data_1QP0
# 
_entry.id   1QP0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QP0         
NDB   PD0057       
RCSB  RCSB009129   
WWPDB D_1000009129 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1BDH . unspecified 
PDB 1QPZ . unspecified 
PDB 1QP4 . unspecified 
PDB 1QP7 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QP0 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Glasfeld, A.'     1 
'Koehler, A.N.'    2 
'Schumacher, M.A.' 3 
'Brennan, R.G.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.' 
J.Mol.Biol. 291 347 361 1999 JMOBAK UK 0022-2836 0070 ? 10438625 10.1006/jmbi.1999.2946 
1       'Crystal Structure of LacI Member, PurR, Bound to DNA: Minor Groove Binding by Alpha Helices' Science     266 763 ?   1994 
SCIEAS US 0036-8075 0038 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Glasfeld, A.'     1 
primary 'Koehler, A.N.'    2 
primary 'Schumacher, M.A.' 3 
primary 'Brennan, R.G.'    4 
1       'Schumacher, M.A.' 5 
1       'Choi, K.Y.'       6 
1       'Zalkin, H.'       7 
1       'Brennan, R.G.'    8 
# 
_cell.entry_id           1QP0 
_cell.length_a           176.470 
_cell.length_b           95.020 
_cell.length_c           81.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QP0 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*CP*CP*GP*GP*TP*TP*GP*CP*GP*T)-3')
;
5203.372  1 ? ? ? ? 
2 polymer     man 'PROTEIN (PURINE NUCLEOTIDE SYNTHESIS REPRESSOR)'                   38091.594 1 ? ? ? ? 
3 non-polymer syn HYPOXANTHINE                                                        136.111   1 ? ? ? ? 
4 water       nat water                                                               18.015    2 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        PURA 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DG)(DC)(DA)(DA)(DC)(DC)(DG)(DG)(DT)(DT)(DG)(DC)(DG)(DT)' TACGCAACCGGTTGCGT M ? 
2 'polypeptide(L)'        no no 
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DC  n 
1 4   DG  n 
1 5   DC  n 
1 6   DA  n 
1 7   DA  n 
1 8   DC  n 
1 9   DC  n 
1 10  DG  n 
1 11  DG  n 
1 12  DT  n 
1 13  DT  n 
1 14  DG  n 
1 15  DC  n 
1 16  DG  n 
1 17  DT  n 
2 1   ALA n 
2 2   THR n 
2 3   ILE n 
2 4   LYS n 
2 5   ASP n 
2 6   VAL n 
2 7   ALA n 
2 8   LYS n 
2 9   ARG n 
2 10  ALA n 
2 11  ASN n 
2 12  VAL n 
2 13  SER n 
2 14  THR n 
2 15  THR n 
2 16  THR n 
2 17  VAL n 
2 18  SER n 
2 19  HIS n 
2 20  VAL n 
2 21  ILE n 
2 22  ASN n 
2 23  LYS n 
2 24  THR n 
2 25  ARG n 
2 26  PHE n 
2 27  VAL n 
2 28  ALA n 
2 29  GLU n 
2 30  GLU n 
2 31  THR n 
2 32  ARG n 
2 33  ASN n 
2 34  ALA n 
2 35  VAL n 
2 36  TRP n 
2 37  ALA n 
2 38  ALA n 
2 39  ILE n 
2 40  LYS n 
2 41  GLU n 
2 42  LEU n 
2 43  HIS n 
2 44  TYR n 
2 45  SER n 
2 46  PRO n 
2 47  SER n 
2 48  ALA n 
2 49  VAL n 
2 50  ALA n 
2 51  ARG n 
2 52  SER n 
2 53  LEU n 
2 54  LYS n 
2 55  VAL n 
2 56  ASN n 
2 57  HIS n 
2 58  THR n 
2 59  LYS n 
2 60  SER n 
2 61  ILE n 
2 62  GLY n 
2 63  LEU n 
2 64  LEU n 
2 65  ALA n 
2 66  THR n 
2 67  SER n 
2 68  SER n 
2 69  GLU n 
2 70  ALA n 
2 71  ALA n 
2 72  TYR n 
2 73  PHE n 
2 74  ALA n 
2 75  GLU n 
2 76  ILE n 
2 77  ILE n 
2 78  GLU n 
2 79  ALA n 
2 80  VAL n 
2 81  GLU n 
2 82  LYS n 
2 83  ASN n 
2 84  CYS n 
2 85  PHE n 
2 86  GLN n 
2 87  LYS n 
2 88  GLY n 
2 89  TYR n 
2 90  THR n 
2 91  LEU n 
2 92  ILE n 
2 93  LEU n 
2 94  GLY n 
2 95  ASN n 
2 96  ALA n 
2 97  TRP n 
2 98  ASN n 
2 99  ASN n 
2 100 LEU n 
2 101 GLU n 
2 102 LYS n 
2 103 GLN n 
2 104 ARG n 
2 105 ALA n 
2 106 TYR n 
2 107 LEU n 
2 108 SER n 
2 109 MET n 
2 110 MET n 
2 111 ALA n 
2 112 GLN n 
2 113 LYS n 
2 114 ARG n 
2 115 VAL n 
2 116 ASP n 
2 117 GLY n 
2 118 LEU n 
2 119 LEU n 
2 120 VAL n 
2 121 MET n 
2 122 CYS n 
2 123 SER n 
2 124 GLU n 
2 125 TYR n 
2 126 PRO n 
2 127 GLU n 
2 128 PRO n 
2 129 LEU n 
2 130 LEU n 
2 131 ALA n 
2 132 MET n 
2 133 LEU n 
2 134 GLU n 
2 135 GLU n 
2 136 TYR n 
2 137 ARG n 
2 138 HIS n 
2 139 ILE n 
2 140 PRO n 
2 141 MET n 
2 142 VAL n 
2 143 VAL n 
2 144 MET n 
2 145 ASP n 
2 146 TRP n 
2 147 GLY n 
2 148 GLU n 
2 149 ALA n 
2 150 LYS n 
2 151 ALA n 
2 152 ASP n 
2 153 PHE n 
2 154 THR n 
2 155 ASP n 
2 156 ALA n 
2 157 VAL n 
2 158 ILE n 
2 159 ASP n 
2 160 ASN n 
2 161 ALA n 
2 162 PHE n 
2 163 GLU n 
2 164 GLY n 
2 165 GLY n 
2 166 TYR n 
2 167 MET n 
2 168 ALA n 
2 169 GLY n 
2 170 ARG n 
2 171 TYR n 
2 172 LEU n 
2 173 ILE n 
2 174 GLU n 
2 175 ARG n 
2 176 GLY n 
2 177 HIS n 
2 178 ARG n 
2 179 GLU n 
2 180 ILE n 
2 181 GLY n 
2 182 VAL n 
2 183 ILE n 
2 184 PRO n 
2 185 GLY n 
2 186 PRO n 
2 187 LEU n 
2 188 GLU n 
2 189 ARG n 
2 190 ASN n 
2 191 THR n 
2 192 GLY n 
2 193 ALA n 
2 194 GLY n 
2 195 ARG n 
2 196 LEU n 
2 197 ALA n 
2 198 GLY n 
2 199 PHE n 
2 200 MET n 
2 201 LYS n 
2 202 ALA n 
2 203 MET n 
2 204 GLU n 
2 205 GLU n 
2 206 ALA n 
2 207 MET n 
2 208 ILE n 
2 209 LYS n 
2 210 VAL n 
2 211 PRO n 
2 212 GLU n 
2 213 SER n 
2 214 TRP n 
2 215 ILE n 
2 216 VAL n 
2 217 GLN n 
2 218 GLY n 
2 219 ASP n 
2 220 PHE n 
2 221 GLU n 
2 222 PRO n 
2 223 GLU n 
2 224 SER n 
2 225 GLY n 
2 226 TYR n 
2 227 ARG n 
2 228 ALA n 
2 229 MET n 
2 230 GLN n 
2 231 GLN n 
2 232 ILE n 
2 233 LEU n 
2 234 SER n 
2 235 GLN n 
2 236 PRO n 
2 237 HIS n 
2 238 ARG n 
2 239 PRO n 
2 240 THR n 
2 241 ALA n 
2 242 VAL n 
2 243 PHE n 
2 244 CYS n 
2 245 GLY n 
2 246 GLY n 
2 247 ASP n 
2 248 ILE n 
2 249 MET n 
2 250 ALA n 
2 251 MET n 
2 252 GLY n 
2 253 ALA n 
2 254 LEU n 
2 255 CYS n 
2 256 ALA n 
2 257 ALA n 
2 258 ASP n 
2 259 GLU n 
2 260 MET n 
2 261 GLY n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 PRO n 
2 266 GLN n 
2 267 ASP n 
2 268 VAL n 
2 269 SER n 
2 270 LEU n 
2 271 ILE n 
2 272 GLY n 
2 273 TYR n 
2 274 ASP n 
2 275 ASN n 
2 276 VAL n 
2 277 ARG n 
2 278 ASN n 
2 279 ALA n 
2 280 ARG n 
2 281 TYR n 
2 282 PHE n 
2 283 THR n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 THR n 
2 288 THR n 
2 289 ILE n 
2 290 HIS n 
2 291 GLN n 
2 292 PRO n 
2 293 LYS n 
2 294 ASP n 
2 295 SER n 
2 296 LEU n 
2 297 GLY n 
2 298 GLU n 
2 299 THR n 
2 300 ALA n 
2 301 PHE n 
2 302 ASN n 
2 303 MET n 
2 304 LEU n 
2 305 LEU n 
2 306 ASP n 
2 307 ARG n 
2 308 ILE n 
2 309 VAL n 
2 310 ASN n 
2 311 LYS n 
2 312 ARG n 
2 313 GLU n 
2 314 GLU n 
2 315 PRO n 
2 316 GLN n 
2 317 SER n 
2 318 ILE n 
2 319 GLU n 
2 320 VAL n 
2 321 HIS n 
2 322 PRO n 
2 323 ARG n 
2 324 LEU n 
2 325 ILE n 
2 326 GLU n 
2 327 ARG n 
2 328 ARG n 
2 329 SER n 
2 330 VAL n 
2 331 ALA n 
2 332 ASP n 
2 333 GLY n 
2 334 PRO n 
2 335 PHE n 
2 336 ARG n 
2 337 ASP n 
2 338 TYR n 
2 339 ARG n 
2 340 ARG n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 PURR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 PURR 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 LAMBDA DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET24A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PDNA100\:K55A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP PURR_ECOLI 2 P0ACP7 ? ? ? 
2 PDB 1QP0       1 1QP0   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QP0 A 1 ? 340 ? P0ACP7 1   ? 340 ? 2   341 
2 2 1QP0 M 1 ? 17  ? 1QP0   699 ? 715 ? 699 715 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
HPA non-polymer         . HYPOXANTHINE                         ? 'C5 H4 N4 O'      136.111 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1QP0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.90 
_exptl_crystal.density_percent_sol   68.49 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, (NH4)2SO4, [Co(NH3)6]Cl3, Na2SO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 '[Co(NH3)6]Cl3' ? ? ? 
1 2 1 Na2SO4          ? ? ? 
1 3 1 '(NH4)2SO4'     ? ? ? 
1 4 1 'PEG 4000'      ? ? ? 
1 5 2 Na2SO4          ? ? ? 
1 6 2 '(NH4)2SO4'     ? ? ? 
1 7 2 'PEG 4000'      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'UCSD MARK III' 
_diffrn_detector.pdbx_collection_date   1996-01-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QP0 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10.0 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   14941 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99. 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              8.9100000 
_reflns.pdbx_netI_over_sigmaI        9.18 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1QP0 
_refine.ls_number_reflns_obs                     14941 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1680000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       
;DNA BASE GEOMETRIES TAKEN FROM CLOWNEY ET AL. (1996) J. AM. CHEM. SOC., VOL. 
118, PP. 509-518. SUGAR PHOSPHATE GEOMETRIES TAKEN FROM GELBIN ET AL. (1996) 
J. AM. CHEM. SOC., VOL. 118, PP. 519-529.
;
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2652 
_refine_hist.pdbx_number_atoms_nucleic_acid   345 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               3009 
_refine_hist.d_res_high                       2.9 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.017 ? 2.1 ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.9   ? 1.8 ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QP0 
_struct.title                     'PURINE REPRESSOR-HYPOXANTHINE-PALINDROMIC OPERATOR COMPLEX' 
_struct.pdbx_descriptor           'PURINE NUCLEOTIDE SYNTHESIS REPRESSOR/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QP0 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'TRANSCRIPTION REGULATION, DNA-BINDING, REPRESSOR, PURINE BIOSYNTHESIS, COMPLEX (DNA-BINDING PROTEIN-DNA), TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE B 3   ? ALA B 10  ? ILE A 4   ALA A 11  1 ? 8  
HELX_P HELX_P2  2  THR B 14  ? ASN B 22  ? THR A 15  ASN A 23  1 ? 9  
HELX_P HELX_P3  3  GLU B 29  ? LEU B 42  ? GLU A 30  LEU A 43  1 ? 14 
HELX_P HELX_P4  4  ALA B 48  ? VAL B 55  ? ALA A 49  VAL A 56  1 ? 8  
HELX_P HELX_P5  5  ALA B 71  ? LYS B 87  ? ALA A 72  LYS A 88  1 ? 17 
HELX_P HELX_P6  6  LEU B 100 ? GLN B 112 ? LEU A 101 GLN A 113 1 ? 13 
HELX_P HELX_P7  7  GLU B 127 ? TYR B 136 ? GLU A 128 TYR A 137 1 ? 10 
HELX_P HELX_P8  8  ALA B 161 ? ARG B 175 ? ALA A 162 ARG A 176 1 ? 15 
HELX_P HELX_P9  9  ASN B 190 ? ALA B 206 ? ASN A 191 ALA A 207 1 ? 17 
HELX_P HELX_P10 10 GLU B 212 ? TRP B 214 ? GLU A 213 TRP A 215 5 ? 3  
HELX_P HELX_P11 11 PRO B 222 ? LEU B 233 ? PRO A 223 LEU A 234 1 ? 12 
HELX_P HELX_P12 12 ASP B 247 ? GLU B 259 ? ASP A 248 GLU A 260 1 ? 13 
HELX_P HELX_P13 13 ALA B 279 ? TYR B 281 ? ALA A 280 TYR A 282 5 ? 3  
HELX_P HELX_P14 14 LYS B 293 ? VAL B 309 ? LYS A 294 VAL A 310 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 A DT 17 N3 ? ? M DA 700 M DT 715 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 A DT 17 O4 ? ? M DA 700 M DT 715 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 3  N3 ? ? ? 1_555 A DG 16 N1 ? ? M DC 701 M DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DC 3  N4 ? ? ? 1_555 A DG 16 O6 ? ? M DC 701 M DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DC 3  O2 ? ? ? 1_555 A DG 16 N2 ? ? M DC 701 M DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 4  N1 ? ? ? 1_555 A DC 15 N3 ? ? M DG 702 M DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 4  N2 ? ? ? 1_555 A DC 15 O2 ? ? M DG 702 M DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4  O6 ? ? ? 1_555 A DC 15 N4 ? ? M DG 702 M DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 5  N3 ? ? ? 1_555 A DG 14 N1 ? ? M DC 703 M DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 5  N4 ? ? ? 1_555 A DG 14 O6 ? ? M DC 703 M DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 5  O2 ? ? ? 1_555 A DG 14 N2 ? ? M DC 703 M DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 6  N1 ? ? ? 1_555 A DT 13 N3 ? ? M DA 704 M DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 6  N6 ? ? ? 1_555 A DT 13 O4 ? ? M DA 704 M DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 7  N1 ? ? ? 1_555 A DT 12 N3 ? ? M DA 705 M DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 7  N6 ? ? ? 1_555 A DT 12 O4 ? ? M DA 705 M DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 8  N3 ? ? ? 1_555 A DG 11 N1 ? ? M DC 706 M DG 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 8  N4 ? ? ? 1_555 A DG 11 O6 ? ? M DC 706 M DG 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 8  O2 ? ? ? 1_555 A DG 11 N2 ? ? M DC 706 M DG 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DC 9  N3 ? ? ? 1_555 A DG 10 N1 ? ? M DC 707 M DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DC 9  N4 ? ? ? 1_555 A DG 10 O6 ? ? M DC 707 M DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 9  O2 ? ? ? 1_555 A DG 10 N2 ? ? M DC 707 M DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DG 10 N1 ? ? ? 1_555 A DC 9  N3 ? ? M DG 708 M DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DG 10 N2 ? ? ? 1_555 A DC 9  O2 ? ? M DG 708 M DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DG 10 O6 ? ? ? 1_555 A DC 9  N4 ? ? M DG 708 M DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DG 11 N1 ? ? ? 1_555 A DC 8  N3 ? ? M DG 709 M DC 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 11 N2 ? ? ? 1_555 A DC 8  O2 ? ? M DG 709 M DC 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 11 O6 ? ? ? 1_555 A DC 8  N4 ? ? M DG 709 M DC 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 12 N3 ? ? ? 1_555 A DA 7  N1 ? ? M DT 710 M DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DT 12 O4 ? ? ? 1_555 A DA 7  N6 ? ? M DT 710 M DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 13 N3 ? ? ? 1_555 A DA 6  N1 ? ? M DT 711 M DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 13 O4 ? ? ? 1_555 A DA 6  N6 ? ? M DT 711 M DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DG 14 N1 ? ? ? 1_555 A DC 5  N3 ? ? M DG 712 M DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DG 14 N2 ? ? ? 1_555 A DC 5  O2 ? ? M DG 712 M DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DG 14 O6 ? ? ? 1_555 A DC 5  N4 ? ? M DG 712 M DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DC 15 N3 ? ? ? 1_555 A DG 4  N1 ? ? M DC 713 M DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DC 15 N4 ? ? ? 1_555 A DG 4  O6 ? ? M DC 713 M DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DC 15 O2 ? ? ? 1_555 A DG 4  N2 ? ? M DC 713 M DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DG 16 N1 ? ? ? 1_555 A DC 3  N3 ? ? M DG 714 M DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DG 16 N2 ? ? ? 1_555 A DC 3  O2 ? ? M DG 714 M DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DG 16 O6 ? ? ? 1_555 A DC 3  N4 ? ? M DG 714 M DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DT 17 N3 ? ? ? 1_555 A DA 2  N1 ? ? M DT 715 M DA 700 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DT 17 O4 ? ? ? 1_555 A DA 2  N6 ? ? M DT 715 M DA 700 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 264 B . ? VAL 265 A PRO 265 B ? PRO 266 A 1 2.94 
2 THR 283 B . ? THR 284 A PRO 284 B ? PRO 285 A 1 1.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR B 90  ? ASN B 95  ? THR A 91  ASN A 96  
A 2 SER B 60  ? ALA B 65  ? SER A 61  ALA A 66  
A 3 GLY B 117 ? VAL B 120 ? GLY A 118 VAL A 121 
A 4 MET B 141 ? TRP B 146 ? MET A 142 TRP A 147 
A 5 ASP B 155 ? ILE B 158 ? ASP A 156 ILE A 159 
A 6 SER B 317 ? GLU B 319 ? SER A 318 GLU A 320 
B 1 ILE B 180 ? ILE B 183 ? ILE A 181 ILE A 184 
B 2 ALA B 241 ? CYS B 244 ? ALA A 242 CYS A 245 
B 3 SER B 269 ? ASP B 274 ? SER A 270 ASP A 275 
B 4 THR B 287 ? HIS B 290 ? THR A 288 HIS A 291 
B 5 ARG B 323 ? ILE B 325 ? ARG A 324 ILE A 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE B 92  ? O ILE A 93  N LEU B 63  ? N LEU A 64  
A 2 3 N LEU B 64  ? N LEU A 65  O LEU B 119 ? O LEU A 120 
A 3 4 N VAL B 120 ? N VAL A 121 O MET B 144 ? O MET A 145 
A 4 5 N VAL B 143 ? N VAL A 144 O ASP B 155 ? O ASP A 156 
A 5 6 N ILE B 158 ? N ILE A 159 O ILE B 318 ? O ILE A 319 
B 1 2 N GLY B 181 ? N GLY A 182 O PHE B 243 ? O PHE A 244 
B 2 3 N VAL B 242 ? N VAL A 243 O ILE B 271 ? O ILE A 272 
B 3 4 N ASP B 274 ? N ASP A 275 O ILE B 289 ? O ILE A 290 
B 4 5 N HIS B 290 ? N HIS A 291 O ARG B 323 ? O ARG A 324 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE HPA A 599' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 TYR B 72  ? TYR A 73  . ? 1_555 ? 
2 AC1 7 PHE B 73  ? PHE A 74  . ? 1_555 ? 
3 AC1 7 ARG B 189 ? ARG A 190 . ? 1_555 ? 
4 AC1 7 THR B 191 ? THR A 192 . ? 1_555 ? 
5 AC1 7 ARG B 195 ? ARG A 196 . ? 1_555 ? 
6 AC1 7 PHE B 220 ? PHE A 221 . ? 1_555 ? 
7 AC1 7 ASP B 274 ? ASP A 275 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QP0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QP0 
_atom_sites.fract_transf_matrix[1][1]   0.005667 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010524 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012338 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 7.338  27.082  19.342  1.00 33.72  ? 699 DT  M "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 7.257  26.795  20.729  1.00 46.67  ? 699 DT  M "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 7.348  25.297  21.017  1.00 100.00 ? 699 DT  M "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 6.228  24.569  20.485  1.00 37.85  ? 699 DT  M "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 8.581  24.588  20.494  1.00 11.38  ? 699 DT  M "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 9.283  24.077  21.614  1.00 88.42  ? 699 DT  M "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 8.038  23.413  19.671  1.00 58.27  ? 699 DT  M "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 6.638  23.249  20.237  1.00 58.68  ? 699 DT  M "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 5.657  22.686  19.307  1.00 65.95  ? 699 DT  M N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 4.903  21.613  19.716  1.00 4.81   ? 699 DT  M C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 5.036  21.080  20.810  1.00 70.67  ? 699 DT  M O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 3.995  21.166  18.783  1.00 100.00 ? 699 DT  M N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 3.768  21.691  17.522  1.00 9.87   ? 699 DT  M C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 2.913  21.195  16.793  1.00 81.04  ? 699 DT  M O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 4.586  22.828  17.177  1.00 94.96  ? 699 DT  M C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 4.405  23.469  15.843  1.00 4.09   ? 699 DT  M C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 5.481  23.259  18.071  1.00 1.57   ? 699 DT  M C6    1 
ATOM   18   P P     . DA  A 1 2   ? 10.500 23.084  21.365  1.00 21.73  ? 700 DA  M P     1 
ATOM   19   O OP1   . DA  A 1 2   ? 11.217 22.912  22.640  1.00 43.61  ? 700 DA  M OP1   1 
ATOM   20   O OP2   . DA  A 1 2   ? 11.202 23.555  20.140  1.00 53.84  ? 700 DA  M OP2   1 
ATOM   21   O "O5'" . DA  A 1 2   ? 9.827  21.685  21.071  1.00 26.66  ? 700 DA  M "O5'" 1 
ATOM   22   C "C5'" . DA  A 1 2   ? 9.547  20.791  22.139  1.00 34.83  ? 700 DA  M "C5'" 1 
ATOM   23   C "C4'" . DA  A 1 2   ? 9.145  19.493  21.521  1.00 83.40  ? 700 DA  M "C4'" 1 
ATOM   24   O "O4'" . DA  A 1 2   ? 8.381  19.843  20.369  1.00 24.59  ? 700 DA  M "O4'" 1 
ATOM   25   C "C3'" . DA  A 1 2   ? 10.353 18.695  21.006  1.00 100.00 ? 700 DA  M "C3'" 1 
ATOM   26   O "O3'" . DA  A 1 2   ? 10.427 17.423  21.662  1.00 59.20  ? 700 DA  M "O3'" 1 
ATOM   27   C "C2'" . DA  A 1 2   ? 10.073 18.455  19.531  1.00 17.09  ? 700 DA  M "C2'" 1 
ATOM   28   C "C1'" . DA  A 1 2   ? 8.642  18.901  19.355  1.00 28.97  ? 700 DA  M "C1'" 1 
ATOM   29   N N9    . DA  A 1 2   ? 8.449  19.580  18.098  1.00 12.96  ? 700 DA  M N9    1 
ATOM   30   C C8    . DA  A 1 2   ? 9.250  20.543  17.548  1.00 100.00 ? 700 DA  M C8    1 
ATOM   31   N N7    . DA  A 1 2   ? 8.815  20.994  16.400  1.00 41.70  ? 700 DA  M N7    1 
ATOM   32   C C5    . DA  A 1 2   ? 7.653  20.279  16.188  1.00 10.92  ? 700 DA  M C5    1 
ATOM   33   C C6    . DA  A 1 2   ? 6.720  20.293  15.149  1.00 47.11  ? 700 DA  M C6    1 
ATOM   34   N N6    . DA  A 1 2   ? 6.824  21.082  14.079  1.00 35.47  ? 700 DA  M N6    1 
ATOM   35   N N1    . DA  A 1 2   ? 5.662  19.463  15.243  1.00 22.80  ? 700 DA  M N1    1 
ATOM   36   C C2    . DA  A 1 2   ? 5.565  18.665  16.313  1.00 21.80  ? 700 DA  M C2    1 
ATOM   37   N N3    . DA  A 1 2   ? 6.377  18.559  17.359  1.00 76.66  ? 700 DA  M N3    1 
ATOM   38   C C4    . DA  A 1 2   ? 7.414  19.402  17.229  1.00 61.22  ? 700 DA  M C4    1 
ATOM   39   P P     . DC  A 1 3   ? 10.975 16.116  20.882  1.00 45.56  ? 701 DC  M P     1 
ATOM   40   O OP1   . DC  A 1 3   ? 10.948 14.954  21.834  1.00 27.40  ? 701 DC  M OP1   1 
ATOM   41   O OP2   . DC  A 1 3   ? 12.156 16.351  20.022  1.00 39.38  ? 701 DC  M OP2   1 
ATOM   42   O "O5'" . DC  A 1 3   ? 9.860  15.782  19.846  1.00 41.81  ? 701 DC  M "O5'" 1 
ATOM   43   C "C5'" . DC  A 1 3   ? 9.257  14.497  19.874  1.00 38.42  ? 701 DC  M "C5'" 1 
ATOM   44   C "C4'" . DC  A 1 3   ? 8.235  14.394  18.778  1.00 27.81  ? 701 DC  M "C4'" 1 
ATOM   45   O "O4'" . DC  A 1 3   ? 8.334  15.578  17.989  1.00 26.37  ? 701 DC  M "O4'" 1 
ATOM   46   C "C3'" . DC  A 1 3   ? 8.503  13.260  17.832  1.00 13.05  ? 701 DC  M "C3'" 1 
ATOM   47   O "O3'" . DC  A 1 3   ? 7.765  12.132  18.292  1.00 30.80  ? 701 DC  M "O3'" 1 
ATOM   48   C "C2'" . DC  A 1 3   ? 7.972  13.770  16.496  1.00 16.39  ? 701 DC  M "C2'" 1 
ATOM   49   C "C1'" . DC  A 1 3   ? 7.768  15.285  16.741  1.00 20.66  ? 701 DC  M "C1'" 1 
ATOM   50   N N1    . DC  A 1 3   ? 8.208  16.276  15.743  1.00 22.98  ? 701 DC  M N1    1 
ATOM   51   C C2    . DC  A 1 3   ? 7.436  16.373  14.596  1.00 31.76  ? 701 DC  M C2    1 
ATOM   52   O O2    . DC  A 1 3   ? 6.468  15.596  14.482  1.00 59.20  ? 701 DC  M O2    1 
ATOM   53   N N3    . DC  A 1 3   ? 7.758  17.274  13.633  1.00 62.52  ? 701 DC  M N3    1 
ATOM   54   C C4    . DC  A 1 3   ? 8.796  18.074  13.800  1.00 15.39  ? 701 DC  M C4    1 
ATOM   55   N N4    . DC  A 1 3   ? 9.061  18.941  12.826  1.00 67.08  ? 701 DC  M N4    1 
ATOM   56   C C5    . DC  A 1 3   ? 9.599  18.027  14.981  1.00 21.38  ? 701 DC  M C5    1 
ATOM   57   C C6    . DC  A 1 3   ? 9.261  17.129  15.933  1.00 21.62  ? 701 DC  M C6    1 
ATOM   58   P P     . DG  A 1 4   ? 7.879  10.768  17.495  1.00 38.86  ? 702 DG  M P     1 
ATOM   59   O OP1   . DG  A 1 4   ? 7.484  9.775   18.521  1.00 44.04  ? 702 DG  M OP1   1 
ATOM   60   O OP2   . DG  A 1 4   ? 9.126  10.546  16.707  1.00 36.31  ? 702 DG  M OP2   1 
ATOM   61   O "O5'" . DG  A 1 4   ? 6.763  10.898  16.377  1.00 52.29  ? 702 DG  M "O5'" 1 
ATOM   62   C "C5'" . DG  A 1 4   ? 5.404  10.690  16.695  1.00 40.46  ? 702 DG  M "C5'" 1 
ATOM   63   C "C4'" . DG  A 1 4   ? 4.557  10.584  15.440  1.00 17.72  ? 702 DG  M "C4'" 1 
ATOM   64   O "O4'" . DG  A 1 4   ? 4.805  11.693  14.541  1.00 96.49  ? 702 DG  M "O4'" 1 
ATOM   65   C "C3'" . DG  A 1 4   ? 4.793  9.323   14.608  1.00 44.57  ? 702 DG  M "C3'" 1 
ATOM   66   O "O3'" . DG  A 1 4   ? 3.565  8.957   13.969  1.00 100.00 ? 702 DG  M "O3'" 1 
ATOM   67   C "C2'" . DG  A 1 4   ? 5.775  9.812   13.556  1.00 100.00 ? 702 DG  M "C2'" 1 
ATOM   68   C "C1'" . DG  A 1 4   ? 5.259  11.216  13.277  1.00 13.03  ? 702 DG  M "C1'" 1 
ATOM   69   N N9    . DG  A 1 4   ? 6.265  12.173  12.810  1.00 52.55  ? 702 DG  M N9    1 
ATOM   70   C C8    . DG  A 1 4   ? 7.432  12.498  13.459  1.00 68.89  ? 702 DG  M C8    1 
ATOM   71   N N7    . DG  A 1 4   ? 8.125  13.420  12.843  1.00 22.30  ? 702 DG  M N7    1 
ATOM   72   C C5    . DG  A 1 4   ? 7.381  13.726  11.716  1.00 14.90  ? 702 DG  M C5    1 
ATOM   73   C C6    . DG  A 1 4   ? 7.636  14.663  10.677  1.00 30.90  ? 702 DG  M C6    1 
ATOM   74   O O6    . DG  A 1 4   ? 8.602  15.414  10.536  1.00 30.58  ? 702 DG  M O6    1 
ATOM   75   N N1    . DG  A 1 4   ? 6.617  14.687  9.739   1.00 31.39  ? 702 DG  M N1    1 
ATOM   76   C C2    . DG  A 1 4   ? 5.494  13.910  9.787   1.00 36.33  ? 702 DG  M C2    1 
ATOM   77   N N2    . DG  A 1 4   ? 4.639  14.088  8.767   1.00 19.62  ? 702 DG  M N2    1 
ATOM   78   N N3    . DG  A 1 4   ? 5.234  13.024  10.752  1.00 14.76  ? 702 DG  M N3    1 
ATOM   79   C C4    . DG  A 1 4   ? 6.213  12.986  11.684  1.00 100.00 ? 702 DG  M C4    1 
ATOM   80   P P     . DC  A 1 5   ? 3.380  7.495   13.343  1.00 45.13  ? 703 DC  M P     1 
ATOM   81   O OP1   . DC  A 1 5   ? 2.333  6.814   14.144  1.00 100.00 ? 703 DC  M OP1   1 
ATOM   82   O OP2   . DC  A 1 5   ? 4.717  6.861   13.195  1.00 100.00 ? 703 DC  M OP2   1 
ATOM   83   O "O5'" . DC  A 1 5   ? 2.795  7.805   11.901  1.00 23.00  ? 703 DC  M "O5'" 1 
ATOM   84   C "C5'" . DC  A 1 5   ? 2.704  9.148   11.467  1.00 43.90  ? 703 DC  M "C5'" 1 
ATOM   85   C "C4'" . DC  A 1 5   ? 1.890  9.231   10.206  1.00 38.88  ? 703 DC  M "C4'" 1 
ATOM   86   O "O4'" . DC  A 1 5   ? 2.529  10.132  9.276   1.00 70.18  ? 703 DC  M "O4'" 1 
ATOM   87   C "C3'" . DC  A 1 5   ? 1.827  7.928   9.445   1.00 24.47  ? 703 DC  M "C3'" 1 
ATOM   88   O "O3'" . DC  A 1 5   ? 0.845  8.068   8.425   1.00 90.60  ? 703 DC  M "O3'" 1 
ATOM   89   C "C2'" . DC  A 1 5   ? 3.177  7.915   8.767   1.00 90.74  ? 703 DC  M "C2'" 1 
ATOM   90   C "C1'" . DC  A 1 5   ? 3.391  9.382   8.419   1.00 35.06  ? 703 DC  M "C1'" 1 
ATOM   91   N N1    . DC  A 1 5   ? 4.755  9.836   8.650   1.00 38.51  ? 703 DC  M N1    1 
ATOM   92   C C2    . DC  A 1 5   ? 5.263  10.878  7.877   1.00 100.00 ? 703 DC  M C2    1 
ATOM   93   O O2    . DC  A 1 5   ? 4.560  11.412  6.994   1.00 31.76  ? 703 DC  M O2    1 
ATOM   94   N N3    . DC  A 1 5   ? 6.531  11.300  8.102   1.00 23.97  ? 703 DC  M N3    1 
ATOM   95   C C4    . DC  A 1 5   ? 7.281  10.744  9.044   1.00 77.58  ? 703 DC  M C4    1 
ATOM   96   N N4    . DC  A 1 5   ? 8.514  11.215  9.204   1.00 41.79  ? 703 DC  M N4    1 
ATOM   97   C C5    . DC  A 1 5   ? 6.779  9.669   9.841   1.00 60.44  ? 703 DC  M C5    1 
ATOM   98   C C6    . DC  A 1 5   ? 5.519  9.254   9.612   1.00 65.75  ? 703 DC  M C6    1 
ATOM   99   P P     . DA  A 1 6   ? 0.406  6.785   7.572   1.00 57.37  ? 704 DA  M P     1 
ATOM   100  O OP1   . DA  A 1 6   ? -0.991 7.071   7.171   1.00 100.00 ? 704 DA  M OP1   1 
ATOM   101  O OP2   . DA  A 1 6   ? 0.715  5.545   8.334   1.00 55.54  ? 704 DA  M OP2   1 
ATOM   102  O "O5'" . DA  A 1 6   ? 1.286  6.877   6.250   1.00 59.76  ? 704 DA  M "O5'" 1 
ATOM   103  C "C5'" . DA  A 1 6   ? 1.322  8.088   5.506   1.00 30.43  ? 704 DA  M "C5'" 1 
ATOM   104  C "C4'" . DA  A 1 6   ? 2.337  8.013   4.388   1.00 100.00 ? 704 DA  M "C4'" 1 
ATOM   105  O "O4'" . DA  A 1 6   ? 3.661  8.351   4.880   1.00 100.00 ? 704 DA  M "O4'" 1 
ATOM   106  C "C3'" . DA  A 1 6   ? 2.491  6.634   3.744   1.00 43.89  ? 704 DA  M "C3'" 1 
ATOM   107  O "O3'" . DA  A 1 6   ? 2.987  6.866   2.429   1.00 68.96  ? 704 DA  M "O3'" 1 
ATOM   108  C "C2'" . DA  A 1 6   ? 3.630  6.050   4.567   1.00 90.17  ? 704 DA  M "C2'" 1 
ATOM   109  C "C1'" . DA  A 1 6   ? 4.545  7.264   4.623   1.00 100.00 ? 704 DA  M "C1'" 1 
ATOM   110  N N9    . DA  A 1 6   ? 5.580  7.247   5.663   1.00 38.83  ? 704 DA  M N9    1 
ATOM   111  C C8    . DA  A 1 6   ? 5.617  6.488   6.805   1.00 100.00 ? 704 DA  M C8    1 
ATOM   112  N N7    . DA  A 1 6   ? 6.677  6.702   7.547   1.00 27.78  ? 704 DA  M N7    1 
ATOM   113  C C5    . DA  A 1 6   ? 7.385  7.671   6.855   1.00 100.00 ? 704 DA  M C5    1 
ATOM   114  C C6    . DA  A 1 6   ? 8.602  8.322   7.126   1.00 13.79  ? 704 DA  M C6    1 
ATOM   115  N N6    . DA  A 1 6   ? 9.335  8.081   8.217   1.00 44.68  ? 704 DA  M N6    1 
ATOM   116  N N1    . DA  A 1 6   ? 9.033  9.238   6.231   1.00 43.05  ? 704 DA  M N1    1 
ATOM   117  C C2    . DA  A 1 6   ? 8.288  9.473   5.139   1.00 35.65  ? 704 DA  M C2    1 
ATOM   118  N N3    . DA  A 1 6   ? 7.126  8.928   4.773   1.00 51.33  ? 704 DA  M N3    1 
ATOM   119  C C4    . DA  A 1 6   ? 6.724  8.019   5.687   1.00 23.45  ? 704 DA  M C4    1 
ATOM   120  P P     . DA  A 1 7   ? 2.456  6.044   1.166   1.00 77.66  ? 705 DA  M P     1 
ATOM   121  O OP1   . DA  A 1 7   ? 1.004  6.309   1.002   1.00 100.00 ? 705 DA  M OP1   1 
ATOM   122  O OP2   . DA  A 1 7   ? 2.961  4.646   1.209   1.00 67.87  ? 705 DA  M OP2   1 
ATOM   123  O "O5'" . DA  A 1 7   ? 3.183  6.802   -0.017  1.00 77.53  ? 705 DA  M "O5'" 1 
ATOM   124  C "C5'" . DA  A 1 7   ? 3.601  8.143   0.180   1.00 100.00 ? 705 DA  M "C5'" 1 
ATOM   125  C "C4'" . DA  A 1 7   ? 4.972  8.376   -0.403  1.00 50.41  ? 705 DA  M "C4'" 1 
ATOM   126  O "O4'" . DA  A 1 7   ? 5.983  8.240   0.618   1.00 73.41  ? 705 DA  M "O4'" 1 
ATOM   127  C "C3'" . DA  A 1 7   ? 5.352  7.395   -1.498  1.00 62.90  ? 705 DA  M "C3'" 1 
ATOM   128  O "O3'" . DA  A 1 7   ? 6.164  8.090   -2.434  1.00 46.14  ? 705 DA  M "O3'" 1 
ATOM   129  C "C2'" . DA  A 1 7   ? 6.193  6.366   -0.764  1.00 17.59  ? 705 DA  M "C2'" 1 
ATOM   130  C "C1'" . DA  A 1 7   ? 6.913  7.236   0.245   1.00 85.19  ? 705 DA  M "C1'" 1 
ATOM   131  N N9    . DA  A 1 7   ? 7.329  6.572   1.474   1.00 19.17  ? 705 DA  M N9    1 
ATOM   132  C C8    . DA  A 1 7   ? 6.720  5.542   2.148   1.00 38.30  ? 705 DA  M C8    1 
ATOM   133  N N7    . DA  A 1 7   ? 7.344  5.199   3.257   1.00 34.99  ? 705 DA  M N7    1 
ATOM   134  C C5    . DA  A 1 7   ? 8.425  6.072   3.312   1.00 59.46  ? 705 DA  M C5    1 
ATOM   135  C C6    . DA  A 1 7   ? 9.474  6.239   4.239   1.00 1.00   ? 705 DA  M C6    1 
ATOM   136  N N6    . DA  A 1 7   ? 9.628  5.508   5.343   1.00 26.60  ? 705 DA  M N6    1 
ATOM   137  N N1    . DA  A 1 7   ? 10.377 7.203   3.983   1.00 26.76  ? 705 DA  M N1    1 
ATOM   138  C C2    . DA  A 1 7   ? 10.240 7.942   2.874   1.00 10.43  ? 705 DA  M C2    1 
ATOM   139  N N3    . DA  A 1 7   ? 9.299  7.890   1.934   1.00 32.99  ? 705 DA  M N3    1 
ATOM   140  C C4    . DA  A 1 7   ? 8.415  6.925   2.220   1.00 33.12  ? 705 DA  M C4    1 
ATOM   141  P P     . DC  A 1 8   ? 6.441  7.430   -3.860  1.00 100.00 ? 706 DC  M P     1 
ATOM   142  O OP1   . DC  A 1 8   ? 6.076  8.413   -4.915  1.00 52.61  ? 706 DC  M OP1   1 
ATOM   143  O OP2   . DC  A 1 8   ? 5.813  6.080   -3.817  1.00 33.37  ? 706 DC  M OP2   1 
ATOM   144  O "O5'" . DC  A 1 8   ? 8.021  7.327   -3.916  1.00 100.00 ? 706 DC  M "O5'" 1 
ATOM   145  C "C5'" . DC  A 1 8   ? 8.812  8.425   -3.479  1.00 100.00 ? 706 DC  M "C5'" 1 
ATOM   146  C "C4'" . DC  A 1 8   ? 10.205 7.984   -3.064  1.00 100.00 ? 706 DC  M "C4'" 1 
ATOM   147  O "O4'" . DC  A 1 8   ? 10.156 7.384   -1.751  1.00 35.09  ? 706 DC  M "O4'" 1 
ATOM   148  C "C3'" . DC  A 1 8   ? 10.828 6.913   -3.976  1.00 60.96  ? 706 DC  M "C3'" 1 
ATOM   149  O "O3'" . DC  A 1 8   ? 12.132 7.341   -4.385  1.00 100.00 ? 706 DC  M "O3'" 1 
ATOM   150  C "C2'" . DC  A 1 8   ? 10.959 5.686   -3.091  1.00 27.03  ? 706 DC  M "C2'" 1 
ATOM   151  C "C1'" . DC  A 1 8   ? 11.091 6.328   -1.726  1.00 64.18  ? 706 DC  M "C1'" 1 
ATOM   152  N N1    . DC  A 1 8   ? 10.782 5.492   -0.556  1.00 29.99  ? 706 DC  M N1    1 
ATOM   153  C C2    . DC  A 1 8   ? 11.623 5.572   0.557   1.00 51.76  ? 706 DC  M C2    1 
ATOM   154  O O2    . DC  A 1 8   ? 12.608 6.319   0.503   1.00 37.45  ? 706 DC  M O2    1 
ATOM   155  N N3    . DC  A 1 8   ? 11.355 4.826   1.651   1.00 32.20  ? 706 DC  M N3    1 
ATOM   156  C C4    . DC  A 1 8   ? 10.286 4.032   1.661   1.00 20.94  ? 706 DC  M C4    1 
ATOM   157  N N4    . DC  A 1 8   ? 10.054 3.312   2.760   1.00 41.37  ? 706 DC  M N4    1 
ATOM   158  C C5    . DC  A 1 8   ? 9.409  3.939   0.543   1.00 43.62  ? 706 DC  M C5    1 
ATOM   159  C C6    . DC  A 1 8   ? 9.688  4.686   -0.532  1.00 27.30  ? 706 DC  M C6    1 
ATOM   160  P P     . DC  A 1 9   ? 12.569 6.950   -5.868  1.00 100.00 ? 707 DC  M P     1 
ATOM   161  O OP1   . DC  A 1 9   ? 12.307 8.134   -6.727  1.00 61.27  ? 707 DC  M OP1   1 
ATOM   162  O OP2   . DC  A 1 9   ? 11.828 5.681   -6.149  1.00 37.03  ? 707 DC  M OP2   1 
ATOM   163  O "O5'" . DC  A 1 9   ? 14.137 6.687   -5.733  1.00 100.00 ? 707 DC  M "O5'" 1 
ATOM   164  C "C5'" . DC  A 1 9   ? 15.009 7.507   -4.952  1.00 100.00 ? 707 DC  M "C5'" 1 
ATOM   165  C "C4'" . DC  A 1 9   ? 16.036 6.618   -4.331  1.00 49.25  ? 707 DC  M "C4'" 1 
ATOM   166  O "O4'" . DC  A 1 9   ? 15.512 6.108   -3.093  1.00 28.16  ? 707 DC  M "O4'" 1 
ATOM   167  C "C3'" . DC  A 1 9   ? 16.285 5.390   -5.128  1.00 10.69  ? 707 DC  M "C3'" 1 
ATOM   168  O "O3'" . DC  A 1 9   ? 17.330 5.578   -6.070  1.00 24.42  ? 707 DC  M "O3'" 1 
ATOM   169  C "C2'" . DC  A 1 9   ? 16.706 4.364   -4.119  1.00 23.54  ? 707 DC  M "C2'" 1 
ATOM   170  C "C1'" . DC  A 1 9   ? 16.139 4.887   -2.794  1.00 20.62  ? 707 DC  M "C1'" 1 
ATOM   171  N N1    . DC  A 1 9   ? 15.125 4.027   -2.172  1.00 29.90  ? 707 DC  M N1    1 
ATOM   172  C C2    . DC  A 1 9   ? 15.191 3.756   -0.796  1.00 57.25  ? 707 DC  M C2    1 
ATOM   173  O O2    . DC  A 1 9   ? 16.096 4.263   -0.133  1.00 13.29  ? 707 DC  M O2    1 
ATOM   174  N N3    . DC  A 1 9   ? 14.267 2.951   -0.227  1.00 40.31  ? 707 DC  M N3    1 
ATOM   175  C C4    . DC  A 1 9   ? 13.312 2.423   -0.986  1.00 10.50  ? 707 DC  M C4    1 
ATOM   176  N N4    . DC  A 1 9   ? 12.417 1.638   -0.387  1.00 100.00 ? 707 DC  M N4    1 
ATOM   177  C C5    . DC  A 1 9   ? 13.227 2.673   -2.393  1.00 39.00  ? 707 DC  M C5    1 
ATOM   178  C C6    . DC  A 1 9   ? 14.146 3.473   -2.936  1.00 43.17  ? 707 DC  M C6    1 
ATOM   179  P P     . DG  A 1 10  ? 17.083 5.245   -7.628  1.00 19.81  ? 708 DG  M P     1 
ATOM   180  O OP1   . DG  A 1 10  ? 17.989 6.026   -8.539  1.00 46.43  ? 708 DG  M OP1   1 
ATOM   181  O OP2   . DG  A 1 10  ? 15.601 5.303   -7.824  1.00 100.00 ? 708 DG  M OP2   1 
ATOM   182  O "O5'" . DG  A 1 10  ? 17.510 3.653   -7.671  1.00 56.47  ? 708 DG  M "O5'" 1 
ATOM   183  C "C5'" . DG  A 1 10  ? 18.752 3.273   -7.118  1.00 28.69  ? 708 DG  M "C5'" 1 
ATOM   184  C "C4'" . DG  A 1 10  ? 18.811 1.778   -6.931  1.00 40.02  ? 708 DG  M "C4'" 1 
ATOM   185  O "O4'" . DG  A 1 10  ? 17.899 1.375   -5.888  1.00 37.99  ? 708 DG  M "O4'" 1 
ATOM   186  C "C3'" . DG  A 1 10  ? 18.443 0.947   -8.175  1.00 84.53  ? 708 DG  M "C3'" 1 
ATOM   187  O "O3'" . DG  A 1 10  ? 19.359 -0.149  -8.300  1.00 33.15  ? 708 DG  M "O3'" 1 
ATOM   188  C "C2'" . DG  A 1 10  ? 17.063 0.425   -7.823  1.00 11.47  ? 708 DG  M "C2'" 1 
ATOM   189  C "C1'" . DG  A 1 10  ? 17.221 0.217   -6.317  1.00 21.21  ? 708 DG  M "C1'" 1 
ATOM   190  N N9    . DG  A 1 10  ? 15.989 0.157   -5.528  1.00 44.96  ? 708 DG  M N9    1 
ATOM   191  C C8    . DG  A 1 10  ? 14.807 0.826   -5.723  1.00 33.34  ? 708 DG  M C8    1 
ATOM   192  N N7    . DG  A 1 10  ? 13.909 0.555   -4.823  1.00 40.22  ? 708 DG  M N7    1 
ATOM   193  C C5    . DG  A 1 10  ? 14.531 -0.364  -3.973  1.00 11.99  ? 708 DG  M C5    1 
ATOM   194  C C6    . DG  A 1 10  ? 14.051 -1.000  -2.779  1.00 8.53   ? 708 DG  M C6    1 
ATOM   195  O O6    . DG  A 1 10  ? 12.935 -0.919  -2.240  1.00 100.00 ? 708 DG  M O6    1 
ATOM   196  N N1    . DG  A 1 10  ? 15.004 -1.830  -2.225  1.00 36.96  ? 708 DG  M N1    1 
ATOM   197  C C2    . DG  A 1 10  ? 16.270 -2.002  -2.728  1.00 100.00 ? 708 DG  M C2    1 
ATOM   198  N N2    . DG  A 1 10  ? 17.031 -2.831  -2.007  1.00 13.75  ? 708 DG  M N2    1 
ATOM   199  N N3    . DG  A 1 10  ? 16.741 -1.399  -3.819  1.00 6.82   ? 708 DG  M N3    1 
ATOM   200  C C4    . DG  A 1 10  ? 15.808 -0.603  -4.377  1.00 56.19  ? 708 DG  M C4    1 
ATOM   201  P P     . DG  A 1 11  ? 19.674 -0.750  -9.755  1.00 36.82  ? 709 DG  M P     1 
ATOM   202  O OP1   . DG  A 1 11  ? 20.777 0.014   -10.391 1.00 56.47  ? 709 DG  M OP1   1 
ATOM   203  O OP2   . DG  A 1 11  ? 18.386 -0.880  -10.496 1.00 48.37  ? 709 DG  M OP2   1 
ATOM   204  O "O5'" . DG  A 1 11  ? 20.219 -2.192  -9.373  1.00 21.35  ? 709 DG  M "O5'" 1 
ATOM   205  C "C5'" . DG  A 1 11  ? 19.354 -3.319  -9.343  1.00 39.96  ? 709 DG  M "C5'" 1 
ATOM   206  C "C4'" . DG  A 1 11  ? 19.181 -3.820  -7.933  1.00 14.16  ? 709 DG  M "C4'" 1 
ATOM   207  O "O4'" . DG  A 1 11  ? 18.159 -3.050  -7.263  1.00 47.94  ? 709 DG  M "O4'" 1 
ATOM   208  C "C3'" . DG  A 1 11  ? 18.698 -5.267  -7.837  1.00 42.26  ? 709 DG  M "C3'" 1 
ATOM   209  O "O3'" . DG  A 1 11  ? 19.819 -6.132  -7.714  1.00 39.09  ? 709 DG  M "O3'" 1 
ATOM   210  C "C2'" . DG  A 1 11  ? 17.916 -5.311  -6.531  1.00 24.65  ? 709 DG  M "C2'" 1 
ATOM   211  C "C1'" . DG  A 1 11  ? 17.562 -3.854  -6.247  1.00 51.14  ? 709 DG  M "C1'" 1 
ATOM   212  N N9    . DG  A 1 11  ? 16.134 -3.566  -6.219  1.00 65.18  ? 709 DG  M N9    1 
ATOM   213  C C8    . DG  A 1 11  ? 15.436 -2.814  -7.127  1.00 37.93  ? 709 DG  M C8    1 
ATOM   214  N N7    . DG  A 1 11  ? 14.173 -2.704  -6.833  1.00 19.23  ? 709 DG  M N7    1 
ATOM   215  C C5    . DG  A 1 11  ? 14.025 -3.435  -5.659  1.00 19.86  ? 709 DG  M C5    1 
ATOM   216  C C6    . DG  A 1 11  ? 12.875 -3.671  -4.868  1.00 32.74  ? 709 DG  M C6    1 
ATOM   217  O O6    . DG  A 1 11  ? 11.715 -3.287  -5.057  1.00 100.00 ? 709 DG  M O6    1 
ATOM   218  N N1    . DG  A 1 11  ? 13.168 -4.454  -3.767  1.00 21.20  ? 709 DG  M N1    1 
ATOM   219  C C2    . DG  A 1 11  ? 14.403 -4.945  -3.461  1.00 44.86  ? 709 DG  M C2    1 
ATOM   220  N N2    . DG  A 1 11  ? 14.473 -5.680  -2.347  1.00 34.63  ? 709 DG  M N2    1 
ATOM   221  N N3    . DG  A 1 11  ? 15.486 -4.733  -4.188  1.00 38.94  ? 709 DG  M N3    1 
ATOM   222  C C4    . DG  A 1 11  ? 15.225 -3.976  -5.268  1.00 13.31  ? 709 DG  M C4    1 
ATOM   223  P P     . DT  A 1 12  ? 19.636 -7.706  -7.920  1.00 31.61  ? 710 DT  M P     1 
ATOM   224  O OP1   . DT  A 1 12  ? 20.948 -8.389  -7.757  1.00 97.62  ? 710 DT  M OP1   1 
ATOM   225  O OP2   . DT  A 1 12  ? 18.898 -7.826  -9.199  1.00 23.69  ? 710 DT  M OP2   1 
ATOM   226  O "O5'" . DT  A 1 12  ? 18.716 -8.155  -6.706  1.00 20.77  ? 710 DT  M "O5'" 1 
ATOM   227  C "C5'" . DT  A 1 12  ? 19.269 -8.325  -5.418  1.00 10.45  ? 710 DT  M "C5'" 1 
ATOM   228  C "C4'" . DT  A 1 12  ? 18.366 -9.168  -4.543  1.00 61.57  ? 710 DT  M "C4'" 1 
ATOM   229  O "O4'" . DT  A 1 12  ? 17.070 -8.544  -4.430  1.00 35.73  ? 710 DT  M "O4'" 1 
ATOM   230  C "C3'" . DT  A 1 12  ? 18.079 -10.577 -5.055  1.00 1.18   ? 710 DT  M "C3'" 1 
ATOM   231  O "O3'" . DT  A 1 12  ? 17.719 -11.365 -3.919  1.00 35.83  ? 710 DT  M "O3'" 1 
ATOM   232  C "C2'" . DT  A 1 12  ? 16.837 -10.342 -5.896  1.00 54.19  ? 710 DT  M "C2'" 1 
ATOM   233  C "C1'" . DT  A 1 12  ? 16.075 -9.417  -4.970  1.00 33.19  ? 710 DT  M "C1'" 1 
ATOM   234  N N1    . DT  A 1 12  ? 15.008 -8.588  -5.570  1.00 40.30  ? 710 DT  M N1    1 
ATOM   235  C C2    . DT  A 1 12  ? 13.858 -8.394  -4.832  1.00 96.96  ? 710 DT  M C2    1 
ATOM   236  O O2    . DT  A 1 12  ? 13.663 -8.914  -3.744  1.00 16.25  ? 710 DT  M O2    1 
ATOM   237  N N3    . DT  A 1 12  ? 12.923 -7.585  -5.423  1.00 9.06   ? 710 DT  M N3    1 
ATOM   238  C C4    . DT  A 1 12  ? 13.013 -6.965  -6.641  1.00 59.14  ? 710 DT  M C4    1 
ATOM   239  O O4    . DT  A 1 12  ? 12.083 -6.268  -7.019  1.00 26.14  ? 710 DT  M O4    1 
ATOM   240  C C5    . DT  A 1 12  ? 14.245 -7.199  -7.368  1.00 32.72  ? 710 DT  M C5    1 
ATOM   241  C C7    . DT  A 1 12  ? 14.425 -6.563  -8.705  1.00 37.47  ? 710 DT  M C7    1 
ATOM   242  C C6    . DT  A 1 12  ? 15.173 -7.985  -6.800  1.00 36.15  ? 710 DT  M C6    1 
ATOM   243  P P     . DT  A 1 13  ? 18.152 -12.903 -3.805  1.00 48.78  ? 711 DT  M P     1 
ATOM   244  O OP1   . DT  A 1 13  ? 18.996 -13.072 -2.594  1.00 37.99  ? 711 DT  M OP1   1 
ATOM   245  O OP2   . DT  A 1 13  ? 18.658 -13.304 -5.140  1.00 27.20  ? 711 DT  M OP2   1 
ATOM   246  O "O5'" . DT  A 1 13  ? 16.806 -13.643 -3.412  1.00 41.38  ? 711 DT  M "O5'" 1 
ATOM   247  C "C5'" . DT  A 1 13  ? 15.974 -13.097 -2.400  1.00 100.00 ? 711 DT  M "C5'" 1 
ATOM   248  C "C4'" . DT  A 1 13  ? 14.527 -13.491 -2.596  1.00 25.17  ? 711 DT  M "C4'" 1 
ATOM   249  O "O4'" . DT  A 1 13  ? 13.851 -12.523 -3.421  1.00 74.02  ? 711 DT  M "O4'" 1 
ATOM   250  C "C3'" . DT  A 1 13  ? 14.311 -14.849 -3.266  1.00 35.99  ? 711 DT  M "C3'" 1 
ATOM   251  O "O3'" . DT  A 1 13  ? 13.371 -15.566 -2.483  1.00 29.45  ? 711 DT  M "O3'" 1 
ATOM   252  C "C2'" . DT  A 1 13  ? 13.679 -14.515 -4.612  1.00 1.00   ? 711 DT  M "C2'" 1 
ATOM   253  C "C1'" . DT  A 1 13  ? 12.975 -13.216 -4.285  1.00 44.22  ? 711 DT  M "C1'" 1 
ATOM   254  N N1    . DT  A 1 13  ? 12.695 -12.334 -5.411  1.00 40.32  ? 711 DT  M N1    1 
ATOM   255  C C2    . DT  A 1 13  ? 11.559 -11.583 -5.322  1.00 14.33  ? 711 DT  M C2    1 
ATOM   256  O O2    . DT  A 1 13  ? 10.802 -11.657 -4.371  1.00 85.32  ? 711 DT  M O2    1 
ATOM   257  N N3    . DT  A 1 13  ? 11.345 -10.743 -6.380  1.00 30.55  ? 711 DT  M N3    1 
ATOM   258  C C4    . DT  A 1 13  ? 12.137 -10.599 -7.499  1.00 10.85  ? 711 DT  M C4    1 
ATOM   259  O O4    . DT  A 1 13  ? 11.816 -9.813  -8.389  1.00 41.81  ? 711 DT  M O4    1 
ATOM   260  C C5    . DT  A 1 13  ? 13.323 -11.421 -7.519  1.00 78.36  ? 711 DT  M C5    1 
ATOM   261  C C7    . DT  A 1 13  ? 14.243 -11.318 -8.681  1.00 1.49   ? 711 DT  M C7    1 
ATOM   262  C C6    . DT  A 1 13  ? 13.554 -12.233 -6.483  1.00 1.00   ? 711 DT  M C6    1 
ATOM   263  P P     . DG  A 1 14  ? 13.607 -17.108 -2.146  1.00 55.19  ? 712 DG  M P     1 
ATOM   264  O OP1   . DG  A 1 14  ? 14.641 -17.208 -1.084  1.00 93.14  ? 712 DG  M OP1   1 
ATOM   265  O OP2   . DG  A 1 14  ? 13.813 -17.808 -3.439  1.00 68.86  ? 712 DG  M OP2   1 
ATOM   266  O "O5'" . DG  A 1 14  ? 12.215 -17.501 -1.487  1.00 55.51  ? 712 DG  M "O5'" 1 
ATOM   267  C "C5'" . DG  A 1 14  ? 11.644 -16.640 -0.506  1.00 80.79  ? 712 DG  M "C5'" 1 
ATOM   268  C "C4'" . DG  A 1 14  ? 10.143 -16.492 -0.671  1.00 45.41  ? 712 DG  M "C4'" 1 
ATOM   269  O "O4'" . DG  A 1 14  ? 9.806  -15.637 -1.789  1.00 35.98  ? 712 DG  M "O4'" 1 
ATOM   270  C "C3'" . DG  A 1 14  ? 9.400  -17.801 -0.886  1.00 44.05  ? 712 DG  M "C3'" 1 
ATOM   271  O "O3'" . DG  A 1 14  ? 8.210  -17.750 -0.090  1.00 100.00 ? 712 DG  M "O3'" 1 
ATOM   272  C "C2'" . DG  A 1 14  ? 9.074  -17.796 -2.383  1.00 54.00  ? 712 DG  M "C2'" 1 
ATOM   273  C "C1'" . DG  A 1 14  ? 8.943  -16.305 -2.698  1.00 23.89  ? 712 DG  M "C1'" 1 
ATOM   274  N N9    . DG  A 1 14  ? 9.300  -15.868 -4.059  1.00 37.41  ? 712 DG  M N9    1 
ATOM   275  C C8    . DG  A 1 14  ? 10.352 -16.278 -4.850  1.00 10.70  ? 712 DG  M C8    1 
ATOM   276  N N7    . DG  A 1 14  ? 10.394 -15.668 -6.007  1.00 75.64  ? 712 DG  M N7    1 
ATOM   277  C C5    . DG  A 1 14  ? 9.296  -14.811 -5.987  1.00 2.05   ? 712 DG  M C5    1 
ATOM   278  C C6    . DG  A 1 14  ? 8.839  -13.884 -6.965  1.00 45.40  ? 712 DG  M C6    1 
ATOM   279  O O6    . DG  A 1 14  ? 9.304  -13.647 -8.095  1.00 16.83  ? 712 DG  M O6    1 
ATOM   280  N N1    . DG  A 1 14  ? 7.711  -13.202 -6.525  1.00 29.25  ? 712 DG  M N1    1 
ATOM   281  C C2    . DG  A 1 14  ? 7.098  -13.390 -5.310  1.00 100.00 ? 712 DG  M C2    1 
ATOM   282  N N2    . DG  A 1 14  ? 6.006  -12.639 -5.099  1.00 31.04  ? 712 DG  M N2    1 
ATOM   283  N N3    . DG  A 1 14  ? 7.524  -14.247 -4.389  1.00 9.42   ? 712 DG  M N3    1 
ATOM   284  C C4    . DG  A 1 14  ? 8.628  -14.905 -4.793  1.00 59.43  ? 712 DG  M C4    1 
ATOM   285  P P     . DC  A 1 15  ? 7.452  -19.086 0.376   1.00 100.00 ? 713 DC  M P     1 
ATOM   286  O OP1   . DC  A 1 15  ? 7.250  -19.110 1.852   1.00 50.99  ? 713 DC  M OP1   1 
ATOM   287  O OP2   . DC  A 1 15  ? 7.968  -20.303 -0.326  1.00 53.30  ? 713 DC  M OP2   1 
ATOM   288  O "O5'" . DC  A 1 15  ? 6.056  -18.851 -0.311  1.00 43.37  ? 713 DC  M "O5'" 1 
ATOM   289  C "C5'" . DC  A 1 15  ? 5.982  -18.948 -1.713  1.00 50.89  ? 713 DC  M "C5'" 1 
ATOM   290  C "C4'" . DC  A 1 15  ? 4.857  -18.123 -2.261  1.00 55.76  ? 713 DC  M "C4'" 1 
ATOM   291  O "O4'" . DC  A 1 15  ? 5.394  -17.202 -3.246  1.00 55.17  ? 713 DC  M "O4'" 1 
ATOM   292  C "C3'" . DC  A 1 15  ? 3.822  -18.973 -2.996  1.00 100.00 ? 713 DC  M "C3'" 1 
ATOM   293  O "O3'" . DC  A 1 15  ? 2.538  -18.363 -2.900  1.00 100.00 ? 713 DC  M "O3'" 1 
ATOM   294  C "C2'" . DC  A 1 15  ? 4.295  -18.903 -4.431  1.00 58.90  ? 713 DC  M "C2'" 1 
ATOM   295  C "C1'" . DC  A 1 15  ? 4.849  -17.491 -4.527  1.00 69.26  ? 713 DC  M "C1'" 1 
ATOM   296  N N1    . DC  A 1 15  ? 5.909  -17.382 -5.530  1.00 28.54  ? 713 DC  M N1    1 
ATOM   297  C C2    . DC  A 1 15  ? 5.690  -16.587 -6.663  1.00 100.00 ? 713 DC  M C2    1 
ATOM   298  O O2    . DC  A 1 15  ? 4.622  -15.953 -6.771  1.00 35.35  ? 713 DC  M O2    1 
ATOM   299  N N3    . DC  A 1 15  ? 6.653  -16.510 -7.607  1.00 69.19  ? 713 DC  M N3    1 
ATOM   300  C C4    . DC  A 1 15  ? 7.791  -17.193 -7.454  1.00 61.94  ? 713 DC  M C4    1 
ATOM   301  N N4    . DC  A 1 15  ? 8.710  -17.079 -8.413  1.00 32.60  ? 713 DC  M N4    1 
ATOM   302  C C5    . DC  A 1 15  ? 8.032  -18.023 -6.319  1.00 41.66  ? 713 DC  M C5    1 
ATOM   303  C C6    . DC  A 1 15  ? 7.070  -18.093 -5.391  1.00 53.09  ? 713 DC  M C6    1 
ATOM   304  P P     . DG  A 1 16  ? 1.234  -19.279 -2.770  1.00 100.00 ? 714 DG  M P     1 
ATOM   305  O OP1   . DG  A 1 16  ? 0.278  -18.550 -1.895  1.00 100.00 ? 714 DG  M OP1   1 
ATOM   306  O OP2   . DG  A 1 16  ? 1.706  -20.624 -2.371  1.00 33.62  ? 714 DG  M OP2   1 
ATOM   307  O "O5'" . DG  A 1 16  ? 0.698  -19.371 -4.265  1.00 26.27  ? 714 DG  M "O5'" 1 
ATOM   308  C "C5'" . DG  A 1 16  ? 1.546  -19.099 -5.365  1.00 52.96  ? 714 DG  M "C5'" 1 
ATOM   309  C "C4'" . DG  A 1 16  ? 0.839  -18.199 -6.341  1.00 38.47  ? 714 DG  M "C4'" 1 
ATOM   310  O "O4'" . DG  A 1 16  ? 1.821  -17.392 -7.018  1.00 100.00 ? 714 DG  M "O4'" 1 
ATOM   311  C "C3'" . DG  A 1 16  ? 0.055  -18.965 -7.400  1.00 100.00 ? 714 DG  M "C3'" 1 
ATOM   312  O "O3'" . DG  A 1 16  ? -1.314 -18.556 -7.400  1.00 100.00 ? 714 DG  M "O3'" 1 
ATOM   313  C "C2'" . DG  A 1 16  ? 0.669  -18.579 -8.734  1.00 100.00 ? 714 DG  M "C2'" 1 
ATOM   314  C "C1'" . DG  A 1 16  ? 1.828  -17.652 -8.410  1.00 56.72  ? 714 DG  M "C1'" 1 
ATOM   315  N N9    . DG  A 1 16  ? 3.119  -18.211 -8.788  1.00 100.00 ? 714 DG  M N9    1 
ATOM   316  C C8    . DG  A 1 16  ? 3.816  -19.226 -8.155  1.00 12.95  ? 714 DG  M C8    1 
ATOM   317  N N7    . DG  A 1 16  ? 4.931  -19.528 -8.774  1.00 49.33  ? 714 DG  M N7    1 
ATOM   318  C C5    . DG  A 1 16  ? 4.968  -18.661 -9.872  1.00 23.71  ? 714 DG  M C5    1 
ATOM   319  C C6    . DG  A 1 16  ? 5.935  -18.508 -10.902 1.00 9.89   ? 714 DG  M C6    1 
ATOM   320  O O6    . DG  A 1 16  ? 6.999  -19.122 -11.067 1.00 100.00 ? 714 DG  M O6    1 
ATOM   321  N N1    . DG  A 1 16  ? 5.572  -17.511 -11.805 1.00 54.27  ? 714 DG  M N1    1 
ATOM   322  C C2    . DG  A 1 16  ? 4.432  -16.754 -11.735 1.00 23.78  ? 714 DG  M C2    1 
ATOM   323  N N2    . DG  A 1 16  ? 4.267  -15.841 -12.707 1.00 63.57  ? 714 DG  M N2    1 
ATOM   324  N N3    . DG  A 1 16  ? 3.522  -16.885 -10.785 1.00 42.19  ? 714 DG  M N3    1 
ATOM   325  C C4    . DG  A 1 16  ? 3.852  -17.850 -9.895  1.00 21.11  ? 714 DG  M C4    1 
ATOM   326  P P     . DT  A 1 17  ? -2.335 -19.279 -8.409  1.00 100.00 ? 715 DT  M P     1 
ATOM   327  O OP1   . DT  A 1 17  ? -3.695 -18.726 -8.170  1.00 100.00 ? 715 DT  M OP1   1 
ATOM   328  O OP2   . DT  A 1 17  ? -2.099 -20.746 -8.284  1.00 62.93  ? 715 DT  M OP2   1 
ATOM   329  O "O5'" . DT  A 1 17  ? -1.827 -18.885 -9.870  1.00 64.33  ? 715 DT  M "O5'" 1 
ATOM   330  C "C5'" . DT  A 1 17  ? -1.799 -17.531 -10.315 1.00 59.30  ? 715 DT  M "C5'" 1 
ATOM   331  C "C4'" . DT  A 1 17  ? -1.698 -17.516 -11.829 1.00 68.33  ? 715 DT  M "C4'" 1 
ATOM   332  O "O4'" . DT  A 1 17  ? -0.302 -17.681 -12.213 1.00 100.00 ? 715 DT  M "O4'" 1 
ATOM   333  C "C3'" . DT  A 1 17  ? -2.440 -18.696 -12.465 1.00 100.00 ? 715 DT  M "C3'" 1 
ATOM   334  O "O3'" . DT  A 1 17  ? -2.934 -18.342 -13.752 1.00 100.00 ? 715 DT  M "O3'" 1 
ATOM   335  C "C2'" . DT  A 1 17  ? -1.340 -19.733 -12.625 1.00 64.73  ? 715 DT  M "C2'" 1 
ATOM   336  C "C1'" . DT  A 1 17  ? -0.166 -18.844 -13.008 1.00 100.00 ? 715 DT  M "C1'" 1 
ATOM   337  N N1    . DT  A 1 17  ? 1.144  -19.463 -12.765 1.00 59.40  ? 715 DT  M N1    1 
ATOM   338  C C2    . DT  A 1 17  ? 2.201  -19.102 -13.569 1.00 56.80  ? 715 DT  M C2    1 
ATOM   339  O O2    . DT  A 1 17  ? 2.109  -18.266 -14.456 1.00 72.47  ? 715 DT  M O2    1 
ATOM   340  N N3    . DT  A 1 17  ? 3.379  -19.750 -13.285 1.00 79.53  ? 715 DT  M N3    1 
ATOM   341  C C4    . DT  A 1 17  ? 3.590  -20.705 -12.306 1.00 50.75  ? 715 DT  M C4    1 
ATOM   342  O O4    . DT  A 1 17  ? 4.703  -21.204 -12.162 1.00 100.00 ? 715 DT  M O4    1 
ATOM   343  C C5    . DT  A 1 17  ? 2.431  -21.039 -11.512 1.00 43.13  ? 715 DT  M C5    1 
ATOM   344  C C7    . DT  A 1 17  ? 2.564  -22.055 -10.427 1.00 27.66  ? 715 DT  M C7    1 
ATOM   345  C C6    . DT  A 1 17  ? 1.282  -20.411 -11.779 1.00 40.03  ? 715 DT  M C6    1 
ATOM   346  N N     . THR B 2 2   ? 16.700 -2.539  11.912  1.00 25.40  ? 3   THR A N     1 
ATOM   347  C CA    . THR B 2 2   ? 17.203 -2.441  13.308  1.00 29.96  ? 3   THR A CA    1 
ATOM   348  C C     . THR B 2 2   ? 16.985 -0.969  13.792  1.00 39.51  ? 3   THR A C     1 
ATOM   349  O O     . THR B 2 2   ? 16.764 -0.762  14.991  1.00 47.07  ? 3   THR A O     1 
ATOM   350  C CB    . THR B 2 2   ? 18.743 -3.044  13.518  1.00 49.82  ? 3   THR A CB    1 
ATOM   351  O OG1   . THR B 2 2   ? 19.024 -3.433  14.889  1.00 38.19  ? 3   THR A OG1   1 
ATOM   352  C CG2   . THR B 2 2   ? 19.872 -2.089  12.972  1.00 45.74  ? 3   THR A CG2   1 
ATOM   353  N N     . ILE B 2 3   ? 17.008 0.044   12.905  1.00 27.10  ? 4   ILE A N     1 
ATOM   354  C CA    . ILE B 2 3   ? 16.707 1.418   13.401  1.00 29.00  ? 4   ILE A CA    1 
ATOM   355  C C     . ILE B 2 3   ? 15.341 1.390   14.117  1.00 39.72  ? 4   ILE A C     1 
ATOM   356  O O     . ILE B 2 3   ? 15.107 2.092   15.096  1.00 39.39  ? 4   ILE A O     1 
ATOM   357  C CB    . ILE B 2 3   ? 16.608 2.473   12.340  1.00 27.07  ? 4   ILE A CB    1 
ATOM   358  C CG1   . ILE B 2 3   ? 16.512 3.819   13.031  1.00 27.48  ? 4   ILE A CG1   1 
ATOM   359  C CG2   . ILE B 2 3   ? 15.374 2.402   11.665  1.00 23.55  ? 4   ILE A CG2   1 
ATOM   360  C CD1   . ILE B 2 3   ? 16.755 4.986   12.087  1.00 34.04  ? 4   ILE A CD1   1 
ATOM   361  N N     . LYS B 2 4   ? 14.472 0.512   13.620  1.00 41.16  ? 5   LYS A N     1 
ATOM   362  C CA    . LYS B 2 4   ? 13.141 0.262   14.164  1.00 41.68  ? 5   LYS A CA    1 
ATOM   363  C C     . LYS B 2 4   ? 13.243 -0.264  15.558  1.00 37.29  ? 5   LYS A C     1 
ATOM   364  O O     . LYS B 2 4   ? 12.431 0.039   16.426  1.00 35.26  ? 5   LYS A O     1 
ATOM   365  C CB    . LYS B 2 4   ? 12.459 -0.858  13.400  1.00 48.58  ? 5   LYS A CB    1 
ATOM   366  C CG    . LYS B 2 4   ? 11.452 -0.373  12.397  1.00 77.58  ? 5   LYS A CG    1 
ATOM   367  C CD    . LYS B 2 4   ? 11.829 -0.823  10.993  1.00 88.50  ? 5   LYS A CD    1 
ATOM   368  C CE    . LYS B 2 4   ? 10.644 -0.759  9.990   1.00 100.00 ? 5   LYS A CE    1 
ATOM   369  N NZ    . LYS B 2 4   ? 9.246  -1.072  10.541  1.00 100.00 ? 5   LYS A NZ    1 
ATOM   370  N N     . ASP B 2 5   ? 14.233 -1.092  15.775  1.00 36.98  ? 6   ASP A N     1 
ATOM   371  C CA    . ASP B 2 5   ? 14.357 -1.643  17.097  1.00 38.01  ? 6   ASP A CA    1 
ATOM   372  C C     . ASP B 2 5   ? 14.788 -0.549  17.988  1.00 40.95  ? 6   ASP A C     1 
ATOM   373  O O     . ASP B 2 5   ? 14.497 -0.565  19.174  1.00 42.17  ? 6   ASP A O     1 
ATOM   374  C CB    . ASP B 2 5   ? 15.312 -2.822  17.128  1.00 39.12  ? 6   ASP A CB    1 
ATOM   375  C CG    . ASP B 2 5   ? 15.113 -3.726  15.971  1.00 54.10  ? 6   ASP A CG    1 
ATOM   376  O OD1   . ASP B 2 5   ? 13.951 -3.954  15.590  1.00 73.08  ? 6   ASP A OD1   1 
ATOM   377  O OD2   . ASP B 2 5   ? 16.107 -4.097  15.347  1.00 43.00  ? 6   ASP A OD2   1 
ATOM   378  N N     . VAL B 2 6   ? 15.465 0.435   17.428  1.00 39.52  ? 7   VAL A N     1 
ATOM   379  C CA    . VAL B 2 6   ? 15.913 1.503   18.315  1.00 42.24  ? 7   VAL A CA    1 
ATOM   380  C C     . VAL B 2 6   ? 14.739 2.388   18.685  1.00 47.32  ? 7   VAL A C     1 
ATOM   381  O O     . VAL B 2 6   ? 14.452 2.636   19.880  1.00 46.68  ? 7   VAL A O     1 
ATOM   382  C CB    . VAL B 2 6   ? 17.199 2.301   17.791  1.00 41.54  ? 7   VAL A CB    1 
ATOM   383  C CG1   . VAL B 2 6   ? 17.886 3.068   18.940  1.00 38.50  ? 7   VAL A CG1   1 
ATOM   384  C CG2   . VAL B 2 6   ? 18.179 1.331   17.216  1.00 39.77  ? 7   VAL A CG2   1 
ATOM   385  N N     . ALA B 2 7   ? 14.062 2.856   17.654  1.00 46.22  ? 8   ALA A N     1 
ATOM   386  C CA    . ALA B 2 7   ? 12.924 3.739   17.845  1.00 50.29  ? 8   ALA A CA    1 
ATOM   387  C C     . ALA B 2 7   ? 11.973 3.174   18.949  1.00 48.06  ? 8   ALA A C     1 
ATOM   388  O O     . ALA B 2 7   ? 11.566 3.862   19.916  1.00 43.47  ? 8   ALA A O     1 
ATOM   389  C CB    . ALA B 2 7   ? 12.209 3.952   16.463  1.00 51.43  ? 8   ALA A CB    1 
ATOM   390  N N     . LYS B 2 8   ? 11.697 1.890   18.791  1.00 41.21  ? 9   LYS A N     1 
ATOM   391  C CA    . LYS B 2 8   ? 10.847 1.151   19.682  1.00 44.87  ? 9   LYS A CA    1 
ATOM   392  C C     . LYS B 2 8   ? 11.326 1.071   21.117  1.00 56.79  ? 9   LYS A C     1 
ATOM   393  O O     . LYS B 2 8   ? 10.553 1.240   22.056  1.00 63.01  ? 9   LYS A O     1 
ATOM   394  C CB    . LYS B 2 8   ? 10.588 -0.235  19.108  1.00 46.86  ? 9   LYS A CB    1 
ATOM   395  C CG    . LYS B 2 8   ? 9.427  -0.993  19.732  1.00 76.19  ? 9   LYS A CG    1 
ATOM   396  C CD    . LYS B 2 8   ? 8.972  -2.156  18.811  1.00 100.00 ? 9   LYS A CD    1 
ATOM   397  C CE    . LYS B 2 8   ? 9.141  -1.814  17.293  1.00 100.00 ? 9   LYS A CE    1 
ATOM   398  N NZ    . LYS B 2 8   ? 9.242  -3.012  16.350  1.00 100.00 ? 9   LYS A NZ    1 
ATOM   399  N N     . ARG B 2 9   ? 12.597 0.797   21.306  1.00 56.90  ? 10  ARG A N     1 
ATOM   400  C CA    . ARG B 2 9   ? 13.051 0.719   22.666  1.00 58.14  ? 10  ARG A CA    1 
ATOM   401  C C     . ARG B 2 9   ? 12.911 2.112   23.250  1.00 59.86  ? 10  ARG A C     1 
ATOM   402  O O     . ARG B 2 9   ? 12.580 2.289   24.414  1.00 61.69  ? 10  ARG A O     1 
ATOM   403  C CB    . ARG B 2 9   ? 14.490 0.234   22.723  1.00 58.99  ? 10  ARG A CB    1 
ATOM   404  C CG    . ARG B 2 9   ? 14.960 -0.046  24.164  1.00 95.63  ? 10  ARG A CG    1 
ATOM   405  C CD    . ARG B 2 9   ? 14.928 -1.545  24.578  1.00 100.00 ? 10  ARG A CD    1 
ATOM   406  N NE    . ARG B 2 9   ? 16.098 -1.883  25.397  1.00 100.00 ? 10  ARG A NE    1 
ATOM   407  C CZ    . ARG B 2 9   ? 16.415 -1.270  26.539  1.00 100.00 ? 10  ARG A CZ    1 
ATOM   408  N NH1   . ARG B 2 9   ? 15.638 -0.292  27.014  1.00 100.00 ? 10  ARG A NH1   1 
ATOM   409  N NH2   . ARG B 2 9   ? 17.510 -1.635  27.210  1.00 100.00 ? 10  ARG A NH2   1 
ATOM   410  N N     . ALA B 2 10  ? 13.146 3.104   22.412  1.00 52.80  ? 11  ALA A N     1 
ATOM   411  C CA    . ALA B 2 10  ? 13.071 4.487   22.839  1.00 54.27  ? 11  ALA A CA    1 
ATOM   412  C C     . ALA B 2 10  ? 11.660 5.087   22.847  1.00 59.98  ? 11  ALA A C     1 
ATOM   413  O O     . ALA B 2 10  ? 11.444 6.249   23.211  1.00 59.15  ? 11  ALA A O     1 
ATOM   414  C CB    . ALA B 2 10  ? 13.977 5.310   21.970  1.00 55.09  ? 11  ALA A CB    1 
ATOM   415  N N     . ASN B 2 11  ? 10.692 4.302   22.433  1.00 55.80  ? 12  ASN A N     1 
ATOM   416  C CA    . ASN B 2 11  ? 9.327  4.796   22.404  1.00 55.14  ? 12  ASN A CA    1 
ATOM   417  C C     . ASN B 2 11  ? 9.158  6.058   21.611  1.00 44.53  ? 12  ASN A C     1 
ATOM   418  O O     . ASN B 2 11  ? 8.451  6.956   22.052  1.00 39.34  ? 12  ASN A O     1 
ATOM   419  C CB    . ASN B 2 11  ? 8.726  4.980   23.800  1.00 61.13  ? 12  ASN A CB    1 
ATOM   420  C CG    . ASN B 2 11  ? 9.628  4.441   24.906  1.00 100.00 ? 12  ASN A CG    1 
ATOM   421  O OD1   . ASN B 2 11  ? 10.214 5.216   25.688  1.00 100.00 ? 12  ASN A OD1   1 
ATOM   422  N ND2   . ASN B 2 11  ? 9.752  3.104   24.981  1.00 100.00 ? 12  ASN A ND2   1 
ATOM   423  N N     . VAL B 2 12  ? 9.786  6.102   20.434  1.00 33.03  ? 13  VAL A N     1 
ATOM   424  C CA    . VAL B 2 12  ? 9.664  7.243   19.535  1.00 29.57  ? 13  VAL A CA    1 
ATOM   425  C C     . VAL B 2 12  ? 9.724  6.709   18.135  1.00 34.95  ? 13  VAL A C     1 
ATOM   426  O O     . VAL B 2 12  ? 9.937  5.515   17.899  1.00 37.97  ? 13  VAL A O     1 
ATOM   427  C CB    . VAL B 2 12  ? 10.807 8.151   19.668  1.00 33.29  ? 13  VAL A CB    1 
ATOM   428  C CG1   . VAL B 2 12  ? 11.184 8.198   21.147  1.00 34.48  ? 13  VAL A CG1   1 
ATOM   429  C CG2   . VAL B 2 12  ? 11.958 7.588   18.817  1.00 32.05  ? 13  VAL A CG2   1 
ATOM   430  N N     . SER B 2 13  ? 9.533  7.601   17.191  1.00 20.96  ? 14  SER A N     1 
ATOM   431  C CA    . SER B 2 13  ? 9.563  7.196   15.812  1.00 18.96  ? 14  SER A CA    1 
ATOM   432  C C     . SER B 2 13  ? 11.026 6.951   15.357  1.00 36.09  ? 14  SER A C     1 
ATOM   433  O O     . SER B 2 13  ? 11.983 7.271   16.049  1.00 46.18  ? 14  SER A O     1 
ATOM   434  C CB    . SER B 2 13  ? 8.940  8.322   14.979  1.00 25.15  ? 14  SER A CB    1 
ATOM   435  O OG    . SER B 2 13  ? 9.883  8.905   14.101  1.00 58.79  ? 14  SER A OG    1 
ATOM   436  N N     . THR B 2 14  ? 11.172 6.405   14.168  1.00 26.02  ? 15  THR A N     1 
ATOM   437  C CA    . THR B 2 14  ? 12.442 6.140   13.603  1.00 24.44  ? 15  THR A CA    1 
ATOM   438  C C     . THR B 2 14  ? 12.930 7.462   13.027  1.00 35.39  ? 15  THR A C     1 
ATOM   439  O O     . THR B 2 14  ? 14.122 7.679   12.904  1.00 35.17  ? 15  THR A O     1 
ATOM   440  C CB    . THR B 2 14  ? 12.247 5.330   12.359  1.00 30.41  ? 15  THR A CB    1 
ATOM   441  O OG1   . THR B 2 14  ? 11.204 5.899   11.569  1.00 24.88  ? 15  THR A OG1   1 
ATOM   442  C CG2   . THR B 2 14  ? 12.010 3.893   12.651  1.00 11.47  ? 15  THR A CG2   1 
ATOM   443  N N     . THR B 2 15  ? 12.002 8.308   12.599  1.00 36.34  ? 16  THR A N     1 
ATOM   444  C CA    . THR B 2 15  ? 12.382 9.590   12.028  1.00 37.05  ? 16  THR A CA    1 
ATOM   445  C C     . THR B 2 15  ? 13.120 10.256  13.153  1.00 35.53  ? 16  THR A C     1 
ATOM   446  O O     . THR B 2 15  ? 14.155 10.895  12.979  1.00 33.76  ? 16  THR A O     1 
ATOM   447  C CB    . THR B 2 15  ? 11.158 10.489  11.769  1.00 29.54  ? 16  THR A CB    1 
ATOM   448  O OG1   . THR B 2 15  ? 10.328 9.877   10.783  1.00 36.07  ? 16  THR A OG1   1 
ATOM   449  C CG2   . THR B 2 15  ? 11.620 11.895  11.308  1.00 20.07  ? 16  THR A CG2   1 
ATOM   450  N N     . THR B 2 16  ? 12.582 10.067  14.343  1.00 22.04  ? 17  THR A N     1 
ATOM   451  C CA    . THR B 2 16  ? 13.227 10.687  15.423  1.00 20.46  ? 17  THR A CA    1 
ATOM   452  C C     . THR B 2 16  ? 14.594 10.127  15.563  1.00 28.04  ? 17  THR A C     1 
ATOM   453  O O     . THR B 2 16  ? 15.566 10.830  15.360  1.00 28.15  ? 17  THR A O     1 
ATOM   454  C CB    . THR B 2 16  ? 12.368 10.735  16.575  1.00 20.43  ? 17  THR A CB    1 
ATOM   455  O OG1   . THR B 2 16  ? 11.542 11.885  16.375  1.00 46.13  ? 17  THR A OG1   1 
ATOM   456  C CG2   . THR B 2 16  ? 13.142 10.952  17.802  1.00 24.74  ? 17  THR A CG2   1 
ATOM   457  N N     . VAL B 2 17  ? 14.631 8.793   15.820  1.00 21.16  ? 18  VAL A N     1 
ATOM   458  C CA    . VAL B 2 17  ? 15.889 8.077   15.933  1.00 22.09  ? 18  VAL A CA    1 
ATOM   459  C C     . VAL B 2 17  ? 16.863 8.598   14.881  1.00 24.96  ? 18  VAL A C     1 
ATOM   460  O O     . VAL B 2 17  ? 17.976 9.011   15.230  1.00 22.56  ? 18  VAL A O     1 
ATOM   461  C CB    . VAL B 2 17  ? 15.719 6.570   15.724  1.00 29.01  ? 18  VAL A CB    1 
ATOM   462  C CG1   . VAL B 2 17  ? 17.054 5.906   15.699  1.00 29.87  ? 18  VAL A CG1   1 
ATOM   463  C CG2   . VAL B 2 17  ? 14.959 5.972   16.854  1.00 32.77  ? 18  VAL A CG2   1 
ATOM   464  N N     . SER B 2 18  ? 16.417 8.665   13.634  1.00 4.39   ? 19  SER A N     1 
ATOM   465  C CA    . SER B 2 18  ? 17.305 9.177   12.654  1.00 7.45   ? 19  SER A CA    1 
ATOM   466  C C     . SER B 2 18  ? 17.821 10.587  13.052  1.00 30.56  ? 19  SER A C     1 
ATOM   467  O O     . SER B 2 18  ? 18.940 10.718  13.493  1.00 43.67  ? 19  SER A O     1 
ATOM   468  C CB    . SER B 2 18  ? 16.784 9.052   11.193  1.00 2.44   ? 19  SER A CB    1 
ATOM   469  O OG    . SER B 2 18  ? 17.307 10.121  10.379  1.00 20.29  ? 19  SER A OG    1 
ATOM   470  N N     . HIS B 2 19  ? 17.011 11.608  12.937  1.00 30.35  ? 20  HIS A N     1 
ATOM   471  C CA    . HIS B 2 19  ? 17.397 12.985  13.287  1.00 29.25  ? 20  HIS A CA    1 
ATOM   472  C C     . HIS B 2 19  ? 18.363 13.153  14.433  1.00 33.27  ? 20  HIS A C     1 
ATOM   473  O O     . HIS B 2 19  ? 19.217 14.024  14.366  1.00 38.81  ? 20  HIS A O     1 
ATOM   474  C CB    . HIS B 2 19  ? 16.143 13.817  13.645  1.00 30.84  ? 20  HIS A CB    1 
ATOM   475  C CG    . HIS B 2 19  ? 15.366 14.234  12.463  1.00 32.39  ? 20  HIS A CG    1 
ATOM   476  N ND1   . HIS B 2 19  ? 15.752 15.284  11.668  1.00 38.58  ? 20  HIS A ND1   1 
ATOM   477  C CD2   . HIS B 2 19  ? 14.293 13.688  11.869  1.00 37.79  ? 20  HIS A CD2   1 
ATOM   478  C CE1   . HIS B 2 19  ? 14.925 15.399  10.648  1.00 38.20  ? 20  HIS A CE1   1 
ATOM   479  N NE2   . HIS B 2 19  ? 14.025 14.440  10.748  1.00 39.29  ? 20  HIS A NE2   1 
ATOM   480  N N     . VAL B 2 20  ? 18.234 12.357  15.496  1.00 28.12  ? 21  VAL A N     1 
ATOM   481  C CA    . VAL B 2 20  ? 19.170 12.542  16.613  1.00 35.71  ? 21  VAL A CA    1 
ATOM   482  C C     . VAL B 2 20  ? 20.576 12.095  16.222  1.00 45.91  ? 21  VAL A C     1 
ATOM   483  O O     . VAL B 2 20  ? 21.579 12.779  16.465  1.00 51.28  ? 21  VAL A O     1 
ATOM   484  C CB    . VAL B 2 20  ? 18.742 11.900  17.986  1.00 38.08  ? 21  VAL A CB    1 
ATOM   485  C CG1   . VAL B 2 20  ? 17.415 11.247  17.929  1.00 40.46  ? 21  VAL A CG1   1 
ATOM   486  C CG2   . VAL B 2 20  ? 19.757 10.935  18.439  1.00 35.28  ? 21  VAL A CG2   1 
ATOM   487  N N     . ILE B 2 21  ? 20.607 10.936  15.599  1.00 36.91  ? 22  ILE A N     1 
ATOM   488  C CA    . ILE B 2 21  ? 21.821 10.331  15.099  1.00 32.72  ? 22  ILE A CA    1 
ATOM   489  C C     . ILE B 2 21  ? 22.446 11.257  14.092  1.00 36.50  ? 22  ILE A C     1 
ATOM   490  O O     . ILE B 2 21  ? 23.624 11.258  13.919  1.00 51.82  ? 22  ILE A O     1 
ATOM   491  C CB    . ILE B 2 21  ? 21.493 9.024   14.370  1.00 32.83  ? 22  ILE A CB    1 
ATOM   492  C CG1   . ILE B 2 21  ? 21.825 7.828   15.228  1.00 32.40  ? 22  ILE A CG1   1 
ATOM   493  C CG2   . ILE B 2 21  ? 22.121 8.916   13.015  1.00 28.53  ? 22  ILE A CG2   1 
ATOM   494  C CD1   . ILE B 2 21  ? 21.265 6.604   14.607  1.00 56.42  ? 22  ILE A CD1   1 
ATOM   495  N N     . ASN B 2 22  ? 21.705 12.049  13.378  1.00 19.64  ? 23  ASN A N     1 
ATOM   496  C CA    . ASN B 2 22  ? 22.454 12.875  12.455  1.00 19.36  ? 23  ASN A CA    1 
ATOM   497  C C     . ASN B 2 22  ? 22.312 14.322  12.694  1.00 24.96  ? 23  ASN A C     1 
ATOM   498  O O     . ASN B 2 22  ? 22.479 15.091  11.738  1.00 22.49  ? 23  ASN A O     1 
ATOM   499  C CB    . ASN B 2 22  ? 22.066 12.708  10.999  1.00 2.21   ? 23  ASN A CB    1 
ATOM   500  C CG    . ASN B 2 22  ? 21.831 11.266  10.607  1.00 50.62  ? 23  ASN A CG    1 
ATOM   501  O OD1   . ASN B 2 22  ? 22.403 10.777  9.606   1.00 30.30  ? 23  ASN A OD1   1 
ATOM   502  N ND2   . ASN B 2 22  ? 20.852 10.648  11.247  1.00 53.21  ? 23  ASN A ND2   1 
ATOM   503  N N     . LYS B 2 23  ? 21.972 14.663  13.925  1.00 26.91  ? 24  LYS A N     1 
ATOM   504  C CA    . LYS B 2 23  ? 21.795 16.049  14.339  1.00 31.81  ? 24  LYS A CA    1 
ATOM   505  C C     . LYS B 2 23  ? 21.173 16.837  13.237  1.00 27.94  ? 24  LYS A C     1 
ATOM   506  O O     . LYS B 2 23  ? 21.654 17.867  12.823  1.00 34.21  ? 24  LYS A O     1 
ATOM   507  C CB    . LYS B 2 23  ? 23.181 16.619  14.634  1.00 39.53  ? 24  LYS A CB    1 
ATOM   508  C CG    . LYS B 2 23  ? 23.902 15.963  15.828  1.00 66.79  ? 24  LYS A CG    1 
ATOM   509  C CD    . LYS B 2 23  ? 25.427 16.206  15.732  1.00 96.27  ? 24  LYS A CD    1 
ATOM   510  C CE    . LYS B 2 23  ? 26.217 15.418  16.789  1.00 100.00 ? 24  LYS A CE    1 
ATOM   511  N NZ    . LYS B 2 23  ? 25.534 15.379  18.131  1.00 100.00 ? 24  LYS A NZ    1 
ATOM   512  N N     . THR B 2 24  ? 20.114 16.332  12.689  1.00 22.16  ? 25  THR A N     1 
ATOM   513  C CA    . THR B 2 24  ? 19.556 17.045  11.560  1.00 22.55  ? 25  THR A CA    1 
ATOM   514  C C     . THR B 2 24  ? 18.297 17.942  11.754  1.00 25.61  ? 25  THR A C     1 
ATOM   515  O O     . THR B 2 24  ? 17.817 18.576  10.803  1.00 27.12  ? 25  THR A O     1 
ATOM   516  C CB    . THR B 2 24  ? 19.359 16.027  10.510  1.00 13.57  ? 25  THR A CB    1 
ATOM   517  O OG1   . THR B 2 24  ? 18.849 16.631  9.332   1.00 23.09  ? 25  THR A OG1   1 
ATOM   518  C CG2   . THR B 2 24  ? 18.452 14.929  11.089  1.00 3.04   ? 25  THR A CG2   1 
ATOM   519  N N     . ARG B 2 25  ? 17.769 18.006  12.968  1.00 18.23  ? 26  ARG A N     1 
ATOM   520  C CA    . ARG B 2 25  ? 16.616 18.881  13.253  1.00 22.78  ? 26  ARG A CA    1 
ATOM   521  C C     . ARG B 2 25  ? 16.531 18.778  14.782  1.00 32.60  ? 26  ARG A C     1 
ATOM   522  O O     . ARG B 2 25  ? 17.060 17.799  15.327  1.00 35.24  ? 26  ARG A O     1 
ATOM   523  C CB    . ARG B 2 25  ? 15.347 18.570  12.423  1.00 19.04  ? 26  ARG A CB    1 
ATOM   524  C CG    . ARG B 2 25  ? 14.501 17.425  12.993  1.00 27.11  ? 26  ARG A CG    1 
ATOM   525  C CD    . ARG B 2 25  ? 13.104 17.821  13.284  1.00 39.87  ? 26  ARG A CD    1 
ATOM   526  N NE    . ARG B 2 25  ? 12.302 16.667  13.663  1.00 49.70  ? 26  ARG A NE    1 
ATOM   527  C CZ    . ARG B 2 25  ? 11.500 16.032  12.833  1.00 31.18  ? 26  ARG A CZ    1 
ATOM   528  N NH1   . ARG B 2 25  ? 11.408 16.420  11.570  1.00 25.00  ? 26  ARG A NH1   1 
ATOM   529  N NH2   . ARG B 2 25  ? 10.837 15.002  13.262  1.00 21.86  ? 26  ARG A NH2   1 
ATOM   530  N N     . PHE B 2 26  ? 16.015 19.811  15.469  1.00 23.22  ? 27  PHE A N     1 
ATOM   531  C CA    . PHE B 2 26  ? 15.986 19.803  16.928  1.00 16.16  ? 27  PHE A CA    1 
ATOM   532  C C     . PHE B 2 26  ? 15.330 18.618  17.629  1.00 23.81  ? 27  PHE A C     1 
ATOM   533  O O     . PHE B 2 26  ? 14.356 18.084  17.145  1.00 35.97  ? 27  PHE A O     1 
ATOM   534  C CB    . PHE B 2 26  ? 15.529 21.162  17.515  1.00 17.31  ? 27  PHE A CB    1 
ATOM   535  C CG    . PHE B 2 26  ? 15.378 21.137  18.998  1.00 18.46  ? 27  PHE A CG    1 
ATOM   536  C CD1   . PHE B 2 26  ? 14.306 20.505  19.594  1.00 25.52  ? 27  PHE A CD1   1 
ATOM   537  C CD2   . PHE B 2 26  ? 16.329 21.632  19.794  1.00 19.64  ? 27  PHE A CD2   1 
ATOM   538  C CE1   . PHE B 2 26  ? 14.185 20.396  20.954  1.00 22.77  ? 27  PHE A CE1   1 
ATOM   539  C CE2   . PHE B 2 26  ? 16.193 21.540  21.172  1.00 23.90  ? 27  PHE A CE2   1 
ATOM   540  C CZ    . PHE B 2 26  ? 15.105 20.928  21.741  1.00 18.32  ? 27  PHE A CZ    1 
ATOM   541  N N     . VAL B 2 27  ? 15.839 18.228  18.797  1.00 12.21  ? 28  VAL A N     1 
ATOM   542  C CA    . VAL B 2 27  ? 15.225 17.155  19.518  1.00 12.63  ? 28  VAL A CA    1 
ATOM   543  C C     . VAL B 2 27  ? 15.364 17.365  20.982  1.00 25.18  ? 28  VAL A C     1 
ATOM   544  O O     . VAL B 2 27  ? 16.380 17.749  21.448  1.00 28.45  ? 28  VAL A O     1 
ATOM   545  C CB    . VAL B 2 27  ? 15.776 15.838  19.194  1.00 14.94  ? 28  VAL A CB    1 
ATOM   546  C CG1   . VAL B 2 27  ? 15.047 14.732  20.057  1.00 10.54  ? 28  VAL A CG1   1 
ATOM   547  C CG2   . VAL B 2 27  ? 15.643 15.631  17.700  1.00 13.28  ? 28  VAL A CG2   1 
ATOM   548  N N     . ALA B 2 28  ? 14.316 17.102  21.713  1.00 31.85  ? 29  ALA A N     1 
ATOM   549  C CA    . ALA B 2 28  ? 14.362 17.310  23.132  1.00 37.33  ? 29  ALA A CA    1 
ATOM   550  C C     . ALA B 2 28  ? 15.476 16.447  23.670  1.00 41.40  ? 29  ALA A C     1 
ATOM   551  O O     . ALA B 2 28  ? 15.817 15.407  23.043  1.00 34.15  ? 29  ALA A O     1 
ATOM   552  C CB    . ALA B 2 28  ? 13.033 16.948  23.770  1.00 38.65  ? 29  ALA A CB    1 
ATOM   553  N N     . GLU B 2 29  ? 16.019 16.918  24.802  1.00 42.17  ? 30  GLU A N     1 
ATOM   554  C CA    . GLU B 2 29  ? 17.106 16.285  25.501  1.00 47.83  ? 30  GLU A CA    1 
ATOM   555  C C     . GLU B 2 29  ? 16.622 14.943  25.924  1.00 46.52  ? 30  GLU A C     1 
ATOM   556  O O     . GLU B 2 29  ? 17.209 13.923  25.548  1.00 36.99  ? 30  GLU A O     1 
ATOM   557  C CB    . GLU B 2 29  ? 17.535 17.093  26.748  1.00 52.56  ? 30  GLU A CB    1 
ATOM   558  C CG    . GLU B 2 29  ? 19.044 17.621  26.779  1.00 79.70  ? 30  GLU A CG    1 
ATOM   559  C CD    . GLU B 2 29  ? 19.592 17.961  28.210  1.00 100.00 ? 30  GLU A CD    1 
ATOM   560  O OE1   . GLU B 2 29  ? 19.822 17.022  29.023  1.00 100.00 ? 30  GLU A OE1   1 
ATOM   561  O OE2   . GLU B 2 29  ? 19.824 19.167  28.505  1.00 100.00 ? 30  GLU A OE2   1 
ATOM   562  N N     . GLU B 2 30  ? 15.539 14.962  26.691  1.00 52.40  ? 31  GLU A N     1 
ATOM   563  C CA    . GLU B 2 30  ? 14.952 13.728  27.205  1.00 59.13  ? 31  GLU A CA    1 
ATOM   564  C C     . GLU B 2 30  ? 14.891 12.717  26.081  1.00 60.35  ? 31  GLU A C     1 
ATOM   565  O O     . GLU B 2 30  ? 15.293 11.543  26.196  1.00 61.38  ? 31  GLU A O     1 
ATOM   566  C CB    . GLU B 2 30  ? 13.522 13.995  27.648  1.00 63.57  ? 31  GLU A CB    1 
ATOM   567  C CG    . GLU B 2 30  ? 13.332 14.405  29.107  1.00 93.35  ? 31  GLU A CG    1 
ATOM   568  C CD    . GLU B 2 30  ? 11.876 14.179  29.569  1.00 100.00 ? 31  GLU A CD    1 
ATOM   569  O OE1   . GLU B 2 30  ? 10.988 15.010  29.180  1.00 100.00 ? 31  GLU A OE1   1 
ATOM   570  O OE2   . GLU B 2 30  ? 11.622 13.134  30.255  1.00 100.00 ? 31  GLU A OE2   1 
ATOM   571  N N     . THR B 2 31  ? 14.412 13.230  24.964  1.00 45.88  ? 32  THR A N     1 
ATOM   572  C CA    . THR B 2 31  ? 14.272 12.450  23.779  1.00 40.02  ? 32  THR A CA    1 
ATOM   573  C C     . THR B 2 31  ? 15.632 11.939  23.322  1.00 37.40  ? 32  THR A C     1 
ATOM   574  O O     . THR B 2 31  ? 15.907 10.692  23.256  1.00 28.77  ? 32  THR A O     1 
ATOM   575  C CB    . THR B 2 31  ? 13.440 13.219  22.822  1.00 33.27  ? 32  THR A CB    1 
ATOM   576  O OG1   . THR B 2 31  ? 12.213 13.521  23.507  1.00 43.86  ? 32  THR A OG1   1 
ATOM   577  C CG2   . THR B 2 31  ? 13.099 12.419  21.605  1.00 35.36  ? 32  THR A CG2   1 
ATOM   578  N N     . ARG B 2 32  ? 16.492 12.893  23.056  1.00 35.62  ? 33  ARG A N     1 
ATOM   579  C CA    . ARG B 2 32  ? 17.843 12.593  22.644  1.00 37.40  ? 33  ARG A CA    1 
ATOM   580  C C     . ARG B 2 32  ? 18.438 11.495  23.514  1.00 45.35  ? 33  ARG A C     1 
ATOM   581  O O     . ARG B 2 32  ? 18.896 10.459  23.016  1.00 47.64  ? 33  ARG A O     1 
ATOM   582  C CB    . ARG B 2 32  ? 18.702 13.826  22.853  1.00 36.65  ? 33  ARG A CB    1 
ATOM   583  C CG    . ARG B 2 32  ? 19.104 14.489  21.598  1.00 51.93  ? 33  ARG A CG    1 
ATOM   584  C CD    . ARG B 2 32  ? 20.248 15.482  21.848  1.00 95.55  ? 33  ARG A CD    1 
ATOM   585  N NE    . ARG B 2 32  ? 19.791 16.862  22.055  1.00 100.00 ? 33  ARG A NE    1 
ATOM   586  C CZ    . ARG B 2 32  ? 19.714 17.448  23.249  1.00 100.00 ? 33  ARG A CZ    1 
ATOM   587  N NH1   . ARG B 2 32  ? 20.072 16.760  24.338  1.00 89.16  ? 33  ARG A NH1   1 
ATOM   588  N NH2   . ARG B 2 32  ? 19.299 18.715  23.351  1.00 100.00 ? 33  ARG A NH2   1 
ATOM   589  N N     . ASN B 2 33  ? 18.406 11.714  24.819  1.00 39.80  ? 34  ASN A N     1 
ATOM   590  C CA    . ASN B 2 33  ? 18.971 10.755  25.743  1.00 44.98  ? 34  ASN A CA    1 
ATOM   591  C C     . ASN B 2 33  ? 18.503 9.334   25.514  1.00 55.05  ? 34  ASN A C     1 
ATOM   592  O O     . ASN B 2 33  ? 19.301 8.401   25.284  1.00 54.01  ? 34  ASN A O     1 
ATOM   593  C CB    . ASN B 2 33  ? 18.662 11.162  27.163  1.00 57.62  ? 34  ASN A CB    1 
ATOM   594  C CG    . ASN B 2 33  ? 19.301 12.465  27.531  1.00 100.00 ? 34  ASN A CG    1 
ATOM   595  O OD1   . ASN B 2 33  ? 19.000 13.023  28.595  1.00 100.00 ? 34  ASN A OD1   1 
ATOM   596  N ND2   . ASN B 2 33  ? 20.169 12.992  26.637  1.00 80.80  ? 34  ASN A ND2   1 
ATOM   597  N N     . ALA B 2 34  ? 17.193 9.184   25.609  1.00 50.50  ? 35  ALA A N     1 
ATOM   598  C CA    . ALA B 2 34  ? 16.570 7.896   25.408  1.00 48.97  ? 35  ALA A CA    1 
ATOM   599  C C     . ALA B 2 34  ? 17.131 7.130   24.185  1.00 42.75  ? 35  ALA A C     1 
ATOM   600  O O     . ALA B 2 34  ? 17.591 6.003   24.318  1.00 41.10  ? 35  ALA A O     1 
ATOM   601  C CB    . ALA B 2 34  ? 15.091 8.081   25.305  1.00 51.10  ? 35  ALA A CB    1 
ATOM   602  N N     . VAL B 2 35  ? 17.096 7.757   23.010  1.00 29.93  ? 36  VAL A N     1 
ATOM   603  C CA    . VAL B 2 35  ? 17.633 7.180   21.783  1.00 29.64  ? 36  VAL A CA    1 
ATOM   604  C C     . VAL B 2 35  ? 19.097 6.791   22.006  1.00 39.62  ? 36  VAL A C     1 
ATOM   605  O O     . VAL B 2 35  ? 19.537 5.682   21.660  1.00 31.77  ? 36  VAL A O     1 
ATOM   606  C CB    . VAL B 2 35  ? 17.688 8.278   20.833  1.00 29.47  ? 36  VAL A CB    1 
ATOM   607  C CG1   . VAL B 2 35  ? 17.824 7.845   19.400  1.00 23.62  ? 36  VAL A CG1   1 
ATOM   608  C CG2   . VAL B 2 35  ? 16.497 9.092   21.115  1.00 32.58  ? 36  VAL A CG2   1 
ATOM   609  N N     . TRP B 2 36  ? 19.859 7.710   22.568  1.00 38.56  ? 37  TRP A N     1 
ATOM   610  C CA    . TRP B 2 36  ? 21.222 7.344   22.805  1.00 45.73  ? 37  TRP A CA    1 
ATOM   611  C C     . TRP B 2 36  ? 21.254 6.061   23.628  1.00 53.20  ? 37  TRP A C     1 
ATOM   612  O O     . TRP B 2 36  ? 21.906 5.081   23.248  1.00 58.85  ? 37  TRP A O     1 
ATOM   613  C CB    . TRP B 2 36  ? 21.951 8.467   23.479  1.00 48.51  ? 37  TRP A CB    1 
ATOM   614  C CG    . TRP B 2 36  ? 22.370 9.361   22.443  1.00 52.63  ? 37  TRP A CG    1 
ATOM   615  C CD1   . TRP B 2 36  ? 22.228 10.728  22.392  1.00 57.21  ? 37  TRP A CD1   1 
ATOM   616  C CD2   . TRP B 2 36  ? 22.943 8.966   21.222  1.00 52.58  ? 37  TRP A CD2   1 
ATOM   617  N NE1   . TRP B 2 36  ? 22.706 11.203  21.191  1.00 56.27  ? 37  TRP A NE1   1 
ATOM   618  C CE2   . TRP B 2 36  ? 23.150 10.137  20.453  1.00 55.64  ? 37  TRP A CE2   1 
ATOM   619  C CE3   . TRP B 2 36  ? 23.322 7.732   20.697  1.00 56.93  ? 37  TRP A CE3   1 
ATOM   620  C CZ2   . TRP B 2 36  ? 23.721 10.112  19.177  1.00 55.91  ? 37  TRP A CZ2   1 
ATOM   621  C CZ3   . TRP B 2 36  ? 23.894 7.699   19.422  1.00 61.08  ? 37  TRP A CZ3   1 
ATOM   622  C CH2   . TRP B 2 36  ? 24.084 8.888   18.674  1.00 61.49  ? 37  TRP A CH2   1 
ATOM   623  N N     . ALA B 2 37  ? 20.495 6.036   24.709  1.00 43.22  ? 38  ALA A N     1 
ATOM   624  C CA    . ALA B 2 37  ? 20.469 4.831   25.511  1.00 45.54  ? 38  ALA A CA    1 
ATOM   625  C C     . ALA B 2 37  ? 20.016 3.607   24.694  1.00 55.50  ? 38  ALA A C     1 
ATOM   626  O O     . ALA B 2 37  ? 20.575 2.524   24.799  1.00 60.99  ? 38  ALA A O     1 
ATOM   627  C CB    . ALA B 2 37  ? 19.571 5.024   26.701  1.00 46.17  ? 38  ALA A CB    1 
ATOM   628  N N     . ALA B 2 38  ? 18.983 3.777   23.894  1.00 47.26  ? 39  ALA A N     1 
ATOM   629  C CA    . ALA B 2 38  ? 18.501 2.668   23.119  1.00 44.99  ? 39  ALA A CA    1 
ATOM   630  C C     . ALA B 2 38  ? 19.604 2.190   22.210  1.00 47.80  ? 39  ALA A C     1 
ATOM   631  O O     . ALA B 2 38  ? 19.822 1.000   22.098  1.00 45.56  ? 39  ALA A O     1 
ATOM   632  C CB    . ALA B 2 38  ? 17.283 3.083   22.282  1.00 43.60  ? 39  ALA A CB    1 
ATOM   633  N N     . ILE B 2 39  ? 20.264 3.133   21.536  1.00 43.48  ? 40  ILE A N     1 
ATOM   634  C CA    . ILE B 2 39  ? 21.317 2.813   20.586  1.00 42.36  ? 40  ILE A CA    1 
ATOM   635  C C     . ILE B 2 39  ? 22.352 2.061   21.346  1.00 46.95  ? 40  ILE A C     1 
ATOM   636  O O     . ILE B 2 39  ? 23.042 1.141   20.875  1.00 36.77  ? 40  ILE A O     1 
ATOM   637  C CB    . ILE B 2 39  ? 22.030 4.044   20.146  1.00 43.96  ? 40  ILE A CB    1 
ATOM   638  C CG1   . ILE B 2 39  ? 21.051 5.059   19.529  1.00 43.35  ? 40  ILE A CG1   1 
ATOM   639  C CG2   . ILE B 2 39  ? 23.078 3.640   19.192  1.00 43.61  ? 40  ILE A CG2   1 
ATOM   640  C CD1   . ILE B 2 39  ? 21.455 5.579   18.161  1.00 35.90  ? 40  ILE A CD1   1 
ATOM   641  N N     . LYS B 2 40  ? 22.464 2.463   22.581  1.00 50.08  ? 41  LYS A N     1 
ATOM   642  C CA    . LYS B 2 40  ? 23.449 1.809   23.367  1.00 55.54  ? 41  LYS A CA    1 
ATOM   643  C C     . LYS B 2 40  ? 23.212 0.386   23.818  1.00 61.96  ? 41  LYS A C     1 
ATOM   644  O O     . LYS B 2 40  ? 23.943 -0.499  23.421  1.00 61.99  ? 41  LYS A O     1 
ATOM   645  C CB    . LYS B 2 40  ? 24.089 2.735   24.380  1.00 63.74  ? 41  LYS A CB    1 
ATOM   646  C CG    . LYS B 2 40  ? 24.931 3.857   23.701  1.00 100.00 ? 41  LYS A CG    1 
ATOM   647  C CD    . LYS B 2 40  ? 24.717 3.944   22.144  1.00 100.00 ? 41  LYS A CD    1 
ATOM   648  C CE    . LYS B 2 40  ? 26.051 4.184   21.335  1.00 100.00 ? 41  LYS A CE    1 
ATOM   649  N NZ    . LYS B 2 40  ? 26.378 3.215   20.189  1.00 100.00 ? 41  LYS A NZ    1 
ATOM   650  N N     . GLU B 2 41  ? 22.173 0.160   24.605  1.00 59.64  ? 42  GLU A N     1 
ATOM   651  C CA    . GLU B 2 41  ? 21.860 -1.189  25.067  1.00 60.14  ? 42  GLU A CA    1 
ATOM   652  C C     . GLU B 2 41  ? 21.738 -2.081  23.855  1.00 59.81  ? 42  GLU A C     1 
ATOM   653  O O     . GLU B 2 41  ? 22.040 -3.271  23.869  1.00 67.48  ? 42  GLU A O     1 
ATOM   654  C CB    . GLU B 2 41  ? 20.504 -1.200  25.780  1.00 63.56  ? 42  GLU A CB    1 
ATOM   655  C CG    . GLU B 2 41  ? 20.547 -0.687  27.226  1.00 90.27  ? 42  GLU A CG    1 
ATOM   656  C CD    . GLU B 2 41  ? 19.660 0.515   27.450  1.00 99.37  ? 42  GLU A CD    1 
ATOM   657  O OE1   . GLU B 2 41  ? 18.973 0.923   26.485  1.00 87.01  ? 42  GLU A OE1   1 
ATOM   658  O OE2   . GLU B 2 41  ? 19.661 1.041   28.587  1.00 78.12  ? 42  GLU A OE2   1 
ATOM   659  N N     . LEU B 2 42  ? 21.294 -1.479  22.782  1.00 49.20  ? 43  LEU A N     1 
ATOM   660  C CA    . LEU B 2 42  ? 21.084 -2.203  21.558  1.00 48.07  ? 43  LEU A CA    1 
ATOM   661  C C     . LEU B 2 42  ? 22.354 -2.473  20.780  1.00 54.83  ? 43  LEU A C     1 
ATOM   662  O O     . LEU B 2 42  ? 22.380 -3.296  19.874  1.00 48.29  ? 43  LEU A O     1 
ATOM   663  C CB    . LEU B 2 42  ? 20.128 -1.393  20.718  1.00 47.70  ? 43  LEU A CB    1 
ATOM   664  C CG    . LEU B 2 42  ? 18.739 -1.947  20.748  1.00 51.44  ? 43  LEU A CG    1 
ATOM   665  C CD1   . LEU B 2 42  ? 18.414 -2.309  19.317  1.00 57.84  ? 43  LEU A CD1   1 
ATOM   666  C CD2   . LEU B 2 42  ? 18.868 -3.162  21.597  1.00 46.00  ? 43  LEU A CD2   1 
ATOM   667  N N     . HIS B 2 43  ? 23.403 -1.746  21.130  1.00 68.02  ? 44  HIS A N     1 
ATOM   668  C CA    . HIS B 2 43  ? 24.676 -1.874  20.441  1.00 76.31  ? 44  HIS A CA    1 
ATOM   669  C C     . HIS B 2 43  ? 24.319 -1.632  18.968  1.00 72.01  ? 44  HIS A C     1 
ATOM   670  O O     . HIS B 2 43  ? 24.356 -2.557  18.143  1.00 72.82  ? 44  HIS A O     1 
ATOM   671  C CB    . HIS B 2 43  ? 25.241 -3.285  20.660  1.00 84.17  ? 44  HIS A CB    1 
ATOM   672  C CG    . HIS B 2 43  ? 26.415 -3.330  21.594  1.00 94.23  ? 44  HIS A CG    1 
ATOM   673  N ND1   . HIS B 2 43  ? 26.312 -3.737  22.911  1.00 99.13  ? 44  HIS A ND1   1 
ATOM   674  C CD2   . HIS B 2 43  ? 27.725 -3.021  21.397  1.00 100.00 ? 44  HIS A CD2   1 
ATOM   675  C CE1   . HIS B 2 43  ? 27.505 -3.671  23.485  1.00 100.00 ? 44  HIS A CE1   1 
ATOM   676  N NE2   . HIS B 2 43  ? 28.380 -3.239  22.588  1.00 100.00 ? 44  HIS A NE2   1 
ATOM   677  N N     . TYR B 2 44  ? 23.922 -0.396  18.664  1.00 56.14  ? 45  TYR A N     1 
ATOM   678  C CA    . TYR B 2 44  ? 23.491 -0.056  17.322  1.00 47.11  ? 45  TYR A CA    1 
ATOM   679  C C     . TYR B 2 44  ? 24.455 0.602   16.323  1.00 39.46  ? 45  TYR A C     1 
ATOM   680  O O     . TYR B 2 44  ? 25.020 1.650   16.589  1.00 40.95  ? 45  TYR A O     1 
ATOM   681  C CB    . TYR B 2 44  ? 22.158 0.709   17.393  1.00 43.74  ? 45  TYR A CB    1 
ATOM   682  C CG    . TYR B 2 44  ? 21.644 1.210   16.038  1.00 38.14  ? 45  TYR A CG    1 
ATOM   683  C CD1   . TYR B 2 44  ? 21.328 0.316   15.050  1.00 38.99  ? 45  TYR A CD1   1 
ATOM   684  C CD2   . TYR B 2 44  ? 21.485 2.581   15.755  1.00 34.83  ? 45  TYR A CD2   1 
ATOM   685  C CE1   . TYR B 2 44  ? 20.867 0.726   13.810  1.00 37.91  ? 45  TYR A CE1   1 
ATOM   686  C CE2   . TYR B 2 44  ? 21.038 3.000   14.499  1.00 32.68  ? 45  TYR A CE2   1 
ATOM   687  C CZ    . TYR B 2 44  ? 20.714 2.050   13.538  1.00 44.32  ? 45  TYR A CZ    1 
ATOM   688  O OH    . TYR B 2 44  ? 20.253 2.352   12.267  1.00 30.53  ? 45  TYR A OH    1 
ATOM   689  N N     . SER B 2 45  ? 24.616 -0.003  15.158  1.00 27.09  ? 46  SER A N     1 
ATOM   690  C CA    . SER B 2 45  ? 25.458 0.583   14.146  1.00 29.91  ? 46  SER A CA    1 
ATOM   691  C C     . SER B 2 45  ? 24.598 0.797   12.942  1.00 31.42  ? 46  SER A C     1 
ATOM   692  O O     . SER B 2 45  ? 24.093 -0.089  12.312  1.00 28.07  ? 46  SER A O     1 
ATOM   693  C CB    . SER B 2 45  ? 26.662 -0.273  13.770  1.00 52.28  ? 46  SER A CB    1 
ATOM   694  O OG    . SER B 2 45  ? 27.719 0.547   13.255  1.00 94.58  ? 46  SER A OG    1 
ATOM   695  N N     . PRO B 2 46  ? 24.418 2.024   12.624  1.00 32.54  ? 47  PRO A N     1 
ATOM   696  C CA    . PRO B 2 46  ? 23.558 2.379   11.516  1.00 31.37  ? 47  PRO A CA    1 
ATOM   697  C C     . PRO B 2 46  ? 24.131 1.952   10.188  1.00 36.33  ? 47  PRO A C     1 
ATOM   698  O O     . PRO B 2 46  ? 25.248 2.291   9.849   1.00 43.48  ? 47  PRO A O     1 
ATOM   699  C CB    . PRO B 2 46  ? 23.502 3.908   11.612  1.00 31.17  ? 47  PRO A CB    1 
ATOM   700  C CG    . PRO B 2 46  ? 24.516 4.260   12.776  1.00 35.04  ? 47  PRO A CG    1 
ATOM   701  C CD    . PRO B 2 46  ? 24.520 3.059   13.647  1.00 29.60  ? 47  PRO A CD    1 
ATOM   702  N N     . SER B 2 47  ? 23.373 1.233   9.388   1.00 24.36  ? 48  SER A N     1 
ATOM   703  C CA    . SER B 2 47  ? 23.922 0.868   8.099   1.00 23.55  ? 48  SER A CA    1 
ATOM   704  C C     . SER B 2 47  ? 24.173 2.027   7.088   1.00 36.86  ? 48  SER A C     1 
ATOM   705  O O     . SER B 2 47  ? 23.273 2.830   6.777   1.00 40.68  ? 48  SER A O     1 
ATOM   706  C CB    . SER B 2 47  ? 23.096 -0.200  7.396   1.00 15.82  ? 48  SER A CB    1 
ATOM   707  O OG    . SER B 2 47  ? 23.334 -0.134  5.956   1.00 22.67  ? 48  SER A OG    1 
ATOM   708  N N     . ALA B 2 48  ? 25.376 2.049   6.509   1.00 25.66  ? 49  ALA A N     1 
ATOM   709  C CA    . ALA B 2 48  ? 25.695 3.067   5.508   1.00 19.07  ? 49  ALA A CA    1 
ATOM   710  C C     . ALA B 2 48  ? 25.236 2.599   4.185   1.00 22.04  ? 49  ALA A C     1 
ATOM   711  O O     . ALA B 2 48  ? 25.216 3.389   3.226   1.00 22.37  ? 49  ALA A O     1 
ATOM   712  C CB    . ALA B 2 48  ? 27.217 3.273   5.399   1.00 20.33  ? 49  ALA A CB    1 
ATOM   713  N N     . VAL B 2 49  ? 24.958 1.306   4.054   1.00 17.50  ? 50  VAL A N     1 
ATOM   714  C CA    . VAL B 2 49  ? 24.589 0.955   2.700   1.00 24.13  ? 50  VAL A CA    1 
ATOM   715  C C     . VAL B 2 49  ? 23.153 1.456   2.510   1.00 35.29  ? 50  VAL A C     1 
ATOM   716  O O     . VAL B 2 49  ? 22.764 1.947   1.414   1.00 28.26  ? 50  VAL A O     1 
ATOM   717  C CB    . VAL B 2 49  ? 24.811 -0.560  2.333   1.00 29.03  ? 50  VAL A CB    1 
ATOM   718  C CG1   . VAL B 2 49  ? 24.565 -1.417  3.507   1.00 28.58  ? 50  VAL A CG1   1 
ATOM   719  C CG2   . VAL B 2 49  ? 23.880 -1.007  1.153   1.00 27.43  ? 50  VAL A CG2   1 
ATOM   720  N N     . ALA B 2 50  ? 22.392 1.334   3.609   1.00 34.72  ? 51  ALA A N     1 
ATOM   721  C CA    . ALA B 2 50  ? 21.003 1.758   3.646   1.00 32.08  ? 51  ALA A CA    1 
ATOM   722  C C     . ALA B 2 50  ? 21.089 3.231   3.415   1.00 31.80  ? 51  ALA A C     1 
ATOM   723  O O     . ALA B 2 50  ? 20.502 3.771   2.440   1.00 36.04  ? 51  ALA A O     1 
ATOM   724  C CB    . ALA B 2 50  ? 20.405 1.506   5.021   1.00 34.25  ? 51  ALA A CB    1 
ATOM   725  N N     . ARG B 2 51  ? 21.848 3.893   4.288   1.00 17.57  ? 52  ARG A N     1 
ATOM   726  C CA    . ARG B 2 51  ? 21.951 5.313   4.096   1.00 13.94  ? 52  ARG A CA    1 
ATOM   727  C C     . ARG B 2 51  ? 22.408 5.747   2.747   1.00 17.86  ? 52  ARG A C     1 
ATOM   728  O O     . ARG B 2 51  ? 21.899 6.689   2.174   1.00 21.62  ? 52  ARG A O     1 
ATOM   729  C CB    . ARG B 2 51  ? 22.672 6.041   5.169   1.00 13.10  ? 52  ARG A CB    1 
ATOM   730  C CG    . ARG B 2 51  ? 23.147 7.426   4.622   1.00 30.08  ? 52  ARG A CG    1 
ATOM   731  C CD    . ARG B 2 51  ? 23.939 8.262   5.690   1.00 19.78  ? 52  ARG A CD    1 
ATOM   732  N NE    . ARG B 2 51  ? 23.103 9.336   6.200   1.00 44.12  ? 52  ARG A NE    1 
ATOM   733  C CZ    . ARG B 2 51  ? 23.222 10.582  5.808   1.00 48.48  ? 52  ARG A CZ    1 
ATOM   734  N NH1   . ARG B 2 51  ? 24.156 10.908  4.925   1.00 67.76  ? 52  ARG A NH1   1 
ATOM   735  N NH2   . ARG B 2 51  ? 22.416 11.491  6.316   1.00 75.02  ? 52  ARG A NH2   1 
ATOM   736  N N     . SER B 2 52  ? 23.353 5.035   2.196   1.00 18.99  ? 53  SER A N     1 
ATOM   737  C CA    . SER B 2 52  ? 23.855 5.418   0.891   1.00 22.52  ? 53  SER A CA    1 
ATOM   738  C C     . SER B 2 52  ? 22.867 5.330   -0.210  1.00 31.74  ? 53  SER A C     1 
ATOM   739  O O     . SER B 2 52  ? 22.915 6.132   -1.196  1.00 29.80  ? 53  SER A O     1 
ATOM   740  C CB    . SER B 2 52  ? 25.083 4.581   0.556   1.00 34.56  ? 53  SER A CB    1 
ATOM   741  O OG    . SER B 2 52  ? 26.189 5.022   1.329   1.00 81.05  ? 53  SER A OG    1 
ATOM   742  N N     . LEU B 2 53  ? 22.006 4.309   -0.051  1.00 35.45  ? 54  LEU A N     1 
ATOM   743  C CA    . LEU B 2 53  ? 20.929 3.973   -1.001  1.00 33.15  ? 54  LEU A CA    1 
ATOM   744  C C     . LEU B 2 53  ? 20.047 5.206   -1.214  1.00 35.73  ? 54  LEU A C     1 
ATOM   745  O O     . LEU B 2 53  ? 19.709 5.621   -2.362  1.00 30.06  ? 54  LEU A O     1 
ATOM   746  C CB    . LEU B 2 53  ? 20.128 2.763   -0.530  1.00 28.86  ? 54  LEU A CB    1 
ATOM   747  C CG    . LEU B 2 53  ? 19.182 2.350   -1.683  1.00 34.17  ? 54  LEU A CG    1 
ATOM   748  C CD1   . LEU B 2 53  ? 19.709 2.390   -3.163  1.00 28.20  ? 54  LEU A CD1   1 
ATOM   749  C CD2   . LEU B 2 53  ? 18.221 1.125   -1.425  1.00 41.82  ? 54  LEU A CD2   1 
ATOM   750  N N     . LYS B 2 54  ? 19.727 5.824   -0.100  1.00 34.24  ? 55  LYS A N     1 
ATOM   751  C CA    . LYS B 2 54  ? 18.916 7.004   -0.176  1.00 38.70  ? 55  LYS A CA    1 
ATOM   752  C C     . LYS B 2 54  ? 19.644 8.296   -0.566  1.00 48.65  ? 55  LYS A C     1 
ATOM   753  O O     . LYS B 2 54  ? 19.279 8.906   -1.587  1.00 55.44  ? 55  LYS A O     1 
ATOM   754  C CB    . LYS B 2 54  ? 18.067 7.148   1.105   1.00 43.55  ? 55  LYS A CB    1 
ATOM   755  C CG    . LYS B 2 54  ? 17.114 8.333   1.136   1.00 48.96  ? 55  LYS A CG    1 
ATOM   756  C CD    . LYS B 2 54  ? 15.643 7.888   1.010   1.00 60.05  ? 55  LYS A CD    1 
ATOM   757  C CE    . LYS B 2 54  ? 14.848 8.659   -0.078  1.00 38.92  ? 55  LYS A CE    1 
ATOM   758  N NZ    . LYS B 2 54  ? 13.720 9.476   0.483   1.00 73.70  ? 55  LYS A NZ    1 
ATOM   759  N N     . VAL B 2 55  ? 20.641 8.708   0.234   1.00 34.25  ? 56  VAL A N     1 
ATOM   760  C CA    . VAL B 2 55  ? 21.396 9.970   0.036   1.00 25.88  ? 56  VAL A CA    1 
ATOM   761  C C     . VAL B 2 55  ? 22.124 10.097  -1.267  1.00 33.70  ? 56  VAL A C     1 
ATOM   762  O O     . VAL B 2 55  ? 22.450 11.215  -1.711  1.00 42.32  ? 56  VAL A O     1 
ATOM   763  C CB    . VAL B 2 55  ? 22.454 10.057  1.029   1.00 24.39  ? 56  VAL A CB    1 
ATOM   764  C CG1   . VAL B 2 55  ? 21.889 10.211  2.402   1.00 20.14  ? 56  VAL A CG1   1 
ATOM   765  C CG2   . VAL B 2 55  ? 23.186 8.728   0.919   1.00 27.56  ? 56  VAL A CG2   1 
ATOM   766  N N     . ASN B 2 56  ? 22.408 8.954   -1.867  1.00 27.04  ? 57  ASN A N     1 
ATOM   767  C CA    . ASN B 2 56  ? 23.107 8.924   -3.146  1.00 29.76  ? 57  ASN A CA    1 
ATOM   768  C C     . ASN B 2 56  ? 24.594 9.220   -3.278  1.00 38.84  ? 57  ASN A C     1 
ATOM   769  O O     . ASN B 2 56  ? 25.028 9.854   -4.260  1.00 32.95  ? 57  ASN A O     1 
ATOM   770  C CB    . ASN B 2 56  ? 22.344 9.588   -4.261  1.00 25.84  ? 57  ASN A CB    1 
ATOM   771  C CG    . ASN B 2 56  ? 22.582 8.903   -5.568  1.00 69.39  ? 57  ASN A CG    1 
ATOM   772  O OD1   . ASN B 2 56  ? 22.593 7.670   -5.633  1.00 100.00 ? 57  ASN A OD1   1 
ATOM   773  N ND2   . ASN B 2 56  ? 22.852 9.677   -6.608  1.00 47.20  ? 57  ASN A ND2   1 
ATOM   774  N N     . HIS B 2 57  ? 25.352 8.737   -2.291  1.00 38.58  ? 58  HIS A N     1 
ATOM   775  C CA    . HIS B 2 57  ? 26.787 8.847   -2.253  1.00 39.10  ? 58  HIS A CA    1 
ATOM   776  C C     . HIS B 2 57  ? 27.325 7.913   -1.176  1.00 40.55  ? 58  HIS A C     1 
ATOM   777  O O     . HIS B 2 57  ? 26.847 7.870   -0.027  1.00 35.04  ? 58  HIS A O     1 
ATOM   778  C CB    . HIS B 2 57  ? 27.232 10.279  -2.080  1.00 42.85  ? 58  HIS A CB    1 
ATOM   779  C CG    . HIS B 2 57  ? 26.870 10.857  -0.755  1.00 51.19  ? 58  HIS A CG    1 
ATOM   780  N ND1   . HIS B 2 57  ? 25.974 11.893  -0.615  1.00 54.25  ? 58  HIS A ND1   1 
ATOM   781  C CD2   . HIS B 2 57  ? 27.294 10.551  0.497   1.00 53.86  ? 58  HIS A CD2   1 
ATOM   782  C CE1   . HIS B 2 57  ? 25.856 12.189  0.672   1.00 53.59  ? 58  HIS A CE1   1 
ATOM   783  N NE2   . HIS B 2 57  ? 26.646 11.391  1.368   1.00 52.29  ? 58  HIS A NE2   1 
ATOM   784  N N     . THR B 2 58  ? 28.323 7.143   -1.568  1.00 35.42  ? 59  THR A N     1 
ATOM   785  C CA    . THR B 2 58  ? 28.960 6.154   -0.696  1.00 29.81  ? 59  THR A CA    1 
ATOM   786  C C     . THR B 2 58  ? 29.949 6.685   0.291   1.00 26.84  ? 59  THR A C     1 
ATOM   787  O O     . THR B 2 58  ? 30.236 6.060   1.317   1.00 17.96  ? 59  THR A O     1 
ATOM   788  C CB    . THR B 2 58  ? 29.725 5.270   -1.541  1.00 30.98  ? 59  THR A CB    1 
ATOM   789  O OG1   . THR B 2 58  ? 30.628 6.039   -2.349  1.00 52.78  ? 59  THR A OG1   1 
ATOM   790  C CG2   . THR B 2 58  ? 28.789 4.602   -2.413  1.00 33.74  ? 59  THR A CG2   1 
ATOM   791  N N     . LYS B 2 59  ? 30.457 7.862   -0.021  1.00 21.37  ? 60  LYS A N     1 
ATOM   792  C CA    . LYS B 2 59  ? 31.421 8.498   0.814   1.00 25.28  ? 60  LYS A CA    1 
ATOM   793  C C     . LYS B 2 59  ? 32.703 7.614   0.826   1.00 35.10  ? 60  LYS A C     1 
ATOM   794  O O     . LYS B 2 59  ? 33.354 7.302   1.871   1.00 30.17  ? 60  LYS A O     1 
ATOM   795  C CB    . LYS B 2 59  ? 30.855 8.754   2.196   1.00 24.64  ? 60  LYS A CB    1 
ATOM   796  C CG    . LYS B 2 59  ? 31.248 10.153  2.728   1.00 52.63  ? 60  LYS A CG    1 
ATOM   797  C CD    . LYS B 2 59  ? 30.917 11.260  1.696   1.00 76.02  ? 60  LYS A CD    1 
ATOM   798  C CE    . LYS B 2 59  ? 30.584 12.640  2.343   1.00 99.16  ? 60  LYS A CE    1 
ATOM   799  N NZ    . LYS B 2 59  ? 31.283 12.914  3.644   1.00 99.78  ? 60  LYS A NZ    1 
ATOM   800  N N     . SER B 2 60  ? 33.068 7.205   -0.371  1.00 27.56  ? 61  SER A N     1 
ATOM   801  C CA    . SER B 2 60  ? 34.238 6.409   -0.455  1.00 32.57  ? 61  SER A CA    1 
ATOM   802  C C     . SER B 2 60  ? 34.783 6.590   -1.853  1.00 41.82  ? 61  SER A C     1 
ATOM   803  O O     . SER B 2 60  ? 34.013 6.685   -2.838  1.00 37.71  ? 61  SER A O     1 
ATOM   804  C CB    . SER B 2 60  ? 33.941 4.941   -0.131  1.00 44.56  ? 61  SER A CB    1 
ATOM   805  O OG    . SER B 2 60  ? 33.081 4.352   -1.089  1.00 66.20  ? 61  SER A OG    1 
ATOM   806  N N     . ILE B 2 61  ? 36.121 6.653   -1.917  1.00 35.62  ? 62  ILE A N     1 
ATOM   807  C CA    . ILE B 2 61  ? 36.806 6.840   -3.172  1.00 32.84  ? 62  ILE A CA    1 
ATOM   808  C C     . ILE B 2 61  ? 37.593 5.620   -3.623  1.00 21.64  ? 62  ILE A C     1 
ATOM   809  O O     . ILE B 2 61  ? 37.999 4.786   -2.801  1.00 11.18  ? 62  ILE A O     1 
ATOM   810  C CB    . ILE B 2 61  ? 37.498 8.232   -3.317  1.00 37.04  ? 62  ILE A CB    1 
ATOM   811  C CG1   . ILE B 2 61  ? 38.959 8.124   -2.969  1.00 35.00  ? 62  ILE A CG1   1 
ATOM   812  C CG2   . ILE B 2 61  ? 36.740 9.374   -2.478  1.00 36.82  ? 62  ILE A CG2   1 
ATOM   813  C CD1   . ILE B 2 61  ? 39.719 7.645   -4.146  1.00 80.02  ? 62  ILE A CD1   1 
ATOM   814  N N     . GLY B 2 62  ? 37.769 5.496   -4.939  1.00 19.36  ? 63  GLY A N     1 
ATOM   815  C CA    . GLY B 2 62  ? 38.487 4.350   -5.476  1.00 23.94  ? 63  GLY A CA    1 
ATOM   816  C C     . GLY B 2 62  ? 39.789 4.699   -6.226  1.00 36.20  ? 63  GLY A C     1 
ATOM   817  O O     . GLY B 2 62  ? 39.806 5.525   -7.163  1.00 39.88  ? 63  GLY A O     1 
ATOM   818  N N     . LEU B 2 63  ? 40.866 4.029   -5.809  1.00 28.84  ? 64  LEU A N     1 
ATOM   819  C CA    . LEU B 2 63  ? 42.220 4.170   -6.360  1.00 24.85  ? 64  LEU A CA    1 
ATOM   820  C C     . LEU B 2 63  ? 42.410 3.044   -7.324  1.00 28.20  ? 64  LEU A C     1 
ATOM   821  O O     . LEU B 2 63  ? 42.520 1.859   -6.901  1.00 31.90  ? 64  LEU A O     1 
ATOM   822  C CB    . LEU B 2 63  ? 43.259 3.915   -5.248  1.00 25.75  ? 64  LEU A CB    1 
ATOM   823  C CG    . LEU B 2 63  ? 44.692 4.467   -5.298  1.00 29.36  ? 64  LEU A CG    1 
ATOM   824  C CD1   . LEU B 2 63  ? 45.017 5.266   -6.529  1.00 25.26  ? 64  LEU A CD1   1 
ATOM   825  C CD2   . LEU B 2 63  ? 44.906 5.308   -4.080  1.00 39.12  ? 64  LEU A CD2   1 
ATOM   826  N N     . LEU B 2 64  ? 42.466 3.391   -8.601  1.00 18.94  ? 65  LEU A N     1 
ATOM   827  C CA    . LEU B 2 64  ? 42.687 2.383   -9.594  1.00 21.05  ? 65  LEU A CA    1 
ATOM   828  C C     . LEU B 2 64  ? 44.210 2.433   -9.892  1.00 33.38  ? 65  LEU A C     1 
ATOM   829  O O     . LEU B 2 64  ? 44.704 3.018   -10.883 1.00 26.16  ? 65  LEU A O     1 
ATOM   830  C CB    . LEU B 2 64  ? 41.879 2.686   -10.828 1.00 21.61  ? 65  LEU A CB    1 
ATOM   831  C CG    . LEU B 2 64  ? 42.155 1.557   -11.820 1.00 22.55  ? 65  LEU A CG    1 
ATOM   832  C CD1   . LEU B 2 64  ? 41.759 0.274   -11.087 1.00 17.56  ? 65  LEU A CD1   1 
ATOM   833  C CD2   . LEU B 2 64  ? 41.364 1.778   -13.126 1.00 12.02  ? 65  LEU A CD2   1 
ATOM   834  N N     . ALA B 2 65  ? 44.958 1.814   -8.986  1.00 35.52  ? 66  ALA A N     1 
ATOM   835  C CA    . ALA B 2 65  ? 46.407 1.750   -9.076  1.00 34.07  ? 66  ALA A CA    1 
ATOM   836  C C     . ALA B 2 65  ? 46.922 0.689   -9.989  1.00 39.34  ? 66  ALA A C     1 
ATOM   837  O O     . ALA B 2 65  ? 46.177 -0.127  -10.522 1.00 41.26  ? 66  ALA A O     1 
ATOM   838  C CB    . ALA B 2 65  ? 47.006 1.545   -7.710  1.00 33.57  ? 66  ALA A CB    1 
ATOM   839  N N     . THR B 2 66  ? 48.245 0.706   -10.112 1.00 37.77  ? 67  THR A N     1 
ATOM   840  C CA    . THR B 2 66  ? 49.005 -0.248  -10.919 1.00 33.30  ? 67  THR A CA    1 
ATOM   841  C C     . THR B 2 66  ? 49.544 -1.402  -10.043 1.00 23.40  ? 67  THR A C     1 
ATOM   842  O O     . THR B 2 66  ? 49.275 -2.581  -10.262 1.00 19.03  ? 67  THR A O     1 
ATOM   843  C CB    . THR B 2 66  ? 50.186 0.476   -11.528 1.00 26.36  ? 67  THR A CB    1 
ATOM   844  O OG1   . THR B 2 66  ? 49.726 1.430   -12.505 1.00 54.35  ? 67  THR A OG1   1 
ATOM   845  C CG2   . THR B 2 66  ? 51.048 -0.467  -12.218 1.00 14.13  ? 67  THR A CG2   1 
ATOM   846  N N     . SER B 2 67  ? 50.281 -1.015  -9.021  1.00 15.80  ? 68  SER A N     1 
ATOM   847  C CA    . SER B 2 67  ? 50.901 -1.964  -8.099  1.00 22.03  ? 68  SER A CA    1 
ATOM   848  C C     . SER B 2 67  ? 51.021 -1.101  -6.832  1.00 25.24  ? 68  SER A C     1 
ATOM   849  O O     . SER B 2 67  ? 50.946 0.134   -6.893  1.00 26.92  ? 68  SER A O     1 
ATOM   850  C CB    . SER B 2 67  ? 52.345 -2.362  -8.636  1.00 32.13  ? 68  SER A CB    1 
ATOM   851  O OG    . SER B 2 67  ? 53.302 -2.579  -7.589  1.00 51.71  ? 68  SER A OG    1 
ATOM   852  N N     . SER B 2 68  ? 51.207 -1.728  -5.695  1.00 17.32  ? 69  SER A N     1 
ATOM   853  C CA    . SER B 2 68  ? 51.300 -0.946  -4.504  1.00 19.92  ? 69  SER A CA    1 
ATOM   854  C C     . SER B 2 68  ? 52.577 -1.188  -3.609  1.00 30.66  ? 69  SER A C     1 
ATOM   855  O O     . SER B 2 68  ? 52.768 -0.446  -2.614  1.00 23.39  ? 69  SER A O     1 
ATOM   856  C CB    . SER B 2 68  ? 49.988 -1.168  -3.731  1.00 30.39  ? 69  SER A CB    1 
ATOM   857  O OG    . SER B 2 68  ? 50.033 -2.321  -2.866  1.00 34.87  ? 69  SER A OG    1 
ATOM   858  N N     . GLU B 2 69  ? 53.436 -2.194  -3.917  1.00 27.97  ? 70  GLU A N     1 
ATOM   859  C CA    . GLU B 2 69  ? 54.644 -2.434  -3.075  1.00 27.88  ? 70  GLU A CA    1 
ATOM   860  C C     . GLU B 2 69  ? 55.765 -1.390  -3.376  1.00 25.27  ? 70  GLU A C     1 
ATOM   861  O O     . GLU B 2 69  ? 56.342 -0.785  -2.491  1.00 24.21  ? 70  GLU A O     1 
ATOM   862  C CB    . GLU B 2 69  ? 55.205 -3.843  -3.206  1.00 30.95  ? 70  GLU A CB    1 
ATOM   863  C CG    . GLU B 2 69  ? 56.209 -4.194  -2.088  1.00 33.44  ? 70  GLU A CG    1 
ATOM   864  C CD    . GLU B 2 69  ? 57.667 -4.029  -2.490  1.00 72.58  ? 70  GLU A CD    1 
ATOM   865  O OE1   . GLU B 2 69  ? 57.866 -3.850  -3.708  1.00 35.70  ? 70  GLU A OE1   1 
ATOM   866  O OE2   . GLU B 2 69  ? 58.581 -4.089  -1.593  1.00 83.79  ? 70  GLU A OE2   1 
ATOM   867  N N     . ALA B 2 70  ? 56.029 -1.189  -4.648  1.00 10.87  ? 71  ALA A N     1 
ATOM   868  C CA    . ALA B 2 70  ? 56.970 -0.202  -5.104  1.00 9.11   ? 71  ALA A CA    1 
ATOM   869  C C     . ALA B 2 70  ? 56.939 1.117   -4.324  1.00 28.54  ? 71  ALA A C     1 
ATOM   870  O O     . ALA B 2 70  ? 55.944 1.844   -4.290  1.00 33.91  ? 71  ALA A O     1 
ATOM   871  C CB    . ALA B 2 70  ? 56.730 0.066   -6.604  1.00 5.48   ? 71  ALA A CB    1 
ATOM   872  N N     . ALA B 2 71  ? 58.066 1.377   -3.684  1.00 28.81  ? 72  ALA A N     1 
ATOM   873  C CA    . ALA B 2 71  ? 58.241 2.550   -2.866  1.00 30.15  ? 72  ALA A CA    1 
ATOM   874  C C     . ALA B 2 71  ? 57.570 3.782   -3.394  1.00 24.85  ? 72  ALA A C     1 
ATOM   875  O O     . ALA B 2 71  ? 56.912 4.469   -2.655  1.00 26.65  ? 72  ALA A O     1 
ATOM   876  C CB    . ALA B 2 71  ? 59.694 2.814   -2.680  1.00 34.45  ? 72  ALA A CB    1 
ATOM   877  N N     . TYR B 2 72  ? 57.765 4.062   -4.667  1.00 14.84  ? 73  TYR A N     1 
ATOM   878  C CA    . TYR B 2 72  ? 57.170 5.243   -5.269  1.00 20.05  ? 73  TYR A CA    1 
ATOM   879  C C     . TYR B 2 72  ? 55.631 5.183   -4.984  1.00 30.23  ? 73  TYR A C     1 
ATOM   880  O O     . TYR B 2 72  ? 55.068 5.971   -4.192  1.00 26.77  ? 73  TYR A O     1 
ATOM   881  C CB    . TYR B 2 72  ? 57.473 5.196   -6.764  1.00 23.63  ? 73  TYR A CB    1 
ATOM   882  C CG    . TYR B 2 72  ? 57.042 6.393   -7.524  1.00 33.23  ? 73  TYR A CG    1 
ATOM   883  C CD1   . TYR B 2 72  ? 57.655 7.594   -7.368  1.00 35.39  ? 73  TYR A CD1   1 
ATOM   884  C CD2   . TYR B 2 72  ? 56.000 6.331   -8.415  1.00 37.93  ? 73  TYR A CD2   1 
ATOM   885  C CE1   . TYR B 2 72  ? 57.233 8.715   -8.083  1.00 28.42  ? 73  TYR A CE1   1 
ATOM   886  C CE2   . TYR B 2 72  ? 55.597 7.438   -9.128  1.00 35.96  ? 73  TYR A CE2   1 
ATOM   887  C CZ    . TYR B 2 72  ? 56.216 8.617   -8.943  1.00 37.02  ? 73  TYR A CZ    1 
ATOM   888  O OH    . TYR B 2 72  ? 55.809 9.708   -9.647  1.00 56.53  ? 73  TYR A OH    1 
ATOM   889  N N     . PHE B 2 73  ? 54.987 4.199   -5.597  1.00 18.72  ? 74  PHE A N     1 
ATOM   890  C CA    . PHE B 2 73  ? 53.571 3.971   -5.428  1.00 9.11   ? 74  PHE A CA    1 
ATOM   891  C C     . PHE B 2 73  ? 53.191 3.957   -4.018  1.00 13.35  ? 74  PHE A C     1 
ATOM   892  O O     . PHE B 2 73  ? 52.391 4.749   -3.557  1.00 26.34  ? 74  PHE A O     1 
ATOM   893  C CB    . PHE B 2 73  ? 53.246 2.625   -6.012  1.00 7.40   ? 74  PHE A CB    1 
ATOM   894  C CG    . PHE B 2 73  ? 53.375 2.643   -7.495  1.00 4.64   ? 74  PHE A CG    1 
ATOM   895  C CD1   . PHE B 2 73  ? 53.242 3.840   -8.146  1.00 5.33   ? 74  PHE A CD1   1 
ATOM   896  C CD2   . PHE B 2 73  ? 53.641 1.508   -8.202  1.00 7.42   ? 74  PHE A CD2   1 
ATOM   897  C CE1   . PHE B 2 73  ? 53.341 3.920   -9.476  1.00 11.69  ? 74  PHE A CE1   1 
ATOM   898  C CE2   . PHE B 2 73  ? 53.752 1.551   -9.582  1.00 10.42  ? 74  PHE A CE2   1 
ATOM   899  C CZ    . PHE B 2 73  ? 53.624 2.769   -10.227 1.00 13.10  ? 74  PHE A CZ    1 
ATOM   900  N N     . ALA B 2 74  ? 53.762 3.047   -3.302  1.00 12.21  ? 75  ALA A N     1 
ATOM   901  C CA    . ALA B 2 74  ? 53.409 2.960   -1.908  1.00 15.12  ? 75  ALA A CA    1 
ATOM   902  C C     . ALA B 2 74  ? 53.352 4.254   -1.139  1.00 26.63  ? 75  ALA A C     1 
ATOM   903  O O     . ALA B 2 74  ? 52.561 4.449   -0.219  1.00 30.54  ? 75  ALA A O     1 
ATOM   904  C CB    . ALA B 2 74  ? 54.321 2.060   -1.252  1.00 14.72  ? 75  ALA A CB    1 
ATOM   905  N N     . GLU B 2 75  ? 54.242 5.135   -1.522  1.00 29.60  ? 76  GLU A N     1 
ATOM   906  C CA    . GLU B 2 75  ? 54.332 6.359   -0.836  1.00 29.83  ? 76  GLU A CA    1 
ATOM   907  C C     . GLU B 2 75  ? 53.202 7.252   -1.220  1.00 33.98  ? 76  GLU A C     1 
ATOM   908  O O     . GLU B 2 75  ? 52.678 7.982   -0.390  1.00 34.66  ? 76  GLU A O     1 
ATOM   909  C CB    . GLU B 2 75  ? 55.672 6.988   -1.086  1.00 31.33  ? 76  GLU A CB    1 
ATOM   910  C CG    . GLU B 2 75  ? 56.528 6.989   0.120   1.00 42.75  ? 76  GLU A CG    1 
ATOM   911  C CD    . GLU B 2 75  ? 57.941 7.517   -0.185  1.00 74.00  ? 76  GLU A CD    1 
ATOM   912  O OE1   . GLU B 2 75  ? 58.037 8.771   -0.266  1.00 41.92  ? 76  GLU A OE1   1 
ATOM   913  O OE2   . GLU B 2 75  ? 58.906 6.677   -0.335  1.00 28.35  ? 76  GLU A OE2   1 
ATOM   914  N N     . ILE B 2 76  ? 52.817 7.229   -2.472  1.00 33.00  ? 77  ILE A N     1 
ATOM   915  C CA    . ILE B 2 76  ? 51.704 8.101   -2.871  1.00 32.26  ? 77  ILE A CA    1 
ATOM   916  C C     . ILE B 2 76  ? 50.424 7.629   -2.170  1.00 33.62  ? 77  ILE A C     1 
ATOM   917  O O     . ILE B 2 76  ? 49.687 8.384   -1.533  1.00 29.71  ? 77  ILE A O     1 
ATOM   918  C CB    . ILE B 2 76  ? 51.432 8.006   -4.356  1.00 29.55  ? 77  ILE A CB    1 
ATOM   919  C CG1   . ILE B 2 76  ? 52.708 8.164   -5.123  1.00 25.23  ? 77  ILE A CG1   1 
ATOM   920  C CG2   . ILE B 2 76  ? 50.618 9.132   -4.718  1.00 34.92  ? 77  ILE A CG2   1 
ATOM   921  C CD1   . ILE B 2 76  ? 52.543 9.073   -6.249  1.00 29.68  ? 77  ILE A CD1   1 
ATOM   922  N N     . ILE B 2 77  ? 50.171 6.349   -2.317  1.00 25.92  ? 78  ILE A N     1 
ATOM   923  C CA    . ILE B 2 77  ? 49.014 5.761   -1.752  1.00 20.51  ? 78  ILE A CA    1 
ATOM   924  C C     . ILE B 2 77  ? 48.827 6.106   -0.306  1.00 22.16  ? 78  ILE A C     1 
ATOM   925  O O     . ILE B 2 77  ? 47.755 6.619   0.091   1.00 24.75  ? 78  ILE A O     1 
ATOM   926  C CB    . ILE B 2 77  ? 49.087 4.314   -1.954  1.00 22.31  ? 78  ILE A CB    1 
ATOM   927  C CG1   . ILE B 2 77  ? 48.682 3.997   -3.394  1.00 14.80  ? 78  ILE A CG1   1 
ATOM   928  C CG2   . ILE B 2 77  ? 48.315 3.625   -0.913  1.00 28.47  ? 78  ILE A CG2   1 
ATOM   929  C CD1   . ILE B 2 77  ? 49.197 2.671   -3.827  1.00 9.59   ? 78  ILE A CD1   1 
ATOM   930  N N     . GLU B 2 78  ? 49.884 5.889   0.471   1.00 12.71  ? 79  GLU A N     1 
ATOM   931  C CA    . GLU B 2 78  ? 49.832 6.202   1.902   1.00 15.86  ? 79  GLU A CA    1 
ATOM   932  C C     . GLU B 2 78  ? 49.343 7.619   2.069   1.00 23.49  ? 79  GLU A C     1 
ATOM   933  O O     . GLU B 2 78  ? 48.603 7.948   3.013   1.00 27.25  ? 79  GLU A O     1 
ATOM   934  C CB    . GLU B 2 78  ? 51.217 6.095   2.559   1.00 16.83  ? 79  GLU A CB    1 
ATOM   935  C CG    . GLU B 2 78  ? 51.164 5.496   3.998   1.00 24.77  ? 79  GLU A CG    1 
ATOM   936  C CD    . GLU B 2 78  ? 52.478 5.563   4.798   1.00 41.12  ? 79  GLU A CD    1 
ATOM   937  O OE1   . GLU B 2 78  ? 53.010 6.699   4.962   1.00 54.59  ? 79  GLU A OE1   1 
ATOM   938  O OE2   . GLU B 2 78  ? 52.909 4.502   5.353   1.00 42.61  ? 79  GLU A OE2   1 
ATOM   939  N N     . ALA B 2 79  ? 49.762 8.458   1.131   1.00 12.77  ? 80  ALA A N     1 
ATOM   940  C CA    . ALA B 2 79  ? 49.384 9.874   1.196   1.00 18.69  ? 80  ALA A CA    1 
ATOM   941  C C     . ALA B 2 79  ? 47.878 10.010  1.050   1.00 32.07  ? 80  ALA A C     1 
ATOM   942  O O     . ALA B 2 79  ? 47.172 10.458  1.984   1.00 28.62  ? 80  ALA A O     1 
ATOM   943  C CB    . ALA B 2 79  ? 50.104 10.717  0.063   1.00 17.48  ? 80  ALA A CB    1 
ATOM   944  N N     . VAL B 2 80  ? 47.433 9.647   -0.161  1.00 19.20  ? 81  VAL A N     1 
ATOM   945  C CA    . VAL B 2 80  ? 46.055 9.661   -0.518  1.00 12.75  ? 81  VAL A CA    1 
ATOM   946  C C     . VAL B 2 80  ? 45.222 9.084   0.659   1.00 24.84  ? 81  VAL A C     1 
ATOM   947  O O     . VAL B 2 80  ? 44.370 9.787   1.171   1.00 26.60  ? 81  VAL A O     1 
ATOM   948  C CB    . VAL B 2 80  ? 45.908 8.827   -1.685  1.00 18.31  ? 81  VAL A CB    1 
ATOM   949  C CG1   . VAL B 2 80  ? 44.563 8.182   -1.679  1.00 17.18  ? 81  VAL A CG1   1 
ATOM   950  C CG2   . VAL B 2 80  ? 46.284 9.661   -2.972  1.00 17.33  ? 81  VAL A CG2   1 
ATOM   951  N N     . GLU B 2 81  ? 45.504 7.875   1.160   1.00 20.57  ? 82  GLU A N     1 
ATOM   952  C CA    . GLU B 2 81  ? 44.685 7.427   2.288   1.00 18.49  ? 82  GLU A CA    1 
ATOM   953  C C     . GLU B 2 81  ? 44.600 8.412   3.415   1.00 28.28  ? 82  GLU A C     1 
ATOM   954  O O     . GLU B 2 81  ? 43.567 8.563   4.020   1.00 35.99  ? 82  GLU A O     1 
ATOM   955  C CB    . GLU B 2 81  ? 45.079 6.082   2.910   1.00 18.31  ? 82  GLU A CB    1 
ATOM   956  C CG    . GLU B 2 81  ? 45.735 6.328   4.316   1.00 50.50  ? 82  GLU A CG    1 
ATOM   957  C CD    . GLU B 2 81  ? 44.843 5.925   5.437   1.00 45.38  ? 82  GLU A CD    1 
ATOM   958  O OE1   . GLU B 2 81  ? 43.880 5.232   5.110   1.00 33.48  ? 82  GLU A OE1   1 
ATOM   959  O OE2   . GLU B 2 81  ? 45.120 6.245   6.626   1.00 46.63  ? 82  GLU A OE2   1 
ATOM   960  N N     . LYS B 2 82  ? 45.694 9.056   3.723   1.00 30.98  ? 83  LYS A N     1 
ATOM   961  C CA    . LYS B 2 82  ? 45.710 9.979   4.841   1.00 32.97  ? 83  LYS A CA    1 
ATOM   962  C C     . LYS B 2 82  ? 44.646 11.023  4.663   1.00 28.75  ? 83  LYS A C     1 
ATOM   963  O O     . LYS B 2 82  ? 43.942 11.373  5.582   1.00 24.40  ? 83  LYS A O     1 
ATOM   964  C CB    . LYS B 2 82  ? 47.087 10.701  4.914   1.00 44.65  ? 83  LYS A CB    1 
ATOM   965  C CG    . LYS B 2 82  ? 48.250 9.902   5.557   1.00 69.72  ? 83  LYS A CG    1 
ATOM   966  C CD    . LYS B 2 82  ? 48.972 10.729  6.666   1.00 70.06  ? 83  LYS A CD    1 
ATOM   967  C CE    . LYS B 2 82  ? 50.411 11.201  6.265   1.00 100.00 ? 83  LYS A CE    1 
ATOM   968  N NZ    . LYS B 2 82  ? 51.515 10.936  7.274   1.00 100.00 ? 83  LYS A NZ    1 
ATOM   969  N N     . ASN B 2 83  ? 44.566 11.522  3.453   1.00 26.03  ? 84  ASN A N     1 
ATOM   970  C CA    . ASN B 2 83  ? 43.634 12.548  3.104   1.00 27.09  ? 84  ASN A CA    1 
ATOM   971  C C     . ASN B 2 83  ? 42.178 12.074  3.141   1.00 44.50  ? 84  ASN A C     1 
ATOM   972  O O     . ASN B 2 83  ? 41.313 12.791  3.651   1.00 53.79  ? 84  ASN A O     1 
ATOM   973  C CB    . ASN B 2 83  ? 43.998 13.047  1.716   1.00 15.06  ? 84  ASN A CB    1 
ATOM   974  C CG    . ASN B 2 83  ? 45.291 13.880  1.690   1.00 74.77  ? 84  ASN A CG    1 
ATOM   975  O OD1   . ASN B 2 83  ? 45.273 15.115  1.874   1.00 55.48  ? 84  ASN A OD1   1 
ATOM   976  N ND2   . ASN B 2 83  ? 46.403 13.220  1.363   1.00 84.32  ? 84  ASN A ND2   1 
ATOM   977  N N     . CYS B 2 84  ? 41.908 10.897  2.574   1.00 32.64  ? 85  CYS A N     1 
ATOM   978  C CA    . CYS B 2 84  ? 40.572 10.344  2.563   1.00 26.75  ? 85  CYS A CA    1 
ATOM   979  C C     . CYS B 2 84  ? 40.118 10.315  4.007   1.00 36.57  ? 85  CYS A C     1 
ATOM   980  O O     . CYS B 2 84  ? 39.121 10.923  4.364   1.00 40.90  ? 85  CYS A O     1 
ATOM   981  C CB    . CYS B 2 84  ? 40.590 8.894   2.067   1.00 23.34  ? 85  CYS A CB    1 
ATOM   982  S SG    . CYS B 2 84  ? 40.770 8.821   0.247   1.00 28.00  ? 85  CYS A SG    1 
ATOM   983  N N     . PHE B 2 85  ? 40.864 9.622   4.854   1.00 27.86  ? 86  PHE A N     1 
ATOM   984  C CA    . PHE B 2 85  ? 40.497 9.504   6.277   1.00 25.20  ? 86  PHE A CA    1 
ATOM   985  C C     . PHE B 2 85  ? 40.224 10.763  6.971   1.00 29.37  ? 86  PHE A C     1 
ATOM   986  O O     . PHE B 2 85  ? 39.459 10.829  7.904   1.00 32.23  ? 86  PHE A O     1 
ATOM   987  C CB    . PHE B 2 85  ? 41.660 8.919   7.059   1.00 23.96  ? 86  PHE A CB    1 
ATOM   988  C CG    . PHE B 2 85  ? 41.408 8.802   8.518   1.00 26.04  ? 86  PHE A CG    1 
ATOM   989  C CD1   . PHE B 2 85  ? 40.532 7.828   8.995   1.00 36.41  ? 86  PHE A CD1   1 
ATOM   990  C CD2   . PHE B 2 85  ? 42.012 9.665   9.405   1.00 31.33  ? 86  PHE A CD2   1 
ATOM   991  C CE1   . PHE B 2 85  ? 40.292 7.678   10.330  1.00 39.09  ? 86  PHE A CE1   1 
ATOM   992  C CE2   . PHE B 2 85  ? 41.790 9.549   10.775  1.00 39.48  ? 86  PHE A CE2   1 
ATOM   993  C CZ    . PHE B 2 85  ? 40.932 8.551   11.246  1.00 41.58  ? 86  PHE A CZ    1 
ATOM   994  N N     . GLN B 2 86  ? 40.968 11.749  6.572   1.00 33.07  ? 87  GLN A N     1 
ATOM   995  C CA    . GLN B 2 86  ? 40.884 13.016  7.236   1.00 37.76  ? 87  GLN A CA    1 
ATOM   996  C C     . GLN B 2 86  ? 39.615 13.759  6.914   1.00 42.01  ? 87  GLN A C     1 
ATOM   997  O O     . GLN B 2 86  ? 39.200 14.612  7.676   1.00 38.60  ? 87  GLN A O     1 
ATOM   998  C CB    . GLN B 2 86  ? 42.196 13.809  7.040   1.00 38.79  ? 87  GLN A CB    1 
ATOM   999  C CG    . GLN B 2 86  ? 42.343 15.051  7.857   1.00 84.94  ? 87  GLN A CG    1 
ATOM   1000 C CD    . GLN B 2 86  ? 42.262 16.295  6.979   1.00 100.00 ? 87  GLN A CD    1 
ATOM   1001 O OE1   . GLN B 2 86  ? 42.738 16.282  5.825   1.00 100.00 ? 87  GLN A OE1   1 
ATOM   1002 N NE2   . GLN B 2 86  ? 41.630 17.374  7.505   1.00 73.17  ? 87  GLN A NE2   1 
ATOM   1003 N N     . LYS B 2 87  ? 38.986 13.382  5.804   1.00 46.40  ? 88  LYS A N     1 
ATOM   1004 C CA    . LYS B 2 87  ? 37.721 13.970  5.320   1.00 42.95  ? 88  LYS A CA    1 
ATOM   1005 C C     . LYS B 2 87  ? 36.643 12.919  5.205   1.00 42.73  ? 88  LYS A C     1 
ATOM   1006 O O     . LYS B 2 87  ? 35.872 12.909  4.241   1.00 45.44  ? 88  LYS A O     1 
ATOM   1007 C CB    . LYS B 2 87  ? 37.929 14.597  3.953   1.00 38.21  ? 88  LYS A CB    1 
ATOM   1008 C CG    . LYS B 2 87  ? 39.197 15.402  3.907   1.00 42.76  ? 88  LYS A CG    1 
ATOM   1009 C CD    . LYS B 2 87  ? 38.920 16.796  3.345   1.00 57.63  ? 88  LYS A CD    1 
ATOM   1010 C CE    . LYS B 2 87  ? 40.037 17.754  3.702   1.00 97.88  ? 88  LYS A CE    1 
ATOM   1011 N NZ    . LYS B 2 87  ? 39.527 18.769  4.678   1.00 100.00 ? 88  LYS A NZ    1 
ATOM   1012 N N     . GLY B 2 88  ? 36.607 12.005  6.171   1.00 33.44  ? 89  GLY A N     1 
ATOM   1013 C CA    . GLY B 2 88  ? 35.602 10.947  6.132   1.00 31.52  ? 89  GLY A CA    1 
ATOM   1014 C C     . GLY B 2 88  ? 35.605 9.893   5.013   1.00 37.15  ? 89  GLY A C     1 
ATOM   1015 O O     . GLY B 2 88  ? 35.028 8.827   5.197   1.00 49.04  ? 89  GLY A O     1 
ATOM   1016 N N     . TYR B 2 89  ? 36.221 10.142  3.863   1.00 22.51  ? 90  TYR A N     1 
ATOM   1017 C CA    . TYR B 2 89  ? 36.247 9.113   2.840   1.00 16.49  ? 90  TYR A CA    1 
ATOM   1018 C C     . TYR B 2 89  ? 36.868 7.785   3.240   1.00 29.73  ? 90  TYR A C     1 
ATOM   1019 O O     . TYR B 2 89  ? 37.648 7.688   4.165   1.00 37.56  ? 90  TYR A O     1 
ATOM   1020 C CB    . TYR B 2 89  ? 36.783 9.622   1.530   1.00 15.35  ? 90  TYR A CB    1 
ATOM   1021 C CG    . TYR B 2 89  ? 35.828 10.606  1.043   1.00 27.03  ? 90  TYR A CG    1 
ATOM   1022 C CD1   . TYR B 2 89  ? 35.675 11.838  1.688   1.00 30.34  ? 90  TYR A CD1   1 
ATOM   1023 C CD2   . TYR B 2 89  ? 34.959 10.282  0.006   1.00 32.50  ? 90  TYR A CD2   1 
ATOM   1024 C CE1   . TYR B 2 89  ? 34.695 12.749  1.246   1.00 38.95  ? 90  TYR A CE1   1 
ATOM   1025 C CE2   . TYR B 2 89  ? 33.979 11.177  -0.444  1.00 32.22  ? 90  TYR A CE2   1 
ATOM   1026 C CZ    . TYR B 2 89  ? 33.846 12.403  0.157   1.00 48.72  ? 90  TYR A CZ    1 
ATOM   1027 O OH    . TYR B 2 89  ? 32.839 13.253  -0.323  1.00 63.85  ? 90  TYR A OH    1 
ATOM   1028 N N     . THR B 2 90  ? 36.501 6.747   2.516   1.00 27.79  ? 91  THR A N     1 
ATOM   1029 C CA    . THR B 2 90  ? 36.996 5.403   2.771   1.00 24.38  ? 91  THR A CA    1 
ATOM   1030 C C     . THR B 2 90  ? 37.688 5.035   1.459   1.00 34.11  ? 91  THR A C     1 
ATOM   1031 O O     . THR B 2 90  ? 37.269 5.480   0.389   1.00 42.69  ? 91  THR A O     1 
ATOM   1032 C CB    . THR B 2 90  ? 35.794 4.481   3.066   1.00 27.67  ? 91  THR A CB    1 
ATOM   1033 O OG1   . THR B 2 90  ? 35.942 3.837   4.336   1.00 23.47  ? 91  THR A OG1   1 
ATOM   1034 C CG2   . THR B 2 90  ? 35.586 3.499   2.011   1.00 13.03  ? 91  THR A CG2   1 
ATOM   1035 N N     . LEU B 2 91  ? 38.758 4.258   1.518   1.00 29.68  ? 92  LEU A N     1 
ATOM   1036 C CA    . LEU B 2 91  ? 39.484 3.944   0.296   1.00 27.71  ? 92  LEU A CA    1 
ATOM   1037 C C     . LEU B 2 91  ? 39.443 2.493   -0.217  1.00 25.39  ? 92  LEU A C     1 
ATOM   1038 O O     . LEU B 2 91  ? 39.514 1.505   0.549   1.00 13.51  ? 92  LEU A O     1 
ATOM   1039 C CB    . LEU B 2 91  ? 40.945 4.391   0.477   1.00 28.93  ? 92  LEU A CB    1 
ATOM   1040 C CG    . LEU B 2 91  ? 41.902 4.906   -0.596  1.00 37.29  ? 92  LEU A CG    1 
ATOM   1041 C CD1   . LEU B 2 91  ? 43.163 4.084   -0.417  1.00 35.92  ? 92  LEU A CD1   1 
ATOM   1042 C CD2   . LEU B 2 91  ? 41.355 4.811   -2.034  1.00 48.55  ? 92  LEU A CD2   1 
ATOM   1043 N N     . ILE B 2 92  ? 39.325 2.394   -1.533  1.00 25.62  ? 93  ILE A N     1 
ATOM   1044 C CA    . ILE B 2 92  ? 39.324 1.134   -2.157  1.00 28.45  ? 93  ILE A CA    1 
ATOM   1045 C C     . ILE B 2 92  ? 40.563 1.131   -3.030  1.00 41.34  ? 93  ILE A C     1 
ATOM   1046 O O     . ILE B 2 92  ? 40.703 1.867   -4.017  1.00 40.92  ? 93  ILE A O     1 
ATOM   1047 C CB    . ILE B 2 92  ? 38.122 0.875   -2.915  1.00 34.21  ? 93  ILE A CB    1 
ATOM   1048 C CG1   . ILE B 2 92  ? 36.947 0.827   -1.932  1.00 40.94  ? 93  ILE A CG1   1 
ATOM   1049 C CG2   . ILE B 2 92  ? 38.282 -0.498  -3.630  1.00 32.81  ? 93  ILE A CG2   1 
ATOM   1050 C CD1   . ILE B 2 92  ? 35.556 0.475   -2.595  1.00 45.53  ? 93  ILE A CD1   1 
ATOM   1051 N N     . LEU B 2 93  ? 41.502 0.305   -2.611  1.00 33.46  ? 94  LEU A N     1 
ATOM   1052 C CA    . LEU B 2 93  ? 42.732 0.232   -3.293  1.00 26.89  ? 94  LEU A CA    1 
ATOM   1053 C C     . LEU B 2 93  ? 42.614 -0.801  -4.354  1.00 23.25  ? 94  LEU A C     1 
ATOM   1054 O O     . LEU B 2 93  ? 42.381 -1.953  -4.046  1.00 17.11  ? 94  LEU A O     1 
ATOM   1055 C CB    . LEU B 2 93  ? 43.768 -0.184  -2.241  1.00 26.00  ? 94  LEU A CB    1 
ATOM   1056 C CG    . LEU B 2 93  ? 45.216 -0.364  -2.740  1.00 27.77  ? 94  LEU A CG    1 
ATOM   1057 C CD1   . LEU B 2 93  ? 45.566 0.693   -3.790  1.00 19.05  ? 94  LEU A CD1   1 
ATOM   1058 C CD2   . LEU B 2 93  ? 46.246 -0.446  -1.569  1.00 30.93  ? 94  LEU A CD2   1 
ATOM   1059 N N     . GLY B 2 94  ? 42.802 -0.474  -5.617  1.00 23.55  ? 95  GLY A N     1 
ATOM   1060 C CA    . GLY B 2 94  ? 42.707 -1.604  -6.559  1.00 26.65  ? 95  GLY A CA    1 
ATOM   1061 C C     . GLY B 2 94  ? 43.884 -1.594  -7.542  1.00 42.31  ? 95  GLY A C     1 
ATOM   1062 O O     . GLY B 2 94  ? 44.088 -0.569  -8.218  1.00 46.03  ? 95  GLY A O     1 
ATOM   1063 N N     . ASN B 2 95  ? 44.652 -2.697  -7.641  1.00 31.64  ? 96  ASN A N     1 
ATOM   1064 C CA    . ASN B 2 95  ? 45.801 -2.726  -8.577  1.00 28.87  ? 96  ASN A CA    1 
ATOM   1065 C C     . ASN B 2 95  ? 45.555 -3.545  -9.829  1.00 30.03  ? 96  ASN A C     1 
ATOM   1066 O O     . ASN B 2 95  ? 45.455 -4.751  -9.719  1.00 36.06  ? 96  ASN A O     1 
ATOM   1067 C CB    . ASN B 2 95  ? 46.991 -3.409  -7.903  1.00 31.01  ? 96  ASN A CB    1 
ATOM   1068 C CG    . ASN B 2 95  ? 47.421 -2.729  -6.663  1.00 48.12  ? 96  ASN A CG    1 
ATOM   1069 O OD1   . ASN B 2 95  ? 47.661 -3.364  -5.665  1.00 29.92  ? 96  ASN A OD1   1 
ATOM   1070 N ND2   . ASN B 2 95  ? 47.550 -1.427  -6.715  1.00 46.10  ? 96  ASN A ND2   1 
ATOM   1071 N N     . ALA B 2 96  ? 45.520 -2.930  -11.004 1.00 22.16  ? 97  ALA A N     1 
ATOM   1072 C CA    . ALA B 2 96  ? 45.292 -3.624  -12.302 1.00 22.60  ? 97  ALA A CA    1 
ATOM   1073 C C     . ALA B 2 96  ? 46.514 -4.195  -13.003 1.00 41.39  ? 97  ALA A C     1 
ATOM   1074 O O     . ALA B 2 96  ? 46.370 -4.787  -14.113 1.00 42.12  ? 97  ALA A O     1 
ATOM   1075 C CB    . ALA B 2 96  ? 44.596 -2.663  -13.302 1.00 25.41  ? 97  ALA A CB    1 
ATOM   1076 N N     . TRP B 2 97  ? 47.690 -3.955  -12.397 1.00 41.01  ? 98  TRP A N     1 
ATOM   1077 C CA    . TRP B 2 97  ? 48.967 -4.424  -12.901 1.00 35.83  ? 98  TRP A CA    1 
ATOM   1078 C C     . TRP B 2 97  ? 49.129 -4.277  -14.360 1.00 37.31  ? 98  TRP A C     1 
ATOM   1079 O O     . TRP B 2 97  ? 49.490 -5.233  -15.025 1.00 37.11  ? 98  TRP A O     1 
ATOM   1080 C CB    . TRP B 2 97  ? 49.093 -5.889  -12.606 1.00 32.98  ? 98  TRP A CB    1 
ATOM   1081 C CG    . TRP B 2 97  ? 49.236 -6.079  -11.177 1.00 33.19  ? 98  TRP A CG    1 
ATOM   1082 C CD1   . TRP B 2 97  ? 48.266 -6.304  -10.307 1.00 35.15  ? 98  TRP A CD1   1 
ATOM   1083 C CD2   . TRP B 2 97  ? 50.443 -6.034  -10.437 1.00 35.13  ? 98  TRP A CD2   1 
ATOM   1084 N NE1   . TRP B 2 97  ? 48.760 -6.468  -9.045  1.00 34.94  ? 98  TRP A NE1   1 
ATOM   1085 C CE2   . TRP B 2 97  ? 50.107 -6.296  -9.093  1.00 38.80  ? 98  TRP A CE2   1 
ATOM   1086 C CE3   . TRP B 2 97  ? 51.782 -5.825  -10.780 1.00 38.58  ? 98  TRP A CE3   1 
ATOM   1087 C CZ2   . TRP B 2 97  ? 51.042 -6.312  -8.073  1.00 39.73  ? 98  TRP A CZ2   1 
ATOM   1088 C CZ3   . TRP B 2 97  ? 52.720 -5.873  -9.777  1.00 43.76  ? 98  TRP A CZ3   1 
ATOM   1089 C CH2   . TRP B 2 97  ? 52.339 -6.111  -8.420  1.00 44.41  ? 98  TRP A CH2   1 
ATOM   1090 N N     . ASN B 2 98  ? 48.869 -3.086  -14.851 1.00 36.76  ? 99  ASN A N     1 
ATOM   1091 C CA    . ASN B 2 98  ? 49.025 -2.796  -16.264 1.00 39.56  ? 99  ASN A CA    1 
ATOM   1092 C C     . ASN B 2 98  ? 48.348 -3.843  -17.154 1.00 43.69  ? 99  ASN A C     1 
ATOM   1093 O O     . ASN B 2 98  ? 48.835 -4.184  -18.232 1.00 44.62  ? 99  ASN A O     1 
ATOM   1094 C CB    . ASN B 2 98  ? 50.514 -2.501  -16.612 1.00 20.47  ? 99  ASN A CB    1 
ATOM   1095 C CG    . ASN B 2 98  ? 50.659 -1.418  -17.652 1.00 90.21  ? 99  ASN A CG    1 
ATOM   1096 O OD1   . ASN B 2 98  ? 51.650 -1.370  -18.384 1.00 100.00 ? 99  ASN A OD1   1 
ATOM   1097 N ND2   . ASN B 2 98  ? 49.650 -0.551  -17.747 1.00 97.93  ? 99  ASN A ND2   1 
ATOM   1098 N N     . ASN B 2 99  ? 47.208 -4.332  -16.684 1.00 42.40  ? 100 ASN A N     1 
ATOM   1099 C CA    . ASN B 2 99  ? 46.433 -5.332  -17.401 1.00 42.55  ? 100 ASN A CA    1 
ATOM   1100 C C     . ASN B 2 99  ? 45.023 -4.779  -17.638 1.00 42.99  ? 100 ASN A C     1 
ATOM   1101 O O     . ASN B 2 99  ? 44.255 -4.523  -16.684 1.00 37.14  ? 100 ASN A O     1 
ATOM   1102 C CB    . ASN B 2 99  ? 46.348 -6.607  -16.568 1.00 41.62  ? 100 ASN A CB    1 
ATOM   1103 C CG    . ASN B 2 99  ? 45.445 -7.626  -17.179 1.00 74.93  ? 100 ASN A CG    1 
ATOM   1104 O OD1   . ASN B 2 99  ? 45.872 -8.739  -17.452 1.00 59.37  ? 100 ASN A OD1   1 
ATOM   1105 N ND2   . ASN B 2 99  ? 44.199 -7.268  -17.423 1.00 81.71  ? 100 ASN A ND2   1 
ATOM   1106 N N     . LEU B 2 100 ? 44.681 -4.675  -18.916 1.00 36.98  ? 101 LEU A N     1 
ATOM   1107 C CA    . LEU B 2 100 ? 43.384 -4.195  -19.356 1.00 35.36  ? 101 LEU A CA    1 
ATOM   1108 C C     . LEU B 2 100 ? 42.228 -4.952  -18.705 1.00 43.89  ? 101 LEU A C     1 
ATOM   1109 O O     . LEU B 2 100 ? 41.318 -4.374  -18.114 1.00 33.65  ? 101 LEU A O     1 
ATOM   1110 C CB    . LEU B 2 100 ? 43.306 -4.461  -20.842 1.00 35.41  ? 101 LEU A CB    1 
ATOM   1111 C CG    . LEU B 2 100 ? 42.360 -3.566  -21.614 1.00 43.93  ? 101 LEU A CG    1 
ATOM   1112 C CD1   . LEU B 2 100 ? 42.326 -2.182  -20.966 1.00 47.07  ? 101 LEU A CD1   1 
ATOM   1113 C CD2   . LEU B 2 100 ? 42.852 -3.462  -23.042 1.00 45.26  ? 101 LEU A CD2   1 
ATOM   1114 N N     . GLU B 2 101 ? 42.257 -6.270  -18.865 1.00 46.09  ? 102 GLU A N     1 
ATOM   1115 C CA    . GLU B 2 101 ? 41.232 -7.131  -18.325 1.00 43.63  ? 102 GLU A CA    1 
ATOM   1116 C C     . GLU B 2 101 ? 40.986 -6.840  -16.867 1.00 38.20  ? 102 GLU A C     1 
ATOM   1117 O O     . GLU B 2 101 ? 39.841 -6.658  -16.446 1.00 42.38  ? 102 GLU A O     1 
ATOM   1118 C CB    . GLU B 2 101 ? 41.573 -8.602  -18.562 1.00 47.16  ? 102 GLU A CB    1 
ATOM   1119 C CG    . GLU B 2 101 ? 40.922 -9.349  -19.849 1.00 79.35  ? 102 GLU A CG    1 
ATOM   1120 C CD    . GLU B 2 101 ? 40.410 -8.451  -21.031 1.00 100.00 ? 102 GLU A CD    1 
ATOM   1121 O OE1   . GLU B 2 101 ? 39.238 -8.004  -20.984 1.00 100.00 ? 102 GLU A OE1   1 
ATOM   1122 O OE2   . GLU B 2 101 ? 41.110 -8.319  -22.077 1.00 100.00 ? 102 GLU A OE2   1 
ATOM   1123 N N     . LYS B 2 102 ? 42.053 -6.786  -16.092 1.00 28.19  ? 103 LYS A N     1 
ATOM   1124 C CA    . LYS B 2 102 ? 41.938 -6.499  -14.661 1.00 27.20  ? 103 LYS A CA    1 
ATOM   1125 C C     . LYS B 2 102 ? 41.506 -5.067  -14.511 1.00 33.27  ? 103 LYS A C     1 
ATOM   1126 O O     . LYS B 2 102 ? 40.831 -4.687  -13.543 1.00 37.12  ? 103 LYS A O     1 
ATOM   1127 C CB    . LYS B 2 102 ? 43.274 -6.597  -14.010 1.00 23.56  ? 103 LYS A CB    1 
ATOM   1128 C CG    . LYS B 2 102 ? 43.426 -7.768  -13.194 1.00 31.79  ? 103 LYS A CG    1 
ATOM   1129 C CD    . LYS B 2 102 ? 44.785 -8.342  -13.497 1.00 54.90  ? 103 LYS A CD    1 
ATOM   1130 C CE    . LYS B 2 102 ? 45.577 -8.597  -12.230 1.00 71.27  ? 103 LYS A CE    1 
ATOM   1131 N NZ    . LYS B 2 102 ? 46.771 -9.456  -12.574 1.00 100.00 ? 103 LYS A NZ    1 
ATOM   1132 N N     . GLN B 2 103 ? 41.905 -4.243  -15.454 1.00 20.25  ? 104 GLN A N     1 
ATOM   1133 C CA    . GLN B 2 103 ? 41.470 -2.908  -15.293 1.00 25.01  ? 104 GLN A CA    1 
ATOM   1134 C C     . GLN B 2 103 ? 39.988 -2.750  -15.562 1.00 36.42  ? 104 GLN A C     1 
ATOM   1135 O O     . GLN B 2 103 ? 39.293 -2.141  -14.739 1.00 36.45  ? 104 GLN A O     1 
ATOM   1136 C CB    . GLN B 2 103 ? 42.374 -1.873  -15.921 1.00 27.44  ? 104 GLN A CB    1 
ATOM   1137 C CG    . GLN B 2 103 ? 42.697 -2.107  -17.359 1.00 55.67  ? 104 GLN A CG    1 
ATOM   1138 C CD    . GLN B 2 103 ? 44.040 -1.534  -17.658 1.00 46.14  ? 104 GLN A CD    1 
ATOM   1139 O OE1   . GLN B 2 103 ? 44.845 -1.415  -16.761 1.00 19.97  ? 104 GLN A OE1   1 
ATOM   1140 N NE2   . GLN B 2 103 ? 44.240 -1.049  -18.860 1.00 56.52  ? 104 GLN A NE2   1 
ATOM   1141 N N     . ARG B 2 104 ? 39.480 -3.325  -16.665 1.00 33.09  ? 105 ARG A N     1 
ATOM   1142 C CA    . ARG B 2 104 ? 38.037 -3.256  -16.936 1.00 32.29  ? 105 ARG A CA    1 
ATOM   1143 C C     . ARG B 2 104 ? 37.345 -3.798  -15.682 1.00 33.53  ? 105 ARG A C     1 
ATOM   1144 O O     . ARG B 2 104 ? 36.531 -3.122  -15.047 1.00 42.48  ? 105 ARG A O     1 
ATOM   1145 C CB    . ARG B 2 104 ? 37.596 -4.006  -18.192 1.00 34.58  ? 105 ARG A CB    1 
ATOM   1146 C CG    . ARG B 2 104 ? 37.475 -5.530  -18.059 1.00 75.42  ? 105 ARG A CG    1 
ATOM   1147 C CD    . ARG B 2 104 ? 36.593 -6.135  -19.183 1.00 97.74  ? 105 ARG A CD    1 
ATOM   1148 N NE    . ARG B 2 104 ? 37.246 -6.159  -20.500 1.00 100.00 ? 105 ARG A NE    1 
ATOM   1149 C CZ    . ARG B 2 104 ? 37.242 -5.149  -21.378 1.00 100.00 ? 105 ARG A CZ    1 
ATOM   1150 N NH1   . ARG B 2 104 ? 36.608 -4.014  -21.088 1.00 95.07  ? 105 ARG A NH1   1 
ATOM   1151 N NH2   . ARG B 2 104 ? 37.875 -5.278  -22.552 1.00 100.00 ? 105 ARG A NH2   1 
ATOM   1152 N N     . ALA B 2 105 ? 37.732 -4.975  -15.260 1.00 16.06  ? 106 ALA A N     1 
ATOM   1153 C CA    . ALA B 2 105 ? 37.153 -5.488  -14.042 1.00 20.78  ? 106 ALA A CA    1 
ATOM   1154 C C     . ALA B 2 105 ? 37.059 -4.561  -12.846 1.00 34.58  ? 106 ALA A C     1 
ATOM   1155 O O     . ALA B 2 105 ? 36.004 -4.354  -12.291 1.00 44.36  ? 106 ALA A O     1 
ATOM   1156 C CB    . ALA B 2 105 ? 37.851 -6.692  -13.630 1.00 23.82  ? 106 ALA A CB    1 
ATOM   1157 N N     . TYR B 2 106 ? 38.177 -4.021  -12.430 1.00 35.36  ? 107 TYR A N     1 
ATOM   1158 C CA    . TYR B 2 106 ? 38.183 -3.167  -11.272 1.00 31.79  ? 107 TYR A CA    1 
ATOM   1159 C C     . TYR B 2 106 ? 37.264 -1.997  -11.533 1.00 28.32  ? 107 TYR A C     1 
ATOM   1160 O O     . TYR B 2 106 ? 36.440 -1.653  -10.714 1.00 25.57  ? 107 TYR A O     1 
ATOM   1161 C CB    . TYR B 2 106 ? 39.641 -2.723  -10.985 1.00 32.96  ? 107 TYR A CB    1 
ATOM   1162 C CG    . TYR B 2 106 ? 40.246 -3.502  -9.840  1.00 36.25  ? 107 TYR A CG    1 
ATOM   1163 C CD1   . TYR B 2 106 ? 39.586 -3.555  -8.621  1.00 38.30  ? 107 TYR A CD1   1 
ATOM   1164 C CD2   . TYR B 2 106 ? 41.421 -4.237  -9.983  1.00 34.99  ? 107 TYR A CD2   1 
ATOM   1165 C CE1   . TYR B 2 106 ? 40.078 -4.260  -7.565  1.00 38.46  ? 107 TYR A CE1   1 
ATOM   1166 C CE2   . TYR B 2 106 ? 41.942 -4.959  -8.901  1.00 35.29  ? 107 TYR A CE2   1 
ATOM   1167 C CZ    . TYR B 2 106 ? 41.252 -4.953  -7.694  1.00 48.18  ? 107 TYR A CZ    1 
ATOM   1168 O OH    . TYR B 2 106 ? 41.698 -5.619  -6.582  1.00 48.91  ? 107 TYR A OH    1 
ATOM   1169 N N     . LEU B 2 107 ? 37.401 -1.405  -12.702 1.00 19.08  ? 108 LEU A N     1 
ATOM   1170 C CA    . LEU B 2 107 ? 36.605 -0.259  -13.035 1.00 19.69  ? 108 LEU A CA    1 
ATOM   1171 C C     . LEU B 2 107 ? 35.117 -0.618  -12.823 1.00 41.73  ? 108 LEU A C     1 
ATOM   1172 O O     . LEU B 2 107 ? 34.348 0.082   -12.160 1.00 42.18  ? 108 LEU A O     1 
ATOM   1173 C CB    . LEU B 2 107 ? 36.875 0.136   -14.489 1.00 15.24  ? 108 LEU A CB    1 
ATOM   1174 C CG    . LEU B 2 107 ? 37.843 1.293   -14.619 1.00 14.64  ? 108 LEU A CG    1 
ATOM   1175 C CD1   . LEU B 2 107 ? 38.171 1.736   -16.074 1.00 8.99   ? 108 LEU A CD1   1 
ATOM   1176 C CD2   . LEU B 2 107 ? 37.438 2.454   -13.739 1.00 11.43  ? 108 LEU A CD2   1 
ATOM   1177 N N     . SER B 2 108 ? 34.719 -1.755  -13.350 1.00 43.33  ? 109 SER A N     1 
ATOM   1178 C CA    . SER B 2 108 ? 33.346 -2.169  -13.193 1.00 42.21  ? 109 SER A CA    1 
ATOM   1179 C C     . SER B 2 108 ? 32.954 -2.416  -11.748 1.00 41.12  ? 109 SER A C     1 
ATOM   1180 O O     . SER B 2 108 ? 31.901 -1.981  -11.341 1.00 40.99  ? 109 SER A O     1 
ATOM   1181 C CB    . SER B 2 108 ? 33.038 -3.374  -14.068 1.00 44.07  ? 109 SER A CB    1 
ATOM   1182 O OG    . SER B 2 108 ? 32.687 -4.481  -13.277 1.00 55.85  ? 109 SER A OG    1 
ATOM   1183 N N     . MET B 2 109 ? 33.765 -3.110  -10.963 1.00 33.96  ? 110 MET A N     1 
ATOM   1184 C CA    . MET B 2 109 ? 33.333 -3.304  -9.610  1.00 35.30  ? 110 MET A CA    1 
ATOM   1185 C C     . MET B 2 109 ? 33.199 -1.948  -8.968  1.00 38.35  ? 110 MET A C     1 
ATOM   1186 O O     . MET B 2 109 ? 32.218 -1.667  -8.318  1.00 40.05  ? 110 MET A O     1 
ATOM   1187 C CB    . MET B 2 109 ? 34.293 -4.161  -8.807  1.00 41.93  ? 110 MET A CB    1 
ATOM   1188 C CG    . MET B 2 109 ? 35.397 -4.759  -9.616  1.00 55.33  ? 110 MET A CG    1 
ATOM   1189 S SD    . MET B 2 109 ? 35.812 -6.504  -9.149  1.00 70.70  ? 110 MET A SD    1 
ATOM   1190 C CE    . MET B 2 109 ? 36.222 -6.383  -7.420  1.00 68.19  ? 110 MET A CE    1 
ATOM   1191 N N     . MET B 2 110 ? 34.185 -1.097  -9.168  1.00 36.73  ? 111 MET A N     1 
ATOM   1192 C CA    . MET B 2 110 ? 34.160 0.235   -8.588  1.00 37.95  ? 111 MET A CA    1 
ATOM   1193 C C     . MET B 2 110 ? 32.832 0.977   -8.883  1.00 35.67  ? 111 MET A C     1 
ATOM   1194 O O     . MET B 2 110 ? 32.165 1.498   -7.982  1.00 34.15  ? 111 MET A O     1 
ATOM   1195 C CB    . MET B 2 110 ? 35.364 1.028   -9.098  1.00 42.19  ? 111 MET A CB    1 
ATOM   1196 C CG    . MET B 2 110 ? 36.681 0.294   -8.908  1.00 44.41  ? 111 MET A CG    1 
ATOM   1197 S SD    . MET B 2 110 ? 38.058 1.332   -8.503  1.00 45.04  ? 111 MET A SD    1 
ATOM   1198 C CE    . MET B 2 110 ? 38.204 1.008   -6.826  1.00 41.70  ? 111 MET A CE    1 
ATOM   1199 N N     . ALA B 2 111 ? 32.439 1.010   -10.148 1.00 32.34  ? 112 ALA A N     1 
ATOM   1200 C CA    . ALA B 2 111 ? 31.175 1.679   -10.580 1.00 32.30  ? 112 ALA A CA    1 
ATOM   1201 C C     . ALA B 2 111 ? 29.953 1.114   -9.800  1.00 32.87  ? 112 ALA A C     1 
ATOM   1202 O O     . ALA B 2 111 ? 29.188 1.847   -9.133  1.00 28.76  ? 112 ALA A O     1 
ATOM   1203 C CB    . ALA B 2 111 ? 31.000 1.505   -12.077 1.00 31.96  ? 112 ALA A CB    1 
ATOM   1204 N N     . GLN B 2 112 ? 29.838 -0.208  -9.858  1.00 18.62  ? 113 GLN A N     1 
ATOM   1205 C CA    . GLN B 2 112 ? 28.856 -0.886  -9.134  1.00 11.37  ? 113 GLN A CA    1 
ATOM   1206 C C     . GLN B 2 112 ? 28.899 -0.544  -7.682  1.00 23.82  ? 113 GLN A C     1 
ATOM   1207 O O     . GLN B 2 112 ? 27.858 -0.250  -7.090  1.00 32.05  ? 113 GLN A O     1 
ATOM   1208 C CB    . GLN B 2 112 ? 28.991 -2.348  -9.351  1.00 10.78  ? 113 GLN A CB    1 
ATOM   1209 C CG    . GLN B 2 112 ? 28.669 -2.714  -10.867 1.00 11.59  ? 113 GLN A CG    1 
ATOM   1210 C CD    . GLN B 2 112 ? 28.788 -4.219  -11.116 1.00 34.48  ? 113 GLN A CD    1 
ATOM   1211 O OE1   . GLN B 2 112 ? 28.769 -4.699  -12.272 1.00 50.28  ? 113 GLN A OE1   1 
ATOM   1212 N NE2   . GLN B 2 112 ? 28.943 -4.972  -10.008 1.00 22.40  ? 113 GLN A NE2   1 
ATOM   1213 N N     . LYS B 2 113 ? 30.052 -0.559  -7.051  1.00 19.73  ? 114 LYS A N     1 
ATOM   1214 C CA    . LYS B 2 113 ? 29.999 -0.194  -5.626  1.00 23.87  ? 114 LYS A CA    1 
ATOM   1215 C C     . LYS B 2 113 ? 29.760 1.319   -5.464  1.00 27.62  ? 114 LYS A C     1 
ATOM   1216 O O     . LYS B 2 113 ? 29.666 1.855   -4.364  1.00 24.61  ? 114 LYS A O     1 
ATOM   1217 C CB    . LYS B 2 113 ? 31.195 -0.678  -4.826  1.00 30.89  ? 114 LYS A CB    1 
ATOM   1218 C CG    . LYS B 2 113 ? 31.330 -2.199  -4.697  1.00 43.17  ? 114 LYS A CG    1 
ATOM   1219 C CD    . LYS B 2 113 ? 31.575 -2.662  -3.239  1.00 31.39  ? 114 LYS A CD    1 
ATOM   1220 C CE    . LYS B 2 113 ? 31.525 -4.191  -3.165  1.00 67.48  ? 114 LYS A CE    1 
ATOM   1221 N NZ    . LYS B 2 113 ? 32.421 -4.712  -2.114  1.00 100.00 ? 114 LYS A NZ    1 
ATOM   1222 N N     . ARG B 2 114 ? 29.594 1.975   -6.596  1.00 26.26  ? 115 ARG A N     1 
ATOM   1223 C CA    . ARG B 2 114 ? 29.274 3.398   -6.644  1.00 28.54  ? 115 ARG A CA    1 
ATOM   1224 C C     . ARG B 2 114 ? 30.202 4.292   -5.825  1.00 39.16  ? 115 ARG A C     1 
ATOM   1225 O O     . ARG B 2 114 ? 29.800 4.921   -4.846  1.00 33.47  ? 115 ARG A O     1 
ATOM   1226 C CB    . ARG B 2 114 ? 27.859 3.615   -6.107  1.00 24.66  ? 115 ARG A CB    1 
ATOM   1227 C CG    . ARG B 2 114 ? 26.709 3.027   -6.924  1.00 20.81  ? 115 ARG A CG    1 
ATOM   1228 C CD    . ARG B 2 114 ? 26.666 3.519   -8.368  1.00 45.98  ? 115 ARG A CD    1 
ATOM   1229 N NE    . ARG B 2 114 ? 25.396 3.130   -8.977  1.00 22.84  ? 115 ARG A NE    1 
ATOM   1230 C CZ    . ARG B 2 114 ? 25.229 2.200   -9.926  1.00 71.00  ? 115 ARG A CZ    1 
ATOM   1231 N NH1   . ARG B 2 114 ? 26.259 1.522   -10.430 1.00 72.63  ? 115 ARG A NH1   1 
ATOM   1232 N NH2   . ARG B 2 114 ? 24.004 1.948   -10.374 1.00 82.04  ? 115 ARG A NH2   1 
ATOM   1233 N N     . VAL B 2 115 ? 31.447 4.381   -6.258  1.00 39.06  ? 116 VAL A N     1 
ATOM   1234 C CA    . VAL B 2 115 ? 32.451 5.224   -5.593  1.00 32.45  ? 116 VAL A CA    1 
ATOM   1235 C C     . VAL B 2 115 ? 32.195 6.693   -5.932  1.00 31.97  ? 116 VAL A C     1 
ATOM   1236 O O     . VAL B 2 115 ? 31.894 7.062   -7.090  1.00 27.97  ? 116 VAL A O     1 
ATOM   1237 C CB    . VAL B 2 115 ? 33.843 4.764   -6.003  1.00 25.09  ? 116 VAL A CB    1 
ATOM   1238 C CG1   . VAL B 2 115 ? 34.068 3.428   -5.346  1.00 22.18  ? 116 VAL A CG1   1 
ATOM   1239 C CG2   . VAL B 2 115 ? 33.890 4.586   -7.530  1.00 21.10  ? 116 VAL A CG2   1 
ATOM   1240 N N     . ASP B 2 116 ? 32.288 7.543   -4.923  1.00 25.30  ? 117 ASP A N     1 
ATOM   1241 C CA    . ASP B 2 116 ? 32.016 8.952   -5.155  1.00 22.91  ? 117 ASP A CA    1 
ATOM   1242 C C     . ASP B 2 116 ? 32.930 9.588   -6.225  1.00 36.18  ? 117 ASP A C     1 
ATOM   1243 O O     . ASP B 2 116 ? 32.548 10.544  -6.912  1.00 32.46  ? 117 ASP A O     1 
ATOM   1244 C CB    . ASP B 2 116 ? 32.018 9.701   -3.827  1.00 22.58  ? 117 ASP A CB    1 
ATOM   1245 C CG    . ASP B 2 116 ? 30.846 9.309   -2.916  1.00 34.33  ? 117 ASP A CG    1 
ATOM   1246 O OD1   . ASP B 2 116 ? 29.821 8.775   -3.408  1.00 41.67  ? 117 ASP A OD1   1 
ATOM   1247 O OD2   . ASP B 2 116 ? 30.934 9.623   -1.715  1.00 38.90  ? 117 ASP A OD2   1 
ATOM   1248 N N     . GLY B 2 117 ? 34.127 9.006   -6.373  1.00 39.53  ? 118 GLY A N     1 
ATOM   1249 C CA    . GLY B 2 117 ? 35.134 9.441   -7.346  1.00 37.03  ? 118 GLY A CA    1 
ATOM   1250 C C     . GLY B 2 117 ? 36.201 8.340   -7.593  1.00 37.66  ? 118 GLY A C     1 
ATOM   1251 O O     . GLY B 2 117 ? 36.221 7.303   -6.926  1.00 37.48  ? 118 GLY A O     1 
ATOM   1252 N N     . LEU B 2 118 ? 37.087 8.596   -8.550  1.00 31.33  ? 119 LEU A N     1 
ATOM   1253 C CA    . LEU B 2 118 ? 38.159 7.697   -8.934  1.00 29.00  ? 119 LEU A CA    1 
ATOM   1254 C C     . LEU B 2 118 ? 39.498 8.405   -9.052  1.00 41.38  ? 119 LEU A C     1 
ATOM   1255 O O     . LEU B 2 118 ? 39.604 9.468   -9.645  1.00 41.29  ? 119 LEU A O     1 
ATOM   1256 C CB    . LEU B 2 118 ? 37.866 7.121   -10.315 1.00 27.44  ? 119 LEU A CB    1 
ATOM   1257 C CG    . LEU B 2 118 ? 38.142 5.631   -10.457 1.00 30.92  ? 119 LEU A CG    1 
ATOM   1258 C CD1   . LEU B 2 118 ? 37.764 4.780   -9.199  1.00 26.31  ? 119 LEU A CD1   1 
ATOM   1259 C CD2   . LEU B 2 118 ? 37.496 5.067   -11.714 1.00 36.18  ? 119 LEU A CD2   1 
ATOM   1260 N N     . LEU B 2 119 ? 40.529 7.772   -8.510  1.00 41.96  ? 120 LEU A N     1 
ATOM   1261 C CA    . LEU B 2 119 ? 41.901 8.252   -8.581  1.00 32.27  ? 120 LEU A CA    1 
ATOM   1262 C C     . LEU B 2 119 ? 42.562 7.230   -9.517  1.00 37.48  ? 120 LEU A C     1 
ATOM   1263 O O     . LEU B 2 119 ? 42.530 6.000   -9.276  1.00 37.58  ? 120 LEU A O     1 
ATOM   1264 C CB    . LEU B 2 119 ? 42.490 8.170   -7.197  1.00 27.11  ? 120 LEU A CB    1 
ATOM   1265 C CG    . LEU B 2 119 ? 42.698 9.553   -6.584  1.00 27.92  ? 120 LEU A CG    1 
ATOM   1266 C CD1   . LEU B 2 119 ? 42.330 10.778  -7.430  1.00 23.68  ? 120 LEU A CD1   1 
ATOM   1267 C CD2   . LEU B 2 119 ? 42.089 9.571   -5.280  1.00 17.91  ? 120 LEU A CD2   1 
ATOM   1268 N N     . VAL B 2 120 ? 43.112 7.714   -10.615 1.00 34.76  ? 121 VAL A N     1 
ATOM   1269 C CA    . VAL B 2 120 ? 43.764 6.808   -11.568 1.00 36.08  ? 121 VAL A CA    1 
ATOM   1270 C C     . VAL B 2 120 ? 45.293 6.932   -11.704 1.00 37.31  ? 121 VAL A C     1 
ATOM   1271 O O     . VAL B 2 120 ? 45.818 8.031   -11.965 1.00 38.23  ? 121 VAL A O     1 
ATOM   1272 C CB    . VAL B 2 120 ? 43.124 6.911   -12.958 1.00 38.80  ? 121 VAL A CB    1 
ATOM   1273 C CG1   . VAL B 2 120 ? 43.843 5.974   -13.997 1.00 36.86  ? 121 VAL A CG1   1 
ATOM   1274 C CG2   . VAL B 2 120 ? 41.650 6.591   -12.845 1.00 37.77  ? 121 VAL A CG2   1 
ATOM   1275 N N     . MET B 2 121 ? 45.975 5.789   -11.545 1.00 31.22  ? 122 MET A N     1 
ATOM   1276 C CA    . MET B 2 121 ? 47.446 5.647   -11.642 1.00 28.04  ? 122 MET A CA    1 
ATOM   1277 C C     . MET B 2 121 ? 47.741 4.392   -12.348 1.00 25.07  ? 122 MET A C     1 
ATOM   1278 O O     . MET B 2 121 ? 48.173 3.436   -11.749 1.00 26.02  ? 122 MET A O     1 
ATOM   1279 C CB    . MET B 2 121 ? 48.111 5.499   -10.258 1.00 29.20  ? 122 MET A CB    1 
ATOM   1280 C CG    . MET B 2 121 ? 49.472 6.185   -10.254 1.00 35.03  ? 122 MET A CG    1 
ATOM   1281 S SD    . MET B 2 121 ? 50.153 6.405   -8.587  1.00 42.66  ? 122 MET A SD    1 
ATOM   1282 C CE    . MET B 2 121 ? 48.961 5.684   -7.648  1.00 37.79  ? 122 MET A CE    1 
ATOM   1283 N N     . CYS B 2 122 ? 47.525 4.385   -13.625 1.00 29.30  ? 123 CYS A N     1 
ATOM   1284 C CA    . CYS B 2 122 ? 47.780 3.172   -14.358 1.00 34.33  ? 123 CYS A CA    1 
ATOM   1285 C C     . CYS B 2 122 ? 49.065 3.083   -15.109 1.00 36.64  ? 123 CYS A C     1 
ATOM   1286 O O     . CYS B 2 122 ? 49.246 2.153   -15.850 1.00 40.33  ? 123 CYS A O     1 
ATOM   1287 C CB    . CYS B 2 122 ? 46.605 2.891   -15.289 1.00 37.12  ? 123 CYS A CB    1 
ATOM   1288 S SG    . CYS B 2 122 ? 45.081 2.371   -14.410 1.00 37.35  ? 123 CYS A SG    1 
ATOM   1289 N N     . SER B 2 123 ? 49.954 4.051   -14.921 1.00 35.60  ? 124 SER A N     1 
ATOM   1290 C CA    . SER B 2 123 ? 51.251 4.024   -15.576 1.00 28.57  ? 124 SER A CA    1 
ATOM   1291 C C     . SER B 2 123 ? 51.164 4.136   -17.041 1.00 26.72  ? 124 SER A C     1 
ATOM   1292 O O     . SER B 2 123 ? 51.434 5.191   -17.565 1.00 30.01  ? 124 SER A O     1 
ATOM   1293 C CB    . SER B 2 123 ? 52.001 2.779   -15.178 1.00 25.63  ? 124 SER A CB    1 
ATOM   1294 O OG    . SER B 2 123 ? 51.946 2.649   -13.758 1.00 29.48  ? 124 SER A OG    1 
ATOM   1295 N N     . GLU B 2 124 ? 50.815 3.069   -17.735 1.00 25.78  ? 125 GLU A N     1 
ATOM   1296 C CA    . GLU B 2 124 ? 50.685 3.165   -19.198 1.00 25.46  ? 125 GLU A CA    1 
ATOM   1297 C C     . GLU B 2 124 ? 49.180 3.306   -19.649 1.00 37.72  ? 125 GLU A C     1 
ATOM   1298 O O     . GLU B 2 124 ? 48.272 2.673   -19.080 1.00 45.34  ? 125 GLU A O     1 
ATOM   1299 C CB    . GLU B 2 124 ? 51.451 2.017   -19.862 1.00 26.13  ? 125 GLU A CB    1 
ATOM   1300 C CG    . GLU B 2 124 ? 52.689 1.558   -19.032 1.00 27.67  ? 125 GLU A CG    1 
ATOM   1301 C CD    . GLU B 2 124 ? 53.521 0.578   -19.798 1.00 49.85  ? 125 GLU A CD    1 
ATOM   1302 O OE1   . GLU B 2 124 ? 53.011 0.054   -20.816 1.00 93.22  ? 125 GLU A OE1   1 
ATOM   1303 O OE2   . GLU B 2 124 ? 54.660 0.313   -19.376 1.00 44.53  ? 125 GLU A OE2   1 
ATOM   1304 N N     . TYR B 2 125 ? 48.935 4.152   -20.651 1.00 30.42  ? 126 TYR A N     1 
ATOM   1305 C CA    . TYR B 2 125 ? 47.571 4.451   -21.196 1.00 25.66  ? 126 TYR A CA    1 
ATOM   1306 C C     . TYR B 2 125 ? 47.345 4.268   -22.663 1.00 29.36  ? 126 TYR A C     1 
ATOM   1307 O O     . TYR B 2 125 ? 47.215 5.260   -23.376 1.00 32.70  ? 126 TYR A O     1 
ATOM   1308 C CB    . TYR B 2 125 ? 47.212 5.912   -20.939 1.00 18.10  ? 126 TYR A CB    1 
ATOM   1309 C CG    . TYR B 2 125 ? 47.121 6.110   -19.475 1.00 22.05  ? 126 TYR A CG    1 
ATOM   1310 C CD1   . TYR B 2 125 ? 48.246 6.210   -18.708 1.00 18.96  ? 126 TYR A CD1   1 
ATOM   1311 C CD2   . TYR B 2 125 ? 45.911 6.088   -18.833 1.00 27.14  ? 126 TYR A CD2   1 
ATOM   1312 C CE1   . TYR B 2 125 ? 48.176 6.363   -17.344 1.00 30.36  ? 126 TYR A CE1   1 
ATOM   1313 C CE2   . TYR B 2 125 ? 45.821 6.199   -17.474 1.00 32.22  ? 126 TYR A CE2   1 
ATOM   1314 C CZ    . TYR B 2 125 ? 46.962 6.361   -16.735 1.00 40.07  ? 126 TYR A CZ    1 
ATOM   1315 O OH    . TYR B 2 125 ? 46.871 6.512   -15.380 1.00 31.19  ? 126 TYR A OH    1 
ATOM   1316 N N     . PRO B 2 126 ? 47.274 3.029   -23.114 1.00 21.48  ? 127 PRO A N     1 
ATOM   1317 C CA    . PRO B 2 126 ? 47.019 2.727   -24.537 1.00 22.83  ? 127 PRO A CA    1 
ATOM   1318 C C     . PRO B 2 126 ? 45.551 3.122   -24.887 1.00 44.06  ? 127 PRO A C     1 
ATOM   1319 O O     . PRO B 2 126 ? 44.717 3.356   -23.988 1.00 45.96  ? 127 PRO A O     1 
ATOM   1320 C CB    . PRO B 2 126 ? 47.244 1.206   -24.636 1.00 18.51  ? 127 PRO A CB    1 
ATOM   1321 C CG    . PRO B 2 126 ? 47.386 0.710   -23.253 1.00 20.23  ? 127 PRO A CG    1 
ATOM   1322 C CD    . PRO B 2 126 ? 47.120 1.857   -22.260 1.00 16.88  ? 127 PRO A CD    1 
ATOM   1323 N N     . GLU B 2 127 ? 45.263 3.237   -26.181 1.00 45.01  ? 128 GLU A N     1 
ATOM   1324 C CA    . GLU B 2 127 ? 43.948 3.670   -26.604 1.00 48.07  ? 128 GLU A CA    1 
ATOM   1325 C C     . GLU B 2 127 ? 42.855 2.925   -25.911 1.00 40.42  ? 128 GLU A C     1 
ATOM   1326 O O     . GLU B 2 127 ? 41.983 3.558   -25.356 1.00 35.58  ? 128 GLU A O     1 
ATOM   1327 C CB    . GLU B 2 127 ? 43.781 3.706   -28.121 1.00 52.85  ? 128 GLU A CB    1 
ATOM   1328 C CG    . GLU B 2 127 ? 43.445 5.114   -28.676 1.00 81.62  ? 128 GLU A CG    1 
ATOM   1329 C CD    . GLU B 2 127 ? 41.985 5.571   -28.380 1.00 100.00 ? 128 GLU A CD    1 
ATOM   1330 O OE1   . GLU B 2 127 ? 41.044 5.120   -29.103 1.00 100.00 ? 128 GLU A OE1   1 
ATOM   1331 O OE2   . GLU B 2 127 ? 41.795 6.406   -27.448 1.00 100.00 ? 128 GLU A OE2   1 
ATOM   1332 N N     . PRO B 2 128 ? 42.947 1.596   -25.877 1.00 32.71  ? 129 PRO A N     1 
ATOM   1333 C CA    . PRO B 2 128 ? 41.966 0.808   -25.187 1.00 29.84  ? 129 PRO A CA    1 
ATOM   1334 C C     . PRO B 2 128 ? 41.777 1.369   -23.794 1.00 39.71  ? 129 PRO A C     1 
ATOM   1335 O O     . PRO B 2 128 ? 40.726 1.877   -23.511 1.00 50.24  ? 129 PRO A O     1 
ATOM   1336 C CB    . PRO B 2 128 ? 42.589 -0.577  -25.148 1.00 30.22  ? 129 PRO A CB    1 
ATOM   1337 C CG    . PRO B 2 128 ? 43.292 -0.677  -26.384 1.00 33.68  ? 129 PRO A CG    1 
ATOM   1338 C CD    . PRO B 2 128 ? 43.947 0.729   -26.504 1.00 32.91  ? 129 PRO A CD    1 
ATOM   1339 N N     . LEU B 2 129 ? 42.767 1.340   -22.928 1.00 30.33  ? 130 LEU A N     1 
ATOM   1340 C CA    . LEU B 2 129 ? 42.525 1.889   -21.594 1.00 30.28  ? 130 LEU A CA    1 
ATOM   1341 C C     . LEU B 2 129 ? 41.962 3.297   -21.628 1.00 30.65  ? 130 LEU A C     1 
ATOM   1342 O O     . LEU B 2 129 ? 41.153 3.722   -20.762 1.00 25.37  ? 130 LEU A O     1 
ATOM   1343 C CB    . LEU B 2 129 ? 43.819 1.911   -20.800 1.00 30.08  ? 130 LEU A CB    1 
ATOM   1344 C CG    . LEU B 2 129 ? 43.746 2.214   -19.298 1.00 30.73  ? 130 LEU A CG    1 
ATOM   1345 C CD1   . LEU B 2 129 ? 44.113 3.678   -19.143 1.00 28.86  ? 130 LEU A CD1   1 
ATOM   1346 C CD2   . LEU B 2 129 ? 42.365 1.897   -18.734 1.00 39.32  ? 130 LEU A CD2   1 
ATOM   1347 N N     . LEU B 2 130 ? 42.392 4.009   -22.647 1.00 26.77  ? 131 LEU A N     1 
ATOM   1348 C CA    . LEU B 2 130 ? 41.945 5.367   -22.805 1.00 36.83  ? 131 LEU A CA    1 
ATOM   1349 C C     . LEU B 2 130 ? 40.435 5.448   -22.950 1.00 55.94  ? 131 LEU A C     1 
ATOM   1350 O O     . LEU B 2 130 ? 39.755 6.247   -22.284 1.00 54.37  ? 131 LEU A O     1 
ATOM   1351 C CB    . LEU B 2 130 ? 42.682 6.045   -23.964 1.00 38.33  ? 131 LEU A CB    1 
ATOM   1352 C CG    . LEU B 2 130 ? 43.762 6.839   -23.224 1.00 39.24  ? 131 LEU A CG    1 
ATOM   1353 C CD1   . LEU B 2 130 ? 43.548 8.276   -23.401 1.00 33.84  ? 131 LEU A CD1   1 
ATOM   1354 C CD2   . LEU B 2 130 ? 43.630 6.523   -21.738 1.00 47.70  ? 131 LEU A CD2   1 
ATOM   1355 N N     . ALA B 2 131 ? 39.932 4.579   -23.821 1.00 56.43  ? 132 ALA A N     1 
ATOM   1356 C CA    . ALA B 2 131 ? 38.514 4.456   -24.111 1.00 50.30  ? 132 ALA A CA    1 
ATOM   1357 C C     . ALA B 2 131 ? 37.684 4.035   -22.881 1.00 53.30  ? 132 ALA A C     1 
ATOM   1358 O O     . ALA B 2 131 ? 36.731 4.741   -22.526 1.00 57.66  ? 132 ALA A O     1 
ATOM   1359 C CB    . ALA B 2 131 ? 38.310 3.489   -25.234 1.00 48.15  ? 132 ALA A CB    1 
ATOM   1360 N N     . MET B 2 132 ? 38.045 2.917   -22.237 1.00 41.20  ? 133 MET A N     1 
ATOM   1361 C CA    . MET B 2 132 ? 37.325 2.434   -21.067 1.00 42.09  ? 133 MET A CA    1 
ATOM   1362 C C     . MET B 2 132 ? 37.069 3.536   -20.086 1.00 43.06  ? 133 MET A C     1 
ATOM   1363 O O     . MET B 2 132 ? 35.981 3.713   -19.619 1.00 46.58  ? 133 MET A O     1 
ATOM   1364 C CB    . MET B 2 132 ? 38.102 1.347   -20.358 1.00 47.56  ? 133 MET A CB    1 
ATOM   1365 C CG    . MET B 2 132 ? 37.783 -0.055  -20.784 1.00 56.20  ? 133 MET A CG    1 
ATOM   1366 S SD    . MET B 2 132 ? 38.659 -1.207  -19.678 1.00 67.23  ? 133 MET A SD    1 
ATOM   1367 C CE    . MET B 2 132 ? 38.171 -0.512  -18.061 1.00 65.71  ? 133 MET A CE    1 
ATOM   1368 N N     . LEU B 2 133 ? 38.097 4.286   -19.786 1.00 43.55  ? 134 LEU A N     1 
ATOM   1369 C CA    . LEU B 2 133 ? 37.990 5.370   -18.851 1.00 45.51  ? 134 LEU A CA    1 
ATOM   1370 C C     . LEU B 2 133 ? 36.909 6.332   -19.286 1.00 51.53  ? 134 LEU A C     1 
ATOM   1371 O O     . LEU B 2 133 ? 36.124 6.777   -18.475 1.00 56.00  ? 134 LEU A O     1 
ATOM   1372 C CB    . LEU B 2 133 ? 39.333 6.097   -18.780 1.00 48.15  ? 134 LEU A CB    1 
ATOM   1373 C CG    . LEU B 2 133 ? 40.549 5.332   -18.259 1.00 46.15  ? 134 LEU A CG    1 
ATOM   1374 C CD1   . LEU B 2 133 ? 41.804 6.174   -18.583 1.00 42.88  ? 134 LEU A CD1   1 
ATOM   1375 C CD2   . LEU B 2 133 ? 40.311 5.157   -16.738 1.00 35.15  ? 134 LEU A CD2   1 
ATOM   1376 N N     . GLU B 2 134 ? 36.858 6.687   -20.555 1.00 54.29  ? 135 GLU A N     1 
ATOM   1377 C CA    . GLU B 2 134 ? 35.803 7.612   -20.980 1.00 57.27  ? 135 GLU A CA    1 
ATOM   1378 C C     . GLU B 2 134 ? 34.418 7.031   -20.658 1.00 56.10  ? 135 GLU A C     1 
ATOM   1379 O O     . GLU B 2 134 ? 33.472 7.765   -20.304 1.00 53.07  ? 135 GLU A O     1 
ATOM   1380 C CB    . GLU B 2 134 ? 35.863 7.851   -22.474 1.00 59.06  ? 135 GLU A CB    1 
ATOM   1381 C CG    . GLU B 2 134 ? 34.932 8.936   -22.926 1.00 67.37  ? 135 GLU A CG    1 
ATOM   1382 C CD    . GLU B 2 134 ? 35.490 9.660   -24.132 1.00 100.00 ? 135 GLU A CD    1 
ATOM   1383 O OE1   . GLU B 2 134 ? 36.364 9.061   -24.799 1.00 100.00 ? 135 GLU A OE1   1 
ATOM   1384 O OE2   . GLU B 2 134 ? 35.103 10.833  -24.387 1.00 100.00 ? 135 GLU A OE2   1 
ATOM   1385 N N     . GLU B 2 135 ? 34.302 5.709   -20.772 1.00 41.56  ? 136 GLU A N     1 
ATOM   1386 C CA    . GLU B 2 135 ? 33.029 5.055   -20.500 1.00 40.31  ? 136 GLU A CA    1 
ATOM   1387 C C     . GLU B 2 135 ? 32.589 5.273   -19.108 1.00 36.36  ? 136 GLU A C     1 
ATOM   1388 O O     . GLU B 2 135 ? 31.620 4.694   -18.705 1.00 46.03  ? 136 GLU A O     1 
ATOM   1389 C CB    . GLU B 2 135 ? 33.021 3.553   -20.764 1.00 43.20  ? 136 GLU A CB    1 
ATOM   1390 C CG    . GLU B 2 135 ? 33.033 3.141   -22.251 1.00 56.26  ? 136 GLU A CG    1 
ATOM   1391 C CD    . GLU B 2 135 ? 32.749 1.635   -22.436 1.00 100.00 ? 136 GLU A CD    1 
ATOM   1392 O OE1   . GLU B 2 135 ? 31.541 1.309   -22.498 1.00 100.00 ? 136 GLU A OE1   1 
ATOM   1393 O OE2   . GLU B 2 135 ? 33.689 0.777   -22.464 1.00 59.17  ? 136 GLU A OE2   1 
ATOM   1394 N N     . TYR B 2 136 ? 33.306 6.073   -18.347 1.00 21.68  ? 137 TYR A N     1 
ATOM   1395 C CA    . TYR B 2 136 ? 32.904 6.354   -16.985 1.00 21.54  ? 137 TYR A CA    1 
ATOM   1396 C C     . TYR B 2 136 ? 33.050 7.803   -16.634 1.00 37.60  ? 137 TYR A C     1 
ATOM   1397 O O     . TYR B 2 136 ? 33.137 8.136   -15.428 1.00 34.79  ? 137 TYR A O     1 
ATOM   1398 C CB    . TYR B 2 136 ? 33.575 5.513   -15.931 1.00 19.80  ? 137 TYR A CB    1 
ATOM   1399 C CG    . TYR B 2 136 ? 33.426 4.034   -16.127 1.00 29.44  ? 137 TYR A CG    1 
ATOM   1400 C CD1   . TYR B 2 136 ? 33.908 3.390   -17.255 1.00 31.17  ? 137 TYR A CD1   1 
ATOM   1401 C CD2   . TYR B 2 136 ? 32.839 3.274   -15.152 1.00 35.59  ? 137 TYR A CD2   1 
ATOM   1402 C CE1   . TYR B 2 136 ? 33.774 2.035   -17.404 1.00 37.45  ? 137 TYR A CE1   1 
ATOM   1403 C CE2   . TYR B 2 136 ? 32.699 1.914   -15.287 1.00 37.33  ? 137 TYR A CE2   1 
ATOM   1404 C CZ    . TYR B 2 136 ? 33.152 1.294   -16.404 1.00 49.15  ? 137 TYR A CZ    1 
ATOM   1405 O OH    . TYR B 2 136 ? 32.978 -0.082  -16.461 1.00 60.91  ? 137 TYR A OH    1 
ATOM   1406 N N     . ARG B 2 137 ? 33.079 8.659   -17.670 1.00 40.94  ? 138 ARG A N     1 
ATOM   1407 C CA    . ARG B 2 137 ? 33.193 10.106  -17.430 1.00 45.17  ? 138 ARG A CA    1 
ATOM   1408 C C     . ARG B 2 137 ? 32.235 10.484  -16.317 1.00 51.28  ? 138 ARG A C     1 
ATOM   1409 O O     . ARG B 2 137 ? 32.477 11.388  -15.519 1.00 60.34  ? 138 ARG A O     1 
ATOM   1410 C CB    . ARG B 2 137 ? 32.778 10.985  -18.622 1.00 41.11  ? 138 ARG A CB    1 
ATOM   1411 C CG    . ARG B 2 137 ? 32.749 10.374  -19.976 1.00 35.09  ? 138 ARG A CG    1 
ATOM   1412 C CD    . ARG B 2 137 ? 32.072 11.394  -20.887 1.00 68.25  ? 138 ARG A CD    1 
ATOM   1413 N NE    . ARG B 2 137 ? 32.818 12.654  -20.883 1.00 99.88  ? 138 ARG A NE    1 
ATOM   1414 C CZ    . ARG B 2 137 ? 33.451 13.155  -21.944 1.00 100.00 ? 138 ARG A CZ    1 
ATOM   1415 N NH1   . ARG B 2 137 ? 33.426 12.507  -23.114 1.00 100.00 ? 138 ARG A NH1   1 
ATOM   1416 N NH2   . ARG B 2 137 ? 34.122 14.302  -21.841 1.00 74.10  ? 138 ARG A NH2   1 
ATOM   1417 N N     . HIS B 2 138 ? 31.133 9.771   -16.267 1.00 42.82  ? 139 HIS A N     1 
ATOM   1418 C CA    . HIS B 2 138 ? 30.154 10.079  -15.267 1.00 40.34  ? 139 HIS A CA    1 
ATOM   1419 C C     . HIS B 2 138 ? 30.642 10.004  -13.849 1.00 49.74  ? 139 HIS A C     1 
ATOM   1420 O O     . HIS B 2 138 ? 30.346 10.863  -13.020 1.00 49.87  ? 139 HIS A O     1 
ATOM   1421 C CB    . HIS B 2 138 ? 28.952 9.319   -15.513 1.00 39.64  ? 139 HIS A CB    1 
ATOM   1422 C CG    . HIS B 2 138 ? 29.072 7.901   -15.158 1.00 42.47  ? 139 HIS A CG    1 
ATOM   1423 N ND1   . HIS B 2 138 ? 29.427 6.936   -16.069 1.00 45.91  ? 139 HIS A ND1   1 
ATOM   1424 C CD2   . HIS B 2 138 ? 28.858 7.271   -13.981 1.00 46.80  ? 139 HIS A CD2   1 
ATOM   1425 C CE1   . HIS B 2 138 ? 29.439 5.759   -15.458 1.00 48.71  ? 139 HIS A CE1   1 
ATOM   1426 N NE2   . HIS B 2 138 ? 29.090 5.937   -14.192 1.00 48.72  ? 139 HIS A NE2   1 
ATOM   1427 N N     . ILE B 2 139 ? 31.444 9.006   -13.549 1.00 50.85  ? 140 ILE A N     1 
ATOM   1428 C CA    . ILE B 2 139 ? 31.951 8.959   -12.202 1.00 46.61  ? 140 ILE A CA    1 
ATOM   1429 C C     . ILE B 2 139 ? 33.076 9.957   -12.330 1.00 41.47  ? 140 ILE A C     1 
ATOM   1430 O O     . ILE B 2 139 ? 33.747 9.983   -13.331 1.00 33.35  ? 140 ILE A O     1 
ATOM   1431 C CB    . ILE B 2 139 ? 32.456 7.594   -11.814 1.00 47.87  ? 140 ILE A CB    1 
ATOM   1432 C CG1   . ILE B 2 139 ? 33.733 7.790   -11.019 1.00 53.13  ? 140 ILE A CG1   1 
ATOM   1433 C CG2   . ILE B 2 139 ? 32.599 6.686   -13.052 1.00 43.25  ? 140 ILE A CG2   1 
ATOM   1434 C CD1   . ILE B 2 139 ? 33.534 8.594   -9.737  1.00 71.64  ? 140 ILE A CD1   1 
ATOM   1435 N N     . PRO B 2 140 ? 33.214 10.835  -11.349 1.00 43.57  ? 141 PRO A N     1 
ATOM   1436 C CA    . PRO B 2 140 ? 34.244 11.878  -11.358 1.00 41.11  ? 141 PRO A CA    1 
ATOM   1437 C C     . PRO B 2 140 ? 35.640 11.358  -11.100 1.00 53.93  ? 141 PRO A C     1 
ATOM   1438 O O     . PRO B 2 140 ? 35.862 10.671  -10.108 1.00 57.66  ? 141 PRO A O     1 
ATOM   1439 C CB    . PRO B 2 140 ? 33.859 12.743  -10.135 1.00 37.74  ? 141 PRO A CB    1 
ATOM   1440 C CG    . PRO B 2 140 ? 32.873 11.963  -9.354  1.00 39.81  ? 141 PRO A CG    1 
ATOM   1441 C CD    . PRO B 2 140 ? 32.159 11.129  -10.358 1.00 40.13  ? 141 PRO A CD    1 
ATOM   1442 N N     . MET B 2 141 ? 36.606 11.706  -11.948 1.00 48.12  ? 142 MET A N     1 
ATOM   1443 C CA    . MET B 2 141 ? 37.971 11.236  -11.680 1.00 41.85  ? 142 MET A CA    1 
ATOM   1444 C C     . MET B 2 141 ? 39.240 12.091  -11.982 1.00 44.86  ? 142 MET A C     1 
ATOM   1445 O O     . MET B 2 141 ? 39.285 12.953  -12.854 1.00 35.85  ? 142 MET A O     1 
ATOM   1446 C CB    . MET B 2 141 ? 38.162 9.840   -12.259 1.00 40.05  ? 142 MET A CB    1 
ATOM   1447 C CG    . MET B 2 141 ? 38.711 9.879   -13.667 1.00 40.55  ? 142 MET A CG    1 
ATOM   1448 S SD    . MET B 2 141 ? 38.176 8.487   -14.641 1.00 46.57  ? 142 MET A SD    1 
ATOM   1449 C CE    . MET B 2 141 ? 38.143 9.193   -16.129 1.00 46.74  ? 142 MET A CE    1 
ATOM   1450 N N     . VAL B 2 142 ? 40.306 11.823  -11.244 1.00 45.67  ? 143 VAL A N     1 
ATOM   1451 C CA    . VAL B 2 142 ? 41.566 12.477  -11.582 1.00 41.03  ? 143 VAL A CA    1 
ATOM   1452 C C     . VAL B 2 142 ? 42.677 11.471  -11.956 1.00 32.44  ? 143 VAL A C     1 
ATOM   1453 O O     . VAL B 2 142 ? 42.916 10.501  -11.256 1.00 29.95  ? 143 VAL A O     1 
ATOM   1454 C CB    . VAL B 2 142 ? 42.117 13.584  -10.673 1.00 39.21  ? 143 VAL A CB    1 
ATOM   1455 C CG1   . VAL B 2 142 ? 41.554 13.571  -9.247  1.00 38.17  ? 143 VAL A CG1   1 
ATOM   1456 C CG2   . VAL B 2 142 ? 43.599 13.502  -10.727 1.00 37.13  ? 143 VAL A CG2   1 
ATOM   1457 N N     . VAL B 2 143 ? 43.340 11.697  -13.080 1.00 31.45  ? 144 VAL A N     1 
ATOM   1458 C CA    . VAL B 2 143 ? 44.456 10.848  -13.454 1.00 29.78  ? 144 VAL A CA    1 
ATOM   1459 C C     . VAL B 2 143 ? 45.668 11.505  -12.758 1.00 32.79  ? 144 VAL A C     1 
ATOM   1460 O O     . VAL B 2 143 ? 45.959 12.693  -12.976 1.00 27.34  ? 144 VAL A O     1 
ATOM   1461 C CB    . VAL B 2 143 ? 44.769 10.860  -14.914 1.00 27.96  ? 144 VAL A CB    1 
ATOM   1462 C CG1   . VAL B 2 143 ? 46.103 10.106  -15.126 1.00 27.85  ? 144 VAL A CG1   1 
ATOM   1463 C CG2   . VAL B 2 143 ? 43.658 10.183  -15.645 1.00 25.67  ? 144 VAL A CG2   1 
ATOM   1464 N N     . MET B 2 144 ? 46.352 10.750  -11.895 1.00 24.61  ? 145 MET A N     1 
ATOM   1465 C CA    . MET B 2 144 ? 47.504 11.299  -11.188 1.00 23.36  ? 145 MET A CA    1 
ATOM   1466 C C     . MET B 2 144 ? 48.881 11.117  -11.858 1.00 33.31  ? 145 MET A C     1 
ATOM   1467 O O     . MET B 2 144 ? 49.879 11.519  -11.303 1.00 30.60  ? 145 MET A O     1 
ATOM   1468 C CB    . MET B 2 144 ? 47.611 10.547  -9.907  1.00 25.92  ? 145 MET A CB    1 
ATOM   1469 C CG    . MET B 2 144 ? 46.515 10.782  -9.006  1.00 31.48  ? 145 MET A CG    1 
ATOM   1470 S SD    . MET B 2 144 ? 46.659 9.556   -7.768  1.00 39.17  ? 145 MET A SD    1 
ATOM   1471 C CE    . MET B 2 144 ? 47.384 10.649  -6.565  1.00 38.46  ? 145 MET A CE    1 
ATOM   1472 N N     . ASP B 2 145 ? 48.944 10.477  -13.019 1.00 32.32  ? 146 ASP A N     1 
ATOM   1473 C CA    . ASP B 2 145 ? 50.214 10.207  -13.624 1.00 27.18  ? 146 ASP A CA    1 
ATOM   1474 C C     . ASP B 2 145 ? 50.535 10.460  -15.096 1.00 43.84  ? 146 ASP A C     1 
ATOM   1475 O O     . ASP B 2 145 ? 51.294 9.683   -15.718 1.00 47.96  ? 146 ASP A O     1 
ATOM   1476 C CB    . ASP B 2 145 ? 50.654 8.825   -13.191 1.00 27.39  ? 146 ASP A CB    1 
ATOM   1477 C CG    . ASP B 2 145 ? 49.732 7.663   -13.718 1.00 42.46  ? 146 ASP A CG    1 
ATOM   1478 O OD1   . ASP B 2 145 ? 48.946 7.884   -14.669 1.00 46.58  ? 146 ASP A OD1   1 
ATOM   1479 O OD2   . ASP B 2 145 ? 49.906 6.487   -13.253 1.00 32.85  ? 146 ASP A OD2   1 
ATOM   1480 N N     . TRP B 2 146 ? 50.012 11.550  -15.659 1.00 45.11  ? 147 TRP A N     1 
ATOM   1481 C CA    . TRP B 2 146 ? 50.316 11.849  -17.045 1.00 46.19  ? 147 TRP A CA    1 
ATOM   1482 C C     . TRP B 2 146 ? 51.307 13.012  -17.085 1.00 48.65  ? 147 TRP A C     1 
ATOM   1483 O O     . TRP B 2 146 ? 51.545 13.728  -16.082 1.00 42.20  ? 147 TRP A O     1 
ATOM   1484 C CB    . TRP B 2 146 ? 49.069 12.250  -17.818 1.00 48.21  ? 147 TRP A CB    1 
ATOM   1485 C CG    . TRP B 2 146 ? 48.062 11.170  -18.120 1.00 51.47  ? 147 TRP A CG    1 
ATOM   1486 C CD1   . TRP B 2 146 ? 48.227 9.790   -18.090 1.00 54.60  ? 147 TRP A CD1   1 
ATOM   1487 C CD2   . TRP B 2 146 ? 46.725 11.397  -18.511 1.00 52.21  ? 147 TRP A CD2   1 
ATOM   1488 N NE1   . TRP B 2 146 ? 47.049 9.163   -18.425 1.00 54.43  ? 147 TRP A NE1   1 
ATOM   1489 C CE2   . TRP B 2 146 ? 46.114 10.132  -18.686 1.00 59.07  ? 147 TRP A CE2   1 
ATOM   1490 C CE3   . TRP B 2 146 ? 45.975 12.551  -18.718 1.00 53.86  ? 147 TRP A CE3   1 
ATOM   1491 C CZ2   . TRP B 2 146 ? 44.788 10.005  -19.058 1.00 61.64  ? 147 TRP A CZ2   1 
ATOM   1492 C CZ3   . TRP B 2 146 ? 44.678 12.423  -19.080 1.00 59.38  ? 147 TRP A CZ3   1 
ATOM   1493 C CH2   . TRP B 2 146 ? 44.085 11.160  -19.262 1.00 61.92  ? 147 TRP A CH2   1 
ATOM   1494 N N     . GLY B 2 147 ? 51.877 13.238  -18.256 1.00 47.50  ? 148 GLY A N     1 
ATOM   1495 C CA    . GLY B 2 147 ? 52.807 14.341  -18.324 1.00 49.45  ? 148 GLY A CA    1 
ATOM   1496 C C     . GLY B 2 147 ? 52.131 15.652  -18.640 1.00 50.65  ? 148 GLY A C     1 
ATOM   1497 O O     . GLY B 2 147 ? 52.527 16.729  -18.135 1.00 47.76  ? 148 GLY A O     1 
ATOM   1498 N N     . GLU B 2 148 ? 51.126 15.519  -19.499 1.00 49.34  ? 149 GLU A N     1 
ATOM   1499 C CA    . GLU B 2 148 ? 50.269 16.567  -20.007 1.00 47.88  ? 149 GLU A CA    1 
ATOM   1500 C C     . GLU B 2 148 ? 48.906 15.896  -20.068 1.00 56.14  ? 149 GLU A C     1 
ATOM   1501 O O     . GLU B 2 148 ? 48.812 14.652  -20.118 1.00 53.12  ? 149 GLU A O     1 
ATOM   1502 C CB    . GLU B 2 148 ? 50.692 16.853  -21.436 1.00 50.36  ? 149 GLU A CB    1 
ATOM   1503 C CG    . GLU B 2 148 ? 50.222 15.785  -22.450 1.00 70.12  ? 149 GLU A CG    1 
ATOM   1504 C CD    . GLU B 2 148 ? 51.201 14.617  -22.648 1.00 100.00 ? 149 GLU A CD    1 
ATOM   1505 O OE1   . GLU B 2 148 ? 51.985 14.298  -21.710 1.00 69.18  ? 149 GLU A OE1   1 
ATOM   1506 O OE2   . GLU B 2 148 ? 51.149 14.004  -23.744 1.00 100.00 ? 149 GLU A OE2   1 
ATOM   1507 N N     . ALA B 2 149 ? 47.847 16.701  -20.075 1.00 55.05  ? 150 ALA A N     1 
ATOM   1508 C CA    . ALA B 2 149 ? 46.485 16.153  -20.151 1.00 49.94  ? 150 ALA A CA    1 
ATOM   1509 C C     . ALA B 2 149 ? 46.116 15.429  -21.463 1.00 41.87  ? 150 ALA A C     1 
ATOM   1510 O O     . ALA B 2 149 ? 46.023 16.000  -22.533 1.00 41.25  ? 150 ALA A O     1 
ATOM   1511 C CB    . ALA B 2 149 ? 45.509 17.190  -19.866 1.00 51.41  ? 150 ALA A CB    1 
ATOM   1512 N N     . LYS B 2 150 ? 45.880 14.147  -21.340 1.00 37.65  ? 151 LYS A N     1 
ATOM   1513 C CA    . LYS B 2 150 ? 45.532 13.322  -22.445 1.00 41.69  ? 151 LYS A CA    1 
ATOM   1514 C C     . LYS B 2 150 ? 44.044 13.164  -22.860 1.00 58.46  ? 151 LYS A C     1 
ATOM   1515 O O     . LYS B 2 150 ? 43.747 12.489  -23.860 1.00 61.19  ? 151 LYS A O     1 
ATOM   1516 C CB    . LYS B 2 150 ? 46.147 11.977  -22.183 1.00 44.50  ? 151 LYS A CB    1 
ATOM   1517 C CG    . LYS B 2 150 ? 47.332 11.838  -23.031 1.00 73.72  ? 151 LYS A CG    1 
ATOM   1518 C CD    . LYS B 2 150 ? 48.539 12.317  -22.322 1.00 79.90  ? 151 LYS A CD    1 
ATOM   1519 C CE    . LYS B 2 150 ? 49.283 11.076  -21.992 1.00 68.00  ? 151 LYS A CE    1 
ATOM   1520 N NZ    . LYS B 2 150 ? 48.288 9.980   -22.241 1.00 31.98  ? 151 LYS A NZ    1 
ATOM   1521 N N     . ALA B 2 151 ? 43.131 13.769  -22.101 1.00 54.49  ? 152 ALA A N     1 
ATOM   1522 C CA    . ALA B 2 151 ? 41.709 13.683  -22.375 1.00 53.23  ? 152 ALA A CA    1 
ATOM   1523 C C     . ALA B 2 151 ? 41.060 14.802  -21.649 1.00 58.97  ? 152 ALA A C     1 
ATOM   1524 O O     . ALA B 2 151 ? 41.561 15.290  -20.639 1.00 58.75  ? 152 ALA A O     1 
ATOM   1525 C CB    . ALA B 2 151 ? 41.140 12.389  -21.869 1.00 54.02  ? 152 ALA A CB    1 
ATOM   1526 N N     . ASP B 2 152 ? 39.904 15.158  -22.174 1.00 60.42  ? 153 ASP A N     1 
ATOM   1527 C CA    . ASP B 2 152 ? 39.055 16.237  -21.678 1.00 64.57  ? 153 ASP A CA    1 
ATOM   1528 C C     . ASP B 2 152 ? 38.036 15.809  -20.568 1.00 58.29  ? 153 ASP A C     1 
ATOM   1529 O O     . ASP B 2 152 ? 37.378 16.638  -19.877 1.00 54.37  ? 153 ASP A O     1 
ATOM   1530 C CB    . ASP B 2 152 ? 38.284 16.773  -22.894 1.00 69.73  ? 153 ASP A CB    1 
ATOM   1531 C CG    . ASP B 2 152 ? 37.583 15.653  -23.674 1.00 100.00 ? 153 ASP A CG    1 
ATOM   1532 O OD1   . ASP B 2 152 ? 38.322 14.850  -24.307 1.00 100.00 ? 153 ASP A OD1   1 
ATOM   1533 O OD2   . ASP B 2 152 ? 36.313 15.570  -23.616 1.00 100.00 ? 153 ASP A OD2   1 
ATOM   1534 N N     . PHE B 2 153 ? 37.889 14.509  -20.389 1.00 43.14  ? 154 PHE A N     1 
ATOM   1535 C CA    . PHE B 2 153 ? 36.926 14.109  -19.418 1.00 40.91  ? 154 PHE A CA    1 
ATOM   1536 C C     . PHE B 2 153 ? 37.510 13.832  -18.071 1.00 52.08  ? 154 PHE A C     1 
ATOM   1537 O O     . PHE B 2 153 ? 36.902 13.164  -17.238 1.00 51.28  ? 154 PHE A O     1 
ATOM   1538 C CB    . PHE B 2 153 ? 36.195 12.936  -19.945 1.00 40.68  ? 154 PHE A CB    1 
ATOM   1539 C CG    . PHE B 2 153 ? 37.080 11.807  -20.191 1.00 42.72  ? 154 PHE A CG    1 
ATOM   1540 C CD1   . PHE B 2 153 ? 37.367 10.923  -19.178 1.00 49.27  ? 154 PHE A CD1   1 
ATOM   1541 C CD2   . PHE B 2 153 ? 37.639 11.659  -21.417 1.00 47.82  ? 154 PHE A CD2   1 
ATOM   1542 C CE1   . PHE B 2 153 ? 38.191 9.877   -19.410 1.00 55.06  ? 154 PHE A CE1   1 
ATOM   1543 C CE2   . PHE B 2 153 ? 38.471 10.609  -21.649 1.00 52.56  ? 154 PHE A CE2   1 
ATOM   1544 C CZ    . PHE B 2 153 ? 38.741 9.708   -20.652 1.00 54.67  ? 154 PHE A CZ    1 
ATOM   1545 N N     . THR B 2 154 ? 38.699 14.337  -17.819 1.00 56.17  ? 155 THR A N     1 
ATOM   1546 C CA    . THR B 2 154 ? 39.268 14.098  -16.489 1.00 50.92  ? 155 THR A CA    1 
ATOM   1547 C C     . THR B 2 154 ? 40.050 15.210  -15.924 1.00 47.83  ? 155 THR A C     1 
ATOM   1548 O O     . THR B 2 154 ? 40.412 16.146  -16.622 1.00 53.87  ? 155 THR A O     1 
ATOM   1549 C CB    . THR B 2 154 ? 40.465 13.095  -16.506 1.00 30.43  ? 155 THR A CB    1 
ATOM   1550 O OG1   . THR B 2 154 ? 40.453 12.270  -17.659 1.00 54.91  ? 155 THR A OG1   1 
ATOM   1551 C CG2   . THR B 2 154 ? 40.443 12.318  -15.238 1.00 22.88  ? 155 THR A CG2   1 
ATOM   1552 N N     . ASP B 2 155 ? 40.424 15.012  -14.666 1.00 40.29  ? 156 ASP A N     1 
ATOM   1553 C CA    . ASP B 2 155 ? 41.341 15.963  -14.053 1.00 38.63  ? 156 ASP A CA    1 
ATOM   1554 C C     . ASP B 2 155 ? 42.760 15.409  -14.161 1.00 44.93  ? 156 ASP A C     1 
ATOM   1555 O O     . ASP B 2 155 ? 42.968 14.185  -14.397 1.00 38.43  ? 156 ASP A O     1 
ATOM   1556 C CB    . ASP B 2 155 ? 40.980 16.272  -12.662 1.00 35.37  ? 156 ASP A CB    1 
ATOM   1557 C CG    . ASP B 2 155 ? 40.008 17.348  -12.619 1.00 38.36  ? 156 ASP A CG    1 
ATOM   1558 O OD1   . ASP B 2 155 ? 39.625 17.813  -13.747 1.00 28.85  ? 156 ASP A OD1   1 
ATOM   1559 O OD2   . ASP B 2 155 ? 39.629 17.752  -11.495 1.00 40.80  ? 156 ASP A OD2   1 
ATOM   1560 N N     . ALA B 2 156 ? 43.757 16.281  -14.062 1.00 41.34  ? 157 ALA A N     1 
ATOM   1561 C CA    . ALA B 2 156 ? 45.131 15.787  -14.180 1.00 34.66  ? 157 ALA A CA    1 
ATOM   1562 C C     . ALA B 2 156 ? 46.037 16.515  -13.283 1.00 29.70  ? 157 ALA A C     1 
ATOM   1563 O O     . ALA B 2 156 ? 45.930 17.701  -13.098 1.00 28.21  ? 157 ALA A O     1 
ATOM   1564 C CB    . ALA B 2 156 ? 45.620 15.908  -15.566 1.00 32.87  ? 157 ALA A CB    1 
ATOM   1565 N N     . VAL B 2 157 ? 46.942 15.789  -12.689 1.00 35.44  ? 158 VAL A N     1 
ATOM   1566 C CA    . VAL B 2 157 ? 47.891 16.456  -11.857 1.00 37.56  ? 158 VAL A CA    1 
ATOM   1567 C C     . VAL B 2 157 ? 49.149 16.102  -12.643 1.00 39.84  ? 158 VAL A C     1 
ATOM   1568 O O     . VAL B 2 157 ? 49.324 14.911  -13.000 1.00 43.19  ? 158 VAL A O     1 
ATOM   1569 C CB    . VAL B 2 157 ? 47.863 15.933  -10.462 1.00 39.85  ? 158 VAL A CB    1 
ATOM   1570 C CG1   . VAL B 2 157 ? 47.614 14.461  -10.482 1.00 40.57  ? 158 VAL A CG1   1 
ATOM   1571 C CG2   . VAL B 2 157 ? 49.165 16.296  -9.808  1.00 40.47  ? 158 VAL A CG2   1 
ATOM   1572 N N     . ILE B 2 158 ? 49.937 17.127  -13.006 1.00 31.88  ? 159 ILE A N     1 
ATOM   1573 C CA    . ILE B 2 158 ? 51.176 16.971  -13.792 1.00 35.02  ? 159 ILE A CA    1 
ATOM   1574 C C     . ILE B 2 158 ? 52.441 17.365  -13.045 1.00 38.94  ? 159 ILE A C     1 
ATOM   1575 O O     . ILE B 2 158 ? 52.537 18.457  -12.451 1.00 32.56  ? 159 ILE A O     1 
ATOM   1576 C CB    . ILE B 2 158 ? 51.165 17.696  -15.120 1.00 40.26  ? 159 ILE A CB    1 
ATOM   1577 C CG1   . ILE B 2 158 ? 51.533 19.139  -14.919 1.00 44.82  ? 159 ILE A CG1   1 
ATOM   1578 C CG2   . ILE B 2 158 ? 49.815 17.552  -15.851 1.00 37.63  ? 159 ILE A CG2   1 
ATOM   1579 C CD1   . ILE B 2 158 ? 52.104 19.728  -16.154 1.00 81.28  ? 159 ILE A CD1   1 
ATOM   1580 N N     . ASP B 2 159 ? 53.402 16.429  -13.109 1.00 32.66  ? 160 ASP A N     1 
ATOM   1581 C CA    . ASP B 2 159 ? 54.713 16.465  -12.454 1.00 21.68  ? 160 ASP A CA    1 
ATOM   1582 C C     . ASP B 2 159 ? 55.913 17.132  -13.078 1.00 29.58  ? 160 ASP A C     1 
ATOM   1583 O O     . ASP B 2 159 ? 56.855 17.350  -12.386 1.00 43.33  ? 160 ASP A O     1 
ATOM   1584 C CB    . ASP B 2 159 ? 55.135 15.052  -12.059 1.00 16.48  ? 160 ASP A CB    1 
ATOM   1585 C CG    . ASP B 2 159 ? 55.353 14.167  -13.255 1.00 22.97  ? 160 ASP A CG    1 
ATOM   1586 O OD1   . ASP B 2 159 ? 55.388 14.772  -14.365 1.00 15.96  ? 160 ASP A OD1   1 
ATOM   1587 O OD2   . ASP B 2 159 ? 55.369 12.891  -13.113 1.00 20.52  ? 160 ASP A OD2   1 
ATOM   1588 N N     . ASN B 2 160 ? 55.936 17.403  -14.360 1.00 27.43  ? 161 ASN A N     1 
ATOM   1589 C CA    . ASN B 2 160 ? 57.117 18.031  -14.874 1.00 33.19  ? 161 ASN A CA    1 
ATOM   1590 C C     . ASN B 2 160 ? 58.350 17.100  -14.876 1.00 45.41  ? 161 ASN A C     1 
ATOM   1591 O O     . ASN B 2 160 ? 59.464 17.493  -14.521 1.00 48.35  ? 161 ASN A O     1 
ATOM   1592 C CB    . ASN B 2 160 ? 57.396 19.291  -14.059 1.00 31.86  ? 161 ASN A CB    1 
ATOM   1593 C CG    . ASN B 2 160 ? 56.444 20.378  -14.370 1.00 40.82  ? 161 ASN A CG    1 
ATOM   1594 O OD1   . ASN B 2 160 ? 56.504 20.971  -15.456 1.00 30.62  ? 161 ASN A OD1   1 
ATOM   1595 N ND2   . ASN B 2 160 ? 55.562 20.691  -13.412 1.00 16.20  ? 161 ASN A ND2   1 
ATOM   1596 N N     . ALA B 2 161 ? 58.134 15.881  -15.307 1.00 40.36  ? 162 ALA A N     1 
ATOM   1597 C CA    . ALA B 2 161 ? 59.162 14.886  -15.404 1.00 44.03  ? 162 ALA A CA    1 
ATOM   1598 C C     . ALA B 2 161 ? 60.312 15.347  -16.322 1.00 49.04  ? 162 ALA A C     1 
ATOM   1599 O O     . ALA B 2 161 ? 61.477 15.002  -16.111 1.00 57.40  ? 162 ALA A O     1 
ATOM   1600 C CB    . ALA B 2 161 ? 58.532 13.628  -15.967 1.00 45.97  ? 162 ALA A CB    1 
ATOM   1601 N N     . PHE B 2 162 ? 59.973 16.113  -17.341 1.00 31.07  ? 163 PHE A N     1 
ATOM   1602 C CA    . PHE B 2 162 ? 60.969 16.604  -18.277 1.00 22.92  ? 163 PHE A CA    1 
ATOM   1603 C C     . PHE B 2 162 ? 61.841 17.607  -17.637 1.00 30.54  ? 163 PHE A C     1 
ATOM   1604 O O     . PHE B 2 162 ? 63.018 17.527  -17.803 1.00 37.49  ? 163 PHE A O     1 
ATOM   1605 C CB    . PHE B 2 162 ? 60.266 17.232  -19.406 1.00 18.24  ? 163 PHE A CB    1 
ATOM   1606 C CG    . PHE B 2 162 ? 61.125 17.951  -20.373 1.00 16.44  ? 163 PHE A CG    1 
ATOM   1607 C CD1   . PHE B 2 162 ? 61.541 19.245  -20.130 1.00 18.39  ? 163 PHE A CD1   1 
ATOM   1608 C CD2   . PHE B 2 162 ? 61.393 17.400  -21.612 1.00 18.36  ? 163 PHE A CD2   1 
ATOM   1609 C CE1   . PHE B 2 162 ? 62.213 19.964  -21.124 1.00 15.23  ? 163 PHE A CE1   1 
ATOM   1610 C CE2   . PHE B 2 162 ? 62.129 18.118  -22.567 1.00 21.15  ? 163 PHE A CE2   1 
ATOM   1611 C CZ    . PHE B 2 162 ? 62.554 19.377  -22.316 1.00 11.01  ? 163 PHE A CZ    1 
ATOM   1612 N N     . GLU B 2 163 ? 61.287 18.541  -16.880 1.00 27.51  ? 164 GLU A N     1 
ATOM   1613 C CA    . GLU B 2 163 ? 62.138 19.499  -16.234 1.00 29.43  ? 164 GLU A CA    1 
ATOM   1614 C C     . GLU B 2 163 ? 62.891 18.873  -15.078 1.00 38.59  ? 164 GLU A C     1 
ATOM   1615 O O     . GLU B 2 163 ? 63.780 19.489  -14.509 1.00 38.27  ? 164 GLU A O     1 
ATOM   1616 C CB    . GLU B 2 163 ? 61.401 20.755  -15.806 1.00 34.03  ? 164 GLU A CB    1 
ATOM   1617 C CG    . GLU B 2 163 ? 60.897 20.701  -14.354 1.00 77.24  ? 164 GLU A CG    1 
ATOM   1618 C CD    . GLU B 2 163 ? 61.084 22.019  -13.559 1.00 100.00 ? 164 GLU A CD    1 
ATOM   1619 O OE1   . GLU B 2 163 ? 62.224 22.548  -13.478 1.00 100.00 ? 164 GLU A OE1   1 
ATOM   1620 O OE2   . GLU B 2 163 ? 60.092 22.491  -12.958 1.00 97.63  ? 164 GLU A OE2   1 
ATOM   1621 N N     . GLY B 2 164 ? 62.558 17.639  -14.730 1.00 42.08  ? 165 GLY A N     1 
ATOM   1622 C CA    . GLY B 2 164 ? 63.261 16.937  -13.640 1.00 38.78  ? 165 GLY A CA    1 
ATOM   1623 C C     . GLY B 2 164 ? 64.448 16.275  -14.353 1.00 42.39  ? 165 GLY A C     1 
ATOM   1624 O O     . GLY B 2 164 ? 65.598 16.361  -13.887 1.00 41.35  ? 165 GLY A O     1 
ATOM   1625 N N     . GLY B 2 165 ? 64.160 15.651  -15.503 1.00 35.91  ? 166 GLY A N     1 
ATOM   1626 C CA    . GLY B 2 165 ? 65.185 14.983  -16.308 1.00 34.96  ? 166 GLY A CA    1 
ATOM   1627 C C     . GLY B 2 165 ? 66.336 15.955  -16.691 1.00 37.49  ? 166 GLY A C     1 
ATOM   1628 O O     . GLY B 2 165 ? 67.521 15.570  -16.641 1.00 36.01  ? 166 GLY A O     1 
ATOM   1629 N N     . TYR B 2 166 ? 65.951 17.187  -17.056 1.00 24.45  ? 167 TYR A N     1 
ATOM   1630 C CA    . TYR B 2 166 ? 66.838 18.262  -17.446 1.00 22.98  ? 167 TYR A CA    1 
ATOM   1631 C C     . TYR B 2 166 ? 67.624 18.616  -16.249 1.00 28.34  ? 167 TYR A C     1 
ATOM   1632 O O     . TYR B 2 166 ? 68.829 18.780  -16.338 1.00 31.94  ? 167 TYR A O     1 
ATOM   1633 C CB    . TYR B 2 166 ? 66.045 19.497  -17.865 1.00 24.11  ? 167 TYR A CB    1 
ATOM   1634 C CG    . TYR B 2 166 ? 66.843 20.625  -18.540 1.00 20.15  ? 167 TYR A CG    1 
ATOM   1635 C CD1   . TYR B 2 166 ? 67.112 20.634  -19.938 1.00 19.74  ? 167 TYR A CD1   1 
ATOM   1636 C CD2   . TYR B 2 166 ? 67.276 21.712  -17.781 1.00 17.27  ? 167 TYR A CD2   1 
ATOM   1637 C CE1   . TYR B 2 166 ? 67.837 21.730  -20.530 1.00 19.27  ? 167 TYR A CE1   1 
ATOM   1638 C CE2   . TYR B 2 166 ? 67.990 22.784  -18.334 1.00 15.75  ? 167 TYR A CE2   1 
ATOM   1639 C CZ    . TYR B 2 166 ? 68.266 22.815  -19.699 1.00 38.30  ? 167 TYR A CZ    1 
ATOM   1640 O OH    . TYR B 2 166 ? 68.970 23.938  -20.163 1.00 35.33  ? 167 TYR A OH    1 
ATOM   1641 N N     . MET B 2 167 ? 66.968 18.738  -15.114 1.00 23.31  ? 168 MET A N     1 
ATOM   1642 C CA    . MET B 2 167 ? 67.730 19.077  -13.918 1.00 23.81  ? 168 MET A CA    1 
ATOM   1643 C C     . MET B 2 167 ? 68.881 18.074  -13.663 1.00 26.94  ? 168 MET A C     1 
ATOM   1644 O O     . MET B 2 167 ? 69.982 18.440  -13.363 1.00 26.04  ? 168 MET A O     1 
ATOM   1645 C CB    . MET B 2 167 ? 66.816 19.151  -12.708 1.00 26.70  ? 168 MET A CB    1 
ATOM   1646 C CG    . MET B 2 167 ? 65.823 20.275  -12.810 1.00 37.09  ? 168 MET A CG    1 
ATOM   1647 S SD    . MET B 2 167 ? 64.880 20.526  -11.223 1.00 49.88  ? 168 MET A SD    1 
ATOM   1648 C CE    . MET B 2 167 ? 65.902 19.636  -9.987  1.00 46.42  ? 168 MET A CE    1 
ATOM   1649 N N     . ALA B 2 168 ? 68.587 16.803  -13.815 1.00 28.57  ? 169 ALA A N     1 
ATOM   1650 C CA    . ALA B 2 168 ? 69.529 15.745  -13.574 1.00 26.40  ? 169 ALA A CA    1 
ATOM   1651 C C     . ALA B 2 168 ? 70.721 15.824  -14.512 1.00 30.76  ? 169 ALA A C     1 
ATOM   1652 O O     . ALA B 2 168 ? 71.870 15.585  -14.118 1.00 29.51  ? 169 ALA A O     1 
ATOM   1653 C CB    . ALA B 2 168 ? 68.798 14.388  -13.719 1.00 27.60  ? 169 ALA A CB    1 
ATOM   1654 N N     . GLY B 2 169 ? 70.445 16.148  -15.762 1.00 27.98  ? 170 GLY A N     1 
ATOM   1655 C CA    . GLY B 2 169 ? 71.494 16.264  -16.754 1.00 28.49  ? 170 GLY A CA    1 
ATOM   1656 C C     . GLY B 2 169 ? 72.452 17.369  -16.343 1.00 40.95  ? 170 GLY A C     1 
ATOM   1657 O O     . GLY B 2 169 ? 73.641 17.145  -16.113 1.00 49.41  ? 170 GLY A O     1 
ATOM   1658 N N     . ARG B 2 170 ? 71.917 18.570  -16.235 1.00 36.40  ? 171 ARG A N     1 
ATOM   1659 C CA    . ARG B 2 170 ? 72.699 19.748  -15.868 1.00 35.23  ? 171 ARG A CA    1 
ATOM   1660 C C     . ARG B 2 170 ? 73.691 19.519  -14.779 1.00 31.43  ? 171 ARG A C     1 
ATOM   1661 O O     . ARG B 2 170 ? 74.853 19.671  -14.987 1.00 41.63  ? 171 ARG A O     1 
ATOM   1662 C CB    . ARG B 2 170 ? 71.761 20.848  -15.444 1.00 35.57  ? 171 ARG A CB    1 
ATOM   1663 C CG    . ARG B 2 170 ? 70.856 21.239  -16.539 1.00 21.29  ? 171 ARG A CG    1 
ATOM   1664 C CD    . ARG B 2 170 ? 71.392 22.347  -17.520 1.00 36.65  ? 171 ARG A CD    1 
ATOM   1665 N NE    . ARG B 2 170 ? 72.711 22.878  -17.236 1.00 41.22  ? 171 ARG A NE    1 
ATOM   1666 C CZ    . ARG B 2 170 ? 73.629 22.975  -18.184 1.00 53.24  ? 171 ARG A CZ    1 
ATOM   1667 N NH1   . ARG B 2 170 ? 73.356 22.597  -19.435 1.00 38.75  ? 171 ARG A NH1   1 
ATOM   1668 N NH2   . ARG B 2 170 ? 74.787 23.457  -17.885 1.00 20.92  ? 171 ARG A NH2   1 
ATOM   1669 N N     . TYR B 2 171 ? 73.205 19.105  -13.632 1.00 24.27  ? 172 TYR A N     1 
ATOM   1670 C CA    . TYR B 2 171 ? 74.023 18.811  -12.465 1.00 22.90  ? 172 TYR A CA    1 
ATOM   1671 C C     . TYR B 2 171 ? 75.191 17.964  -12.880 1.00 25.13  ? 172 TYR A C     1 
ATOM   1672 O O     . TYR B 2 171 ? 76.339 18.290  -12.596 1.00 25.69  ? 172 TYR A O     1 
ATOM   1673 C CB    . TYR B 2 171 ? 73.203 17.989  -11.509 1.00 18.49  ? 172 TYR A CB    1 
ATOM   1674 C CG    . TYR B 2 171 ? 73.843 17.877  -10.203 1.00 15.18  ? 172 TYR A CG    1 
ATOM   1675 C CD1   . TYR B 2 171 ? 73.914 18.985  -9.318  1.00 16.38  ? 172 TYR A CD1   1 
ATOM   1676 C CD2   . TYR B 2 171 ? 74.346 16.657  -9.787  1.00 9.65   ? 172 TYR A CD2   1 
ATOM   1677 C CE1   . TYR B 2 171 ? 74.539 18.854  -7.979  1.00 13.34  ? 172 TYR A CE1   1 
ATOM   1678 C CE2   . TYR B 2 171 ? 74.937 16.518  -8.482  1.00 9.28   ? 172 TYR A CE2   1 
ATOM   1679 C CZ    . TYR B 2 171 ? 75.055 17.610  -7.613  1.00 17.02  ? 172 TYR A CZ    1 
ATOM   1680 O OH    . TYR B 2 171 ? 75.644 17.374  -6.400  1.00 29.05  ? 172 TYR A OH    1 
ATOM   1681 N N     . LEU B 2 172 ? 74.891 16.895  -13.592 1.00 15.45  ? 173 LEU A N     1 
ATOM   1682 C CA    . LEU B 2 172 ? 75.955 16.047  -14.039 1.00 20.98  ? 173 LEU A CA    1 
ATOM   1683 C C     . LEU B 2 172 ? 76.951 16.913  -14.777 1.00 32.73  ? 173 LEU A C     1 
ATOM   1684 O O     . LEU B 2 172 ? 78.143 16.918  -14.453 1.00 31.19  ? 173 LEU A O     1 
ATOM   1685 C CB    . LEU B 2 172 ? 75.438 14.983  -14.977 1.00 19.98  ? 173 LEU A CB    1 
ATOM   1686 C CG    . LEU B 2 172 ? 74.664 13.983  -14.139 1.00 24.49  ? 173 LEU A CG    1 
ATOM   1687 C CD1   . LEU B 2 172 ? 74.569 12.732  -14.921 1.00 28.11  ? 173 LEU A CD1   1 
ATOM   1688 C CD2   . LEU B 2 172 ? 75.376 13.757  -12.857 1.00 12.21  ? 173 LEU A CD2   1 
ATOM   1689 N N     . ILE B 2 173 ? 76.435 17.672  -15.731 1.00 22.85  ? 174 ILE A N     1 
ATOM   1690 C CA    . ILE B 2 173 ? 77.236 18.558  -16.538 1.00 20.98  ? 174 ILE A CA    1 
ATOM   1691 C C     . ILE B 2 173 ? 78.109 19.538  -15.810 1.00 34.27  ? 174 ILE A C     1 
ATOM   1692 O O     . ILE B 2 173 ? 79.346 19.576  -15.972 1.00 44.43  ? 174 ILE A O     1 
ATOM   1693 C CB    . ILE B 2 173 ? 76.409 19.292  -17.486 1.00 18.56  ? 174 ILE A CB    1 
ATOM   1694 C CG1   . ILE B 2 173 ? 76.082 18.311  -18.589 1.00 17.43  ? 174 ILE A CG1   1 
ATOM   1695 C CG2   . ILE B 2 173 ? 77.143 20.570  -18.015 1.00 9.31   ? 174 ILE A CG2   1 
ATOM   1696 C CD1   . ILE B 2 173 ? 75.613 18.989  -19.834 1.00 27.09  ? 174 ILE A CD1   1 
ATOM   1697 N N     . GLU B 2 174 ? 77.453 20.337  -15.020 1.00 27.13  ? 175 GLU A N     1 
ATOM   1698 C CA    . GLU B 2 174 ? 78.106 21.353  -14.226 1.00 29.36  ? 175 GLU A CA    1 
ATOM   1699 C C     . GLU B 2 174 ? 79.014 20.737  -13.181 1.00 37.43  ? 175 GLU A C     1 
ATOM   1700 O O     . GLU B 2 174 ? 79.717 21.472  -12.488 1.00 37.12  ? 175 GLU A O     1 
ATOM   1701 C CB    . GLU B 2 174 ? 77.043 22.214  -13.537 1.00 29.61  ? 175 GLU A CB    1 
ATOM   1702 C CG    . GLU B 2 174 ? 75.751 22.148  -14.268 1.00 68.38  ? 175 GLU A CG    1 
ATOM   1703 C CD    . GLU B 2 174 ? 74.925 23.380  -14.148 1.00 84.84  ? 175 GLU A CD    1 
ATOM   1704 O OE1   . GLU B 2 174 ? 74.717 23.826  -12.959 1.00 29.82  ? 175 GLU A OE1   1 
ATOM   1705 O OE2   . GLU B 2 174 ? 74.486 23.841  -15.265 1.00 32.12  ? 175 GLU A OE2   1 
ATOM   1706 N N     . ARG B 2 175 ? 79.002 19.414  -13.022 1.00 34.17  ? 176 ARG A N     1 
ATOM   1707 C CA    . ARG B 2 175 ? 79.916 18.850  -12.025 1.00 33.37  ? 176 ARG A CA    1 
ATOM   1708 C C     . ARG B 2 175 ? 81.159 18.263  -12.681 1.00 40.52  ? 176 ARG A C     1 
ATOM   1709 O O     . ARG B 2 175 ? 82.064 17.760  -12.017 1.00 42.59  ? 176 ARG A O     1 
ATOM   1710 C CB    . ARG B 2 175 ? 79.258 17.906  -11.052 1.00 37.19  ? 176 ARG A CB    1 
ATOM   1711 C CG    . ARG B 2 175 ? 78.683 18.595  -9.841  1.00 27.53  ? 176 ARG A CG    1 
ATOM   1712 C CD    . ARG B 2 175 ? 79.566 18.424  -8.665  1.00 22.56  ? 176 ARG A CD    1 
ATOM   1713 N NE    . ARG B 2 175 ? 79.082 17.380  -7.801  1.00 40.70  ? 176 ARG A NE    1 
ATOM   1714 C CZ    . ARG B 2 175 ? 79.820 16.837  -6.850  1.00 71.23  ? 176 ARG A CZ    1 
ATOM   1715 N NH1   . ARG B 2 175 ? 81.061 17.240  -6.674  1.00 99.68  ? 176 ARG A NH1   1 
ATOM   1716 N NH2   . ARG B 2 175 ? 79.335 15.884  -6.089  1.00 88.20  ? 176 ARG A NH2   1 
ATOM   1717 N N     . GLY B 2 176 ? 81.205 18.343  -14.006 1.00 33.70  ? 177 GLY A N     1 
ATOM   1718 C CA    . GLY B 2 176 ? 82.378 17.897  -14.679 1.00 30.28  ? 177 GLY A CA    1 
ATOM   1719 C C     . GLY B 2 176 ? 82.234 16.826  -15.650 1.00 34.61  ? 177 GLY A C     1 
ATOM   1720 O O     . GLY B 2 176 ? 83.201 16.466  -16.328 1.00 42.93  ? 177 GLY A O     1 
ATOM   1721 N N     . HIS B 2 177 ? 81.050 16.285  -15.746 1.00 24.81  ? 178 HIS A N     1 
ATOM   1722 C CA    . HIS B 2 177 ? 80.874 15.173  -16.679 1.00 17.84  ? 178 HIS A CA    1 
ATOM   1723 C C     . HIS B 2 177 ? 80.491 15.464  -18.146 1.00 16.31  ? 178 HIS A C     1 
ATOM   1724 O O     . HIS B 2 177 ? 79.913 16.514  -18.471 1.00 26.78  ? 178 HIS A O     1 
ATOM   1725 C CB    . HIS B 2 177 ? 80.006 14.077  -16.067 1.00 15.27  ? 178 HIS A CB    1 
ATOM   1726 C CG    . HIS B 2 177 ? 80.337 13.713  -14.652 1.00 16.34  ? 178 HIS A CG    1 
ATOM   1727 N ND1   . HIS B 2 177 ? 80.872 12.485  -14.326 1.00 17.77  ? 178 HIS A ND1   1 
ATOM   1728 C CD2   . HIS B 2 177 ? 80.154 14.368  -13.477 1.00 24.11  ? 178 HIS A CD2   1 
ATOM   1729 C CE1   . HIS B 2 177 ? 81.038 12.413  -13.021 1.00 21.46  ? 178 HIS A CE1   1 
ATOM   1730 N NE2   . HIS B 2 177 ? 80.606 13.540  -12.475 1.00 23.19  ? 178 HIS A NE2   1 
ATOM   1731 N N     . ARG B 2 178 ? 80.839 14.514  -19.003 1.00 6.50   ? 179 ARG A N     1 
ATOM   1732 C CA    . ARG B 2 178 ? 80.580 14.546  -20.434 1.00 8.57   ? 179 ARG A CA    1 
ATOM   1733 C C     . ARG B 2 178 ? 80.497 13.104  -20.981 1.00 24.07  ? 179 ARG A C     1 
ATOM   1734 O O     . ARG B 2 178 ? 80.116 12.893  -22.134 1.00 34.97  ? 179 ARG A O     1 
ATOM   1735 C CB    . ARG B 2 178 ? 81.609 15.374  -21.214 1.00 9.81   ? 179 ARG A CB    1 
ATOM   1736 C CG    . ARG B 2 178 ? 81.608 16.869  -20.941 1.00 28.70  ? 179 ARG A CG    1 
ATOM   1737 C CD    . ARG B 2 178 ? 82.110 17.581  -22.138 1.00 24.74  ? 179 ARG A CD    1 
ATOM   1738 N NE    . ARG B 2 178 ? 81.109 18.092  -23.074 1.00 29.32  ? 179 ARG A NE    1 
ATOM   1739 C CZ    . ARG B 2 178 ? 81.059 17.675  -24.332 1.00 79.53  ? 179 ARG A CZ    1 
ATOM   1740 N NH1   . ARG B 2 178 ? 81.911 16.744  -24.748 1.00 72.13  ? 179 ARG A NH1   1 
ATOM   1741 N NH2   . ARG B 2 178 ? 80.160 18.160  -25.169 1.00 94.92  ? 179 ARG A NH2   1 
ATOM   1742 N N     . GLU B 2 179 ? 80.859 12.118  -20.169 1.00 20.03  ? 180 GLU A N     1 
ATOM   1743 C CA    . GLU B 2 179 ? 80.730 10.721  -20.614 1.00 28.17  ? 180 GLU A CA    1 
ATOM   1744 C C     . GLU B 2 179 ? 79.701 10.144  -19.614 1.00 37.85  ? 180 GLU A C     1 
ATOM   1745 O O     . GLU B 2 179 ? 80.050 9.597   -18.532 1.00 29.64  ? 180 GLU A O     1 
ATOM   1746 C CB    . GLU B 2 179 ? 82.038 9.929   -20.570 1.00 29.88  ? 180 GLU A CB    1 
ATOM   1747 C CG    . GLU B 2 179 ? 82.923 10.118  -21.792 1.00 28.47  ? 180 GLU A CG    1 
ATOM   1748 C CD    . GLU B 2 179 ? 84.402 9.882   -21.429 1.00 87.94  ? 180 GLU A CD    1 
ATOM   1749 O OE1   . GLU B 2 179 ? 84.971 10.777  -20.701 1.00 50.26  ? 180 GLU A OE1   1 
ATOM   1750 O OE2   . GLU B 2 179 ? 84.925 8.770   -21.788 1.00 49.39  ? 180 GLU A OE2   1 
ATOM   1751 N N     . ILE B 2 180 ? 78.431 10.311  -19.995 1.00 38.53  ? 181 ILE A N     1 
ATOM   1752 C CA    . ILE B 2 180 ? 77.272 9.907   -19.190 1.00 34.56  ? 181 ILE A CA    1 
ATOM   1753 C C     . ILE B 2 180 ? 76.352 8.842   -19.764 1.00 31.46  ? 181 ILE A C     1 
ATOM   1754 O O     . ILE B 2 180 ? 76.038 8.783   -20.964 1.00 34.50  ? 181 ILE A O     1 
ATOM   1755 C CB    . ILE B 2 180 ? 76.407 11.144  -18.882 1.00 34.77  ? 181 ILE A CB    1 
ATOM   1756 C CG1   . ILE B 2 180 ? 77.209 12.165  -18.075 1.00 36.52  ? 181 ILE A CG1   1 
ATOM   1757 C CG2   . ILE B 2 180 ? 75.103 10.751  -18.217 1.00 27.10  ? 181 ILE A CG2   1 
ATOM   1758 C CD1   . ILE B 2 180 ? 76.893 13.604  -18.434 1.00 26.17  ? 181 ILE A CD1   1 
ATOM   1759 N N     . GLY B 2 181 ? 75.887 8.000   -18.886 1.00 27.78  ? 182 GLY A N     1 
ATOM   1760 C CA    . GLY B 2 181 ? 74.980 6.965   -19.329 1.00 33.24  ? 182 GLY A CA    1 
ATOM   1761 C C     . GLY B 2 181 ? 73.607 7.158   -18.716 1.00 39.50  ? 182 GLY A C     1 
ATOM   1762 O O     . GLY B 2 181 ? 73.420 7.936   -17.777 1.00 42.02  ? 182 GLY A O     1 
ATOM   1763 N N     . VAL B 2 182 ? 72.637 6.436   -19.254 1.00 38.17  ? 183 VAL A N     1 
ATOM   1764 C CA    . VAL B 2 182 ? 71.271 6.539   -18.750 1.00 33.37  ? 183 VAL A CA    1 
ATOM   1765 C C     . VAL B 2 182 ? 70.454 5.271   -18.810 1.00 26.74  ? 183 VAL A C     1 
ATOM   1766 O O     . VAL B 2 182 ? 70.328 4.576   -19.841 1.00 24.52  ? 183 VAL A O     1 
ATOM   1767 C CB    . VAL B 2 182 ? 70.507 7.693   -19.426 1.00 33.18  ? 183 VAL A CB    1 
ATOM   1768 C CG1   . VAL B 2 182 ? 70.680 7.659   -20.953 1.00 29.23  ? 183 VAL A CG1   1 
ATOM   1769 C CG2   . VAL B 2 182 ? 69.077 7.634   -19.042 1.00 30.41  ? 183 VAL A CG2   1 
ATOM   1770 N N     . ILE B 2 183 ? 69.887 4.976   -17.661 1.00 20.58  ? 184 ILE A N     1 
ATOM   1771 C CA    . ILE B 2 183 ? 68.996 3.822   -17.539 1.00 20.59  ? 184 ILE A CA    1 
ATOM   1772 C C     . ILE B 2 183 ? 67.592 4.419   -17.314 1.00 27.67  ? 184 ILE A C     1 
ATOM   1773 O O     . ILE B 2 183 ? 67.231 4.879   -16.195 1.00 18.59  ? 184 ILE A O     1 
ATOM   1774 C CB    . ILE B 2 183 ? 69.383 2.999   -16.389 1.00 22.27  ? 184 ILE A CB    1 
ATOM   1775 C CG1   . ILE B 2 183 ? 70.870 2.716   -16.533 1.00 22.00  ? 184 ILE A CG1   1 
ATOM   1776 C CG2   . ILE B 2 183 ? 68.504 1.765   -16.325 1.00 23.78  ? 184 ILE A CG2   1 
ATOM   1777 C CD1   . ILE B 2 183 ? 71.413 1.742   -15.540 1.00 6.54   ? 184 ILE A CD1   1 
ATOM   1778 N N     . PRO B 2 184 ? 66.822 4.496   -18.393 1.00 25.25  ? 185 PRO A N     1 
ATOM   1779 C CA    . PRO B 2 184 ? 65.495 5.084   -18.256 1.00 26.73  ? 185 PRO A CA    1 
ATOM   1780 C C     . PRO B 2 184 ? 64.513 3.977   -17.850 1.00 40.82  ? 185 PRO A C     1 
ATOM   1781 O O     . PRO B 2 184 ? 64.858 2.785   -17.843 1.00 36.31  ? 185 PRO A O     1 
ATOM   1782 C CB    . PRO B 2 184 ? 65.203 5.555   -19.675 1.00 27.41  ? 185 PRO A CB    1 
ATOM   1783 C CG    . PRO B 2 184 ? 65.996 4.522   -20.600 1.00 24.56  ? 185 PRO A CG    1 
ATOM   1784 C CD    . PRO B 2 184 ? 67.083 3.949   -19.748 1.00 22.57  ? 185 PRO A CD    1 
ATOM   1785 N N     . GLY B 2 185 ? 63.295 4.394   -17.508 1.00 41.40  ? 186 GLY A N     1 
ATOM   1786 C CA    . GLY B 2 185 ? 62.219 3.480   -17.137 1.00 37.58  ? 186 GLY A CA    1 
ATOM   1787 C C     . GLY B 2 185 ? 61.435 3.327   -18.433 1.00 39.39  ? 186 GLY A C     1 
ATOM   1788 O O     . GLY B 2 185 ? 61.820 3.901   -19.478 1.00 46.56  ? 186 GLY A O     1 
ATOM   1789 N N     . PRO B 2 186 ? 60.353 2.560   -18.384 1.00 23.31  ? 187 PRO A N     1 
ATOM   1790 C CA    . PRO B 2 186 ? 59.515 2.285   -19.577 1.00 20.58  ? 187 PRO A CA    1 
ATOM   1791 C C     . PRO B 2 186 ? 59.190 3.530   -20.350 1.00 29.91  ? 187 PRO A C     1 
ATOM   1792 O O     . PRO B 2 186 ? 58.841 4.581   -19.796 1.00 39.66  ? 187 PRO A O     1 
ATOM   1793 C CB    . PRO B 2 186 ? 58.302 1.626   -19.003 1.00 25.46  ? 187 PRO A CB    1 
ATOM   1794 C CG    . PRO B 2 186 ? 58.759 1.116   -17.606 1.00 33.26  ? 187 PRO A CG    1 
ATOM   1795 C CD    . PRO B 2 186 ? 59.721 2.142   -17.131 1.00 26.01  ? 187 PRO A CD    1 
ATOM   1796 N N     . LEU B 2 187 ? 59.359 3.451   -21.645 1.00 24.71  ? 188 LEU A N     1 
ATOM   1797 C CA    . LEU B 2 187 ? 59.139 4.622   -22.451 1.00 30.34  ? 188 LEU A CA    1 
ATOM   1798 C C     . LEU B 2 187 ? 57.688 4.942   -22.561 1.00 42.69  ? 188 LEU A C     1 
ATOM   1799 O O     . LEU B 2 187 ? 57.312 6.082   -22.840 1.00 41.84  ? 188 LEU A O     1 
ATOM   1800 C CB    . LEU B 2 187 ? 59.732 4.366   -23.818 1.00 33.94  ? 188 LEU A CB    1 
ATOM   1801 C CG    . LEU B 2 187 ? 61.277 4.364   -23.731 1.00 38.42  ? 188 LEU A CG    1 
ATOM   1802 C CD1   . LEU B 2 187 ? 61.907 4.344   -25.131 1.00 38.53  ? 188 LEU A CD1   1 
ATOM   1803 C CD2   . LEU B 2 187 ? 61.871 5.471   -22.833 1.00 21.78  ? 188 LEU A CD2   1 
ATOM   1804 N N     . GLU B 2 188 ? 56.872 3.911   -22.305 1.00 44.39  ? 189 GLU A N     1 
ATOM   1805 C CA    . GLU B 2 188 ? 55.416 3.989   -22.361 1.00 38.56  ? 189 GLU A CA    1 
ATOM   1806 C C     . GLU B 2 188 ? 54.808 4.697   -21.178 1.00 47.16  ? 189 GLU A C     1 
ATOM   1807 O O     . GLU B 2 188 ? 53.614 4.710   -21.001 1.00 60.20  ? 189 GLU A O     1 
ATOM   1808 C CB    . GLU B 2 188 ? 54.870 2.588   -22.456 1.00 39.43  ? 189 GLU A CB    1 
ATOM   1809 C CG    . GLU B 2 188 ? 55.602 1.751   -23.505 1.00 63.33  ? 189 GLU A CG    1 
ATOM   1810 C CD    . GLU B 2 188 ? 56.664 0.890   -22.876 1.00 100.00 ? 189 GLU A CD    1 
ATOM   1811 O OE1   . GLU B 2 188 ? 56.278 -0.217  -22.434 1.00 100.00 ? 189 GLU A OE1   1 
ATOM   1812 O OE2   . GLU B 2 188 ? 57.834 1.352   -22.734 1.00 94.89  ? 189 GLU A OE2   1 
ATOM   1813 N N     . ARG B 2 189 ? 55.647 5.300   -20.370 1.00 39.37  ? 190 ARG A N     1 
ATOM   1814 C CA    . ARG B 2 189 ? 55.238 6.020   -19.198 1.00 33.12  ? 190 ARG A CA    1 
ATOM   1815 C C     . ARG B 2 189 ? 55.694 7.448   -19.225 1.00 36.34  ? 190 ARG A C     1 
ATOM   1816 O O     . ARG B 2 189 ? 56.361 7.890   -20.129 1.00 49.35  ? 190 ARG A O     1 
ATOM   1817 C CB    . ARG B 2 189 ? 55.848 5.370   -18.001 1.00 38.96  ? 190 ARG A CB    1 
ATOM   1818 C CG    . ARG B 2 189 ? 54.907 4.508   -17.365 1.00 31.99  ? 190 ARG A CG    1 
ATOM   1819 C CD    . ARG B 2 189 ? 55.333 3.147   -17.443 1.00 15.04  ? 190 ARG A CD    1 
ATOM   1820 N NE    . ARG B 2 189 ? 55.492 2.728   -16.053 1.00 28.07  ? 190 ARG A NE    1 
ATOM   1821 C CZ    . ARG B 2 189 ? 55.261 1.478   -15.691 1.00 40.13  ? 190 ARG A CZ    1 
ATOM   1822 N NH1   . ARG B 2 189 ? 54.870 0.611   -16.622 1.00 23.62  ? 190 ARG A NH1   1 
ATOM   1823 N NH2   . ARG B 2 189 ? 55.399 1.093   -14.428 1.00 10.05  ? 190 ARG A NH2   1 
ATOM   1824 N N     . ASN B 2 190 ? 55.305 8.192   -18.218 1.00 32.60  ? 191 ASN A N     1 
ATOM   1825 C CA    . ASN B 2 190 ? 55.669 9.594   -18.178 1.00 32.79  ? 191 ASN A CA    1 
ATOM   1826 C C     . ASN B 2 190 ? 57.044 9.680   -17.557 1.00 34.20  ? 191 ASN A C     1 
ATOM   1827 O O     . ASN B 2 190 ? 57.966 10.200  -18.156 1.00 33.49  ? 191 ASN A O     1 
ATOM   1828 C CB    . ASN B 2 190 ? 54.661 10.413  -17.376 1.00 13.01  ? 191 ASN A CB    1 
ATOM   1829 C CG    . ASN B 2 190 ? 54.997 11.855  -17.419 1.00 23.24  ? 191 ASN A CG    1 
ATOM   1830 O OD1   . ASN B 2 190 ? 55.305 12.370  -18.527 1.00 21.19  ? 191 ASN A OD1   1 
ATOM   1831 N ND2   . ASN B 2 190 ? 55.081 12.520  -16.221 1.00 1.66   ? 191 ASN A ND2   1 
ATOM   1832 N N     . THR B 2 191 ? 57.147 9.139   -16.349 1.00 30.50  ? 192 THR A N     1 
ATOM   1833 C CA    . THR B 2 191 ? 58.374 9.045   -15.585 1.00 28.31  ? 192 THR A CA    1 
ATOM   1834 C C     . THR B 2 191 ? 59.418 8.272   -16.373 1.00 33.80  ? 192 THR A C     1 
ATOM   1835 O O     . THR B 2 191 ? 60.577 8.285   -16.002 1.00 51.35  ? 192 THR A O     1 
ATOM   1836 C CB    . THR B 2 191 ? 58.109 8.259   -14.368 1.00 17.06  ? 192 THR A CB    1 
ATOM   1837 O OG1   . THR B 2 191 ? 57.164 7.301   -14.742 1.00 19.05  ? 192 THR A OG1   1 
ATOM   1838 C CG2   . THR B 2 191 ? 57.411 9.106   -13.232 1.00 3.43   ? 192 THR A CG2   1 
ATOM   1839 N N     . GLY B 2 192 ? 59.023 7.604   -17.453 1.00 20.00  ? 193 GLY A N     1 
ATOM   1840 C CA    . GLY B 2 192 ? 59.970 6.899   -18.316 1.00 16.43  ? 193 GLY A CA    1 
ATOM   1841 C C     . GLY B 2 192 ? 60.284 7.961   -19.367 1.00 26.35  ? 193 GLY A C     1 
ATOM   1842 O O     . GLY B 2 192 ? 60.980 8.899   -19.109 1.00 32.79  ? 193 GLY A O     1 
ATOM   1843 N N     . ALA B 2 193 ? 59.720 7.863   -20.544 1.00 30.81  ? 194 ALA A N     1 
ATOM   1844 C CA    . ALA B 2 193 ? 59.949 8.860   -21.595 1.00 27.54  ? 194 ALA A CA    1 
ATOM   1845 C C     . ALA B 2 193 ? 60.171 10.308  -21.232 1.00 30.62  ? 194 ALA A C     1 
ATOM   1846 O O     . ALA B 2 193 ? 60.966 11.031  -21.810 1.00 36.16  ? 194 ALA A O     1 
ATOM   1847 C CB    . ALA B 2 193 ? 58.804 8.815   -22.520 1.00 24.71  ? 194 ALA A CB    1 
ATOM   1848 N N     . GLY B 2 194 ? 59.429 10.759  -20.271 1.00 19.84  ? 195 GLY A N     1 
ATOM   1849 C CA    . GLY B 2 194 ? 59.532 12.148  -19.948 1.00 19.90  ? 195 GLY A CA    1 
ATOM   1850 C C     . GLY B 2 194 ? 60.718 12.580  -19.222 1.00 29.39  ? 195 GLY A C     1 
ATOM   1851 O O     . GLY B 2 194 ? 61.193 13.712  -19.393 1.00 34.93  ? 195 GLY A O     1 
ATOM   1852 N N     . ARG B 2 195 ? 61.181 11.704  -18.353 1.00 24.27  ? 196 ARG A N     1 
ATOM   1853 C CA    . ARG B 2 195 ? 62.360 12.041  -17.589 1.00 24.86  ? 196 ARG A CA    1 
ATOM   1854 C C     . ARG B 2 195 ? 63.556 11.976  -18.570 1.00 24.58  ? 196 ARG A C     1 
ATOM   1855 O O     . ARG B 2 195 ? 64.381 12.852  -18.597 1.00 27.50  ? 196 ARG A O     1 
ATOM   1856 C CB    . ARG B 2 195 ? 62.492 11.073  -16.434 1.00 21.53  ? 196 ARG A CB    1 
ATOM   1857 C CG    . ARG B 2 195 ? 61.499 11.360  -15.305 1.00 7.17   ? 196 ARG A CG    1 
ATOM   1858 C CD    . ARG B 2 195 ? 61.519 10.190  -14.234 1.00 26.64  ? 196 ARG A CD    1 
ATOM   1859 N NE    . ARG B 2 195 ? 60.669 10.464  -13.068 1.00 19.03  ? 196 ARG A NE    1 
ATOM   1860 C CZ    . ARG B 2 195 ? 60.588 9.694   -11.993 1.00 32.69  ? 196 ARG A CZ    1 
ATOM   1861 N NH1   . ARG B 2 195 ? 61.324 8.601   -11.893 1.00 50.93  ? 196 ARG A NH1   1 
ATOM   1862 N NH2   . ARG B 2 195 ? 59.767 9.997   -11.013 1.00 18.87  ? 196 ARG A NH2   1 
ATOM   1863 N N     . LEU B 2 196 ? 63.564 10.978  -19.431 1.00 13.23  ? 197 LEU A N     1 
ATOM   1864 C CA    . LEU B 2 196 ? 64.604 10.787  -20.394 1.00 16.35  ? 197 LEU A CA    1 
ATOM   1865 C C     . LEU B 2 196 ? 64.838 11.938  -21.262 1.00 31.81  ? 197 LEU A C     1 
ATOM   1866 O O     . LEU B 2 196 ? 65.966 12.308  -21.523 1.00 44.90  ? 197 LEU A O     1 
ATOM   1867 C CB    . LEU B 2 196 ? 64.211 9.686   -21.352 1.00 18.57  ? 197 LEU A CB    1 
ATOM   1868 C CG    . LEU B 2 196 ? 65.348 9.194   -22.218 1.00 25.53  ? 197 LEU A CG    1 
ATOM   1869 C CD1   . LEU B 2 196 ? 66.437 8.794   -21.301 1.00 28.05  ? 197 LEU A CD1   1 
ATOM   1870 C CD2   . LEU B 2 196 ? 64.924 7.969   -22.991 1.00 21.11  ? 197 LEU A CD2   1 
ATOM   1871 N N     . ALA B 2 197 ? 63.770 12.474  -21.793 1.00 31.03  ? 198 ALA A N     1 
ATOM   1872 C CA    . ALA B 2 197 ? 63.939 13.570  -22.701 1.00 32.13  ? 198 ALA A CA    1 
ATOM   1873 C C     . ALA B 2 197 ? 64.282 14.865  -22.021 1.00 39.78  ? 198 ALA A C     1 
ATOM   1874 O O     . ALA B 2 197 ? 64.942 15.697  -22.603 1.00 42.89  ? 198 ALA A O     1 
ATOM   1875 C CB    . ALA B 2 197 ? 62.799 13.708  -23.554 1.00 33.41  ? 198 ALA A CB    1 
ATOM   1876 N N     . GLY B 2 198 ? 63.854 15.047  -20.782 1.00 38.16  ? 199 GLY A N     1 
ATOM   1877 C CA    . GLY B 2 198 ? 64.227 16.275  -20.084 1.00 41.16  ? 199 GLY A CA    1 
ATOM   1878 C C     . GLY B 2 198 ? 65.779 16.255  -20.023 1.00 40.78  ? 199 GLY A C     1 
ATOM   1879 O O     . GLY B 2 198 ? 66.481 17.256  -20.301 1.00 40.64  ? 199 GLY A O     1 
ATOM   1880 N N     . PHE B 2 199 ? 66.271 15.068  -19.707 1.00 30.09  ? 200 PHE A N     1 
ATOM   1881 C CA    . PHE B 2 199 ? 67.683 14.765  -19.620 1.00 31.33  ? 200 PHE A CA    1 
ATOM   1882 C C     . PHE B 2 199 ? 68.379 14.915  -20.951 1.00 32.10  ? 200 PHE A C     1 
ATOM   1883 O O     . PHE B 2 199 ? 69.415 15.536  -21.059 1.00 33.64  ? 200 PHE A O     1 
ATOM   1884 C CB    . PHE B 2 199 ? 67.862 13.303  -19.299 1.00 33.42  ? 200 PHE A CB    1 
ATOM   1885 C CG    . PHE B 2 199 ? 69.282 12.903  -19.197 1.00 36.98  ? 200 PHE A CG    1 
ATOM   1886 C CD1   . PHE B 2 199 ? 70.044 13.286  -18.081 1.00 44.32  ? 200 PHE A CD1   1 
ATOM   1887 C CD2   . PHE B 2 199 ? 69.856 12.140  -20.173 1.00 37.02  ? 200 PHE A CD2   1 
ATOM   1888 C CE1   . PHE B 2 199 ? 71.352 12.886  -17.967 1.00 46.76  ? 200 PHE A CE1   1 
ATOM   1889 C CE2   . PHE B 2 199 ? 71.154 11.711  -20.080 1.00 44.72  ? 200 PHE A CE2   1 
ATOM   1890 C CZ    . PHE B 2 199 ? 71.918 12.089  -18.991 1.00 48.21  ? 200 PHE A CZ    1 
ATOM   1891 N N     . MET B 2 200 ? 67.825 14.298  -21.971 1.00 19.26  ? 201 MET A N     1 
ATOM   1892 C CA    . MET B 2 200 ? 68.461 14.392  -23.249 1.00 13.85  ? 201 MET A CA    1 
ATOM   1893 C C     . MET B 2 200 ? 68.539 15.841  -23.751 1.00 27.26  ? 201 MET A C     1 
ATOM   1894 O O     . MET B 2 200 ? 69.493 16.193  -24.433 1.00 30.10  ? 201 MET A O     1 
ATOM   1895 C CB    . MET B 2 200 ? 67.737 13.488  -24.215 1.00 15.13  ? 201 MET A CB    1 
ATOM   1896 C CG    . MET B 2 200 ? 68.590 12.616  -25.120 1.00 25.57  ? 201 MET A CG    1 
ATOM   1897 S SD    . MET B 2 200 ? 69.603 11.344  -24.323 1.00 33.70  ? 201 MET A SD    1 
ATOM   1898 C CE    . MET B 2 200 ? 68.956 11.508  -22.811 1.00 33.46  ? 201 MET A CE    1 
ATOM   1899 N N     . LYS B 2 201 ? 67.571 16.709  -23.443 1.00 25.59  ? 202 LYS A N     1 
ATOM   1900 C CA    . LYS B 2 201 ? 67.701 18.043  -24.000 1.00 25.62  ? 202 LYS A CA    1 
ATOM   1901 C C     . LYS B 2 201 ? 68.929 18.681  -23.470 1.00 34.48  ? 202 LYS A C     1 
ATOM   1902 O O     . LYS B 2 201 ? 69.717 19.269  -24.228 1.00 30.50  ? 202 LYS A O     1 
ATOM   1903 C CB    . LYS B 2 201 ? 66.503 18.932  -23.792 1.00 28.98  ? 202 LYS A CB    1 
ATOM   1904 C CG    . LYS B 2 201 ? 66.783 20.129  -22.906 1.00 50.33  ? 202 LYS A CG    1 
ATOM   1905 C CD    . LYS B 2 201 ? 66.357 21.373  -23.626 1.00 39.77  ? 202 LYS A CD    1 
ATOM   1906 C CE    . LYS B 2 201 ? 66.112 21.061  -25.115 1.00 57.09  ? 202 LYS A CE    1 
ATOM   1907 N NZ    . LYS B 2 201 ? 66.195 22.277  -26.028 1.00 86.51  ? 202 LYS A NZ    1 
ATOM   1908 N N     . ALA B 2 202 ? 69.090 18.554  -22.163 1.00 32.14  ? 203 ALA A N     1 
ATOM   1909 C CA    . ALA B 2 202 ? 70.261 19.109  -21.481 1.00 30.91  ? 203 ALA A CA    1 
ATOM   1910 C C     . ALA B 2 202 ? 71.570 18.683  -22.237 1.00 39.78  ? 203 ALA A C     1 
ATOM   1911 O O     . ALA B 2 202 ? 72.429 19.526  -22.556 1.00 42.16  ? 203 ALA A O     1 
ATOM   1912 C CB    . ALA B 2 202 ? 70.265 18.632  -20.040 1.00 29.01  ? 203 ALA A CB    1 
ATOM   1913 N N     . MET B 2 203 ? 71.687 17.383  -22.527 1.00 26.88  ? 204 MET A N     1 
ATOM   1914 C CA    . MET B 2 203 ? 72.812 16.830  -23.258 1.00 22.54  ? 204 MET A CA    1 
ATOM   1915 C C     . MET B 2 203 ? 72.917 17.546  -24.635 1.00 27.49  ? 204 MET A C     1 
ATOM   1916 O O     . MET B 2 203 ? 73.919 18.146  -24.915 1.00 29.82  ? 204 MET A O     1 
ATOM   1917 C CB    . MET B 2 203 ? 72.618 15.320  -23.472 1.00 20.05  ? 204 MET A CB    1 
ATOM   1918 C CG    . MET B 2 203 ? 72.433 14.577  -22.211 1.00 22.24  ? 204 MET A CG    1 
ATOM   1919 S SD    . MET B 2 203 ? 73.936 14.416  -21.251 1.00 30.88  ? 204 MET A SD    1 
ATOM   1920 C CE    . MET B 2 203 ? 73.588 15.158  -19.665 1.00 26.81  ? 204 MET A CE    1 
ATOM   1921 N N     . GLU B 2 204 ? 71.898 17.481  -25.479 1.00 23.66  ? 205 GLU A N     1 
ATOM   1922 C CA    . GLU B 2 204 ? 71.989 18.158  -26.773 1.00 28.60  ? 205 GLU A CA    1 
ATOM   1923 C C     . GLU B 2 204 ? 72.474 19.574  -26.578 1.00 30.19  ? 205 GLU A C     1 
ATOM   1924 O O     . GLU B 2 204 ? 73.300 20.059  -27.310 1.00 32.86  ? 205 GLU A O     1 
ATOM   1925 C CB    . GLU B 2 204 ? 70.634 18.237  -27.534 1.00 30.56  ? 205 GLU A CB    1 
ATOM   1926 C CG    . GLU B 2 204 ? 69.676 17.051  -27.307 1.00 75.37  ? 205 GLU A CG    1 
ATOM   1927 C CD    . GLU B 2 204 ? 69.371 16.196  -28.583 1.00 100.00 ? 205 GLU A CD    1 
ATOM   1928 O OE1   . GLU B 2 204 ? 68.452 16.569  -29.367 1.00 100.00 ? 205 GLU A OE1   1 
ATOM   1929 O OE2   . GLU B 2 204 ? 69.990 15.104  -28.750 1.00 100.00 ? 205 GLU A OE2   1 
ATOM   1930 N N     . GLU B 2 205 ? 71.950 20.228  -25.569 1.00 28.45  ? 206 GLU A N     1 
ATOM   1931 C CA    . GLU B 2 205 ? 72.328 21.587  -25.325 1.00 30.91  ? 206 GLU A CA    1 
ATOM   1932 C C     . GLU B 2 205 ? 73.800 21.704  -25.161 1.00 45.73  ? 206 GLU A C     1 
ATOM   1933 O O     . GLU B 2 205 ? 74.370 22.680  -25.567 1.00 56.52  ? 206 GLU A O     1 
ATOM   1934 C CB    . GLU B 2 205 ? 71.642 22.140  -24.086 1.00 31.92  ? 206 GLU A CB    1 
ATOM   1935 C CG    . GLU B 2 205 ? 70.272 22.703  -24.312 1.00 37.68  ? 206 GLU A CG    1 
ATOM   1936 C CD    . GLU B 2 205 ? 69.762 23.201  -23.027 1.00 59.39  ? 206 GLU A CD    1 
ATOM   1937 O OE1   . GLU B 2 205 ? 70.451 22.893  -22.026 1.00 61.58  ? 206 GLU A OE1   1 
ATOM   1938 O OE2   . GLU B 2 205 ? 68.768 23.958  -23.045 1.00 47.85  ? 206 GLU A OE2   1 
ATOM   1939 N N     . ALA B 2 206 ? 74.430 20.704  -24.571 1.00 40.13  ? 207 ALA A N     1 
ATOM   1940 C CA    . ALA B 2 206 ? 75.877 20.749  -24.332 1.00 36.50  ? 207 ALA A CA    1 
ATOM   1941 C C     . ALA B 2 206 ? 76.686 19.948  -25.282 1.00 36.82  ? 207 ALA A C     1 
ATOM   1942 O O     . ALA B 2 206 ? 77.702 19.441  -24.896 1.00 44.42  ? 207 ALA A O     1 
ATOM   1943 C CB    . ALA B 2 206 ? 76.185 20.276  -22.917 1.00 34.95  ? 207 ALA A CB    1 
ATOM   1944 N N     . MET B 2 207 ? 76.214 19.782  -26.494 1.00 36.45  ? 208 MET A N     1 
ATOM   1945 C CA    . MET B 2 207 ? 76.930 18.970  -27.482 1.00 45.29  ? 208 MET A CA    1 
ATOM   1946 C C     . MET B 2 207 ? 77.456 17.617  -26.996 1.00 40.06  ? 208 MET A C     1 
ATOM   1947 O O     . MET B 2 207 ? 78.462 17.088  -27.499 1.00 49.12  ? 208 MET A O     1 
ATOM   1948 C CB    . MET B 2 207 ? 77.992 19.785  -28.193 1.00 52.83  ? 208 MET A CB    1 
ATOM   1949 C CG    . MET B 2 207 ? 77.466 21.166  -28.551 1.00 65.91  ? 208 MET A CG    1 
ATOM   1950 S SD    . MET B 2 207 ? 77.860 21.493  -30.252 1.00 83.49  ? 208 MET A SD    1 
ATOM   1951 C CE    . MET B 2 207 ? 79.341 22.649  -30.029 1.00 82.95  ? 208 MET A CE    1 
ATOM   1952 N N     . ILE B 2 208 ? 76.764 17.063  -26.020 1.00 18.31  ? 209 ILE A N     1 
ATOM   1953 C CA    . ILE B 2 208 ? 77.129 15.775  -25.481 1.00 16.35  ? 209 ILE A CA    1 
ATOM   1954 C C     . ILE B 2 208 ? 76.236 14.771  -26.147 1.00 34.79  ? 209 ILE A C     1 
ATOM   1955 O O     . ILE B 2 208 ? 75.053 14.947  -26.203 1.00 47.77  ? 209 ILE A O     1 
ATOM   1956 C CB    . ILE B 2 208 ? 76.804 15.720  -24.032 1.00 14.84  ? 209 ILE A CB    1 
ATOM   1957 C CG1   . ILE B 2 208 ? 77.728 16.655  -23.254 1.00 17.11  ? 209 ILE A CG1   1 
ATOM   1958 C CG2   . ILE B 2 208 ? 76.850 14.338  -23.601 1.00 6.29   ? 209 ILE A CG2   1 
ATOM   1959 C CD1   . ILE B 2 208 ? 77.716 16.394  -21.755 1.00 14.64  ? 209 ILE A CD1   1 
ATOM   1960 N N     . LYS B 2 209 ? 76.840 13.715  -26.681 1.00 32.39  ? 210 LYS A N     1 
ATOM   1961 C CA    . LYS B 2 209 ? 76.039 12.710  -27.345 1.00 36.85  ? 210 LYS A CA    1 
ATOM   1962 C C     . LYS B 2 209 ? 76.046 11.413  -26.556 1.00 39.92  ? 210 LYS A C     1 
ATOM   1963 O O     . LYS B 2 209 ? 77.033 11.047  -25.952 1.00 40.55  ? 210 LYS A O     1 
ATOM   1964 C CB    . LYS B 2 209 ? 76.611 12.471  -28.735 1.00 41.07  ? 210 LYS A CB    1 
ATOM   1965 C CG    . LYS B 2 209 ? 78.021 11.882  -28.722 1.00 95.54  ? 210 LYS A CG    1 
ATOM   1966 C CD    . LYS B 2 209 ? 79.051 12.883  -28.166 1.00 100.00 ? 210 LYS A CD    1 
ATOM   1967 C CE    . LYS B 2 209 ? 79.813 12.390  -26.890 1.00 100.00 ? 210 LYS A CE    1 
ATOM   1968 N NZ    . LYS B 2 209 ? 80.559 13.463  -26.069 1.00 86.84  ? 210 LYS A NZ    1 
ATOM   1969 N N     . VAL B 2 210 ? 74.938 10.715  -26.531 1.00 37.62  ? 211 VAL A N     1 
ATOM   1970 C CA    . VAL B 2 210 ? 74.976 9.506   -25.801 1.00 34.10  ? 211 VAL A CA    1 
ATOM   1971 C C     . VAL B 2 210 ? 75.012 8.362   -26.677 1.00 42.99  ? 211 VAL A C     1 
ATOM   1972 O O     . VAL B 2 210 ? 74.200 8.242   -27.561 1.00 50.80  ? 211 VAL A O     1 
ATOM   1973 C CB    . VAL B 2 210 ? 74.479 9.513   -24.336 1.00 34.65  ? 211 VAL A CB    1 
ATOM   1974 C CG1   . VAL B 2 210 ? 73.746 10.842  -24.011 1.00 28.13  ? 211 VAL A CG1   1 
ATOM   1975 C CG2   . VAL B 2 210 ? 73.647 8.309   -24.003 1.00 33.13  ? 211 VAL A CG2   1 
ATOM   1976 N N     . PRO B 2 211 ? 76.075 7.616   -26.535 1.00 40.95  ? 212 PRO A N     1 
ATOM   1977 C CA    . PRO B 2 211 ? 76.328 6.437   -27.304 1.00 39.64  ? 212 PRO A CA    1 
ATOM   1978 C C     . PRO B 2 211 ? 75.207 5.549   -26.903 1.00 40.09  ? 212 PRO A C     1 
ATOM   1979 O O     . PRO B 2 211 ? 74.892 5.364   -25.648 1.00 38.94  ? 212 PRO A O     1 
ATOM   1980 C CB    . PRO B 2 211 ? 77.608 5.907   -26.675 1.00 42.08  ? 212 PRO A CB    1 
ATOM   1981 C CG    . PRO B 2 211 ? 77.740 6.633   -25.384 1.00 48.91  ? 212 PRO A CG    1 
ATOM   1982 C CD    . PRO B 2 211 ? 77.197 7.963   -25.666 1.00 42.43  ? 212 PRO A CD    1 
ATOM   1983 N N     . GLU B 2 212 ? 74.618 4.890   -27.880 1.00 39.03  ? 213 GLU A N     1 
ATOM   1984 C CA    . GLU B 2 212 ? 73.507 4.029   -27.598 1.00 42.51  ? 213 GLU A CA    1 
ATOM   1985 C C     . GLU B 2 212 ? 73.905 2.857   -26.688 1.00 39.90  ? 213 GLU A C     1 
ATOM   1986 O O     . GLU B 2 212 ? 73.104 2.329   -25.923 1.00 47.02  ? 213 GLU A O     1 
ATOM   1987 C CB    . GLU B 2 212 ? 72.795 3.528   -28.895 1.00 46.97  ? 213 GLU A CB    1 
ATOM   1988 C CG    . GLU B 2 212 ? 73.747 2.982   -29.982 1.00 88.98  ? 213 GLU A CG    1 
ATOM   1989 C CD    . GLU B 2 212 ? 73.066 1.888   -30.857 1.00 100.00 ? 213 GLU A CD    1 
ATOM   1990 O OE1   . GLU B 2 212 ? 72.454 2.275   -31.905 1.00 100.00 ? 213 GLU A OE1   1 
ATOM   1991 O OE2   . GLU B 2 212 ? 73.165 0.650   -30.517 1.00 100.00 ? 213 GLU A OE2   1 
ATOM   1992 N N     . SER B 2 213 ? 75.153 2.440   -26.747 1.00 28.18  ? 214 SER A N     1 
ATOM   1993 C CA    . SER B 2 213 ? 75.524 1.331   -25.876 1.00 30.41  ? 214 SER A CA    1 
ATOM   1994 C C     . SER B 2 213 ? 75.470 1.846   -24.439 1.00 38.18  ? 214 SER A C     1 
ATOM   1995 O O     . SER B 2 213 ? 75.684 1.113   -23.463 1.00 44.21  ? 214 SER A O     1 
ATOM   1996 C CB    . SER B 2 213 ? 76.939 0.897   -26.177 1.00 37.46  ? 214 SER A CB    1 
ATOM   1997 O OG    . SER B 2 213 ? 77.777 2.039   -26.364 1.00 64.66  ? 214 SER A OG    1 
ATOM   1998 N N     . TRP B 2 214 ? 75.198 3.124   -24.308 1.00 28.95  ? 215 TRP A N     1 
ATOM   1999 C CA    . TRP B 2 214 ? 75.178 3.710   -22.996 1.00 37.18  ? 215 TRP A CA    1 
ATOM   2000 C C     . TRP B 2 214 ? 73.831 4.030   -22.419 1.00 36.67  ? 215 TRP A C     1 
ATOM   2001 O O     . TRP B 2 214 ? 73.733 4.549   -21.308 1.00 29.21  ? 215 TRP A O     1 
ATOM   2002 C CB    . TRP B 2 214 ? 76.112 4.927   -22.930 1.00 41.53  ? 215 TRP A CB    1 
ATOM   2003 C CG    . TRP B 2 214 ? 77.553 4.575   -22.726 1.00 43.54  ? 215 TRP A CG    1 
ATOM   2004 C CD1   . TRP B 2 214 ? 78.069 3.335   -22.638 1.00 46.91  ? 215 TRP A CD1   1 
ATOM   2005 C CD2   . TRP B 2 214 ? 78.650 5.484   -22.598 1.00 45.24  ? 215 TRP A CD2   1 
ATOM   2006 N NE1   . TRP B 2 214 ? 79.419 3.402   -22.454 1.00 48.70  ? 215 TRP A NE1   1 
ATOM   2007 C CE2   . TRP B 2 214 ? 79.799 4.718   -22.389 1.00 49.75  ? 215 TRP A CE2   1 
ATOM   2008 C CE3   . TRP B 2 214 ? 78.757 6.882   -22.586 1.00 50.12  ? 215 TRP A CE3   1 
ATOM   2009 C CZ2   . TRP B 2 214 ? 81.051 5.280   -22.220 1.00 50.23  ? 215 TRP A CZ2   1 
ATOM   2010 C CZ3   . TRP B 2 214 ? 80.013 7.451   -22.380 1.00 53.22  ? 215 TRP A CZ3   1 
ATOM   2011 C CH2   . TRP B 2 214 ? 81.141 6.643   -22.242 1.00 53.94  ? 215 TRP A CH2   1 
ATOM   2012 N N     . ILE B 2 215 ? 72.774 3.761   -23.166 1.00 35.19  ? 216 ILE A N     1 
ATOM   2013 C CA    . ILE B 2 215 ? 71.460 3.982   -22.598 1.00 37.37  ? 216 ILE A CA    1 
ATOM   2014 C C     . ILE B 2 215 ? 70.800 2.590   -22.400 1.00 36.44  ? 216 ILE A C     1 
ATOM   2015 O O     . ILE B 2 215 ? 70.670 1.775   -23.339 1.00 33.71  ? 216 ILE A O     1 
ATOM   2016 C CB    . ILE B 2 215 ? 70.587 5.112   -23.234 1.00 43.65  ? 216 ILE A CB    1 
ATOM   2017 C CG1   . ILE B 2 215 ? 69.234 4.555   -23.586 1.00 49.13  ? 216 ILE A CG1   1 
ATOM   2018 C CG2   . ILE B 2 215 ? 71.226 5.792   -24.440 1.00 39.51  ? 216 ILE A CG2   1 
ATOM   2019 C CD1   . ILE B 2 215 ? 69.260 3.644   -24.795 1.00 97.67  ? 216 ILE A CD1   1 
ATOM   2020 N N     . VAL B 2 216 ? 70.484 2.249   -21.161 1.00 29.67  ? 217 VAL A N     1 
ATOM   2021 C CA    . VAL B 2 216 ? 69.896 0.926   -20.988 1.00 35.06  ? 217 VAL A CA    1 
ATOM   2022 C C     . VAL B 2 216 ? 68.554 1.028   -20.250 1.00 44.08  ? 217 VAL A C     1 
ATOM   2023 O O     . VAL B 2 216 ? 68.473 1.625   -19.155 1.00 43.38  ? 217 VAL A O     1 
ATOM   2024 C CB    . VAL B 2 216 ? 70.846 -0.170  -20.317 1.00 36.64  ? 217 VAL A CB    1 
ATOM   2025 C CG1   . VAL B 2 216 ? 70.496 -1.514  -20.750 1.00 34.25  ? 217 VAL A CG1   1 
ATOM   2026 C CG2   . VAL B 2 216 ? 72.233 0.001   -20.696 1.00 37.36  ? 217 VAL A CG2   1 
ATOM   2027 N N     . GLN B 2 217 ? 67.539 0.428   -20.886 1.00 35.19  ? 218 GLN A N     1 
ATOM   2028 C CA    . GLN B 2 217 ? 66.161 0.370   -20.423 1.00 34.45  ? 218 GLN A CA    1 
ATOM   2029 C C     . GLN B 2 217 ? 65.998 -0.388  -19.139 1.00 37.46  ? 218 GLN A C     1 
ATOM   2030 O O     . GLN B 2 217 ? 66.501 -1.492  -19.001 1.00 43.14  ? 218 GLN A O     1 
ATOM   2031 C CB    . GLN B 2 217 ? 65.269 -0.340  -21.438 1.00 34.66  ? 218 GLN A CB    1 
ATOM   2032 C CG    . GLN B 2 217 ? 64.350 0.580   -22.253 1.00 47.43  ? 218 GLN A CG    1 
ATOM   2033 C CD    . GLN B 2 217 ? 63.357 1.345   -21.424 1.00 66.10  ? 218 GLN A CD    1 
ATOM   2034 O OE1   . GLN B 2 217 ? 62.414 1.909   -21.963 1.00 72.19  ? 218 GLN A OE1   1 
ATOM   2035 N NE2   . GLN B 2 217 ? 63.580 1.406   -20.107 1.00 54.87  ? 218 GLN A NE2   1 
ATOM   2036 N N     . GLY B 2 218 ? 65.258 0.216   -18.220 1.00 25.44  ? 219 GLY A N     1 
ATOM   2037 C CA    . GLY B 2 218 ? 64.960 -0.356  -16.933 1.00 25.27  ? 219 GLY A CA    1 
ATOM   2038 C C     . GLY B 2 218 ? 63.428 -0.547  -16.894 1.00 39.45  ? 219 GLY A C     1 
ATOM   2039 O O     . GLY B 2 218 ? 62.719 -0.309  -17.880 1.00 39.70  ? 219 GLY A O     1 
ATOM   2040 N N     . ASP B 2 219 ? 62.915 -0.981  -15.749 1.00 31.48  ? 220 ASP A N     1 
ATOM   2041 C CA    . ASP B 2 219 ? 61.499 -1.211  -15.631 1.00 21.63  ? 220 ASP A CA    1 
ATOM   2042 C C     . ASP B 2 219 ? 61.044 -0.725  -14.279 1.00 22.87  ? 220 ASP A C     1 
ATOM   2043 O O     . ASP B 2 219 ? 59.945 -1.038  -13.816 1.00 26.93  ? 220 ASP A O     1 
ATOM   2044 C CB    . ASP B 2 219 ? 61.185 -2.704  -15.879 1.00 13.10  ? 220 ASP A CB    1 
ATOM   2045 C CG    . ASP B 2 219 ? 61.629 -3.609  -14.766 1.00 19.39  ? 220 ASP A CG    1 
ATOM   2046 O OD1   . ASP B 2 219 ? 62.034 -3.191  -13.647 1.00 22.27  ? 220 ASP A OD1   1 
ATOM   2047 O OD2   . ASP B 2 219 ? 61.632 -4.809  -15.043 1.00 49.81  ? 220 ASP A OD2   1 
ATOM   2048 N N     . PHE B 2 220 ? 61.940 0.015   -13.652 1.00 15.63  ? 221 PHE A N     1 
ATOM   2049 C CA    . PHE B 2 220 ? 61.760 0.604   -12.333 1.00 20.60  ? 221 PHE A CA    1 
ATOM   2050 C C     . PHE B 2 220 ? 62.018 -0.363  -11.212 1.00 30.46  ? 221 PHE A C     1 
ATOM   2051 O O     . PHE B 2 220 ? 61.893 0.009   -10.039 1.00 37.83  ? 221 PHE A O     1 
ATOM   2052 C CB    . PHE B 2 220 ? 60.409 1.258   -12.134 1.00 25.13  ? 221 PHE A CB    1 
ATOM   2053 C CG    . PHE B 2 220 ? 60.265 2.550   -12.799 1.00 25.72  ? 221 PHE A CG    1 
ATOM   2054 C CD1   . PHE B 2 220 ? 60.923 3.658   -12.314 1.00 32.28  ? 221 PHE A CD1   1 
ATOM   2055 C CD2   . PHE B 2 220 ? 59.474 2.663   -13.915 1.00 25.04  ? 221 PHE A CD2   1 
ATOM   2056 C CE1   . PHE B 2 220 ? 60.780 4.892   -12.931 1.00 30.57  ? 221 PHE A CE1   1 
ATOM   2057 C CE2   . PHE B 2 220 ? 59.324 3.874   -14.536 1.00 28.60  ? 221 PHE A CE2   1 
ATOM   2058 C CZ    . PHE B 2 220 ? 59.994 5.000   -14.044 1.00 26.76  ? 221 PHE A CZ    1 
ATOM   2059 N N     . GLU B 2 221 ? 62.388 -1.589  -11.555 1.00 26.03  ? 222 GLU A N     1 
ATOM   2060 C CA    . GLU B 2 221 ? 62.705 -2.593  -10.527 1.00 27.92  ? 222 GLU A CA    1 
ATOM   2061 C C     . GLU B 2 221 ? 64.257 -2.775  -10.339 1.00 31.41  ? 222 GLU A C     1 
ATOM   2062 O O     . GLU B 2 221 ? 65.055 -2.766  -11.311 1.00 27.43  ? 222 GLU A O     1 
ATOM   2063 C CB    . GLU B 2 221 ? 61.985 -3.927  -10.847 1.00 29.79  ? 222 GLU A CB    1 
ATOM   2064 C CG    . GLU B 2 221 ? 60.454 -3.948  -10.624 1.00 39.10  ? 222 GLU A CG    1 
ATOM   2065 C CD    . GLU B 2 221 ? 60.012 -4.075  -9.143  1.00 99.87  ? 222 GLU A CD    1 
ATOM   2066 O OE1   . GLU B 2 221 ? 59.939 -5.222  -8.618  1.00 100.00 ? 222 GLU A OE1   1 
ATOM   2067 O OE2   . GLU B 2 221 ? 59.693 -3.031  -8.512  1.00 100.00 ? 222 GLU A OE2   1 
ATOM   2068 N N     . PRO B 2 222 ? 64.666 -2.941  -9.091  1.00 26.23  ? 223 PRO A N     1 
ATOM   2069 C CA    . PRO B 2 222 ? 66.077 -3.115  -8.750  1.00 27.25  ? 223 PRO A CA    1 
ATOM   2070 C C     . PRO B 2 222 ? 66.829 -4.004  -9.706  1.00 31.63  ? 223 PRO A C     1 
ATOM   2071 O O     . PRO B 2 222 ? 67.863 -3.611  -10.229 1.00 33.76  ? 223 PRO A O     1 
ATOM   2072 C CB    . PRO B 2 222 ? 66.035 -3.777  -7.382  1.00 28.34  ? 223 PRO A CB    1 
ATOM   2073 C CG    . PRO B 2 222 ? 64.720 -3.342  -6.809  1.00 32.41  ? 223 PRO A CG    1 
ATOM   2074 C CD    . PRO B 2 222 ? 63.792 -3.345  -8.002  1.00 26.43  ? 223 PRO A CD    1 
ATOM   2075 N N     . GLU B 2 223 ? 66.321 -5.191  -9.950  1.00 23.49  ? 224 GLU A N     1 
ATOM   2076 C CA    . GLU B 2 223 ? 67.015 -6.048  -10.836 1.00 21.11  ? 224 GLU A CA    1 
ATOM   2077 C C     . GLU B 2 223 ? 67.379 -5.405  -12.141 1.00 35.46  ? 224 GLU A C     1 
ATOM   2078 O O     . GLU B 2 223 ? 68.508 -5.595  -12.591 1.00 34.95  ? 224 GLU A O     1 
ATOM   2079 C CB    . GLU B 2 223 ? 66.194 -7.269  -11.119 1.00 24.13  ? 224 GLU A CB    1 
ATOM   2080 C CG    . GLU B 2 223 ? 66.908 -8.281  -12.027 1.00 47.61  ? 224 GLU A CG    1 
ATOM   2081 C CD    . GLU B 2 223 ? 67.752 -9.265  -11.230 1.00 90.09  ? 224 GLU A CD    1 
ATOM   2082 O OE1   . GLU B 2 223 ? 67.136 -10.147 -10.604 1.00 100.00 ? 224 GLU A OE1   1 
ATOM   2083 O OE2   . GLU B 2 223 ? 69.005 -9.152  -11.196 1.00 98.54  ? 224 GLU A OE2   1 
ATOM   2084 N N     . SER B 2 224 ? 66.444 -4.639  -12.735 1.00 37.34  ? 225 SER A N     1 
ATOM   2085 C CA    . SER B 2 224 ? 66.707 -3.982  -14.029 1.00 36.19  ? 225 SER A CA    1 
ATOM   2086 C C     . SER B 2 224 ? 67.793 -2.991  -13.921 1.00 27.39  ? 225 SER A C     1 
ATOM   2087 O O     . SER B 2 224 ? 68.463 -2.728  -14.883 1.00 33.01  ? 225 SER A O     1 
ATOM   2088 C CB    . SER B 2 224 ? 65.460 -3.367  -14.677 1.00 42.63  ? 225 SER A CB    1 
ATOM   2089 O OG    . SER B 2 224 ? 64.927 -2.298  -13.927 1.00 44.56  ? 225 SER A OG    1 
ATOM   2090 N N     . GLY B 2 225 ? 67.954 -2.466  -12.716 1.00 25.38  ? 226 GLY A N     1 
ATOM   2091 C CA    . GLY B 2 225 ? 68.994 -1.488  -12.362 1.00 28.65  ? 226 GLY A CA    1 
ATOM   2092 C C     . GLY B 2 225 ? 70.330 -2.238  -12.428 1.00 41.00  ? 226 GLY A C     1 
ATOM   2093 O O     . GLY B 2 225 ? 71.235 -1.866  -13.175 1.00 47.57  ? 226 GLY A O     1 
ATOM   2094 N N     . TYR B 2 226 ? 70.407 -3.319  -11.662 1.00 36.30  ? 227 TYR A N     1 
ATOM   2095 C CA    . TYR B 2 226 ? 71.560 -4.201  -11.621 1.00 31.18  ? 227 TYR A CA    1 
ATOM   2096 C C     . TYR B 2 226 ? 71.950 -4.492  -13.078 1.00 32.49  ? 227 TYR A C     1 
ATOM   2097 O O     . TYR B 2 226 ? 72.882 -3.900  -13.590 1.00 40.44  ? 227 TYR A O     1 
ATOM   2098 C CB    . TYR B 2 226 ? 71.141 -5.448  -10.883 1.00 32.29  ? 227 TYR A CB    1 
ATOM   2099 C CG    . TYR B 2 226 ? 72.278 -6.278  -10.435 1.00 35.56  ? 227 TYR A CG    1 
ATOM   2100 C CD1   . TYR B 2 226 ? 72.886 -7.149  -11.308 1.00 37.78  ? 227 TYR A CD1   1 
ATOM   2101 C CD2   . TYR B 2 226 ? 72.754 -6.191  -9.148  1.00 38.81  ? 227 TYR A CD2   1 
ATOM   2102 C CE1   . TYR B 2 226 ? 73.951 -7.908  -10.914 1.00 49.26  ? 227 TYR A CE1   1 
ATOM   2103 C CE2   . TYR B 2 226 ? 73.834 -6.967  -8.721  1.00 40.44  ? 227 TYR A CE2   1 
ATOM   2104 C CZ    . TYR B 2 226 ? 74.421 -7.819  -9.611  1.00 54.10  ? 227 TYR A CZ    1 
ATOM   2105 O OH    . TYR B 2 226 ? 75.480 -8.590  -9.214  1.00 57.45  ? 227 TYR A OH    1 
ATOM   2106 N N     . ARG B 2 227 ? 71.200 -5.320  -13.781 1.00 22.44  ? 228 ARG A N     1 
ATOM   2107 C CA    . ARG B 2 227 ? 71.511 -5.603  -15.185 1.00 22.61  ? 228 ARG A CA    1 
ATOM   2108 C C     . ARG B 2 227 ? 71.950 -4.431  -16.085 1.00 36.60  ? 228 ARG A C     1 
ATOM   2109 O O     . ARG B 2 227 ? 72.772 -4.615  -16.973 1.00 38.19  ? 228 ARG A O     1 
ATOM   2110 C CB    . ARG B 2 227 ? 70.336 -6.331  -15.864 1.00 37.81  ? 228 ARG A CB    1 
ATOM   2111 C CG    . ARG B 2 227 ? 70.361 -7.862  -15.823 1.00 74.93  ? 228 ARG A CG    1 
ATOM   2112 C CD    . ARG B 2 227 ? 69.772 -8.414  -14.513 1.00 95.25  ? 228 ARG A CD    1 
ATOM   2113 N NE    . ARG B 2 227 ? 68.472 -9.053  -14.743 1.00 100.00 ? 228 ARG A NE    1 
ATOM   2114 C CZ    . ARG B 2 227 ? 68.171 -10.306 -14.400 1.00 100.00 ? 228 ARG A CZ    1 
ATOM   2115 N NH1   . ARG B 2 227 ? 69.077 -11.076 -13.794 1.00 100.00 ? 228 ARG A NH1   1 
ATOM   2116 N NH2   . ARG B 2 227 ? 66.953 -10.786 -14.663 1.00 100.00 ? 228 ARG A NH2   1 
ATOM   2117 N N     . ALA B 2 228 ? 71.400 -3.233  -15.886 1.00 37.64  ? 229 ALA A N     1 
ATOM   2118 C CA    . ALA B 2 228 ? 71.792 -2.135  -16.749 1.00 32.92  ? 229 ALA A CA    1 
ATOM   2119 C C     . ALA B 2 228 ? 73.155 -1.632  -16.326 1.00 34.91  ? 229 ALA A C     1 
ATOM   2120 O O     . ALA B 2 228 ? 74.064 -1.528  -17.151 1.00 37.60  ? 229 ALA A O     1 
ATOM   2121 C CB    . ALA B 2 228 ? 70.812 -1.081  -16.689 1.00 31.98  ? 229 ALA A CB    1 
ATOM   2122 N N     . MET B 2 229 ? 73.311 -1.359  -15.032 1.00 27.41  ? 230 MET A N     1 
ATOM   2123 C CA    . MET B 2 229 ? 74.587 -0.857  -14.520 1.00 27.82  ? 230 MET A CA    1 
ATOM   2124 C C     . MET B 2 229 ? 75.663 -1.770  -15.002 1.00 37.83  ? 230 MET A C     1 
ATOM   2125 O O     . MET B 2 229 ? 76.671 -1.364  -15.534 1.00 41.80  ? 230 MET A O     1 
ATOM   2126 C CB    . MET B 2 229 ? 74.645 -0.888  -12.999 1.00 29.48  ? 230 MET A CB    1 
ATOM   2127 C CG    . MET B 2 229 ? 75.693 0.063   -12.411 1.00 30.69  ? 230 MET A CG    1 
ATOM   2128 S SD    . MET B 2 229 ? 75.761 1.590   -13.404 1.00 37.75  ? 230 MET A SD    1 
ATOM   2129 C CE    . MET B 2 229 ? 76.328 2.673   -12.117 1.00 32.61  ? 230 MET A CE    1 
ATOM   2130 N N     . GLN B 2 230 ? 75.417 -3.040  -14.839 1.00 32.51  ? 231 GLN A N     1 
ATOM   2131 C CA    . GLN B 2 230 ? 76.384 -3.992  -15.270 1.00 29.28  ? 231 GLN A CA    1 
ATOM   2132 C C     . GLN B 2 230 ? 76.566 -4.031  -16.766 1.00 38.25  ? 231 GLN A C     1 
ATOM   2133 O O     . GLN B 2 230 ? 77.684 -4.190  -17.245 1.00 45.13  ? 231 GLN A O     1 
ATOM   2134 C CB    . GLN B 2 230 ? 76.140 -5.337  -14.634 1.00 28.12  ? 231 GLN A CB    1 
ATOM   2135 C CG    . GLN B 2 230 ? 76.417 -6.529  -15.512 1.00 44.93  ? 231 GLN A CG    1 
ATOM   2136 C CD    . GLN B 2 230 ? 75.857 -7.790  -14.893 1.00 93.33  ? 231 GLN A CD    1 
ATOM   2137 O OE1   . GLN B 2 230 ? 75.972 -7.993  -13.667 1.00 77.72  ? 231 GLN A OE1   1 
ATOM   2138 N NE2   . GLN B 2 230 ? 75.191 -8.619  -15.712 1.00 100.00 ? 231 GLN A NE2   1 
ATOM   2139 N N     . GLN B 2 231 ? 75.522 -3.828  -17.542 1.00 32.88  ? 232 GLN A N     1 
ATOM   2140 C CA    . GLN B 2 231 ? 75.788 -3.857  -18.979 1.00 31.37  ? 232 GLN A CA    1 
ATOM   2141 C C     . GLN B 2 231 ? 76.533 -2.605  -19.363 1.00 47.16  ? 232 GLN A C     1 
ATOM   2142 O O     . GLN B 2 231 ? 77.214 -2.576  -20.383 1.00 50.41  ? 232 GLN A O     1 
ATOM   2143 C CB    . GLN B 2 231 ? 74.537 -3.923  -19.796 1.00 28.49  ? 232 GLN A CB    1 
ATOM   2144 C CG    . GLN B 2 231 ? 74.173 -5.280  -20.291 1.00 86.34  ? 232 GLN A CG    1 
ATOM   2145 C CD    . GLN B 2 231 ? 73.169 -5.177  -21.420 1.00 100.00 ? 232 GLN A CD    1 
ATOM   2146 O OE1   . GLN B 2 231 ? 73.285 -4.295  -22.281 1.00 82.37  ? 232 GLN A OE1   1 
ATOM   2147 N NE2   . GLN B 2 231 ? 72.129 -6.013  -21.373 1.00 100.00 ? 232 GLN A NE2   1 
ATOM   2148 N N     . ILE B 2 232 ? 76.421 -1.555  -18.560 1.00 43.91  ? 233 ILE A N     1 
ATOM   2149 C CA    . ILE B 2 232 ? 77.127 -0.333  -18.935 1.00 42.58  ? 233 ILE A CA    1 
ATOM   2150 C C     . ILE B 2 232 ? 78.596 -0.327  -18.590 1.00 44.55  ? 233 ILE A C     1 
ATOM   2151 O O     . ILE B 2 232 ? 79.407 0.124   -19.349 1.00 42.11  ? 233 ILE A O     1 
ATOM   2152 C CB    . ILE B 2 232 ? 76.491 0.934   -18.340 1.00 42.70  ? 233 ILE A CB    1 
ATOM   2153 C CG1   . ILE B 2 232 ? 75.361 1.412   -19.231 1.00 40.79  ? 233 ILE A CG1   1 
ATOM   2154 C CG2   . ILE B 2 232 ? 77.504 2.032   -18.325 1.00 41.26  ? 233 ILE A CG2   1 
ATOM   2155 C CD1   . ILE B 2 232 ? 74.311 2.068   -18.473 1.00 44.84  ? 233 ILE A CD1   1 
ATOM   2156 N N     . LEU B 2 233 ? 78.914 -0.784  -17.400 1.00 45.87  ? 234 LEU A N     1 
ATOM   2157 C CA    . LEU B 2 233 ? 80.277 -0.801  -16.943 1.00 45.18  ? 234 LEU A CA    1 
ATOM   2158 C C     . LEU B 2 233 ? 80.963 -2.022  -17.504 1.00 58.57  ? 234 LEU A C     1 
ATOM   2159 O O     . LEU B 2 233 ? 82.147 -2.170  -17.346 1.00 64.12  ? 234 LEU A O     1 
ATOM   2160 C CB    . LEU B 2 233 ? 80.351 -0.761  -15.399 1.00 43.55  ? 234 LEU A CB    1 
ATOM   2161 C CG    . LEU B 2 233 ? 79.342 0.115   -14.625 1.00 43.44  ? 234 LEU A CG    1 
ATOM   2162 C CD1   . LEU B 2 233 ? 79.529 0.025   -13.155 1.00 42.56  ? 234 LEU A CD1   1 
ATOM   2163 C CD2   . LEU B 2 233 ? 79.489 1.527   -15.064 1.00 44.99  ? 234 LEU A CD2   1 
ATOM   2164 N N     . SER B 2 234 ? 80.227 -2.893  -18.173 1.00 57.22  ? 235 SER A N     1 
ATOM   2165 C CA    . SER B 2 234 ? 80.871 -4.067  -18.743 1.00 60.84  ? 235 SER A CA    1 
ATOM   2166 C C     . SER B 2 234 ? 81.691 -3.713  -20.010 1.00 74.39  ? 235 SER A C     1 
ATOM   2167 O O     . SER B 2 234 ? 82.538 -4.484  -20.446 1.00 80.13  ? 235 SER A O     1 
ATOM   2168 C CB    . SER B 2 234 ? 79.840 -5.179  -19.047 1.00 64.95  ? 235 SER A CB    1 
ATOM   2169 O OG    . SER B 2 234 ? 80.075 -6.335  -18.240 1.00 72.30  ? 235 SER A OG    1 
ATOM   2170 N N     . GLN B 2 235 ? 81.442 -2.541  -20.591 1.00 73.17  ? 236 GLN A N     1 
ATOM   2171 C CA    . GLN B 2 235 ? 82.124 -2.101  -21.821 1.00 71.97  ? 236 GLN A CA    1 
ATOM   2172 C C     . GLN B 2 235 ? 83.582 -1.660  -21.790 1.00 73.11  ? 236 GLN A C     1 
ATOM   2173 O O     . GLN B 2 235 ? 84.095 -1.216  -20.757 1.00 71.96  ? 236 GLN A O     1 
ATOM   2174 C CB    . GLN B 2 235 ? 81.322 -1.010  -22.531 1.00 73.16  ? 236 GLN A CB    1 
ATOM   2175 C CG    . GLN B 2 235 ? 79.960 -0.780  -22.018 1.00 40.47  ? 236 GLN A CG    1 
ATOM   2176 C CD    . GLN B 2 235 ? 79.008 -0.567  -23.114 1.00 62.82  ? 236 GLN A CD    1 
ATOM   2177 O OE1   . GLN B 2 235 ? 79.093 0.417   -23.847 1.00 76.88  ? 236 GLN A OE1   1 
ATOM   2178 N NE2   . GLN B 2 235 ? 78.093 -1.500  -23.270 1.00 77.67  ? 236 GLN A NE2   1 
ATOM   2179 N N     . PRO B 2 236 ? 84.215 -1.761  -22.967 1.00 73.50  ? 237 PRO A N     1 
ATOM   2180 C CA    . PRO B 2 236 ? 85.608 -1.381  -23.167 1.00 72.62  ? 237 PRO A CA    1 
ATOM   2181 C C     . PRO B 2 236 ? 85.771 0.038   -22.682 1.00 71.84  ? 237 PRO A C     1 
ATOM   2182 O O     . PRO B 2 236 ? 86.609 0.314   -21.818 1.00 67.81  ? 237 PRO A O     1 
ATOM   2183 C CB    . PRO B 2 236 ? 85.727 -1.385  -24.696 1.00 75.10  ? 237 PRO A CB    1 
ATOM   2184 C CG    . PRO B 2 236 ? 84.347 -1.035  -25.174 1.00 78.74  ? 237 PRO A CG    1 
ATOM   2185 C CD    . PRO B 2 236 ? 83.518 -1.877  -24.266 1.00 75.65  ? 237 PRO A CD    1 
ATOM   2186 N N     . HIS B 2 237 ? 84.936 0.906   -23.273 1.00 72.14  ? 238 HIS A N     1 
ATOM   2187 C CA    . HIS B 2 237 ? 84.821 2.346   -23.013 1.00 70.64  ? 238 HIS A CA    1 
ATOM   2188 C C     . HIS B 2 237 ? 83.549 2.525   -22.145 1.00 58.98  ? 238 HIS A C     1 
ATOM   2189 O O     . HIS B 2 237 ? 82.433 2.164   -22.556 1.00 55.01  ? 238 HIS A O     1 
ATOM   2190 C CB    . HIS B 2 237 ? 84.651 3.088   -24.350 1.00 76.66  ? 238 HIS A CB    1 
ATOM   2191 C CG    . HIS B 2 237 ? 84.664 4.573   -24.210 1.00 88.09  ? 238 HIS A CG    1 
ATOM   2192 N ND1   . HIS B 2 237 ? 84.430 5.427   -25.271 1.00 95.02  ? 238 HIS A ND1   1 
ATOM   2193 C CD2   . HIS B 2 237 ? 84.884 5.365   -23.128 1.00 94.48  ? 238 HIS A CD2   1 
ATOM   2194 C CE1   . HIS B 2 237 ? 84.502 6.681   -24.846 1.00 96.31  ? 238 HIS A CE1   1 
ATOM   2195 N NE2   . HIS B 2 237 ? 84.776 6.671   -23.550 1.00 95.97  ? 238 HIS A NE2   1 
ATOM   2196 N N     . ARG B 2 238 ? 83.728 3.069   -20.942 1.00 42.83  ? 239 ARG A N     1 
ATOM   2197 C CA    . ARG B 2 238 ? 82.639 3.267   -20.000 1.00 31.83  ? 239 ARG A CA    1 
ATOM   2198 C C     . ARG B 2 238 ? 82.455 4.750   -19.474 1.00 40.13  ? 239 ARG A C     1 
ATOM   2199 O O     . ARG B 2 238 ? 83.419 5.487   -19.314 1.00 44.24  ? 239 ARG A O     1 
ATOM   2200 C CB    . ARG B 2 238 ? 82.891 2.309   -18.860 1.00 14.12  ? 239 ARG A CB    1 
ATOM   2201 C CG    . ARG B 2 238 ? 82.933 3.028   -17.531 1.00 53.94  ? 239 ARG A CG    1 
ATOM   2202 C CD    . ARG B 2 238 ? 83.609 2.184   -16.480 1.00 67.16  ? 239 ARG A CD    1 
ATOM   2203 N NE    . ARG B 2 238 ? 83.790 0.817   -16.963 1.00 91.81  ? 239 ARG A NE    1 
ATOM   2204 C CZ    . ARG B 2 238 ? 84.603 -0.079  -16.403 1.00 100.00 ? 239 ARG A CZ    1 
ATOM   2205 N NH1   . ARG B 2 238 ? 85.335 0.245   -15.336 1.00 100.00 ? 239 ARG A NH1   1 
ATOM   2206 N NH2   . ARG B 2 238 ? 84.691 -1.301  -16.915 1.00 100.00 ? 239 ARG A NH2   1 
ATOM   2207 N N     . PRO B 2 239 ? 81.218 5.186   -19.200 1.00 35.36  ? 240 PRO A N     1 
ATOM   2208 C CA    . PRO B 2 239 ? 80.972 6.544   -18.751 1.00 31.82  ? 240 PRO A CA    1 
ATOM   2209 C C     . PRO B 2 239 ? 81.464 6.796   -17.335 1.00 33.13  ? 240 PRO A C     1 
ATOM   2210 O O     . PRO B 2 239 ? 81.801 5.869   -16.597 1.00 29.41  ? 240 PRO A O     1 
ATOM   2211 C CB    . PRO B 2 239 ? 79.451 6.660   -18.820 1.00 29.78  ? 240 PRO A CB    1 
ATOM   2212 C CG    . PRO B 2 239 ? 78.956 5.279   -18.993 1.00 31.72  ? 240 PRO A CG    1 
ATOM   2213 C CD    . PRO B 2 239 ? 80.076 4.343   -18.837 1.00 31.76  ? 240 PRO A CD    1 
ATOM   2214 N N     . THR B 2 240 ? 81.503 8.076   -16.984 1.00 28.38  ? 241 THR A N     1 
ATOM   2215 C CA    . THR B 2 240 ? 81.983 8.566   -15.700 1.00 29.50  ? 241 THR A CA    1 
ATOM   2216 C C     . THR B 2 240 ? 80.807 8.966   -14.862 1.00 41.98  ? 241 THR A C     1 
ATOM   2217 O O     . THR B 2 240 ? 80.932 9.423   -13.723 1.00 38.86  ? 241 THR A O     1 
ATOM   2218 C CB    . THR B 2 240 ? 82.836 9.853   -15.919 1.00 43.54  ? 241 THR A CB    1 
ATOM   2219 O OG1   . THR B 2 240 ? 81.985 10.973  -16.189 1.00 49.17  ? 241 THR A OG1   1 
ATOM   2220 C CG2   . THR B 2 240 ? 83.667 9.702   -17.147 1.00 75.06  ? 241 THR A CG2   1 
ATOM   2221 N N     . ALA B 2 241 ? 79.631 8.842   -15.435 1.00 43.05  ? 242 ALA A N     1 
ATOM   2222 C CA    . ALA B 2 241 ? 78.474 9.228   -14.660 1.00 38.32  ? 242 ALA A CA    1 
ATOM   2223 C C     . ALA B 2 241 ? 77.234 8.619   -15.197 1.00 32.80  ? 242 ALA A C     1 
ATOM   2224 O O     . ALA B 2 241 ? 77.043 8.503   -16.423 1.00 26.01  ? 242 ALA A O     1 
ATOM   2225 C CB    . ALA B 2 241 ? 78.357 10.697  -14.629 1.00 39.98  ? 242 ALA A CB    1 
ATOM   2226 N N     . VAL B 2 242 ? 76.394 8.202   -14.279 1.00 31.68  ? 243 VAL A N     1 
ATOM   2227 C CA    . VAL B 2 242 ? 75.151 7.614   -14.717 1.00 32.97  ? 243 VAL A CA    1 
ATOM   2228 C C     . VAL B 2 242 ? 73.848 8.168   -14.171 1.00 28.86  ? 243 VAL A C     1 
ATOM   2229 O O     . VAL B 2 242 ? 73.659 8.342   -12.951 1.00 29.88  ? 243 VAL A O     1 
ATOM   2230 C CB    . VAL B 2 242 ? 75.150 6.144   -14.609 1.00 31.48  ? 243 VAL A CB    1 
ATOM   2231 C CG1   . VAL B 2 242 ? 73.794 5.721   -14.322 1.00 27.76  ? 243 VAL A CG1   1 
ATOM   2232 C CG2   . VAL B 2 242 ? 75.546 5.615   -15.909 1.00 31.60  ? 243 VAL A CG2   1 
ATOM   2233 N N     . PHE B 2 243 ? 72.959 8.462   -15.095 1.00 22.58  ? 244 PHE A N     1 
ATOM   2234 C CA    . PHE B 2 243 ? 71.634 8.957   -14.718 1.00 27.11  ? 244 PHE A CA    1 
ATOM   2235 C C     . PHE B 2 243 ? 70.604 7.816   -14.721 1.00 24.74  ? 244 PHE A C     1 
ATOM   2236 O O     . PHE B 2 243 ? 70.271 7.215   -15.815 1.00 16.45  ? 244 PHE A O     1 
ATOM   2237 C CB    . PHE B 2 243 ? 71.105 9.943   -15.683 1.00 28.84  ? 244 PHE A CB    1 
ATOM   2238 C CG    . PHE B 2 243 ? 69.721 10.302  -15.356 1.00 32.97  ? 244 PHE A CG    1 
ATOM   2239 C CD1   . PHE B 2 243 ? 69.350 10.389  -14.025 1.00 35.37  ? 244 PHE A CD1   1 
ATOM   2240 C CD2   . PHE B 2 243 ? 68.767 10.527  -16.356 1.00 32.19  ? 244 PHE A CD2   1 
ATOM   2241 C CE1   . PHE B 2 243 ? 68.048 10.728  -13.676 1.00 34.27  ? 244 PHE A CE1   1 
ATOM   2242 C CE2   . PHE B 2 243 ? 67.473 10.893  -16.025 1.00 29.30  ? 244 PHE A CE2   1 
ATOM   2243 C CZ    . PHE B 2 243 ? 67.117 10.993  -14.673 1.00 28.08  ? 244 PHE A CZ    1 
ATOM   2244 N N     . CYS B 2 244 ? 70.122 7.512   -13.518 1.00 19.59  ? 245 CYS A N     1 
ATOM   2245 C CA    . CYS B 2 244 ? 69.149 6.399   -13.317 1.00 28.32  ? 245 CYS A CA    1 
ATOM   2246 C C     . CYS B 2 244 ? 67.653 6.840   -13.107 1.00 27.44  ? 245 CYS A C     1 
ATOM   2247 O O     . CYS B 2 244 ? 67.315 7.545   -12.135 1.00 24.77  ? 245 CYS A O     1 
ATOM   2248 C CB    . CYS B 2 244 ? 69.628 5.446   -12.188 1.00 32.43  ? 245 CYS A CB    1 
ATOM   2249 S SG    . CYS B 2 244 ? 68.696 3.859   -12.006 1.00 38.48  ? 245 CYS A SG    1 
ATOM   2250 N N     . GLY B 2 245 ? 66.802 6.416   -14.045 1.00 18.35  ? 246 GLY A N     1 
ATOM   2251 C CA    . GLY B 2 245 ? 65.349 6.692   -14.120 1.00 14.73  ? 246 GLY A CA    1 
ATOM   2252 C C     . GLY B 2 245 ? 64.597 6.782   -12.830 1.00 19.22  ? 246 GLY A C     1 
ATOM   2253 O O     . GLY B 2 245 ? 63.709 7.603   -12.718 1.00 26.94  ? 246 GLY A O     1 
ATOM   2254 N N     . GLY B 2 246 ? 64.961 5.963   -11.845 1.00 15.97  ? 247 GLY A N     1 
ATOM   2255 C CA    . GLY B 2 246 ? 64.343 5.983   -10.530 1.00 15.58  ? 247 GLY A CA    1 
ATOM   2256 C C     . GLY B 2 246 ? 65.198 5.406   -9.362  1.00 19.71  ? 247 GLY A C     1 
ATOM   2257 O O     . GLY B 2 246 ? 66.061 4.533   -9.535  1.00 16.36  ? 247 GLY A O     1 
ATOM   2258 N N     . ASP B 2 247 ? 64.903 5.876   -8.155  1.00 11.02  ? 248 ASP A N     1 
ATOM   2259 C CA    . ASP B 2 247 ? 65.632 5.412   -7.016  1.00 6.84   ? 248 ASP A CA    1 
ATOM   2260 C C     . ASP B 2 247 ? 65.752 3.931   -6.722  1.00 25.80  ? 248 ASP A C     1 
ATOM   2261 O O     . ASP B 2 247 ? 66.772 3.459   -6.220  1.00 30.10  ? 248 ASP A O     1 
ATOM   2262 C CB    . ASP B 2 247 ? 65.313 6.173   -5.763  1.00 6.88   ? 248 ASP A CB    1 
ATOM   2263 C CG    . ASP B 2 247 ? 65.598 7.657   -5.862  1.00 20.03  ? 248 ASP A CG    1 
ATOM   2264 O OD1   . ASP B 2 247 ? 66.008 8.101   -6.948  1.00 21.49  ? 248 ASP A OD1   1 
ATOM   2265 O OD2   . ASP B 2 247 ? 65.450 8.369   -4.815  1.00 22.13  ? 248 ASP A OD2   1 
ATOM   2266 N N     . ILE B 2 248 ? 64.726 3.163   -7.002  1.00 28.03  ? 249 ILE A N     1 
ATOM   2267 C CA    . ILE B 2 248 ? 64.867 1.755   -6.671  1.00 20.22  ? 249 ILE A CA    1 
ATOM   2268 C C     . ILE B 2 248 ? 65.716 0.996   -7.626  1.00 18.77  ? 249 ILE A C     1 
ATOM   2269 O O     . ILE B 2 248 ? 66.483 0.095   -7.225  1.00 19.19  ? 249 ILE A O     1 
ATOM   2270 C CB    . ILE B 2 248 ? 63.571 1.097   -6.340  1.00 16.42  ? 249 ILE A CB    1 
ATOM   2271 C CG1   . ILE B 2 248 ? 62.931 1.842   -5.169  1.00 14.53  ? 249 ILE A CG1   1 
ATOM   2272 C CG2   . ILE B 2 248 ? 63.754 -0.384  -6.070  1.00 19.02  ? 249 ILE A CG2   1 
ATOM   2273 C CD1   . ILE B 2 248 ? 62.973 1.127   -3.849  1.00 6.60   ? 249 ILE A CD1   1 
ATOM   2274 N N     . MET B 2 249 ? 65.585 1.352   -8.886  1.00 11.67  ? 250 MET A N     1 
ATOM   2275 C CA    . MET B 2 249 ? 66.382 0.732   -9.950  1.00 12.14  ? 250 MET A CA    1 
ATOM   2276 C C     . MET B 2 249 ? 67.838 1.244   -9.588  1.00 32.49  ? 250 MET A C     1 
ATOM   2277 O O     . MET B 2 249 ? 68.848 0.568   -9.786  1.00 24.01  ? 250 MET A O     1 
ATOM   2278 C CB    . MET B 2 249 ? 66.000 1.398   -11.299 1.00 9.40   ? 250 MET A CB    1 
ATOM   2279 C CG    . MET B 2 249 ? 65.233 0.584   -12.247 1.00 14.05  ? 250 MET A CG    1 
ATOM   2280 S SD    . MET B 2 249 ? 65.068 1.362   -13.926 1.00 27.20  ? 250 MET A SD    1 
ATOM   2281 C CE    . MET B 2 249 ? 65.351 3.099   -13.581 1.00 24.64  ? 250 MET A CE    1 
ATOM   2282 N N     . ALA B 2 250 ? 67.926 2.466   -9.064  1.00 34.09  ? 251 ALA A N     1 
ATOM   2283 C CA    . ALA B 2 250 ? 69.240 3.009   -8.776  1.00 32.93  ? 251 ALA A CA    1 
ATOM   2284 C C     . ALA B 2 250 ? 69.910 2.188   -7.776  1.00 33.31  ? 251 ALA A C     1 
ATOM   2285 O O     . ALA B 2 250 ? 71.068 1.842   -7.905  1.00 44.64  ? 251 ALA A O     1 
ATOM   2286 C CB    . ALA B 2 250 ? 69.146 4.420   -8.252  1.00 33.26  ? 251 ALA A CB    1 
ATOM   2287 N N     . MET B 2 251 ? 69.173 1.920   -6.733  1.00 22.50  ? 252 MET A N     1 
ATOM   2288 C CA    . MET B 2 251 ? 69.744 1.170   -5.680  1.00 22.69  ? 252 MET A CA    1 
ATOM   2289 C C     . MET B 2 251 ? 70.181 -0.158  -6.288  1.00 33.65  ? 252 MET A C     1 
ATOM   2290 O O     . MET B 2 251 ? 70.972 -0.871  -5.728  1.00 38.37  ? 252 MET A O     1 
ATOM   2291 C CB    . MET B 2 251 ? 68.773 0.998   -4.501  1.00 22.77  ? 252 MET A CB    1 
ATOM   2292 C CG    . MET B 2 251 ? 68.015 -0.316  -4.492  1.00 29.88  ? 252 MET A CG    1 
ATOM   2293 S SD    . MET B 2 251 ? 67.823 -1.083  -2.817  1.00 42.77  ? 252 MET A SD    1 
ATOM   2294 C CE    . MET B 2 251 ? 67.684 0.311   -1.793  1.00 43.75  ? 252 MET A CE    1 
ATOM   2295 N N     . GLY B 2 252 ? 69.711 -0.490  -7.466  1.00 27.59  ? 253 GLY A N     1 
ATOM   2296 C CA    . GLY B 2 252 ? 70.162 -1.773  -8.007  1.00 31.03  ? 253 GLY A CA    1 
ATOM   2297 C C     . GLY B 2 252 ? 71.413 -1.637  -8.867  1.00 38.71  ? 253 GLY A C     1 
ATOM   2298 O O     . GLY B 2 252 ? 72.035 -2.622  -9.244  1.00 38.32  ? 253 GLY A O     1 
ATOM   2299 N N     . ALA B 2 253 ? 71.728 -0.393  -9.179  1.00 36.39  ? 254 ALA A N     1 
ATOM   2300 C CA    . ALA B 2 253 ? 72.849 -0.025  -9.982  1.00 35.67  ? 254 ALA A CA    1 
ATOM   2301 C C     . ALA B 2 253 ? 74.042 0.052   -9.018  1.00 35.82  ? 254 ALA A C     1 
ATOM   2302 O O     . ALA B 2 253 ? 75.182 -0.295  -9.389  1.00 29.78  ? 254 ALA A O     1 
ATOM   2303 C CB    . ALA B 2 253 ? 72.580 1.302   -10.605 1.00 36.08  ? 254 ALA A CB    1 
ATOM   2304 N N     . LEU B 2 254 ? 73.771 0.489   -7.779  1.00 18.64  ? 255 LEU A N     1 
ATOM   2305 C CA    . LEU B 2 254 ? 74.838 0.564   -6.792  1.00 9.24   ? 255 LEU A CA    1 
ATOM   2306 C C     . LEU B 2 254 ? 75.336 -0.863  -6.486  1.00 33.55  ? 255 LEU A C     1 
ATOM   2307 O O     . LEU B 2 254 ? 76.534 -1.125  -6.503  1.00 44.41  ? 255 LEU A O     1 
ATOM   2308 C CB    . LEU B 2 254 ? 74.317 1.170   -5.527  1.00 9.65   ? 255 LEU A CB    1 
ATOM   2309 C CG    . LEU B 2 254 ? 74.530 2.670   -5.292  1.00 17.87  ? 255 LEU A CG    1 
ATOM   2310 C CD1   . LEU B 2 254 ? 74.792 3.419   -6.611  1.00 13.74  ? 255 LEU A CD1   1 
ATOM   2311 C CD2   . LEU B 2 254 ? 73.248 3.146   -4.648  1.00 29.87  ? 255 LEU A CD2   1 
ATOM   2312 N N     . CYS B 2 255 ? 74.426 -1.800  -6.257  1.00 37.20  ? 256 CYS A N     1 
ATOM   2313 C CA    . CYS B 2 255 ? 74.813 -3.190  -5.998  1.00 40.28  ? 256 CYS A CA    1 
ATOM   2314 C C     . CYS B 2 255 ? 75.836 -3.751  -7.030  1.00 42.51  ? 256 CYS A C     1 
ATOM   2315 O O     . CYS B 2 255 ? 76.942 -4.184  -6.665  1.00 37.56  ? 256 CYS A O     1 
ATOM   2316 C CB    . CYS B 2 255 ? 73.571 -4.090  -5.998  1.00 40.61  ? 256 CYS A CB    1 
ATOM   2317 S SG    . CYS B 2 255 ? 73.722 -5.712  -5.155  1.00 44.20  ? 256 CYS A SG    1 
ATOM   2318 N N     . ALA B 2 256 ? 75.445 -3.737  -8.303  1.00 35.74  ? 257 ALA A N     1 
ATOM   2319 C CA    . ALA B 2 256 ? 76.277 -4.232  -9.390  1.00 35.20  ? 257 ALA A CA    1 
ATOM   2320 C C     . ALA B 2 256 ? 77.693 -3.642  -9.415  1.00 40.71  ? 257 ALA A C     1 
ATOM   2321 O O     . ALA B 2 256 ? 78.686 -4.370  -9.551  1.00 45.13  ? 257 ALA A O     1 
ATOM   2322 C CB    . ALA B 2 256 ? 75.594 -3.973  -10.730 1.00 34.39  ? 257 ALA A CB    1 
ATOM   2323 N N     . ALA B 2 257 ? 77.758 -2.318  -9.316  1.00 29.25  ? 258 ALA A N     1 
ATOM   2324 C CA    . ALA B 2 257 ? 78.995 -1.581  -9.342  1.00 24.95  ? 258 ALA A CA    1 
ATOM   2325 C C     . ALA B 2 257 ? 79.783 -2.110  -8.153  1.00 32.84  ? 258 ALA A C     1 
ATOM   2326 O O     . ALA B 2 257 ? 80.955 -2.467  -8.259  1.00 31.07  ? 258 ALA A O     1 
ATOM   2327 C CB    . ALA B 2 257 ? 78.692 -0.122  -9.180  1.00 24.01  ? 258 ALA A CB    1 
ATOM   2328 N N     . ASP B 2 258 ? 79.130 -2.207  -7.012  1.00 28.75  ? 259 ASP A N     1 
ATOM   2329 C CA    . ASP B 2 258 ? 79.843 -2.719  -5.871  1.00 28.15  ? 259 ASP A CA    1 
ATOM   2330 C C     . ASP B 2 258 ? 80.149 -4.166  -6.086  1.00 32.63  ? 259 ASP A C     1 
ATOM   2331 O O     . ASP B 2 258 ? 80.916 -4.745  -5.368  1.00 34.06  ? 259 ASP A O     1 
ATOM   2332 C CB    . ASP B 2 258 ? 79.006 -2.581  -4.645  1.00 33.15  ? 259 ASP A CB    1 
ATOM   2333 C CG    . ASP B 2 258 ? 79.578 -3.309  -3.448  1.00 45.62  ? 259 ASP A CG    1 
ATOM   2334 O OD1   . ASP B 2 258 ? 79.250 -4.527  -3.277  1.00 63.50  ? 259 ASP A OD1   1 
ATOM   2335 O OD2   . ASP B 2 258 ? 80.255 -2.625  -2.625  1.00 35.78  ? 259 ASP A OD2   1 
ATOM   2336 N N     . GLU B 2 259 ? 79.565 -4.792  -7.076  1.00 34.65  ? 260 GLU A N     1 
ATOM   2337 C CA    . GLU B 2 259 ? 79.921 -6.187  -7.234  1.00 40.24  ? 260 GLU A CA    1 
ATOM   2338 C C     . GLU B 2 259 ? 81.109 -6.421  -8.178  1.00 55.97  ? 260 GLU A C     1 
ATOM   2339 O O     . GLU B 2 259 ? 81.804 -7.425  -8.073  1.00 63.02  ? 260 GLU A O     1 
ATOM   2340 C CB    . GLU B 2 259 ? 78.736 -7.195  -7.227  1.00 40.46  ? 260 GLU A CB    1 
ATOM   2341 C CG    . GLU B 2 259 ? 77.737 -6.939  -6.049  1.00 58.81  ? 260 GLU A CG    1 
ATOM   2342 C CD    . GLU B 2 259 ? 76.709 -8.061  -5.783  1.00 82.48  ? 260 GLU A CD    1 
ATOM   2343 O OE1   . GLU B 2 259 ? 76.330 -8.742  -6.747  1.00 36.25  ? 260 GLU A OE1   1 
ATOM   2344 O OE2   . GLU B 2 259 ? 76.256 -8.234  -4.607  1.00 62.04  ? 260 GLU A OE2   1 
ATOM   2345 N N     . MET B 2 260 ? 81.376 -5.461  -9.058  1.00 48.60  ? 261 MET A N     1 
ATOM   2346 C CA    . MET B 2 260 ? 82.519 -5.558  -9.949  1.00 45.97  ? 261 MET A CA    1 
ATOM   2347 C C     . MET B 2 260 ? 83.527 -4.623  -9.281  1.00 38.35  ? 261 MET A C     1 
ATOM   2348 O O     . MET B 2 260 ? 84.373 -3.956  -9.899  1.00 34.68  ? 261 MET A O     1 
ATOM   2349 C CB    . MET B 2 260 ? 82.173 -5.024  -11.308 1.00 51.15  ? 261 MET A CB    1 
ATOM   2350 C CG    . MET B 2 260 ? 80.837 -4.362  -11.392 1.00 57.45  ? 261 MET A CG    1 
ATOM   2351 S SD    . MET B 2 260 ? 79.910 -5.162  -12.710 1.00 63.76  ? 261 MET A SD    1 
ATOM   2352 C CE    . MET B 2 260 ? 80.605 -4.324  -14.227 1.00 57.42  ? 261 MET A CE    1 
ATOM   2353 N N     . GLY B 2 261 ? 83.387 -4.548  -7.977  1.00 28.42  ? 262 GLY A N     1 
ATOM   2354 C CA    . GLY B 2 261 ? 84.257 -3.727  -7.177  1.00 24.89  ? 262 GLY A CA    1 
ATOM   2355 C C     . GLY B 2 261 ? 84.498 -2.335  -7.695  1.00 34.74  ? 262 GLY A C     1 
ATOM   2356 O O     . GLY B 2 261 ? 85.579 -1.819  -7.490  1.00 35.12  ? 262 GLY A O     1 
ATOM   2357 N N     . LEU B 2 262 ? 83.503 -1.713  -8.345  1.00 34.65  ? 263 LEU A N     1 
ATOM   2358 C CA    . LEU B 2 262 ? 83.627 -0.326  -8.818  1.00 28.72  ? 263 LEU A CA    1 
ATOM   2359 C C     . LEU B 2 262 ? 83.324 0.571   -7.646  1.00 33.41  ? 263 LEU A C     1 
ATOM   2360 O O     . LEU B 2 262 ? 82.814 0.125   -6.646  1.00 44.00  ? 263 LEU A O     1 
ATOM   2361 C CB    . LEU B 2 262 ? 82.707 -0.023  -9.941  1.00 29.47  ? 263 LEU A CB    1 
ATOM   2362 C CG    . LEU B 2 262 ? 83.649 0.028   -11.112 1.00 30.07  ? 263 LEU A CG    1 
ATOM   2363 C CD1   . LEU B 2 262 ? 84.740 -0.817  -10.615 1.00 28.58  ? 263 LEU A CD1   1 
ATOM   2364 C CD2   . LEU B 2 262 ? 83.009 -0.644  -12.290 1.00 35.53  ? 263 LEU A CD2   1 
ATOM   2365 N N     . ARG B 2 263 ? 83.653 1.838   -7.711  1.00 31.38  ? 264 ARG A N     1 
ATOM   2366 C CA    . ARG B 2 263 ? 83.419 2.664   -6.541  1.00 30.45  ? 264 ARG A CA    1 
ATOM   2367 C C     . ARG B 2 263 ? 82.483 3.805   -6.713  1.00 39.04  ? 264 ARG A C     1 
ATOM   2368 O O     . ARG B 2 263 ? 82.628 4.572   -7.636  1.00 36.45  ? 264 ARG A O     1 
ATOM   2369 C CB    . ARG B 2 263 ? 84.718 3.188   -6.050  1.00 34.96  ? 264 ARG A CB    1 
ATOM   2370 C CG    . ARG B 2 263 ? 84.999 2.628   -4.712  1.00 70.43  ? 264 ARG A CG    1 
ATOM   2371 C CD    . ARG B 2 263 ? 83.874 2.981   -3.746  1.00 95.99  ? 264 ARG A CD    1 
ATOM   2372 N NE    . ARG B 2 263 ? 84.404 3.562   -2.504  1.00 100.00 ? 264 ARG A NE    1 
ATOM   2373 C CZ    . ARG B 2 263 ? 83.689 3.830   -1.400  1.00 100.00 ? 264 ARG A CZ    1 
ATOM   2374 N NH1   . ARG B 2 263 ? 82.367 3.574   -1.345  1.00 100.00 ? 264 ARG A NH1   1 
ATOM   2375 N NH2   . ARG B 2 263 ? 84.304 4.369   -0.336  1.00 100.00 ? 264 ARG A NH2   1 
ATOM   2376 N N     . VAL B 2 264 ? 81.497 3.937   -5.838  1.00 33.48  ? 265 VAL A N     1 
ATOM   2377 C CA    . VAL B 2 264 ? 80.588 5.053   -6.020  1.00 26.31  ? 265 VAL A CA    1 
ATOM   2378 C C     . VAL B 2 264 ? 80.750 5.965   -4.828  1.00 27.62  ? 265 VAL A C     1 
ATOM   2379 O O     . VAL B 2 264 ? 80.723 5.550   -3.653  1.00 33.65  ? 265 VAL A O     1 
ATOM   2380 C CB    . VAL B 2 264 ? 79.117 4.618   -6.313  1.00 33.00  ? 265 VAL A CB    1 
ATOM   2381 C CG1   . VAL B 2 264 ? 78.234 5.847   -6.587  1.00 35.81  ? 265 VAL A CG1   1 
ATOM   2382 C CG2   . VAL B 2 264 ? 79.034 3.643   -7.509  1.00 31.29  ? 265 VAL A CG2   1 
ATOM   2383 N N     . PRO B 2 265 ? 80.983 7.223   -5.119  1.00 17.79  ? 266 PRO A N     1 
ATOM   2384 C CA    . PRO B 2 265 ? 81.020 7.733   -6.483  1.00 18.47  ? 266 PRO A CA    1 
ATOM   2385 C C     . PRO B 2 265 ? 82.390 7.757   -7.106  1.00 37.22  ? 266 PRO A C     1 
ATOM   2386 O O     . PRO B 2 265 ? 82.543 8.273   -8.219  1.00 45.38  ? 266 PRO A O     1 
ATOM   2387 C CB    . PRO B 2 265 ? 80.692 9.213   -6.294  1.00 20.06  ? 266 PRO A CB    1 
ATOM   2388 C CG    . PRO B 2 265 ? 81.266 9.548   -4.923  1.00 25.97  ? 266 PRO A CG    1 
ATOM   2389 C CD    . PRO B 2 265 ? 81.168 8.262   -4.092  1.00 19.80  ? 266 PRO A CD    1 
ATOM   2390 N N     . GLN B 2 266 ? 83.387 7.274   -6.391  1.00 28.39  ? 267 GLN A N     1 
ATOM   2391 C CA    . GLN B 2 266 ? 84.718 7.299   -6.918  1.00 29.47  ? 267 GLN A CA    1 
ATOM   2392 C C     . GLN B 2 266 ? 85.040 6.780   -8.306  1.00 35.56  ? 267 GLN A C     1 
ATOM   2393 O O     . GLN B 2 266 ? 85.695 7.458   -9.067  1.00 41.85  ? 267 GLN A O     1 
ATOM   2394 C CB    . GLN B 2 266 ? 85.697 6.971   -5.864  1.00 35.78  ? 267 GLN A CB    1 
ATOM   2395 C CG    . GLN B 2 266 ? 85.443 7.779   -4.588  1.00 61.85  ? 267 GLN A CG    1 
ATOM   2396 C CD    . GLN B 2 266 ? 84.838 6.878   -3.562  1.00 81.94  ? 267 GLN A CD    1 
ATOM   2397 O OE1   . GLN B 2 266 ? 84.254 5.867   -3.953  1.00 46.47  ? 267 GLN A OE1   1 
ATOM   2398 N NE2   . GLN B 2 266 ? 85.051 7.159   -2.262  1.00 96.97  ? 267 GLN A NE2   1 
ATOM   2399 N N     . ASP B 2 267 ? 84.548 5.620   -8.677  1.00 29.54  ? 268 ASP A N     1 
ATOM   2400 C CA    . ASP B 2 267 ? 84.740 5.105   -10.023 1.00 29.39  ? 268 ASP A CA    1 
ATOM   2401 C C     . ASP B 2 267 ? 83.565 5.464   -10.928 1.00 40.00  ? 268 ASP A C     1 
ATOM   2402 O O     . ASP B 2 267 ? 83.757 5.548   -12.142 1.00 45.16  ? 268 ASP A O     1 
ATOM   2403 C CB    . ASP B 2 267 ? 85.010 3.596   -10.040 1.00 31.19  ? 268 ASP A CB    1 
ATOM   2404 C CG    . ASP B 2 267 ? 86.180 3.242   -9.154  1.00 57.37  ? 268 ASP A CG    1 
ATOM   2405 O OD1   . ASP B 2 267 ? 87.055 4.129   -9.029  1.00 77.07  ? 268 ASP A OD1   1 
ATOM   2406 O OD2   . ASP B 2 267 ? 86.178 2.189   -8.474  1.00 40.35  ? 268 ASP A OD2   1 
ATOM   2407 N N     . VAL B 2 268 ? 82.349 5.649   -10.366 1.00 34.68  ? 269 VAL A N     1 
ATOM   2408 C CA    . VAL B 2 268 ? 81.103 6.011   -11.130 1.00 26.73  ? 269 VAL A CA    1 
ATOM   2409 C C     . VAL B 2 268 ? 80.223 6.839   -10.263 1.00 33.22  ? 269 VAL A C     1 
ATOM   2410 O O     . VAL B 2 268 ? 80.048 6.528   -9.080  1.00 36.57  ? 269 VAL A O     1 
ATOM   2411 C CB    . VAL B 2 268 ? 80.150 4.864   -11.394 1.00 25.95  ? 269 VAL A CB    1 
ATOM   2412 C CG1   . VAL B 2 268 ? 80.124 4.460   -12.826 1.00 28.39  ? 269 VAL A CG1   1 
ATOM   2413 C CG2   . VAL B 2 268 ? 80.346 3.715   -10.447 1.00 25.46  ? 269 VAL A CG2   1 
ATOM   2414 N N     . SER B 2 269 ? 79.649 7.888   -10.837 1.00 33.94  ? 270 SER A N     1 
ATOM   2415 C CA    . SER B 2 269 ? 78.754 8.757   -10.058 1.00 31.23  ? 270 SER A CA    1 
ATOM   2416 C C     . SER B 2 269 ? 77.359 8.373   -10.490 1.00 30.14  ? 270 SER A C     1 
ATOM   2417 O O     . SER B 2 269 ? 77.090 8.006   -11.650 1.00 27.44  ? 270 SER A O     1 
ATOM   2418 C CB    . SER B 2 269 ? 79.077 10.265  -10.195 1.00 34.63  ? 270 SER A CB    1 
ATOM   2419 O OG    . SER B 2 269 ? 80.499 10.542  -10.301 1.00 54.25  ? 270 SER A OG    1 
ATOM   2420 N N     . LEU B 2 270 ? 76.459 8.397   -9.549  1.00 30.69  ? 271 LEU A N     1 
ATOM   2421 C CA    . LEU B 2 270 ? 75.100 8.015   -9.890  1.00 34.16  ? 271 LEU A CA    1 
ATOM   2422 C C     . LEU B 2 270 ? 74.095 9.083   -9.510  1.00 34.69  ? 271 LEU A C     1 
ATOM   2423 O O     . LEU B 2 270 ? 74.025 9.530   -8.332  1.00 28.60  ? 271 LEU A O     1 
ATOM   2424 C CB    . LEU B 2 270 ? 74.707 6.745   -9.080  1.00 32.44  ? 271 LEU A CB    1 
ATOM   2425 C CG    . LEU B 2 270 ? 73.663 5.852   -9.703  1.00 30.34  ? 271 LEU A CG    1 
ATOM   2426 C CD1   . LEU B 2 270 ? 73.633 6.264   -11.126 1.00 33.13  ? 271 LEU A CD1   1 
ATOM   2427 C CD2   . LEU B 2 270 ? 74.040 4.390   -9.638  1.00 33.33  ? 271 LEU A CD2   1 
ATOM   2428 N N     . ILE B 2 271 ? 73.259 9.466   -10.445 1.00 27.47  ? 272 ILE A N     1 
ATOM   2429 C CA    . ILE B 2 271 ? 72.240 10.408  -9.995  1.00 27.12  ? 272 ILE A CA    1 
ATOM   2430 C C     . ILE B 2 271 ? 70.911 9.688   -10.169 1.00 36.59  ? 272 ILE A C     1 
ATOM   2431 O O     . ILE B 2 271 ? 70.632 9.069   -11.236 1.00 36.56  ? 272 ILE A O     1 
ATOM   2432 C CB    . ILE B 2 271 ? 72.271 11.730  -10.661 1.00 29.91  ? 272 ILE A CB    1 
ATOM   2433 C CG1   . ILE B 2 271 ? 71.210 12.561  -9.986  1.00 31.12  ? 272 ILE A CG1   1 
ATOM   2434 C CG2   . ILE B 2 271 ? 72.178 11.601  -12.194 1.00 26.43  ? 272 ILE A CG2   1 
ATOM   2435 C CD1   . ILE B 2 271 ? 70.935 13.829  -10.668 1.00 23.47  ? 272 ILE A CD1   1 
ATOM   2436 N N     . GLY B 2 272 ? 70.098 9.688   -9.122  1.00 34.69  ? 273 GLY A N     1 
ATOM   2437 C CA    . GLY B 2 272 ? 68.822 8.953   -9.225  1.00 33.37  ? 273 GLY A CA    1 
ATOM   2438 C C     . GLY B 2 272 ? 67.573 9.784   -9.491  1.00 26.90  ? 273 GLY A C     1 
ATOM   2439 O O     . GLY B 2 272 ? 67.606 10.943  -9.904  1.00 18.80  ? 273 GLY A O     1 
ATOM   2440 N N     . TYR B 2 273 ? 66.432 9.185   -9.235  1.00 27.47  ? 274 TYR A N     1 
ATOM   2441 C CA    . TYR B 2 273 ? 65.197 9.919   -9.436  1.00 22.59  ? 274 TYR A CA    1 
ATOM   2442 C C     . TYR B 2 273 ? 64.027 9.391   -8.724  1.00 23.13  ? 274 TYR A C     1 
ATOM   2443 O O     . TYR B 2 273 ? 63.598 8.273   -9.043  1.00 19.78  ? 274 TYR A O     1 
ATOM   2444 C CB    . TYR B 2 273 ? 64.812 9.918   -10.892 1.00 22.86  ? 274 TYR A CB    1 
ATOM   2445 C CG    . TYR B 2 273 ? 63.974 11.097  -11.198 1.00 28.43  ? 274 TYR A CG    1 
ATOM   2446 C CD1   . TYR B 2 273 ? 62.959 11.466  -10.344 1.00 29.18  ? 274 TYR A CD1   1 
ATOM   2447 C CD2   . TYR B 2 273 ? 64.209 11.889  -12.326 1.00 27.71  ? 274 TYR A CD2   1 
ATOM   2448 C CE1   . TYR B 2 273 ? 62.151 12.524  -10.613 1.00 35.28  ? 274 TYR A CE1   1 
ATOM   2449 C CE2   . TYR B 2 273 ? 63.398 12.990  -12.610 1.00 29.02  ? 274 TYR A CE2   1 
ATOM   2450 C CZ    . TYR B 2 273 ? 62.353 13.291  -11.739 1.00 39.87  ? 274 TYR A CZ    1 
ATOM   2451 O OH    . TYR B 2 273 ? 61.500 14.387  -11.914 1.00 16.05  ? 274 TYR A OH    1 
ATOM   2452 N N     . ASP B 2 274 ? 63.495 10.251  -7.832  1.00 20.48  ? 275 ASP A N     1 
ATOM   2453 C CA    . ASP B 2 274 ? 62.278 10.058  -7.005  1.00 20.47  ? 275 ASP A CA    1 
ATOM   2454 C C     . ASP B 2 274 ? 62.326 10.654  -5.603  1.00 33.48  ? 275 ASP A C     1 
ATOM   2455 O O     . ASP B 2 274 ? 61.409 11.343  -5.117  1.00 37.27  ? 275 ASP A O     1 
ATOM   2456 C CB    . ASP B 2 274 ? 61.896 8.580   -6.859  1.00 21.04  ? 275 ASP A CB    1 
ATOM   2457 C CG    . ASP B 2 274 ? 61.063 8.059   -8.027  1.00 24.09  ? 275 ASP A CG    1 
ATOM   2458 O OD1   . ASP B 2 274 ? 60.848 8.823   -8.987  1.00 14.98  ? 275 ASP A OD1   1 
ATOM   2459 O OD2   . ASP B 2 274 ? 60.746 6.839   -8.080  1.00 39.15  ? 275 ASP A OD2   1 
ATOM   2460 N N     . ASN B 2 275 ? 63.416 10.338  -4.938  1.00 25.12  ? 276 ASN A N     1 
ATOM   2461 C CA    . ASN B 2 275 ? 63.636 10.709  -3.569  1.00 18.65  ? 276 ASN A CA    1 
ATOM   2462 C C     . ASN B 2 275 ? 62.740 9.933   -2.660  1.00 22.09  ? 276 ASN A C     1 
ATOM   2463 O O     . ASN B 2 275 ? 62.050 10.454  -1.819  1.00 31.22  ? 276 ASN A O     1 
ATOM   2464 C CB    . ASN B 2 275 ? 63.635 12.170  -3.229  1.00 15.25  ? 276 ASN A CB    1 
ATOM   2465 C CG    . ASN B 2 275 ? 64.179 12.393  -1.835  1.00 38.53  ? 276 ASN A CG    1 
ATOM   2466 O OD1   . ASN B 2 275 ? 65.166 11.799  -1.473  1.00 41.11  ? 276 ASN A OD1   1 
ATOM   2467 N ND2   . ASN B 2 275 ? 63.431 13.051  -1.005  1.00 33.09  ? 276 ASN A ND2   1 
ATOM   2468 N N     . VAL B 2 276 ? 62.819 8.633   -2.799  1.00 20.90  ? 277 VAL A N     1 
ATOM   2469 C CA    . VAL B 2 276 ? 62.071 7.730   -1.961  1.00 15.63  ? 277 VAL A CA    1 
ATOM   2470 C C     . VAL B 2 276 ? 62.489 7.811   -0.522  1.00 18.55  ? 277 VAL A C     1 
ATOM   2471 O O     . VAL B 2 276 ? 63.606 8.086   -0.206  1.00 26.80  ? 277 VAL A O     1 
ATOM   2472 C CB    . VAL B 2 276 ? 62.275 6.319   -2.432  1.00 21.51  ? 277 VAL A CB    1 
ATOM   2473 C CG1   . VAL B 2 276 ? 62.036 5.329   -1.252  1.00 33.62  ? 277 VAL A CG1   1 
ATOM   2474 C CG2   . VAL B 2 276 ? 61.361 6.052   -3.588  1.00 12.83  ? 277 VAL A CG2   1 
ATOM   2475 N N     . ARG B 2 277 ? 61.569 7.524   0.367   1.00 25.72  ? 278 ARG A N     1 
ATOM   2476 C CA    . ARG B 2 277 ? 61.855 7.553   1.775   1.00 26.64  ? 278 ARG A CA    1 
ATOM   2477 C C     . ARG B 2 277 ? 63.195 7.010   2.279   1.00 33.33  ? 278 ARG A C     1 
ATOM   2478 O O     . ARG B 2 277 ? 63.687 7.491   3.275   1.00 36.94  ? 278 ARG A O     1 
ATOM   2479 C CB    . ARG B 2 277 ? 60.704 6.943   2.530   1.00 29.53  ? 278 ARG A CB    1 
ATOM   2480 C CG    . ARG B 2 277 ? 59.983 7.929   3.365   1.00 36.70  ? 278 ARG A CG    1 
ATOM   2481 C CD    . ARG B 2 277 ? 59.389 7.309   4.631   1.00 65.13  ? 278 ARG A CD    1 
ATOM   2482 N NE    . ARG B 2 277 ? 58.017 6.871   4.373   1.00 100.00 ? 278 ARG A NE    1 
ATOM   2483 C CZ    . ARG B 2 277 ? 57.021 7.659   3.953   1.00 100.00 ? 278 ARG A CZ    1 
ATOM   2484 N NH1   . ARG B 2 277 ? 57.207 8.967   3.736   1.00 57.97  ? 278 ARG A NH1   1 
ATOM   2485 N NH2   . ARG B 2 277 ? 55.817 7.135   3.750   1.00 100.00 ? 278 ARG A NH2   1 
ATOM   2486 N N     . ASN B 2 278 ? 63.804 6.032   1.624   1.00 33.18  ? 279 ASN A N     1 
ATOM   2487 C CA    . ASN B 2 278 ? 65.101 5.526   2.119   1.00 38.75  ? 279 ASN A CA    1 
ATOM   2488 C C     . ASN B 2 278 ? 66.341 5.794   1.279   1.00 49.92  ? 279 ASN A C     1 
ATOM   2489 O O     . ASN B 2 278 ? 67.427 5.239   1.565   1.00 47.56  ? 279 ASN A O     1 
ATOM   2490 C CB    . ASN B 2 278 ? 65.161 4.024   2.223   1.00 47.77  ? 279 ASN A CB    1 
ATOM   2491 C CG    . ASN B 2 278 ? 63.868 3.396   2.416   1.00 63.08  ? 279 ASN A CG    1 
ATOM   2492 O OD1   . ASN B 2 278 ? 63.446 3.243   3.559   1.00 34.90  ? 279 ASN A OD1   1 
ATOM   2493 N ND2   . ASN B 2 278 ? 63.364 2.758   1.348   1.00 57.82  ? 279 ASN A ND2   1 
ATOM   2494 N N     . ALA B 2 279 ? 66.202 6.572   0.223   1.00 46.39  ? 280 ALA A N     1 
ATOM   2495 C CA    . ALA B 2 279 ? 67.362 6.818   -0.595  1.00 43.32  ? 280 ALA A CA    1 
ATOM   2496 C C     . ALA B 2 279 ? 68.480 7.438   0.251   1.00 36.64  ? 280 ALA A C     1 
ATOM   2497 O O     . ALA B 2 279 ? 69.658 7.176   0.027   1.00 34.94  ? 280 ALA A O     1 
ATOM   2498 C CB    . ALA B 2 279 ? 66.996 7.657   -1.742  1.00 44.98  ? 280 ALA A CB    1 
ATOM   2499 N N     . ARG B 2 280 ? 68.133 8.224   1.258   1.00 27.41  ? 281 ARG A N     1 
ATOM   2500 C CA    . ARG B 2 280 ? 69.209 8.778   2.085   1.00 27.74  ? 281 ARG A CA    1 
ATOM   2501 C C     . ARG B 2 280 ? 69.959 7.686   2.794   1.00 32.09  ? 281 ARG A C     1 
ATOM   2502 O O     . ARG B 2 280 ? 71.075 7.867   3.238   1.00 36.46  ? 281 ARG A O     1 
ATOM   2503 C CB    . ARG B 2 280 ? 68.718 9.723   3.150   1.00 27.67  ? 281 ARG A CB    1 
ATOM   2504 C CG    . ARG B 2 280 ? 69.814 10.145  4.086   1.00 39.90  ? 281 ARG A CG    1 
ATOM   2505 C CD    . ARG B 2 280 ? 69.859 9.279   5.324   1.00 61.55  ? 281 ARG A CD    1 
ATOM   2506 N NE    . ARG B 2 280 ? 70.828 9.809   6.279   1.00 69.92  ? 281 ARG A NE    1 
ATOM   2507 C CZ    . ARG B 2 280 ? 72.135 9.750   6.081   1.00 71.39  ? 281 ARG A CZ    1 
ATOM   2508 N NH1   . ARG B 2 280 ? 72.580 9.194   4.983   1.00 35.57  ? 281 ARG A NH1   1 
ATOM   2509 N NH2   . ARG B 2 280 ? 72.984 10.237  6.973   1.00 98.80  ? 281 ARG A NH2   1 
ATOM   2510 N N     . TYR B 2 281 ? 69.332 6.542   2.933   1.00 23.62  ? 282 TYR A N     1 
ATOM   2511 C CA    . TYR B 2 281 ? 70.020 5.523   3.595   1.00 16.77  ? 282 TYR A CA    1 
ATOM   2512 C C     . TYR B 2 281 ? 70.519 4.572   2.611   1.00 23.78  ? 282 TYR A C     1 
ATOM   2513 O O     . TYR B 2 281 ? 70.832 3.455   2.947   1.00 27.04  ? 282 TYR A O     1 
ATOM   2514 C CB    . TYR B 2 281 ? 69.177 4.865   4.604   1.00 18.24  ? 282 TYR A CB    1 
ATOM   2515 C CG    . TYR B 2 281 ? 68.859 5.781   5.672   1.00 20.77  ? 282 TYR A CG    1 
ATOM   2516 C CD1   . TYR B 2 281 ? 69.742 6.069   6.655   1.00 24.61  ? 282 TYR A CD1   1 
ATOM   2517 C CD2   . TYR B 2 281 ? 67.663 6.379   5.695   1.00 27.77  ? 282 TYR A CD2   1 
ATOM   2518 C CE1   . TYR B 2 281 ? 69.395 6.924   7.677   1.00 29.52  ? 282 TYR A CE1   1 
ATOM   2519 C CE2   . TYR B 2 281 ? 67.327 7.264   6.678   1.00 30.91  ? 282 TYR A CE2   1 
ATOM   2520 C CZ    . TYR B 2 281 ? 68.171 7.533   7.648   1.00 32.00  ? 282 TYR A CZ    1 
ATOM   2521 O OH    . TYR B 2 281 ? 67.746 8.438   8.556   1.00 37.49  ? 282 TYR A OH    1 
ATOM   2522 N N     . PHE B 2 282 ? 70.616 5.014   1.375   1.00 24.56  ? 283 PHE A N     1 
ATOM   2523 C CA    . PHE B 2 282 ? 71.196 4.172   0.345   1.00 22.68  ? 283 PHE A CA    1 
ATOM   2524 C C     . PHE B 2 282 ? 72.697 4.258   0.718   1.00 28.77  ? 283 PHE A C     1 
ATOM   2525 O O     . PHE B 2 282 ? 73.095 5.006   1.639   1.00 24.31  ? 283 PHE A O     1 
ATOM   2526 C CB    . PHE B 2 282 ? 70.911 4.759   -1.037  1.00 25.20  ? 283 PHE A CB    1 
ATOM   2527 C CG    . PHE B 2 282 ? 69.609 4.276   -1.625  1.00 27.00  ? 283 PHE A CG    1 
ATOM   2528 C CD1   . PHE B 2 282 ? 68.629 3.760   -0.797  1.00 26.14  ? 283 PHE A CD1   1 
ATOM   2529 C CD2   . PHE B 2 282 ? 69.379 4.305   -2.994  1.00 27.49  ? 283 PHE A CD2   1 
ATOM   2530 C CE1   . PHE B 2 282 ? 67.471 3.292   -1.300  1.00 22.07  ? 283 PHE A CE1   1 
ATOM   2531 C CE2   . PHE B 2 282 ? 68.189 3.857   -3.489  1.00 29.99  ? 283 PHE A CE2   1 
ATOM   2532 C CZ    . PHE B 2 282 ? 67.237 3.332   -2.625  1.00 20.88  ? 283 PHE A CZ    1 
ATOM   2533 N N     . THR B 2 283 ? 73.530 3.493   0.046   1.00 31.55  ? 284 THR A N     1 
ATOM   2534 C CA    . THR B 2 283 ? 74.959 3.476   0.385   1.00 28.32  ? 284 THR A CA    1 
ATOM   2535 C C     . THR B 2 283 ? 75.775 3.491   -0.912  1.00 38.67  ? 284 THR A C     1 
ATOM   2536 O O     . THR B 2 283 ? 75.877 2.473   -1.625  1.00 41.80  ? 284 THR A O     1 
ATOM   2537 C CB    . THR B 2 283 ? 75.240 2.171   1.152   1.00 28.70  ? 284 THR A CB    1 
ATOM   2538 O OG1   . THR B 2 283 ? 75.095 2.343   2.574   1.00 44.15  ? 284 THR A OG1   1 
ATOM   2539 C CG2   . THR B 2 283 ? 76.529 1.586   0.822   1.00 21.01  ? 284 THR A CG2   1 
ATOM   2540 N N     . PRO B 2 284 ? 76.355 4.644   -1.239  1.00 30.54  ? 285 PRO A N     1 
ATOM   2541 C CA    . PRO B 2 284 ? 76.276 5.846   -0.442  1.00 30.00  ? 285 PRO A CA    1 
ATOM   2542 C C     . PRO B 2 284 ? 74.894 6.418   -0.485  1.00 26.85  ? 285 PRO A C     1 
ATOM   2543 O O     . PRO B 2 284 ? 74.053 5.959   -1.250  1.00 23.60  ? 285 PRO A O     1 
ATOM   2544 C CB    . PRO B 2 284 ? 77.201 6.789   -1.198  1.00 30.53  ? 285 PRO A CB    1 
ATOM   2545 C CG    . PRO B 2 284 ? 77.440 6.165   -2.565  1.00 25.40  ? 285 PRO A CG    1 
ATOM   2546 C CD    . PRO B 2 284 ? 76.594 4.961   -2.642  1.00 23.12  ? 285 PRO A CD    1 
ATOM   2547 N N     . ALA B 2 285 ? 74.674 7.428   0.351   1.00 23.24  ? 286 ALA A N     1 
ATOM   2548 C CA    . ALA B 2 285 ? 73.375 8.100   0.420   1.00 16.00  ? 286 ALA A CA    1 
ATOM   2549 C C     . ALA B 2 285 ? 73.240 8.709   -0.954  1.00 26.59  ? 286 ALA A C     1 
ATOM   2550 O O     . ALA B 2 285 ? 74.128 9.423   -1.414  1.00 33.92  ? 286 ALA A O     1 
ATOM   2551 C CB    . ALA B 2 285 ? 73.347 9.141   1.520   1.00 12.25  ? 286 ALA A CB    1 
ATOM   2552 N N     . LEU B 2 286 ? 72.127 8.365   -1.604  1.00 22.04  ? 287 LEU A N     1 
ATOM   2553 C CA    . LEU B 2 286 ? 71.770 8.765   -2.964  1.00 16.70  ? 287 LEU A CA    1 
ATOM   2554 C C     . LEU B 2 286 ? 71.470 10.197  -3.264  1.00 22.35  ? 287 LEU A C     1 
ATOM   2555 O O     . LEU B 2 286 ? 70.764 10.817  -2.587  1.00 30.12  ? 287 LEU A O     1 
ATOM   2556 C CB    . LEU B 2 286 ? 70.578 7.970   -3.458  1.00 14.68  ? 287 LEU A CB    1 
ATOM   2557 C CG    . LEU B 2 286 ? 70.497 8.133   -4.969  1.00 17.58  ? 287 LEU A CG    1 
ATOM   2558 C CD1   . LEU B 2 286 ? 71.626 7.403   -5.553  1.00 15.34  ? 287 LEU A CD1   1 
ATOM   2559 C CD2   . LEU B 2 286 ? 69.237 7.562   -5.492  1.00 26.19  ? 287 LEU A CD2   1 
ATOM   2560 N N     . THR B 2 287 ? 72.004 10.700  -4.337  1.00 26.55  ? 288 THR A N     1 
ATOM   2561 C CA    . THR B 2 287 ? 71.774 12.052  -4.749  1.00 27.57  ? 288 THR A CA    1 
ATOM   2562 C C     . THR B 2 287 ? 70.688 11.820  -5.775  1.00 26.37  ? 288 THR A C     1 
ATOM   2563 O O     . THR B 2 287 ? 70.786 10.926  -6.633  1.00 21.34  ? 288 THR A O     1 
ATOM   2564 C CB    . THR B 2 287 ? 73.035 12.642  -5.435  1.00 20.65  ? 288 THR A CB    1 
ATOM   2565 O OG1   . THR B 2 287 ? 73.865 13.200  -4.430  1.00 32.21  ? 288 THR A OG1   1 
ATOM   2566 C CG2   . THR B 2 287 ? 72.673 13.774  -6.379  1.00 25.12  ? 288 THR A CG2   1 
ATOM   2567 N N     . THR B 2 288 ? 69.640 12.615  -5.724  1.00 29.06  ? 289 THR A N     1 
ATOM   2568 C CA    . THR B 2 288 ? 68.545 12.363  -6.671  1.00 27.90  ? 289 THR A CA    1 
ATOM   2569 C C     . THR B 2 288 ? 67.595 13.499  -6.816  1.00 12.73  ? 289 THR A C     1 
ATOM   2570 O O     . THR B 2 288 ? 67.615 14.448  -6.025  1.00 11.54  ? 289 THR A O     1 
ATOM   2571 C CB    . THR B 2 288 ? 67.665 11.170  -6.084  1.00 21.27  ? 289 THR A CB    1 
ATOM   2572 O OG1   . THR B 2 288 ? 66.720 10.671  -7.030  1.00 15.63  ? 289 THR A OG1   1 
ATOM   2573 C CG2   . THR B 2 288 ? 66.989 11.580  -4.854  1.00 4.97   ? 289 THR A CG2   1 
ATOM   2574 N N     . ILE B 2 289 ? 66.781 13.402  -7.852  1.00 19.17  ? 290 ILE A N     1 
ATOM   2575 C CA    . ILE B 2 289 ? 65.724 14.393  -8.045  1.00 25.30  ? 290 ILE A CA    1 
ATOM   2576 C C     . ILE B 2 289 ? 64.485 13.973  -7.228  1.00 31.42  ? 290 ILE A C     1 
ATOM   2577 O O     . ILE B 2 289 ? 63.972 12.841  -7.364  1.00 33.66  ? 290 ILE A O     1 
ATOM   2578 C CB    . ILE B 2 289 ? 65.252 14.540  -9.438  1.00 26.75  ? 290 ILE A CB    1 
ATOM   2579 C CG1   . ILE B 2 289 ? 66.448 14.933  -10.302 1.00 29.28  ? 290 ILE A CG1   1 
ATOM   2580 C CG2   . ILE B 2 289 ? 64.283 15.671  -9.372  1.00 21.23  ? 290 ILE A CG2   1 
ATOM   2581 C CD1   . ILE B 2 289 ? 67.274 16.000  -9.639  1.00 69.93  ? 290 ILE A CD1   1 
ATOM   2582 N N     . HIS B 2 290 ? 64.024 14.874  -6.373  1.00 23.79  ? 291 HIS A N     1 
ATOM   2583 C CA    . HIS B 2 290 ? 62.869 14.591  -5.532  1.00 19.78  ? 291 HIS A CA    1 
ATOM   2584 C C     . HIS B 2 290 ? 61.547 14.943  -6.145  1.00 16.82  ? 291 HIS A C     1 
ATOM   2585 O O     . HIS B 2 290 ? 61.387 16.067  -6.595  1.00 21.80  ? 291 HIS A O     1 
ATOM   2586 C CB    . HIS B 2 290 ? 62.975 15.420  -4.396  1.00 21.61  ? 291 HIS A CB    1 
ATOM   2587 C CG    . HIS B 2 290 ? 61.725 15.522  -3.619  1.00 27.43  ? 291 HIS A CG    1 
ATOM   2588 N ND1   . HIS B 2 290 ? 61.518 14.775  -2.481  1.00 32.71  ? 291 HIS A ND1   1 
ATOM   2589 C CD2   . HIS B 2 290 ? 60.635 16.296  -3.779  1.00 26.60  ? 291 HIS A CD2   1 
ATOM   2590 C CE1   . HIS B 2 290 ? 60.341 15.080  -1.976  1.00 30.16  ? 291 HIS A CE1   1 
ATOM   2591 N NE2   . HIS B 2 290 ? 59.782 15.988  -2.754  1.00 29.12  ? 291 HIS A NE2   1 
ATOM   2592 N N     . GLN B 2 291 ? 60.604 14.001  -6.137  1.00 14.57  ? 292 GLN A N     1 
ATOM   2593 C CA    . GLN B 2 291 ? 59.226 14.216  -6.642  1.00 15.45  ? 292 GLN A CA    1 
ATOM   2594 C C     . GLN B 2 291 ? 58.391 14.449  -5.412  1.00 22.16  ? 292 GLN A C     1 
ATOM   2595 O O     . GLN B 2 291 ? 58.439 13.684  -4.457  1.00 23.13  ? 292 GLN A O     1 
ATOM   2596 C CB    . GLN B 2 291 ? 58.627 12.965  -7.245  1.00 20.90  ? 292 GLN A CB    1 
ATOM   2597 C CG    . GLN B 2 291 ? 57.177 13.152  -7.652  1.00 36.87  ? 292 GLN A CG    1 
ATOM   2598 C CD    . GLN B 2 291 ? 57.061 13.422  -9.152  1.00 67.50  ? 292 GLN A CD    1 
ATOM   2599 O OE1   . GLN B 2 291 ? 56.574 12.580  -9.898  1.00 33.78  ? 292 GLN A OE1   1 
ATOM   2600 N NE2   . GLN B 2 291 ? 57.561 14.577  -9.597  1.00 76.57  ? 292 GLN A NE2   1 
ATOM   2601 N N     . PRO B 2 292 ? 57.623 15.511  -5.394  1.00 23.31  ? 293 PRO A N     1 
ATOM   2602 C CA    . PRO B 2 292 ? 56.789 15.776  -4.204  1.00 25.27  ? 293 PRO A CA    1 
ATOM   2603 C C     . PRO B 2 292 ? 55.696 14.684  -4.277  1.00 31.09  ? 293 PRO A C     1 
ATOM   2604 O O     . PRO B 2 292 ? 54.746 14.796  -5.023  1.00 21.91  ? 293 PRO A O     1 
ATOM   2605 C CB    . PRO B 2 292 ? 56.285 17.180  -4.467  1.00 22.48  ? 293 PRO A CB    1 
ATOM   2606 C CG    . PRO B 2 292 ? 56.399 17.341  -5.995  1.00 23.96  ? 293 PRO A CG    1 
ATOM   2607 C CD    . PRO B 2 292 ? 57.130 16.195  -6.594  1.00 18.04  ? 293 PRO A CD    1 
ATOM   2608 N N     . LYS B 2 293 ? 55.887 13.573  -3.585  1.00 31.32  ? 294 LYS A N     1 
ATOM   2609 C CA    . LYS B 2 293 ? 54.889 12.533  -3.710  1.00 32.74  ? 294 LYS A CA    1 
ATOM   2610 C C     . LYS B 2 293 ? 53.638 12.872  -2.897  1.00 35.73  ? 294 LYS A C     1 
ATOM   2611 O O     . LYS B 2 293 ? 52.494 12.769  -3.396  1.00 33.07  ? 294 LYS A O     1 
ATOM   2612 C CB    . LYS B 2 293 ? 55.480 11.190  -3.371  1.00 36.01  ? 294 LYS A CB    1 
ATOM   2613 C CG    . LYS B 2 293 ? 56.422 10.630  -4.454  1.00 44.40  ? 294 LYS A CG    1 
ATOM   2614 C CD    . LYS B 2 293 ? 57.593 9.749   -3.845  1.00 22.78  ? 294 LYS A CD    1 
ATOM   2615 C CE    . LYS B 2 293 ? 58.258 10.420  -2.599  1.00 54.38  ? 294 LYS A CE    1 
ATOM   2616 N NZ    . LYS B 2 293 ? 59.444 11.264  -2.893  1.00 40.77  ? 294 LYS A NZ    1 
ATOM   2617 N N     . ASP B 2 294 ? 53.864 13.312  -1.660  1.00 30.21  ? 295 ASP A N     1 
ATOM   2618 C CA    . ASP B 2 294 ? 52.758 13.721  -0.781  1.00 33.86  ? 295 ASP A CA    1 
ATOM   2619 C C     . ASP B 2 294 ? 51.828 14.840  -1.341  1.00 45.12  ? 295 ASP A C     1 
ATOM   2620 O O     . ASP B 2 294 ? 50.618 14.787  -1.234  1.00 42.36  ? 295 ASP A O     1 
ATOM   2621 C CB    . ASP B 2 294 ? 53.241 14.058  0.631   1.00 35.78  ? 295 ASP A CB    1 
ATOM   2622 C CG    . ASP B 2 294 ? 54.763 14.446  0.684   1.00 99.87  ? 295 ASP A CG    1 
ATOM   2623 O OD1   . ASP B 2 294 ? 55.308 15.237  -0.189  1.00 100.00 ? 295 ASP A OD1   1 
ATOM   2624 O OD2   . ASP B 2 294 ? 55.397 13.983  1.677   1.00 100.00 ? 295 ASP A OD2   1 
ATOM   2625 N N     . SER B 2 295 ? 52.408 15.860  -1.939  1.00 46.73  ? 296 SER A N     1 
ATOM   2626 C CA    . SER B 2 295 ? 51.631 16.945  -2.510  1.00 40.59  ? 296 SER A CA    1 
ATOM   2627 C C     . SER B 2 295 ? 51.038 16.358  -3.769  1.00 38.52  ? 296 SER A C     1 
ATOM   2628 O O     . SER B 2 295 ? 50.028 16.824  -4.263  1.00 45.29  ? 296 SER A O     1 
ATOM   2629 C CB    . SER B 2 295 ? 52.578 18.052  -2.903  1.00 43.67  ? 296 SER A CB    1 
ATOM   2630 O OG    . SER B 2 295 ? 53.897 17.543  -2.820  1.00 94.88  ? 296 SER A OG    1 
ATOM   2631 N N     . LEU B 2 296 ? 51.681 15.334  -4.305  1.00 27.12  ? 297 LEU A N     1 
ATOM   2632 C CA    . LEU B 2 296 ? 51.145 14.718  -5.498  1.00 28.01  ? 297 LEU A CA    1 
ATOM   2633 C C     . LEU B 2 296 ? 49.838 14.092  -5.033  1.00 44.76  ? 297 LEU A C     1 
ATOM   2634 O O     . LEU B 2 296 ? 48.789 14.223  -5.666  1.00 48.61  ? 297 LEU A O     1 
ATOM   2635 C CB    . LEU B 2 296 ? 52.036 13.587  -6.047  1.00 27.24  ? 297 LEU A CB    1 
ATOM   2636 C CG    . LEU B 2 296 ? 51.896 13.638  -7.557  1.00 29.83  ? 297 LEU A CG    1 
ATOM   2637 C CD1   . LEU B 2 296 ? 52.737 12.647  -8.199  1.00 18.45  ? 297 LEU A CD1   1 
ATOM   2638 C CD2   . LEU B 2 296 ? 50.462 13.326  -7.885  1.00 41.19  ? 297 LEU A CD2   1 
ATOM   2639 N N     . GLY B 2 297 ? 49.875 13.403  -3.909  1.00 42.01  ? 298 GLY A N     1 
ATOM   2640 C CA    . GLY B 2 297 ? 48.640 12.776  -3.445  1.00 41.47  ? 298 GLY A CA    1 
ATOM   2641 C C     . GLY B 2 297 ? 47.491 13.729  -3.083  1.00 38.11  ? 298 GLY A C     1 
ATOM   2642 O O     . GLY B 2 297 ? 46.418 13.654  -3.670  1.00 39.87  ? 298 GLY A O     1 
ATOM   2643 N N     . GLU B 2 298 ? 47.734 14.589  -2.097  1.00 23.93  ? 299 GLU A N     1 
ATOM   2644 C CA    . GLU B 2 298 ? 46.764 15.520  -1.599  1.00 22.93  ? 299 GLU A CA    1 
ATOM   2645 C C     . GLU B 2 298 ? 46.347 16.438  -2.669  1.00 31.39  ? 299 GLU A C     1 
ATOM   2646 O O     . GLU B 2 298 ? 45.173 16.827  -2.772  1.00 29.89  ? 299 GLU A O     1 
ATOM   2647 C CB    . GLU B 2 298 ? 47.262 16.343  -0.441  1.00 22.03  ? 299 GLU A CB    1 
ATOM   2648 C CG    . GLU B 2 298 ? 47.476 17.789  -0.844  1.00 33.11  ? 299 GLU A CG    1 
ATOM   2649 C CD    . GLU B 2 298 ? 47.689 18.691  0.378   1.00 84.91  ? 299 GLU A CD    1 
ATOM   2650 O OE1   . GLU B 2 298 ? 47.867 18.171  1.513   1.00 55.49  ? 299 GLU A OE1   1 
ATOM   2651 O OE2   . GLU B 2 298 ? 47.637 19.926  0.208   1.00 100.00 ? 299 GLU A OE2   1 
ATOM   2652 N N     . THR B 2 299 ? 47.266 16.817  -3.502  1.00 32.66  ? 300 THR A N     1 
ATOM   2653 C CA    . THR B 2 299 ? 46.756 17.692  -4.543  1.00 38.25  ? 300 THR A CA    1 
ATOM   2654 C C     . THR B 2 299 ? 45.666 16.965  -5.446  1.00 37.25  ? 300 THR A C     1 
ATOM   2655 O O     . THR B 2 299 ? 44.752 17.571  -5.995  1.00 29.26  ? 300 THR A O     1 
ATOM   2656 C CB    . THR B 2 299 ? 47.893 18.456  -5.315  1.00 24.19  ? 300 THR A CB    1 
ATOM   2657 O OG1   . THR B 2 299 ? 48.177 19.685  -4.599  1.00 38.28  ? 300 THR A OG1   1 
ATOM   2658 C CG2   . THR B 2 299 ? 47.433 18.798  -6.775  1.00 12.22  ? 300 THR A CG2   1 
ATOM   2659 N N     . ALA B 2 300 ? 45.773 15.652  -5.557  1.00 34.21  ? 301 ALA A N     1 
ATOM   2660 C CA    . ALA B 2 300 ? 44.838 14.897  -6.377  1.00 34.44  ? 301 ALA A CA    1 
ATOM   2661 C C     . ALA B 2 300 ? 43.464 14.806  -5.712  1.00 38.88  ? 301 ALA A C     1 
ATOM   2662 O O     . ALA B 2 300 ? 42.412 14.922  -6.378  1.00 35.91  ? 301 ALA A O     1 
ATOM   2663 C CB    . ALA B 2 300 ? 45.398 13.436  -6.630  1.00 35.55  ? 301 ALA A CB    1 
ATOM   2664 N N     . PHE B 2 301 ? 43.479 14.544  -4.411  1.00 29.85  ? 302 PHE A N     1 
ATOM   2665 C CA    . PHE B 2 301 ? 42.260 14.391  -3.681  1.00 29.16  ? 302 PHE A CA    1 
ATOM   2666 C C     . PHE B 2 301 ? 41.418 15.574  -3.887  1.00 40.83  ? 302 PHE A C     1 
ATOM   2667 O O     . PHE B 2 301 ? 40.278 15.520  -4.350  1.00 47.64  ? 302 PHE A O     1 
ATOM   2668 C CB    . PHE B 2 301 ? 42.564 14.479  -2.237  1.00 29.66  ? 302 PHE A CB    1 
ATOM   2669 C CG    . PHE B 2 301 ? 41.552 13.828  -1.389  1.00 30.63  ? 302 PHE A CG    1 
ATOM   2670 C CD1   . PHE B 2 301 ? 41.120 12.531  -1.671  1.00 35.26  ? 302 PHE A CD1   1 
ATOM   2671 C CD2   . PHE B 2 301 ? 41.086 14.462  -0.272  1.00 30.50  ? 302 PHE A CD2   1 
ATOM   2672 C CE1   . PHE B 2 301 ? 40.240 11.896  -0.816  1.00 36.57  ? 302 PHE A CE1   1 
ATOM   2673 C CE2   . PHE B 2 301 ? 40.211 13.842  0.596   1.00 34.53  ? 302 PHE A CE2   1 
ATOM   2674 C CZ    . PHE B 2 301 ? 39.791 12.559  0.341   1.00 34.10  ? 302 PHE A CZ    1 
ATOM   2675 N N     . ASN B 2 302 ? 42.002 16.664  -3.459  1.00 33.41  ? 303 ASN A N     1 
ATOM   2676 C CA    . ASN B 2 302 ? 41.364 17.923  -3.528  1.00 29.24  ? 303 ASN A CA    1 
ATOM   2677 C C     . ASN B 2 302 ? 40.768 18.254  -4.871  1.00 33.13  ? 303 ASN A C     1 
ATOM   2678 O O     . ASN B 2 302 ? 39.686 18.806  -4.919  1.00 41.07  ? 303 ASN A O     1 
ATOM   2679 C CB    . ASN B 2 302 ? 42.263 18.971  -2.947  1.00 26.36  ? 303 ASN A CB    1 
ATOM   2680 C CG    . ASN B 2 302 ? 42.646 18.615  -1.534  1.00 76.82  ? 303 ASN A CG    1 
ATOM   2681 O OD1   . ASN B 2 302 ? 41.985 17.766  -0.922  1.00 60.45  ? 303 ASN A OD1   1 
ATOM   2682 N ND2   . ASN B 2 302 ? 43.745 19.182  -1.029  1.00 77.59  ? 303 ASN A ND2   1 
ATOM   2683 N N     . MET B 2 303 ? 41.407 17.899  -5.969  1.00 22.50  ? 304 MET A N     1 
ATOM   2684 C CA    . MET B 2 303 ? 40.774 18.222  -7.240  1.00 30.92  ? 304 MET A CA    1 
ATOM   2685 C C     . MET B 2 303 ? 39.505 17.366  -7.258  1.00 39.60  ? 304 MET A C     1 
ATOM   2686 O O     . MET B 2 303 ? 38.401 17.885  -7.486  1.00 45.55  ? 304 MET A O     1 
ATOM   2687 C CB    . MET B 2 303 ? 41.663 17.941  -8.466  1.00 37.86  ? 304 MET A CB    1 
ATOM   2688 C CG    . MET B 2 303 ? 42.772 18.969  -8.779  1.00 45.36  ? 304 MET A CG    1 
ATOM   2689 S SD    . MET B 2 303 ? 43.864 18.317  -10.086 1.00 56.31  ? 304 MET A SD    1 
ATOM   2690 C CE    . MET B 2 303 ? 43.157 19.083  -11.574 1.00 52.56  ? 304 MET A CE    1 
ATOM   2691 N N     . LEU B 2 304 ? 39.645 16.072  -6.947  1.00 28.84  ? 305 LEU A N     1 
ATOM   2692 C CA    . LEU B 2 304 ? 38.475 15.171  -6.884  1.00 26.69  ? 305 LEU A CA    1 
ATOM   2693 C C     . LEU B 2 304 ? 37.364 15.799  -6.002  1.00 36.72  ? 305 LEU A C     1 
ATOM   2694 O O     . LEU B 2 304 ? 36.300 16.118  -6.500  1.00 35.04  ? 305 LEU A O     1 
ATOM   2695 C CB    . LEU B 2 304 ? 38.851 13.815  -6.284  1.00 20.65  ? 305 LEU A CB    1 
ATOM   2696 C CG    . LEU B 2 304 ? 38.081 12.620  -6.813  1.00 21.87  ? 305 LEU A CG    1 
ATOM   2697 C CD1   . LEU B 2 304 ? 38.101 12.538  -8.351  1.00 21.31  ? 305 LEU A CD1   1 
ATOM   2698 C CD2   . LEU B 2 304 ? 38.634 11.348  -6.155  1.00 19.73  ? 305 LEU A CD2   1 
ATOM   2699 N N     . LEU B 2 305 ? 37.644 15.961  -4.710  1.00 28.76  ? 306 LEU A N     1 
ATOM   2700 C CA    . LEU B 2 305 ? 36.710 16.521  -3.792  1.00 29.08  ? 306 LEU A CA    1 
ATOM   2701 C C     . LEU B 2 305 ? 35.966 17.699  -4.333  1.00 39.48  ? 306 LEU A C     1 
ATOM   2702 O O     . LEU B 2 305 ? 34.793 17.852  -4.085  1.00 43.16  ? 306 LEU A O     1 
ATOM   2703 C CB    . LEU B 2 305 ? 37.427 16.943  -2.550  1.00 28.87  ? 306 LEU A CB    1 
ATOM   2704 C CG    . LEU B 2 305 ? 36.651 16.231  -1.456  1.00 35.27  ? 306 LEU A CG    1 
ATOM   2705 C CD1   . LEU B 2 305 ? 36.766 14.676  -1.543  1.00 31.40  ? 306 LEU A CD1   1 
ATOM   2706 C CD2   . LEU B 2 305 ? 36.933 16.804  -0.081  1.00 37.01  ? 306 LEU A CD2   1 
ATOM   2707 N N     . ASP B 2 306 ? 36.653 18.526  -5.091  1.00 33.79  ? 307 ASP A N     1 
ATOM   2708 C CA    . ASP B 2 306 ? 36.028 19.683  -5.676  1.00 35.19  ? 307 ASP A CA    1 
ATOM   2709 C C     . ASP B 2 306 ? 34.985 19.176  -6.647  1.00 45.73  ? 307 ASP A C     1 
ATOM   2710 O O     . ASP B 2 306 ? 33.801 19.460  -6.512  1.00 50.25  ? 307 ASP A O     1 
ATOM   2711 C CB    . ASP B 2 306 ? 37.089 20.410  -6.472  1.00 40.60  ? 307 ASP A CB    1 
ATOM   2712 C CG    . ASP B 2 306 ? 36.579 21.668  -7.160  1.00 49.45  ? 307 ASP A CG    1 
ATOM   2713 O OD1   . ASP B 2 306 ? 36.015 22.548  -6.467  1.00 45.08  ? 307 ASP A OD1   1 
ATOM   2714 O OD2   . ASP B 2 306 ? 36.848 21.817  -8.384  1.00 48.05  ? 307 ASP A OD2   1 
ATOM   2715 N N     . ARG B 2 307 ? 35.430 18.430  -7.648  1.00 46.53  ? 308 ARG A N     1 
ATOM   2716 C CA    . ARG B 2 307 ? 34.493 17.885  -8.663  1.00 49.73  ? 308 ARG A CA    1 
ATOM   2717 C C     . ARG B 2 307 ? 33.293 17.225  -7.950  1.00 56.63  ? 308 ARG A C     1 
ATOM   2718 O O     . ARG B 2 307 ? 32.135 17.445  -8.315  1.00 56.20  ? 308 ARG A O     1 
ATOM   2719 C CB    . ARG B 2 307 ? 35.182 16.858  -9.595  1.00 45.89  ? 308 ARG A CB    1 
ATOM   2720 C CG    . ARG B 2 307 ? 35.838 17.409  -10.879 1.00 40.69  ? 308 ARG A CG    1 
ATOM   2721 C CD    . ARG B 2 307 ? 35.889 16.341  -12.017 1.00 49.08  ? 308 ARG A CD    1 
ATOM   2722 N NE    . ARG B 2 307 ? 36.347 16.939  -13.277 1.00 55.19  ? 308 ARG A NE    1 
ATOM   2723 C CZ    . ARG B 2 307 ? 36.168 16.401  -14.481 1.00 88.53  ? 308 ARG A CZ    1 
ATOM   2724 N NH1   . ARG B 2 307 ? 35.536 15.235  -14.587 1.00 86.44  ? 308 ARG A NH1   1 
ATOM   2725 N NH2   . ARG B 2 307 ? 36.625 17.022  -15.576 1.00 69.51  ? 308 ARG A NH2   1 
ATOM   2726 N N     . ILE B 2 308 ? 33.594 16.459  -6.896  1.00 51.84  ? 309 ILE A N     1 
ATOM   2727 C CA    . ILE B 2 308 ? 32.576 15.783  -6.114  1.00 47.63  ? 309 ILE A CA    1 
ATOM   2728 C C     . ILE B 2 308 ? 31.780 16.884  -5.518  1.00 45.22  ? 309 ILE A C     1 
ATOM   2729 O O     . ILE B 2 308 ? 30.768 17.224  -6.061  1.00 51.50  ? 309 ILE A O     1 
ATOM   2730 C CB    . ILE B 2 308 ? 33.162 14.925  -4.971  1.00 49.16  ? 309 ILE A CB    1 
ATOM   2731 C CG1   . ILE B 2 308 ? 33.554 13.529  -5.469  1.00 51.21  ? 309 ILE A CG1   1 
ATOM   2732 C CG2   . ILE B 2 308 ? 32.190 14.820  -3.803  1.00 33.61  ? 309 ILE A CG2   1 
ATOM   2733 C CD1   . ILE B 2 308 ? 35.023 13.298  -5.394  1.00 76.68  ? 309 ILE A CD1   1 
ATOM   2734 N N     . VAL B 2 309 ? 32.235 17.493  -4.442  1.00 32.98  ? 310 VAL A N     1 
ATOM   2735 C CA    . VAL B 2 309 ? 31.410 18.561  -3.901  1.00 33.58  ? 310 VAL A CA    1 
ATOM   2736 C C     . VAL B 2 309 ? 30.940 19.738  -4.746  1.00 47.24  ? 310 VAL A C     1 
ATOM   2737 O O     . VAL B 2 309 ? 29.755 19.859  -5.040  1.00 52.21  ? 310 VAL A O     1 
ATOM   2738 C CB    . VAL B 2 309 ? 31.615 18.978  -2.473  1.00 31.45  ? 310 VAL A CB    1 
ATOM   2739 C CG1   . VAL B 2 309 ? 32.614 18.132  -1.721  1.00 31.71  ? 310 VAL A CG1   1 
ATOM   2740 C CG2   . VAL B 2 309 ? 31.842 20.443  -2.424  1.00 28.94  ? 310 VAL A CG2   1 
ATOM   2741 N N     . ASN B 2 310 ? 31.844 20.607  -5.145  1.00 43.17  ? 311 ASN A N     1 
ATOM   2742 C CA    . ASN B 2 310 ? 31.425 21.731  -5.949  1.00 45.31  ? 311 ASN A CA    1 
ATOM   2743 C C     . ASN B 2 310 ? 30.905 21.393  -7.336  1.00 44.65  ? 311 ASN A C     1 
ATOM   2744 O O     . ASN B 2 310 ? 30.696 22.254  -8.201  1.00 42.07  ? 311 ASN A O     1 
ATOM   2745 C CB    . ASN B 2 310 ? 32.453 22.818  -5.906  1.00 50.80  ? 311 ASN A CB    1 
ATOM   2746 C CG    . ASN B 2 310 ? 32.935 23.033  -4.513  1.00 100.00 ? 311 ASN A CG    1 
ATOM   2747 O OD1   . ASN B 2 310 ? 32.145 22.926  -3.570  1.00 90.55  ? 311 ASN A OD1   1 
ATOM   2748 N ND2   . ASN B 2 310 ? 34.250 23.185  -4.345  1.00 100.00 ? 311 ASN A ND2   1 
ATOM   2749 N N     . LYS B 2 311 ? 30.649 20.115  -7.515  1.00 40.35  ? 312 LYS A N     1 
ATOM   2750 C CA    . LYS B 2 311 ? 30.097 19.619  -8.754  1.00 45.99  ? 312 LYS A CA    1 
ATOM   2751 C C     . LYS B 2 311 ? 30.688 20.185  -10.049 1.00 55.61  ? 312 LYS A C     1 
ATOM   2752 O O     . LYS B 2 311 ? 29.955 20.334  -11.040 1.00 54.00  ? 312 LYS A O     1 
ATOM   2753 C CB    . LYS B 2 311 ? 28.563 19.775  -8.741  1.00 50.68  ? 312 LYS A CB    1 
ATOM   2754 C CG    . LYS B 2 311 ? 27.744 18.491  -8.362  1.00 77.86  ? 312 LYS A CG    1 
ATOM   2755 C CD    . LYS B 2 311 ? 26.212 18.592  -8.672  1.00 100.00 ? 312 LYS A CD    1 
ATOM   2756 C CE    . LYS B 2 311 ? 25.767 17.807  -9.957  1.00 100.00 ? 312 LYS A CE    1 
ATOM   2757 N NZ    . LYS B 2 311 ? 25.019 18.625  -11.010 1.00 100.00 ? 312 LYS A NZ    1 
ATOM   2758 N N     . ARG B 2 312 ? 32.000 20.476  -10.046 1.00 56.59  ? 313 ARG A N     1 
ATOM   2759 C CA    . ARG B 2 312 ? 32.637 21.013  -11.246 1.00 55.98  ? 313 ARG A CA    1 
ATOM   2760 C C     . ARG B 2 312 ? 32.523 20.073  -12.439 1.00 64.41  ? 313 ARG A C     1 
ATOM   2761 O O     . ARG B 2 312 ? 32.327 18.876  -12.294 1.00 67.32  ? 313 ARG A O     1 
ATOM   2762 C CB    . ARG B 2 312 ? 34.072 21.420  -11.028 1.00 56.68  ? 313 ARG A CB    1 
ATOM   2763 C CG    . ARG B 2 312 ? 34.860 21.398  -12.340 1.00 70.70  ? 313 ARG A CG    1 
ATOM   2764 C CD    . ARG B 2 312 ? 36.184 22.054  -12.183 1.00 73.93  ? 313 ARG A CD    1 
ATOM   2765 N NE    . ARG B 2 312 ? 36.917 21.513  -11.051 1.00 44.00  ? 313 ARG A NE    1 
ATOM   2766 C CZ    . ARG B 2 312 ? 37.718 20.451  -11.123 1.00 66.49  ? 313 ARG A CZ    1 
ATOM   2767 N NH1   . ARG B 2 312 ? 37.870 19.814  -12.280 1.00 48.19  ? 313 ARG A NH1   1 
ATOM   2768 N NH2   . ARG B 2 312 ? 38.354 20.030  -10.033 1.00 66.54  ? 313 ARG A NH2   1 
ATOM   2769 N N     . GLU B 2 313 ? 32.581 20.636  -13.624 1.00 63.98  ? 314 GLU A N     1 
ATOM   2770 C CA    . GLU B 2 313 ? 32.403 19.884  -14.835 1.00 68.24  ? 314 GLU A CA    1 
ATOM   2771 C C     . GLU B 2 313 ? 33.581 19.925  -15.803 1.00 69.43  ? 314 GLU A C     1 
ATOM   2772 O O     . GLU B 2 313 ? 33.812 19.014  -16.620 1.00 62.23  ? 314 GLU A O     1 
ATOM   2773 C CB    . GLU B 2 313 ? 31.203 20.565  -15.523 1.00 72.67  ? 314 GLU A CB    1 
ATOM   2774 C CG    . GLU B 2 313 ? 29.890 19.856  -15.300 1.00 99.70  ? 314 GLU A CG    1 
ATOM   2775 C CD    . GLU B 2 313 ? 30.015 18.370  -15.638 1.00 100.00 ? 314 GLU A CD    1 
ATOM   2776 O OE1   . GLU B 2 313 ? 30.762 17.655  -14.900 1.00 100.00 ? 314 GLU A OE1   1 
ATOM   2777 O OE2   . GLU B 2 313 ? 29.435 17.949  -16.681 1.00 100.00 ? 314 GLU A OE2   1 
ATOM   2778 N N     . GLU B 2 314 ? 34.292 21.035  -15.724 1.00 70.66  ? 315 GLU A N     1 
ATOM   2779 C CA    . GLU B 2 314 ? 35.418 21.293  -16.583 1.00 71.04  ? 315 GLU A CA    1 
ATOM   2780 C C     . GLU B 2 314 ? 36.659 20.733  -15.961 1.00 66.88  ? 315 GLU A C     1 
ATOM   2781 O O     . GLU B 2 314 ? 36.928 20.924  -14.760 1.00 67.48  ? 315 GLU A O     1 
ATOM   2782 C CB    . GLU B 2 314 ? 35.576 22.810  -16.830 1.00 73.98  ? 315 GLU A CB    1 
ATOM   2783 C CG    . GLU B 2 314 ? 34.239 23.586  -16.860 1.00 97.26  ? 315 GLU A CG    1 
ATOM   2784 C CD    . GLU B 2 314 ? 33.766 24.052  -15.461 1.00 100.00 ? 315 GLU A CD    1 
ATOM   2785 O OE1   . GLU B 2 314 ? 34.463 24.916  -14.866 1.00 100.00 ? 315 GLU A OE1   1 
ATOM   2786 O OE2   . GLU B 2 314 ? 32.688 23.579  -14.978 1.00 100.00 ? 315 GLU A OE2   1 
ATOM   2787 N N     . PRO B 2 315 ? 37.407 20.042  -16.804 1.00 52.35  ? 316 PRO A N     1 
ATOM   2788 C CA    . PRO B 2 315 ? 38.652 19.434  -16.427 1.00 50.41  ? 316 PRO A CA    1 
ATOM   2789 C C     . PRO B 2 315 ? 39.660 20.460  -15.886 1.00 52.41  ? 316 PRO A C     1 
ATOM   2790 O O     . PRO B 2 315 ? 39.761 21.603  -16.323 1.00 50.70  ? 316 PRO A O     1 
ATOM   2791 C CB    . PRO B 2 315 ? 39.150 18.872  -17.756 1.00 50.43  ? 316 PRO A CB    1 
ATOM   2792 C CG    . PRO B 2 315 ? 38.688 19.858  -18.746 1.00 55.22  ? 316 PRO A CG    1 
ATOM   2793 C CD    . PRO B 2 315 ? 37.392 20.428  -18.218 1.00 50.54  ? 316 PRO A CD    1 
ATOM   2794 N N     . GLN B 2 316 ? 40.437 20.037  -14.924 1.00 48.79  ? 317 GLN A N     1 
ATOM   2795 C CA    . GLN B 2 316 ? 41.423 20.946  -14.416 1.00 48.64  ? 317 GLN A CA    1 
ATOM   2796 C C     . GLN B 2 316 ? 42.744 20.215  -14.550 1.00 53.39  ? 317 GLN A C     1 
ATOM   2797 O O     . GLN B 2 316 ? 42.764 18.994  -14.799 1.00 52.61  ? 317 GLN A O     1 
ATOM   2798 C CB    . GLN B 2 316 ? 41.143 21.183  -12.955 1.00 48.06  ? 317 GLN A CB    1 
ATOM   2799 C CG    . GLN B 2 316 ? 41.577 22.506  -12.542 1.00 41.60  ? 317 GLN A CG    1 
ATOM   2800 C CD    . GLN B 2 316 ? 40.551 23.193  -11.707 1.00 80.14  ? 317 GLN A CD    1 
ATOM   2801 O OE1   . GLN B 2 316 ? 39.644 23.876  -12.231 1.00 82.34  ? 317 GLN A OE1   1 
ATOM   2802 N NE2   . GLN B 2 316 ? 40.661 23.012  -10.386 1.00 56.61  ? 317 GLN A NE2   1 
ATOM   2803 N N     . SER B 2 317 ? 43.841 20.947  -14.373 1.00 48.21  ? 318 SER A N     1 
ATOM   2804 C CA    . SER B 2 317 ? 45.195 20.357  -14.410 1.00 45.78  ? 318 SER A CA    1 
ATOM   2805 C C     . SER B 2 317 ? 46.151 21.139  -13.551 1.00 45.32  ? 318 SER A C     1 
ATOM   2806 O O     . SER B 2 317 ? 46.446 22.293  -13.817 1.00 49.83  ? 318 SER A O     1 
ATOM   2807 C CB    . SER B 2 317 ? 45.752 20.103  -15.824 1.00 48.33  ? 318 SER A CB    1 
ATOM   2808 O OG    . SER B 2 317 ? 46.613 21.134  -16.272 1.00 66.89  ? 318 SER A OG    1 
ATOM   2809 N N     . ILE B 2 318 ? 46.612 20.527  -12.483 1.00 41.91  ? 319 ILE A N     1 
ATOM   2810 C CA    . ILE B 2 318 ? 47.549 21.214  -11.628 1.00 41.74  ? 319 ILE A CA    1 
ATOM   2811 C C     . ILE B 2 318 ? 48.930 20.623  -11.847 1.00 40.28  ? 319 ILE A C     1 
ATOM   2812 O O     . ILE B 2 318 ? 49.070 19.431  -12.097 1.00 40.53  ? 319 ILE A O     1 
ATOM   2813 C CB    . ILE B 2 318 ? 47.130 21.168  -10.213 1.00 46.58  ? 319 ILE A CB    1 
ATOM   2814 C CG1   . ILE B 2 318 ? 45.810 21.908  -10.089 1.00 49.65  ? 319 ILE A CG1   1 
ATOM   2815 C CG2   . ILE B 2 318 ? 48.114 21.849  -9.376  1.00 46.98  ? 319 ILE A CG2   1 
ATOM   2816 C CD1   . ILE B 2 318 ? 45.077 21.620  -8.795  1.00 62.70  ? 319 ILE A CD1   1 
ATOM   2817 N N     . GLU B 2 319 ? 49.935 21.489  -11.805 1.00 32.93  ? 320 GLU A N     1 
ATOM   2818 C CA    . GLU B 2 319 ? 51.338 21.109  -11.992 1.00 26.23  ? 320 GLU A CA    1 
ATOM   2819 C C     . GLU B 2 319 ? 52.010 21.073  -10.637 1.00 36.50  ? 320 GLU A C     1 
ATOM   2820 O O     . GLU B 2 319 ? 51.709 21.868  -9.741  1.00 37.55  ? 320 GLU A O     1 
ATOM   2821 C CB    . GLU B 2 319 ? 52.040 22.139  -12.821 1.00 22.67  ? 320 GLU A CB    1 
ATOM   2822 C CG    . GLU B 2 319 ? 51.725 22.011  -14.248 1.00 32.14  ? 320 GLU A CG    1 
ATOM   2823 C CD    . GLU B 2 319 ? 52.549 22.972  -15.063 1.00 75.08  ? 320 GLU A CD    1 
ATOM   2824 O OE1   . GLU B 2 319 ? 53.388 23.643  -14.436 1.00 56.44  ? 320 GLU A OE1   1 
ATOM   2825 O OE2   . GLU B 2 319 ? 52.342 23.076  -16.298 1.00 84.10  ? 320 GLU A OE2   1 
ATOM   2826 N N     . VAL B 2 320 ? 52.949 20.158  -10.490 1.00 35.84  ? 321 VAL A N     1 
ATOM   2827 C CA    . VAL B 2 320 ? 53.677 20.029  -9.238  1.00 32.21  ? 321 VAL A CA    1 
ATOM   2828 C C     . VAL B 2 320 ? 55.174 20.153  -9.627  1.00 30.73  ? 321 VAL A C     1 
ATOM   2829 O O     . VAL B 2 320 ? 55.510 19.965  -10.826 1.00 18.14  ? 321 VAL A O     1 
ATOM   2830 C CB    . VAL B 2 320 ? 53.299 18.705  -8.604  1.00 29.56  ? 321 VAL A CB    1 
ATOM   2831 C CG1   . VAL B 2 320 ? 53.822 17.501  -9.455  1.00 26.46  ? 321 VAL A CG1   1 
ATOM   2832 C CG2   . VAL B 2 320 ? 53.722 18.684  -7.220  1.00 27.32  ? 321 VAL A CG2   1 
ATOM   2833 N N     . HIS B 2 321 ? 56.057 20.496  -8.674  1.00 37.42  ? 322 HIS A N     1 
ATOM   2834 C CA    . HIS B 2 321 ? 57.494 20.618  -9.057  1.00 42.24  ? 322 HIS A CA    1 
ATOM   2835 C C     . HIS B 2 321 ? 58.631 19.774  -8.488  1.00 50.32  ? 322 HIS A C     1 
ATOM   2836 O O     . HIS B 2 321 ? 58.811 19.703  -7.264  1.00 57.10  ? 322 HIS A O     1 
ATOM   2837 C CB    . HIS B 2 321 ? 57.923 22.019  -9.267  1.00 45.42  ? 322 HIS A CB    1 
ATOM   2838 C CG    . HIS B 2 321 ? 57.312 22.636  -10.475 1.00 53.59  ? 322 HIS A CG    1 
ATOM   2839 N ND1   . HIS B 2 321 ? 57.702 22.306  -11.760 1.00 59.41  ? 322 HIS A ND1   1 
ATOM   2840 C CD2   . HIS B 2 321 ? 56.309 23.532  -10.598 1.00 56.23  ? 322 HIS A CD2   1 
ATOM   2841 C CE1   . HIS B 2 321 ? 56.984 23.006  -12.622 1.00 59.89  ? 322 HIS A CE1   1 
ATOM   2842 N NE2   . HIS B 2 321 ? 56.128 23.750  -11.943 1.00 59.02  ? 322 HIS A NE2   1 
ATOM   2843 N N     . PRO B 2 322 ? 59.413 19.148  -9.379  1.00 37.86  ? 323 PRO A N     1 
ATOM   2844 C CA    . PRO B 2 322 ? 60.528 18.314  -8.942  1.00 32.47  ? 323 PRO A CA    1 
ATOM   2845 C C     . PRO B 2 322 ? 61.655 19.169  -8.381  1.00 41.33  ? 323 PRO A C     1 
ATOM   2846 O O     . PRO B 2 322 ? 61.733 20.371  -8.619  1.00 42.76  ? 323 PRO A O     1 
ATOM   2847 C CB    . PRO B 2 322 ? 60.981 17.677  -10.247 1.00 29.55  ? 323 PRO A CB    1 
ATOM   2848 C CG    . PRO B 2 322 ? 60.704 18.672  -11.258 1.00 32.08  ? 323 PRO A CG    1 
ATOM   2849 C CD    . PRO B 2 322 ? 59.450 19.367  -10.841 1.00 32.62  ? 323 PRO A CD    1 
ATOM   2850 N N     . ARG B 2 323 ? 62.554 18.573  -7.638  1.00 37.45  ? 324 ARG A N     1 
ATOM   2851 C CA    . ARG B 2 323 ? 63.661 19.376  -7.142  1.00 31.72  ? 324 ARG A CA    1 
ATOM   2852 C C     . ARG B 2 323 ? 64.923 18.566  -6.762  1.00 34.17  ? 324 ARG A C     1 
ATOM   2853 O O     . ARG B 2 323 ? 64.839 17.384  -6.373  1.00 29.12  ? 324 ARG A O     1 
ATOM   2854 C CB    . ARG B 2 323 ? 63.207 20.205  -6.036  1.00 18.76  ? 324 ARG A CB    1 
ATOM   2855 C CG    . ARG B 2 323 ? 63.518 19.565  -4.766  1.00 23.89  ? 324 ARG A CG    1 
ATOM   2856 C CD    . ARG B 2 323 ? 62.921 20.466  -3.668  1.00 31.36  ? 324 ARG A CD    1 
ATOM   2857 N NE    . ARG B 2 323 ? 63.182 19.868  -2.351  1.00 95.37  ? 324 ARG A NE    1 
ATOM   2858 C CZ    . ARG B 2 323 ? 62.258 19.308  -1.574  1.00 100.00 ? 324 ARG A CZ    1 
ATOM   2859 N NH1   . ARG B 2 323 ? 60.978 19.291  -1.967  1.00 100.00 ? 324 ARG A NH1   1 
ATOM   2860 N NH2   . ARG B 2 323 ? 62.613 18.791  -0.386  1.00 87.32  ? 324 ARG A NH2   1 
ATOM   2861 N N     . LEU B 2 324 ? 66.098 19.177  -6.922  1.00 31.48  ? 325 LEU A N     1 
ATOM   2862 C CA    . LEU B 2 324 ? 67.315 18.430  -6.634  1.00 32.71  ? 325 LEU A CA    1 
ATOM   2863 C C     . LEU B 2 324 ? 67.700 18.200  -5.205  1.00 32.19  ? 325 LEU A C     1 
ATOM   2864 O O     . LEU B 2 324 ? 67.743 19.148  -4.424  1.00 35.02  ? 325 LEU A O     1 
ATOM   2865 C CB    . LEU B 2 324 ? 68.517 18.871  -7.471  1.00 32.88  ? 325 LEU A CB    1 
ATOM   2866 C CG    . LEU B 2 324 ? 69.983 18.436  -7.260  1.00 36.25  ? 325 LEU A CG    1 
ATOM   2867 C CD1   . LEU B 2 324 ? 70.190 17.188  -6.441  1.00 37.77  ? 325 LEU A CD1   1 
ATOM   2868 C CD2   . LEU B 2 324 ? 70.646 18.242  -8.578  1.00 38.60  ? 325 LEU A CD2   1 
ATOM   2869 N N     . ILE B 2 325 ? 67.992 16.940  -4.875  1.00 19.38  ? 326 ILE A N     1 
ATOM   2870 C CA    . ILE B 2 325 ? 68.436 16.649  -3.543  1.00 25.43  ? 326 ILE A CA    1 
ATOM   2871 C C     . ILE B 2 325 ? 69.869 16.186  -3.603  1.00 31.05  ? 326 ILE A C     1 
ATOM   2872 O O     . ILE B 2 325 ? 70.148 15.070  -4.015  1.00 31.01  ? 326 ILE A O     1 
ATOM   2873 C CB    . ILE B 2 325 ? 67.697 15.533  -2.908  1.00 33.89  ? 326 ILE A CB    1 
ATOM   2874 C CG1   . ILE B 2 325 ? 66.221 15.815  -2.981  1.00 34.35  ? 326 ILE A CG1   1 
ATOM   2875 C CG2   . ILE B 2 325 ? 68.084 15.540  -1.413  1.00 31.46  ? 326 ILE A CG2   1 
ATOM   2876 C CD1   . ILE B 2 325 ? 65.910 16.984  -2.081  1.00 14.25  ? 326 ILE A CD1   1 
ATOM   2877 N N     . GLU B 2 326 ? 70.780 17.037  -3.175  1.00 31.21  ? 327 GLU A N     1 
ATOM   2878 C CA    . GLU B 2 326 ? 72.180 16.651  -3.199  1.00 28.43  ? 327 GLU A CA    1 
ATOM   2879 C C     . GLU B 2 326 ? 72.634 15.779  -2.059  1.00 24.24  ? 327 GLU A C     1 
ATOM   2880 O O     . GLU B 2 326 ? 72.605 16.169  -0.903  1.00 26.57  ? 327 GLU A O     1 
ATOM   2881 C CB    . GLU B 2 326 ? 73.068 17.886  -3.182  1.00 29.18  ? 327 GLU A CB    1 
ATOM   2882 C CG    . GLU B 2 326 ? 73.554 18.297  -4.524  1.00 48.18  ? 327 GLU A CG    1 
ATOM   2883 C CD    . GLU B 2 326 ? 74.380 19.564  -4.462  1.00 66.57  ? 327 GLU A CD    1 
ATOM   2884 O OE1   . GLU B 2 326 ? 73.785 20.638  -4.216  1.00 59.57  ? 327 GLU A OE1   1 
ATOM   2885 O OE2   . GLU B 2 326 ? 75.612 19.466  -4.609  1.00 46.94  ? 327 GLU A OE2   1 
ATOM   2886 N N     . ARG B 2 327 ? 73.082 14.591  -2.390  1.00 24.04  ? 328 ARG A N     1 
ATOM   2887 C CA    . ARG B 2 327 ? 73.642 13.636  -1.411  1.00 25.67  ? 328 ARG A CA    1 
ATOM   2888 C C     . ARG B 2 327 ? 75.226 13.279  -1.624  1.00 37.06  ? 328 ARG A C     1 
ATOM   2889 O O     . ARG B 2 327 ? 76.136 14.142  -1.602  1.00 36.71  ? 328 ARG A O     1 
ATOM   2890 C CB    . ARG B 2 327 ? 72.766 12.402  -1.301  1.00 28.02  ? 328 ARG A CB    1 
ATOM   2891 C CG    . ARG B 2 327 ? 72.311 12.175  0.126   1.00 56.02  ? 328 ARG A CG    1 
ATOM   2892 C CD    . ARG B 2 327 ? 70.984 12.785  0.421   1.00 51.07  ? 328 ARG A CD    1 
ATOM   2893 N NE    . ARG B 2 327 ? 70.046 12.368  -0.595  1.00 51.38  ? 328 ARG A NE    1 
ATOM   2894 C CZ    . ARG B 2 327 ? 68.748 12.135  -0.408  1.00 49.04  ? 328 ARG A CZ    1 
ATOM   2895 N NH1   . ARG B 2 327 ? 68.185 12.265  0.769   1.00 13.53  ? 328 ARG A NH1   1 
ATOM   2896 N NH2   . ARG B 2 327 ? 68.001 11.777  -1.438  1.00 63.80  ? 328 ARG A NH2   1 
ATOM   2897 N N     . ARG B 2 328 ? 75.570 12.018  -1.795  1.00 23.84  ? 329 ARG A N     1 
ATOM   2898 C CA    . ARG B 2 328 ? 76.959 11.699  -1.888  1.00 15.57  ? 329 ARG A CA    1 
ATOM   2899 C C     . ARG B 2 328 ? 77.175 10.630  -2.849  1.00 23.21  ? 329 ARG A C     1 
ATOM   2900 O O     . ARG B 2 328 ? 77.788 9.680   -2.483  1.00 24.61  ? 329 ARG A O     1 
ATOM   2901 C CB    . ARG B 2 328 ? 77.314 11.004  -0.597  1.00 2.68   ? 329 ARG A CB    1 
ATOM   2902 C CG    . ARG B 2 328 ? 76.581 11.485  0.643   1.00 39.76  ? 329 ARG A CG    1 
ATOM   2903 C CD    . ARG B 2 328 ? 77.532 11.891  1.783   1.00 25.35  ? 329 ARG A CD    1 
ATOM   2904 N NE    . ARG B 2 328 ? 78.831 11.204  1.727   1.00 92.06  ? 329 ARG A NE    1 
ATOM   2905 C CZ    . ARG B 2 328 ? 79.012 9.876   1.880   1.00 100.00 ? 329 ARG A CZ    1 
ATOM   2906 N NH1   . ARG B 2 328 ? 77.979 9.048   2.022   1.00 88.50  ? 329 ARG A NH1   1 
ATOM   2907 N NH2   . ARG B 2 328 ? 80.237 9.391   1.809   1.00 95.53  ? 329 ARG A NH2   1 
ATOM   2908 N N     . SER B 2 329 ? 76.631 10.700  -4.028  1.00 19.66  ? 330 SER A N     1 
ATOM   2909 C CA    . SER B 2 329 ? 76.785 9.571   -4.898  1.00 15.16  ? 330 SER A CA    1 
ATOM   2910 C C     . SER B 2 329 ? 77.223 10.147  -6.197  1.00 15.24  ? 330 SER A C     1 
ATOM   2911 O O     . SER B 2 329 ? 77.346 9.446   -7.230  1.00 18.40  ? 330 SER A O     1 
ATOM   2912 C CB    . SER B 2 329 ? 75.435 8.801   -4.944  1.00 27.74  ? 330 SER A CB    1 
ATOM   2913 O OG    . SER B 2 329 ? 74.411 9.467   -5.707  1.00 25.45  ? 330 SER A OG    1 
ATOM   2914 N N     . VAL B 2 330 ? 77.458 11.460  -6.154  1.00 16.58  ? 331 VAL A N     1 
ATOM   2915 C CA    . VAL B 2 330 ? 77.994 12.133  -7.320  1.00 26.09  ? 331 VAL A CA    1 
ATOM   2916 C C     . VAL B 2 330 ? 79.259 12.843  -6.868  1.00 37.36  ? 331 VAL A C     1 
ATOM   2917 O O     . VAL B 2 330 ? 79.314 13.314  -5.736  1.00 34.97  ? 331 VAL A O     1 
ATOM   2918 C CB    . VAL B 2 330 ? 77.035 13.012  -8.100  1.00 35.64  ? 331 VAL A CB    1 
ATOM   2919 C CG1   . VAL B 2 330 ? 77.819 13.914  -9.088  1.00 33.36  ? 331 VAL A CG1   1 
ATOM   2920 C CG2   . VAL B 2 330 ? 76.091 12.115  -8.926  1.00 38.37  ? 331 VAL A CG2   1 
ATOM   2921 N N     . ALA B 2 331 ? 80.246 12.857  -7.774  1.00 42.24  ? 332 ALA A N     1 
ATOM   2922 C CA    . ALA B 2 331 ? 81.593 13.423  -7.604  1.00 40.02  ? 332 ALA A CA    1 
ATOM   2923 C C     . ALA B 2 331 ? 81.998 14.286  -8.795  1.00 39.66  ? 332 ALA A C     1 
ATOM   2924 O O     . ALA B 2 331 ? 81.469 14.064  -9.917  1.00 43.10  ? 332 ALA A O     1 
ATOM   2925 C CB    . ALA B 2 331 ? 82.545 12.319  -7.457  1.00 41.54  ? 332 ALA A CB    1 
ATOM   2926 N N     . ASP B 2 332 ? 82.911 15.257  -8.574  1.00 22.74  ? 333 ASP A N     1 
ATOM   2927 C CA    . ASP B 2 332 ? 83.317 16.153  -9.669  1.00 14.72  ? 333 ASP A CA    1 
ATOM   2928 C C     . ASP B 2 332 ? 83.796 15.299  -10.793 1.00 12.56  ? 333 ASP A C     1 
ATOM   2929 O O     . ASP B 2 332 ? 84.149 14.194  -10.575 1.00 21.56  ? 333 ASP A O     1 
ATOM   2930 C CB    . ASP B 2 332 ? 84.387 17.128  -9.227  1.00 17.28  ? 333 ASP A CB    1 
ATOM   2931 C CG    . ASP B 2 332 ? 83.856 18.197  -8.331  1.00 41.67  ? 333 ASP A CG    1 
ATOM   2932 O OD1   . ASP B 2 332 ? 82.912 18.872  -8.748  1.00 58.67  ? 333 ASP A OD1   1 
ATOM   2933 O OD2   . ASP B 2 332 ? 84.347 18.366  -7.202  1.00 46.62  ? 333 ASP A OD2   1 
ATOM   2934 N N     . GLY B 2 333 ? 83.787 15.784  -12.003 1.00 12.13  ? 334 GLY A N     1 
ATOM   2935 C CA    . GLY B 2 333 ? 84.226 14.980  -13.143 1.00 12.99  ? 334 GLY A CA    1 
ATOM   2936 C C     . GLY B 2 333 ? 85.338 15.726  -13.894 1.00 34.72  ? 334 GLY A C     1 
ATOM   2937 O O     . GLY B 2 333 ? 85.645 16.930  -13.662 1.00 41.55  ? 334 GLY A O     1 
ATOM   2938 N N     . PRO B 2 334 ? 85.929 14.995  -14.812 1.00 30.60  ? 335 PRO A N     1 
ATOM   2939 C CA    . PRO B 2 334 ? 87.025 15.479  -15.618 1.00 26.11  ? 335 PRO A CA    1 
ATOM   2940 C C     . PRO B 2 334 ? 86.968 16.931  -16.068 1.00 31.56  ? 335 PRO A C     1 
ATOM   2941 O O     . PRO B 2 334 ? 88.019 17.622  -16.138 1.00 39.87  ? 335 PRO A O     1 
ATOM   2942 C CB    . PRO B 2 334 ? 87.007 14.537  -16.820 1.00 27.75  ? 335 PRO A CB    1 
ATOM   2943 C CG    . PRO B 2 334 ? 86.188 13.352  -16.394 1.00 32.74  ? 335 PRO A CG    1 
ATOM   2944 C CD    . PRO B 2 334 ? 85.157 13.944  -15.493 1.00 29.67  ? 335 PRO A CD    1 
ATOM   2945 N N     . PHE B 2 335 ? 85.774 17.434  -16.379 1.00 11.67  ? 336 PHE A N     1 
ATOM   2946 C CA    . PHE B 2 335 ? 85.797 18.792  -16.839 1.00 4.40   ? 336 PHE A CA    1 
ATOM   2947 C C     . PHE B 2 335 ? 85.474 19.890  -15.876 1.00 14.48  ? 336 PHE A C     1 
ATOM   2948 O O     . PHE B 2 335 ? 85.354 21.078  -16.277 1.00 14.18  ? 336 PHE A O     1 
ATOM   2949 C CB    . PHE B 2 335 ? 85.112 18.992  -18.114 1.00 4.04   ? 336 PHE A CB    1 
ATOM   2950 C CG    . PHE B 2 335 ? 85.480 18.011  -19.157 1.00 10.43  ? 336 PHE A CG    1 
ATOM   2951 C CD1   . PHE B 2 335 ? 85.283 16.662  -18.949 1.00 14.33  ? 336 PHE A CD1   1 
ATOM   2952 C CD2   . PHE B 2 335 ? 85.979 18.444  -20.389 1.00 15.48  ? 336 PHE A CD2   1 
ATOM   2953 C CE1   . PHE B 2 335 ? 85.617 15.727  -19.939 1.00 11.91  ? 336 PHE A CE1   1 
ATOM   2954 C CE2   . PHE B 2 335 ? 86.313 17.526  -21.393 1.00 20.22  ? 336 PHE A CE2   1 
ATOM   2955 C CZ    . PHE B 2 335 ? 86.113 16.167  -21.171 1.00 15.75  ? 336 PHE A CZ    1 
ATOM   2956 N N     . ARG B 2 336 ? 85.356 19.526  -14.603 1.00 7.00   ? 337 ARG A N     1 
ATOM   2957 C CA    . ARG B 2 336 ? 85.029 20.564  -13.663 1.00 10.07  ? 337 ARG A CA    1 
ATOM   2958 C C     . ARG B 2 336 ? 85.791 21.845  -13.744 1.00 33.31  ? 337 ARG A C     1 
ATOM   2959 O O     . ARG B 2 336 ? 85.164 22.882  -13.895 1.00 39.93  ? 337 ARG A O     1 
ATOM   2960 C CB    . ARG B 2 336 ? 84.869 20.111  -12.223 1.00 5.49   ? 337 ARG A CB    1 
ATOM   2961 C CG    . ARG B 2 336 ? 84.057 21.114  -11.458 1.00 34.06  ? 337 ARG A CG    1 
ATOM   2962 C CD    . ARG B 2 336 ? 84.198 21.042  -9.950  1.00 65.40  ? 337 ARG A CD    1 
ATOM   2963 N NE    . ARG B 2 336 ? 84.929 22.179  -9.346  1.00 100.00 ? 337 ARG A NE    1 
ATOM   2964 C CZ    . ARG B 2 336 ? 85.092 23.411  -9.865  1.00 100.00 ? 337 ARG A CZ    1 
ATOM   2965 N NH1   . ARG B 2 336 ? 84.565 23.764  -11.050 1.00 100.00 ? 337 ARG A NH1   1 
ATOM   2966 N NH2   . ARG B 2 336 ? 85.799 24.322  -9.178  1.00 100.00 ? 337 ARG A NH2   1 
ATOM   2967 N N     . ASP B 2 337 ? 87.120 21.790  -13.655 1.00 37.93  ? 338 ASP A N     1 
ATOM   2968 C CA    . ASP B 2 337 ? 87.912 23.021  -13.664 1.00 40.48  ? 338 ASP A CA    1 
ATOM   2969 C C     . ASP B 2 337 ? 87.998 23.835  -14.924 1.00 36.76  ? 338 ASP A C     1 
ATOM   2970 O O     . ASP B 2 337 ? 88.263 25.047  -14.855 1.00 36.36  ? 338 ASP A O     1 
ATOM   2971 C CB    . ASP B 2 337 ? 89.281 22.868  -13.007 1.00 47.55  ? 338 ASP A CB    1 
ATOM   2972 C CG    . ASP B 2 337 ? 89.298 21.807  -11.913 1.00 54.27  ? 338 ASP A CG    1 
ATOM   2973 O OD1   . ASP B 2 337 ? 88.946 22.175  -10.770 1.00 40.10  ? 338 ASP A OD1   1 
ATOM   2974 O OD2   . ASP B 2 337 ? 89.693 20.637  -12.194 1.00 58.14  ? 338 ASP A OD2   1 
ATOM   2975 N N     . TYR B 2 338 ? 87.734 23.181  -16.053 1.00 33.10  ? 339 TYR A N     1 
ATOM   2976 C CA    . TYR B 2 338 ? 87.721 23.821  -17.373 1.00 36.95  ? 339 TYR A CA    1 
ATOM   2977 C C     . TYR B 2 338 ? 86.290 24.294  -17.653 1.00 48.43  ? 339 TYR A C     1 
ATOM   2978 O O     . TYR B 2 338 ? 85.687 23.935  -18.646 1.00 59.01  ? 339 TYR A O     1 
ATOM   2979 C CB    . TYR B 2 338 ? 88.129 22.815  -18.474 1.00 40.41  ? 339 TYR A CB    1 
ATOM   2980 C CG    . TYR B 2 338 ? 89.393 22.044  -18.204 1.00 40.51  ? 339 TYR A CG    1 
ATOM   2981 C CD1   . TYR B 2 338 ? 89.475 21.219  -17.130 1.00 45.03  ? 339 TYR A CD1   1 
ATOM   2982 C CD2   . TYR B 2 338 ? 90.494 22.154  -19.025 1.00 41.06  ? 339 TYR A CD2   1 
ATOM   2983 C CE1   . TYR B 2 338 ? 90.613 20.527  -16.860 1.00 55.35  ? 339 TYR A CE1   1 
ATOM   2984 C CE2   . TYR B 2 338 ? 91.628 21.446  -18.774 1.00 43.10  ? 339 TYR A CE2   1 
ATOM   2985 C CZ    . TYR B 2 338 ? 91.686 20.641  -17.681 1.00 55.08  ? 339 TYR A CZ    1 
ATOM   2986 O OH    . TYR B 2 338 ? 92.802 19.922  -17.360 1.00 66.23  ? 339 TYR A OH    1 
ATOM   2987 N N     . ARG B 2 339 ? 85.746 25.089  -16.755 1.00 45.68  ? 340 ARG A N     1 
ATOM   2988 C CA    . ARG B 2 339 ? 84.390 25.615  -16.867 1.00 60.34  ? 340 ARG A CA    1 
ATOM   2989 C C     . ARG B 2 339 ? 84.288 26.995  -16.208 1.00 77.67  ? 340 ARG A C     1 
ATOM   2990 O O     . ARG B 2 339 ? 83.701 27.924  -16.769 1.00 71.94  ? 340 ARG A O     1 
ATOM   2991 C CB    . ARG B 2 339 ? 83.451 24.663  -16.147 1.00 58.50  ? 340 ARG A CB    1 
ATOM   2992 C CG    . ARG B 2 339 ? 82.715 23.723  -17.078 1.00 56.87  ? 340 ARG A CG    1 
ATOM   2993 C CD    . ARG B 2 339 ? 81.501 23.057  -16.373 1.00 80.29  ? 340 ARG A CD    1 
ATOM   2994 N NE    . ARG B 2 339 ? 80.278 23.835  -16.585 1.00 98.98  ? 340 ARG A NE    1 
ATOM   2995 C CZ    . ARG B 2 339 ? 79.511 24.312  -15.605 1.00 92.20  ? 340 ARG A CZ    1 
ATOM   2996 N NH1   . ARG B 2 339 ? 79.832 24.089  -14.335 1.00 41.57  ? 340 ARG A NH1   1 
ATOM   2997 N NH2   . ARG B 2 339 ? 78.434 25.037  -15.875 1.00 54.31  ? 340 ARG A NH2   1 
HETATM 2998 N N1    . HPA C 3 .   ? 56.554 3.131   -12.025 1.00 24.24  ? 599 HPA A N1    1 
HETATM 2999 C C2    . HPA C 3 .   ? 57.181 2.815   -10.838 1.00 80.65  ? 599 HPA A C2    1 
HETATM 3000 N N3    . HPA C 3 .   ? 57.918 3.645   -10.102 1.00 13.36  ? 599 HPA A N3    1 
HETATM 3001 C C4    . HPA C 3 .   ? 58.009 4.862   -10.705 1.00 61.15  ? 599 HPA A C4    1 
HETATM 3002 C C5    . HPA C 3 .   ? 57.452 5.275   -11.901 1.00 29.09  ? 599 HPA A C5    1 
HETATM 3003 C C6    . HPA C 3 .   ? 56.664 4.360   -12.662 1.00 100.00 ? 599 HPA A C6    1 
HETATM 3004 O O6    . HPA C 3 .   ? 56.064 4.499   -13.740 1.00 100.00 ? 599 HPA A O6    1 
HETATM 3005 N N7    . HPA C 3 .   ? 57.800 6.598   -12.150 1.00 53.83  ? 599 HPA A N7    1 
HETATM 3006 C C8    . HPA C 3 .   ? 58.551 6.945   -11.145 1.00 42.49  ? 599 HPA A C8    1 
HETATM 3007 N N9    . HPA C 3 .   ? 58.704 5.943   -10.219 1.00 10.65  ? 599 HPA A N9    1 
HETATM 3008 O O     . HOH D 4 .   ? 11.664 14.916  8.735   1.00 37.35  ? 717 HOH A O     1 
HETATM 3009 O O     . HOH D 4 .   ? 11.516 4.449   9.504   1.00 62.42  ? 718 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   699 699 DT  T   M . n 
A 1 2   DA  2   700 700 DA  A   M . n 
A 1 3   DC  3   701 701 DC  C   M . n 
A 1 4   DG  4   702 702 DG  G   M . n 
A 1 5   DC  5   703 703 DC  C   M . n 
A 1 6   DA  6   704 704 DA  A   M . n 
A 1 7   DA  7   705 705 DA  A   M . n 
A 1 8   DC  8   706 706 DC  C   M . n 
A 1 9   DC  9   707 707 DC  C   M . n 
A 1 10  DG  10  708 708 DG  G   M . n 
A 1 11  DG  11  709 709 DG  G   M . n 
A 1 12  DT  12  710 710 DT  T   M . n 
A 1 13  DT  13  711 711 DT  T   M . n 
A 1 14  DG  14  712 712 DG  G   M . n 
A 1 15  DC  15  713 713 DC  C   M . n 
A 1 16  DG  16  714 714 DG  G   M . n 
A 1 17  DT  17  715 715 DT  T   M . n 
B 2 1   ALA 1   2   ?   ?   ?   A . n 
B 2 2   THR 2   3   3   THR THR A . n 
B 2 3   ILE 3   4   4   ILE ILE A . n 
B 2 4   LYS 4   5   5   LYS LYS A . n 
B 2 5   ASP 5   6   6   ASP ASP A . n 
B 2 6   VAL 6   7   7   VAL VAL A . n 
B 2 7   ALA 7   8   8   ALA ALA A . n 
B 2 8   LYS 8   9   9   LYS LYS A . n 
B 2 9   ARG 9   10  10  ARG ARG A . n 
B 2 10  ALA 10  11  11  ALA ALA A . n 
B 2 11  ASN 11  12  12  ASN ASN A . n 
B 2 12  VAL 12  13  13  VAL VAL A . n 
B 2 13  SER 13  14  14  SER SER A . n 
B 2 14  THR 14  15  15  THR THR A . n 
B 2 15  THR 15  16  16  THR THR A . n 
B 2 16  THR 16  17  17  THR THR A . n 
B 2 17  VAL 17  18  18  VAL VAL A . n 
B 2 18  SER 18  19  19  SER SER A . n 
B 2 19  HIS 19  20  20  HIS HIS A . n 
B 2 20  VAL 20  21  21  VAL VAL A . n 
B 2 21  ILE 21  22  22  ILE ILE A . n 
B 2 22  ASN 22  23  23  ASN ASN A . n 
B 2 23  LYS 23  24  24  LYS LYS A . n 
B 2 24  THR 24  25  25  THR THR A . n 
B 2 25  ARG 25  26  26  ARG ARG A . n 
B 2 26  PHE 26  27  27  PHE PHE A . n 
B 2 27  VAL 27  28  28  VAL VAL A . n 
B 2 28  ALA 28  29  29  ALA ALA A . n 
B 2 29  GLU 29  30  30  GLU GLU A . n 
B 2 30  GLU 30  31  31  GLU GLU A . n 
B 2 31  THR 31  32  32  THR THR A . n 
B 2 32  ARG 32  33  33  ARG ARG A . n 
B 2 33  ASN 33  34  34  ASN ASN A . n 
B 2 34  ALA 34  35  35  ALA ALA A . n 
B 2 35  VAL 35  36  36  VAL VAL A . n 
B 2 36  TRP 36  37  37  TRP TRP A . n 
B 2 37  ALA 37  38  38  ALA ALA A . n 
B 2 38  ALA 38  39  39  ALA ALA A . n 
B 2 39  ILE 39  40  40  ILE ILE A . n 
B 2 40  LYS 40  41  41  LYS LYS A . n 
B 2 41  GLU 41  42  42  GLU GLU A . n 
B 2 42  LEU 42  43  43  LEU LEU A . n 
B 2 43  HIS 43  44  44  HIS HIS A . n 
B 2 44  TYR 44  45  45  TYR TYR A . n 
B 2 45  SER 45  46  46  SER SER A . n 
B 2 46  PRO 46  47  47  PRO PRO A . n 
B 2 47  SER 47  48  48  SER SER A . n 
B 2 48  ALA 48  49  49  ALA ALA A . n 
B 2 49  VAL 49  50  50  VAL VAL A . n 
B 2 50  ALA 50  51  51  ALA ALA A . n 
B 2 51  ARG 51  52  52  ARG ARG A . n 
B 2 52  SER 52  53  53  SER SER A . n 
B 2 53  LEU 53  54  54  LEU LEU A . n 
B 2 54  LYS 54  55  55  LYS LYS A . n 
B 2 55  VAL 55  56  56  VAL VAL A . n 
B 2 56  ASN 56  57  57  ASN ASN A . n 
B 2 57  HIS 57  58  58  HIS HIS A . n 
B 2 58  THR 58  59  59  THR THR A . n 
B 2 59  LYS 59  60  60  LYS LYS A . n 
B 2 60  SER 60  61  61  SER SER A . n 
B 2 61  ILE 61  62  62  ILE ILE A . n 
B 2 62  GLY 62  63  63  GLY GLY A . n 
B 2 63  LEU 63  64  64  LEU LEU A . n 
B 2 64  LEU 64  65  65  LEU LEU A . n 
B 2 65  ALA 65  66  66  ALA ALA A . n 
B 2 66  THR 66  67  67  THR THR A . n 
B 2 67  SER 67  68  68  SER SER A . n 
B 2 68  SER 68  69  69  SER SER A . n 
B 2 69  GLU 69  70  70  GLU GLU A . n 
B 2 70  ALA 70  71  71  ALA ALA A . n 
B 2 71  ALA 71  72  72  ALA ALA A . n 
B 2 72  TYR 72  73  73  TYR TYR A . n 
B 2 73  PHE 73  74  74  PHE PHE A . n 
B 2 74  ALA 74  75  75  ALA ALA A . n 
B 2 75  GLU 75  76  76  GLU GLU A . n 
B 2 76  ILE 76  77  77  ILE ILE A . n 
B 2 77  ILE 77  78  78  ILE ILE A . n 
B 2 78  GLU 78  79  79  GLU GLU A . n 
B 2 79  ALA 79  80  80  ALA ALA A . n 
B 2 80  VAL 80  81  81  VAL VAL A . n 
B 2 81  GLU 81  82  82  GLU GLU A . n 
B 2 82  LYS 82  83  83  LYS LYS A . n 
B 2 83  ASN 83  84  84  ASN ASN A . n 
B 2 84  CYS 84  85  85  CYS CYS A . n 
B 2 85  PHE 85  86  86  PHE PHE A . n 
B 2 86  GLN 86  87  87  GLN GLN A . n 
B 2 87  LYS 87  88  88  LYS LYS A . n 
B 2 88  GLY 88  89  89  GLY GLY A . n 
B 2 89  TYR 89  90  90  TYR TYR A . n 
B 2 90  THR 90  91  91  THR THR A . n 
B 2 91  LEU 91  92  92  LEU LEU A . n 
B 2 92  ILE 92  93  93  ILE ILE A . n 
B 2 93  LEU 93  94  94  LEU LEU A . n 
B 2 94  GLY 94  95  95  GLY GLY A . n 
B 2 95  ASN 95  96  96  ASN ASN A . n 
B 2 96  ALA 96  97  97  ALA ALA A . n 
B 2 97  TRP 97  98  98  TRP TRP A . n 
B 2 98  ASN 98  99  99  ASN ASN A . n 
B 2 99  ASN 99  100 100 ASN ASN A . n 
B 2 100 LEU 100 101 101 LEU LEU A . n 
B 2 101 GLU 101 102 102 GLU GLU A . n 
B 2 102 LYS 102 103 103 LYS LYS A . n 
B 2 103 GLN 103 104 104 GLN GLN A . n 
B 2 104 ARG 104 105 105 ARG ARG A . n 
B 2 105 ALA 105 106 106 ALA ALA A . n 
B 2 106 TYR 106 107 107 TYR TYR A . n 
B 2 107 LEU 107 108 108 LEU LEU A . n 
B 2 108 SER 108 109 109 SER SER A . n 
B 2 109 MET 109 110 110 MET MET A . n 
B 2 110 MET 110 111 111 MET MET A . n 
B 2 111 ALA 111 112 112 ALA ALA A . n 
B 2 112 GLN 112 113 113 GLN GLN A . n 
B 2 113 LYS 113 114 114 LYS LYS A . n 
B 2 114 ARG 114 115 115 ARG ARG A . n 
B 2 115 VAL 115 116 116 VAL VAL A . n 
B 2 116 ASP 116 117 117 ASP ASP A . n 
B 2 117 GLY 117 118 118 GLY GLY A . n 
B 2 118 LEU 118 119 119 LEU LEU A . n 
B 2 119 LEU 119 120 120 LEU LEU A . n 
B 2 120 VAL 120 121 121 VAL VAL A . n 
B 2 121 MET 121 122 122 MET MET A . n 
B 2 122 CYS 122 123 123 CYS CYS A . n 
B 2 123 SER 123 124 124 SER SER A . n 
B 2 124 GLU 124 125 125 GLU GLU A . n 
B 2 125 TYR 125 126 126 TYR TYR A . n 
B 2 126 PRO 126 127 127 PRO PRO A . n 
B 2 127 GLU 127 128 128 GLU GLU A . n 
B 2 128 PRO 128 129 129 PRO PRO A . n 
B 2 129 LEU 129 130 130 LEU LEU A . n 
B 2 130 LEU 130 131 131 LEU LEU A . n 
B 2 131 ALA 131 132 132 ALA ALA A . n 
B 2 132 MET 132 133 133 MET MET A . n 
B 2 133 LEU 133 134 134 LEU LEU A . n 
B 2 134 GLU 134 135 135 GLU GLU A . n 
B 2 135 GLU 135 136 136 GLU GLU A . n 
B 2 136 TYR 136 137 137 TYR TYR A . n 
B 2 137 ARG 137 138 138 ARG ARG A . n 
B 2 138 HIS 138 139 139 HIS HIS A . n 
B 2 139 ILE 139 140 140 ILE ILE A . n 
B 2 140 PRO 140 141 141 PRO PRO A . n 
B 2 141 MET 141 142 142 MET MET A . n 
B 2 142 VAL 142 143 143 VAL VAL A . n 
B 2 143 VAL 143 144 144 VAL VAL A . n 
B 2 144 MET 144 145 145 MET MET A . n 
B 2 145 ASP 145 146 146 ASP ASP A . n 
B 2 146 TRP 146 147 147 TRP TRP A . n 
B 2 147 GLY 147 148 148 GLY GLY A . n 
B 2 148 GLU 148 149 149 GLU GLU A . n 
B 2 149 ALA 149 150 150 ALA ALA A . n 
B 2 150 LYS 150 151 151 LYS LYS A . n 
B 2 151 ALA 151 152 152 ALA ALA A . n 
B 2 152 ASP 152 153 153 ASP ASP A . n 
B 2 153 PHE 153 154 154 PHE PHE A . n 
B 2 154 THR 154 155 155 THR THR A . n 
B 2 155 ASP 155 156 156 ASP ASP A . n 
B 2 156 ALA 156 157 157 ALA ALA A . n 
B 2 157 VAL 157 158 158 VAL VAL A . n 
B 2 158 ILE 158 159 159 ILE ILE A . n 
B 2 159 ASP 159 160 160 ASP ASP A . n 
B 2 160 ASN 160 161 161 ASN ASN A . n 
B 2 161 ALA 161 162 162 ALA ALA A . n 
B 2 162 PHE 162 163 163 PHE PHE A . n 
B 2 163 GLU 163 164 164 GLU GLU A . n 
B 2 164 GLY 164 165 165 GLY GLY A . n 
B 2 165 GLY 165 166 166 GLY GLY A . n 
B 2 166 TYR 166 167 167 TYR TYR A . n 
B 2 167 MET 167 168 168 MET MET A . n 
B 2 168 ALA 168 169 169 ALA ALA A . n 
B 2 169 GLY 169 170 170 GLY GLY A . n 
B 2 170 ARG 170 171 171 ARG ARG A . n 
B 2 171 TYR 171 172 172 TYR TYR A . n 
B 2 172 LEU 172 173 173 LEU LEU A . n 
B 2 173 ILE 173 174 174 ILE ILE A . n 
B 2 174 GLU 174 175 175 GLU GLU A . n 
B 2 175 ARG 175 176 176 ARG ARG A . n 
B 2 176 GLY 176 177 177 GLY GLY A . n 
B 2 177 HIS 177 178 178 HIS HIS A . n 
B 2 178 ARG 178 179 179 ARG ARG A . n 
B 2 179 GLU 179 180 180 GLU GLU A . n 
B 2 180 ILE 180 181 181 ILE ILE A . n 
B 2 181 GLY 181 182 182 GLY GLY A . n 
B 2 182 VAL 182 183 183 VAL VAL A . n 
B 2 183 ILE 183 184 184 ILE ILE A . n 
B 2 184 PRO 184 185 185 PRO PRO A . n 
B 2 185 GLY 185 186 186 GLY GLY A . n 
B 2 186 PRO 186 187 187 PRO PRO A . n 
B 2 187 LEU 187 188 188 LEU LEU A . n 
B 2 188 GLU 188 189 189 GLU GLU A . n 
B 2 189 ARG 189 190 190 ARG ARG A . n 
B 2 190 ASN 190 191 191 ASN ASN A . n 
B 2 191 THR 191 192 192 THR THR A . n 
B 2 192 GLY 192 193 193 GLY GLY A . n 
B 2 193 ALA 193 194 194 ALA ALA A . n 
B 2 194 GLY 194 195 195 GLY GLY A . n 
B 2 195 ARG 195 196 196 ARG ARG A . n 
B 2 196 LEU 196 197 197 LEU LEU A . n 
B 2 197 ALA 197 198 198 ALA ALA A . n 
B 2 198 GLY 198 199 199 GLY GLY A . n 
B 2 199 PHE 199 200 200 PHE PHE A . n 
B 2 200 MET 200 201 201 MET MET A . n 
B 2 201 LYS 201 202 202 LYS LYS A . n 
B 2 202 ALA 202 203 203 ALA ALA A . n 
B 2 203 MET 203 204 204 MET MET A . n 
B 2 204 GLU 204 205 205 GLU GLU A . n 
B 2 205 GLU 205 206 206 GLU GLU A . n 
B 2 206 ALA 206 207 207 ALA ALA A . n 
B 2 207 MET 207 208 208 MET MET A . n 
B 2 208 ILE 208 209 209 ILE ILE A . n 
B 2 209 LYS 209 210 210 LYS LYS A . n 
B 2 210 VAL 210 211 211 VAL VAL A . n 
B 2 211 PRO 211 212 212 PRO PRO A . n 
B 2 212 GLU 212 213 213 GLU GLU A . n 
B 2 213 SER 213 214 214 SER SER A . n 
B 2 214 TRP 214 215 215 TRP TRP A . n 
B 2 215 ILE 215 216 216 ILE ILE A . n 
B 2 216 VAL 216 217 217 VAL VAL A . n 
B 2 217 GLN 217 218 218 GLN GLN A . n 
B 2 218 GLY 218 219 219 GLY GLY A . n 
B 2 219 ASP 219 220 220 ASP ASP A . n 
B 2 220 PHE 220 221 221 PHE PHE A . n 
B 2 221 GLU 221 222 222 GLU GLU A . n 
B 2 222 PRO 222 223 223 PRO PRO A . n 
B 2 223 GLU 223 224 224 GLU GLU A . n 
B 2 224 SER 224 225 225 SER SER A . n 
B 2 225 GLY 225 226 226 GLY GLY A . n 
B 2 226 TYR 226 227 227 TYR TYR A . n 
B 2 227 ARG 227 228 228 ARG ARG A . n 
B 2 228 ALA 228 229 229 ALA ALA A . n 
B 2 229 MET 229 230 230 MET MET A . n 
B 2 230 GLN 230 231 231 GLN GLN A . n 
B 2 231 GLN 231 232 232 GLN GLN A . n 
B 2 232 ILE 232 233 233 ILE ILE A . n 
B 2 233 LEU 233 234 234 LEU LEU A . n 
B 2 234 SER 234 235 235 SER SER A . n 
B 2 235 GLN 235 236 236 GLN GLN A . n 
B 2 236 PRO 236 237 237 PRO PRO A . n 
B 2 237 HIS 237 238 238 HIS HIS A . n 
B 2 238 ARG 238 239 239 ARG ARG A . n 
B 2 239 PRO 239 240 240 PRO PRO A . n 
B 2 240 THR 240 241 241 THR THR A . n 
B 2 241 ALA 241 242 242 ALA ALA A . n 
B 2 242 VAL 242 243 243 VAL VAL A . n 
B 2 243 PHE 243 244 244 PHE PHE A . n 
B 2 244 CYS 244 245 245 CYS CYS A . n 
B 2 245 GLY 245 246 246 GLY GLY A . n 
B 2 246 GLY 246 247 247 GLY GLY A . n 
B 2 247 ASP 247 248 248 ASP ASP A . n 
B 2 248 ILE 248 249 249 ILE ILE A . n 
B 2 249 MET 249 250 250 MET MET A . n 
B 2 250 ALA 250 251 251 ALA ALA A . n 
B 2 251 MET 251 252 252 MET MET A . n 
B 2 252 GLY 252 253 253 GLY GLY A . n 
B 2 253 ALA 253 254 254 ALA ALA A . n 
B 2 254 LEU 254 255 255 LEU LEU A . n 
B 2 255 CYS 255 256 256 CYS CYS A . n 
B 2 256 ALA 256 257 257 ALA ALA A . n 
B 2 257 ALA 257 258 258 ALA ALA A . n 
B 2 258 ASP 258 259 259 ASP ASP A . n 
B 2 259 GLU 259 260 260 GLU GLU A . n 
B 2 260 MET 260 261 261 MET MET A . n 
B 2 261 GLY 261 262 262 GLY GLY A . n 
B 2 262 LEU 262 263 263 LEU LEU A . n 
B 2 263 ARG 263 264 264 ARG ARG A . n 
B 2 264 VAL 264 265 265 VAL VAL A . n 
B 2 265 PRO 265 266 266 PRO PRO A . n 
B 2 266 GLN 266 267 267 GLN GLN A . n 
B 2 267 ASP 267 268 268 ASP ASP A . n 
B 2 268 VAL 268 269 269 VAL VAL A . n 
B 2 269 SER 269 270 270 SER SER A . n 
B 2 270 LEU 270 271 271 LEU LEU A . n 
B 2 271 ILE 271 272 272 ILE ILE A . n 
B 2 272 GLY 272 273 273 GLY GLY A . n 
B 2 273 TYR 273 274 274 TYR TYR A . n 
B 2 274 ASP 274 275 275 ASP ASP A . n 
B 2 275 ASN 275 276 276 ASN ASN A . n 
B 2 276 VAL 276 277 277 VAL VAL A . n 
B 2 277 ARG 277 278 278 ARG ARG A . n 
B 2 278 ASN 278 279 279 ASN ASN A . n 
B 2 279 ALA 279 280 280 ALA ALA A . n 
B 2 280 ARG 280 281 281 ARG ARG A . n 
B 2 281 TYR 281 282 282 TYR TYR A . n 
B 2 282 PHE 282 283 283 PHE PHE A . n 
B 2 283 THR 283 284 284 THR THR A . n 
B 2 284 PRO 284 285 285 PRO PRO A . n 
B 2 285 ALA 285 286 286 ALA ALA A . n 
B 2 286 LEU 286 287 287 LEU LEU A . n 
B 2 287 THR 287 288 288 THR THR A . n 
B 2 288 THR 288 289 289 THR THR A . n 
B 2 289 ILE 289 290 290 ILE ILE A . n 
B 2 290 HIS 290 291 291 HIS HIS A . n 
B 2 291 GLN 291 292 292 GLN GLN A . n 
B 2 292 PRO 292 293 293 PRO PRO A . n 
B 2 293 LYS 293 294 294 LYS LYS A . n 
B 2 294 ASP 294 295 295 ASP ASP A . n 
B 2 295 SER 295 296 296 SER SER A . n 
B 2 296 LEU 296 297 297 LEU LEU A . n 
B 2 297 GLY 297 298 298 GLY GLY A . n 
B 2 298 GLU 298 299 299 GLU GLU A . n 
B 2 299 THR 299 300 300 THR THR A . n 
B 2 300 ALA 300 301 301 ALA ALA A . n 
B 2 301 PHE 301 302 302 PHE PHE A . n 
B 2 302 ASN 302 303 303 ASN ASN A . n 
B 2 303 MET 303 304 304 MET MET A . n 
B 2 304 LEU 304 305 305 LEU LEU A . n 
B 2 305 LEU 305 306 306 LEU LEU A . n 
B 2 306 ASP 306 307 307 ASP ASP A . n 
B 2 307 ARG 307 308 308 ARG ARG A . n 
B 2 308 ILE 308 309 309 ILE ILE A . n 
B 2 309 VAL 309 310 310 VAL VAL A . n 
B 2 310 ASN 310 311 311 ASN ASN A . n 
B 2 311 LYS 311 312 312 LYS LYS A . n 
B 2 312 ARG 312 313 313 ARG ARG A . n 
B 2 313 GLU 313 314 314 GLU GLU A . n 
B 2 314 GLU 314 315 315 GLU GLU A . n 
B 2 315 PRO 315 316 316 PRO PRO A . n 
B 2 316 GLN 316 317 317 GLN GLN A . n 
B 2 317 SER 317 318 318 SER SER A . n 
B 2 318 ILE 318 319 319 ILE ILE A . n 
B 2 319 GLU 319 320 320 GLU GLU A . n 
B 2 320 VAL 320 321 321 VAL VAL A . n 
B 2 321 HIS 321 322 322 HIS HIS A . n 
B 2 322 PRO 322 323 323 PRO PRO A . n 
B 2 323 ARG 323 324 324 ARG ARG A . n 
B 2 324 LEU 324 325 325 LEU LEU A . n 
B 2 325 ILE 325 326 326 ILE ILE A . n 
B 2 326 GLU 326 327 327 GLU GLU A . n 
B 2 327 ARG 327 328 328 ARG ARG A . n 
B 2 328 ARG 328 329 329 ARG ARG A . n 
B 2 329 SER 329 330 330 SER SER A . n 
B 2 330 VAL 330 331 331 VAL VAL A . n 
B 2 331 ALA 331 332 332 ALA ALA A . n 
B 2 332 ASP 332 333 333 ASP ASP A . n 
B 2 333 GLY 333 334 334 GLY GLY A . n 
B 2 334 PRO 334 335 335 PRO PRO A . n 
B 2 335 PHE 335 336 336 PHE PHE A . n 
B 2 336 ARG 336 337 337 ARG ARG A . n 
B 2 337 ASP 337 338 338 ASP ASP A . n 
B 2 338 TYR 338 339 339 TYR TYR A . n 
B 2 339 ARG 339 340 340 ARG ARG A . n 
B 2 340 ARG 340 341 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HPA 1 599 599 HPA HPA A . 
D 4 HOH 1 717 717 HOH HOH A . 
D 4 HOH 2 718 718 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-07 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT         refinement       . ? 1 
UCSD-system 'data reduction' . ? 2 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD1 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            TYR 
_pdbx_validate_rmsd_bond.auth_seq_id_1             172 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            TYR 
_pdbx_validate_rmsd_bond.auth_seq_id_2             172 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.483 
_pdbx_validate_rmsd_bond.bond_target_value         1.389 
_pdbx_validate_rmsd_bond.bond_deviation            0.094 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.015 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A THR 155 ? ? CA A THR 155 ? ? C   A THR 155 ? ? 94.71  111.60 -16.89 2.70 N 
2 1 CB A VAL 211 ? ? CA A VAL 211 ? ? C   A VAL 211 ? ? 125.96 111.40 14.56  1.90 N 
3 1 CB A LEU 263 ? ? CG A LEU 263 ? ? CD1 A LEU 263 ? ? 100.52 111.00 -10.48 1.70 N 
4 1 CB A VAL 269 ? ? CA A VAL 269 ? ? C   A VAL 269 ? ? 98.68  111.40 -12.72 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 19  ? ? -55.44  -74.60  
2  1 HIS A 20  ? ? -33.32  -38.90  
3  1 LYS A 24  ? ? 37.02   49.47   
4  1 ASN A 57  ? ? 73.90   38.65   
5  1 ALA A 71  ? ? -39.28  116.61  
6  1 SER A 124 ? ? 65.11   -77.68  
7  1 GLU A 136 ? ? -61.00  4.86    
8  1 ARG A 179 ? ? -153.51 -9.84   
9  1 ALA A 194 ? ? -33.05  -39.84  
10 1 MET A 208 ? ? 45.80   28.65   
11 1 PHE A 221 ? ? 81.15   1.06    
12 1 TYR A 227 ? ? -47.21  -74.51  
13 1 TYR A 274 ? ? -160.04 118.40  
14 1 ASP A 275 ? ? 144.34  -49.20  
15 1 ASN A 276 ? ? 70.73   54.39   
16 1 ILE A 309 ? ? -63.84  -80.65  
17 1 ASN A 311 ? ? -66.43  13.32   
18 1 ARG A 328 ? ? -115.76 -122.65 
19 1 ARG A 329 ? ? -143.36 48.79   
20 1 PRO A 335 ? ? -37.73  -36.40  
21 1 TYR A 339 ? ? -91.39  55.35   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 2   ? B ALA 1   
2 1 Y 1 A ARG 341 ? B ARG 340 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1QP0 'double helix'        
1QP0 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 A DT 17 4_555 0.119  0.040  -0.336 -18.841 1.435   -6.822 1  M_DA700:DT715_M M 700 ? M 715 ? 20 1 
1 A DC 3  1_555 A DG 16 4_555 0.551  -0.321 0.546  -8.690  3.100   -2.334 2  M_DC701:DG714_M M 701 ? M 714 ? 19 1 
1 A DG 4  1_555 A DC 15 4_555 0.141  -0.210 0.301  4.293   4.121   -2.357 3  M_DG702:DC713_M M 702 ? M 713 ? 19 1 
1 A DC 5  1_555 A DG 14 4_555 -0.041 -0.265 0.075  3.345   -20.827 0.106  4  M_DC703:DG712_M M 703 ? M 712 ? 19 1 
1 A DA 6  1_555 A DT 13 4_555 0.050  -0.151 0.012  -0.495  -1.943  4.109  5  M_DA704:DT711_M M 704 ? M 711 ? 20 1 
1 A DA 7  1_555 A DT 12 4_555 0.135  0.011  -0.064 6.891   -10.150 2.341  6  M_DA705:DT710_M M 705 ? M 710 ? 20 1 
1 A DC 8  1_555 A DG 11 4_555 -0.108 -0.140 -0.168 18.974  -12.999 -0.010 7  M_DC706:DG709_M M 706 ? M 709 ? 19 1 
1 A DC 9  1_555 A DG 10 4_555 0.300  -0.191 -0.479 21.139  -15.837 0.129  8  M_DC707:DG708_M M 707 ? M 708 ? 19 1 
1 A DG 10 1_555 A DC 9  4_555 -0.300 -0.191 -0.479 -21.139 -15.837 0.129  9  M_DG708:DC707_M M 708 ? M 707 ? 19 1 
1 A DG 11 1_555 A DC 8  4_555 0.108  -0.140 -0.168 -18.974 -12.999 -0.010 10 M_DG709:DC706_M M 709 ? M 706 ? 19 1 
1 A DT 12 1_555 A DA 7  4_555 -0.135 0.011  -0.064 -6.891  -10.150 2.341  11 M_DT710:DA705_M M 710 ? M 705 ? 20 1 
1 A DT 13 1_555 A DA 6  4_555 -0.050 -0.151 0.012  0.495   -1.943  4.109  12 M_DT711:DA704_M M 711 ? M 704 ? 20 1 
1 A DG 14 1_555 A DC 5  4_555 0.041  -0.265 0.075  -3.345  -20.827 0.106  13 M_DG712:DC703_M M 712 ? M 703 ? 19 1 
1 A DC 15 1_555 A DG 4  4_555 -0.141 -0.210 0.301  -4.293  4.121   -2.357 14 M_DC713:DG702_M M 713 ? M 702 ? 19 1 
1 A DG 16 1_555 A DC 3  4_555 -0.551 -0.321 0.546  8.690   3.100   -2.334 15 M_DG714:DC701_M M 714 ? M 701 ? 19 1 
1 A DT 17 1_555 A DA 2  4_555 -0.119 0.040  -0.336 18.841  1.435   -6.822 16 M_DT715:DA700_M M 715 ? M 700 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 A DT 17 4_555 A DC 3  1_555 A DG 16 4_555 0.456  -0.926 3.197 -8.911 5.186  24.878 -3.225 -3.103 2.637 11.432  
19.642  26.899 1  MM_DA700DC701:DG714DT715_MM M 700 ? M 715 ? M 701 ? M 714 ? 
1 A DC 3  1_555 A DG 16 4_555 A DG 4  1_555 A DC 15 4_555 -1.085 -0.836 3.134 0.213  -6.990 34.910 -0.369 1.805  3.230 -11.508 
-0.351  35.582 2  MM_DC701DG702:DC713DG714_MM M 701 ? M 714 ? M 702 ? M 713 ? 
1 A DG 4  1_555 A DC 15 4_555 A DC 5  1_555 A DG 14 4_555 -0.846 -0.146 3.323 3.769  0.663  35.736 -0.332 1.910  3.217 1.076   
-6.120  35.934 3  MM_DG702DC703:DG712DC713_MM M 702 ? M 713 ? M 703 ? M 712 ? 
1 A DC 5  1_555 A DG 14 4_555 A DA 6  1_555 A DT 13 4_555 1.294  1.166  3.672 -0.445 4.227  34.413 1.216  -2.250 3.768 7.110   
0.748   34.666 4  MM_DC703DA704:DT711DG712_MM M 703 ? M 712 ? M 704 ? M 711 ? 
1 A DA 6  1_555 A DT 13 4_555 A DA 7  1_555 A DT 12 4_555 -0.516 0.548  3.275 -1.063 0.347  35.509 0.847  0.690  3.293 0.568   
1.743   35.526 5  MM_DA704DA705:DT710DT711_MM M 704 ? M 711 ? M 705 ? M 710 ? 
1 A DA 7  1_555 A DT 12 4_555 A DC 8  1_555 A DG 11 4_555 0.276  -0.508 3.045 -4.068 6.070  32.260 -1.831 -1.114 2.850 10.753  
7.206   33.056 6  MM_DA705DC706:DG709DT710_MM M 705 ? M 710 ? M 706 ? M 709 ? 
1 A DC 8  1_555 A DG 11 4_555 A DC 9  1_555 A DG 10 4_555 -0.522 0.450  3.457 5.888  -3.634 36.403 1.216  1.643  3.277 -5.752  
-9.321  37.033 7  MM_DC706DC707:DG708DG709_MM M 706 ? M 709 ? M 707 ? M 708 ? 
1 A DC 9  1_555 A DG 10 4_555 A DG 10 1_555 A DC 9  4_555 0.000  1.491  5.204 0.000  55.858 4.446  -5.391 0.000  1.915 85.815  
0.000   56.020 8  MM_DC707DG708:DC707DG708_MM M 707 ? M 708 ? M 708 ? M 707 ? 
1 A DG 10 1_555 A DC 9  4_555 A DG 11 1_555 A DC 8  4_555 0.522  0.450  3.457 -5.888 -3.634 36.403 1.216  -1.643 3.277 -5.752  
9.321   37.033 9  MM_DG708DG709:DC706DC707_MM M 708 ? M 707 ? M 709 ? M 706 ? 
1 A DG 11 1_555 A DC 8  4_555 A DT 12 1_555 A DA 7  4_555 -0.276 -0.508 3.045 4.068  6.070  32.260 -1.831 1.114  2.850 10.753  
-7.206  33.056 10 MM_DG709DT710:DA705DC706_MM M 709 ? M 706 ? M 710 ? M 705 ? 
1 A DT 12 1_555 A DA 7  4_555 A DT 13 1_555 A DA 6  4_555 0.516  0.548  3.275 1.063  0.347  35.509 0.847  -0.690 3.293 0.568   
-1.743  35.526 11 MM_DT710DT711:DA704DA705_MM M 710 ? M 705 ? M 711 ? M 704 ? 
1 A DT 13 1_555 A DA 6  4_555 A DG 14 1_555 A DC 5  4_555 -1.294 1.166  3.672 0.445  4.227  34.413 1.216  2.250  3.768 7.110   
-0.748  34.666 12 MM_DT711DG712:DC703DA704_MM M 711 ? M 704 ? M 712 ? M 703 ? 
1 A DG 14 1_555 A DC 5  4_555 A DC 15 1_555 A DG 4  4_555 0.846  -0.146 3.323 -3.769 0.663  35.736 -0.332 -1.910 3.217 1.076   
6.120   35.934 13 MM_DG712DC713:DG702DC703_MM M 712 ? M 703 ? M 713 ? M 702 ? 
1 A DC 15 1_555 A DG 4  4_555 A DG 16 1_555 A DC 3  4_555 1.085  -0.836 3.134 -0.213 -6.990 34.910 -0.369 -1.805 3.230 -11.508 
0.351   35.582 14 MM_DC713DG714:DC701DG702_MM M 713 ? M 702 ? M 714 ? M 701 ? 
1 A DG 16 1_555 A DC 3  4_555 A DT 17 1_555 A DA 2  4_555 -0.456 -0.926 3.197 8.911  5.186  24.878 -3.225 3.103  2.637 11.432  
-19.642 26.899 15 MM_DG714DT715:DA700DC701_MM M 714 ? M 701 ? M 715 ? M 700 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 HYPOXANTHINE HPA 
4 water        HOH 
#