data_1QP7
# 
_entry.id   1QP7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1QP7         pdb_00001qp7 10.2210/pdb1qp7/pdb 
NDB   PD0059       ?            ?                   
RCSB  RCSB009136   ?            ?                   
WWPDB D_1000009136 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1BDH . unspecified 
PDB 1QPZ . unspecified 
PDB 1QP4 . unspecified 
PDB 1QP0 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QP7 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Glasfeld, A.'     1 
'Koehler, A.N.'    2 
'Schumacher, M.A.' 3 
'Brennan, R.G.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.' 
J.Mol.Biol. 291 347 361 1999 JMOBAK UK 0022-2836 0070 ? 10438625 10.1006/jmbi.1999.2946 
1       'Crystal Structure of LacI Member, PurR, Bound to DNA: Minor Groove Binding by Alpha Helices' Science     266 763 ?   1994 
SCIEAS US 0036-8075 0038 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Glasfeld, A.'     1 ? 
primary 'Koehler, A.N.'    2 ? 
primary 'Schumacher, M.A.' 3 ? 
primary 'Brennan, R.G.'    4 ? 
1       'Schumacher, M.A.' 5 ? 
1       'Choi, K.Y.'       6 ? 
1       'Zalkin, H.'       7 ? 
1       'Brennan, R.G.'    8 ? 
# 
_cell.entry_id           1QP7 
_cell.length_a           176.670 
_cell.length_b           95.490 
_cell.length_c           80.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1QP7 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*CP*CP*GP*GP*TP*TP*GP*CP*GP*T)-3')
;
5203.372  1 ? ?    ? ? 
2 polymer     man 'PROTEIN (PURINE NUCLEOTIDE SYNTHESIS REPRESSOR)'                   38033.492 1 ? K55A ? ? 
3 non-polymer syn HYPOXANTHINE                                                        136.111   1 ? ?    ? ? 
4 water       nat water                                                               18.015    2 ? ?    ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        PURA 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DG)(DC)(DA)(DA)(DC)(DC)(DG)(DG)(DT)(DT)(DG)(DC)(DG)(DT)' TACGCAACCGGTTGCGT M ? 
2 'polypeptide(L)'        no no 
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DC  n 
1 4   DG  n 
1 5   DC  n 
1 6   DA  n 
1 7   DA  n 
1 8   DC  n 
1 9   DC  n 
1 10  DG  n 
1 11  DG  n 
1 12  DT  n 
1 13  DT  n 
1 14  DG  n 
1 15  DC  n 
1 16  DG  n 
1 17  DT  n 
2 1   ALA n 
2 2   THR n 
2 3   ILE n 
2 4   LYS n 
2 5   ASP n 
2 6   VAL n 
2 7   ALA n 
2 8   LYS n 
2 9   ARG n 
2 10  ALA n 
2 11  ASN n 
2 12  VAL n 
2 13  SER n 
2 14  THR n 
2 15  THR n 
2 16  THR n 
2 17  VAL n 
2 18  SER n 
2 19  HIS n 
2 20  VAL n 
2 21  ILE n 
2 22  ASN n 
2 23  LYS n 
2 24  THR n 
2 25  ARG n 
2 26  PHE n 
2 27  VAL n 
2 28  ALA n 
2 29  GLU n 
2 30  GLU n 
2 31  THR n 
2 32  ARG n 
2 33  ASN n 
2 34  ALA n 
2 35  VAL n 
2 36  TRP n 
2 37  ALA n 
2 38  ALA n 
2 39  ILE n 
2 40  LYS n 
2 41  GLU n 
2 42  LEU n 
2 43  HIS n 
2 44  TYR n 
2 45  SER n 
2 46  PRO n 
2 47  SER n 
2 48  ALA n 
2 49  VAL n 
2 50  ALA n 
2 51  ARG n 
2 52  SER n 
2 53  LEU n 
2 54  ALA n 
2 55  VAL n 
2 56  ASN n 
2 57  HIS n 
2 58  THR n 
2 59  LYS n 
2 60  SER n 
2 61  ILE n 
2 62  GLY n 
2 63  LEU n 
2 64  LEU n 
2 65  ALA n 
2 66  THR n 
2 67  SER n 
2 68  SER n 
2 69  GLU n 
2 70  ALA n 
2 71  ALA n 
2 72  TYR n 
2 73  PHE n 
2 74  ALA n 
2 75  GLU n 
2 76  ILE n 
2 77  ILE n 
2 78  GLU n 
2 79  ALA n 
2 80  VAL n 
2 81  GLU n 
2 82  LYS n 
2 83  ASN n 
2 84  CYS n 
2 85  PHE n 
2 86  GLN n 
2 87  LYS n 
2 88  GLY n 
2 89  TYR n 
2 90  THR n 
2 91  LEU n 
2 92  ILE n 
2 93  LEU n 
2 94  GLY n 
2 95  ASN n 
2 96  ALA n 
2 97  TRP n 
2 98  ASN n 
2 99  ASN n 
2 100 LEU n 
2 101 GLU n 
2 102 LYS n 
2 103 GLN n 
2 104 ARG n 
2 105 ALA n 
2 106 TYR n 
2 107 LEU n 
2 108 SER n 
2 109 MET n 
2 110 MET n 
2 111 ALA n 
2 112 GLN n 
2 113 LYS n 
2 114 ARG n 
2 115 VAL n 
2 116 ASP n 
2 117 GLY n 
2 118 LEU n 
2 119 LEU n 
2 120 VAL n 
2 121 MET n 
2 122 CYS n 
2 123 SER n 
2 124 GLU n 
2 125 TYR n 
2 126 PRO n 
2 127 GLU n 
2 128 PRO n 
2 129 LEU n 
2 130 LEU n 
2 131 ALA n 
2 132 MET n 
2 133 LEU n 
2 134 GLU n 
2 135 GLU n 
2 136 TYR n 
2 137 ARG n 
2 138 HIS n 
2 139 ILE n 
2 140 PRO n 
2 141 MET n 
2 142 VAL n 
2 143 VAL n 
2 144 MET n 
2 145 ASP n 
2 146 TRP n 
2 147 GLY n 
2 148 GLU n 
2 149 ALA n 
2 150 LYS n 
2 151 ALA n 
2 152 ASP n 
2 153 PHE n 
2 154 THR n 
2 155 ASP n 
2 156 ALA n 
2 157 VAL n 
2 158 ILE n 
2 159 ASP n 
2 160 ASN n 
2 161 ALA n 
2 162 PHE n 
2 163 GLU n 
2 164 GLY n 
2 165 GLY n 
2 166 TYR n 
2 167 MET n 
2 168 ALA n 
2 169 GLY n 
2 170 ARG n 
2 171 TYR n 
2 172 LEU n 
2 173 ILE n 
2 174 GLU n 
2 175 ARG n 
2 176 GLY n 
2 177 HIS n 
2 178 ARG n 
2 179 GLU n 
2 180 ILE n 
2 181 GLY n 
2 182 VAL n 
2 183 ILE n 
2 184 PRO n 
2 185 GLY n 
2 186 PRO n 
2 187 LEU n 
2 188 GLU n 
2 189 ARG n 
2 190 ASN n 
2 191 THR n 
2 192 GLY n 
2 193 ALA n 
2 194 GLY n 
2 195 ARG n 
2 196 LEU n 
2 197 ALA n 
2 198 GLY n 
2 199 PHE n 
2 200 MET n 
2 201 LYS n 
2 202 ALA n 
2 203 MET n 
2 204 GLU n 
2 205 GLU n 
2 206 ALA n 
2 207 MET n 
2 208 ILE n 
2 209 LYS n 
2 210 VAL n 
2 211 PRO n 
2 212 GLU n 
2 213 SER n 
2 214 TRP n 
2 215 ILE n 
2 216 VAL n 
2 217 GLN n 
2 218 GLY n 
2 219 ASP n 
2 220 PHE n 
2 221 GLU n 
2 222 PRO n 
2 223 GLU n 
2 224 SER n 
2 225 GLY n 
2 226 TYR n 
2 227 ARG n 
2 228 ALA n 
2 229 MET n 
2 230 GLN n 
2 231 GLN n 
2 232 ILE n 
2 233 LEU n 
2 234 SER n 
2 235 GLN n 
2 236 PRO n 
2 237 HIS n 
2 238 ARG n 
2 239 PRO n 
2 240 THR n 
2 241 ALA n 
2 242 VAL n 
2 243 PHE n 
2 244 CYS n 
2 245 GLY n 
2 246 GLY n 
2 247 ASP n 
2 248 ILE n 
2 249 MET n 
2 250 ALA n 
2 251 MET n 
2 252 GLY n 
2 253 ALA n 
2 254 LEU n 
2 255 CYS n 
2 256 ALA n 
2 257 ALA n 
2 258 ASP n 
2 259 GLU n 
2 260 MET n 
2 261 GLY n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 PRO n 
2 266 GLN n 
2 267 ASP n 
2 268 VAL n 
2 269 SER n 
2 270 LEU n 
2 271 ILE n 
2 272 GLY n 
2 273 TYR n 
2 274 ASP n 
2 275 ASN n 
2 276 VAL n 
2 277 ARG n 
2 278 ASN n 
2 279 ALA n 
2 280 ARG n 
2 281 TYR n 
2 282 PHE n 
2 283 THR n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 THR n 
2 288 THR n 
2 289 ILE n 
2 290 HIS n 
2 291 GLN n 
2 292 PRO n 
2 293 LYS n 
2 294 ASP n 
2 295 SER n 
2 296 LEU n 
2 297 GLY n 
2 298 GLU n 
2 299 THR n 
2 300 ALA n 
2 301 PHE n 
2 302 ASN n 
2 303 MET n 
2 304 LEU n 
2 305 LEU n 
2 306 ASP n 
2 307 ARG n 
2 308 ILE n 
2 309 VAL n 
2 310 ASN n 
2 311 LYS n 
2 312 ARG n 
2 313 GLU n 
2 314 GLU n 
2 315 PRO n 
2 316 GLN n 
2 317 SER n 
2 318 ILE n 
2 319 GLU n 
2 320 VAL n 
2 321 HIS n 
2 322 PRO n 
2 323 ARG n 
2 324 LEU n 
2 325 ILE n 
2 326 GLU n 
2 327 ARG n 
2 328 ARG n 
2 329 SER n 
2 330 VAL n 
2 331 ALA n 
2 332 ASP n 
2 333 GLY n 
2 334 PRO n 
2 335 PHE n 
2 336 ARG n 
2 337 ASP n 
2 338 TYR n 
2 339 ARG n 
2 340 ARG n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 PURR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 PURR 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 LAMBDA DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET24A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PDNA100\:K55A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP PURR_ECOLI 2 P0ACP7 ? ? ? 
2 PDB 1QP7       1 1QP7   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QP7 A 1 ? 340 ? P0ACP7 1   ? 340 ? 2   341 
2 2 1QP7 M 1 ? 17  ? 1QP7   699 ? 715 ? 699 715 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1QP7 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      54 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P0ACP7 
_struct_ref_seq_dif.db_mon_id                    LYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          54 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            55 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
HPA non-polymer         . HYPOXANTHINE                         ? 'C5 H4 N4 O'      136.111 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1QP7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.90 
_exptl_crystal.density_percent_sol   68.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, (NH4)3PO4, [CO(NH3)6]CL3, NA2SO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 '[CO(NH3)6]CL3' ? ? ? 
1 2 1 NA2SO4          ? ? ? 
1 3 1 '(NH4)3PO4'     ? ? ? 
1 4 1 'PEG 4000'      ? ? ? 
1 5 2 NA2SO4          ? ? ? 
1 6 2 '(NH4)3PO4'     ? ? ? 
1 7 2 'PEG 4000'      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'UCSD MARK III' 
_diffrn_detector.pdbx_collection_date   1996-01-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QP7 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10.0 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   14777 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98. 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              7.6500000 
_reflns.pdbx_netI_over_sigmaI        9.63 
_reflns.B_iso_Wilson_estimate        44.7 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.12 
_reflns_shell.percent_possible_all   76.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.50 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1QP7 
_refine.ls_number_reflns_obs                     14777 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1680000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       
;DNA BASE GEOMETRIES TAKEN FROM CLOWNEY ET AL. (1996) J. AM. CHEM. SOC., VOL. 
118, PP. 509-518. SUGAR PHOSPHATE GEOMETRIES TAKEN FROM GELBIN ET AL. (1996) 
J. AM. CHEM. SOC., VOL. 118, PP. 519-529.
;
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2648 
_refine_hist.pdbx_number_atoms_nucleic_acid   345 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               3005 
_refine_hist.d_res_high                       2.9 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.015 ? 2.1 ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.8   ? 1.8 ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ?   ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QP7 
_struct.title                     'PURINE REPRESSOR MUTANT-HYPOXANTHINE-PALINDROMIC OPERATOR COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QP7 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'TRANSCRIPTION REGULATION, DNA-BINDING, REPRESSOR, PURINE BIOSYNTHESIS, COMPLEX (DNA-BINDING PROTEIN-DNA), TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE B 3   ? ALA B 10  ? ILE A 4   ALA A 11  1 ? 8  
HELX_P HELX_P2  2  THR B 14  ? ASN B 22  ? THR A 15  ASN A 23  1 ? 9  
HELX_P HELX_P3  3  GLU B 29  ? LEU B 42  ? GLU A 30  LEU A 43  1 ? 14 
HELX_P HELX_P4  4  ALA B 48  ? VAL B 55  ? ALA A 49  VAL A 56  1 ? 8  
HELX_P HELX_P5  5  ALA B 54  ? LYS B 87  ? ALA A 55  LYS A 88  1 ? 34 
HELX_P HELX_P6  6  LEU B 100 ? GLN B 112 ? LEU A 101 GLN A 113 1 ? 13 
HELX_P HELX_P7  7  GLU B 127 ? TYR B 136 ? GLU A 128 TYR A 137 1 ? 10 
HELX_P HELX_P8  8  ALA B 161 ? ARG B 175 ? ALA A 162 ARG A 176 1 ? 15 
HELX_P HELX_P9  9  ASN B 190 ? ALA B 206 ? ASN A 191 ALA A 207 1 ? 17 
HELX_P HELX_P10 10 GLU B 212 ? TRP B 214 ? GLU A 213 TRP A 215 5 ? 3  
HELX_P HELX_P11 11 PRO B 222 ? LEU B 233 ? PRO A 223 LEU A 234 1 ? 12 
HELX_P HELX_P12 12 ASP B 247 ? GLU B 259 ? ASP A 248 GLU A 260 1 ? 13 
HELX_P HELX_P13 13 ALA B 279 ? TYR B 281 ? ALA A 280 TYR A 282 5 ? 3  
HELX_P HELX_P14 14 LYS B 293 ? VAL B 309 ? LYS A 294 VAL A 310 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 A DT 17 N3 ? ? M DA 700 M DT 715 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 A DT 17 O4 ? ? M DA 700 M DT 715 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DC 3  N3 ? ? ? 1_555 A DG 16 N1 ? ? M DC 701 M DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DC 3  N4 ? ? ? 1_555 A DG 16 O6 ? ? M DC 701 M DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DC 3  O2 ? ? ? 1_555 A DG 16 N2 ? ? M DC 701 M DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DG 4  N1 ? ? ? 1_555 A DC 15 N3 ? ? M DG 702 M DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DG 4  N2 ? ? ? 1_555 A DC 15 O2 ? ? M DG 702 M DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DG 4  O6 ? ? ? 1_555 A DC 15 N4 ? ? M DG 702 M DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DC 5  N3 ? ? ? 1_555 A DG 14 N1 ? ? M DC 703 M DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DC 5  N4 ? ? ? 1_555 A DG 14 O6 ? ? M DC 703 M DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DC 5  O2 ? ? ? 1_555 A DG 14 N2 ? ? M DC 703 M DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DA 6  N1 ? ? ? 1_555 A DT 13 N3 ? ? M DA 704 M DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DA 6  N6 ? ? ? 1_555 A DT 13 O4 ? ? M DA 704 M DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 7  N1 ? ? ? 1_555 A DT 12 N3 ? ? M DA 705 M DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DA 7  N6 ? ? ? 1_555 A DT 12 O4 ? ? M DA 705 M DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 8  N3 ? ? ? 1_555 A DG 11 N1 ? ? M DC 706 M DG 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 8  N4 ? ? ? 1_555 A DG 11 O6 ? ? M DC 706 M DG 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 8  O2 ? ? ? 1_555 A DG 11 N2 ? ? M DC 706 M DG 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DC 9  N3 ? ? ? 1_555 A DG 10 N1 ? ? M DC 707 M DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DC 9  N4 ? ? ? 1_555 A DG 10 O6 ? ? M DC 707 M DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DC 9  O2 ? ? ? 1_555 A DG 10 N2 ? ? M DC 707 M DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DG 10 N1 ? ? ? 1_555 A DC 9  N3 ? ? M DG 708 M DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DG 10 N2 ? ? ? 1_555 A DC 9  O2 ? ? M DG 708 M DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DG 10 O6 ? ? ? 1_555 A DC 9  N4 ? ? M DG 708 M DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DG 11 N1 ? ? ? 1_555 A DC 8  N3 ? ? M DG 709 M DC 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DG 11 N2 ? ? ? 1_555 A DC 8  O2 ? ? M DG 709 M DC 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DG 11 O6 ? ? ? 1_555 A DC 8  N4 ? ? M DG 709 M DC 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DT 12 N3 ? ? ? 1_555 A DA 7  N1 ? ? M DT 710 M DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DT 12 O4 ? ? ? 1_555 A DA 7  N6 ? ? M DT 710 M DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DT 13 N3 ? ? ? 1_555 A DA 6  N1 ? ? M DT 711 M DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DT 13 O4 ? ? ? 1_555 A DA 6  N6 ? ? M DT 711 M DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DG 14 N1 ? ? ? 1_555 A DC 5  N3 ? ? M DG 712 M DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DG 14 N2 ? ? ? 1_555 A DC 5  O2 ? ? M DG 712 M DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DG 14 O6 ? ? ? 1_555 A DC 5  N4 ? ? M DG 712 M DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DC 15 N3 ? ? ? 1_555 A DG 4  N1 ? ? M DC 713 M DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DC 15 N4 ? ? ? 1_555 A DG 4  O6 ? ? M DC 713 M DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DC 15 O2 ? ? ? 1_555 A DG 4  N2 ? ? M DC 713 M DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DG 16 N1 ? ? ? 1_555 A DC 3  N3 ? ? M DG 714 M DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DG 16 N2 ? ? ? 1_555 A DC 3  O2 ? ? M DG 714 M DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DG 16 O6 ? ? ? 1_555 A DC 3  N4 ? ? M DG 714 M DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? A DT 17 N3 ? ? ? 1_555 A DA 2  N1 ? ? M DT 715 M DA 700 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? A DT 17 O4 ? ? ? 1_555 A DA 2  N6 ? ? M DT 715 M DA 700 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 264 B . ? VAL 265 A PRO 265 B ? PRO 266 A 1 3.60 
2 THR 283 B . ? THR 284 A PRO 284 B ? PRO 285 A 1 2.33 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR B 90  ? ASN B 95  ? THR A 91  ASN A 96  
A 2 SER B 60  ? ALA B 65  ? SER A 61  ALA A 66  
A 3 LEU B 118 ? VAL B 120 ? LEU A 119 VAL A 121 
A 4 MET B 141 ? VAL B 143 ? MET A 142 VAL A 144 
A 5 ASP B 155 ? ILE B 158 ? ASP A 156 ILE A 159 
A 6 SER B 317 ? GLU B 319 ? SER A 318 GLU A 320 
B 1 ILE B 180 ? ILE B 183 ? ILE A 181 ILE A 184 
B 2 ALA B 241 ? CYS B 244 ? ALA A 242 CYS A 245 
B 3 SER B 269 ? ILE B 271 ? SER A 270 ILE A 272 
C 1 THR B 288 ? HIS B 290 ? THR A 289 HIS A 291 
C 2 ARG B 323 ? ILE B 325 ? ARG A 324 ILE A 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR B 90  ? O THR A 91  N ILE B 61  ? N ILE A 62  
A 2 3 N GLY B 62  ? N GLY A 63  O LEU B 119 ? O LEU A 120 
A 3 4 N LEU B 118 ? N LEU A 119 O VAL B 142 ? O VAL A 143 
A 4 5 N MET B 141 ? N MET A 142 O ASP B 155 ? O ASP A 156 
A 5 6 N ILE B 158 ? N ILE A 159 O ILE B 318 ? O ILE A 319 
B 1 2 N GLY B 181 ? N GLY A 182 O PHE B 243 ? O PHE A 244 
B 2 3 N VAL B 242 ? N VAL A 243 O ILE B 271 ? O ILE A 272 
C 1 2 N HIS B 290 ? N HIS A 291 O ARG B 323 ? O ARG A 324 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    HPA 
_struct_site.pdbx_auth_seq_id     599 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE HPA A 599' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 TYR B 72  ? TYR A 73  . ? 1_555 ? 
2 AC1 7 PHE B 73  ? PHE A 74  . ? 1_555 ? 
3 AC1 7 ARG B 189 ? ARG A 190 . ? 1_555 ? 
4 AC1 7 THR B 191 ? THR A 192 . ? 1_555 ? 
5 AC1 7 ARG B 195 ? ARG A 196 . ? 1_555 ? 
6 AC1 7 PHE B 220 ? PHE A 221 . ? 1_555 ? 
7 AC1 7 ASP B 274 ? ASP A 275 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QP7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QP7 
_atom_sites.fract_transf_matrix[1][1]   0.005660 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010472 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012453 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 7.330  26.774  18.684  1.00 100.00 ? 699 DT  M "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 7.165  26.796  20.095  1.00 27.95  ? 699 DT  M "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 7.367  25.406  20.696  1.00 100.00 ? 699 DT  M "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 6.246  24.535  20.398  1.00 43.22  ? 699 DT  M "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 8.607  24.665  20.221  1.00 18.61  ? 699 DT  M "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 9.182  24.004  21.340  1.00 45.53  ? 699 DT  M "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 8.050  23.635  19.248  1.00 40.45  ? 699 DT  M "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 6.710  23.307  19.884  1.00 53.38  ? 699 DT  M "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 5.687  22.831  18.943  1.00 36.54  ? 699 DT  M N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 4.887  21.786  19.334  1.00 100.00 ? 699 DT  M C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 5.004  21.232  20.419  1.00 49.38  ? 699 DT  M O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 3.943  21.411  18.405  1.00 32.55  ? 699 DT  M N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 3.728  21.970  17.159  1.00 60.83  ? 699 DT  M C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 2.839  21.526  16.433  1.00 71.85  ? 699 DT  M O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 4.607  23.069  16.823  1.00 59.23  ? 699 DT  M C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 4.457  23.743  15.499  1.00 48.17  ? 699 DT  M C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 5.527  23.443  17.722  1.00 40.54  ? 699 DT  M C6    1 
ATOM   18   P P     . DA  A 1 2   ? 10.526 23.148  21.165  1.00 37.40  ? 700 DA  M P     1 
ATOM   19   O OP1   . DA  A 1 2   ? 11.183 22.988  22.486  1.00 31.22  ? 700 DA  M OP1   1 
ATOM   20   O OP2   . DA  A 1 2   ? 11.312 23.666  20.018  1.00 36.38  ? 700 DA  M OP2   1 
ATOM   21   O "O5'" . DA  A 1 2   ? 9.955  21.710  20.846  1.00 32.00  ? 700 DA  M "O5'" 1 
ATOM   22   C "C5'" . DA  A 1 2   ? 9.396  20.949  21.901  1.00 69.26  ? 700 DA  M "C5'" 1 
ATOM   23   C "C4'" . DA  A 1 2   ? 9.011  19.590  21.390  1.00 38.67  ? 700 DA  M "C4'" 1 
ATOM   24   O "O4'" . DA  A 1 2   ? 8.186  19.784  20.228  1.00 37.27  ? 700 DA  M "O4'" 1 
ATOM   25   C "C3'" . DA  A 1 2   ? 10.210 18.745  20.947  1.00 100.00 ? 700 DA  M "C3'" 1 
ATOM   26   O "O3'" . DA  A 1 2   ? 10.115 17.426  21.471  1.00 40.97  ? 700 DA  M "O3'" 1 
ATOM   27   C "C2'" . DA  A 1 2   ? 10.109 18.668  19.444  1.00 4.93   ? 700 DA  M "C2'" 1 
ATOM   28   C "C1'" . DA  A 1 2   ? 8.656  18.986  19.170  1.00 21.78  ? 700 DA  M "C1'" 1 
ATOM   29   N N9    . DA  A 1 2   ? 8.458  19.733  17.950  1.00 13.89  ? 700 DA  M N9    1 
ATOM   30   C C8    . DA  A 1 2   ? 9.213  20.755  17.432  1.00 73.63  ? 700 DA  M C8    1 
ATOM   31   N N7    . DA  A 1 2   ? 8.758  21.207  16.286  1.00 58.04  ? 700 DA  M N7    1 
ATOM   32   C C5    . DA  A 1 2   ? 7.638  20.424  16.045  1.00 12.31  ? 700 DA  M C5    1 
ATOM   33   C C6    . DA  A 1 2   ? 6.705  20.397  14.993  1.00 51.62  ? 700 DA  M C6    1 
ATOM   34   N N6    . DA  A 1 2   ? 6.757  21.211  13.941  1.00 27.33  ? 700 DA  M N6    1 
ATOM   35   N N1    . DA  A 1 2   ? 5.704  19.494  15.059  1.00 24.42  ? 700 DA  M N1    1 
ATOM   36   C C2    . DA  A 1 2   ? 5.655  18.671  16.116  1.00 46.02  ? 700 DA  M C2    1 
ATOM   37   N N3    . DA  A 1 2   ? 6.471  18.598  17.165  1.00 51.79  ? 700 DA  M N3    1 
ATOM   38   C C4    . DA  A 1 2   ? 7.448  19.514  17.066  1.00 57.02  ? 700 DA  M C4    1 
ATOM   39   P P     . DC  A 1 3   ? 10.800 16.218  20.681  1.00 59.82  ? 701 DC  M P     1 
ATOM   40   O OP1   . DC  A 1 3   ? 10.867 15.171  21.731  1.00 18.53  ? 701 DC  M OP1   1 
ATOM   41   O OP2   . DC  A 1 3   ? 12.012 16.556  19.871  1.00 21.76  ? 701 DC  M OP2   1 
ATOM   42   O "O5'" . DC  A 1 3   ? 9.689  15.813  19.643  1.00 17.20  ? 701 DC  M "O5'" 1 
ATOM   43   C "C5'" . DC  A 1 3   ? 8.990  14.610  19.838  1.00 83.28  ? 701 DC  M "C5'" 1 
ATOM   44   C "C4'" . DC  A 1 3   ? 8.135  14.346  18.644  1.00 15.66  ? 701 DC  M "C4'" 1 
ATOM   45   O "O4'" . DC  A 1 3   ? 8.060  15.536  17.833  1.00 57.22  ? 701 DC  M "O4'" 1 
ATOM   46   C "C3'" . DC  A 1 3   ? 8.655  13.224  17.733  1.00 51.53  ? 701 DC  M "C3'" 1 
ATOM   47   O "O3'" . DC  A 1 3   ? 7.593  12.297  17.553  1.00 32.79  ? 701 DC  M "O3'" 1 
ATOM   48   C "C2'" . DC  A 1 3   ? 8.860  13.920  16.402  1.00 64.79  ? 701 DC  M "C2'" 1 
ATOM   49   C "C1'" . DC  A 1 3   ? 7.903  15.094  16.509  1.00 15.33  ? 701 DC  M "C1'" 1 
ATOM   50   N N1    . DC  A 1 3   ? 8.224  16.177  15.584  1.00 40.14  ? 701 DC  M N1    1 
ATOM   51   C C2    . DC  A 1 3   ? 7.357  16.382  14.524  1.00 59.17  ? 701 DC  M C2    1 
ATOM   52   O O2    . DC  A 1 3   ? 6.347  15.660  14.443  1.00 47.42  ? 701 DC  M O2    1 
ATOM   53   N N3    . DC  A 1 3   ? 7.627  17.354  13.628  1.00 55.15  ? 701 DC  M N3    1 
ATOM   54   C C4    . DC  A 1 3   ? 8.727  18.092  13.768  1.00 9.97   ? 701 DC  M C4    1 
ATOM   55   N N4    . DC  A 1 3   ? 8.949  19.045  12.867  1.00 77.73  ? 701 DC  M N4    1 
ATOM   56   C C5    . DC  A 1 3   ? 9.639  17.900  14.847  1.00 52.61  ? 701 DC  M C5    1 
ATOM   57   C C6    . DC  A 1 3   ? 9.351  16.934  15.725  1.00 31.80  ? 701 DC  M C6    1 
ATOM   58   P P     . DG  A 1 4   ? 7.858  10.738  17.357  1.00 46.58  ? 702 DG  M P     1 
ATOM   59   O OP1   . DG  A 1 4   ? 7.520  10.166  18.687  1.00 49.25  ? 702 DG  M OP1   1 
ATOM   60   O OP2   . DG  A 1 4   ? 9.193  10.499  16.755  1.00 51.02  ? 702 DG  M OP2   1 
ATOM   61   O "O5'" . DG  A 1 4   ? 6.728  10.342  16.318  1.00 56.04  ? 702 DG  M "O5'" 1 
ATOM   62   C "C5'" . DG  A 1 4   ? 5.436  10.896  16.478  1.00 43.18  ? 702 DG  M "C5'" 1 
ATOM   63   C "C4'" . DG  A 1 4   ? 4.626  10.771  15.216  1.00 18.07  ? 702 DG  M "C4'" 1 
ATOM   64   O "O4'" . DG  A 1 4   ? 4.967  11.858  14.328  1.00 100.00 ? 702 DG  M "O4'" 1 
ATOM   65   C "C3'" . DG  A 1 4   ? 4.898  9.499   14.418  1.00 28.76  ? 702 DG  M "C3'" 1 
ATOM   66   O "O3'" . DG  A 1 4   ? 3.734  9.192   13.643  1.00 100.00 ? 702 DG  M "O3'" 1 
ATOM   67   C "C2'" . DG  A 1 4   ? 6.019  9.955   13.496  1.00 100.00 ? 702 DG  M "C2'" 1 
ATOM   68   C "C1'" . DG  A 1 4   ? 5.529  11.343  13.128  1.00 12.02  ? 702 DG  M "C1'" 1 
ATOM   69   N N9    . DG  A 1 4   ? 6.535  12.306  12.679  1.00 74.12  ? 702 DG  M N9    1 
ATOM   70   C C8    . DG  A 1 4   ? 7.709  12.630  13.314  1.00 100.00 ? 702 DG  M C8    1 
ATOM   71   N N7    . DG  A 1 4   ? 8.396  13.555  12.686  1.00 35.18  ? 702 DG  M N7    1 
ATOM   72   C C5    . DG  A 1 4   ? 7.623  13.870  11.576  1.00 21.18  ? 702 DG  M C5    1 
ATOM   73   C C6    . DG  A 1 4   ? 7.847  14.804  10.523  1.00 44.39  ? 702 DG  M C6    1 
ATOM   74   O O6    . DG  A 1 4   ? 8.799  15.565  10.352  1.00 28.20  ? 702 DG  M O6    1 
ATOM   75   N N1    . DG  A 1 4   ? 6.812  14.814  9.604   1.00 21.68  ? 702 DG  M N1    1 
ATOM   76   C C2    . DG  A 1 4   ? 5.697  14.024  9.675   1.00 44.03  ? 702 DG  M C2    1 
ATOM   77   N N2    . DG  A 1 4   ? 4.817  14.184  8.675   1.00 29.28  ? 702 DG  M N2    1 
ATOM   78   N N3    . DG  A 1 4   ? 5.465  13.147  10.645  1.00 36.28  ? 702 DG  M N3    1 
ATOM   79   C C4    . DG  A 1 4   ? 6.464  13.119  11.559  1.00 24.78  ? 702 DG  M C4    1 
ATOM   80   P P     . DC  A 1 5   ? 3.521  7.727   13.028  1.00 49.75  ? 703 DC  M P     1 
ATOM   81   O OP1   . DC  A 1 5   ? 2.510  7.054   13.883  1.00 74.21  ? 703 DC  M OP1   1 
ATOM   82   O OP2   . DC  A 1 5   ? 4.838  7.077   12.802  1.00 100.00 ? 703 DC  M OP2   1 
ATOM   83   O "O5'" . DC  A 1 5   ? 2.883  8.041   11.608  1.00 21.17  ? 703 DC  M "O5'" 1 
ATOM   84   C "C5'" . DC  A 1 5   ? 2.718  9.385   11.218  1.00 68.29  ? 703 DC  M "C5'" 1 
ATOM   85   C "C4'" . DC  A 1 5   ? 2.028  9.458   9.890   1.00 21.26  ? 703 DC  M "C4'" 1 
ATOM   86   O "O4'" . DC  A 1 5   ? 2.801  10.313  9.028   1.00 92.48  ? 703 DC  M "O4'" 1 
ATOM   87   C "C3'" . DC  A 1 5   ? 1.992  8.129   9.158   1.00 40.16  ? 703 DC  M "C3'" 1 
ATOM   88   O "O3'" . DC  A 1 5   ? 1.078  8.259   8.056   1.00 100.00 ? 703 DC  M "O3'" 1 
ATOM   89   C "C2'" . DC  A 1 5   ? 3.417  8.065   8.636   1.00 88.95  ? 703 DC  M "C2'" 1 
ATOM   90   C "C1'" . DC  A 1 5   ? 3.684  9.519   8.249   1.00 12.88  ? 703 DC  M "C1'" 1 
ATOM   91   N N1    . DC  A 1 5   ? 5.047  10.003  8.507   1.00 49.46  ? 703 DC  M N1    1 
ATOM   92   C C2    . DC  A 1 5   ? 5.540  11.036  7.709   1.00 91.84  ? 703 DC  M C2    1 
ATOM   93   O O2    . DC  A 1 5   ? 4.812  11.499  6.814   1.00 24.91  ? 703 DC  M O2    1 
ATOM   94   N N3    . DC  A 1 5   ? 6.789  11.503  7.928   1.00 22.05  ? 703 DC  M N3    1 
ATOM   95   C C4    . DC  A 1 5   ? 7.541  10.977  8.894   1.00 71.17  ? 703 DC  M C4    1 
ATOM   96   N N4    . DC  A 1 5   ? 8.771  11.473  9.067   1.00 49.81  ? 703 DC  M N4    1 
ATOM   97   C C5    . DC  A 1 5   ? 7.060  9.922   9.725   1.00 66.95  ? 703 DC  M C5    1 
ATOM   98   C C6    . DC  A 1 5   ? 5.815  9.472   9.502   1.00 44.01  ? 703 DC  M C6    1 
ATOM   99   P P     . DA  A 1 6   ? 0.555  6.977   7.233   1.00 59.60  ? 704 DA  M P     1 
ATOM   100  O OP1   . DA  A 1 6   ? -0.843 7.297   6.861   1.00 100.00 ? 704 DA  M OP1   1 
ATOM   101  O OP2   . DA  A 1 6   ? 0.862  5.719   7.964   1.00 68.71  ? 704 DA  M OP2   1 
ATOM   102  O "O5'" . DA  A 1 6   ? 1.391  7.045   5.884   1.00 66.69  ? 704 DA  M "O5'" 1 
ATOM   103  C "C5'" . DA  A 1 6   ? 1.606  8.306   5.267   1.00 54.68  ? 704 DA  M "C5'" 1 
ATOM   104  C "C4'" . DA  A 1 6   ? 2.561  8.208   4.099   1.00 100.00 ? 704 DA  M "C4'" 1 
ATOM   105  O "O4'" . DA  A 1 6   ? 3.913  8.519   4.522   1.00 100.00 ? 704 DA  M "O4'" 1 
ATOM   106  C "C3'" . DA  A 1 6   ? 2.672  6.829   3.465   1.00 70.37  ? 704 DA  M "C3'" 1 
ATOM   107  O "O3'" . DA  A 1 6   ? 3.225  7.036   2.168   1.00 64.54  ? 704 DA  M "O3'" 1 
ATOM   108  C "C2'" . DA  A 1 6   ? 3.760  6.214   4.321   1.00 100.00 ? 704 DA  M "C2'" 1 
ATOM   109  C "C1'" . DA  A 1 6   ? 4.737  7.376   4.315   1.00 100.00 ? 704 DA  M "C1'" 1 
ATOM   110  N N9    . DA  A 1 6   ? 5.758  7.356   5.361   1.00 35.54  ? 704 DA  M N9    1 
ATOM   111  C C8    . DA  A 1 6   ? 5.816  6.558   6.477   1.00 100.00 ? 704 DA  M C8    1 
ATOM   112  N N7    . DA  A 1 6   ? 6.859  6.793   7.238   1.00 25.95  ? 704 DA  M N7    1 
ATOM   113  C C5    . DA  A 1 6   ? 7.531  7.810   6.577   1.00 100.00 ? 704 DA  M C5    1 
ATOM   114  C C6    . DA  A 1 6   ? 8.712  8.506   6.870   1.00 30.13  ? 704 DA  M C6    1 
ATOM   115  N N6    . DA  A 1 6   ? 9.461  8.272   7.949   1.00 61.82  ? 704 DA  M N6    1 
ATOM   116  N N1    . DA  A 1 6   ? 9.099  9.468   6.008   1.00 49.95  ? 704 DA  M N1    1 
ATOM   117  C C2    . DA  A 1 6   ? 8.342  9.704   4.925   1.00 29.15  ? 704 DA  M C2    1 
ATOM   118  N N3    . DA  A 1 6   ? 7.214  9.116   4.538   1.00 77.19  ? 704 DA  M N3    1 
ATOM   119  C C4    . DA  A 1 6   ? 6.861  8.165   5.418   1.00 42.12  ? 704 DA  M C4    1 
ATOM   120  P P     . DA  A 1 7   ? 2.651  6.257   0.899   1.00 99.82  ? 705 DA  M P     1 
ATOM   121  O OP1   . DA  A 1 7   ? 1.226  6.645   0.730   1.00 90.40  ? 705 DA  M OP1   1 
ATOM   122  O OP2   . DA  A 1 7   ? 3.046  4.827   0.984   1.00 61.58  ? 705 DA  M OP2   1 
ATOM   123  O "O5'" . DA  A 1 7   ? 3.469  6.910   -0.287  1.00 59.66  ? 705 DA  M "O5'" 1 
ATOM   124  C "C5'" . DA  A 1 7   ? 3.777  8.289   -0.246  1.00 100.00 ? 705 DA  M "C5'" 1 
ATOM   125  C "C4'" . DA  A 1 7   ? 5.210  8.533   -0.648  1.00 48.58  ? 705 DA  M "C4'" 1 
ATOM   126  O "O4'" . DA  A 1 7   ? 6.092  8.322   0.473   1.00 85.91  ? 705 DA  M "O4'" 1 
ATOM   127  C "C3'" . DA  A 1 7   ? 5.725  7.626   -1.764  1.00 46.54  ? 705 DA  M "C3'" 1 
ATOM   128  O "O3'" . DA  A 1 7   ? 6.588  8.411   -2.581  1.00 100.00 ? 705 DA  M "O3'" 1 
ATOM   129  C "C2'" . DA  A 1 7   ? 6.542  6.588   -1.013  1.00 52.25  ? 705 DA  M "C2'" 1 
ATOM   130  C "C1'" . DA  A 1 7   ? 7.136  7.445   0.086   1.00 48.43  ? 705 DA  M "C1'" 1 
ATOM   131  N N9    . DA  A 1 7   ? 7.565  6.743   1.289   1.00 19.91  ? 705 DA  M N9    1 
ATOM   132  C C8    . DA  A 1 7   ? 6.977  5.679   1.920   1.00 25.86  ? 705 DA  M C8    1 
ATOM   133  N N7    . DA  A 1 7   ? 7.607  5.299   3.009   1.00 100.00 ? 705 DA  M N7    1 
ATOM   134  C C5    . DA  A 1 7   ? 8.677  6.179   3.098   1.00 20.54  ? 705 DA  M C5    1 
ATOM   135  C C6    . DA  A 1 7   ? 9.726  6.312   4.026   1.00 39.05  ? 705 DA  M C6    1 
ATOM   136  N N6    . DA  A 1 7   ? 9.882  5.529   5.096   1.00 49.98  ? 705 DA  M N6    1 
ATOM   137  N N1    . DA  A 1 7   ? 10.622 7.294   3.814   1.00 32.33  ? 705 DA  M N1    1 
ATOM   138  C C2    . DA  A 1 7   ? 10.464 8.085   2.746   1.00 29.00  ? 705 DA  M C2    1 
ATOM   139  N N3    . DA  A 1 7   ? 9.522  8.065   1.808   1.00 23.60  ? 705 DA  M N3    1 
ATOM   140  C C4    . DA  A 1 7   ? 8.651  7.078   2.047   1.00 59.57  ? 705 DA  M C4    1 
ATOM   141  P P     . DC  A 1 8   ? 6.964  7.923   -4.055  1.00 99.69  ? 706 DC  M P     1 
ATOM   142  O OP1   . DC  A 1 8   ? 6.681  9.028   -5.012  1.00 63.01  ? 706 DC  M OP1   1 
ATOM   143  O OP2   . DC  A 1 8   ? 6.304  6.603   -4.224  1.00 55.74  ? 706 DC  M OP2   1 
ATOM   144  O "O5'" . DC  A 1 8   ? 8.547  7.765   -3.976  1.00 100.00 ? 706 DC  M "O5'" 1 
ATOM   145  C "C5'" . DC  A 1 8   ? 9.365  8.834   -3.513  1.00 100.00 ? 706 DC  M "C5'" 1 
ATOM   146  C "C4'" . DC  A 1 8   ? 10.754 8.347   -3.162  1.00 100.00 ? 706 DC  M "C4'" 1 
ATOM   147  O "O4'" . DC  A 1 8   ? 10.722 7.793   -1.819  1.00 79.30  ? 706 DC  M "O4'" 1 
ATOM   148  C "C3'" . DC  A 1 8   ? 11.313 7.275   -4.094  1.00 84.77  ? 706 DC  M "C3'" 1 
ATOM   149  O "O3'" . DC  A 1 8   ? 12.577 7.691   -4.594  1.00 84.22  ? 706 DC  M "O3'" 1 
ATOM   150  C "C2'" . DC  A 1 8   ? 11.483 6.056   -3.194  1.00 46.42  ? 706 DC  M "C2'" 1 
ATOM   151  C "C1'" . DC  A 1 8   ? 11.568 6.673   -1.792  1.00 70.13  ? 706 DC  M "C1'" 1 
ATOM   152  N N1    . DC  A 1 8   ? 11.166 5.799   -0.685  1.00 25.12  ? 706 DC  M N1    1 
ATOM   153  C C2    . DC  A 1 8   ? 11.966 5.747   0.462   1.00 56.26  ? 706 DC  M C2    1 
ATOM   154  O O2    . DC  A 1 8   ? 12.981 6.457   0.517   1.00 60.15  ? 706 DC  M O2    1 
ATOM   155  N N3    . DC  A 1 8   ? 11.613 4.929   1.480   1.00 16.69  ? 706 DC  M N3    1 
ATOM   156  C C4    . DC  A 1 8   ? 10.512 4.182   1.380   1.00 59.32  ? 706 DC  M C4    1 
ATOM   157  N N4    . DC  A 1 8   ? 10.201 3.391   2.405   1.00 52.22  ? 706 DC  M N4    1 
ATOM   158  C C5    . DC  A 1 8   ? 9.683  4.207   0.220   1.00 19.37  ? 706 DC  M C5    1 
ATOM   159  C C6    . DC  A 1 8   ? 10.047 5.026   -0.780  1.00 66.78  ? 706 DC  M C6    1 
ATOM   160  P P     . DC  A 1 9   ? 12.964 7.187   -6.090  1.00 73.95  ? 707 DC  M P     1 
ATOM   161  O OP1   . DC  A 1 9   ? 12.609 8.283   -7.051  1.00 96.25  ? 707 DC  M OP1   1 
ATOM   162  O OP2   . DC  A 1 9   ? 12.256 5.887   -6.192  1.00 35.17  ? 707 DC  M OP2   1 
ATOM   163  O "O5'" . DC  A 1 9   ? 14.522 6.926   -6.049  1.00 80.74  ? 707 DC  M "O5'" 1 
ATOM   164  C "C5'" . DC  A 1 9   ? 15.412 7.673   -5.216  1.00 100.00 ? 707 DC  M "C5'" 1 
ATOM   165  C "C4'" . DC  A 1 9   ? 16.391 6.720   -4.546  1.00 59.77  ? 707 DC  M "C4'" 1 
ATOM   166  O "O4'" . DC  A 1 9   ? 15.787 6.201   -3.357  1.00 34.01  ? 707 DC  M "O4'" 1 
ATOM   167  C "C3'" . DC  A 1 9   ? 16.607 5.449   -5.359  1.00 17.09  ? 707 DC  M "C3'" 1 
ATOM   168  O "O3'" . DC  A 1 9   ? 17.728 5.604   -6.246  1.00 40.40  ? 707 DC  M "O3'" 1 
ATOM   169  C "C2'" . DC  A 1 9   ? 16.929 4.383   -4.331  1.00 36.44  ? 707 DC  M "C2'" 1 
ATOM   170  C "C1'" . DC  A 1 9   ? 16.396 4.962   -3.043  1.00 28.11  ? 707 DC  M "C1'" 1 
ATOM   171  N N1    . DC  A 1 9   ? 15.394 4.124   -2.384  1.00 64.58  ? 707 DC  M N1    1 
ATOM   172  C C2    . DC  A 1 9   ? 15.574 3.795   -1.032  1.00 39.33  ? 707 DC  M C2    1 
ATOM   173  O O2    . DC  A 1 9   ? 16.575 4.204   -0.429  1.00 30.40  ? 707 DC  M O2    1 
ATOM   174  N N3    . DC  A 1 9   ? 14.654 3.031   -0.411  1.00 21.93  ? 707 DC  M N3    1 
ATOM   175  C C4    . DC  A 1 9   ? 13.592 2.603   -1.068  1.00 21.48  ? 707 DC  M C4    1 
ATOM   176  N N4    . DC  A 1 9   ? 12.739 1.853   -0.383  1.00 56.07  ? 707 DC  M N4    1 
ATOM   177  C C5    . DC  A 1 9   ? 13.368 2.918   -2.445  1.00 100.00 ? 707 DC  M C5    1 
ATOM   178  C C6    . DC  A 1 9   ? 14.288 3.682   -3.060  1.00 8.09   ? 707 DC  M C6    1 
ATOM   179  P P     . DG  A 1 10  ? 17.549 5.209   -7.783  1.00 34.72  ? 708 DG  M P     1 
ATOM   180  O OP1   . DG  A 1 10  ? 18.419 6.037   -8.663  1.00 88.52  ? 708 DG  M OP1   1 
ATOM   181  O OP2   . DG  A 1 10  ? 16.075 5.200   -7.978  1.00 54.92  ? 708 DG  M OP2   1 
ATOM   182  O "O5'" . DG  A 1 10  ? 18.003 3.655   -7.780  1.00 63.45  ? 708 DG  M "O5'" 1 
ATOM   183  C "C5'" . DG  A 1 10  ? 18.966 3.196   -6.841  1.00 32.27  ? 708 DG  M "C5'" 1 
ATOM   184  C "C4'" . DG  A 1 10  ? 19.056 1.676   -6.784  1.00 25.82  ? 708 DG  M "C4'" 1 
ATOM   185  O "O4'" . DG  A 1 10  ? 18.218 1.179   -5.701  1.00 38.96  ? 708 DG  M "O4'" 1 
ATOM   186  C "C3'" . DG  A 1 10  ? 18.568 0.978   -8.062  1.00 97.57  ? 708 DG  M "C3'" 1 
ATOM   187  O "O3'" . DG  A 1 10  ? 19.328 -0.233  -8.208  1.00 36.24  ? 708 DG  M "O3'" 1 
ATOM   188  C "C2'" . DG  A 1 10  ? 17.152 0.592   -7.669  1.00 6.86   ? 708 DG  M "C2'" 1 
ATOM   189  C "C1'" . DG  A 1 10  ? 17.363 0.178   -6.218  1.00 34.24  ? 708 DG  M "C1'" 1 
ATOM   190  N N9    . DG  A 1 10  ? 16.145 0.121   -5.416  1.00 20.49  ? 708 DG  M N9    1 
ATOM   191  C C8    . DG  A 1 10  ? 14.974 0.800   -5.644  1.00 50.04  ? 708 DG  M C8    1 
ATOM   192  N N7    . DG  A 1 10  ? 14.056 0.548   -4.751  1.00 45.55  ? 708 DG  M N7    1 
ATOM   193  C C5    . DG  A 1 10  ? 14.649 -0.356  -3.877  1.00 16.50  ? 708 DG  M C5    1 
ATOM   194  C C6    . DG  A 1 10  ? 14.128 -0.987  -2.701  1.00 45.22  ? 708 DG  M C6    1 
ATOM   195  O O6    . DG  A 1 10  ? 13.006 -0.874  -2.188  1.00 97.68  ? 708 DG  M O6    1 
ATOM   196  N N1    . DG  A 1 10  ? 15.059 -1.826  -2.112  1.00 27.22  ? 708 DG  M N1    1 
ATOM   197  C C2    . DG  A 1 10  ? 16.335 -2.036  -2.583  1.00 100.00 ? 708 DG  M C2    1 
ATOM   198  N N2    . DG  A 1 10  ? 17.089 -2.889  -1.862  1.00 20.93  ? 708 DG  M N2    1 
ATOM   199  N N3    . DG  A 1 10  ? 16.841 -1.454  -3.673  1.00 11.50  ? 708 DG  M N3    1 
ATOM   200  C C4    . DG  A 1 10  ? 15.943 -0.633  -4.272  1.00 49.68  ? 708 DG  M C4    1 
ATOM   201  P P     . DG  A 1 11  ? 19.712 -0.787  -9.674  1.00 57.36  ? 709 DG  M P     1 
ATOM   202  O OP1   . DG  A 1 11  ? 20.868 0.000   -10.219 1.00 45.89  ? 709 DG  M OP1   1 
ATOM   203  O OP2   . DG  A 1 11  ? 18.436 -0.921  -10.454 1.00 51.64  ? 709 DG  M OP2   1 
ATOM   204  O "O5'" . DG  A 1 11  ? 20.263 -2.212  -9.323  1.00 30.16  ? 709 DG  M "O5'" 1 
ATOM   205  C "C5'" . DG  A 1 11  ? 19.396 -3.333  -9.301  1.00 82.51  ? 709 DG  M "C5'" 1 
ATOM   206  C "C4'" . DG  A 1 11  ? 19.155 -3.804  -7.879  1.00 15.37  ? 709 DG  M "C4'" 1 
ATOM   207  O "O4'" . DG  A 1 11  ? 18.078 -3.034  -7.304  1.00 100.00 ? 709 DG  M "O4'" 1 
ATOM   208  C "C3'" . DG  A 1 11  ? 18.720 -5.268  -7.771  1.00 100.00 ? 709 DG  M "C3'" 1 
ATOM   209  O "O3'" . DG  A 1 11  ? 19.867 -6.092  -7.465  1.00 44.47  ? 709 DG  M "O3'" 1 
ATOM   210  C "C2'" . DG  A 1 11  ? 17.708 -5.298  -6.619  1.00 41.31  ? 709 DG  M "C2'" 1 
ATOM   211  C "C1'" . DG  A 1 11  ? 17.405 -3.823  -6.332  1.00 19.14  ? 709 DG  M "C1'" 1 
ATOM   212  N N9    . DG  A 1 11  ? 15.982 -3.470  -6.293  1.00 48.82  ? 709 DG  M N9    1 
ATOM   213  C C8    . DG  A 1 11  ? 15.227 -2.711  -7.168  1.00 31.66  ? 709 DG  M C8    1 
ATOM   214  N N7    . DG  A 1 11  ? 13.966 -2.611  -6.804  1.00 63.33  ? 709 DG  M N7    1 
ATOM   215  C C5    . DG  A 1 11  ? 13.896 -3.359  -5.632  1.00 37.35  ? 709 DG  M C5    1 
ATOM   216  C C6    . DG  A 1 11  ? 12.806 -3.629  -4.756  1.00 33.68  ? 709 DG  M C6    1 
ATOM   217  O O6    . DG  A 1 11  ? 11.632 -3.258  -4.844  1.00 100.00 ? 709 DG  M O6    1 
ATOM   218  N N1    . DG  A 1 11  ? 13.188 -4.424  -3.691  1.00 32.27  ? 709 DG  M N1    1 
ATOM   219  C C2    . DG  A 1 11  ? 14.450 -4.903  -3.487  1.00 36.54  ? 709 DG  M C2    1 
ATOM   220  N N2    . DG  A 1 11  ? 14.619 -5.655  -2.396  1.00 94.95  ? 709 DG  M N2    1 
ATOM   221  N N3    . DG  A 1 11  ? 15.472 -4.666  -4.285  1.00 33.72  ? 709 DG  M N3    1 
ATOM   222  C C4    . DG  A 1 11  ? 15.127 -3.893  -5.326  1.00 4.53   ? 709 DG  M C4    1 
ATOM   223  P P     . DT  A 1 12  ? 19.845 -7.669  -7.854  1.00 37.41  ? 710 DT  M P     1 
ATOM   224  O OP1   . DT  A 1 12  ? 21.195 -8.224  -7.595  1.00 60.80  ? 710 DT  M OP1   1 
ATOM   225  O OP2   . DT  A 1 12  ? 19.195 -7.963  -9.157  1.00 34.89  ? 710 DT  M OP2   1 
ATOM   226  O "O5'" . DT  A 1 12  ? 18.948 -8.341  -6.731  1.00 19.90  ? 710 DT  M "O5'" 1 
ATOM   227  C "C5'" . DT  A 1 12  ? 19.556 -8.790  -5.538  1.00 33.37  ? 710 DT  M "C5'" 1 
ATOM   228  C "C4'" . DT  A 1 12  ? 18.528 -9.408  -4.625  1.00 21.88  ? 710 DT  M "C4'" 1 
ATOM   229  O "O4'" . DT  A 1 12  ? 17.323 -8.608  -4.594  1.00 59.76  ? 710 DT  M "O4'" 1 
ATOM   230  C "C3'" . DT  A 1 12  ? 18.076 -10.815 -5.023  1.00 23.01  ? 710 DT  M "C3'" 1 
ATOM   231  O "O3'" . DT  A 1 12  ? 17.914 -11.584 -3.831  1.00 53.58  ? 710 DT  M "O3'" 1 
ATOM   232  C "C2'" . DT  A 1 12  ? 16.713 -10.568 -5.662  1.00 51.73  ? 710 DT  M "C2'" 1 
ATOM   233  C "C1'" . DT  A 1 12  ? 16.196 -9.449  -4.788  1.00 12.02  ? 710 DT  M "C1'" 1 
ATOM   234  N N1    . DT  A 1 12  ? 15.121 -8.617  -5.351  1.00 76.25  ? 710 DT  M N1    1 
ATOM   235  C C2    . DT  A 1 12  ? 14.002 -8.434  -4.583  1.00 28.26  ? 710 DT  M C2    1 
ATOM   236  O O2    . DT  A 1 12  ? 13.865 -8.944  -3.486  1.00 75.17  ? 710 DT  M O2    1 
ATOM   237  N N3    . DT  A 1 12  ? 13.044 -7.629  -5.142  1.00 48.83  ? 710 DT  M N3    1 
ATOM   238  C C4    . DT  A 1 12  ? 13.090 -7.002  -6.368  1.00 35.31  ? 710 DT  M C4    1 
ATOM   239  O O4    . DT  A 1 12  ? 12.141 -6.309  -6.727  1.00 38.01  ? 710 DT  M O4    1 
ATOM   240  C C5    . DT  A 1 12  ? 14.298 -7.237  -7.130  1.00 33.17  ? 710 DT  M C5    1 
ATOM   241  C C7    . DT  A 1 12  ? 14.440 -6.603  -8.481  1.00 34.69  ? 710 DT  M C7    1 
ATOM   242  C C6    . DT  A 1 12  ? 15.245 -8.023  -6.587  1.00 12.29  ? 710 DT  M C6    1 
ATOM   243  P P     . DT  A 1 13  ? 18.366 -13.122 -3.792  1.00 52.39  ? 711 DT  M P     1 
ATOM   244  O OP1   . DT  A 1 13  ? 19.265 -13.325 -2.623  1.00 36.93  ? 711 DT  M OP1   1 
ATOM   245  O OP2   . DT  A 1 13  ? 18.821 -13.480 -5.164  1.00 37.01  ? 711 DT  M OP2   1 
ATOM   246  O "O5'" . DT  A 1 13  ? 17.015 -13.871 -3.418  1.00 44.53  ? 711 DT  M "O5'" 1 
ATOM   247  C "C5'" . DT  A 1 13  ? 16.141 -13.298 -2.461  1.00 100.00 ? 711 DT  M "C5'" 1 
ATOM   248  C "C4'" . DT  A 1 13  ? 14.734 -13.806 -2.630  1.00 41.91  ? 711 DT  M "C4'" 1 
ATOM   249  O "O4'" . DT  A 1 13  ? 13.943 -12.847 -3.367  1.00 91.36  ? 711 DT  M "O4'" 1 
ATOM   250  C "C3'" . DT  A 1 13  ? 14.615 -15.123 -3.399  1.00 51.68  ? 711 DT  M "C3'" 1 
ATOM   251  O "O3'" . DT  A 1 13  ? 13.557 -15.861 -2.802  1.00 65.18  ? 711 DT  M "O3'" 1 
ATOM   252  C "C2'" . DT  A 1 13  ? 14.151 -14.680 -4.777  1.00 30.35  ? 711 DT  M "C2'" 1 
ATOM   253  C "C1'" . DT  A 1 13  ? 13.240 -13.536 -4.388  1.00 44.50  ? 711 DT  M "C1'" 1 
ATOM   254  N N1    . DT  A 1 13  ? 12.909 -12.571 -5.441  1.00 47.96  ? 711 DT  M N1    1 
ATOM   255  C C2    . DT  A 1 13  ? 11.726 -11.905 -5.305  1.00 21.49  ? 711 DT  M C2    1 
ATOM   256  O O2    . DT  A 1 13  ? 10.971 -12.101 -4.369  1.00 71.25  ? 711 DT  M O2    1 
ATOM   257  N N3    . DT  A 1 13  ? 11.458 -11.001 -6.296  1.00 30.97  ? 711 DT  M N3    1 
ATOM   258  C C4    . DT  A 1 13  ? 12.241 -10.715 -7.392  1.00 100.00 ? 711 DT  M C4    1 
ATOM   259  O O4    . DT  A 1 13  ? 11.858 -9.880  -8.206  1.00 38.93  ? 711 DT  M O4    1 
ATOM   260  C C5    . DT  A 1 13  ? 13.479 -11.457 -7.476  1.00 28.80  ? 711 DT  M C5    1 
ATOM   261  C C7    . DT  A 1 13  ? 14.397 -11.209 -8.630  1.00 41.06  ? 711 DT  M C7    1 
ATOM   262  C C6    . DT  A 1 13  ? 13.753 -12.337 -6.503  1.00 17.59  ? 711 DT  M C6    1 
ATOM   263  P P     . DG  A 1 14  ? 13.778 -17.382 -2.380  1.00 62.44  ? 712 DG  M P     1 
ATOM   264  O OP1   . DG  A 1 14  ? 14.789 -17.470 -1.295  1.00 69.27  ? 712 DG  M OP1   1 
ATOM   265  O OP2   . DG  A 1 14  ? 13.998 -18.122 -3.649  1.00 100.00 ? 712 DG  M OP2   1 
ATOM   266  O "O5'" . DG  A 1 14  ? 12.364 -17.755 -1.753  1.00 50.68  ? 712 DG  M "O5'" 1 
ATOM   267  C "C5'" . DG  A 1 14  ? 11.874 -17.088 -0.597  1.00 71.43  ? 712 DG  M "C5'" 1 
ATOM   268  C "C4'" . DG  A 1 14  ? 10.364 -16.878 -0.656  1.00 51.49  ? 712 DG  M "C4'" 1 
ATOM   269  O "O4'" . DG  A 1 14  ? 10.094 -15.964 -1.743  1.00 59.61  ? 712 DG  M "O4'" 1 
ATOM   270  C "C3'" . DG  A 1 14  ? 9.492  -18.116 -0.870  1.00 78.41  ? 712 DG  M "C3'" 1 
ATOM   271  O "O3'" . DG  A 1 14  ? 8.307  -17.922 -0.071  1.00 100.00 ? 712 DG  M "O3'" 1 
ATOM   272  C "C2'" . DG  A 1 14  ? 9.091  -18.022 -2.329  1.00 74.71  ? 712 DG  M "C2'" 1 
ATOM   273  C "C1'" . DG  A 1 14  ? 9.135  -16.506 -2.624  1.00 45.11  ? 712 DG  M "C1'" 1 
ATOM   274  N N9    . DG  A 1 14  ? 9.500  -16.046 -3.972  1.00 48.45  ? 712 DG  M N9    1 
ATOM   275  C C8    . DG  A 1 14  ? 10.590 -16.408 -4.729  1.00 29.64  ? 712 DG  M C8    1 
ATOM   276  N N7    . DG  A 1 14  ? 10.650 -15.779 -5.877  1.00 53.28  ? 712 DG  M N7    1 
ATOM   277  C C5    . DG  A 1 14  ? 9.544  -14.937 -5.869  1.00 17.39  ? 712 DG  M C5    1 
ATOM   278  C C6    . DG  A 1 14  ? 9.081  -14.006 -6.842  1.00 50.50  ? 712 DG  M C6    1 
ATOM   279  O O6    . DG  A 1 14  ? 9.558  -13.714 -7.952  1.00 26.07  ? 712 DG  M O6    1 
ATOM   280  N N1    . DG  A 1 14  ? 7.928  -13.370 -6.418  1.00 29.86  ? 712 DG  M N1    1 
ATOM   281  C C2    . DG  A 1 14  ? 7.292  -13.586 -5.222  1.00 100.00 ? 712 DG  M C2    1 
ATOM   282  N N2    . DG  A 1 14  ? 6.186  -12.860 -5.021  1.00 33.73  ? 712 DG  M N2    1 
ATOM   283  N N3    . DG  A 1 14  ? 7.703  -14.450 -4.303  1.00 17.47  ? 712 DG  M N3    1 
ATOM   284  C C4    . DG  A 1 14  ? 8.835  -15.080 -4.690  1.00 71.19  ? 712 DG  M C4    1 
ATOM   285  P P     . DC  A 1 15  ? 7.531  -19.209 0.521   1.00 100.00 ? 713 DC  M P     1 
ATOM   286  O OP1   . DC  A 1 15  ? 7.585  -19.073 2.003   1.00 100.00 ? 713 DC  M OP1   1 
ATOM   287  O OP2   . DC  A 1 15  ? 8.056  -20.445 -0.142  1.00 53.02  ? 713 DC  M OP2   1 
ATOM   288  O "O5'" . DC  A 1 15  ? 6.118  -18.937 -0.114  1.00 46.61  ? 713 DC  M "O5'" 1 
ATOM   289  C "C5'" . DC  A 1 15  ? 5.909  -19.282 -1.466  1.00 57.30  ? 713 DC  M "C5'" 1 
ATOM   290  C "C4'" . DC  A 1 15  ? 4.895  -18.368 -2.105  1.00 68.78  ? 713 DC  M "C4'" 1 
ATOM   291  O "O4'" . DC  A 1 15  ? 5.562  -17.536 -3.079  1.00 47.98  ? 713 DC  M "O4'" 1 
ATOM   292  C "C3'" . DC  A 1 15  ? 3.843  -19.152 -2.882  1.00 100.00 ? 713 DC  M "C3'" 1 
ATOM   293  O "O3'" . DC  A 1 15  ? 2.561  -18.528 -2.755  1.00 100.00 ? 713 DC  M "O3'" 1 
ATOM   294  C "C2'" . DC  A 1 15  ? 4.330  -19.096 -4.315  1.00 56.83  ? 713 DC  M "C2'" 1 
ATOM   295  C "C1'" . DC  A 1 15  ? 4.965  -17.727 -4.360  1.00 100.00 ? 713 DC  M "C1'" 1 
ATOM   296  N N1    . DC  A 1 15  ? 6.017  -17.637 -5.369  1.00 44.71  ? 713 DC  M N1    1 
ATOM   297  C C2    . DC  A 1 15  ? 5.798  -16.872 -6.522  1.00 100.00 ? 713 DC  M C2    1 
ATOM   298  O O2    . DC  A 1 15  ? 4.715  -16.278 -6.661  1.00 58.67  ? 713 DC  M O2    1 
ATOM   299  N N3    . DC  A 1 15  ? 6.771  -16.792 -7.461  1.00 61.20  ? 713 DC  M N3    1 
ATOM   300  C C4    . DC  A 1 15  ? 7.922  -17.435 -7.278  1.00 29.05  ? 713 DC  M C4    1 
ATOM   301  N N4    . DC  A 1 15  ? 8.849  -17.316 -8.230  1.00 57.23  ? 713 DC  M N4    1 
ATOM   302  C C5    . DC  A 1 15  ? 8.171  -18.225 -6.114  1.00 100.00 ? 713 DC  M C5    1 
ATOM   303  C C6    . DC  A 1 15  ? 7.195  -18.295 -5.195  1.00 32.65  ? 713 DC  M C6    1 
ATOM   304  P P     . DG  A 1 16  ? 1.274  -19.432 -2.615  1.00 100.00 ? 714 DG  M P     1 
ATOM   305  O OP1   . DG  A 1 16  ? 0.326  -18.777 -1.692  1.00 100.00 ? 714 DG  M OP1   1 
ATOM   306  O OP2   . DG  A 1 16  ? 1.731  -20.814 -2.345  1.00 47.62  ? 714 DG  M OP2   1 
ATOM   307  O "O5'" . DG  A 1 16  ? 0.714  -19.478 -4.111  1.00 50.54  ? 714 DG  M "O5'" 1 
ATOM   308  C "C5'" . DG  A 1 16  ? 1.591  -19.292 -5.190  1.00 32.13  ? 714 DG  M "C5'" 1 
ATOM   309  C "C4'" . DG  A 1 16  ? 0.956  -18.386 -6.199  1.00 42.65  ? 714 DG  M "C4'" 1 
ATOM   310  O "O4'" . DG  A 1 16  ? 1.984  -17.700 -6.933  1.00 100.00 ? 714 DG  M "O4'" 1 
ATOM   311  C "C3'" . DG  A 1 16  ? 0.112  -19.146 -7.203  1.00 100.00 ? 714 DG  M "C3'" 1 
ATOM   312  O "O3'" . DG  A 1 16  ? -1.133 -18.495 -7.399  1.00 100.00 ? 714 DG  M "O3'" 1 
ATOM   313  C "C2'" . DG  A 1 16  ? 0.899  -19.135 -8.498  1.00 100.00 ? 714 DG  M "C2'" 1 
ATOM   314  C "C1'" . DG  A 1 16  ? 1.988  -18.092 -8.295  1.00 23.49  ? 714 DG  M "C1'" 1 
ATOM   315  N N9    . DG  A 1 16  ? 3.313  -18.600 -8.606  1.00 100.00 ? 714 DG  M N9    1 
ATOM   316  C C8    . DG  A 1 16  ? 4.018  -19.568 -7.923  1.00 13.61  ? 714 DG  M C8    1 
ATOM   317  N N7    . DG  A 1 16  ? 5.180  -19.819 -8.470  1.00 86.81  ? 714 DG  M N7    1 
ATOM   318  C C5    . DG  A 1 16  ? 5.242  -18.962 -9.571  1.00 15.64  ? 714 DG  M C5    1 
ATOM   319  C C6    . DG  A 1 16  ? 6.258  -18.774 -10.547 1.00 56.44  ? 714 DG  M C6    1 
ATOM   320  O O6    . DG  A 1 16  ? 7.351  -19.347 -10.643 1.00 100.00 ? 714 DG  M O6    1 
ATOM   321  N N1    . DG  A 1 16  ? 5.895  -17.809 -11.487 1.00 24.76  ? 714 DG  M N1    1 
ATOM   322  C C2    . DG  A 1 16  ? 4.714  -17.106 -11.485 1.00 63.40  ? 714 DG  M C2    1 
ATOM   323  N N2    . DG  A 1 16  ? 4.554  -16.209 -12.469 1.00 39.79  ? 714 DG  M N2    1 
ATOM   324  N N3    . DG  A 1 16  ? 3.757  -17.276 -10.587 1.00 36.28  ? 714 DG  M N3    1 
ATOM   325  C C4    . DG  A 1 16  ? 4.088  -18.211 -9.669  1.00 25.58  ? 714 DG  M C4    1 
ATOM   326  P P     . DT  A 1 17  ? -2.232 -19.310 -8.215  1.00 100.00 ? 715 DT  M P     1 
ATOM   327  O OP1   . DT  A 1 17  ? -3.557 -18.712 -7.899  1.00 100.00 ? 715 DT  M OP1   1 
ATOM   328  O OP2   . DT  A 1 17  ? -1.939 -20.732 -7.852  1.00 69.00  ? 715 DT  M OP2   1 
ATOM   329  O "O5'" . DT  A 1 17  ? -1.844 -19.034 -9.734  1.00 100.00 ? 715 DT  M "O5'" 1 
ATOM   330  C "C5'" . DT  A 1 17  ? -1.543 -17.714 -10.180 1.00 59.13  ? 715 DT  M "C5'" 1 
ATOM   331  C "C4'" . DT  A 1 17  ? -1.408 -17.728 -11.689 1.00 100.00 ? 715 DT  M "C4'" 1 
ATOM   332  O "O4'" . DT  A 1 17  ? -0.008 -17.917 -12.046 1.00 100.00 ? 715 DT  M "O4'" 1 
ATOM   333  C "C3'" . DT  A 1 17  ? -2.162 -18.901 -12.317 1.00 100.00 ? 715 DT  M "C3'" 1 
ATOM   334  O "O3'" . DT  A 1 17  ? -2.677 -18.536 -13.593 1.00 100.00 ? 715 DT  M "O3'" 1 
ATOM   335  C "C2'" . DT  A 1 17  ? -1.075 -19.951 -12.490 1.00 86.19  ? 715 DT  M "C2'" 1 
ATOM   336  C "C1'" . DT  A 1 17  ? 0.119  -19.078 -12.846 1.00 100.00 ? 715 DT  M "C1'" 1 
ATOM   337  N N1    . DT  A 1 17  ? 1.411  -19.711 -12.575 1.00 86.45  ? 715 DT  M N1    1 
ATOM   338  C C2    . DT  A 1 17  ? 2.499  -19.309 -13.310 1.00 20.42  ? 715 DT  M C2    1 
ATOM   339  O O2    . DT  A 1 17  ? 2.437  -18.437 -14.168 1.00 100.00 ? 715 DT  M O2    1 
ATOM   340  N N3    . DT  A 1 17  ? 3.667  -19.964 -13.000 1.00 100.00 ? 715 DT  M N3    1 
ATOM   341  C C4    . DT  A 1 17  ? 3.840  -20.959 -12.051 1.00 100.00 ? 715 DT  M C4    1 
ATOM   342  O O4    . DT  A 1 17  ? 4.950  -21.459 -11.877 1.00 100.00 ? 715 DT  M O4    1 
ATOM   343  C C5    . DT  A 1 17  ? 2.646  -21.331 -11.321 1.00 35.72  ? 715 DT  M C5    1 
ATOM   344  C C7    . DT  A 1 17  ? 2.739  -22.395 -10.275 1.00 52.03  ? 715 DT  M C7    1 
ATOM   345  C C6    . DT  A 1 17  ? 1.506  -20.698 -11.619 1.00 28.57  ? 715 DT  M C6    1 
ATOM   346  N N     . THR B 2 2   ? 16.877 -2.439  11.969  1.00 23.74  ? 3   THR A N     1 
ATOM   347  C CA    . THR B 2 2   ? 17.486 -2.269  13.293  1.00 27.48  ? 3   THR A CA    1 
ATOM   348  C C     . THR B 2 2   ? 17.190 -0.850  13.779  1.00 42.02  ? 3   THR A C     1 
ATOM   349  O O     . THR B 2 2   ? 16.983 -0.636  14.970  1.00 49.15  ? 3   THR A O     1 
ATOM   350  C CB    . THR B 2 2   ? 18.984 -2.931  13.496  1.00 49.24  ? 3   THR A CB    1 
ATOM   351  O OG1   . THR B 2 2   ? 19.311 -3.327  14.873  1.00 30.54  ? 3   THR A OG1   1 
ATOM   352  C CG2   . THR B 2 2   ? 20.130 -2.195  12.736  1.00 43.24  ? 3   THR A CG2   1 
ATOM   353  N N     . ILE B 2 3   ? 17.114 0.121   12.871  1.00 36.58  ? 4   ILE A N     1 
ATOM   354  C CA    . ILE B 2 3   ? 16.759 1.482   13.276  1.00 34.14  ? 4   ILE A CA    1 
ATOM   355  C C     . ILE B 2 3   ? 15.363 1.426   13.950  1.00 37.12  ? 4   ILE A C     1 
ATOM   356  O O     . ILE B 2 3   ? 15.100 2.168   14.888  1.00 36.17  ? 4   ILE A O     1 
ATOM   357  C CB    . ILE B 2 3   ? 16.655 2.432   12.082  1.00 34.20  ? 4   ILE A CB    1 
ATOM   358  C CG1   . ILE B 2 3   ? 16.831 3.870   12.563  1.00 32.91  ? 4   ILE A CG1   1 
ATOM   359  C CG2   . ILE B 2 3   ? 15.310 2.330   11.448  1.00 33.09  ? 4   ILE A CG2   1 
ATOM   360  C CD1   . ILE B 2 3   ? 16.753 4.832   11.449  1.00 36.86  ? 4   ILE A CD1   1 
ATOM   361  N N     . LYS B 2 4   ? 14.490 0.533   13.472  1.00 35.64  ? 5   LYS A N     1 
ATOM   362  C CA    . LYS B 2 4   ? 13.150 0.355   14.042  1.00 35.95  ? 5   LYS A CA    1 
ATOM   363  C C     . LYS B 2 4   ? 13.327 -0.147  15.454  1.00 39.41  ? 5   LYS A C     1 
ATOM   364  O O     . LYS B 2 4   ? 12.635 0.221   16.386  1.00 42.02  ? 5   LYS A O     1 
ATOM   365  C CB    . LYS B 2 4   ? 12.426 -0.806  13.373  1.00 39.60  ? 5   LYS A CB    1 
ATOM   366  C CG    . LYS B 2 4   ? 11.633 -0.449  12.155  1.00 74.33  ? 5   LYS A CG    1 
ATOM   367  C CD    . LYS B 2 4   ? 12.577 -0.323  10.960  1.00 100.00 ? 5   LYS A CD    1 
ATOM   368  C CE    . LYS B 2 4   ? 12.006 -0.972  9.681   1.00 100.00 ? 5   LYS A CE    1 
ATOM   369  N NZ    . LYS B 2 4   ? 13.039 -1.788  8.909   1.00 100.00 ? 5   LYS A NZ    1 
ATOM   370  N N     . ASP B 2 5   ? 14.261 -1.042  15.598  1.00 35.91  ? 6   ASP A N     1 
ATOM   371  C CA    . ASP B 2 5   ? 14.475 -1.595  16.906  1.00 40.50  ? 6   ASP A CA    1 
ATOM   372  C C     . ASP B 2 5   ? 14.821 -0.513  17.892  1.00 45.49  ? 6   ASP A C     1 
ATOM   373  O O     . ASP B 2 5   ? 14.468 -0.578  19.084  1.00 44.88  ? 6   ASP A O     1 
ATOM   374  C CB    . ASP B 2 5   ? 15.570 -2.684  16.860  1.00 43.28  ? 6   ASP A CB    1 
ATOM   375  C CG    . ASP B 2 5   ? 15.280 -3.725  15.821  1.00 56.23  ? 6   ASP A CG    1 
ATOM   376  O OD1   . ASP B 2 5   ? 14.101 -4.163  15.776  1.00 61.87  ? 6   ASP A OD1   1 
ATOM   377  O OD2   . ASP B 2 5   ? 16.182 -4.029  15.010  1.00 45.93  ? 6   ASP A OD2   1 
ATOM   378  N N     . VAL B 2 6   ? 15.516 0.495   17.413  1.00 43.07  ? 7   VAL A N     1 
ATOM   379  C CA    . VAL B 2 6   ? 15.888 1.517   18.357  1.00 45.90  ? 7   VAL A CA    1 
ATOM   380  C C     . VAL B 2 6   ? 14.694 2.366   18.682  1.00 48.10  ? 7   VAL A C     1 
ATOM   381  O O     . VAL B 2 6   ? 14.372 2.620   19.874  1.00 44.12  ? 7   VAL A O     1 
ATOM   382  C CB    . VAL B 2 6   ? 17.125 2.346   17.919  1.00 50.26  ? 7   VAL A CB    1 
ATOM   383  C CG1   . VAL B 2 6   ? 18.066 2.509   19.077  1.00 47.20  ? 7   VAL A CG1   1 
ATOM   384  C CG2   . VAL B 2 6   ? 17.868 1.623   16.812  1.00 51.98  ? 7   VAL A CG2   1 
ATOM   385  N N     . ALA B 2 7   ? 14.038 2.791   17.611  1.00 43.08  ? 8   ALA A N     1 
ATOM   386  C CA    . ALA B 2 7   ? 12.871 3.647   17.755  1.00 42.38  ? 8   ALA A CA    1 
ATOM   387  C C     . ALA B 2 7   ? 11.923 3.016   18.773  1.00 45.57  ? 8   ALA A C     1 
ATOM   388  O O     . ALA B 2 7   ? 11.396 3.680   19.690  1.00 39.23  ? 8   ALA A O     1 
ATOM   389  C CB    . ALA B 2 7   ? 12.229 3.922   16.399  1.00 41.66  ? 8   ALA A CB    1 
ATOM   390  N N     . LYS B 2 8   ? 11.765 1.704   18.636  1.00 46.42  ? 9   LYS A N     1 
ATOM   391  C CA    . LYS B 2 8   ? 10.915 0.985   19.552  1.00 45.74  ? 9   LYS A CA    1 
ATOM   392  C C     . LYS B 2 8   ? 11.255 0.948   21.007  1.00 53.76  ? 9   LYS A C     1 
ATOM   393  O O     . LYS B 2 8   ? 10.413 1.090   21.897  1.00 59.56  ? 9   LYS A O     1 
ATOM   394  C CB    . LYS B 2 8   ? 9.831  0.075   18.972  1.00 47.95  ? 9   LYS A CB    1 
ATOM   395  C CG    . LYS B 2 8   ? 10.205 -1.365  18.698  1.00 91.99  ? 9   LYS A CG    1 
ATOM   396  C CD    . LYS B 2 8   ? 8.949  -2.188  18.291  1.00 100.00 ? 9   LYS A CD    1 
ATOM   397  C CE    . LYS B 2 8   ? 8.498  -1.965  16.801  1.00 100.00 ? 9   LYS A CE    1 
ATOM   398  N NZ    . LYS B 2 8   ? 7.051  -2.319  16.457  1.00 100.00 ? 9   LYS A NZ    1 
ATOM   399  N N     . ARG B 2 9   ? 12.535 0.810   21.255  1.00 49.31  ? 10  ARG A N     1 
ATOM   400  C CA    . ARG B 2 9   ? 12.975 0.806   22.617  1.00 48.36  ? 10  ARG A CA    1 
ATOM   401  C C     . ARG B 2 9   ? 12.724 2.217   23.081  1.00 50.69  ? 10  ARG A C     1 
ATOM   402  O O     . ARG B 2 9   ? 12.177 2.437   24.141  1.00 51.41  ? 10  ARG A O     1 
ATOM   403  C CB    . ARG B 2 9   ? 14.468 0.535   22.662  1.00 54.09  ? 10  ARG A CB    1 
ATOM   404  C CG    . ARG B 2 9   ? 14.936 0.056   24.012  1.00 83.24  ? 10  ARG A CG    1 
ATOM   405  C CD    . ARG B 2 9   ? 14.860 -1.470  24.138  1.00 100.00 ? 10  ARG A CD    1 
ATOM   406  N NE    . ARG B 2 9   ? 15.759 -1.925  25.192  1.00 100.00 ? 10  ARG A NE    1 
ATOM   407  C CZ    . ARG B 2 9   ? 15.760 -1.420  26.427  1.00 100.00 ? 10  ARG A CZ    1 
ATOM   408  N NH1   . ARG B 2 9   ? 14.897 -0.447  26.760  1.00 100.00 ? 10  ARG A NH1   1 
ATOM   409  N NH2   . ARG B 2 9   ? 16.625 -1.891  27.334  1.00 100.00 ? 10  ARG A NH2   1 
ATOM   410  N N     . ALA B 2 10  ? 13.123 3.180   22.260  1.00 48.84  ? 11  ALA A N     1 
ATOM   411  C CA    . ALA B 2 10  ? 12.973 4.595   22.588  1.00 49.09  ? 11  ALA A CA    1 
ATOM   412  C C     . ALA B 2 10  ? 11.570 5.170   22.606  1.00 51.24  ? 11  ALA A C     1 
ATOM   413  O O     . ALA B 2 10  ? 11.341 6.270   23.114  1.00 52.37  ? 11  ALA A O     1 
ATOM   414  C CB    . ALA B 2 10  ? 13.828 5.408   21.686  1.00 50.51  ? 11  ALA A CB    1 
ATOM   415  N N     . ASN B 2 11  ? 10.631 4.438   22.041  1.00 44.57  ? 12  ASN A N     1 
ATOM   416  C CA    . ASN B 2 11  ? 9.249  4.895   21.997  1.00 45.25  ? 12  ASN A CA    1 
ATOM   417  C C     . ASN B 2 11  ? 9.161  6.203   21.308  1.00 42.45  ? 12  ASN A C     1 
ATOM   418  O O     . ASN B 2 11  ? 8.525  7.115   21.799  1.00 46.95  ? 12  ASN A O     1 
ATOM   419  C CB    . ASN B 2 11  ? 8.564  4.960   23.370  1.00 48.02  ? 12  ASN A CB    1 
ATOM   420  C CG    . ASN B 2 11  ? 9.386  4.280   24.446  1.00 100.00 ? 12  ASN A CG    1 
ATOM   421  O OD1   . ASN B 2 11  ? 10.039 4.946   25.277  1.00 100.00 ? 12  ASN A OD1   1 
ATOM   422  N ND2   . ASN B 2 11  ? 9.411  2.935   24.406  1.00 100.00 ? 12  ASN A ND2   1 
ATOM   423  N N     . VAL B 2 12  ? 9.798  6.259   20.150  1.00 31.19  ? 13  VAL A N     1 
ATOM   424  C CA    . VAL B 2 12  ? 9.813  7.425   19.285  1.00 28.68  ? 13  VAL A CA    1 
ATOM   425  C C     . VAL B 2 12  ? 9.820  6.852   17.899  1.00 34.01  ? 13  VAL A C     1 
ATOM   426  O O     . VAL B 2 12  ? 9.984  5.664   17.694  1.00 36.44  ? 13  VAL A O     1 
ATOM   427  C CB    . VAL B 2 12  ? 11.148 8.068   19.349  1.00 32.32  ? 13  VAL A CB    1 
ATOM   428  C CG1   . VAL B 2 12  ? 11.570 8.153   20.805  1.00 32.88  ? 13  VAL A CG1   1 
ATOM   429  C CG2   . VAL B 2 12  ? 12.143 7.188   18.548  1.00 29.34  ? 13  VAL A CG2   1 
ATOM   430  N N     . SER B 2 13  ? 9.681  7.710   16.925  1.00 32.72  ? 14  SER A N     1 
ATOM   431  C CA    . SER B 2 13  ? 9.694  7.248   15.559  1.00 32.25  ? 14  SER A CA    1 
ATOM   432  C C     . SER B 2 13  ? 11.141 7.065   15.112  1.00 40.19  ? 14  SER A C     1 
ATOM   433  O O     . SER B 2 13  ? 12.099 7.553   15.726  1.00 41.68  ? 14  SER A O     1 
ATOM   434  C CB    . SER B 2 13  ? 9.015  8.295   14.682  1.00 34.55  ? 14  SER A CB    1 
ATOM   435  O OG    . SER B 2 13  ? 9.874  9.383   14.439  1.00 56.15  ? 14  SER A OG    1 
ATOM   436  N N     . THR B 2 14  ? 11.286 6.361   14.015  1.00 37.15  ? 15  THR A N     1 
ATOM   437  C CA    . THR B 2 14  ? 12.583 6.108   13.455  1.00 38.79  ? 15  THR A CA    1 
ATOM   438  C C     . THR B 2 14  ? 13.100 7.446   12.974  1.00 44.55  ? 15  THR A C     1 
ATOM   439  O O     . THR B 2 14  ? 14.290 7.761   13.132  1.00 44.14  ? 15  THR A O     1 
ATOM   440  C CB    . THR B 2 14  ? 12.420 5.241   12.205  1.00 44.89  ? 15  THR A CB    1 
ATOM   441  O OG1   . THR B 2 14  ? 11.329 5.738   11.415  1.00 37.14  ? 15  THR A OG1   1 
ATOM   442  C CG2   . THR B 2 14  ? 12.224 3.765   12.590  1.00 27.36  ? 15  THR A CG2   1 
ATOM   443  N N     . THR B 2 15  ? 12.180 8.208   12.377  1.00 40.84  ? 16  THR A N     1 
ATOM   444  C CA    . THR B 2 15  ? 12.483 9.538   11.851  1.00 39.97  ? 16  THR A CA    1 
ATOM   445  C C     . THR B 2 15  ? 13.212 10.241  12.961  1.00 37.93  ? 16  THR A C     1 
ATOM   446  O O     . THR B 2 15  ? 14.273 10.835  12.770  1.00 36.10  ? 16  THR A O     1 
ATOM   447  C CB    . THR B 2 15  ? 11.210 10.387  11.678  1.00 29.84  ? 16  THR A CB    1 
ATOM   448  O OG1   . THR B 2 15  ? 10.329 9.779   10.725  1.00 46.20  ? 16  THR A OG1   1 
ATOM   449  C CG2   . THR B 2 15  ? 11.597 11.732  11.194  1.00 24.15  ? 16  THR A CG2   1 
ATOM   450  N N     . THR B 2 16  ? 12.633 10.133  14.141  1.00 26.22  ? 17  THR A N     1 
ATOM   451  C CA    . THR B 2 16  ? 13.253 10.761  15.230  1.00 25.70  ? 17  THR A CA    1 
ATOM   452  C C     . THR B 2 16  ? 14.641 10.208  15.368  1.00 32.35  ? 17  THR A C     1 
ATOM   453  O O     . THR B 2 16  ? 15.625 10.928  15.098  1.00 32.83  ? 17  THR A O     1 
ATOM   454  C CB    . THR B 2 16  ? 12.426 10.709  16.446  1.00 31.85  ? 17  THR A CB    1 
ATOM   455  O OG1   . THR B 2 16  ? 11.521 11.815  16.388  1.00 34.62  ? 17  THR A OG1   1 
ATOM   456  C CG2   . THR B 2 16  ? 13.295 10.887  17.621  1.00 28.06  ? 17  THR A CG2   1 
ATOM   457  N N     . VAL B 2 17  ? 14.718 8.931   15.713  1.00 26.76  ? 18  VAL A N     1 
ATOM   458  C CA    . VAL B 2 17  ? 16.011 8.269   15.874  1.00 24.49  ? 18  VAL A CA    1 
ATOM   459  C C     . VAL B 2 17  ? 17.007 8.733   14.830  1.00 27.09  ? 18  VAL A C     1 
ATOM   460  O O     . VAL B 2 17  ? 18.155 9.026   15.131  1.00 31.80  ? 18  VAL A O     1 
ATOM   461  C CB    . VAL B 2 17  ? 15.873 6.794   15.713  1.00 27.69  ? 18  VAL A CB    1 
ATOM   462  C CG1   . VAL B 2 17  ? 17.236 6.154   15.673  1.00 27.36  ? 18  VAL A CG1   1 
ATOM   463  C CG2   . VAL B 2 17  ? 15.041 6.237   16.857  1.00 28.36  ? 18  VAL A CG2   1 
ATOM   464  N N     . SER B 2 18  ? 16.547 8.840   13.608  1.00 14.39  ? 19  SER A N     1 
ATOM   465  C CA    . SER B 2 18  ? 17.440 9.266   12.606  1.00 17.17  ? 19  SER A CA    1 
ATOM   466  C C     . SER B 2 18  ? 17.971 10.633  13.004  1.00 31.66  ? 19  SER A C     1 
ATOM   467  O O     . SER B 2 18  ? 19.104 10.714  13.461  1.00 34.45  ? 19  SER A O     1 
ATOM   468  C CB    . SER B 2 18  ? 16.799 9.199   11.202  1.00 22.54  ? 19  SER A CB    1 
ATOM   469  O OG    . SER B 2 18  ? 17.411 10.113  10.307  1.00 26.36  ? 19  SER A OG    1 
ATOM   470  N N     . HIS B 2 19  ? 17.161 11.676  12.866  1.00 31.75  ? 20  HIS A N     1 
ATOM   471  C CA    . HIS B 2 19  ? 17.554 13.063  13.208  1.00 31.00  ? 20  HIS A CA    1 
ATOM   472  C C     . HIS B 2 19  ? 18.492 13.232  14.375  1.00 34.93  ? 20  HIS A C     1 
ATOM   473  O O     . HIS B 2 19  ? 19.451 13.985  14.304  1.00 37.25  ? 20  HIS A O     1 
ATOM   474  C CB    . HIS B 2 19  ? 16.336 13.891  13.572  1.00 29.58  ? 20  HIS A CB    1 
ATOM   475  C CG    . HIS B 2 19  ? 15.514 14.270  12.405  1.00 30.07  ? 20  HIS A CG    1 
ATOM   476  N ND1   . HIS B 2 19  ? 15.885 15.267  11.540  1.00 33.38  ? 20  HIS A ND1   1 
ATOM   477  C CD2   . HIS B 2 19  ? 14.348 13.784  11.940  1.00 31.92  ? 20  HIS A CD2   1 
ATOM   478  C CE1   . HIS B 2 19  ? 14.985 15.389  10.584  1.00 31.76  ? 20  HIS A CE1   1 
ATOM   479  N NE2   . HIS B 2 19  ? 14.038 14.500  10.804  1.00 32.50  ? 20  HIS A NE2   1 
ATOM   480  N N     . VAL B 2 20  ? 18.207 12.556  15.474  1.00 29.73  ? 21  VAL A N     1 
ATOM   481  C CA    . VAL B 2 20  ? 19.096 12.707  16.607  1.00 32.96  ? 21  VAL A CA    1 
ATOM   482  C C     . VAL B 2 20  ? 20.479 12.253  16.254  1.00 37.58  ? 21  VAL A C     1 
ATOM   483  O O     . VAL B 2 20  ? 21.458 12.935  16.524  1.00 43.28  ? 21  VAL A O     1 
ATOM   484  C CB    . VAL B 2 20  ? 18.647 11.950  17.849  1.00 37.05  ? 21  VAL A CB    1 
ATOM   485  C CG1   . VAL B 2 20  ? 17.355 11.218  17.579  1.00 41.73  ? 21  VAL A CG1   1 
ATOM   486  C CG2   . VAL B 2 20  ? 19.741 11.051  18.298  1.00 33.04  ? 21  VAL A CG2   1 
ATOM   487  N N     . ILE B 2 21  ? 20.541 11.093  15.647  1.00 32.79  ? 22  ILE A N     1 
ATOM   488  C CA    . ILE B 2 21  ? 21.803 10.523  15.233  1.00 37.57  ? 22  ILE A CA    1 
ATOM   489  C C     . ILE B 2 21  ? 22.541 11.480  14.300  1.00 41.01  ? 22  ILE A C     1 
ATOM   490  O O     . ILE B 2 21  ? 23.751 11.661  14.414  1.00 43.24  ? 22  ILE A O     1 
ATOM   491  C CB    . ILE B 2 21  ? 21.547 9.295   14.398  1.00 41.89  ? 22  ILE A CB    1 
ATOM   492  C CG1   . ILE B 2 21  ? 21.946 8.030   15.102  1.00 41.26  ? 22  ILE A CG1   1 
ATOM   493  C CG2   . ILE B 2 21  ? 22.276 9.362   13.113  1.00 41.37  ? 22  ILE A CG2   1 
ATOM   494  C CD1   . ILE B 2 21  ? 21.456 6.909   14.238  1.00 55.42  ? 22  ILE A CD1   1 
ATOM   495  N N     . ASN B 2 22  ? 21.840 12.092  13.361  1.00 32.41  ? 23  ASN A N     1 
ATOM   496  C CA    . ASN B 2 22  ? 22.570 12.995  12.493  1.00 31.27  ? 23  ASN A CA    1 
ATOM   497  C C     . ASN B 2 22  ? 22.294 14.440  12.717  1.00 36.99  ? 23  ASN A C     1 
ATOM   498  O O     . ASN B 2 22  ? 22.411 15.211  11.767  1.00 32.41  ? 23  ASN A O     1 
ATOM   499  C CB    . ASN B 2 22  ? 22.453 12.689  11.023  1.00 18.00  ? 23  ASN A CB    1 
ATOM   500  C CG    . ASN B 2 22  ? 21.690 11.456  10.744  1.00 65.26  ? 23  ASN A CG    1 
ATOM   501  O OD1   . ASN B 2 22  ? 22.173 10.598  9.990   1.00 48.37  ? 23  ASN A OD1   1 
ATOM   502  N ND2   . ASN B 2 22  ? 20.450 11.373  11.266  1.00 67.03  ? 23  ASN A ND2   1 
ATOM   503  N N     . LYS B 2 23  ? 21.932 14.751  13.970  1.00 39.33  ? 24  LYS A N     1 
ATOM   504  C CA    . LYS B 2 23  ? 21.642 16.099  14.467  1.00 42.20  ? 24  LYS A CA    1 
ATOM   505  C C     . LYS B 2 23  ? 21.181 16.906  13.302  1.00 37.64  ? 24  LYS A C     1 
ATOM   506  O O     . LYS B 2 23  ? 21.797 17.844  12.886  1.00 41.96  ? 24  LYS A O     1 
ATOM   507  C CB    . LYS B 2 23  ? 22.983 16.665  14.944  1.00 49.05  ? 24  LYS A CB    1 
ATOM   508  C CG    . LYS B 2 23  ? 23.838 15.661  15.714  1.00 64.14  ? 24  LYS A CG    1 
ATOM   509  C CD    . LYS B 2 23  ? 25.285 16.116  15.780  1.00 83.78  ? 24  LYS A CD    1 
ATOM   510  C CE    . LYS B 2 23  ? 26.088 15.262  16.772  1.00 100.00 ? 24  LYS A CE    1 
ATOM   511  N NZ    . LYS B 2 23  ? 26.683 16.038  17.926  1.00 100.00 ? 24  LYS A NZ    1 
ATOM   512  N N     . THR B 2 24  ? 20.107 16.487  12.718  1.00 31.29  ? 25  THR A N     1 
ATOM   513  C CA    . THR B 2 24  ? 19.672 17.157  11.530  1.00 30.38  ? 25  THR A CA    1 
ATOM   514  C C     . THR B 2 24  ? 18.375 17.968  11.655  1.00 28.89  ? 25  THR A C     1 
ATOM   515  O O     . THR B 2 24  ? 17.756 18.460  10.696  1.00 26.64  ? 25  THR A O     1 
ATOM   516  C CB    . THR B 2 24  ? 19.618 16.036  10.532  1.00 25.93  ? 25  THR A CB    1 
ATOM   517  O OG1   . THR B 2 24  ? 19.525 16.541  9.219   1.00 25.80  ? 25  THR A OG1   1 
ATOM   518  C CG2   . THR B 2 24  ? 18.480 15.089  10.870  1.00 14.77  ? 25  THR A CG2   1 
ATOM   519  N N     . ARG B 2 25  ? 17.977 18.090  12.895  1.00 23.43  ? 26  ARG A N     1 
ATOM   520  C CA    . ARG B 2 25  ? 16.814 18.843  13.250  1.00 25.11  ? 26  ARG A CA    1 
ATOM   521  C C     . ARG B 2 25  ? 16.729 18.754  14.786  1.00 39.46  ? 26  ARG A C     1 
ATOM   522  O O     . ARG B 2 25  ? 17.314 17.834  15.395  1.00 46.65  ? 26  ARG A O     1 
ATOM   523  C CB    . ARG B 2 25  ? 15.569 18.455  12.466  1.00 14.66  ? 26  ARG A CB    1 
ATOM   524  C CG    . ARG B 2 25  ? 14.474 17.888  13.358  1.00 22.40  ? 26  ARG A CG    1 
ATOM   525  C CD    . ARG B 2 25  ? 13.320 17.432  12.522  1.00 34.48  ? 26  ARG A CD    1 
ATOM   526  N NE    . ARG B 2 25  ? 12.442 16.506  13.220  1.00 39.54  ? 26  ARG A NE    1 
ATOM   527  C CZ    . ARG B 2 25  ? 11.316 16.104  12.676  1.00 40.62  ? 26  ARG A CZ    1 
ATOM   528  N NH1   . ARG B 2 25  ? 11.019 16.580  11.476  1.00 29.86  ? 26  ARG A NH1   1 
ATOM   529  N NH2   . ARG B 2 25  ? 10.529 15.253  13.304  1.00 37.51  ? 26  ARG A NH2   1 
ATOM   530  N N     . PHE B 2 26  ? 16.063 19.724  15.414  1.00 30.71  ? 27  PHE A N     1 
ATOM   531  C CA    . PHE B 2 26  ? 15.982 19.729  16.862  1.00 30.62  ? 27  PHE A CA    1 
ATOM   532  C C     . PHE B 2 26  ? 15.283 18.602  17.611  1.00 38.26  ? 27  PHE A C     1 
ATOM   533  O O     . PHE B 2 26  ? 14.173 18.140  17.218  1.00 47.03  ? 27  PHE A O     1 
ATOM   534  C CB    . PHE B 2 26  ? 15.597 21.116  17.427  1.00 30.78  ? 27  PHE A CB    1 
ATOM   535  C CG    . PHE B 2 26  ? 15.496 21.142  18.918  1.00 26.46  ? 27  PHE A CG    1 
ATOM   536  C CD1   . PHE B 2 26  ? 14.345 20.788  19.537  1.00 25.36  ? 27  PHE A CD1   1 
ATOM   537  C CD2   . PHE B 2 26  ? 16.564 21.487  19.682  1.00 32.07  ? 27  PHE A CD2   1 
ATOM   538  C CE1   . PHE B 2 26  ? 14.236 20.754  20.883  1.00 27.13  ? 27  PHE A CE1   1 
ATOM   539  C CE2   . PHE B 2 26  ? 16.460 21.484  21.054  1.00 37.70  ? 27  PHE A CE2   1 
ATOM   540  C CZ    . PHE B 2 26  ? 15.277 21.122  21.650  1.00 31.63  ? 27  PHE A CZ    1 
ATOM   541  N N     . VAL B 2 27  ? 15.922 18.167  18.696  1.00 22.35  ? 28  VAL A N     1 
ATOM   542  C CA    . VAL B 2 27  ? 15.290 17.131  19.489  1.00 24.86  ? 28  VAL A CA    1 
ATOM   543  C C     . VAL B 2 27  ? 15.373 17.364  20.965  1.00 35.92  ? 28  VAL A C     1 
ATOM   544  O O     . VAL B 2 27  ? 16.443 17.583  21.519  1.00 34.96  ? 28  VAL A O     1 
ATOM   545  C CB    . VAL B 2 27  ? 15.842 15.723  19.286  1.00 25.86  ? 28  VAL A CB    1 
ATOM   546  C CG1   . VAL B 2 27  ? 15.087 14.717  20.182  1.00 21.40  ? 28  VAL A CG1   1 
ATOM   547  C CG2   . VAL B 2 27  ? 15.804 15.361  17.839  1.00 24.69  ? 28  VAL A CG2   1 
ATOM   548  N N     . ALA B 2 28  ? 14.222 17.267  21.594  1.00 37.15  ? 29  ALA A N     1 
ATOM   549  C CA    . ALA B 2 28  ? 14.134 17.417  23.020  1.00 39.41  ? 29  ALA A CA    1 
ATOM   550  C C     . ALA B 2 28  ? 15.223 16.544  23.667  1.00 47.34  ? 29  ALA A C     1 
ATOM   551  O O     . ALA B 2 28  ? 15.485 15.401  23.226  1.00 43.08  ? 29  ALA A O     1 
ATOM   552  C CB    . ALA B 2 28  ? 12.739 16.978  23.499  1.00 39.37  ? 29  ALA A CB    1 
ATOM   553  N N     . GLU B 2 29  ? 15.853 17.124  24.687  1.00 49.66  ? 30  GLU A N     1 
ATOM   554  C CA    . GLU B 2 29  ? 16.920 16.482  25.425  1.00 54.82  ? 30  GLU A CA    1 
ATOM   555  C C     . GLU B 2 29  ? 16.518 15.093  25.842  1.00 54.12  ? 30  GLU A C     1 
ATOM   556  O O     . GLU B 2 29  ? 17.169 14.124  25.459  1.00 47.33  ? 30  GLU A O     1 
ATOM   557  C CB    . GLU B 2 29  ? 17.337 17.313  26.651  1.00 60.36  ? 30  GLU A CB    1 
ATOM   558  C CG    . GLU B 2 29  ? 18.852 17.758  26.688  1.00 88.81  ? 30  GLU A CG    1 
ATOM   559  C CD    . GLU B 2 29  ? 19.414 18.066  28.120  1.00 100.00 ? 30  GLU A CD    1 
ATOM   560  O OE1   . GLU B 2 29  ? 19.578 17.105  28.936  1.00 100.00 ? 30  GLU A OE1   1 
ATOM   561  O OE2   . GLU B 2 29  ? 19.726 19.265  28.409  1.00 100.00 ? 30  GLU A OE2   1 
ATOM   562  N N     . GLU B 2 30  ? 15.447 15.002  26.618  1.00 57.24  ? 31  GLU A N     1 
ATOM   563  C CA    . GLU B 2 30  ? 14.962 13.693  27.072  1.00 61.36  ? 31  GLU A CA    1 
ATOM   564  C C     . GLU B 2 30  ? 14.935 12.729  25.938  1.00 63.59  ? 31  GLU A C     1 
ATOM   565  O O     . GLU B 2 30  ? 15.548 11.648  25.985  1.00 72.19  ? 31  GLU A O     1 
ATOM   566  C CB    . GLU B 2 30  ? 13.511 13.773  27.415  1.00 64.41  ? 31  GLU A CB    1 
ATOM   567  C CG    . GLU B 2 30  ? 13.195 14.695  28.531  1.00 100.00 ? 31  GLU A CG    1 
ATOM   568  C CD    . GLU B 2 30  ? 11.808 14.369  29.052  1.00 100.00 ? 31  GLU A CD    1 
ATOM   569  O OE1   . GLU B 2 30  ? 10.812 14.891  28.431  1.00 100.00 ? 31  GLU A OE1   1 
ATOM   570  O OE2   . GLU B 2 30  ? 11.735 13.520  30.007  1.00 100.00 ? 31  GLU A OE2   1 
ATOM   571  N N     . THR B 2 31  ? 14.197 13.154  24.924  1.00 43.04  ? 32  THR A N     1 
ATOM   572  C CA    . THR B 2 31  ? 14.048 12.383  23.742  1.00 37.37  ? 32  THR A CA    1 
ATOM   573  C C     . THR B 2 31  ? 15.430 11.953  23.262  1.00 36.67  ? 32  THR A C     1 
ATOM   574  O O     . THR B 2 31  ? 15.715 10.745  23.119  1.00 34.34  ? 32  THR A O     1 
ATOM   575  C CB    . THR B 2 31  ? 13.304 13.189  22.723  1.00 36.66  ? 32  THR A CB    1 
ATOM   576  O OG1   . THR B 2 31  ? 12.031 13.524  23.284  1.00 35.88  ? 32  THR A OG1   1 
ATOM   577  C CG2   . THR B 2 31  ? 13.072 12.356  21.462  1.00 37.65  ? 32  THR A CG2   1 
ATOM   578  N N     . ARG B 2 32  ? 16.287 12.937  23.051  1.00 30.34  ? 33  ARG A N     1 
ATOM   579  C CA    . ARG B 2 32  ? 17.626 12.667  22.594  1.00 30.81  ? 33  ARG A CA    1 
ATOM   580  C C     . ARG B 2 32  ? 18.263 11.571  23.421  1.00 44.09  ? 33  ARG A C     1 
ATOM   581  O O     . ARG B 2 32  ? 18.755 10.573  22.891  1.00 49.50  ? 33  ARG A O     1 
ATOM   582  C CB    . ARG B 2 32  ? 18.460 13.904  22.801  1.00 31.07  ? 33  ARG A CB    1 
ATOM   583  C CG    . ARG B 2 32  ? 18.878 14.580  21.549  1.00 64.05  ? 33  ARG A CG    1 
ATOM   584  C CD    . ARG B 2 32  ? 20.146 15.404  21.804  1.00 92.05  ? 33  ARG A CD    1 
ATOM   585  N NE    . ARG B 2 32  ? 19.881 16.843  21.873  1.00 100.00 ? 33  ARG A NE    1 
ATOM   586  C CZ    . ARG B 2 32  ? 19.636 17.509  23.005  1.00 100.00 ? 33  ARG A CZ    1 
ATOM   587  N NH1   . ARG B 2 32  ? 19.638 16.854  24.166  1.00 100.00 ? 33  ARG A NH1   1 
ATOM   588  N NH2   . ARG B 2 32  ? 19.400 18.828  22.981  1.00 100.00 ? 33  ARG A NH2   1 
ATOM   589  N N     . ASN B 2 33  ? 18.245 11.750  24.731  1.00 42.93  ? 34  ASN A N     1 
ATOM   590  C CA    . ASN B 2 33  ? 18.842 10.777  25.635  1.00 45.79  ? 34  ASN A CA    1 
ATOM   591  C C     . ASN B 2 33  ? 18.321 9.376   25.459  1.00 51.74  ? 34  ASN A C     1 
ATOM   592  O O     . ASN B 2 33  ? 19.085 8.403   25.354  1.00 53.83  ? 34  ASN A O     1 
ATOM   593  C CB    . ASN B 2 33  ? 18.597 11.201  27.059  1.00 59.09  ? 34  ASN A CB    1 
ATOM   594  C CG    . ASN B 2 33  ? 19.205 12.517  27.347  1.00 97.85  ? 34  ASN A CG    1 
ATOM   595  O OD1   . ASN B 2 33  ? 18.840 13.169  28.320  1.00 100.00 ? 34  ASN A OD1   1 
ATOM   596  N ND2   . ASN B 2 33  ? 20.133 12.946  26.477  1.00 88.13  ? 34  ASN A ND2   1 
ATOM   597  N N     . ALA B 2 34  ? 17.008 9.278   25.446  1.00 42.94  ? 35  ALA A N     1 
ATOM   598  C CA    . ALA B 2 34  ? 16.383 7.992   25.278  1.00 44.45  ? 35  ALA A CA    1 
ATOM   599  C C     . ALA B 2 34  ? 16.963 7.213   24.077  1.00 42.95  ? 35  ALA A C     1 
ATOM   600  O O     . ALA B 2 34  ? 17.357 6.030   24.188  1.00 40.61  ? 35  ALA A O     1 
ATOM   601  C CB    . ALA B 2 34  ? 14.913 8.206   25.098  1.00 46.89  ? 35  ALA A CB    1 
ATOM   602  N N     . VAL B 2 35  ? 16.994 7.893   22.934  1.00 33.31  ? 36  VAL A N     1 
ATOM   603  C CA    . VAL B 2 35  ? 17.502 7.327   21.694  1.00 33.27  ? 36  VAL A CA    1 
ATOM   604  C C     . VAL B 2 35  ? 18.955 6.927   21.857  1.00 44.43  ? 36  VAL A C     1 
ATOM   605  O O     . VAL B 2 35  ? 19.415 5.886   21.389  1.00 41.83  ? 36  VAL A O     1 
ATOM   606  C CB    . VAL B 2 35  ? 17.419 8.407   20.685  1.00 33.03  ? 36  VAL A CB    1 
ATOM   607  C CG1   . VAL B 2 35  ? 17.904 7.968   19.270  1.00 27.22  ? 36  VAL A CG1   1 
ATOM   608  C CG2   . VAL B 2 35  ? 15.992 8.896   20.734  1.00 33.76  ? 36  VAL A CG2   1 
ATOM   609  N N     . TRP B 2 36  ? 19.692 7.763   22.536  1.00 42.16  ? 37  TRP A N     1 
ATOM   610  C CA    . TRP B 2 36  ? 21.037 7.412   22.714  1.00 47.24  ? 37  TRP A CA    1 
ATOM   611  C C     . TRP B 2 36  ? 21.095 6.168   23.547  1.00 53.42  ? 37  TRP A C     1 
ATOM   612  O O     . TRP B 2 36  ? 21.855 5.260   23.253  1.00 55.02  ? 37  TRP A O     1 
ATOM   613  C CB    . TRP B 2 36  ? 21.708 8.554   23.378  1.00 51.31  ? 37  TRP A CB    1 
ATOM   614  C CG    . TRP B 2 36  ? 22.165 9.400   22.336  1.00 57.57  ? 37  TRP A CG    1 
ATOM   615  C CD1   . TRP B 2 36  ? 21.959 10.743  22.198  1.00 62.59  ? 37  TRP A CD1   1 
ATOM   616  C CD2   . TRP B 2 36  ? 22.900 8.982   21.207  1.00 58.40  ? 37  TRP A CD2   1 
ATOM   617  N NE1   . TRP B 2 36  ? 22.555 11.196  21.039  1.00 62.73  ? 37  TRP A NE1   1 
ATOM   618  C CE2   . TRP B 2 36  ? 23.137 10.126  20.409  1.00 64.23  ? 37  TRP A CE2   1 
ATOM   619  C CE3   . TRP B 2 36  ? 23.398 7.756   20.794  1.00 62.23  ? 37  TRP A CE3   1 
ATOM   620  C CZ2   . TRP B 2 36  ? 23.841 10.071  19.202  1.00 64.97  ? 37  TRP A CZ2   1 
ATOM   621  C CZ3   . TRP B 2 36  ? 24.098 7.700   19.597  1.00 66.44  ? 37  TRP A CZ3   1 
ATOM   622  C CH2   . TRP B 2 36  ? 24.312 8.853   18.812  1.00 66.93  ? 37  TRP A CH2   1 
ATOM   623  N N     . ALA B 2 37  ? 20.275 6.107   24.578  1.00 52.57  ? 38  ALA A N     1 
ATOM   624  C CA    . ALA B 2 37  ? 20.278 4.925   25.430  1.00 55.52  ? 38  ALA A CA    1 
ATOM   625  C C     . ALA B 2 37  ? 20.004 3.681   24.621  1.00 63.21  ? 38  ALA A C     1 
ATOM   626  O O     . ALA B 2 37  ? 20.778 2.720   24.654  1.00 66.64  ? 38  ALA A O     1 
ATOM   627  C CB    . ALA B 2 37  ? 19.235 5.040   26.483  1.00 56.64  ? 38  ALA A CB    1 
ATOM   628  N N     . ALA B 2 38  ? 18.872 3.716   23.922  1.00 53.16  ? 39  ALA A N     1 
ATOM   629  C CA    . ALA B 2 38  ? 18.453 2.613   23.099  1.00 47.53  ? 39  ALA A CA    1 
ATOM   630  C C     . ALA B 2 38  ? 19.635 2.254   22.223  1.00 52.04  ? 39  ALA A C     1 
ATOM   631  O O     . ALA B 2 38  ? 20.081 1.105   22.236  1.00 55.77  ? 39  ALA A O     1 
ATOM   632  C CB    . ALA B 2 38  ? 17.270 3.022   22.252  1.00 46.39  ? 39  ALA A CB    1 
ATOM   633  N N     . ILE B 2 39  ? 20.142 3.246   21.484  1.00 43.92  ? 40  ILE A N     1 
ATOM   634  C CA    . ILE B 2 39  ? 21.259 3.063   20.571  1.00 40.16  ? 40  ILE A CA    1 
ATOM   635  C C     . ILE B 2 39  ? 22.339 2.302   21.278  1.00 53.64  ? 40  ILE A C     1 
ATOM   636  O O     . ILE B 2 39  ? 22.994 1.410   20.725  1.00 52.67  ? 40  ILE A O     1 
ATOM   637  C CB    . ILE B 2 39  ? 21.828 4.392   20.150  1.00 38.23  ? 40  ILE A CB    1 
ATOM   638  C CG1   . ILE B 2 39  ? 20.877 5.053   19.188  1.00 37.28  ? 40  ILE A CG1   1 
ATOM   639  C CG2   . ILE B 2 39  ? 23.134 4.203   19.448  1.00 35.49  ? 40  ILE A CG2   1 
ATOM   640  C CD1   . ILE B 2 39  ? 21.424 6.291   18.569  1.00 50.76  ? 40  ILE A CD1   1 
ATOM   641  N N     . LYS B 2 40  ? 22.519 2.644   22.535  1.00 54.56  ? 41  LYS A N     1 
ATOM   642  C CA    . LYS B 2 40  ? 23.542 1.949   23.258  1.00 58.85  ? 41  LYS A CA    1 
ATOM   643  C C     . LYS B 2 40  ? 23.275 0.512   23.609  1.00 64.83  ? 41  LYS A C     1 
ATOM   644  O O     . LYS B 2 40  ? 24.025 -0.349  23.176  1.00 66.80  ? 41  LYS A O     1 
ATOM   645  C CB    . LYS B 2 40  ? 24.272 2.804   24.288  1.00 66.08  ? 41  LYS A CB    1 
ATOM   646  C CG    . LYS B 2 40  ? 25.125 3.942   23.605  1.00 100.00 ? 41  LYS A CG    1 
ATOM   647  C CD    . LYS B 2 40  ? 25.137 3.876   22.014  1.00 100.00 ? 41  LYS A CD    1 
ATOM   648  C CE    . LYS B 2 40  ? 26.369 4.607   21.327  1.00 100.00 ? 41  LYS A CE    1 
ATOM   649  N NZ    . LYS B 2 40  ? 26.817 4.108   19.930  1.00 100.00 ? 41  LYS A NZ    1 
ATOM   650  N N     . GLU B 2 41  ? 22.204 0.227   24.344  1.00 60.66  ? 42  GLU A N     1 
ATOM   651  C CA    . GLU B 2 41  ? 21.916 -1.164  24.677  1.00 59.45  ? 42  GLU A CA    1 
ATOM   652  C C     . GLU B 2 41  ? 21.820 -2.032  23.455  1.00 66.23  ? 42  GLU A C     1 
ATOM   653  O O     . GLU B 2 41  ? 22.376 -3.119  23.422  1.00 74.99  ? 42  GLU A O     1 
ATOM   654  C CB    . GLU B 2 41  ? 20.660 -1.320  25.509  1.00 61.26  ? 42  GLU A CB    1 
ATOM   655  C CG    . GLU B 2 41  ? 20.712 -0.511  26.791  1.00 89.67  ? 42  GLU A CG    1 
ATOM   656  C CD    . GLU B 2 41  ? 19.342 -0.039  27.186  1.00 100.00 ? 42  GLU A CD    1 
ATOM   657  O OE1   . GLU B 2 41  ? 18.390 -0.527  26.526  1.00 93.34  ? 42  GLU A OE1   1 
ATOM   658  O OE2   . GLU B 2 41  ? 19.224 0.804   28.120  1.00 100.00 ? 42  GLU A OE2   1 
ATOM   659  N N     . LEU B 2 42  ? 21.133 -1.584  22.425  1.00 57.09  ? 43  LEU A N     1 
ATOM   660  C CA    . LEU B 2 42  ? 21.066 -2.450  21.263  1.00 56.48  ? 43  LEU A CA    1 
ATOM   661  C C     . LEU B 2 42  ? 22.398 -2.590  20.557  1.00 61.60  ? 43  LEU A C     1 
ATOM   662  O O     . LEU B 2 42  ? 22.536 -3.453  19.698  1.00 60.37  ? 43  LEU A O     1 
ATOM   663  C CB    . LEU B 2 42  ? 20.017 -1.978  20.283  1.00 55.89  ? 43  LEU A CB    1 
ATOM   664  C CG    . LEU B 2 42  ? 18.682 -1.902  20.968  1.00 60.06  ? 43  LEU A CG    1 
ATOM   665  C CD1   . LEU B 2 42  ? 17.657 -2.289  19.931  1.00 60.64  ? 43  LEU A CD1   1 
ATOM   666  C CD2   . LEU B 2 42  ? 18.736 -2.926  22.083  1.00 70.72  ? 43  LEU A CD2   1 
ATOM   667  N N     . HIS B 2 43  ? 23.359 -1.745  20.911  1.00 64.60  ? 44  HIS A N     1 
ATOM   668  C CA    . HIS B 2 43  ? 24.653 -1.809  20.280  1.00 71.22  ? 44  HIS A CA    1 
ATOM   669  C C     . HIS B 2 43  ? 24.303 -1.599  18.844  1.00 66.99  ? 44  HIS A C     1 
ATOM   670  O O     . HIS B 2 43  ? 24.353 -2.532  18.054  1.00 67.97  ? 44  HIS A O     1 
ATOM   671  C CB    . HIS B 2 43  ? 25.162 -3.221  20.418  1.00 81.01  ? 44  HIS A CB    1 
ATOM   672  C CG    . HIS B 2 43  ? 26.360 -3.349  21.296  1.00 92.84  ? 44  HIS A CG    1 
ATOM   673  N ND1   . HIS B 2 43  ? 26.265 -3.520  22.667  1.00 98.02  ? 44  HIS A ND1   1 
ATOM   674  C CD2   . HIS B 2 43  ? 27.688 -3.347  20.997  1.00 100.00 ? 44  HIS A CD2   1 
ATOM   675  C CE1   . HIS B 2 43  ? 27.488 -3.607  23.174  1.00 100.00 ? 44  HIS A CE1   1 
ATOM   676  N NE2   . HIS B 2 43  ? 28.369 -3.511  22.183  1.00 100.00 ? 44  HIS A NE2   1 
ATOM   677  N N     . TYR B 2 44  ? 23.901 -0.384  18.515  1.00 58.55  ? 45  TYR A N     1 
ATOM   678  C CA    . TYR B 2 44  ? 23.482 -0.049  17.165  1.00 51.31  ? 45  TYR A CA    1 
ATOM   679  C C     . TYR B 2 44  ? 24.518 0.609   16.248  1.00 52.65  ? 45  TYR A C     1 
ATOM   680  O O     . TYR B 2 44  ? 25.101 1.639   16.572  1.00 54.28  ? 45  TYR A O     1 
ATOM   681  C CB    . TYR B 2 44  ? 22.245 0.835   17.274  1.00 46.41  ? 45  TYR A CB    1 
ATOM   682  C CG    . TYR B 2 44  ? 21.743 1.332   15.960  1.00 41.18  ? 45  TYR A CG    1 
ATOM   683  C CD1   . TYR B 2 44  ? 21.220 0.464   15.051  1.00 40.49  ? 45  TYR A CD1   1 
ATOM   684  C CD2   . TYR B 2 44  ? 21.807 2.681   15.614  1.00 40.07  ? 45  TYR A CD2   1 
ATOM   685  C CE1   . TYR B 2 44  ? 20.743 0.899   13.842  1.00 38.69  ? 45  TYR A CE1   1 
ATOM   686  C CE2   . TYR B 2 44  ? 21.348 3.111   14.380  1.00 39.14  ? 45  TYR A CE2   1 
ATOM   687  C CZ    . TYR B 2 44  ? 20.795 2.194   13.509  1.00 39.88  ? 45  TYR A CZ    1 
ATOM   688  O OH    . TYR B 2 44  ? 20.292 2.481   12.260  1.00 42.09  ? 45  TYR A OH    1 
ATOM   689  N N     . SER B 2 45  ? 24.743 0.015   15.091  1.00 45.04  ? 46  SER A N     1 
ATOM   690  C CA    . SER B 2 45  ? 25.675 0.599   14.152  1.00 44.57  ? 46  SER A CA    1 
ATOM   691  C C     . SER B 2 45  ? 24.715 0.855   13.008  1.00 47.50  ? 46  SER A C     1 
ATOM   692  O O     . SER B 2 45  ? 23.991 -0.006  12.548  1.00 48.46  ? 46  SER A O     1 
ATOM   693  C CB    . SER B 2 45  ? 26.782 -0.377  13.752  1.00 54.36  ? 46  SER A CB    1 
ATOM   694  O OG    . SER B 2 45  ? 27.188 -0.175  12.402  1.00 82.15  ? 46  SER A OG    1 
ATOM   695  N N     . PRO B 2 46  ? 24.671 2.068   12.553  1.00 42.17  ? 47  PRO A N     1 
ATOM   696  C CA    . PRO B 2 46  ? 23.741 2.353   11.494  1.00 42.31  ? 47  PRO A CA    1 
ATOM   697  C C     . PRO B 2 46  ? 24.330 1.861   10.195  1.00 47.89  ? 47  PRO A C     1 
ATOM   698  O O     . PRO B 2 46  ? 25.500 2.072   9.955   1.00 52.58  ? 47  PRO A O     1 
ATOM   699  C CB    . PRO B 2 46  ? 23.689 3.889   11.500  1.00 42.45  ? 47  PRO A CB    1 
ATOM   700  C CG    . PRO B 2 46  ? 24.448 4.324   12.775  1.00 43.56  ? 47  PRO A CG    1 
ATOM   701  C CD    . PRO B 2 46  ? 24.719 3.112   13.578  1.00 39.43  ? 47  PRO A CD    1 
ATOM   702  N N     . SER B 2 47  ? 23.542 1.224   9.336   1.00 40.34  ? 48  SER A N     1 
ATOM   703  C CA    . SER B 2 47  ? 24.101 0.779   8.066   1.00 38.45  ? 48  SER A CA    1 
ATOM   704  C C     . SER B 2 47  ? 24.474 1.921   7.093   1.00 43.54  ? 48  SER A C     1 
ATOM   705  O O     . SER B 2 47  ? 23.609 2.741   6.725   1.00 44.64  ? 48  SER A O     1 
ATOM   706  C CB    . SER B 2 47  ? 23.116 -0.093  7.290   1.00 37.32  ? 48  SER A CB    1 
ATOM   707  O OG    . SER B 2 47  ? 23.414 -0.024  5.867   1.00 40.07  ? 48  SER A OG    1 
ATOM   708  N N     . ALA B 2 48  ? 25.722 1.950   6.625   1.00 31.57  ? 49  ALA A N     1 
ATOM   709  C CA    . ALA B 2 48  ? 26.087 2.976   5.667   1.00 28.81  ? 49  ALA A CA    1 
ATOM   710  C C     . ALA B 2 48  ? 25.539 2.576   4.317   1.00 31.02  ? 49  ALA A C     1 
ATOM   711  O O     . ALA B 2 48  ? 25.332 3.412   3.450   1.00 28.69  ? 49  ALA A O     1 
ATOM   712  C CB    . ALA B 2 48  ? 27.530 3.085   5.544   1.00 29.71  ? 49  ALA A CB    1 
ATOM   713  N N     . VAL B 2 49  ? 25.301 1.294   4.098   1.00 26.69  ? 50  VAL A N     1 
ATOM   714  C CA    . VAL B 2 49  ? 24.818 1.003   2.771   1.00 27.81  ? 50  VAL A CA    1 
ATOM   715  C C     . VAL B 2 49  ? 23.419 1.510   2.608   1.00 35.05  ? 50  VAL A C     1 
ATOM   716  O O     . VAL B 2 49  ? 23.041 2.073   1.538   1.00 30.09  ? 50  VAL A O     1 
ATOM   717  C CB    . VAL B 2 49  ? 25.033 -0.444  2.373   1.00 28.70  ? 50  VAL A CB    1 
ATOM   718  C CG1   . VAL B 2 49  ? 25.118 -1.223  3.612   1.00 29.67  ? 50  VAL A CG1   1 
ATOM   719  C CG2   . VAL B 2 49  ? 23.888 -0.957  1.450   1.00 27.06  ? 50  VAL A CG2   1 
ATOM   720  N N     . ALA B 2 50  ? 22.656 1.322   3.685   1.00 31.75  ? 51  ALA A N     1 
ATOM   721  C CA    . ALA B 2 50  ? 21.271 1.761   3.672   1.00 33.30  ? 51  ALA A CA    1 
ATOM   722  C C     . ALA B 2 50  ? 21.306 3.251   3.466   1.00 30.90  ? 51  ALA A C     1 
ATOM   723  O O     . ALA B 2 50  ? 20.650 3.795   2.551   1.00 31.27  ? 51  ALA A O     1 
ATOM   724  C CB    . ALA B 2 50  ? 20.567 1.420   4.980   1.00 35.80  ? 51  ALA A CB    1 
ATOM   725  N N     . ARG B 2 51  ? 22.109 3.911   4.290   1.00 17.38  ? 52  ARG A N     1 
ATOM   726  C CA    . ARG B 2 51  ? 22.176 5.322   4.133   1.00 17.80  ? 52  ARG A CA    1 
ATOM   727  C C     . ARG B 2 51  ? 22.620 5.693   2.728   1.00 24.53  ? 52  ARG A C     1 
ATOM   728  O O     . ARG B 2 51  ? 22.034 6.567   2.109   1.00 26.62  ? 52  ARG A O     1 
ATOM   729  C CB    . ARG B 2 51  ? 23.045 5.965   5.198   1.00 21.87  ? 52  ARG A CB    1 
ATOM   730  C CG    . ARG B 2 51  ? 23.708 7.302   4.752   1.00 38.27  ? 52  ARG A CG    1 
ATOM   731  C CD    . ARG B 2 51  ? 24.243 8.140   5.951   1.00 44.42  ? 52  ARG A CD    1 
ATOM   732  N NE    . ARG B 2 51  ? 23.374 9.282   6.199   1.00 52.26  ? 52  ARG A NE    1 
ATOM   733  C CZ    . ARG B 2 51  ? 23.594 10.498  5.741   1.00 59.30  ? 52  ARG A CZ    1 
ATOM   734  N NH1   . ARG B 2 51  ? 24.681 10.762  5.011   1.00 69.56  ? 52  ARG A NH1   1 
ATOM   735  N NH2   . ARG B 2 51  ? 22.715 11.443  6.027   1.00 77.85  ? 52  ARG A NH2   1 
ATOM   736  N N     . SER B 2 52  ? 23.628 5.028   2.189   1.00 17.91  ? 53  SER A N     1 
ATOM   737  C CA    . SER B 2 52  ? 24.045 5.416   0.856   1.00 17.71  ? 53  SER A CA    1 
ATOM   738  C C     . SER B 2 52  ? 22.977 5.260   -0.146  1.00 29.47  ? 53  SER A C     1 
ATOM   739  O O     . SER B 2 52  ? 22.888 6.064   -1.082  1.00 26.37  ? 53  SER A O     1 
ATOM   740  C CB    . SER B 2 52  ? 25.243 4.629   0.417   1.00 26.25  ? 53  SER A CB    1 
ATOM   741  O OG    . SER B 2 52  ? 26.087 4.375   1.533   1.00 69.26  ? 53  SER A OG    1 
ATOM   742  N N     . LEU B 2 53  ? 22.181 4.207   0.058   1.00 34.13  ? 54  LEU A N     1 
ATOM   743  C CA    . LEU B 2 53  ? 21.090 3.892   -0.852  1.00 35.08  ? 54  LEU A CA    1 
ATOM   744  C C     . LEU B 2 53  ? 20.195 5.083   -0.940  1.00 35.69  ? 54  LEU A C     1 
ATOM   745  O O     . LEU B 2 53  ? 19.817 5.571   -2.037  1.00 31.75  ? 54  LEU A O     1 
ATOM   746  C CB    . LEU B 2 53  ? 20.288 2.677   -0.395  1.00 35.06  ? 54  LEU A CB    1 
ATOM   747  C CG    . LEU B 2 53  ? 19.392 2.320   -1.601  1.00 36.55  ? 54  LEU A CG    1 
ATOM   748  C CD1   . LEU B 2 53  ? 20.069 2.258   -3.009  1.00 27.44  ? 54  LEU A CD1   1 
ATOM   749  C CD2   . LEU B 2 53  ? 18.318 1.227   -1.377  1.00 38.09  ? 54  LEU A CD2   1 
ATOM   750  N N     . ALA B 2 54  ? 19.885 5.572   0.251   1.00 33.04  ? 55  ALA A N     1 
ATOM   751  C CA    . ALA B 2 54  ? 19.046 6.733   0.354   1.00 34.30  ? 55  ALA A CA    1 
ATOM   752  C C     . ALA B 2 54  ? 19.717 8.050   -0.115  1.00 49.14  ? 55  ALA A C     1 
ATOM   753  O O     . ALA B 2 54  ? 19.292 8.656   -1.104  1.00 61.60  ? 55  ALA A O     1 
ATOM   754  C CB    . ALA B 2 54  ? 18.514 6.865   1.765   1.00 34.60  ? 55  ALA A CB    1 
ATOM   755  N N     . VAL B 2 55  ? 20.757 8.492   0.585   1.00 35.22  ? 56  VAL A N     1 
ATOM   756  C CA    . VAL B 2 55  ? 21.442 9.738   0.263   1.00 31.31  ? 56  VAL A CA    1 
ATOM   757  C C     . VAL B 2 55  ? 22.138 9.871   -1.052  1.00 34.47  ? 56  VAL A C     1 
ATOM   758  O O     . VAL B 2 55  ? 22.492 10.972  -1.426  1.00 34.11  ? 56  VAL A O     1 
ATOM   759  C CB    . VAL B 2 55  ? 22.515 10.012  1.241   1.00 31.47  ? 56  VAL A CB    1 
ATOM   760  C CG1   . VAL B 2 55  ? 21.945 9.954   2.639   1.00 27.48  ? 56  VAL A CG1   1 
ATOM   761  C CG2   . VAL B 2 55  ? 23.627 8.995   0.965   1.00 31.78  ? 56  VAL A CG2   1 
ATOM   762  N N     . ASN B 2 56  ? 22.366 8.768   -1.740  1.00 36.81  ? 57  ASN A N     1 
ATOM   763  C CA    . ASN B 2 56  ? 23.036 8.803   -3.045  1.00 37.29  ? 57  ASN A CA    1 
ATOM   764  C C     . ASN B 2 56  ? 24.510 9.094   -3.166  1.00 43.23  ? 57  ASN A C     1 
ATOM   765  O O     . ASN B 2 56  ? 24.924 9.750   -4.106  1.00 44.35  ? 57  ASN A O     1 
ATOM   766  C CB    . ASN B 2 56  ? 22.302 9.636   -4.077  1.00 33.35  ? 57  ASN A CB    1 
ATOM   767  C CG    . ASN B 2 56  ? 22.146 8.899   -5.393  1.00 92.75  ? 57  ASN A CG    1 
ATOM   768  O OD1   . ASN B 2 56  ? 21.223 8.072   -5.558  1.00 100.00 ? 57  ASN A OD1   1 
ATOM   769  N ND2   . ASN B 2 56  ? 23.063 9.162   -6.332  1.00 58.41  ? 57  ASN A ND2   1 
ATOM   770  N N     . HIS B 2 57  ? 25.294 8.598   -2.223  1.00 44.36  ? 58  HIS A N     1 
ATOM   771  C CA    . HIS B 2 57  ? 26.735 8.768   -2.244  1.00 45.29  ? 58  HIS A CA    1 
ATOM   772  C C     . HIS B 2 57  ? 27.308 7.838   -1.186  1.00 42.55  ? 58  HIS A C     1 
ATOM   773  O O     . HIS B 2 57  ? 26.775 7.689   -0.079  1.00 44.50  ? 58  HIS A O     1 
ATOM   774  C CB    . HIS B 2 57  ? 27.183 10.246  -2.179  1.00 49.89  ? 58  HIS A CB    1 
ATOM   775  C CG    . HIS B 2 57  ? 26.877 10.913  -0.882  1.00 56.79  ? 58  HIS A CG    1 
ATOM   776  N ND1   . HIS B 2 57  ? 25.742 11.674  -0.687  1.00 60.60  ? 58  HIS A ND1   1 
ATOM   777  C CD2   . HIS B 2 57  ? 27.551 10.924  0.295   1.00 61.68  ? 58  HIS A CD2   1 
ATOM   778  C CE1   . HIS B 2 57  ? 25.727 12.120  0.562   1.00 62.54  ? 58  HIS A CE1   1 
ATOM   779  N NE2   . HIS B 2 57  ? 26.813 11.679  1.180   1.00 62.84  ? 58  HIS A NE2   1 
ATOM   780  N N     . THR B 2 58  ? 28.374 7.159   -1.544  1.00 34.58  ? 59  THR A N     1 
ATOM   781  C CA    . THR B 2 58  ? 29.003 6.199   -0.631  1.00 33.44  ? 59  THR A CA    1 
ATOM   782  C C     . THR B 2 58  ? 30.044 6.720   0.357   1.00 33.97  ? 59  THR A C     1 
ATOM   783  O O     . THR B 2 58  ? 30.375 6.049   1.319   1.00 29.65  ? 59  THR A O     1 
ATOM   784  C CB    . THR B 2 58  ? 29.763 5.264   -1.483  1.00 41.68  ? 59  THR A CB    1 
ATOM   785  O OG1   . THR B 2 58  ? 30.914 5.942   -2.036  1.00 39.70  ? 59  THR A OG1   1 
ATOM   786  C CG2   . THR B 2 58  ? 28.864 4.837   -2.578  1.00 43.34  ? 59  THR A CG2   1 
ATOM   787  N N     . LYS B 2 59  ? 30.572 7.907   0.085   1.00 29.62  ? 60  LYS A N     1 
ATOM   788  C CA    . LYS B 2 59  ? 31.581 8.502   0.920   1.00 28.79  ? 60  LYS A CA    1 
ATOM   789  C C     . LYS B 2 59  ? 32.782 7.578   0.942   1.00 33.88  ? 60  LYS A C     1 
ATOM   790  O O     . LYS B 2 59  ? 33.382 7.278   1.984   1.00 39.22  ? 60  LYS A O     1 
ATOM   791  C CB    . LYS B 2 59  ? 31.076 8.866   2.311   1.00 29.24  ? 60  LYS A CB    1 
ATOM   792  C CG    . LYS B 2 59  ? 31.549 10.260  2.828   1.00 48.76  ? 60  LYS A CG    1 
ATOM   793  C CD    . LYS B 2 59  ? 30.950 11.459  2.023   1.00 81.26  ? 60  LYS A CD    1 
ATOM   794  C CE    . LYS B 2 59  ? 30.749 12.755  2.876   1.00 100.00 ? 60  LYS A CE    1 
ATOM   795  N NZ    . LYS B 2 59  ? 31.905 13.103  3.791   1.00 100.00 ? 60  LYS A NZ    1 
ATOM   796  N N     . SER B 2 60  ? 33.140 7.134   -0.239  1.00 24.53  ? 61  SER A N     1 
ATOM   797  C CA    . SER B 2 60  ? 34.275 6.281   -0.337  1.00 26.26  ? 61  SER A CA    1 
ATOM   798  C C     . SER B 2 60  ? 34.826 6.574   -1.718  1.00 32.14  ? 61  SER A C     1 
ATOM   799  O O     . SER B 2 60  ? 34.076 6.841   -2.679  1.00 30.19  ? 61  SER A O     1 
ATOM   800  C CB    . SER B 2 60  ? 33.821 4.842   -0.214  1.00 34.56  ? 61  SER A CB    1 
ATOM   801  O OG    . SER B 2 60  ? 33.082 4.476   -1.345  1.00 57.45  ? 61  SER A OG    1 
ATOM   802  N N     . ILE B 2 61  ? 36.146 6.557   -1.824  1.00 32.77  ? 62  ILE A N     1 
ATOM   803  C CA    . ILE B 2 61  ? 36.759 6.843   -3.118  1.00 34.79  ? 62  ILE A CA    1 
ATOM   804  C C     . ILE B 2 61  ? 37.695 5.721   -3.492  1.00 33.10  ? 62  ILE A C     1 
ATOM   805  O O     . ILE B 2 61  ? 38.311 5.083   -2.626  1.00 29.99  ? 62  ILE A O     1 
ATOM   806  C CB    . ILE B 2 61  ? 37.431 8.274   -3.234  1.00 37.88  ? 62  ILE A CB    1 
ATOM   807  C CG1   . ILE B 2 61  ? 38.913 8.186   -3.035  1.00 33.76  ? 62  ILE A CG1   1 
ATOM   808  C CG2   . ILE B 2 61  ? 36.760 9.374   -2.402  1.00 41.46  ? 62  ILE A CG2   1 
ATOM   809  C CD1   . ILE B 2 61  ? 39.547 7.903   -4.363  1.00 47.92  ? 62  ILE A CD1   1 
ATOM   810  N N     . GLY B 2 62  ? 37.780 5.454   -4.788  1.00 28.91  ? 63  GLY A N     1 
ATOM   811  C CA    . GLY B 2 62  ? 38.640 4.360   -5.232  1.00 31.35  ? 63  GLY A CA    1 
ATOM   812  C C     . GLY B 2 62  ? 39.918 4.756   -5.978  1.00 43.31  ? 63  GLY A C     1 
ATOM   813  O O     . GLY B 2 62  ? 39.926 5.665   -6.808  1.00 47.66  ? 63  GLY A O     1 
ATOM   814  N N     . LEU B 2 63  ? 40.991 4.046   -5.652  1.00 38.39  ? 64  LEU A N     1 
ATOM   815  C CA    . LEU B 2 63  ? 42.319 4.223   -6.216  1.00 34.16  ? 64  LEU A CA    1 
ATOM   816  C C     . LEU B 2 63  ? 42.550 3.077   -7.150  1.00 36.24  ? 64  LEU A C     1 
ATOM   817  O O     . LEU B 2 63  ? 42.723 1.912   -6.704  1.00 33.30  ? 64  LEU A O     1 
ATOM   818  C CB    . LEU B 2 63  ? 43.348 4.048   -5.105  1.00 33.20  ? 64  LEU A CB    1 
ATOM   819  C CG    . LEU B 2 63  ? 44.769 4.589   -5.291  1.00 36.76  ? 64  LEU A CG    1 
ATOM   820  C CD1   . LEU B 2 63  ? 44.971 5.356   -6.533  1.00 34.18  ? 64  LEU A CD1   1 
ATOM   821  C CD2   . LEU B 2 63  ? 45.082 5.459   -4.120  1.00 42.13  ? 64  LEU A CD2   1 
ATOM   822  N N     . LEU B 2 64  ? 42.546 3.408   -8.434  1.00 27.43  ? 65  LEU A N     1 
ATOM   823  C CA    . LEU B 2 64  ? 42.782 2.410   -9.449  1.00 25.28  ? 65  LEU A CA    1 
ATOM   824  C C     . LEU B 2 64  ? 44.255 2.566   -9.800  1.00 30.67  ? 65  LEU A C     1 
ATOM   825  O O     . LEU B 2 64  ? 44.650 3.302   -10.701 1.00 31.99  ? 65  LEU A O     1 
ATOM   826  C CB    . LEU B 2 64  ? 41.917 2.688   -10.652 1.00 25.89  ? 65  LEU A CB    1 
ATOM   827  C CG    . LEU B 2 64  ? 42.378 1.780   -11.785 1.00 30.44  ? 65  LEU A CG    1 
ATOM   828  C CD1   . LEU B 2 64  ? 42.631 0.446   -11.173 1.00 29.91  ? 65  LEU A CD1   1 
ATOM   829  C CD2   . LEU B 2 64  ? 41.347 1.694   -12.909 1.00 22.18  ? 65  LEU A CD2   1 
ATOM   830  N N     . ALA B 2 65  ? 45.070 1.858   -9.049  1.00 26.89  ? 66  ALA A N     1 
ATOM   831  C CA    . ALA B 2 65  ? 46.508 1.892   -9.192  1.00 24.32  ? 66  ALA A CA    1 
ATOM   832  C C     . ALA B 2 65  ? 47.105 0.905   -10.128 1.00 32.88  ? 66  ALA A C     1 
ATOM   833  O O     . ALA B 2 65  ? 46.425 0.279   -10.887 1.00 36.48  ? 66  ALA A O     1 
ATOM   834  C CB    . ALA B 2 65  ? 47.103 1.632   -7.844  1.00 25.22  ? 66  ALA A CB    1 
ATOM   835  N N     . THR B 2 66  ? 48.420 0.760   -10.016 1.00 34.76  ? 67  THR A N     1 
ATOM   836  C CA    . THR B 2 66  ? 49.195 -0.169  -10.827 1.00 31.72  ? 67  THR A CA    1 
ATOM   837  C C     . THR B 2 66  ? 49.702 -1.294  -9.928  1.00 29.18  ? 67  THR A C     1 
ATOM   838  O O     . THR B 2 66  ? 49.255 -2.412  -9.990  1.00 25.58  ? 67  THR A O     1 
ATOM   839  C CB    . THR B 2 66  ? 50.346 0.575   -11.478 1.00 28.74  ? 67  THR A CB    1 
ATOM   840  O OG1   . THR B 2 66  ? 49.825 1.549   -12.402 1.00 53.69  ? 67  THR A OG1   1 
ATOM   841  C CG2   . THR B 2 66  ? 51.181 -0.373  -12.246 1.00 18.18  ? 67  THR A CG2   1 
ATOM   842  N N     . SER B 2 67  ? 50.642 -0.956  -9.074  1.00 28.28  ? 68  SER A N     1 
ATOM   843  C CA    . SER B 2 67  ? 51.237 -1.868  -8.122  1.00 29.29  ? 68  SER A CA    1 
ATOM   844  C C     . SER B 2 67  ? 51.256 -1.000  -6.847  1.00 36.33  ? 68  SER A C     1 
ATOM   845  O O     . SER B 2 67  ? 51.178 0.213   -6.911  1.00 41.49  ? 68  SER A O     1 
ATOM   846  C CB    . SER B 2 67  ? 52.687 -2.261  -8.551  1.00 33.00  ? 68  SER A CB    1 
ATOM   847  O OG    . SER B 2 67  ? 53.529 -2.629  -7.418  1.00 44.70  ? 68  SER A OG    1 
ATOM   848  N N     . SER B 2 68  ? 51.372 -1.603  -5.685  1.00 29.27  ? 69  SER A N     1 
ATOM   849  C CA    . SER B 2 68  ? 51.371 -0.822  -4.487  1.00 27.36  ? 69  SER A CA    1 
ATOM   850  C C     . SER B 2 68  ? 52.569 -1.105  -3.585  1.00 33.39  ? 69  SER A C     1 
ATOM   851  O O     . SER B 2 68  ? 52.676 -0.501  -2.531  1.00 33.58  ? 69  SER A O     1 
ATOM   852  C CB    . SER B 2 68  ? 50.045 -1.107  -3.725  1.00 35.62  ? 69  SER A CB    1 
ATOM   853  O OG    . SER B 2 68  ? 50.031 -2.345  -2.980  1.00 39.97  ? 69  SER A OG    1 
ATOM   854  N N     . GLU B 2 69  ? 53.449 -2.042  -3.948  1.00 28.82  ? 70  GLU A N     1 
ATOM   855  C CA    . GLU B 2 69  ? 54.587 -2.335  -3.073  1.00 27.43  ? 70  GLU A CA    1 
ATOM   856  C C     . GLU B 2 69  ? 55.717 -1.348  -3.351  1.00 30.86  ? 70  GLU A C     1 
ATOM   857  O O     . GLU B 2 69  ? 56.362 -0.829  -2.451  1.00 36.83  ? 70  GLU A O     1 
ATOM   858  C CB    . GLU B 2 69  ? 55.061 -3.766  -3.258  1.00 30.49  ? 70  GLU A CB    1 
ATOM   859  C CG    . GLU B 2 69  ? 56.058 -4.217  -2.195  1.00 47.76  ? 70  GLU A CG    1 
ATOM   860  C CD    . GLU B 2 69  ? 57.500 -4.100  -2.658  1.00 73.85  ? 70  GLU A CD    1 
ATOM   861  O OE1   . GLU B 2 69  ? 57.664 -3.920  -3.896  1.00 50.42  ? 70  GLU A OE1   1 
ATOM   862  O OE2   . GLU B 2 69  ? 58.442 -4.168  -1.801  1.00 65.08  ? 70  GLU A OE2   1 
ATOM   863  N N     . ALA B 2 70  ? 55.942 -1.090  -4.623  1.00 20.04  ? 71  ALA A N     1 
ATOM   864  C CA    . ALA B 2 70  ? 56.952 -0.152  -5.081  1.00 13.66  ? 71  ALA A CA    1 
ATOM   865  C C     . ALA B 2 70  ? 56.971 1.153   -4.285  1.00 22.26  ? 71  ALA A C     1 
ATOM   866  O O     . ALA B 2 70  ? 55.946 1.905   -4.198  1.00 18.87  ? 71  ALA A O     1 
ATOM   867  C CB    . ALA B 2 70  ? 56.641 0.178   -6.527  1.00 13.93  ? 71  ALA A CB    1 
ATOM   868  N N     . ALA B 2 71  ? 58.150 1.427   -3.734  1.00 20.27  ? 72  ALA A N     1 
ATOM   869  C CA    . ALA B 2 71  ? 58.337 2.610   -2.910  1.00 19.50  ? 72  ALA A CA    1 
ATOM   870  C C     . ALA B 2 71  ? 57.584 3.816   -3.371  1.00 23.61  ? 72  ALA A C     1 
ATOM   871  O O     . ALA B 2 71  ? 56.779 4.404   -2.618  1.00 20.81  ? 72  ALA A O     1 
ATOM   872  C CB    . ALA B 2 71  ? 59.770 2.939   -2.819  1.00 19.21  ? 72  ALA A CB    1 
ATOM   873  N N     . TYR B 2 72  ? 57.865 4.156   -4.626  1.00 17.65  ? 73  TYR A N     1 
ATOM   874  C CA    . TYR B 2 72  ? 57.282 5.317   -5.212  1.00 19.55  ? 73  TYR A CA    1 
ATOM   875  C C     . TYR B 2 72  ? 55.791 5.246   -5.007  1.00 25.52  ? 73  TYR A C     1 
ATOM   876  O O     . TYR B 2 72  ? 55.185 6.070   -4.293  1.00 24.68  ? 73  TYR A O     1 
ATOM   877  C CB    . TYR B 2 72  ? 57.706 5.345   -6.644  1.00 25.42  ? 73  TYR A CB    1 
ATOM   878  C CG    . TYR B 2 72  ? 57.129 6.452   -7.416  1.00 31.87  ? 73  TYR A CG    1 
ATOM   879  C CD1   . TYR B 2 72  ? 55.942 6.302   -8.022  1.00 37.13  ? 73  TYR A CD1   1 
ATOM   880  C CD2   . TYR B 2 72  ? 57.780 7.654   -7.557  1.00 36.82  ? 73  TYR A CD2   1 
ATOM   881  C CE1   . TYR B 2 72  ? 55.399 7.318   -8.768  1.00 41.98  ? 73  TYR A CE1   1 
ATOM   882  C CE2   . TYR B 2 72  ? 57.222 8.718   -8.298  1.00 43.39  ? 73  TYR A CE2   1 
ATOM   883  C CZ    . TYR B 2 72  ? 56.026 8.522   -8.905  1.00 48.84  ? 73  TYR A CZ    1 
ATOM   884  O OH    . TYR B 2 72  ? 55.410 9.479   -9.674  1.00 46.79  ? 73  TYR A OH    1 
ATOM   885  N N     . PHE B 2 73  ? 55.213 4.209   -5.581  1.00 19.57  ? 74  PHE A N     1 
ATOM   886  C CA    . PHE B 2 73  ? 53.798 4.017   -5.426  1.00 20.46  ? 74  PHE A CA    1 
ATOM   887  C C     . PHE B 2 73  ? 53.367 3.969   -3.999  1.00 22.55  ? 74  PHE A C     1 
ATOM   888  O O     . PHE B 2 73  ? 52.450 4.654   -3.563  1.00 21.24  ? 74  PHE A O     1 
ATOM   889  C CB    . PHE B 2 73  ? 53.420 2.701   -6.020  1.00 23.01  ? 74  PHE A CB    1 
ATOM   890  C CG    . PHE B 2 73  ? 53.525 2.716   -7.471  1.00 23.57  ? 74  PHE A CG    1 
ATOM   891  C CD1   . PHE B 2 73  ? 53.339 3.873   -8.123  1.00 22.09  ? 74  PHE A CD1   1 
ATOM   892  C CD2   . PHE B 2 73  ? 53.825 1.595   -8.171  1.00 24.22  ? 74  PHE A CD2   1 
ATOM   893  C CE1   . PHE B 2 73  ? 53.437 3.893   -9.433  1.00 26.28  ? 74  PHE A CE1   1 
ATOM   894  C CE2   . PHE B 2 73  ? 53.929 1.627   -9.520  1.00 23.30  ? 74  PHE A CE2   1 
ATOM   895  C CZ    . PHE B 2 73  ? 53.752 2.754   -10.151 1.00 20.39  ? 74  PHE A CZ    1 
ATOM   896  N N     . ALA B 2 74  ? 54.022 3.113   -3.264  1.00 19.89  ? 75  ALA A N     1 
ATOM   897  C CA    . ALA B 2 74  ? 53.643 2.997   -1.881  1.00 20.47  ? 75  ALA A CA    1 
ATOM   898  C C     . ALA B 2 74  ? 53.536 4.334   -1.139  1.00 31.63  ? 75  ALA A C     1 
ATOM   899  O O     . ALA B 2 74  ? 52.577 4.570   -0.376  1.00 31.75  ? 75  ALA A O     1 
ATOM   900  C CB    . ALA B 2 74  ? 54.576 2.059   -1.177  1.00 18.51  ? 75  ALA A CB    1 
ATOM   901  N N     . GLU B 2 75  ? 54.506 5.206   -1.396  1.00 27.98  ? 76  GLU A N     1 
ATOM   902  C CA    . GLU B 2 75  ? 54.491 6.465   -0.729  1.00 29.87  ? 76  GLU A CA    1 
ATOM   903  C C     . GLU B 2 75  ? 53.276 7.283   -1.126  1.00 35.62  ? 76  GLU A C     1 
ATOM   904  O O     . GLU B 2 75  ? 52.593 7.855   -0.261  1.00 31.12  ? 76  GLU A O     1 
ATOM   905  C CB    . GLU B 2 75  ? 55.777 7.183   -0.981  1.00 32.41  ? 76  GLU A CB    1 
ATOM   906  C CG    . GLU B 2 75  ? 56.949 6.525   -0.338  1.00 52.21  ? 76  GLU A CG    1 
ATOM   907  C CD    . GLU B 2 75  ? 58.124 7.467   -0.217  1.00 64.02  ? 76  GLU A CD    1 
ATOM   908  O OE1   . GLU B 2 75  ? 57.886 8.690   0.048   1.00 41.31  ? 76  GLU A OE1   1 
ATOM   909  O OE2   . GLU B 2 75  ? 59.264 6.966   -0.400  1.00 39.02  ? 76  GLU A OE2   1 
ATOM   910  N N     . ILE B 2 76  ? 52.983 7.338   -2.420  1.00 31.45  ? 77  ILE A N     1 
ATOM   911  C CA    . ILE B 2 76  ? 51.808 8.108   -2.815  1.00 30.37  ? 77  ILE A CA    1 
ATOM   912  C C     . ILE B 2 76  ? 50.535 7.590   -2.145  1.00 31.65  ? 77  ILE A C     1 
ATOM   913  O O     . ILE B 2 76  ? 49.748 8.329   -1.561  1.00 33.19  ? 77  ILE A O     1 
ATOM   914  C CB    . ILE B 2 76  ? 51.534 8.009   -4.288  1.00 31.97  ? 77  ILE A CB    1 
ATOM   915  C CG1   . ILE B 2 76  ? 52.469 8.905   -5.018  1.00 27.57  ? 77  ILE A CG1   1 
ATOM   916  C CG2   . ILE B 2 76  ? 50.160 8.503   -4.563  1.00 40.79  ? 77  ILE A CG2   1 
ATOM   917  C CD1   . ILE B 2 76  ? 53.016 8.225   -6.146  1.00 31.00  ? 77  ILE A CD1   1 
ATOM   918  N N     . ILE B 2 77  ? 50.316 6.301   -2.266  1.00 22.96  ? 78  ILE A N     1 
ATOM   919  C CA    . ILE B 2 77  ? 49.141 5.747   -1.696  1.00 24.21  ? 78  ILE A CA    1 
ATOM   920  C C     . ILE B 2 77  ? 48.966 6.071   -0.228  1.00 26.26  ? 78  ILE A C     1 
ATOM   921  O O     . ILE B 2 77  ? 47.897 6.562   0.186   1.00 24.11  ? 78  ILE A O     1 
ATOM   922  C CB    . ILE B 2 77  ? 49.138 4.307   -1.919  1.00 29.61  ? 78  ILE A CB    1 
ATOM   923  C CG1   . ILE B 2 77  ? 48.702 4.042   -3.356  1.00 29.83  ? 78  ILE A CG1   1 
ATOM   924  C CG2   . ILE B 2 77  ? 48.253 3.665   -0.948  1.00 29.50  ? 78  ILE A CG2   1 
ATOM   925  C CD1   . ILE B 2 77  ? 49.383 2.802   -3.926  1.00 22.07  ? 78  ILE A CD1   1 
ATOM   926  N N     . GLU B 2 78  ? 50.018 5.821   0.546   1.00 18.17  ? 79  GLU A N     1 
ATOM   927  C CA    . GLU B 2 78  ? 49.957 6.112   1.973   1.00 16.03  ? 79  GLU A CA    1 
ATOM   928  C C     . GLU B 2 78  ? 49.455 7.532   2.157   1.00 22.82  ? 79  GLU A C     1 
ATOM   929  O O     . GLU B 2 78  ? 48.652 7.817   3.045   1.00 25.15  ? 79  GLU A O     1 
ATOM   930  C CB    . GLU B 2 78  ? 51.317 5.992   2.654   1.00 15.58  ? 79  GLU A CB    1 
ATOM   931  C CG    . GLU B 2 78  ? 51.192 5.893   4.151   1.00 26.11  ? 79  GLU A CG    1 
ATOM   932  C CD    . GLU B 2 78  ? 52.457 5.465   4.888   1.00 50.00  ? 79  GLU A CD    1 
ATOM   933  O OE1   . GLU B 2 78  ? 52.733 4.241   5.059   1.00 39.01  ? 79  GLU A OE1   1 
ATOM   934  O OE2   . GLU B 2 78  ? 53.144 6.390   5.366   1.00 41.92  ? 79  GLU A OE2   1 
ATOM   935  N N     . ALA B 2 79  ? 49.907 8.419   1.282   1.00 19.16  ? 80  ALA A N     1 
ATOM   936  C CA    . ALA B 2 79  ? 49.483 9.822   1.365   1.00 16.61  ? 80  ALA A CA    1 
ATOM   937  C C     . ALA B 2 79  ? 47.992 9.906   1.139   1.00 27.04  ? 80  ALA A C     1 
ATOM   938  O O     . ALA B 2 79  ? 47.233 10.347  2.041   1.00 28.16  ? 80  ALA A O     1 
ATOM   939  C CB    . ALA B 2 79  ? 50.229 10.732  0.345   1.00 12.56  ? 80  ALA A CB    1 
ATOM   940  N N     . VAL B 2 80  ? 47.600 9.477   -0.061  1.00 18.22  ? 81  VAL A N     1 
ATOM   941  C CA    . VAL B 2 80  ? 46.220 9.493   -0.444  1.00 19.89  ? 81  VAL A CA    1 
ATOM   942  C C     . VAL B 2 80  ? 45.339 9.076   0.711   1.00 31.42  ? 81  VAL A C     1 
ATOM   943  O O     . VAL B 2 80  ? 44.484 9.826   1.122   1.00 33.30  ? 81  VAL A O     1 
ATOM   944  C CB    . VAL B 2 80  ? 45.970 8.557   -1.565  1.00 24.37  ? 81  VAL A CB    1 
ATOM   945  C CG1   . VAL B 2 80  ? 44.476 8.366   -1.691  1.00 23.22  ? 81  VAL A CG1   1 
ATOM   946  C CG2   . VAL B 2 80  ? 46.539 9.164   -2.846  1.00 26.25  ? 81  VAL A CG2   1 
ATOM   947  N N     . GLU B 2 81  ? 45.589 7.904   1.275   1.00 30.45  ? 82  GLU A N     1 
ATOM   948  C CA    . GLU B 2 81  ? 44.772 7.443   2.385   1.00 31.46  ? 82  GLU A CA    1 
ATOM   949  C C     . GLU B 2 81  ? 44.598 8.439   3.490   1.00 36.19  ? 82  GLU A C     1 
ATOM   950  O O     . GLU B 2 81  ? 43.471 8.638   3.953   1.00 38.02  ? 82  GLU A O     1 
ATOM   951  C CB    . GLU B 2 81  ? 45.286 6.122   2.984   1.00 34.60  ? 82  GLU A CB    1 
ATOM   952  C CG    . GLU B 2 81  ? 46.050 6.265   4.339   1.00 65.57  ? 82  GLU A CG    1 
ATOM   953  C CD    . GLU B 2 81  ? 45.160 5.950   5.521   1.00 68.53  ? 82  GLU A CD    1 
ATOM   954  O OE1   . GLU B 2 81  ? 44.038 5.475   5.259   1.00 18.31  ? 82  GLU A OE1   1 
ATOM   955  O OE2   . GLU B 2 81  ? 45.552 6.195   6.680   1.00 62.45  ? 82  GLU A OE2   1 
ATOM   956  N N     . LYS B 2 82  ? 45.709 9.039   3.918   1.00 31.90  ? 83  LYS A N     1 
ATOM   957  C CA    . LYS B 2 82  ? 45.681 9.998   5.022   1.00 32.39  ? 83  LYS A CA    1 
ATOM   958  C C     . LYS B 2 82  ? 44.616 11.034  4.743   1.00 33.59  ? 83  LYS A C     1 
ATOM   959  O O     . LYS B 2 82  ? 43.792 11.369  5.579   1.00 30.93  ? 83  LYS A O     1 
ATOM   960  C CB    . LYS B 2 82  ? 47.037 10.699  5.162   1.00 37.62  ? 83  LYS A CB    1 
ATOM   961  C CG    . LYS B 2 82  ? 48.140 9.909   5.892   1.00 76.26  ? 83  LYS A CG    1 
ATOM   962  C CD    . LYS B 2 82  ? 49.110 10.844  6.692   1.00 92.32  ? 83  LYS A CD    1 
ATOM   963  C CE    . LYS B 2 82  ? 50.619 10.533  6.439   1.00 100.00 ? 83  LYS A CE    1 
ATOM   964  N NZ    . LYS B 2 82  ? 51.556 10.669  7.621   1.00 100.00 ? 83  LYS A NZ    1 
ATOM   965  N N     . ASN B 2 83  ? 44.644 11.521  3.522   1.00 28.96  ? 84  ASN A N     1 
ATOM   966  C CA    . ASN B 2 83  ? 43.710 12.514  3.116   1.00 30.43  ? 84  ASN A CA    1 
ATOM   967  C C     . ASN B 2 83  ? 42.296 12.042  3.169   1.00 37.71  ? 84  ASN A C     1 
ATOM   968  O O     . ASN B 2 83  ? 41.462 12.713  3.730   1.00 42.92  ? 84  ASN A O     1 
ATOM   969  C CB    . ASN B 2 83  ? 44.121 13.078  1.774   1.00 42.31  ? 84  ASN A CB    1 
ATOM   970  C CG    . ASN B 2 83  ? 45.252 14.075  1.905   1.00 78.41  ? 84  ASN A CG    1 
ATOM   971  O OD1   . ASN B 2 83  ? 45.030 15.262  2.181   1.00 79.18  ? 84  ASN A OD1   1 
ATOM   972  N ND2   . ASN B 2 83  ? 46.476 13.591  1.767   1.00 82.11  ? 84  ASN A ND2   1 
ATOM   973  N N     . CYS B 2 84  ? 42.022 10.884  2.601   1.00 34.41  ? 85  CYS A N     1 
ATOM   974  C CA    . CYS B 2 84  ? 40.678 10.355  2.657   1.00 35.19  ? 85  CYS A CA    1 
ATOM   975  C C     . CYS B 2 84  ? 40.207 10.272  4.118   1.00 37.42  ? 85  CYS A C     1 
ATOM   976  O O     . CYS B 2 84  ? 39.130 10.739  4.469   1.00 30.19  ? 85  CYS A O     1 
ATOM   977  C CB    . CYS B 2 84  ? 40.683 8.928   2.139   1.00 35.52  ? 85  CYS A CB    1 
ATOM   978  S SG    . CYS B 2 84  ? 40.901 8.818   0.344   1.00 40.66  ? 85  CYS A SG    1 
ATOM   979  N N     . PHE B 2 85  ? 41.020 9.654   4.963   1.00 36.02  ? 86  PHE A N     1 
ATOM   980  C CA    . PHE B 2 85  ? 40.646 9.499   6.365   1.00 37.34  ? 86  PHE A CA    1 
ATOM   981  C C     . PHE B 2 85  ? 40.168 10.730  7.036   1.00 41.23  ? 86  PHE A C     1 
ATOM   982  O O     . PHE B 2 85  ? 39.147 10.768  7.715   1.00 38.57  ? 86  PHE A O     1 
ATOM   983  C CB    . PHE B 2 85  ? 41.853 9.115   7.190   1.00 37.93  ? 86  PHE A CB    1 
ATOM   984  C CG    . PHE B 2 85  ? 41.518 8.834   8.623   1.00 39.74  ? 86  PHE A CG    1 
ATOM   985  C CD1   . PHE B 2 85  ? 40.526 7.907   8.942   1.00 48.02  ? 86  PHE A CD1   1 
ATOM   986  C CD2   . PHE B 2 85  ? 42.169 9.480   9.645   1.00 44.13  ? 86  PHE A CD2   1 
ATOM   987  C CE1   . PHE B 2 85  ? 40.202 7.604   10.264  1.00 49.40  ? 86  PHE A CE1   1 
ATOM   988  C CE2   . PHE B 2 85  ? 41.858 9.200   10.984  1.00 50.39  ? 86  PHE A CE2   1 
ATOM   989  C CZ    . PHE B 2 85  ? 40.876 8.255   11.292  1.00 49.96  ? 86  PHE A CZ    1 
ATOM   990  N N     . GLN B 2 86  ? 41.009 11.717  6.849   1.00 41.44  ? 87  GLN A N     1 
ATOM   991  C CA    . GLN B 2 86  ? 40.863 13.023  7.407   1.00 45.93  ? 87  GLN A CA    1 
ATOM   992  C C     . GLN B 2 86  ? 39.605 13.747  7.021   1.00 51.33  ? 87  GLN A C     1 
ATOM   993  O O     . GLN B 2 86  ? 39.166 14.614  7.754   1.00 60.54  ? 87  GLN A O     1 
ATOM   994  C CB    . GLN B 2 86  ? 42.099 13.826  7.016   1.00 50.50  ? 87  GLN A CB    1 
ATOM   995  C CG    . GLN B 2 86  ? 42.381 15.044  7.847   1.00 95.85  ? 87  GLN A CG    1 
ATOM   996  C CD    . GLN B 2 86  ? 42.776 16.225  6.969   1.00 100.00 ? 87  GLN A CD    1 
ATOM   997  O OE1   . GLN B 2 86  ? 43.832 16.201  6.293   1.00 100.00 ? 87  GLN A OE1   1 
ATOM   998  N NE2   . GLN B 2 86  ? 41.904 17.259  6.937   1.00 100.00 ? 87  GLN A NE2   1 
ATOM   999  N N     . LYS B 2 87  ? 39.036 13.398  5.876   1.00 40.54  ? 88  LYS A N     1 
ATOM   1000 C CA    . LYS B 2 87  ? 37.813 14.026  5.381   1.00 37.44  ? 88  LYS A CA    1 
ATOM   1001 C C     . LYS B 2 87  ? 36.734 12.968  5.300   1.00 38.35  ? 88  LYS A C     1 
ATOM   1002 O O     . LYS B 2 87  ? 35.875 12.982  4.398   1.00 43.24  ? 88  LYS A O     1 
ATOM   1003 C CB    . LYS B 2 87  ? 38.051 14.605  3.974   1.00 38.19  ? 88  LYS A CB    1 
ATOM   1004 C CG    . LYS B 2 87  ? 39.307 15.410  3.870   1.00 51.35  ? 88  LYS A CG    1 
ATOM   1005 C CD    . LYS B 2 87  ? 38.995 16.877  3.623   1.00 74.76  ? 88  LYS A CD    1 
ATOM   1006 C CE    . LYS B 2 87  ? 40.261 17.735  3.652   1.00 100.00 ? 88  LYS A CE    1 
ATOM   1007 N NZ    . LYS B 2 87  ? 39.981 19.050  4.323   1.00 100.00 ? 88  LYS A NZ    1 
ATOM   1008 N N     . GLY B 2 88  ? 36.798 12.032  6.226   1.00 30.23  ? 89  GLY A N     1 
ATOM   1009 C CA    . GLY B 2 88  ? 35.824 10.939  6.265   1.00 34.70  ? 89  GLY A CA    1 
ATOM   1010 C C     . GLY B 2 88  ? 35.591 9.995   5.053   1.00 49.26  ? 89  GLY A C     1 
ATOM   1011 O O     . GLY B 2 88  ? 34.582 9.296   5.001   1.00 57.36  ? 89  GLY A O     1 
ATOM   1012 N N     . TYR B 2 89  ? 36.506 9.953   4.095   1.00 41.86  ? 90  TYR A N     1 
ATOM   1013 C CA    . TYR B 2 89  ? 36.334 9.066   2.962   1.00 36.22  ? 90  TYR A CA    1 
ATOM   1014 C C     . TYR B 2 89  ? 37.008 7.738   3.214   1.00 39.14  ? 90  TYR A C     1 
ATOM   1015 O O     . TYR B 2 89  ? 38.045 7.645   3.874   1.00 39.01  ? 90  TYR A O     1 
ATOM   1016 C CB    . TYR B 2 89  ? 36.848 9.710   1.689   1.00 36.93  ? 90  TYR A CB    1 
ATOM   1017 C CG    . TYR B 2 89  ? 35.838 10.689  1.170   1.00 41.49  ? 90  TYR A CG    1 
ATOM   1018 C CD1   . TYR B 2 89  ? 35.742 11.981  1.673   1.00 42.11  ? 90  TYR A CD1   1 
ATOM   1019 C CD2   . TYR B 2 89  ? 34.935 10.299  0.207   1.00 44.58  ? 90  TYR A CD2   1 
ATOM   1020 C CE1   . TYR B 2 89  ? 34.776 12.863  1.172   1.00 45.69  ? 90  TYR A CE1   1 
ATOM   1021 C CE2   . TYR B 2 89  ? 33.977 11.149  -0.287  1.00 45.31  ? 90  TYR A CE2   1 
ATOM   1022 C CZ    . TYR B 2 89  ? 33.889 12.423  0.175   1.00 55.56  ? 90  TYR A CZ    1 
ATOM   1023 O OH    . TYR B 2 89  ? 32.885 13.205  -0.379  1.00 59.59  ? 90  TYR A OH    1 
ATOM   1024 N N     . THR B 2 90  ? 36.384 6.705   2.679   1.00 37.36  ? 91  THR A N     1 
ATOM   1025 C CA    . THR B 2 90  ? 36.856 5.334   2.776   1.00 35.35  ? 91  THR A CA    1 
ATOM   1026 C C     . THR B 2 90  ? 37.613 5.024   1.459   1.00 40.18  ? 91  THR A C     1 
ATOM   1027 O O     . THR B 2 90  ? 37.173 5.419   0.369   1.00 43.89  ? 91  THR A O     1 
ATOM   1028 C CB    . THR B 2 90  ? 35.650 4.458   2.884   1.00 39.60  ? 91  THR A CB    1 
ATOM   1029 O OG1   . THR B 2 90  ? 35.732 3.705   4.092   1.00 35.09  ? 91  THR A OG1   1 
ATOM   1030 C CG2   . THR B 2 90  ? 35.579 3.540   1.726   1.00 54.91  ? 91  THR A CG2   1 
ATOM   1031 N N     . LEU B 2 91  ? 38.751 4.338   1.545   1.00 31.89  ? 92  LEU A N     1 
ATOM   1032 C CA    . LEU B 2 91  ? 39.579 4.032   0.356   1.00 26.59  ? 92  LEU A CA    1 
ATOM   1033 C C     . LEU B 2 91  ? 39.559 2.633   -0.211  1.00 26.71  ? 92  LEU A C     1 
ATOM   1034 O O     . LEU B 2 91  ? 39.732 1.649   0.500   1.00 24.47  ? 92  LEU A O     1 
ATOM   1035 C CB    . LEU B 2 91  ? 41.039 4.378   0.648   1.00 25.54  ? 92  LEU A CB    1 
ATOM   1036 C CG    . LEU B 2 91  ? 41.954 4.834   -0.476  1.00 31.90  ? 92  LEU A CG    1 
ATOM   1037 C CD1   . LEU B 2 91  ? 43.253 4.166   -0.198  1.00 29.56  ? 92  LEU A CD1   1 
ATOM   1038 C CD2   . LEU B 2 91  ? 41.430 4.491   -1.900  1.00 42.59  ? 92  LEU A CD2   1 
ATOM   1039 N N     . ILE B 2 92  ? 39.353 2.544   -1.517  1.00 27.19  ? 93  ILE A N     1 
ATOM   1040 C CA    . ILE B 2 92  ? 39.344 1.236   -2.100  1.00 28.49  ? 93  ILE A CA    1 
ATOM   1041 C C     . ILE B 2 92  ? 40.568 1.146   -2.958  1.00 37.99  ? 93  ILE A C     1 
ATOM   1042 O O     . ILE B 2 92  ? 40.673 1.802   -3.989  1.00 41.51  ? 93  ILE A O     1 
ATOM   1043 C CB    . ILE B 2 92  ? 38.081 0.909   -2.819  1.00 31.17  ? 93  ILE A CB    1 
ATOM   1044 C CG1   . ILE B 2 92  ? 36.938 0.773   -1.801  1.00 36.38  ? 93  ILE A CG1   1 
ATOM   1045 C CG2   . ILE B 2 92  ? 38.224 -0.384  -3.570  1.00 17.65  ? 93  ILE A CG2   1 
ATOM   1046 C CD1   . ILE B 2 92  ? 35.519 0.633   -2.478  1.00 39.73  ? 93  ILE A CD1   1 
ATOM   1047 N N     . LEU B 2 93  ? 41.519 0.338   -2.501  1.00 29.61  ? 94  LEU A N     1 
ATOM   1048 C CA    . LEU B 2 93  ? 42.748 0.182   -3.220  1.00 27.35  ? 94  LEU A CA    1 
ATOM   1049 C C     . LEU B 2 93  ? 42.611 -0.849  -4.336  1.00 30.55  ? 94  LEU A C     1 
ATOM   1050 O O     . LEU B 2 93  ? 42.186 -1.942  -4.088  1.00 36.06  ? 94  LEU A O     1 
ATOM   1051 C CB    . LEU B 2 93  ? 43.818 -0.220  -2.208  1.00 26.47  ? 94  LEU A CB    1 
ATOM   1052 C CG    . LEU B 2 93  ? 45.221 -0.373  -2.817  1.00 31.00  ? 94  LEU A CG    1 
ATOM   1053 C CD1   . LEU B 2 93  ? 45.545 0.643   -3.914  1.00 23.29  ? 94  LEU A CD1   1 
ATOM   1054 C CD2   . LEU B 2 93  ? 46.306 -0.468  -1.728  1.00 35.02  ? 94  LEU A CD2   1 
ATOM   1055 N N     . GLY B 2 94  ? 42.944 -0.537  -5.572  1.00 28.24  ? 95  GLY A N     1 
ATOM   1056 C CA    . GLY B 2 94  ? 42.828 -1.569  -6.617  1.00 28.46  ? 95  GLY A CA    1 
ATOM   1057 C C     . GLY B 2 94  ? 44.058 -1.576  -7.555  1.00 38.28  ? 95  GLY A C     1 
ATOM   1058 O O     . GLY B 2 94  ? 44.327 -0.577  -8.237  1.00 40.69  ? 95  GLY A O     1 
ATOM   1059 N N     . ASN B 2 95  ? 44.810 -2.672  -7.602  1.00 36.06  ? 96  ASN A N     1 
ATOM   1060 C CA    . ASN B 2 95  ? 45.998 -2.707  -8.466  1.00 37.47  ? 96  ASN A CA    1 
ATOM   1061 C C     . ASN B 2 95  ? 45.703 -3.421  -9.773  1.00 46.04  ? 96  ASN A C     1 
ATOM   1062 O O     . ASN B 2 95  ? 45.471 -4.613  -9.714  1.00 51.62  ? 96  ASN A O     1 
ATOM   1063 C CB    . ASN B 2 95  ? 47.088 -3.521  -7.777  1.00 32.67  ? 96  ASN A CB    1 
ATOM   1064 C CG    . ASN B 2 95  ? 47.658 -2.846  -6.582  1.00 23.95  ? 96  ASN A CG    1 
ATOM   1065 O OD1   . ASN B 2 95  ? 47.766 -3.437  -5.530  1.00 45.41  ? 96  ASN A OD1   1 
ATOM   1066 N ND2   . ASN B 2 95  ? 48.113 -1.637  -6.758  1.00 51.44  ? 96  ASN A ND2   1 
ATOM   1067 N N     . ALA B 2 96  ? 45.729 -2.735  -10.930 1.00 40.24  ? 97  ALA A N     1 
ATOM   1068 C CA    . ALA B 2 96  ? 45.449 -3.374  -12.246 1.00 39.20  ? 97  ALA A CA    1 
ATOM   1069 C C     . ALA B 2 96  ? 46.651 -3.985  -12.962 1.00 44.95  ? 97  ALA A C     1 
ATOM   1070 O O     . ALA B 2 96  ? 46.526 -4.609  -14.037 1.00 38.85  ? 97  ALA A O     1 
ATOM   1071 C CB    . ALA B 2 96  ? 44.663 -2.467  -13.195 1.00 39.68  ? 97  ALA A CB    1 
ATOM   1072 N N     . TRP B 2 97  ? 47.813 -3.801  -12.350 1.00 46.02  ? 98  TRP A N     1 
ATOM   1073 C CA    . TRP B 2 97  ? 49.044 -4.355  -12.882 1.00 47.06  ? 98  TRP A CA    1 
ATOM   1074 C C     . TRP B 2 97  ? 49.246 -4.145  -14.343 1.00 48.60  ? 98  TRP A C     1 
ATOM   1075 O O     . TRP B 2 97  ? 49.802 -4.998  -15.023 1.00 44.98  ? 98  TRP A O     1 
ATOM   1076 C CB    . TRP B 2 97  ? 49.080 -5.848  -12.601 1.00 45.75  ? 98  TRP A CB    1 
ATOM   1077 C CG    . TRP B 2 97  ? 49.230 -6.070  -11.179 1.00 45.79  ? 98  TRP A CG    1 
ATOM   1078 C CD1   . TRP B 2 97  ? 48.246 -6.329  -10.272 1.00 48.80  ? 98  TRP A CD1   1 
ATOM   1079 C CD2   . TRP B 2 97  ? 50.439 -5.980  -10.448 1.00 44.79  ? 98  TRP A CD2   1 
ATOM   1080 N NE1   . TRP B 2 97  ? 48.782 -6.456  -9.011  1.00 47.21  ? 98  TRP A NE1   1 
ATOM   1081 C CE2   . TRP B 2 97  ? 50.129 -6.243  -9.094  1.00 48.18  ? 98  TRP A CE2   1 
ATOM   1082 C CE3   . TRP B 2 97  ? 51.755 -5.736  -10.804 1.00 46.09  ? 98  TRP A CE3   1 
ATOM   1083 C CZ2   . TRP B 2 97  ? 51.086 -6.230  -8.102  1.00 47.71  ? 98  TRP A CZ2   1 
ATOM   1084 C CZ3   . TRP B 2 97  ? 52.708 -5.731  -9.816  1.00 49.21  ? 98  TRP A CZ3   1 
ATOM   1085 C CH2   . TRP B 2 97  ? 52.370 -5.973  -8.478  1.00 49.77  ? 98  TRP A CH2   1 
ATOM   1086 N N     . ASN B 2 98  ? 48.779 -3.010  -14.827 1.00 48.89  ? 99  ASN A N     1 
ATOM   1087 C CA    . ASN B 2 98  ? 48.947 -2.686  -16.232 1.00 47.80  ? 99  ASN A CA    1 
ATOM   1088 C C     . ASN B 2 98  ? 48.311 -3.751  -17.087 1.00 46.77  ? 99  ASN A C     1 
ATOM   1089 O O     . ASN B 2 98  ? 48.808 -4.088  -18.146 1.00 45.49  ? 99  ASN A O     1 
ATOM   1090 C CB    . ASN B 2 98  ? 50.447 -2.582  -16.559 1.00 37.34  ? 99  ASN A CB    1 
ATOM   1091 C CG    . ASN B 2 98  ? 50.763 -1.487  -17.548 1.00 70.23  ? 99  ASN A CG    1 
ATOM   1092 O OD1   . ASN B 2 98  ? 51.895 -1.380  -18.007 1.00 82.05  ? 99  ASN A OD1   1 
ATOM   1093 N ND2   . ASN B 2 98  ? 49.766 -0.671  -17.896 1.00 83.36  ? 99  ASN A ND2   1 
ATOM   1094 N N     . ASN B 2 99  ? 47.205 -4.292  -16.632 1.00 43.60  ? 100 ASN A N     1 
ATOM   1095 C CA    . ASN B 2 99  ? 46.580 -5.315  -17.422 1.00 44.11  ? 100 ASN A CA    1 
ATOM   1096 C C     . ASN B 2 99  ? 45.217 -4.788  -17.700 1.00 51.93  ? 100 ASN A C     1 
ATOM   1097 O O     . ASN B 2 99  ? 44.416 -4.471  -16.795 1.00 54.78  ? 100 ASN A O     1 
ATOM   1098 C CB    . ASN B 2 99  ? 46.555 -6.629  -16.647 1.00 47.71  ? 100 ASN A CB    1 
ATOM   1099 C CG    . ASN B 2 99  ? 45.507 -7.557  -17.135 1.00 79.79  ? 100 ASN A CG    1 
ATOM   1100 O OD1   . ASN B 2 99  ? 45.816 -8.577  -17.712 1.00 77.31  ? 100 ASN A OD1   1 
ATOM   1101 N ND2   . ASN B 2 99  ? 44.249 -7.221  -16.899 1.00 88.91  ? 100 ASN A ND2   1 
ATOM   1102 N N     . LEU B 2 100 ? 44.962 -4.673  -18.977 1.00 45.10  ? 101 LEU A N     1 
ATOM   1103 C CA    . LEU B 2 100 ? 43.696 -4.164  -19.410 1.00 44.70  ? 101 LEU A CA    1 
ATOM   1104 C C     . LEU B 2 100 ? 42.486 -4.844  -18.757 1.00 47.71  ? 101 LEU A C     1 
ATOM   1105 O O     . LEU B 2 100 ? 41.568 -4.203  -18.223 1.00 44.02  ? 101 LEU A O     1 
ATOM   1106 C CB    . LEU B 2 100 ? 43.667 -4.336  -20.904 1.00 45.09  ? 101 LEU A CB    1 
ATOM   1107 C CG    . LEU B 2 100 ? 42.641 -3.571  -21.699 1.00 53.85  ? 101 LEU A CG    1 
ATOM   1108 C CD1   . LEU B 2 100 ? 41.839 -2.695  -20.747 1.00 57.08  ? 101 LEU A CD1   1 
ATOM   1109 C CD2   . LEU B 2 100 ? 43.384 -2.774  -22.770 1.00 55.96  ? 101 LEU A CD2   1 
ATOM   1110 N N     . GLU B 2 101 ? 42.485 -6.162  -18.804 1.00 48.03  ? 102 GLU A N     1 
ATOM   1111 C CA    . GLU B 2 101 ? 41.373 -6.903  -18.248 1.00 50.94  ? 102 GLU A CA    1 
ATOM   1112 C C     . GLU B 2 101 ? 41.155 -6.613  -16.790 1.00 47.37  ? 102 GLU A C     1 
ATOM   1113 O O     . GLU B 2 101 ? 40.046 -6.307  -16.360 1.00 49.58  ? 102 GLU A O     1 
ATOM   1114 C CB    . GLU B 2 101 ? 41.560 -8.387  -18.505 1.00 56.09  ? 102 GLU A CB    1 
ATOM   1115 C CG    . GLU B 2 101 ? 40.458 -9.031  -19.399 1.00 95.72  ? 102 GLU A CG    1 
ATOM   1116 C CD    . GLU B 2 101 ? 40.472 -8.561  -20.879 1.00 100.00 ? 102 GLU A CD    1 
ATOM   1117 O OE1   . GLU B 2 101 ? 41.550 -8.600  -21.541 1.00 100.00 ? 102 GLU A OE1   1 
ATOM   1118 O OE2   . GLU B 2 101 ? 39.378 -8.184  -21.388 1.00 100.00 ? 102 GLU A OE2   1 
ATOM   1119 N N     . LYS B 2 102 ? 42.241 -6.711  -16.043 1.00 34.97  ? 103 LYS A N     1 
ATOM   1120 C CA    . LYS B 2 102 ? 42.242 -6.454  -14.623 1.00 28.42  ? 103 LYS A CA    1 
ATOM   1121 C C     . LYS B 2 102 ? 41.716 -5.040  -14.552 1.00 34.14  ? 103 LYS A C     1 
ATOM   1122 O O     . LYS B 2 102 ? 40.875 -4.680  -13.724 1.00 34.05  ? 103 LYS A O     1 
ATOM   1123 C CB    . LYS B 2 102 ? 43.679 -6.457  -14.134 1.00 21.94  ? 103 LYS A CB    1 
ATOM   1124 C CG    . LYS B 2 102 ? 43.919 -7.428  -13.039 1.00 40.30  ? 103 LYS A CG    1 
ATOM   1125 C CD    . LYS B 2 102 ? 45.087 -8.340  -13.356 1.00 56.87  ? 103 LYS A CD    1 
ATOM   1126 C CE    . LYS B 2 102 ? 45.755 -8.857  -12.070 1.00 75.33  ? 103 LYS A CE    1 
ATOM   1127 N NZ    . LYS B 2 102 ? 47.078 -9.533  -12.339 1.00 98.77  ? 103 LYS A NZ    1 
ATOM   1128 N N     . GLN B 2 103 ? 42.204 -4.206  -15.443 1.00 28.05  ? 104 GLN A N     1 
ATOM   1129 C CA    . GLN B 2 103 ? 41.700 -2.889  -15.343 1.00 28.16  ? 104 GLN A CA    1 
ATOM   1130 C C     . GLN B 2 103 ? 40.233 -2.714  -15.680 1.00 31.80  ? 104 GLN A C     1 
ATOM   1131 O O     . GLN B 2 103 ? 39.536 -1.967  -14.999 1.00 29.82  ? 104 GLN A O     1 
ATOM   1132 C CB    . GLN B 2 103 ? 42.666 -1.843  -15.862 1.00 30.22  ? 104 GLN A CB    1 
ATOM   1133 C CG    . GLN B 2 103 ? 42.908 -1.888  -17.337 1.00 47.77  ? 104 GLN A CG    1 
ATOM   1134 C CD    . GLN B 2 103 ? 44.304 -1.461  -17.657 1.00 47.47  ? 104 GLN A CD    1 
ATOM   1135 O OE1   . GLN B 2 103 ? 45.045 -1.120  -16.765 1.00 30.21  ? 104 GLN A OE1   1 
ATOM   1136 N NE2   . GLN B 2 103 ? 44.688 -1.510  -18.926 1.00 85.17  ? 104 GLN A NE2   1 
ATOM   1137 N N     . ARG B 2 104 ? 39.730 -3.403  -16.697 1.00 32.16  ? 105 ARG A N     1 
ATOM   1138 C CA    . ARG B 2 104 ? 38.305 -3.223  -16.987 1.00 35.91  ? 105 ARG A CA    1 
ATOM   1139 C C     . ARG B 2 104 ? 37.536 -3.764  -15.781 1.00 38.33  ? 105 ARG A C     1 
ATOM   1140 O O     . ARG B 2 104 ? 36.535 -3.224  -15.317 1.00 41.01  ? 105 ARG A O     1 
ATOM   1141 C CB    . ARG B 2 104 ? 37.885 -3.948  -18.255 1.00 41.42  ? 105 ARG A CB    1 
ATOM   1142 C CG    . ARG B 2 104 ? 37.609 -5.426  -18.033 1.00 88.63  ? 105 ARG A CG    1 
ATOM   1143 C CD    . ARG B 2 104 ? 36.714 -6.027  -19.142 1.00 100.00 ? 105 ARG A CD    1 
ATOM   1144 N NE    . ARG B 2 104 ? 37.375 -6.047  -20.457 1.00 100.00 ? 105 ARG A NE    1 
ATOM   1145 C CZ    . ARG B 2 104 ? 37.360 -5.037  -21.337 1.00 100.00 ? 105 ARG A CZ    1 
ATOM   1146 N NH1   . ARG B 2 104 ? 36.702 -3.904  -21.051 1.00 96.70  ? 105 ARG A NH1   1 
ATOM   1147 N NH2   . ARG B 2 104 ? 38.004 -5.157  -22.510 1.00 100.00 ? 105 ARG A NH2   1 
ATOM   1148 N N     . ALA B 2 105 ? 38.045 -4.847  -15.261 1.00 27.20  ? 106 ALA A N     1 
ATOM   1149 C CA    . ALA B 2 105 ? 37.451 -5.465  -14.116 1.00 27.58  ? 106 ALA A CA    1 
ATOM   1150 C C     . ALA B 2 105 ? 37.306 -4.528  -12.918 1.00 39.11  ? 106 ALA A C     1 
ATOM   1151 O O     . ALA B 2 105 ? 36.240 -4.301  -12.385 1.00 42.26  ? 106 ALA A O     1 
ATOM   1152 C CB    . ALA B 2 105 ? 38.354 -6.566  -13.719 1.00 28.28  ? 106 ALA A CB    1 
ATOM   1153 N N     . TYR B 2 106 ? 38.419 -4.007  -12.461 1.00 35.86  ? 107 TYR A N     1 
ATOM   1154 C CA    . TYR B 2 106 ? 38.383 -3.151  -11.326 1.00 33.34  ? 107 TYR A CA    1 
ATOM   1155 C C     . TYR B 2 106 ? 37.489 -1.934  -11.574 1.00 32.63  ? 107 TYR A C     1 
ATOM   1156 O O     . TYR B 2 106 ? 36.667 -1.541  -10.720 1.00 27.64  ? 107 TYR A O     1 
ATOM   1157 C CB    . TYR B 2 106 ? 39.811 -2.772  -11.041 1.00 35.18  ? 107 TYR A CB    1 
ATOM   1158 C CG    . TYR B 2 106 ? 40.409 -3.514  -9.862  1.00 41.29  ? 107 TYR A CG    1 
ATOM   1159 C CD1   . TYR B 2 106 ? 39.756 -3.533  -8.630  1.00 43.93  ? 107 TYR A CD1   1 
ATOM   1160 C CD2   . TYR B 2 106 ? 41.639 -4.190  -9.970  1.00 44.19  ? 107 TYR A CD2   1 
ATOM   1161 C CE1   . TYR B 2 106 ? 40.311 -4.198  -7.518  1.00 51.36  ? 107 TYR A CE1   1 
ATOM   1162 C CE2   . TYR B 2 106 ? 42.218 -4.861  -8.863  1.00 46.52  ? 107 TYR A CE2   1 
ATOM   1163 C CZ    . TYR B 2 106 ? 41.542 -4.853  -7.637  1.00 65.28  ? 107 TYR A CZ    1 
ATOM   1164 O OH    . TYR B 2 106 ? 42.063 -5.490  -6.527  1.00 68.79  ? 107 TYR A OH    1 
ATOM   1165 N N     . LEU B 2 107 ? 37.658 -1.341  -12.748 1.00 27.42  ? 108 LEU A N     1 
ATOM   1166 C CA    . LEU B 2 107 ? 36.874 -0.175  -13.119 1.00 27.60  ? 108 LEU A CA    1 
ATOM   1167 C C     . LEU B 2 107 ? 35.369 -0.498  -12.875 1.00 44.76  ? 108 LEU A C     1 
ATOM   1168 O O     . LEU B 2 107 ? 34.654 0.221   -12.176 1.00 49.89  ? 108 LEU A O     1 
ATOM   1169 C CB    . LEU B 2 107 ? 37.166 0.159   -14.577 1.00 25.33  ? 108 LEU A CB    1 
ATOM   1170 C CG    . LEU B 2 107 ? 37.607 1.587   -14.914 1.00 27.10  ? 108 LEU A CG    1 
ATOM   1171 C CD1   . LEU B 2 107 ? 37.891 2.368   -13.701 1.00 23.72  ? 108 LEU A CD1   1 
ATOM   1172 C CD2   . LEU B 2 107 ? 38.754 1.739   -15.964 1.00 28.02  ? 108 LEU A CD2   1 
ATOM   1173 N N     . SER B 2 108 ? 34.902 -1.620  -13.394 1.00 42.35  ? 109 SER A N     1 
ATOM   1174 C CA    . SER B 2 108 ? 33.505 -2.011  -13.192 1.00 41.92  ? 109 SER A CA    1 
ATOM   1175 C C     . SER B 2 108 ? 33.041 -2.279  -11.752 1.00 40.69  ? 109 SER A C     1 
ATOM   1176 O O     . SER B 2 108 ? 31.931 -1.888  -11.381 1.00 36.10  ? 109 SER A O     1 
ATOM   1177 C CB    . SER B 2 108 ? 33.162 -3.217  -14.057 1.00 48.75  ? 109 SER A CB    1 
ATOM   1178 O OG    . SER B 2 108 ? 32.691 -4.298  -13.263 1.00 73.39  ? 109 SER A OG    1 
ATOM   1179 N N     . MET B 2 109 ? 33.854 -2.959  -10.947 1.00 36.07  ? 110 MET A N     1 
ATOM   1180 C CA    . MET B 2 109 ? 33.410 -3.212  -9.601  1.00 38.28  ? 110 MET A CA    1 
ATOM   1181 C C     . MET B 2 109 ? 33.294 -1.843  -8.966  1.00 43.02  ? 110 MET A C     1 
ATOM   1182 O O     . MET B 2 109 ? 32.338 -1.532  -8.260  1.00 39.72  ? 110 MET A O     1 
ATOM   1183 C CB    . MET B 2 109 ? 34.424 -4.035  -8.836  1.00 44.61  ? 110 MET A CB    1 
ATOM   1184 C CG    . MET B 2 109 ? 35.541 -4.586  -9.695  1.00 59.63  ? 110 MET A CG    1 
ATOM   1185 S SD    . MET B 2 109 ? 36.081 -6.244  -9.053  1.00 76.29  ? 110 MET A SD    1 
ATOM   1186 C CE    . MET B 2 109 ? 34.707 -6.535  -7.781  1.00 74.84  ? 110 MET A CE    1 
ATOM   1187 N N     . MET B 2 110 ? 34.289 -1.017  -9.240  1.00 39.54  ? 111 MET A N     1 
ATOM   1188 C CA    . MET B 2 110 ? 34.305 0.292   -8.693  1.00 38.40  ? 111 MET A CA    1 
ATOM   1189 C C     . MET B 2 110 ? 33.022 1.060   -8.962  1.00 44.62  ? 111 MET A C     1 
ATOM   1190 O O     . MET B 2 110 ? 32.386 1.605   -8.039  1.00 41.70  ? 111 MET A O     1 
ATOM   1191 C CB    . MET B 2 110 ? 35.522 1.006   -9.199  1.00 41.71  ? 111 MET A CB    1 
ATOM   1192 C CG    . MET B 2 110 ? 36.445 1.254   -8.046  1.00 47.06  ? 111 MET A CG    1 
ATOM   1193 S SD    . MET B 2 110 ? 38.124 1.124   -8.467  1.00 50.91  ? 111 MET A SD    1 
ATOM   1194 C CE    . MET B 2 110 ? 38.853 1.033   -6.905  1.00 47.93  ? 111 MET A CE    1 
ATOM   1195 N N     . ALA B 2 111 ? 32.626 1.085   -10.225 1.00 42.10  ? 112 ALA A N     1 
ATOM   1196 C CA    . ALA B 2 111 ? 31.402 1.783   -10.608 1.00 43.03  ? 112 ALA A CA    1 
ATOM   1197 C C     . ALA B 2 111 ? 30.200 1.184   -9.887  1.00 40.90  ? 112 ALA A C     1 
ATOM   1198 O O     . ALA B 2 111 ? 29.374 1.879   -9.302  1.00 41.68  ? 112 ALA A O     1 
ATOM   1199 C CB    . ALA B 2 111 ? 31.217 1.689   -12.084 1.00 44.80  ? 112 ALA A CB    1 
ATOM   1200 N N     . GLN B 2 112 ? 30.123 -0.127  -9.927  1.00 32.11  ? 113 GLN A N     1 
ATOM   1201 C CA    . GLN B 2 112 ? 29.038 -0.785  -9.267  1.00 30.70  ? 113 GLN A CA    1 
ATOM   1202 C C     . GLN B 2 112 ? 29.077 -0.474  -7.813  1.00 35.16  ? 113 GLN A C     1 
ATOM   1203 O O     . GLN B 2 112 ? 28.042 -0.219  -7.242  1.00 40.44  ? 113 GLN A O     1 
ATOM   1204 C CB    . GLN B 2 112 ? 29.061 -2.280  -9.511  1.00 32.41  ? 113 GLN A CB    1 
ATOM   1205 C CG    . GLN B 2 112 ? 28.805 -2.642  -10.990 1.00 40.71  ? 113 GLN A CG    1 
ATOM   1206 C CD    . GLN B 2 112 ? 29.031 -4.097  -11.257 1.00 66.93  ? 113 GLN A CD    1 
ATOM   1207 O OE1   . GLN B 2 112 ? 29.131 -4.512  -12.403 1.00 75.78  ? 113 GLN A OE1   1 
ATOM   1208 N NE2   . GLN B 2 112 ? 29.104 -4.893  -10.190 1.00 66.38  ? 113 GLN A NE2   1 
ATOM   1209 N N     . LYS B 2 113 ? 30.251 -0.482  -7.195  1.00 29.47  ? 114 LYS A N     1 
ATOM   1210 C CA    . LYS B 2 113 ? 30.300 -0.164  -5.771  1.00 29.85  ? 114 LYS A CA    1 
ATOM   1211 C C     . LYS B 2 113 ? 29.948 1.324   -5.590  1.00 35.26  ? 114 LYS A C     1 
ATOM   1212 O O     . LYS B 2 113 ? 29.754 1.796   -4.460  1.00 35.77  ? 114 LYS A O     1 
ATOM   1213 C CB    . LYS B 2 113 ? 31.651 -0.490  -5.156  1.00 34.21  ? 114 LYS A CB    1 
ATOM   1214 C CG    . LYS B 2 113 ? 31.857 -1.949  -4.794  1.00 32.41  ? 114 LYS A CG    1 
ATOM   1215 C CD    . LYS B 2 113 ? 31.553 -2.284  -3.318  1.00 46.88  ? 114 LYS A CD    1 
ATOM   1216 C CE    . LYS B 2 113 ? 31.508 -3.817  -3.106  1.00 69.93  ? 114 LYS A CE    1 
ATOM   1217 N NZ    . LYS B 2 113 ? 32.515 -4.343  -2.154  1.00 86.60  ? 114 LYS A NZ    1 
ATOM   1218 N N     . ARG B 2 114 ? 29.850 2.048   -6.710  1.00 28.89  ? 115 ARG A N     1 
ATOM   1219 C CA    . ARG B 2 114 ? 29.460 3.466   -6.676  1.00 28.67  ? 115 ARG A CA    1 
ATOM   1220 C C     . ARG B 2 114 ? 30.381 4.388   -5.895  1.00 42.62  ? 115 ARG A C     1 
ATOM   1221 O O     . ARG B 2 114 ? 29.950 5.138   -5.024  1.00 39.55  ? 115 ARG A O     1 
ATOM   1222 C CB    . ARG B 2 114 ? 28.102 3.589   -6.017  1.00 23.70  ? 115 ARG A CB    1 
ATOM   1223 C CG    . ARG B 2 114 ? 26.955 3.006   -6.826  1.00 35.02  ? 115 ARG A CG    1 
ATOM   1224 C CD    . ARG B 2 114 ? 26.993 3.435   -8.274  1.00 42.89  ? 115 ARG A CD    1 
ATOM   1225 N NE    . ARG B 2 114 ? 25.686 3.235   -8.906  1.00 26.02  ? 115 ARG A NE    1 
ATOM   1226 C CZ    . ARG B 2 114 ? 25.471 2.390   -9.922  1.00 94.31  ? 115 ARG A CZ    1 
ATOM   1227 N NH1   . ARG B 2 114 ? 26.472 1.660   -10.417 1.00 91.87  ? 115 ARG A NH1   1 
ATOM   1228 N NH2   . ARG B 2 114 ? 24.252 2.270   -10.445 1.00 100.00 ? 115 ARG A NH2   1 
ATOM   1229 N N     . VAL B 2 115 ? 31.661 4.335   -6.215  1.00 43.87  ? 116 VAL A N     1 
ATOM   1230 C CA    . VAL B 2 115 ? 32.644 5.172   -5.573  1.00 39.35  ? 116 VAL A CA    1 
ATOM   1231 C C     . VAL B 2 115 ? 32.275 6.601   -5.923  1.00 46.93  ? 116 VAL A C     1 
ATOM   1232 O O     . VAL B 2 115 ? 31.815 6.900   -7.054  1.00 45.86  ? 116 VAL A O     1 
ATOM   1233 C CB    . VAL B 2 115 ? 33.996 4.832   -6.132  1.00 39.02  ? 116 VAL A CB    1 
ATOM   1234 C CG1   . VAL B 2 115 ? 34.501 3.647   -5.414  1.00 40.58  ? 116 VAL A CG1   1 
ATOM   1235 C CG2   . VAL B 2 115 ? 33.857 4.416   -7.559  1.00 35.72  ? 116 VAL A CG2   1 
ATOM   1236 N N     . ASP B 2 116 ? 32.464 7.481   -4.942  1.00 42.56  ? 117 ASP A N     1 
ATOM   1237 C CA    . ASP B 2 116 ? 32.127 8.886   -5.107  1.00 37.38  ? 117 ASP A CA    1 
ATOM   1238 C C     . ASP B 2 116 ? 32.935 9.603   -6.174  1.00 40.71  ? 117 ASP A C     1 
ATOM   1239 O O     . ASP B 2 116 ? 32.425 10.514  -6.844  1.00 41.79  ? 117 ASP A O     1 
ATOM   1240 C CB    . ASP B 2 116 ? 32.069 9.598   -3.751  1.00 36.36  ? 117 ASP A CB    1 
ATOM   1241 C CG    . ASP B 2 116 ? 30.818 9.194   -2.921  1.00 41.47  ? 117 ASP A CG    1 
ATOM   1242 O OD1   . ASP B 2 116 ? 29.813 8.679   -3.493  1.00 46.55  ? 117 ASP A OD1   1 
ATOM   1243 O OD2   . ASP B 2 116 ? 30.841 9.360   -1.685  1.00 28.74  ? 117 ASP A OD2   1 
ATOM   1244 N N     . GLY B 2 117 ? 34.183 9.148   -6.332  1.00 35.94  ? 118 GLY A N     1 
ATOM   1245 C CA    . GLY B 2 117 ? 35.160 9.667   -7.296  1.00 31.89  ? 118 GLY A CA    1 
ATOM   1246 C C     . GLY B 2 117 ? 36.256 8.606   -7.486  1.00 32.60  ? 118 GLY A C     1 
ATOM   1247 O O     . GLY B 2 117 ? 36.310 7.603   -6.774  1.00 36.51  ? 118 GLY A O     1 
ATOM   1248 N N     . LEU B 2 118 ? 37.123 8.841   -8.455  1.00 27.70  ? 119 LEU A N     1 
ATOM   1249 C CA    . LEU B 2 118 ? 38.216 7.947   -8.792  1.00 27.33  ? 119 LEU A CA    1 
ATOM   1250 C C     . LEU B 2 118 ? 39.640 8.561   -8.918  1.00 35.23  ? 119 LEU A C     1 
ATOM   1251 O O     . LEU B 2 118 ? 39.872 9.556   -9.626  1.00 32.89  ? 119 LEU A O     1 
ATOM   1252 C CB    . LEU B 2 118 ? 37.906 7.387   -10.170 1.00 28.56  ? 119 LEU A CB    1 
ATOM   1253 C CG    . LEU B 2 118 ? 38.414 5.966   -10.358 1.00 36.85  ? 119 LEU A CG    1 
ATOM   1254 C CD1   . LEU B 2 118 ? 38.357 5.256   -9.039  1.00 37.97  ? 119 LEU A CD1   1 
ATOM   1255 C CD2   . LEU B 2 118 ? 37.537 5.257   -11.349 1.00 41.01  ? 119 LEU A CD2   1 
ATOM   1256 N N     . LEU B 2 119 ? 40.610 7.936   -8.261  1.00 30.79  ? 120 LEU A N     1 
ATOM   1257 C CA    . LEU B 2 119 ? 41.985 8.377   -8.377  1.00 28.14  ? 120 LEU A CA    1 
ATOM   1258 C C     . LEU B 2 119 ? 42.603 7.344   -9.367  1.00 36.21  ? 120 LEU A C     1 
ATOM   1259 O O     . LEU B 2 119 ? 42.451 6.122   -9.166  1.00 38.64  ? 120 LEU A O     1 
ATOM   1260 C CB    . LEU B 2 119 ? 42.673 8.353   -7.033  1.00 26.34  ? 120 LEU A CB    1 
ATOM   1261 C CG    . LEU B 2 119 ? 42.734 9.721   -6.349  1.00 30.67  ? 120 LEU A CG    1 
ATOM   1262 C CD1   . LEU B 2 119 ? 42.152 10.874  -7.132  1.00 28.10  ? 120 LEU A CD1   1 
ATOM   1263 C CD2   . LEU B 2 119 ? 41.971 9.587   -5.109  1.00 32.66  ? 120 LEU A CD2   1 
ATOM   1264 N N     . VAL B 2 120 ? 43.258 7.821   -10.438 1.00 31.86  ? 121 VAL A N     1 
ATOM   1265 C CA    . VAL B 2 120 ? 43.864 6.930   -11.446 1.00 33.80  ? 121 VAL A CA    1 
ATOM   1266 C C     . VAL B 2 120 ? 45.374 7.010   -11.632 1.00 37.90  ? 121 VAL A C     1 
ATOM   1267 O O     . VAL B 2 120 ? 45.942 8.062   -12.008 1.00 36.59  ? 121 VAL A O     1 
ATOM   1268 C CB    . VAL B 2 120 ? 43.207 7.069   -12.829 1.00 39.56  ? 121 VAL A CB    1 
ATOM   1269 C CG1   . VAL B 2 120 ? 43.961 6.265   -13.863 1.00 38.79  ? 121 VAL A CG1   1 
ATOM   1270 C CG2   . VAL B 2 120 ? 41.792 6.591   -12.771 1.00 40.48  ? 121 VAL A CG2   1 
ATOM   1271 N N     . MET B 2 121 ? 46.018 5.876   -11.379 1.00 31.72  ? 122 MET A N     1 
ATOM   1272 C CA    . MET B 2 121 ? 47.475 5.759   -11.494 1.00 29.33  ? 122 MET A CA    1 
ATOM   1273 C C     . MET B 2 121 ? 47.783 4.509   -12.296 1.00 30.23  ? 122 MET A C     1 
ATOM   1274 O O     . MET B 2 121 ? 48.209 3.474   -11.771 1.00 27.99  ? 122 MET A O     1 
ATOM   1275 C CB    . MET B 2 121 ? 48.132 5.717   -10.106 1.00 30.22  ? 122 MET A CB    1 
ATOM   1276 C CG    . MET B 2 121 ? 49.518 6.224   -10.170 1.00 37.99  ? 122 MET A CG    1 
ATOM   1277 S SD    . MET B 2 121 ? 50.272 6.615   -8.601  1.00 47.53  ? 122 MET A SD    1 
ATOM   1278 C CE    . MET B 2 121 ? 49.153 5.831   -7.513  1.00 46.04  ? 122 MET A CE    1 
ATOM   1279 N N     . CYS B 2 122 ? 47.557 4.605   -13.588 1.00 28.29  ? 123 CYS A N     1 
ATOM   1280 C CA    . CYS B 2 122 ? 47.786 3.447   -14.413 1.00 32.82  ? 123 CYS A CA    1 
ATOM   1281 C C     . CYS B 2 122 ? 49.104 3.221   -15.074 1.00 35.80  ? 123 CYS A C     1 
ATOM   1282 O O     . CYS B 2 122 ? 49.303 2.231   -15.731 1.00 33.99  ? 123 CYS A O     1 
ATOM   1283 C CB    . CYS B 2 122 ? 46.583 3.175   -15.305 1.00 35.25  ? 123 CYS A CB    1 
ATOM   1284 S SG    . CYS B 2 122 ? 45.197 2.596   -14.268 1.00 39.00  ? 123 CYS A SG    1 
ATOM   1285 N N     . SER B 2 123 ? 50.025 4.136   -14.884 1.00 36.60  ? 124 SER A N     1 
ATOM   1286 C CA    . SER B 2 123 ? 51.322 3.961   -15.498 1.00 35.45  ? 124 SER A CA    1 
ATOM   1287 C C     . SER B 2 123 ? 51.305 4.078   -16.996 1.00 36.63  ? 124 SER A C     1 
ATOM   1288 O O     . SER B 2 123 ? 51.690 5.079   -17.491 1.00 38.58  ? 124 SER A O     1 
ATOM   1289 C CB    . SER B 2 123 ? 52.026 2.716   -15.010 1.00 32.93  ? 124 SER A CB    1 
ATOM   1290 O OG    . SER B 2 123 ? 52.157 2.856   -13.619 1.00 43.74  ? 124 SER A OG    1 
ATOM   1291 N N     . GLU B 2 124 ? 50.864 3.092   -17.740 1.00 32.24  ? 125 GLU A N     1 
ATOM   1292 C CA    . GLU B 2 124 ? 50.883 3.272   -19.187 1.00 30.94  ? 125 GLU A CA    1 
ATOM   1293 C C     . GLU B 2 124 ? 49.428 3.434   -19.676 1.00 42.67  ? 125 GLU A C     1 
ATOM   1294 O O     . GLU B 2 124 ? 48.530 2.757   -19.155 1.00 48.48  ? 125 GLU A O     1 
ATOM   1295 C CB    . GLU B 2 124 ? 51.698 2.128   -19.839 1.00 30.82  ? 125 GLU A CB    1 
ATOM   1296 C CG    . GLU B 2 124 ? 53.061 1.643   -19.056 1.00 1.00   ? 125 GLU A CG    1 
ATOM   1297 C CD    . GLU B 2 124 ? 53.646 0.467   -19.804 1.00 55.56  ? 125 GLU A CD    1 
ATOM   1298 O OE1   . GLU B 2 124 ? 52.960 0.020   -20.760 1.00 82.89  ? 125 GLU A OE1   1 
ATOM   1299 O OE2   . GLU B 2 124 ? 54.756 -0.001  -19.477 1.00 58.58  ? 125 GLU A OE2   1 
ATOM   1300 N N     . TYR B 2 125 ? 49.187 4.343   -20.632 1.00 36.79  ? 126 TYR A N     1 
ATOM   1301 C CA    . TYR B 2 125 ? 47.824 4.624   -21.168 1.00 33.03  ? 126 TYR A CA    1 
ATOM   1302 C C     . TYR B 2 125 ? 47.522 4.413   -22.665 1.00 41.78  ? 126 TYR A C     1 
ATOM   1303 O O     . TYR B 2 125 ? 47.426 5.379   -23.417 1.00 44.88  ? 126 TYR A O     1 
ATOM   1304 C CB    . TYR B 2 125 ? 47.434 6.049   -20.822 1.00 28.55  ? 126 TYR A CB    1 
ATOM   1305 C CG    . TYR B 2 125 ? 47.274 6.269   -19.372 1.00 31.67  ? 126 TYR A CG    1 
ATOM   1306 C CD1   . TYR B 2 125 ? 48.377 6.282   -18.549 1.00 31.63  ? 126 TYR A CD1   1 
ATOM   1307 C CD2   . TYR B 2 125 ? 46.021 6.348   -18.802 1.00 36.12  ? 126 TYR A CD2   1 
ATOM   1308 C CE1   . TYR B 2 125 ? 48.235 6.397   -17.168 1.00 34.49  ? 126 TYR A CE1   1 
ATOM   1309 C CE2   . TYR B 2 125 ? 45.872 6.480   -17.420 1.00 37.48  ? 126 TYR A CE2   1 
ATOM   1310 C CZ    . TYR B 2 125 ? 46.984 6.571   -16.631 1.00 38.29  ? 126 TYR A CZ    1 
ATOM   1311 O OH    . TYR B 2 125 ? 46.816 6.716   -15.312 1.00 37.84  ? 126 TYR A OH    1 
ATOM   1312 N N     . PRO B 2 126 ? 47.343 3.178   -23.103 1.00 37.37  ? 127 PRO A N     1 
ATOM   1313 C CA    . PRO B 2 126 ? 47.026 2.888   -24.506 1.00 38.13  ? 127 PRO A CA    1 
ATOM   1314 C C     . PRO B 2 126 ? 45.599 3.307   -24.809 1.00 45.63  ? 127 PRO A C     1 
ATOM   1315 O O     . PRO B 2 126 ? 44.757 3.394   -23.894 1.00 45.37  ? 127 PRO A O     1 
ATOM   1316 C CB    . PRO B 2 126 ? 47.067 1.378   -24.567 1.00 40.29  ? 127 PRO A CB    1 
ATOM   1317 C CG    . PRO B 2 126 ? 47.662 0.941   -23.283 1.00 42.84  ? 127 PRO A CG    1 
ATOM   1318 C CD    . PRO B 2 126 ? 47.326 1.974   -22.283 1.00 37.88  ? 127 PRO A CD    1 
ATOM   1319 N N     . GLU B 2 127 ? 45.340 3.562   -26.087 1.00 44.12  ? 128 GLU A N     1 
ATOM   1320 C CA    . GLU B 2 127 ? 44.033 3.999   -26.500 1.00 46.23  ? 128 GLU A CA    1 
ATOM   1321 C C     . GLU B 2 127 ? 42.915 3.273   -25.814 1.00 45.75  ? 128 GLU A C     1 
ATOM   1322 O O     . GLU B 2 127 ? 42.102 3.905   -25.140 1.00 46.19  ? 128 GLU A O     1 
ATOM   1323 C CB    . GLU B 2 127 ? 43.888 4.088   -27.998 1.00 50.32  ? 128 GLU A CB    1 
ATOM   1324 C CG    . GLU B 2 127 ? 43.423 5.503   -28.458 1.00 82.35  ? 128 GLU A CG    1 
ATOM   1325 C CD    . GLU B 2 127 ? 41.894 5.781   -28.213 1.00 100.00 ? 128 GLU A CD    1 
ATOM   1326 O OE1   . GLU B 2 127 ? 41.010 5.094   -28.824 1.00 100.00 ? 128 GLU A OE1   1 
ATOM   1327 O OE2   . GLU B 2 127 ? 41.583 6.722   -27.432 1.00 99.49  ? 128 GLU A OE2   1 
ATOM   1328 N N     . PRO B 2 128 ? 42.927 1.955   -25.924 1.00 36.36  ? 129 PRO A N     1 
ATOM   1329 C CA    . PRO B 2 128 ? 41.933 1.133   -25.260 1.00 35.39  ? 129 PRO A CA    1 
ATOM   1330 C C     . PRO B 2 128 ? 41.746 1.628   -23.825 1.00 45.98  ? 129 PRO A C     1 
ATOM   1331 O O     . PRO B 2 128 ? 40.637 1.938   -23.416 1.00 52.68  ? 129 PRO A O     1 
ATOM   1332 C CB    . PRO B 2 128 ? 42.576 -0.260  -25.231 1.00 36.41  ? 129 PRO A CB    1 
ATOM   1333 C CG    . PRO B 2 128 ? 43.534 -0.272  -26.337 1.00 40.19  ? 129 PRO A CG    1 
ATOM   1334 C CD    . PRO B 2 128 ? 44.055 1.159   -26.429 1.00 35.99  ? 129 PRO A CD    1 
ATOM   1335 N N     . LEU B 2 129 ? 42.812 1.750   -23.054 1.00 37.28  ? 130 LEU A N     1 
ATOM   1336 C CA    . LEU B 2 129 ? 42.610 2.233   -21.708 1.00 36.12  ? 130 LEU A CA    1 
ATOM   1337 C C     . LEU B 2 129 ? 41.939 3.612   -21.682 1.00 36.62  ? 130 LEU A C     1 
ATOM   1338 O O     . LEU B 2 129 ? 41.046 3.868   -20.853 1.00 31.92  ? 130 LEU A O     1 
ATOM   1339 C CB    . LEU B 2 129 ? 43.938 2.280   -20.977 1.00 35.93  ? 130 LEU A CB    1 
ATOM   1340 C CG    . LEU B 2 129 ? 43.918 2.423   -19.449 1.00 37.58  ? 130 LEU A CG    1 
ATOM   1341 C CD1   . LEU B 2 129 ? 44.822 3.561   -19.088 1.00 39.09  ? 130 LEU A CD1   1 
ATOM   1342 C CD2   . LEU B 2 129 ? 42.533 2.643   -18.897 1.00 35.83  ? 130 LEU A CD2   1 
ATOM   1343 N N     . LEU B 2 130 ? 42.360 4.494   -22.587 1.00 33.79  ? 131 LEU A N     1 
ATOM   1344 C CA    . LEU B 2 130 ? 41.767 5.827   -22.600 1.00 40.12  ? 131 LEU A CA    1 
ATOM   1345 C C     . LEU B 2 130 ? 40.290 5.683   -22.851 1.00 54.32  ? 131 LEU A C     1 
ATOM   1346 O O     . LEU B 2 130 ? 39.433 6.309   -22.209 1.00 57.28  ? 131 LEU A O     1 
ATOM   1347 C CB    . LEU B 2 130 ? 42.327 6.691   -23.719 1.00 41.33  ? 131 LEU A CB    1 
ATOM   1348 C CG    . LEU B 2 130 ? 43.671 7.348   -23.466 1.00 46.82  ? 131 LEU A CG    1 
ATOM   1349 C CD1   . LEU B 2 130 ? 43.695 8.038   -22.114 1.00 44.59  ? 131 LEU A CD1   1 
ATOM   1350 C CD2   . LEU B 2 130 ? 44.581 6.146   -23.488 1.00 62.02  ? 131 LEU A CD2   1 
ATOM   1351 N N     . ALA B 2 131 ? 40.003 4.842   -23.824 1.00 49.87  ? 132 ALA A N     1 
ATOM   1352 C CA    . ALA B 2 131 ? 38.636 4.582   -24.193 1.00 47.38  ? 132 ALA A CA    1 
ATOM   1353 C C     . ALA B 2 131 ? 37.776 4.173   -22.981 1.00 55.30  ? 132 ALA A C     1 
ATOM   1354 O O     . ALA B 2 131 ? 36.754 4.799   -22.705 1.00 58.57  ? 132 ALA A O     1 
ATOM   1355 C CB    . ALA B 2 131 ? 38.592 3.537   -25.284 1.00 46.19  ? 132 ALA A CB    1 
ATOM   1356 N N     . MET B 2 132 ? 38.189 3.141   -22.255 1.00 49.56  ? 133 MET A N     1 
ATOM   1357 C CA    . MET B 2 132 ? 37.434 2.684   -21.105 1.00 50.59  ? 133 MET A CA    1 
ATOM   1358 C C     . MET B 2 132 ? 37.173 3.822   -20.158 1.00 51.40  ? 133 MET A C     1 
ATOM   1359 O O     . MET B 2 132 ? 36.054 4.026   -19.683 1.00 49.25  ? 133 MET A O     1 
ATOM   1360 C CB    . MET B 2 132 ? 38.261 1.666   -20.350 1.00 56.09  ? 133 MET A CB    1 
ATOM   1361 C CG    . MET B 2 132 ? 37.613 0.330   -20.216 1.00 64.35  ? 133 MET A CG    1 
ATOM   1362 S SD    . MET B 2 132 ? 38.903 -0.892  -20.224 1.00 73.57  ? 133 MET A SD    1 
ATOM   1363 C CE    . MET B 2 132 ? 39.403 -0.956  -18.499 1.00 70.96  ? 133 MET A CE    1 
ATOM   1364 N N     . LEU B 2 133 ? 38.231 4.559   -19.881 1.00 45.44  ? 134 LEU A N     1 
ATOM   1365 C CA    . LEU B 2 133 ? 38.122 5.666   -18.976 1.00 44.13  ? 134 LEU A CA    1 
ATOM   1366 C C     . LEU B 2 133 ? 36.960 6.600   -19.336 1.00 49.23  ? 134 LEU A C     1 
ATOM   1367 O O     . LEU B 2 133 ? 36.149 6.954   -18.481 1.00 45.87  ? 134 LEU A O     1 
ATOM   1368 C CB    . LEU B 2 133 ? 39.457 6.393   -18.945 1.00 43.14  ? 134 LEU A CB    1 
ATOM   1369 C CG    . LEU B 2 133 ? 40.549 5.593   -18.260 1.00 43.77  ? 134 LEU A CG    1 
ATOM   1370 C CD1   . LEU B 2 133 ? 41.809 6.417   -18.222 1.00 40.58  ? 134 LEU A CD1   1 
ATOM   1371 C CD2   . LEU B 2 133 ? 40.048 5.223   -16.849 1.00 40.21  ? 134 LEU A CD2   1 
ATOM   1372 N N     . GLU B 2 134 ? 36.878 6.997   -20.600 1.00 50.71  ? 135 GLU A N     1 
ATOM   1373 C CA    . GLU B 2 134 ? 35.811 7.887   -21.013 1.00 53.69  ? 135 GLU A CA    1 
ATOM   1374 C C     . GLU B 2 134 ? 34.467 7.266   -20.664 1.00 58.71  ? 135 GLU A C     1 
ATOM   1375 O O     . GLU B 2 134 ? 33.532 7.952   -20.237 1.00 63.63  ? 135 GLU A O     1 
ATOM   1376 C CB    . GLU B 2 134 ? 35.873 8.118   -22.508 1.00 56.30  ? 135 GLU A CB    1 
ATOM   1377 C CG    . GLU B 2 134 ? 35.172 9.391   -22.959 1.00 78.62  ? 135 GLU A CG    1 
ATOM   1378 C CD    . GLU B 2 134 ? 35.868 10.043  -24.177 1.00 100.00 ? 135 GLU A CD    1 
ATOM   1379 O OE1   . GLU B 2 134 ? 36.933 9.501   -24.616 1.00 100.00 ? 135 GLU A OE1   1 
ATOM   1380 O OE2   . GLU B 2 134 ? 35.359 11.095  -24.680 1.00 100.00 ? 135 GLU A OE2   1 
ATOM   1381 N N     . GLU B 2 135 ? 34.381 5.955   -20.839 1.00 45.24  ? 136 GLU A N     1 
ATOM   1382 C CA    . GLU B 2 135 ? 33.144 5.244   -20.542 1.00 44.54  ? 136 GLU A CA    1 
ATOM   1383 C C     . GLU B 2 135 ? 32.663 5.540   -19.159 1.00 45.00  ? 136 GLU A C     1 
ATOM   1384 O O     . GLU B 2 135 ? 31.537 5.249   -18.829 1.00 47.23  ? 136 GLU A O     1 
ATOM   1385 C CB    . GLU B 2 135 ? 33.349 3.729   -20.586 1.00 46.82  ? 136 GLU A CB    1 
ATOM   1386 C CG    . GLU B 2 135 ? 33.783 3.135   -21.933 1.00 72.77  ? 136 GLU A CG    1 
ATOM   1387 C CD    . GLU B 2 135 ? 33.000 1.875   -22.277 1.00 100.00 ? 136 GLU A CD    1 
ATOM   1388 O OE1   . GLU B 2 135 ? 31.819 2.055   -22.678 1.00 100.00 ? 136 GLU A OE1   1 
ATOM   1389 O OE2   . GLU B 2 135 ? 33.546 0.733   -22.133 1.00 70.83  ? 136 GLU A OE2   1 
ATOM   1390 N N     . TYR B 2 136 ? 33.526 6.091   -18.324 1.00 38.62  ? 137 TYR A N     1 
ATOM   1391 C CA    . TYR B 2 136 ? 33.100 6.365   -16.981 1.00 37.36  ? 137 TYR A CA    1 
ATOM   1392 C C     . TYR B 2 136 ? 33.307 7.765   -16.609 1.00 48.37  ? 137 TYR A C     1 
ATOM   1393 O O     . TYR B 2 136 ? 33.479 8.083   -15.408 1.00 48.63  ? 137 TYR A O     1 
ATOM   1394 C CB    . TYR B 2 136 ? 33.842 5.525   -15.997 1.00 39.06  ? 137 TYR A CB    1 
ATOM   1395 C CG    . TYR B 2 136 ? 33.621 4.062   -16.217 1.00 45.39  ? 137 TYR A CG    1 
ATOM   1396 C CD1   . TYR B 2 136 ? 34.361 3.355   -17.166 1.00 45.61  ? 137 TYR A CD1   1 
ATOM   1397 C CD2   . TYR B 2 136 ? 32.692 3.375   -15.453 1.00 49.26  ? 137 TYR A CD2   1 
ATOM   1398 C CE1   . TYR B 2 136 ? 34.172 2.018   -17.350 1.00 44.20  ? 137 TYR A CE1   1 
ATOM   1399 C CE2   . TYR B 2 136 ? 32.493 2.032   -15.626 1.00 51.40  ? 137 TYR A CE2   1 
ATOM   1400 C CZ    . TYR B 2 136 ? 33.222 1.359   -16.574 1.00 62.57  ? 137 TYR A CZ    1 
ATOM   1401 O OH    . TYR B 2 136 ? 32.985 0.012   -16.717 1.00 72.24  ? 137 TYR A OH    1 
ATOM   1402 N N     . ARG B 2 137 ? 33.300 8.609   -17.635 1.00 47.12  ? 138 ARG A N     1 
ATOM   1403 C CA    . ARG B 2 137 ? 33.425 10.013  -17.383 1.00 46.10  ? 138 ARG A CA    1 
ATOM   1404 C C     . ARG B 2 137 ? 32.369 10.460  -16.396 1.00 49.30  ? 138 ARG A C     1 
ATOM   1405 O O     . ARG B 2 137 ? 32.522 11.456  -15.723 1.00 55.29  ? 138 ARG A O     1 
ATOM   1406 C CB    . ARG B 2 137 ? 33.465 10.849  -18.667 1.00 47.29  ? 138 ARG A CB    1 
ATOM   1407 C CG    . ARG B 2 137 ? 32.467 10.552  -19.765 1.00 41.60  ? 138 ARG A CG    1 
ATOM   1408 C CD    . ARG B 2 137 ? 31.808 11.856  -20.274 1.00 72.73  ? 138 ARG A CD    1 
ATOM   1409 N NE    . ARG B 2 137 ? 32.738 12.991  -20.449 1.00 100.00 ? 138 ARG A NE    1 
ATOM   1410 C CZ    . ARG B 2 137 ? 33.426 13.268  -21.568 1.00 100.00 ? 138 ARG A CZ    1 
ATOM   1411 N NH1   . ARG B 2 137 ? 33.310 12.488  -22.644 1.00 100.00 ? 138 ARG A NH1   1 
ATOM   1412 N NH2   . ARG B 2 137 ? 34.238 14.326  -21.621 1.00 82.58  ? 138 ARG A NH2   1 
ATOM   1413 N N     . HIS B 2 138 ? 31.283 9.724   -16.267 1.00 43.92  ? 139 HIS A N     1 
ATOM   1414 C CA    . HIS B 2 138 ? 30.290 10.186  -15.328 1.00 44.22  ? 139 HIS A CA    1 
ATOM   1415 C C     . HIS B 2 138 ? 30.757 10.125  -13.885 1.00 47.06  ? 139 HIS A C     1 
ATOM   1416 O O     . HIS B 2 138 ? 30.261 10.839  -13.008 1.00 47.82  ? 139 HIS A O     1 
ATOM   1417 C CB    . HIS B 2 138 ? 29.041 9.429   -15.526 1.00 47.43  ? 139 HIS A CB    1 
ATOM   1418 C CG    . HIS B 2 138 ? 29.152 8.009   -15.120 1.00 52.59  ? 139 HIS A CG    1 
ATOM   1419 N ND1   . HIS B 2 138 ? 29.820 7.077   -15.884 1.00 56.13  ? 139 HIS A ND1   1 
ATOM   1420 C CD2   . HIS B 2 138 ? 28.687 7.355   -14.027 1.00 55.83  ? 139 HIS A CD2   1 
ATOM   1421 C CE1   . HIS B 2 138 ? 29.763 5.904   -15.273 1.00 56.65  ? 139 HIS A CE1   1 
ATOM   1422 N NE2   . HIS B 2 138 ? 29.079 6.045   -14.147 1.00 56.81  ? 139 HIS A NE2   1 
ATOM   1423 N N     . ILE B 2 139 ? 31.723 9.269   -13.615 1.00 42.59  ? 140 ILE A N     1 
ATOM   1424 C CA    . ILE B 2 139 ? 32.193 9.212   -12.250 1.00 40.51  ? 140 ILE A CA    1 
ATOM   1425 C C     . ILE B 2 139 ? 33.389 10.146  -12.228 1.00 43.38  ? 140 ILE A C     1 
ATOM   1426 O O     . ILE B 2 139 ? 34.333 10.001  -12.978 1.00 42.70  ? 140 ILE A O     1 
ATOM   1427 C CB    . ILE B 2 139 ? 32.578 7.811   -11.814 1.00 42.22  ? 140 ILE A CB    1 
ATOM   1428 C CG1   . ILE B 2 139 ? 33.833 7.910   -10.985 1.00 46.48  ? 140 ILE A CG1   1 
ATOM   1429 C CG2   . ILE B 2 139 ? 32.749 6.884   -13.004 1.00 34.89  ? 140 ILE A CG2   1 
ATOM   1430 C CD1   . ILE B 2 139 ? 33.638 8.688   -9.681  1.00 78.07  ? 140 ILE A CD1   1 
ATOM   1431 N N     . PRO B 2 140 ? 33.318 11.132  -11.366 1.00 41.40  ? 141 PRO A N     1 
ATOM   1432 C CA    . PRO B 2 140 ? 34.365 12.127  -11.224 1.00 39.89  ? 141 PRO A CA    1 
ATOM   1433 C C     . PRO B 2 140 ? 35.728 11.528  -11.062 1.00 45.05  ? 141 PRO A C     1 
ATOM   1434 O O     . PRO B 2 140 ? 35.896 10.622  -10.262 1.00 45.45  ? 141 PRO A O     1 
ATOM   1435 C CB    . PRO B 2 140 ? 34.029 12.790  -9.885  1.00 40.26  ? 141 PRO A CB    1 
ATOM   1436 C CG    . PRO B 2 140 ? 33.031 11.941  -9.224  1.00 46.14  ? 141 PRO A CG    1 
ATOM   1437 C CD    . PRO B 2 140 ? 32.299 11.241  -10.316 1.00 43.96  ? 141 PRO A CD    1 
ATOM   1438 N N     . MET B 2 141 ? 36.713 12.041  -11.788 1.00 39.31  ? 142 MET A N     1 
ATOM   1439 C CA    . MET B 2 141 ? 38.053 11.501  -11.626 1.00 37.85  ? 142 MET A CA    1 
ATOM   1440 C C     . MET B 2 141 ? 39.321 12.354  -11.911 1.00 40.88  ? 142 MET A C     1 
ATOM   1441 O O     . MET B 2 141 ? 39.329 13.326  -12.649 1.00 41.81  ? 142 MET A O     1 
ATOM   1442 C CB    . MET B 2 141 ? 38.151 10.121  -12.275 1.00 38.82  ? 142 MET A CB    1 
ATOM   1443 C CG    . MET B 2 141 ? 38.758 10.105  -13.667 1.00 41.76  ? 142 MET A CG    1 
ATOM   1444 S SD    . MET B 2 141 ? 38.085 8.727   -14.655 1.00 51.10  ? 142 MET A SD    1 
ATOM   1445 C CE    . MET B 2 141 ? 38.657 9.211   -16.122 1.00 51.35  ? 142 MET A CE    1 
ATOM   1446 N N     . VAL B 2 142 ? 40.432 11.980  -11.324 1.00 35.22  ? 143 VAL A N     1 
ATOM   1447 C CA    . VAL B 2 142 ? 41.640 12.713  -11.629 1.00 35.18  ? 143 VAL A CA    1 
ATOM   1448 C C     . VAL B 2 142 ? 42.761 11.702  -11.840 1.00 38.73  ? 143 VAL A C     1 
ATOM   1449 O O     . VAL B 2 142 ? 42.935 10.779  -11.030 1.00 39.63  ? 143 VAL A O     1 
ATOM   1450 C CB    . VAL B 2 142 ? 42.050 13.790  -10.616 1.00 38.57  ? 143 VAL A CB    1 
ATOM   1451 C CG1   . VAL B 2 142 ? 41.319 13.646  -9.261  1.00 38.48  ? 143 VAL A CG1   1 
ATOM   1452 C CG2   . VAL B 2 142 ? 43.522 13.780  -10.475 1.00 36.88  ? 143 VAL A CG2   1 
ATOM   1453 N N     . VAL B 2 143 ? 43.494 11.859  -12.938 1.00 30.45  ? 144 VAL A N     1 
ATOM   1454 C CA    . VAL B 2 143 ? 44.607 10.968  -13.238 1.00 28.75  ? 144 VAL A CA    1 
ATOM   1455 C C     . VAL B 2 143 ? 45.789 11.614  -12.532 1.00 32.64  ? 144 VAL A C     1 
ATOM   1456 O O     . VAL B 2 143 ? 45.975 12.827  -12.616 1.00 29.63  ? 144 VAL A O     1 
ATOM   1457 C CB    . VAL B 2 143 ? 44.996 10.967  -14.702 1.00 29.84  ? 144 VAL A CB    1 
ATOM   1458 C CG1   . VAL B 2 143 ? 46.344 10.241  -14.878 1.00 28.23  ? 144 VAL A CG1   1 
ATOM   1459 C CG2   . VAL B 2 143 ? 43.893 10.386  -15.540 1.00 27.87  ? 144 VAL A CG2   1 
ATOM   1460 N N     . MET B 2 144 ? 46.586 10.816  -11.835 1.00 32.09  ? 145 MET A N     1 
ATOM   1461 C CA    . MET B 2 144 ? 47.720 11.382  -11.130 1.00 31.94  ? 145 MET A CA    1 
ATOM   1462 C C     . MET B 2 144 ? 49.034 11.135  -11.810 1.00 39.51  ? 145 MET A C     1 
ATOM   1463 O O     . MET B 2 144 ? 50.048 11.577  -11.315 1.00 38.12  ? 145 MET A O     1 
ATOM   1464 C CB    . MET B 2 144 ? 47.817 10.775  -9.756  1.00 33.58  ? 145 MET A CB    1 
ATOM   1465 C CG    . MET B 2 144 ? 46.514 10.577  -9.133  1.00 41.14  ? 145 MET A CG    1 
ATOM   1466 S SD    . MET B 2 144 ? 46.784 9.618   -7.680  1.00 51.56  ? 145 MET A SD    1 
ATOM   1467 C CE    . MET B 2 144 ? 47.909 10.752  -6.743  1.00 46.91  ? 145 MET A CE    1 
ATOM   1468 N N     . ASP B 2 145 ? 49.043 10.428  -12.934 1.00 39.58  ? 146 ASP A N     1 
ATOM   1469 C CA    . ASP B 2 145 ? 50.321 10.133  -13.572 1.00 35.63  ? 146 ASP A CA    1 
ATOM   1470 C C     . ASP B 2 145 ? 50.715 10.536  -14.997 1.00 43.52  ? 146 ASP A C     1 
ATOM   1471 O O     . ASP B 2 145 ? 51.645 9.950   -15.587 1.00 42.30  ? 146 ASP A O     1 
ATOM   1472 C CB    . ASP B 2 145 ? 50.720 8.701   -13.255 1.00 35.78  ? 146 ASP A CB    1 
ATOM   1473 C CG    . ASP B 2 145 ? 49.665 7.663   -13.673 1.00 44.41  ? 146 ASP A CG    1 
ATOM   1474 O OD1   . ASP B 2 145 ? 48.808 7.954   -14.563 1.00 45.84  ? 146 ASP A OD1   1 
ATOM   1475 O OD2   . ASP B 2 145 ? 49.772 6.520   -13.136 1.00 48.83  ? 146 ASP A OD2   1 
ATOM   1476 N N     . TRP B 2 146 ? 50.032 11.540  -15.554 1.00 44.55  ? 147 TRP A N     1 
ATOM   1477 C CA    . TRP B 2 146 ? 50.337 11.995  -16.893 1.00 41.55  ? 147 TRP A CA    1 
ATOM   1478 C C     . TRP B 2 146 ? 51.353 13.122  -16.849 1.00 48.11  ? 147 TRP A C     1 
ATOM   1479 O O     . TRP B 2 146 ? 51.586 13.780  -15.817 1.00 48.63  ? 147 TRP A O     1 
ATOM   1480 C CB    . TRP B 2 146 ? 49.087 12.508  -17.561 1.00 41.70  ? 147 TRP A CB    1 
ATOM   1481 C CG    . TRP B 2 146 ? 48.139 11.475  -17.993 1.00 44.67  ? 147 TRP A CG    1 
ATOM   1482 C CD1   . TRP B 2 146 ? 48.359 10.124  -18.084 1.00 47.73  ? 147 TRP A CD1   1 
ATOM   1483 C CD2   . TRP B 2 146 ? 46.781 11.693  -18.370 1.00 45.71  ? 147 TRP A CD2   1 
ATOM   1484 N NE1   . TRP B 2 146 ? 47.210 9.484   -18.488 1.00 48.86  ? 147 TRP A NE1   1 
ATOM   1485 C CE2   . TRP B 2 146 ? 46.226 10.423  -18.685 1.00 51.32  ? 147 TRP A CE2   1 
ATOM   1486 C CE3   . TRP B 2 146 ? 45.982 12.829  -18.472 1.00 47.44  ? 147 TRP A CE3   1 
ATOM   1487 C CZ2   . TRP B 2 146 ? 44.907 10.265  -19.108 1.00 50.82  ? 147 TRP A CZ2   1 
ATOM   1488 C CZ3   . TRP B 2 146 ? 44.680 12.674  -18.887 1.00 52.20  ? 147 TRP A CZ3   1 
ATOM   1489 C CH2   . TRP B 2 146 ? 44.148 11.393  -19.210 1.00 53.18  ? 147 TRP A CH2   1 
ATOM   1490 N N     . GLY B 2 147 ? 51.968 13.365  -17.984 1.00 48.35  ? 148 GLY A N     1 
ATOM   1491 C CA    . GLY B 2 147 ? 52.921 14.436  -17.978 1.00 52.73  ? 148 GLY A CA    1 
ATOM   1492 C C     . GLY B 2 147 ? 52.225 15.721  -18.409 1.00 60.82  ? 148 GLY A C     1 
ATOM   1493 O O     . GLY B 2 147 ? 52.590 16.816  -17.942 1.00 64.79  ? 148 GLY A O     1 
ATOM   1494 N N     . GLU B 2 148 ? 51.240 15.562  -19.300 1.00 49.98  ? 149 GLU A N     1 
ATOM   1495 C CA    . GLU B 2 148 ? 50.445 16.649  -19.840 1.00 45.72  ? 149 GLU A CA    1 
ATOM   1496 C C     . GLU B 2 148 ? 49.067 16.081  -19.862 1.00 47.40  ? 149 GLU A C     1 
ATOM   1497 O O     . GLU B 2 148 ? 48.924 14.877  -19.792 1.00 45.81  ? 149 GLU A O     1 
ATOM   1498 C CB    . GLU B 2 148 ? 50.896 16.909  -21.269 1.00 47.82  ? 149 GLU A CB    1 
ATOM   1499 C CG    . GLU B 2 148 ? 50.232 16.056  -22.327 1.00 67.58  ? 149 GLU A CG    1 
ATOM   1500 C CD    . GLU B 2 148 ? 51.054 14.832  -22.689 1.00 100.00 ? 149 GLU A CD    1 
ATOM   1501 O OE1   . GLU B 2 148 ? 52.037 14.529  -21.958 1.00 100.00 ? 149 GLU A OE1   1 
ATOM   1502 O OE2   . GLU B 2 148 ? 50.699 14.170  -23.695 1.00 99.76  ? 149 GLU A OE2   1 
ATOM   1503 N N     . ALA B 2 149 ? 48.031 16.892  -19.980 1.00 49.49  ? 150 ALA A N     1 
ATOM   1504 C CA    . ALA B 2 149 ? 46.699 16.269  -20.002 1.00 51.15  ? 150 ALA A CA    1 
ATOM   1505 C C     . ALA B 2 149 ? 46.203 15.599  -21.272 1.00 53.00  ? 150 ALA A C     1 
ATOM   1506 O O     . ALA B 2 149 ? 45.942 16.257  -22.258 1.00 51.73  ? 150 ALA A O     1 
ATOM   1507 C CB    . ALA B 2 149 ? 45.702 17.159  -19.510 1.00 52.80  ? 150 ALA A CB    1 
ATOM   1508 N N     . LYS B 2 150 ? 46.054 14.282  -21.206 1.00 50.26  ? 151 LYS A N     1 
ATOM   1509 C CA    . LYS B 2 150 ? 45.590 13.468  -22.315 1.00 48.52  ? 151 LYS A CA    1 
ATOM   1510 C C     . LYS B 2 150 ? 44.088 13.367  -22.615 1.00 60.87  ? 151 LYS A C     1 
ATOM   1511 O O     . LYS B 2 150 ? 43.708 12.683  -23.573 1.00 62.86  ? 151 LYS A O     1 
ATOM   1512 C CB    . LYS B 2 150 ? 46.117 12.068  -22.123 1.00 44.25  ? 151 LYS A CB    1 
ATOM   1513 C CG    . LYS B 2 150 ? 47.470 11.960  -22.663 1.00 64.74  ? 151 LYS A CG    1 
ATOM   1514 C CD    . LYS B 2 150 ? 48.438 12.421  -21.634 1.00 89.14  ? 151 LYS A CD    1 
ATOM   1515 C CE    . LYS B 2 150 ? 49.367 11.282  -21.389 1.00 90.34  ? 151 LYS A CE    1 
ATOM   1516 N NZ    . LYS B 2 150 ? 48.934 10.241  -22.362 1.00 54.86  ? 151 LYS A NZ    1 
ATOM   1517 N N     . ALA B 2 151 ? 43.235 14.010  -21.815 1.00 58.28  ? 152 ALA A N     1 
ATOM   1518 C CA    . ALA B 2 151 ? 41.795 13.927  -22.044 1.00 56.71  ? 152 ALA A CA    1 
ATOM   1519 C C     . ALA B 2 151 ? 41.065 15.013  -21.353 1.00 61.52  ? 152 ALA A C     1 
ATOM   1520 O O     . ALA B 2 151 ? 41.454 15.476  -20.280 1.00 63.15  ? 152 ALA A O     1 
ATOM   1521 C CB    . ALA B 2 151 ? 41.276 12.648  -21.556 1.00 57.12  ? 152 ALA A CB    1 
ATOM   1522 N N     . ASP B 2 152 ? 39.977 15.395  -21.981 1.00 59.65  ? 153 ASP A N     1 
ATOM   1523 C CA    . ASP B 2 152 ? 39.137 16.464  -21.476 1.00 63.88  ? 153 ASP A CA    1 
ATOM   1524 C C     . ASP B 2 152 ? 38.148 16.006  -20.407 1.00 63.98  ? 153 ASP A C     1 
ATOM   1525 O O     . ASP B 2 152 ? 37.435 16.817  -19.788 1.00 64.97  ? 153 ASP A O     1 
ATOM   1526 C CB    . ASP B 2 152 ? 38.329 17.020  -22.656 1.00 68.44  ? 153 ASP A CB    1 
ATOM   1527 C CG    . ASP B 2 152 ? 37.672 15.903  -23.477 1.00 99.46  ? 153 ASP A CG    1 
ATOM   1528 O OD1   . ASP B 2 152 ? 38.428 15.095  -24.085 1.00 100.00 ? 153 ASP A OD1   1 
ATOM   1529 O OD2   . ASP B 2 152 ? 36.412 15.802  -23.467 1.00 100.00 ? 153 ASP A OD2   1 
ATOM   1530 N N     . PHE B 2 153 ? 38.063 14.716  -20.176 1.00 51.40  ? 154 PHE A N     1 
ATOM   1531 C CA    . PHE B 2 153 ? 37.082 14.335  -19.198 1.00 50.45  ? 154 PHE A CA    1 
ATOM   1532 C C     . PHE B 2 153 ? 37.608 14.039  -17.819 1.00 58.97  ? 154 PHE A C     1 
ATOM   1533 O O     . PHE B 2 153 ? 36.934 13.360  -17.041 1.00 64.51  ? 154 PHE A O     1 
ATOM   1534 C CB    . PHE B 2 153 ? 36.320 13.152  -19.737 1.00 51.50  ? 154 PHE A CB    1 
ATOM   1535 C CG    . PHE B 2 153 ? 37.211 12.039  -20.106 1.00 54.52  ? 154 PHE A CG    1 
ATOM   1536 C CD1   . PHE B 2 153 ? 37.974 12.111  -21.234 1.00 58.78  ? 154 PHE A CD1   1 
ATOM   1537 C CD2   . PHE B 2 153 ? 37.342 10.948  -19.284 1.00 58.26  ? 154 PHE A CD2   1 
ATOM   1538 C CE1   . PHE B 2 153 ? 38.808 11.075  -21.553 1.00 60.20  ? 154 PHE A CE1   1 
ATOM   1539 C CE2   . PHE B 2 153 ? 38.179 9.927   -19.611 1.00 59.72  ? 154 PHE A CE2   1 
ATOM   1540 C CZ    . PHE B 2 153 ? 38.908 9.989   -20.739 1.00 56.54  ? 154 PHE A CZ    1 
ATOM   1541 N N     . THR B 2 154 ? 38.798 14.543  -17.503 1.00 49.65  ? 155 THR A N     1 
ATOM   1542 C CA    . THR B 2 154 ? 39.380 14.301  -16.186 1.00 44.95  ? 155 THR A CA    1 
ATOM   1543 C C     . THR B 2 154 ? 40.252 15.383  -15.696 1.00 49.64  ? 155 THR A C     1 
ATOM   1544 O O     . THR B 2 154 ? 40.797 16.183  -16.481 1.00 56.06  ? 155 THR A O     1 
ATOM   1545 C CB    . THR B 2 154 ? 40.536 13.297  -16.252 1.00 38.25  ? 155 THR A CB    1 
ATOM   1546 O OG1   . THR B 2 154 ? 40.507 12.517  -17.457 1.00 47.67  ? 155 THR A OG1   1 
ATOM   1547 C CG2   . THR B 2 154 ? 40.573 12.484  -15.002 1.00 27.83  ? 155 THR A CG2   1 
ATOM   1548 N N     . ASP B 2 155 ? 40.479 15.356  -14.395 1.00 37.88  ? 156 ASP A N     1 
ATOM   1549 C CA    . ASP B 2 155 ? 41.395 16.322  -13.847 1.00 33.70  ? 156 ASP A CA    1 
ATOM   1550 C C     . ASP B 2 155 ? 42.805 15.670  -13.980 1.00 41.38  ? 156 ASP A C     1 
ATOM   1551 O O     . ASP B 2 155 ? 42.947 14.460  -14.239 1.00 33.50  ? 156 ASP A O     1 
ATOM   1552 C CB    . ASP B 2 155 ? 41.046 16.661  -12.441 1.00 31.07  ? 156 ASP A CB    1 
ATOM   1553 C CG    . ASP B 2 155 ? 39.972 17.654  -12.375 1.00 47.52  ? 156 ASP A CG    1 
ATOM   1554 O OD1   . ASP B 2 155 ? 39.502 18.093  -13.449 1.00 44.75  ? 156 ASP A OD1   1 
ATOM   1555 O OD2   . ASP B 2 155 ? 39.606 18.013  -11.243 1.00 68.17  ? 156 ASP A OD2   1 
ATOM   1556 N N     . ALA B 2 156 ? 43.847 16.485  -13.842 1.00 40.51  ? 157 ALA A N     1 
ATOM   1557 C CA    . ALA B 2 156 ? 45.208 15.975  -13.960 1.00 32.91  ? 157 ALA A CA    1 
ATOM   1558 C C     . ALA B 2 156 ? 46.129 16.711  -13.043 1.00 37.22  ? 157 ALA A C     1 
ATOM   1559 O O     . ALA B 2 156 ? 45.959 17.880  -12.742 1.00 35.90  ? 157 ALA A O     1 
ATOM   1560 C CB    . ALA B 2 156 ? 45.698 16.137  -15.336 1.00 29.54  ? 157 ALA A CB    1 
ATOM   1561 N N     . VAL B 2 157 ? 47.136 16.018  -12.580 1.00 36.57  ? 158 VAL A N     1 
ATOM   1562 C CA    . VAL B 2 157 ? 48.084 16.700  -11.753 1.00 36.90  ? 158 VAL A CA    1 
ATOM   1563 C C     . VAL B 2 157 ? 49.296 16.350  -12.614 1.00 43.61  ? 158 VAL A C     1 
ATOM   1564 O O     . VAL B 2 157 ? 49.407 15.194  -13.101 1.00 48.68  ? 158 VAL A O     1 
ATOM   1565 C CB    . VAL B 2 157 ? 48.145 16.143  -10.389 1.00 37.07  ? 158 VAL A CB    1 
ATOM   1566 C CG1   . VAL B 2 157 ? 47.572 14.810  -10.404 1.00 35.71  ? 158 VAL A CG1   1 
ATOM   1567 C CG2   . VAL B 2 157 ? 49.551 16.128  -9.931  1.00 37.15  ? 158 VAL A CG2   1 
ATOM   1568 N N     . ILE B 2 158 ? 50.152 17.344  -12.865 1.00 32.93  ? 159 ILE A N     1 
ATOM   1569 C CA    . ILE B 2 158 ? 51.344 17.147  -13.694 1.00 31.27  ? 159 ILE A CA    1 
ATOM   1570 C C     . ILE B 2 158 ? 52.559 17.436  -12.853 1.00 38.25  ? 159 ILE A C     1 
ATOM   1571 O O     . ILE B 2 158 ? 52.562 18.362  -12.024 1.00 34.97  ? 159 ILE A O     1 
ATOM   1572 C CB    . ILE B 2 158 ? 51.297 17.903  -14.988 1.00 35.91  ? 159 ILE A CB    1 
ATOM   1573 C CG1   . ILE B 2 158 ? 51.344 19.378  -14.704 1.00 42.60  ? 159 ILE A CG1   1 
ATOM   1574 C CG2   . ILE B 2 158 ? 49.993 17.619  -15.715 1.00 33.65  ? 159 ILE A CG2   1 
ATOM   1575 C CD1   . ILE B 2 158 ? 52.760 19.822  -14.578 1.00 94.59  ? 159 ILE A CD1   1 
ATOM   1576 N N     . ASP B 2 159 ? 53.578 16.594  -13.057 1.00 39.92  ? 160 ASP A N     1 
ATOM   1577 C CA    . ASP B 2 159 ? 54.833 16.616  -12.300 1.00 34.30  ? 160 ASP A CA    1 
ATOM   1578 C C     . ASP B 2 159 ? 56.083 17.241  -12.860 1.00 38.04  ? 160 ASP A C     1 
ATOM   1579 O O     . ASP B 2 159 ? 57.078 17.320  -12.161 1.00 43.28  ? 160 ASP A O     1 
ATOM   1580 C CB    . ASP B 2 159 ? 55.151 15.190  -11.899 1.00 34.34  ? 160 ASP A CB    1 
ATOM   1581 C CG    . ASP B 2 159 ? 55.521 14.323  -13.091 1.00 44.22  ? 160 ASP A CG    1 
ATOM   1582 O OD1   . ASP B 2 159 ? 55.656 14.905  -14.191 1.00 47.14  ? 160 ASP A OD1   1 
ATOM   1583 O OD2   . ASP B 2 159 ? 55.665 13.077  -12.937 1.00 39.45  ? 160 ASP A OD2   1 
ATOM   1584 N N     . ASN B 2 160 ? 56.072 17.651  -14.116 1.00 34.67  ? 161 ASN A N     1 
ATOM   1585 C CA    . ASN B 2 160 ? 57.268 18.268  -14.675 1.00 38.91  ? 161 ASN A CA    1 
ATOM   1586 C C     . ASN B 2 160 ? 58.467 17.324  -14.697 1.00 46.06  ? 161 ASN A C     1 
ATOM   1587 O O     . ASN B 2 160 ? 59.583 17.650  -14.322 1.00 47.16  ? 161 ASN A O     1 
ATOM   1588 C CB    . ASN B 2 160 ? 57.586 19.566  -13.931 1.00 38.44  ? 161 ASN A CB    1 
ATOM   1589 C CG    . ASN B 2 160 ? 56.517 20.599  -14.138 1.00 50.70  ? 161 ASN A CG    1 
ATOM   1590 O OD1   . ASN B 2 160 ? 56.466 21.236  -15.195 1.00 41.54  ? 161 ASN A OD1   1 
ATOM   1591 N ND2   . ASN B 2 160 ? 55.580 20.690  -13.187 1.00 34.97  ? 161 ASN A ND2   1 
ATOM   1592 N N     . ALA B 2 161 ? 58.200 16.137  -15.175 1.00 42.26  ? 162 ALA A N     1 
ATOM   1593 C CA    . ALA B 2 161 ? 59.188 15.117  -15.280 1.00 44.37  ? 162 ALA A CA    1 
ATOM   1594 C C     . ALA B 2 161 ? 60.294 15.527  -16.225 1.00 48.32  ? 162 ALA A C     1 
ATOM   1595 O O     . ALA B 2 161 ? 61.411 15.030  -16.190 1.00 55.70  ? 162 ALA A O     1 
ATOM   1596 C CB    . ALA B 2 161 ? 58.511 13.873  -15.798 1.00 46.78  ? 162 ALA A CB    1 
ATOM   1597 N N     . PHE B 2 162 ? 59.984 16.432  -17.109 1.00 40.09  ? 163 PHE A N     1 
ATOM   1598 C CA    . PHE B 2 162 ? 60.986 16.860  -18.059 1.00 34.23  ? 163 PHE A CA    1 
ATOM   1599 C C     . PHE B 2 162 ? 61.887 17.864  -17.393 1.00 34.21  ? 163 PHE A C     1 
ATOM   1600 O O     . PHE B 2 162 ? 63.068 17.855  -17.641 1.00 36.53  ? 163 PHE A O     1 
ATOM   1601 C CB    . PHE B 2 162 ? 60.251 17.490  -19.202 1.00 34.69  ? 163 PHE A CB    1 
ATOM   1602 C CG    . PHE B 2 162 ? 61.114 18.123  -20.206 1.00 35.01  ? 163 PHE A CG    1 
ATOM   1603 C CD1   . PHE B 2 162 ? 61.529 19.429  -20.046 1.00 37.08  ? 163 PHE A CD1   1 
ATOM   1604 C CD2   . PHE B 2 162 ? 61.486 17.438  -21.337 1.00 37.15  ? 163 PHE A CD2   1 
ATOM   1605 C CE1   . PHE B 2 162 ? 62.321 20.037  -21.005 1.00 35.04  ? 163 PHE A CE1   1 
ATOM   1606 C CE2   . PHE B 2 162 ? 62.276 18.039  -22.282 1.00 39.06  ? 163 PHE A CE2   1 
ATOM   1607 C CZ    . PHE B 2 162 ? 62.696 19.342  -22.117 1.00 33.21  ? 163 PHE A CZ    1 
ATOM   1608 N N     . GLU B 2 163 ? 61.355 18.728  -16.537 1.00 28.66  ? 164 GLU A N     1 
ATOM   1609 C CA    . GLU B 2 163 ? 62.234 19.675  -15.900 1.00 35.13  ? 164 GLU A CA    1 
ATOM   1610 C C     . GLU B 2 163 ? 63.123 19.010  -14.833 1.00 43.71  ? 164 GLU A C     1 
ATOM   1611 O O     . GLU B 2 163 ? 64.187 19.514  -14.446 1.00 45.85  ? 164 GLU A O     1 
ATOM   1612 C CB    . GLU B 2 163 ? 61.479 20.893  -15.356 1.00 40.62  ? 164 GLU A CB    1 
ATOM   1613 C CG    . GLU B 2 163 ? 61.029 20.753  -13.891 1.00 86.25  ? 164 GLU A CG    1 
ATOM   1614 C CD    . GLU B 2 163 ? 60.883 22.086  -13.140 1.00 100.00 ? 164 GLU A CD    1 
ATOM   1615 O OE1   . GLU B 2 163 ? 61.916 22.606  -12.658 1.00 100.00 ? 164 GLU A OE1   1 
ATOM   1616 O OE2   . GLU B 2 163 ? 59.733 22.569  -12.981 1.00 82.87  ? 164 GLU A OE2   1 
ATOM   1617 N N     . GLY B 2 164 ? 62.700 17.859  -14.357 1.00 41.89  ? 165 GLY A N     1 
ATOM   1618 C CA    . GLY B 2 164 ? 63.494 17.161  -13.358 1.00 40.73  ? 165 GLY A CA    1 
ATOM   1619 C C     . GLY B 2 164 ? 64.604 16.443  -14.101 1.00 37.87  ? 165 GLY A C     1 
ATOM   1620 O O     . GLY B 2 164 ? 65.721 16.330  -13.624 1.00 40.21  ? 165 GLY A O     1 
ATOM   1621 N N     . GLY B 2 165 ? 64.274 15.952  -15.281 1.00 32.68  ? 166 GLY A N     1 
ATOM   1622 C CA    . GLY B 2 165 ? 65.237 15.240  -16.112 1.00 34.03  ? 166 GLY A CA    1 
ATOM   1623 C C     . GLY B 2 165 ? 66.360 16.196  -16.495 1.00 38.10  ? 166 GLY A C     1 
ATOM   1624 O O     . GLY B 2 165 ? 67.535 15.843  -16.410 1.00 36.98  ? 166 GLY A O     1 
ATOM   1625 N N     . TYR B 2 166 ? 65.971 17.406  -16.897 1.00 30.44  ? 167 TYR A N     1 
ATOM   1626 C CA    . TYR B 2 166 ? 66.900 18.449  -17.280 1.00 26.88  ? 167 TYR A CA    1 
ATOM   1627 C C     . TYR B 2 166 ? 67.705 18.767  -16.050 1.00 28.94  ? 167 TYR A C     1 
ATOM   1628 O O     . TYR B 2 166 ? 68.909 18.922  -16.136 1.00 32.53  ? 167 TYR A O     1 
ATOM   1629 C CB    . TYR B 2 166 ? 66.134 19.698  -17.722 1.00 26.27  ? 167 TYR A CB    1 
ATOM   1630 C CG    . TYR B 2 166 ? 66.959 20.841  -18.344 1.00 27.16  ? 167 TYR A CG    1 
ATOM   1631 C CD1   . TYR B 2 166 ? 67.284 20.872  -19.721 1.00 30.28  ? 167 TYR A CD1   1 
ATOM   1632 C CD2   . TYR B 2 166 ? 67.362 21.926  -17.568 1.00 23.97  ? 167 TYR A CD2   1 
ATOM   1633 C CE1   . TYR B 2 166 ? 68.007 21.959  -20.302 1.00 29.64  ? 167 TYR A CE1   1 
ATOM   1634 C CE2   . TYR B 2 166 ? 68.073 22.990  -18.122 1.00 22.60  ? 167 TYR A CE2   1 
ATOM   1635 C CZ    . TYR B 2 166 ? 68.400 23.014  -19.465 1.00 35.68  ? 167 TYR A CZ    1 
ATOM   1636 O OH    . TYR B 2 166 ? 69.118 24.113  -19.880 1.00 39.31  ? 167 TYR A OH    1 
ATOM   1637 N N     . MET B 2 167 ? 67.071 18.866  -14.892 1.00 24.50  ? 168 MET A N     1 
ATOM   1638 C CA    . MET B 2 167 ? 67.858 19.183  -13.708 1.00 25.39  ? 168 MET A CA    1 
ATOM   1639 C C     . MET B 2 167 ? 68.973 18.195  -13.462 1.00 29.99  ? 168 MET A C     1 
ATOM   1640 O O     . MET B 2 167 ? 70.073 18.553  -13.058 1.00 30.68  ? 168 MET A O     1 
ATOM   1641 C CB    . MET B 2 167 ? 66.999 19.271  -12.474 1.00 29.45  ? 168 MET A CB    1 
ATOM   1642 C CG    . MET B 2 167 ? 66.038 20.452  -12.523 1.00 40.43  ? 168 MET A CG    1 
ATOM   1643 S SD    . MET B 2 167 ? 64.931 20.583  -11.047 1.00 49.68  ? 168 MET A SD    1 
ATOM   1644 C CE    . MET B 2 167 ? 66.030 20.235  -9.801  1.00 46.21  ? 168 MET A CE    1 
ATOM   1645 N N     . ALA B 2 168 ? 68.691 16.939  -13.717 1.00 26.19  ? 169 ALA A N     1 
ATOM   1646 C CA    . ALA B 2 168 ? 69.673 15.922  -13.481 1.00 27.91  ? 169 ALA A CA    1 
ATOM   1647 C C     . ALA B 2 168 ? 70.903 16.074  -14.367 1.00 34.54  ? 169 ALA A C     1 
ATOM   1648 O O     . ALA B 2 168 ? 72.046 16.124  -13.898 1.00 34.18  ? 169 ALA A O     1 
ATOM   1649 C CB    . ALA B 2 168 ? 69.028 14.550  -13.626 1.00 30.02  ? 169 ALA A CB    1 
ATOM   1650 N N     . GLY B 2 169 ? 70.677 16.148  -15.664 1.00 32.91  ? 170 GLY A N     1 
ATOM   1651 C CA    . GLY B 2 169 ? 71.799 16.304  -16.571 1.00 32.91  ? 170 GLY A CA    1 
ATOM   1652 C C     . GLY B 2 169 ? 72.643 17.538  -16.218 1.00 35.74  ? 170 GLY A C     1 
ATOM   1653 O O     . GLY B 2 169 ? 73.894 17.502  -16.187 1.00 38.50  ? 170 GLY A O     1 
ATOM   1654 N N     . ARG B 2 170 ? 71.962 18.642  -15.945 1.00 23.86  ? 171 ARG A N     1 
ATOM   1655 C CA    . ARG B 2 170 ? 72.688 19.849  -15.626 1.00 23.01  ? 171 ARG A CA    1 
ATOM   1656 C C     . ARG B 2 170 ? 73.708 19.653  -14.546 1.00 29.04  ? 171 ARG A C     1 
ATOM   1657 O O     . ARG B 2 170 ? 74.895 19.899  -14.733 1.00 29.52  ? 171 ARG A O     1 
ATOM   1658 C CB    . ARG B 2 170 ? 71.730 20.960  -15.284 1.00 22.66  ? 171 ARG A CB    1 
ATOM   1659 C CG    . ARG B 2 170 ? 70.988 21.493  -16.493 1.00 43.84  ? 171 ARG A CG    1 
ATOM   1660 C CD    . ARG B 2 170 ? 71.660 22.632  -17.336 1.00 39.18  ? 171 ARG A CD    1 
ATOM   1661 N NE    . ARG B 2 170 ? 72.962 23.096  -16.891 1.00 33.97  ? 171 ARG A NE    1 
ATOM   1662 C CZ    . ARG B 2 170 ? 73.950 23.301  -17.748 1.00 53.72  ? 171 ARG A CZ    1 
ATOM   1663 N NH1   . ARG B 2 170 ? 73.724 23.076  -19.060 1.00 33.49  ? 171 ARG A NH1   1 
ATOM   1664 N NH2   . ARG B 2 170 ? 75.132 23.716  -17.300 1.00 11.72  ? 171 ARG A NH2   1 
ATOM   1665 N N     . TYR B 2 171 ? 73.215 19.157  -13.429 1.00 28.52  ? 172 TYR A N     1 
ATOM   1666 C CA    . TYR B 2 171 ? 74.032 18.875  -12.266 1.00 28.00  ? 172 TYR A CA    1 
ATOM   1667 C C     . TYR B 2 171 ? 75.230 18.101  -12.722 1.00 28.03  ? 172 TYR A C     1 
ATOM   1668 O O     . TYR B 2 171 ? 76.371 18.463  -12.437 1.00 26.25  ? 172 TYR A O     1 
ATOM   1669 C CB    . TYR B 2 171 ? 73.245 18.034  -11.274 1.00 25.35  ? 172 TYR A CB    1 
ATOM   1670 C CG    . TYR B 2 171 ? 73.926 17.930  -9.969  1.00 24.01  ? 172 TYR A CG    1 
ATOM   1671 C CD1   . TYR B 2 171 ? 73.975 18.994  -9.109  1.00 28.30  ? 172 TYR A CD1   1 
ATOM   1672 C CD2   . TYR B 2 171 ? 74.529 16.763  -9.585  1.00 26.49  ? 172 TYR A CD2   1 
ATOM   1673 C CE1   . TYR B 2 171 ? 74.646 18.896  -7.865  1.00 36.13  ? 172 TYR A CE1   1 
ATOM   1674 C CE2   . TYR B 2 171 ? 75.183 16.649  -8.358  1.00 28.50  ? 172 TYR A CE2   1 
ATOM   1675 C CZ    . TYR B 2 171 ? 75.242 17.716  -7.506  1.00 35.24  ? 172 TYR A CZ    1 
ATOM   1676 O OH    . TYR B 2 171 ? 75.884 17.572  -6.306  1.00 38.74  ? 172 TYR A OH    1 
ATOM   1677 N N     . LEU B 2 172 ? 74.962 17.045  -13.462 1.00 21.66  ? 173 LEU A N     1 
ATOM   1678 C CA    . LEU B 2 172 ? 76.068 16.259  -13.940 1.00 27.33  ? 173 LEU A CA    1 
ATOM   1679 C C     . LEU B 2 172 ? 77.004 17.149  -14.718 1.00 29.38  ? 173 LEU A C     1 
ATOM   1680 O O     . LEU B 2 172 ? 78.172 17.221  -14.413 1.00 30.47  ? 173 LEU A O     1 
ATOM   1681 C CB    . LEU B 2 172 ? 75.546 15.147  -14.827 1.00 30.27  ? 173 LEU A CB    1 
ATOM   1682 C CG    . LEU B 2 172 ? 74.730 14.194  -13.972 1.00 35.26  ? 173 LEU A CG    1 
ATOM   1683 C CD1   . LEU B 2 172 ? 74.200 13.099  -14.857 1.00 38.96  ? 173 LEU A CD1   1 
ATOM   1684 C CD2   . LEU B 2 172 ? 75.653 13.683  -12.898 1.00 21.82  ? 173 LEU A CD2   1 
ATOM   1685 N N     . ILE B 2 173 ? 76.468 17.852  -15.699 1.00 23.80  ? 174 ILE A N     1 
ATOM   1686 C CA    . ILE B 2 173 ? 77.278 18.735  -16.492 1.00 22.63  ? 174 ILE A CA    1 
ATOM   1687 C C     . ILE B 2 173 ? 78.082 19.711  -15.666 1.00 30.06  ? 174 ILE A C     1 
ATOM   1688 O O     . ILE B 2 173 ? 79.299 19.848  -15.822 1.00 38.09  ? 174 ILE A O     1 
ATOM   1689 C CB    . ILE B 2 173 ? 76.445 19.521  -17.452 1.00 22.44  ? 174 ILE A CB    1 
ATOM   1690 C CG1   . ILE B 2 173 ? 76.343 18.707  -18.720 1.00 22.30  ? 174 ILE A CG1   1 
ATOM   1691 C CG2   . ILE B 2 173 ? 77.161 20.834  -17.782 1.00 17.60  ? 174 ILE A CG2   1 
ATOM   1692 C CD1   . ILE B 2 173 ? 75.133 18.962  -19.471 1.00 32.15  ? 174 ILE A CD1   1 
ATOM   1693 N N     . GLU B 2 174 ? 77.397 20.388  -14.781 1.00 22.27  ? 175 GLU A N     1 
ATOM   1694 C CA    . GLU B 2 174 ? 78.057 21.344  -13.929 1.00 25.89  ? 175 GLU A CA    1 
ATOM   1695 C C     . GLU B 2 174 ? 79.056 20.737  -12.949 1.00 38.45  ? 175 GLU A C     1 
ATOM   1696 O O     . GLU B 2 174 ? 79.867 21.466  -12.399 1.00 42.51  ? 175 GLU A O     1 
ATOM   1697 C CB    . GLU B 2 174 ? 77.001 22.145  -13.167 1.00 28.10  ? 175 GLU A CB    1 
ATOM   1698 C CG    . GLU B 2 174 ? 75.847 22.502  -14.093 1.00 50.90  ? 175 GLU A CG    1 
ATOM   1699 C CD    . GLU B 2 174 ? 74.999 23.647  -13.617 1.00 78.14  ? 175 GLU A CD    1 
ATOM   1700 O OE1   . GLU B 2 174 ? 74.892 23.873  -12.371 1.00 35.33  ? 175 GLU A OE1   1 
ATOM   1701 O OE2   . GLU B 2 174 ? 74.410 24.279  -14.535 1.00 74.10  ? 175 GLU A OE2   1 
ATOM   1702 N N     . ARG B 2 175 ? 79.026 19.425  -12.707 1.00 34.38  ? 176 ARG A N     1 
ATOM   1703 C CA    . ARG B 2 175 ? 79.982 18.855  -11.762 1.00 31.47  ? 176 ARG A CA    1 
ATOM   1704 C C     . ARG B 2 175 ? 81.267 18.359  -12.396 1.00 36.73  ? 176 ARG A C     1 
ATOM   1705 O O     . ARG B 2 175 ? 82.186 17.932  -11.684 1.00 40.85  ? 176 ARG A O     1 
ATOM   1706 C CB    . ARG B 2 175 ? 79.367 17.794  -10.864 1.00 35.02  ? 176 ARG A CB    1 
ATOM   1707 C CG    . ARG B 2 175 ? 78.607 18.331  -9.676  1.00 21.46  ? 176 ARG A CG    1 
ATOM   1708 C CD    . ARG B 2 175 ? 79.516 18.525  -8.504  1.00 29.03  ? 176 ARG A CD    1 
ATOM   1709 N NE    . ARG B 2 175 ? 79.177 17.589  -7.446  1.00 29.60  ? 176 ARG A NE    1 
ATOM   1710 C CZ    . ARG B 2 175 ? 80.075 16.952  -6.723  1.00 60.34  ? 176 ARG A CZ    1 
ATOM   1711 N NH1   . ARG B 2 175 ? 81.361 17.170  -6.941  1.00 83.48  ? 176 ARG A NH1   1 
ATOM   1712 N NH2   . ARG B 2 175 ? 79.691 16.105  -5.786  1.00 92.27  ? 176 ARG A NH2   1 
ATOM   1713 N N     . GLY B 2 176 ? 81.348 18.415  -13.723 1.00 28.93  ? 177 GLY A N     1 
ATOM   1714 C CA    . GLY B 2 176 ? 82.573 18.005  -14.379 1.00 28.72  ? 177 GLY A CA    1 
ATOM   1715 C C     . GLY B 2 176 ? 82.411 16.917  -15.384 1.00 33.11  ? 177 GLY A C     1 
ATOM   1716 O O     . GLY B 2 176 ? 83.377 16.493  -15.989 1.00 36.25  ? 177 GLY A O     1 
ATOM   1717 N N     . HIS B 2 177 ? 81.189 16.464  -15.575 1.00 29.49  ? 178 HIS A N     1 
ATOM   1718 C CA    . HIS B 2 177 ? 80.922 15.357  -16.500 1.00 28.46  ? 178 HIS A CA    1 
ATOM   1719 C C     . HIS B 2 177 ? 80.545 15.569  -18.004 1.00 36.65  ? 178 HIS A C     1 
ATOM   1720 O O     . HIS B 2 177 ? 79.842 16.522  -18.365 1.00 43.79  ? 178 HIS A O     1 
ATOM   1721 C CB    . HIS B 2 177 ? 79.939 14.359  -15.799 1.00 25.22  ? 178 HIS A CB    1 
ATOM   1722 C CG    . HIS B 2 177 ? 80.360 13.919  -14.417 1.00 27.36  ? 178 HIS A CG    1 
ATOM   1723 N ND1   . HIS B 2 177 ? 81.162 12.816  -14.198 1.00 28.83  ? 178 HIS A ND1   1 
ATOM   1724 C CD2   . HIS B 2 177 ? 80.063 14.410  -13.186 1.00 30.86  ? 178 HIS A CD2   1 
ATOM   1725 C CE1   . HIS B 2 177 ? 81.355 12.655  -12.899 1.00 29.86  ? 178 HIS A CE1   1 
ATOM   1726 N NE2   . HIS B 2 177 ? 80.700 13.610  -12.260 1.00 31.14  ? 178 HIS A NE2   1 
ATOM   1727 N N     . ARG B 2 178 ? 81.007 14.664  -18.868 1.00 25.84  ? 179 ARG A N     1 
ATOM   1728 C CA    . ARG B 2 178 ? 80.709 14.712  -20.313 1.00 25.06  ? 179 ARG A CA    1 
ATOM   1729 C C     . ARG B 2 178 ? 80.453 13.287  -20.815 1.00 40.02  ? 179 ARG A C     1 
ATOM   1730 O O     . ARG B 2 178 ? 79.740 13.080  -21.796 1.00 48.02  ? 179 ARG A O     1 
ATOM   1731 C CB    . ARG B 2 178 ? 81.806 15.387  -21.145 1.00 24.92  ? 179 ARG A CB    1 
ATOM   1732 C CG    . ARG B 2 178 ? 82.040 16.872  -20.843 1.00 33.82  ? 179 ARG A CG    1 
ATOM   1733 C CD    . ARG B 2 178 ? 82.391 17.645  -22.100 1.00 31.05  ? 179 ARG A CD    1 
ATOM   1734 N NE    . ARG B 2 178 ? 81.244 18.262  -22.757 1.00 34.06  ? 179 ARG A NE    1 
ATOM   1735 C CZ    . ARG B 2 178 ? 80.953 18.061  -24.040 1.00 84.84  ? 179 ARG A CZ    1 
ATOM   1736 N NH1   . ARG B 2 178 ? 81.710 17.260  -24.787 1.00 65.46  ? 179 ARG A NH1   1 
ATOM   1737 N NH2   . ARG B 2 178 ? 79.902 18.649  -24.579 1.00 100.00 ? 179 ARG A NH2   1 
ATOM   1738 N N     . GLU B 2 179 ? 81.019 12.291  -20.137 1.00 36.91  ? 180 GLU A N     1 
ATOM   1739 C CA    . GLU B 2 179 ? 80.778 10.910  -20.532 1.00 34.69  ? 180 GLU A CA    1 
ATOM   1740 C C     . GLU B 2 179 ? 79.788 10.399  -19.476 1.00 34.47  ? 180 GLU A C     1 
ATOM   1741 O O     . GLU B 2 179 ? 80.151 10.043  -18.332 1.00 30.13  ? 180 GLU A O     1 
ATOM   1742 C CB    . GLU B 2 179 ? 82.050 10.097  -20.504 1.00 36.60  ? 180 GLU A CB    1 
ATOM   1743 C CG    . GLU B 2 179 ? 82.919 10.189  -21.745 1.00 31.47  ? 180 GLU A CG    1 
ATOM   1744 C CD    . GLU B 2 179 ? 84.358 9.948   -21.362 1.00 76.39  ? 180 GLU A CD    1 
ATOM   1745 O OE1   . GLU B 2 179 ? 84.956 10.854  -20.707 1.00 73.94  ? 180 GLU A OE1   1 
ATOM   1746 O OE2   . GLU B 2 179 ? 84.835 8.814   -21.610 1.00 75.22  ? 180 GLU A OE2   1 
ATOM   1747 N N     . ILE B 2 180 ? 78.527 10.385  -19.885 1.00 32.82  ? 181 ILE A N     1 
ATOM   1748 C CA    . ILE B 2 180 ? 77.435 9.980   -19.008 1.00 33.35  ? 181 ILE A CA    1 
ATOM   1749 C C     . ILE B 2 180 ? 76.521 8.977   -19.645 1.00 31.81  ? 181 ILE A C     1 
ATOM   1750 O O     . ILE B 2 180 ? 76.324 8.958   -20.859 1.00 27.00  ? 181 ILE A O     1 
ATOM   1751 C CB    . ILE B 2 180 ? 76.527 11.216  -18.734 1.00 36.92  ? 181 ILE A CB    1 
ATOM   1752 C CG1   . ILE B 2 180 ? 77.368 12.460  -18.383 1.00 34.47  ? 181 ILE A CG1   1 
ATOM   1753 C CG2   . ILE B 2 180 ? 75.317 10.872  -17.849 1.00 34.25  ? 181 ILE A CG2   1 
ATOM   1754 C CD1   . ILE B 2 180 ? 76.739 13.367  -17.389 1.00 51.61  ? 181 ILE A CD1   1 
ATOM   1755 N N     . GLY B 2 181 ? 75.939 8.160   -18.787 1.00 30.03  ? 182 GLY A N     1 
ATOM   1756 C CA    . GLY B 2 181 ? 75.024 7.130   -19.225 1.00 29.08  ? 182 GLY A CA    1 
ATOM   1757 C C     . GLY B 2 181 ? 73.667 7.309   -18.567 1.00 35.12  ? 182 GLY A C     1 
ATOM   1758 O O     . GLY B 2 181 ? 73.501 8.046   -17.579 1.00 34.59  ? 182 GLY A O     1 
ATOM   1759 N N     . VAL B 2 182 ? 72.697 6.610   -19.132 1.00 34.58  ? 183 VAL A N     1 
ATOM   1760 C CA    . VAL B 2 182 ? 71.354 6.684   -18.639 1.00 33.59  ? 183 VAL A CA    1 
ATOM   1761 C C     . VAL B 2 182 ? 70.625 5.346   -18.734 1.00 37.38  ? 183 VAL A C     1 
ATOM   1762 O O     . VAL B 2 182 ? 70.724 4.575   -19.705 1.00 36.16  ? 183 VAL A O     1 
ATOM   1763 C CB    . VAL B 2 182 ? 70.559 7.805   -19.359 1.00 36.66  ? 183 VAL A CB    1 
ATOM   1764 C CG1   . VAL B 2 182 ? 70.890 7.859   -20.802 1.00 35.65  ? 183 VAL A CG1   1 
ATOM   1765 C CG2   . VAL B 2 182 ? 69.140 7.522   -19.292 1.00 38.01  ? 183 VAL A CG2   1 
ATOM   1766 N N     . ILE B 2 183 ? 69.873 5.098   -17.683 1.00 30.03  ? 184 ILE A N     1 
ATOM   1767 C CA    . ILE B 2 183 ? 69.084 3.915   -17.584 1.00 26.98  ? 184 ILE A CA    1 
ATOM   1768 C C     . ILE B 2 183 ? 67.750 4.495   -17.278 1.00 30.89  ? 184 ILE A C     1 
ATOM   1769 O O     . ILE B 2 183 ? 67.449 4.796   -16.133 1.00 30.26  ? 184 ILE A O     1 
ATOM   1770 C CB    . ILE B 2 183 ? 69.443 3.146   -16.381 1.00 29.04  ? 184 ILE A CB    1 
ATOM   1771 C CG1   . ILE B 2 183 ? 70.946 2.905   -16.393 1.00 29.99  ? 184 ILE A CG1   1 
ATOM   1772 C CG2   . ILE B 2 183 ? 68.598 1.920   -16.345 1.00 27.77  ? 184 ILE A CG2   1 
ATOM   1773 C CD1   . ILE B 2 183 ? 71.446 1.916   -15.385 1.00 22.69  ? 184 ILE A CD1   1 
ATOM   1774 N N     . PRO B 2 184 ? 66.956 4.665   -18.316 1.00 31.73  ? 185 PRO A N     1 
ATOM   1775 C CA    . PRO B 2 184 ? 65.592 5.233   -18.178 1.00 30.69  ? 185 PRO A CA    1 
ATOM   1776 C C     . PRO B 2 184 ? 64.560 4.168   -17.795 1.00 39.35  ? 185 PRO A C     1 
ATOM   1777 O O     . PRO B 2 184 ? 64.817 2.966   -17.892 1.00 37.66  ? 185 PRO A O     1 
ATOM   1778 C CB    . PRO B 2 184 ? 65.285 5.650   -19.603 1.00 30.24  ? 185 PRO A CB    1 
ATOM   1779 C CG    . PRO B 2 184 ? 66.022 4.493   -20.443 1.00 35.08  ? 185 PRO A CG    1 
ATOM   1780 C CD    . PRO B 2 184 ? 67.276 4.178   -19.682 1.00 29.35  ? 185 PRO A CD    1 
ATOM   1781 N N     . GLY B 2 185 ? 63.377 4.605   -17.377 1.00 40.79  ? 186 GLY A N     1 
ATOM   1782 C CA    . GLY B 2 185 ? 62.311 3.659   -17.030 1.00 36.73  ? 186 GLY A CA    1 
ATOM   1783 C C     . GLY B 2 185 ? 61.485 3.542   -18.325 1.00 35.06  ? 186 GLY A C     1 
ATOM   1784 O O     . GLY B 2 185 ? 61.697 4.275   -19.296 1.00 38.56  ? 186 GLY A O     1 
ATOM   1785 N N     . PRO B 2 186 ? 60.542 2.623   -18.356 1.00 27.67  ? 187 PRO A N     1 
ATOM   1786 C CA    . PRO B 2 186 ? 59.684 2.422   -19.545 1.00 27.03  ? 187 PRO A CA    1 
ATOM   1787 C C     . PRO B 2 186 ? 59.197 3.674   -20.266 1.00 33.14  ? 187 PRO A C     1 
ATOM   1788 O O     . PRO B 2 186 ? 58.534 4.546   -19.698 1.00 33.69  ? 187 PRO A O     1 
ATOM   1789 C CB    . PRO B 2 186 ? 58.509 1.621   -19.011 1.00 27.67  ? 187 PRO A CB    1 
ATOM   1790 C CG    . PRO B 2 186 ? 58.865 1.265   -17.598 1.00 30.69  ? 187 PRO A CG    1 
ATOM   1791 C CD    . PRO B 2 186 ? 59.876 2.229   -17.114 1.00 25.98  ? 187 PRO A CD    1 
ATOM   1792 N N     . LEU B 2 187 ? 59.553 3.752   -21.533 1.00 33.02  ? 188 LEU A N     1 
ATOM   1793 C CA    . LEU B 2 187 ? 59.205 4.878   -22.376 1.00 34.07  ? 188 LEU A CA    1 
ATOM   1794 C C     . LEU B 2 187 ? 57.732 5.151   -22.512 1.00 38.02  ? 188 LEU A C     1 
ATOM   1795 O O     . LEU B 2 187 ? 57.307 6.232   -22.942 1.00 36.68  ? 188 LEU A O     1 
ATOM   1796 C CB    . LEU B 2 187 ? 59.799 4.622   -23.734 1.00 34.70  ? 188 LEU A CB    1 
ATOM   1797 C CG    . LEU B 2 187 ? 61.297 4.528   -23.477 1.00 39.41  ? 188 LEU A CG    1 
ATOM   1798 C CD1   . LEU B 2 187 ? 62.034 4.842   -24.717 1.00 38.51  ? 188 LEU A CD1   1 
ATOM   1799 C CD2   . LEU B 2 187 ? 61.729 5.418   -22.310 1.00 36.83  ? 188 LEU A CD2   1 
ATOM   1800 N N     . GLU B 2 188 ? 56.946 4.159   -22.139 1.00 36.16  ? 189 GLU A N     1 
ATOM   1801 C CA    . GLU B 2 188 ? 55.504 4.268   -22.224 1.00 35.01  ? 189 GLU A CA    1 
ATOM   1802 C C     . GLU B 2 188 ? 54.957 4.955   -21.004 1.00 43.54  ? 189 GLU A C     1 
ATOM   1803 O O     . GLU B 2 188 ? 53.759 4.963   -20.737 1.00 46.91  ? 189 GLU A O     1 
ATOM   1804 C CB    . GLU B 2 188 ? 54.937 2.872   -22.383 1.00 37.07  ? 189 GLU A CB    1 
ATOM   1805 C CG    . GLU B 2 188 ? 55.589 2.136   -23.563 1.00 59.36  ? 189 GLU A CG    1 
ATOM   1806 C CD    . GLU B 2 188 ? 56.670 1.196   -23.119 1.00 76.62  ? 189 GLU A CD    1 
ATOM   1807 O OE1   . GLU B 2 188 ? 57.647 1.656   -22.476 1.00 81.96  ? 189 GLU A OE1   1 
ATOM   1808 O OE2   . GLU B 2 188 ? 56.517 -0.009  -23.403 1.00 100.00 ? 189 GLU A OE2   1 
ATOM   1809 N N     . ARG B 2 189 ? 55.861 5.544   -20.254 1.00 43.24  ? 190 ARG A N     1 
ATOM   1810 C CA    . ARG B 2 189 ? 55.478 6.223   -19.055 1.00 41.31  ? 190 ARG A CA    1 
ATOM   1811 C C     . ARG B 2 189 ? 56.041 7.598   -19.050 1.00 43.23  ? 190 ARG A C     1 
ATOM   1812 O O     . ARG B 2 189 ? 57.023 7.885   -19.696 1.00 50.78  ? 190 ARG A O     1 
ATOM   1813 C CB    . ARG B 2 189 ? 56.025 5.474   -17.853 1.00 41.62  ? 190 ARG A CB    1 
ATOM   1814 C CG    . ARG B 2 189 ? 55.041 4.499   -17.307 1.00 40.48  ? 190 ARG A CG    1 
ATOM   1815 C CD    . ARG B 2 189 ? 55.701 3.208   -17.197 1.00 45.49  ? 190 ARG A CD    1 
ATOM   1816 N NE    . ARG B 2 189 ? 55.680 2.724   -15.838 1.00 46.32  ? 190 ARG A NE    1 
ATOM   1817 C CZ    . ARG B 2 189 ? 55.324 1.486   -15.567 1.00 60.93  ? 190 ARG A CZ    1 
ATOM   1818 N NH1   . ARG B 2 189 ? 54.990 0.703   -16.588 1.00 42.64  ? 190 ARG A NH1   1 
ATOM   1819 N NH2   . ARG B 2 189 ? 55.309 1.037   -14.320 1.00 36.09  ? 190 ARG A NH2   1 
ATOM   1820 N N     . ASN B 2 190 ? 55.403 8.446   -18.281 1.00 37.08  ? 191 ASN A N     1 
ATOM   1821 C CA    . ASN B 2 190 ? 55.815 9.824   -18.129 1.00 37.08  ? 191 ASN A CA    1 
ATOM   1822 C C     . ASN B 2 190 ? 57.186 9.824   -17.466 1.00 38.85  ? 191 ASN A C     1 
ATOM   1823 O O     . ASN B 2 190 ? 58.202 10.275  -18.032 1.00 37.56  ? 191 ASN A O     1 
ATOM   1824 C CB    . ASN B 2 190 ? 54.815 10.502  -17.195 1.00 34.72  ? 191 ASN A CB    1 
ATOM   1825 C CG    . ASN B 2 190 ? 55.086 11.924  -17.062 1.00 37.57  ? 191 ASN A CG    1 
ATOM   1826 O OD1   . ASN B 2 190 ? 55.453 12.575  -18.044 1.00 39.50  ? 191 ASN A OD1   1 
ATOM   1827 N ND2   . ASN B 2 190 ? 55.020 12.425  -15.844 1.00 35.56  ? 191 ASN A ND2   1 
ATOM   1828 N N     . THR B 2 191 ? 57.178 9.283   -16.251 1.00 33.16  ? 192 THR A N     1 
ATOM   1829 C CA    . THR B 2 191 ? 58.344 9.141   -15.409 1.00 28.99  ? 192 THR A CA    1 
ATOM   1830 C C     . THR B 2 191 ? 59.417 8.457   -16.217 1.00 34.48  ? 192 THR A C     1 
ATOM   1831 O O     . THR B 2 191 ? 60.585 8.578   -15.855 1.00 44.86  ? 192 THR A O     1 
ATOM   1832 C CB    . THR B 2 191 ? 57.997 8.316   -14.177 1.00 28.93  ? 192 THR A CB    1 
ATOM   1833 O OG1   . THR B 2 191 ? 57.246 7.177   -14.590 1.00 38.24  ? 192 THR A OG1   1 
ATOM   1834 C CG2   . THR B 2 191 ? 57.085 9.123   -13.250 1.00 9.99   ? 192 THR A CG2   1 
ATOM   1835 N N     . GLY B 2 192 ? 59.037 7.758   -17.302 1.00 22.04  ? 193 GLY A N     1 
ATOM   1836 C CA    . GLY B 2 192 ? 60.006 7.079   -18.164 1.00 24.10  ? 193 GLY A CA    1 
ATOM   1837 C C     . GLY B 2 192 ? 60.422 8.091   -19.227 1.00 35.81  ? 193 GLY A C     1 
ATOM   1838 O O     . GLY B 2 192 ? 61.346 8.870   -19.068 1.00 40.56  ? 193 GLY A O     1 
ATOM   1839 N N     . ALA B 2 193 ? 59.697 8.070   -20.317 1.00 31.45  ? 194 ALA A N     1 
ATOM   1840 C CA    . ALA B 2 193 ? 59.901 8.974   -21.415 1.00 27.69  ? 194 ALA A CA    1 
ATOM   1841 C C     . ALA B 2 193 ? 60.250 10.408  -21.018 1.00 31.04  ? 194 ALA A C     1 
ATOM   1842 O O     . ALA B 2 193 ? 61.220 11.006  -21.466 1.00 35.41  ? 194 ALA A O     1 
ATOM   1843 C CB    . ALA B 2 193 ? 58.624 9.033   -22.149 1.00 25.71  ? 194 ALA A CB    1 
ATOM   1844 N N     . GLY B 2 194 ? 59.410 10.958  -20.178 1.00 22.27  ? 195 GLY A N     1 
ATOM   1845 C CA    . GLY B 2 194 ? 59.573 12.324  -19.753 1.00 21.21  ? 195 GLY A CA    1 
ATOM   1846 C C     . GLY B 2 194 ? 60.833 12.681  -19.093 1.00 29.11  ? 195 GLY A C     1 
ATOM   1847 O O     . GLY B 2 194 ? 61.448 13.671  -19.411 1.00 34.87  ? 195 GLY A O     1 
ATOM   1848 N N     . ARG B 2 195 ? 61.225 11.881  -18.140 1.00 26.79  ? 196 ARG A N     1 
ATOM   1849 C CA    . ARG B 2 195 ? 62.436 12.196  -17.445 1.00 24.64  ? 196 ARG A CA    1 
ATOM   1850 C C     . ARG B 2 195 ? 63.599 12.112  -18.425 1.00 27.07  ? 196 ARG A C     1 
ATOM   1851 O O     . ARG B 2 195 ? 64.506 12.928  -18.432 1.00 32.40  ? 196 ARG A O     1 
ATOM   1852 C CB    . ARG B 2 195 ? 62.580 11.242  -16.272 1.00 20.93  ? 196 ARG A CB    1 
ATOM   1853 C CG    . ARG B 2 195 ? 61.560 11.506  -15.118 1.00 20.82  ? 196 ARG A CG    1 
ATOM   1854 C CD    . ARG B 2 195 ? 61.596 10.431  -13.988 1.00 16.23  ? 196 ARG A CD    1 
ATOM   1855 N NE    . ARG B 2 195 ? 60.529 10.591  -13.017 1.00 30.84  ? 196 ARG A NE    1 
ATOM   1856 C CZ    . ARG B 2 195 ? 60.449 9.921   -11.875 1.00 42.68  ? 196 ARG A CZ    1 
ATOM   1857 N NH1   . ARG B 2 195 ? 61.373 9.046   -11.534 1.00 32.28  ? 196 ARG A NH1   1 
ATOM   1858 N NH2   . ARG B 2 195 ? 59.433 10.139  -11.068 1.00 44.30  ? 196 ARG A NH2   1 
ATOM   1859 N N     . LEU B 2 196 ? 63.561 11.128  -19.284 1.00 15.81  ? 197 LEU A N     1 
ATOM   1860 C CA    . LEU B 2 196 ? 64.633 10.960  -20.231 1.00 19.04  ? 197 LEU A CA    1 
ATOM   1861 C C     . LEU B 2 196 ? 64.796 12.128  -21.166 1.00 32.82  ? 197 LEU A C     1 
ATOM   1862 O O     . LEU B 2 196 ? 65.908 12.526  -21.517 1.00 33.33  ? 197 LEU A O     1 
ATOM   1863 C CB    . LEU B 2 196 ? 64.343 9.736   -21.074 1.00 20.16  ? 197 LEU A CB    1 
ATOM   1864 C CG    . LEU B 2 196 ? 65.383 9.415   -22.130 1.00 26.41  ? 197 LEU A CG    1 
ATOM   1865 C CD1   . LEU B 2 196 ? 66.715 9.340   -21.446 1.00 27.17  ? 197 LEU A CD1   1 
ATOM   1866 C CD2   . LEU B 2 196 ? 65.050 8.081   -22.803 1.00 26.39  ? 197 LEU A CD2   1 
ATOM   1867 N N     . ALA B 2 197 ? 63.679 12.672  -21.606 1.00 34.92  ? 198 ALA A N     1 
ATOM   1868 C CA    . ALA B 2 197 ? 63.764 13.784  -22.518 1.00 35.92  ? 198 ALA A CA    1 
ATOM   1869 C C     . ALA B 2 197 ? 64.322 15.030  -21.881 1.00 39.87  ? 198 ALA A C     1 
ATOM   1870 O O     . ALA B 2 197 ? 65.128 15.711  -22.466 1.00 40.61  ? 198 ALA A O     1 
ATOM   1871 C CB    . ALA B 2 197 ? 62.484 14.047  -23.087 1.00 36.70  ? 198 ALA A CB    1 
ATOM   1872 N N     . GLY B 2 198 ? 63.886 15.342  -20.680 1.00 40.35  ? 199 GLY A N     1 
ATOM   1873 C CA    . GLY B 2 198 ? 64.408 16.530  -20.021 1.00 42.51  ? 199 GLY A CA    1 
ATOM   1874 C C     . GLY B 2 198 ? 65.905 16.294  -19.892 1.00 42.34  ? 199 GLY A C     1 
ATOM   1875 O O     . GLY B 2 198 ? 66.720 17.178  -20.144 1.00 41.11  ? 199 GLY A O     1 
ATOM   1876 N N     . PHE B 2 199 ? 66.253 15.074  -19.527 1.00 33.52  ? 200 PHE A N     1 
ATOM   1877 C CA    . PHE B 2 199 ? 67.650 14.741  -19.401 1.00 34.02  ? 200 PHE A CA    1 
ATOM   1878 C C     . PHE B 2 199 ? 68.371 14.840  -20.743 1.00 35.77  ? 200 PHE A C     1 
ATOM   1879 O O     . PHE B 2 199 ? 69.510 15.261  -20.828 1.00 33.42  ? 200 PHE A O     1 
ATOM   1880 C CB    . PHE B 2 199 ? 67.846 13.302  -18.932 1.00 35.75  ? 200 PHE A CB    1 
ATOM   1881 C CG    . PHE B 2 199 ? 69.280 12.923  -18.869 1.00 34.20  ? 200 PHE A CG    1 
ATOM   1882 C CD1   . PHE B 2 199 ? 70.032 13.185  -17.720 1.00 38.44  ? 200 PHE A CD1   1 
ATOM   1883 C CD2   . PHE B 2 199 ? 69.889 12.369  -19.966 1.00 31.84  ? 200 PHE A CD2   1 
ATOM   1884 C CE1   . PHE B 2 199 ? 71.373 12.859  -17.666 1.00 42.56  ? 200 PHE A CE1   1 
ATOM   1885 C CE2   . PHE B 2 199 ? 71.222 12.029  -19.943 1.00 38.75  ? 200 PHE A CE2   1 
ATOM   1886 C CZ    . PHE B 2 199 ? 71.980 12.283  -18.797 1.00 41.36  ? 200 PHE A CZ    1 
ATOM   1887 N N     . MET B 2 200 ? 67.733 14.424  -21.811 1.00 29.63  ? 201 MET A N     1 
ATOM   1888 C CA    . MET B 2 200 ? 68.447 14.515  -23.055 1.00 28.68  ? 201 MET A CA    1 
ATOM   1889 C C     . MET B 2 200 ? 68.627 15.972  -23.565 1.00 38.51  ? 201 MET A C     1 
ATOM   1890 O O     . MET B 2 200 ? 69.646 16.307  -24.198 1.00 40.06  ? 201 MET A O     1 
ATOM   1891 C CB    . MET B 2 200 ? 67.792 13.596  -24.067 1.00 31.15  ? 201 MET A CB    1 
ATOM   1892 C CG    . MET B 2 200 ? 68.771 12.790  -24.937 1.00 39.06  ? 201 MET A CG    1 
ATOM   1893 S SD    . MET B 2 200 ? 69.855 11.616  -24.110 1.00 44.29  ? 201 MET A SD    1 
ATOM   1894 C CE    . MET B 2 200 ? 68.997 11.634  -22.595 1.00 44.36  ? 201 MET A CE    1 
ATOM   1895 N N     . LYS B 2 201 ? 67.663 16.847  -23.275 1.00 32.95  ? 202 LYS A N     1 
ATOM   1896 C CA    . LYS B 2 201 ? 67.747 18.226  -23.728 1.00 32.86  ? 202 LYS A CA    1 
ATOM   1897 C C     . LYS B 2 201 ? 69.000 18.908  -23.199 1.00 40.77  ? 202 LYS A C     1 
ATOM   1898 O O     . LYS B 2 201 ? 69.779 19.525  -23.948 1.00 38.32  ? 202 LYS A O     1 
ATOM   1899 C CB    . LYS B 2 201 ? 66.534 19.030  -23.280 1.00 36.23  ? 202 LYS A CB    1 
ATOM   1900 C CG    . LYS B 2 201 ? 66.933 20.325  -22.575 1.00 59.23  ? 202 LYS A CG    1 
ATOM   1901 C CD    . LYS B 2 201 ? 66.520 21.554  -23.335 1.00 58.70  ? 202 LYS A CD    1 
ATOM   1902 C CE    . LYS B 2 201 ? 66.375 21.228  -24.806 1.00 62.26  ? 202 LYS A CE    1 
ATOM   1903 N NZ    . LYS B 2 201 ? 65.962 22.449  -25.552 1.00 100.00 ? 202 LYS A NZ    1 
ATOM   1904 N N     . ALA B 2 202 ? 69.167 18.802  -21.890 1.00 38.59  ? 203 ALA A N     1 
ATOM   1905 C CA    . ALA B 2 202 ? 70.308 19.384  -21.212 1.00 40.33  ? 203 ALA A CA    1 
ATOM   1906 C C     . ALA B 2 202 ? 71.621 19.008  -21.915 1.00 43.53  ? 203 ALA A C     1 
ATOM   1907 O O     . ALA B 2 202 ? 72.543 19.839  -22.016 1.00 45.49  ? 203 ALA A O     1 
ATOM   1908 C CB    . ALA B 2 202 ? 70.333 18.891  -19.788 1.00 41.28  ? 203 ALA A CB    1 
ATOM   1909 N N     . MET B 2 203 ? 71.686 17.755  -22.384 1.00 32.96  ? 204 MET A N     1 
ATOM   1910 C CA    . MET B 2 203 ? 72.845 17.209  -23.086 1.00 29.14  ? 204 MET A CA    1 
ATOM   1911 C C     . MET B 2 203 ? 73.049 17.877  -24.434 1.00 31.58  ? 204 MET A C     1 
ATOM   1912 O O     . MET B 2 203 ? 74.159 18.330  -24.715 1.00 25.67  ? 204 MET A O     1 
ATOM   1913 C CB    . MET B 2 203 ? 72.672 15.712  -23.297 1.00 30.03  ? 204 MET A CB    1 
ATOM   1914 C CG    . MET B 2 203 ? 72.536 14.930  -21.994 1.00 33.89  ? 204 MET A CG    1 
ATOM   1915 S SD    . MET B 2 203 ? 74.117 14.600  -21.102 1.00 34.89  ? 204 MET A SD    1 
ATOM   1916 C CE    . MET B 2 203 ? 74.028 15.552  -19.672 1.00 30.65  ? 204 MET A CE    1 
ATOM   1917 N N     . GLU B 2 204 ? 71.998 17.928  -25.264 1.00 27.75  ? 205 GLU A N     1 
ATOM   1918 C CA    . GLU B 2 204 ? 72.146 18.573  -26.575 1.00 29.41  ? 205 GLU A CA    1 
ATOM   1919 C C     . GLU B 2 204 ? 72.653 19.952  -26.341 1.00 33.75  ? 205 GLU A C     1 
ATOM   1920 O O     . GLU B 2 204 ? 73.541 20.415  -27.032 1.00 36.08  ? 205 GLU A O     1 
ATOM   1921 C CB    . GLU B 2 204 ? 70.845 18.707  -27.379 1.00 31.60  ? 205 GLU A CB    1 
ATOM   1922 C CG    . GLU B 2 204 ? 69.811 17.615  -27.100 1.00 82.28  ? 205 GLU A CG    1 
ATOM   1923 C CD    . GLU B 2 204 ? 69.952 16.324  -27.973 1.00 100.00 ? 205 GLU A CD    1 
ATOM   1924 O OE1   . GLU B 2 204 ? 70.905 15.515  -27.719 1.00 100.00 ? 205 GLU A OE1   1 
ATOM   1925 O OE2   . GLU B 2 204 ? 69.062 16.092  -28.855 1.00 100.00 ? 205 GLU A OE2   1 
ATOM   1926 N N     . GLU B 2 205 ? 72.066 20.606  -25.360 1.00 30.92  ? 206 GLU A N     1 
ATOM   1927 C CA    . GLU B 2 205 ? 72.480 21.946  -25.059 1.00 31.14  ? 206 GLU A CA    1 
ATOM   1928 C C     . GLU B 2 205 ? 73.942 21.927  -24.874 1.00 46.09  ? 206 GLU A C     1 
ATOM   1929 O O     . GLU B 2 205 ? 74.620 22.775  -25.384 1.00 55.41  ? 206 GLU A O     1 
ATOM   1930 C CB    . GLU B 2 205 ? 71.855 22.434  -23.780 1.00 31.27  ? 206 GLU A CB    1 
ATOM   1931 C CG    . GLU B 2 205 ? 70.435 22.710  -23.989 1.00 38.00  ? 206 GLU A CG    1 
ATOM   1932 C CD    . GLU B 2 205 ? 69.871 23.411  -22.834 1.00 53.39  ? 206 GLU A CD    1 
ATOM   1933 O OE1   . GLU B 2 205 ? 70.448 23.283  -21.722 1.00 53.65  ? 206 GLU A OE1   1 
ATOM   1934 O OE2   . GLU B 2 205 ? 68.868 24.094  -23.070 1.00 35.10  ? 206 GLU A OE2   1 
ATOM   1935 N N     . ALA B 2 206 ? 74.454 20.943  -24.161 1.00 42.18  ? 207 ALA A N     1 
ATOM   1936 C CA    . ALA B 2 206 ? 75.889 20.904  -23.950 1.00 39.68  ? 207 ALA A CA    1 
ATOM   1937 C C     . ALA B 2 206 ? 76.677 20.233  -25.037 1.00 44.66  ? 207 ALA A C     1 
ATOM   1938 O O     . ALA B 2 206 ? 77.862 20.041  -24.875 1.00 46.19  ? 207 ALA A O     1 
ATOM   1939 C CB    . ALA B 2 206 ? 76.220 20.280  -22.614 1.00 40.66  ? 207 ALA A CB    1 
ATOM   1940 N N     . MET B 2 207 ? 76.051 19.862  -26.138 1.00 45.95  ? 208 MET A N     1 
ATOM   1941 C CA    . MET B 2 207 ? 76.800 19.196  -27.198 1.00 50.79  ? 208 MET A CA    1 
ATOM   1942 C C     . MET B 2 207 ? 77.432 17.892  -26.686 1.00 48.14  ? 208 MET A C     1 
ATOM   1943 O O     . MET B 2 207 ? 78.561 17.501  -27.042 1.00 49.16  ? 208 MET A O     1 
ATOM   1944 C CB    . MET B 2 207 ? 77.825 20.131  -27.814 1.00 56.70  ? 208 MET A CB    1 
ATOM   1945 C CG    . MET B 2 207 ? 77.220 21.421  -28.327 1.00 68.51  ? 208 MET A CG    1 
ATOM   1946 S SD    . MET B 2 207 ? 78.030 21.805  -29.875 1.00 82.91  ? 208 MET A SD    1 
ATOM   1947 C CE    . MET B 2 207 ? 79.652 20.873  -29.655 1.00 82.40  ? 208 MET A CE    1 
ATOM   1948 N N     . ILE B 2 208 ? 76.668 17.220  -25.838 1.00 34.29  ? 209 ILE A N     1 
ATOM   1949 C CA    . ILE B 2 208 ? 77.107 15.985  -25.294 1.00 30.00  ? 209 ILE A CA    1 
ATOM   1950 C C     . ILE B 2 208 ? 76.210 15.036  -25.990 1.00 47.12  ? 209 ILE A C     1 
ATOM   1951 O O     . ILE B 2 208 ? 75.006 15.256  -26.089 1.00 54.79  ? 209 ILE A O     1 
ATOM   1952 C CB    . ILE B 2 208 ? 76.813 15.905  -23.862 1.00 30.13  ? 209 ILE A CB    1 
ATOM   1953 C CG1   . ILE B 2 208 ? 77.761 16.854  -23.115 1.00 29.58  ? 209 ILE A CG1   1 
ATOM   1954 C CG2   . ILE B 2 208 ? 76.983 14.499  -23.460 1.00 29.99  ? 209 ILE A CG2   1 
ATOM   1955 C CD1   . ILE B 2 208 ? 77.937 16.550  -21.667 1.00 29.51  ? 209 ILE A CD1   1 
ATOM   1956 N N     . LYS B 2 209 ? 76.817 13.986  -26.502 1.00 46.12  ? 210 LYS A N     1 
ATOM   1957 C CA    . LYS B 2 209 ? 76.133 12.940  -27.240 1.00 45.81  ? 210 LYS A CA    1 
ATOM   1958 C C     . LYS B 2 209 ? 76.185 11.723  -26.375 1.00 53.09  ? 210 LYS A C     1 
ATOM   1959 O O     . LYS B 2 209 ? 77.208 11.385  -25.787 1.00 56.04  ? 210 LYS A O     1 
ATOM   1960 C CB    . LYS B 2 209 ? 76.940 12.613  -28.504 1.00 48.58  ? 210 LYS A CB    1 
ATOM   1961 C CG    . LYS B 2 209 ? 78.366 12.024  -28.232 1.00 95.90  ? 210 LYS A CG    1 
ATOM   1962 C CD    . LYS B 2 209 ? 79.381 13.058  -27.599 1.00 100.00 ? 210 LYS A CD    1 
ATOM   1963 C CE    . LYS B 2 209 ? 80.175 12.508  -26.357 1.00 100.00 ? 210 LYS A CE    1 
ATOM   1964 N NZ    . LYS B 2 209 ? 80.778 13.549  -25.425 1.00 75.54  ? 210 LYS A NZ    1 
ATOM   1965 N N     . VAL B 2 210 ? 75.088 11.029  -26.252 1.00 49.52  ? 211 VAL A N     1 
ATOM   1966 C CA    . VAL B 2 210 ? 75.245 9.871   -25.432 1.00 44.01  ? 211 VAL A CA    1 
ATOM   1967 C C     . VAL B 2 210 ? 75.104 8.750   -26.383 1.00 44.14  ? 211 VAL A C     1 
ATOM   1968 O O     . VAL B 2 210 ? 74.062 8.595   -27.009 1.00 48.79  ? 211 VAL A O     1 
ATOM   1969 C CB    . VAL B 2 210 ? 74.373 9.785   -24.156 1.00 41.52  ? 211 VAL A CB    1 
ATOM   1970 C CG1   . VAL B 2 210 ? 73.634 11.078  -23.841 1.00 38.42  ? 211 VAL A CG1   1 
ATOM   1971 C CG2   . VAL B 2 210 ? 73.526 8.544   -24.143 1.00 40.12  ? 211 VAL A CG2   1 
ATOM   1972 N N     . PRO B 2 211 ? 76.199 8.015   -26.507 1.00 35.04  ? 212 PRO A N     1 
ATOM   1973 C CA    . PRO B 2 211 ? 76.331 6.846   -27.351 1.00 32.19  ? 212 PRO A CA    1 
ATOM   1974 C C     . PRO B 2 211 ? 75.299 5.812   -26.943 1.00 43.49  ? 212 PRO A C     1 
ATOM   1975 O O     . PRO B 2 211 ? 75.120 5.533   -25.744 1.00 42.84  ? 212 PRO A O     1 
ATOM   1976 C CB    . PRO B 2 211 ? 77.692 6.312   -26.956 1.00 31.84  ? 212 PRO A CB    1 
ATOM   1977 C CG    . PRO B 2 211 ? 78.043 6.939   -25.642 1.00 35.32  ? 212 PRO A CG    1 
ATOM   1978 C CD    . PRO B 2 211 ? 76.989 7.909   -25.273 1.00 33.64  ? 212 PRO A CD    1 
ATOM   1979 N N     . GLU B 2 212 ? 74.631 5.236   -27.935 1.00 45.24  ? 213 GLU A N     1 
ATOM   1980 C CA    . GLU B 2 212 ? 73.605 4.246   -27.657 1.00 48.65  ? 213 GLU A CA    1 
ATOM   1981 C C     . GLU B 2 212 ? 73.938 3.057   -26.728 1.00 48.58  ? 213 GLU A C     1 
ATOM   1982 O O     . GLU B 2 212 ? 73.053 2.489   -26.072 1.00 53.43  ? 213 GLU A O     1 
ATOM   1983 C CB    . GLU B 2 212 ? 72.777 3.916   -28.900 1.00 52.70  ? 213 GLU A CB    1 
ATOM   1984 C CG    . GLU B 2 212 ? 73.568 3.227   -30.010 1.00 85.54  ? 213 GLU A CG    1 
ATOM   1985 C CD    . GLU B 2 212 ? 72.805 2.022   -30.633 1.00 100.00 ? 213 GLU A CD    1 
ATOM   1986 O OE1   . GLU B 2 212 ? 71.774 2.289   -31.318 1.00 100.00 ? 213 GLU A OE1   1 
ATOM   1987 O OE2   . GLU B 2 212 ? 73.233 0.829   -30.456 1.00 100.00 ? 213 GLU A OE2   1 
ATOM   1988 N N     . SER B 2 213 ? 75.211 2.697   -26.647 1.00 35.82  ? 214 SER A N     1 
ATOM   1989 C CA    . SER B 2 213 ? 75.613 1.608   -25.762 1.00 34.46  ? 214 SER A CA    1 
ATOM   1990 C C     . SER B 2 213 ? 75.610 2.145   -24.357 1.00 43.75  ? 214 SER A C     1 
ATOM   1991 O O     . SER B 2 213 ? 75.939 1.454   -23.402 1.00 44.36  ? 214 SER A O     1 
ATOM   1992 C CB    . SER B 2 213 ? 77.052 1.201   -26.045 1.00 37.55  ? 214 SER A CB    1 
ATOM   1993 O OG    . SER B 2 213 ? 77.784 2.332   -26.486 1.00 71.85  ? 214 SER A OG    1 
ATOM   1994 N N     . TRP B 2 214 ? 75.285 3.409   -24.225 1.00 45.27  ? 215 TRP A N     1 
ATOM   1995 C CA    . TRP B 2 214 ? 75.303 3.973   -22.918 1.00 46.82  ? 215 TRP A CA    1 
ATOM   1996 C C     . TRP B 2 214 ? 73.900 4.188   -22.413 1.00 43.13  ? 215 TRP A C     1 
ATOM   1997 O O     . TRP B 2 214 ? 73.681 4.609   -21.291 1.00 39.98  ? 215 TRP A O     1 
ATOM   1998 C CB    . TRP B 2 214 ? 76.151 5.229   -22.958 1.00 50.21  ? 215 TRP A CB    1 
ATOM   1999 C CG    . TRP B 2 214 ? 77.596 4.896   -22.785 1.00 54.29  ? 215 TRP A CG    1 
ATOM   2000 C CD1   . TRP B 2 214 ? 78.135 3.661   -22.808 1.00 58.35  ? 215 TRP A CD1   1 
ATOM   2001 C CD2   . TRP B 2 214 ? 78.684 5.808   -22.515 1.00 54.78  ? 215 TRP A CD2   1 
ATOM   2002 N NE1   . TRP B 2 214 ? 79.487 3.733   -22.582 1.00 58.76  ? 215 TRP A NE1   1 
ATOM   2003 C CE2   . TRP B 2 214 ? 79.846 5.039   -22.386 1.00 57.98  ? 215 TRP A CE2   1 
ATOM   2004 C CE3   . TRP B 2 214 ? 78.779 7.195   -22.340 1.00 56.92  ? 215 TRP A CE3   1 
ATOM   2005 C CZ2   . TRP B 2 214 ? 81.089 5.597   -22.121 1.00 56.73  ? 215 TRP A CZ2   1 
ATOM   2006 C CZ3   . TRP B 2 214 ? 80.036 7.753   -22.103 1.00 57.39  ? 215 TRP A CZ3   1 
ATOM   2007 C CH2   . TRP B 2 214 ? 81.166 6.952   -21.992 1.00 57.11  ? 215 TRP A CH2   1 
ATOM   2008 N N     . ILE B 2 215 ? 72.920 3.900   -23.243 1.00 39.49  ? 216 ILE A N     1 
ATOM   2009 C CA    . ILE B 2 215 ? 71.577 4.076   -22.743 1.00 39.90  ? 216 ILE A CA    1 
ATOM   2010 C C     . ILE B 2 215 ? 70.895 2.706   -22.524 1.00 42.03  ? 216 ILE A C     1 
ATOM   2011 O O     . ILE B 2 215 ? 70.731 1.934   -23.456 1.00 44.36  ? 216 ILE A O     1 
ATOM   2012 C CB    . ILE B 2 215 ? 70.790 5.345   -23.245 1.00 41.66  ? 216 ILE A CB    1 
ATOM   2013 C CG1   . ILE B 2 215 ? 69.354 5.002   -23.445 1.00 46.69  ? 216 ILE A CG1   1 
ATOM   2014 C CG2   . ILE B 2 215 ? 71.334 5.955   -24.545 1.00 33.23  ? 216 ILE A CG2   1 
ATOM   2015 C CD1   . ILE B 2 215 ? 69.165 3.990   -24.568 1.00 100.00 ? 216 ILE A CD1   1 
ATOM   2016 N N     . VAL B 2 216 ? 70.549 2.364   -21.291 1.00 33.23  ? 217 VAL A N     1 
ATOM   2017 C CA    . VAL B 2 216 ? 69.958 1.058   -21.083 1.00 32.49  ? 217 VAL A CA    1 
ATOM   2018 C C     . VAL B 2 216 ? 68.646 1.162   -20.317 1.00 39.22  ? 217 VAL A C     1 
ATOM   2019 O O     . VAL B 2 216 ? 68.589 1.708   -19.203 1.00 37.66  ? 217 VAL A O     1 
ATOM   2020 C CB    . VAL B 2 216 ? 70.979 0.088   -20.389 1.00 36.27  ? 217 VAL A CB    1 
ATOM   2021 C CG1   . VAL B 2 216 ? 70.538 -1.316  -20.442 1.00 36.05  ? 217 VAL A CG1   1 
ATOM   2022 C CG2   . VAL B 2 216 ? 72.340 0.172   -21.012 1.00 34.90  ? 217 VAL A CG2   1 
ATOM   2023 N N     . GLN B 2 217 ? 67.599 0.621   -20.946 1.00 35.29  ? 218 GLN A N     1 
ATOM   2024 C CA    . GLN B 2 217 ? 66.239 0.638   -20.404 1.00 32.66  ? 218 GLN A CA    1 
ATOM   2025 C C     . GLN B 2 217 ? 66.067 -0.087  -19.119 1.00 35.30  ? 218 GLN A C     1 
ATOM   2026 O O     . GLN B 2 217 ? 66.515 -1.190  -19.006 1.00 44.21  ? 218 GLN A O     1 
ATOM   2027 C CB    . GLN B 2 217 ? 65.250 0.002   -21.376 1.00 29.73  ? 218 GLN A CB    1 
ATOM   2028 C CG    . GLN B 2 217 ? 64.315 0.993   -22.097 1.00 45.44  ? 218 GLN A CG    1 
ATOM   2029 C CD    . GLN B 2 217 ? 63.243 1.560   -21.209 1.00 82.41  ? 218 GLN A CD    1 
ATOM   2030 O OE1   . GLN B 2 217 ? 62.110 1.753   -21.642 1.00 92.20  ? 218 GLN A OE1   1 
ATOM   2031 N NE2   . GLN B 2 217 ? 63.593 1.840   -19.962 1.00 71.26  ? 218 GLN A NE2   1 
ATOM   2032 N N     . GLY B 2 218 ? 65.384 0.521   -18.168 1.00 24.95  ? 219 GLY A N     1 
ATOM   2033 C CA    . GLY B 2 218 ? 65.115 -0.112  -16.894 1.00 26.89  ? 219 GLY A CA    1 
ATOM   2034 C C     . GLY B 2 218 ? 63.603 -0.343  -16.914 1.00 42.29  ? 219 GLY A C     1 
ATOM   2035 O O     . GLY B 2 218 ? 62.944 -0.057  -17.919 1.00 51.59  ? 219 GLY A O     1 
ATOM   2036 N N     . ASP B 2 219 ? 63.051 -0.854  -15.819 1.00 34.41  ? 220 ASP A N     1 
ATOM   2037 C CA    . ASP B 2 219 ? 61.610 -1.101  -15.709 1.00 28.76  ? 220 ASP A CA    1 
ATOM   2038 C C     . ASP B 2 219 ? 61.224 -0.629  -14.298 1.00 31.79  ? 220 ASP A C     1 
ATOM   2039 O O     . ASP B 2 219 ? 60.189 -0.980  -13.771 1.00 34.62  ? 220 ASP A O     1 
ATOM   2040 C CB    . ASP B 2 219 ? 61.333 -2.601  -15.861 1.00 25.73  ? 220 ASP A CB    1 
ATOM   2041 C CG    . ASP B 2 219 ? 61.886 -3.407  -14.721 1.00 47.80  ? 220 ASP A CG    1 
ATOM   2042 O OD1   . ASP B 2 219 ? 62.737 -2.917  -13.950 1.00 57.41  ? 220 ASP A OD1   1 
ATOM   2043 O OD2   . ASP B 2 219 ? 61.441 -4.542  -14.563 1.00 61.02  ? 220 ASP A OD2   1 
ATOM   2044 N N     . PHE B 2 220 ? 62.103 0.154   -13.699 1.00 28.11  ? 221 PHE A N     1 
ATOM   2045 C CA    . PHE B 2 220 ? 61.924 0.693   -12.364 1.00 30.17  ? 221 PHE A CA    1 
ATOM   2046 C C     . PHE B 2 220 ? 62.236 -0.274  -11.245 1.00 32.99  ? 221 PHE A C     1 
ATOM   2047 O O     . PHE B 2 220 ? 62.150 0.089   -10.071 1.00 34.33  ? 221 PHE A O     1 
ATOM   2048 C CB    . PHE B 2 220 ? 60.536 1.263   -12.147 1.00 33.50  ? 221 PHE A CB    1 
ATOM   2049 C CG    . PHE B 2 220 ? 60.335 2.622   -12.739 1.00 36.47  ? 221 PHE A CG    1 
ATOM   2050 C CD1   . PHE B 2 220 ? 61.062 3.699   -12.290 1.00 41.00  ? 221 PHE A CD1   1 
ATOM   2051 C CD2   . PHE B 2 220 ? 59.400 2.819   -13.746 1.00 37.78  ? 221 PHE A CD2   1 
ATOM   2052 C CE1   . PHE B 2 220 ? 60.869 4.950   -12.831 1.00 42.58  ? 221 PHE A CE1   1 
ATOM   2053 C CE2   . PHE B 2 220 ? 59.215 4.047   -14.296 1.00 40.99  ? 221 PHE A CE2   1 
ATOM   2054 C CZ    . PHE B 2 220 ? 59.948 5.126   -13.840 1.00 40.33  ? 221 PHE A CZ    1 
ATOM   2055 N N     . GLU B 2 221 ? 62.600 -1.498  -11.584 1.00 24.79  ? 222 GLU A N     1 
ATOM   2056 C CA    . GLU B 2 221 ? 62.895 -2.465  -10.528 1.00 23.56  ? 222 GLU A CA    1 
ATOM   2057 C C     . GLU B 2 221 ? 64.377 -2.728  -10.373 1.00 24.96  ? 222 GLU A C     1 
ATOM   2058 O O     . GLU B 2 221 ? 65.136 -2.772  -11.343 1.00 26.71  ? 222 GLU A O     1 
ATOM   2059 C CB    . GLU B 2 221 ? 62.121 -3.768  -10.760 1.00 26.09  ? 222 GLU A CB    1 
ATOM   2060 C CG    . GLU B 2 221 ? 60.573 -3.661  -10.720 1.00 36.05  ? 222 GLU A CG    1 
ATOM   2061 C CD    . GLU B 2 221 ? 59.985 -3.834  -9.318  1.00 100.00 ? 222 GLU A CD    1 
ATOM   2062 O OE1   . GLU B 2 221 ? 59.817 -4.998  -8.871  1.00 100.00 ? 222 GLU A OE1   1 
ATOM   2063 O OE2   . GLU B 2 221 ? 59.681 -2.805  -8.662  1.00 100.00 ? 222 GLU A OE2   1 
ATOM   2064 N N     . PRO B 2 222 ? 64.780 -2.885  -9.133  1.00 21.81  ? 223 PRO A N     1 
ATOM   2065 C CA    . PRO B 2 222 ? 66.185 -3.127  -8.746  1.00 22.69  ? 223 PRO A CA    1 
ATOM   2066 C C     . PRO B 2 222 ? 66.916 -4.023  -9.696  1.00 30.84  ? 223 PRO A C     1 
ATOM   2067 O O     . PRO B 2 222 ? 68.038 -3.737  -10.069 1.00 32.57  ? 223 PRO A O     1 
ATOM   2068 C CB    . PRO B 2 222 ? 66.094 -3.776  -7.357  1.00 24.12  ? 223 PRO A CB    1 
ATOM   2069 C CG    . PRO B 2 222 ? 64.706 -3.420  -6.876  1.00 30.29  ? 223 PRO A CG    1 
ATOM   2070 C CD    . PRO B 2 222 ? 63.827 -3.336  -8.129  1.00 22.40  ? 223 PRO A CD    1 
ATOM   2071 N N     . GLU B 2 223 ? 66.294 -5.108  -10.111 1.00 29.90  ? 224 GLU A N     1 
ATOM   2072 C CA    . GLU B 2 223 ? 67.000 -5.954  -11.041 1.00 29.00  ? 224 GLU A CA    1 
ATOM   2073 C C     . GLU B 2 223 ? 67.458 -5.225  -12.320 1.00 35.53  ? 224 GLU A C     1 
ATOM   2074 O O     . GLU B 2 223 ? 68.602 -5.398  -12.725 1.00 39.12  ? 224 GLU A O     1 
ATOM   2075 C CB    . GLU B 2 223 ? 66.152 -7.149  -11.414 1.00 31.68  ? 224 GLU A CB    1 
ATOM   2076 C CG    . GLU B 2 223 ? 66.943 -8.206  -12.216 1.00 42.64  ? 224 GLU A CG    1 
ATOM   2077 C CD    . GLU B 2 223 ? 67.823 -9.064  -11.333 1.00 100.00 ? 224 GLU A CD    1 
ATOM   2078 O OE1   . GLU B 2 223 ? 67.235 -9.888  -10.591 1.00 100.00 ? 224 GLU A OE1   1 
ATOM   2079 O OE2   . GLU B 2 223 ? 69.081 -8.927  -11.384 1.00 100.00 ? 224 GLU A OE2   1 
ATOM   2080 N N     . SER B 2 224 ? 66.585 -4.431  -12.958 1.00 29.07  ? 225 SER A N     1 
ATOM   2081 C CA    . SER B 2 224 ? 66.951 -3.698  -14.185 1.00 28.23  ? 225 SER A CA    1 
ATOM   2082 C C     . SER B 2 224 ? 68.120 -2.788  -13.889 1.00 33.00  ? 225 SER A C     1 
ATOM   2083 O O     . SER B 2 224 ? 69.029 -2.617  -14.713 1.00 33.23  ? 225 SER A O     1 
ATOM   2084 C CB    . SER B 2 224 ? 65.801 -2.834  -14.688 1.00 33.68  ? 225 SER A CB    1 
ATOM   2085 O OG    . SER B 2 224 ? 64.990 -2.401  -13.618 1.00 54.38  ? 225 SER A OG    1 
ATOM   2086 N N     . GLY B 2 225 ? 68.079 -2.203  -12.696 1.00 28.38  ? 226 GLY A N     1 
ATOM   2087 C CA    . GLY B 2 225 ? 69.136 -1.313  -12.228 1.00 28.41  ? 226 GLY A CA    1 
ATOM   2088 C C     . GLY B 2 225 ? 70.437 -2.120  -12.284 1.00 36.12  ? 226 GLY A C     1 
ATOM   2089 O O     . GLY B 2 225 ? 71.456 -1.694  -12.853 1.00 37.08  ? 226 GLY A O     1 
ATOM   2090 N N     . TYR B 2 226 ? 70.376 -3.302  -11.696 1.00 33.79  ? 227 TYR A N     1 
ATOM   2091 C CA    . TYR B 2 226 ? 71.506 -4.203  -11.683 1.00 31.95  ? 227 TYR A CA    1 
ATOM   2092 C C     . TYR B 2 226 ? 71.972 -4.495  -13.146 1.00 35.21  ? 227 TYR A C     1 
ATOM   2093 O O     . TYR B 2 226 ? 73.035 -4.035  -13.567 1.00 35.58  ? 227 TYR A O     1 
ATOM   2094 C CB    . TYR B 2 226 ? 71.126 -5.463  -10.916 1.00 30.54  ? 227 TYR A CB    1 
ATOM   2095 C CG    . TYR B 2 226 ? 72.317 -6.250  -10.488 1.00 33.59  ? 227 TYR A CG    1 
ATOM   2096 C CD1   . TYR B 2 226 ? 73.013 -7.039  -11.385 1.00 37.38  ? 227 TYR A CD1   1 
ATOM   2097 C CD2   . TYR B 2 226 ? 72.761 -6.202  -9.194  1.00 33.27  ? 227 TYR A CD2   1 
ATOM   2098 C CE1   . TYR B 2 226 ? 74.114 -7.760  -10.988 1.00 40.75  ? 227 TYR A CE1   1 
ATOM   2099 C CE2   . TYR B 2 226 ? 73.865 -6.925  -8.787  1.00 31.69  ? 227 TYR A CE2   1 
ATOM   2100 C CZ    . TYR B 2 226 ? 74.532 -7.705  -9.678  1.00 39.33  ? 227 TYR A CZ    1 
ATOM   2101 O OH    . TYR B 2 226 ? 75.624 -8.421  -9.250  1.00 46.53  ? 227 TYR A OH    1 
ATOM   2102 N N     . ARG B 2 227 ? 71.182 -5.230  -13.918 1.00 29.29  ? 228 ARG A N     1 
ATOM   2103 C CA    . ARG B 2 227 ? 71.538 -5.555  -15.301 1.00 30.05  ? 228 ARG A CA    1 
ATOM   2104 C C     . ARG B 2 227 ? 72.174 -4.403  -16.105 1.00 36.88  ? 228 ARG A C     1 
ATOM   2105 O O     . ARG B 2 227 ? 73.252 -4.562  -16.698 1.00 36.53  ? 228 ARG A O     1 
ATOM   2106 C CB    . ARG B 2 227 ? 70.287 -6.049  -16.052 1.00 38.09  ? 228 ARG A CB    1 
ATOM   2107 C CG    . ARG B 2 227 ? 70.094 -7.574  -16.195 1.00 74.18  ? 228 ARG A CG    1 
ATOM   2108 C CD    . ARG B 2 227 ? 69.746 -8.281  -14.854 1.00 100.00 ? 228 ARG A CD    1 
ATOM   2109 N NE    . ARG B 2 227 ? 68.416 -8.931  -14.844 1.00 100.00 ? 228 ARG A NE    1 
ATOM   2110 C CZ    . ARG B 2 227 ? 68.145 -10.098 -14.239 1.00 100.00 ? 228 ARG A CZ    1 
ATOM   2111 N NH1   . ARG B 2 227 ? 69.124 -10.760 -13.607 1.00 100.00 ? 228 ARG A NH1   1 
ATOM   2112 N NH2   . ARG B 2 227 ? 66.901 -10.606 -14.267 1.00 97.26  ? 228 ARG A NH2   1 
ATOM   2113 N N     . ALA B 2 228 ? 71.497 -3.252  -16.115 1.00 34.29  ? 229 ALA A N     1 
ATOM   2114 C CA    . ALA B 2 228 ? 71.960 -2.083  -16.842 1.00 29.78  ? 229 ALA A CA    1 
ATOM   2115 C C     . ALA B 2 228 ? 73.295 -1.582  -16.354 1.00 30.94  ? 229 ALA A C     1 
ATOM   2116 O O     . ALA B 2 228 ? 74.242 -1.511  -17.117 1.00 30.89  ? 229 ALA A O     1 
ATOM   2117 C CB    . ALA B 2 228 ? 70.976 -1.027  -16.746 1.00 29.69  ? 229 ALA A CB    1 
ATOM   2118 N N     . MET B 2 229 ? 73.366 -1.234  -15.081 1.00 27.93  ? 230 MET A N     1 
ATOM   2119 C CA    . MET B 2 229 ? 74.617 -0.730  -14.539 1.00 30.76  ? 230 MET A CA    1 
ATOM   2120 C C     . MET B 2 229 ? 75.733 -1.612  -14.954 1.00 37.46  ? 230 MET A C     1 
ATOM   2121 O O     . MET B 2 229 ? 76.816 -1.171  -15.258 1.00 38.34  ? 230 MET A O     1 
ATOM   2122 C CB    . MET B 2 229 ? 74.620 -0.718  -13.013 1.00 32.32  ? 230 MET A CB    1 
ATOM   2123 C CG    . MET B 2 229 ? 75.781 0.069   -12.447 1.00 35.31  ? 230 MET A CG    1 
ATOM   2124 S SD    . MET B 2 229 ? 75.885 1.716   -13.226 1.00 42.54  ? 230 MET A SD    1 
ATOM   2125 C CE    . MET B 2 229 ? 76.507 2.652   -11.810 1.00 37.98  ? 230 MET A CE    1 
ATOM   2126 N N     . GLN B 2 230 ? 75.424 -2.887  -14.973 1.00 39.35  ? 231 GLN A N     1 
ATOM   2127 C CA    . GLN B 2 230 ? 76.385 -3.895  -15.341 1.00 42.24  ? 231 GLN A CA    1 
ATOM   2128 C C     . GLN B 2 230 ? 76.715 -3.740  -16.790 1.00 42.66  ? 231 GLN A C     1 
ATOM   2129 O O     . GLN B 2 230 ? 77.874 -3.548  -17.135 1.00 45.70  ? 231 GLN A O     1 
ATOM   2130 C CB    . GLN B 2 230 ? 75.755 -5.264  -15.142 1.00 46.45  ? 231 GLN A CB    1 
ATOM   2131 C CG    . GLN B 2 230 ? 76.697 -6.427  -14.926 1.00 66.03  ? 231 GLN A CG    1 
ATOM   2132 C CD    . GLN B 2 230 ? 75.918 -7.713  -14.683 1.00 100.00 ? 231 GLN A CD    1 
ATOM   2133 O OE1   . GLN B 2 230 ? 75.911 -8.242  -13.559 1.00 96.11  ? 231 GLN A OE1   1 
ATOM   2134 N NE2   . GLN B 2 230 ? 75.211 -8.195  -15.725 1.00 90.22  ? 231 GLN A NE2   1 
ATOM   2135 N N     . GLN B 2 231 ? 75.708 -3.829  -17.647 1.00 32.49  ? 232 GLN A N     1 
ATOM   2136 C CA    . GLN B 2 231 ? 75.983 -3.699  -19.063 1.00 31.07  ? 232 GLN A CA    1 
ATOM   2137 C C     . GLN B 2 231 ? 76.741 -2.414  -19.358 1.00 46.56  ? 232 GLN A C     1 
ATOM   2138 O O     . GLN B 2 231 ? 77.576 -2.379  -20.256 1.00 49.23  ? 232 GLN A O     1 
ATOM   2139 C CB    . GLN B 2 231 ? 74.723 -3.714  -19.863 1.00 29.54  ? 232 GLN A CB    1 
ATOM   2140 C CG    . GLN B 2 231 ? 74.129 -5.060  -20.135 1.00 87.83  ? 232 GLN A CG    1 
ATOM   2141 C CD    . GLN B 2 231 ? 73.069 -4.976  -21.247 1.00 100.00 ? 232 GLN A CD    1 
ATOM   2142 O OE1   . GLN B 2 231 ? 73.208 -4.182  -22.216 1.00 64.16  ? 232 GLN A OE1   1 
ATOM   2143 N NE2   . GLN B 2 231 ? 71.989 -5.770  -21.101 1.00 100.00 ? 232 GLN A NE2   1 
ATOM   2144 N N     . ILE B 2 232 ? 76.479 -1.353  -18.599 1.00 46.05  ? 233 ILE A N     1 
ATOM   2145 C CA    . ILE B 2 232 ? 77.201 -0.112  -18.850 1.00 45.69  ? 233 ILE A CA    1 
ATOM   2146 C C     . ILE B 2 232 ? 78.709 -0.185  -18.574 1.00 45.93  ? 233 ILE A C     1 
ATOM   2147 O O     . ILE B 2 232 ? 79.527 0.131   -19.445 1.00 48.15  ? 233 ILE A O     1 
ATOM   2148 C CB    . ILE B 2 232 ? 76.643 1.047   -18.070 1.00 47.80  ? 233 ILE A CB    1 
ATOM   2149 C CG1   . ILE B 2 232 ? 75.769 1.881   -18.980 1.00 44.31  ? 233 ILE A CG1   1 
ATOM   2150 C CG2   . ILE B 2 232 ? 77.780 1.859   -17.465 1.00 51.56  ? 233 ILE A CG2   1 
ATOM   2151 C CD1   . ILE B 2 232 ? 74.364 1.606   -18.710 1.00 50.79  ? 233 ILE A CD1   1 
ATOM   2152 N N     . LEU B 2 233 ? 79.065 -0.587  -17.363 1.00 38.10  ? 234 LEU A N     1 
ATOM   2153 C CA    . LEU B 2 233 ? 80.457 -0.693  -16.973 1.00 40.26  ? 234 LEU A CA    1 
ATOM   2154 C C     . LEU B 2 233 ? 81.122 -1.903  -17.582 1.00 51.71  ? 234 LEU A C     1 
ATOM   2155 O O     . LEU B 2 233 ? 82.332 -1.957  -17.656 1.00 51.16  ? 234 LEU A O     1 
ATOM   2156 C CB    . LEU B 2 233 ? 80.604 -0.715  -15.455 1.00 40.28  ? 234 LEU A CB    1 
ATOM   2157 C CG    . LEU B 2 233 ? 79.533 0.169   -14.841 1.00 48.00  ? 234 LEU A CG    1 
ATOM   2158 C CD1   . LEU B 2 233 ? 79.349 -0.097  -13.380 1.00 47.57  ? 234 LEU A CD1   1 
ATOM   2159 C CD2   . LEU B 2 233 ? 79.858 1.611   -15.116 1.00 57.42  ? 234 LEU A CD2   1 
ATOM   2160 N N     . SER B 2 234 ? 80.338 -2.876  -18.025 1.00 55.01  ? 235 SER A N     1 
ATOM   2161 C CA    . SER B 2 234 ? 80.917 -4.063  -18.630 1.00 57.41  ? 235 SER A CA    1 
ATOM   2162 C C     . SER B 2 234 ? 81.678 -3.707  -19.919 1.00 72.60  ? 235 SER A C     1 
ATOM   2163 O O     . SER B 2 234 ? 82.457 -4.510  -20.441 1.00 77.87  ? 235 SER A O     1 
ATOM   2164 C CB    . SER B 2 234 ? 79.845 -5.116  -18.904 1.00 60.40  ? 235 SER A CB    1 
ATOM   2165 O OG    . SER B 2 234 ? 80.136 -6.288  -18.150 1.00 90.67  ? 235 SER A OG    1 
ATOM   2166 N N     . GLN B 2 235 ? 81.463 -2.492  -20.421 1.00 68.68  ? 236 GLN A N     1 
ATOM   2167 C CA    . GLN B 2 235 ? 82.121 -2.043  -21.642 1.00 64.32  ? 236 GLN A CA    1 
ATOM   2168 C C     . GLN B 2 235 ? 83.568 -1.542  -21.664 1.00 61.92  ? 236 GLN A C     1 
ATOM   2169 O O     . GLN B 2 235 ? 84.121 -1.192  -20.607 1.00 55.81  ? 236 GLN A O     1 
ATOM   2170 C CB    . GLN B 2 235 ? 81.159 -1.468  -22.677 1.00 65.73  ? 236 GLN A CB    1 
ATOM   2171 C CG    . GLN B 2 235 ? 80.419 -0.233  -22.342 1.00 56.63  ? 236 GLN A CG    1 
ATOM   2172 C CD    . GLN B 2 235 ? 79.244 -0.165  -23.242 1.00 77.90  ? 236 GLN A CD    1 
ATOM   2173 O OE1   . GLN B 2 235 ? 79.252 0.543   -24.245 1.00 84.85  ? 236 GLN A OE1   1 
ATOM   2174 N NE2   . GLN B 2 235 ? 78.291 -1.046  -23.005 1.00 60.67  ? 236 GLN A NE2   1 
ATOM   2175 N N     . PRO B 2 236 ? 84.189 -1.539  -22.857 1.00 66.57  ? 237 PRO A N     1 
ATOM   2176 C CA    . PRO B 2 236 ? 85.593 -1.127  -22.987 1.00 68.47  ? 237 PRO A CA    1 
ATOM   2177 C C     . PRO B 2 236 ? 85.747 0.250   -22.454 1.00 76.35  ? 237 PRO A C     1 
ATOM   2178 O O     . PRO B 2 236 ? 86.604 0.523   -21.599 1.00 75.28  ? 237 PRO A O     1 
ATOM   2179 C CB    . PRO B 2 236 ? 85.789 -1.080  -24.504 1.00 70.42  ? 237 PRO A CB    1 
ATOM   2180 C CG    . PRO B 2 236 ? 84.418 -0.757  -25.043 1.00 72.93  ? 237 PRO A CG    1 
ATOM   2181 C CD    . PRO B 2 236 ? 83.558 -1.617  -24.195 1.00 67.45  ? 237 PRO A CD    1 
ATOM   2182 N N     . HIS B 2 237 ? 84.877 1.091   -23.013 1.00 79.81  ? 238 HIS A N     1 
ATOM   2183 C CA    . HIS B 2 237 ? 84.742 2.503   -22.730 1.00 81.42  ? 238 HIS A CA    1 
ATOM   2184 C C     . HIS B 2 237 ? 83.481 2.690   -21.893 1.00 73.94  ? 238 HIS A C     1 
ATOM   2185 O O     . HIS B 2 237 ? 82.388 2.238   -22.273 1.00 72.94  ? 238 HIS A O     1 
ATOM   2186 C CB    . HIS B 2 237 ? 84.616 3.294   -24.043 1.00 86.48  ? 238 HIS A CB    1 
ATOM   2187 C CG    . HIS B 2 237 ? 84.808 4.766   -23.856 1.00 95.51  ? 238 HIS A CG    1 
ATOM   2188 N ND1   . HIS B 2 237 ? 84.263 5.706   -24.707 1.00 100.00 ? 238 HIS A ND1   1 
ATOM   2189 C CD2   . HIS B 2 237 ? 85.474 5.467   -22.899 1.00 100.00 ? 238 HIS A CD2   1 
ATOM   2190 C CE1   . HIS B 2 237 ? 84.590 6.921   -24.287 1.00 100.00 ? 238 HIS A CE1   1 
ATOM   2191 N NE2   . HIS B 2 237 ? 85.322 6.804   -23.191 1.00 100.00 ? 238 HIS A NE2   1 
ATOM   2192 N N     . ARG B 2 238 ? 83.637 3.351   -20.752 1.00 61.26  ? 239 ARG A N     1 
ATOM   2193 C CA    . ARG B 2 238 ? 82.503 3.572   -19.883 1.00 57.54  ? 239 ARG A CA    1 
ATOM   2194 C C     . ARG B 2 238 ? 82.467 5.017   -19.373 1.00 49.82  ? 239 ARG A C     1 
ATOM   2195 O O     . ARG B 2 238 ? 83.524 5.648   -19.202 1.00 48.61  ? 239 ARG A O     1 
ATOM   2196 C CB    . ARG B 2 238 ? 82.605 2.604   -18.731 1.00 54.99  ? 239 ARG A CB    1 
ATOM   2197 C CG    . ARG B 2 238 ? 83.771 2.949   -17.896 1.00 67.67  ? 239 ARG A CG    1 
ATOM   2198 C CD    . ARG B 2 238 ? 83.662 2.256   -16.596 1.00 85.37  ? 239 ARG A CD    1 
ATOM   2199 N NE    . ARG B 2 238 ? 83.838 0.823   -16.812 1.00 100.00 ? 239 ARG A NE    1 
ATOM   2200 C CZ    . ARG B 2 238 ? 84.802 0.094   -16.250 1.00 100.00 ? 239 ARG A CZ    1 
ATOM   2201 N NH1   . ARG B 2 238 ? 85.680 0.663   -15.426 1.00 100.00 ? 239 ARG A NH1   1 
ATOM   2202 N NH2   . ARG B 2 238 ? 84.889 -1.208  -16.502 1.00 100.00 ? 239 ARG A NH2   1 
ATOM   2203 N N     . PRO B 2 239 ? 81.244 5.521   -19.151 1.00 35.61  ? 240 PRO A N     1 
ATOM   2204 C CA    . PRO B 2 239 ? 81.006 6.884   -18.679 1.00 31.27  ? 240 PRO A CA    1 
ATOM   2205 C C     . PRO B 2 239 ? 81.564 7.087   -17.314 1.00 35.84  ? 240 PRO A C     1 
ATOM   2206 O O     . PRO B 2 239 ? 82.030 6.140   -16.645 1.00 35.09  ? 240 PRO A O     1 
ATOM   2207 C CB    . PRO B 2 239 ? 79.488 6.967   -18.562 1.00 30.90  ? 240 PRO A CB    1 
ATOM   2208 C CG    . PRO B 2 239 ? 79.006 5.533   -18.572 1.00 35.02  ? 240 PRO A CG    1 
ATOM   2209 C CD    . PRO B 2 239 ? 80.188 4.619   -18.686 1.00 32.41  ? 240 PRO A CD    1 
ATOM   2210 N N     . THR B 2 240 ? 81.496 8.338   -16.891 1.00 28.98  ? 241 THR A N     1 
ATOM   2211 C CA    . THR B 2 240 ? 82.023 8.700   -15.590 1.00 27.89  ? 241 THR A CA    1 
ATOM   2212 C C     . THR B 2 240 ? 80.870 9.044   -14.738 1.00 33.82  ? 241 THR A C     1 
ATOM   2213 O O     . THR B 2 240 ? 80.999 9.396   -13.575 1.00 33.64  ? 241 THR A O     1 
ATOM   2214 C CB    . THR B 2 240 ? 82.994 9.896   -15.723 1.00 29.39  ? 241 THR A CB    1 
ATOM   2215 O OG1   . THR B 2 240 ? 82.257 11.114  -15.800 1.00 43.66  ? 241 THR A OG1   1 
ATOM   2216 C CG2   . THR B 2 240 ? 83.686 9.789   -17.041 1.00 48.61  ? 241 THR A CG2   1 
ATOM   2217 N N     . ALA B 2 241 ? 79.699 8.949   -15.323 1.00 33.56  ? 242 ALA A N     1 
ATOM   2218 C CA    . ALA B 2 241 ? 78.565 9.287   -14.521 1.00 33.36  ? 242 ALA A CA    1 
ATOM   2219 C C     . ALA B 2 241 ? 77.333 8.701   -15.120 1.00 32.92  ? 242 ALA A C     1 
ATOM   2220 O O     . ALA B 2 241 ? 77.216 8.601   -16.353 1.00 30.87  ? 242 ALA A O     1 
ATOM   2221 C CB    . ALA B 2 241 ? 78.448 10.800  -14.445 1.00 33.57  ? 242 ALA A CB    1 
ATOM   2222 N N     . VAL B 2 242 ? 76.414 8.331   -14.238 1.00 27.66  ? 243 VAL A N     1 
ATOM   2223 C CA    . VAL B 2 242 ? 75.158 7.776   -14.681 1.00 27.91  ? 243 VAL A CA    1 
ATOM   2224 C C     . VAL B 2 242 ? 73.890 8.358   -14.100 1.00 24.92  ? 243 VAL A C     1 
ATOM   2225 O O     . VAL B 2 242 ? 73.733 8.580   -12.864 1.00 16.16  ? 243 VAL A O     1 
ATOM   2226 C CB    . VAL B 2 242 ? 75.105 6.283   -14.555 1.00 30.28  ? 243 VAL A CB    1 
ATOM   2227 C CG1   . VAL B 2 242 ? 73.699 5.811   -14.619 1.00 26.35  ? 243 VAL A CG1   1 
ATOM   2228 C CG2   . VAL B 2 242 ? 75.793 5.727   -15.694 1.00 32.66  ? 243 VAL A CG2   1 
ATOM   2229 N N     . PHE B 2 243 ? 72.979 8.582   -15.026 1.00 19.76  ? 244 PHE A N     1 
ATOM   2230 C CA    . PHE B 2 243 ? 71.718 9.108   -14.625 1.00 24.72  ? 244 PHE A CA    1 
ATOM   2231 C C     . PHE B 2 243 ? 70.742 7.958   -14.638 1.00 33.56  ? 244 PHE A C     1 
ATOM   2232 O O     . PHE B 2 243 ? 70.496 7.358   -15.692 1.00 33.88  ? 244 PHE A O     1 
ATOM   2233 C CB    . PHE B 2 243 ? 71.202 10.161  -15.563 1.00 26.32  ? 244 PHE A CB    1 
ATOM   2234 C CG    . PHE B 2 243 ? 69.813 10.517  -15.246 1.00 27.17  ? 244 PHE A CG    1 
ATOM   2235 C CD1   . PHE B 2 243 ? 69.440 10.569  -13.908 1.00 32.07  ? 244 PHE A CD1   1 
ATOM   2236 C CD2   . PHE B 2 243 ? 68.869 10.680  -16.226 1.00 23.97  ? 244 PHE A CD2   1 
ATOM   2237 C CE1   . PHE B 2 243 ? 68.115 10.880  -13.535 1.00 32.48  ? 244 PHE A CE1   1 
ATOM   2238 C CE2   . PHE B 2 243 ? 67.552 10.997  -15.869 1.00 26.15  ? 244 PHE A CE2   1 
ATOM   2239 C CZ    . PHE B 2 243 ? 67.172 11.085  -14.511 1.00 25.41  ? 244 PHE A CZ    1 
ATOM   2240 N N     . CYS B 2 244 ? 70.189 7.649   -13.473 1.00 31.21  ? 245 CYS A N     1 
ATOM   2241 C CA    . CYS B 2 244 ? 69.242 6.538   -13.333 1.00 32.09  ? 245 CYS A CA    1 
ATOM   2242 C C     . CYS B 2 244 ? 67.789 6.993   -13.023 1.00 34.96  ? 245 CYS A C     1 
ATOM   2243 O O     . CYS B 2 244 ? 67.496 7.628   -11.974 1.00 37.44  ? 245 CYS A O     1 
ATOM   2244 C CB    . CYS B 2 244 ? 69.787 5.558   -12.284 1.00 33.27  ? 245 CYS A CB    1 
ATOM   2245 S SG    . CYS B 2 244 ? 68.824 4.044   -11.969 1.00 37.44  ? 245 CYS A SG    1 
ATOM   2246 N N     . GLY B 2 245 ? 66.905 6.648   -13.964 1.00 22.97  ? 246 GLY A N     1 
ATOM   2247 C CA    . GLY B 2 245 ? 65.469 6.963   -13.965 1.00 22.15  ? 246 GLY A CA    1 
ATOM   2248 C C     . GLY B 2 245 ? 64.615 6.955   -12.696 1.00 28.37  ? 246 GLY A C     1 
ATOM   2249 O O     . GLY B 2 245 ? 63.560 7.598   -12.679 1.00 26.64  ? 246 GLY A O     1 
ATOM   2250 N N     . GLY B 2 246 ? 65.058 6.221   -11.668 1.00 22.80  ? 247 GLY A N     1 
ATOM   2251 C CA    . GLY B 2 246 ? 64.365 6.093   -10.392 1.00 19.43  ? 247 GLY A CA    1 
ATOM   2252 C C     . GLY B 2 246 ? 65.308 5.551   -9.295  1.00 28.98  ? 247 GLY A C     1 
ATOM   2253 O O     . GLY B 2 246 ? 66.282 4.803   -9.546  1.00 26.16  ? 247 GLY A O     1 
ATOM   2254 N N     . ASP B 2 247 ? 65.007 5.934   -8.059  1.00 27.92  ? 248 ASP A N     1 
ATOM   2255 C CA    . ASP B 2 247 ? 65.820 5.506   -6.941  1.00 24.76  ? 248 ASP A CA    1 
ATOM   2256 C C     . ASP B 2 247 ? 66.019 4.016   -6.722  1.00 31.37  ? 248 ASP A C     1 
ATOM   2257 O O     . ASP B 2 247 ? 67.118 3.583   -6.389  1.00 30.89  ? 248 ASP A O     1 
ATOM   2258 C CB    . ASP B 2 247 ? 65.402 6.218   -5.677  1.00 26.34  ? 248 ASP A CB    1 
ATOM   2259 C CG    . ASP B 2 247 ? 65.567 7.734   -5.780  1.00 41.56  ? 248 ASP A CG    1 
ATOM   2260 O OD1   . ASP B 2 247 ? 65.877 8.218   -6.889  1.00 47.92  ? 248 ASP A OD1   1 
ATOM   2261 O OD2   . ASP B 2 247 ? 65.379 8.436   -4.754  1.00 35.35  ? 248 ASP A OD2   1 
ATOM   2262 N N     . ILE B 2 248 ? 64.979 3.210   -6.908  1.00 33.99  ? 249 ILE A N     1 
ATOM   2263 C CA    . ILE B 2 248 ? 65.164 1.765   -6.694  1.00 33.51  ? 249 ILE A CA    1 
ATOM   2264 C C     . ILE B 2 248 ? 66.090 1.119   -7.697  1.00 32.67  ? 249 ILE A C     1 
ATOM   2265 O O     . ILE B 2 248 ? 66.985 0.380   -7.310  1.00 31.18  ? 249 ILE A O     1 
ATOM   2266 C CB    . ILE B 2 248 ? 63.895 0.953   -6.718  1.00 36.94  ? 249 ILE A CB    1 
ATOM   2267 C CG1   . ILE B 2 248 ? 62.823 1.546   -5.795  1.00 32.13  ? 249 ILE A CG1   1 
ATOM   2268 C CG2   . ILE B 2 248 ? 64.252 -0.513  -6.447  1.00 38.70  ? 249 ILE A CG2   1 
ATOM   2269 C CD1   . ILE B 2 248 ? 63.227 1.564   -4.409  1.00 1.00   ? 249 ILE A CD1   1 
ATOM   2270 N N     . MET B 2 249 ? 65.857 1.384   -8.980  1.00 27.58  ? 250 MET A N     1 
ATOM   2271 C CA    . MET B 2 249 ? 66.728 0.831   -10.004 1.00 25.53  ? 250 MET A CA    1 
ATOM   2272 C C     . MET B 2 249 ? 68.100 1.403   -9.585  1.00 32.20  ? 250 MET A C     1 
ATOM   2273 O O     . MET B 2 249 ? 69.138 0.777   -9.759  1.00 23.20  ? 250 MET A O     1 
ATOM   2274 C CB    . MET B 2 249 ? 66.398 1.442   -11.364 1.00 26.02  ? 250 MET A CB    1 
ATOM   2275 C CG    . MET B 2 249 ? 65.256 0.816   -12.128 1.00 31.05  ? 250 MET A CG    1 
ATOM   2276 S SD    . MET B 2 249 ? 65.063 1.446   -13.880 1.00 38.77  ? 250 MET A SD    1 
ATOM   2277 C CE    . MET B 2 249 ? 66.082 2.799   -13.873 1.00 36.97  ? 250 MET A CE    1 
ATOM   2278 N N     . ALA B 2 250 ? 68.094 2.610   -9.025  1.00 33.21  ? 251 ALA A N     1 
ATOM   2279 C CA    . ALA B 2 250 ? 69.365 3.204   -8.638  1.00 32.08  ? 251 ALA A CA    1 
ATOM   2280 C C     . ALA B 2 250 ? 70.049 2.329   -7.682  1.00 31.29  ? 251 ALA A C     1 
ATOM   2281 O O     . ALA B 2 250 ? 71.231 1.995   -7.818  1.00 27.68  ? 251 ALA A O     1 
ATOM   2282 C CB    . ALA B 2 250 ? 69.152 4.502   -8.004  1.00 31.48  ? 251 ALA A CB    1 
ATOM   2283 N N     . MET B 2 251 ? 69.269 1.983   -6.684  1.00 26.50  ? 252 MET A N     1 
ATOM   2284 C CA    . MET B 2 251 ? 69.805 1.174   -5.669  1.00 27.12  ? 252 MET A CA    1 
ATOM   2285 C C     . MET B 2 251 ? 70.293 -0.093  -6.322  1.00 34.64  ? 252 MET A C     1 
ATOM   2286 O O     . MET B 2 251 ? 71.163 -0.749  -5.819  1.00 36.99  ? 252 MET A O     1 
ATOM   2287 C CB    . MET B 2 251 ? 68.826 1.004   -4.512  1.00 29.45  ? 252 MET A CB    1 
ATOM   2288 C CG    . MET B 2 251 ? 68.063 -0.302  -4.478  1.00 36.11  ? 252 MET A CG    1 
ATOM   2289 S SD    . MET B 2 251 ? 67.945 -1.086  -2.821  1.00 44.50  ? 252 MET A SD    1 
ATOM   2290 C CE    . MET B 2 251 ? 67.531 0.288   -1.714  1.00 44.86  ? 252 MET A CE    1 
ATOM   2291 N N     . GLY B 2 252 ? 69.781 -0.433  -7.487  1.00 31.97  ? 253 GLY A N     1 
ATOM   2292 C CA    . GLY B 2 252 ? 70.263 -1.679  -8.107  1.00 30.21  ? 253 GLY A CA    1 
ATOM   2293 C C     . GLY B 2 252 ? 71.599 -1.467  -8.778  1.00 36.87  ? 253 GLY A C     1 
ATOM   2294 O O     . GLY B 2 252 ? 72.441 -2.323  -8.782  1.00 38.72  ? 253 GLY A O     1 
ATOM   2295 N N     . ALA B 2 253 ? 71.782 -0.298  -9.353  1.00 32.48  ? 254 ALA A N     1 
ATOM   2296 C CA    . ALA B 2 253 ? 72.995 0.006   -10.029 1.00 25.51  ? 254 ALA A CA    1 
ATOM   2297 C C     . ALA B 2 253 ? 74.094 0.148   -8.963  1.00 34.12  ? 254 ALA A C     1 
ATOM   2298 O O     . ALA B 2 253 ? 75.287 -0.128  -9.215  1.00 35.33  ? 254 ALA A O     1 
ATOM   2299 C CB    . ALA B 2 253 ? 72.792 1.236   -10.793 1.00 24.65  ? 254 ALA A CB    1 
ATOM   2300 N N     . LEU B 2 254 ? 73.730 0.561   -7.755  1.00 24.31  ? 255 LEU A N     1 
ATOM   2301 C CA    . LEU B 2 254 ? 74.791 0.661   -6.786  1.00 21.53  ? 255 LEU A CA    1 
ATOM   2302 C C     . LEU B 2 254 ? 75.337 -0.764  -6.510  1.00 37.82  ? 255 LEU A C     1 
ATOM   2303 O O     . LEU B 2 254 ? 76.551 -0.973  -6.475  1.00 41.62  ? 255 LEU A O     1 
ATOM   2304 C CB    . LEU B 2 254 ? 74.290 1.265   -5.508  1.00 21.57  ? 255 LEU A CB    1 
ATOM   2305 C CG    . LEU B 2 254 ? 74.292 2.760   -5.271  1.00 29.56  ? 255 LEU A CG    1 
ATOM   2306 C CD1   . LEU B 2 254 ? 74.802 3.515   -6.513  1.00 29.62  ? 255 LEU A CD1   1 
ATOM   2307 C CD2   . LEU B 2 254 ? 72.849 3.132   -4.893  1.00 35.81  ? 255 LEU A CD2   1 
ATOM   2308 N N     . CYS B 2 255 ? 74.450 -1.747  -6.318  1.00 39.52  ? 256 CYS A N     1 
ATOM   2309 C CA    . CYS B 2 255 ? 74.857 -3.144  -6.039  1.00 42.29  ? 256 CYS A CA    1 
ATOM   2310 C C     . CYS B 2 255 ? 75.900 -3.640  -7.023  1.00 45.74  ? 256 CYS A C     1 
ATOM   2311 O O     . CYS B 2 255 ? 77.044 -3.923  -6.678  1.00 44.89  ? 256 CYS A O     1 
ATOM   2312 C CB    . CYS B 2 255 ? 73.654 -4.086  -6.150  1.00 44.15  ? 256 CYS A CB    1 
ATOM   2313 S SG    . CYS B 2 255 ? 73.696 -5.633  -5.171  1.00 48.20  ? 256 CYS A SG    1 
ATOM   2314 N N     . ALA B 2 256 ? 75.470 -3.755  -8.263  1.00 41.29  ? 257 ALA A N     1 
ATOM   2315 C CA    . ALA B 2 256 ? 76.323 -4.208  -9.327  1.00 43.81  ? 257 ALA A CA    1 
ATOM   2316 C C     . ALA B 2 256 ? 77.699 -3.547  -9.367  1.00 47.97  ? 257 ALA A C     1 
ATOM   2317 O O     . ALA B 2 256 ? 78.715 -4.222  -9.527  1.00 52.17  ? 257 ALA A O     1 
ATOM   2318 C CB    . ALA B 2 256 ? 75.606 -4.024  -10.671 1.00 44.76  ? 257 ALA A CB    1 
ATOM   2319 N N     . ALA B 2 257 ? 77.727 -2.228  -9.240  1.00 39.18  ? 258 ALA A N     1 
ATOM   2320 C CA    . ALA B 2 257 ? 78.983 -1.495  -9.291  1.00 36.29  ? 258 ALA A CA    1 
ATOM   2321 C C     . ALA B 2 257 ? 79.855 -2.013  -8.197  1.00 34.37  ? 258 ALA A C     1 
ATOM   2322 O O     . ALA B 2 257 ? 81.042 -2.287  -8.388  1.00 25.61  ? 258 ALA A O     1 
ATOM   2323 C CB    . ALA B 2 257 ? 78.728 -0.036  -9.112  1.00 37.62  ? 258 ALA A CB    1 
ATOM   2324 N N     . ASP B 2 258 ? 79.242 -2.168  -7.033  1.00 35.16  ? 259 ASP A N     1 
ATOM   2325 C CA    . ASP B 2 258 ? 79.991 -2.674  -5.896  1.00 37.94  ? 259 ASP A CA    1 
ATOM   2326 C C     . ASP B 2 258 ? 80.410 -4.090  -6.213  1.00 40.33  ? 259 ASP A C     1 
ATOM   2327 O O     . ASP B 2 258 ? 81.508 -4.506  -5.909  1.00 45.40  ? 259 ASP A O     1 
ATOM   2328 C CB    . ASP B 2 258 ? 79.139 -2.636  -4.632  1.00 40.99  ? 259 ASP A CB    1 
ATOM   2329 C CG    . ASP B 2 258 ? 79.699 -3.489  -3.496  1.00 70.14  ? 259 ASP A CG    1 
ATOM   2330 O OD1   . ASP B 2 258 ? 79.303 -4.681  -3.423  1.00 86.68  ? 259 ASP A OD1   1 
ATOM   2331 O OD2   . ASP B 2 258 ? 80.466 -2.948  -2.648  1.00 72.34  ? 259 ASP A OD2   1 
ATOM   2332 N N     . GLU B 2 259 ? 79.525 -4.839  -6.826  1.00 34.16  ? 260 GLU A N     1 
ATOM   2333 C CA    . GLU B 2 259 ? 79.869 -6.190  -7.143  1.00 37.41  ? 260 GLU A CA    1 
ATOM   2334 C C     . GLU B 2 259 ? 81.007 -6.273  -8.174  1.00 51.11  ? 260 GLU A C     1 
ATOM   2335 O O     . GLU B 2 259 ? 81.840 -7.184  -8.076  1.00 55.54  ? 260 GLU A O     1 
ATOM   2336 C CB    . GLU B 2 259 ? 78.620 -7.078  -7.369  1.00 38.97  ? 260 GLU A CB    1 
ATOM   2337 C CG    . GLU B 2 259 ? 77.645 -6.963  -6.160  1.00 73.59  ? 260 GLU A CG    1 
ATOM   2338 C CD    . GLU B 2 259 ? 76.654 -8.118  -5.992  1.00 88.23  ? 260 GLU A CD    1 
ATOM   2339 O OE1   . GLU B 2 259 ? 76.497 -8.890  -6.952  1.00 36.75  ? 260 GLU A OE1   1 
ATOM   2340 O OE2   . GLU B 2 259 ? 76.021 -8.221  -4.903  1.00 72.70  ? 260 GLU A OE2   1 
ATOM   2341 N N     . MET B 2 260 ? 81.072 -5.329  -9.124  1.00 42.57  ? 261 MET A N     1 
ATOM   2342 C CA    . MET B 2 260 ? 82.147 -5.357  -10.101 1.00 42.03  ? 261 MET A CA    1 
ATOM   2343 C C     . MET B 2 260 ? 83.343 -4.800  -9.373  1.00 42.11  ? 261 MET A C     1 
ATOM   2344 O O     . MET B 2 260 ? 84.405 -4.671  -9.927  1.00 44.75  ? 261 MET A O     1 
ATOM   2345 C CB    . MET B 2 260 ? 81.955 -4.355  -11.225 1.00 49.08  ? 261 MET A CB    1 
ATOM   2346 C CG    . MET B 2 260 ? 80.575 -3.971  -11.579 1.00 59.39  ? 261 MET A CG    1 
ATOM   2347 S SD    . MET B 2 260 ? 80.200 -4.948  -13.005 1.00 68.79  ? 261 MET A SD    1 
ATOM   2348 C CE    . MET B 2 260 ? 80.969 -3.966  -14.361 1.00 65.58  ? 261 MET A CE    1 
ATOM   2349 N N     . GLY B 2 261 ? 83.195 -4.411  -8.132  1.00 35.84  ? 262 GLY A N     1 
ATOM   2350 C CA    . GLY B 2 261 ? 84.361 -3.865  -7.471  1.00 33.52  ? 262 GLY A CA    1 
ATOM   2351 C C     . GLY B 2 261 ? 84.557 -2.391  -7.806  1.00 45.85  ? 262 GLY A C     1 
ATOM   2352 O O     . GLY B 2 261 ? 85.602 -1.853  -7.472  1.00 46.00  ? 262 GLY A O     1 
ATOM   2353 N N     . LEU B 2 262 ? 83.561 -1.736  -8.435  1.00 47.82  ? 263 LEU A N     1 
ATOM   2354 C CA    . LEU B 2 262 ? 83.626 -0.288  -8.786  1.00 44.03  ? 263 LEU A CA    1 
ATOM   2355 C C     . LEU B 2 262 ? 83.197 0.545   -7.611  1.00 47.32  ? 263 LEU A C     1 
ATOM   2356 O O     . LEU B 2 262 ? 82.326 0.154   -6.841  1.00 48.25  ? 263 LEU A O     1 
ATOM   2357 C CB    . LEU B 2 262 ? 82.724 0.087   -9.942  1.00 42.64  ? 263 LEU A CB    1 
ATOM   2358 C CG    . LEU B 2 262 ? 83.634 0.084   -11.150 1.00 44.29  ? 263 LEU A CG    1 
ATOM   2359 C CD1   . LEU B 2 262 ? 84.773 -0.809  -10.719 1.00 42.54  ? 263 LEU A CD1   1 
ATOM   2360 C CD2   . LEU B 2 262 ? 82.937 -0.488  -12.384 1.00 43.31  ? 263 LEU A CD2   1 
ATOM   2361 N N     . ARG B 2 263 ? 83.807 1.708   -7.482  1.00 42.94  ? 264 ARG A N     1 
ATOM   2362 C CA    . ARG B 2 263 ? 83.507 2.595   -6.372  1.00 41.46  ? 264 ARG A CA    1 
ATOM   2363 C C     . ARG B 2 263 ? 82.562 3.736   -6.639  1.00 44.31  ? 264 ARG A C     1 
ATOM   2364 O O     . ARG B 2 263 ? 82.702 4.455   -7.634  1.00 41.43  ? 264 ARG A O     1 
ATOM   2365 C CB    . ARG B 2 263 ? 84.803 3.199   -5.886  1.00 40.48  ? 264 ARG A CB    1 
ATOM   2366 C CG    . ARG B 2 263 ? 85.181 2.745   -4.516  1.00 66.95  ? 264 ARG A CG    1 
ATOM   2367 C CD    . ARG B 2 263 ? 83.956 2.746   -3.582  1.00 100.00 ? 264 ARG A CD    1 
ATOM   2368 N NE    . ARG B 2 263 ? 84.238 3.438   -2.310  1.00 100.00 ? 264 ARG A NE    1 
ATOM   2369 C CZ    . ARG B 2 263 ? 83.344 3.682   -1.333  1.00 100.00 ? 264 ARG A CZ    1 
ATOM   2370 N NH1   . ARG B 2 263 ? 82.053 3.288   -1.441  1.00 100.00 ? 264 ARG A NH1   1 
ATOM   2371 N NH2   . ARG B 2 263 ? 83.743 4.333   -0.225  1.00 100.00 ? 264 ARG A NH2   1 
ATOM   2372 N N     . VAL B 2 264 ? 81.594 3.921   -5.741  1.00 39.23  ? 265 VAL A N     1 
ATOM   2373 C CA    . VAL B 2 264 ? 80.672 5.043   -5.917  1.00 34.88  ? 265 VAL A CA    1 
ATOM   2374 C C     . VAL B 2 264 ? 80.803 5.999   -4.767  1.00 36.32  ? 265 VAL A C     1 
ATOM   2375 O O     . VAL B 2 264 ? 80.773 5.609   -3.590  1.00 38.09  ? 265 VAL A O     1 
ATOM   2376 C CB    . VAL B 2 264 ? 79.252 4.696   -6.202  1.00 35.82  ? 265 VAL A CB    1 
ATOM   2377 C CG1   . VAL B 2 264 ? 78.516 5.946   -6.433  1.00 34.59  ? 265 VAL A CG1   1 
ATOM   2378 C CG2   . VAL B 2 264 ? 79.160 3.796   -7.444  1.00 35.53  ? 265 VAL A CG2   1 
ATOM   2379 N N     . PRO B 2 265 ? 81.029 7.259   -5.105  1.00 29.55  ? 266 PRO A N     1 
ATOM   2380 C CA    . PRO B 2 265 ? 81.073 7.731   -6.464  1.00 29.65  ? 266 PRO A CA    1 
ATOM   2381 C C     . PRO B 2 265 ? 82.445 7.817   -7.079  1.00 37.90  ? 266 PRO A C     1 
ATOM   2382 O O     . PRO B 2 265 ? 82.602 8.308   -8.207  1.00 46.43  ? 266 PRO A O     1 
ATOM   2383 C CB    . PRO B 2 265 ? 80.604 9.163   -6.284  1.00 31.27  ? 266 PRO A CB    1 
ATOM   2384 C CG    . PRO B 2 265 ? 81.149 9.539   -4.984  1.00 31.86  ? 266 PRO A CG    1 
ATOM   2385 C CD    . PRO B 2 265 ? 81.440 8.319   -4.188  1.00 24.94  ? 266 PRO A CD    1 
ATOM   2386 N N     . GLN B 2 266 ? 83.441 7.361   -6.353  1.00 32.03  ? 267 GLN A N     1 
ATOM   2387 C CA    . GLN B 2 266 ? 84.805 7.412   -6.845  1.00 34.14  ? 267 GLN A CA    1 
ATOM   2388 C C     . GLN B 2 266 ? 85.100 6.846   -8.209  1.00 38.78  ? 267 GLN A C     1 
ATOM   2389 O O     . GLN B 2 266 ? 85.932 7.382   -8.909  1.00 42.64  ? 267 GLN A O     1 
ATOM   2390 C CB    . GLN B 2 266 ? 85.743 6.785   -5.861  1.00 38.35  ? 267 GLN A CB    1 
ATOM   2391 C CG    . GLN B 2 266 ? 85.704 7.437   -4.509  1.00 79.67  ? 267 GLN A CG    1 
ATOM   2392 C CD    . GLN B 2 266 ? 84.630 6.838   -3.668  1.00 99.74  ? 267 GLN A CD    1 
ATOM   2393 O OE1   . GLN B 2 266 ? 83.679 6.243   -4.193  1.00 94.22  ? 267 GLN A OE1   1 
ATOM   2394 N NE2   . GLN B 2 266 ? 84.758 6.987   -2.352  1.00 97.76  ? 267 GLN A NE2   1 
ATOM   2395 N N     . ASP B 2 267 ? 84.450 5.765   -8.602  1.00 32.87  ? 268 ASP A N     1 
ATOM   2396 C CA    . ASP B 2 267 ? 84.722 5.233   -9.923  1.00 30.22  ? 268 ASP A CA    1 
ATOM   2397 C C     . ASP B 2 267 ? 83.609 5.622   -10.856 1.00 37.49  ? 268 ASP A C     1 
ATOM   2398 O O     . ASP B 2 267 ? 83.817 5.726   -12.056 1.00 46.39  ? 268 ASP A O     1 
ATOM   2399 C CB    . ASP B 2 267 ? 84.965 3.725   -9.888  1.00 32.27  ? 268 ASP A CB    1 
ATOM   2400 C CG    . ASP B 2 267 ? 86.222 3.392   -9.125  1.00 50.03  ? 268 ASP A CG    1 
ATOM   2401 O OD1   . ASP B 2 267 ? 87.197 4.158   -9.310  1.00 59.07  ? 268 ASP A OD1   1 
ATOM   2402 O OD2   . ASP B 2 267 ? 86.223 2.457   -8.288  1.00 41.72  ? 268 ASP A OD2   1 
ATOM   2403 N N     . VAL B 2 268 ? 82.422 5.849   -10.308 1.00 32.30  ? 269 VAL A N     1 
ATOM   2404 C CA    . VAL B 2 268 ? 81.273 6.240   -11.126 1.00 29.30  ? 269 VAL A CA    1 
ATOM   2405 C C     . VAL B 2 268 ? 80.356 6.992   -10.236 1.00 39.98  ? 269 VAL A C     1 
ATOM   2406 O O     . VAL B 2 268 ? 80.060 6.516   -9.120  1.00 41.70  ? 269 VAL A O     1 
ATOM   2407 C CB    . VAL B 2 268 ? 80.368 5.065   -11.534 1.00 29.05  ? 269 VAL A CB    1 
ATOM   2408 C CG1   . VAL B 2 268 ? 80.280 4.917   -12.996 1.00 29.66  ? 269 VAL A CG1   1 
ATOM   2409 C CG2   . VAL B 2 268 ? 80.662 3.800   -10.807 1.00 28.41  ? 269 VAL A CG2   1 
ATOM   2410 N N     . SER B 2 269 ? 79.873 8.135   -10.725 1.00 35.86  ? 270 SER A N     1 
ATOM   2411 C CA    . SER B 2 269 ? 78.935 8.907   -9.925  1.00 35.00  ? 270 SER A CA    1 
ATOM   2412 C C     . SER B 2 269 ? 77.582 8.479   -10.436 1.00 39.62  ? 270 SER A C     1 
ATOM   2413 O O     . SER B 2 269 ? 77.418 8.094   -11.609 1.00 40.03  ? 270 SER A O     1 
ATOM   2414 C CB    . SER B 2 269 ? 79.122 10.433  -10.035 1.00 37.09  ? 270 SER A CB    1 
ATOM   2415 O OG    . SER B 2 269 ? 80.484 10.839  -10.030 1.00 51.89  ? 270 SER A OG    1 
ATOM   2416 N N     . LEU B 2 270 ? 76.602 8.544   -9.561  1.00 35.39  ? 271 LEU A N     1 
ATOM   2417 C CA    . LEU B 2 270 ? 75.292 8.142   -9.978  1.00 34.62  ? 271 LEU A CA    1 
ATOM   2418 C C     . LEU B 2 270 ? 74.246 9.079   -9.451  1.00 37.05  ? 271 LEU A C     1 
ATOM   2419 O O     . LEU B 2 270 ? 74.191 9.351   -8.253  1.00 37.94  ? 271 LEU A O     1 
ATOM   2420 C CB    . LEU B 2 270 ? 75.042 6.794   -9.347  1.00 35.83  ? 271 LEU A CB    1 
ATOM   2421 C CG    . LEU B 2 270 ? 73.741 6.063   -9.600  1.00 43.60  ? 271 LEU A CG    1 
ATOM   2422 C CD1   . LEU B 2 270 ? 73.389 6.190   -11.077 1.00 48.07  ? 271 LEU A CD1   1 
ATOM   2423 C CD2   . LEU B 2 270 ? 73.946 4.603   -9.224  1.00 46.61  ? 271 LEU A CD2   1 
ATOM   2424 N N     . ILE B 2 271 ? 73.391 9.576   -10.327 1.00 29.55  ? 272 ILE A N     1 
ATOM   2425 C CA    . ILE B 2 271 ? 72.345 10.445  -9.846  1.00 25.53  ? 272 ILE A CA    1 
ATOM   2426 C C     . ILE B 2 271 ? 71.009 9.699   -9.954  1.00 33.35  ? 272 ILE A C     1 
ATOM   2427 O O     . ILE B 2 271 ? 70.733 8.993   -10.959 1.00 30.82  ? 272 ILE A O     1 
ATOM   2428 C CB    . ILE B 2 271 ? 72.281 11.703  -10.613 1.00 27.02  ? 272 ILE A CB    1 
ATOM   2429 C CG1   . ILE B 2 271 ? 71.338 12.641  -9.870  1.00 26.18  ? 272 ILE A CG1   1 
ATOM   2430 C CG2   . ILE B 2 271 ? 71.919 11.420  -12.106 1.00 22.41  ? 272 ILE A CG2   1 
ATOM   2431 C CD1   . ILE B 2 271 ? 71.282 13.971  -10.492 1.00 38.96  ? 272 ILE A CD1   1 
ATOM   2432 N N     . GLY B 2 272 ? 70.167 9.832   -8.931  1.00 31.31  ? 273 GLY A N     1 
ATOM   2433 C CA    . GLY B 2 272 ? 68.895 9.114   -8.973  1.00 29.78  ? 273 GLY A CA    1 
ATOM   2434 C C     . GLY B 2 272 ? 67.702 9.925   -9.399  1.00 31.87  ? 273 GLY A C     1 
ATOM   2435 O O     . GLY B 2 272 ? 67.808 10.913  -10.099 1.00 25.82  ? 273 GLY A O     1 
ATOM   2436 N N     . TYR B 2 273 ? 66.540 9.486   -8.957  1.00 31.19  ? 274 TYR A N     1 
ATOM   2437 C CA    . TYR B 2 273 ? 65.330 10.184  -9.287  1.00 26.20  ? 274 TYR A CA    1 
ATOM   2438 C C     . TYR B 2 273 ? 64.135 9.629   -8.631  1.00 21.23  ? 274 TYR A C     1 
ATOM   2439 O O     . TYR B 2 273 ? 63.673 8.557   -9.051  1.00 11.95  ? 274 TYR A O     1 
ATOM   2440 C CB    . TYR B 2 273 ? 65.056 10.123  -10.758 1.00 28.41  ? 274 TYR A CB    1 
ATOM   2441 C CG    . TYR B 2 273 ? 64.153 11.260  -11.140 1.00 35.93  ? 274 TYR A CG    1 
ATOM   2442 C CD1   . TYR B 2 273 ? 63.020 11.549  -10.403 1.00 35.71  ? 274 TYR A CD1   1 
ATOM   2443 C CD2   . TYR B 2 273 ? 64.445 12.068  -12.222 1.00 38.94  ? 274 TYR A CD2   1 
ATOM   2444 C CE1   . TYR B 2 273 ? 62.209 12.584  -10.722 1.00 37.22  ? 274 TYR A CE1   1 
ATOM   2445 C CE2   . TYR B 2 273 ? 63.612 13.116  -12.557 1.00 41.97  ? 274 TYR A CE2   1 
ATOM   2446 C CZ    . TYR B 2 273 ? 62.492 13.375  -11.800 1.00 42.68  ? 274 TYR A CZ    1 
ATOM   2447 O OH    . TYR B 2 273 ? 61.656 14.425  -12.119 1.00 28.84  ? 274 TYR A OH    1 
ATOM   2448 N N     . ASP B 2 274 ? 63.631 10.418  -7.666  1.00 23.24  ? 275 ASP A N     1 
ATOM   2449 C CA    . ASP B 2 274 ? 62.416 10.137  -6.876  1.00 24.26  ? 275 ASP A CA    1 
ATOM   2450 C C     . ASP B 2 274 ? 62.479 10.587  -5.442  1.00 32.18  ? 275 ASP A C     1 
ATOM   2451 O O     . ASP B 2 274 ? 61.491 10.999  -4.867  1.00 35.66  ? 275 ASP A O     1 
ATOM   2452 C CB    . ASP B 2 274 ? 62.070 8.643   -6.849  1.00 24.21  ? 275 ASP A CB    1 
ATOM   2453 C CG    . ASP B 2 274 ? 61.207 8.225   -8.014  1.00 22.75  ? 275 ASP A CG    1 
ATOM   2454 O OD1   . ASP B 2 274 ? 60.959 9.048   -8.931  1.00 19.13  ? 275 ASP A OD1   1 
ATOM   2455 O OD2   . ASP B 2 274 ? 60.856 7.037   -8.058  1.00 35.31  ? 275 ASP A OD2   1 
ATOM   2456 N N     . ASN B 2 275 ? 63.658 10.488  -4.867  1.00 27.22  ? 276 ASN A N     1 
ATOM   2457 C CA    . ASN B 2 275 ? 63.860 10.827  -3.484  1.00 24.14  ? 276 ASN A CA    1 
ATOM   2458 C C     . ASN B 2 275 ? 62.907 10.072  -2.670  1.00 30.00  ? 276 ASN A C     1 
ATOM   2459 O O     . ASN B 2 275 ? 62.041 10.591  -1.999  1.00 32.25  ? 276 ASN A O     1 
ATOM   2460 C CB    . ASN B 2 275 ? 63.861 12.284  -3.077  1.00 19.92  ? 276 ASN A CB    1 
ATOM   2461 C CG    . ASN B 2 275 ? 64.275 12.434  -1.618  1.00 39.12  ? 276 ASN A CG    1 
ATOM   2462 O OD1   . ASN B 2 275 ? 65.106 11.678  -1.137  1.00 51.43  ? 276 ASN A OD1   1 
ATOM   2463 N ND2   . ASN B 2 275 ? 63.610 13.293  -0.889  1.00 42.12  ? 276 ASN A ND2   1 
ATOM   2464 N N     . VAL B 2 276 ? 63.099 8.786   -2.730  1.00 33.21  ? 277 VAL A N     1 
ATOM   2465 C CA    . VAL B 2 276 ? 62.278 7.873   -1.976  1.00 30.14  ? 277 VAL A CA    1 
ATOM   2466 C C     . VAL B 2 276 ? 62.681 7.877   -0.494  1.00 24.85  ? 277 VAL A C     1 
ATOM   2467 O O     . VAL B 2 276 ? 63.829 8.076   -0.151  1.00 27.02  ? 277 VAL A O     1 
ATOM   2468 C CB    . VAL B 2 276 ? 62.501 6.500   -2.565  1.00 29.93  ? 277 VAL A CB    1 
ATOM   2469 C CG1   . VAL B 2 276 ? 62.675 5.497   -1.440  1.00 35.53  ? 277 VAL A CG1   1 
ATOM   2470 C CG2   . VAL B 2 276 ? 61.376 6.190   -3.534  1.00 23.01  ? 277 VAL A CG2   1 
ATOM   2471 N N     . ARG B 2 277 ? 61.737 7.642   0.383   1.00 21.50  ? 278 ARG A N     1 
ATOM   2472 C CA    . ARG B 2 277 ? 62.029 7.611   1.813   1.00 20.25  ? 278 ARG A CA    1 
ATOM   2473 C C     . ARG B 2 277 ? 63.342 7.006   2.316   1.00 29.13  ? 278 ARG A C     1 
ATOM   2474 O O     . ARG B 2 277 ? 63.831 7.417   3.342   1.00 35.52  ? 278 ARG A O     1 
ATOM   2475 C CB    . ARG B 2 277 ? 60.862 7.022   2.576   1.00 13.54  ? 278 ARG A CB    1 
ATOM   2476 C CG    . ARG B 2 277 ? 60.020 8.031   3.257   1.00 33.16  ? 278 ARG A CG    1 
ATOM   2477 C CD    . ARG B 2 277 ? 59.471 7.548   4.617   1.00 81.65  ? 278 ARG A CD    1 
ATOM   2478 N NE    . ARG B 2 277 ? 58.112 7.037   4.434   1.00 100.00 ? 278 ARG A NE    1 
ATOM   2479 C CZ    . ARG B 2 277 ? 57.070 7.785   4.077   1.00 100.00 ? 278 ARG A CZ    1 
ATOM   2480 N NH1   . ARG B 2 277 ? 57.223 9.096   3.885   1.00 76.75  ? 278 ARG A NH1   1 
ATOM   2481 N NH2   . ARG B 2 277 ? 55.875 7.221   3.923   1.00 100.00 ? 278 ARG A NH2   1 
ATOM   2482 N N     . ASN B 2 278 ? 63.935 6.050   1.622   1.00 26.80  ? 279 ASN A N     1 
ATOM   2483 C CA    . ASN B 2 278 ? 65.199 5.479   2.121   1.00 27.54  ? 279 ASN A CA    1 
ATOM   2484 C C     . ASN B 2 278 ? 66.451 5.833   1.349   1.00 33.82  ? 279 ASN A C     1 
ATOM   2485 O O     . ASN B 2 278 ? 67.576 5.429   1.722   1.00 29.25  ? 279 ASN A O     1 
ATOM   2486 C CB    . ASN B 2 278 ? 65.143 3.978   2.086   1.00 36.87  ? 279 ASN A CB    1 
ATOM   2487 C CG    . ASN B 2 278 ? 63.840 3.461   2.500   1.00 65.17  ? 279 ASN A CG    1 
ATOM   2488 O OD1   . ASN B 2 278 ? 63.467 3.606   3.656   1.00 42.90  ? 279 ASN A OD1   1 
ATOM   2489 N ND2   . ASN B 2 278 ? 63.129 2.820   1.571   1.00 77.45  ? 279 ASN A ND2   1 
ATOM   2490 N N     . ALA B 2 279 ? 66.250 6.546   0.250   1.00 36.47  ? 280 ALA A N     1 
ATOM   2491 C CA    . ALA B 2 279 ? 67.344 6.981   -0.605  1.00 35.69  ? 280 ALA A CA    1 
ATOM   2492 C C     . ALA B 2 279 ? 68.512 7.510   0.220   1.00 32.01  ? 280 ALA A C     1 
ATOM   2493 O O     . ALA B 2 279 ? 69.650 7.237   -0.090  1.00 32.69  ? 280 ALA A O     1 
ATOM   2494 C CB    . ALA B 2 279 ? 66.844 8.030   -1.524  1.00 36.76  ? 280 ALA A CB    1 
ATOM   2495 N N     . ARG B 2 280 ? 68.240 8.241   1.293   1.00 30.49  ? 281 ARG A N     1 
ATOM   2496 C CA    . ARG B 2 280 ? 69.342 8.750   2.123   1.00 34.40  ? 281 ARG A CA    1 
ATOM   2497 C C     . ARG B 2 280 ? 70.097 7.626   2.798   1.00 37.25  ? 281 ARG A C     1 
ATOM   2498 O O     . ARG B 2 280 ? 71.217 7.776   3.259   1.00 36.70  ? 281 ARG A O     1 
ATOM   2499 C CB    . ARG B 2 280 ? 68.840 9.632   3.249   1.00 38.31  ? 281 ARG A CB    1 
ATOM   2500 C CG    . ARG B 2 280 ? 69.958 10.062  4.181   1.00 54.56  ? 281 ARG A CG    1 
ATOM   2501 C CD    . ARG B 2 280 ? 69.813 9.530   5.602   1.00 64.20  ? 281 ARG A CD    1 
ATOM   2502 N NE    . ARG B 2 280 ? 70.987 9.918   6.380   1.00 60.54  ? 281 ARG A NE    1 
ATOM   2503 C CZ    . ARG B 2 280 ? 72.220 9.598   6.007   1.00 76.81  ? 281 ARG A CZ    1 
ATOM   2504 N NH1   . ARG B 2 280 ? 72.377 8.893   4.898   1.00 59.26  ? 281 ARG A NH1   1 
ATOM   2505 N NH2   . ARG B 2 280 ? 73.285 9.956   6.722   1.00 66.32  ? 281 ARG A NH2   1 
ATOM   2506 N N     . TYR B 2 281 ? 69.461 6.485   2.885   1.00 29.81  ? 282 TYR A N     1 
ATOM   2507 C CA    . TYR B 2 281 ? 70.142 5.428   3.517   1.00 24.26  ? 282 TYR A CA    1 
ATOM   2508 C C     . TYR B 2 281 ? 70.715 4.463   2.546   1.00 32.90  ? 282 TYR A C     1 
ATOM   2509 O O     . TYR B 2 281 ? 71.288 3.461   2.971   1.00 33.98  ? 282 TYR A O     1 
ATOM   2510 C CB    . TYR B 2 281 ? 69.257 4.774   4.462   1.00 21.71  ? 282 TYR A CB    1 
ATOM   2511 C CG    . TYR B 2 281 ? 68.979 5.664   5.592   1.00 24.57  ? 282 TYR A CG    1 
ATOM   2512 C CD1   . TYR B 2 281 ? 69.971 6.070   6.461   1.00 29.71  ? 282 TYR A CD1   1 
ATOM   2513 C CD2   . TYR B 2 281 ? 67.726 6.067   5.817   1.00 25.71  ? 282 TYR A CD2   1 
ATOM   2514 C CE1   . TYR B 2 281 ? 69.668 6.888   7.545   1.00 34.75  ? 282 TYR A CE1   1 
ATOM   2515 C CE2   . TYR B 2 281 ? 67.436 6.863   6.840   1.00 28.53  ? 282 TYR A CE2   1 
ATOM   2516 C CZ    . TYR B 2 281 ? 68.376 7.279   7.694   1.00 33.79  ? 282 TYR A CZ    1 
ATOM   2517 O OH    . TYR B 2 281 ? 67.919 8.096   8.676   1.00 36.54  ? 282 TYR A OH    1 
ATOM   2518 N N     . PHE B 2 282 ? 70.609 4.763   1.243   1.00 26.94  ? 283 PHE A N     1 
ATOM   2519 C CA    . PHE B 2 282 ? 71.231 3.894   0.249   1.00 24.53  ? 283 PHE A CA    1 
ATOM   2520 C C     . PHE B 2 282 ? 72.702 4.144   0.635   1.00 29.13  ? 283 PHE A C     1 
ATOM   2521 O O     . PHE B 2 282 ? 73.041 5.062   1.411   1.00 23.65  ? 283 PHE A O     1 
ATOM   2522 C CB    . PHE B 2 282 ? 71.034 4.360   -1.185  1.00 27.74  ? 283 PHE A CB    1 
ATOM   2523 C CG    . PHE B 2 282 ? 69.673 4.080   -1.730  1.00 31.51  ? 283 PHE A CG    1 
ATOM   2524 C CD1   . PHE B 2 282 ? 68.621 3.779   -0.875  1.00 32.02  ? 283 PHE A CD1   1 
ATOM   2525 C CD2   . PHE B 2 282 ? 69.444 4.145   -3.104  1.00 34.66  ? 283 PHE A CD2   1 
ATOM   2526 C CE1   . PHE B 2 282 ? 67.384 3.533   -1.377  1.00 30.29  ? 283 PHE A CE1   1 
ATOM   2527 C CE2   . PHE B 2 282 ? 68.198 3.902   -3.611  1.00 35.67  ? 283 PHE A CE2   1 
ATOM   2528 C CZ    . PHE B 2 282 ? 67.173 3.591   -2.754  1.00 31.12  ? 283 PHE A CZ    1 
ATOM   2529 N N     . THR B 2 283 ? 73.592 3.331   0.101   1.00 29.91  ? 284 THR A N     1 
ATOM   2530 C CA    . THR B 2 283 ? 75.002 3.439   0.457   1.00 28.75  ? 284 THR A CA    1 
ATOM   2531 C C     . THR B 2 283 ? 75.780 3.492   -0.828  1.00 38.28  ? 284 THR A C     1 
ATOM   2532 O O     . THR B 2 283 ? 75.885 2.500   -1.545  1.00 43.23  ? 284 THR A O     1 
ATOM   2533 C CB    . THR B 2 283 ? 75.358 2.077   1.185   1.00 38.62  ? 284 THR A CB    1 
ATOM   2534 O OG1   . THR B 2 283 ? 75.016 2.069   2.588   1.00 54.58  ? 284 THR A OG1   1 
ATOM   2535 C CG2   . THR B 2 283 ? 76.709 1.655   0.969   1.00 12.73  ? 284 THR A CG2   1 
ATOM   2536 N N     . PRO B 2 284 ? 76.330 4.644   -1.160  1.00 33.14  ? 285 PRO A N     1 
ATOM   2537 C CA    . PRO B 2 284 ? 76.290 5.854   -0.370  1.00 29.53  ? 285 PRO A CA    1 
ATOM   2538 C C     . PRO B 2 284 ? 74.977 6.537   -0.417  1.00 26.10  ? 285 PRO A C     1 
ATOM   2539 O O     . PRO B 2 284 ? 74.161 6.202   -1.254  1.00 25.14  ? 285 PRO A O     1 
ATOM   2540 C CB    . PRO B 2 284 ? 77.291 6.735   -1.108  1.00 32.34  ? 285 PRO A CB    1 
ATOM   2541 C CG    . PRO B 2 284 ? 77.852 5.872   -2.283  1.00 33.81  ? 285 PRO A CG    1 
ATOM   2542 C CD    . PRO B 2 284 ? 76.816 4.895   -2.522  1.00 29.51  ? 285 PRO A CD    1 
ATOM   2543 N N     . ALA B 2 285 ? 74.780 7.510   0.481   1.00 24.68  ? 286 ALA A N     1 
ATOM   2544 C CA    . ALA B 2 285 ? 73.516 8.232   0.516   1.00 21.60  ? 286 ALA A CA    1 
ATOM   2545 C C     . ALA B 2 285 ? 73.354 8.818   -0.864  1.00 27.14  ? 286 ALA A C     1 
ATOM   2546 O O     . ALA B 2 285 ? 74.218 9.482   -1.402  1.00 30.53  ? 286 ALA A O     1 
ATOM   2547 C CB    . ALA B 2 285 ? 73.507 9.234   1.559   1.00 20.54  ? 286 ALA A CB    1 
ATOM   2548 N N     . LEU B 2 286 ? 72.232 8.512   -1.456  1.00 21.46  ? 287 LEU A N     1 
ATOM   2549 C CA    . LEU B 2 286 ? 71.953 8.935   -2.792  1.00 19.07  ? 287 LEU A CA    1 
ATOM   2550 C C     . LEU B 2 286 ? 71.547 10.325  -3.137  1.00 27.71  ? 287 LEU A C     1 
ATOM   2551 O O     . LEU B 2 286 ? 70.547 10.811  -2.666  1.00 29.21  ? 287 LEU A O     1 
ATOM   2552 C CB    . LEU B 2 286 ? 70.817 8.074   -3.286  1.00 16.88  ? 287 LEU A CB    1 
ATOM   2553 C CG    . LEU B 2 286 ? 70.614 8.177   -4.780  1.00 17.15  ? 287 LEU A CG    1 
ATOM   2554 C CD1   . LEU B 2 286 ? 71.701 7.381   -5.403  1.00 12.50  ? 287 LEU A CD1   1 
ATOM   2555 C CD2   . LEU B 2 286 ? 69.307 7.546   -5.072  1.00 30.04  ? 287 LEU A CD2   1 
ATOM   2556 N N     . THR B 2 287 ? 72.289 10.945  -4.034  1.00 26.98  ? 288 THR A N     1 
ATOM   2557 C CA    . THR B 2 287 ? 71.931 12.268  -4.514  1.00 25.63  ? 288 THR A CA    1 
ATOM   2558 C C     . THR B 2 287 ? 70.862 11.952  -5.598  1.00 30.05  ? 288 THR A C     1 
ATOM   2559 O O     . THR B 2 287 ? 71.091 11.168  -6.564  1.00 25.37  ? 288 THR A O     1 
ATOM   2560 C CB    . THR B 2 287 ? 73.078 12.961  -5.286  1.00 25.09  ? 288 THR A CB    1 
ATOM   2561 O OG1   . THR B 2 287 ? 74.260 13.068  -4.489  1.00 38.29  ? 288 THR A OG1   1 
ATOM   2562 C CG2   . THR B 2 287 ? 72.651 14.301  -5.605  1.00 33.82  ? 288 THR A CG2   1 
ATOM   2563 N N     . THR B 2 288 ? 69.688 12.547  -5.445  1.00 30.15  ? 289 THR A N     1 
ATOM   2564 C CA    . THR B 2 288 ? 68.631 12.313  -6.428  1.00 30.14  ? 289 THR A CA    1 
ATOM   2565 C C     . THR B 2 288 ? 67.773 13.564  -6.641  1.00 30.89  ? 289 THR A C     1 
ATOM   2566 O O     . THR B 2 288 ? 67.920 14.598  -5.959  1.00 26.86  ? 289 THR A O     1 
ATOM   2567 C CB    . THR B 2 288 ? 67.690 11.138  -5.960  1.00 32.06  ? 289 THR A CB    1 
ATOM   2568 O OG1   . THR B 2 288 ? 66.715 10.830  -6.961  1.00 39.70  ? 289 THR A OG1   1 
ATOM   2569 C CG2   . THR B 2 288 ? 66.933 11.539  -4.737  1.00 18.09  ? 289 THR A CG2   1 
ATOM   2570 N N     . ILE B 2 289 ? 66.857 13.449  -7.591  1.00 30.01  ? 290 ILE A N     1 
ATOM   2571 C CA    . ILE B 2 289 ? 65.939 14.530  -7.829  1.00 32.27  ? 290 ILE A CA    1 
ATOM   2572 C C     . ILE B 2 289 ? 64.707 14.109  -7.019  1.00 41.15  ? 290 ILE A C     1 
ATOM   2573 O O     . ILE B 2 289 ? 64.246 12.946  -7.102  1.00 45.97  ? 290 ILE A O     1 
ATOM   2574 C CB    . ILE B 2 289 ? 65.432 14.601  -9.211  1.00 34.62  ? 290 ILE A CB    1 
ATOM   2575 C CG1   . ILE B 2 289 ? 66.558 14.990  -10.152 1.00 35.31  ? 290 ILE A CG1   1 
ATOM   2576 C CG2   . ILE B 2 289 ? 64.380 15.675  -9.184  1.00 30.96  ? 290 ILE A CG2   1 
ATOM   2577 C CD1   . ILE B 2 289 ? 67.428 16.018  -9.529  1.00 61.65  ? 290 ILE A CD1   1 
ATOM   2578 N N     . HIS B 2 290 ? 64.160 15.039  -6.249  1.00 29.02  ? 291 HIS A N     1 
ATOM   2579 C CA    . HIS B 2 290 ? 63.002 14.733  -5.438  1.00 24.04  ? 291 HIS A CA    1 
ATOM   2580 C C     . HIS B 2 290 ? 61.662 15.029  -6.075  1.00 25.39  ? 291 HIS A C     1 
ATOM   2581 O O     . HIS B 2 290 ? 61.448 16.098  -6.653  1.00 29.54  ? 291 HIS A O     1 
ATOM   2582 C CB    . HIS B 2 290 ? 63.092 15.559  -4.224  1.00 25.64  ? 291 HIS A CB    1 
ATOM   2583 C CG    . HIS B 2 290 ? 61.813 15.652  -3.469  1.00 31.58  ? 291 HIS A CG    1 
ATOM   2584 N ND1   . HIS B 2 290 ? 61.549 14.881  -2.361  1.00 35.30  ? 291 HIS A ND1   1 
ATOM   2585 C CD2   . HIS B 2 290 ? 60.724 16.430  -3.649  1.00 35.50  ? 291 HIS A CD2   1 
ATOM   2586 C CE1   . HIS B 2 290 ? 60.350 15.168  -1.901  1.00 34.73  ? 291 HIS A CE1   1 
ATOM   2587 N NE2   . HIS B 2 290 ? 59.829 16.110  -2.663  1.00 35.02  ? 291 HIS A NE2   1 
ATOM   2588 N N     . GLN B 2 291 ? 60.752 14.079  -5.956  1.00 18.01  ? 292 GLN A N     1 
ATOM   2589 C CA    . GLN B 2 291 ? 59.403 14.239  -6.484  1.00 18.83  ? 292 GLN A CA    1 
ATOM   2590 C C     . GLN B 2 291 ? 58.504 14.381  -5.278  1.00 26.50  ? 292 GLN A C     1 
ATOM   2591 O O     . GLN B 2 291 ? 58.491 13.514  -4.386  1.00 21.97  ? 292 GLN A O     1 
ATOM   2592 C CB    . GLN B 2 291 ? 58.893 12.976  -7.139  1.00 21.17  ? 292 GLN A CB    1 
ATOM   2593 C CG    . GLN B 2 291 ? 57.424 13.100  -7.447  1.00 39.27  ? 292 GLN A CG    1 
ATOM   2594 C CD    . GLN B 2 291 ? 57.187 13.351  -8.933  1.00 60.91  ? 292 GLN A CD    1 
ATOM   2595 O OE1   . GLN B 2 291 ? 56.537 12.554  -9.580  1.00 32.66  ? 292 GLN A OE1   1 
ATOM   2596 N NE2   . GLN B 2 291 ? 57.777 14.421  -9.490  1.00 62.70  ? 292 GLN A NE2   1 
ATOM   2597 N N     . PRO B 2 292 ? 57.757 15.472  -5.251  1.00 26.49  ? 293 PRO A N     1 
ATOM   2598 C CA    . PRO B 2 292 ? 56.835 15.770  -4.153  1.00 26.50  ? 293 PRO A CA    1 
ATOM   2599 C C     . PRO B 2 292 ? 55.740 14.712  -4.193  1.00 29.80  ? 293 PRO A C     1 
ATOM   2600 O O     . PRO B 2 292 ? 54.756 14.851  -4.859  1.00 29.00  ? 293 PRO A O     1 
ATOM   2601 C CB    . PRO B 2 292 ? 56.305 17.139  -4.537  1.00 25.23  ? 293 PRO A CB    1 
ATOM   2602 C CG    . PRO B 2 292 ? 56.559 17.240  -6.056  1.00 28.87  ? 293 PRO A CG    1 
ATOM   2603 C CD    . PRO B 2 292 ? 57.268 16.007  -6.519  1.00 24.54  ? 293 PRO A CD    1 
ATOM   2604 N N     . LYS B 2 293 ? 55.926 13.625  -3.482  1.00 29.11  ? 294 LYS A N     1 
ATOM   2605 C CA    . LYS B 2 293 ? 54.926 12.615  -3.532  1.00 29.62  ? 294 LYS A CA    1 
ATOM   2606 C C     . LYS B 2 293 ? 53.616 12.942  -2.809  1.00 34.52  ? 294 LYS A C     1 
ATOM   2607 O O     . LYS B 2 293 ? 52.512 12.822  -3.354  1.00 31.83  ? 294 LYS A O     1 
ATOM   2608 C CB    . LYS B 2 293 ? 55.554 11.324  -3.098  1.00 28.59  ? 294 LYS A CB    1 
ATOM   2609 C CG    . LYS B 2 293 ? 56.324 10.627  -4.236  1.00 41.07  ? 294 LYS A CG    1 
ATOM   2610 C CD    . LYS B 2 293 ? 57.647 9.881   -3.741  1.00 33.87  ? 294 LYS A CD    1 
ATOM   2611 C CE    . LYS B 2 293 ? 58.317 10.521  -2.500  1.00 42.00  ? 294 LYS A CE    1 
ATOM   2612 N NZ    . LYS B 2 293 ? 59.653 11.090  -2.820  1.00 40.34  ? 294 LYS A NZ    1 
ATOM   2613 N N     . ASP B 2 294 ? 53.754 13.366  -1.574  1.00 33.37  ? 295 ASP A N     1 
ATOM   2614 C CA    . ASP B 2 294 ? 52.615 13.726  -0.732  1.00 38.60  ? 295 ASP A CA    1 
ATOM   2615 C C     . ASP B 2 294 ? 51.704 14.813  -1.329  1.00 41.89  ? 295 ASP A C     1 
ATOM   2616 O O     . ASP B 2 294 ? 50.493 14.715  -1.347  1.00 44.66  ? 295 ASP A O     1 
ATOM   2617 C CB    . ASP B 2 294 ? 53.167 14.203  0.622   1.00 43.89  ? 295 ASP A CB    1 
ATOM   2618 C CG    . ASP B 2 294 ? 54.745 14.313  0.634   1.00 98.86  ? 295 ASP A CG    1 
ATOM   2619 O OD1   . ASP B 2 294 ? 55.397 15.164  -0.117  1.00 100.00 ? 295 ASP A OD1   1 
ATOM   2620 O OD2   . ASP B 2 294 ? 55.317 13.522  1.442   1.00 100.00 ? 295 ASP A OD2   1 
ATOM   2621 N N     . SER B 2 295 ? 52.324 15.868  -1.803  1.00 39.56  ? 296 SER A N     1 
ATOM   2622 C CA    . SER B 2 295 ? 51.634 16.991  -2.394  1.00 38.20  ? 296 SER A CA    1 
ATOM   2623 C C     . SER B 2 295 ? 50.989 16.375  -3.579  1.00 32.79  ? 296 SER A C     1 
ATOM   2624 O O     . SER B 2 295 ? 49.824 16.630  -3.848  1.00 35.37  ? 296 SER A O     1 
ATOM   2625 C CB    . SER B 2 295 ? 52.693 17.975  -2.835  1.00 44.25  ? 296 SER A CB    1 
ATOM   2626 O OG    . SER B 2 295 ? 53.961 17.374  -2.541  1.00 84.93  ? 296 SER A OG    1 
ATOM   2627 N N     . LEU B 2 296 ? 51.755 15.538  -4.264  1.00 24.62  ? 297 LEU A N     1 
ATOM   2628 C CA    . LEU B 2 296 ? 51.242 14.835  -5.437  1.00 26.06  ? 297 LEU A CA    1 
ATOM   2629 C C     . LEU B 2 296 ? 49.954 14.131  -5.003  1.00 37.01  ? 297 LEU A C     1 
ATOM   2630 O O     . LEU B 2 296 ? 48.995 14.042  -5.748  1.00 42.10  ? 297 LEU A O     1 
ATOM   2631 C CB    . LEU B 2 296 ? 52.223 13.774  -5.927  1.00 24.79  ? 297 LEU A CB    1 
ATOM   2632 C CG    . LEU B 2 296 ? 51.953 13.696  -7.422  1.00 31.59  ? 297 LEU A CG    1 
ATOM   2633 C CD1   . LEU B 2 296 ? 53.114 13.085  -8.158  1.00 28.82  ? 297 LEU A CD1   1 
ATOM   2634 C CD2   . LEU B 2 296 ? 50.679 12.935  -7.673  1.00 33.91  ? 297 LEU A CD2   1 
ATOM   2635 N N     . GLY B 2 297 ? 49.926 13.650  -3.772  1.00 27.68  ? 298 GLY A N     1 
ATOM   2636 C CA    . GLY B 2 297 ? 48.757 12.977  -3.294  1.00 25.26  ? 298 GLY A CA    1 
ATOM   2637 C C     . GLY B 2 297 ? 47.627 13.906  -2.947  1.00 34.46  ? 298 GLY A C     1 
ATOM   2638 O O     . GLY B 2 297 ? 46.567 13.858  -3.584  1.00 42.12  ? 298 GLY A O     1 
ATOM   2639 N N     . GLU B 2 298 ? 47.837 14.728  -1.920  1.00 25.04  ? 299 GLU A N     1 
ATOM   2640 C CA    . GLU B 2 298 ? 46.802 15.636  -1.480  1.00 24.87  ? 299 GLU A CA    1 
ATOM   2641 C C     . GLU B 2 298 ? 46.341 16.503  -2.574  1.00 25.94  ? 299 GLU A C     1 
ATOM   2642 O O     . GLU B 2 298 ? 45.173 16.802  -2.671  1.00 22.31  ? 299 GLU A O     1 
ATOM   2643 C CB    . GLU B 2 298 ? 47.229 16.484  -0.326  1.00 27.78  ? 299 GLU A CB    1 
ATOM   2644 C CG    . GLU B 2 298 ? 47.539 17.909  -0.674  1.00 50.34  ? 299 GLU A CG    1 
ATOM   2645 C CD    . GLU B 2 298 ? 48.227 18.582  0.497   1.00 96.99  ? 299 GLU A CD    1 
ATOM   2646 O OE1   . GLU B 2 298 ? 47.692 18.488  1.627   1.00 64.50  ? 299 GLU A OE1   1 
ATOM   2647 O OE2   . GLU B 2 298 ? 49.331 19.144  0.308   1.00 100.00 ? 299 GLU A OE2   1 
ATOM   2648 N N     . THR B 2 299 ? 47.237 16.902  -3.437  1.00 29.59  ? 300 THR A N     1 
ATOM   2649 C CA    . THR B 2 299 ? 46.730 17.730  -4.506  1.00 34.67  ? 300 THR A CA    1 
ATOM   2650 C C     . THR B 2 299 ? 45.648 17.004  -5.355  1.00 37.11  ? 300 THR A C     1 
ATOM   2651 O O     . THR B 2 299 ? 44.635 17.577  -5.755  1.00 32.76  ? 300 THR A O     1 
ATOM   2652 C CB    . THR B 2 299 ? 47.849 18.452  -5.325  1.00 34.40  ? 300 THR A CB    1 
ATOM   2653 O OG1   . THR B 2 299 ? 48.360 19.547  -4.539  1.00 45.51  ? 300 THR A OG1   1 
ATOM   2654 C CG2   . THR B 2 299 ? 47.264 19.022  -6.624  1.00 22.98  ? 300 THR A CG2   1 
ATOM   2655 N N     . ALA B 2 300 ? 45.864 15.728  -5.603  1.00 36.65  ? 301 ALA A N     1 
ATOM   2656 C CA    . ALA B 2 300 ? 44.901 14.973  -6.392  1.00 36.23  ? 301 ALA A CA    1 
ATOM   2657 C C     . ALA B 2 300 ? 43.581 14.884  -5.622  1.00 38.50  ? 301 ALA A C     1 
ATOM   2658 O O     . ALA B 2 300 ? 42.481 15.078  -6.169  1.00 34.30  ? 301 ALA A O     1 
ATOM   2659 C CB    . ALA B 2 300 ? 45.478 13.531  -6.739  1.00 35.08  ? 301 ALA A CB    1 
ATOM   2660 N N     . PHE B 2 301 ? 43.697 14.574  -4.342  1.00 36.80  ? 302 PHE A N     1 
ATOM   2661 C CA    . PHE B 2 301 ? 42.513 14.434  -3.533  1.00 38.79  ? 302 PHE A CA    1 
ATOM   2662 C C     . PHE B 2 301 ? 41.695 15.656  -3.592  1.00 44.46  ? 302 PHE A C     1 
ATOM   2663 O O     . PHE B 2 301 ? 40.469 15.634  -3.736  1.00 46.97  ? 302 PHE A O     1 
ATOM   2664 C CB    . PHE B 2 301 ? 42.896 14.276  -2.101  1.00 39.52  ? 302 PHE A CB    1 
ATOM   2665 C CG    . PHE B 2 301 ? 41.791 13.776  -1.255  1.00 40.08  ? 302 PHE A CG    1 
ATOM   2666 C CD1   . PHE B 2 301 ? 41.223 12.575  -1.511  1.00 43.87  ? 302 PHE A CD1   1 
ATOM   2667 C CD2   . PHE B 2 301 ? 41.350 14.503  -0.177  1.00 44.77  ? 302 PHE A CD2   1 
ATOM   2668 C CE1   . PHE B 2 301 ? 40.233 12.116  -0.694  1.00 50.82  ? 302 PHE A CE1   1 
ATOM   2669 C CE2   . PHE B 2 301 ? 40.362 14.037  0.656   1.00 49.11  ? 302 PHE A CE2   1 
ATOM   2670 C CZ    . PHE B 2 301 ? 39.798 12.853  0.402   1.00 49.45  ? 302 PHE A CZ    1 
ATOM   2671 N N     . ASN B 2 302 ? 42.403 16.752  -3.457  1.00 40.03  ? 303 ASN A N     1 
ATOM   2672 C CA    . ASN B 2 302 ? 41.735 18.003  -3.474  1.00 39.25  ? 303 ASN A CA    1 
ATOM   2673 C C     . ASN B 2 302 ? 40.953 18.273  -4.730  1.00 42.15  ? 303 ASN A C     1 
ATOM   2674 O O     . ASN B 2 302 ? 39.762 18.574  -4.653  1.00 46.32  ? 303 ASN A O     1 
ATOM   2675 C CB    . ASN B 2 302 ? 42.614 19.067  -2.905  1.00 42.55  ? 303 ASN A CB    1 
ATOM   2676 C CG    . ASN B 2 302 ? 42.967 18.751  -1.478  1.00 84.34  ? 303 ASN A CG    1 
ATOM   2677 O OD1   . ASN B 2 302 ? 42.195 18.077  -0.793  1.00 68.18  ? 303 ASN A OD1   1 
ATOM   2678 N ND2   . ASN B 2 302 ? 44.145 19.176  -1.032  1.00 93.80  ? 303 ASN A ND2   1 
ATOM   2679 N N     . MET B 2 303 ? 41.579 18.115  -5.882  1.00 35.59  ? 304 MET A N     1 
ATOM   2680 C CA    . MET B 2 303 ? 40.843 18.316  -7.123  1.00 39.79  ? 304 MET A CA    1 
ATOM   2681 C C     . MET B 2 303 ? 39.621 17.375  -7.112  1.00 42.70  ? 304 MET A C     1 
ATOM   2682 O O     . MET B 2 303 ? 38.500 17.820  -7.409  1.00 44.98  ? 304 MET A O     1 
ATOM   2683 C CB    . MET B 2 303 ? 41.712 18.096  -8.386  1.00 44.30  ? 304 MET A CB    1 
ATOM   2684 C CG    . MET B 2 303 ? 42.762 19.182  -8.660  1.00 51.21  ? 304 MET A CG    1 
ATOM   2685 S SD    . MET B 2 303 ? 43.986 18.623  -9.826  1.00 62.84  ? 304 MET A SD    1 
ATOM   2686 C CE    . MET B 2 303 ? 43.040 18.652  -11.410 1.00 59.15  ? 304 MET A CE    1 
ATOM   2687 N N     . LEU B 2 304 ? 39.818 16.104  -6.738  1.00 33.59  ? 305 LEU A N     1 
ATOM   2688 C CA    . LEU B 2 304 ? 38.678 15.178  -6.698  1.00 31.81  ? 305 LEU A CA    1 
ATOM   2689 C C     . LEU B 2 304 ? 37.507 15.756  -5.888  1.00 33.19  ? 305 LEU A C     1 
ATOM   2690 O O     . LEU B 2 304 ? 36.459 16.039  -6.457  1.00 31.85  ? 305 LEU A O     1 
ATOM   2691 C CB    . LEU B 2 304 ? 39.073 13.776  -6.218  1.00 29.86  ? 305 LEU A CB    1 
ATOM   2692 C CG    . LEU B 2 304 ? 38.102 12.630  -6.537  1.00 32.25  ? 305 LEU A CG    1 
ATOM   2693 C CD1   . LEU B 2 304 ? 37.693 12.490  -8.033  1.00 29.02  ? 305 LEU A CD1   1 
ATOM   2694 C CD2   . LEU B 2 304 ? 38.728 11.370  -6.052  1.00 35.28  ? 305 LEU A CD2   1 
ATOM   2695 N N     . LEU B 2 305 ? 37.717 15.959  -4.589  1.00 26.04  ? 306 LEU A N     1 
ATOM   2696 C CA    . LEU B 2 305 ? 36.704 16.500  -3.718  1.00 28.94  ? 306 LEU A CA    1 
ATOM   2697 C C     . LEU B 2 305 ? 35.909 17.627  -4.304  1.00 36.24  ? 306 LEU A C     1 
ATOM   2698 O O     . LEU B 2 305 ? 34.669 17.643  -4.256  1.00 34.14  ? 306 LEU A O     1 
ATOM   2699 C CB    . LEU B 2 305 ? 37.370 17.036  -2.489  1.00 30.82  ? 306 LEU A CB    1 
ATOM   2700 C CG    . LEU B 2 305 ? 36.638 16.384  -1.330  1.00 38.86  ? 306 LEU A CG    1 
ATOM   2701 C CD1   . LEU B 2 305 ? 36.457 14.888  -1.624  1.00 38.12  ? 306 LEU A CD1   1 
ATOM   2702 C CD2   . LEU B 2 305 ? 37.373 16.616  -0.032  1.00 42.51  ? 306 LEU A CD2   1 
ATOM   2703 N N     . ASP B 2 306 ? 36.655 18.567  -4.857  1.00 34.72  ? 307 ASP A N     1 
ATOM   2704 C CA    . ASP B 2 306 ? 36.084 19.733  -5.483  1.00 38.42  ? 307 ASP A CA    1 
ATOM   2705 C C     . ASP B 2 306 ? 35.009 19.298  -6.474  1.00 46.98  ? 307 ASP A C     1 
ATOM   2706 O O     . ASP B 2 306 ? 33.815 19.642  -6.370  1.00 45.95  ? 307 ASP A O     1 
ATOM   2707 C CB    . ASP B 2 306 ? 37.194 20.416  -6.276  1.00 42.53  ? 307 ASP A CB    1 
ATOM   2708 C CG    . ASP B 2 306 ? 36.771 21.765  -6.876  1.00 66.61  ? 307 ASP A CG    1 
ATOM   2709 O OD1   . ASP B 2 306 ? 36.399 22.664  -6.097  1.00 71.61  ? 307 ASP A OD1   1 
ATOM   2710 O OD2   . ASP B 2 306 ? 36.883 21.954  -8.115  1.00 70.28  ? 307 ASP A OD2   1 
ATOM   2711 N N     . ARG B 2 307 ? 35.473 18.541  -7.451  1.00 43.48  ? 308 ARG A N     1 
ATOM   2712 C CA    . ARG B 2 307 ? 34.610 18.053  -8.493  1.00 44.06  ? 308 ARG A CA    1 
ATOM   2713 C C     . ARG B 2 307 ? 33.408 17.394  -7.828  1.00 50.90  ? 308 ARG A C     1 
ATOM   2714 O O     . ARG B 2 307 ? 32.267 17.545  -8.263  1.00 50.35  ? 308 ARG A O     1 
ATOM   2715 C CB    . ARG B 2 307 ? 35.385 17.053  -9.356  1.00 41.84  ? 308 ARG A CB    1 
ATOM   2716 C CG    . ARG B 2 307 ? 35.576 17.479  -10.818 1.00 51.46  ? 308 ARG A CG    1 
ATOM   2717 C CD    . ARG B 2 307 ? 36.234 16.387  -11.664 1.00 42.96  ? 308 ARG A CD    1 
ATOM   2718 N NE    . ARG B 2 307 ? 36.701 16.882  -12.960 1.00 60.37  ? 308 ARG A NE    1 
ATOM   2719 C CZ    . ARG B 2 307 ? 36.139 16.550  -14.113 1.00 87.16  ? 308 ARG A CZ    1 
ATOM   2720 N NH1   . ARG B 2 307 ? 35.095 15.733  -14.099 1.00 87.08  ? 308 ARG A NH1   1 
ATOM   2721 N NH2   . ARG B 2 307 ? 36.612 17.025  -15.263 1.00 80.88  ? 308 ARG A NH2   1 
ATOM   2722 N N     . ILE B 2 308 ? 33.680 16.680  -6.747  1.00 47.49  ? 309 ILE A N     1 
ATOM   2723 C CA    . ILE B 2 308 ? 32.632 16.002  -6.029  1.00 44.70  ? 309 ILE A CA    1 
ATOM   2724 C C     . ILE B 2 308 ? 31.769 17.038  -5.407  1.00 58.13  ? 309 ILE A C     1 
ATOM   2725 O O     . ILE B 2 308 ? 30.700 17.312  -5.892  1.00 65.12  ? 309 ILE A O     1 
ATOM   2726 C CB    . ILE B 2 308 ? 33.150 15.198  -4.858  1.00 43.58  ? 309 ILE A CB    1 
ATOM   2727 C CG1   . ILE B 2 308 ? 33.806 13.913  -5.326  1.00 45.41  ? 309 ILE A CG1   1 
ATOM   2728 C CG2   . ILE B 2 308 ? 32.032 14.867  -3.952  1.00 33.79  ? 309 ILE A CG2   1 
ATOM   2729 C CD1   . ILE B 2 308 ? 35.228 13.798  -4.851  1.00 62.79  ? 309 ILE A CD1   1 
ATOM   2730 N N     . VAL B 2 309 ? 32.208 17.626  -4.314  1.00 51.76  ? 310 VAL A N     1 
ATOM   2731 C CA    . VAL B 2 309 ? 31.332 18.600  -3.713  1.00 51.81  ? 310 VAL A CA    1 
ATOM   2732 C C     . VAL B 2 309 ? 30.908 19.818  -4.518  1.00 62.22  ? 310 VAL A C     1 
ATOM   2733 O O     . VAL B 2 309 ? 29.720 20.073  -4.702  1.00 67.64  ? 310 VAL A O     1 
ATOM   2734 C CB    . VAL B 2 309 ? 31.726 18.975  -2.319  1.00 53.74  ? 310 VAL A CB    1 
ATOM   2735 C CG1   . VAL B 2 309 ? 32.831 18.076  -1.801  1.00 53.52  ? 310 VAL A CG1   1 
ATOM   2736 C CG2   . VAL B 2 309 ? 32.059 20.411  -2.264  1.00 52.72  ? 310 VAL A CG2   1 
ATOM   2737 N N     . ASN B 2 310 ? 31.863 20.583  -5.006  1.00 55.01  ? 311 ASN A N     1 
ATOM   2738 C CA    . ASN B 2 310 ? 31.504 21.759  -5.768  1.00 51.35  ? 311 ASN A CA    1 
ATOM   2739 C C     . ASN B 2 310 ? 31.027 21.418  -7.166  1.00 49.54  ? 311 ASN A C     1 
ATOM   2740 O O     . ASN B 2 310 ? 30.927 22.282  -8.036  1.00 46.85  ? 311 ASN A O     1 
ATOM   2741 C CB    . ASN B 2 310 ? 32.663 22.729  -5.767  1.00 46.52  ? 311 ASN A CB    1 
ATOM   2742 C CG    . ASN B 2 310 ? 33.189 22.979  -4.364  1.00 100.00 ? 311 ASN A CG    1 
ATOM   2743 O OD1   . ASN B 2 310 ? 32.436 22.900  -3.384  1.00 100.00 ? 311 ASN A OD1   1 
ATOM   2744 N ND2   . ASN B 2 310 ? 34.486 23.269  -4.254  1.00 100.00 ? 311 ASN A ND2   1 
ATOM   2745 N N     . LYS B 2 311 ? 30.719 20.149  -7.360  1.00 45.14  ? 312 LYS A N     1 
ATOM   2746 C CA    . LYS B 2 311 ? 30.246 19.657  -8.648  1.00 49.91  ? 312 LYS A CA    1 
ATOM   2747 C C     . LYS B 2 311 ? 30.853 20.276  -9.894  1.00 59.74  ? 312 LYS A C     1 
ATOM   2748 O O     . LYS B 2 311 ? 30.154 20.415  -10.903 1.00 60.61  ? 312 LYS A O     1 
ATOM   2749 C CB    . LYS B 2 311 ? 28.722 19.733  -8.733  1.00 54.28  ? 312 LYS A CB    1 
ATOM   2750 C CG    . LYS B 2 311 ? 28.000 18.507  -8.113  1.00 92.56  ? 312 LYS A CG    1 
ATOM   2751 C CD    . LYS B 2 311 ? 26.456 18.599  -8.155  1.00 100.00 ? 312 LYS A CD    1 
ATOM   2752 C CE    . LYS B 2 311 ? 25.813 17.586  -9.152  1.00 100.00 ? 312 LYS A CE    1 
ATOM   2753 N NZ    . LYS B 2 311 ? 24.988 18.176  -10.286 1.00 100.00 ? 312 LYS A NZ    1 
ATOM   2754 N N     . ARG B 2 312 ? 32.130 20.659  -9.836  1.00 58.66  ? 313 ARG A N     1 
ATOM   2755 C CA    . ARG B 2 312 ? 32.727 21.261  -11.018 1.00 60.75  ? 313 ARG A CA    1 
ATOM   2756 C C     . ARG B 2 312 ? 32.630 20.315  -12.207 1.00 73.71  ? 313 ARG A C     1 
ATOM   2757 O O     . ARG B 2 312 ? 32.615 19.100  -12.071 1.00 74.53  ? 313 ARG A O     1 
ATOM   2758 C CB    . ARG B 2 312 ? 34.174 21.652  -10.820 1.00 57.59  ? 313 ARG A CB    1 
ATOM   2759 C CG    . ARG B 2 312 ? 34.908 21.614  -12.153 1.00 53.26  ? 313 ARG A CG    1 
ATOM   2760 C CD    . ARG B 2 312 ? 36.254 22.230  -12.013 1.00 56.74  ? 313 ARG A CD    1 
ATOM   2761 N NE    . ARG B 2 312 ? 36.973 21.683  -10.876 1.00 45.87  ? 313 ARG A NE    1 
ATOM   2762 C CZ    . ARG B 2 312 ? 37.739 20.591  -10.958 1.00 77.05  ? 313 ARG A CZ    1 
ATOM   2763 N NH1   . ARG B 2 312 ? 37.871 19.947  -12.135 1.00 46.80  ? 313 ARG A NH1   1 
ATOM   2764 N NH2   . ARG B 2 312 ? 38.368 20.143  -9.863  1.00 43.57  ? 313 ARG A NH2   1 
ATOM   2765 N N     . GLU B 2 313 ? 32.519 20.886  -13.389 1.00 74.67  ? 314 GLU A N     1 
ATOM   2766 C CA    . GLU B 2 313 ? 32.378 20.098  -14.595 1.00 75.87  ? 314 GLU A CA    1 
ATOM   2767 C C     . GLU B 2 313 ? 33.568 20.168  -15.527 1.00 77.11  ? 314 GLU A C     1 
ATOM   2768 O O     . GLU B 2 313 ? 33.760 19.301  -16.404 1.00 73.37  ? 314 GLU A O     1 
ATOM   2769 C CB    . GLU B 2 313 ? 31.199 20.715  -15.357 1.00 80.03  ? 314 GLU A CB    1 
ATOM   2770 C CG    . GLU B 2 313 ? 29.810 20.196  -14.975 1.00 100.00 ? 314 GLU A CG    1 
ATOM   2771 C CD    . GLU B 2 313 ? 29.637 18.712  -15.332 1.00 100.00 ? 314 GLU A CD    1 
ATOM   2772 O OE1   . GLU B 2 313 ? 29.445 18.385  -16.557 1.00 100.00 ? 314 GLU A OE1   1 
ATOM   2773 O OE2   . GLU B 2 313 ? 29.709 17.890  -14.364 1.00 100.00 ? 314 GLU A OE2   1 
ATOM   2774 N N     . GLU B 2 314 ? 34.343 21.235  -15.358 1.00 76.24  ? 315 GLU A N     1 
ATOM   2775 C CA    . GLU B 2 314 ? 35.519 21.464  -16.191 1.00 75.00  ? 315 GLU A CA    1 
ATOM   2776 C C     . GLU B 2 314 ? 36.795 20.881  -15.633 1.00 69.56  ? 315 GLU A C     1 
ATOM   2777 O O     . GLU B 2 314 ? 37.134 21.015  -14.445 1.00 65.23  ? 315 GLU A O     1 
ATOM   2778 C CB    . GLU B 2 314 ? 35.700 22.933  -16.617 1.00 76.08  ? 315 GLU A CB    1 
ATOM   2779 C CG    . GLU B 2 314 ? 34.398 23.730  -16.635 1.00 91.04  ? 315 GLU A CG    1 
ATOM   2780 C CD    . GLU B 2 314 ? 34.022 24.255  -15.232 1.00 100.00 ? 315 GLU A CD    1 
ATOM   2781 O OE1   . GLU B 2 314 ? 34.867 24.992  -14.650 1.00 100.00 ? 315 GLU A OE1   1 
ATOM   2782 O OE2   . GLU B 2 314 ? 32.910 23.919  -14.711 1.00 100.00 ? 315 GLU A OE2   1 
ATOM   2783 N N     . PRO B 2 315 ? 37.479 20.213  -16.541 1.00 59.97  ? 316 PRO A N     1 
ATOM   2784 C CA    . PRO B 2 315 ? 38.720 19.581  -16.250 1.00 59.14  ? 316 PRO A CA    1 
ATOM   2785 C C     . PRO B 2 315 ? 39.738 20.613  -15.772 1.00 60.64  ? 316 PRO A C     1 
ATOM   2786 O O     . PRO B 2 315 ? 39.882 21.714  -16.307 1.00 59.70  ? 316 PRO A O     1 
ATOM   2787 C CB    . PRO B 2 315 ? 39.117 19.012  -17.610 1.00 61.02  ? 316 PRO A CB    1 
ATOM   2788 C CG    . PRO B 2 315 ? 38.604 20.000  -18.578 1.00 64.48  ? 316 PRO A CG    1 
ATOM   2789 C CD    . PRO B 2 315 ? 37.381 20.617  -17.951 1.00 59.82  ? 316 PRO A CD    1 
ATOM   2790 N N     . GLN B 2 316 ? 40.460 20.242  -14.741 1.00 57.19  ? 317 GLN A N     1 
ATOM   2791 C CA    . GLN B 2 316 ? 41.452 21.127  -14.210 1.00 56.18  ? 317 GLN A CA    1 
ATOM   2792 C C     . GLN B 2 316 ? 42.757 20.376  -14.323 1.00 57.90  ? 317 GLN A C     1 
ATOM   2793 O O     . GLN B 2 316 ? 42.775 19.171  -14.600 1.00 58.30  ? 317 GLN A O     1 
ATOM   2794 C CB    . GLN B 2 316 ? 41.144 21.334  -12.745 1.00 57.61  ? 317 GLN A CB    1 
ATOM   2795 C CG    . GLN B 2 316 ? 41.656 22.582  -12.196 1.00 62.37  ? 317 GLN A CG    1 
ATOM   2796 C CD    . GLN B 2 316 ? 40.581 23.281  -11.475 1.00 97.43  ? 317 GLN A CD    1 
ATOM   2797 O OE1   . GLN B 2 316 ? 39.660 23.833  -12.096 1.00 100.00 ? 317 GLN A OE1   1 
ATOM   2798 N NE2   . GLN B 2 316 ? 40.625 23.205  -10.148 1.00 91.83  ? 317 GLN A NE2   1 
ATOM   2799 N N     . SER B 2 317 ? 43.849 21.089  -14.093 1.00 50.92  ? 318 SER A N     1 
ATOM   2800 C CA    . SER B 2 317 ? 45.161 20.477  -14.161 1.00 48.73  ? 318 SER A CA    1 
ATOM   2801 C C     . SER B 2 317 ? 46.160 21.230  -13.308 1.00 46.38  ? 318 SER A C     1 
ATOM   2802 O O     . SER B 2 317 ? 46.450 22.387  -13.564 1.00 44.69  ? 318 SER A O     1 
ATOM   2803 C CB    . SER B 2 317 ? 45.639 20.361  -15.615 1.00 51.34  ? 318 SER A CB    1 
ATOM   2804 O OG    . SER B 2 317 ? 46.771 21.169  -15.845 1.00 66.29  ? 318 SER A OG    1 
ATOM   2805 N N     . ILE B 2 318 ? 46.695 20.578  -12.284 1.00 41.99  ? 319 ILE A N     1 
ATOM   2806 C CA    . ILE B 2 318 ? 47.658 21.259  -11.460 1.00 39.53  ? 319 ILE A CA    1 
ATOM   2807 C C     . ILE B 2 318 ? 49.050 20.718  -11.678 1.00 40.85  ? 319 ILE A C     1 
ATOM   2808 O O     . ILE B 2 318 ? 49.221 19.530  -11.897 1.00 46.07  ? 319 ILE A O     1 
ATOM   2809 C CB    . ILE B 2 318 ? 47.267 21.254  -10.038 1.00 43.56  ? 319 ILE A CB    1 
ATOM   2810 C CG1   . ILE B 2 318 ? 46.048 22.164  -9.861  1.00 47.70  ? 319 ILE A CG1   1 
ATOM   2811 C CG2   . ILE B 2 318 ? 48.336 21.860  -9.252  1.00 44.96  ? 319 ILE A CG2   1 
ATOM   2812 C CD1   . ILE B 2 318 ? 45.183 21.824  -8.629  1.00 55.72  ? 319 ILE A CD1   1 
ATOM   2813 N N     . GLU B 2 319 ? 50.031 21.611  -11.645 1.00 30.74  ? 320 GLU A N     1 
ATOM   2814 C CA    . GLU B 2 319 ? 51.434 21.265  -11.823 1.00 28.31  ? 320 GLU A CA    1 
ATOM   2815 C C     . GLU B 2 319 ? 52.090 21.214  -10.445 1.00 38.23  ? 320 GLU A C     1 
ATOM   2816 O O     . GLU B 2 319 ? 51.722 21.948  -9.516  1.00 35.86  ? 320 GLU A O     1 
ATOM   2817 C CB    . GLU B 2 319 ? 52.176 22.354  -12.569 1.00 28.36  ? 320 GLU A CB    1 
ATOM   2818 C CG    . GLU B 2 319 ? 51.806 22.533  -14.004 1.00 53.17  ? 320 GLU A CG    1 
ATOM   2819 C CD    . GLU B 2 319 ? 52.976 23.098  -14.800 1.00 91.77  ? 320 GLU A CD    1 
ATOM   2820 O OE1   . GLU B 2 319 ? 53.953 23.539  -14.155 1.00 52.98  ? 320 GLU A OE1   1 
ATOM   2821 O OE2   . GLU B 2 319 ? 52.931 23.105  -16.054 1.00 100.00 ? 320 GLU A OE2   1 
ATOM   2822 N N     . VAL B 2 320 ? 53.104 20.369  -10.324 1.00 38.46  ? 321 VAL A N     1 
ATOM   2823 C CA    . VAL B 2 320 ? 53.821 20.232  -9.058  1.00 35.92  ? 321 VAL A CA    1 
ATOM   2824 C C     . VAL B 2 320 ? 55.296 20.289  -9.447  1.00 33.75  ? 321 VAL A C     1 
ATOM   2825 O O     . VAL B 2 320 ? 55.580 20.077  -10.621 1.00 25.28  ? 321 VAL A O     1 
ATOM   2826 C CB    . VAL B 2 320 ? 53.476 18.887  -8.461  1.00 37.31  ? 321 VAL A CB    1 
ATOM   2827 C CG1   . VAL B 2 320 ? 54.046 17.743  -9.313  1.00 36.10  ? 321 VAL A CG1   1 
ATOM   2828 C CG2   . VAL B 2 320 ? 53.932 18.836  -7.084  1.00 37.38  ? 321 VAL A CG2   1 
ATOM   2829 N N     . HIS B 2 321 ? 56.227 20.582  -8.521  1.00 35.09  ? 322 HIS A N     1 
ATOM   2830 C CA    . HIS B 2 321 ? 57.644 20.627  -8.932  1.00 38.37  ? 322 HIS A CA    1 
ATOM   2831 C C     . HIS B 2 321 ? 58.766 19.810  -8.348  1.00 45.56  ? 322 HIS A C     1 
ATOM   2832 O O     . HIS B 2 321 ? 58.940 19.740  -7.132  1.00 52.05  ? 322 HIS A O     1 
ATOM   2833 C CB    . HIS B 2 321 ? 58.129 21.998  -9.172  1.00 44.09  ? 322 HIS A CB    1 
ATOM   2834 C CG    . HIS B 2 321 ? 57.393 22.671  -10.270 1.00 53.07  ? 322 HIS A CG    1 
ATOM   2835 N ND1   . HIS B 2 321 ? 57.795 22.602  -11.588 1.00 57.80  ? 322 HIS A ND1   1 
ATOM   2836 C CD2   . HIS B 2 321 ? 56.245 23.384  -10.253 1.00 58.03  ? 322 HIS A CD2   1 
ATOM   2837 C CE1   . HIS B 2 321 ? 56.937 23.272  -12.333 1.00 59.44  ? 322 HIS A CE1   1 
ATOM   2838 N NE2   . HIS B 2 321 ? 55.986 23.751  -11.547 1.00 60.05  ? 322 HIS A NE2   1 
ATOM   2839 N N     . PRO B 2 322 ? 59.552 19.217  -9.248  1.00 35.89  ? 323 PRO A N     1 
ATOM   2840 C CA    . PRO B 2 322 ? 60.712 18.394  -8.884  1.00 30.95  ? 323 PRO A CA    1 
ATOM   2841 C C     . PRO B 2 322 ? 61.815 19.289  -8.325  1.00 38.60  ? 323 PRO A C     1 
ATOM   2842 O O     . PRO B 2 322 ? 61.840 20.494  -8.567  1.00 41.25  ? 323 PRO A O     1 
ATOM   2843 C CB    . PRO B 2 322 ? 61.181 17.854  -10.242 1.00 30.78  ? 323 PRO A CB    1 
ATOM   2844 C CG    . PRO B 2 322 ? 60.726 18.811  -11.250 1.00 34.28  ? 323 PRO A CG    1 
ATOM   2845 C CD    . PRO B 2 322 ? 59.453 19.448  -10.708 1.00 32.72  ? 323 PRO A CD    1 
ATOM   2846 N N     . ARG B 2 323 ? 62.745 18.714  -7.586  1.00 34.46  ? 324 ARG A N     1 
ATOM   2847 C CA    . ARG B 2 323 ? 63.824 19.521  -7.036  1.00 30.61  ? 324 ARG A CA    1 
ATOM   2848 C C     . ARG B 2 323 ? 65.049 18.655  -6.645  1.00 32.53  ? 324 ARG A C     1 
ATOM   2849 O O     . ARG B 2 323 ? 64.921 17.550  -6.126  1.00 30.81  ? 324 ARG A O     1 
ATOM   2850 C CB    . ARG B 2 323 ? 63.279 20.253  -5.855  1.00 24.07  ? 324 ARG A CB    1 
ATOM   2851 C CG    . ARG B 2 323 ? 63.735 19.657  -4.573  1.00 28.40  ? 324 ARG A CG    1 
ATOM   2852 C CD    . ARG B 2 323 ? 63.335 20.540  -3.393  1.00 47.02  ? 324 ARG A CD    1 
ATOM   2853 N NE    . ARG B 2 323 ? 63.461 19.807  -2.135  1.00 94.28  ? 324 ARG A NE    1 
ATOM   2854 C CZ    . ARG B 2 323 ? 62.422 19.373  -1.422  1.00 100.00 ? 324 ARG A CZ    1 
ATOM   2855 N NH1   . ARG B 2 323 ? 61.179 19.623  -1.848  1.00 100.00 ? 324 ARG A NH1   1 
ATOM   2856 N NH2   . ARG B 2 323 ? 62.623 18.694  -0.286  1.00 100.00 ? 324 ARG A NH2   1 
ATOM   2857 N N     . LEU B 2 324 ? 66.237 19.164  -6.914  1.00 28.61  ? 325 LEU A N     1 
ATOM   2858 C CA    . LEU B 2 324 ? 67.464 18.428  -6.645  1.00 30.37  ? 325 LEU A CA    1 
ATOM   2859 C C     . LEU B 2 324 ? 67.759 18.237  -5.177  1.00 34.83  ? 325 LEU A C     1 
ATOM   2860 O O     . LEU B 2 324 ? 67.544 19.150  -4.386  1.00 35.88  ? 325 LEU A O     1 
ATOM   2861 C CB    . LEU B 2 324 ? 68.694 19.058  -7.367  1.00 29.77  ? 325 LEU A CB    1 
ATOM   2862 C CG    . LEU B 2 324 ? 70.123 18.469  -7.315  1.00 37.20  ? 325 LEU A CG    1 
ATOM   2863 C CD1   . LEU B 2 324 ? 70.619 18.084  -5.929  1.00 39.48  ? 325 LEU A CD1   1 
ATOM   2864 C CD2   . LEU B 2 324 ? 70.207 17.224  -8.142  1.00 42.81  ? 325 LEU A CD2   1 
ATOM   2865 N N     . ILE B 2 325 ? 68.278 17.060  -4.828  1.00 22.95  ? 326 ILE A N     1 
ATOM   2866 C CA    . ILE B 2 325 ? 68.618 16.807  -3.456  1.00 23.49  ? 326 ILE A CA    1 
ATOM   2867 C C     . ILE B 2 325 ? 70.035 16.344  -3.500  1.00 30.43  ? 326 ILE A C     1 
ATOM   2868 O O     . ILE B 2 325 ? 70.303 15.260  -3.982  1.00 29.31  ? 326 ILE A O     1 
ATOM   2869 C CB    . ILE B 2 325 ? 67.872 15.625  -2.897  1.00 26.49  ? 326 ILE A CB    1 
ATOM   2870 C CG1   . ILE B 2 325 ? 66.381 15.843  -2.997  1.00 26.67  ? 326 ILE A CG1   1 
ATOM   2871 C CG2   . ILE B 2 325 ? 68.165 15.547  -1.422  1.00 21.78  ? 326 ILE A CG2   1 
ATOM   2872 C CD1   . ILE B 2 325 ? 65.931 16.818  -1.957  1.00 14.97  ? 326 ILE A CD1   1 
ATOM   2873 N N     . GLU B 2 326 ? 70.956 17.133  -2.984  1.00 29.12  ? 327 GLU A N     1 
ATOM   2874 C CA    . GLU B 2 326 ? 72.335 16.681  -3.036  1.00 28.53  ? 327 GLU A CA    1 
ATOM   2875 C C     . GLU B 2 326 ? 72.746 15.789  -1.899  1.00 32.52  ? 327 GLU A C     1 
ATOM   2876 O O     . GLU B 2 326 ? 72.685 16.190  -0.752  1.00 35.30  ? 327 GLU A O     1 
ATOM   2877 C CB    . GLU B 2 326 ? 73.296 17.856  -3.066  1.00 31.67  ? 327 GLU A CB    1 
ATOM   2878 C CG    . GLU B 2 326 ? 73.571 18.460  -4.430  1.00 48.06  ? 327 GLU A CG    1 
ATOM   2879 C CD    . GLU B 2 326 ? 74.541 19.603  -4.334  1.00 56.63  ? 327 GLU A CD    1 
ATOM   2880 O OE1   . GLU B 2 326 ? 75.744 19.300  -4.233  1.00 54.44  ? 327 GLU A OE1   1 
ATOM   2881 O OE2   . GLU B 2 326 ? 74.090 20.777  -4.305  1.00 65.69  ? 327 GLU A OE2   1 
ATOM   2882 N N     . ARG B 2 327 ? 73.199 14.584  -2.231  1.00 28.11  ? 328 ARG A N     1 
ATOM   2883 C CA    . ARG B 2 327 ? 73.660 13.624  -1.252  1.00 24.98  ? 328 ARG A CA    1 
ATOM   2884 C C     . ARG B 2 327 ? 75.134 13.177  -1.532  1.00 32.05  ? 328 ARG A C     1 
ATOM   2885 O O     . ARG B 2 327 ? 75.982 13.954  -1.967  1.00 36.09  ? 328 ARG A O     1 
ATOM   2886 C CB    . ARG B 2 327 ? 72.707 12.456  -1.230  1.00 28.54  ? 328 ARG A CB    1 
ATOM   2887 C CG    . ARG B 2 327 ? 72.265 12.154  0.168   1.00 55.59  ? 328 ARG A CG    1 
ATOM   2888 C CD    . ARG B 2 327 ? 70.870 12.631  0.396   1.00 21.34  ? 328 ARG A CD    1 
ATOM   2889 N NE    . ARG B 2 327 ? 70.059 12.078  -0.651  1.00 47.44  ? 328 ARG A NE    1 
ATOM   2890 C CZ    . ARG B 2 327 ? 68.754 11.904  -0.536  1.00 73.16  ? 328 ARG A CZ    1 
ATOM   2891 N NH1   . ARG B 2 327 ? 68.181 12.244  0.588   1.00 1.44   ? 328 ARG A NH1   1 
ATOM   2892 N NH2   . ARG B 2 327 ? 68.033 11.403  -1.532  1.00 97.02  ? 328 ARG A NH2   1 
ATOM   2893 N N     . ARG B 2 328 ? 75.483 11.927  -1.302  1.00 25.74  ? 329 ARG A N     1 
ATOM   2894 C CA    . ARG B 2 328 ? 76.868 11.588  -1.550  1.00 22.44  ? 329 ARG A CA    1 
ATOM   2895 C C     . ARG B 2 328 ? 77.265 10.737  -2.695  1.00 26.05  ? 329 ARG A C     1 
ATOM   2896 O O     . ARG B 2 328 ? 78.389 10.304  -2.738  1.00 35.86  ? 329 ARG A O     1 
ATOM   2897 C CB    . ARG B 2 328 ? 77.463 10.929  -0.327  1.00 22.23  ? 329 ARG A CB    1 
ATOM   2898 C CG    . ARG B 2 328 ? 76.789 11.269  0.973   1.00 44.15  ? 329 ARG A CG    1 
ATOM   2899 C CD    . ARG B 2 328 ? 77.737 11.945  1.991   1.00 62.74  ? 329 ARG A CD    1 
ATOM   2900 N NE    . ARG B 2 328 ? 79.070 11.350  1.989   1.00 92.27  ? 329 ARG A NE    1 
ATOM   2901 C CZ    . ARG B 2 328 ? 79.315 10.034  2.012   1.00 100.00 ? 329 ARG A CZ    1 
ATOM   2902 N NH1   . ARG B 2 328 ? 78.317 9.147   2.108   1.00 100.00 ? 329 ARG A NH1   1 
ATOM   2903 N NH2   . ARG B 2 328 ? 80.565 9.585   1.950   1.00 100.00 ? 329 ARG A NH2   1 
ATOM   2904 N N     . SER B 2 329 ? 76.387 10.470  -3.622  1.00 19.85  ? 330 SER A N     1 
ATOM   2905 C CA    . SER B 2 329 ? 76.759 9.618   -4.734  1.00 22.41  ? 330 SER A CA    1 
ATOM   2906 C C     . SER B 2 329 ? 77.349 10.294  -5.990  1.00 32.01  ? 330 SER A C     1 
ATOM   2907 O O     . SER B 2 329 ? 77.621 9.628   -7.002  1.00 31.60  ? 330 SER A O     1 
ATOM   2908 C CB    . SER B 2 329 ? 75.535 8.794   -5.108  1.00 31.68  ? 330 SER A CB    1 
ATOM   2909 O OG    . SER B 2 329 ? 74.454 9.619   -5.505  1.00 38.20  ? 330 SER A OG    1 
ATOM   2910 N N     . VAL B 2 330 ? 77.529 11.611  -5.953  1.00 31.47  ? 331 VAL A N     1 
ATOM   2911 C CA    . VAL B 2 330 ? 78.101 12.278  -7.113  1.00 32.90  ? 331 VAL A CA    1 
ATOM   2912 C C     . VAL B 2 330 ? 79.394 12.927  -6.712  1.00 43.84  ? 331 VAL A C     1 
ATOM   2913 O O     . VAL B 2 330 ? 79.581 13.306  -5.549  1.00 46.05  ? 331 VAL A O     1 
ATOM   2914 C CB    . VAL B 2 330 ? 77.148 13.238  -7.860  1.00 36.08  ? 331 VAL A CB    1 
ATOM   2915 C CG1   . VAL B 2 330 ? 77.895 14.097  -8.941  1.00 30.97  ? 331 VAL A CG1   1 
ATOM   2916 C CG2   . VAL B 2 330 ? 76.049 12.431  -8.504  1.00 37.40  ? 331 VAL A CG2   1 
ATOM   2917 N N     . ALA B 2 331 ? 80.285 13.017  -7.692  1.00 42.04  ? 332 ALA A N     1 
ATOM   2918 C CA    . ALA B 2 331 ? 81.610 13.572  -7.526  1.00 40.43  ? 332 ALA A CA    1 
ATOM   2919 C C     . ALA B 2 331 ? 82.042 14.440  -8.717  1.00 39.15  ? 332 ALA A C     1 
ATOM   2920 O O     . ALA B 2 331 ? 81.533 14.286  -9.849  1.00 36.62  ? 332 ALA A O     1 
ATOM   2921 C CB    . ALA B 2 331 ? 82.552 12.434  -7.339  1.00 41.49  ? 332 ALA A CB    1 
ATOM   2922 N N     . ASP B 2 332 ? 82.979 15.352  -8.470  1.00 32.67  ? 333 ASP A N     1 
ATOM   2923 C CA    . ASP B 2 332 ? 83.420 16.232  -9.557  1.00 31.20  ? 333 ASP A CA    1 
ATOM   2924 C C     . ASP B 2 332 ? 83.871 15.495  -10.810 1.00 26.91  ? 333 ASP A C     1 
ATOM   2925 O O     . ASP B 2 332 ? 84.553 14.540  -10.718 1.00 21.10  ? 333 ASP A O     1 
ATOM   2926 C CB    . ASP B 2 332 ? 84.475 17.218  -9.061  1.00 32.93  ? 333 ASP A CB    1 
ATOM   2927 C CG    . ASP B 2 332 ? 83.894 18.237  -8.119  1.00 56.85  ? 333 ASP A CG    1 
ATOM   2928 O OD1   . ASP B 2 332 ? 82.727 18.636  -8.324  1.00 68.14  ? 333 ASP A OD1   1 
ATOM   2929 O OD2   . ASP B 2 332 ? 84.572 18.601  -7.142  1.00 67.18  ? 333 ASP A OD2   1 
ATOM   2930 N N     . GLY B 2 333 ? 83.481 15.930  -11.992 1.00 28.42  ? 334 GLY A N     1 
ATOM   2931 C CA    . GLY B 2 333 ? 83.907 15.230  -13.192 1.00 26.90  ? 334 GLY A CA    1 
ATOM   2932 C C     . GLY B 2 333 ? 85.253 15.783  -13.636 1.00 34.02  ? 334 GLY A C     1 
ATOM   2933 O O     . GLY B 2 333 ? 85.783 16.720  -13.081 1.00 35.47  ? 334 GLY A O     1 
ATOM   2934 N N     . PRO B 2 334 ? 85.822 15.192  -14.658 1.00 34.19  ? 335 PRO A N     1 
ATOM   2935 C CA    . PRO B 2 334 ? 87.103 15.648  -15.162 1.00 33.52  ? 335 PRO A CA    1 
ATOM   2936 C C     . PRO B 2 334 ? 87.124 17.096  -15.680 1.00 38.63  ? 335 PRO A C     1 
ATOM   2937 O O     . PRO B 2 334 ? 88.175 17.740  -15.692 1.00 41.76  ? 335 PRO A O     1 
ATOM   2938 C CB    . PRO B 2 334 ? 87.380 14.690  -16.302 1.00 34.31  ? 335 PRO A CB    1 
ATOM   2939 C CG    . PRO B 2 334 ? 86.512 13.536  -16.085 1.00 40.30  ? 335 PRO A CG    1 
ATOM   2940 C CD    . PRO B 2 334 ? 85.307 14.036  -15.401 1.00 35.36  ? 335 PRO A CD    1 
ATOM   2941 N N     . PHE B 2 335 ? 85.977 17.615  -16.093 1.00 29.66  ? 336 PHE A N     1 
ATOM   2942 C CA    . PHE B 2 335 ? 85.957 18.977  -16.589 1.00 26.88  ? 336 PHE A CA    1 
ATOM   2943 C C     . PHE B 2 335 ? 85.568 20.073  -15.610 1.00 35.79  ? 336 PHE A C     1 
ATOM   2944 O O     . PHE B 2 335 ? 85.362 21.225  -16.019 1.00 39.73  ? 336 PHE A O     1 
ATOM   2945 C CB    . PHE B 2 335 ? 85.071 19.077  -17.785 1.00 23.99  ? 336 PHE A CB    1 
ATOM   2946 C CG    . PHE B 2 335 ? 85.506 18.225  -18.889 1.00 27.39  ? 336 PHE A CG    1 
ATOM   2947 C CD1   . PHE B 2 335 ? 85.229 16.868  -18.878 1.00 28.82  ? 336 PHE A CD1   1 
ATOM   2948 C CD2   . PHE B 2 335 ? 86.204 18.781  -19.964 1.00 36.53  ? 336 PHE A CD2   1 
ATOM   2949 C CE1   . PHE B 2 335 ? 85.646 16.069  -19.931 1.00 30.35  ? 336 PHE A CE1   1 
ATOM   2950 C CE2   . PHE B 2 335 ? 86.639 17.987  -21.038 1.00 38.52  ? 336 PHE A CE2   1 
ATOM   2951 C CZ    . PHE B 2 335 ? 86.360 16.625  -21.018 1.00 32.95  ? 336 PHE A CZ    1 
ATOM   2952 N N     . ARG B 2 336 ? 85.458 19.734  -14.339 1.00 27.85  ? 337 ARG A N     1 
ATOM   2953 C CA    . ARG B 2 336 ? 85.065 20.750  -13.405 1.00 26.87  ? 337 ARG A CA    1 
ATOM   2954 C C     . ARG B 2 336 ? 85.918 21.974  -13.491 1.00 45.54  ? 337 ARG A C     1 
ATOM   2955 O O     . ARG B 2 336 ? 85.412 23.031  -13.794 1.00 55.55  ? 337 ARG A O     1 
ATOM   2956 C CB    . ARG B 2 336 ? 84.926 20.254  -11.963 1.00 20.11  ? 337 ARG A CB    1 
ATOM   2957 C CG    . ARG B 2 336 ? 83.923 21.070  -11.156 1.00 53.19  ? 337 ARG A CG    1 
ATOM   2958 C CD    . ARG B 2 336 ? 84.275 21.279  -9.660  1.00 95.14  ? 337 ARG A CD    1 
ATOM   2959 N NE    . ARG B 2 336 ? 85.300 22.314  -9.347  1.00 100.00 ? 337 ARG A NE    1 
ATOM   2960 C CZ    . ARG B 2 336 ? 85.253 23.631  -9.642  1.00 100.00 ? 337 ARG A CZ    1 
ATOM   2961 N NH1   . ARG B 2 336 ? 84.210 24.172  -10.303 1.00 100.00 ? 337 ARG A NH1   1 
ATOM   2962 N NH2   . ARG B 2 336 ? 86.281 24.420  -9.271  1.00 100.00 ? 337 ARG A NH2   1 
ATOM   2963 N N     . ASP B 2 337 ? 87.208 21.860  -13.264 1.00 44.65  ? 338 ASP A N     1 
ATOM   2964 C CA    . ASP B 2 337 ? 88.025 23.059  -13.323 1.00 44.01  ? 338 ASP A CA    1 
ATOM   2965 C C     . ASP B 2 337 ? 88.029 23.844  -14.600 1.00 43.31  ? 338 ASP A C     1 
ATOM   2966 O O     . ASP B 2 337 ? 88.406 25.014  -14.586 1.00 49.06  ? 338 ASP A O     1 
ATOM   2967 C CB    . ASP B 2 337 ? 89.449 22.765  -12.901 1.00 48.39  ? 338 ASP A CB    1 
ATOM   2968 C CG    . ASP B 2 337 ? 89.523 21.973  -11.612 1.00 61.71  ? 338 ASP A CG    1 
ATOM   2969 O OD1   . ASP B 2 337 ? 88.910 22.421  -10.603 1.00 54.05  ? 338 ASP A OD1   1 
ATOM   2970 O OD2   . ASP B 2 337 ? 90.204 20.915  -11.625 1.00 71.76  ? 338 ASP A OD2   1 
ATOM   2971 N N     . TYR B 2 338 ? 87.625 23.226  -15.704 1.00 38.83  ? 339 TYR A N     1 
ATOM   2972 C CA    . TYR B 2 338 ? 87.607 23.924  -17.001 1.00 38.43  ? 339 TYR A CA    1 
ATOM   2973 C C     . TYR B 2 338 ? 86.311 24.625  -17.353 1.00 44.67  ? 339 TYR A C     1 
ATOM   2974 O O     . TYR B 2 338 ? 85.939 24.624  -18.499 1.00 50.11  ? 339 TYR A O     1 
ATOM   2975 C CB    . TYR B 2 338 ? 87.956 22.993  -18.161 1.00 35.93  ? 339 TYR A CB    1 
ATOM   2976 C CG    . TYR B 2 338 ? 89.258 22.299  -17.989 1.00 34.65  ? 339 TYR A CG    1 
ATOM   2977 C CD1   . TYR B 2 338 ? 89.421 21.383  -16.997 1.00 35.03  ? 339 TYR A CD1   1 
ATOM   2978 C CD2   . TYR B 2 338 ? 90.320 22.554  -18.824 1.00 37.41  ? 339 TYR A CD2   1 
ATOM   2979 C CE1   . TYR B 2 338 ? 90.584 20.735  -16.827 1.00 34.45  ? 339 TYR A CE1   1 
ATOM   2980 C CE2   . TYR B 2 338 ? 91.505 21.902  -18.663 1.00 38.88  ? 339 TYR A CE2   1 
ATOM   2981 C CZ    . TYR B 2 338 ? 91.629 20.984  -17.651 1.00 43.39  ? 339 TYR A CZ    1 
ATOM   2982 O OH    . TYR B 2 338 ? 92.806 20.308  -17.434 1.00 51.87  ? 339 TYR A OH    1 
ATOM   2983 N N     . ARG B 2 339 ? 85.646 25.228  -16.380 1.00 41.57  ? 340 ARG A N     1 
ATOM   2984 C CA    . ARG B 2 339 ? 84.390 25.928  -16.594 1.00 57.89  ? 340 ARG A CA    1 
ATOM   2985 C C     . ARG B 2 339 ? 84.354 27.354  -16.021 1.00 100.00 ? 340 ARG A C     1 
ATOM   2986 O O     . ARG B 2 339 ? 83.489 28.171  -16.380 1.00 89.66  ? 340 ARG A O     1 
ATOM   2987 C CB    . ARG B 2 339 ? 83.301 25.094  -15.942 1.00 58.76  ? 340 ARG A CB    1 
ATOM   2988 C CG    . ARG B 2 339 ? 82.880 23.871  -16.759 1.00 60.14  ? 340 ARG A CG    1 
ATOM   2989 C CD    . ARG B 2 339 ? 81.740 23.116  -16.047 1.00 64.30  ? 340 ARG A CD    1 
ATOM   2990 N NE    . ARG B 2 339 ? 80.443 23.717  -16.343 1.00 76.50  ? 340 ARG A NE    1 
ATOM   2991 C CZ    . ARG B 2 339 ? 79.668 24.320  -15.439 1.00 90.75  ? 340 ARG A CZ    1 
ATOM   2992 N NH1   . ARG B 2 339 ? 80.050 24.397  -14.162 1.00 43.36  ? 340 ARG A NH1   1 
ATOM   2993 N NH2   . ARG B 2 339 ? 78.500 24.857  -15.806 1.00 77.85  ? 340 ARG A NH2   1 
HETATM 2994 N N1    . HPA C 3 .   ? 57.118 2.544   -11.035 1.00 68.13  ? 599 HPA A N1    1 
HETATM 2995 C C2    . HPA C 3 .   ? 57.917 2.529   -9.920  1.00 100.00 ? 599 HPA A C2    1 
HETATM 2996 N N3    . HPA C 3 .   ? 58.551 3.593   -9.463  1.00 19.71  ? 599 HPA A N3    1 
HETATM 2997 C C4    . HPA C 3 .   ? 58.333 4.699   -10.221 1.00 52.55  ? 599 HPA A C4    1 
HETATM 2998 C C5    . HPA C 3 .   ? 57.554 4.809   -11.346 1.00 40.83  ? 599 HPA A C5    1 
HETATM 2999 C C6    . HPA C 3 .   ? 56.877 3.661   -11.822 1.00 22.02  ? 599 HPA A C6    1 
HETATM 3000 O O6    . HPA C 3 .   ? 56.125 3.544   -12.798 1.00 62.03  ? 599 HPA A O6    1 
HETATM 3001 N N7    . HPA C 3 .   ? 57.578 6.112   -11.832 1.00 43.60  ? 599 HPA A N7    1 
HETATM 3002 C C8    . HPA C 3 .   ? 58.385 6.752   -11.032 1.00 18.53  ? 599 HPA A C8    1 
HETATM 3003 N N9    . HPA C 3 .   ? 58.857 5.960   -10.015 1.00 14.42  ? 599 HPA A N9    1 
HETATM 3004 O O     . HOH D 4 .   ? 11.769 -14.974 -8.607  1.00 28.97  ? 717 HOH M O     1 
HETATM 3005 O O     . HOH D 4 .   ? 11.680 -4.808  -9.320  1.00 59.42  ? 718 HOH M O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   699 699 DT  DT  M . n 
A 1 2   DA  2   700 700 DA  DA  M . n 
A 1 3   DC  3   701 701 DC  DC  M . n 
A 1 4   DG  4   702 702 DG  DG  M . n 
A 1 5   DC  5   703 703 DC  DC  M . n 
A 1 6   DA  6   704 704 DA  DA  M . n 
A 1 7   DA  7   705 705 DA  DA  M . n 
A 1 8   DC  8   706 706 DC  DC  M . n 
A 1 9   DC  9   707 707 DC  DC  M . n 
A 1 10  DG  10  708 708 DG  DG  M . n 
A 1 11  DG  11  709 709 DG  DG  M . n 
A 1 12  DT  12  710 710 DT  DT  M . n 
A 1 13  DT  13  711 711 DT  DT  M . n 
A 1 14  DG  14  712 712 DG  DG  M . n 
A 1 15  DC  15  713 713 DC  DC  M . n 
A 1 16  DG  16  714 714 DG  DG  M . n 
A 1 17  DT  17  715 715 DT  DT  M . n 
B 2 1   ALA 1   2   ?   ?   ?   A . n 
B 2 2   THR 2   3   3   THR THR A . n 
B 2 3   ILE 3   4   4   ILE ILE A . n 
B 2 4   LYS 4   5   5   LYS LYS A . n 
B 2 5   ASP 5   6   6   ASP ASP A . n 
B 2 6   VAL 6   7   7   VAL VAL A . n 
B 2 7   ALA 7   8   8   ALA ALA A . n 
B 2 8   LYS 8   9   9   LYS LYS A . n 
B 2 9   ARG 9   10  10  ARG ARG A . n 
B 2 10  ALA 10  11  11  ALA ALA A . n 
B 2 11  ASN 11  12  12  ASN ASN A . n 
B 2 12  VAL 12  13  13  VAL VAL A . n 
B 2 13  SER 13  14  14  SER SER A . n 
B 2 14  THR 14  15  15  THR THR A . n 
B 2 15  THR 15  16  16  THR THR A . n 
B 2 16  THR 16  17  17  THR THR A . n 
B 2 17  VAL 17  18  18  VAL VAL A . n 
B 2 18  SER 18  19  19  SER SER A . n 
B 2 19  HIS 19  20  20  HIS HIS A . n 
B 2 20  VAL 20  21  21  VAL VAL A . n 
B 2 21  ILE 21  22  22  ILE ILE A . n 
B 2 22  ASN 22  23  23  ASN ASN A . n 
B 2 23  LYS 23  24  24  LYS LYS A . n 
B 2 24  THR 24  25  25  THR THR A . n 
B 2 25  ARG 25  26  26  ARG ARG A . n 
B 2 26  PHE 26  27  27  PHE PHE A . n 
B 2 27  VAL 27  28  28  VAL VAL A . n 
B 2 28  ALA 28  29  29  ALA ALA A . n 
B 2 29  GLU 29  30  30  GLU GLU A . n 
B 2 30  GLU 30  31  31  GLU GLU A . n 
B 2 31  THR 31  32  32  THR THR A . n 
B 2 32  ARG 32  33  33  ARG ARG A . n 
B 2 33  ASN 33  34  34  ASN ASN A . n 
B 2 34  ALA 34  35  35  ALA ALA A . n 
B 2 35  VAL 35  36  36  VAL VAL A . n 
B 2 36  TRP 36  37  37  TRP TRP A . n 
B 2 37  ALA 37  38  38  ALA ALA A . n 
B 2 38  ALA 38  39  39  ALA ALA A . n 
B 2 39  ILE 39  40  40  ILE ILE A . n 
B 2 40  LYS 40  41  41  LYS LYS A . n 
B 2 41  GLU 41  42  42  GLU GLU A . n 
B 2 42  LEU 42  43  43  LEU LEU A . n 
B 2 43  HIS 43  44  44  HIS HIS A . n 
B 2 44  TYR 44  45  45  TYR TYR A . n 
B 2 45  SER 45  46  46  SER SER A . n 
B 2 46  PRO 46  47  47  PRO PRO A . n 
B 2 47  SER 47  48  48  SER SER A . n 
B 2 48  ALA 48  49  49  ALA ALA A . n 
B 2 49  VAL 49  50  50  VAL VAL A . n 
B 2 50  ALA 50  51  51  ALA ALA A . n 
B 2 51  ARG 51  52  52  ARG ARG A . n 
B 2 52  SER 52  53  53  SER SER A . n 
B 2 53  LEU 53  54  54  LEU LEU A . n 
B 2 54  ALA 54  55  55  ALA ALA A . n 
B 2 55  VAL 55  56  56  VAL VAL A . n 
B 2 56  ASN 56  57  57  ASN ASN A . n 
B 2 57  HIS 57  58  58  HIS HIS A . n 
B 2 58  THR 58  59  59  THR THR A . n 
B 2 59  LYS 59  60  60  LYS LYS A . n 
B 2 60  SER 60  61  61  SER SER A . n 
B 2 61  ILE 61  62  62  ILE ILE A . n 
B 2 62  GLY 62  63  63  GLY GLY A . n 
B 2 63  LEU 63  64  64  LEU LEU A . n 
B 2 64  LEU 64  65  65  LEU LEU A . n 
B 2 65  ALA 65  66  66  ALA ALA A . n 
B 2 66  THR 66  67  67  THR THR A . n 
B 2 67  SER 67  68  68  SER SER A . n 
B 2 68  SER 68  69  69  SER SER A . n 
B 2 69  GLU 69  70  70  GLU GLU A . n 
B 2 70  ALA 70  71  71  ALA ALA A . n 
B 2 71  ALA 71  72  72  ALA ALA A . n 
B 2 72  TYR 72  73  73  TYR TYR A . n 
B 2 73  PHE 73  74  74  PHE PHE A . n 
B 2 74  ALA 74  75  75  ALA ALA A . n 
B 2 75  GLU 75  76  76  GLU GLU A . n 
B 2 76  ILE 76  77  77  ILE ILE A . n 
B 2 77  ILE 77  78  78  ILE ILE A . n 
B 2 78  GLU 78  79  79  GLU GLU A . n 
B 2 79  ALA 79  80  80  ALA ALA A . n 
B 2 80  VAL 80  81  81  VAL VAL A . n 
B 2 81  GLU 81  82  82  GLU GLU A . n 
B 2 82  LYS 82  83  83  LYS LYS A . n 
B 2 83  ASN 83  84  84  ASN ASN A . n 
B 2 84  CYS 84  85  85  CYS CYS A . n 
B 2 85  PHE 85  86  86  PHE PHE A . n 
B 2 86  GLN 86  87  87  GLN GLN A . n 
B 2 87  LYS 87  88  88  LYS LYS A . n 
B 2 88  GLY 88  89  89  GLY GLY A . n 
B 2 89  TYR 89  90  90  TYR TYR A . n 
B 2 90  THR 90  91  91  THR THR A . n 
B 2 91  LEU 91  92  92  LEU LEU A . n 
B 2 92  ILE 92  93  93  ILE ILE A . n 
B 2 93  LEU 93  94  94  LEU LEU A . n 
B 2 94  GLY 94  95  95  GLY GLY A . n 
B 2 95  ASN 95  96  96  ASN ASN A . n 
B 2 96  ALA 96  97  97  ALA ALA A . n 
B 2 97  TRP 97  98  98  TRP TRP A . n 
B 2 98  ASN 98  99  99  ASN ASN A . n 
B 2 99  ASN 99  100 100 ASN ASN A . n 
B 2 100 LEU 100 101 101 LEU LEU A . n 
B 2 101 GLU 101 102 102 GLU GLU A . n 
B 2 102 LYS 102 103 103 LYS LYS A . n 
B 2 103 GLN 103 104 104 GLN GLN A . n 
B 2 104 ARG 104 105 105 ARG ARG A . n 
B 2 105 ALA 105 106 106 ALA ALA A . n 
B 2 106 TYR 106 107 107 TYR TYR A . n 
B 2 107 LEU 107 108 108 LEU LEU A . n 
B 2 108 SER 108 109 109 SER SER A . n 
B 2 109 MET 109 110 110 MET MET A . n 
B 2 110 MET 110 111 111 MET MET A . n 
B 2 111 ALA 111 112 112 ALA ALA A . n 
B 2 112 GLN 112 113 113 GLN GLN A . n 
B 2 113 LYS 113 114 114 LYS LYS A . n 
B 2 114 ARG 114 115 115 ARG ARG A . n 
B 2 115 VAL 115 116 116 VAL VAL A . n 
B 2 116 ASP 116 117 117 ASP ASP A . n 
B 2 117 GLY 117 118 118 GLY GLY A . n 
B 2 118 LEU 118 119 119 LEU LEU A . n 
B 2 119 LEU 119 120 120 LEU LEU A . n 
B 2 120 VAL 120 121 121 VAL VAL A . n 
B 2 121 MET 121 122 122 MET MET A . n 
B 2 122 CYS 122 123 123 CYS CYS A . n 
B 2 123 SER 123 124 124 SER SER A . n 
B 2 124 GLU 124 125 125 GLU GLU A . n 
B 2 125 TYR 125 126 126 TYR TYR A . n 
B 2 126 PRO 126 127 127 PRO PRO A . n 
B 2 127 GLU 127 128 128 GLU GLU A . n 
B 2 128 PRO 128 129 129 PRO PRO A . n 
B 2 129 LEU 129 130 130 LEU LEU A . n 
B 2 130 LEU 130 131 131 LEU LEU A . n 
B 2 131 ALA 131 132 132 ALA ALA A . n 
B 2 132 MET 132 133 133 MET MET A . n 
B 2 133 LEU 133 134 134 LEU LEU A . n 
B 2 134 GLU 134 135 135 GLU GLU A . n 
B 2 135 GLU 135 136 136 GLU GLU A . n 
B 2 136 TYR 136 137 137 TYR TYR A . n 
B 2 137 ARG 137 138 138 ARG ARG A . n 
B 2 138 HIS 138 139 139 HIS HIS A . n 
B 2 139 ILE 139 140 140 ILE ILE A . n 
B 2 140 PRO 140 141 141 PRO PRO A . n 
B 2 141 MET 141 142 142 MET MET A . n 
B 2 142 VAL 142 143 143 VAL VAL A . n 
B 2 143 VAL 143 144 144 VAL VAL A . n 
B 2 144 MET 144 145 145 MET MET A . n 
B 2 145 ASP 145 146 146 ASP ASP A . n 
B 2 146 TRP 146 147 147 TRP TRP A . n 
B 2 147 GLY 147 148 148 GLY GLY A . n 
B 2 148 GLU 148 149 149 GLU GLU A . n 
B 2 149 ALA 149 150 150 ALA ALA A . n 
B 2 150 LYS 150 151 151 LYS LYS A . n 
B 2 151 ALA 151 152 152 ALA ALA A . n 
B 2 152 ASP 152 153 153 ASP ASP A . n 
B 2 153 PHE 153 154 154 PHE PHE A . n 
B 2 154 THR 154 155 155 THR THR A . n 
B 2 155 ASP 155 156 156 ASP ASP A . n 
B 2 156 ALA 156 157 157 ALA ALA A . n 
B 2 157 VAL 157 158 158 VAL VAL A . n 
B 2 158 ILE 158 159 159 ILE ILE A . n 
B 2 159 ASP 159 160 160 ASP ASP A . n 
B 2 160 ASN 160 161 161 ASN ASN A . n 
B 2 161 ALA 161 162 162 ALA ALA A . n 
B 2 162 PHE 162 163 163 PHE PHE A . n 
B 2 163 GLU 163 164 164 GLU GLU A . n 
B 2 164 GLY 164 165 165 GLY GLY A . n 
B 2 165 GLY 165 166 166 GLY GLY A . n 
B 2 166 TYR 166 167 167 TYR TYR A . n 
B 2 167 MET 167 168 168 MET MET A . n 
B 2 168 ALA 168 169 169 ALA ALA A . n 
B 2 169 GLY 169 170 170 GLY GLY A . n 
B 2 170 ARG 170 171 171 ARG ARG A . n 
B 2 171 TYR 171 172 172 TYR TYR A . n 
B 2 172 LEU 172 173 173 LEU LEU A . n 
B 2 173 ILE 173 174 174 ILE ILE A . n 
B 2 174 GLU 174 175 175 GLU GLU A . n 
B 2 175 ARG 175 176 176 ARG ARG A . n 
B 2 176 GLY 176 177 177 GLY GLY A . n 
B 2 177 HIS 177 178 178 HIS HIS A . n 
B 2 178 ARG 178 179 179 ARG ARG A . n 
B 2 179 GLU 179 180 180 GLU GLU A . n 
B 2 180 ILE 180 181 181 ILE ILE A . n 
B 2 181 GLY 181 182 182 GLY GLY A . n 
B 2 182 VAL 182 183 183 VAL VAL A . n 
B 2 183 ILE 183 184 184 ILE ILE A . n 
B 2 184 PRO 184 185 185 PRO PRO A . n 
B 2 185 GLY 185 186 186 GLY GLY A . n 
B 2 186 PRO 186 187 187 PRO PRO A . n 
B 2 187 LEU 187 188 188 LEU LEU A . n 
B 2 188 GLU 188 189 189 GLU GLU A . n 
B 2 189 ARG 189 190 190 ARG ARG A . n 
B 2 190 ASN 190 191 191 ASN ASN A . n 
B 2 191 THR 191 192 192 THR THR A . n 
B 2 192 GLY 192 193 193 GLY GLY A . n 
B 2 193 ALA 193 194 194 ALA ALA A . n 
B 2 194 GLY 194 195 195 GLY GLY A . n 
B 2 195 ARG 195 196 196 ARG ARG A . n 
B 2 196 LEU 196 197 197 LEU LEU A . n 
B 2 197 ALA 197 198 198 ALA ALA A . n 
B 2 198 GLY 198 199 199 GLY GLY A . n 
B 2 199 PHE 199 200 200 PHE PHE A . n 
B 2 200 MET 200 201 201 MET MET A . n 
B 2 201 LYS 201 202 202 LYS LYS A . n 
B 2 202 ALA 202 203 203 ALA ALA A . n 
B 2 203 MET 203 204 204 MET MET A . n 
B 2 204 GLU 204 205 205 GLU GLU A . n 
B 2 205 GLU 205 206 206 GLU GLU A . n 
B 2 206 ALA 206 207 207 ALA ALA A . n 
B 2 207 MET 207 208 208 MET MET A . n 
B 2 208 ILE 208 209 209 ILE ILE A . n 
B 2 209 LYS 209 210 210 LYS LYS A . n 
B 2 210 VAL 210 211 211 VAL VAL A . n 
B 2 211 PRO 211 212 212 PRO PRO A . n 
B 2 212 GLU 212 213 213 GLU GLU A . n 
B 2 213 SER 213 214 214 SER SER A . n 
B 2 214 TRP 214 215 215 TRP TRP A . n 
B 2 215 ILE 215 216 216 ILE ILE A . n 
B 2 216 VAL 216 217 217 VAL VAL A . n 
B 2 217 GLN 217 218 218 GLN GLN A . n 
B 2 218 GLY 218 219 219 GLY GLY A . n 
B 2 219 ASP 219 220 220 ASP ASP A . n 
B 2 220 PHE 220 221 221 PHE PHE A . n 
B 2 221 GLU 221 222 222 GLU GLU A . n 
B 2 222 PRO 222 223 223 PRO PRO A . n 
B 2 223 GLU 223 224 224 GLU GLU A . n 
B 2 224 SER 224 225 225 SER SER A . n 
B 2 225 GLY 225 226 226 GLY GLY A . n 
B 2 226 TYR 226 227 227 TYR TYR A . n 
B 2 227 ARG 227 228 228 ARG ARG A . n 
B 2 228 ALA 228 229 229 ALA ALA A . n 
B 2 229 MET 229 230 230 MET MET A . n 
B 2 230 GLN 230 231 231 GLN GLN A . n 
B 2 231 GLN 231 232 232 GLN GLN A . n 
B 2 232 ILE 232 233 233 ILE ILE A . n 
B 2 233 LEU 233 234 234 LEU LEU A . n 
B 2 234 SER 234 235 235 SER SER A . n 
B 2 235 GLN 235 236 236 GLN GLN A . n 
B 2 236 PRO 236 237 237 PRO PRO A . n 
B 2 237 HIS 237 238 238 HIS HIS A . n 
B 2 238 ARG 238 239 239 ARG ARG A . n 
B 2 239 PRO 239 240 240 PRO PRO A . n 
B 2 240 THR 240 241 241 THR THR A . n 
B 2 241 ALA 241 242 242 ALA ALA A . n 
B 2 242 VAL 242 243 243 VAL VAL A . n 
B 2 243 PHE 243 244 244 PHE PHE A . n 
B 2 244 CYS 244 245 245 CYS CYS A . n 
B 2 245 GLY 245 246 246 GLY GLY A . n 
B 2 246 GLY 246 247 247 GLY GLY A . n 
B 2 247 ASP 247 248 248 ASP ASP A . n 
B 2 248 ILE 248 249 249 ILE ILE A . n 
B 2 249 MET 249 250 250 MET MET A . n 
B 2 250 ALA 250 251 251 ALA ALA A . n 
B 2 251 MET 251 252 252 MET MET A . n 
B 2 252 GLY 252 253 253 GLY GLY A . n 
B 2 253 ALA 253 254 254 ALA ALA A . n 
B 2 254 LEU 254 255 255 LEU LEU A . n 
B 2 255 CYS 255 256 256 CYS CYS A . n 
B 2 256 ALA 256 257 257 ALA ALA A . n 
B 2 257 ALA 257 258 258 ALA ALA A . n 
B 2 258 ASP 258 259 259 ASP ASP A . n 
B 2 259 GLU 259 260 260 GLU GLU A . n 
B 2 260 MET 260 261 261 MET MET A . n 
B 2 261 GLY 261 262 262 GLY GLY A . n 
B 2 262 LEU 262 263 263 LEU LEU A . n 
B 2 263 ARG 263 264 264 ARG ARG A . n 
B 2 264 VAL 264 265 265 VAL VAL A . n 
B 2 265 PRO 265 266 266 PRO PRO A . n 
B 2 266 GLN 266 267 267 GLN GLN A . n 
B 2 267 ASP 267 268 268 ASP ASP A . n 
B 2 268 VAL 268 269 269 VAL VAL A . n 
B 2 269 SER 269 270 270 SER SER A . n 
B 2 270 LEU 270 271 271 LEU LEU A . n 
B 2 271 ILE 271 272 272 ILE ILE A . n 
B 2 272 GLY 272 273 273 GLY GLY A . n 
B 2 273 TYR 273 274 274 TYR TYR A . n 
B 2 274 ASP 274 275 275 ASP ASP A . n 
B 2 275 ASN 275 276 276 ASN ASN A . n 
B 2 276 VAL 276 277 277 VAL VAL A . n 
B 2 277 ARG 277 278 278 ARG ARG A . n 
B 2 278 ASN 278 279 279 ASN ASN A . n 
B 2 279 ALA 279 280 280 ALA ALA A . n 
B 2 280 ARG 280 281 281 ARG ARG A . n 
B 2 281 TYR 281 282 282 TYR TYR A . n 
B 2 282 PHE 282 283 283 PHE PHE A . n 
B 2 283 THR 283 284 284 THR THR A . n 
B 2 284 PRO 284 285 285 PRO PRO A . n 
B 2 285 ALA 285 286 286 ALA ALA A . n 
B 2 286 LEU 286 287 287 LEU LEU A . n 
B 2 287 THR 287 288 288 THR THR A . n 
B 2 288 THR 288 289 289 THR THR A . n 
B 2 289 ILE 289 290 290 ILE ILE A . n 
B 2 290 HIS 290 291 291 HIS HIS A . n 
B 2 291 GLN 291 292 292 GLN GLN A . n 
B 2 292 PRO 292 293 293 PRO PRO A . n 
B 2 293 LYS 293 294 294 LYS LYS A . n 
B 2 294 ASP 294 295 295 ASP ASP A . n 
B 2 295 SER 295 296 296 SER SER A . n 
B 2 296 LEU 296 297 297 LEU LEU A . n 
B 2 297 GLY 297 298 298 GLY GLY A . n 
B 2 298 GLU 298 299 299 GLU GLU A . n 
B 2 299 THR 299 300 300 THR THR A . n 
B 2 300 ALA 300 301 301 ALA ALA A . n 
B 2 301 PHE 301 302 302 PHE PHE A . n 
B 2 302 ASN 302 303 303 ASN ASN A . n 
B 2 303 MET 303 304 304 MET MET A . n 
B 2 304 LEU 304 305 305 LEU LEU A . n 
B 2 305 LEU 305 306 306 LEU LEU A . n 
B 2 306 ASP 306 307 307 ASP ASP A . n 
B 2 307 ARG 307 308 308 ARG ARG A . n 
B 2 308 ILE 308 309 309 ILE ILE A . n 
B 2 309 VAL 309 310 310 VAL VAL A . n 
B 2 310 ASN 310 311 311 ASN ASN A . n 
B 2 311 LYS 311 312 312 LYS LYS A . n 
B 2 312 ARG 312 313 313 ARG ARG A . n 
B 2 313 GLU 313 314 314 GLU GLU A . n 
B 2 314 GLU 314 315 315 GLU GLU A . n 
B 2 315 PRO 315 316 316 PRO PRO A . n 
B 2 316 GLN 316 317 317 GLN GLN A . n 
B 2 317 SER 317 318 318 SER SER A . n 
B 2 318 ILE 318 319 319 ILE ILE A . n 
B 2 319 GLU 319 320 320 GLU GLU A . n 
B 2 320 VAL 320 321 321 VAL VAL A . n 
B 2 321 HIS 321 322 322 HIS HIS A . n 
B 2 322 PRO 322 323 323 PRO PRO A . n 
B 2 323 ARG 323 324 324 ARG ARG A . n 
B 2 324 LEU 324 325 325 LEU LEU A . n 
B 2 325 ILE 325 326 326 ILE ILE A . n 
B 2 326 GLU 326 327 327 GLU GLU A . n 
B 2 327 ARG 327 328 328 ARG ARG A . n 
B 2 328 ARG 328 329 329 ARG ARG A . n 
B 2 329 SER 329 330 330 SER SER A . n 
B 2 330 VAL 330 331 331 VAL VAL A . n 
B 2 331 ALA 331 332 332 ALA ALA A . n 
B 2 332 ASP 332 333 333 ASP ASP A . n 
B 2 333 GLY 333 334 334 GLY GLY A . n 
B 2 334 PRO 334 335 335 PRO PRO A . n 
B 2 335 PHE 335 336 336 PHE PHE A . n 
B 2 336 ARG 336 337 337 ARG ARG A . n 
B 2 337 ASP 337 338 338 ASP ASP A . n 
B 2 338 TYR 338 339 339 TYR TYR A . n 
B 2 339 ARG 339 340 340 ARG ARG A . n 
B 2 340 ARG 340 341 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HPA 1 599 599 HPA HPA A . 
D 4 HOH 1 717 717 HOH HOH M . 
D 4 HOH 2 718 718 HOH HOH M . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-04 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-04-04 
6 'Structure model' 1 5 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Data collection'           
5 6 'Structure model' 'Database references'       
6 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' diffrn_source      
3 6 'Structure model' database_2         
4 6 'Structure model' struct_ref_seq_dif 
5 6 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'                      
2 5 'Structure model' '_diffrn_source.type'                 
3 6 'Structure model' '_database_2.pdbx_DOI'                
4 6 'Structure model' '_database_2.pdbx_database_accession' 
5 6 'Structure model' '_struct_ref_seq_dif.details'         
6 6 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 6 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 6 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT         refinement       . ? 1 
UCSD-system 'data reduction' . ? 2 
UCSD-system 'data scaling'   . ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             125 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             125 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.645 
_pdbx_validate_rmsd_bond.bond_target_value         1.517 
_pdbx_validate_rmsd_bond.bond_deviation            0.128 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" M DC  707 ? ? "C4'" M DC  707 ? ? "C3'" M DC  707 ? ? 101.57 104.50 -2.93  0.40 N 
2 1 "O4'" M DG  709 ? ? "C1'" M DG  709 ? ? N9    M DG  709 ? ? 110.12 108.30 1.82   0.30 N 
3 1 NE    A ARG 26  ? ? CZ    A ARG 26  ? ? NH1   A ARG 26  ? ? 117.22 120.30 -3.08  0.50 N 
4 1 C     A SER 46  ? ? N     A PRO 47  ? ? CD    A PRO 47  ? ? 114.86 128.40 -13.54 2.10 Y 
5 1 CB    A LEU 131 ? ? CG    A LEU 131 ? ? CD2   A LEU 131 ? ? 100.78 111.00 -10.22 1.70 N 
6 1 CB    A THR 155 ? ? CA    A THR 155 ? ? C     A THR 155 ? ? 92.81  111.60 -18.79 2.70 N 
7 1 C     A VAL 211 ? ? N     A PRO 212 ? ? CD    A PRO 212 ? ? 113.95 128.40 -14.45 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 19  ? ? -58.76  -74.95  
2  1 LYS A 24  ? ? 26.74   61.18   
3  1 HIS A 44  ? ? 58.63   70.39   
4  1 ASN A 57  ? ? 72.09   37.09   
5  1 THR A 67  ? ? -111.00 -70.71  
6  1 SER A 124 ? ? 68.50   -77.07  
7  1 TYR A 126 ? ? -119.79 76.91   
8  1 ARG A 179 ? ? -140.07 -25.80  
9  1 PHE A 221 ? ? 79.44   -1.65   
10 1 TYR A 274 ? ? -175.44 109.18  
11 1 ASP A 275 ? ? 144.37  -35.10  
12 1 ARG A 278 ? ? -37.75  -28.48  
13 1 PRO A 293 ? ? -66.25  90.98   
14 1 ILE A 309 ? ? -67.84  -77.66  
15 1 LYS A 312 ? ? 36.33   33.29   
16 1 ARG A 328 ? ? -122.92 -143.48 
17 1 TYR A 339 ? ? -91.06  37.70   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    LYS 
_pdbx_validate_chiral.auth_seq_id     9 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 2   ? B ALA 1   
2 1 Y 1 A ARG 341 ? B ARG 340 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1QP7 'double helix'        
1QP7 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 A DT 17 4_555 -0.203 -0.081 -0.505 -23.856 2.893   -7.364 1  M_DA700:DT715_M M 700 ? M 715 ? 20 1 
1 A DC 3  1_555 A DG 16 4_555 0.039  -0.227 -0.092 -3.042  5.556   -1.046 2  M_DC701:DG714_M M 701 ? M 714 ? 19 1 
1 A DG 4  1_555 A DC 15 4_555 0.144  -0.122 0.487  6.238   5.798   -2.958 3  M_DG702:DC713_M M 702 ? M 713 ? 19 1 
1 A DC 5  1_555 A DG 14 4_555 -0.103 -0.353 0.077  2.953   -16.544 -1.231 4  M_DC703:DG712_M M 703 ? M 712 ? 19 1 
1 A DA 6  1_555 A DT 13 4_555 0.088  -0.130 0.118  4.242   0.499   -0.074 5  M_DA704:DT711_M M 704 ? M 711 ? 20 1 
1 A DA 7  1_555 A DT 12 4_555 0.213  -0.165 -0.106 5.539   -13.388 1.768  6  M_DA705:DT710_M M 705 ? M 710 ? 20 1 
1 A DC 8  1_555 A DG 11 4_555 -0.171 -0.185 -0.036 15.068  -13.708 1.349  7  M_DC706:DG709_M M 706 ? M 709 ? 19 1 
1 A DC 9  1_555 A DG 10 4_555 -0.144 -0.124 -0.253 17.227  -9.097  -0.552 8  M_DC707:DG708_M M 707 ? M 708 ? 19 1 
1 A DG 10 1_555 A DC 9  4_555 0.144  -0.124 -0.253 -17.227 -9.097  -0.552 9  M_DG708:DC707_M M 708 ? M 707 ? 19 1 
1 A DG 11 1_555 A DC 8  4_555 0.171  -0.185 -0.036 -15.068 -13.708 1.349  10 M_DG709:DC706_M M 709 ? M 706 ? 19 1 
1 A DT 12 1_555 A DA 7  4_555 -0.213 -0.165 -0.106 -5.539  -13.388 1.768  11 M_DT710:DA705_M M 710 ? M 705 ? 20 1 
1 A DT 13 1_555 A DA 6  4_555 -0.088 -0.130 0.118  -4.242  0.499   -0.074 12 M_DT711:DA704_M M 711 ? M 704 ? 20 1 
1 A DG 14 1_555 A DC 5  4_555 0.103  -0.353 0.077  -2.953  -16.544 -1.231 13 M_DG712:DC703_M M 712 ? M 703 ? 19 1 
1 A DC 15 1_555 A DG 4  4_555 -0.144 -0.122 0.487  -6.238  5.798   -2.958 14 M_DC713:DG702_M M 713 ? M 702 ? 19 1 
1 A DG 16 1_555 A DC 3  4_555 -0.039 -0.227 -0.092 3.042   5.556   -1.046 15 M_DG714:DC701_M M 714 ? M 701 ? 19 1 
1 A DT 17 1_555 A DA 2  4_555 0.203  -0.081 -0.505 23.857  2.893   -7.364 16 M_DT715:DA700_M M 715 ? M 700 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 A DT 17 4_555 A DC 3  1_555 A DG 16 4_555 0.406  -0.742 2.956 -4.326 1.699  25.311 -2.089 -1.988 2.793 3.835  
9.768  25.727 1  MM_DA700DC701:DG714DT715_MM M 700 ? M 715 ? M 701 ? M 714 ? 
1 A DC 3  1_555 A DG 16 4_555 A DG 4  1_555 A DC 15 4_555 -0.870 -0.690 3.311 -4.249 -4.360 34.818 -0.466 0.780  3.448 -7.217 
7.034  35.330 2  MM_DC701DG702:DC713DG714_MM M 701 ? M 714 ? M 702 ? M 713 ? 
1 A DG 4  1_555 A DC 15 4_555 A DC 5  1_555 A DG 14 4_555 -0.765 -0.187 3.430 4.349  1.248  35.851 -0.484 1.869  3.310 2.018  
-7.030 36.126 3  MM_DG702DC703:DG712DC713_MM M 702 ? M 713 ? M 703 ? M 712 ? 
1 A DC 5  1_555 A DG 14 4_555 A DA 6  1_555 A DT 13 4_555 1.219  1.211  3.478 1.212  2.021  36.769 1.620  -1.751 3.574 3.200  
-1.919 36.842 4  MM_DC703DA704:DT711DG712_MM M 703 ? M 712 ? M 704 ? M 711 ? 
1 A DA 6  1_555 A DT 13 4_555 A DA 7  1_555 A DT 12 4_555 -0.309 0.553  3.561 -0.062 2.111  34.858 0.573  0.505  3.588 3.520  
0.104  34.920 5  MM_DA704DA705:DT710DT711_MM M 704 ? M 711 ? M 705 ? M 710 ? 
1 A DA 7  1_555 A DT 12 4_555 A DC 8  1_555 A DG 11 4_555 0.511  -0.530 3.019 -4.157 6.252  35.545 -1.638 -1.344 2.813 10.102 
6.717  36.304 6  MM_DA705DC706:DG709DT710_MM M 705 ? M 710 ? M 706 ? M 709 ? 
1 A DC 8  1_555 A DG 11 4_555 A DC 9  1_555 A DG 10 4_555 -0.772 0.281  3.496 3.835  -0.886 29.974 0.728  2.299  3.364 -1.704 
-7.376 30.226 7  MM_DC706DC707:DG708DG709_MM M 706 ? M 709 ? M 707 ? M 708 ? 
1 A DC 9  1_555 A DG 10 4_555 A DG 10 1_555 A DC 9  4_555 0.000  1.054  5.135 0.000  49.847 10.535 -5.576 0.000  2.127 78.824 
0.000  50.878 8  MM_DC707DG708:DC707DG708_MM M 707 ? M 708 ? M 708 ? M 707 ? 
1 A DG 10 1_555 A DC 9  4_555 A DG 11 1_555 A DC 8  4_555 0.772  0.281  3.496 -3.835 -0.886 29.974 0.728  -2.299 3.364 -1.704 
7.375  30.226 9  MM_DG708DG709:DC706DC707_MM M 708 ? M 707 ? M 709 ? M 706 ? 
1 A DG 11 1_555 A DC 8  4_555 A DT 12 1_555 A DA 7  4_555 -0.511 -0.530 3.019 4.157  6.252  35.545 -1.638 1.344  2.813 10.102 
-6.717 36.304 10 MM_DG709DT710:DA705DC706_MM M 709 ? M 706 ? M 710 ? M 705 ? 
1 A DT 12 1_555 A DA 7  4_555 A DT 13 1_555 A DA 6  4_555 0.309  0.553  3.561 0.062  2.111  34.858 0.573  -0.505 3.588 3.520  
-0.104 34.920 11 MM_DT710DT711:DA704DA705_MM M 710 ? M 705 ? M 711 ? M 704 ? 
1 A DT 13 1_555 A DA 6  4_555 A DG 14 1_555 A DC 5  4_555 -1.219 1.211  3.478 -1.212 2.021  36.769 1.620  1.751  3.574 3.200  
1.919  36.842 12 MM_DT711DG712:DC703DA704_MM M 711 ? M 704 ? M 712 ? M 703 ? 
1 A DG 14 1_555 A DC 5  4_555 A DC 15 1_555 A DG 4  4_555 0.765  -0.187 3.430 -4.349 1.248  35.851 -0.484 -1.869 3.310 2.018  
7.030  36.126 13 MM_DG712DC713:DG702DC703_MM M 712 ? M 703 ? M 713 ? M 702 ? 
1 A DC 15 1_555 A DG 4  4_555 A DG 16 1_555 A DC 3  4_555 0.870  -0.690 3.311 4.249  -4.360 34.818 -0.466 -0.780 3.448 -7.217 
-7.034 35.330 14 MM_DC713DG714:DC701DG702_MM M 713 ? M 702 ? M 714 ? M 701 ? 
1 A DG 16 1_555 A DC 3  4_555 A DT 17 1_555 A DA 2  4_555 -0.406 -0.742 2.956 4.326  1.699  25.311 -2.089 1.988  2.793 3.835  
-9.768 25.727 15 MM_DG714DT715:DA700DC701_MM M 714 ? M 701 ? M 715 ? M 700 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 HYPOXANTHINE HPA 
4 water        HOH 
#