.00 43.35  ? 509 MET A CA  1 
ATOM   3740 C C   . MET A 1 509 ? 30.724 46.682 12.351  1.00 44.08  ? 509 MET A C   1 
ATOM   3741 O O   . MET A 1 509 ? 29.599 47.168 12.201  1.00 44.34  ? 509 MET A O   1 
ATOM   3742 C CB  . MET A 1 509 ? 32.155 48.114 13.860  1.00 42.85  ? 509 MET A CB  1 
ATOM   3743 C CG  . MET A 1 509 ? 32.558 48.381 15.297  1.00 38.18  ? 509 MET A CG  1 
ATOM   3744 S SD  . MET A 1 509 ? 33.424 49.922 15.519  1.00 39.53  ? 509 MET A SD  1 
ATOM   3745 C CE  . MET A 1 509 ? 32.137 51.079 15.081  1.00 38.18  ? 509 MET A CE  1 
ATOM   3746 N N   . LEU A 1 510 ? 31.362 46.052 11.368  1.00 43.33  ? 510 LEU A N   1 
ATOM   3747 C CA  . LEU A 1 510 ? 30.713 45.909 10.068  1.00 42.57  ? 510 LEU A CA  1 
ATOM   3748 C C   . LEU A 1 510 ? 29.675 44.796 10.225  1.00 42.88  ? 510 LEU A C   1 
ATOM   3749 O O   . LEU A 1 510 ? 28.610 44.839 9.612   1.00 43.97  ? 510 LEU A O   1 
ATOM   3750 C CB  . LEU A 1 510 ? 31.750 45.568 8.979   1.00 41.82  ? 510 LEU A CB  1 
ATOM   3751 C CG  . LEU A 1 510 ? 31.441 45.516 7.462   1.00 42.84  ? 510 LEU A CG  1 
ATOM   3752 C CD1 . LEU A 1 510 ? 31.040 44.111 7.045   1.00 39.71  ? 510 LEU A CD1 1 
ATOM   3753 C CD2 . LEU A 1 510 ? 30.365 46.532 7.086   1.00 42.09  ? 510 LEU A CD2 1 
ATOM   3754 N N   . SER A 1 511 ? 29.951 43.831 11.100  1.00 42.22  ? 511 SER A N   1 
ATOM   3755 C CA  . SER A 1 511 ? 29.090 42.666 11.327  1.00 41.82  ? 511 SER A CA  1 
ATOM   3756 C C   . SER A 1 511 ? 27.860 43.130 12.097  1.00 40.94  ? 511 SER A C   1 
ATOM   3757 O O   . SER A 1 511 ? 26.768 42.542 11.907  1.00 42.03  ? 511 SER A O   1 
ATOM   3758 C CB  . SER A 1 511 ? 29.845 41.608 12.136  1.00 41.59  ? 511 SER A CB  1 
ATOM   3759 O OG  . SER A 1 511 ? 29.016 40.474 12.347  1.00 45.36  ? 511 SER A OG  1 
ATOM   3760 N N   . ALA A 1 512 ? 27.999 44.076 12.990  1.00 39.24  ? 512 ALA A N   1 
ATOM   3761 C CA  . ALA A 1 512 ? 26.862 44.562 13.756  1.00 37.20  ? 512 ALA A CA  1 
ATOM   3762 C C   . ALA A 1 512 ? 25.908 45.196 12.742  1.00 36.12  ? 512 ALA A C   1 
ATOM   3763 O O   . ALA A 1 512 ? 24.709 44.926 12.744  1.00 35.09  ? 512 ALA A O   1 
ATOM   3764 C CB  . ALA A 1 512 ? 27.326 45.599 14.793  1.00 34.51  ? 512 ALA A CB  1 
ATOM   3765 N N   . VAL A 1 513 ? 26.457 46.025 11.860  1.00 35.21  ? 513 VAL A N   1 
ATOM   3766 C CA  . VAL A 1 513 ? 25.653 46.686 10.850  1.00 33.61  ? 513 VAL A CA  1 
ATOM   3767 C C   . VAL A 1 513 ? 24.945 45.654 9.980   1.00 35.76  ? 513 VAL A C   1 
ATOM   3768 O O   . VAL A 1 513 ? 23.725 45.702 9.830   1.00 37.73  ? 513 VAL A O   1 
ATOM   3769 C CB  . VAL A 1 513 ? 26.519 47.598 9.946   1.00 30.74  ? 513 VAL A CB  1 
ATOM   3770 C CG1 . VAL A 1 513 ? 25.662 48.230 8.867   1.00 27.58  ? 513 VAL A CG1 1 
ATOM   3771 C CG2 . VAL A 1 513 ? 27.187 48.674 10.781  1.00 30.70  ? 513 VAL A CG2 1 
ATOM   3772 N N   . ILE A 1 514 ? 25.713 44.716 9.425   1.00 35.64  ? 514 ILE A N   1 
ATOM   3773 C CA  . ILE A 1 514 ? 25.179 43.682 8.542   1.00 33.47  ? 514 ILE A CA  1 
ATOM   3774 C C   . ILE A 1 514 ? 24.126 42.813 9.221   1.00 35.21  ? 514 ILE A C   1 
ATOM   3775 O O   . ILE A 1 514 ? 23.022 42.654 8.710   1.00 35.10  ? 514 ILE A O   1 
ATOM   3776 C CB  . ILE A 1 514 ? 26.319 42.796 7.995   1.00 32.14  ? 514 ILE A CB  1 
ATOM   3777 C CG1 . ILE A 1 514 ? 27.299 43.652 7.183   1.00 28.36  ? 514 ILE A CG1 1 
ATOM   3778 C CG2 . ILE A 1 514 ? 25.740 41.656 7.154   1.00 31.21  ? 514 ILE A CG2 1 
ATOM   3779 C CD1 . ILE A 1 514 ? 26.683 44.363 5.980   1.00 25.54  ? 514 ILE A CD1 1 
ATOM   3780 N N   . GLU A 1 515 ? 24.464 42.241 10.369  1.00 37.73  ? 515 GLU A N   1 
ATOM   3781 C CA  . GLU A 1 515 ? 23.499 41.421 11.096  1.00 40.74  ? 515 GLU A CA  1 
ATOM   3782 C C   . GLU A 1 515 ? 22.244 42.239 11.398  1.00 39.96  ? 515 GLU A C   1 
ATOM   3783 O O   . GLU A 1 515 ? 21.129 41.717 11.395  1.00 40.73  ? 515 GLU A O   1 
ATOM   3784 C CB  . GLU A 1 515 ? 24.099 40.920 12.415  1.00 44.64  ? 515 GLU A CB  1 
ATOM   3785 C CG  . GLU A 1 515 ? 24.794 39.581 12.316  1.00 50.46  ? 515 GLU A CG  1 
ATOM   3786 C CD  . GLU A 1 515 ? 23.853 38.489 11.848  1.00 53.23  ? 515 GLU A CD  1 
ATOM   3787 O OE1 . GLU A 1 515 ? 22.978 38.080 12.651  1.00 54.33  ? 515 GLU A OE1 1 
ATOM   3788 O OE2 . GLU A 1 515 ? 23.981 38.054 10.680  1.00 53.46  ? 515 GLU A OE2 1 
ATOM   3789 N N   . PHE A 1 516 ? 22.428 43.526 11.660  1.00 38.17  ? 516 PHE A N   1 
ATOM   3790 C CA  . PHE A 1 516 ? 21.295 44.382 11.962  1.00 36.89  ? 516 PHE A CA  1 
ATOM   3791 C C   . PHE A 1 516 ? 20.373 44.510 10.764  1.00 37.60  ? 516 PHE A C   1 
ATOM   3792 O O   . PHE A 1 516 ? 19.150 44.417 10.894  1.00 36.55  ? 516 PHE A O   1 
ATOM   3793 C CB  . PHE A 1 516 ? 21.752 45.771 12.374  1.00 32.10  ? 516 PHE A CB  1 
ATOM   3794 C CG  . PHE A 1 516 ? 20.625 46.723 12.585  1.00 28.44  ? 516 PHE A CG  1 
ATOM   3795 C CD1 . PHE A 1 516 ? 19.732 46.538 13.629  1.00 28.98  ? 516 PHE A CD1 1 
ATOM   3796 C CD2 . PHE A 1 516 ? 20.437 47.794 11.727  1.00 28.52  ? 516 PHE A CD2 1 
ATOM   3797 C CE1 . PHE A 1 516 ? 18.669 47.410 13.813  1.00 24.92  ? 516 PHE A CE1 1 
ATOM   3798 C CE2 . PHE A 1 516 ? 19.383 48.665 11.902  1.00 26.38  ? 516 PHE A CE2 1 
ATOM   3799 C CZ  . PHE A 1 516 ? 18.497 48.472 12.949  1.00 26.06  ? 516 PHE A CZ  1 
ATOM   3800 N N   . ALA A 1 517 ? 20.969 44.731 9.598   1.00 37.43  ? 517 ALA A N   1 
ATOM   3801 C CA  . ALA A 1 517 ? 20.202 44.882 8.380   1.00 39.33  ? 517 ALA A CA  1 
ATOM   3802 C C   . ALA A 1 517 ? 19.527 43.559 8.062   1.00 42.10  ? 517 ALA A C   1 
ATOM   3803 O O   . ALA A 1 517 ? 18.434 43.522 7.485   1.00 43.61  ? 517 ALA A O   1 
ATOM   3804 C CB  . ALA A 1 517 ? 21.120 45.300 7.231   1.00 36.69  ? 517 ALA A CB  1 
ATOM   3805 N N   . LYS A 1 518 ? 20.176 42.473 8.467   1.00 43.13  ? 518 LYS A N   1 
ATOM   3806 C CA  . LYS A 1 518 ? 19.669 41.142 8.192   1.00 44.32  ? 518 LYS A CA  1 
ATOM   3807 C C   . LYS A 1 518 ? 18.625 40.587 9.152   1.00 46.81  ? 518 LYS A C   1 
ATOM   3808 O O   . LYS A 1 518 ? 17.768 39.803 8.742   1.00 48.60  ? 518 LYS A O   1 
ATOM   3809 C CB  . LYS A 1 518 ? 20.836 40.165 8.102   1.00 41.40  ? 518 LYS A CB  1 
ATOM   3810 C CG  . LYS A 1 518 ? 21.649 40.294 6.841   1.00 39.46  ? 518 LYS A CG  1 
ATOM   3811 C CD  . LYS A 1 518 ? 22.729 39.230 6.793   1.00 37.48  ? 518 LYS A CD  1 
ATOM   3812 C CE  . LYS A 1 518 ? 23.576 39.372 5.558   1.00 36.45  ? 518 LYS A CE  1 
ATOM   3813 N NZ  . LYS A 1 518 ? 24.706 38.414 5.571   1.00 39.54  ? 518 LYS A NZ  1 
ATOM   3814 N N   . THR A 1 519 ? 18.680 40.982 10.417  1.00 48.04  ? 519 THR A N   1 
ATOM   3815 C CA  . THR A 1 519 ? 17.731 40.450 11.387  1.00 49.57  ? 519 THR A CA  1 
ATOM   3816 C C   . THR A 1 519 ? 17.160 41.496 12.331  1.00 51.25  ? 519 THR A C   1 
ATOM   3817 O O   . THR A 1 519 ? 16.379 41.172 13.224  1.00 50.22  ? 519 THR A O   1 
ATOM   3818 C CB  . THR A 1 519 ? 18.397 39.383 12.252  1.00 50.25  ? 519 THR A CB  1 
ATOM   3819 O OG1 . THR A 1 519 ? 19.280 40.021 13.186  1.00 50.97  ? 519 THR A OG1 1 
ATOM   3820 C CG2 . THR A 1 519 ? 19.195 38.421 11.387  1.00 48.70  ? 519 THR A CG2 1 
ATOM   3821 N N   . GLY A 1 520 ? 17.551 42.748 12.143  1.00 53.14  ? 520 GLY A N   1 
ATOM   3822 C CA  . GLY A 1 520 ? 17.060 43.791 13.019  1.00 54.24  ? 520 GLY A CA  1 
ATOM   3823 C C   . GLY A 1 520 ? 17.733 43.665 14.367  1.00 54.97  ? 520 GLY A C   1 
ATOM   3824 O O   . GLY A 1 520 ? 17.276 44.218 15.359  1.00 55.94  ? 520 GLY A O   1 
ATOM   3825 N N   . ASN A 1 521 ? 18.830 42.926 14.401  1.00 57.06  ? 521 ASN A N   1 
ATOM   3826 C CA  . ASN A 1 521 ? 19.560 42.740 15.636  1.00 59.73  ? 521 ASN A CA  1 
ATOM   3827 C C   . ASN A 1 521 ? 21.053 42.698 15.347  1.00 61.40  ? 521 ASN A C   1 
ATOM   3828 O O   . ASN A 1 521 ? 21.541 41.790 14.672  1.00 61.68  ? 521 ASN A O   1 
ATOM   3829 C CB  . ASN A 1 521 ? 19.117 41.451 16.302  1.00 61.99  ? 521 ASN A CB  1 
ATOM   3830 C CG  . ASN A 1 521 ? 19.320 41.479 17.791  1.00 65.05  ? 521 ASN A CG  1 
ATOM   3831 O OD1 . ASN A 1 521 ? 20.452 41.568 18.280  1.00 66.64  ? 521 ASN A OD1 1 
ATOM   3832 N ND2 . ASN A 1 521 ? 18.218 41.415 18.532  1.00 66.94  ? 521 ASN A ND2 1 
ATOM   3833 N N   . PRO A 1 522 ? 21.800 43.681 15.871  1.00 62.16  ? 522 PRO A N   1 
ATOM   3834 C CA  . PRO A 1 522 ? 23.246 43.812 15.692  1.00 63.68  ? 522 PRO A CA  1 
ATOM   3835 C C   . PRO A 1 522 ? 24.033 42.661 16.284  1.00 66.22  ? 522 PRO A C   1 
ATOM   3836 O O   . PRO A 1 522 ? 25.145 42.355 15.850  1.00 65.75  ? 522 PRO A O   1 
ATOM   3837 C CB  . PRO A 1 522 ? 23.550 45.128 16.398  1.00 62.36  ? 522 PRO A CB  1 
ATOM   3838 C CG  . PRO A 1 522 ? 22.612 45.093 17.535  1.00 60.66  ? 522 PRO A CG  1 
ATOM   3839 C CD  . PRO A 1 522 ? 21.325 44.646 16.879  1.00 61.64  ? 522 PRO A CD  1 
ATOM   3840 N N   . ALA A 1 523 ? 23.437 42.020 17.277  1.00 70.18  ? 523 ALA A N   1 
ATOM   3841 C CA  . ALA A 1 523 ? 24.088 40.928 17.972  1.00 74.49  ? 523 ALA A CA  1 
ATOM   3842 C C   . ALA A 1 523 ? 24.061 39.587 17.267  1.00 77.85  ? 523 ALA A C   1 
ATOM   3843 O O   . ALA A 1 523 ? 23.062 39.203 16.655  1.00 77.85  ? 523 ALA A O   1 
ATOM   3844 C CB  . ALA A 1 523 ? 23.489 40.784 19.360  1.00 74.17  ? 523 ALA A CB  1 
ATOM   3845 N N   . GLN A 1 524 ? 25.188 38.890 17.354  1.00 82.61  ? 524 GLN A N   1 
ATOM   3846 C CA  . GLN A 1 524 ? 25.320 37.551 16.801  1.00 87.44  ? 524 GLN A CA  1 
ATOM   3847 C C   . GLN A 1 524 ? 25.288 36.645 18.038  1.00 88.83  ? 524 GLN A C   1 
ATOM   3848 O O   . GLN A 1 524 ? 25.418 37.123 19.170  1.00 89.35  ? 524 GLN A O   1 
ATOM   3849 C CB  . GLN A 1 524 ? 26.655 37.365 16.050  1.00 89.98  ? 524 GLN A CB  1 
ATOM   3850 C CG  . GLN A 1 524 ? 27.528 38.613 15.876  1.00 93.65  ? 524 GLN A CG  1 
ATOM   3851 C CD  . GLN A 1 524 ? 28.179 39.066 17.173  1.00 95.19  ? 524 GLN A CD  1 
ATOM   3852 O OE1 . GLN A 1 524 ? 27.511 39.594 18.058  1.00 96.21  ? 524 GLN A OE1 1 
ATOM   3853 N NE2 . GLN A 1 524 ? 29.488 38.854 17.291  1.00 95.65  ? 524 GLN A NE2 1 
ATOM   3854 N N   . ASP A 1 525 ? 25.103 35.348 17.834  1.00 89.57  ? 525 ASP A N   1 
ATOM   3855 C CA  . ASP A 1 525 ? 25.056 34.406 18.947  1.00 89.40  ? 525 ASP A CA  1 
ATOM   3856 C C   . ASP A 1 525 ? 26.332 34.451 19.776  1.00 87.48  ? 525 ASP A C   1 
ATOM   3857 O O   . ASP A 1 525 ? 27.398 34.825 19.281  1.00 87.25  ? 525 ASP A O   1 
ATOM   3858 C CB  . ASP A 1 525 ? 24.872 32.999 18.411  1.00 92.32  ? 525 ASP A CB  1 
ATOM   3859 C CG  . ASP A 1 525 ? 25.873 32.675 17.332  1.00 94.85  ? 525 ASP A CG  1 
ATOM   3860 O OD1 . ASP A 1 525 ? 27.090 32.791 17.606  1.00 95.54  ? 525 ASP A OD1 1 
ATOM   3861 O OD2 . ASP A 1 525 ? 25.441 32.318 16.212  1.00 96.66  ? 525 ASP A OD2 1 
ATOM   3862 N N   . GLY A 1 526 ? 26.217 34.051 21.038  1.00 84.89  ? 526 GLY A N   1 
ATOM   3863 C CA  . GLY A 1 526 ? 27.369 34.045 21.917  1.00 80.59  ? 526 GLY A CA  1 
ATOM   3864 C C   . GLY A 1 526 ? 27.625 35.423 22.474  1.00 77.37  ? 526 GLY A C   1 
ATOM   3865 O O   . GLY A 1 526 ? 27.944 35.575 23.652  1.00 77.47  ? 526 GLY A O   1 
ATOM   3866 N N   . GLU A 1 527 ? 27.492 36.432 21.619  1.00 74.78  ? 527 GLU A N   1 
ATOM   3867 C CA  . GLU A 1 527 ? 27.699 37.811 22.042  1.00 71.87  ? 527 GLU A CA  1 
ATOM   3868 C C   . GLU A 1 527 ? 26.393 38.344 22.602  1.00 66.69  ? 527 GLU A C   1 
ATOM   3869 O O   . GLU A 1 527 ? 25.356 38.334 21.933  1.00 65.69  ? 527 GLU A O   1 
ATOM   3870 C CB  . GLU A 1 527 ? 28.143 38.697 20.873  1.00 75.51  ? 527 GLU A CB  1 
ATOM   3871 C CG  . GLU A 1 527 ? 28.519 40.120 21.298  1.00 80.79  ? 527 GLU A CG  1 
ATOM   3872 C CD  . GLU A 1 527 ? 28.357 41.143 20.178  1.00 84.06  ? 527 GLU A CD  1 
ATOM   3873 O OE1 . GLU A 1 527 ? 27.220 41.301 19.678  1.00 85.36  ? 527 GLU A OE1 1 
ATOM   3874 O OE2 . GLU A 1 527 ? 29.359 41.794 19.803  1.00 86.03  ? 527 GLU A OE2 1 
ATOM   3875 N N   . GLU A 1 528 ? 26.442 38.802 23.841  1.00 60.17  ? 528 GLU A N   1 
ATOM   3876 C CA  . GLU A 1 528 ? 25.255 39.335 24.460  1.00 54.15  ? 528 GLU A CA  1 
ATOM   3877 C C   . GLU A 1 528 ? 25.132 40.806 24.165  1.00 51.73  ? 528 GLU A C   1 
ATOM   3878 O O   . GLU A 1 528 ? 26.071 41.566 24.381  1.00 52.10  ? 528 GLU A O   1 
ATOM   3879 C CB  . GLU A 1 528 ? 25.308 39.127 25.971  1.00 53.11  ? 528 GLU A CB  1 
ATOM   3880 C CG  . GLU A 1 528 ? 24.695 37.817 26.422  1.00 51.19  ? 528 GLU A CG  1 
ATOM   3881 C CD  . GLU A 1 528 ? 23.226 37.732 26.071  1.00 48.58  ? 528 GLU A CD  1 
ATOM   3882 O OE1 . GLU A 1 528 ? 22.430 38.491 26.673  1.00 48.59  ? 528 GLU A OE1 1 
ATOM   3883 O OE2 . GLU A 1 528 ? 22.874 36.921 25.188  1.00 44.35  ? 528 GLU A OE2 1 
ATOM   3884 N N   . TRP A 1 529 ? 23.988 41.206 23.633  1.00 48.32  ? 529 TRP A N   1 
ATOM   3885 C CA  . TRP A 1 529 ? 23.750 42.616 23.375  1.00 46.57  ? 529 TRP A CA  1 
ATOM   3886 C C   . TRP A 1 529 ? 22.260 42.828 23.631  1.00 46.33  ? 529 TRP A C   1 
ATOM   3887 O O   . TRP A 1 529 ? 21.423 42.669 22.735  1.00 46.41  ? 529 TRP A O   1 
ATOM   3888 C CB  . TRP A 1 529 ? 24.132 43.015 21.943  1.00 43.19  ? 529 TRP A CB  1 
ATOM   3889 C CG  . TRP A 1 529 ? 24.182 44.522 21.744  1.00 40.36  ? 529 TRP A CG  1 
ATOM   3890 C CD1 . TRP A 1 529 ? 23.558 45.465 22.510  1.00 39.27  ? 529 TRP A CD1 1 
ATOM   3891 C CD2 . TRP A 1 529 ? 24.793 45.237 20.655  1.00 37.12  ? 529 TRP A CD2 1 
ATOM   3892 N NE1 . TRP A 1 529 ? 23.730 46.711 21.965  1.00 38.54  ? 529 TRP A NE1 1 
ATOM   3893 C CE2 . TRP A 1 529 ? 24.483 46.602 20.826  1.00 36.24  ? 529 TRP A CE2 1 
ATOM   3894 C CE3 . TRP A 1 529 ? 25.567 44.856 19.553  1.00 34.32  ? 529 TRP A CE3 1 
ATOM   3895 C CZ2 . TRP A 1 529 ? 24.917 47.586 19.938  1.00 34.59  ? 529 TRP A CZ2 1 
ATOM   3896 C CZ3 . TRP A 1 529 ? 25.997 45.834 18.672  1.00 34.61  ? 529 TRP A CZ3 1 
ATOM   3897 C CH2 . TRP A 1 529 ? 25.671 47.184 18.871  1.00 34.85  ? 529 TRP A CH2 1 
ATOM   3898 N N   . PRO A 1 530 ? 21.918 43.171 24.884  1.00 45.00  ? 530 PRO A N   1 
ATOM   3899 C CA  . PRO A 1 530 ? 20.569 43.423 25.388  1.00 43.95  ? 530 PRO A CA  1 
ATOM   3900 C C   . PRO A 1 530 ? 19.946 44.673 24.794  1.00 44.11  ? 530 PRO A C   1 
ATOM   3901 O O   . PRO A 1 530 ? 20.645 45.646 24.504  1.00 44.05  ? 530 PRO A O   1 
ATOM   3902 C CB  . PRO A 1 530 ? 20.781 43.589 26.895  1.00 43.79  ? 530 PRO A CB  1 
ATOM   3903 C CG  . PRO A 1 530 ? 22.102 42.973 27.158  1.00 43.85  ? 530 PRO A CG  1 
ATOM   3904 C CD  . PRO A 1 530 ? 22.899 43.358 25.962  1.00 44.64  ? 530 PRO A CD  1 
ATOM   3905 N N   . ASN A 1 531 ? 18.628 44.644 24.628  1.00 42.79  ? 531 ASN A N   1 
ATOM   3906 C CA  . ASN A 1 531 ? 17.920 45.797 24.106  1.00 42.67  ? 531 ASN A CA  1 
ATOM   3907 C C   . ASN A 1 531 ? 18.112 46.958 25.060  1.00 42.12  ? 531 ASN A C   1 
ATOM   3908 O O   . ASN A 1 531 ? 18.413 46.770 26.235  1.00 43.44  ? 531 ASN A O   1 
ATOM   3909 C CB  . ASN A 1 531 ? 16.431 45.497 23.980  1.00 42.31  ? 531 ASN A CB  1 
ATOM   3910 C CG  . ASN A 1 531 ? 16.105 44.731 22.728  1.00 43.34  ? 531 ASN A CG  1 
ATOM   3911 O OD1 . ASN A 1 531 ? 15.506 45.270 21.797  1.00 45.55  ? 531 ASN A OD1 1 
ATOM   3912 N ND2 . ASN A 1 531 ? 16.508 43.467 22.686  1.00 44.60  ? 531 ASN A ND2 1 
ATOM   3913 N N   . PHE A 1 532 ? 17.949 48.164 24.541  1.00 41.35  ? 532 PHE A N   1 
ATOM   3914 C CA  . PHE A 1 532 ? 18.079 49.359 25.349  1.00 40.62  ? 532 PHE A CA  1 
ATOM   3915 C C   . PHE A 1 532 ? 16.691 49.975 25.546  1.00 41.97  ? 532 PHE A C   1 
ATOM   3916 O O   . PHE A 1 532 ? 15.918 50.118 24.590  1.00 41.33  ? 532 PHE A O   1 
ATOM   3917 C CB  . PHE A 1 532 ? 19.027 50.356 24.659  1.00 38.76  ? 532 PHE A CB  1 
ATOM   3918 C CG  . PHE A 1 532 ? 19.008 51.738 25.255  1.00 34.65  ? 532 PHE A CG  1 
ATOM   3919 C CD1 . PHE A 1 532 ? 17.959 52.612 24.990  1.00 30.66  ? 532 PHE A CD1 1 
ATOM   3920 C CD2 . PHE A 1 532 ? 20.036 52.162 26.090  1.00 34.70  ? 532 PHE A CD2 1 
ATOM   3921 C CE1 . PHE A 1 532 ? 17.931 53.885 25.545  1.00 31.26  ? 532 PHE A CE1 1 
ATOM   3922 C CE2 . PHE A 1 532 ? 20.016 53.445 26.654  1.00 34.26  ? 532 PHE A CE2 1 
ATOM   3923 C CZ  . PHE A 1 532 ? 18.958 54.307 26.380  1.00 30.43  ? 532 PHE A CZ  1 
ATOM   3924 N N   . SER A 1 533 ? 16.382 50.311 26.798  1.00 43.39  ? 533 SER A N   1 
ATOM   3925 C CA  . SER A 1 533 ? 15.115 50.936 27.174  1.00 44.69  ? 533 SER A CA  1 
ATOM   3926 C C   . SER A 1 533 ? 15.432 51.738 28.423  1.00 45.66  ? 533 SER A C   1 
ATOM   3927 O O   . SER A 1 533 ? 16.486 51.538 29.025  1.00 45.50  ? 533 SER A O   1 
ATOM   3928 C CB  . SER A 1 533 ? 14.050 49.880 27.485  1.00 45.35  ? 533 SER A CB  1 
ATOM   3929 O OG  . SER A 1 533 ? 14.321 49.219 28.709  1.00 46.53  ? 533 SER A OG  1 
ATOM   3930 N N   . LYS A 1 534 ? 14.543 52.648 28.811  1.00 47.33  ? 534 LYS A N   1 
ATOM   3931 C CA  . LYS A 1 534 ? 14.790 53.457 30.002  1.00 49.23  ? 534 LYS A CA  1 
ATOM   3932 C C   . LYS A 1 534 ? 15.005 52.562 31.221  1.00 49.52  ? 534 LYS A C   1 
ATOM   3933 O O   . LYS A 1 534 ? 15.824 52.861 32.092  1.00 47.41  ? 534 LYS A O   1 
ATOM   3934 C CB  . LYS A 1 534 ? 13.614 54.403 30.266  1.00 50.45  ? 534 LYS A CB  1 
ATOM   3935 C CG  . LYS A 1 534 ? 13.822 55.301 31.477  1.00 52.79  ? 534 LYS A CG  1 
ATOM   3936 C CD  . LYS A 1 534 ? 12.592 56.149 31.810  1.00 56.42  ? 534 LYS A CD  1 
ATOM   3937 C CE  . LYS A 1 534 ? 12.315 57.238 30.771  1.00 58.90  ? 534 LYS A CE  1 
ATOM   3938 N NZ  . LYS A 1 534 ? 11.723 56.709 29.503  1.00 61.72  ? 534 LYS A NZ  1 
ATOM   3939 N N   . GLU A 1 535 ? 14.266 51.457 31.262  1.00 51.61  ? 535 GLU A N   1 
ATOM   3940 C CA  . GLU A 1 535 ? 14.328 50.494 32.364  1.00 53.61  ? 535 GLU A CA  1 
ATOM   3941 C C   . GLU A 1 535 ? 15.730 49.946 32.567  1.00 52.92  ? 535 GLU A C   1 
ATOM   3942 O O   . GLU A 1 535 ? 16.208 49.820 33.693  1.00 51.94  ? 535 GLU A O   1 
ATOM   3943 C CB  . GLU A 1 535 ? 13.378 49.326 32.090  1.00 56.25  ? 535 GLU A CB  1 
ATOM   3944 C CG  . GLU A 1 535 ? 11.918 49.733 31.875  1.00 62.64  ? 535 GLU A CG  1 
ATOM   3945 C CD  . GLU A 1 535 ? 11.739 50.749 30.748  1.00 65.27  ? 535 GLU A CD  1 
ATOM   3946 O OE1 . GLU A 1 535 ? 12.132 50.447 29.601  1.00 68.39  ? 535 GLU A OE1 1 
ATOM   3947 O OE2 . GLU A 1 535 ? 11.206 51.851 31.008  1.00 65.83  ? 535 GLU A OE2 1 
ATOM   3948 N N   . ASP A 1 536 ? 16.377 49.630 31.452  1.00 51.90  ? 536 ASP A N   1 
ATOM   3949 C CA  . ASP A 1 536 ? 17.712 49.062 31.448  1.00 49.08  ? 536 ASP A CA  1 
ATOM   3950 C C   . ASP A 1 536 ? 18.497 49.621 30.255  1.00 48.09  ? 536 ASP A C   1 
ATOM   3951 O O   . ASP A 1 536 ? 18.533 49.017 29.181  1.00 49.20  ? 536 ASP A O   1 
ATOM   3952 C CB  . ASP A 1 536 ? 17.569 47.541 31.369  1.00 48.56  ? 536 ASP A CB  1 
ATOM   3953 C CG  . ASP A 1 536 ? 18.878 46.838 31.148  1.00 48.99  ? 536 ASP A CG  1 
ATOM   3954 O OD1 . ASP A 1 536 ? 19.894 47.232 31.766  1.00 49.03  ? 536 ASP A OD1 1 
ATOM   3955 O OD2 . ASP A 1 536 ? 18.882 45.873 30.356  1.00 49.73  ? 536 ASP A OD2 1 
ATOM   3956 N N   . PRO A 1 537 ? 19.140 50.786 30.437  1.00 45.62  ? 537 PRO A N   1 
ATOM   3957 C CA  . PRO A 1 537 ? 19.937 51.496 29.432  1.00 45.15  ? 537 PRO A CA  1 
ATOM   3958 C C   . PRO A 1 537 ? 21.263 50.833 29.098  1.00 44.07  ? 537 PRO A C   1 
ATOM   3959 O O   . PRO A 1 537 ? 22.308 51.455 29.256  1.00 44.88  ? 537 PRO A O   1 
ATOM   3960 C CB  . PRO A 1 537 ? 20.178 52.871 30.067  1.00 44.97  ? 537 PRO A CB  1 
ATOM   3961 C CG  . PRO A 1 537 ? 19.262 52.921 31.240  1.00 46.30  ? 537 PRO A CG  1 
ATOM   3962 C CD  . PRO A 1 537 ? 19.197 51.505 31.713  1.00 45.92  ? 537 PRO A CD  1 
ATOM   3963 N N   . VAL A 1 538 ? 21.228 49.587 28.640  1.00 43.24  ? 538 VAL A N   1 
ATOM   3964 C CA  . VAL A 1 538 ? 22.457 48.878 28.298  1.00 42.87  ? 538 VAL A CA  1 
ATOM   3965 C C   . VAL A 1 538 ? 22.943 49.277 26.919  1.00 41.97  ? 538 VAL A C   1 
ATOM   3966 O O   . VAL A 1 538 ? 22.149 49.378 25.978  1.00 43.25  ? 538 VAL A O   1 
ATOM   3967 C CB  . VAL A 1 538 ? 22.266 47.338 28.230  1.00 45.07  ? 538 VAL A CB  1 
ATOM   3968 C CG1 . VAL A 1 538 ? 23.500 46.619 28.797  1.00 42.32  ? 538 VAL A CG1 1 
ATOM   3969 C CG2 . VAL A 1 538 ? 20.998 46.935 28.933  1.00 46.48  ? 538 VAL A CG2 1 
ATOM   3970 N N   . TYR A 1 539 ? 24.248 49.491 26.800  1.00 39.89  ? 539 TYR A N   1 
ATOM   3971 C CA  . TYR A 1 539 ? 24.850 49.813 25.515  1.00 38.22  ? 539 TYR A CA  1 
ATOM   3972 C C   . TYR A 1 539 ? 26.099 48.967 25.319  1.00 37.56  ? 539 TYR A C   1 
ATOM   3973 O O   . TYR A 1 539 ? 26.749 48.564 26.280  1.00 37.74  ? 539 TYR A O   1 
ATOM   3974 C CB  . TYR A 1 539 ? 25.189 51.290 25.435  1.00 37.45  ? 539 TYR A CB  1 
ATOM   3975 C CG  . TYR A 1 539 ? 25.952 51.827 26.615  1.00 37.23  ? 539 TYR A CG  1 
ATOM   3976 C CD1 . TYR A 1 539 ? 25.279 52.324 27.733  1.00 35.89  ? 539 TYR A CD1 1 
ATOM   3977 C CD2 . TYR A 1 539 ? 27.339 51.935 26.578  1.00 34.61  ? 539 TYR A CD2 1 
ATOM   3978 C CE1 . TYR A 1 539 ? 25.968 52.928 28.778  1.00 33.96  ? 539 TYR A CE1 1 
ATOM   3979 C CE2 . TYR A 1 539 ? 28.034 52.538 27.614  1.00 34.94  ? 539 TYR A CE2 1 
ATOM   3980 C CZ  . TYR A 1 539 ? 27.347 53.038 28.708  1.00 34.72  ? 539 TYR A CZ  1 
ATOM   3981 O OH  . TYR A 1 539 ? 28.044 53.666 29.715  1.00 34.75  ? 539 TYR A OH  1 
ATOM   3982 N N   . TYR A 1 540 ? 26.420 48.675 24.071  1.00 36.62  ? 540 TYR A N   1 
ATOM   3983 C CA  . TYR A 1 540 ? 27.591 47.869 23.771  1.00 36.65  ? 540 TYR A CA  1 
ATOM   3984 C C   . TYR A 1 540 ? 28.771 48.801 23.558  1.00 37.56  ? 540 TYR A C   1 
ATOM   3985 O O   . TYR A 1 540 ? 28.662 49.780 22.817  1.00 37.14  ? 540 TYR A O   1 
ATOM   3986 C CB  . TYR A 1 540 ? 27.352 47.060 22.497  1.00 34.98  ? 540 TYR A CB  1 
ATOM   3987 C CG  . TYR A 1 540 ? 28.354 45.967 22.264  1.00 33.33  ? 540 TYR A CG  1 
ATOM   3988 C CD1 . TYR A 1 540 ? 28.192 44.713 22.841  1.00 34.23  ? 540 TYR A CD1 1 
ATOM   3989 C CD2 . TYR A 1 540 ? 29.463 46.181 21.456  1.00 33.69  ? 540 TYR A CD2 1 
ATOM   3990 C CE1 . TYR A 1 540 ? 29.110 43.698 22.612  1.00 35.80  ? 540 TYR A CE1 1 
ATOM   3991 C CE2 . TYR A 1 540 ? 30.384 45.182 21.222  1.00 34.24  ? 540 TYR A CE2 1 
ATOM   3992 C CZ  . TYR A 1 540 ? 30.207 43.943 21.797  1.00 37.09  ? 540 TYR A CZ  1 
ATOM   3993 O OH  . TYR A 1 540 ? 31.126 42.948 21.547  1.00 39.76  ? 540 TYR A OH  1 
ATOM   3994 N N   . ILE A 1 541 ? 29.893 48.525 24.215  1.00 38.87  ? 541 ILE A N   1 
ATOM   3995 C CA  . ILE A 1 541 ? 31.060 49.375 24.017  1.00 41.70  ? 541 ILE A CA  1 
ATOM   3996 C C   . ILE A 1 541 ? 31.871 48.796 22.869  1.00 43.79  ? 541 ILE A C   1 
ATOM   3997 O O   . ILE A 1 541 ? 32.118 47.586 22.815  1.00 45.08  ? 541 ILE A O   1 
ATOM   3998 C CB  . ILE A 1 541 ? 31.985 49.441 25.252  1.00 40.85  ? 541 ILE A CB  1 
ATOM   3999 C CG1 . ILE A 1 541 ? 31.207 49.908 26.492  1.00 37.54  ? 541 ILE A CG1 1 
ATOM   4000 C CG2 . ILE A 1 541 ? 33.166 50.375 24.940  1.00 36.24  ? 541 ILE A CG2 1 
ATOM   4001 C CD1 . ILE A 1 541 ? 30.976 51.383 26.552  1.00 36.47  ? 541 ILE A CD1 1 
ATOM   4002 N N   . PHE A 1 542 ? 32.262 49.658 21.940  1.00 45.23  ? 542 PHE A N   1 
ATOM   4003 C CA  . PHE A 1 542 ? 33.063 49.234 20.804  1.00 46.24  ? 542 PHE A CA  1 
ATOM   4004 C C   . PHE A 1 542 ? 34.468 49.718 21.066  1.00 47.94  ? 542 PHE A C   1 
ATOM   4005 O O   . PHE A 1 542 ? 34.727 50.921 21.104  1.00 47.37  ? 542 PHE A O   1 
ATOM   4006 C CB  . PHE A 1 542 ? 32.508 49.831 19.509  1.00 44.68  ? 542 PHE A CB  1 
ATOM   4007 C CG  . PHE A 1 542 ? 31.465 48.970 18.851  1.00 42.17  ? 542 PHE A CG  1 
ATOM   4008 C CD1 . PHE A 1 542 ? 31.683 47.601 18.689  1.00 39.27  ? 542 PHE A CD1 1 
ATOM   4009 C CD2 . PHE A 1 542 ? 30.277 49.519 18.387  1.00 39.80  ? 542 PHE A CD2 1 
ATOM   4010 C CE1 . PHE A 1 542 ? 30.737 46.796 18.075  1.00 38.11  ? 542 PHE A CE1 1 
ATOM   4011 C CE2 . PHE A 1 542 ? 29.319 48.721 17.770  1.00 39.55  ? 542 PHE A CE2 1 
ATOM   4012 C CZ  . PHE A 1 542 ? 29.546 47.359 17.613  1.00 39.78  ? 542 PHE A CZ  1 
ATOM   4013 N N   . SER A 1 543 ? 35.378 48.777 21.276  1.00 51.89  ? 543 SER A N   1 
ATOM   4014 C CA  . SER A 1 543 ? 36.759 49.135 21.564  1.00 56.72  ? 543 SER A CA  1 
ATOM   4015 C C   . SER A 1 543 ? 37.692 47.970 21.289  1.00 58.74  ? 543 SER A C   1 
ATOM   4016 O O   . SER A 1 543 ? 37.257 46.827 21.200  1.00 58.64  ? 543 SER A O   1 
ATOM   4017 C CB  . SER A 1 543 ? 36.882 49.557 23.033  1.00 57.00  ? 543 SER A CB  1 
ATOM   4018 O OG  . SER A 1 543 ? 38.182 50.024 23.332  1.00 58.63  ? 543 SER A OG  1 
ATOM   4019 N N   . THR A 1 544 ? 38.978 48.264 21.143  1.00 62.44  ? 544 THR A N   1 
ATOM   4020 C CA  . THR A 1 544 ? 39.950 47.209 20.909  1.00 66.06  ? 544 THR A CA  1 
ATOM   4021 C C   . THR A 1 544 ? 40.367 46.647 22.255  1.00 68.42  ? 544 THR A C   1 
ATOM   4022 O O   . THR A 1 544 ? 40.751 45.482 22.359  1.00 69.61  ? 544 THR A O   1 
ATOM   4023 C CB  . THR A 1 544 ? 41.189 47.732 20.196  1.00 65.50  ? 544 THR A CB  1 
ATOM   4024 O OG1 . THR A 1 544 ? 41.708 48.860 20.911  1.00 66.74  ? 544 THR A OG1 1 
ATOM   4025 C CG2 . THR A 1 544 ? 40.847 48.114 18.771  1.00 66.30  ? 544 THR A CG2 1 
ATOM   4026 N N   . ASP A 1 545 ? 40.291 47.485 23.286  1.00 70.91  ? 545 ASP A N   1 
ATOM   4027 C CA  . ASP A 1 545 ? 40.646 47.065 24.630  1.00 71.97  ? 545 ASP A CA  1 
ATOM   4028 C C   . ASP A 1 545 ? 39.681 45.957 25.009  1.00 73.73  ? 545 ASP A C   1 
ATOM   4029 O O   . ASP A 1 545 ? 38.473 46.176 25.108  1.00 74.39  ? 545 ASP A O   1 
ATOM   4030 C CB  . ASP A 1 545 ? 40.502 48.223 25.607  1.00 72.13  ? 545 ASP A CB  1 
ATOM   4031 C CG  . ASP A 1 545 ? 41.182 47.948 26.922  1.00 72.09  ? 545 ASP A CG  1 
ATOM   4032 O OD1 . ASP A 1 545 ? 41.367 46.760 27.245  1.00 71.17  ? 545 ASP A OD1 1 
ATOM   4033 O OD2 . ASP A 1 545 ? 41.524 48.912 27.636  1.00 72.29  ? 545 ASP A OD2 1 
ATOM   4034 N N   . ASP A 1 546 ? 40.215 44.761 25.211  1.00 75.53  ? 546 ASP A N   1 
ATOM   4035 C CA  . ASP A 1 546 ? 39.394 43.612 25.556  1.00 77.06  ? 546 ASP A CA  1 
ATOM   4036 C C   . ASP A 1 546 ? 39.262 43.401 27.060  1.00 76.17  ? 546 ASP A C   1 
ATOM   4037 O O   . ASP A 1 546 ? 38.590 42.475 27.504  1.00 75.63  ? 546 ASP A O   1 
ATOM   4038 C CB  . ASP A 1 546 ? 39.966 42.360 24.885  1.00 79.47  ? 546 ASP A CB  1 
ATOM   4039 C CG  . ASP A 1 546 ? 41.402 42.081 25.290  1.00 81.30  ? 546 ASP A CG  1 
ATOM   4040 O OD1 . ASP A 1 546 ? 42.163 43.046 25.517  1.00 83.19  ? 546 ASP A OD1 1 
ATOM   4041 O OD2 . ASP A 1 546 ? 41.772 40.890 25.363  1.00 81.81  ? 546 ASP A OD2 1 
ATOM   4042 N N   . LYS A 1 547 ? 39.897 44.275 27.834  1.00 75.81  ? 547 LYS A N   1 
ATOM   4043 C CA  . LYS A 1 547 ? 39.855 44.200 29.292  1.00 75.33  ? 547 LYS A CA  1 
ATOM   4044 C C   . LYS A 1 547 ? 38.590 44.836 29.865  1.00 73.72  ? 547 LYS A C   1 
ATOM   4045 O O   . LYS A 1 547 ? 38.205 44.541 30.997  1.00 74.23  ? 547 LYS A O   1 
ATOM   4046 C CB  . LYS A 1 547 ? 41.065 44.911 29.898  1.00 77.61  ? 547 LYS A CB  1 
ATOM   4047 C CG  . LYS A 1 547 ? 42.413 44.381 29.461  1.00 81.13  ? 547 LYS A CG  1 
ATOM   4048 C CD  . LYS A 1 547 ? 43.524 45.301 29.944  1.00 84.35  ? 547 LYS A CD  1 
ATOM   4049 C CE  . LYS A 1 547 ? 44.886 44.800 29.498  1.00 87.12  ? 547 LYS A CE  1 
ATOM   4050 N NZ  . LYS A 1 547 ? 45.985 45.741 29.846  1.00 89.24  ? 547 LYS A NZ  1 
ATOM   4051 N N   . ILE A 1 548 ? 37.952 45.713 29.096  1.00 71.05  ? 548 ILE A N   1 
ATOM   4052 C CA  . ILE A 1 548 ? 36.745 46.380 29.566  1.00 67.90  ? 548 ILE A CA  1 
ATOM   4053 C C   . ILE A 1 548 ? 35.521 45.484 29.457  1.00 66.72  ? 548 ILE A C   1 
ATOM   4054 O O   . ILE A 1 548 ? 35.552 44.438 28.801  1.00 65.59  ? 548 ILE A O   1 
ATOM   4055 C CB  . ILE A 1 548 ? 36.473 47.694 28.790  1.00 67.00  ? 548 ILE A CB  1 
ATOM   4056 C CG1 . ILE A 1 548 ? 36.268 47.405 27.305  1.00 66.69  ? 548 ILE A CG1 1 
ATOM   4057 C CG2 . ILE A 1 548 ? 37.622 48.656 28.980  1.00 66.32  ? 548 ILE A CG2 1 
ATOM   4058 C CD1 . ILE A 1 548 ? 34.852 47.648 26.825  1.00 64.54  ? 548 ILE A CD1 1 
ATOM   4059 N N   . GLU A 1 549 ? 34.447 45.899 30.121  1.00 64.50  ? 549 GLU A N   1 
ATOM   4060 C CA  . GLU A 1 549 ? 33.196 45.156 30.109  1.00 63.46  ? 549 GLU A CA  1 
ATOM   4061 C C   . GLU A 1 549 ? 32.448 45.572 28.845  1.00 62.52  ? 549 GLU A C   1 
ATOM   4062 O O   . GLU A 1 549 ? 31.984 46.706 28.737  1.00 60.78  ? 549 GLU A O   1 
ATOM   4063 C CB  . GLU A 1 549 ? 32.384 45.502 31.361  1.00 63.83  ? 549 GLU A CB  1 
ATOM   4064 C CG  . GLU A 1 549 ? 31.180 44.618 31.609  1.00 62.47  ? 549 GLU A CG  1 
ATOM   4065 C CD  . GLU A 1 549 ? 31.562 43.171 31.801  1.00 61.30  ? 549 GLU A CD  1 
ATOM   4066 O OE1 . GLU A 1 549 ? 32.376 42.877 32.694  1.00 60.58  ? 549 GLU A OE1 1 
ATOM   4067 O OE2 . GLU A 1 549 ? 31.046 42.323 31.056  1.00 62.66  ? 549 GLU A OE2 1 
ATOM   4068 N N   . LYS A 1 550 ? 32.346 44.654 27.886  1.00 62.62  ? 550 LYS A N   1 
ATOM   4069 C CA  . LYS A 1 550 ? 31.681 44.942 26.615  1.00 62.54  ? 550 LYS A CA  1 
ATOM   4070 C C   . LYS A 1 550 ? 30.479 45.863 26.777  1.00 60.58  ? 550 LYS A C   1 
ATOM   4071 O O   . LYS A 1 550 ? 30.384 46.894 26.106  1.00 60.60  ? 550 LYS A O   1 
ATOM   4072 C CB  . LYS A 1 550 ? 31.221 43.651 25.923  1.00 65.14  ? 550 LYS A CB  1 
ATOM   4073 C CG  . LYS A 1 550 ? 32.332 42.692 25.535  1.00 68.29  ? 550 LYS A CG  1 
ATOM   4074 C CD  . LYS A 1 550 ? 33.224 43.240 24.443  1.00 68.38  ? 550 LYS A CD  1 
ATOM   4075 C CE  . LYS A 1 550 ? 34.285 42.212 24.090  1.00 70.01  ? 550 LYS A CE  1 
ATOM   4076 N NZ  . LYS A 1 550 ? 35.212 42.685 23.027  1.00 73.01  ? 550 LYS A NZ  1 
ATOM   4077 N N   . LEU A 1 551 ? 29.557 45.504 27.663  1.00 56.38  ? 551 LEU A N   1 
ATOM   4078 C CA  . LEU A 1 551 ? 28.387 46.340 27.829  1.00 53.18  ? 551 LEU A CA  1 
ATOM   4079 C C   . LEU A 1 551 ? 28.191 46.914 29.211  1.00 51.38  ? 551 LEU A C   1 
ATOM   4080 O O   . LEU A 1 551 ? 28.429 46.254 30.215  1.00 52.43  ? 551 LEU A O   1 
ATOM   4081 C CB  . LEU A 1 551 ? 27.139 45.588 27.367  1.00 52.07  ? 551 LEU A CB  1 
ATOM   4082 C CG  . LEU A 1 551 ? 26.963 44.128 27.745  1.00 48.74  ? 551 LEU A CG  1 
ATOM   4083 C CD1 . LEU A 1 551 ? 26.084 44.026 28.957  1.00 49.73  ? 551 LEU A CD1 1 
ATOM   4084 C CD2 . LEU A 1 551 ? 26.317 43.405 26.596  1.00 47.32  ? 551 LEU A CD2 1 
ATOM   4085 N N   . ALA A 1 552 ? 27.767 48.171 29.237  1.00 48.90  ? 552 ALA A N   1 
ATOM   4086 C CA  . ALA A 1 552 ? 27.536 48.888 30.471  1.00 47.85  ? 552 ALA A CA  1 
ATOM   4087 C C   . ALA A 1 552 ? 26.301 49.742 30.327  1.00 48.70  ? 552 ALA A C   1 
ATOM   4088 O O   . ALA A 1 552 ? 25.766 49.886 29.230  1.00 49.79  ? 552 ALA A O   1 
ATOM   4089 C CB  . ALA A 1 552 ? 28.715 49.759 30.782  1.00 48.21  ? 552 ALA A CB  1 
ATOM   4090 N N   . ARG A 1 553 ? 25.852 50.313 31.439  1.00 49.50  ? 553 ARG A N   1 
ATOM   4091 C CA  . ARG A 1 553 ? 24.681 51.173 31.428  1.00 49.05  ? 553 ARG A CA  1 
ATOM   4092 C C   . ARG A 1 553 ? 24.801 52.298 32.434  1.00 48.91  ? 553 ARG A C   1 
ATOM   4093 O O   . ARG A 1 553 ? 23.904 53.122 32.549  1.00 51.35  ? 553 ARG A O   1 
ATOM   4094 C CB  . ARG A 1 553 ? 23.423 50.350 31.700  1.00 49.06  ? 553 ARG A CB  1 
ATOM   4095 C CG  . ARG A 1 553 ? 23.596 49.266 32.725  1.00 49.29  ? 553 ARG A CG  1 
ATOM   4096 C CD  . ARG A 1 553 ? 22.866 47.996 32.308  1.00 51.22  ? 553 ARG A CD  1 
ATOM   4097 N NE  . ARG A 1 553 ? 23.787 46.859 32.288  1.00 55.85  ? 553 ARG A NE  1 
ATOM   4098 C CZ  . ARG A 1 553 ? 23.453 45.614 31.957  1.00 56.85  ? 553 ARG A CZ  1 
ATOM   4099 N NH1 . ARG A 1 553 ? 22.208 45.330 31.604  1.00 57.21  ? 553 ARG A NH1 1 
ATOM   4100 N NH2 . ARG A 1 553 ? 24.370 44.652 31.976  1.00 56.46  ? 553 ARG A NH2 1 
ATOM   4101 N N   . GLY A 1 554 ? 25.931 52.354 33.129  1.00 47.91  ? 554 GLY A N   1 
ATOM   4102 C CA  . GLY A 1 554 ? 26.122 53.377 34.140  1.00 47.81  ? 554 GLY A CA  1 
ATOM   4103 C C   . GLY A 1 554 ? 26.605 54.749 33.715  1.00 47.23  ? 554 GLY A C   1 
ATOM   4104 O O   . GLY A 1 554 ? 25.930 55.741 33.966  1.00 47.55  ? 554 GLY A O   1 
ATOM   4105 N N   . PRO A 1 555 ? 27.783 54.846 33.092  1.00 48.36  ? 555 PRO A N   1 
ATOM   4106 C CA  . PRO A 1 555 ? 28.325 56.135 32.654  1.00 49.07  ? 555 PRO A CA  1 
ATOM   4107 C C   . PRO A 1 555 ? 27.429 57.023 31.782  1.00 49.12  ? 555 PRO A C   1 
ATOM   4108 O O   . PRO A 1 555 ? 27.301 58.221 32.052  1.00 50.02  ? 555 PRO A O   1 
ATOM   4109 C CB  . PRO A 1 555 ? 29.625 55.733 31.966  1.00 49.39  ? 555 PRO A CB  1 
ATOM   4110 C CG  . PRO A 1 555 ? 30.086 54.610 32.838  1.00 48.16  ? 555 PRO A CG  1 
ATOM   4111 C CD  . PRO A 1 555 ? 28.813 53.796 32.993  1.00 48.58  ? 555 PRO A CD  1 
ATOM   4112 N N   . LEU A 1 556 ? 26.824 56.467 30.738  1.00 47.19  ? 556 LEU A N   1 
ATOM   4113 C CA  . LEU A 1 556 ? 25.959 57.286 29.904  1.00 47.43  ? 556 LEU A CA  1 
ATOM   4114 C C   . LEU A 1 556 ? 24.744 57.757 30.696  1.00 47.53  ? 556 LEU A C   1 
ATOM   4115 O O   . LEU A 1 556 ? 24.324 58.909 30.587  1.00 46.67  ? 556 LEU A O   1 
ATOM   4116 C CB  . LEU A 1 556 ? 25.506 56.513 28.670  1.00 47.58  ? 556 LEU A CB  1 
ATOM   4117 C CG  . LEU A 1 556 ? 26.558 56.382 27.572  1.00 50.19  ? 556 LEU A CG  1 
ATOM   4118 C CD1 . LEU A 1 556 ? 25.903 55.793 26.339  1.00 52.29  ? 556 LEU A CD1 1 
ATOM   4119 C CD2 . LEU A 1 556 ? 27.160 57.747 27.244  1.00 49.63  ? 556 LEU A CD2 1 
ATOM   4120 N N   . ALA A 1 557 ? 24.186 56.858 31.497  1.00 48.23  ? 557 ALA A N   1 
ATOM   4121 C CA  . ALA A 1 557 ? 23.034 57.187 32.319  1.00 48.52  ? 557 ALA A CA  1 
ATOM   4122 C C   . ALA A 1 557 ? 23.375 58.392 33.184  1.00 48.22  ? 557 ALA A C   1 
ATOM   4123 O O   . ALA A 1 557 ? 22.631 59.371 33.239  1.00 48.13  ? 557 ALA A O   1 
ATOM   4124 C CB  . ALA A 1 557 ? 22.667 55.999 33.202  1.00 46.96  ? 557 ALA A CB  1 
ATOM   4125 N N   . ALA A 1 558 ? 24.519 58.316 33.847  1.00 47.85  ? 558 ALA A N   1 
ATOM   4126 C CA  . ALA A 1 558 ? 24.956 59.390 34.724  1.00 48.40  ? 558 ALA A CA  1 
ATOM   4127 C C   . ALA A 1 558 ? 25.160 60.724 34.017  1.00 47.39  ? 558 ALA A C   1 
ATOM   4128 O O   . ALA A 1 558 ? 24.749 61.769 34.528  1.00 49.19  ? 558 ALA A O   1 
ATOM   4129 C CB  . ALA A 1 558 ? 26.231 58.978 35.438  1.00 51.02  ? 558 ALA A CB  1 
ATOM   4130 N N   . ARG A 1 559 ? 25.806 60.694 32.857  1.00 45.62  ? 559 ARG A N   1 
ATOM   4131 C CA  . ARG A 1 559 ? 26.061 61.914 32.094  1.00 44.36  ? 559 ARG A CA  1 
ATOM   4132 C C   . ARG A 1 559 ? 24.782 62.639 31.714  1.00 41.60  ? 559 ARG A C   1 
ATOM   4133 O O   . ARG A 1 559 ? 24.588 63.820 32.011  1.00 38.25  ? 559 ARG A O   1 
ATOM   4134 C CB  . ARG A 1 559 ? 26.784 61.588 30.796  1.00 47.39  ? 559 ARG A CB  1 
ATOM   4135 C CG  . ARG A 1 559 ? 28.247 61.329 30.907  1.00 52.22  ? 559 ARG A CG  1 
ATOM   4136 C CD  . ARG A 1 559 ? 28.813 61.351 29.519  1.00 57.05  ? 559 ARG A CD  1 
ATOM   4137 N NE  . ARG A 1 559 ? 30.239 61.082 29.488  1.00 61.34  ? 559 ARG A NE  1 
ATOM   4138 C CZ  . ARG A 1 559 ? 30.943 61.020 28.368  1.00 62.36  ? 559 ARG A CZ  1 
ATOM   4139 N NH1 . ARG A 1 559 ? 30.339 61.214 27.204  1.00 63.86  ? 559 ARG A NH1 1 
ATOM   4140 N NH2 . ARG A 1 559 ? 32.240 60.755 28.412  1.00 64.47  ? 559 ARG A NH2 1 
ATOM   4141 N N   . CYS A 1 560 ? 23.923 61.896 31.032  1.00 40.27  ? 560 CYS A N   1 
ATOM   4142 C CA  . CYS A 1 560 ? 22.663 62.395 30.532  1.00 38.84  ? 560 CYS A CA  1 
ATOM   4143 C C   . CYS A 1 560 ? 21.567 62.619 31.547  1.00 39.12  ? 560 CYS A C   1 
ATOM   4144 O O   . CYS A 1 560 ? 20.590 63.307 31.253  1.00 40.04  ? 560 CYS A O   1 
ATOM   4145 C CB  . CYS A 1 560 ? 22.183 61.464 29.441  1.00 38.14  ? 560 CYS A CB  1 
ATOM   4146 S SG  . CYS A 1 560 ? 23.387 61.449 28.095  1.00 38.90  ? 560 CYS A SG  1 
ATOM   4147 N N   . SER A 1 561 ? 21.714 62.031 32.729  1.00 38.96  ? 561 SER A N   1 
ATOM   4148 C CA  . SER A 1 561 ? 20.729 62.225 33.781  1.00 38.26  ? 561 SER A CA  1 
ATOM   4149 C C   . SER A 1 561 ? 20.635 63.722 33.988  1.00 37.00  ? 561 SER A C   1 
ATOM   4150 O O   . SER A 1 561 ? 19.551 64.266 34.177  1.00 36.38  ? 561 SER A O   1 
ATOM   4151 C CB  . SER A 1 561 ? 21.189 61.574 35.077  1.00 39.56  ? 561 SER A CB  1 
ATOM   4152 O OG  . SER A 1 561 ? 20.301 61.915 36.127  1.00 44.39  ? 561 SER A OG  1 
ATOM   4153 N N   . PHE A 1 562 ? 21.796 64.374 33.945  1.00 36.47  ? 562 PHE A N   1 
ATOM   4154 C CA  . PHE A 1 562 ? 21.905 65.811 34.109  1.00 36.55  ? 562 PHE A CA  1 
ATOM   4155 C C   . PHE A 1 562 ? 21.112 66.530 33.042  1.00 38.92  ? 562 PHE A C   1 
ATOM   4156 O O   . PHE A 1 562 ? 20.244 67.341 33.352  1.00 40.57  ? 562 PHE A O   1 
ATOM   4157 C CB  . PHE A 1 562 ? 23.361 66.254 34.001  1.00 37.17  ? 562 PHE A CB  1 
ATOM   4158 C CG  . PHE A 1 562 ? 23.544 67.752 33.989  1.00 38.87  ? 562 PHE A CG  1 
ATOM   4159 C CD1 . PHE A 1 562 ? 23.367 68.500 35.143  1.00 39.59  ? 562 PHE A CD1 1 
ATOM   4160 C CD2 . PHE A 1 562 ? 23.884 68.417 32.815  1.00 40.66  ? 562 PHE A CD2 1 
ATOM   4161 C CE1 . PHE A 1 562 ? 23.527 69.891 35.129  1.00 40.04  ? 562 PHE A CE1 1 
ATOM   4162 C CE2 . PHE A 1 562 ? 24.045 69.808 32.790  1.00 40.93  ? 562 PHE A CE2 1 
ATOM   4163 C CZ  . PHE A 1 562 ? 23.866 70.545 33.948  1.00 40.16  ? 562 PHE A CZ  1 
ATOM   4164 N N   . TRP A 1 563 ? 21.407 66.225 31.781  1.00 40.01  ? 563 TRP A N   1 
ATOM   4165 C CA  . TRP A 1 563 ? 20.740 66.888 30.667  1.00 40.21  ? 563 TRP A CA  1 
ATOM   4166 C C   . TRP A 1 563 ? 19.284 66.562 30.413  1.00 41.30  ? 563 TRP A C   1 
ATOM   4167 O O   . TRP A 1 563 ? 18.510 67.452 30.066  1.00 43.29  ? 563 TRP A O   1 
ATOM   4168 C CB  . TRP A 1 563 ? 21.499 66.647 29.368  1.00 37.61  ? 563 TRP A CB  1 
ATOM   4169 C CG  . TRP A 1 563 ? 22.872 67.201 29.352  1.00 36.25  ? 563 TRP A CG  1 
ATOM   4170 C CD1 . TRP A 1 563 ? 24.024 66.521 29.591  1.00 37.05  ? 563 TRP A CD1 1 
ATOM   4171 C CD2 . TRP A 1 563 ? 23.253 68.554 29.070  1.00 36.27  ? 563 TRP A CD2 1 
ATOM   4172 N NE1 . TRP A 1 563 ? 25.106 67.362 29.474  1.00 37.77  ? 563 TRP A NE1 1 
ATOM   4173 C CE2 . TRP A 1 563 ? 24.660 68.618 29.155  1.00 36.30  ? 563 TRP A CE2 1 
ATOM   4174 C CE3 . TRP A 1 563 ? 22.541 69.721 28.757  1.00 36.91  ? 563 TRP A CE3 1 
ATOM   4175 C CZ2 . TRP A 1 563 ? 25.375 69.800 28.938  1.00 34.59  ? 563 TRP A CZ2 1 
ATOM   4176 C CZ3 . TRP A 1 563 ? 23.251 70.901 28.540  1.00 35.49  ? 563 TRP A CZ3 1 
ATOM   4177 C CH2 . TRP A 1 563 ? 24.656 70.927 28.632  1.00 35.12  ? 563 TRP A CH2 1 
ATOM   4178 N N   . ASN A 1 564 ? 18.905 65.299 30.560  1.00 42.72  ? 564 ASN A N   1 
ATOM   4179 C CA  . ASN A 1 564 ? 17.528 64.907 30.285  1.00 45.56  ? 564 ASN A CA  1 
ATOM   4180 C C   . ASN A 1 564 ? 16.611 64.784 31.496  1.00 46.80  ? 564 ASN A C   1 
ATOM   4181 O O   . ASN A 1 564 ? 15.436 64.457 31.338  1.00 48.38  ? 564 ASN A O   1 
ATOM   4182 C CB  . ASN A 1 564 ? 17.496 63.580 29.519  1.00 45.80  ? 564 ASN A CB  1 
ATOM   4183 C CG  . ASN A 1 564 ? 18.455 63.555 28.352  1.00 44.70  ? 564 ASN A CG  1 
ATOM   4184 O OD1 . ASN A 1 564 ? 18.499 64.486 27.545  1.00 47.56  ? 564 ASN A OD1 1 
ATOM   4185 N ND2 . ASN A 1 564 ? 19.219 62.477 28.244  1.00 42.37  ? 564 ASN A ND2 1 
ATOM   4186 N N   . ASP A 1 565 ? 17.125 65.035 32.695  1.00 47.60  ? 565 ASP A N   1 
ATOM   4187 C CA  . ASP A 1 565 ? 16.289 64.926 33.888  1.00 50.35  ? 565 ASP A CA  1 
ATOM   4188 C C   . ASP A 1 565 ? 16.368 66.136 34.811  1.00 49.88  ? 565 ASP A C   1 
ATOM   4189 O O   . ASP A 1 565 ? 15.366 66.788 35.109  1.00 50.16  ? 565 ASP A O   1 
ATOM   4190 C CB  . ASP A 1 565 ? 16.662 63.675 34.688  1.00 53.67  ? 565 ASP A CB  1 
ATOM   4191 C CG  . ASP A 1 565 ? 16.564 62.407 33.866  1.00 57.18  ? 565 ASP A CG  1 
ATOM   4192 O OD1 . ASP A 1 565 ? 15.528 62.218 33.195  1.00 58.81  ? 565 ASP A OD1 1 
ATOM   4193 O OD2 . ASP A 1 565 ? 17.517 61.598 33.895  1.00 60.12  ? 565 ASP A OD2 1 
ATOM   4194 N N   . TYR A 1 566 ? 17.574 66.432 35.264  1.00 49.53  ? 566 TYR A N   1 
ATOM   4195 C CA  . TYR A 1 566 ? 17.789 67.533 36.174  1.00 48.36  ? 566 TYR A CA  1 
ATOM   4196 C C   . TYR A 1 566 ? 17.672 68.920 35.540  1.00 48.74  ? 566 TYR A C   1 
ATOM   4197 O O   . TYR A 1 566 ? 16.871 69.737 35.985  1.00 48.26  ? 566 TYR A O   1 
ATOM   4198 C CB  . TYR A 1 566 ? 19.154 67.363 36.837  1.00 44.46  ? 566 TYR A CB  1 
ATOM   4199 C CG  . TYR A 1 566 ? 19.542 68.499 37.739  1.00 42.88  ? 566 TYR A CG  1 
ATOM   4200 C CD1 . TYR A 1 566 ? 18.838 68.761 38.910  1.00 40.38  ? 566 TYR A CD1 1 
ATOM   4201 C CD2 . TYR A 1 566 ? 20.615 69.328 37.410  1.00 42.13  ? 566 TYR A CD2 1 
ATOM   4202 C CE1 . TYR A 1 566 ? 19.197 69.831 39.738  1.00 41.53  ? 566 TYR A CE1 1 
ATOM   4203 C CE2 . TYR A 1 566 ? 20.981 70.395 38.224  1.00 41.84  ? 566 TYR A CE2 1 
ATOM   4204 C CZ  . TYR A 1 566 ? 20.272 70.646 39.385  1.00 41.50  ? 566 TYR A CZ  1 
ATOM   4205 O OH  . TYR A 1 566 ? 20.640 71.722 40.168  1.00 40.11  ? 566 TYR A OH  1 
ATOM   4206 N N   . LEU A 1 567 ? 18.460 69.179 34.500  1.00 50.31  ? 567 LEU A N   1 
ATOM   4207 C CA  . LEU A 1 567 ? 18.475 70.489 33.844  1.00 50.67  ? 567 LEU A CA  1 
ATOM   4208 C C   . LEU A 1 567 ? 17.094 71.026 33.464  1.00 52.01  ? 567 LEU A C   1 
ATOM   4209 O O   . LEU A 1 567 ? 16.849 72.234 33.542  1.00 51.12  ? 567 LEU A O   1 
ATOM   4210 C CB  . LEU A 1 567 ? 19.398 70.460 32.621  1.00 49.40  ? 567 LEU A CB  1 
ATOM   4211 C CG  . LEU A 1 567 ? 20.077 71.804 32.357  1.00 49.79  ? 567 LEU A CG  1 
ATOM   4212 C CD1 . LEU A 1 567 ? 20.771 72.282 33.624  1.00 48.96  ? 567 LEU A CD1 1 
ATOM   4213 C CD2 . LEU A 1 567 ? 21.077 71.671 31.227  1.00 50.90  ? 567 LEU A CD2 1 
ATOM   4214 N N   . PRO A 1 568 ? 16.180 70.144 33.024  1.00 52.19  ? 568 PRO A N   1 
ATOM   4215 C CA  . PRO A 1 568 ? 14.830 70.587 32.656  1.00 53.21  ? 568 PRO A CA  1 
ATOM   4216 C C   . PRO A 1 568 ? 14.104 71.207 33.857  1.00 54.66  ? 568 PRO A C   1 
ATOM   4217 O O   . PRO A 1 568 ? 13.251 72.079 33.698  1.00 56.06  ? 568 PRO A O   1 
ATOM   4218 C CB  . PRO A 1 568 ? 14.171 69.299 32.185  1.00 50.85  ? 568 PRO A CB  1 
ATOM   4219 C CG  . PRO A 1 568 ? 15.292 68.624 31.511  1.00 51.71  ? 568 PRO A CG  1 
ATOM   4220 C CD  . PRO A 1 568 ? 16.434 68.796 32.495  1.00 50.57  ? 568 PRO A CD  1 
ATOM   4221 N N   . LYS A 1 569 ? 14.454 70.742 35.053  1.00 55.40  ? 569 LYS A N   1 
ATOM   4222 C CA  . LYS A 1 569 ? 13.869 71.237 36.288  1.00 56.53  ? 569 LYS A CA  1 
ATOM   4223 C C   . LYS A 1 569 ? 14.485 72.593 36.618  1.00 58.86  ? 569 LYS A C   1 
ATOM   4224 O O   . LYS A 1 569 ? 13.790 73.523 37.030  1.00 60.16  ? 569 LYS A O   1 
ATOM   4225 C CB  . LYS A 1 569 ? 14.143 70.248 37.421  1.00 56.77  ? 569 LYS A CB  1 
ATOM   4226 C CG  . LYS A 1 569 ? 13.596 68.864 37.162  1.00 56.68  ? 569 LYS A CG  1 
ATOM   4227 C CD  . LYS A 1 569 ? 13.977 67.896 38.263  1.00 58.14  ? 569 LYS A CD  1 
ATOM   4228 C CE  . LYS A 1 569 ? 13.314 66.541 38.028  1.00 59.97  ? 569 LYS A CE  1 
ATOM   4229 N NZ  . LYS A 1 569 ? 13.643 65.536 39.076  1.00 58.65  ? 569 LYS A NZ  1 
ATOM   4230 N N   . VAL A 1 570 ? 15.798 72.697 36.453  1.00 60.05  ? 570 VAL A N   1 
ATOM   4231 C CA  . VAL A 1 570 ? 16.489 73.948 36.711  1.00 61.34  ? 570 VAL A CA  1 
ATOM   4232 C C   . VAL A 1 570 ? 15.833 74.970 35.818  1.00 65.18  ? 570 VAL A C   1 
ATOM   4233 O O   . VAL A 1 570 ? 15.553 76.095 36.225  1.00 66.01  ? 570 VAL A O   1 
ATOM   4234 C CB  . VAL A 1 570 ? 17.958 73.850 36.318  1.00 59.39  ? 570 VAL A CB  1 
ATOM   4235 C CG1 . VAL A 1 570 ? 18.596 75.225 36.322  1.00 57.47  ? 570 VAL A CG1 1 
ATOM   4236 C CG2 . VAL A 1 570 ? 18.668 72.928 37.271  1.00 60.20  ? 570 VAL A CG2 1 
ATOM   4237 N N   . ARG A 1 571 ? 15.591 74.534 34.587  1.00 69.54  ? 571 ARG A N   1 
ATOM   4238 C CA  . ARG A 1 571 ? 14.974 75.326 33.532  1.00 71.99  ? 571 ARG A CA  1 
ATOM   4239 C C   . ARG A 1 571 ? 13.724 76.030 34.042  1.00 74.29  ? 571 ARG A C   1 
ATOM   4240 O O   . ARG A 1 571 ? 13.414 77.137 33.610  1.00 74.93  ? 571 ARG A O   1 
ATOM   4241 C CB  . ARG A 1 571 ? 14.635 74.395 32.366  1.00 71.52  ? 571 ARG A CB  1 
ATOM   4242 C CG  . ARG A 1 571 ? 14.537 75.043 31.008  1.00 72.15  ? 571 ARG A CG  1 
ATOM   4243 C CD  . ARG A 1 571 ? 14.700 73.970 29.946  1.00 72.36  ? 571 ARG A CD  1 
ATOM   4244 N NE  . ARG A 1 571 ? 16.053 73.410 29.953  1.00 73.21  ? 571 ARG A NE  1 
ATOM   4245 C CZ  . ARG A 1 571 ? 16.396 72.257 29.382  1.00 74.28  ? 571 ARG A CZ  1 
ATOM   4246 N NH1 . ARG A 1 571 ? 15.483 71.523 28.758  1.00 74.62  ? 571 ARG A NH1 1 
ATOM   4247 N NH2 . ARG A 1 571 ? 17.657 71.843 29.414  1.00 74.10  ? 571 ARG A NH2 1 
ATOM   4248 N N   . SER A 1 572 ? 13.019 75.384 34.969  1.00 77.00  ? 572 SER A N   1 
ATOM   4249 C CA  . SER A 1 572 ? 11.804 75.949 35.551  1.00 79.81  ? 572 SER A CA  1 
ATOM   4250 C C   . SER A 1 572 ? 12.091 77.261 36.273  1.00 81.80  ? 572 SER A C   1 
ATOM   4251 O O   . SER A 1 572 ? 12.559 77.261 37.415  1.00 82.32  ? 572 SER A O   1 
ATOM   4252 C CB  . SER A 1 572 ? 11.170 74.955 36.526  1.00 79.74  ? 572 SER A CB  1 
ATOM   4253 O OG  . SER A 1 572 ? 10.778 73.772 35.848  1.00 78.96  ? 572 SER A OG  1 
ATOM   4254 N N   . TRP A 1 573 ? 11.801 78.366 35.582  1.00 83.52  ? 573 TRP A N   1 
ATOM   4255 C CA  . TRP A 1 573 ? 11.994 79.732 36.074  1.00 84.82  ? 573 TRP A CA  1 
ATOM   4256 C C   . TRP A 1 573 ? 12.441 79.812 37.530  1.00 85.92  ? 573 TRP A C   1 
ATOM   4257 O O   . TRP A 1 573 ? 11.647 80.345 38.333  1.00 87.15  ? 573 TRP A O   1 
ATOM   4258 C CB  . TRP A 1 573 ? 10.704 80.538 35.877  1.00 84.67  ? 573 TRP A CB  1 
HETATM 4259 C C1  . NAG B 2 .   ? 41.349 50.596 0.102   1.00 65.16  ? 1   NAG B C1  1 
HETATM 4260 C C2  . NAG B 2 .   ? 40.255 51.169 -0.782  1.00 66.47  ? 1   NAG B C2  1 
HETATM 4261 C C3  . NAG B 2 .   ? 40.862 51.389 -2.169  1.00 67.40  ? 1   NAG B C3  1 
HETATM 4262 C C4  . NAG B 2 .   ? 42.005 52.399 -2.018  1.00 70.41  ? 1   NAG B C4  1 
HETATM 4263 C C5  . NAG B 2 .   ? 43.021 51.891 -0.991  1.00 70.35  ? 1   NAG B C5  1 
HETATM 4264 C C6  . NAG B 2 .   ? 44.091 52.912 -0.687  1.00 71.43  ? 1   NAG B C6  1 
HETATM 4265 C C7  . NAG B 2 .   ? 39.219 49.005 -1.046  1.00 65.41  ? 1   NAG B C7  1 
HETATM 4266 C C8  . NAG B 2 .   ? 37.930 48.197 -1.060  1.00 64.04  ? 1   NAG B C8  1 
HETATM 4267 N N2  . NAG B 2 .   ? 39.092 50.305 -0.821  1.00 66.30  ? 1   NAG B N2  1 
HETATM 4268 O O3  . NAG B 2 .   ? 39.879 51.884 -3.065  1.00 64.68  ? 1   NAG B O3  1 
HETATM 4269 O O4  . NAG B 2 .   ? 42.663 52.617 -3.281  1.00 75.67  ? 1   NAG B O4  1 
HETATM 4270 O O5  . NAG B 2 .   ? 42.366 51.581 0.260   1.00 67.26  ? 1   NAG B O5  1 
HETATM 4271 O O6  . NAG B 2 .   ? 44.557 52.779 0.646   1.00 74.50  ? 1   NAG B O6  1 
HETATM 4272 O O7  . NAG B 2 .   ? 40.308 48.455 -1.241  1.00 65.37  ? 1   NAG B O7  1 
HETATM 4273 C C1  . NAG B 2 .   ? 42.186 53.684 -4.020  1.00 80.88  ? 2   NAG B C1  1 
HETATM 4274 C C2  . NAG B 2 .   ? 43.343 54.499 -4.593  1.00 82.72  ? 2   NAG B C2  1 
HETATM 4275 C C3  . NAG B 2 .   ? 42.788 55.631 -5.447  1.00 84.95  ? 2   NAG B C3  1 
HETATM 4276 C C4  . NAG B 2 .   ? 41.818 55.111 -6.514  1.00 87.08  ? 2   NAG B C4  1 
HETATM 4277 C C5  . NAG B 2 .   ? 40.760 54.192 -5.861  1.00 85.64  ? 2   NAG B C5  1 
HETATM 4278 C C6  . NAG B 2 .   ? 39.853 53.493 -6.860  1.00 86.27  ? 2   NAG B C6  1 
HETATM 4279 C C7  . NAG B 2 .   ? 45.295 54.507 -3.186  1.00 83.28  ? 2   NAG B C7  1 
HETATM 4280 C C8  . NAG B 2 .   ? 46.080 55.175 -2.070  1.00 84.44  ? 2   NAG B C8  1 
HETATM 4281 N N2  . NAG B 2 .   ? 44.140 55.068 -3.526  1.00 82.95  ? 2   NAG B N2  1 
HETATM 4282 O O3  . NAG B 2 .   ? 43.856 56.329 -6.070  1.00 84.91  ? 2   NAG B O3  1 
HETATM 4283 O O4  . NAG B 2 .   ? 41.170 56.250 -7.130  1.00 91.21  ? 2   NAG B O4  1 
HETATM 4284 O O5  . NAG B 2 .   ? 41.398 53.157 -5.088  1.00 82.96  ? 2   NAG B O5  1 
HETATM 4285 O O6  . NAG B 2 .   ? 40.263 52.150 -7.081  1.00 86.98  ? 2   NAG B O6  1 
HETATM 4286 O O7  . NAG B 2 .   ? 45.729 53.486 -3.718  1.00 83.35  ? 2   NAG B O7  1 
HETATM 4287 C C1  . BMA B 2 .   ? 41.368 56.505 -8.485  1.00 94.05  ? 3   BMA B C1  1 
HETATM 4288 C C2  . BMA B 2 .   ? 40.507 55.593 -9.331  1.00 95.90  ? 3   BMA B C2  1 
HETATM 4289 C C3  . BMA B 2 .   ? 40.463 56.177 -10.738 1.00 96.75  ? 3   BMA B C3  1 
HETATM 4290 C C4  . BMA B 2 .   ? 41.817 56.819 -11.115 1.00 97.55  ? 3   BMA B C4  1 
HETATM 4291 C C5  . BMA B 2 .   ? 43.050 56.420 -10.246 1.00 96.75  ? 3   BMA B C5  1 
HETATM 4292 C C6  . BMA B 2 .   ? 44.172 57.454 -10.381 1.00 96.64  ? 3   BMA B C6  1 
HETATM 4293 O O2  . BMA B 2 .   ? 39.198 55.544 -8.779  1.00 98.07  ? 3   BMA B O2  1 
HETATM 4294 O O3  . BMA B 2 .   ? 39.478 57.231 -10.776 1.00 95.52  ? 3   BMA B O3  1 
HETATM 4295 O O4  . BMA B 2 .   ? 42.101 56.545 -12.478 1.00 99.40  ? 3   BMA B O4  1 
HETATM 4296 O O5  . BMA B 2 .   ? 42.751 56.323 -8.819  1.00 95.26  ? 3   BMA B O5  1 
HETATM 4297 O O6  . BMA B 2 .   ? 43.812 58.669 -9.683  1.00 96.54  ? 3   BMA B O6  1 
HETATM 4298 C C1  . BMA B 2 .   ? 38.121 57.038 -11.080 0.50 94.56  ? 4   BMA B C1  1 
HETATM 4299 C C2  . BMA B 2 .   ? 37.707 55.596 -11.445 0.50 93.90  ? 4   BMA B C2  1 
HETATM 4300 C C3  . BMA B 2 .   ? 36.173 55.525 -11.363 0.50 94.08  ? 4   BMA B C3  1 
HETATM 4301 C C4  . BMA B 2 .   ? 35.570 56.941 -11.323 0.50 94.22  ? 4   BMA B C4  1 
HETATM 4302 C C5  . BMA B 2 .   ? 36.248 57.830 -12.371 0.50 94.26  ? 4   BMA B C5  1 
HETATM 4303 C C6  . BMA B 2 .   ? 35.684 59.234 -12.419 0.50 94.17  ? 4   BMA B C6  1 
HETATM 4304 O O2  . BMA B 2 .   ? 38.273 54.650 -10.556 0.50 93.31  ? 4   BMA B O2  1 
HETATM 4305 O O3  . BMA B 2 .   ? 35.794 54.822 -10.188 0.50 93.69  ? 4   BMA B O3  1 
HETATM 4306 O O4  . BMA B 2 .   ? 34.178 56.892 -11.554 0.50 94.60  ? 4   BMA B O4  1 
HETATM 4307 O O5  . BMA B 2 .   ? 37.656 57.944 -12.076 0.50 94.17  ? 4   BMA B O5  1 
HETATM 4308 O O6  . BMA B 2 .   ? 34.624 59.327 -13.360 0.50 94.13  ? 4   BMA B O6  1 
HETATM 4309 C C1  . BMA B 2 .   ? 44.551 59.785 -10.096 0.50 95.61  ? 5   BMA B C1  1 
HETATM 4310 C C2  . BMA B 2 .   ? 45.447 60.259 -8.941  0.50 95.25  ? 5   BMA B C2  1 
HETATM 4311 C C3  . BMA B 2 .   ? 46.370 61.402 -9.391  0.50 94.52  ? 5   BMA B C3  1 
HETATM 4312 C C4  . BMA B 2 .   ? 45.740 62.206 -10.532 0.50 94.24  ? 5   BMA B C4  1 
HETATM 4313 C C5  . BMA B 2 .   ? 44.218 62.195 -10.387 0.50 94.05  ? 5   BMA B C5  1 
HETATM 4314 C C6  . BMA B 2 .   ? 43.519 63.077 -11.404 0.50 92.83  ? 5   BMA B C6  1 
HETATM 4315 O O2  . BMA B 2 .   ? 46.229 59.172 -8.468  0.50 95.53  ? 5   BMA B O2  1 
HETATM 4316 O O3  . BMA B 2 .   ? 47.616 60.873 -9.814  0.50 93.89  ? 5   BMA B O3  1 
HETATM 4317 O O4  . BMA B 2 .   ? 46.218 63.542 -10.501 0.50 94.69  ? 5   BMA B O4  1 
HETATM 4318 O O5  . BMA B 2 .   ? 43.702 60.849 -10.556 0.50 95.24  ? 5   BMA B O5  1 
HETATM 4319 O O6  . BMA B 2 .   ? 42.770 64.101 -10.766 0.50 91.13  ? 5   BMA B O6  1 
HETATM 4320 S S   . SO4 C 3 .   ? 26.525 66.752 12.052  1.00 57.65  ? 601 SO4 A S   1 
HETATM 4321 O O1  . SO4 C 3 .   ? 27.932 66.586 11.676  1.00 55.12  ? 601 SO4 A O1  1 
HETATM 4322 O O2  . SO4 C 3 .   ? 25.655 66.354 10.940  1.00 56.93  ? 601 SO4 A O2  1 
HETATM 4323 O O3  . SO4 C 3 .   ? 26.151 66.061 13.319  1.00 61.04  ? 601 SO4 A O3  1 
HETATM 4324 O O4  . SO4 C 3 .   ? 26.295 68.121 12.342  1.00 62.71  ? 601 SO4 A O4  1 
HETATM 4325 C C1  . I40 D 4 .   ? 31.880 63.629 9.868   1.00 82.42  ? 602 I40 A C1  1 
HETATM 4326 C C2  . I40 D 4 .   ? 30.834 63.686 8.747   1.00 81.19  ? 602 I40 A C2  1 
HETATM 4327 C C3  . I40 D 4 .   ? 30.255 64.941 8.570   1.00 80.57  ? 602 I40 A C3  1 
HETATM 4328 C C4  . I40 D 4 .   ? 31.203 66.210 8.408   1.00 82.36  ? 602 I40 A C4  1 
HETATM 4329 C C5  . I40 D 4 .   ? 33.625 67.038 9.253   1.00 82.71  ? 602 I40 A C5  1 
HETATM 4330 C C6  . I40 D 4 .   ? 35.945 67.716 10.138  1.00 82.07  ? 602 I40 A C6  1 
HETATM 4331 C C7  . I40 D 4 .   ? 37.102 67.427 10.844  1.00 82.44  ? 602 I40 A C7  1 
HETATM 4332 C C8  . I40 D 4 .   ? 37.214 66.145 11.445  1.00 83.27  ? 602 I40 A C8  1 
HETATM 4333 C C9  . I40 D 4 .   ? 36.267 65.216 11.364  1.00 83.08  ? 602 I40 A C9  1 
HETATM 4334 N N1  . I40 D 4 .   ? 34.040 64.516 10.546  1.00 82.85  ? 602 I40 A N1  1 
HETATM 4335 C C10 . I40 D 4 .   ? 32.955 64.755 9.900   1.00 83.05  ? 602 I40 A C10 1 
HETATM 4336 C C11 . I40 D 4 .   ? 32.575 65.961 9.182   1.00 82.80  ? 602 I40 A C11 1 
HETATM 4337 C C12 . I40 D 4 .   ? 34.884 66.841 9.973   1.00 82.60  ? 602 I40 A C12 1 
HETATM 4338 C C13 . I40 D 4 .   ? 35.037 65.468 10.635  1.00 82.62  ? 602 I40 A C13 1 
HETATM 4339 N N2  . I40 D 4 .   ? 33.187 68.109 8.603   1.00 82.63  ? 602 I40 A N2  1 
HETATM 4340 I I1  . I40 D 4 .   ? 28.999 71.038 10.601  0.60 86.85  ? 602 I40 A I1  1 
HETATM 4341 C C14 . I40 D 4 .   ? 33.798 69.454 8.445   1.00 84.58  ? 602 I40 A C14 1 
HETATM 4342 C C15 . I40 D 4 .   ? 33.045 70.277 9.533   1.00 86.11  ? 602 I40 A C15 1 
HETATM 4343 C C16 . I40 D 4 .   ? 31.672 70.282 9.557   1.00 87.32  ? 602 I40 A C16 1 
HETATM 4344 C C17 . I40 D 4 .   ? 31.036 70.977 10.510  1.00 87.70  ? 602 I40 A C17 1 
HETATM 4345 C C18 . I40 D 4 .   ? 31.691 71.706 11.495  1.00 87.59  ? 602 I40 A C18 1 
HETATM 4346 C C19 . I40 D 4 .   ? 33.033 71.723 11.506  1.00 86.33  ? 602 I40 A C19 1 
HETATM 4347 C C20 . I40 D 4 .   ? 33.783 71.007 10.523  1.00 85.57  ? 602 I40 A C20 1 
HETATM 4348 O O   . HOH E 5 .   ? 29.680 60.190 14.958  1.00 23.41  ? 701 HOH A O   1 
HETATM 4349 O O   . HOH E 5 .   ? 17.075 66.199 24.242  1.00 56.52  ? 702 HOH A O   1 
HETATM 4350 O O   . HOH E 5 .   ? 29.404 63.493 4.756   1.00 8.28   ? 703 HOH A O   1 
HETATM 4351 O O   . HOH E 5 .   ? 33.388 62.349 27.011  1.00 65.60  ? 704 HOH A O   1 
HETATM 4352 O O   . HOH E 5 .   ? 38.090 51.493 25.247  1.00 38.98  ? 705 HOH A O   1 
HETATM 4353 O O   . HOH E 5 .   ? 7.770  75.522 13.486  1.00 52.24  ? 706 HOH A O   1 
HETATM 4354 O O   . HOH E 5 .   ? 27.617 56.935 16.515  1.00 19.33  ? 707 HOH A O   1 
HETATM 4355 O O   . HOH E 5 .   ? 24.609 66.990 5.908   1.00 28.64  ? 708 HOH A O   1 
HETATM 4356 O O   . HOH E 5 .   ? 29.182 68.529 10.835  1.00 23.70  ? 709 HOH A O   1 
HETATM 4357 O O   . HOH E 5 .   ? 38.178 56.944 12.413  1.00 33.90  ? 710 HOH A O   1 
HETATM 4358 O O   . HOH E 5 .   ? 12.378 68.076 19.899  1.00 35.92  ? 711 HOH A O   1 
HETATM 4359 O O   . HOH E 5 .   ? 43.107 68.280 26.981  1.00 39.26  ? 712 HOH A O   1 
HETATM 4360 O O   . HOH E 5 .   ? 23.520 71.857 -4.712  1.00 30.43  ? 713 HOH A O   1 
HETATM 4361 O O   . HOH E 5 .   ? 21.197 43.306 30.489  1.00 39.80  ? 714 HOH A O   1 
HETATM 4362 O O   . HOH E 5 .   ? 38.603 51.260 1.897   1.00 34.81  ? 715 HOH A O   1 
HETATM 4363 O O   . HOH E 5 .   ? 39.053 85.136 17.726  1.00 51.54  ? 716 HOH A O   1 
HETATM 4364 O O   . HOH E 5 .   ? 20.576 38.625 24.914  1.00 30.68  ? 717 HOH A O   1 
HETATM 4365 O O   . HOH E 5 .   ? 17.264 73.734 -4.785  1.00 33.66  ? 718 HOH A O   1 
HETATM 4366 O O   . HOH E 5 .   ? 33.589 67.531 -14.196 1.00 42.12  ? 719 HOH A O   1 
HETATM 4367 O O   . HOH E 5 .   ? 17.559 46.917 17.272  1.00 25.02  ? 720 HOH A O   1 
HETATM 4368 O O   . HOH E 5 .   ? 37.629 43.581 22.739  1.00 31.62  ? 721 HOH A O   1 
HETATM 4369 O O   . HOH E 5 .   ? 0.080  55.629 19.542  1.00 52.29  ? 722 HOH A O   1 
HETATM 4370 O O   . HOH E 5 .   ? 46.487 75.472 16.284  1.00 52.51  ? 723 HOH A O   1 
HETATM 4371 O O   . HOH E 5 .   ? 23.315 37.012 20.984  1.00 53.08  ? 724 HOH A O   1 
HETATM 4372 O O   . HOH E 5 .   ? 20.635 74.106 13.262  1.00 33.04  ? 725 HOH A O   1 
HETATM 4373 O O   . HOH E 5 .   ? 31.973 71.044 2.184   1.00 24.78  ? 726 HOH A O   1 
HETATM 4374 O O   . HOH E 5 .   ? 12.469 74.348 0.149   1.00 39.71  ? 727 HOH A O   1 
HETATM 4375 O O   . HOH E 5 .   ? 35.328 77.313 -4.348  1.00 47.46  ? 728 HOH A O   1 
HETATM 4376 O O   . HOH E 5 .   ? 43.214 68.761 41.970  1.00 34.62  ? 729 HOH A O   1 
HETATM 4377 O O   . HOH E 5 .   ? 13.742 94.495 -6.705  1.00 51.51  ? 730 HOH A O   1 
HETATM 4378 O O   . HOH E 5 .   ? 16.514 76.601 7.014   1.00 25.72  ? 731 HOH A O   1 
HETATM 4379 O O   . HOH E 5 .   ? 10.121 62.836 -2.478  1.00 26.72  ? 732 HOH A O   1 
HETATM 4380 O O   . HOH E 5 .   ? 19.432 77.534 -10.187 1.00 40.04  ? 733 HOH A O   1 
HETATM 4381 O O   . HOH E 5 .   ? 26.917 65.490 32.257  1.00 33.88  ? 734 HOH A O   1 
HETATM 4382 O O   . HOH E 5 .   ? 48.399 74.962 26.477  1.00 25.10  ? 735 HOH A O   1 
HETATM 4383 O O   . HOH E 5 .   ? 26.454 69.537 39.090  1.00 22.65  ? 736 HOH A O   1 
HETATM 4384 O O   . HOH E 5 .   ? 21.770 48.111 23.609  1.00 26.80  ? 737 HOH A O   1 
HETATM 4385 O O   . HOH E 5 .   ? 35.427 57.403 10.177  1.00 37.18  ? 738 HOH A O   1 
HETATM 4386 O O   . HOH E 5 .   ? 8.162  72.460 -4.332  1.00 29.93  ? 739 HOH A O   1 
HETATM 4387 O O   . HOH E 5 .   ? 38.503 63.268 34.639  1.00 46.82  ? 740 HOH A O   1 
HETATM 4388 O O   . HOH E 5 .   ? 48.168 64.966 7.070   1.00 51.53  ? 741 HOH A O   1 
HETATM 4389 O O   . HOH E 5 .   ? 49.263 69.544 9.754   1.00 56.43  ? 742 HOH A O   1 
HETATM 4390 O O   . HOH E 5 .   ? 36.879 62.622 0.577   1.00 69.95  ? 743 HOH A O   1 
HETATM 4391 O O   . HOH E 5 .   ? 10.336 87.784 13.506  1.00 35.07  ? 744 HOH A O   1 
HETATM 4392 O O   . HOH E 5 .   ? 43.740 44.743 23.927  1.00 39.72  ? 745 HOH A O   1 
HETATM 4393 O O   . HOH E 5 .   ? 39.499 44.859 0.390   1.00 51.40  ? 746 HOH A O   1 
HETATM 4394 O O   . HOH E 5 .   ? 48.636 69.416 6.701   1.00 58.75  ? 747 HOH A O   1 
HETATM 4395 O O   . HOH E 5 .   ? 47.557 43.560 7.302   1.00 54.60  ? 748 HOH A O   1 
HETATM 4396 O O   . HOH E 5 .   ? 15.861 75.093 8.226   1.00 37.27  ? 749 HOH A O   1 
HETATM 4397 O O   . HOH E 5 .   ? 38.116 85.243 22.095  1.00 54.75  ? 750 HOH A O   1 
HETATM 4398 O O   . HOH E 5 .   ? 31.675 56.559 -1.586  1.00 40.50  ? 751 HOH A O   1 
HETATM 4399 O O   . HOH E 5 .   ? 25.175 35.096 25.134  1.00 27.82  ? 752 HOH A O   1 
HETATM 4400 O O   . HOH E 5 .   ? 18.087 77.888 18.552  1.00 41.38  ? 753 HOH A O   1 
HETATM 4401 O O   . HOH E 5 .   ? 28.233 53.767 -21.829 1.00 45.09  ? 754 HOH A O   1 
HETATM 4402 O O   . HOH E 5 .   ? 39.070 63.422 24.635  1.00 29.75  ? 755 HOH A O   1 
HETATM 4403 O O   . HOH E 5 .   ? 18.215 74.768 14.345  1.00 29.49  ? 756 HOH A O   1 
HETATM 4404 O O   . HOH E 5 .   ? 2.739  55.747 22.476  1.00 37.18  ? 757 HOH A O   1 
HETATM 4405 O O   . HOH E 5 .   ? 20.135 64.687 -11.473 1.00 38.04  ? 758 HOH A O   1 
HETATM 4406 O O   . HOH E 5 .   ? 21.261 46.773 -25.385 1.00 46.55  ? 759 HOH A O   1 
HETATM 4407 O O   . HOH E 5 .   ? 20.941 71.651 -5.569  1.00 32.81  ? 760 HOH A O   1 
HETATM 4408 O O   . HOH E 5 .   ? 31.596 66.788 1.248   1.00 33.89  ? 761 HOH A O   1 
HETATM 4409 O O   . HOH E 5 .   ? 49.053 72.954 14.596  1.00 37.03  ? 762 HOH A O   1 
HETATM 4410 O O   . HOH E 5 .   ? 20.040 79.963 40.272  1.00 41.27  ? 763 HOH A O   1 
HETATM 4411 O O   . HOH E 5 .   ? 35.040 59.524 29.032  1.00 47.47  ? 764 HOH A O   1 
HETATM 4412 O O   . HOH E 5 .   ? 6.236  80.482 10.290  1.00 27.97  ? 765 HOH A O   1 
HETATM 4413 O O   . HOH E 5 .   ? 41.365 54.281 22.448  1.00 18.60  ? 766 HOH A O   1 
HETATM 4414 O O   . HOH E 5 .   ? -3.915 86.861 -0.942  1.00 46.85  ? 767 HOH A O   1 
HETATM 4415 O O   . HOH E 5 .   ? -3.757 82.327 0.807   1.00 39.70  ? 768 HOH A O   1 
HETATM 4416 O O   . HOH E 5 .   ? 39.221 64.126 -6.522  1.00 62.86  ? 769 HOH A O   1 
HETATM 4417 O O   . HOH E 5 .   ? 18.248 75.775 27.028  1.00 41.02  ? 770 HOH A O   1 
HETATM 4418 O O   . HOH E 5 .   ? 16.731 68.866 27.230  1.00 54.07  ? 771 HOH A O   1 
HETATM 4419 O O   . HOH E 5 .   ? 44.771 42.831 27.556  1.00 51.94  ? 772 HOH A O   1 
HETATM 4420 O O   . HOH E 5 .   ? 44.853 45.625 26.714  1.00 63.16  ? 773 HOH A O   1 
HETATM 4421 O O   . HOH E 5 .   ? 35.937 70.274 -5.060  1.00 51.35  ? 774 HOH A O   1 
HETATM 4422 O O   . HOH E 5 .   ? 13.586 67.527 27.664  1.00 42.60  ? 775 HOH A O   1 
HETATM 4423 O O   . HOH E 5 .   ? 29.184 40.665 25.268  1.00 55.11  ? 776 HOH A O   1 
HETATM 4424 O O   . HOH E 5 .   ? 49.061 66.870 24.049  1.00 46.23  ? 777 HOH A O   1 
HETATM 4425 O O   . HOH E 5 .   ? 20.125 66.818 25.731  1.00 36.13  ? 778 HOH A O   1 
HETATM 4426 O O   . HOH E 5 .   ? 11.486 58.095 -7.284  1.00 42.31  ? 779 HOH A O   1 
HETATM 4427 O O   . HOH E 5 .   ? 15.207 59.431 -23.879 1.00 49.30  ? 780 HOH A O   1 
HETATM 4428 O O   . HOH E 5 .   ? 15.032 84.674 16.929  1.00 48.47  ? 781 HOH A O   1 
HETATM 4429 O O   . HOH E 5 .   ? 14.180 87.898 14.101  1.00 43.68  ? 782 HOH A O   1 
HETATM 4430 O O   . HOH E 5 .   ? 38.346 55.450 3.827   1.00 39.21  ? 783 HOH A O   1 
HETATM 4431 O O   . HOH E 5 .   ? 33.214 49.095 -16.960 1.00 54.04  ? 784 HOH A O   1 
HETATM 4432 O O   . HOH E 5 .   ? 12.141 44.756 22.544  1.00 33.67  ? 785 HOH A O   1 
HETATM 4433 O O   . HOH E 5 .   ? 23.857 88.436 8.391   1.00 81.36  ? 786 HOH A O   1 
HETATM 4434 O O   . HOH E 5 .   ? 11.473 47.001 29.464  1.00 42.95  ? 787 HOH A O   1 
HETATM 4435 O O   . HOH E 5 .   ? 20.350 74.208 26.779  1.00 31.53  ? 788 HOH A O   1 
HETATM 4436 O O   . HOH E 5 .   ? 6.950  67.022 -6.955  1.00 59.82  ? 789 HOH A O   1 
HETATM 4437 O O   . HOH E 5 .   ? 12.347 86.085 17.333  1.00 74.61  ? 790 HOH A O   1 
HETATM 4438 O O   . HOH E 5 .   ? 29.728 64.926 37.627  1.00 43.97  ? 791 HOH A O   1 
HETATM 4439 O O   . HOH E 5 .   ? 18.318 56.022 31.803  1.00 26.23  ? 792 HOH A O   1 
HETATM 4440 O O   . HOH E 5 .   ? 8.224  42.635 15.139  1.00 43.58  ? 793 HOH A O   1 
HETATM 4441 O O   . HOH E 5 .   ? 28.961 73.656 -12.000 1.00 46.91  ? 794 HOH A O   1 
HETATM 4442 O O   . HOH E 5 .   ? 34.212 64.212 36.071  1.00 43.96  ? 795 HOH A O   1 
HETATM 4443 O O   . HOH E 5 .   ? 35.050 59.261 33.448  1.00 62.94  ? 796 HOH A O   1 
HETATM 4444 O O   . HOH E 5 .   ? 33.355 76.945 6.105   1.00 49.57  ? 797 HOH A O   1 
HETATM 4445 O O   . HOH E 5 .   ? 48.114 50.176 -1.359  1.00 48.76  ? 798 HOH A O   1 
HETATM 4446 O O   . HOH E 5 .   ? 35.966 54.983 -14.797 1.00 41.90  ? 799 HOH A O   1 
HETATM 4447 O O   . HOH E 5 .   ? 40.222 66.524 -2.065  1.00 45.58  ? 800 HOH A O   1 
HETATM 4448 O O   . HOH E 5 .   ? 7.142  49.616 27.048  1.00 38.83  ? 801 HOH A O   1 
HETATM 4449 O O   . HOH E 5 .   ? 43.637 51.622 22.638  1.00 59.09  ? 802 HOH A O   1 
HETATM 4450 O O   . HOH E 5 .   ? 28.162 38.740 7.133   1.00 58.93  ? 803 HOH A O   1 
HETATM 4451 O O   . HOH E 5 .   ? 3.661  68.403 -4.648  1.00 55.98  ? 804 HOH A O   1 
HETATM 4452 O O   . HOH E 5 .   ? 41.943 79.530 10.451  1.00 59.26  ? 805 HOH A O   1 
HETATM 4453 O O   . HOH E 5 .   ? 42.517 52.181 25.774  1.00 57.74  ? 806 HOH A O   1 
HETATM 4454 O O   . HOH E 5 .   ? 17.922 73.052 25.660  1.00 48.82  ? 807 HOH A O   1 
HETATM 4455 O O   . HOH E 5 .   ? 21.083 52.817 35.342  1.00 43.39  ? 808 HOH A O   1 
HETATM 4456 O O   . HOH E 5 .   ? 29.307 85.938 -12.300 1.00 39.18  ? 809 HOH A O   1 
HETATM 4457 O O   . HOH E 5 .   ? 16.449 53.519 -27.184 1.00 39.36  ? 810 HOH A O   1 
HETATM 4458 O O   . HOH E 5 .   ? 14.204 55.503 -25.168 1.00 44.67  ? 811 HOH A O   1 
HETATM 4459 O O   . HOH E 5 .   ? 17.029 86.253 15.010  1.00 39.10  ? 812 HOH A O   1 
HETATM 4460 O O   . HOH E 5 .   ? 30.163 77.589 39.102  1.00 46.07  ? 813 HOH A O   1 
HETATM 4461 O O   . HOH E 5 .   ? 19.946 35.289 13.317  1.00 54.18  ? 814 HOH A O   1 
HETATM 4462 O O   . HOH E 5 .   ? 4.489  47.360 22.376  1.00 39.18  ? 815 HOH A O   1 
HETATM 4463 O O   . HOH E 5 .   ? 30.512 81.020 -10.906 1.00 59.97  ? 816 HOH A O   1 
HETATM 4464 O O   . HOH E 5 .   ? 35.305 69.441 -15.739 1.00 62.75  ? 817 HOH A O   1 
HETATM 4465 O O   . HOH E 5 .   ? 37.604 81.472 9.594   1.00 42.49  ? 818 HOH A O   1 
HETATM 4466 O O   . HOH E 5 .   ? 22.447 50.683 -26.266 1.00 52.94  ? 819 HOH A O   1 
HETATM 4467 O O   . HOH E 5 .   ? 40.513 85.467 20.662  1.00 53.88  ? 820 HOH A O   1 
HETATM 4468 O O   . HOH E 5 .   ? 18.615 55.203 34.648  1.00 45.83  ? 821 HOH A O   1 
HETATM 4469 O O   . HOH E 5 .   ? 17.414 42.682 33.173  1.00 52.50  ? 822 HOH A O   1 
HETATM 4470 O O   . HOH E 5 .   ? 19.641 41.430 29.815  1.00 33.81  ? 823 HOH A O   1 
HETATM 4471 O O   . HOH E 5 .   ? 49.145 49.170 30.117  1.00 44.53  ? 824 HOH A O   1 
HETATM 4472 O O   . HOH E 5 .   ? 34.515 55.969 27.659  1.00 50.88  ? 825 HOH A O   1 
HETATM 4473 O O   . HOH E 5 .   ? 37.848 87.066 15.994  1.00 49.14  ? 826 HOH A O   1 
HETATM 4474 O O   . HOH E 5 .   ? 40.034 80.011 9.119   1.00 42.54  ? 827 HOH A O   1 
HETATM 4475 O O   . HOH E 5 .   ? 34.095 66.520 41.134  1.00 50.13  ? 828 HOH A O   1 
HETATM 4476 O O   . HOH E 5 .   ? 48.150 66.086 27.679  1.00 54.68  ? 829 HOH A O   1 
HETATM 4477 O O   . HOH E 5 .   ? 36.744 73.264 -13.470 1.00 66.08  ? 830 HOH A O   1 
HETATM 4478 O O   . HOH E 5 .   ? 45.716 53.688 24.026  1.00 53.71  ? 831 HOH A O   1 
HETATM 4479 O O   . HOH E 5 .   ? 32.587 62.390 37.319  1.00 53.23  ? 832 HOH A O   1 
HETATM 4480 O O   . HOH E 5 .   ? 14.052 86.955 19.258  1.00 58.05  ? 833 HOH A O   1 
HETATM 4481 O O   . HOH E 5 .   ? 9.105  44.915 30.182  1.00 57.07  ? 834 HOH A O   1 
HETATM 4482 O O   . HOH E 5 .   ? 39.410 89.755 21.785  1.00 45.93  ? 835 HOH A O   1 
HETATM 4483 O O   . HOH E 5 .   ? 37.817 72.993 -15.996 1.00 46.56  ? 836 HOH A O   1 
HETATM 4484 O O   . HOH E 5 .   ? 37.753 90.755 18.666  1.00 74.41  ? 837 HOH A O   1 
HETATM 4485 O O   . HOH E 5 .   ? 39.983 84.404 7.680   1.00 39.37  ? 838 HOH A O   1 
HETATM 4486 O O   . HOH E 5 .   ? 48.986 57.641 -9.862  1.00 60.15  ? 839 HOH A O   1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'BMA B 3 HAS WRONG CHIRALITY AT ATOM C1' 
2 'BMA B 4 HAS WRONG CHIRALITY AT ATOM C1' 
3 'BMA B 5 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  TRP 53  53  53  TRP TRP A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  CYS 93  93  93  CYS CYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LYS 103 103 ?   ?   ?   A . n 
A 1 104 ALA 104 104 ?   ?   ?   A . n 
A 1 105 ARG 105 105 ?   ?   ?   A . n 
A 1 106 LEU 106 106 ?   ?   ?   A . n 
A 1 107 ARG 107 107 ?   ?   ?   A . n 
A 1 108 HIS 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 ARG 110 110 ?   ?   ?   A . n 
A 1 111 GLY 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLY 114 114 ?   ?   ?   A . n 
A 1 115 GLY 115 115 ?   ?   ?   A . n 
A 1 116 GLU 116 116 ?   ?   ?   A . n 
A 1 117 HIS 117 117 ?   ?   ?   A . n 
A 1 118 PRO 118 118 ?   ?   ?   A . n 
A 1 119 ASN 119 119 ?   ?   ?   A . n 
A 1 120 GLY 120 120 ?   ?   ?   A . n 
A 1 121 LYS 121 121 ?   ?   ?   A . n 
A 1 122 GLN 122 122 ?   ?   ?   A . n 
A 1 123 ALA 123 123 ?   ?   ?   A . n 
A 1 124 ASP 124 124 ?   ?   ?   A . n 
A 1 125 THR 125 125 ?   ?   ?   A . n 
A 1 126 ASP 126 126 ?   ?   ?   A . n 
A 1 127 HIS 127 127 ?   ?   ?   A . n 
A 1 128 LEU 128 128 ?   ?   ?   A . n 
A 1 129 ILE 129 129 ?   ?   ?   A . n 
A 1 130 HIS 130 130 ?   ?   ?   A . n 
A 1 131 ASN 131 131 ?   ?   ?   A . n 
A 1 132 GLY 132 132 ?   ?   ?   A . n 
A 1 133 ASN 133 133 ?   ?   ?   A . n 
A 1 134 PRO 134 134 ?   ?   ?   A . n 
A 1 135 GLN 135 135 ?   ?   ?   A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 MET 267 267 267 MET MET A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TRP 271 271 271 TRP TRP A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 MET 305 305 305 MET MET A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 CYS 307 307 307 CYS CYS A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 TRP 321 321 321 TRP TRP A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ASP 337 337 337 ASP ASP A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 MET 346 346 346 MET MET A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 LEU 348 348 348 LEU LEU A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 ASP 353 353 353 ASP ASP A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 TYR 357 357 357 TYR TYR A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 MET 361 361 361 MET MET A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 VAL 364 364 364 VAL VAL A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 TYR 370 370 370 TYR TYR A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ARG 390 390 390 ARG ARG A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 LYS 392 392 392 LYS LYS A . n 
A 1 393 TYR 393 393 393 TYR TYR A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 MET 397 397 397 MET MET A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PHE 401 401 401 PHE PHE A . n 
A 1 402 GLY 402 402 402 GLY GLY A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 THR 405 405 405 THR THR A . n 
A 1 406 GLN 406 406 406 GLN GLN A . n 
A 1 407 ALA 407 407 407 ALA ALA A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 ARG 409 409 409 ARG ARG A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 THR 417 417 417 THR THR A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 TRP 419 419 419 TRP TRP A . n 
A 1 420 GLU 420 420 420 GLU GLU A . n 
A 1 421 GLY 421 421 421 GLY GLY A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 GLN 429 429 429 GLN GLN A . n 
A 1 430 GLN 430 430 430 GLN GLN A . n 
A 1 431 ILE 431 431 431 ILE ILE A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 THR 444 444 444 THR THR A . n 
A 1 445 ASN 445 445 445 ASN ASN A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 TYR 447 447 447 TYR TYR A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 ALA 452 452 452 ALA ALA A . n 
A 1 453 GLU 453 453 453 GLU GLU A . n 
A 1 454 ARG 454 454 454 ARG ARG A . n 
A 1 455 GLY 455 455 455 GLY GLY A . n 
A 1 456 ALA 456 456 456 ALA ALA A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 HIS 459 459 459 HIS HIS A . n 
A 1 460 TYR 460 460 460 TYR TYR A . n 
A 1 461 TYR 461 461 461 TYR TYR A . n 
A 1 462 TYR 462 462 462 TYR TYR A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 HIS 465 465 465 HIS HIS A . n 
A 1 466 ARG 466 466 466 ARG ARG A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 SER 468 468 468 SER SER A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 TRP 472 472 472 TRP TRP A . n 
A 1 473 GLY 473 473 473 GLY GLY A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 TRP 475 475 475 TRP TRP A . n 
A 1 476 MET 476 476 476 MET MET A . n 
A 1 477 GLY 477 477 477 GLY GLY A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 HIS 480 480 480 HIS HIS A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 TYR 486 486 486 TYR TYR A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 GLN 490 490 490 GLN GLN A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 ASN 493 493 493 ASN ASN A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 TYR 498 498 498 TYR TYR A . n 
A 1 499 ARG 499 499 499 ARG ARG A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 GLU 502 502 502 GLU GLU A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 ARG 508 508 508 ARG ARG A . n 
A 1 509 MET 509 509 509 MET MET A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 SER 511 511 511 SER SER A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 PHE 516 516 516 PHE PHE A . n 
A 1 517 ALA 517 517 517 ALA ALA A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 GLY 520 520 520 GLY GLY A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 ALA 523 523 523 ALA ALA A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 ASP 525 525 525 ASP ASP A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 TRP 529 529 529 TRP TRP A . n 
A 1 530 PRO 530 530 530 PRO PRO A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 LYS 534 534 534 LYS LYS A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 ASP 536 536 536 ASP ASP A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 VAL 538 538 538 VAL VAL A . n 
A 1 539 TYR 539 539 539 TYR TYR A . n 
A 1 540 TYR 540 540 540 TYR TYR A . n 
A 1 541 ILE 541 541 541 ILE ILE A . n 
A 1 542 PHE 542 542 542 PHE PHE A . n 
A 1 543 SER 543 543 543 SER SER A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 ASP 546 546 546 ASP ASP A . n 
A 1 547 LYS 547 547 547 LYS LYS A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 ALA 552 552 552 ALA ALA A . n 
A 1 553 ARG 553 553 553 ARG ARG A . n 
A 1 554 GLY 554 554 554 GLY GLY A . n 
A 1 555 PRO 555 555 555 PRO PRO A . n 
A 1 556 LEU 556 556 556 LEU LEU A . n 
A 1 557 ALA 557 557 557 ALA ALA A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 CYS 560 560 560 CYS CYS A . n 
A 1 561 SER 561 561 561 SER SER A . n 
A 1 562 PHE 562 562 562 PHE PHE A . n 
A 1 563 TRP 563 563 563 TRP TRP A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 LYS 569 569 569 LYS LYS A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 ARG 571 571 571 ARG ARG A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 TRP 573 573 573 TRP TRP A . n 
A 1 574 ALA 574 574 ?   ?   ?   A . n 
A 1 575 GLY 575 575 ?   ?   ?   A . n 
A 1 576 THR 576 576 ?   ?   ?   A . n 
A 1 577 CYS 577 577 ?   ?   ?   A . n 
A 1 578 ASP 578 578 ?   ?   ?   A . n 
A 1 579 GLY 579 579 ?   ?   ?   A . n 
A 1 580 ASP 580 580 ?   ?   ?   A . n 
A 1 581 SER 581 581 ?   ?   ?   A . n 
A 1 582 GLY 582 582 ?   ?   ?   A . n 
A 1 583 SER 583 583 ?   ?   ?   A . n 
A 1 584 ALA 584 584 ?   ?   ?   A . n 
A 1 585 SER 585 585 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   601 593  SO4 SO4 A . 
D 4 I40 1   602 997  I40 I40 A . 
E 5 HOH 1   701 2111 HOH HOH A . 
E 5 HOH 2   702 2103 HOH HOH A . 
E 5 HOH 3   703 2044 HOH HOH A . 
E 5 HOH 4   704 2135 HOH HOH A . 
E 5 HOH 5   705 2126 HOH HOH A . 
E 5 HOH 6   706 2062 HOH HOH A . 
E 5 HOH 7   707 2107 HOH HOH A . 
E 5 HOH 8   708 2042 HOH HOH A . 
E 5 HOH 9   709 2138 HOH HOH A . 
E 5 HOH 10  710 2112 HOH HOH A . 
E 5 HOH 11  711 2077 HOH HOH A . 
E 5 HOH 12  712 2100 HOH HOH A . 
E 5 HOH 13  713 2022 HOH HOH A . 
E 5 HOH 14  714 2132 HOH HOH A . 
E 5 HOH 15  715 2114 HOH HOH A . 
E 5 HOH 16  716 2082 HOH HOH A . 
E 5 HOH 17  717 2120 HOH HOH A . 
E 5 HOH 18  718 2013 HOH HOH A . 
E 5 HOH 19  719 2037 HOH HOH A . 
E 5 HOH 20  720 2106 HOH HOH A . 
E 5 HOH 21  721 2131 HOH HOH A . 
E 5 HOH 22  722 2078 HOH HOH A . 
E 5 HOH 23  723 2084 HOH HOH A . 
E 5 HOH 24  724 2118 HOH HOH A . 
E 5 HOH 25  725 2074 HOH HOH A . 
E 5 HOH 26  726 2023 HOH HOH A . 
E 5 HOH 27  727 2053 HOH HOH A . 
E 5 HOH 28  728 2072 HOH HOH A . 
E 5 HOH 29  729 2097 HOH HOH A . 
E 5 HOH 30  730 2068 HOH HOH A . 
E 5 HOH 31  731 2075 HOH HOH A . 
E 5 HOH 32  732 2055 HOH HOH A . 
E 5 HOH 33  733 2012 HOH HOH A . 
E 5 HOH 34  734 2095 HOH HOH A . 
E 5 HOH 35  735 2088 HOH HOH A . 
E 5 HOH 36  736 2093 HOH HOH A . 
E 5 HOH 37  737 2125 HOH HOH A . 
E 5 HOH 38  738 2110 HOH HOH A . 
E 5 HOH 39  739 2014 HOH HOH A . 
E 5 HOH 40  740 2098 HOH HOH A . 
E 5 HOH 41  741 2033 HOH HOH A . 
E 5 HOH 42  742 2086 HOH HOH A . 
E 5 HOH 43  743 2034 HOH HOH A . 
E 5 HOH 44  744 2065 HOH HOH A . 
E 5 HOH 45  745 2127 HOH HOH A . 
E 5 HOH 46  746 2008 HOH HOH A . 
E 5 HOH 47  747 2032 HOH HOH A . 
E 5 HOH 48  748 2115 HOH HOH A . 
E 5 HOH 49  749 2076 HOH HOH A . 
E 5 HOH 50  750 2083 HOH HOH A . 
E 5 HOH 51  751 2043 HOH HOH A . 
E 5 HOH 52  752 2121 HOH HOH A . 
E 5 HOH 53  753 2063 HOH HOH A . 
E 5 HOH 54  754 2005 HOH HOH A . 
E 5 HOH 55  755 2109 HOH HOH A . 
E 5 HOH 56  756 2060 HOH HOH A . 
E 5 HOH 57  757 2079 HOH HOH A . 
E 5 HOH 58  758 2011 HOH HOH A . 
E 5 HOH 59  759 2001 HOH HOH A . 
E 5 HOH 60  760 2039 HOH HOH A . 
E 5 HOH 61  761 2035 HOH HOH A . 
E 5 HOH 62  762 2085 HOH HOH A . 
E 5 HOH 63  763 2092 HOH HOH A . 
E 5 HOH 64  764 2134 HOH HOH A . 
E 5 HOH 65  765 2061 HOH HOH A . 
E 5 HOH 66  766 2108 HOH HOH A . 
E 5 HOH 67  767 2069 HOH HOH A . 
E 5 HOH 68  768 2052 HOH HOH A . 
E 5 HOH 69  769 2036 HOH HOH A . 
E 5 HOH 70  770 2091 HOH HOH A . 
E 5 HOH 71  771 2137 HOH HOH A . 
E 5 HOH 72  772 2128 HOH HOH A . 
E 5 HOH 73  773 2129 HOH HOH A . 
E 5 HOH 74  774 2024 HOH HOH A . 
E 5 HOH 75  775 2102 HOH HOH A . 
E 5 HOH 76  776 2119 HOH HOH A . 
E 5 HOH 77  777 2087 HOH HOH A . 
E 5 HOH 78  778 2136 HOH HOH A . 
E 5 HOH 79  779 2056 HOH HOH A . 
E 5 HOH 80  780 2018 HOH HOH A . 
E 5 HOH 81  781 2067 HOH HOH A . 
E 5 HOH 82  782 2066 HOH HOH A . 
E 5 HOH 83  783 2113 HOH HOH A . 
E 5 HOH 84  784 2006 HOH HOH A . 
E 5 HOH 85  785 2122 HOH HOH A . 
E 5 HOH 86  786 2073 HOH HOH A . 
E 5 HOH 87  787 2124 HOH HOH A . 
E 5 HOH 88  788 2090 HOH HOH A . 
E 5 HOH 89  789 2016 HOH HOH A . 
E 5 HOH 90  790 2064 HOH HOH A . 
E 5 HOH 91  791 2094 HOH HOH A . 
E 5 HOH 92  792 2104 HOH HOH A . 
E 5 HOH 93  793 2081 HOH HOH A . 
E 5 HOH 94  794 2038 HOH HOH A . 
E 5 HOH 95  795 2099 HOH HOH A . 
E 5 HOH 96  796 2101 HOH HOH A . 
E 5 HOH 97  797 2025 HOH HOH A . 
E 5 HOH 98  798 2116 HOH HOH A . 
E 5 HOH 99  799 2020 HOH HOH A . 
E 5 HOH 100 800 2026 HOH HOH A . 
E 5 HOH 101 801 2105 HOH HOH A . 
E 5 HOH 102 802 2054 HOH HOH A . 
E 5 HOH 103 803 2045 HOH HOH A . 
E 5 HOH 104 804 2015 HOH HOH A . 
E 5 HOH 105 805 2029 HOH HOH A . 
E 5 HOH 106 806 2028 HOH HOH A . 
E 5 HOH 107 807 2050 HOH HOH A . 
E 5 HOH 108 808 2133 HOH HOH A . 
E 5 HOH 109 809 2070 HOH HOH A . 
E 5 HOH 110 810 2019 HOH HOH A . 
E 5 HOH 111 811 2017 HOH HOH A . 
E 5 HOH 112 812 2041 HOH HOH A . 
E 5 HOH 113 813 2089 HOH HOH A . 
E 5 HOH 114 814 2117 HOH HOH A . 
E 5 HOH 115 815 2080 HOH HOH A . 
E 5 HOH 116 816 2071 HOH HOH A . 
E 5 HOH 117 817 2010 HOH HOH A . 
E 5 HOH 118 818 2031 HOH HOH A . 
E 5 HOH 119 819 2002 HOH HOH A . 
E 5 HOH 120 820 2046 HOH HOH A . 
E 5 HOH 121 821 2123 HOH HOH A . 
E 5 HOH 122 822 2007 HOH HOH A . 
E 5 HOH 123 823 2058 HOH HOH A . 
E 5 HOH 124 824 2130 HOH HOH A . 
E 5 HOH 125 825 2059 HOH HOH A . 
E 5 HOH 126 826 2047 HOH HOH A . 
E 5 HOH 127 827 2030 HOH HOH A . 
E 5 HOH 128 828 2096 HOH HOH A . 
E 5 HOH 129 829 2049 HOH HOH A . 
E 5 HOH 130 830 2003 HOH HOH A . 
E 5 HOH 131 831 2027 HOH HOH A . 
E 5 HOH 132 832 2051 HOH HOH A . 
E 5 HOH 133 833 2040 HOH HOH A . 
E 5 HOH 134 834 2057 HOH HOH A . 
E 5 HOH 135 835 2048 HOH HOH A . 
E 5 HOH 136 836 2004 HOH HOH A . 
E 5 HOH 137 837 2021 HOH HOH A . 
E 5 HOH 138 838 2009 HOH HOH A . 
E 5 HOH 139 839 2139 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     493 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      493 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
1 2 A,C,D,E   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 94.9300000000 -1.0000000000 
0.0000000000 0.0000000000 94.9300000000 0.0000000000 0.0000000000 -1.0000000000 80.0100000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-20 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-10-09 
5 'Structure model' 2 0 2020-07-29 
6 'Structure model' 3 0 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' Other                       
7  5 'Structure model' Advisory                    
8  5 'Structure model' 'Atomic model'              
9  5 'Structure model' 'Data collection'           
10 5 'Structure model' 'Derived calculations'      
11 5 'Structure model' 'Structure summary'         
12 6 'Structure model' Advisory                    
13 6 'Structure model' 'Atomic model'              
14 6 'Structure model' 'Data collection'           
15 6 'Structure model' 'Derived calculations'      
16 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                      
2  4 'Structure model' pdbx_database_status          
3  4 'Structure model' struct_conn                   
4  5 'Structure model' atom_site                     
5  5 'Structure model' chem_comp                     
6  5 'Structure model' database_PDB_caveat           
7  5 'Structure model' entity                        
8  5 'Structure model' pdbx_branch_scheme            
9  5 'Structure model' pdbx_chem_comp_identifier     
10 5 'Structure model' pdbx_entity_branch            
11 5 'Structure model' pdbx_entity_branch_descriptor 
12 5 'Structure model' pdbx_entity_branch_link       
13 5 'Structure model' pdbx_entity_branch_list       
14 5 'Structure model' pdbx_entity_nonpoly           
15 5 'Structure model' pdbx_nonpoly_scheme           
16 5 'Structure model' pdbx_struct_assembly_gen      
17 5 'Structure model' pdbx_validate_chiral          
18 5 'Structure model' pdbx_validate_close_contact   
19 5 'Structure model' struct_asym                   
20 5 'Structure model' struct_conn                   
21 5 'Structure model' struct_site                   
22 5 'Structure model' struct_site_gen               
23 6 'Structure model' atom_site                     
24 6 'Structure model' chem_comp                     
25 6 'Structure model' pdbx_distant_solvent_atoms    
26 6 'Structure model' pdbx_nonpoly_scheme           
27 6 'Structure model' pdbx_struct_assembly          
28 6 'Structure model' pdbx_struct_assembly_gen      
29 6 'Structure model' pdbx_struct_oper_list         
30 6 'Structure model' pdbx_validate_close_contact   
31 6 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.page_last'                                         
2  4 'Structure model' '_citation.pdbx_database_id_DOI'                              
3  4 'Structure model' '_citation.title'                                             
4  4 'Structure model' '_pdbx_database_status.status_code_sf'                        
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'                         
6  5 'Structure model' '_atom_site.B_iso_or_equiv'                                   
7  5 'Structure model' '_atom_site.Cartn_x'                                          
8  5 'Structure model' '_atom_site.Cartn_y'                                          
9  5 'Structure model' '_atom_site.Cartn_z'                                          
10 5 'Structure model' '_atom_site.auth_asym_id'                                     
11 5 'Structure model' '_atom_site.auth_atom_id'                                     
12 5 'Structure model' '_atom_site.auth_comp_id'                                     
13 5 'Structure model' '_atom_site.auth_seq_id'                                      
14 5 'Structure model' '_atom_site.label_asym_id'                                    
15 5 'Structure model' '_atom_site.label_atom_id'                                    
16 5 'Structure model' '_atom_site.label_comp_id'                                    
17 5 'Structure model' '_atom_site.label_entity_id'                                  
18 5 'Structure model' '_atom_site.occupancy'                                        
19 5 'Structure model' '_atom_site.type_symbol'                                      
20 5 'Structure model' '_chem_comp.name'                                             
21 5 'Structure model' '_chem_comp.type'                                             
22 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'                      
23 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id'                          
24 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id'                           
25 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1'                 
26 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2'                 
27 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'                  
28 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'                  
29 5 'Structure model' '_struct_conn.pdbx_dist_value'                                
30 5 'Structure model' '_struct_conn.pdbx_role'                                      
31 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'                             
32 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'                              
33 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'                            
34 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'                            
35 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'                             
36 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'                              
37 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'                            
38 6 'Structure model' '_atom_site.B_iso_or_equiv'                                   
39 6 'Structure model' '_atom_site.Cartn_x'                                          
40 6 'Structure model' '_atom_site.Cartn_y'                                          
41 6 'Structure model' '_atom_site.Cartn_z'                                          
42 6 'Structure model' '_atom_site.auth_seq_id'                                      
43 6 'Structure model' '_chem_comp.pdbx_synonyms'                                    
44 6 'Structure model' '_pdbx_distant_solvent_atoms.auth_seq_id'                     
45 6 'Structure model' '_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance' 
46 6 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num'                           
47 6 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'                            
48 6 'Structure model' '_pdbx_struct_assembly.details'                               
49 6 'Structure model' '_pdbx_struct_assembly.method_details'                        
50 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'                      
51 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'                    
52 6 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'                  
53 6 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'                  
54 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'                         
55 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id'                              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       3.8 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CCP4      phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 1QON 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'RESIDUES 103-135 ARE MISSING DUE TO DISORDER.' 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A GLY 151 ? ? N   A PHE 152 ? ? 1.74 
2 1 ND2 A ASN 205 ? ? OD2 A ASP 337 ? ? 1.81 
3 1 O   A SER 272 ? ? CG  A PRO 334 ? ? 2.02 
4 1 O   A HOH 731 ? ? O   A HOH 749 ? ? 2.04 
5 1 SD  A MET 153 ? ? OG  A SER 332 ? ? 2.18 
6 1 O2  B BMA 3   ? ? O2  B BMA 4   ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C A GLY 151 ? ? N A PHE 152 ? ? 1.031 1.336 -0.305 0.023 Y 
2 1 C A THR 154 ? ? N A GLY 155 ? ? 1.485 1.336 0.149  0.023 Y 
3 1 C A MET 349 ? ? N A LYS 350 ? ? 1.119 1.336 -0.217 0.023 Y 
4 1 C A ALA 352 ? ? N A ASP 353 ? ? 1.612 1.336 0.276  0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A GLY 151 ? ? C A GLY 151 ? ? N  A PHE 152 ? ? 138.39 117.20 21.19  2.20 Y 
2 1 O  A GLY 151 ? ? C A GLY 151 ? ? N  A PHE 152 ? ? 100.09 122.70 -22.61 1.60 Y 
3 1 C  A GLY 151 ? ? N A PHE 152 ? ? CA A PHE 152 ? ? 157.86 121.70 36.16  2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 2   ? ? 96.78   72.88   
2  1 SER A 10  ? ? -48.02  -16.93  
3  1 GLU A 40  ? ? 53.14   -106.81 
4  1 PHE A 44  ? ? 69.17   -12.39  
5  1 HIS A 54  ? ? -72.66  -83.74  
6  1 ASP A 58  ? ? -64.79  87.16   
7  1 ALA A 59  ? ? -101.02 66.83   
8  1 CYS A 93  ? ? -140.51 -3.93   
9  1 LEU A 94  ? ? -68.84  79.51   
10 1 THR A 138 ? ? -162.49 -71.38  
11 1 ASN A 139 ? ? -45.89  -91.82  
12 1 PHE A 152 ? ? -7.51   -5.88   
13 1 PHE A 198 ? ? -96.50  31.20   
14 1 GLU A 200 ? ? -68.94  7.55    
15 1 ALA A 202 ? ? -158.79 73.09   
16 1 SER A 238 ? ? 61.76   -130.35 
17 1 ARG A 254 ? ? -39.44  132.60  
18 1 LEU A 256 ? ? -23.20  -64.76  
19 1 ASN A 291 ? ? 67.74   79.75   
20 1 CYS A 292 ? ? -162.33 24.50   
21 1 ASN A 293 ? ? 31.05   89.53   
22 1 THR A 299 ? ? -61.89  -72.67  
23 1 SER A 325 ? ? -80.94  -74.65  
24 1 THR A 335 ? ? 54.60   129.12  
25 1 ALA A 339 ? ? -113.74 -80.44  
26 1 LEU A 354 ? ? -87.23  44.88   
27 1 PHE A 376 ? ? -143.55 48.80   
28 1 PRO A 389 ? ? -58.31  176.73  
29 1 ASN A 422 ? ? 91.82   158.00  
30 1 PRO A 423 ? ? -90.16  -145.31 
31 1 PHE A 440 ? ? -136.74 -74.74  
32 1 LEU A 471 ? ? -95.88  42.67   
33 1 ASP A 565 ? ? -130.47 -58.18  
34 1 SER A 572 ? ? -61.17  99.50   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    151 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    152 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -121.52 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLY 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              151 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -10.96 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? B BMA 3 ? 'WRONG HAND' . 
2 1 C1 ? B BMA 4 ? 'WRONG HAND' . 
3 1 C1 ? B BMA 5 ? 'WRONG HAND' . 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A GLY 151 ? ? N A PHE 152 ? ? 1.03 
2 1 C A MET 349 ? ? N A LYS 350 ? ? 1.12 
3 1 C A ALA 352 ? ? N A ASP 353 ? ? 1.61 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 833 ? 5.98 . 
2 1 O ? A HOH 834 ? 6.33 . 
3 1 O ? A HOH 835 ? 6.90 . 
4 1 O ? A HOH 836 ? 7.08 . 
5 1 O ? A HOH 837 ? 8.24 . 
6 1 O ? A HOH 838 ? 8.40 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 254 ? CZ  ? A ARG 254 CZ  
2  1 Y 1 A ARG 254 ? NH1 ? A ARG 254 NH1 
3  1 Y 1 A ARG 254 ? NH2 ? A ARG 254 NH2 
4  1 Y 1 A ARG 454 ? NE  ? A ARG 454 NE  
5  1 Y 1 A ARG 454 ? CZ  ? A ARG 454 CZ  
6  1 Y 1 A ARG 454 ? NH1 ? A ARG 454 NH1 
7  1 Y 1 A ARG 454 ? NH2 ? A ARG 454 NH2 
8  1 Y 1 A GLU 474 ? CD  ? A GLU 474 CD  
9  1 Y 1 A GLU 474 ? OE1 ? A GLU 474 OE1 
10 1 Y 1 A GLU 474 ? OE2 ? A GLU 474 OE2 
11 1 Y 1 A TRP 573 ? CG  ? A TRP 573 CG  
12 1 Y 1 A TRP 573 ? CD1 ? A TRP 573 CD1 
13 1 Y 1 A TRP 573 ? CD2 ? A TRP 573 CD2 
14 1 Y 1 A TRP 573 ? NE1 ? A TRP 573 NE1 
15 1 Y 1 A TRP 573 ? CE2 ? A TRP 573 CE2 
16 1 Y 1 A TRP 573 ? CE3 ? A TRP 573 CE3 
17 1 Y 1 A TRP 573 ? CZ2 ? A TRP 573 CZ2 
18 1 Y 1 A TRP 573 ? CZ3 ? A TRP 573 CZ3 
19 1 Y 1 A TRP 573 ? CH2 ? A TRP 573 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 103 ? A LYS 103 
2  1 Y 1 A ALA 104 ? A ALA 104 
3  1 Y 1 A ARG 105 ? A ARG 105 
4  1 Y 1 A LEU 106 ? A LEU 106 
5  1 Y 1 A ARG 107 ? A ARG 107 
6  1 Y 1 A HIS 108 ? A HIS 108 
7  1 Y 1 A GLY 109 ? A GLY 109 
8  1 Y 1 A ARG 110 ? A ARG 110 
9  1 Y 1 A GLY 111 ? A GLY 111 
10 1 Y 1 A ALA 112 ? A ALA 112 
11 1 Y 1 A ASN 113 ? A ASN 113 
12 1 Y 1 A GLY 114 ? A GLY 114 
13 1 Y 1 A GLY 115 ? A GLY 115 
14 1 Y 1 A GLU 116 ? A GLU 116 
15 1 Y 1 A HIS 117 ? A HIS 117 
16 1 Y 1 A PRO 118 ? A PRO 118 
17 1 Y 1 A ASN 119 ? A ASN 119 
18 1 Y 1 A GLY 120 ? A GLY 120 
19 1 Y 1 A LYS 121 ? A LYS 121 
20 1 Y 1 A GLN 122 ? A GLN 122 
21 1 Y 1 A ALA 123 ? A ALA 123 
22 1 Y 1 A ASP 124 ? A ASP 124 
23 1 Y 1 A THR 125 ? A THR 125 
24 1 Y 1 A ASP 126 ? A ASP 126 
25 1 Y 1 A HIS 127 ? A HIS 127 
26 1 Y 1 A LEU 128 ? A LEU 128 
27 1 Y 1 A ILE 129 ? A ILE 129 
28 1 Y 1 A HIS 130 ? A HIS 130 
29 1 Y 1 A ASN 131 ? A ASN 131 
30 1 Y 1 A GLY 132 ? A GLY 132 
31 1 Y 1 A ASN 133 ? A ASN 133 
32 1 Y 1 A PRO 134 ? A PRO 134 
33 1 Y 1 A GLN 135 ? A GLN 135 
34 1 Y 1 A ALA 574 ? A ALA 574 
35 1 Y 1 A GLY 575 ? A GLY 575 
36 1 Y 1 A THR 576 ? A THR 576 
37 1 Y 1 A CYS 577 ? A CYS 577 
38 1 Y 1 A ASP 578 ? A ASP 578 
39 1 Y 1 A GLY 579 ? A GLY 579 
40 1 Y 1 A ASP 580 ? A ASP 580 
41 1 Y 1 A SER 581 ? A SER 581 
42 1 Y 1 A GLY 582 ? A GLY 582 
43 1 Y 1 A SER 583 ? A SER 583 
44 1 Y 1 A ALA 584 ? A ALA 584 
45 1 Y 1 A SER 585 ? A SER 585 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 991 n 
B 2 NAG 2 B NAG 2 A NAG 993 n 
B 2 BMA 3 B BMA 3 A BMA 994 n 
B 2 BMA 4 B BMA 4 A BMA 996 n 
B 2 BMA 5 B BMA 5 A BMA 995 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DManpb1-3[DManpb1-6]DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-'                                                      
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,5,4/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2-2-2/a4-b1_b4-c1_c3-d1_c6-e1'                WURCS PDB2Glycan 
1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-Manp]{[(3+1)][a-D-Manp]{}[(6+1)][a-D-Manp]{}}}}}' LINUCS PDB-CARE   
?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 2 4 BMA C1 O1 3 BMA O3 HO3 sing ? 
4 2 5 BMA C1 O1 3 BMA O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
2 BMA 4 n 
2 BMA 5 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                                      SO4 
4 '9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' I40 
5 water                                              HOH 
#