data_1QQG
# 
_entry.id   1QQG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QQG         
RCSB  RCSB009146   
WWPDB D_1000009146 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QQG 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dhe-Paganon, S.' 1 
'Shoelson, S.E.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the pleckstrin homology-phosphotyrosine binding (PH-PTB) targeting region of insulin receptor substrate 1.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            96 
_citation.page_first                8378 
_citation.page_last                 8383 
_citation.year                      1999 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10411883 
_citation.pdbx_database_id_DOI      10.1073/pnas.96.15.8378 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dhe-Paganon, S.' 1 
primary 'Ottinger, E.A.'  2 
primary 'Nolte, R.T.'     3 
primary 'Eck, M.J.'       4 
primary 'Shoelson, S.E.'  5 
# 
_cell.entry_id           1QQG 
_cell.length_a           120.439 
_cell.length_b           120.439 
_cell.length_c           79.598 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        120 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QQG 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INSULIN RECEPTOR SUBSTRATE 1' 29156.021 2   ? ? 'PH-PTB (N-TERMINAL DOMAIN)' ? 
2 water   nat water                          18.015    168 ? ? ?                            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IRS-1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKNKHL
VALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGHHDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEV
WQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDS
VVAQNMHETILEAMRAMSDEFRPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKNKHL
VALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGHHDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEV
WQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDS
VVAQNMHETILEAMRAMSDEFRPR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   PRO n 
1 3   GLU n 
1 4   SER n 
1 5   ASP n 
1 6   GLY n 
1 7   PHE n 
1 8   SER n 
1 9   ASP n 
1 10  VAL n 
1 11  ARG n 
1 12  LYS n 
1 13  VAL n 
1 14  GLY n 
1 15  TYR n 
1 16  LEU n 
1 17  ARG n 
1 18  LYS n 
1 19  PRO n 
1 20  LYS n 
1 21  SER n 
1 22  MET n 
1 23  HIS n 
1 24  LYS n 
1 25  ARG n 
1 26  PHE n 
1 27  PHE n 
1 28  VAL n 
1 29  LEU n 
1 30  ARG n 
1 31  ALA n 
1 32  ALA n 
1 33  SER n 
1 34  GLU n 
1 35  ALA n 
1 36  GLY n 
1 37  GLY n 
1 38  PRO n 
1 39  ALA n 
1 40  ARG n 
1 41  LEU n 
1 42  GLU n 
1 43  TYR n 
1 44  TYR n 
1 45  GLU n 
1 46  ASN n 
1 47  GLU n 
1 48  LYS n 
1 49  LYS n 
1 50  TRP n 
1 51  ARG n 
1 52  HIS n 
1 53  LYS n 
1 54  SER n 
1 55  SER n 
1 56  ALA n 
1 57  PRO n 
1 58  LYS n 
1 59  ARG n 
1 60  SER n 
1 61  ILE n 
1 62  PRO n 
1 63  LEU n 
1 64  GLU n 
1 65  SER n 
1 66  CYS n 
1 67  PHE n 
1 68  ASN n 
1 69  ILE n 
1 70  ASN n 
1 71  LYS n 
1 72  ARG n 
1 73  ALA n 
1 74  ASP n 
1 75  SER n 
1 76  LYS n 
1 77  ASN n 
1 78  LYS n 
1 79  HIS n 
1 80  LEU n 
1 81  VAL n 
1 82  ALA n 
1 83  LEU n 
1 84  TYR n 
1 85  THR n 
1 86  ARG n 
1 87  ASP n 
1 88  GLU n 
1 89  HIS n 
1 90  PHE n 
1 91  ALA n 
1 92  ILE n 
1 93  ALA n 
1 94  ALA n 
1 95  ASP n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  GLU n 
1 100 GLN n 
1 101 ASP n 
1 102 SER n 
1 103 TRP n 
1 104 TYR n 
1 105 GLN n 
1 106 ALA n 
1 107 LEU n 
1 108 LEU n 
1 109 GLN n 
1 110 LEU n 
1 111 HIS n 
1 112 ASN n 
1 113 ARG n 
1 114 ALA n 
1 115 LYS n 
1 116 GLY n 
1 117 HIS n 
1 118 HIS n 
1 119 ASP n 
1 120 GLY n 
1 121 ALA n 
1 122 ALA n 
1 123 ALA n 
1 124 LEU n 
1 125 GLY n 
1 126 ALA n 
1 127 GLY n 
1 128 GLY n 
1 129 GLY n 
1 130 GLY n 
1 131 GLY n 
1 132 SER n 
1 133 CYS n 
1 134 SER n 
1 135 GLY n 
1 136 SER n 
1 137 SER n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
1 141 GLU n 
1 142 ALA n 
1 143 GLY n 
1 144 GLU n 
1 145 ASP n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 GLY n 
1 150 ASP n 
1 151 VAL n 
1 152 PRO n 
1 153 PRO n 
1 154 GLY n 
1 155 PRO n 
1 156 ALA n 
1 157 PHE n 
1 158 LYS n 
1 159 GLU n 
1 160 VAL n 
1 161 TRP n 
1 162 GLN n 
1 163 VAL n 
1 164 ILE n 
1 165 LEU n 
1 166 LYS n 
1 167 PRO n 
1 168 LYS n 
1 169 GLY n 
1 170 LEU n 
1 171 GLY n 
1 172 GLN n 
1 173 THR n 
1 174 LYS n 
1 175 ASN n 
1 176 LEU n 
1 177 ILE n 
1 178 GLY n 
1 179 ILE n 
1 180 TYR n 
1 181 ARG n 
1 182 LEU n 
1 183 CYS n 
1 184 LEU n 
1 185 THR n 
1 186 SER n 
1 187 LYS n 
1 188 THR n 
1 189 ILE n 
1 190 SER n 
1 191 PHE n 
1 192 VAL n 
1 193 LYS n 
1 194 LEU n 
1 195 ASN n 
1 196 SER n 
1 197 GLU n 
1 198 ALA n 
1 199 ALA n 
1 200 ALA n 
1 201 VAL n 
1 202 VAL n 
1 203 LEU n 
1 204 GLN n 
1 205 LEU n 
1 206 MET n 
1 207 ASN n 
1 208 ILE n 
1 209 ARG n 
1 210 ARG n 
1 211 CYS n 
1 212 GLY n 
1 213 HIS n 
1 214 SER n 
1 215 GLU n 
1 216 ASN n 
1 217 PHE n 
1 218 PHE n 
1 219 PHE n 
1 220 ILE n 
1 221 GLU n 
1 222 VAL n 
1 223 GLY n 
1 224 ARG n 
1 225 SER n 
1 226 ALA n 
1 227 VAL n 
1 228 THR n 
1 229 GLY n 
1 230 PRO n 
1 231 GLY n 
1 232 GLU n 
1 233 PHE n 
1 234 TRP n 
1 235 MET n 
1 236 GLN n 
1 237 VAL n 
1 238 ASP n 
1 239 ASP n 
1 240 SER n 
1 241 VAL n 
1 242 VAL n 
1 243 ALA n 
1 244 GLN n 
1 245 ASN n 
1 246 MET n 
1 247 HIS n 
1 248 GLU n 
1 249 THR n 
1 250 ILE n 
1 251 LEU n 
1 252 GLU n 
1 253 ALA n 
1 254 MET n 
1 255 ARG n 
1 256 ALA n 
1 257 MET n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 PHE n 
1 262 ARG n 
1 263 PRO n 
1 264 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'THIS SEQUENCE OCCURS NATURALLY IN HUMANS.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IRS1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P35568 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QQG A 1 ? 264 ? P35568 4 ? 267 ? 4 267 
2 1 1QQG B 1 ? 264 ? P35568 4 ? 267 ? 4 267 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QQG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   56.94 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '1.7M SODIUM PHOSPHATE, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 21K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ELLIOTT GX-13' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QQG 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   91581 
_reflns.number_all                   93545 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.0630000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.94 
_reflns.B_iso_Wilson_estimate        35 
_reflns.pdbx_redundancy              3.11 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.40 
_reflns_shell.percent_possible_all   98.3 
_reflns_shell.Rmerge_I_obs           0.4100000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QQG 
_refine.ls_number_reflns_obs                     26412 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1910000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1910000 
_refine.ls_R_factor_R_free                       0.2470000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1240 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3358 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             168 
_refine_hist.number_atoms_total               3526 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        8 
# 
_struct.entry_id                  1QQG 
_struct.title                     'CRYSTAL STRUCTURE OF THE PH-PTB TARGETING REGION OF IRS-1' 
_struct.pdbx_descriptor           'INSULIN RECEPTOR SUBSTRATE 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QQG 
_struct_keywords.pdbx_keywords   'SIGNAL TRANSDUCTION' 
_struct_keywords.text            'BETA-SANDWHICH, SIGNAL TRANSDUCTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 46  ? HIS A 52  ? ASN A 49  HIS A 55  1 ? 7  
HELX_P HELX_P2  2  SER A 96  ? HIS A 111 ? SER A 99  HIS A 114 1 ? 16 
HELX_P HELX_P3  3  LEU A 170 ? LYS A 174 ? LEU A 173 LYS A 177 1 ? 5  
HELX_P HELX_P4  4  ASP A 239 ? ALA A 256 ? ASP A 242 ALA A 259 1 ? 18 
HELX_P HELX_P5  5  MET A 257 ? ASP A 259 ? MET A 260 ASP A 262 5 ? 3  
HELX_P HELX_P6  6  ASN B 46  ? HIS B 52  ? ASN B 49  HIS B 55  1 ? 7  
HELX_P HELX_P7  7  SER B 96  ? HIS B 111 ? SER B 99  HIS B 114 1 ? 16 
HELX_P HELX_P8  8  GLY B 169 ? ASN B 175 ? GLY B 172 ASN B 178 1 ? 7  
HELX_P HELX_P9  9  ASP B 239 ? ALA B 256 ? ASP B 242 ALA B 259 1 ? 18 
HELX_P HELX_P10 10 MET B 257 ? GLU B 260 ? MET B 260 GLU B 263 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 7 ? 
D ? 4 ? 
E ? 3 ? 
F ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 10  ? ARG A 17  ? VAL A 13  ARG A 20  
A 2 LYS A 24  ? ARG A 30  ? LYS A 27  ARG A 33  
A 3 ARG A 40  ? TYR A 44  ? ARG A 43  TYR A 47  
A 4 ARG A 59  ? PRO A 62  ? ARG A 62  PRO A 65  
B 1 CYS A 66  ? ARG A 72  ? CYS A 69  ARG A 75  
B 2 LEU A 80  ? THR A 85  ? LEU A 83  THR A 88  
B 3 HIS A 89  ? ALA A 93  ? HIS A 92  ALA A 96  
C 1 VAL A 201 ? GLN A 204 ? VAL A 204 GLN A 207 
C 2 THR A 188 ? LYS A 193 ? THR A 191 LYS A 196 
C 3 GLY A 178 ? LEU A 184 ? GLY A 181 LEU A 187 
C 4 GLU A 159 ? GLY A 169 ? GLU A 162 GLY A 172 
C 5 GLY A 231 ? GLN A 236 ? GLY A 234 GLN A 239 
C 6 PHE A 217 ? VAL A 222 ? PHE A 220 VAL A 225 
C 7 ILE A 208 ? SER A 214 ? ILE A 211 SER A 217 
D 1 VAL B 10  ? ARG B 17  ? VAL B 13  ARG B 20  
D 2 LYS B 24  ? ARG B 30  ? LYS B 27  ARG B 33  
D 3 ARG B 40  ? TYR B 44  ? ARG B 43  TYR B 47  
D 4 ARG B 59  ? PRO B 62  ? ARG B 62  PRO B 65  
E 1 CYS B 66  ? ARG B 72  ? CYS B 69  ARG B 75  
E 2 LEU B 80  ? THR B 85  ? LEU B 83  THR B 88  
E 3 HIS B 89  ? ALA B 93  ? HIS B 92  ALA B 96  
F 1 VAL B 201 ? GLN B 204 ? VAL B 204 GLN B 207 
F 2 THR B 188 ? LYS B 193 ? THR B 191 LYS B 196 
F 3 GLY B 178 ? LEU B 184 ? GLY B 181 LEU B 187 
F 4 GLU B 159 ? LEU B 165 ? GLU B 162 LEU B 168 
F 5 GLY B 231 ? GLN B 236 ? GLY B 234 GLN B 239 
F 6 PHE B 217 ? VAL B 222 ? PHE B 220 VAL B 225 
F 7 ILE B 208 ? SER B 214 ? ILE B 211 SER B 217 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 16  ? O LEU A 19  N ARG A 25  ? N ARG A 28  
A 2 3 N ARG A 30  ? N ARG A 33  O ARG A 40  ? O ARG A 43  
A 3 4 N TYR A 43  ? N TYR A 46  O ARG A 59  ? O ARG A 62  
B 1 2 N ARG A 72  ? N ARG A 75  O LEU A 80  ? O LEU A 83  
B 2 3 N LEU A 83  ? N LEU A 86  O PHE A 90  ? O PHE A 93  
C 1 2 N LEU A 203 ? N LEU A 206 O ILE A 189 ? O ILE A 192 
C 2 3 N VAL A 192 ? N VAL A 195 O ARG A 181 ? O ARG A 184 
C 3 4 N LEU A 184 ? N LEU A 187 O GLU A 159 ? O GLU A 162 
C 4 5 N LYS A 166 ? N LYS A 169 O TRP A 234 ? O TRP A 237 
C 5 6 O MET A 235 ? O MET A 238 N PHE A 218 ? N PHE A 221 
C 6 7 O GLU A 221 ? O GLU A 224 N ARG A 209 ? N ARG A 212 
D 1 2 O LEU B 16  ? O LEU B 19  N ARG B 25  ? N ARG B 28  
D 2 3 N ARG B 30  ? N ARG B 33  O ARG B 40  ? O ARG B 43  
D 3 4 N TYR B 43  ? N TYR B 46  O ARG B 59  ? O ARG B 62  
E 1 2 O ARG B 72  ? O ARG B 75  N LEU B 80  ? N LEU B 83  
E 2 3 N LEU B 83  ? N LEU B 86  O PHE B 90  ? O PHE B 93  
F 1 2 N LEU B 203 ? N LEU B 206 O ILE B 189 ? O ILE B 192 
F 2 3 N VAL B 192 ? N VAL B 195 O ARG B 181 ? O ARG B 184 
F 3 4 N LEU B 184 ? N LEU B 187 O GLU B 159 ? O GLU B 162 
F 4 5 O ILE B 164 ? O ILE B 167 N GLN B 236 ? N GLN B 239 
F 5 6 O MET B 235 ? O MET B 238 N PHE B 218 ? N PHE B 221 
F 6 7 O GLU B 221 ? O GLU B 224 N ARG B 209 ? N ARG B 212 
# 
_database_PDB_matrix.entry_id          1QQG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QQG 
_atom_sites.fract_transf_matrix[1][1]   0.008303 
_atom_sites.fract_transf_matrix[1][2]   0.004794 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009587 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012563 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 9   ? -8.867  55.472 59.103  1.00 35.47 ? 12  ASP A N   1 
ATOM   2    C CA  . ASP A 1 9   ? -7.753  55.589 58.107  1.00 35.20 ? 12  ASP A CA  1 
ATOM   3    C C   . ASP A 1 9   ? -7.736  54.435 57.084  1.00 34.21 ? 12  ASP A C   1 
ATOM   4    O O   . ASP A 1 9   ? -6.972  54.456 56.123  1.00 34.14 ? 12  ASP A O   1 
ATOM   5    C CB  . ASP A 1 9   ? -6.405  55.663 58.840  1.00 36.36 ? 12  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 9   ? -6.033  54.357 59.532  1.00 37.45 ? 12  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 9   ? -6.937  53.643 60.025  1.00 37.76 ? 12  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 9   ? -4.825  54.045 59.591  1.00 38.52 ? 12  ASP A OD2 1 
ATOM   9    N N   . VAL A 1 10  ? -8.586  53.435 57.304  1.00 33.29 ? 13  VAL A N   1 
ATOM   10   C CA  . VAL A 1 10  ? -8.674  52.274 56.431  1.00 32.86 ? 13  VAL A CA  1 
ATOM   11   C C   . VAL A 1 10  ? -9.438  52.575 55.153  1.00 33.27 ? 13  VAL A C   1 
ATOM   12   O O   . VAL A 1 10  ? -10.623 52.872 55.186  1.00 35.07 ? 13  VAL A O   1 
ATOM   13   C CB  . VAL A 1 10  ? -9.323  51.090 57.166  1.00 30.95 ? 13  VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 10  ? -9.496  49.900 56.230  1.00 31.06 ? 13  VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 10  ? -8.450  50.695 58.330  1.00 29.26 ? 13  VAL A CG2 1 
ATOM   16   N N   . ARG A 1 11  ? -8.748  52.488 54.023  1.00 33.12 ? 14  ARG A N   1 
ATOM   17   C CA  . ARG A 1 11  ? -9.356  52.756 52.726  1.00 32.01 ? 14  ARG A CA  1 
ATOM   18   C C   . ARG A 1 11  ? -9.855  51.527 51.989  1.00 29.58 ? 14  ARG A C   1 
ATOM   19   O O   . ARG A 1 11  ? -10.855 51.596 51.290  1.00 29.83 ? 14  ARG A O   1 
ATOM   20   C CB  . ARG A 1 11  ? -8.376  53.521 51.837  1.00 34.04 ? 14  ARG A CB  1 
ATOM   21   C CG  . ARG A 1 11  ? -8.133  54.948 52.302  1.00 38.02 ? 14  ARG A CG  1 
ATOM   22   C CD  . ARG A 1 11  ? -9.451  55.721 52.426  1.00 42.42 ? 14  ARG A CD  1 
ATOM   23   N NE  . ARG A 1 11  ? -9.238  57.080 52.916  1.00 47.16 ? 14  ARG A NE  1 
ATOM   24   C CZ  . ARG A 1 11  ? -9.367  57.448 54.188  1.00 49.56 ? 14  ARG A CZ  1 
ATOM   25   N NH1 . ARG A 1 11  ? -9.721  56.560 55.112  1.00 50.99 ? 14  ARG A NH1 1 
ATOM   26   N NH2 . ARG A 1 11  ? -9.104  58.704 54.540  1.00 50.72 ? 14  ARG A NH2 1 
ATOM   27   N N   . LYS A 1 12  ? -9.155  50.406 52.138  1.00 28.44 ? 15  LYS A N   1 
ATOM   28   C CA  . LYS A 1 12  ? -9.539  49.167 51.454  1.00 26.59 ? 15  LYS A CA  1 
ATOM   29   C C   . LYS A 1 12  ? -9.066  47.929 52.229  1.00 25.85 ? 15  LYS A C   1 
ATOM   30   O O   . LYS A 1 12  ? -7.991  47.945 52.834  1.00 26.32 ? 15  LYS A O   1 
ATOM   31   C CB  . LYS A 1 12  ? -8.967  49.166 50.030  1.00 24.27 ? 15  LYS A CB  1 
ATOM   32   C CG  . LYS A 1 12  ? -9.568  48.108 49.130  1.00 21.38 ? 15  LYS A CG  1 
ATOM   33   C CD  . LYS A 1 12  ? -9.181  48.329 47.679  1.00 21.74 ? 15  LYS A CD  1 
ATOM   34   C CE  . LYS A 1 12  ? -9.741  47.218 46.811  1.00 22.84 ? 15  LYS A CE  1 
ATOM   35   N NZ  . LYS A 1 12  ? -11.219 47.150 46.895  1.00 23.06 ? 15  LYS A NZ  1 
ATOM   36   N N   . VAL A 1 13  ? -9.826  46.840 52.144  1.00 24.80 ? 16  VAL A N   1 
ATOM   37   C CA  . VAL A 1 13  ? -9.485  45.635 52.880  1.00 24.72 ? 16  VAL A CA  1 
ATOM   38   C C   . VAL A 1 13  ? -9.899  44.332 52.165  1.00 24.40 ? 16  VAL A C   1 
ATOM   39   O O   . VAL A 1 13  ? -10.871 44.314 51.403  1.00 25.45 ? 16  VAL A O   1 
ATOM   40   C CB  . VAL A 1 13  ? -10.173 45.725 54.300  1.00 25.74 ? 16  VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 13  ? -11.197 44.617 54.515  1.00 25.47 ? 16  VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 13  ? -9.141  45.777 55.410  1.00 27.27 ? 16  VAL A CG2 1 
ATOM   43   N N   . GLY A 1 14  ? -9.168  43.244 52.420  1.00 23.43 ? 17  GLY A N   1 
ATOM   44   C CA  . GLY A 1 14  ? -9.522  41.963 51.835  1.00 20.37 ? 17  GLY A CA  1 
ATOM   45   C C   . GLY A 1 14  ? -8.399  40.953 51.687  1.00 21.96 ? 17  GLY A C   1 
ATOM   46   O O   . GLY A 1 14  ? -7.227  41.299 51.779  1.00 24.06 ? 17  GLY A O   1 
ATOM   47   N N   . TYR A 1 15  ? -8.762  39.692 51.470  1.00 22.38 ? 18  TYR A N   1 
ATOM   48   C CA  . TYR A 1 15  ? -7.780  38.635 51.267  1.00 23.66 ? 18  TYR A CA  1 
ATOM   49   C C   . TYR A 1 15  ? -7.253  38.629 49.838  1.00 25.78 ? 18  TYR A C   1 
ATOM   50   O O   . TYR A 1 15  ? -8.019  38.760 48.874  1.00 25.92 ? 18  TYR A O   1 
ATOM   51   C CB  . TYR A 1 15  ? -8.380  37.260 51.540  1.00 24.52 ? 18  TYR A CB  1 
ATOM   52   C CG  . TYR A 1 15  ? -8.440  36.883 52.998  1.00 26.57 ? 18  TYR A CG  1 
ATOM   53   C CD1 . TYR A 1 15  ? -9.665  36.673 53.630  1.00 26.70 ? 18  TYR A CD1 1 
ATOM   54   C CD2 . TYR A 1 15  ? -7.271  36.750 53.752  1.00 26.82 ? 18  TYR A CD2 1 
ATOM   55   C CE1 . TYR A 1 15  ? -9.725  36.345 54.971  1.00 27.55 ? 18  TYR A CE1 1 
ATOM   56   C CE2 . TYR A 1 15  ? -7.317  36.419 55.098  1.00 27.15 ? 18  TYR A CE2 1 
ATOM   57   C CZ  . TYR A 1 15  ? -8.548  36.218 55.702  1.00 28.53 ? 18  TYR A CZ  1 
ATOM   58   O OH  . TYR A 1 15  ? -8.610  35.876 57.032  1.00 30.52 ? 18  TYR A OH  1 
ATOM   59   N N   . LEU A 1 16  ? -5.933  38.522 49.721  1.00 25.51 ? 19  LEU A N   1 
ATOM   60   C CA  . LEU A 1 16  ? -5.243  38.437 48.437  1.00 26.57 ? 19  LEU A CA  1 
ATOM   61   C C   . LEU A 1 16  ? -4.229  37.338 48.662  1.00 28.75 ? 19  LEU A C   1 
ATOM   62   O O   . LEU A 1 16  ? -4.054  36.886 49.794  1.00 28.17 ? 19  LEU A O   1 
ATOM   63   C CB  . LEU A 1 16  ? -4.517  39.742 48.091  1.00 23.86 ? 19  LEU A CB  1 
ATOM   64   C CG  . LEU A 1 16  ? -5.351  41.023 48.092  1.00 20.50 ? 19  LEU A CG  1 
ATOM   65   C CD1 . LEU A 1 16  ? -4.464  42.205 47.735  1.00 17.85 ? 19  LEU A CD1 1 
ATOM   66   C CD2 . LEU A 1 16  ? -6.497  40.892 47.110  1.00 19.89 ? 19  LEU A CD2 1 
ATOM   67   N N   . ARG A 1 17  ? -3.600  36.865 47.596  1.00 31.68 ? 20  ARG A N   1 
ATOM   68   C CA  . ARG A 1 17  ? -2.598  35.820 47.753  1.00 35.64 ? 20  ARG A CA  1 
ATOM   69   C C   . ARG A 1 17  ? -1.210  36.348 47.466  1.00 37.64 ? 20  ARG A C   1 
ATOM   70   O O   . ARG A 1 17  ? -1.046  37.283 46.694  1.00 36.65 ? 20  ARG A O   1 
ATOM   71   C CB  . ARG A 1 17  ? -2.905  34.617 46.865  1.00 35.83 ? 20  ARG A CB  1 
ATOM   72   C CG  . ARG A 1 17  ? -4.046  33.772 47.371  1.00 39.76 ? 20  ARG A CG  1 
ATOM   73   C CD  . ARG A 1 17  ? -4.359  32.622 46.433  1.00 44.72 ? 20  ARG A CD  1 
ATOM   74   N NE  . ARG A 1 17  ? -5.477  31.823 46.927  1.00 51.10 ? 20  ARG A NE  1 
ATOM   75   C CZ  . ARG A 1 17  ? -5.360  30.858 47.837  1.00 54.13 ? 20  ARG A CZ  1 
ATOM   76   N NH1 . ARG A 1 17  ? -4.168  30.563 48.341  1.00 54.82 ? 20  ARG A NH1 1 
ATOM   77   N NH2 . ARG A 1 17  ? -6.437  30.215 48.275  1.00 54.93 ? 20  ARG A NH2 1 
ATOM   78   N N   . LYS A 1 18  ? -0.232  35.832 48.196  1.00 41.61 ? 21  LYS A N   1 
ATOM   79   C CA  . LYS A 1 18  ? 1.153   36.210 47.988  1.00 45.96 ? 21  LYS A CA  1 
ATOM   80   C C   . LYS A 1 18  ? 1.494   35.381 46.758  1.00 48.85 ? 21  LYS A C   1 
ATOM   81   O O   . LYS A 1 18  ? 1.414   34.157 46.805  1.00 49.40 ? 21  LYS A O   1 
ATOM   82   C CB  . LYS A 1 18  ? 1.999   35.763 49.176  1.00 47.02 ? 21  LYS A CB  1 
ATOM   83   C CG  . LYS A 1 18  ? 1.570   36.378 50.505  1.00 49.51 ? 21  LYS A CG  1 
ATOM   84   C CD  . LYS A 1 18  ? 1.784   37.891 50.547  1.00 51.53 ? 21  LYS A CD  1 
ATOM   85   C CE  . LYS A 1 18  ? 3.247   38.260 50.339  1.00 50.99 ? 21  LYS A CE  1 
ATOM   86   N NZ  . LYS A 1 18  ? 4.162   37.463 51.207  1.00 51.36 ? 21  LYS A NZ  1 
ATOM   87   N N   . PRO A 1 19  ? 1.838   36.031 45.635  1.00 50.75 ? 22  PRO A N   1 
ATOM   88   C CA  . PRO A 1 19  ? 2.173   35.344 44.380  1.00 52.63 ? 22  PRO A CA  1 
ATOM   89   C C   . PRO A 1 19  ? 3.151   34.178 44.460  1.00 55.26 ? 22  PRO A C   1 
ATOM   90   O O   . PRO A 1 19  ? 2.940   33.151 43.807  1.00 56.23 ? 22  PRO A O   1 
ATOM   91   C CB  . PRO A 1 19  ? 2.713   36.473 43.504  1.00 52.06 ? 22  PRO A CB  1 
ATOM   92   C CG  . PRO A 1 19  ? 3.233   37.447 44.497  1.00 51.92 ? 22  PRO A CG  1 
ATOM   93   C CD  . PRO A 1 19  ? 2.142   37.461 45.525  1.00 50.37 ? 22  PRO A CD  1 
ATOM   94   N N   . LYS A 1 20  ? 4.189   34.315 45.290  1.00 57.36 ? 23  LYS A N   1 
ATOM   95   C CA  . LYS A 1 20  ? 5.210   33.272 45.428  1.00 58.59 ? 23  LYS A CA  1 
ATOM   96   C C   . LYS A 1 20  ? 4.757   31.997 46.139  1.00 59.12 ? 23  LYS A C   1 
ATOM   97   O O   . LYS A 1 20  ? 4.814   30.916 45.564  1.00 59.76 ? 23  LYS A O   1 
ATOM   98   C CB  . LYS A 1 20  ? 6.454   33.838 46.113  1.00 59.79 ? 23  LYS A CB  1 
ATOM   99   C CG  . LYS A 1 20  ? 7.748   33.551 45.364  1.00 63.55 ? 23  LYS A CG  1 
ATOM   100  C CD  . LYS A 1 20  ? 7.947   32.056 45.154  1.00 65.88 ? 23  LYS A CD  1 
ATOM   101  C CE  . LYS A 1 20  ? 9.296   31.746 44.517  1.00 67.12 ? 23  LYS A CE  1 
ATOM   102  N NZ  . LYS A 1 20  ? 9.478   30.274 44.331  1.00 67.69 ? 23  LYS A NZ  1 
ATOM   103  N N   . SER A 1 21  ? 4.310   32.126 47.384  1.00 59.73 ? 24  SER A N   1 
ATOM   104  C CA  . SER A 1 21  ? 3.860   30.978 48.171  1.00 59.81 ? 24  SER A CA  1 
ATOM   105  C C   . SER A 1 21  ? 2.380   30.690 47.982  1.00 57.95 ? 24  SER A C   1 
ATOM   106  O O   . SER A 1 21  ? 1.864   29.694 48.479  1.00 56.70 ? 24  SER A O   1 
ATOM   107  C CB  . SER A 1 21  ? 4.116   31.238 49.653  1.00 61.87 ? 24  SER A CB  1 
ATOM   108  O OG  . SER A 1 21  ? 3.325   32.326 50.110  1.00 65.32 ? 24  SER A OG  1 
ATOM   109  N N   . MET A 1 22  ? 1.703   31.604 47.300  1.00 57.06 ? 25  MET A N   1 
ATOM   110  C CA  . MET A 1 22  ? 0.273   31.523 47.037  1.00 56.30 ? 25  MET A CA  1 
ATOM   111  C C   . MET A 1 22  ? -0.555  31.448 48.330  1.00 54.53 ? 25  MET A C   1 
ATOM   112  O O   . MET A 1 22  ? -1.683  30.945 48.336  1.00 53.88 ? 25  MET A O   1 
ATOM   113  C CB  . MET A 1 22  ? -0.045  30.360 46.099  1.00 59.23 ? 25  MET A CB  1 
ATOM   114  C CG  . MET A 1 22  ? -1.292  30.597 45.254  1.00 63.51 ? 25  MET A CG  1 
ATOM   115  S SD  . MET A 1 22  ? -1.104  31.933 44.018  1.00 69.12 ? 25  MET A SD  1 
ATOM   116  C CE  . MET A 1 22  ? -1.579  30.986 42.495  1.00 65.06 ? 25  MET A CE  1 
ATOM   117  N N   . HIS A 1 23  ? 0.021   31.960 49.421  1.00 51.90 ? 26  HIS A N   1 
ATOM   118  C CA  . HIS A 1 23  ? -0.640  31.984 50.728  1.00 49.36 ? 26  HIS A CA  1 
ATOM   119  C C   . HIS A 1 23  ? -1.686  33.089 50.740  1.00 46.06 ? 26  HIS A C   1 
ATOM   120  O O   . HIS A 1 23  ? -1.485  34.150 50.155  1.00 45.88 ? 26  HIS A O   1 
ATOM   121  C CB  . HIS A 1 23  ? 0.370   32.276 51.850  1.00 52.33 ? 26  HIS A CB  1 
ATOM   122  C CG  . HIS A 1 23  ? 1.319   31.150 52.142  1.00 56.26 ? 26  HIS A CG  1 
ATOM   123  N ND1 . HIS A 1 23  ? 2.589   31.362 52.640  1.00 57.14 ? 26  HIS A ND1 1 
ATOM   124  C CD2 . HIS A 1 23  ? 1.181   29.807 52.025  1.00 57.54 ? 26  HIS A CD2 1 
ATOM   125  C CE1 . HIS A 1 23  ? 3.190   30.200 52.818  1.00 58.01 ? 26  HIS A CE1 1 
ATOM   126  N NE2 . HIS A 1 23  ? 2.358   29.241 52.452  1.00 58.94 ? 26  HIS A NE2 1 
ATOM   127  N N   . LYS A 1 24  ? -2.789  32.847 51.433  1.00 42.13 ? 27  LYS A N   1 
ATOM   128  C CA  . LYS A 1 24  ? -3.861  33.828 51.543  1.00 38.89 ? 27  LYS A CA  1 
ATOM   129  C C   . LYS A 1 24  ? -3.571  34.766 52.721  1.00 36.94 ? 27  LYS A C   1 
ATOM   130  O O   . LYS A 1 24  ? -3.554  34.345 53.883  1.00 38.40 ? 27  LYS A O   1 
ATOM   131  C CB  . LYS A 1 24  ? -5.183  33.105 51.765  1.00 40.16 ? 27  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 24  ? -6.344  33.725 51.067  1.00 43.18 ? 27  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 24  ? -7.579  32.902 51.307  1.00 45.71 ? 27  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 24  ? -7.926  32.850 52.790  1.00 46.04 ? 27  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 24  ? -9.377  32.585 52.993  1.00 47.38 ? 27  LYS A NZ  1 
ATOM   136  N N   . ARG A 1 25  ? -3.322  36.031 52.422  1.00 33.44 ? 28  ARG A N   1 
ATOM   137  C CA  . ARG A 1 25  ? -3.022  37.001 53.457  1.00 31.63 ? 28  ARG A CA  1 
ATOM   138  C C   . ARG A 1 25  ? -4.022  38.142 53.417  1.00 28.84 ? 28  ARG A C   1 
ATOM   139  O O   . ARG A 1 25  ? -4.449  38.545 52.338  1.00 29.97 ? 28  ARG A O   1 
ATOM   140  C CB  . ARG A 1 25  ? -1.608  37.534 53.263  1.00 33.64 ? 28  ARG A CB  1 
ATOM   141  C CG  . ARG A 1 25  ? -0.536  36.487 53.437  1.00 36.43 ? 28  ARG A CG  1 
ATOM   142  C CD  . ARG A 1 25  ? -0.253  36.238 54.922  1.00 41.10 ? 28  ARG A CD  1 
ATOM   143  N NE  . ARG A 1 25  ? -0.894  35.037 55.453  1.00 43.24 ? 28  ARG A NE  1 
ATOM   144  C CZ  . ARG A 1 25  ? -0.355  33.823 55.414  1.00 46.21 ? 28  ARG A CZ  1 
ATOM   145  N NH1 . ARG A 1 25  ? 0.838   33.641 54.859  1.00 47.13 ? 28  ARG A NH1 1 
ATOM   146  N NH2 . ARG A 1 25  ? -0.998  32.796 55.958  1.00 46.32 ? 28  ARG A NH2 1 
ATOM   147  N N   . PHE A 1 26  ? -4.372  38.670 54.594  1.00 26.24 ? 29  PHE A N   1 
ATOM   148  C CA  . PHE A 1 26  ? -5.336  39.761 54.707  1.00 23.07 ? 29  PHE A CA  1 
ATOM   149  C C   . PHE A 1 26  ? -4.700  41.135 54.536  1.00 22.39 ? 29  PHE A C   1 
ATOM   150  O O   . PHE A 1 26  ? -4.003  41.620 55.432  1.00 22.50 ? 29  PHE A O   1 
ATOM   151  C CB  . PHE A 1 26  ? -6.061  39.696 56.046  1.00 20.01 ? 29  PHE A CB  1 
ATOM   152  C CG  . PHE A 1 26  ? -7.307  40.520 56.081  1.00 20.13 ? 29  PHE A CG  1 
ATOM   153  C CD1 . PHE A 1 26  ? -8.497  40.014 55.564  1.00 17.00 ? 29  PHE A CD1 1 
ATOM   154  C CD2 . PHE A 1 26  ? -7.283  41.825 56.570  1.00 17.94 ? 29  PHE A CD2 1 
ATOM   155  C CE1 . PHE A 1 26  ? -9.636  40.796 55.525  1.00 14.55 ? 29  PHE A CE1 1 
ATOM   156  C CE2 . PHE A 1 26  ? -8.417  42.609 56.532  1.00 16.94 ? 29  PHE A CE2 1 
ATOM   157  C CZ  . PHE A 1 26  ? -9.596  42.094 56.009  1.00 13.78 ? 29  PHE A CZ  1 
ATOM   158  N N   . PHE A 1 27  ? -4.976  41.776 53.403  1.00 21.48 ? 30  PHE A N   1 
ATOM   159  C CA  . PHE A 1 27  ? -4.412  43.084 53.105  1.00 20.66 ? 30  PHE A CA  1 
ATOM   160  C C   . PHE A 1 27  ? -5.251  44.257 53.576  1.00 21.17 ? 30  PHE A C   1 
ATOM   161  O O   . PHE A 1 27  ? -6.474  44.212 53.537  1.00 21.18 ? 30  PHE A O   1 
ATOM   162  C CB  . PHE A 1 27  ? -4.087  43.207 51.608  1.00 20.01 ? 30  PHE A CB  1 
ATOM   163  C CG  . PHE A 1 27  ? -2.848  42.462 51.195  1.00 19.66 ? 30  PHE A CG  1 
ATOM   164  C CD1 . PHE A 1 27  ? -2.883  41.082 50.986  1.00 20.00 ? 30  PHE A CD1 1 
ATOM   165  C CD2 . PHE A 1 27  ? -1.640  43.136 51.018  1.00 19.15 ? 30  PHE A CD2 1 
ATOM   166  C CE1 . PHE A 1 27  ? -1.723  40.375 50.600  1.00 18.74 ? 30  PHE A CE1 1 
ATOM   167  C CE2 . PHE A 1 27  ? -0.467  42.439 50.631  1.00 17.76 ? 30  PHE A CE2 1 
ATOM   168  C CZ  . PHE A 1 27  ? -0.514  41.059 50.424  1.00 18.06 ? 30  PHE A CZ  1 
ATOM   169  N N   . VAL A 1 28  ? -4.570  45.319 53.999  1.00 22.21 ? 31  VAL A N   1 
ATOM   170  C CA  . VAL A 1 28  ? -5.217  46.522 54.510  1.00 23.04 ? 31  VAL A CA  1 
ATOM   171  C C   . VAL A 1 28  ? -4.553  47.762 53.922  1.00 24.31 ? 31  VAL A C   1 
ATOM   172  O O   . VAL A 1 28  ? -3.350  47.963 54.100  1.00 25.48 ? 31  VAL A O   1 
ATOM   173  C CB  . VAL A 1 28  ? -5.088  46.626 56.061  1.00 22.24 ? 31  VAL A CB  1 
ATOM   174  C CG1 . VAL A 1 28  ? -5.803  47.881 56.573  1.00 22.27 ? 31  VAL A CG1 1 
ATOM   175  C CG2 . VAL A 1 28  ? -5.639  45.379 56.738  1.00 23.20 ? 31  VAL A CG2 1 
ATOM   176  N N   . LEU A 1 29  ? -5.336  48.589 53.233  1.00 23.87 ? 32  LEU A N   1 
ATOM   177  C CA  . LEU A 1 29  ? -4.814  49.811 52.641  1.00 25.49 ? 32  LEU A CA  1 
ATOM   178  C C   . LEU A 1 29  ? -5.179  50.901 53.614  1.00 25.65 ? 32  LEU A C   1 
ATOM   179  O O   . LEU A 1 29  ? -6.329  50.966 54.052  1.00 24.54 ? 32  LEU A O   1 
ATOM   180  C CB  . LEU A 1 29  ? -5.493  50.117 51.300  1.00 25.98 ? 32  LEU A CB  1 
ATOM   181  C CG  . LEU A 1 29  ? -4.659  50.667 50.123  1.00 27.67 ? 32  LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 29  ? -5.573  51.493 49.193  1.00 25.45 ? 32  LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 29  ? -3.470  51.502 50.591  1.00 24.26 ? 32  LEU A CD2 1 
ATOM   184  N N   . ARG A 1 30  ? -4.221  51.772 53.921  1.00 26.61 ? 33  ARG A N   1 
ATOM   185  C CA  . ARG A 1 30  ? -4.449  52.867 54.862  1.00 27.93 ? 33  ARG A CA  1 
ATOM   186  C C   . ARG A 1 30  ? -4.036  54.228 54.321  1.00 27.65 ? 33  ARG A C   1 
ATOM   187  O O   . ARG A 1 30  ? -2.954  54.376 53.740  1.00 25.91 ? 33  ARG A O   1 
ATOM   188  C CB  . ARG A 1 30  ? -3.685  52.624 56.170  1.00 27.32 ? 33  ARG A CB  1 
ATOM   189  C CG  . ARG A 1 30  ? -4.225  51.506 57.044  1.00 29.35 ? 33  ARG A CG  1 
ATOM   190  C CD  . ARG A 1 30  ? -3.284  51.247 58.211  1.00 29.61 ? 33  ARG A CD  1 
ATOM   191  N NE  . ARG A 1 30  ? -3.678  50.083 59.001  1.00 31.31 ? 33  ARG A NE  1 
ATOM   192  C CZ  . ARG A 1 30  ? -4.723  50.057 59.821  1.00 30.87 ? 33  ARG A CZ  1 
ATOM   193  N NH1 . ARG A 1 30  ? -5.483  51.140 59.956  1.00 30.99 ? 33  ARG A NH1 1 
ATOM   194  N NH2 . ARG A 1 30  ? -5.011  48.945 60.496  1.00 30.75 ? 33  ARG A NH2 1 
ATOM   195  N N   . ALA A 1 31  ? -4.912  55.212 54.520  1.00 28.20 ? 34  ALA A N   1 
ATOM   196  C CA  . ALA A 1 31  ? -4.665  56.587 54.121  1.00 29.87 ? 34  ALA A CA  1 
ATOM   197  C C   . ALA A 1 31  ? -3.750  57.204 55.169  1.00 33.29 ? 34  ALA A C   1 
ATOM   198  O O   . ALA A 1 31  ? -3.666  56.714 56.298  1.00 34.25 ? 34  ALA A O   1 
ATOM   199  C CB  . ALA A 1 31  ? -5.950  57.331 54.077  1.00 29.34 ? 34  ALA A CB  1 
ATOM   200  N N   . ALA A 1 32  ? -3.049  58.269 54.804  1.00 35.61 ? 35  ALA A N   1 
ATOM   201  C CA  . ALA A 1 32  ? -2.152  58.925 55.747  1.00 38.46 ? 35  ALA A CA  1 
ATOM   202  C C   . ALA A 1 32  ? -2.922  59.628 56.851  1.00 41.81 ? 35  ALA A C   1 
ATOM   203  O O   . ALA A 1 32  ? -3.975  60.216 56.608  1.00 43.01 ? 35  ALA A O   1 
ATOM   204  C CB  . ALA A 1 32  ? -1.264  59.912 55.032  1.00 36.09 ? 35  ALA A CB  1 
ATOM   205  N N   . SER A 1 33  ? -2.412  59.527 58.072  1.00 45.19 ? 36  SER A N   1 
ATOM   206  C CA  . SER A 1 33  ? -3.023  60.183 59.222  1.00 49.39 ? 36  SER A CA  1 
ATOM   207  C C   . SER A 1 33  ? -1.921  60.808 60.071  1.00 52.93 ? 36  SER A C   1 
ATOM   208  O O   . SER A 1 33  ? -0.815  60.278 60.150  1.00 52.87 ? 36  SER A O   1 
ATOM   209  C CB  . SER A 1 33  ? -3.827  59.189 60.056  1.00 47.50 ? 36  SER A CB  1 
ATOM   210  O OG  . SER A 1 33  ? -2.993  58.185 60.601  1.00 47.01 ? 36  SER A OG  1 
ATOM   211  N N   . GLU A 1 34  ? -2.201  61.963 60.663  1.00 57.90 ? 37  GLU A N   1 
ATOM   212  C CA  . GLU A 1 34  ? -1.213  62.635 61.506  1.00 62.59 ? 37  GLU A CA  1 
ATOM   213  C C   . GLU A 1 34  ? -1.360  62.111 62.933  1.00 63.30 ? 37  GLU A C   1 
ATOM   214  O O   . GLU A 1 34  ? -1.537  62.880 63.877  1.00 64.80 ? 37  GLU A O   1 
ATOM   215  C CB  . GLU A 1 34  ? -1.391  64.165 61.461  1.00 65.78 ? 37  GLU A CB  1 
ATOM   216  C CG  . GLU A 1 34  ? -0.941  64.833 60.148  1.00 72.18 ? 37  GLU A CG  1 
ATOM   217  C CD  . GLU A 1 34  ? -1.765  64.403 58.930  1.00 76.08 ? 37  GLU A CD  1 
ATOM   218  O OE1 . GLU A 1 34  ? -2.916  64.877 58.789  1.00 78.25 ? 37  GLU A OE1 1 
ATOM   219  O OE2 . GLU A 1 34  ? -1.261  63.595 58.113  1.00 77.97 ? 37  GLU A OE2 1 
ATOM   220  N N   . ALA A 1 35  ? -1.290  60.789 63.069  1.00 63.05 ? 38  ALA A N   1 
ATOM   221  C CA  . ALA A 1 35  ? -1.422  60.112 64.351  1.00 62.51 ? 38  ALA A CA  1 
ATOM   222  C C   . ALA A 1 35  ? -1.054  58.640 64.192  1.00 62.79 ? 38  ALA A C   1 
ATOM   223  O O   . ALA A 1 35  ? -0.143  58.136 64.865  1.00 64.28 ? 38  ALA A O   1 
ATOM   224  C CB  . ALA A 1 35  ? -2.856  60.234 64.859  1.00 61.79 ? 38  ALA A CB  1 
ATOM   225  N N   . GLY A 1 36  ? -1.757  57.972 63.276  1.00 61.19 ? 39  GLY A N   1 
ATOM   226  C CA  . GLY A 1 36  ? -1.538  56.559 63.018  1.00 57.52 ? 39  GLY A CA  1 
ATOM   227  C C   . GLY A 1 36  ? -0.388  56.218 62.087  1.00 54.36 ? 39  GLY A C   1 
ATOM   228  O O   . GLY A 1 36  ? 0.033   55.058 62.039  1.00 55.51 ? 39  GLY A O   1 
ATOM   229  N N   . GLY A 1 37  ? 0.105   57.200 61.336  1.00 50.22 ? 40  GLY A N   1 
ATOM   230  C CA  . GLY A 1 37  ? 1.210   56.944 60.427  1.00 45.67 ? 40  GLY A CA  1 
ATOM   231  C C   . GLY A 1 37  ? 0.902   57.338 58.994  1.00 43.64 ? 40  GLY A C   1 
ATOM   232  O O   . GLY A 1 37  ? -0.205  57.793 58.707  1.00 43.55 ? 40  GLY A O   1 
ATOM   233  N N   . PRO A 1 38  ? 1.849   57.135 58.062  1.00 42.24 ? 41  PRO A N   1 
ATOM   234  C CA  . PRO A 1 38  ? 1.732   57.459 56.627  1.00 39.75 ? 41  PRO A CA  1 
ATOM   235  C C   . PRO A 1 38  ? 0.870   56.495 55.797  1.00 37.82 ? 41  PRO A C   1 
ATOM   236  O O   . PRO A 1 38  ? 0.469   55.446 56.287  1.00 37.63 ? 41  PRO A O   1 
ATOM   237  C CB  . PRO A 1 38  ? 3.186   57.440 56.166  1.00 40.08 ? 41  PRO A CB  1 
ATOM   238  C CG  . PRO A 1 38  ? 3.763   56.328 57.000  1.00 41.59 ? 41  PRO A CG  1 
ATOM   239  C CD  . PRO A 1 38  ? 3.177   56.570 58.374  1.00 41.57 ? 41  PRO A CD  1 
ATOM   240  N N   . ALA A 1 39  ? 0.535   56.886 54.565  1.00 36.46 ? 42  ALA A N   1 
ATOM   241  C CA  . ALA A 1 39  ? -0.261  56.030 53.669  1.00 33.95 ? 42  ALA A CA  1 
ATOM   242  C C   . ALA A 1 39  ? 0.543   54.757 53.449  1.00 32.01 ? 42  ALA A C   1 
ATOM   243  O O   . ALA A 1 39  ? 1.720   54.815 53.069  1.00 31.05 ? 42  ALA A O   1 
ATOM   244  C CB  . ALA A 1 39  ? -0.515  56.725 52.327  1.00 33.10 ? 42  ALA A CB  1 
ATOM   245  N N   . ARG A 1 40  ? -0.081  53.606 53.659  1.00 29.15 ? 43  ARG A N   1 
ATOM   246  C CA  . ARG A 1 40  ? 0.670   52.380 53.517  1.00 27.70 ? 43  ARG A CA  1 
ATOM   247  C C   . ARG A 1 40  ? -0.159  51.127 53.224  1.00 27.67 ? 43  ARG A C   1 
ATOM   248  O O   . ARG A 1 40  ? -1.353  51.029 53.561  1.00 26.81 ? 43  ARG A O   1 
ATOM   249  C CB  . ARG A 1 40  ? 1.482   52.164 54.804  1.00 26.25 ? 43  ARG A CB  1 
ATOM   250  C CG  . ARG A 1 40  ? 0.620   51.703 55.995  1.00 27.12 ? 43  ARG A CG  1 
ATOM   251  C CD  . ARG A 1 40  ? 1.212   52.040 57.348  1.00 27.20 ? 43  ARG A CD  1 
ATOM   252  N NE  . ARG A 1 40  ? 0.624   53.273 57.846  1.00 30.44 ? 43  ARG A NE  1 
ATOM   253  C CZ  . ARG A 1 40  ? -0.138  53.378 58.931  1.00 31.41 ? 43  ARG A CZ  1 
ATOM   254  N NH1 . ARG A 1 40  ? -0.417  52.322 59.689  1.00 28.87 ? 43  ARG A NH1 1 
ATOM   255  N NH2 . ARG A 1 40  ? -0.686  54.548 59.212  1.00 32.84 ? 43  ARG A NH2 1 
ATOM   256  N N   . LEU A 1 41  ? 0.492   50.167 52.581  1.00 27.44 ? 44  LEU A N   1 
ATOM   257  C CA  . LEU A 1 41  ? -0.135  48.903 52.288  1.00 26.84 ? 44  LEU A CA  1 
ATOM   258  C C   . LEU A 1 41  ? 0.507   47.977 53.315  1.00 27.16 ? 44  LEU A C   1 
ATOM   259  O O   . LEU A 1 41  ? 1.726   48.004 53.519  1.00 25.77 ? 44  LEU A O   1 
ATOM   260  C CB  . LEU A 1 41  ? 0.182   48.425 50.861  1.00 26.08 ? 44  LEU A CB  1 
ATOM   261  C CG  . LEU A 1 41  ? -0.464  47.057 50.572  1.00 25.18 ? 44  LEU A CG  1 
ATOM   262  C CD1 . LEU A 1 41  ? -1.985  47.216 50.492  1.00 23.24 ? 44  LEU A CD1 1 
ATOM   263  C CD2 . LEU A 1 41  ? 0.097   46.418 49.302  1.00 24.67 ? 44  LEU A CD2 1 
ATOM   264  N N   . GLU A 1 42  ? -0.335  47.212 53.999  1.00 27.15 ? 45  GLU A N   1 
ATOM   265  C CA  . GLU A 1 42  ? 0.099   46.264 55.012  1.00 26.38 ? 45  GLU A CA  1 
ATOM   266  C C   . GLU A 1 42  ? -0.751  45.018 54.854  1.00 25.94 ? 45  GLU A C   1 
ATOM   267  O O   . GLU A 1 42  ? -1.805  45.064 54.222  1.00 26.04 ? 45  GLU A O   1 
ATOM   268  C CB  . GLU A 1 42  ? -0.165  46.840 56.409  1.00 27.07 ? 45  GLU A CB  1 
ATOM   269  C CG  . GLU A 1 42  ? 0.383   48.240 56.635  1.00 29.94 ? 45  GLU A CG  1 
ATOM   270  C CD  . GLU A 1 42  ? 0.148   48.761 58.048  1.00 30.90 ? 45  GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 42  ? -0.963  48.571 58.597  1.00 33.85 ? 45  GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 42  ? 1.082   49.384 58.602  1.00 30.66 ? 45  GLU A OE2 1 
ATOM   273  N N   . TYR A 1 43  ? -0.272  43.898 55.379  1.00 25.57 ? 46  TYR A N   1 
ATOM   274  C CA  . TYR A 1 43  ? -1.058  42.669 55.347  1.00 26.03 ? 46  TYR A CA  1 
ATOM   275  C C   . TYR A 1 43  ? -0.815  41.894 56.629  1.00 26.00 ? 46  TYR A C   1 
ATOM   276  O O   . TYR A 1 43  ? 0.224   42.061 57.266  1.00 24.92 ? 46  TYR A O   1 
ATOM   277  C CB  . TYR A 1 43  ? -0.804  41.816 54.092  1.00 23.78 ? 46  TYR A CB  1 
ATOM   278  C CG  . TYR A 1 43  ? 0.487   41.040 54.047  1.00 22.61 ? 46  TYR A CG  1 
ATOM   279  C CD1 . TYR A 1 43  ? 0.570   39.766 54.602  1.00 22.94 ? 46  TYR A CD1 1 
ATOM   280  C CD2 . TYR A 1 43  ? 1.609   41.548 53.380  1.00 22.83 ? 46  TYR A CD2 1 
ATOM   281  C CE1 . TYR A 1 43  ? 1.735   39.013 54.494  1.00 22.27 ? 46  TYR A CE1 1 
ATOM   282  C CE2 . TYR A 1 43  ? 2.782   40.798 53.265  1.00 22.51 ? 46  TYR A CE2 1 
ATOM   283  C CZ  . TYR A 1 43  ? 2.831   39.533 53.823  1.00 23.07 ? 46  TYR A CZ  1 
ATOM   284  O OH  . TYR A 1 43  ? 3.971   38.775 53.708  1.00 27.43 ? 46  TYR A OH  1 
ATOM   285  N N   . TYR A 1 44  ? -1.800  41.085 57.008  1.00 26.82 ? 47  TYR A N   1 
ATOM   286  C CA  . TYR A 1 44  ? -1.781  40.278 58.228  1.00 27.45 ? 47  TYR A CA  1 
ATOM   287  C C   . TYR A 1 44  ? -1.892  38.791 57.909  1.00 28.58 ? 47  TYR A C   1 
ATOM   288  O O   . TYR A 1 44  ? -2.180  38.414 56.775  1.00 29.45 ? 47  TYR A O   1 
ATOM   289  C CB  . TYR A 1 44  ? -2.962  40.691 59.120  1.00 28.37 ? 47  TYR A CB  1 
ATOM   290  C CG  . TYR A 1 44  ? -2.916  42.139 59.538  1.00 27.45 ? 47  TYR A CG  1 
ATOM   291  C CD1 . TYR A 1 44  ? -3.305  43.156 58.659  1.00 27.94 ? 47  TYR A CD1 1 
ATOM   292  C CD2 . TYR A 1 44  ? -2.396  42.503 60.772  1.00 26.05 ? 47  TYR A CD2 1 
ATOM   293  C CE1 . TYR A 1 44  ? -3.162  44.505 59.002  1.00 27.34 ? 47  TYR A CE1 1 
ATOM   294  C CE2 . TYR A 1 44  ? -2.249  43.842 61.125  1.00 24.99 ? 47  TYR A CE2 1 
ATOM   295  C CZ  . TYR A 1 44  ? -2.629  44.837 60.241  1.00 26.66 ? 47  TYR A CZ  1 
ATOM   296  O OH  . TYR A 1 44  ? -2.461  46.152 60.603  1.00 27.65 ? 47  TYR A OH  1 
ATOM   297  N N   . GLU A 1 45  ? -1.701  37.949 58.923  1.00 29.53 ? 48  GLU A N   1 
ATOM   298  C CA  . GLU A 1 45  ? -1.789  36.502 58.745  1.00 31.17 ? 48  GLU A CA  1 
ATOM   299  C C   . GLU A 1 45  ? -3.206  36.195 58.299  1.00 29.62 ? 48  GLU A C   1 
ATOM   300  O O   . GLU A 1 45  ? -3.418  35.435 57.357  1.00 30.87 ? 48  GLU A O   1 
ATOM   301  C CB  . GLU A 1 45  ? -1.489  35.774 60.054  1.00 34.81 ? 48  GLU A CB  1 
ATOM   302  C CG  . GLU A 1 45  ? -1.400  34.252 59.913  1.00 41.20 ? 48  GLU A CG  1 
ATOM   303  C CD  . GLU A 1 45  ? -1.450  33.532 61.256  1.00 45.36 ? 48  GLU A CD  1 
ATOM   304  O OE1 . GLU A 1 45  ? -2.569  33.337 61.777  1.00 48.76 ? 48  GLU A OE1 1 
ATOM   305  O OE2 . GLU A 1 45  ? -0.381  33.163 61.791  1.00 46.99 ? 48  GLU A OE2 1 
ATOM   306  N N   . ASN A 1 46  ? -4.166  36.799 58.991  1.00 27.85 ? 49  ASN A N   1 
ATOM   307  C CA  . ASN A 1 46  ? -5.580  36.655 58.668  1.00 26.73 ? 49  ASN A CA  1 
ATOM   308  C C   . ASN A 1 46  ? -6.350  37.901 59.124  1.00 26.20 ? 49  ASN A C   1 
ATOM   309  O O   . ASN A 1 46  ? -5.752  38.872 59.606  1.00 25.47 ? 49  ASN A O   1 
ATOM   310  C CB  . ASN A 1 46  ? -6.181  35.369 59.254  1.00 26.42 ? 49  ASN A CB  1 
ATOM   311  C CG  . ASN A 1 46  ? -5.939  35.229 60.738  1.00 26.97 ? 49  ASN A CG  1 
ATOM   312  O OD1 . ASN A 1 46  ? -6.246  36.128 61.513  1.00 27.00 ? 49  ASN A OD1 1 
ATOM   313  N ND2 . ASN A 1 46  ? -5.381  34.096 61.139  1.00 27.27 ? 49  ASN A ND2 1 
ATOM   314  N N   . GLU A 1 47  ? -7.662  37.887 58.921  1.00 25.01 ? 50  GLU A N   1 
ATOM   315  C CA  . GLU A 1 47  ? -8.513  38.998 59.285  1.00 24.94 ? 50  GLU A CA  1 
ATOM   316  C C   . GLU A 1 47  ? -8.654  39.174 60.794  1.00 27.13 ? 50  GLU A C   1 
ATOM   317  O O   . GLU A 1 47  ? -8.667  40.292 61.293  1.00 25.65 ? 50  GLU A O   1 
ATOM   318  C CB  . GLU A 1 47  ? -9.893  38.802 58.670  1.00 24.12 ? 50  GLU A CB  1 
ATOM   319  C CG  . GLU A 1 47  ? -10.852 39.956 58.965  1.00 25.13 ? 50  GLU A CG  1 
ATOM   320  C CD  . GLU A 1 47  ? -12.249 39.694 58.476  1.00 25.63 ? 50  GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 47  ? -12.700 38.534 58.573  1.00 25.74 ? 50  GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 47  ? -12.892 40.651 58.006  1.00 24.66 ? 50  GLU A OE2 1 
ATOM   323  N N   . LYS A 1 48  ? -8.795  38.060 61.506  1.00 30.07 ? 51  LYS A N   1 
ATOM   324  C CA  . LYS A 1 48  ? -8.947  38.067 62.954  1.00 34.12 ? 51  LYS A CA  1 
ATOM   325  C C   . LYS A 1 48  ? -7.868  38.900 63.657  1.00 34.06 ? 51  LYS A C   1 
ATOM   326  O O   . LYS A 1 48  ? -8.185  39.730 64.520  1.00 33.42 ? 51  LYS A O   1 
ATOM   327  C CB  . LYS A 1 48  ? -8.938  36.638 63.490  1.00 37.54 ? 51  LYS A CB  1 
ATOM   328  C CG  . LYS A 1 48  ? -9.279  36.536 64.959  1.00 43.70 ? 51  LYS A CG  1 
ATOM   329  C CD  . LYS A 1 48  ? -9.471  35.098 65.378  1.00 47.91 ? 51  LYS A CD  1 
ATOM   330  C CE  . LYS A 1 48  ? -10.471 34.389 64.464  1.00 50.75 ? 51  LYS A CE  1 
ATOM   331  N NZ  . LYS A 1 48  ? -11.811 35.038 64.493  1.00 55.26 ? 51  LYS A NZ  1 
ATOM   332  N N   . LYS A 1 49  ? -6.611  38.702 63.254  1.00 33.15 ? 52  LYS A N   1 
ATOM   333  C CA  . LYS A 1 49  ? -5.474  39.420 63.824  1.00 32.31 ? 52  LYS A CA  1 
ATOM   334  C C   . LYS A 1 49  ? -5.599  40.933 63.609  1.00 31.99 ? 52  LYS A C   1 
ATOM   335  O O   . LYS A 1 49  ? -5.161  41.727 64.441  1.00 31.87 ? 52  LYS A O   1 
ATOM   336  C CB  . LYS A 1 49  ? -4.180  38.934 63.187  1.00 33.10 ? 52  LYS A CB  1 
ATOM   337  C CG  . LYS A 1 49  ? -3.949  37.446 63.239  1.00 35.62 ? 52  LYS A CG  1 
ATOM   338  C CD  . LYS A 1 49  ? -3.482  37.008 64.603  1.00 40.32 ? 52  LYS A CD  1 
ATOM   339  C CE  . LYS A 1 49  ? -3.110  35.535 64.581  1.00 42.04 ? 52  LYS A CE  1 
ATOM   340  N NZ  . LYS A 1 49  ? -2.674  35.065 65.923  1.00 47.99 ? 52  LYS A NZ  1 
ATOM   341  N N   . TRP A 1 50  ? -6.154  41.332 62.472  1.00 30.57 ? 53  TRP A N   1 
ATOM   342  C CA  . TRP A 1 50  ? -6.331  42.752 62.183  1.00 29.97 ? 53  TRP A CA  1 
ATOM   343  C C   . TRP A 1 50  ? -7.530  43.355 62.957  1.00 32.69 ? 53  TRP A C   1 
ATOM   344  O O   . TRP A 1 50  ? -7.446  44.485 63.463  1.00 32.11 ? 53  TRP A O   1 
ATOM   345  C CB  . TRP A 1 50  ? -6.474  42.981 60.663  1.00 25.90 ? 53  TRP A CB  1 
ATOM   346  C CG  . TRP A 1 50  ? -6.958  44.356 60.302  1.00 18.29 ? 53  TRP A CG  1 
ATOM   347  C CD1 . TRP A 1 50  ? -6.271  45.535 60.426  1.00 17.83 ? 53  TRP A CD1 1 
ATOM   348  C CD2 . TRP A 1 50  ? -8.268  44.702 59.857  1.00 16.96 ? 53  TRP A CD2 1 
ATOM   349  N NE1 . TRP A 1 50  ? -7.087  46.598 60.107  1.00 16.44 ? 53  TRP A NE1 1 
ATOM   350  C CE2 . TRP A 1 50  ? -8.320  46.114 59.751  1.00 16.14 ? 53  TRP A CE2 1 
ATOM   351  C CE3 . TRP A 1 50  ? -9.411  43.955 59.540  1.00 17.51 ? 53  TRP A CE3 1 
ATOM   352  C CZ2 . TRP A 1 50  ? -9.468  46.795 59.346  1.00 17.98 ? 53  TRP A CZ2 1 
ATOM   353  C CZ3 . TRP A 1 50  ? -10.555 44.631 59.134  1.00 18.91 ? 53  TRP A CZ3 1 
ATOM   354  C CH2 . TRP A 1 50  ? -10.573 46.042 59.043  1.00 17.60 ? 53  TRP A CH2 1 
ATOM   355  N N   . ARG A 1 51  ? -8.632  42.603 63.039  1.00 36.17 ? 54  ARG A N   1 
ATOM   356  C CA  . ARG A 1 51  ? -9.832  43.042 63.755  1.00 38.90 ? 54  ARG A CA  1 
ATOM   357  C C   . ARG A 1 51  ? -9.559  43.130 65.255  1.00 39.24 ? 54  ARG A C   1 
ATOM   358  O O   . ARG A 1 51  ? -9.900  44.117 65.904  1.00 39.48 ? 54  ARG A O   1 
ATOM   359  C CB  . ARG A 1 51  ? -10.982 42.062 63.547  1.00 42.71 ? 54  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 51  ? -11.596 42.035 62.161  1.00 48.69 ? 54  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 51  ? -12.696 40.968 62.100  1.00 53.10 ? 54  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 51  ? -12.204 39.691 62.617  1.00 57.86 ? 54  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 51  ? -12.770 38.508 62.400  1.00 60.58 ? 54  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 51  ? -13.871 38.413 61.661  1.00 61.61 ? 54  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 51  ? -12.215 37.409 62.901  1.00 61.67 ? 54  ARG A NH2 1 
ATOM   366  N N   . HIS A 1 52  ? -8.927  42.092 65.789  1.00 38.77 ? 55  HIS A N   1 
ATOM   367  C CA  . HIS A 1 52  ? -8.602  42.018 67.202  1.00 39.67 ? 55  HIS A CA  1 
ATOM   368  C C   . HIS A 1 52  ? -7.351  42.783 67.605  1.00 40.09 ? 55  HIS A C   1 
ATOM   369  O O   . HIS A 1 52  ? -6.969  42.763 68.772  1.00 41.71 ? 55  HIS A O   1 
ATOM   370  C CB  . HIS A 1 52  ? -8.452  40.558 67.610  1.00 42.00 ? 55  HIS A CB  1 
ATOM   371  C CG  . HIS A 1 52  ? -9.730  39.784 67.547  1.00 46.17 ? 55  HIS A CG  1 
ATOM   372  N ND1 . HIS A 1 52  ? -9.785  38.415 67.712  1.00 47.73 ? 55  HIS A ND1 1 
ATOM   373  C CD2 . HIS A 1 52  ? -11.005 40.189 67.327  1.00 46.66 ? 55  HIS A CD2 1 
ATOM   374  C CE1 . HIS A 1 52  ? -11.037 38.009 67.594  1.00 47.84 ? 55  HIS A CE1 1 
ATOM   375  N NE2 . HIS A 1 52  ? -11.796 39.066 67.360  1.00 49.05 ? 55  HIS A NE2 1 
ATOM   376  N N   . LYS A 1 53  ? -6.723  43.476 66.658  1.00 39.12 ? 56  LYS A N   1 
ATOM   377  C CA  . LYS A 1 53  ? -5.490  44.214 66.928  1.00 37.03 ? 56  LYS A CA  1 
ATOM   378  C C   . LYS A 1 53  ? -4.518  43.351 67.762  1.00 35.33 ? 56  LYS A C   1 
ATOM   379  O O   . LYS A 1 53  ? -3.829  43.855 68.655  1.00 34.94 ? 56  LYS A O   1 
ATOM   380  C CB  . LYS A 1 53  ? -5.788  45.527 67.655  1.00 37.11 ? 56  LYS A CB  1 
ATOM   381  C CG  . LYS A 1 53  ? -6.512  46.567 66.833  1.00 39.53 ? 56  LYS A CG  1 
ATOM   382  C CD  . LYS A 1 53  ? -6.553  47.907 67.575  1.00 41.74 ? 56  LYS A CD  1 
ATOM   383  C CE  . LYS A 1 53  ? -7.350  48.967 66.810  1.00 44.89 ? 56  LYS A CE  1 
ATOM   384  N NZ  . LYS A 1 53  ? -8.801  48.586 66.645  1.00 47.21 ? 56  LYS A NZ  1 
ATOM   385  N N   . SER A 1 54  ? -4.457  42.059 67.450  1.00 32.62 ? 57  SER A N   1 
ATOM   386  C CA  . SER A 1 54  ? -3.613  41.143 68.189  1.00 31.72 ? 57  SER A CA  1 
ATOM   387  C C   . SER A 1 54  ? -2.294  40.752 67.520  1.00 31.76 ? 57  SER A C   1 
ATOM   388  O O   . SER A 1 54  ? -1.592  39.862 68.005  1.00 31.50 ? 57  SER A O   1 
ATOM   389  C CB  . SER A 1 54  ? -4.405  39.883 68.502  1.00 32.59 ? 57  SER A CB  1 
ATOM   390  O OG  . SER A 1 54  ? -4.683  39.151 67.318  1.00 33.24 ? 57  SER A OG  1 
ATOM   391  N N   . SER A 1 55  ? -1.968  41.398 66.406  1.00 31.61 ? 58  SER A N   1 
ATOM   392  C CA  . SER A 1 55  ? -0.735  41.094 65.683  1.00 30.98 ? 58  SER A CA  1 
ATOM   393  C C   . SER A 1 55  ? -0.254  42.225 64.815  1.00 31.13 ? 58  SER A C   1 
ATOM   394  O O   . SER A 1 55  ? -1.053  42.975 64.259  1.00 32.05 ? 58  SER A O   1 
ATOM   395  C CB  . SER A 1 55  ? -0.913  39.879 64.788  1.00 32.26 ? 58  SER A CB  1 
ATOM   396  O OG  . SER A 1 55  ? -0.535  38.704 65.468  1.00 35.64 ? 58  SER A OG  1 
ATOM   397  N N   . ALA A 1 56  ? 1.066   42.339 64.703  1.00 29.20 ? 59  ALA A N   1 
ATOM   398  C CA  . ALA A 1 56  ? 1.666   43.364 63.859  1.00 28.43 ? 59  ALA A CA  1 
ATOM   399  C C   . ALA A 1 56  ? 1.559   42.859 62.423  1.00 27.29 ? 59  ALA A C   1 
ATOM   400  O O   . ALA A 1 56  ? 1.553   41.640 62.176  1.00 25.08 ? 59  ALA A O   1 
ATOM   401  C CB  . ALA A 1 56  ? 3.136   43.589 64.242  1.00 26.43 ? 59  ALA A CB  1 
ATOM   402  N N   . PRO A 1 57  ? 1.393   43.777 61.462  1.00 26.39 ? 60  PRO A N   1 
ATOM   403  C CA  . PRO A 1 57  ? 1.294   43.334 60.069  1.00 26.26 ? 60  PRO A CA  1 
ATOM   404  C C   . PRO A 1 57  ? 2.618   42.713 59.643  1.00 27.41 ? 60  PRO A C   1 
ATOM   405  O O   . PRO A 1 57  ? 3.682   43.236 59.998  1.00 27.88 ? 60  PRO A O   1 
ATOM   406  C CB  . PRO A 1 57  ? 1.026   44.638 59.314  1.00 26.03 ? 60  PRO A CB  1 
ATOM   407  C CG  . PRO A 1 57  ? 1.660   45.698 60.204  1.00 26.06 ? 60  PRO A CG  1 
ATOM   408  C CD  . PRO A 1 57  ? 1.222   45.235 61.573  1.00 26.41 ? 60  PRO A CD  1 
ATOM   409  N N   . LYS A 1 58  ? 2.548   41.586 58.928  1.00 27.36 ? 61  LYS A N   1 
ATOM   410  C CA  . LYS A 1 58  ? 3.738   40.885 58.439  1.00 27.70 ? 61  LYS A CA  1 
ATOM   411  C C   . LYS A 1 58  ? 4.589   41.817 57.570  1.00 28.08 ? 61  LYS A C   1 
ATOM   412  O O   . LYS A 1 58  ? 5.824   41.730 57.553  1.00 28.04 ? 61  LYS A O   1 
ATOM   413  C CB  . LYS A 1 58  ? 3.326   39.671 57.628  1.00 28.97 ? 61  LYS A CB  1 
ATOM   414  C CG  . LYS A 1 58  ? 2.537   38.653 58.399  1.00 33.00 ? 61  LYS A CG  1 
ATOM   415  C CD  . LYS A 1 58  ? 3.396   37.965 59.427  1.00 39.16 ? 61  LYS A CD  1 
ATOM   416  C CE  . LYS A 1 58  ? 2.683   36.757 60.032  1.00 43.60 ? 61  LYS A CE  1 
ATOM   417  N NZ  . LYS A 1 58  ? 2.316   35.704 59.018  1.00 44.79 ? 61  LYS A NZ  1 
ATOM   418  N N   . ARG A 1 59  ? 3.908   42.707 56.855  1.00 26.77 ? 62  ARG A N   1 
ATOM   419  C CA  . ARG A 1 59  ? 4.554   43.691 56.006  1.00 26.73 ? 62  ARG A CA  1 
ATOM   420  C C   . ARG A 1 59  ? 3.838   45.023 56.098  1.00 26.05 ? 62  ARG A C   1 
ATOM   421  O O   . ARG A 1 59  ? 2.622   45.081 56.279  1.00 25.60 ? 62  ARG A O   1 
ATOM   422  C CB  . ARG A 1 59  ? 4.605   43.224 54.549  1.00 27.80 ? 62  ARG A CB  1 
ATOM   423  C CG  . ARG A 1 59  ? 5.730   42.235 54.271  1.00 29.52 ? 62  ARG A CG  1 
ATOM   424  C CD  . ARG A 1 59  ? 7.078   42.885 54.522  1.00 29.36 ? 62  ARG A CD  1 
ATOM   425  N NE  . ARG A 1 59  ? 7.937   42.662 53.379  1.00 34.66 ? 62  ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 59  ? 8.341   43.599 52.524  1.00 36.57 ? 62  ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 59  ? 8.008   44.877 52.652  1.00 39.88 ? 62  ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 59  ? 9.001   43.216 51.462  1.00 30.09 ? 62  ARG A NH2 1 
ATOM   429  N N   . SER A 1 60  ? 4.610   46.096 55.984  1.00 25.57 ? 63  SER A N   1 
ATOM   430  C CA  . SER A 1 60  ? 4.077   47.443 56.050  1.00 25.48 ? 63  SER A CA  1 
ATOM   431  C C   . SER A 1 60  ? 4.889   48.267 55.052  1.00 26.66 ? 63  SER A C   1 
ATOM   432  O O   . SER A 1 60  ? 6.016   48.672 55.353  1.00 28.41 ? 63  SER A O   1 
ATOM   433  C CB  . SER A 1 60  ? 4.234   47.987 57.480  1.00 23.79 ? 63  SER A CB  1 
ATOM   434  O OG  . SER A 1 60  ? 3.572   49.234 57.660  1.00 24.12 ? 63  SER A OG  1 
ATOM   435  N N   . ILE A 1 61  ? 4.348   48.437 53.843  1.00 26.95 ? 64  ILE A N   1 
ATOM   436  C CA  . ILE A 1 61  ? 5.011   49.199 52.773  1.00 27.10 ? 64  ILE A CA  1 
ATOM   437  C C   . ILE A 1 61  ? 4.402   50.592 52.579  1.00 28.26 ? 64  ILE A C   1 
ATOM   438  O O   . ILE A 1 61  ? 3.230   50.717 52.208  1.00 29.66 ? 64  ILE A O   1 
ATOM   439  C CB  . ILE A 1 61  ? 4.933   48.438 51.436  1.00 25.54 ? 64  ILE A CB  1 
ATOM   440  C CG1 . ILE A 1 61  ? 5.534   47.045 51.599  1.00 23.54 ? 64  ILE A CG1 1 
ATOM   441  C CG2 . ILE A 1 61  ? 5.644   49.205 50.341  1.00 24.84 ? 64  ILE A CG2 1 
ATOM   442  C CD1 . ILE A 1 61  ? 4.684   45.939 51.000  1.00 24.72 ? 64  ILE A CD1 1 
ATOM   443  N N   . PRO A 1 62  ? 5.181   51.658 52.854  1.00 28.31 ? 65  PRO A N   1 
ATOM   444  C CA  . PRO A 1 62  ? 4.722   53.054 52.710  1.00 29.65 ? 65  PRO A CA  1 
ATOM   445  C C   . PRO A 1 62  ? 4.570   53.436 51.231  1.00 30.00 ? 65  PRO A C   1 
ATOM   446  O O   . PRO A 1 62  ? 5.487   53.243 50.434  1.00 30.45 ? 65  PRO A O   1 
ATOM   447  C CB  . PRO A 1 62  ? 5.852   53.858 53.371  1.00 29.40 ? 65  PRO A CB  1 
ATOM   448  C CG  . PRO A 1 62  ? 6.497   52.862 54.304  1.00 28.21 ? 65  PRO A CG  1 
ATOM   449  C CD  . PRO A 1 62  ? 6.504   51.600 53.496  1.00 27.09 ? 65  PRO A CD  1 
ATOM   450  N N   . LEU A 1 63  ? 3.428   53.998 50.862  1.00 31.35 ? 66  LEU A N   1 
ATOM   451  C CA  . LEU A 1 63  ? 3.192   54.357 49.463  1.00 33.66 ? 66  LEU A CA  1 
ATOM   452  C C   . LEU A 1 63  ? 4.168   55.368 48.875  1.00 34.88 ? 66  LEU A C   1 
ATOM   453  O O   . LEU A 1 63  ? 4.554   55.248 47.726  1.00 36.45 ? 66  LEU A O   1 
ATOM   454  C CB  . LEU A 1 63  ? 1.746   54.822 49.253  1.00 31.88 ? 66  LEU A CB  1 
ATOM   455  C CG  . LEU A 1 63  ? 0.687   53.780 49.626  1.00 32.14 ? 66  LEU A CG  1 
ATOM   456  C CD1 . LEU A 1 63  ? -0.687  54.316 49.291  1.00 33.42 ? 66  LEU A CD1 1 
ATOM   457  C CD2 . LEU A 1 63  ? 0.939   52.455 48.899  1.00 29.96 ? 66  LEU A CD2 1 
ATOM   458  N N   . GLU A 1 64  ? 4.584   56.342 49.674  1.00 37.31 ? 67  GLU A N   1 
ATOM   459  C CA  . GLU A 1 64  ? 5.518   57.370 49.228  1.00 39.74 ? 67  GLU A CA  1 
ATOM   460  C C   . GLU A 1 64  ? 6.863   56.787 48.788  1.00 40.28 ? 67  GLU A C   1 
ATOM   461  O O   . GLU A 1 64  ? 7.675   57.490 48.192  1.00 40.59 ? 67  GLU A O   1 
ATOM   462  C CB  . GLU A 1 64  ? 5.730   58.402 50.341  1.00 43.58 ? 67  GLU A CB  1 
ATOM   463  C CG  . GLU A 1 64  ? 6.204   57.788 51.669  1.00 52.09 ? 67  GLU A CG  1 
ATOM   464  C CD  . GLU A 1 64  ? 6.216   58.776 52.840  1.00 56.76 ? 67  GLU A CD  1 
ATOM   465  O OE1 . GLU A 1 64  ? 6.395   58.322 53.997  1.00 58.21 ? 67  GLU A OE1 1 
ATOM   466  O OE2 . GLU A 1 64  ? 6.053   60.000 52.612  1.00 59.01 ? 67  GLU A OE2 1 
ATOM   467  N N   . SER A 1 65  ? 7.099   55.507 49.082  1.00 39.38 ? 68  SER A N   1 
ATOM   468  C CA  . SER A 1 65  ? 8.347   54.848 48.703  1.00 38.86 ? 68  SER A CA  1 
ATOM   469  C C   . SER A 1 65  ? 8.212   54.053 47.403  1.00 38.96 ? 68  SER A C   1 
ATOM   470  O O   . SER A 1 65  ? 9.188   53.480 46.918  1.00 39.38 ? 68  SER A O   1 
ATOM   471  C CB  . SER A 1 65  ? 8.845   53.933 49.828  1.00 38.73 ? 68  SER A CB  1 
ATOM   472  O OG  . SER A 1 65  ? 8.031   52.787 49.976  1.00 40.31 ? 68  SER A OG  1 
ATOM   473  N N   . CYS A 1 66  ? 6.990   53.984 46.873  1.00 38.72 ? 69  CYS A N   1 
ATOM   474  C CA  . CYS A 1 66  ? 6.714   53.281 45.622  1.00 38.60 ? 69  CYS A CA  1 
ATOM   475  C C   . CYS A 1 66  ? 6.788   54.305 44.496  1.00 38.59 ? 69  CYS A C   1 
ATOM   476  O O   . CYS A 1 66  ? 6.000   55.245 44.476  1.00 38.67 ? 69  CYS A O   1 
ATOM   477  C CB  . CYS A 1 66  ? 5.305   52.678 45.621  1.00 38.05 ? 69  CYS A CB  1 
ATOM   478  S SG  . CYS A 1 66  ? 4.976   51.378 46.808  1.00 39.68 ? 69  CYS A SG  1 
ATOM   479  N N   . PHE A 1 67  ? 7.728   54.140 43.569  1.00 37.85 ? 70  PHE A N   1 
ATOM   480  C CA  . PHE A 1 67  ? 7.829   55.081 42.457  1.00 37.86 ? 70  PHE A CA  1 
ATOM   481  C C   . PHE A 1 67  ? 6.955   54.655 41.277  1.00 37.98 ? 70  PHE A C   1 
ATOM   482  O O   . PHE A 1 67  ? 6.763   55.415 40.340  1.00 38.60 ? 70  PHE A O   1 
ATOM   483  C CB  . PHE A 1 67  ? 9.284   55.251 42.005  1.00 35.76 ? 70  PHE A CB  1 
ATOM   484  C CG  . PHE A 1 67  ? 9.833   54.078 41.243  1.00 34.83 ? 70  PHE A CG  1 
ATOM   485  C CD1 . PHE A 1 67  ? 9.655   53.981 39.864  1.00 34.40 ? 70  PHE A CD1 1 
ATOM   486  C CD2 . PHE A 1 67  ? 10.567  53.096 41.892  1.00 31.98 ? 70  PHE A CD2 1 
ATOM   487  C CE1 . PHE A 1 67  ? 10.204  52.931 39.150  1.00 33.95 ? 70  PHE A CE1 1 
ATOM   488  C CE2 . PHE A 1 67  ? 11.119  52.039 41.184  1.00 32.42 ? 70  PHE A CE2 1 
ATOM   489  C CZ  . PHE A 1 67  ? 10.941  51.953 39.811  1.00 33.00 ? 70  PHE A CZ  1 
ATOM   490  N N   . ASN A 1 68  ? 6.451   53.429 41.314  1.00 37.61 ? 71  ASN A N   1 
ATOM   491  C CA  . ASN A 1 68  ? 5.613   52.926 40.236  1.00 35.93 ? 71  ASN A CA  1 
ATOM   492  C C   . ASN A 1 68  ? 4.756   51.767 40.719  1.00 33.64 ? 71  ASN A C   1 
ATOM   493  O O   . ASN A 1 68  ? 5.157   50.996 41.590  1.00 32.58 ? 71  ASN A O   1 
ATOM   494  C CB  . ASN A 1 68  ? 6.476   52.510 39.032  1.00 39.01 ? 71  ASN A CB  1 
ATOM   495  C CG  . ASN A 1 68  ? 5.648   51.958 37.865  1.00 42.66 ? 71  ASN A CG  1 
ATOM   496  O OD1 . ASN A 1 68  ? 5.554   50.742 37.682  1.00 44.01 ? 71  ASN A OD1 1 
ATOM   497  N ND2 . ASN A 1 68  ? 5.063   52.850 37.067  1.00 42.92 ? 71  ASN A ND2 1 
ATOM   498  N N   . ILE A 1 69  ? 3.559   51.684 40.150  1.00 33.08 ? 72  ILE A N   1 
ATOM   499  C CA  . ILE A 1 69  ? 2.585   50.667 40.477  1.00 33.43 ? 72  ILE A CA  1 
ATOM   500  C C   . ILE A 1 69  ? 2.046   50.159 39.138  1.00 33.77 ? 72  ILE A C   1 
ATOM   501  O O   . ILE A 1 69  ? 1.674   50.948 38.281  1.00 32.63 ? 72  ILE A O   1 
ATOM   502  C CB  . ILE A 1 69  ? 1.478   51.283 41.378  1.00 34.05 ? 72  ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 69  ? 2.116   51.790 42.679  1.00 34.12 ? 72  ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 69  ? 0.399   50.250 41.697  1.00 34.06 ? 72  ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 69  ? 1.185   52.490 43.614  1.00 35.35 ? 72  ILE A CD1 1 
ATOM   506  N N   . ASN A 1 70  ? 2.047   48.845 38.943  1.00 34.43 ? 73  ASN A N   1 
ATOM   507  C CA  . ASN A 1 70  ? 1.598   48.257 37.681  1.00 34.45 ? 73  ASN A CA  1 
ATOM   508  C C   . ASN A 1 70  ? 0.765   46.984 37.788  1.00 33.74 ? 73  ASN A C   1 
ATOM   509  O O   . ASN A 1 70  ? 0.925   46.193 38.718  1.00 34.79 ? 73  ASN A O   1 
ATOM   510  C CB  . ASN A 1 70  ? 2.812   47.912 36.805  1.00 36.33 ? 73  ASN A CB  1 
ATOM   511  C CG  . ASN A 1 70  ? 3.358   49.108 36.047  1.00 40.55 ? 73  ASN A CG  1 
ATOM   512  O OD1 . ASN A 1 70  ? 2.604   49.935 35.519  1.00 43.43 ? 73  ASN A OD1 1 
ATOM   513  N ND2 . ASN A 1 70  ? 4.680   49.189 35.960  1.00 39.93 ? 73  ASN A ND2 1 
ATOM   514  N N   . LYS A 1 71  ? -0.121  46.790 36.814  1.00 31.07 ? 74  LYS A N   1 
ATOM   515  C CA  . LYS A 1 71  ? -0.916  45.573 36.739  1.00 29.75 ? 74  LYS A CA  1 
ATOM   516  C C   . LYS A 1 71  ? -0.004  44.635 35.963  1.00 28.83 ? 74  LYS A C   1 
ATOM   517  O O   . LYS A 1 71  ? 0.556   45.029 34.953  1.00 30.16 ? 74  LYS A O   1 
ATOM   518  C CB  . LYS A 1 71  ? -2.188  45.804 35.939  1.00 28.70 ? 74  LYS A CB  1 
ATOM   519  C CG  . LYS A 1 71  ? -3.238  46.612 36.648  1.00 26.87 ? 74  LYS A CG  1 
ATOM   520  C CD  . LYS A 1 71  ? -4.437  46.746 35.749  1.00 28.64 ? 74  LYS A CD  1 
ATOM   521  C CE  . LYS A 1 71  ? -5.509  47.602 36.370  1.00 32.23 ? 74  LYS A CE  1 
ATOM   522  N NZ  . LYS A 1 71  ? -6.656  47.745 35.438  1.00 33.38 ? 74  LYS A NZ  1 
ATOM   523  N N   . ARG A 1 72  ? 0.176   43.416 36.441  1.00 28.45 ? 75  ARG A N   1 
ATOM   524  C CA  . ARG A 1 72  ? 1.053   42.465 35.773  1.00 27.55 ? 75  ARG A CA  1 
ATOM   525  C C   . ARG A 1 72  ? 0.362   41.111 35.655  1.00 27.96 ? 75  ARG A C   1 
ATOM   526  O O   . ARG A 1 72  ? -0.778  40.955 36.091  1.00 29.59 ? 75  ARG A O   1 
ATOM   527  C CB  . ARG A 1 72  ? 2.357   42.323 36.573  1.00 28.01 ? 75  ARG A CB  1 
ATOM   528  C CG  . ARG A 1 72  ? 3.278   43.554 36.519  1.00 29.59 ? 75  ARG A CG  1 
ATOM   529  C CD  . ARG A 1 72  ? 4.066   43.585 35.209  1.00 31.45 ? 75  ARG A CD  1 
ATOM   530  N NE  . ARG A 1 72  ? 4.856   44.799 35.029  1.00 31.11 ? 75  ARG A NE  1 
ATOM   531  C CZ  . ARG A 1 72  ? 4.598   45.711 34.101  1.00 31.71 ? 75  ARG A CZ  1 
ATOM   532  N NH1 . ARG A 1 72  ? 3.574   45.535 33.286  1.00 32.28 ? 75  ARG A NH1 1 
ATOM   533  N NH2 . ARG A 1 72  ? 5.348   46.796 33.986  1.00 31.94 ? 75  ARG A NH2 1 
ATOM   534  N N   . ALA A 1 73  ? 1.060   40.137 35.071  1.00 27.15 ? 76  ALA A N   1 
ATOM   535  C CA  . ALA A 1 73  ? 0.547   38.782 34.893  1.00 28.14 ? 76  ALA A CA  1 
ATOM   536  C C   . ALA A 1 73  ? 1.621   37.847 34.348  1.00 29.82 ? 76  ALA A C   1 
ATOM   537  O O   . ALA A 1 73  ? 2.338   38.196 33.409  1.00 31.25 ? 76  ALA A O   1 
ATOM   538  C CB  . ALA A 1 73  ? -0.633  38.790 33.944  1.00 27.42 ? 76  ALA A CB  1 
ATOM   539  N N   . ASP A 1 74  ? 1.769   36.678 34.965  1.00 31.41 ? 77  ASP A N   1 
ATOM   540  C CA  . ASP A 1 74  ? 2.726   35.692 34.472  1.00 32.83 ? 77  ASP A CA  1 
ATOM   541  C C   . ASP A 1 74  ? 2.050   34.342 34.241  1.00 34.55 ? 77  ASP A C   1 
ATOM   542  O O   . ASP A 1 74  ? 0.821   34.285 34.137  1.00 35.21 ? 77  ASP A O   1 
ATOM   543  C CB  . ASP A 1 74  ? 3.976   35.584 35.357  1.00 32.27 ? 77  ASP A CB  1 
ATOM   544  C CG  . ASP A 1 74  ? 3.662   35.345 36.815  1.00 32.70 ? 77  ASP A CG  1 
ATOM   545  O OD1 . ASP A 1 74  ? 4.329   35.997 37.645  1.00 32.97 ? 77  ASP A OD1 1 
ATOM   546  O OD2 . ASP A 1 74  ? 2.799   34.494 37.131  1.00 31.56 ? 77  ASP A OD2 1 
ATOM   547  N N   . SER A 1 75  ? 2.837   33.275 34.115  1.00 35.54 ? 78  SER A N   1 
ATOM   548  C CA  . SER A 1 75  ? 2.279   31.945 33.867  1.00 37.62 ? 78  SER A CA  1 
ATOM   549  C C   . SER A 1 75  ? 1.546   31.317 35.056  1.00 39.92 ? 78  SER A C   1 
ATOM   550  O O   . SER A 1 75  ? 0.734   30.405 34.868  1.00 40.36 ? 78  SER A O   1 
ATOM   551  C CB  . SER A 1 75  ? 3.375   30.994 33.425  1.00 37.24 ? 78  SER A CB  1 
ATOM   552  O OG  . SER A 1 75  ? 4.232   30.708 34.513  1.00 39.47 ? 78  SER A OG  1 
ATOM   553  N N   . LYS A 1 76  ? 1.857   31.789 36.268  1.00 40.73 ? 79  LYS A N   1 
ATOM   554  C CA  . LYS A 1 76  ? 1.255   31.275 37.501  1.00 41.66 ? 79  LYS A CA  1 
ATOM   555  C C   . LYS A 1 76  ? 0.087   32.106 38.038  1.00 41.67 ? 79  LYS A C   1 
ATOM   556  O O   . LYS A 1 76  ? -0.864  31.556 38.588  1.00 43.45 ? 79  LYS A O   1 
ATOM   557  C CB  . LYS A 1 76  ? 2.323   31.142 38.582  1.00 43.79 ? 79  LYS A CB  1 
ATOM   558  C CG  . LYS A 1 76  ? 3.490   30.247 38.200  1.00 47.71 ? 79  LYS A CG  1 
ATOM   559  C CD  . LYS A 1 76  ? 4.839   30.893 38.566  1.00 51.43 ? 79  LYS A CD  1 
ATOM   560  C CE  . LYS A 1 76  ? 5.118   32.161 37.728  1.00 52.91 ? 79  LYS A CE  1 
ATOM   561  N NZ  . LYS A 1 76  ? 6.386   32.884 38.072  1.00 51.86 ? 79  LYS A NZ  1 
ATOM   562  N N   . ASN A 1 77  ? 0.174   33.427 37.917  1.00 40.41 ? 80  ASN A N   1 
ATOM   563  C CA  . ASN A 1 77  ? -0.886  34.313 38.390  1.00 38.89 ? 80  ASN A CA  1 
ATOM   564  C C   . ASN A 1 77  ? -1.279  35.246 37.273  1.00 38.17 ? 80  ASN A C   1 
ATOM   565  O O   . ASN A 1 77  ? -0.424  35.918 36.711  1.00 38.72 ? 80  ASN A O   1 
ATOM   566  C CB  . ASN A 1 77  ? -0.409  35.149 39.569  1.00 39.66 ? 80  ASN A CB  1 
ATOM   567  C CG  . ASN A 1 77  ? -0.104  34.317 40.779  1.00 40.40 ? 80  ASN A CG  1 
ATOM   568  O OD1 . ASN A 1 77  ? -1.013  33.839 41.457  1.00 42.38 ? 80  ASN A OD1 1 
ATOM   569  N ND2 . ASN A 1 77  ? 1.181   34.137 41.062  1.00 39.44 ? 80  ASN A ND2 1 
ATOM   570  N N   . LYS A 1 78  ? -2.575  35.323 36.991  1.00 36.83 ? 81  LYS A N   1 
ATOM   571  C CA  . LYS A 1 78  ? -3.075  36.173 35.920  1.00 36.60 ? 81  LYS A CA  1 
ATOM   572  C C   . LYS A 1 78  ? -3.518  37.592 36.300  1.00 35.10 ? 81  LYS A C   1 
ATOM   573  O O   . LYS A 1 78  ? -3.692  38.444 35.423  1.00 33.80 ? 81  LYS A O   1 
ATOM   574  C CB  . LYS A 1 78  ? -4.206  35.445 35.199  1.00 38.71 ? 81  LYS A CB  1 
ATOM   575  C CG  . LYS A 1 78  ? -3.741  34.216 34.424  1.00 43.45 ? 81  LYS A CG  1 
ATOM   576  C CD  . LYS A 1 78  ? -4.872  33.211 34.239  1.00 48.65 ? 81  LYS A CD  1 
ATOM   577  C CE  . LYS A 1 78  ? -4.634  32.282 33.054  1.00 50.57 ? 81  LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 78  ? -4.896  32.987 31.764  1.00 55.10 ? 81  LYS A NZ  1 
ATOM   579  N N   . HIS A 1 79  ? -3.663  37.868 37.593  1.00 33.92 ? 82  HIS A N   1 
ATOM   580  C CA  . HIS A 1 79  ? -4.124  39.180 38.028  1.00 31.89 ? 82  HIS A CA  1 
ATOM   581  C C   . HIS A 1 79  ? -3.292  39.788 39.144  1.00 31.34 ? 82  HIS A C   1 
ATOM   582  O O   . HIS A 1 79  ? -3.773  39.992 40.258  1.00 32.07 ? 82  HIS A O   1 
ATOM   583  C CB  . HIS A 1 79  ? -5.585  39.081 38.446  1.00 31.93 ? 82  HIS A CB  1 
ATOM   584  C CG  . HIS A 1 79  ? -6.428  38.328 37.467  1.00 34.20 ? 82  HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 79  ? -6.957  37.085 37.739  1.00 33.57 ? 82  HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 79  ? -6.782  38.619 36.192  1.00 34.67 ? 82  HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 79  ? -7.598  36.642 36.672  1.00 32.53 ? 82  HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 79  ? -7.506  37.554 35.721  1.00 34.81 ? 82  HIS A NE2 1 
ATOM   589  N N   . LEU A 1 80  ? -2.058  40.141 38.805  1.00 28.95 ? 83  LEU A N   1 
ATOM   590  C CA  . LEU A 1 80  ? -1.117  40.724 39.748  1.00 26.50 ? 83  LEU A CA  1 
ATOM   591  C C   . LEU A 1 80  ? -1.131  42.247 39.787  1.00 25.92 ? 83  LEU A C   1 
ATOM   592  O O   . LEU A 1 80  ? -1.455  42.900 38.802  1.00 25.31 ? 83  LEU A O   1 
ATOM   593  C CB  . LEU A 1 80  ? 0.290   40.275 39.377  1.00 25.20 ? 83  LEU A CB  1 
ATOM   594  C CG  . LEU A 1 80  ? 0.597   38.785 39.461  1.00 25.00 ? 83  LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 80  ? 1.787   38.422 38.562  1.00 23.16 ? 83  LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 80  ? 0.853   38.412 40.923  1.00 23.54 ? 83  LEU A CD2 1 
ATOM   597  N N   . VAL A 1 81  ? -0.827  42.801 40.957  1.00 25.73 ? 84  VAL A N   1 
ATOM   598  C CA  . VAL A 1 81  ? -0.705  44.248 41.124  1.00 24.39 ? 84  VAL A CA  1 
ATOM   599  C C   . VAL A 1 81  ? 0.679   44.367 41.742  1.00 24.45 ? 84  VAL A C   1 
ATOM   600  O O   . VAL A 1 81  ? 0.948   43.772 42.784  1.00 24.89 ? 84  VAL A O   1 
ATOM   601  C CB  . VAL A 1 81  ? -1.756  44.846 42.074  1.00 23.45 ? 84  VAL A CB  1 
ATOM   602  C CG1 . VAL A 1 81  ? -1.497  46.326 42.254  1.00 23.77 ? 84  VAL A CG1 1 
ATOM   603  C CG2 . VAL A 1 81  ? -3.161  44.629 41.520  1.00 24.20 ? 84  VAL A CG2 1 
ATOM   604  N N   . ALA A 1 82  ? 1.588   45.026 41.039  1.00 25.38 ? 85  ALA A N   1 
ATOM   605  C CA  . ALA A 1 82  ? 2.952   45.163 41.520  1.00 24.58 ? 85  ALA A CA  1 
ATOM   606  C C   . ALA A 1 82  ? 3.356   46.554 41.962  1.00 24.38 ? 85  ALA A C   1 
ATOM   607  O O   . ALA A 1 82  ? 3.062   47.553 41.307  1.00 25.49 ? 85  ALA A O   1 
ATOM   608  C CB  . ALA A 1 82  ? 3.929   44.652 40.477  1.00 25.40 ? 85  ALA A CB  1 
ATOM   609  N N   . LEU A 1 83  ? 4.065   46.595 43.081  1.00 23.65 ? 86  LEU A N   1 
ATOM   610  C CA  . LEU A 1 83  ? 4.561   47.837 43.638  1.00 23.10 ? 86  LEU A CA  1 
ATOM   611  C C   . LEU A 1 83  ? 6.050   47.791 43.431  1.00 21.92 ? 86  LEU A C   1 
ATOM   612  O O   . LEU A 1 83  ? 6.682   46.749 43.608  1.00 22.40 ? 86  LEU A O   1 
ATOM   613  C CB  . LEU A 1 83  ? 4.273   47.922 45.142  1.00 25.24 ? 86  LEU A CB  1 
ATOM   614  C CG  . LEU A 1 83  ? 2.837   48.064 45.628  1.00 23.95 ? 86  LEU A CG  1 
ATOM   615  C CD1 . LEU A 1 83  ? 2.071   46.778 45.398  1.00 26.37 ? 86  LEU A CD1 1 
ATOM   616  C CD2 . LEU A 1 83  ? 2.881   48.362 47.104  1.00 24.79 ? 86  LEU A CD2 1 
ATOM   617  N N   . TYR A 1 84  ? 6.607   48.908 43.006  1.00 21.53 ? 87  TYR A N   1 
ATOM   618  C CA  . TYR A 1 84  ? 8.039   48.982 42.781  1.00 22.26 ? 87  TYR A CA  1 
ATOM   619  C C   . TYR A 1 84  ? 8.570   50.102 43.654  1.00 24.05 ? 87  TYR A C   1 
ATOM   620  O O   . TYR A 1 84  ? 8.134   51.254 43.551  1.00 23.77 ? 87  TYR A O   1 
ATOM   621  C CB  . TYR A 1 84  ? 8.351   49.248 41.298  1.00 21.59 ? 87  TYR A CB  1 
ATOM   622  C CG  . TYR A 1 84  ? 7.963   48.118 40.372  1.00 19.45 ? 87  TYR A CG  1 
ATOM   623  C CD1 . TYR A 1 84  ? 8.843   47.078 40.116  1.00 20.07 ? 87  TYR A CD1 1 
ATOM   624  C CD2 . TYR A 1 84  ? 6.698   48.066 39.794  1.00 20.41 ? 87  TYR A CD2 1 
ATOM   625  C CE1 . TYR A 1 84  ? 8.477   45.999 39.312  1.00 20.91 ? 87  TYR A CE1 1 
ATOM   626  C CE2 . TYR A 1 84  ? 6.314   46.997 38.988  1.00 20.65 ? 87  TYR A CE2 1 
ATOM   627  C CZ  . TYR A 1 84  ? 7.209   45.958 38.753  1.00 21.36 ? 87  TYR A CZ  1 
ATOM   628  O OH  . TYR A 1 84  ? 6.823   44.862 38.000  1.00 20.80 ? 87  TYR A OH  1 
ATOM   629  N N   . THR A 1 85  ? 9.395   49.726 44.619  1.00 25.65 ? 88  THR A N   1 
ATOM   630  C CA  . THR A 1 85  ? 9.997   50.706 45.500  1.00 26.56 ? 88  THR A CA  1 
ATOM   631  C C   . THR A 1 85  ? 11.449  50.752 45.063  1.00 27.21 ? 88  THR A C   1 
ATOM   632  O O   . THR A 1 85  ? 11.856  50.015 44.164  1.00 27.27 ? 88  THR A O   1 
ATOM   633  C CB  . THR A 1 85  ? 9.958   50.265 46.983  1.00 26.19 ? 88  THR A CB  1 
ATOM   634  O OG1 . THR A 1 85  ? 10.786  49.106 47.153  1.00 29.42 ? 88  THR A OG1 1 
ATOM   635  C CG2 . THR A 1 85  ? 8.524   49.942 47.433  1.00 26.41 ? 88  THR A CG2 1 
ATOM   636  N N   . ARG A 1 86  ? 12.238  51.590 45.722  1.00 28.02 ? 89  ARG A N   1 
ATOM   637  C CA  . ARG A 1 86  ? 13.647  51.688 45.401  1.00 27.73 ? 89  ARG A CA  1 
ATOM   638  C C   . ARG A 1 86  ? 14.368  50.359 45.658  1.00 27.05 ? 89  ARG A C   1 
ATOM   639  O O   . ARG A 1 86  ? 15.173  49.922 44.850  1.00 27.97 ? 89  ARG A O   1 
ATOM   640  C CB  . ARG A 1 86  ? 14.300  52.781 46.240  1.00 27.52 ? 89  ARG A CB  1 
ATOM   641  C CG  . ARG A 1 86  ? 15.781  52.936 45.958  1.00 31.13 ? 89  ARG A CG  1 
ATOM   642  C CD  . ARG A 1 86  ? 16.618  52.741 47.205  1.00 33.34 ? 89  ARG A CD  1 
ATOM   643  N NE  . ARG A 1 86  ? 16.598  53.901 48.081  1.00 35.77 ? 89  ARG A NE  1 
ATOM   644  C CZ  . ARG A 1 86  ? 16.507  53.842 49.405  1.00 35.92 ? 89  ARG A CZ  1 
ATOM   645  N NH1 . ARG A 1 86  ? 16.416  52.684 50.036  1.00 34.83 ? 89  ARG A NH1 1 
ATOM   646  N NH2 . ARG A 1 86  ? 16.550  54.956 50.104  1.00 37.99 ? 89  ARG A NH2 1 
ATOM   647  N N   . ASP A 1 87  ? 13.990  49.672 46.732  1.00 28.67 ? 90  ASP A N   1 
ATOM   648  C CA  . ASP A 1 87  ? 14.657  48.441 47.132  1.00 28.84 ? 90  ASP A CA  1 
ATOM   649  C C   . ASP A 1 87  ? 14.054  47.117 46.765  1.00 28.89 ? 90  ASP A C   1 
ATOM   650  O O   . ASP A 1 87  ? 14.749  46.094 46.805  1.00 27.69 ? 90  ASP A O   1 
ATOM   651  C CB  . ASP A 1 87  ? 14.891  48.480 48.629  1.00 31.80 ? 90  ASP A CB  1 
ATOM   652  C CG  . ASP A 1 87  ? 15.613  49.728 49.051  1.00 34.34 ? 90  ASP A CG  1 
ATOM   653  O OD1 . ASP A 1 87  ? 16.647  50.040 48.426  1.00 34.36 ? 90  ASP A OD1 1 
ATOM   654  O OD2 . ASP A 1 87  ? 15.129  50.417 49.973  1.00 37.33 ? 90  ASP A OD2 1 
ATOM   655  N N   . GLU A 1 88  ? 12.768  47.114 46.426  1.00 29.69 ? 91  GLU A N   1 
ATOM   656  C CA  . GLU A 1 88  ? 12.114  45.865 46.067  1.00 30.16 ? 91  GLU A CA  1 
ATOM   657  C C   . GLU A 1 88  ? 10.927  46.007 45.129  1.00 29.95 ? 91  GLU A C   1 
ATOM   658  O O   . GLU A 1 88  ? 10.519  47.112 44.756  1.00 30.04 ? 91  GLU A O   1 
ATOM   659  C CB  . GLU A 1 88  ? 11.643  45.144 47.322  1.00 31.17 ? 91  GLU A CB  1 
ATOM   660  C CG  . GLU A 1 88  ? 10.280  45.602 47.787  1.00 33.56 ? 91  GLU A CG  1 
ATOM   661  C CD  . GLU A 1 88  ? 9.803   44.861 49.004  1.00 36.64 ? 91  GLU A CD  1 
ATOM   662  O OE1 . GLU A 1 88  ? 9.873   45.454 50.103  1.00 38.49 ? 91  GLU A OE1 1 
ATOM   663  O OE2 . GLU A 1 88  ? 9.354   43.701 48.863  1.00 35.93 ? 91  GLU A OE2 1 
ATOM   664  N N   . HIS A 1 89  ? 10.393  44.845 44.764  1.00 30.22 ? 92  HIS A N   1 
ATOM   665  C CA  . HIS A 1 89  ? 9.221   44.708 43.902  1.00 29.44 ? 92  HIS A CA  1 
ATOM   666  C C   . HIS A 1 89  ? 8.261   43.846 44.713  1.00 28.41 ? 92  HIS A C   1 
ATOM   667  O O   . HIS A 1 89  ? 8.574   42.696 45.014  1.00 27.01 ? 92  HIS A O   1 
ATOM   668  C CB  . HIS A 1 89  ? 9.608   43.991 42.600  1.00 27.64 ? 92  HIS A CB  1 
ATOM   669  C CG  . HIS A 1 89  ? 8.475   43.264 41.953  1.00 27.02 ? 92  HIS A CG  1 
ATOM   670  N ND1 . HIS A 1 89  ? 8.457   41.893 41.824  1.00 26.79 ? 92  HIS A ND1 1 
ATOM   671  C CD2 . HIS A 1 89  ? 7.313   43.709 41.416  1.00 28.57 ? 92  HIS A CD2 1 
ATOM   672  C CE1 . HIS A 1 89  ? 7.332   41.521 41.240  1.00 26.11 ? 92  HIS A CE1 1 
ATOM   673  N NE2 . HIS A 1 89  ? 6.621   42.605 40.981  1.00 29.03 ? 92  HIS A NE2 1 
ATOM   674  N N   . PHE A 1 90  ? 7.140   44.423 45.131  1.00 27.44 ? 93  PHE A N   1 
ATOM   675  C CA  . PHE A 1 90  ? 6.156   43.687 45.926  1.00 26.99 ? 93  PHE A CA  1 
ATOM   676  C C   . PHE A 1 90  ? 4.862   43.438 45.140  1.00 27.42 ? 93  PHE A C   1 
ATOM   677  O O   . PHE A 1 90  ? 4.127   44.369 44.830  1.00 28.78 ? 93  PHE A O   1 
ATOM   678  C CB  . PHE A 1 90  ? 5.863   44.448 47.232  1.00 27.51 ? 93  PHE A CB  1 
ATOM   679  C CG  . PHE A 1 90  ? 4.948   43.712 48.181  1.00 28.84 ? 93  PHE A CG  1 
ATOM   680  C CD1 . PHE A 1 90  ? 3.594   44.022 48.248  1.00 29.84 ? 93  PHE A CD1 1 
ATOM   681  C CD2 . PHE A 1 90  ? 5.439   42.706 49.003  1.00 28.50 ? 93  PHE A CD2 1 
ATOM   682  C CE1 . PHE A 1 90  ? 2.747   43.347 49.114  1.00 29.47 ? 93  PHE A CE1 1 
ATOM   683  C CE2 . PHE A 1 90  ? 4.593   42.026 49.871  1.00 27.67 ? 93  PHE A CE2 1 
ATOM   684  C CZ  . PHE A 1 90  ? 3.246   42.351 49.923  1.00 29.28 ? 93  PHE A CZ  1 
ATOM   685  N N   . ALA A 1 91  ? 4.570   42.174 44.853  1.00 25.94 ? 94  ALA A N   1 
ATOM   686  C CA  . ALA A 1 91  ? 3.369   41.850 44.094  1.00 25.47 ? 94  ALA A CA  1 
ATOM   687  C C   . ALA A 1 91  ? 2.320   41.121 44.904  1.00 25.94 ? 94  ALA A C   1 
ATOM   688  O O   . ALA A 1 91  ? 2.646   40.310 45.773  1.00 26.35 ? 94  ALA A O   1 
ATOM   689  C CB  . ALA A 1 91  ? 3.722   41.034 42.846  1.00 24.55 ? 94  ALA A CB  1 
ATOM   690  N N   . ILE A 1 92  ? 1.056   41.428 44.601  1.00 25.20 ? 95  ILE A N   1 
ATOM   691  C CA  . ILE A 1 92  ? -0.099  40.808 45.246  1.00 24.41 ? 95  ILE A CA  1 
ATOM   692  C C   . ILE A 1 92  ? -0.942  40.182 44.128  1.00 23.70 ? 95  ILE A C   1 
ATOM   693  O O   . ILE A 1 92  ? -1.157  40.795 43.079  1.00 25.57 ? 95  ILE A O   1 
ATOM   694  C CB  . ILE A 1 92  ? -0.947  41.844 46.049  1.00 24.78 ? 95  ILE A CB  1 
ATOM   695  C CG1 . ILE A 1 92  ? -1.727  42.767 45.108  1.00 24.80 ? 95  ILE A CG1 1 
ATOM   696  C CG2 . ILE A 1 92  ? -0.048  42.675 46.960  1.00 23.03 ? 95  ILE A CG2 1 
ATOM   697  C CD1 . ILE A 1 92  ? -2.446  43.909 45.791  1.00 25.37 ? 95  ILE A CD1 1 
ATOM   698  N N   . ALA A 1 93  ? -1.400  38.957 44.343  1.00 23.53 ? 96  ALA A N   1 
ATOM   699  C CA  . ALA A 1 93  ? -2.199  38.250 43.352  1.00 22.30 ? 96  ALA A CA  1 
ATOM   700  C C   . ALA A 1 93  ? -3.700  38.296 43.632  1.00 23.49 ? 96  ALA A C   1 
ATOM   701  O O   . ALA A 1 93  ? -4.156  37.780 44.651  1.00 23.36 ? 96  ALA A O   1 
ATOM   702  C CB  . ALA A 1 93  ? -1.734  36.790 43.265  1.00 20.93 ? 96  ALA A CB  1 
ATOM   703  N N   . ALA A 1 94  ? -4.458  38.920 42.733  1.00 23.15 ? 97  ALA A N   1 
ATOM   704  C CA  . ALA A 1 94  ? -5.916  39.002 42.879  1.00 22.27 ? 97  ALA A CA  1 
ATOM   705  C C   . ALA A 1 94  ? -6.571  37.796 42.199  1.00 22.66 ? 97  ALA A C   1 
ATOM   706  O O   . ALA A 1 94  ? -5.933  37.107 41.398  1.00 23.19 ? 97  ALA A O   1 
ATOM   707  C CB  . ALA A 1 94  ? -6.445  40.297 42.299  1.00 20.40 ? 97  ALA A CB  1 
ATOM   708  N N   . ASP A 1 95  ? -7.842  37.550 42.496  1.00 22.40 ? 98  ASP A N   1 
ATOM   709  C CA  . ASP A 1 95  ? -8.536  36.395 41.940  1.00 23.73 ? 98  ASP A CA  1 
ATOM   710  C C   . ASP A 1 95  ? -9.278  36.660 40.635  1.00 25.88 ? 98  ASP A C   1 
ATOM   711  O O   . ASP A 1 95  ? -9.951  35.769 40.102  1.00 26.22 ? 98  ASP A O   1 
ATOM   712  C CB  . ASP A 1 95  ? -9.513  35.829 42.983  1.00 24.29 ? 98  ASP A CB  1 
ATOM   713  C CG  . ASP A 1 95  ? -10.630 36.813 43.358  1.00 26.02 ? 98  ASP A CG  1 
ATOM   714  O OD1 . ASP A 1 95  ? -10.749 37.880 42.711  1.00 25.51 ? 98  ASP A OD1 1 
ATOM   715  O OD2 . ASP A 1 95  ? -11.395 36.519 44.306  1.00 25.52 ? 98  ASP A OD2 1 
ATOM   716  N N   . SER A 1 96  ? -9.192  37.899 40.160  1.00 27.10 ? 99  SER A N   1 
ATOM   717  C CA  . SER A 1 96  ? -9.860  38.324 38.939  1.00 27.64 ? 99  SER A CA  1 
ATOM   718  C C   . SER A 1 96  ? -9.290  39.652 38.467  1.00 28.91 ? 99  SER A C   1 
ATOM   719  O O   . SER A 1 96  ? -8.582  40.344 39.201  1.00 29.52 ? 99  SER A O   1 
ATOM   720  C CB  . SER A 1 96  ? -11.348 38.510 39.201  1.00 28.27 ? 99  SER A CB  1 
ATOM   721  O OG  . SER A 1 96  ? -11.566 39.651 40.011  1.00 29.69 ? 99  SER A OG  1 
ATOM   722  N N   . GLU A 1 97  ? -9.613  40.007 37.233  1.00 28.16 ? 100 GLU A N   1 
ATOM   723  C CA  . GLU A 1 97  ? -9.159  41.255 36.647  1.00 28.36 ? 100 GLU A CA  1 
ATOM   724  C C   . GLU A 1 97  ? -9.885  42.419 37.321  1.00 27.31 ? 100 GLU A C   1 
ATOM   725  O O   . GLU A 1 97  ? -9.370  43.531 37.409  1.00 29.03 ? 100 GLU A O   1 
ATOM   726  C CB  . GLU A 1 97  ? -9.464  41.247 35.155  1.00 30.23 ? 100 GLU A CB  1 
ATOM   727  C CG  . GLU A 1 97  ? -9.254  42.572 34.476  1.00 36.27 ? 100 GLU A CG  1 
ATOM   728  C CD  . GLU A 1 97  ? -9.874  42.620 33.105  1.00 41.23 ? 100 GLU A CD  1 
ATOM   729  O OE1 . GLU A 1 97  ? -9.904  41.567 32.422  1.00 41.46 ? 100 GLU A OE1 1 
ATOM   730  O OE2 . GLU A 1 97  ? -10.334 43.719 32.720  1.00 44.92 ? 100 GLU A OE2 1 
ATOM   731  N N   . ALA A 1 98  ? -11.090 42.152 37.801  1.00 27.13 ? 101 ALA A N   1 
ATOM   732  C CA  . ALA A 1 98  ? -11.879 43.174 38.461  1.00 26.67 ? 101 ALA A CA  1 
ATOM   733  C C   . ALA A 1 98  ? -11.206 43.592 39.783  1.00 26.41 ? 101 ALA A C   1 
ATOM   734  O O   . ALA A 1 98  ? -10.931 44.773 40.019  1.00 24.70 ? 101 ALA A O   1 
ATOM   735  C CB  . ALA A 1 98  ? -13.311 42.648 38.700  1.00 25.78 ? 101 ALA A CB  1 
ATOM   736  N N   . GLU A 1 99  ? -10.893 42.592 40.603  1.00 26.51 ? 102 GLU A N   1 
ATOM   737  C CA  . GLU A 1 99  ? -10.270 42.803 41.899  1.00 27.38 ? 102 GLU A CA  1 
ATOM   738  C C   . GLU A 1 99  ? -8.875  43.402 41.751  1.00 28.41 ? 102 GLU A C   1 
ATOM   739  O O   . GLU A 1 99  ? -8.469  44.241 42.554  1.00 30.05 ? 102 GLU A O   1 
ATOM   740  C CB  . GLU A 1 99  ? -10.214 41.481 42.663  1.00 27.26 ? 102 GLU A CB  1 
ATOM   741  C CG  . GLU A 1 99  ? -9.706  41.604 44.076  1.00 26.81 ? 102 GLU A CG  1 
ATOM   742  C CD  . GLU A 1 99  ? -9.793  40.297 44.803  1.00 28.07 ? 102 GLU A CD  1 
ATOM   743  O OE1 . GLU A 1 99  ? -10.890 39.977 45.300  1.00 30.86 ? 102 GLU A OE1 1 
ATOM   744  O OE2 . GLU A 1 99  ? -8.780  39.566 44.850  1.00 28.79 ? 102 GLU A OE2 1 
ATOM   745  N N   . GLN A 1 100 ? -8.152  42.972 40.720  1.00 27.66 ? 103 GLN A N   1 
ATOM   746  C CA  . GLN A 1 100 ? -6.816  43.487 40.456  1.00 25.92 ? 103 GLN A CA  1 
ATOM   747  C C   . GLN A 1 100 ? -6.947  44.974 40.150  1.00 27.47 ? 103 GLN A C   1 
ATOM   748  O O   . GLN A 1 100 ? -6.172  45.788 40.652  1.00 27.39 ? 103 GLN A O   1 
ATOM   749  C CB  . GLN A 1 100 ? -6.207  42.754 39.262  1.00 24.75 ? 103 GLN A CB  1 
ATOM   750  C CG  . GLN A 1 100 ? -5.011  43.435 38.624  1.00 24.88 ? 103 GLN A CG  1 
ATOM   751  C CD  . GLN A 1 100 ? -4.718  42.899 37.231  1.00 25.74 ? 103 GLN A CD  1 
ATOM   752  O OE1 . GLN A 1 100 ? -5.631  42.654 36.444  1.00 26.20 ? 103 GLN A OE1 1 
ATOM   753  N NE2 . GLN A 1 100 ? -3.442  42.741 36.912  1.00 22.64 ? 103 GLN A NE2 1 
ATOM   754  N N   . ASP A 1 101 ? -7.973  45.331 39.378  1.00 28.29 ? 104 ASP A N   1 
ATOM   755  C CA  . ASP A 1 101 ? -8.195  46.729 39.014  1.00 28.54 ? 104 ASP A CA  1 
ATOM   756  C C   . ASP A 1 101 ? -8.639  47.572 40.201  1.00 28.14 ? 104 ASP A C   1 
ATOM   757  O O   . ASP A 1 101 ? -8.252  48.733 40.325  1.00 29.09 ? 104 ASP A O   1 
ATOM   758  C CB  . ASP A 1 101 ? -9.218  46.845 37.882  1.00 29.49 ? 104 ASP A CB  1 
ATOM   759  C CG  . ASP A 1 101 ? -9.494  48.289 37.506  1.00 30.83 ? 104 ASP A CG  1 
ATOM   760  O OD1 . ASP A 1 101 ? -8.541  49.003 37.124  1.00 31.98 ? 104 ASP A OD1 1 
ATOM   761  O OD2 . ASP A 1 101 ? -10.659 48.725 37.630  1.00 32.05 ? 104 ASP A OD2 1 
ATOM   762  N N   . SER A 1 102 ? -9.470  46.987 41.059  1.00 27.99 ? 105 SER A N   1 
ATOM   763  C CA  . SER A 1 102 ? -9.963  47.666 42.250  1.00 26.80 ? 105 SER A CA  1 
ATOM   764  C C   . SER A 1 102 ? -8.801  48.074 43.159  1.00 25.92 ? 105 SER A C   1 
ATOM   765  O O   . SER A 1 102 ? -8.705  49.222 43.587  1.00 25.31 ? 105 SER A O   1 
ATOM   766  C CB  . SER A 1 102 ? -10.900 46.745 43.007  1.00 26.27 ? 105 SER A CB  1 
ATOM   767  O OG  . SER A 1 102 ? -11.608 47.501 43.964  1.00 30.71 ? 105 SER A OG  1 
ATOM   768  N N   . TRP A 1 103 ? -7.921  47.114 43.434  1.00 25.42 ? 106 TRP A N   1 
ATOM   769  C CA  . TRP A 1 103 ? -6.742  47.339 44.249  1.00 25.31 ? 106 TRP A CA  1 
ATOM   770  C C   . TRP A 1 103 ? -5.795  48.299 43.547  1.00 26.23 ? 106 TRP A C   1 
ATOM   771  O O   . TRP A 1 103 ? -5.266  49.219 44.167  1.00 28.06 ? 106 TRP A O   1 
ATOM   772  C CB  . TRP A 1 103 ? -6.030  46.007 44.547  1.00 24.52 ? 106 TRP A CB  1 
ATOM   773  C CG  . TRP A 1 103 ? -6.642  45.261 45.712  1.00 24.44 ? 106 TRP A CG  1 
ATOM   774  C CD1 . TRP A 1 103 ? -7.504  44.207 45.647  1.00 22.11 ? 106 TRP A CD1 1 
ATOM   775  C CD2 . TRP A 1 103 ? -6.477  45.558 47.113  1.00 22.32 ? 106 TRP A CD2 1 
ATOM   776  N NE1 . TRP A 1 103 ? -7.892  43.831 46.914  1.00 23.07 ? 106 TRP A NE1 1 
ATOM   777  C CE2 . TRP A 1 103 ? -7.280  44.641 47.832  1.00 22.40 ? 106 TRP A CE2 1 
ATOM   778  C CE3 . TRP A 1 103 ? -5.735  46.513 47.826  1.00 22.31 ? 106 TRP A CE3 1 
ATOM   779  C CZ2 . TRP A 1 103 ? -7.364  44.649 49.235  1.00 21.00 ? 106 TRP A CZ2 1 
ATOM   780  C CZ3 . TRP A 1 103 ? -5.819  46.521 49.225  1.00 22.48 ? 106 TRP A CZ3 1 
ATOM   781  C CH2 . TRP A 1 103 ? -6.630  45.591 49.909  1.00 21.59 ? 106 TRP A CH2 1 
ATOM   782  N N   . TYR A 1 104 ? -5.607  48.097 42.245  1.00 27.77 ? 107 TYR A N   1 
ATOM   783  C CA  . TYR A 1 104 ? -4.725  48.945 41.448  1.00 27.28 ? 107 TYR A CA  1 
ATOM   784  C C   . TYR A 1 104 ? -5.136  50.407 41.525  1.00 27.01 ? 107 TYR A C   1 
ATOM   785  O O   . TYR A 1 104 ? -4.285  51.277 41.678  1.00 27.78 ? 107 TYR A O   1 
ATOM   786  C CB  . TYR A 1 104 ? -4.687  48.485 39.983  1.00 26.73 ? 107 TYR A CB  1 
ATOM   787  C CG  . TYR A 1 104 ? -3.989  49.461 39.050  1.00 28.64 ? 107 TYR A CG  1 
ATOM   788  C CD1 . TYR A 1 104 ? -2.591  49.583 39.033  1.00 28.63 ? 107 TYR A CD1 1 
ATOM   789  C CD2 . TYR A 1 104 ? -4.730  50.287 38.206  1.00 28.82 ? 107 TYR A CD2 1 
ATOM   790  C CE1 . TYR A 1 104 ? -1.957  50.509 38.199  1.00 26.80 ? 107 TYR A CE1 1 
ATOM   791  C CE2 . TYR A 1 104 ? -4.108  51.213 37.371  1.00 26.54 ? 107 TYR A CE2 1 
ATOM   792  C CZ  . TYR A 1 104 ? -2.731  51.321 37.370  1.00 27.42 ? 107 TYR A CZ  1 
ATOM   793  O OH  . TYR A 1 104 ? -2.152  52.250 36.538  1.00 28.25 ? 107 TYR A OH  1 
ATOM   794  N N   . GLN A 1 105 ? -6.439  50.665 41.445  1.00 27.41 ? 108 GLN A N   1 
ATOM   795  C CA  . GLN A 1 105 ? -6.971  52.030 41.495  1.00 28.73 ? 108 GLN A CA  1 
ATOM   796  C C   . GLN A 1 105 ? -6.917  52.625 42.894  1.00 29.01 ? 108 GLN A C   1 
ATOM   797  O O   . GLN A 1 105 ? -6.623  53.808 43.051  1.00 28.81 ? 108 GLN A O   1 
ATOM   798  C CB  . GLN A 1 105 ? -8.409  52.083 40.966  1.00 29.32 ? 108 GLN A CB  1 
ATOM   799  C CG  . GLN A 1 105 ? -8.586  51.679 39.493  1.00 32.59 ? 108 GLN A CG  1 
ATOM   800  C CD  . GLN A 1 105 ? -7.835  52.578 38.525  1.00 33.86 ? 108 GLN A CD  1 
ATOM   801  O OE1 . GLN A 1 105 ? -7.692  53.782 38.745  1.00 35.73 ? 108 GLN A OE1 1 
ATOM   802  N NE2 . GLN A 1 105 ? -7.345  51.989 37.444  1.00 34.85 ? 108 GLN A NE2 1 
ATOM   803  N N   . ALA A 1 106 ? -7.205  51.811 43.909  1.00 29.60 ? 109 ALA A N   1 
ATOM   804  C CA  . ALA A 1 106 ? -7.154  52.278 45.297  1.00 29.21 ? 109 ALA A CA  1 
ATOM   805  C C   . ALA A 1 106 ? -5.725  52.692 45.628  1.00 29.27 ? 109 ALA A C   1 
ATOM   806  O O   . ALA A 1 106 ? -5.501  53.772 46.162  1.00 30.25 ? 109 ALA A O   1 
ATOM   807  C CB  . ALA A 1 106 ? -7.623  51.189 46.247  1.00 29.30 ? 109 ALA A CB  1 
ATOM   808  N N   . LEU A 1 107 ? -4.765  51.836 45.291  1.00 28.37 ? 110 LEU A N   1 
ATOM   809  C CA  . LEU A 1 107 ? -3.352  52.130 45.525  1.00 31.25 ? 110 LEU A CA  1 
ATOM   810  C C   . LEU A 1 107 ? -2.934  53.429 44.825  1.00 32.90 ? 110 LEU A C   1 
ATOM   811  O O   . LEU A 1 107 ? -2.144  54.191 45.362  1.00 34.82 ? 110 LEU A O   1 
ATOM   812  C CB  . LEU A 1 107 ? -2.475  50.971 45.041  1.00 31.76 ? 110 LEU A CB  1 
ATOM   813  C CG  . LEU A 1 107 ? -2.439  49.688 45.881  1.00 31.80 ? 110 LEU A CG  1 
ATOM   814  C CD1 . LEU A 1 107 ? -1.921  48.549 45.046  1.00 30.43 ? 110 LEU A CD1 1 
ATOM   815  C CD2 . LEU A 1 107 ? -1.561  49.889 47.106  1.00 31.65 ? 110 LEU A CD2 1 
ATOM   816  N N   . LEU A 1 108 ? -3.458  53.660 43.622  1.00 35.49 ? 111 LEU A N   1 
ATOM   817  C CA  . LEU A 1 108 ? -3.186  54.871 42.843  1.00 37.33 ? 111 LEU A CA  1 
ATOM   818  C C   . LEU A 1 108 ? -3.860  56.092 43.458  1.00 39.31 ? 111 LEU A C   1 
ATOM   819  O O   . LEU A 1 108 ? -3.350  57.207 43.347  1.00 39.62 ? 111 LEU A O   1 
ATOM   820  C CB  . LEU A 1 108 ? -3.721  54.733 41.420  1.00 37.02 ? 111 LEU A CB  1 
ATOM   821  C CG  . LEU A 1 108 ? -2.959  53.917 40.388  1.00 38.72 ? 111 LEU A CG  1 
ATOM   822  C CD1 . LEU A 1 108 ? -3.596  54.175 39.030  1.00 38.84 ? 111 LEU A CD1 1 
ATOM   823  C CD2 . LEU A 1 108 ? -1.491  54.322 40.371  1.00 38.93 ? 111 LEU A CD2 1 
ATOM   824  N N   . GLN A 1 109 ? -5.039  55.886 44.041  1.00 41.98 ? 112 GLN A N   1 
ATOM   825  C CA  . GLN A 1 109 ? -5.789  56.968 44.659  1.00 45.78 ? 112 GLN A CA  1 
ATOM   826  C C   . GLN A 1 109 ? -4.999  57.559 45.823  1.00 47.11 ? 112 GLN A C   1 
ATOM   827  O O   . GLN A 1 109 ? -4.889  58.773 45.947  1.00 48.53 ? 112 GLN A O   1 
ATOM   828  C CB  . GLN A 1 109 ? -7.164  56.470 45.119  1.00 48.92 ? 112 GLN A CB  1 
ATOM   829  C CG  . GLN A 1 109 ? -8.136  56.161 43.969  1.00 55.01 ? 112 GLN A CG  1 
ATOM   830  C CD  . GLN A 1 109 ? -9.227  55.136 44.325  1.00 58.90 ? 112 GLN A CD  1 
ATOM   831  O OE1 . GLN A 1 109 ? -9.442  54.803 45.496  1.00 61.77 ? 112 GLN A OE1 1 
ATOM   832  N NE2 . GLN A 1 109 ? -9.913  54.631 43.303  1.00 59.18 ? 112 GLN A NE2 1 
ATOM   833  N N   . LEU A 1 110 ? -4.423  56.700 46.659  1.00 47.30 ? 113 LEU A N   1 
ATOM   834  C CA  . LEU A 1 110 ? -3.634  57.172 47.793  1.00 48.28 ? 113 LEU A CA  1 
ATOM   835  C C   . LEU A 1 110 ? -2.222  57.550 47.385  1.00 48.97 ? 113 LEU A C   1 
ATOM   836  O O   . LEU A 1 110 ? -1.530  58.263 48.112  1.00 50.78 ? 113 LEU A O   1 
ATOM   837  C CB  . LEU A 1 110 ? -3.582  56.132 48.915  1.00 47.49 ? 113 LEU A CB  1 
ATOM   838  C CG  . LEU A 1 110 ? -4.900  55.832 49.616  1.00 46.84 ? 113 LEU A CG  1 
ATOM   839  C CD1 . LEU A 1 110 ? -4.643  54.953 50.821  1.00 46.17 ? 113 LEU A CD1 1 
ATOM   840  C CD2 . LEU A 1 110 ? -5.565  57.140 50.016  1.00 46.95 ? 113 LEU A CD2 1 
ATOM   841  N N   . HIS A 1 111 ? -1.767  57.046 46.248  1.00 49.08 ? 114 HIS A N   1 
ATOM   842  C CA  . HIS A 1 111 ? -0.437  57.394 45.788  1.00 49.64 ? 114 HIS A CA  1 
ATOM   843  C C   . HIS A 1 111 ? -0.490  58.753 45.084  1.00 49.66 ? 114 HIS A C   1 
ATOM   844  O O   . HIS A 1 111 ? 0.575   59.392 44.969  1.00 49.18 ? 114 HIS A O   1 
ATOM   845  C CB  . HIS A 1 111 ? 0.103   56.323 44.846  1.00 51.58 ? 114 HIS A CB  1 
ATOM   846  C CG  . HIS A 1 111 ? 1.581   56.398 44.632  1.00 53.25 ? 114 HIS A CG  1 
ATOM   847  N ND1 . HIS A 1 111 ? 2.454   56.821 45.611  1.00 53.81 ? 114 HIS A ND1 1 
ATOM   848  C CD2 . HIS A 1 111 ? 2.341   56.111 43.549  1.00 54.18 ? 114 HIS A CD2 1 
ATOM   849  C CE1 . HIS A 1 111 ? 3.686   56.793 45.142  1.00 53.31 ? 114 HIS A CE1 1 
ATOM   850  N NE2 . HIS A 1 111 ? 3.646   56.366 43.893  1.00 54.38 ? 114 HIS A NE2 1 
ATOM   851  N N   . ALA A 1 156 ? 5.073   58.813 35.989  1.00 51.92 ? 159 ALA A N   1 
ATOM   852  C CA  . ALA A 1 156 ? 6.553   58.754 35.803  1.00 51.39 ? 159 ALA A CA  1 
ATOM   853  C C   . ALA A 1 156 ? 6.911   57.794 34.675  1.00 50.96 ? 159 ALA A C   1 
ATOM   854  O O   . ALA A 1 156 ? 7.531   58.190 33.685  1.00 52.05 ? 159 ALA A O   1 
ATOM   855  C CB  . ALA A 1 156 ? 7.237   58.320 37.105  1.00 51.70 ? 159 ALA A CB  1 
ATOM   856  N N   . PHE A 1 157 ? 6.536   56.529 34.844  1.00 48.80 ? 160 PHE A N   1 
ATOM   857  C CA  . PHE A 1 157 ? 6.808   55.498 33.848  1.00 45.40 ? 160 PHE A CA  1 
ATOM   858  C C   . PHE A 1 157 ? 5.521   54.780 33.469  1.00 44.67 ? 160 PHE A C   1 
ATOM   859  O O   . PHE A 1 157 ? 4.686   54.497 34.323  1.00 43.75 ? 160 PHE A O   1 
ATOM   860  C CB  . PHE A 1 157 ? 7.814   54.473 34.385  1.00 44.45 ? 160 PHE A CB  1 
ATOM   861  C CG  . PHE A 1 157 ? 9.139   55.066 34.779  1.00 45.08 ? 160 PHE A CG  1 
ATOM   862  C CD1 . PHE A 1 157 ? 9.586   54.983 36.093  1.00 44.78 ? 160 PHE A CD1 1 
ATOM   863  C CD2 . PHE A 1 157 ? 9.931   55.723 33.845  1.00 45.30 ? 160 PHE A CD2 1 
ATOM   864  C CE1 . PHE A 1 157 ? 10.802  55.544 36.476  1.00 44.47 ? 160 PHE A CE1 1 
ATOM   865  C CE2 . PHE A 1 157 ? 11.146  56.289 34.215  1.00 45.82 ? 160 PHE A CE2 1 
ATOM   866  C CZ  . PHE A 1 157 ? 11.581  56.198 35.538  1.00 45.25 ? 160 PHE A CZ  1 
ATOM   867  N N   . LYS A 1 158 ? 5.335   54.520 32.181  1.00 44.06 ? 161 LYS A N   1 
ATOM   868  C CA  . LYS A 1 158 ? 4.145   53.808 31.748  1.00 42.70 ? 161 LYS A CA  1 
ATOM   869  C C   . LYS A 1 158 ? 4.228   52.376 32.275  1.00 41.17 ? 161 LYS A C   1 
ATOM   870  O O   . LYS A 1 158 ? 3.249   51.828 32.794  1.00 42.18 ? 161 LYS A O   1 
ATOM   871  C CB  . LYS A 1 158 ? 4.050   53.778 30.222  1.00 44.74 ? 161 LYS A CB  1 
ATOM   872  C CG  . LYS A 1 158 ? 3.706   55.100 29.563  1.00 47.40 ? 161 LYS A CG  1 
ATOM   873  C CD  . LYS A 1 158 ? 3.244   54.892 28.119  1.00 49.30 ? 161 LYS A CD  1 
ATOM   874  C CE  . LYS A 1 158 ? 4.335   54.281 27.212  1.00 52.37 ? 161 LYS A CE  1 
ATOM   875  N NZ  . LYS A 1 158 ? 4.616   52.809 27.398  1.00 53.58 ? 161 LYS A NZ  1 
ATOM   876  N N   . GLU A 1 159 ? 5.428   51.808 32.191  1.00 37.79 ? 162 GLU A N   1 
ATOM   877  C CA  . GLU A 1 159 ? 5.669   50.439 32.613  1.00 34.91 ? 162 GLU A CA  1 
ATOM   878  C C   . GLU A 1 159 ? 6.989   50.273 33.344  1.00 31.93 ? 162 GLU A C   1 
ATOM   879  O O   . GLU A 1 159 ? 7.941   50.996 33.078  1.00 30.74 ? 162 GLU A O   1 
ATOM   880  C CB  . GLU A 1 159 ? 5.701   49.535 31.381  1.00 35.84 ? 162 GLU A CB  1 
ATOM   881  C CG  . GLU A 1 159 ? 4.444   49.570 30.521  1.00 35.42 ? 162 GLU A CG  1 
ATOM   882  C CD  . GLU A 1 159 ? 3.266   48.890 31.177  1.00 37.00 ? 162 GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 159 ? 3.457   47.843 31.839  1.00 35.27 ? 162 GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 159 ? 2.143   49.406 31.020  1.00 40.93 ? 162 GLU A OE2 1 
ATOM   885  N N   . VAL A 1 160 ? 7.050   49.293 34.245  1.00 29.46 ? 163 VAL A N   1 
ATOM   886  C CA  . VAL A 1 160 ? 8.277   48.991 34.989  1.00 26.31 ? 163 VAL A CA  1 
ATOM   887  C C   . VAL A 1 160 ? 8.358   47.490 35.214  1.00 24.38 ? 163 VAL A C   1 
ATOM   888  O O   . VAL A 1 160 ? 7.424   46.898 35.714  1.00 24.51 ? 163 VAL A O   1 
ATOM   889  C CB  . VAL A 1 160 ? 8.340   49.714 36.378  1.00 24.97 ? 163 VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 160 ? 9.530   49.223 37.194  1.00 21.73 ? 163 VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 160 ? 8.455   51.204 36.201  1.00 24.18 ? 163 VAL A CG2 1 
ATOM   892  N N   . TRP A 1 161 ? 9.430   46.869 34.732  1.00 23.30 ? 164 TRP A N   1 
ATOM   893  C CA  . TRP A 1 161 ? 9.653   45.437 34.933  1.00 23.53 ? 164 TRP A CA  1 
ATOM   894  C C   . TRP A 1 161 ? 11.010  45.291 35.624  1.00 24.64 ? 164 TRP A C   1 
ATOM   895  O O   . TRP A 1 161 ? 11.984  45.953 35.254  1.00 24.93 ? 164 TRP A O   1 
ATOM   896  C CB  . TRP A 1 161 ? 9.730   44.648 33.615  1.00 22.48 ? 164 TRP A CB  1 
ATOM   897  C CG  . TRP A 1 161 ? 8.508   44.658 32.768  1.00 22.74 ? 164 TRP A CG  1 
ATOM   898  C CD1 . TRP A 1 161 ? 7.518   43.723 32.752  1.00 20.60 ? 164 TRP A CD1 1 
ATOM   899  C CD2 . TRP A 1 161 ? 8.170   45.620 31.764  1.00 22.73 ? 164 TRP A CD2 1 
ATOM   900  N NE1 . TRP A 1 161 ? 6.583   44.037 31.793  1.00 21.10 ? 164 TRP A NE1 1 
ATOM   901  C CE2 . TRP A 1 161 ? 6.962   45.198 31.167  1.00 23.37 ? 164 TRP A CE2 1 
ATOM   902  C CE3 . TRP A 1 161 ? 8.773   46.803 31.301  1.00 23.33 ? 164 TRP A CE3 1 
ATOM   903  C CZ2 . TRP A 1 161 ? 6.347   45.913 30.130  1.00 23.22 ? 164 TRP A CZ2 1 
ATOM   904  C CZ3 . TRP A 1 161 ? 8.158   47.510 30.272  1.00 23.18 ? 164 TRP A CZ3 1 
ATOM   905  C CH2 . TRP A 1 161 ? 6.962   47.061 29.701  1.00 22.02 ? 164 TRP A CH2 1 
ATOM   906  N N   . GLN A 1 162 ? 11.058  44.444 36.643  1.00 25.26 ? 165 GLN A N   1 
ATOM   907  C CA  . GLN A 1 162 ? 12.292  44.188 37.348  1.00 23.94 ? 165 GLN A CA  1 
ATOM   908  C C   . GLN A 1 162 ? 12.903  43.010 36.605  1.00 23.46 ? 165 GLN A C   1 
ATOM   909  O O   . GLN A 1 162 ? 12.241  41.999 36.368  1.00 22.10 ? 165 GLN A O   1 
ATOM   910  C CB  . GLN A 1 162 ? 12.011  43.834 38.809  1.00 23.20 ? 165 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 162 ? 13.281  43.615 39.594  1.00 24.29 ? 165 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 162 ? 13.039  43.527 41.070  1.00 22.57 ? 165 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 162 ? 12.855  44.541 41.753  1.00 23.82 ? 165 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 162 ? 13.051  42.309 41.584  1.00 19.47 ? 165 GLN A NE2 1 
ATOM   915  N N   . VAL A 1 163 ? 14.165  43.128 36.229  1.00 23.98 ? 166 VAL A N   1 
ATOM   916  C CA  . VAL A 1 163 ? 14.791  42.062 35.467  1.00 24.25 ? 166 VAL A CA  1 
ATOM   917  C C   . VAL A 1 163 ? 16.160  41.656 35.971  1.00 26.75 ? 166 VAL A C   1 
ATOM   918  O O   . VAL A 1 163 ? 16.722  42.283 36.863  1.00 28.51 ? 166 VAL A O   1 
ATOM   919  C CB  . VAL A 1 163 ? 14.895  42.463 33.968  1.00 21.96 ? 166 VAL A CB  1 
ATOM   920  C CG1 . VAL A 1 163 ? 13.496  42.575 33.355  1.00 18.34 ? 166 VAL A CG1 1 
ATOM   921  C CG2 . VAL A 1 163 ? 15.662  43.786 33.814  1.00 18.09 ? 166 VAL A CG2 1 
ATOM   922  N N   . ILE A 1 164 ? 16.673  40.572 35.408  1.00 27.96 ? 167 ILE A N   1 
ATOM   923  C CA  . ILE A 1 164 ? 17.983  40.078 35.760  1.00 29.47 ? 167 ILE A CA  1 
ATOM   924  C C   . ILE A 1 164 ? 18.885  40.352 34.560  1.00 29.84 ? 167 ILE A C   1 
ATOM   925  O O   . ILE A 1 164 ? 18.923  39.565 33.609  1.00 29.77 ? 167 ILE A O   1 
ATOM   926  C CB  . ILE A 1 164 ? 17.954  38.552 36.033  1.00 31.25 ? 167 ILE A CB  1 
ATOM   927  C CG1 . ILE A 1 164 ? 17.025  38.226 37.207  1.00 29.23 ? 167 ILE A CG1 1 
ATOM   928  C CG2 . ILE A 1 164 ? 19.372  38.026 36.313  1.00 29.73 ? 167 ILE A CG2 1 
ATOM   929  C CD1 . ILE A 1 164 ? 16.790  36.734 37.367  1.00 28.68 ? 167 ILE A CD1 1 
ATOM   930  N N   . LEU A 1 165 ? 19.553  41.502 34.569  1.00 31.31 ? 168 LEU A N   1 
ATOM   931  C CA  . LEU A 1 165 ? 20.456  41.841 33.482  1.00 33.27 ? 168 LEU A CA  1 
ATOM   932  C C   . LEU A 1 165 ? 21.593  40.827 33.415  1.00 35.75 ? 168 LEU A C   1 
ATOM   933  O O   . LEU A 1 165 ? 22.380  40.694 34.346  1.00 37.59 ? 168 LEU A O   1 
ATOM   934  C CB  . LEU A 1 165 ? 20.984  43.276 33.622  1.00 30.57 ? 168 LEU A CB  1 
ATOM   935  C CG  . LEU A 1 165 ? 20.132  44.326 32.888  1.00 30.07 ? 168 LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 165 ? 20.631  45.751 33.141  1.00 28.93 ? 168 LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 165 ? 20.139  44.028 31.394  1.00 28.57 ? 168 LEU A CD2 1 
ATOM   938  N N   . LYS A 1 166 ? 21.606  40.044 32.342  1.00 37.93 ? 169 LYS A N   1 
ATOM   939  C CA  . LYS A 1 166 ? 22.626  39.024 32.138  1.00 40.15 ? 169 LYS A CA  1 
ATOM   940  C C   . LYS A 1 166 ? 23.948  39.607 31.648  1.00 42.47 ? 169 LYS A C   1 
ATOM   941  O O   . LYS A 1 166 ? 23.990  40.730 31.147  1.00 42.18 ? 169 LYS A O   1 
ATOM   942  C CB  . LYS A 1 166 ? 22.109  37.953 31.182  1.00 40.57 ? 169 LYS A CB  1 
ATOM   943  C CG  . LYS A 1 166 ? 21.913  36.593 31.837  1.00 41.81 ? 169 LYS A CG  1 
ATOM   944  C CD  . LYS A 1 166 ? 20.881  36.634 32.954  1.00 44.38 ? 169 LYS A CD  1 
ATOM   945  C CE  . LYS A 1 166 ? 20.876  35.329 33.757  1.00 47.30 ? 169 LYS A CE  1 
ATOM   946  N NZ  . LYS A 1 166 ? 22.003  35.222 34.741  1.00 49.80 ? 169 LYS A NZ  1 
ATOM   947  N N   . PRO A 1 167 ? 25.063  38.868 31.851  1.00 45.47 ? 170 PRO A N   1 
ATOM   948  C CA  . PRO A 1 167 ? 26.394  39.324 31.424  1.00 46.85 ? 170 PRO A CA  1 
ATOM   949  C C   . PRO A 1 167 ? 26.705  39.079 29.942  1.00 48.33 ? 170 PRO A C   1 
ATOM   950  O O   . PRO A 1 167 ? 27.866  39.032 29.549  1.00 49.37 ? 170 PRO A O   1 
ATOM   951  C CB  . PRO A 1 167 ? 27.327  38.539 32.345  1.00 45.94 ? 170 PRO A CB  1 
ATOM   952  C CG  . PRO A 1 167 ? 26.625  37.225 32.450  1.00 46.53 ? 170 PRO A CG  1 
ATOM   953  C CD  . PRO A 1 167 ? 25.169  37.627 32.644  1.00 45.80 ? 170 PRO A CD  1 
ATOM   954  N N   . LYS A 1 168 ? 25.659  38.911 29.132  1.00 48.92 ? 171 LYS A N   1 
ATOM   955  C CA  . LYS A 1 168 ? 25.810  38.702 27.696  1.00 48.28 ? 171 LYS A CA  1 
ATOM   956  C C   . LYS A 1 168 ? 25.855  40.081 27.036  1.00 47.13 ? 171 LYS A C   1 
ATOM   957  O O   . LYS A 1 168 ? 25.290  41.037 27.561  1.00 47.87 ? 171 LYS A O   1 
ATOM   958  C CB  . LYS A 1 168 ? 24.604  37.940 27.131  1.00 50.59 ? 171 LYS A CB  1 
ATOM   959  C CG  . LYS A 1 168 ? 24.191  36.681 27.897  1.00 54.51 ? 171 LYS A CG  1 
ATOM   960  C CD  . LYS A 1 168 ? 22.904  36.078 27.308  1.00 56.33 ? 171 LYS A CD  1 
ATOM   961  C CE  . LYS A 1 168 ? 22.332  34.933 28.163  1.00 57.52 ? 171 LYS A CE  1 
ATOM   962  N NZ  . LYS A 1 168 ? 21.056  34.359 27.597  1.00 57.79 ? 171 LYS A NZ  1 
ATOM   963  N N   . GLY A 1 169 ? 26.549  40.182 25.906  1.00 45.31 ? 172 GLY A N   1 
ATOM   964  C CA  . GLY A 1 169 ? 26.637  41.426 25.158  1.00 41.92 ? 172 GLY A CA  1 
ATOM   965  C C   . GLY A 1 169 ? 26.991  42.693 25.899  1.00 41.33 ? 172 GLY A C   1 
ATOM   966  O O   . GLY A 1 169 ? 28.012  42.776 26.558  1.00 41.41 ? 172 GLY A O   1 
ATOM   967  N N   . LEU A 1 170 ? 26.127  43.691 25.766  1.00 40.58 ? 173 LEU A N   1 
ATOM   968  C CA  . LEU A 1 170 ? 26.301  44.999 26.392  1.00 40.68 ? 173 LEU A CA  1 
ATOM   969  C C   . LEU A 1 170 ? 26.223  44.927 27.920  1.00 42.10 ? 173 LEU A C   1 
ATOM   970  O O   . LEU A 1 170 ? 26.453  45.922 28.616  1.00 42.10 ? 173 LEU A O   1 
ATOM   971  C CB  . LEU A 1 170 ? 25.234  45.955 25.852  1.00 39.50 ? 173 LEU A CB  1 
ATOM   972  C CG  . LEU A 1 170 ? 25.641  47.241 25.128  1.00 39.45 ? 173 LEU A CG  1 
ATOM   973  C CD1 . LEU A 1 170 ? 26.877  47.041 24.277  1.00 39.74 ? 173 LEU A CD1 1 
ATOM   974  C CD2 . LEU A 1 170 ? 24.476  47.715 24.269  1.00 37.69 ? 173 LEU A CD2 1 
ATOM   975  N N   . GLY A 1 171 ? 25.848  43.756 28.431  1.00 43.74 ? 174 GLY A N   1 
ATOM   976  C CA  . GLY A 1 171 ? 25.760  43.560 29.868  1.00 46.52 ? 174 GLY A CA  1 
ATOM   977  C C   . GLY A 1 171 ? 27.154  43.556 30.467  1.00 48.16 ? 174 GLY A C   1 
ATOM   978  O O   . GLY A 1 171 ? 27.431  44.311 31.400  1.00 47.84 ? 174 GLY A O   1 
ATOM   979  N N   . GLN A 1 172 ? 28.042  42.726 29.922  1.00 49.85 ? 175 GLN A N   1 
ATOM   980  C CA  . GLN A 1 172 ? 29.406  42.659 30.423  1.00 52.53 ? 175 GLN A CA  1 
ATOM   981  C C   . GLN A 1 172 ? 30.202  43.913 30.082  1.00 52.50 ? 175 GLN A C   1 
ATOM   982  O O   . GLN A 1 172 ? 30.814  44.524 30.958  1.00 52.82 ? 175 GLN A O   1 
ATOM   983  C CB  . GLN A 1 172 ? 30.135  41.425 29.884  1.00 54.81 ? 175 GLN A CB  1 
ATOM   984  C CG  . GLN A 1 172 ? 31.513  41.205 30.520  1.00 60.83 ? 175 GLN A CG  1 
ATOM   985  C CD  . GLN A 1 172 ? 31.462  41.105 32.053  1.00 64.72 ? 175 GLN A CD  1 
ATOM   986  O OE1 . GLN A 1 172 ? 31.307  40.015 32.615  1.00 66.58 ? 175 GLN A OE1 1 
ATOM   987  N NE2 . GLN A 1 172 ? 31.592  42.247 32.730  1.00 65.38 ? 175 GLN A NE2 1 
ATOM   988  N N   . THR A 1 173 ? 30.161  44.300 28.813  1.00 52.44 ? 176 THR A N   1 
ATOM   989  C CA  . THR A 1 173 ? 30.888  45.464 28.313  1.00 52.23 ? 176 THR A CA  1 
ATOM   990  C C   . THR A 1 173 ? 30.605  46.769 29.062  1.00 51.92 ? 176 THR A C   1 
ATOM   991  O O   . THR A 1 173 ? 31.513  47.565 29.285  1.00 52.21 ? 176 THR A O   1 
ATOM   992  C CB  . THR A 1 173 ? 30.656  45.634 26.786  1.00 51.52 ? 176 THR A CB  1 
ATOM   993  O OG1 . THR A 1 173 ? 31.235  44.521 26.093  1.00 54.07 ? 176 THR A OG1 1 
ATOM   994  C CG2 . THR A 1 173 ? 31.283  46.915 26.271  1.00 50.19 ? 176 THR A CG2 1 
ATOM   995  N N   . LYS A 1 174 ? 29.361  46.982 29.467  1.00 51.42 ? 177 LYS A N   1 
ATOM   996  C CA  . LYS A 1 174 ? 29.008  48.198 30.189  1.00 51.61 ? 177 LYS A CA  1 
ATOM   997  C C   . LYS A 1 174 ? 28.824  47.906 31.679  1.00 51.81 ? 177 LYS A C   1 
ATOM   998  O O   . LYS A 1 174 ? 28.373  48.761 32.437  1.00 51.05 ? 177 LYS A O   1 
ATOM   999  C CB  . LYS A 1 174 ? 27.736  48.806 29.598  1.00 52.38 ? 177 LYS A CB  1 
ATOM   1000 C CG  . LYS A 1 174 ? 27.895  49.351 28.175  1.00 53.06 ? 177 LYS A CG  1 
ATOM   1001 C CD  . LYS A 1 174 ? 28.494  50.754 28.169  1.00 53.71 ? 177 LYS A CD  1 
ATOM   1002 C CE  . LYS A 1 174 ? 28.907  51.187 26.759  1.00 55.88 ? 177 LYS A CE  1 
ATOM   1003 N NZ  . LYS A 1 174 ? 29.302  52.635 26.669  1.00 55.61 ? 177 LYS A NZ  1 
ATOM   1004 N N   . ASN A 1 175 ? 29.218  46.698 32.082  1.00 52.30 ? 178 ASN A N   1 
ATOM   1005 C CA  . ASN A 1 175 ? 29.113  46.211 33.458  1.00 52.56 ? 178 ASN A CA  1 
ATOM   1006 C C   . ASN A 1 175 ? 27.772  46.528 34.091  1.00 51.30 ? 178 ASN A C   1 
ATOM   1007 O O   . ASN A 1 175 ? 27.684  47.223 35.105  1.00 51.47 ? 178 ASN A O   1 
ATOM   1008 C CB  . ASN A 1 175 ? 30.266  46.705 34.333  1.00 53.29 ? 178 ASN A CB  1 
ATOM   1009 C CG  . ASN A 1 175 ? 30.295  46.028 35.699  1.00 53.48 ? 178 ASN A CG  1 
ATOM   1010 O OD1 . ASN A 1 175 ? 30.345  46.700 36.726  1.00 54.43 ? 178 ASN A OD1 1 
ATOM   1011 N ND2 . ASN A 1 175 ? 30.263  44.700 35.714  1.00 54.51 ? 178 ASN A ND2 1 
ATOM   1012 N N   . LEU A 1 176 ? 26.731  46.074 33.402  1.00 49.57 ? 179 LEU A N   1 
ATOM   1013 C CA  . LEU A 1 176 ? 25.347  46.221 33.818  1.00 45.30 ? 179 LEU A CA  1 
ATOM   1014 C C   . LEU A 1 176 ? 24.861  44.785 33.921  1.00 43.85 ? 179 LEU A C   1 
ATOM   1015 O O   . LEU A 1 176 ? 24.432  44.180 32.935  1.00 43.21 ? 179 LEU A O   1 
ATOM   1016 C CB  . LEU A 1 176 ? 24.546  46.995 32.772  1.00 43.58 ? 179 LEU A CB  1 
ATOM   1017 C CG  . LEU A 1 176 ? 24.948  48.457 32.622  1.00 41.05 ? 179 LEU A CG  1 
ATOM   1018 C CD1 . LEU A 1 176 ? 24.082  49.131 31.595  1.00 43.24 ? 179 LEU A CD1 1 
ATOM   1019 C CD2 . LEU A 1 176 ? 24.794  49.148 33.945  1.00 41.55 ? 179 LEU A CD2 1 
ATOM   1020 N N   . ILE A 1 177 ? 25.028  44.229 35.117  1.00 42.55 ? 180 ILE A N   1 
ATOM   1021 C CA  . ILE A 1 177 ? 24.660  42.854 35.420  1.00 40.94 ? 180 ILE A CA  1 
ATOM   1022 C C   . ILE A 1 177 ? 23.892  42.833 36.732  1.00 39.99 ? 180 ILE A C   1 
ATOM   1023 O O   . ILE A 1 177 ? 24.062  43.716 37.565  1.00 41.84 ? 180 ILE A O   1 
ATOM   1024 C CB  . ILE A 1 177 ? 25.931  41.967 35.548  1.00 41.23 ? 180 ILE A CB  1 
ATOM   1025 C CG1 . ILE A 1 177 ? 26.719  42.008 34.232  1.00 40.20 ? 180 ILE A CG1 1 
ATOM   1026 C CG2 . ILE A 1 177 ? 25.550  40.529 35.906  1.00 39.84 ? 180 ILE A CG2 1 
ATOM   1027 C CD1 . ILE A 1 177 ? 28.089  41.435 34.303  1.00 39.67 ? 180 ILE A CD1 1 
ATOM   1028 N N   . GLY A 1 178 ? 23.027  41.839 36.896  1.00 37.48 ? 181 GLY A N   1 
ATOM   1029 C CA  . GLY A 1 178 ? 22.244  41.725 38.112  1.00 33.85 ? 181 GLY A CA  1 
ATOM   1030 C C   . GLY A 1 178 ? 20.884  42.384 38.032  1.00 31.53 ? 181 GLY A C   1 
ATOM   1031 O O   . GLY A 1 178 ? 20.456  42.817 36.964  1.00 32.72 ? 181 GLY A O   1 
ATOM   1032 N N   . ILE A 1 179 ? 20.256  42.553 39.193  1.00 29.60 ? 182 ILE A N   1 
ATOM   1033 C CA  . ILE A 1 179 ? 18.918  43.132 39.290  1.00 27.58 ? 182 ILE A CA  1 
ATOM   1034 C C   . ILE A 1 179 ? 18.766  44.608 38.930  1.00 26.14 ? 182 ILE A C   1 
ATOM   1035 O O   . ILE A 1 179 ? 19.292  45.491 39.598  1.00 26.59 ? 182 ILE A O   1 
ATOM   1036 C CB  . ILE A 1 179 ? 18.264  42.871 40.699  1.00 27.14 ? 182 ILE A CB  1 
ATOM   1037 C CG1 . ILE A 1 179 ? 18.500  41.417 41.152  1.00 25.37 ? 182 ILE A CG1 1 
ATOM   1038 C CG2 . ILE A 1 179 ? 16.759  43.188 40.656  1.00 25.27 ? 182 ILE A CG2 1 
ATOM   1039 C CD1 . ILE A 1 179 ? 18.179  40.365 40.117  1.00 27.87 ? 182 ILE A CD1 1 
ATOM   1040 N N   . TYR A 1 180 ? 18.022  44.854 37.860  1.00 26.29 ? 183 TYR A N   1 
ATOM   1041 C CA  . TYR A 1 180 ? 17.747  46.209 37.402  1.00 25.75 ? 183 TYR A CA  1 
ATOM   1042 C C   . TYR A 1 180 ? 16.256  46.359 37.198  1.00 24.15 ? 183 TYR A C   1 
ATOM   1043 O O   . TYR A 1 180 ? 15.493  45.401 37.332  1.00 22.49 ? 183 TYR A O   1 
ATOM   1044 C CB  . TYR A 1 180 ? 18.489  46.523 36.091  1.00 25.91 ? 183 TYR A CB  1 
ATOM   1045 C CG  . TYR A 1 180 ? 19.950  46.864 36.287  1.00 28.48 ? 183 TYR A CG  1 
ATOM   1046 C CD1 . TYR A 1 180 ? 20.882  45.875 36.627  1.00 28.57 ? 183 TYR A CD1 1 
ATOM   1047 C CD2 . TYR A 1 180 ? 20.398  48.191 36.191  1.00 29.76 ? 183 TYR A CD2 1 
ATOM   1048 C CE1 . TYR A 1 180 ? 22.215  46.196 36.873  1.00 27.72 ? 183 TYR A CE1 1 
ATOM   1049 C CE2 . TYR A 1 180 ? 21.735  48.519 36.440  1.00 29.40 ? 183 TYR A CE2 1 
ATOM   1050 C CZ  . TYR A 1 180 ? 22.633  47.514 36.782  1.00 29.78 ? 183 TYR A CZ  1 
ATOM   1051 O OH  . TYR A 1 180 ? 23.946  47.831 37.054  1.00 29.40 ? 183 TYR A OH  1 
ATOM   1052 N N   . ARG A 1 181 ? 15.842  47.586 36.917  1.00 24.79 ? 184 ARG A N   1 
ATOM   1053 C CA  . ARG A 1 181 ? 14.440  47.864 36.661  1.00 26.72 ? 184 ARG A CA  1 
ATOM   1054 C C   . ARG A 1 181 ? 14.311  48.503 35.281  1.00 26.97 ? 184 ARG A C   1 
ATOM   1055 O O   . ARG A 1 181 ? 14.886  49.565 35.033  1.00 25.85 ? 184 ARG A O   1 
ATOM   1056 C CB  . ARG A 1 181 ? 13.866  48.801 37.722  1.00 27.38 ? 184 ARG A CB  1 
ATOM   1057 C CG  . ARG A 1 181 ? 12.644  48.235 38.412  1.00 31.20 ? 184 ARG A CG  1 
ATOM   1058 C CD  . ARG A 1 181 ? 13.029  47.239 39.489  1.00 34.62 ? 184 ARG A CD  1 
ATOM   1059 N NE  . ARG A 1 181 ? 13.496  47.933 40.681  1.00 39.11 ? 184 ARG A NE  1 
ATOM   1060 C CZ  . ARG A 1 181 ? 12.921  47.844 41.878  1.00 39.61 ? 184 ARG A CZ  1 
ATOM   1061 N NH1 . ARG A 1 181 ? 11.862  47.069 42.067  1.00 33.94 ? 184 ARG A NH1 1 
ATOM   1062 N NH2 . ARG A 1 181 ? 13.357  48.610 42.864  1.00 41.09 ? 184 ARG A NH2 1 
ATOM   1063 N N   . LEU A 1 182 ? 13.657  47.798 34.360  1.00 26.62 ? 185 LEU A N   1 
ATOM   1064 C CA  . LEU A 1 182 ? 13.432  48.326 33.018  1.00 25.45 ? 185 LEU A CA  1 
ATOM   1065 C C   . LEU A 1 182 ? 12.220  49.259 33.114  1.00 25.15 ? 185 LEU A C   1 
ATOM   1066 O O   . LEU A 1 182 ? 11.078  48.817 33.309  1.00 24.50 ? 185 LEU A O   1 
ATOM   1067 C CB  . LEU A 1 182 ? 13.189  47.180 32.025  1.00 25.66 ? 185 LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 182 ? 13.403  47.464 30.533  1.00 24.31 ? 185 LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 182 ? 13.443  46.164 29.777  1.00 26.34 ? 185 LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 182 ? 12.295  48.344 29.986  1.00 25.79 ? 185 LEU A CD2 1 
ATOM   1071 N N   . CYS A 1 183 ? 12.487  50.549 32.952  1.00 25.50 ? 186 CYS A N   1 
ATOM   1072 C CA  . CYS A 1 183 ? 11.471  51.582 33.062  1.00 26.40 ? 186 CYS A CA  1 
ATOM   1073 C C   . CYS A 1 183 ? 11.094  52.211 31.727  1.00 27.33 ? 186 CYS A C   1 
ATOM   1074 O O   . CYS A 1 183 ? 11.843  52.996 31.154  1.00 26.57 ? 186 CYS A O   1 
ATOM   1075 C CB  . CYS A 1 183 ? 11.963  52.653 34.038  1.00 27.52 ? 186 CYS A CB  1 
ATOM   1076 S SG  . CYS A 1 183 ? 12.680  51.963 35.579  1.00 29.71 ? 186 CYS A SG  1 
ATOM   1077 N N   . LEU A 1 184 ? 9.882   51.919 31.279  1.00 28.08 ? 187 LEU A N   1 
ATOM   1078 C CA  . LEU A 1 184 ? 9.379   52.421 30.006  1.00 29.95 ? 187 LEU A CA  1 
ATOM   1079 C C   . LEU A 1 184 ? 8.482   53.671 30.032  1.00 31.31 ? 187 LEU A C   1 
ATOM   1080 O O   . LEU A 1 184 ? 7.488   53.732 30.759  1.00 29.95 ? 187 LEU A O   1 
ATOM   1081 C CB  . LEU A 1 184 ? 8.651   51.287 29.282  1.00 27.37 ? 187 LEU A CB  1 
ATOM   1082 C CG  . LEU A 1 184 ? 7.947   51.584 27.970  1.00 27.03 ? 187 LEU A CG  1 
ATOM   1083 C CD1 . LEU A 1 184 ? 8.974   51.839 26.848  1.00 27.90 ? 187 LEU A CD1 1 
ATOM   1084 C CD2 . LEU A 1 184 ? 7.075   50.404 27.630  1.00 24.55 ? 187 LEU A CD2 1 
ATOM   1085 N N   . THR A 1 185 ? 8.859   54.659 29.217  1.00 33.94 ? 188 THR A N   1 
ATOM   1086 C CA  . THR A 1 185 ? 8.085   55.893 29.054  1.00 35.49 ? 188 THR A CA  1 
ATOM   1087 C C   . THR A 1 185 ? 7.538   55.840 27.624  1.00 35.71 ? 188 THR A C   1 
ATOM   1088 O O   . THR A 1 185 ? 7.657   54.816 26.968  1.00 36.15 ? 188 THR A O   1 
ATOM   1089 C CB  . THR A 1 185 ? 8.952   57.163 29.210  1.00 35.77 ? 188 THR A CB  1 
ATOM   1090 O OG1 . THR A 1 185 ? 9.886   57.246 28.130  1.00 35.05 ? 188 THR A OG1 1 
ATOM   1091 C CG2 . THR A 1 185 ? 9.694   57.146 30.537  1.00 35.12 ? 188 THR A CG2 1 
ATOM   1092 N N   . SER A 1 186 ? 6.932   56.915 27.138  1.00 37.53 ? 189 SER A N   1 
ATOM   1093 C CA  . SER A 1 186 ? 6.418   56.892 25.770  1.00 39.16 ? 189 SER A CA  1 
ATOM   1094 C C   . SER A 1 186 ? 7.542   57.100 24.748  1.00 39.79 ? 189 SER A C   1 
ATOM   1095 O O   . SER A 1 186 ? 7.396   56.747 23.580  1.00 40.67 ? 189 SER A O   1 
ATOM   1096 C CB  . SER A 1 186 ? 5.315   57.934 25.568  1.00 38.66 ? 189 SER A CB  1 
ATOM   1097 O OG  . SER A 1 186 ? 5.850   59.235 25.476  1.00 41.46 ? 189 SER A OG  1 
ATOM   1098 N N   . LYS A 1 187 ? 8.683   57.620 25.202  1.00 40.41 ? 190 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 187 ? 9.810   57.854 24.308  1.00 39.94 ? 190 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 187 ? 11.164  57.250 24.726  1.00 37.75 ? 190 LYS A C   1 
ATOM   1101 O O   . LYS A 1 187 ? 12.110  57.262 23.940  1.00 37.64 ? 190 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 187 ? 9.942   59.353 23.999  1.00 43.88 ? 190 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 187 ? 10.268  60.253 25.195  1.00 51.53 ? 190 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 187 ? 9.131   60.326 26.238  1.00 55.84 ? 190 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 187 ? 9.452   61.314 27.369  1.00 57.24 ? 190 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 187 ? 10.810  61.100 27.969  1.00 58.67 ? 190 LYS A NZ  1 
ATOM   1107 N N   . THR A 1 188 ? 11.252  56.665 25.918  1.00 35.11 ? 191 THR A N   1 
ATOM   1108 C CA  . THR A 1 188 ? 12.513  56.064 26.371  1.00 34.12 ? 191 THR A CA  1 
ATOM   1109 C C   . THR A 1 188 ? 12.388  54.756 27.160  1.00 33.78 ? 191 THR A C   1 
ATOM   1110 O O   . THR A 1 188 ? 11.289  54.285 27.469  1.00 35.17 ? 191 THR A O   1 
ATOM   1111 C CB  . THR A 1 188 ? 13.339  57.024 27.267  1.00 34.20 ? 191 THR A CB  1 
ATOM   1112 O OG1 . THR A 1 188 ? 12.510  57.532 28.316  1.00 34.92 ? 191 THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 188 ? 13.938  58.167 26.474  1.00 33.92 ? 191 THR A CG2 1 
ATOM   1114 N N   . ILE A 1 189 ? 13.551  54.164 27.433  1.00 33.14 ? 192 ILE A N   1 
ATOM   1115 C CA  . ILE A 1 189 ? 13.698  52.945 28.216  1.00 33.05 ? 192 ILE A CA  1 
ATOM   1116 C C   . ILE A 1 189 ? 14.914  53.214 29.095  1.00 33.41 ? 192 ILE A C   1 
ATOM   1117 O O   . ILE A 1 189 ? 16.008  53.484 28.606  1.00 33.77 ? 192 ILE A O   1 
ATOM   1118 C CB  . ILE A 1 189 ? 13.914  51.688 27.346  1.00 31.58 ? 192 ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 189 ? 12.561  51.125 26.924  1.00 31.68 ? 192 ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 189 ? 14.668  50.615 28.121  1.00 32.50 ? 192 ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 189 ? 12.633  49.782 26.231  1.00 31.71 ? 192 ILE A CD1 1 
ATOM   1122 N N   . SER A 1 190 ? 14.700  53.186 30.400  1.00 32.87 ? 193 SER A N   1 
ATOM   1123 C CA  . SER A 1 190 ? 15.763  53.468 31.336  1.00 32.44 ? 193 SER A CA  1 
ATOM   1124 C C   . SER A 1 190 ? 16.048  52.294 32.237  1.00 32.56 ? 193 SER A C   1 
ATOM   1125 O O   . SER A 1 190 ? 15.138  51.588 32.652  1.00 33.56 ? 193 SER A O   1 
ATOM   1126 C CB  . SER A 1 190 ? 15.375  54.679 32.167  1.00 33.13 ? 193 SER A CB  1 
ATOM   1127 O OG  . SER A 1 190 ? 16.527  55.315 32.680  1.00 37.27 ? 193 SER A OG  1 
ATOM   1128 N N   . PHE A 1 191 ? 17.321  52.049 32.501  1.00 32.47 ? 194 PHE A N   1 
ATOM   1129 C CA  . PHE A 1 191 ? 17.716  50.961 33.380  1.00 31.31 ? 194 PHE A CA  1 
ATOM   1130 C C   . PHE A 1 191 ? 18.160  51.533 34.725  1.00 30.23 ? 194 PHE A C   1 
ATOM   1131 O O   . PHE A 1 191 ? 19.087  52.328 34.790  1.00 28.43 ? 194 PHE A O   1 
ATOM   1132 C CB  . PHE A 1 191 ? 18.843  50.151 32.755  1.00 32.45 ? 194 PHE A CB  1 
ATOM   1133 C CG  . PHE A 1 191 ? 18.381  49.159 31.724  1.00 34.77 ? 194 PHE A CG  1 
ATOM   1134 C CD1 . PHE A 1 191 ? 17.759  47.973 32.112  1.00 35.53 ? 194 PHE A CD1 1 
ATOM   1135 C CD2 . PHE A 1 191 ? 18.605  49.384 30.370  1.00 34.27 ? 194 PHE A CD2 1 
ATOM   1136 C CE1 . PHE A 1 191 ? 17.373  47.027 31.167  1.00 35.27 ? 194 PHE A CE1 1 
ATOM   1137 C CE2 . PHE A 1 191 ? 18.226  48.451 29.423  1.00 33.93 ? 194 PHE A CE2 1 
ATOM   1138 C CZ  . PHE A 1 191 ? 17.611  47.270 29.820  1.00 34.47 ? 194 PHE A CZ  1 
ATOM   1139 N N   . VAL A 1 192 ? 17.429  51.185 35.780  1.00 30.45 ? 195 VAL A N   1 
ATOM   1140 C CA  . VAL A 1 192 ? 17.730  51.640 37.143  1.00 30.39 ? 195 VAL A CA  1 
ATOM   1141 C C   . VAL A 1 192 ? 18.116  50.423 38.001  1.00 31.12 ? 195 VAL A C   1 
ATOM   1142 O O   . VAL A 1 192 ? 17.298  49.514 38.222  1.00 31.11 ? 195 VAL A O   1 
ATOM   1143 C CB  . VAL A 1 192 ? 16.512  52.330 37.797  1.00 29.83 ? 195 VAL A CB  1 
ATOM   1144 C CG1 . VAL A 1 192 ? 16.940  53.065 39.047  1.00 28.89 ? 195 VAL A CG1 1 
ATOM   1145 C CG2 . VAL A 1 192 ? 15.865  53.284 36.832  1.00 29.14 ? 195 VAL A CG2 1 
ATOM   1146 N N   . LYS A 1 193 ? 19.371  50.381 38.443  1.00 30.95 ? 196 LYS A N   1 
ATOM   1147 C CA  . LYS A 1 193 ? 19.840  49.271 39.266  1.00 32.07 ? 196 LYS A CA  1 
ATOM   1148 C C   . LYS A 1 193 ? 19.044  49.224 40.557  1.00 31.46 ? 196 LYS A C   1 
ATOM   1149 O O   . LYS A 1 193 ? 18.738  50.267 41.124  1.00 32.79 ? 196 LYS A O   1 
ATOM   1150 C CB  . LYS A 1 193 ? 21.324  49.429 39.589  1.00 33.61 ? 196 LYS A CB  1 
ATOM   1151 C CG  . LYS A 1 193 ? 21.877  48.314 40.452  1.00 35.78 ? 196 LYS A CG  1 
ATOM   1152 C CD  . LYS A 1 193 ? 23.373  48.443 40.626  1.00 39.97 ? 196 LYS A CD  1 
ATOM   1153 C CE  . LYS A 1 193 ? 23.865  47.622 41.811  1.00 43.75 ? 196 LYS A CE  1 
ATOM   1154 N NZ  . LYS A 1 193 ? 23.373  48.189 43.110  1.00 46.26 ? 196 LYS A NZ  1 
ATOM   1155 N N   . LEU A 1 194 ? 18.700  48.023 41.011  1.00 30.73 ? 197 LEU A N   1 
ATOM   1156 C CA  . LEU A 1 194 ? 17.945  47.882 42.254  1.00 30.45 ? 197 LEU A CA  1 
ATOM   1157 C C   . LEU A 1 194 ? 18.674  48.603 43.387  1.00 30.82 ? 197 LEU A C   1 
ATOM   1158 O O   . LEU A 1 194 ? 19.903  48.603 43.436  1.00 32.16 ? 197 LEU A O   1 
ATOM   1159 C CB  . LEU A 1 194 ? 17.762  46.409 42.621  1.00 29.16 ? 197 LEU A CB  1 
ATOM   1160 C CG  . LEU A 1 194 ? 16.963  46.194 43.907  1.00 27.82 ? 197 LEU A CG  1 
ATOM   1161 C CD1 . LEU A 1 194 ? 15.518  46.527 43.635  1.00 28.35 ? 197 LEU A CD1 1 
ATOM   1162 C CD2 . LEU A 1 194 ? 17.106  44.765 44.393  1.00 26.56 ? 197 LEU A CD2 1 
ATOM   1163 N N   . ASN A 1 195 ? 17.905  49.224 44.274  1.00 30.90 ? 198 ASN A N   1 
ATOM   1164 C CA  . ASN A 1 195 ? 18.419  49.981 45.422  1.00 32.22 ? 198 ASN A CA  1 
ATOM   1165 C C   . ASN A 1 195 ? 18.918  51.358 45.036  1.00 34.55 ? 198 ASN A C   1 
ATOM   1166 O O   . ASN A 1 195 ? 19.157  52.190 45.903  1.00 34.11 ? 198 ASN A O   1 
ATOM   1167 C CB  . ASN A 1 195 ? 19.542  49.239 46.159  1.00 30.35 ? 198 ASN A CB  1 
ATOM   1168 C CG  . ASN A 1 195 ? 19.112  47.888 46.671  1.00 30.51 ? 198 ASN A CG  1 
ATOM   1169 O OD1 . ASN A 1 195 ? 18.247  47.783 47.537  1.00 31.50 ? 198 ASN A OD1 1 
ATOM   1170 N ND2 . ASN A 1 195 ? 19.718  46.837 46.134  1.00 29.43 ? 198 ASN A ND2 1 
ATOM   1171 N N   . SER A 1 196 ? 19.084  51.597 43.741  1.00 37.00 ? 199 SER A N   1 
ATOM   1172 C CA  . SER A 1 196 ? 19.570  52.893 43.269  1.00 39.82 ? 199 SER A CA  1 
ATOM   1173 C C   . SER A 1 196 ? 18.412  53.837 43.002  1.00 40.30 ? 199 SER A C   1 
ATOM   1174 O O   . SER A 1 196 ? 17.261  53.405 42.899  1.00 39.67 ? 199 SER A O   1 
ATOM   1175 C CB  . SER A 1 196 ? 20.418  52.726 42.001  1.00 40.79 ? 199 SER A CB  1 
ATOM   1176 O OG  . SER A 1 196 ? 21.471  51.796 42.215  1.00 45.45 ? 199 SER A OG  1 
ATOM   1177 N N   . GLU A 1 197 ? 18.710  55.125 42.894  1.00 43.17 ? 200 GLU A N   1 
ATOM   1178 C CA  . GLU A 1 197 ? 17.659  56.099 42.630  1.00 46.56 ? 200 GLU A CA  1 
ATOM   1179 C C   . GLU A 1 197 ? 17.806  56.749 41.254  1.00 46.30 ? 200 GLU A C   1 
ATOM   1180 O O   . GLU A 1 197 ? 16.854  57.313 40.718  1.00 46.37 ? 200 GLU A O   1 
ATOM   1181 C CB  . GLU A 1 197 ? 17.605  57.136 43.754  1.00 49.48 ? 200 GLU A CB  1 
ATOM   1182 C CG  . GLU A 1 197 ? 17.363  56.476 45.099  1.00 55.02 ? 200 GLU A CG  1 
ATOM   1183 C CD  . GLU A 1 197 ? 17.050  57.445 46.207  1.00 58.56 ? 200 GLU A CD  1 
ATOM   1184 O OE1 . GLU A 1 197 ? 16.085  58.228 46.040  1.00 60.84 ? 200 GLU A OE1 1 
ATOM   1185 O OE2 . GLU A 1 197 ? 17.747  57.391 47.256  1.00 58.96 ? 200 GLU A OE2 1 
ATOM   1186 N N   . ALA A 1 198 ? 18.995  56.624 40.675  1.00 45.22 ? 201 ALA A N   1 
ATOM   1187 C CA  . ALA A 1 198 ? 19.278  57.174 39.356  1.00 43.98 ? 201 ALA A CA  1 
ATOM   1188 C C   . ALA A 1 198 ? 19.462  56.038 38.350  1.00 42.49 ? 201 ALA A C   1 
ATOM   1189 O O   . ALA A 1 198 ? 19.912  54.947 38.708  1.00 43.12 ? 201 ALA A O   1 
ATOM   1190 C CB  . ALA A 1 198 ? 20.532  58.034 39.405  1.00 44.03 ? 201 ALA A CB  1 
ATOM   1191 N N   . ALA A 1 199 ? 19.110  56.302 37.093  1.00 39.94 ? 202 ALA A N   1 
ATOM   1192 C CA  . ALA A 1 199 ? 19.245  55.313 36.032  1.00 38.49 ? 202 ALA A CA  1 
ATOM   1193 C C   . ALA A 1 199 ? 20.684  55.152 35.566  1.00 38.04 ? 202 ALA A C   1 
ATOM   1194 O O   . ALA A 1 199 ? 21.412  56.129 35.397  1.00 37.90 ? 202 ALA A O   1 
ATOM   1195 C CB  . ALA A 1 199 ? 18.379  55.688 34.860  1.00 38.64 ? 202 ALA A CB  1 
ATOM   1196 N N   . ALA A 1 200 ? 21.102  53.906 35.395  1.00 38.01 ? 203 ALA A N   1 
ATOM   1197 C CA  . ALA A 1 200 ? 22.441  53.633 34.917  1.00 38.75 ? 203 ALA A CA  1 
ATOM   1198 C C   . ALA A 1 200 ? 22.493  54.223 33.513  1.00 39.68 ? 203 ALA A C   1 
ATOM   1199 O O   . ALA A 1 200 ? 23.232  55.171 33.273  1.00 40.54 ? 203 ALA A O   1 
ATOM   1200 C CB  . ALA A 1 200 ? 22.701  52.133 34.889  1.00 38.01 ? 203 ALA A CB  1 
ATOM   1201 N N   . VAL A 1 201 ? 21.633  53.731 32.621  1.00 40.87 ? 204 VAL A N   1 
ATOM   1202 C CA  . VAL A 1 201 ? 21.586  54.230 31.247  1.00 41.29 ? 204 VAL A CA  1 
ATOM   1203 C C   . VAL A 1 201 ? 20.172  54.585 30.761  1.00 39.79 ? 204 VAL A C   1 
ATOM   1204 O O   . VAL A 1 201 ? 19.180  54.032 31.232  1.00 38.28 ? 204 VAL A O   1 
ATOM   1205 C CB  . VAL A 1 201 ? 22.253  53.230 30.260  1.00 43.10 ? 204 VAL A CB  1 
ATOM   1206 C CG1 . VAL A 1 201 ? 21.353  52.038 29.991  1.00 44.53 ? 204 VAL A CG1 1 
ATOM   1207 C CG2 . VAL A 1 201 ? 22.612  53.930 28.975  1.00 43.45 ? 204 VAL A CG2 1 
ATOM   1208 N N   . VAL A 1 202 ? 20.092  55.560 29.860  1.00 39.47 ? 205 VAL A N   1 
ATOM   1209 C CA  . VAL A 1 202 ? 18.808  55.980 29.290  1.00 39.78 ? 205 VAL A CA  1 
ATOM   1210 C C   . VAL A 1 202 ? 18.791  55.793 27.764  1.00 40.69 ? 205 VAL A C   1 
ATOM   1211 O O   . VAL A 1 202 ? 19.449  56.527 27.027  1.00 42.73 ? 205 VAL A O   1 
ATOM   1212 C CB  . VAL A 1 202 ? 18.472  57.469 29.619  1.00 39.48 ? 205 VAL A CB  1 
ATOM   1213 C CG1 . VAL A 1 202 ? 17.183  57.879 28.923  1.00 38.10 ? 205 VAL A CG1 1 
ATOM   1214 C CG2 . VAL A 1 202 ? 18.334  57.673 31.125  1.00 38.54 ? 205 VAL A CG2 1 
ATOM   1215 N N   . LEU A 1 203 ? 18.065  54.785 27.301  1.00 39.33 ? 206 LEU A N   1 
ATOM   1216 C CA  . LEU A 1 203 ? 17.947  54.507 25.879  1.00 37.35 ? 206 LEU A CA  1 
ATOM   1217 C C   . LEU A 1 203 ? 16.734  55.199 25.258  1.00 37.73 ? 206 LEU A C   1 
ATOM   1218 O O   . LEU A 1 203 ? 15.630  55.146 25.804  1.00 38.59 ? 206 LEU A O   1 
ATOM   1219 C CB  . LEU A 1 203 ? 17.819  53.002 25.660  1.00 36.44 ? 206 LEU A CB  1 
ATOM   1220 C CG  . LEU A 1 203 ? 19.073  52.151 25.432  1.00 35.99 ? 206 LEU A CG  1 
ATOM   1221 C CD1 . LEU A 1 203 ? 20.311  52.835 25.933  1.00 37.91 ? 206 LEU A CD1 1 
ATOM   1222 C CD2 . LEU A 1 203 ? 18.890  50.792 26.079  1.00 35.74 ? 206 LEU A CD2 1 
ATOM   1223 N N   . GLN A 1 204 ? 16.949  55.883 24.133  1.00 36.91 ? 207 GLN A N   1 
ATOM   1224 C CA  . GLN A 1 204 ? 15.854  56.542 23.404  1.00 35.07 ? 207 GLN A CA  1 
ATOM   1225 C C   . GLN A 1 204 ? 15.239  55.409 22.588  1.00 33.99 ? 207 GLN A C   1 
ATOM   1226 O O   . GLN A 1 204 ? 15.978  54.594 22.031  1.00 31.84 ? 207 GLN A O   1 
ATOM   1227 C CB  . GLN A 1 204 ? 16.401  57.607 22.440  1.00 35.72 ? 207 GLN A CB  1 
ATOM   1228 C CG  . GLN A 1 204 ? 17.346  58.626 23.066  1.00 37.83 ? 207 GLN A CG  1 
ATOM   1229 C CD  . GLN A 1 204 ? 16.638  59.546 24.037  1.00 40.28 ? 207 GLN A CD  1 
ATOM   1230 O OE1 . GLN A 1 204 ? 15.548  60.065 23.738  1.00 40.65 ? 207 GLN A OE1 1 
ATOM   1231 N NE2 . GLN A 1 204 ? 17.236  59.745 25.219  1.00 39.13 ? 207 GLN A NE2 1 
ATOM   1232 N N   . LEU A 1 205 ? 13.911  55.327 22.542  1.00 34.44 ? 208 LEU A N   1 
ATOM   1233 C CA  . LEU A 1 205 ? 13.247  54.268 21.777  1.00 35.84 ? 208 LEU A CA  1 
ATOM   1234 C C   . LEU A 1 205 ? 13.709  54.203 20.308  1.00 36.84 ? 208 LEU A C   1 
ATOM   1235 O O   . LEU A 1 205 ? 13.913  53.119 19.761  1.00 36.32 ? 208 LEU A O   1 
ATOM   1236 C CB  . LEU A 1 205 ? 11.721  54.412 21.859  1.00 35.04 ? 208 LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 205 ? 11.093  54.081 23.223  1.00 35.67 ? 208 LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 205 ? 9.565   54.144 23.160  1.00 33.20 ? 208 LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 205 ? 11.553  52.700 23.679  1.00 34.07 ? 208 LEU A CD2 1 
ATOM   1240 N N   . MET A 1 206 ? 13.948  55.364 19.705  1.00 37.95 ? 209 MET A N   1 
ATOM   1241 C CA  . MET A 1 206 ? 14.395  55.452 18.320  1.00 40.00 ? 209 MET A CA  1 
ATOM   1242 C C   . MET A 1 206 ? 15.719  54.742 18.056  1.00 38.88 ? 209 MET A C   1 
ATOM   1243 O O   . MET A 1 206 ? 16.020  54.376 16.916  1.00 40.13 ? 209 MET A O   1 
ATOM   1244 C CB  . MET A 1 206 ? 14.508  56.917 17.897  1.00 43.43 ? 209 MET A CB  1 
ATOM   1245 C CG  . MET A 1 206 ? 13.187  57.661 17.915  1.00 47.78 ? 209 MET A CG  1 
ATOM   1246 S SD  . MET A 1 206 ? 13.346  59.415 17.538  1.00 57.61 ? 209 MET A SD  1 
ATOM   1247 C CE  . MET A 1 206 ? 15.139  59.736 17.896  1.00 53.95 ? 209 MET A CE  1 
ATOM   1248 N N   . ASN A 1 207 ? 16.504  54.554 19.110  1.00 36.81 ? 210 ASN A N   1 
ATOM   1249 C CA  . ASN A 1 207 ? 17.801  53.895 19.014  1.00 35.53 ? 210 ASN A CA  1 
ATOM   1250 C C   . ASN A 1 207 ? 17.729  52.372 19.020  1.00 33.54 ? 210 ASN A C   1 
ATOM   1251 O O   . ASN A 1 207 ? 18.698  51.713 18.680  1.00 32.85 ? 210 ASN A O   1 
ATOM   1252 C CB  . ASN A 1 207 ? 18.711  54.365 20.147  1.00 39.52 ? 210 ASN A CB  1 
ATOM   1253 C CG  . ASN A 1 207 ? 19.030  55.840 20.057  1.00 43.42 ? 210 ASN A CG  1 
ATOM   1254 O OD1 . ASN A 1 207 ? 18.413  56.585 19.290  1.00 46.28 ? 210 ASN A OD1 1 
ATOM   1255 N ND2 . ASN A 1 207 ? 20.017  56.270 20.825  1.00 45.33 ? 210 ASN A ND2 1 
ATOM   1256 N N   . ILE A 1 208 ? 16.591  51.805 19.404  1.00 32.27 ? 211 ILE A N   1 
ATOM   1257 C CA  . ILE A 1 208 ? 16.476  50.348 19.426  1.00 33.48 ? 211 ILE A CA  1 
ATOM   1258 C C   . ILE A 1 208 ? 16.275  49.794 18.021  1.00 34.17 ? 211 ILE A C   1 
ATOM   1259 O O   . ILE A 1 208 ? 15.404  50.254 17.293  1.00 36.06 ? 211 ILE A O   1 
ATOM   1260 C CB  . ILE A 1 208 ? 15.302  49.863 20.326  1.00 33.01 ? 211 ILE A CB  1 
ATOM   1261 C CG1 . ILE A 1 208 ? 15.427  50.479 21.724  1.00 33.49 ? 211 ILE A CG1 1 
ATOM   1262 C CG2 . ILE A 1 208 ? 15.298  48.337 20.418  1.00 30.33 ? 211 ILE A CG2 1 
ATOM   1263 C CD1 . ILE A 1 208 ? 14.294  50.135 22.662  1.00 33.47 ? 211 ILE A CD1 1 
ATOM   1264 N N   . ARG A 1 209 ? 17.120  48.856 17.615  1.00 33.81 ? 212 ARG A N   1 
ATOM   1265 C CA  . ARG A 1 209 ? 16.961  48.237 16.308  1.00 34.86 ? 212 ARG A CA  1 
ATOM   1266 C C   . ARG A 1 209 ? 15.888  47.152 16.396  1.00 35.74 ? 212 ARG A C   1 
ATOM   1267 O O   . ARG A 1 209 ? 14.975  47.105 15.578  1.00 36.74 ? 212 ARG A O   1 
ATOM   1268 C CB  . ARG A 1 209 ? 18.284  47.657 15.798  1.00 34.69 ? 212 ARG A CB  1 
ATOM   1269 C CG  . ARG A 1 209 ? 19.195  48.694 15.170  1.00 35.01 ? 212 ARG A CG  1 
ATOM   1270 C CD  . ARG A 1 209 ? 20.400  48.063 14.507  1.00 37.34 ? 212 ARG A CD  1 
ATOM   1271 N NE  . ARG A 1 209 ? 20.013  46.902 13.710  1.00 37.92 ? 212 ARG A NE  1 
ATOM   1272 C CZ  . ARG A 1 209 ? 20.051  46.837 12.382  1.00 34.70 ? 212 ARG A CZ  1 
ATOM   1273 N NH1 . ARG A 1 209 ? 20.458  47.870 11.655  1.00 31.38 ? 212 ARG A NH1 1 
ATOM   1274 N NH2 . ARG A 1 209 ? 19.687  45.712 11.788  1.00 34.77 ? 212 ARG A NH2 1 
ATOM   1275 N N   . ARG A 1 210 ? 15.984  46.300 17.410  1.00 35.90 ? 213 ARG A N   1 
ATOM   1276 C CA  . ARG A 1 210 ? 15.003  45.243 17.583  1.00 36.54 ? 213 ARG A CA  1 
ATOM   1277 C C   . ARG A 1 210 ? 15.039  44.656 18.988  1.00 36.67 ? 213 ARG A C   1 
ATOM   1278 O O   . ARG A 1 210 ? 16.064  44.683 19.668  1.00 35.98 ? 213 ARG A O   1 
ATOM   1279 C CB  . ARG A 1 210 ? 15.229  44.123 16.567  1.00 36.41 ? 213 ARG A CB  1 
ATOM   1280 C CG  . ARG A 1 210 ? 16.425  43.269 16.884  1.00 41.31 ? 213 ARG A CG  1 
ATOM   1281 C CD  . ARG A 1 210 ? 16.615  42.136 15.907  1.00 44.73 ? 213 ARG A CD  1 
ATOM   1282 N NE  . ARG A 1 210 ? 15.555  41.136 15.967  1.00 46.26 ? 213 ARG A NE  1 
ATOM   1283 C CZ  . ARG A 1 210 ? 15.777  39.827 15.896  1.00 48.31 ? 213 ARG A CZ  1 
ATOM   1284 N NH1 . ARG A 1 210 ? 17.017  39.364 15.779  1.00 49.12 ? 213 ARG A NH1 1 
ATOM   1285 N NH2 . ARG A 1 210 ? 14.762  38.978 15.888  1.00 47.78 ? 213 ARG A NH2 1 
ATOM   1286 N N   . CYS A 1 211 ? 13.902  44.129 19.416  1.00 36.17 ? 214 CYS A N   1 
ATOM   1287 C CA  . CYS A 1 211 ? 13.786  43.503 20.720  1.00 35.95 ? 214 CYS A CA  1 
ATOM   1288 C C   . CYS A 1 211 ? 13.024  42.207 20.483  1.00 36.02 ? 214 CYS A C   1 
ATOM   1289 O O   . CYS A 1 211 ? 12.286  42.090 19.498  1.00 36.56 ? 214 CYS A O   1 
ATOM   1290 C CB  . CYS A 1 211 ? 13.029  44.412 21.694  1.00 34.70 ? 214 CYS A CB  1 
ATOM   1291 S SG  . CYS A 1 211 ? 11.317  44.715 21.267  1.00 33.34 ? 214 CYS A SG  1 
ATOM   1292 N N   . GLY A 1 212 ? 13.233  41.229 21.357  1.00 35.35 ? 215 GLY A N   1 
ATOM   1293 C CA  . GLY A 1 212 ? 12.561  39.957 21.205  1.00 34.04 ? 215 GLY A CA  1 
ATOM   1294 C C   . GLY A 1 212 ? 12.693  39.116 22.449  1.00 34.83 ? 215 GLY A C   1 
ATOM   1295 O O   . GLY A 1 212 ? 13.304  39.547 23.432  1.00 32.94 ? 215 GLY A O   1 
ATOM   1296 N N   . HIS A 1 213 ? 12.130  37.913 22.408  1.00 35.47 ? 216 HIS A N   1 
ATOM   1297 C CA  . HIS A 1 213 ? 12.198  37.026 23.551  1.00 37.31 ? 216 HIS A CA  1 
ATOM   1298 C C   . HIS A 1 213 ? 12.441  35.592 23.140  1.00 38.03 ? 216 HIS A C   1 
ATOM   1299 O O   . HIS A 1 213 ? 12.122  35.189 22.031  1.00 37.91 ? 216 HIS A O   1 
ATOM   1300 C CB  . HIS A 1 213 ? 10.914  37.115 24.373  1.00 37.90 ? 216 HIS A CB  1 
ATOM   1301 C CG  . HIS A 1 213 ? 9.694   36.641 23.647  1.00 40.15 ? 216 HIS A CG  1 
ATOM   1302 N ND1 . HIS A 1 213 ? 9.060   37.395 22.678  1.00 40.35 ? 216 HIS A ND1 1 
ATOM   1303 C CD2 . HIS A 1 213 ? 8.960   35.509 23.780  1.00 41.34 ? 216 HIS A CD2 1 
ATOM   1304 C CE1 . HIS A 1 213 ? 7.988   36.751 22.250  1.00 41.15 ? 216 HIS A CE1 1 
ATOM   1305 N NE2 . HIS A 1 213 ? 7.906   35.603 22.902  1.00 42.81 ? 216 HIS A NE2 1 
ATOM   1306 N N   . SER A 1 214 ? 13.027  34.831 24.047  1.00 38.75 ? 217 SER A N   1 
ATOM   1307 C CA  . SER A 1 214 ? 13.301  33.423 23.831  1.00 40.53 ? 217 SER A CA  1 
ATOM   1308 C C   . SER A 1 214 ? 13.136  32.811 25.209  1.00 41.96 ? 217 SER A C   1 
ATOM   1309 O O   . SER A 1 214 ? 13.874  33.156 26.136  1.00 43.53 ? 217 SER A O   1 
ATOM   1310 C CB  . SER A 1 214 ? 14.732  33.215 23.331  1.00 41.51 ? 217 SER A CB  1 
ATOM   1311 O OG  . SER A 1 214 ? 15.045  31.831 23.264  1.00 42.94 ? 217 SER A OG  1 
ATOM   1312 N N   . GLU A 1 215 ? 12.153  31.927 25.349  1.00 42.15 ? 218 GLU A N   1 
ATOM   1313 C CA  . GLU A 1 215 ? 11.870  31.288 26.633  1.00 43.01 ? 218 GLU A CA  1 
ATOM   1314 C C   . GLU A 1 215 ? 11.574  32.406 27.642  1.00 41.97 ? 218 GLU A C   1 
ATOM   1315 O O   . GLU A 1 215 ? 10.742  33.276 27.372  1.00 42.05 ? 218 GLU A O   1 
ATOM   1316 C CB  . GLU A 1 215 ? 13.061  30.437 27.094  1.00 46.47 ? 218 GLU A CB  1 
ATOM   1317 C CG  . GLU A 1 215 ? 13.524  29.388 26.100  1.00 52.25 ? 218 GLU A CG  1 
ATOM   1318 C CD  . GLU A 1 215 ? 14.999  29.053 26.275  1.00 56.98 ? 218 GLU A CD  1 
ATOM   1319 O OE1 . GLU A 1 215 ? 15.845  29.979 26.172  1.00 59.58 ? 218 GLU A OE1 1 
ATOM   1320 O OE2 . GLU A 1 215 ? 15.314  27.865 26.515  1.00 59.28 ? 218 GLU A OE2 1 
ATOM   1321 N N   . ASN A 1 216 ? 12.276  32.416 28.770  1.00 40.06 ? 219 ASN A N   1 
ATOM   1322 C CA  . ASN A 1 216 ? 12.061  33.446 29.772  1.00 39.14 ? 219 ASN A CA  1 
ATOM   1323 C C   . ASN A 1 216 ? 13.112  34.538 29.658  1.00 37.96 ? 219 ASN A C   1 
ATOM   1324 O O   . ASN A 1 216 ? 13.490  35.153 30.661  1.00 36.94 ? 219 ASN A O   1 
ATOM   1325 C CB  . ASN A 1 216 ? 12.038  32.842 31.186  1.00 39.71 ? 219 ASN A CB  1 
ATOM   1326 C CG  . ASN A 1 216 ? 13.381  32.299 31.618  1.00 39.47 ? 219 ASN A CG  1 
ATOM   1327 O OD1 . ASN A 1 216 ? 14.001  31.503 30.920  1.00 40.13 ? 219 ASN A OD1 1 
ATOM   1328 N ND2 . ASN A 1 216 ? 13.835  32.725 32.782  1.00 41.45 ? 219 ASN A ND2 1 
ATOM   1329 N N   . PHE A 1 217 ? 13.585  34.771 28.433  1.00 36.03 ? 220 PHE A N   1 
ATOM   1330 C CA  . PHE A 1 217 ? 14.590  35.807 28.180  1.00 35.61 ? 220 PHE A CA  1 
ATOM   1331 C C   . PHE A 1 217 ? 14.046  36.900 27.292  1.00 34.06 ? 220 PHE A C   1 
ATOM   1332 O O   . PHE A 1 217 ? 13.157  36.663 26.484  1.00 34.95 ? 220 PHE A O   1 
ATOM   1333 C CB  . PHE A 1 217 ? 15.857  35.221 27.553  1.00 36.73 ? 220 PHE A CB  1 
ATOM   1334 C CG  . PHE A 1 217 ? 16.651  34.374 28.498  1.00 39.93 ? 220 PHE A CG  1 
ATOM   1335 C CD1 . PHE A 1 217 ? 16.391  33.009 28.617  1.00 40.63 ? 220 PHE A CD1 1 
ATOM   1336 C CD2 . PHE A 1 217 ? 17.638  34.946 29.299  1.00 40.39 ? 220 PHE A CD2 1 
ATOM   1337 C CE1 . PHE A 1 217 ? 17.102  32.226 29.525  1.00 41.53 ? 220 PHE A CE1 1 
ATOM   1338 C CE2 . PHE A 1 217 ? 18.355  34.174 30.208  1.00 41.02 ? 220 PHE A CE2 1 
ATOM   1339 C CZ  . PHE A 1 217 ? 18.086  32.812 30.322  1.00 41.10 ? 220 PHE A CZ  1 
ATOM   1340 N N   . PHE A 1 218 ? 14.593  38.099 27.444  1.00 32.48 ? 221 PHE A N   1 
ATOM   1341 C CA  . PHE A 1 218 ? 14.178  39.243 26.652  1.00 30.68 ? 221 PHE A CA  1 
ATOM   1342 C C   . PHE A 1 218 ? 15.403  40.075 26.295  1.00 31.94 ? 221 PHE A C   1 
ATOM   1343 O O   . PHE A 1 218 ? 16.211  40.429 27.154  1.00 31.29 ? 221 PHE A O   1 
ATOM   1344 C CB  . PHE A 1 218 ? 13.160  40.096 27.420  1.00 27.22 ? 221 PHE A CB  1 
ATOM   1345 C CG  . PHE A 1 218 ? 12.866  41.429 26.767  1.00 25.16 ? 221 PHE A CG  1 
ATOM   1346 C CD1 . PHE A 1 218 ? 12.155  41.495 25.567  1.00 25.01 ? 221 PHE A CD1 1 
ATOM   1347 C CD2 . PHE A 1 218 ? 13.306  42.614 27.343  1.00 23.91 ? 221 PHE A CD2 1 
ATOM   1348 C CE1 . PHE A 1 218 ? 11.891  42.723 24.954  1.00 24.19 ? 221 PHE A CE1 1 
ATOM   1349 C CE2 . PHE A 1 218 ? 13.047  43.833 26.747  1.00 25.24 ? 221 PHE A CE2 1 
ATOM   1350 C CZ  . PHE A 1 218 ? 12.337  43.889 25.545  1.00 25.05 ? 221 PHE A CZ  1 
ATOM   1351 N N   . PHE A 1 219 ? 15.540  40.409 25.022  1.00 32.74 ? 222 PHE A N   1 
ATOM   1352 C CA  . PHE A 1 219 ? 16.680  41.203 24.611  1.00 33.12 ? 222 PHE A CA  1 
ATOM   1353 C C   . PHE A 1 219 ? 16.283  42.505 23.918  1.00 32.56 ? 222 PHE A C   1 
ATOM   1354 O O   . PHE A 1 219 ? 15.160  42.678 23.435  1.00 31.72 ? 222 PHE A O   1 
ATOM   1355 C CB  . PHE A 1 219 ? 17.598  40.373 23.711  1.00 34.27 ? 222 PHE A CB  1 
ATOM   1356 C CG  . PHE A 1 219 ? 16.969  39.981 22.406  1.00 35.29 ? 222 PHE A CG  1 
ATOM   1357 C CD1 . PHE A 1 219 ? 17.093  40.807 21.286  1.00 36.55 ? 222 PHE A CD1 1 
ATOM   1358 C CD2 . PHE A 1 219 ? 16.227  38.814 22.303  1.00 33.68 ? 222 PHE A CD2 1 
ATOM   1359 C CE1 . PHE A 1 219 ? 16.486  40.477 20.091  1.00 36.84 ? 222 PHE A CE1 1 
ATOM   1360 C CE2 . PHE A 1 219 ? 15.619  38.476 21.110  1.00 34.77 ? 222 PHE A CE2 1 
ATOM   1361 C CZ  . PHE A 1 219 ? 15.746  39.311 19.997  1.00 35.67 ? 222 PHE A CZ  1 
ATOM   1362 N N   . ILE A 1 220 ? 17.232  43.426 23.900  1.00 33.20 ? 223 ILE A N   1 
ATOM   1363 C CA  . ILE A 1 220 ? 17.061  44.714 23.270  1.00 32.76 ? 223 ILE A CA  1 
ATOM   1364 C C   . ILE A 1 220 ? 18.389  44.979 22.585  1.00 32.42 ? 223 ILE A C   1 
ATOM   1365 O O   . ILE A 1 220 ? 19.428  45.045 23.241  1.00 31.31 ? 223 ILE A O   1 
ATOM   1366 C CB  . ILE A 1 220 ? 16.812  45.845 24.303  1.00 33.24 ? 223 ILE A CB  1 
ATOM   1367 C CG1 . ILE A 1 220 ? 15.453  45.669 24.977  1.00 33.69 ? 223 ILE A CG1 1 
ATOM   1368 C CG2 . ILE A 1 220 ? 16.876  47.207 23.622  1.00 32.01 ? 223 ILE A CG2 1 
ATOM   1369 C CD1 . ILE A 1 220 ? 15.032  46.852 25.857  1.00 35.04 ? 223 ILE A CD1 1 
ATOM   1370 N N   . GLU A 1 221 ? 18.359  45.028 21.258  1.00 33.09 ? 224 GLU A N   1 
ATOM   1371 C CA  . GLU A 1 221 ? 19.545  45.326 20.471  1.00 32.97 ? 224 GLU A CA  1 
ATOM   1372 C C   . GLU A 1 221 ? 19.395  46.776 20.068  1.00 31.75 ? 224 GLU A C   1 
ATOM   1373 O O   . GLU A 1 221 ? 18.421  47.129 19.429  1.00 32.49 ? 224 GLU A O   1 
ATOM   1374 C CB  . GLU A 1 221 ? 19.594  44.465 19.215  1.00 34.01 ? 224 GLU A CB  1 
ATOM   1375 C CG  . GLU A 1 221 ? 20.741  44.811 18.277  1.00 35.25 ? 224 GLU A CG  1 
ATOM   1376 C CD  . GLU A 1 221 ? 20.521  44.302 16.861  1.00 36.04 ? 224 GLU A CD  1 
ATOM   1377 O OE1 . GLU A 1 221 ? 19.731  43.346 16.678  1.00 36.40 ? 224 GLU A OE1 1 
ATOM   1378 O OE2 . GLU A 1 221 ? 21.139  44.863 15.929  1.00 36.20 ? 224 GLU A OE2 1 
ATOM   1379 N N   . VAL A 1 222 ? 20.312  47.625 20.507  1.00 31.25 ? 225 VAL A N   1 
ATOM   1380 C CA  . VAL A 1 222 ? 20.268  49.039 20.152  1.00 32.24 ? 225 VAL A CA  1 
ATOM   1381 C C   . VAL A 1 222 ? 21.163  49.335 18.935  1.00 33.10 ? 225 VAL A C   1 
ATOM   1382 O O   . VAL A 1 222 ? 22.011  48.526 18.559  1.00 33.48 ? 225 VAL A O   1 
ATOM   1383 C CB  . VAL A 1 222 ? 20.665  49.932 21.356  1.00 32.77 ? 225 VAL A CB  1 
ATOM   1384 C CG1 . VAL A 1 222 ? 19.655  49.774 22.478  1.00 32.46 ? 225 VAL A CG1 1 
ATOM   1385 C CG2 . VAL A 1 222 ? 22.062  49.582 21.845  1.00 33.32 ? 225 VAL A CG2 1 
ATOM   1386 N N   . GLY A 1 223 ? 20.987  50.505 18.334  1.00 35.28 ? 226 GLY A N   1 
ATOM   1387 C CA  . GLY A 1 223 ? 21.767  50.864 17.158  1.00 37.30 ? 226 GLY A CA  1 
ATOM   1388 C C   . GLY A 1 223 ? 22.993  51.701 17.470  1.00 39.39 ? 226 GLY A C   1 
ATOM   1389 O O   . GLY A 1 223 ? 23.291  51.957 18.642  1.00 39.74 ? 226 GLY A O   1 
ATOM   1390 N N   . ARG A 1 224 ? 23.693  52.147 16.426  1.00 40.10 ? 227 ARG A N   1 
ATOM   1391 C CA  . ARG A 1 224 ? 24.900  52.956 16.601  1.00 41.64 ? 227 ARG A CA  1 
ATOM   1392 C C   . ARG A 1 224 ? 24.630  54.283 17.296  1.00 42.18 ? 227 ARG A C   1 
ATOM   1393 O O   . ARG A 1 224 ? 25.467  54.762 18.059  1.00 42.66 ? 227 ARG A O   1 
ATOM   1394 C CB  . ARG A 1 224 ? 25.606  53.230 15.264  1.00 42.02 ? 227 ARG A CB  1 
ATOM   1395 C CG  . ARG A 1 224 ? 26.198  52.012 14.564  1.00 42.71 ? 227 ARG A CG  1 
ATOM   1396 C CD  . ARG A 1 224 ? 27.108  52.447 13.415  1.00 43.92 ? 227 ARG A CD  1 
ATOM   1397 N NE  . ARG A 1 224 ? 26.491  53.483 12.585  1.00 45.29 ? 227 ARG A NE  1 
ATOM   1398 C CZ  . ARG A 1 224 ? 27.111  54.176 11.631  1.00 45.52 ? 227 ARG A CZ  1 
ATOM   1399 N NH1 . ARG A 1 224 ? 28.391  53.961 11.349  1.00 45.23 ? 227 ARG A NH1 1 
ATOM   1400 N NH2 . ARG A 1 224 ? 26.443  55.110 10.964  1.00 45.77 ? 227 ARG A NH2 1 
ATOM   1401 N N   . SER A 1 225 ? 23.467  54.874 17.041  1.00 43.18 ? 228 SER A N   1 
ATOM   1402 C CA  . SER A 1 225 ? 23.123  56.152 17.657  1.00 44.77 ? 228 SER A CA  1 
ATOM   1403 C C   . SER A 1 225 ? 22.896  56.036 19.165  1.00 45.56 ? 228 SER A C   1 
ATOM   1404 O O   . SER A 1 225 ? 22.682  57.033 19.848  1.00 45.77 ? 228 SER A O   1 
ATOM   1405 C CB  . SER A 1 225 ? 21.897  56.756 16.988  1.00 44.65 ? 228 SER A CB  1 
ATOM   1406 O OG  . SER A 1 225 ? 20.760  55.978 17.276  1.00 47.55 ? 228 SER A OG  1 
ATOM   1407 N N   . ALA A 1 226 ? 22.944  54.813 19.682  1.00 46.05 ? 229 ALA A N   1 
ATOM   1408 C CA  . ALA A 1 226 ? 22.758  54.583 21.110  1.00 45.48 ? 229 ALA A CA  1 
ATOM   1409 C C   . ALA A 1 226 ? 23.899  55.186 21.915  1.00 44.78 ? 229 ALA A C   1 
ATOM   1410 O O   . ALA A 1 226 ? 25.062  55.150 21.504  1.00 41.77 ? 229 ALA A O   1 
ATOM   1411 C CB  . ALA A 1 226 ? 22.640  53.084 21.408  1.00 46.25 ? 229 ALA A CB  1 
ATOM   1412 N N   . VAL A 1 227 ? 23.541  55.726 23.075  1.00 45.12 ? 230 VAL A N   1 
ATOM   1413 C CA  . VAL A 1 227 ? 24.489  56.343 23.996  1.00 44.69 ? 230 VAL A CA  1 
ATOM   1414 C C   . VAL A 1 227 ? 25.537  55.310 24.459  1.00 43.95 ? 230 VAL A C   1 
ATOM   1415 O O   . VAL A 1 227 ? 26.646  55.664 24.852  1.00 45.03 ? 230 VAL A O   1 
ATOM   1416 C CB  . VAL A 1 227 ? 23.724  56.945 25.208  1.00 45.19 ? 230 VAL A CB  1 
ATOM   1417 C CG1 . VAL A 1 227 ? 23.156  55.834 26.100  1.00 43.87 ? 230 VAL A CG1 1 
ATOM   1418 C CG2 . VAL A 1 227 ? 24.606  57.907 25.978  1.00 46.70 ? 230 VAL A CG2 1 
ATOM   1419 N N   . THR A 1 228 ? 25.182  54.034 24.356  1.00 43.05 ? 231 THR A N   1 
ATOM   1420 C CA  . THR A 1 228 ? 26.049  52.926 24.732  1.00 42.14 ? 231 THR A CA  1 
ATOM   1421 C C   . THR A 1 228 ? 26.767  52.316 23.532  1.00 42.60 ? 231 THR A C   1 
ATOM   1422 O O   . THR A 1 228 ? 27.571  51.401 23.696  1.00 43.02 ? 231 THR A O   1 
ATOM   1423 C CB  . THR A 1 228 ? 25.219  51.783 25.330  1.00 42.33 ? 231 THR A CB  1 
ATOM   1424 O OG1 . THR A 1 228 ? 24.237  51.367 24.373  1.00 42.62 ? 231 THR A OG1 1 
ATOM   1425 C CG2 . THR A 1 228 ? 24.506  52.229 26.594  1.00 42.86 ? 231 THR A CG2 1 
ATOM   1426 N N   . GLY A 1 229 ? 26.460  52.807 22.329  1.00 43.55 ? 232 GLY A N   1 
ATOM   1427 C CA  . GLY A 1 229 ? 27.038  52.246 21.114  1.00 42.48 ? 232 GLY A CA  1 
ATOM   1428 C C   . GLY A 1 229 ? 26.129  51.096 20.691  1.00 41.46 ? 232 GLY A C   1 
ATOM   1429 O O   . GLY A 1 229 ? 25.084  50.887 21.319  1.00 42.84 ? 232 GLY A O   1 
ATOM   1430 N N   . PRO A 1 230 ? 26.451  50.351 19.623  1.00 39.58 ? 233 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 230 ? 25.559  49.250 19.245  1.00 38.21 ? 233 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 230 ? 25.810  48.032 20.128  1.00 37.57 ? 233 PRO A C   1 
ATOM   1433 O O   . PRO A 1 230 ? 26.860  47.920 20.760  1.00 38.40 ? 233 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 230 ? 25.952  48.982 17.797  1.00 37.53 ? 233 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 230 ? 27.418  49.230 17.817  1.00 37.68 ? 233 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 230 ? 27.531  50.514 18.635  1.00 38.92 ? 233 PRO A CD  1 
ATOM   1437 N N   . GLY A 1 231 ? 24.846  47.123 20.173  1.00 36.59 ? 234 GLY A N   1 
ATOM   1438 C CA  . GLY A 1 231 ? 24.987  45.931 20.983  1.00 35.84 ? 234 GLY A CA  1 
ATOM   1439 C C   . GLY A 1 231 ? 23.652  45.558 21.591  1.00 36.51 ? 234 GLY A C   1 
ATOM   1440 O O   . GLY A 1 231 ? 22.659  46.272 21.423  1.00 35.92 ? 234 GLY A O   1 
ATOM   1441 N N   . GLU A 1 232 ? 23.634  44.466 22.347  1.00 36.82 ? 235 GLU A N   1 
ATOM   1442 C CA  . GLU A 1 232 ? 22.401  44.006 22.967  1.00 37.83 ? 235 GLU A CA  1 
ATOM   1443 C C   . GLU A 1 232 ? 22.412  43.671 24.472  1.00 37.09 ? 235 GLU A C   1 
ATOM   1444 O O   . GLU A 1 232 ? 23.355  43.073 25.009  1.00 37.65 ? 235 GLU A O   1 
ATOM   1445 C CB  . GLU A 1 232 ? 21.848  42.829 22.169  1.00 39.05 ? 235 GLU A CB  1 
ATOM   1446 C CG  . GLU A 1 232 ? 22.896  41.822 21.764  1.00 42.29 ? 235 GLU A CG  1 
ATOM   1447 C CD  . GLU A 1 232 ? 22.335  40.714 20.902  1.00 45.60 ? 235 GLU A CD  1 
ATOM   1448 O OE1 . GLU A 1 232 ? 22.691  39.542 21.143  1.00 44.94 ? 235 GLU A OE1 1 
ATOM   1449 O OE2 . GLU A 1 232 ? 21.549  41.006 19.974  1.00 50.52 ? 235 GLU A OE2 1 
ATOM   1450 N N   . PHE A 1 233 ? 21.349  44.099 25.142  1.00 35.41 ? 236 PHE A N   1 
ATOM   1451 C CA  . PHE A 1 233 ? 21.153  43.841 26.557  1.00 32.80 ? 236 PHE A CA  1 
ATOM   1452 C C   . PHE A 1 233 ? 20.291  42.591 26.696  1.00 31.90 ? 236 PHE A C   1 
ATOM   1453 O O   . PHE A 1 233 ? 19.204  42.512 26.119  1.00 30.44 ? 236 PHE A O   1 
ATOM   1454 C CB  . PHE A 1 233 ? 20.421  45.009 27.214  1.00 31.19 ? 236 PHE A CB  1 
ATOM   1455 C CG  . PHE A 1 233 ? 21.219  46.278 27.282  1.00 32.20 ? 236 PHE A CG  1 
ATOM   1456 C CD1 . PHE A 1 233 ? 22.266  46.413 28.200  1.00 32.89 ? 236 PHE A CD1 1 
ATOM   1457 C CD2 . PHE A 1 233 ? 20.919  47.353 26.439  1.00 31.84 ? 236 PHE A CD2 1 
ATOM   1458 C CE1 . PHE A 1 233 ? 23.005  47.608 28.278  1.00 35.39 ? 236 PHE A CE1 1 
ATOM   1459 C CE2 . PHE A 1 233 ? 21.649  48.551 26.509  1.00 33.02 ? 236 PHE A CE2 1 
ATOM   1460 C CZ  . PHE A 1 233 ? 22.691  48.677 27.425  1.00 34.23 ? 236 PHE A CZ  1 
ATOM   1461 N N   . TRP A 1 234 ? 20.795  41.586 27.400  1.00 31.85 ? 237 TRP A N   1 
ATOM   1462 C CA  . TRP A 1 234 ? 20.028  40.372 27.635  1.00 33.78 ? 237 TRP A CA  1 
ATOM   1463 C C   . TRP A 1 234 ? 19.531  40.367 29.065  1.00 34.83 ? 237 TRP A C   1 
ATOM   1464 O O   . TRP A 1 234 ? 20.286  40.630 29.987  1.00 35.24 ? 237 TRP A O   1 
ATOM   1465 C CB  . TRP A 1 234 ? 20.862  39.129 27.364  1.00 35.41 ? 237 TRP A CB  1 
ATOM   1466 C CG  . TRP A 1 234 ? 20.931  38.847 25.912  1.00 36.08 ? 237 TRP A CG  1 
ATOM   1467 C CD1 . TRP A 1 234 ? 21.765  39.436 25.007  1.00 35.97 ? 237 TRP A CD1 1 
ATOM   1468 C CD2 . TRP A 1 234 ? 20.066  37.986 25.165  1.00 35.16 ? 237 TRP A CD2 1 
ATOM   1469 N NE1 . TRP A 1 234 ? 21.463  39.006 23.743  1.00 38.27 ? 237 TRP A NE1 1 
ATOM   1470 C CE2 . TRP A 1 234 ? 20.425  38.112 23.806  1.00 36.68 ? 237 TRP A CE2 1 
ATOM   1471 C CE3 . TRP A 1 234 ? 19.017  37.122 25.511  1.00 34.59 ? 237 TRP A CE3 1 
ATOM   1472 C CZ2 . TRP A 1 234 ? 19.773  37.410 22.786  1.00 35.85 ? 237 TRP A CZ2 1 
ATOM   1473 C CZ3 . TRP A 1 234 ? 18.363  36.421 24.498  1.00 34.67 ? 237 TRP A CZ3 1 
ATOM   1474 C CH2 . TRP A 1 234 ? 18.746  36.570 23.152  1.00 36.20 ? 237 TRP A CH2 1 
ATOM   1475 N N   . MET A 1 235 ? 18.247  40.113 29.252  1.00 35.26 ? 238 MET A N   1 
ATOM   1476 C CA  . MET A 1 235 ? 17.711  40.099 30.592  1.00 35.75 ? 238 MET A CA  1 
ATOM   1477 C C   . MET A 1 235 ? 16.718  38.975 30.819  1.00 35.73 ? 238 MET A C   1 
ATOM   1478 O O   . MET A 1 235 ? 15.861  38.707 29.977  1.00 35.31 ? 238 MET A O   1 
ATOM   1479 C CB  . MET A 1 235 ? 17.115  41.459 30.940  1.00 35.23 ? 238 MET A CB  1 
ATOM   1480 C CG  . MET A 1 235 ? 15.995  41.903 30.068  1.00 34.86 ? 238 MET A CG  1 
ATOM   1481 S SD  . MET A 1 235 ? 15.945  43.691 30.061  1.00 36.60 ? 238 MET A SD  1 
ATOM   1482 C CE  . MET A 1 235 ? 16.618  44.036 28.408  1.00 33.95 ? 238 MET A CE  1 
ATOM   1483 N N   . GLN A 1 236 ? 16.873  38.303 31.960  1.00 35.92 ? 239 GLN A N   1 
ATOM   1484 C CA  . GLN A 1 236 ? 16.020  37.189 32.332  1.00 36.01 ? 239 GLN A CA  1 
ATOM   1485 C C   . GLN A 1 236 ? 14.860  37.653 33.201  1.00 36.09 ? 239 GLN A C   1 
ATOM   1486 O O   . GLN A 1 236 ? 14.995  38.578 33.999  1.00 36.77 ? 239 GLN A O   1 
ATOM   1487 C CB  . GLN A 1 236 ? 16.843  36.123 33.044  1.00 36.40 ? 239 GLN A CB  1 
ATOM   1488 C CG  . GLN A 1 236 ? 16.067  34.889 33.409  1.00 41.07 ? 239 GLN A CG  1 
ATOM   1489 C CD  . GLN A 1 236 ? 16.941  33.810 34.007  1.00 44.46 ? 239 GLN A CD  1 
ATOM   1490 O OE1 . GLN A 1 236 ? 17.496  33.966 35.101  1.00 45.84 ? 239 GLN A OE1 1 
ATOM   1491 N NE2 . GLN A 1 236 ? 17.070  32.698 33.288  1.00 46.93 ? 239 GLN A NE2 1 
ATOM   1492 N N   . VAL A 1 237 ? 13.714  37.006 33.012  1.00 36.10 ? 240 VAL A N   1 
ATOM   1493 C CA  . VAL A 1 237 ? 12.487  37.321 33.740  1.00 35.20 ? 240 VAL A CA  1 
ATOM   1494 C C   . VAL A 1 237 ? 11.899  36.037 34.316  1.00 35.21 ? 240 VAL A C   1 
ATOM   1495 O O   . VAL A 1 237 ? 12.418  34.945 34.062  1.00 32.95 ? 240 VAL A O   1 
ATOM   1496 C CB  . VAL A 1 237 ? 11.438  38.019 32.825  1.00 35.33 ? 240 VAL A CB  1 
ATOM   1497 C CG1 . VAL A 1 237 ? 11.963  39.375 32.359  1.00 35.10 ? 240 VAL A CG1 1 
ATOM   1498 C CG2 . VAL A 1 237 ? 11.092  37.134 31.624  1.00 33.81 ? 240 VAL A CG2 1 
ATOM   1499 N N   . ASP A 1 238 ? 10.797  36.167 35.056  1.00 35.65 ? 241 ASP A N   1 
ATOM   1500 C CA  . ASP A 1 238 ? 10.178  35.008 35.697  1.00 37.69 ? 241 ASP A CA  1 
ATOM   1501 C C   . ASP A 1 238 ? 9.827   33.867 34.764  1.00 37.39 ? 241 ASP A C   1 
ATOM   1502 O O   . ASP A 1 238 ? 10.271  32.742 34.961  1.00 36.85 ? 241 ASP A O   1 
ATOM   1503 C CB  . ASP A 1 238 ? 8.991   35.428 36.564  1.00 40.64 ? 241 ASP A CB  1 
ATOM   1504 C CG  . ASP A 1 238 ? 9.430   36.177 37.821  1.00 43.43 ? 241 ASP A CG  1 
ATOM   1505 O OD1 . ASP A 1 238 ? 10.579  35.970 38.280  1.00 42.19 ? 241 ASP A OD1 1 
ATOM   1506 O OD2 . ASP A 1 238 ? 8.628   36.982 38.338  1.00 46.26 ? 241 ASP A OD2 1 
ATOM   1507 N N   . ASP A 1 239 ? 9.056   34.157 33.731  1.00 37.94 ? 242 ASP A N   1 
ATOM   1508 C CA  . ASP A 1 239 ? 8.710   33.136 32.770  1.00 37.66 ? 242 ASP A CA  1 
ATOM   1509 C C   . ASP A 1 239 ? 8.533   33.734 31.377  1.00 37.37 ? 242 ASP A C   1 
ATOM   1510 O O   . ASP A 1 239 ? 8.765   34.929 31.173  1.00 38.03 ? 242 ASP A O   1 
ATOM   1511 C CB  . ASP A 1 239 ? 7.478   32.354 33.227  1.00 37.41 ? 242 ASP A CB  1 
ATOM   1512 C CG  . ASP A 1 239 ? 6.311   33.238 33.557  1.00 38.38 ? 242 ASP A CG  1 
ATOM   1513 O OD1 . ASP A 1 239 ? 5.987   34.139 32.757  1.00 38.30 ? 242 ASP A OD1 1 
ATOM   1514 O OD2 . ASP A 1 239 ? 5.704   33.014 34.620  1.00 42.94 ? 242 ASP A OD2 1 
ATOM   1515 N N   . SER A 1 240 ? 8.182   32.879 30.420  1.00 36.26 ? 243 SER A N   1 
ATOM   1516 C CA  . SER A 1 240 ? 7.977   33.271 29.033  1.00 34.89 ? 243 SER A CA  1 
ATOM   1517 C C   . SER A 1 240 ? 6.776   34.193 28.859  1.00 33.48 ? 243 SER A C   1 
ATOM   1518 O O   . SER A 1 240 ? 6.740   35.000 27.931  1.00 33.15 ? 243 SER A O   1 
ATOM   1519 C CB  . SER A 1 240 ? 7.813   32.022 28.173  1.00 36.01 ? 243 SER A CB  1 
ATOM   1520 O OG  . SER A 1 240 ? 6.888   31.126 28.767  1.00 38.61 ? 243 SER A OG  1 
ATOM   1521 N N   . VAL A 1 241 ? 5.791   34.075 29.746  1.00 32.77 ? 244 VAL A N   1 
ATOM   1522 C CA  . VAL A 1 241 ? 4.610   34.930 29.669  1.00 31.49 ? 244 VAL A CA  1 
ATOM   1523 C C   . VAL A 1 241 ? 5.019   36.387 29.866  1.00 30.07 ? 244 VAL A C   1 
ATOM   1524 O O   . VAL A 1 241 ? 4.548   37.258 29.149  1.00 31.57 ? 244 VAL A O   1 
ATOM   1525 C CB  . VAL A 1 241 ? 3.536   34.512 30.702  1.00 31.17 ? 244 VAL A CB  1 
ATOM   1526 C CG1 . VAL A 1 241 ? 2.367   35.485 30.703  1.00 29.91 ? 244 VAL A CG1 1 
ATOM   1527 C CG2 . VAL A 1 241 ? 3.043   33.129 30.375  1.00 31.16 ? 244 VAL A CG2 1 
ATOM   1528 N N   . VAL A 1 242 ? 5.941   36.640 30.794  1.00 28.03 ? 245 VAL A N   1 
ATOM   1529 C CA  . VAL A 1 242 ? 6.392   38.005 31.032  1.00 27.38 ? 245 VAL A CA  1 
ATOM   1530 C C   . VAL A 1 242 ? 7.373   38.539 29.981  1.00 26.75 ? 245 VAL A C   1 
ATOM   1531 O O   . VAL A 1 242 ? 7.342   39.723 29.667  1.00 25.75 ? 245 VAL A O   1 
ATOM   1532 C CB  . VAL A 1 242 ? 6.885   38.230 32.510  1.00 27.59 ? 245 VAL A CB  1 
ATOM   1533 C CG1 . VAL A 1 242 ? 7.620   37.040 33.012  1.00 28.72 ? 245 VAL A CG1 1 
ATOM   1534 C CG2 . VAL A 1 242 ? 7.760   39.488 32.619  1.00 25.86 ? 245 VAL A CG2 1 
ATOM   1535 N N   . ALA A 1 243 ? 8.206   37.669 29.417  1.00 27.31 ? 246 ALA A N   1 
ATOM   1536 C CA  . ALA A 1 243 ? 9.166   38.066 28.372  1.00 27.61 ? 246 ALA A CA  1 
ATOM   1537 C C   . ALA A 1 243 ? 8.412   38.468 27.099  1.00 29.01 ? 246 ALA A C   1 
ATOM   1538 O O   . ALA A 1 243 ? 8.698   39.501 26.472  1.00 28.95 ? 246 ALA A O   1 
ATOM   1539 C CB  . ALA A 1 243 ? 10.117  36.918 28.070  1.00 26.71 ? 246 ALA A CB  1 
ATOM   1540 N N   . GLN A 1 244 ? 7.435   37.643 26.736  1.00 31.62 ? 247 GLN A N   1 
ATOM   1541 C CA  . GLN A 1 244 ? 6.611   37.901 25.570  1.00 34.62 ? 247 GLN A CA  1 
ATOM   1542 C C   . GLN A 1 244 ? 5.897   39.236 25.732  1.00 34.42 ? 247 GLN A C   1 
ATOM   1543 O O   . GLN A 1 244 ? 5.883   40.065 24.824  1.00 35.76 ? 247 GLN A O   1 
ATOM   1544 C CB  . GLN A 1 244 ? 5.586   36.790 25.403  1.00 37.76 ? 247 GLN A CB  1 
ATOM   1545 C CG  . GLN A 1 244 ? 4.542   37.074 24.349  1.00 43.52 ? 247 GLN A CG  1 
ATOM   1546 C CD  . GLN A 1 244 ? 3.542   35.947 24.224  1.00 49.25 ? 247 GLN A CD  1 
ATOM   1547 O OE1 . GLN A 1 244 ? 3.776   34.830 24.720  1.00 51.68 ? 247 GLN A OE1 1 
ATOM   1548 N NE2 . GLN A 1 244 ? 2.415   36.224 23.562  1.00 51.25 ? 247 GLN A NE2 1 
ATOM   1549 N N   . ASN A 1 245 ? 5.341   39.450 26.914  1.00 34.53 ? 248 ASN A N   1 
ATOM   1550 C CA  . ASN A 1 245 ? 4.616   40.666 27.221  1.00 34.09 ? 248 ASN A CA  1 
ATOM   1551 C C   . ASN A 1 245 ? 5.478   41.925 27.172  1.00 33.66 ? 248 ASN A C   1 
ATOM   1552 O O   . ASN A 1 245 ? 4.987   43.005 26.807  1.00 34.96 ? 248 ASN A O   1 
ATOM   1553 C CB  . ASN A 1 245 ? 3.977   40.545 28.594  1.00 37.79 ? 248 ASN A CB  1 
ATOM   1554 C CG  . ASN A 1 245 ? 2.982   41.622 28.844  1.00 40.74 ? 248 ASN A CG  1 
ATOM   1555 O OD1 . ASN A 1 245 ? 1.893   41.595 28.288  1.00 44.01 ? 248 ASN A OD1 1 
ATOM   1556 N ND2 . ASN A 1 245 ? 3.361   42.614 29.634  1.00 42.92 ? 248 ASN A ND2 1 
ATOM   1557 N N   . MET A 1 246 ? 6.736   41.812 27.606  1.00 31.03 ? 249 MET A N   1 
ATOM   1558 C CA  . MET A 1 246 ? 7.639   42.964 27.579  1.00 30.06 ? 249 MET A CA  1 
ATOM   1559 C C   . MET A 1 246 ? 7.851   43.277 26.123  1.00 30.99 ? 249 MET A C   1 
ATOM   1560 O O   . MET A 1 246 ? 7.705   44.424 25.693  1.00 31.13 ? 249 MET A O   1 
ATOM   1561 C CB  . MET A 1 246 ? 8.989   42.644 28.207  1.00 26.85 ? 249 MET A CB  1 
ATOM   1562 C CG  . MET A 1 246 ? 8.919   42.363 29.679  1.00 26.87 ? 249 MET A CG  1 
ATOM   1563 S SD  . MET A 1 246 ? 10.537  42.018 30.321  1.00 28.76 ? 249 MET A SD  1 
ATOM   1564 C CE  . MET A 1 246 ? 11.228  43.721 30.343  1.00 20.63 ? 249 MET A CE  1 
ATOM   1565 N N   . HIS A 1 247 ? 8.164   42.220 25.371  1.00 31.92 ? 250 HIS A N   1 
ATOM   1566 C CA  . HIS A 1 247 ? 8.393   42.321 23.931  1.00 32.57 ? 250 HIS A CA  1 
ATOM   1567 C C   . HIS A 1 247 ? 7.254   43.101 23.264  1.00 31.85 ? 250 HIS A C   1 
ATOM   1568 O O   . HIS A 1 247 ? 7.497   44.155 22.686  1.00 29.97 ? 250 HIS A O   1 
ATOM   1569 C CB  . HIS A 1 247 ? 8.528   40.921 23.320  1.00 33.88 ? 250 HIS A CB  1 
ATOM   1570 C CG  . HIS A 1 247 ? 8.768   40.930 21.844  1.00 35.09 ? 250 HIS A CG  1 
ATOM   1571 N ND1 . HIS A 1 247 ? 9.153   42.061 21.157  1.00 36.91 ? 250 HIS A ND1 1 
ATOM   1572 C CD2 . HIS A 1 247 ? 8.656   39.950 20.918  1.00 35.64 ? 250 HIS A CD2 1 
ATOM   1573 C CE1 . HIS A 1 247 ? 9.264   41.779 19.872  1.00 36.10 ? 250 HIS A CE1 1 
ATOM   1574 N NE2 . HIS A 1 247 ? 8.969   40.505 19.700  1.00 36.28 ? 250 HIS A NE2 1 
ATOM   1575 N N   . GLU A 1 248 ? 6.020   42.614 23.415  1.00 31.78 ? 251 GLU A N   1 
ATOM   1576 C CA  . GLU A 1 248 ? 4.835   43.251 22.847  1.00 32.84 ? 251 GLU A CA  1 
ATOM   1577 C C   . GLU A 1 248 ? 4.702   44.708 23.256  1.00 32.34 ? 251 GLU A C   1 
ATOM   1578 O O   . GLU A 1 248 ? 4.677   45.611 22.410  1.00 33.86 ? 251 GLU A O   1 
ATOM   1579 C CB  . GLU A 1 248 ? 3.568   42.517 23.285  1.00 35.07 ? 251 GLU A CB  1 
ATOM   1580 C CG  . GLU A 1 248 ? 3.425   41.119 22.730  1.00 41.12 ? 251 GLU A CG  1 
ATOM   1581 C CD  . GLU A 1 248 ? 2.089   40.470 23.090  1.00 44.95 ? 251 GLU A CD  1 
ATOM   1582 O OE1 . GLU A 1 248 ? 2.063   39.228 23.296  1.00 46.28 ? 251 GLU A OE1 1 
ATOM   1583 O OE2 . GLU A 1 248 ? 1.064   41.197 23.153  1.00 46.37 ? 251 GLU A OE2 1 
ATOM   1584 N N   . THR A 1 249 ? 4.617   44.927 24.567  1.00 31.21 ? 252 THR A N   1 
ATOM   1585 C CA  . THR A 1 249 ? 4.457   46.261 25.150  1.00 29.10 ? 252 THR A CA  1 
ATOM   1586 C C   . THR A 1 249 ? 5.456   47.277 24.612  1.00 27.94 ? 252 THR A C   1 
ATOM   1587 O O   . THR A 1 249 ? 5.096   48.376 24.209  1.00 27.76 ? 252 THR A O   1 
ATOM   1588 C CB  . THR A 1 249 ? 4.617   46.196 26.680  1.00 28.69 ? 252 THR A CB  1 
ATOM   1589 O OG1 . THR A 1 249 ? 3.719   45.214 27.212  1.00 28.68 ? 252 THR A OG1 1 
ATOM   1590 C CG2 . THR A 1 249 ? 4.328   47.551 27.306  1.00 27.67 ? 252 THR A CG2 1 
ATOM   1591 N N   . ILE A 1 250 ? 6.718   46.887 24.622  1.00 28.99 ? 253 ILE A N   1 
ATOM   1592 C CA  . ILE A 1 250 ? 7.801   47.730 24.169  1.00 28.43 ? 253 ILE A CA  1 
ATOM   1593 C C   . ILE A 1 250 ? 7.773   47.919 22.666  1.00 28.46 ? 253 ILE A C   1 
ATOM   1594 O O   . ILE A 1 250 ? 7.951   49.042 22.176  1.00 29.18 ? 253 ILE A O   1 
ATOM   1595 C CB  . ILE A 1 250 ? 9.155   47.140 24.620  1.00 27.02 ? 253 ILE A CB  1 
ATOM   1596 C CG1 . ILE A 1 250 ? 9.212   47.138 26.159  1.00 24.27 ? 253 ILE A CG1 1 
ATOM   1597 C CG2 . ILE A 1 250 ? 10.331  47.905 23.968  1.00 26.63 ? 253 ILE A CG2 1 
ATOM   1598 C CD1 . ILE A 1 250 ? 10.411  46.451 26.736  1.00 23.08 ? 253 ILE A CD1 1 
ATOM   1599 N N   . LEU A 1 251 ? 7.517   46.832 21.941  1.00 28.21 ? 254 LEU A N   1 
ATOM   1600 C CA  . LEU A 1 251 ? 7.473   46.885 20.486  1.00 29.36 ? 254 LEU A CA  1 
ATOM   1601 C C   . LEU A 1 251 ? 6.408   47.882 20.072  1.00 29.01 ? 254 LEU A C   1 
ATOM   1602 O O   . LEU A 1 251 ? 6.671   48.759 19.250  1.00 29.35 ? 254 LEU A O   1 
ATOM   1603 C CB  . LEU A 1 251 ? 7.195   45.507 19.890  1.00 28.03 ? 254 LEU A CB  1 
ATOM   1604 C CG  . LEU A 1 251 ? 7.134   45.435 18.364  1.00 27.48 ? 254 LEU A CG  1 
ATOM   1605 C CD1 . LEU A 1 251 ? 8.345   46.120 17.727  1.00 24.30 ? 254 LEU A CD1 1 
ATOM   1606 C CD2 . LEU A 1 251 ? 7.064   43.980 17.969  1.00 27.68 ? 254 LEU A CD2 1 
ATOM   1607 N N   . GLU A 1 252 ? 5.246   47.798 20.722  1.00 28.39 ? 255 GLU A N   1 
ATOM   1608 C CA  . GLU A 1 252 ? 4.131   48.704 20.463  1.00 27.15 ? 255 GLU A CA  1 
ATOM   1609 C C   . GLU A 1 252 ? 4.563   50.146 20.729  1.00 27.03 ? 255 GLU A C   1 
ATOM   1610 O O   . GLU A 1 252 ? 4.060   51.084 20.114  1.00 26.37 ? 255 GLU A O   1 
ATOM   1611 C CB  . GLU A 1 252 ? 2.950   48.361 21.374  1.00 27.38 ? 255 GLU A CB  1 
ATOM   1612 C CG  . GLU A 1 252 ? 1.797   49.360 21.301  1.00 29.47 ? 255 GLU A CG  1 
ATOM   1613 C CD  . GLU A 1 252 ? 1.317   49.576 19.873  1.00 31.76 ? 255 GLU A CD  1 
ATOM   1614 O OE1 . GLU A 1 252 ? 1.058   50.740 19.486  1.00 30.27 ? 255 GLU A OE1 1 
ATOM   1615 O OE2 . GLU A 1 252 ? 1.220   48.569 19.130  1.00 33.24 ? 255 GLU A OE2 1 
ATOM   1616 N N   . ALA A 1 253 ? 5.493   50.299 21.671  1.00 28.32 ? 256 ALA A N   1 
ATOM   1617 C CA  . ALA A 1 253 ? 6.016   51.595 22.064  1.00 27.52 ? 256 ALA A CA  1 
ATOM   1618 C C   . ALA A 1 253 ? 6.908   52.123 20.956  1.00 27.47 ? 256 ALA A C   1 
ATOM   1619 O O   . ALA A 1 253 ? 6.959   53.329 20.703  1.00 27.65 ? 256 ALA A O   1 
ATOM   1620 C CB  . ALA A 1 253 ? 6.778   51.478 23.386  1.00 27.87 ? 256 ALA A CB  1 
ATOM   1621 N N   . MET A 1 254 ? 7.612   51.222 20.287  1.00 26.64 ? 257 MET A N   1 
ATOM   1622 C CA  . MET A 1 254 ? 8.465   51.622 19.171  1.00 28.36 ? 257 MET A CA  1 
ATOM   1623 C C   . MET A 1 254 ? 7.565   52.010 17.974  1.00 28.57 ? 257 MET A C   1 
ATOM   1624 O O   . MET A 1 254 ? 7.703   53.089 17.399  1.00 29.17 ? 257 MET A O   1 
ATOM   1625 C CB  . MET A 1 254 ? 9.421   50.476 18.811  1.00 28.25 ? 257 MET A CB  1 
ATOM   1626 C CG  . MET A 1 254 ? 10.576  50.270 19.802  1.00 27.16 ? 257 MET A CG  1 
ATOM   1627 S SD  . MET A 1 254 ? 11.182  48.559 19.779  1.00 29.20 ? 257 MET A SD  1 
ATOM   1628 C CE  . MET A 1 254 ? 12.107  48.502 18.205  1.00 28.13 ? 257 MET A CE  1 
ATOM   1629 N N   . ARG A 1 255 ? 6.602   51.151 17.659  1.00 28.09 ? 258 ARG A N   1 
ATOM   1630 C CA  . ARG A 1 255 ? 5.668   51.385 16.568  1.00 28.84 ? 258 ARG A CA  1 
ATOM   1631 C C   . ARG A 1 255 ? 4.763   52.605 16.789  1.00 30.64 ? 258 ARG A C   1 
ATOM   1632 O O   . ARG A 1 255 ? 4.483   53.355 15.843  1.00 32.20 ? 258 ARG A O   1 
ATOM   1633 C CB  . ARG A 1 255 ? 4.805   50.142 16.340  1.00 27.26 ? 258 ARG A CB  1 
ATOM   1634 C CG  . ARG A 1 255 ? 5.573   48.960 15.810  1.00 25.24 ? 258 ARG A CG  1 
ATOM   1635 C CD  . ARG A 1 255 ? 4.688   47.727 15.703  1.00 26.44 ? 258 ARG A CD  1 
ATOM   1636 N NE  . ARG A 1 255 ? 5.374   46.613 15.044  1.00 26.42 ? 258 ARG A NE  1 
ATOM   1637 C CZ  . ARG A 1 255 ? 4.929   45.358 15.019  1.00 27.37 ? 258 ARG A CZ  1 
ATOM   1638 N NH1 . ARG A 1 255 ? 3.795   45.035 15.619  1.00 27.33 ? 258 ARG A NH1 1 
ATOM   1639 N NH2 . ARG A 1 255 ? 5.619   44.424 14.383  1.00 27.54 ? 258 ARG A NH2 1 
ATOM   1640 N N   . ALA A 1 256 ? 4.292   52.801 18.024  1.00 31.64 ? 259 ALA A N   1 
ATOM   1641 C CA  . ALA A 1 256 ? 3.417   53.935 18.335  1.00 31.17 ? 259 ALA A CA  1 
ATOM   1642 C C   . ALA A 1 256 ? 4.110   55.269 18.099  1.00 31.94 ? 259 ALA A C   1 
ATOM   1643 O O   . ALA A 1 256 ? 3.464   56.309 18.068  1.00 32.93 ? 259 ALA A O   1 
ATOM   1644 C CB  . ALA A 1 256 ? 2.924   53.860 19.753  1.00 30.90 ? 259 ALA A CB  1 
ATOM   1645 N N   . MET A 1 257 ? 5.430   55.250 17.945  1.00 34.16 ? 260 MET A N   1 
ATOM   1646 C CA  . MET A 1 257 ? 6.141   56.489 17.708  1.00 37.39 ? 260 MET A CA  1 
ATOM   1647 C C   . MET A 1 257 ? 5.894   57.038 16.318  1.00 39.43 ? 260 MET A C   1 
ATOM   1648 O O   . MET A 1 257 ? 6.014   58.242 16.098  1.00 41.75 ? 260 MET A O   1 
ATOM   1649 C CB  . MET A 1 257 ? 7.628   56.326 17.955  1.00 39.10 ? 260 MET A CB  1 
ATOM   1650 C CG  . MET A 1 257 ? 7.999   56.329 19.423  1.00 40.05 ? 260 MET A CG  1 
ATOM   1651 S SD  . MET A 1 257 ? 9.688   56.882 19.578  1.00 44.81 ? 260 MET A SD  1 
ATOM   1652 C CE  . MET A 1 257 ? 10.527  55.580 18.568  1.00 38.70 ? 260 MET A CE  1 
ATOM   1653 N N   . SER A 1 258 ? 5.541   56.164 15.376  1.00 40.61 ? 261 SER A N   1 
ATOM   1654 C CA  . SER A 1 258 ? 5.257   56.616 14.015  1.00 40.93 ? 261 SER A CA  1 
ATOM   1655 C C   . SER A 1 258 ? 3.841   57.217 13.914  1.00 42.50 ? 261 SER A C   1 
ATOM   1656 O O   . SER A 1 258 ? 3.345   57.477 12.813  1.00 44.12 ? 261 SER A O   1 
ATOM   1657 C CB  . SER A 1 258 ? 5.442   55.478 13.008  1.00 39.18 ? 261 SER A CB  1 
ATOM   1658 O OG  . SER A 1 258 ? 4.389   54.540 13.096  1.00 40.88 ? 261 SER A OG  1 
ATOM   1659 N N   . ASP A 1 259 ? 3.183   57.401 15.062  1.00 42.83 ? 262 ASP A N   1 
ATOM   1660 C CA  . ASP A 1 259 ? 1.849   58.003 15.106  1.00 42.83 ? 262 ASP A CA  1 
ATOM   1661 C C   . ASP A 1 259 ? 1.922   59.459 15.571  1.00 43.61 ? 262 ASP A C   1 
ATOM   1662 O O   . ASP A 1 259 ? 0.853   60.002 15.932  1.00 45.64 ? 262 ASP A O   1 
ATOM   1663 C CB  . ASP A 1 259 ? 0.936   57.229 16.045  1.00 41.71 ? 262 ASP A CB  1 
ATOM   1664 C CG  . ASP A 1 259 ? 0.699   55.829 15.584  1.00 42.87 ? 262 ASP A CG  1 
ATOM   1665 O OD1 . ASP A 1 259 ? 1.315   54.907 16.148  1.00 44.81 ? 262 ASP A OD1 1 
ATOM   1666 O OD2 . ASP A 1 259 ? -0.105  55.640 14.652  1.00 45.13 ? 262 ASP A OD2 1 
ATOM   1667 N N   . SER B 1 8   ? 34.232  46.588 -30.112 1.00 45.09 ? 11  SER B N   1 
ATOM   1668 C CA  . SER B 1 8   ? 33.359  46.928 -31.286 1.00 45.22 ? 11  SER B CA  1 
ATOM   1669 C C   . SER B 1 8   ? 31.971  46.345 -31.221 1.00 43.60 ? 11  SER B C   1 
ATOM   1670 O O   . SER B 1 8   ? 31.686  45.288 -31.806 1.00 44.64 ? 11  SER B O   1 
ATOM   1671 C CB  . SER B 1 8   ? 34.009  46.564 -32.626 1.00 46.14 ? 11  SER B CB  1 
ATOM   1672 O OG  . SER B 1 8   ? 34.803  47.638 -33.102 1.00 49.48 ? 11  SER B OG  1 
ATOM   1673 N N   . ASP B 1 9   ? 31.131  47.092 -30.505 1.00 41.41 ? 12  ASP B N   1 
ATOM   1674 C CA  . ASP B 1 9   ? 29.718  46.831 -30.275 1.00 38.15 ? 12  ASP B CA  1 
ATOM   1675 C C   . ASP B 1 9   ? 29.407  45.806 -29.190 1.00 34.59 ? 12  ASP B C   1 
ATOM   1676 O O   . ASP B 1 9   ? 28.936  46.164 -28.114 1.00 33.41 ? 12  ASP B O   1 
ATOM   1677 C CB  . ASP B 1 9   ? 29.007  46.491 -31.597 1.00 43.77 ? 12  ASP B CB  1 
ATOM   1678 C CG  . ASP B 1 9   ? 27.488  46.561 -31.492 1.00 46.73 ? 12  ASP B CG  1 
ATOM   1679 O OD1 . ASP B 1 9   ? 26.969  47.591 -31.018 1.00 49.95 ? 12  ASP B OD1 1 
ATOM   1680 O OD2 . ASP B 1 9   ? 26.818  45.589 -31.899 1.00 46.07 ? 12  ASP B OD2 1 
ATOM   1681 N N   . VAL B 1 10  ? 29.688  44.540 -29.457 1.00 31.28 ? 13  VAL B N   1 
ATOM   1682 C CA  . VAL B 1 10  ? 29.384  43.499 -28.495 1.00 29.44 ? 13  VAL B CA  1 
ATOM   1683 C C   . VAL B 1 10  ? 30.322  43.441 -27.296 1.00 29.13 ? 13  VAL B C   1 
ATOM   1684 O O   . VAL B 1 10  ? 31.506  43.106 -27.426 1.00 28.85 ? 13  VAL B O   1 
ATOM   1685 C CB  . VAL B 1 10  ? 29.340  42.122 -29.167 1.00 29.04 ? 13  VAL B CB  1 
ATOM   1686 C CG1 . VAL B 1 10  ? 28.851  41.061 -28.169 1.00 28.15 ? 13  VAL B CG1 1 
ATOM   1687 C CG2 . VAL B 1 10  ? 28.446  42.176 -30.415 1.00 28.56 ? 13  VAL B CG2 1 
ATOM   1688 N N   . ARG B 1 11  ? 29.759  43.750 -26.128 1.00 28.54 ? 14  ARG B N   1 
ATOM   1689 C CA  . ARG B 1 11  ? 30.475  43.729 -24.854 1.00 26.85 ? 14  ARG B CA  1 
ATOM   1690 C C   . ARG B 1 11  ? 30.389  42.362 -24.177 1.00 24.94 ? 14  ARG B C   1 
ATOM   1691 O O   . ARG B 1 11  ? 31.387  41.863 -23.652 1.00 26.01 ? 14  ARG B O   1 
ATOM   1692 C CB  . ARG B 1 11  ? 29.920  44.811 -23.911 1.00 28.30 ? 14  ARG B CB  1 
ATOM   1693 C CG  . ARG B 1 11  ? 30.193  44.607 -22.407 1.00 30.25 ? 14  ARG B CG  1 
ATOM   1694 C CD  . ARG B 1 11  ? 31.675  44.484 -22.062 1.00 31.00 ? 14  ARG B CD  1 
ATOM   1695 N NE  . ARG B 1 11  ? 31.899  44.356 -20.617 1.00 35.21 ? 14  ARG B NE  1 
ATOM   1696 C CZ  . ARG B 1 11  ? 32.058  43.205 -19.956 1.00 36.11 ? 14  ARG B CZ  1 
ATOM   1697 N NH1 . ARG B 1 11  ? 32.015  42.039 -20.582 1.00 38.46 ? 14  ARG B NH1 1 
ATOM   1698 N NH2 . ARG B 1 11  ? 32.311  43.220 -18.659 1.00 38.40 ? 14  ARG B NH2 1 
ATOM   1699 N N   . LYS B 1 12  ? 29.215  41.743 -24.199 1.00 24.03 ? 15  LYS B N   1 
ATOM   1700 C CA  . LYS B 1 12  ? 29.069  40.462 -23.525 1.00 22.28 ? 15  LYS B CA  1 
ATOM   1701 C C   . LYS B 1 12  ? 28.092  39.583 -24.270 1.00 22.24 ? 15  LYS B C   1 
ATOM   1702 O O   . LYS B 1 12  ? 27.106  40.067 -24.810 1.00 23.55 ? 15  LYS B O   1 
ATOM   1703 C CB  . LYS B 1 12  ? 28.637  40.686 -22.069 1.00 21.75 ? 15  LYS B CB  1 
ATOM   1704 C CG  . LYS B 1 12  ? 28.687  39.450 -21.183 1.00 21.00 ? 15  LYS B CG  1 
ATOM   1705 C CD  . LYS B 1 12  ? 28.552  39.844 -19.714 1.00 20.50 ? 15  LYS B CD  1 
ATOM   1706 C CE  . LYS B 1 12  ? 28.534  38.610 -18.809 1.00 20.31 ? 15  LYS B CE  1 
ATOM   1707 N NZ  . LYS B 1 12  ? 29.737  37.718 -18.944 1.00 18.79 ? 15  LYS B NZ  1 
ATOM   1708 N N   . VAL B 1 13  ? 28.307  38.279 -24.181 1.00 21.12 ? 16  VAL B N   1 
ATOM   1709 C CA  . VAL B 1 13  ? 27.518  37.313 -24.925 1.00 22.87 ? 16  VAL B CA  1 
ATOM   1710 C C   . VAL B 1 13  ? 27.369  35.978 -24.182 1.00 23.39 ? 16  VAL B C   1 
ATOM   1711 O O   . VAL B 1 13  ? 28.298  35.532 -23.492 1.00 24.20 ? 16  VAL B O   1 
ATOM   1712 C CB  . VAL B 1 13  ? 28.260  37.069 -26.298 1.00 24.23 ? 16  VAL B CB  1 
ATOM   1713 C CG1 . VAL B 1 13  ? 28.385  35.585 -26.638 1.00 22.78 ? 16  VAL B CG1 1 
ATOM   1714 C CG2 . VAL B 1 13  ? 27.628  37.875 -27.415 1.00 24.73 ? 16  VAL B CG2 1 
ATOM   1715 N N   . GLY B 1 14  ? 26.202  35.343 -24.334 1.00 21.94 ? 17  GLY B N   1 
ATOM   1716 C CA  . GLY B 1 14  ? 25.990  34.034 -23.724 1.00 19.67 ? 17  GLY B CA  1 
ATOM   1717 C C   . GLY B 1 14  ? 24.566  33.566 -23.535 1.00 20.97 ? 17  GLY B C   1 
ATOM   1718 O O   . GLY B 1 14  ? 23.635  34.365 -23.567 1.00 21.42 ? 17  GLY B O   1 
ATOM   1719 N N   . TYR B 1 15  ? 24.394  32.260 -23.372 1.00 21.07 ? 18  TYR B N   1 
ATOM   1720 C CA  . TYR B 1 15  ? 23.077  31.697 -23.115 1.00 24.05 ? 18  TYR B CA  1 
ATOM   1721 C C   . TYR B 1 15  ? 22.688  31.972 -21.664 1.00 25.58 ? 18  TYR B C   1 
ATOM   1722 O O   . TYR B 1 15  ? 23.509  31.842 -20.749 1.00 25.90 ? 18  TYR B O   1 
ATOM   1723 C CB  . TYR B 1 15  ? 23.057  30.181 -23.330 1.00 25.77 ? 18  TYR B CB  1 
ATOM   1724 C CG  . TYR B 1 15  ? 22.975  29.750 -24.775 1.00 27.58 ? 18  TYR B CG  1 
ATOM   1725 C CD1 . TYR B 1 15  ? 24.031  29.056 -25.373 1.00 29.07 ? 18  TYR B CD1 1 
ATOM   1726 C CD2 . TYR B 1 15  ? 21.850  30.045 -25.553 1.00 28.01 ? 18  TYR B CD2 1 
ATOM   1727 C CE1 . TYR B 1 15  ? 23.974  28.669 -26.708 1.00 28.36 ? 18  TYR B CE1 1 
ATOM   1728 C CE2 . TYR B 1 15  ? 21.784  29.657 -26.903 1.00 29.40 ? 18  TYR B CE2 1 
ATOM   1729 C CZ  . TYR B 1 15  ? 22.853  28.971 -27.466 1.00 29.21 ? 18  TYR B CZ  1 
ATOM   1730 O OH  . TYR B 1 15  ? 22.816  28.582 -28.781 1.00 28.57 ? 18  TYR B OH  1 
ATOM   1731 N N   . LEU B 1 16  ? 21.452  32.421 -21.488 1.00 25.95 ? 19  LEU B N   1 
ATOM   1732 C CA  . LEU B 1 16  ? 20.860  32.711 -20.192 1.00 26.52 ? 19  LEU B CA  1 
ATOM   1733 C C   . LEU B 1 16  ? 19.434  32.209 -20.317 1.00 29.24 ? 19  LEU B C   1 
ATOM   1734 O O   . LEU B 1 16  ? 18.932  32.042 -21.426 1.00 28.42 ? 19  LEU B O   1 
ATOM   1735 C CB  . LEU B 1 16  ? 20.857  34.212 -19.897 1.00 24.45 ? 19  LEU B CB  1 
ATOM   1736 C CG  . LEU B 1 16  ? 22.186  34.921 -19.642 1.00 21.41 ? 19  LEU B CG  1 
ATOM   1737 C CD1 . LEU B 1 16  ? 21.955  36.423 -19.467 1.00 18.64 ? 19  LEU B CD1 1 
ATOM   1738 C CD2 . LEU B 1 16  ? 22.835  34.329 -18.401 1.00 20.16 ? 19  LEU B CD2 1 
ATOM   1739 N N   . ARG B 1 17  ? 18.774  31.989 -19.185 1.00 32.44 ? 20  ARG B N   1 
ATOM   1740 C CA  . ARG B 1 17  ? 17.409  31.469 -19.186 1.00 36.71 ? 20  ARG B CA  1 
ATOM   1741 C C   . ARG B 1 17  ? 16.344  32.518 -18.940 1.00 38.95 ? 20  ARG B C   1 
ATOM   1742 O O   . ARG B 1 17  ? 16.610  33.563 -18.348 1.00 38.04 ? 20  ARG B O   1 
ATOM   1743 C CB  . ARG B 1 17  ? 17.289  30.359 -18.150 1.00 37.17 ? 20  ARG B CB  1 
ATOM   1744 C CG  . ARG B 1 17  ? 16.634  29.116 -18.681 1.00 42.44 ? 20  ARG B CG  1 
ATOM   1745 C CD  . ARG B 1 17  ? 16.877  27.915 -17.774 1.00 45.87 ? 20  ARG B CD  1 
ATOM   1746 N NE  . ARG B 1 17  ? 17.985  27.078 -18.231 1.00 52.43 ? 20  ARG B NE  1 
ATOM   1747 C CZ  . ARG B 1 17  ? 17.888  26.154 -19.189 1.00 54.50 ? 20  ARG B CZ  1 
ATOM   1748 N NH1 . ARG B 1 17  ? 16.731  25.938 -19.806 1.00 55.07 ? 20  ARG B NH1 1 
ATOM   1749 N NH2 . ARG B 1 17  ? 18.954  25.441 -19.533 1.00 56.10 ? 20  ARG B NH2 1 
ATOM   1750 N N   . LYS B 1 18  ? 15.156  32.266 -19.478 1.00 43.00 ? 21  LYS B N   1 
ATOM   1751 C CA  . LYS B 1 18  ? 14.015  33.163 -19.285 1.00 46.95 ? 21  LYS B CA  1 
ATOM   1752 C C   . LYS B 1 18  ? 13.414  32.641 -17.989 1.00 49.21 ? 21  LYS B C   1 
ATOM   1753 O O   . LYS B 1 18  ? 13.155  31.447 -17.870 1.00 50.54 ? 21  LYS B O   1 
ATOM   1754 C CB  . LYS B 1 18  ? 13.005  33.009 -20.429 1.00 48.21 ? 21  LYS B CB  1 
ATOM   1755 C CG  . LYS B 1 18  ? 13.600  33.217 -21.809 1.00 49.76 ? 21  LYS B CG  1 
ATOM   1756 C CD  . LYS B 1 18  ? 14.287  34.572 -21.924 1.00 51.02 ? 21  LYS B CD  1 
ATOM   1757 C CE  . LYS B 1 18  ? 13.312  35.713 -21.692 1.00 51.08 ? 21  LYS B CE  1 
ATOM   1758 N NZ  . LYS B 1 18  ? 12.082  35.561 -22.525 1.00 52.07 ? 21  LYS B NZ  1 
ATOM   1759 N N   . PRO B 1 19  ? 13.232  33.508 -16.985 1.00 50.91 ? 22  PRO B N   1 
ATOM   1760 C CA  . PRO B 1 19  ? 12.668  33.049 -15.713 1.00 53.24 ? 22  PRO B CA  1 
ATOM   1761 C C   . PRO B 1 19  ? 11.340  32.293 -15.770 1.00 55.79 ? 22  PRO B C   1 
ATOM   1762 O O   . PRO B 1 19  ? 11.163  31.307 -15.048 1.00 56.44 ? 22  PRO B O   1 
ATOM   1763 C CB  . PRO B 1 19  ? 12.587  34.332 -14.885 1.00 51.23 ? 22  PRO B CB  1 
ATOM   1764 C CG  . PRO B 1 19  ? 12.547  35.407 -15.902 1.00 51.08 ? 22  PRO B CG  1 
ATOM   1765 C CD  . PRO B 1 19  ? 13.531  34.944 -16.928 1.00 50.76 ? 22  PRO B CD  1 
ATOM   1766 N N   . LYS B 1 20  ? 10.434  32.706 -16.655 1.00 57.62 ? 23  LYS B N   1 
ATOM   1767 C CA  . LYS B 1 20  ? 9.134   32.048 -16.761 1.00 59.13 ? 23  LYS B CA  1 
ATOM   1768 C C   . LYS B 1 20  ? 9.206   30.674 -17.422 1.00 59.53 ? 23  LYS B C   1 
ATOM   1769 O O   . LYS B 1 20  ? 9.214   29.653 -16.728 1.00 60.05 ? 23  LYS B O   1 
ATOM   1770 C CB  . LYS B 1 20  ? 8.136   32.948 -17.484 1.00 60.37 ? 23  LYS B CB  1 
ATOM   1771 C CG  . LYS B 1 20  ? 7.868   34.283 -16.771 1.00 63.62 ? 23  LYS B CG  1 
ATOM   1772 C CD  . LYS B 1 20  ? 7.228   34.078 -15.389 1.00 65.02 ? 23  LYS B CD  1 
ATOM   1773 C CE  . LYS B 1 20  ? 6.648   35.383 -14.833 1.00 65.58 ? 23  LYS B CE  1 
ATOM   1774 N NZ  . LYS B 1 20  ? 5.926   35.175 -13.539 1.00 66.62 ? 23  LYS B NZ  1 
ATOM   1775 N N   . SER B 1 21  ? 9.300   30.650 -18.751 1.00 60.47 ? 24  SER B N   1 
ATOM   1776 C CA  . SER B 1 21  ? 9.367   29.395 -19.511 1.00 60.36 ? 24  SER B CA  1 
ATOM   1777 C C   . SER B 1 21  ? 10.670  28.637 -19.311 1.00 58.78 ? 24  SER B C   1 
ATOM   1778 O O   . SER B 1 21  ? 10.773  27.476 -19.696 1.00 58.75 ? 24  SER B O   1 
ATOM   1779 C CB  . SER B 1 21  ? 9.178   29.648 -21.014 1.00 61.72 ? 24  SER B CB  1 
ATOM   1780 O OG  . SER B 1 21  ? 10.326  30.255 -21.593 1.00 62.28 ? 24  SER B OG  1 
ATOM   1781 N N   . MET B 1 22  ? 11.665  29.308 -18.745 1.00 57.44 ? 25  MET B N   1 
ATOM   1782 C CA  . MET B 1 22  ? 12.969  28.708 -18.500 1.00 56.72 ? 25  MET B CA  1 
ATOM   1783 C C   . MET B 1 22  ? 13.655  28.125 -19.743 1.00 54.75 ? 25  MET B C   1 
ATOM   1784 O O   . MET B 1 22  ? 14.306  27.075 -19.691 1.00 53.70 ? 25  MET B O   1 
ATOM   1785 C CB  . MET B 1 22  ? 12.883  27.686 -17.365 1.00 59.79 ? 25  MET B CB  1 
ATOM   1786 C CG  . MET B 1 22  ? 12.549  28.321 -16.019 1.00 63.49 ? 25  MET B CG  1 
ATOM   1787 S SD  . MET B 1 22  ? 13.350  29.946 -15.810 1.00 69.22 ? 25  MET B SD  1 
ATOM   1788 C CE  . MET B 1 22  ? 14.997  29.493 -15.491 1.00 67.55 ? 25  MET B CE  1 
ATOM   1789 N N   . HIS B 1 23  ? 13.492  28.823 -20.862 1.00 52.46 ? 26  HIS B N   1 
ATOM   1790 C CA  . HIS B 1 23  ? 14.103  28.423 -22.119 1.00 49.64 ? 26  HIS B CA  1 
ATOM   1791 C C   . HIS B 1 23  ? 15.424  29.140 -22.259 1.00 46.64 ? 26  HIS B C   1 
ATOM   1792 O O   . HIS B 1 23  ? 15.578  30.264 -21.789 1.00 45.27 ? 26  HIS B O   1 
ATOM   1793 C CB  . HIS B 1 23  ? 13.225  28.817 -23.304 1.00 52.45 ? 26  HIS B CB  1 
ATOM   1794 C CG  . HIS B 1 23  ? 11.959  28.031 -23.411 1.00 55.09 ? 26  HIS B CG  1 
ATOM   1795 N ND1 . HIS B 1 23  ? 10.780  28.583 -23.872 1.00 56.47 ? 26  HIS B ND1 1 
ATOM   1796 C CD2 . HIS B 1 23  ? 11.691  26.730 -23.143 1.00 55.40 ? 26  HIS B CD2 1 
ATOM   1797 C CE1 . HIS B 1 23  ? 9.842   27.654 -23.887 1.00 56.42 ? 26  HIS B CE1 1 
ATOM   1798 N NE2 . HIS B 1 23  ? 10.368  26.521 -23.449 1.00 56.85 ? 26  HIS B NE2 1 
ATOM   1799 N N   . LYS B 1 24  ? 16.381  28.478 -22.894 1.00 43.42 ? 27  LYS B N   1 
ATOM   1800 C CA  . LYS B 1 24  ? 17.686  29.069 -23.132 1.00 41.03 ? 27  LYS B CA  1 
ATOM   1801 C C   . LYS B 1 24  ? 17.528  30.035 -24.284 1.00 38.41 ? 27  LYS B C   1 
ATOM   1802 O O   . LYS B 1 24  ? 16.960  29.689 -25.320 1.00 38.75 ? 27  LYS B O   1 
ATOM   1803 C CB  . LYS B 1 24  ? 18.700  28.008 -23.548 1.00 43.32 ? 27  LYS B CB  1 
ATOM   1804 C CG  . LYS B 1 24  ? 19.276  27.174 -22.429 1.00 45.14 ? 27  LYS B CG  1 
ATOM   1805 C CD  . LYS B 1 24  ? 20.134  26.053 -22.999 1.00 46.85 ? 27  LYS B CD  1 
ATOM   1806 C CE  . LYS B 1 24  ? 21.019  26.552 -24.150 1.00 47.37 ? 27  LYS B CE  1 
ATOM   1807 N NZ  . LYS B 1 24  ? 22.087  25.580 -24.528 1.00 48.44 ? 27  LYS B NZ  1 
ATOM   1808 N N   . ARG B 1 25  ? 17.988  31.258 -24.079 1.00 34.66 ? 28  ARG B N   1 
ATOM   1809 C CA  . ARG B 1 25  ? 17.948  32.286 -25.100 1.00 31.29 ? 28  ARG B CA  1 
ATOM   1810 C C   . ARG B 1 25  ? 19.361  32.852 -25.124 1.00 28.64 ? 28  ARG B C   1 
ATOM   1811 O O   . ARG B 1 25  ? 20.038  32.881 -24.091 1.00 27.75 ? 28  ARG B O   1 
ATOM   1812 C CB  . ARG B 1 25  ? 16.920  33.346 -24.733 1.00 32.97 ? 28  ARG B CB  1 
ATOM   1813 C CG  . ARG B 1 25  ? 15.485  32.846 -24.773 1.00 36.30 ? 28  ARG B CG  1 
ATOM   1814 C CD  . ARG B 1 25  ? 14.953  32.745 -26.205 1.00 42.72 ? 28  ARG B CD  1 
ATOM   1815 N NE  . ARG B 1 25  ? 14.928  31.383 -26.733 1.00 46.45 ? 28  ARG B NE  1 
ATOM   1816 C CZ  . ARG B 1 25  ? 13.824  30.644 -26.844 1.00 49.06 ? 28  ARG B CZ  1 
ATOM   1817 N NH1 . ARG B 1 25  ? 12.651  31.131 -26.459 1.00 50.43 ? 28  ARG B NH1 1 
ATOM   1818 N NH2 . ARG B 1 25  ? 13.886  29.425 -27.362 1.00 49.23 ? 28  ARG B NH2 1 
ATOM   1819 N N   . PHE B 1 26  ? 19.845  33.225 -26.303 1.00 25.18 ? 29  PHE B N   1 
ATOM   1820 C CA  . PHE B 1 26  ? 21.199  33.754 -26.406 1.00 22.17 ? 29  PHE B CA  1 
ATOM   1821 C C   . PHE B 1 26  ? 21.225  35.273 -26.344 1.00 22.00 ? 29  PHE B C   1 
ATOM   1822 O O   . PHE B 1 26  ? 20.857  35.946 -27.306 1.00 22.35 ? 29  PHE B O   1 
ATOM   1823 C CB  . PHE B 1 26  ? 21.852  33.260 -27.682 1.00 18.90 ? 29  PHE B CB  1 
ATOM   1824 C CG  . PHE B 1 26  ? 23.325  33.448 -27.709 1.00 17.50 ? 29  PHE B CG  1 
ATOM   1825 C CD1 . PHE B 1 26  ? 24.165  32.496 -27.127 1.00 14.95 ? 29  PHE B CD1 1 
ATOM   1826 C CD2 . PHE B 1 26  ? 23.885  34.581 -28.308 1.00 16.20 ? 29  PHE B CD2 1 
ATOM   1827 C CE1 . PHE B 1 26  ? 25.540  32.669 -27.140 1.00 13.27 ? 29  PHE B CE1 1 
ATOM   1828 C CE2 . PHE B 1 26  ? 25.256  34.764 -28.325 1.00 13.79 ? 29  PHE B CE2 1 
ATOM   1829 C CZ  . PHE B 1 26  ? 26.083  33.805 -27.738 1.00 12.66 ? 29  PHE B CZ  1 
ATOM   1830 N N   . PHE B 1 27  ? 21.710  35.803 -25.224 1.00 21.39 ? 30  PHE B N   1 
ATOM   1831 C CA  . PHE B 1 27  ? 21.780  37.238 -24.996 1.00 20.39 ? 30  PHE B CA  1 
ATOM   1832 C C   . PHE B 1 27  ? 23.037  37.898 -25.531 1.00 21.14 ? 30  PHE B C   1 
ATOM   1833 O O   . PHE B 1 27  ? 24.102  37.280 -25.591 1.00 21.71 ? 30  PHE B O   1 
ATOM   1834 C CB  . PHE B 1 27  ? 21.585  37.542 -23.509 1.00 20.52 ? 30  PHE B CB  1 
ATOM   1835 C CG  . PHE B 1 27  ? 20.215  37.175 -22.997 1.00 20.29 ? 30  PHE B CG  1 
ATOM   1836 C CD1 . PHE B 1 27  ? 19.856  35.844 -22.816 1.00 19.24 ? 30  PHE B CD1 1 
ATOM   1837 C CD2 . PHE B 1 27  ? 19.272  38.162 -22.717 1.00 20.91 ? 30  PHE B CD2 1 
ATOM   1838 C CE1 . PHE B 1 27  ? 18.576  35.496 -22.361 1.00 18.84 ? 30  PHE B CE1 1 
ATOM   1839 C CE2 . PHE B 1 27  ? 17.987  37.819 -22.263 1.00 21.45 ? 30  PHE B CE2 1 
ATOM   1840 C CZ  . PHE B 1 27  ? 17.644  36.485 -22.085 1.00 18.64 ? 30  PHE B CZ  1 
ATOM   1841 N N   . VAL B 1 28  ? 22.893  39.166 -25.914 1.00 21.51 ? 31  VAL B N   1 
ATOM   1842 C CA  . VAL B 1 28  ? 23.975  39.965 -26.480 1.00 22.39 ? 31  VAL B CA  1 
ATOM   1843 C C   . VAL B 1 28  ? 23.902  41.386 -25.947 1.00 22.56 ? 31  VAL B C   1 
ATOM   1844 O O   . VAL B 1 28  ? 22.909  42.067 -26.163 1.00 23.67 ? 31  VAL B O   1 
ATOM   1845 C CB  . VAL B 1 28  ? 23.856  40.055 -28.049 1.00 22.29 ? 31  VAL B CB  1 
ATOM   1846 C CG1 . VAL B 1 28  ? 24.927  40.972 -28.627 1.00 19.76 ? 31  VAL B CG1 1 
ATOM   1847 C CG2 . VAL B 1 28  ? 23.941  38.674 -28.683 1.00 22.62 ? 31  VAL B CG2 1 
ATOM   1848 N N   . LEU B 1 29  ? 24.935  41.828 -25.235 1.00 23.02 ? 32  LEU B N   1 
ATOM   1849 C CA  . LEU B 1 29  ? 24.949  43.198 -24.721 1.00 24.25 ? 32  LEU B CA  1 
ATOM   1850 C C   . LEU B 1 29  ? 25.820  43.990 -25.686 1.00 22.80 ? 32  LEU B C   1 
ATOM   1851 O O   . LEU B 1 29  ? 26.904  43.536 -26.068 1.00 22.18 ? 32  LEU B O   1 
ATOM   1852 C CB  . LEU B 1 29  ? 25.555  43.269 -23.313 1.00 24.20 ? 32  LEU B CB  1 
ATOM   1853 C CG  . LEU B 1 29  ? 25.004  44.256 -22.272 1.00 24.45 ? 32  LEU B CG  1 
ATOM   1854 C CD1 . LEU B 1 29  ? 26.048  44.425 -21.191 1.00 25.03 ? 32  LEU B CD1 1 
ATOM   1855 C CD2 . LEU B 1 29  ? 24.632  45.598 -22.827 1.00 20.78 ? 32  LEU B CD2 1 
ATOM   1856 N N   . ARG B 1 30  ? 25.345  45.166 -26.079 1.00 23.76 ? 33  ARG B N   1 
ATOM   1857 C CA  . ARG B 1 30  ? 26.086  46.007 -27.016 1.00 25.07 ? 33  ARG B CA  1 
ATOM   1858 C C   . ARG B 1 30  ? 26.221  47.412 -26.486 1.00 25.51 ? 33  ARG B C   1 
ATOM   1859 O O   . ARG B 1 30  ? 25.256  47.992 -25.975 1.00 25.29 ? 33  ARG B O   1 
ATOM   1860 C CB  . ARG B 1 30  ? 25.372  46.086 -28.371 1.00 24.63 ? 33  ARG B CB  1 
ATOM   1861 C CG  . ARG B 1 30  ? 25.082  44.758 -29.043 1.00 26.29 ? 33  ARG B CG  1 
ATOM   1862 C CD  . ARG B 1 30  ? 24.200  44.972 -30.266 1.00 26.39 ? 33  ARG B CD  1 
ATOM   1863 N NE  . ARG B 1 30  ? 23.692  43.720 -30.830 1.00 26.76 ? 33  ARG B NE  1 
ATOM   1864 C CZ  . ARG B 1 30  ? 24.331  42.975 -31.730 1.00 25.17 ? 33  ARG B CZ  1 
ATOM   1865 N NH1 . ARG B 1 30  ? 25.530  43.339 -32.168 1.00 24.81 ? 33  ARG B NH1 1 
ATOM   1866 N NH2 . ARG B 1 30  ? 23.762  41.870 -32.204 1.00 24.02 ? 33  ARG B NH2 1 
ATOM   1867 N N   . ALA B 1 31  ? 27.418  47.962 -26.672 1.00 27.11 ? 34  ALA B N   1 
ATOM   1868 C CA  . ALA B 1 31  ? 27.766  49.321 -26.267 1.00 30.47 ? 34  ALA B CA  1 
ATOM   1869 C C   . ALA B 1 31  ? 27.189  50.307 -27.283 1.00 32.40 ? 34  ALA B C   1 
ATOM   1870 O O   . ALA B 1 31  ? 26.904  49.939 -28.427 1.00 32.29 ? 34  ALA B O   1 
ATOM   1871 C CB  . ALA B 1 31  ? 29.284  49.460 -26.214 1.00 29.20 ? 34  ALA B CB  1 
ATOM   1872 N N   . ALA B 1 32  ? 27.014  51.558 -26.875 1.00 34.42 ? 35  ALA B N   1 
ATOM   1873 C CA  . ALA B 1 32  ? 26.490  52.567 -27.787 1.00 38.23 ? 35  ALA B CA  1 
ATOM   1874 C C   . ALA B 1 32  ? 27.509  52.909 -28.873 1.00 41.67 ? 35  ALA B C   1 
ATOM   1875 O O   . ALA B 1 32  ? 28.712  52.956 -28.616 1.00 43.29 ? 35  ALA B O   1 
ATOM   1876 C CB  . ALA B 1 32  ? 26.104  53.821 -27.019 1.00 35.11 ? 35  ALA B CB  1 
ATOM   1877 N N   . SER B 1 33  ? 27.020  53.120 -30.090 1.00 45.43 ? 36  SER B N   1 
ATOM   1878 C CA  . SER B 1 33  ? 27.867  53.492 -31.219 1.00 48.61 ? 36  SER B CA  1 
ATOM   1879 C C   . SER B 1 33  ? 27.094  54.420 -32.157 1.00 52.84 ? 36  SER B C   1 
ATOM   1880 O O   . SER B 1 33  ? 25.857  54.438 -32.149 1.00 53.06 ? 36  SER B O   1 
ATOM   1881 C CB  . SER B 1 33  ? 28.340  52.251 -31.978 1.00 47.60 ? 36  SER B CB  1 
ATOM   1882 O OG  . SER B 1 33  ? 27.270  51.597 -32.636 1.00 47.45 ? 36  SER B OG  1 
ATOM   1883 N N   . GLU B 1 34  ? 27.818  55.228 -32.929 1.00 57.75 ? 37  GLU B N   1 
ATOM   1884 C CA  . GLU B 1 34  ? 27.182  56.143 -33.873 1.00 62.11 ? 37  GLU B CA  1 
ATOM   1885 C C   . GLU B 1 34  ? 27.054  55.479 -35.235 1.00 62.50 ? 37  GLU B C   1 
ATOM   1886 O O   . GLU B 1 34  ? 27.737  55.864 -36.181 1.00 63.75 ? 37  GLU B O   1 
ATOM   1887 C CB  . GLU B 1 34  ? 27.941  57.481 -33.979 1.00 65.39 ? 37  GLU B CB  1 
ATOM   1888 C CG  . GLU B 1 34  ? 29.456  57.434 -33.698 1.00 72.50 ? 37  GLU B CG  1 
ATOM   1889 C CD  . GLU B 1 34  ? 30.280  56.700 -34.762 1.00 77.27 ? 37  GLU B CD  1 
ATOM   1890 O OE1 . GLU B 1 34  ? 30.166  55.453 -34.867 1.00 79.50 ? 37  GLU B OE1 1 
ATOM   1891 O OE2 . GLU B 1 34  ? 31.068  57.370 -35.474 1.00 78.38 ? 37  GLU B OE2 1 
ATOM   1892 N N   . ALA B 1 35  ? 26.205  54.455 -35.308 1.00 62.67 ? 38  ALA B N   1 
ATOM   1893 C CA  . ALA B 1 35  ? 25.948  53.699 -36.539 1.00 62.67 ? 38  ALA B CA  1 
ATOM   1894 C C   . ALA B 1 35  ? 25.120  52.471 -36.210 1.00 62.65 ? 38  ALA B C   1 
ATOM   1895 O O   . ALA B 1 35  ? 24.082  52.221 -36.829 1.00 63.53 ? 38  ALA B O   1 
ATOM   1896 C CB  . ALA B 1 35  ? 27.255  53.262 -37.196 1.00 62.97 ? 38  ALA B CB  1 
ATOM   1897 N N   . GLY B 1 36  ? 25.622  51.691 -35.252 1.00 61.33 ? 39  GLY B N   1 
ATOM   1898 C CA  . GLY B 1 36  ? 24.947  50.480 -34.822 1.00 58.21 ? 39  GLY B CA  1 
ATOM   1899 C C   . GLY B 1 36  ? 23.692  50.783 -34.032 1.00 54.94 ? 39  GLY B C   1 
ATOM   1900 O O   . GLY B 1 36  ? 22.643  50.190 -34.280 1.00 56.11 ? 39  GLY B O   1 
ATOM   1901 N N   . GLY B 1 37  ? 23.797  51.725 -33.099 1.00 50.47 ? 40  GLY B N   1 
ATOM   1902 C CA  . GLY B 1 37  ? 22.658  52.095 -32.281 1.00 45.53 ? 40  GLY B CA  1 
ATOM   1903 C C   . GLY B 1 37  ? 23.034  52.306 -30.823 1.00 43.22 ? 40  GLY B C   1 
ATOM   1904 O O   . GLY B 1 37  ? 24.212  52.244 -30.468 1.00 41.93 ? 40  GLY B O   1 
ATOM   1905 N N   . PRO B 1 38  ? 22.044  52.531 -29.944 1.00 41.20 ? 41  PRO B N   1 
ATOM   1906 C CA  . PRO B 1 38  ? 22.255  52.757 -28.511 1.00 39.35 ? 41  PRO B CA  1 
ATOM   1907 C C   . PRO B 1 38  ? 22.684  51.520 -27.717 1.00 37.67 ? 41  PRO B C   1 
ATOM   1908 O O   . PRO B 1 38  ? 22.682  50.410 -28.247 1.00 37.18 ? 41  PRO B O   1 
ATOM   1909 C CB  . PRO B 1 38  ? 20.890  53.261 -28.060 1.00 39.15 ? 41  PRO B CB  1 
ATOM   1910 C CG  . PRO B 1 38  ? 19.967  52.496 -28.929 1.00 39.66 ? 41  PRO B CG  1 
ATOM   1911 C CD  . PRO B 1 38  ? 20.614  52.624 -30.278 1.00 39.40 ? 41  PRO B CD  1 
ATOM   1912 N N   . ALA B 1 39  ? 23.100  51.732 -26.464 1.00 35.72 ? 42  ALA B N   1 
ATOM   1913 C CA  . ALA B 1 39  ? 23.504  50.630 -25.577 1.00 32.85 ? 42  ALA B CA  1 
ATOM   1914 C C   . ALA B 1 39  ? 22.218  49.875 -25.351 1.00 30.50 ? 42  ALA B C   1 
ATOM   1915 O O   . ALA B 1 39  ? 21.200  50.469 -24.972 1.00 30.09 ? 42  ALA B O   1 
ATOM   1916 C CB  . ALA B 1 39  ? 24.052  51.153 -24.247 1.00 32.00 ? 42  ALA B CB  1 
ATOM   1917 N N   . ARG B 1 40  ? 22.263  48.567 -25.562 1.00 28.26 ? 43  ARG B N   1 
ATOM   1918 C CA  . ARG B 1 40  ? 21.057  47.768 -25.454 1.00 26.52 ? 43  ARG B CA  1 
ATOM   1919 C C   . ARG B 1 40  ? 21.348  46.308 -25.148 1.00 25.37 ? 43  ARG B C   1 
ATOM   1920 O O   . ARG B 1 40  ? 22.430  45.786 -25.458 1.00 25.44 ? 43  ARG B O   1 
ATOM   1921 C CB  . ARG B 1 40  ? 20.293  47.863 -26.790 1.00 25.88 ? 43  ARG B CB  1 
ATOM   1922 C CG  . ARG B 1 40  ? 20.959  47.083 -27.939 1.00 26.80 ? 43  ARG B CG  1 
ATOM   1923 C CD  . ARG B 1 40  ? 20.532  47.539 -29.328 1.00 27.73 ? 43  ARG B CD  1 
ATOM   1924 N NE  . ARG B 1 40  ? 21.540  48.423 -29.902 1.00 31.19 ? 43  ARG B NE  1 
ATOM   1925 C CZ  . ARG B 1 40  ? 22.213  48.201 -31.032 1.00 31.20 ? 43  ARG B CZ  1 
ATOM   1926 N NH1 . ARG B 1 40  ? 22.002  47.117 -31.771 1.00 29.93 ? 43  ARG B NH1 1 
ATOM   1927 N NH2 . ARG B 1 40  ? 23.156  49.053 -31.387 1.00 31.70 ? 43  ARG B NH2 1 
ATOM   1928 N N   . LEU B 1 41  ? 20.358  45.656 -24.552 1.00 24.95 ? 44  LEU B N   1 
ATOM   1929 C CA  . LEU B 1 41  ? 20.448  44.250 -24.220 1.00 24.51 ? 44  LEU B CA  1 
ATOM   1930 C C   . LEU B 1 41  ? 19.477  43.585 -25.173 1.00 24.61 ? 44  LEU B C   1 
ATOM   1931 O O   . LEU B 1 41  ? 18.316  43.981 -25.273 1.00 22.94 ? 44  LEU B O   1 
ATOM   1932 C CB  . LEU B 1 41  ? 20.019  43.998 -22.771 1.00 24.11 ? 44  LEU B CB  1 
ATOM   1933 C CG  . LEU B 1 41  ? 19.958  42.529 -22.335 1.00 23.97 ? 44  LEU B CG  1 
ATOM   1934 C CD1 . LEU B 1 41  ? 21.347  41.894 -22.366 1.00 21.78 ? 44  LEU B CD1 1 
ATOM   1935 C CD2 . LEU B 1 41  ? 19.354  42.444 -20.953 1.00 22.75 ? 44  LEU B CD2 1 
ATOM   1936 N N   . GLU B 1 42  ? 19.971  42.590 -25.894 1.00 23.96 ? 45  GLU B N   1 
ATOM   1937 C CA  . GLU B 1 42  ? 19.158  41.872 -26.856 1.00 23.62 ? 45  GLU B CA  1 
ATOM   1938 C C   . GLU B 1 42  ? 19.311  40.381 -26.621 1.00 23.09 ? 45  GLU B C   1 
ATOM   1939 O O   . GLU B 1 42  ? 20.183  39.968 -25.866 1.00 23.42 ? 45  GLU B O   1 
ATOM   1940 C CB  . GLU B 1 42  ? 19.644  42.201 -28.272 1.00 24.65 ? 45  GLU B CB  1 
ATOM   1941 C CG  . GLU B 1 42  ? 19.968  43.675 -28.495 1.00 27.90 ? 45  GLU B CG  1 
ATOM   1942 C CD  . GLU B 1 42  ? 20.226  44.019 -29.956 1.00 29.33 ? 45  GLU B CD  1 
ATOM   1943 O OE1 . GLU B 1 42  ? 21.041  43.332 -30.614 1.00 30.36 ? 45  GLU B OE1 1 
ATOM   1944 O OE2 . GLU B 1 42  ? 19.596  44.983 -30.448 1.00 30.36 ? 45  GLU B OE2 1 
ATOM   1945 N N   . TYR B 1 43  ? 18.413  39.587 -27.192 1.00 22.21 ? 46  TYR B N   1 
ATOM   1946 C CA  . TYR B 1 43  ? 18.525  38.136 -27.102 1.00 23.65 ? 46  TYR B CA  1 
ATOM   1947 C C   . TYR B 1 43  ? 17.909  37.547 -28.363 1.00 24.07 ? 46  TYR B C   1 
ATOM   1948 O O   . TYR B 1 43  ? 17.017  38.156 -28.956 1.00 22.92 ? 46  TYR B O   1 
ATOM   1949 C CB  . TYR B 1 43  ? 17.931  37.551 -25.801 1.00 23.13 ? 46  TYR B CB  1 
ATOM   1950 C CG  . TYR B 1 43  ? 16.434  37.367 -25.743 1.00 21.71 ? 46  TYR B CG  1 
ATOM   1951 C CD1 . TYR B 1 43  ? 15.818  36.301 -26.399 1.00 22.15 ? 46  TYR B CD1 1 
ATOM   1952 C CD2 . TYR B 1 43  ? 15.630  38.250 -25.023 1.00 21.04 ? 46  TYR B CD2 1 
ATOM   1953 C CE1 . TYR B 1 43  ? 14.442  36.121 -26.348 1.00 20.27 ? 46  TYR B CE1 1 
ATOM   1954 C CE2 . TYR B 1 43  ? 14.249  38.071 -24.965 1.00 20.97 ? 46  TYR B CE2 1 
ATOM   1955 C CZ  . TYR B 1 43  ? 13.664  37.003 -25.641 1.00 20.73 ? 46  TYR B CZ  1 
ATOM   1956 O OH  . TYR B 1 43  ? 12.299  36.845 -25.657 1.00 22.44 ? 46  TYR B OH  1 
ATOM   1957 N N   . TYR B 1 44  ? 18.455  36.417 -28.805 1.00 24.59 ? 47  TYR B N   1 
ATOM   1958 C CA  . TYR B 1 44  ? 18.020  35.724 -30.012 1.00 25.52 ? 47  TYR B CA  1 
ATOM   1959 C C   . TYR B 1 44  ? 17.596  34.310 -29.647 1.00 26.78 ? 47  TYR B C   1 
ATOM   1960 O O   . TYR B 1 44  ? 17.887  33.847 -28.542 1.00 27.03 ? 47  TYR B O   1 
ATOM   1961 C CB  . TYR B 1 44  ? 19.181  35.644 -31.009 1.00 25.92 ? 47  TYR B CB  1 
ATOM   1962 C CG  . TYR B 1 44  ? 19.752  36.984 -31.422 1.00 26.17 ? 47  TYR B CG  1 
ATOM   1963 C CD1 . TYR B 1 44  ? 20.479  37.769 -30.520 1.00 25.93 ? 47  TYR B CD1 1 
ATOM   1964 C CD2 . TYR B 1 44  ? 19.534  37.486 -32.701 1.00 25.87 ? 47  TYR B CD2 1 
ATOM   1965 C CE1 . TYR B 1 44  ? 20.964  39.018 -30.883 1.00 24.59 ? 47  TYR B CE1 1 
ATOM   1966 C CE2 . TYR B 1 44  ? 20.016  38.732 -33.071 1.00 22.68 ? 47  TYR B CE2 1 
ATOM   1967 C CZ  . TYR B 1 44  ? 20.722  39.492 -32.165 1.00 23.24 ? 47  TYR B CZ  1 
ATOM   1968 O OH  . TYR B 1 44  ? 21.164  40.741 -32.529 1.00 25.02 ? 47  TYR B OH  1 
ATOM   1969 N N   . GLU B 1 45  ? 16.954  33.611 -30.588 1.00 28.45 ? 48  GLU B N   1 
ATOM   1970 C CA  . GLU B 1 45  ? 16.502  32.236 -30.357 1.00 29.75 ? 48  GLU B CA  1 
ATOM   1971 C C   . GLU B 1 45  ? 17.675  31.360 -29.898 1.00 28.84 ? 48  GLU B C   1 
ATOM   1972 O O   . GLU B 1 45  ? 17.563  30.575 -28.954 1.00 28.22 ? 48  GLU B O   1 
ATOM   1973 C CB  . GLU B 1 45  ? 15.887  31.649 -31.627 1.00 32.52 ? 48  GLU B CB  1 
ATOM   1974 C CG  . GLU B 1 45  ? 15.266  30.255 -31.400 1.00 40.13 ? 48  GLU B CG  1 
ATOM   1975 C CD  . GLU B 1 45  ? 15.030  29.451 -32.682 1.00 44.69 ? 48  GLU B CD  1 
ATOM   1976 O OE1 . GLU B 1 45  ? 14.930  28.210 -32.574 1.00 47.32 ? 48  GLU B OE1 1 
ATOM   1977 O OE2 . GLU B 1 45  ? 14.947  30.040 -33.786 1.00 45.84 ? 48  GLU B OE2 1 
ATOM   1978 N N   . ASN B 1 46  ? 18.801  31.512 -30.581 1.00 28.47 ? 49  ASN B N   1 
ATOM   1979 C CA  . ASN B 1 46  ? 20.015  30.781 -30.263 1.00 25.95 ? 49  ASN B CA  1 
ATOM   1980 C C   . ASN B 1 46  ? 21.216  31.560 -30.778 1.00 24.84 ? 49  ASN B C   1 
ATOM   1981 O O   . ASN B 1 46  ? 21.068  32.660 -31.318 1.00 24.16 ? 49  ASN B O   1 
ATOM   1982 C CB  . ASN B 1 46  ? 19.984  29.371 -30.847 1.00 26.07 ? 49  ASN B CB  1 
ATOM   1983 C CG  . ASN B 1 46  ? 19.684  29.358 -32.327 1.00 26.55 ? 49  ASN B CG  1 
ATOM   1984 O OD1 . ASN B 1 46  ? 20.388  29.985 -33.132 1.00 26.58 ? 49  ASN B OD1 1 
ATOM   1985 N ND2 . ASN B 1 46  ? 18.625  28.650 -32.697 1.00 26.05 ? 49  ASN B ND2 1 
ATOM   1986 N N   . GLU B 1 47  ? 22.404  31.002 -30.570 1.00 24.44 ? 50  GLU B N   1 
ATOM   1987 C CA  . GLU B 1 47  ? 23.642  31.644 -30.982 1.00 26.02 ? 50  GLU B CA  1 
ATOM   1988 C C   . GLU B 1 47  ? 23.861  31.693 -32.486 1.00 28.52 ? 50  GLU B C   1 
ATOM   1989 O O   . GLU B 1 47  ? 24.440  32.658 -32.997 1.00 29.25 ? 50  GLU B O   1 
ATOM   1990 C CB  . GLU B 1 47  ? 24.826  30.946 -30.348 1.00 22.08 ? 50  GLU B CB  1 
ATOM   1991 C CG  . GLU B 1 47  ? 26.139  31.486 -30.839 1.00 24.17 ? 50  GLU B CG  1 
ATOM   1992 C CD  . GLU B 1 47  ? 27.321  30.707 -30.336 1.00 24.14 ? 50  GLU B CD  1 
ATOM   1993 O OE1 . GLU B 1 47  ? 27.285  29.459 -30.339 1.00 24.08 ? 50  GLU B OE1 1 
ATOM   1994 O OE2 . GLU B 1 47  ? 28.296  31.356 -29.933 1.00 26.67 ? 50  GLU B OE2 1 
ATOM   1995 N N   . LYS B 1 48  ? 23.433  30.637 -33.179 1.00 31.39 ? 51  LYS B N   1 
ATOM   1996 C CA  . LYS B 1 48  ? 23.594  30.523 -34.629 1.00 34.49 ? 51  LYS B CA  1 
ATOM   1997 C C   . LYS B 1 48  ? 22.935  31.680 -35.387 1.00 34.21 ? 51  LYS B C   1 
ATOM   1998 O O   . LYS B 1 48  ? 23.537  32.252 -36.297 1.00 33.24 ? 51  LYS B O   1 
ATOM   1999 C CB  . LYS B 1 48  ? 23.024  29.186 -35.103 1.00 37.58 ? 51  LYS B CB  1 
ATOM   2000 C CG  . LYS B 1 48  ? 23.230  28.903 -36.580 1.00 43.89 ? 51  LYS B CG  1 
ATOM   2001 C CD  . LYS B 1 48  ? 22.540  27.616 -36.992 1.00 48.96 ? 51  LYS B CD  1 
ATOM   2002 C CE  . LYS B 1 48  ? 23.106  26.433 -36.209 1.00 52.72 ? 51  LYS B CE  1 
ATOM   2003 N NZ  . LYS B 1 48  ? 22.394  25.151 -36.490 1.00 56.93 ? 51  LYS B NZ  1 
ATOM   2004 N N   . LYS B 1 49  ? 21.714  32.030 -34.975 1.00 34.23 ? 52  LYS B N   1 
ATOM   2005 C CA  . LYS B 1 49  ? 20.941  33.111 -35.581 1.00 34.12 ? 52  LYS B CA  1 
ATOM   2006 C C   . LYS B 1 49  ? 21.600  34.473 -35.399 1.00 33.54 ? 52  LYS B C   1 
ATOM   2007 O O   . LYS B 1 49  ? 21.351  35.400 -36.173 1.00 35.24 ? 52  LYS B O   1 
ATOM   2008 C CB  . LYS B 1 49  ? 19.543  33.162 -34.975 1.00 35.73 ? 52  LYS B CB  1 
ATOM   2009 C CG  . LYS B 1 49  ? 18.673  31.946 -35.245 1.00 38.72 ? 52  LYS B CG  1 
ATOM   2010 C CD  . LYS B 1 49  ? 18.207  31.908 -36.680 1.00 42.83 ? 52  LYS B CD  1 
ATOM   2011 C CE  . LYS B 1 49  ? 17.256  30.752 -36.912 1.00 44.54 ? 52  LYS B CE  1 
ATOM   2012 N NZ  . LYS B 1 49  ? 16.800  30.731 -38.330 1.00 48.47 ? 52  LYS B NZ  1 
ATOM   2013 N N   . TRP B 1 50  ? 22.382  34.618 -34.332 1.00 32.13 ? 53  TRP B N   1 
ATOM   2014 C CA  . TRP B 1 50  ? 23.080  35.872 -34.072 1.00 30.07 ? 53  TRP B CA  1 
ATOM   2015 C C   . TRP B 1 50  ? 24.341  35.940 -34.913 1.00 33.07 ? 53  TRP B C   1 
ATOM   2016 O O   . TRP B 1 50  ? 24.579  36.929 -35.615 1.00 34.46 ? 53  TRP B O   1 
ATOM   2017 C CB  . TRP B 1 50  ? 23.465  35.980 -32.601 1.00 25.97 ? 53  TRP B CB  1 
ATOM   2018 C CG  . TRP B 1 50  ? 24.485  37.043 -32.338 1.00 20.82 ? 53  TRP B CG  1 
ATOM   2019 C CD1 . TRP B 1 50  ? 24.299  38.391 -32.402 1.00 18.09 ? 53  TRP B CD1 1 
ATOM   2020 C CD2 . TRP B 1 50  ? 25.839  36.843 -31.911 1.00 19.71 ? 53  TRP B CD2 1 
ATOM   2021 N NE1 . TRP B 1 50  ? 25.449  39.049 -32.032 1.00 18.18 ? 53  TRP B NE1 1 
ATOM   2022 C CE2 . TRP B 1 50  ? 26.411  38.124 -31.725 1.00 19.22 ? 53  TRP B CE2 1 
ATOM   2023 C CE3 . TRP B 1 50  ? 26.620  35.704 -31.654 1.00 18.55 ? 53  TRP B CE3 1 
ATOM   2024 C CZ2 . TRP B 1 50  ? 27.732  38.301 -31.296 1.00 19.08 ? 53  TRP B CZ2 1 
ATOM   2025 C CZ3 . TRP B 1 50  ? 27.928  35.879 -31.225 1.00 18.46 ? 53  TRP B CZ3 1 
ATOM   2026 C CH2 . TRP B 1 50  ? 28.472  37.173 -31.050 1.00 18.44 ? 53  TRP B CH2 1 
ATOM   2027 N N   . ARG B 1 51  ? 25.157  34.890 -34.799 1.00 35.76 ? 54  ARG B N   1 
ATOM   2028 C CA  . ARG B 1 51  ? 26.414  34.783 -35.533 1.00 39.15 ? 54  ARG B CA  1 
ATOM   2029 C C   . ARG B 1 51  ? 26.208  34.998 -37.023 1.00 39.37 ? 54  ARG B C   1 
ATOM   2030 O O   . ARG B 1 51  ? 26.855  35.852 -37.630 1.00 38.81 ? 54  ARG B O   1 
ATOM   2031 C CB  . ARG B 1 51  ? 27.057  33.410 -35.307 1.00 42.84 ? 54  ARG B CB  1 
ATOM   2032 C CG  . ARG B 1 51  ? 28.122  33.388 -34.224 1.00 47.36 ? 54  ARG B CG  1 
ATOM   2033 C CD  . ARG B 1 51  ? 28.980  32.119 -34.277 1.00 52.81 ? 54  ARG B CD  1 
ATOM   2034 N NE  . ARG B 1 51  ? 28.403  30.960 -33.582 1.00 58.57 ? 54  ARG B NE  1 
ATOM   2035 C CZ  . ARG B 1 51  ? 27.424  30.185 -34.057 1.00 60.62 ? 54  ARG B CZ  1 
ATOM   2036 N NH1 . ARG B 1 51  ? 26.873  30.432 -35.239 1.00 62.67 ? 54  ARG B NH1 1 
ATOM   2037 N NH2 . ARG B 1 51  ? 27.039  29.111 -33.376 1.00 60.81 ? 54  ARG B NH2 1 
ATOM   2038 N N   . HIS B 1 52  ? 25.276  34.234 -37.588 1.00 39.83 ? 55  HIS B N   1 
ATOM   2039 C CA  . HIS B 1 52  ? 24.952  34.289 -39.006 1.00 41.03 ? 55  HIS B CA  1 
ATOM   2040 C C   . HIS B 1 52  ? 24.117  35.489 -39.435 1.00 40.85 ? 55  HIS B C   1 
ATOM   2041 O O   . HIS B 1 52  ? 23.756  35.590 -40.604 1.00 41.83 ? 55  HIS B O   1 
ATOM   2042 C CB  . HIS B 1 52  ? 24.222  33.007 -39.411 1.00 43.41 ? 55  HIS B CB  1 
ATOM   2043 C CG  . HIS B 1 52  ? 25.058  31.771 -39.280 1.00 47.46 ? 55  HIS B CG  1 
ATOM   2044 N ND1 . HIS B 1 52  ? 24.551  30.502 -39.465 1.00 48.81 ? 55  HIS B ND1 1 
ATOM   2045 C CD2 . HIS B 1 52  ? 26.371  31.611 -38.980 1.00 48.51 ? 55  HIS B CD2 1 
ATOM   2046 C CE1 . HIS B 1 52  ? 25.513  29.614 -39.284 1.00 49.55 ? 55  HIS B CE1 1 
ATOM   2047 N NE2 . HIS B 1 52  ? 26.626  30.262 -38.989 1.00 49.41 ? 55  HIS B NE2 1 
ATOM   2048 N N   . LYS B 1 53  ? 23.793  36.385 -38.502 1.00 39.35 ? 56  LYS B N   1 
ATOM   2049 C CA  . LYS B 1 53  ? 22.974  37.559 -38.806 1.00 37.29 ? 56  LYS B CA  1 
ATOM   2050 C C   . LYS B 1 53  ? 21.702  37.160 -39.557 1.00 36.20 ? 56  LYS B C   1 
ATOM   2051 O O   . LYS B 1 53  ? 21.196  37.914 -40.386 1.00 37.71 ? 56  LYS B O   1 
ATOM   2052 C CB  . LYS B 1 53  ? 23.771  38.578 -39.620 1.00 36.49 ? 56  LYS B CB  1 
ATOM   2053 C CG  . LYS B 1 53  ? 25.013  39.046 -38.908 1.00 37.97 ? 56  LYS B CG  1 
ATOM   2054 C CD  . LYS B 1 53  ? 25.682  40.198 -39.627 1.00 38.39 ? 56  LYS B CD  1 
ATOM   2055 C CE  . LYS B 1 53  ? 26.826  40.758 -38.795 1.00 41.04 ? 56  LYS B CE  1 
ATOM   2056 N NZ  . LYS B 1 53  ? 27.785  39.672 -38.431 1.00 45.58 ? 56  LYS B NZ  1 
ATOM   2057 N N   . SER B 1 54  ? 21.182  35.980 -39.236 1.00 33.29 ? 57  SER B N   1 
ATOM   2058 C CA  . SER B 1 54  ? 19.994  35.433 -39.874 1.00 32.87 ? 57  SER B CA  1 
ATOM   2059 C C   . SER B 1 54  ? 18.635  35.726 -39.215 1.00 32.03 ? 57  SER B C   1 
ATOM   2060 O O   . SER B 1 54  ? 17.599  35.230 -39.664 1.00 31.38 ? 57  SER B O   1 
ATOM   2061 C CB  . SER B 1 54  ? 20.175  33.925 -40.011 1.00 34.18 ? 57  SER B CB  1 
ATOM   2062 O OG  . SER B 1 54  ? 20.442  33.334 -38.754 1.00 34.60 ? 57  SER B OG  1 
ATOM   2063 N N   . SER B 1 55  ? 18.632  36.523 -38.156 1.00 32.80 ? 58  SER B N   1 
ATOM   2064 C CA  . SER B 1 55  ? 17.394  36.838 -37.453 1.00 31.86 ? 58  SER B CA  1 
ATOM   2065 C C   . SER B 1 55  ? 17.552  38.058 -36.603 1.00 30.67 ? 58  SER B C   1 
ATOM   2066 O O   . SER B 1 55  ? 18.652  38.363 -36.143 1.00 33.39 ? 58  SER B O   1 
ATOM   2067 C CB  . SER B 1 55  ? 16.973  35.692 -36.541 1.00 33.54 ? 58  SER B CB  1 
ATOM   2068 O OG  . SER B 1 55  ? 16.351  34.662 -37.282 1.00 39.05 ? 58  SER B OG  1 
ATOM   2069 N N   . ALA B 1 56  ? 16.441  38.749 -36.386 1.00 28.47 ? 59  ALA B N   1 
ATOM   2070 C CA  . ALA B 1 56  ? 16.429  39.943 -35.558 1.00 27.09 ? 59  ALA B CA  1 
ATOM   2071 C C   . ALA B 1 56  ? 16.308  39.507 -34.097 1.00 25.84 ? 59  ALA B C   1 
ATOM   2072 O O   . ALA B 1 56  ? 15.807  38.419 -33.792 1.00 23.41 ? 59  ALA B O   1 
ATOM   2073 C CB  . ALA B 1 56  ? 15.259  40.840 -35.951 1.00 26.50 ? 59  ALA B CB  1 
ATOM   2074 N N   . PRO B 1 57  ? 16.860  40.295 -33.177 1.00 26.40 ? 60  PRO B N   1 
ATOM   2075 C CA  . PRO B 1 57  ? 16.720  39.865 -31.792 1.00 26.96 ? 60  PRO B CA  1 
ATOM   2076 C C   . PRO B 1 57  ? 15.253  39.819 -31.364 1.00 26.61 ? 60  PRO B C   1 
ATOM   2077 O O   . PRO B 1 57  ? 14.471  40.720 -31.696 1.00 26.43 ? 60  PRO B O   1 
ATOM   2078 C CB  . PRO B 1 57  ? 17.513  40.932 -31.021 1.00 26.26 ? 60  PRO B CB  1 
ATOM   2079 C CG  . PRO B 1 57  ? 17.501  42.113 -31.928 1.00 28.14 ? 60  PRO B CG  1 
ATOM   2080 C CD  . PRO B 1 57  ? 17.731  41.476 -33.273 1.00 27.91 ? 60  PRO B CD  1 
ATOM   2081 N N   . LYS B 1 58  ? 14.886  38.741 -30.668 1.00 26.69 ? 61  LYS B N   1 
ATOM   2082 C CA  . LYS B 1 58  ? 13.533  38.553 -30.157 1.00 27.44 ? 61  LYS B CA  1 
ATOM   2083 C C   . LYS B 1 58  ? 13.127  39.724 -29.267 1.00 28.11 ? 61  LYS B C   1 
ATOM   2084 O O   . LYS B 1 58  ? 11.939  40.030 -29.140 1.00 29.35 ? 61  LYS B O   1 
ATOM   2085 C CB  . LYS B 1 58  ? 13.430  37.242 -29.393 1.00 29.54 ? 61  LYS B CB  1 
ATOM   2086 C CG  . LYS B 1 58  ? 13.428  36.012 -30.291 1.00 34.08 ? 61  LYS B CG  1 
ATOM   2087 C CD  . LYS B 1 58  ? 13.145  34.737 -29.493 1.00 38.98 ? 61  LYS B CD  1 
ATOM   2088 C CE  . LYS B 1 58  ? 12.836  33.546 -30.407 1.00 43.34 ? 61  LYS B CE  1 
ATOM   2089 N NZ  . LYS B 1 58  ? 12.620  32.268 -29.654 1.00 45.15 ? 61  LYS B NZ  1 
ATOM   2090 N N   . ARG B 1 59  ? 14.126  40.374 -28.664 1.00 27.30 ? 62  ARG B N   1 
ATOM   2091 C CA  . ARG B 1 59  ? 13.936  41.552 -27.811 1.00 27.76 ? 62  ARG B CA  1 
ATOM   2092 C C   . ARG B 1 59  ? 15.196  42.415 -27.897 1.00 27.53 ? 62  ARG B C   1 
ATOM   2093 O O   . ARG B 1 59  ? 16.303  41.893 -28.016 1.00 26.61 ? 62  ARG B O   1 
ATOM   2094 C CB  . ARG B 1 59  ? 13.677  41.164 -26.339 1.00 28.20 ? 62  ARG B CB  1 
ATOM   2095 C CG  . ARG B 1 59  ? 12.346  40.450 -26.083 1.00 29.36 ? 62  ARG B CG  1 
ATOM   2096 C CD  . ARG B 1 59  ? 11.159  41.357 -26.321 1.00 28.99 ? 62  ARG B CD  1 
ATOM   2097 N NE  . ARG B 1 59  ? 11.014  42.304 -25.231 1.00 33.45 ? 62  ARG B NE  1 
ATOM   2098 C CZ  . ARG B 1 59  ? 11.286  43.596 -25.324 1.00 33.51 ? 62  ARG B CZ  1 
ATOM   2099 N NH1 . ARG B 1 59  ? 11.721  44.091 -26.484 1.00 36.90 ? 62  ARG B NH1 1 
ATOM   2100 N NH2 . ARG B 1 59  ? 11.160  44.384 -24.259 1.00 25.87 ? 62  ARG B NH2 1 
ATOM   2101 N N   . SER B 1 60  ? 15.018  43.731 -27.815 1.00 26.93 ? 63  SER B N   1 
ATOM   2102 C CA  . SER B 1 60  ? 16.119  44.688 -27.881 1.00 26.17 ? 63  SER B CA  1 
ATOM   2103 C C   . SER B 1 60  ? 15.772  45.816 -26.911 1.00 26.33 ? 63  SER B C   1 
ATOM   2104 O O   . SER B 1 60  ? 15.018  46.731 -27.241 1.00 27.30 ? 63  SER B O   1 
ATOM   2105 C CB  . SER B 1 60  ? 16.267  45.228 -29.319 1.00 25.51 ? 63  SER B CB  1 
ATOM   2106 O OG  . SER B 1 60  ? 17.337  46.150 -29.466 1.00 23.88 ? 63  SER B OG  1 
ATOM   2107 N N   . ILE B 1 61  ? 16.298  45.723 -25.699 1.00 27.97 ? 64  ILE B N   1 
ATOM   2108 C CA  . ILE B 1 61  ? 16.032  46.719 -24.667 1.00 26.98 ? 64  ILE B CA  1 
ATOM   2109 C C   . ILE B 1 61  ? 17.147  47.748 -24.448 1.00 27.07 ? 64  ILE B C   1 
ATOM   2110 O O   . ILE B 1 61  ? 18.272  47.394 -24.083 1.00 26.31 ? 64  ILE B O   1 
ATOM   2111 C CB  . ILE B 1 61  ? 15.721  46.014 -23.322 1.00 26.72 ? 64  ILE B CB  1 
ATOM   2112 C CG1 . ILE B 1 61  ? 14.569  45.021 -23.518 1.00 25.82 ? 64  ILE B CG1 1 
ATOM   2113 C CG2 . ILE B 1 61  ? 15.398  47.054 -22.234 1.00 25.93 ? 64  ILE B CG2 1 
ATOM   2114 C CD1 . ILE B 1 61  ? 14.601  43.821 -22.605 1.00 26.23 ? 64  ILE B CD1 1 
ATOM   2115 N N   . PRO B 1 62  ? 16.854  49.036 -24.707 1.00 28.20 ? 65  PRO B N   1 
ATOM   2116 C CA  . PRO B 1 62  ? 17.821  50.134 -24.528 1.00 29.50 ? 65  PRO B CA  1 
ATOM   2117 C C   . PRO B 1 62  ? 18.141  50.304 -23.036 1.00 29.02 ? 65  PRO B C   1 
ATOM   2118 O O   . PRO B 1 62  ? 17.229  50.338 -22.215 1.00 28.93 ? 65  PRO B O   1 
ATOM   2119 C CB  . PRO B 1 62  ? 17.051  51.356 -25.050 1.00 28.35 ? 65  PRO B CB  1 
ATOM   2120 C CG  . PRO B 1 62  ? 16.130  50.764 -26.093 1.00 27.96 ? 65  PRO B CG  1 
ATOM   2121 C CD  . PRO B 1 62  ? 15.642  49.507 -25.405 1.00 28.05 ? 65  PRO B CD  1 
ATOM   2122 N N   . LEU B 1 63  ? 19.420  50.390 -22.682 1.00 29.96 ? 66  LEU B N   1 
ATOM   2123 C CA  . LEU B 1 63  ? 19.802  50.549 -21.274 1.00 32.26 ? 66  LEU B CA  1 
ATOM   2124 C C   . LEU B 1 63  ? 19.376  51.897 -20.695 1.00 34.14 ? 66  LEU B C   1 
ATOM   2125 O O   . LEU B 1 63  ? 19.092  52.009 -19.498 1.00 34.25 ? 66  LEU B O   1 
ATOM   2126 C CB  . LEU B 1 63  ? 21.311  50.383 -21.086 1.00 31.99 ? 66  LEU B CB  1 
ATOM   2127 C CG  . LEU B 1 63  ? 21.919  49.015 -21.372 1.00 32.37 ? 66  LEU B CG  1 
ATOM   2128 C CD1 . LEU B 1 63  ? 23.392  49.027 -21.004 1.00 32.43 ? 66  LEU B CD1 1 
ATOM   2129 C CD2 . LEU B 1 63  ? 21.166  47.948 -20.589 1.00 30.65 ? 66  LEU B CD2 1 
ATOM   2130 N N   . GLU B 1 64  ? 19.342  52.913 -21.554 1.00 35.95 ? 67  GLU B N   1 
ATOM   2131 C CA  . GLU B 1 64  ? 18.955  54.260 -21.161 1.00 37.77 ? 67  GLU B CA  1 
ATOM   2132 C C   . GLU B 1 64  ? 17.496  54.317 -20.718 1.00 37.28 ? 67  GLU B C   1 
ATOM   2133 O O   . GLU B 1 64  ? 17.084  55.276 -20.083 1.00 37.24 ? 67  GLU B O   1 
ATOM   2134 C CB  . GLU B 1 64  ? 19.207  55.249 -22.312 1.00 42.03 ? 67  GLU B CB  1 
ATOM   2135 C CG  . GLU B 1 64  ? 18.496  54.879 -23.613 1.00 50.21 ? 67  GLU B CG  1 
ATOM   2136 C CD  . GLU B 1 64  ? 18.712  55.883 -24.742 1.00 54.90 ? 67  GLU B CD  1 
ATOM   2137 O OE1 . GLU B 1 64  ? 18.121  55.671 -25.836 1.00 56.43 ? 67  GLU B OE1 1 
ATOM   2138 O OE2 . GLU B 1 64  ? 19.459  56.872 -24.537 1.00 57.17 ? 67  GLU B OE2 1 
ATOM   2139 N N   . SER B 1 65  ? 16.708  53.304 -21.064 1.00 37.07 ? 68  SER B N   1 
ATOM   2140 C CA  . SER B 1 65  ? 15.308  53.283 -20.651 1.00 36.67 ? 68  SER B CA  1 
ATOM   2141 C C   . SER B 1 65  ? 15.094  52.520 -19.329 1.00 36.44 ? 68  SER B C   1 
ATOM   2142 O O   . SER B 1 65  ? 13.987  52.499 -18.782 1.00 35.91 ? 68  SER B O   1 
ATOM   2143 C CB  . SER B 1 65  ? 14.406  52.735 -21.770 1.00 37.01 ? 68  SER B CB  1 
ATOM   2144 O OG  . SER B 1 65  ? 14.628  51.363 -22.027 1.00 39.56 ? 68  SER B OG  1 
ATOM   2145 N N   . CYS B 1 66  ? 16.165  51.906 -18.825 1.00 36.98 ? 69  CYS B N   1 
ATOM   2146 C CA  . CYS B 1 66  ? 16.124  51.158 -17.564 1.00 38.28 ? 69  CYS B CA  1 
ATOM   2147 C C   . CYS B 1 66  ? 16.429  52.104 -16.389 1.00 38.02 ? 69  CYS B C   1 
ATOM   2148 O O   . CYS B 1 66  ? 17.568  52.565 -16.238 1.00 38.07 ? 69  CYS B O   1 
ATOM   2149 C CB  . CYS B 1 66  ? 17.158  50.019 -17.574 1.00 37.66 ? 69  CYS B CB  1 
ATOM   2150 S SG  . CYS B 1 66  ? 16.897  48.728 -18.836 1.00 40.39 ? 69  CYS B SG  1 
ATOM   2151 N N   . PHE B 1 67  ? 15.422  52.413 -15.570 1.00 36.78 ? 70  PHE B N   1 
ATOM   2152 C CA  . PHE B 1 67  ? 15.672  53.294 -14.444 1.00 35.37 ? 70  PHE B CA  1 
ATOM   2153 C C   . PHE B 1 67  ? 16.379  52.575 -13.302 1.00 35.55 ? 70  PHE B C   1 
ATOM   2154 O O   . PHE B 1 67  ? 17.119  53.195 -12.550 1.00 36.27 ? 70  PHE B O   1 
ATOM   2155 C CB  . PHE B 1 67  ? 14.396  54.011 -13.981 1.00 34.58 ? 70  PHE B CB  1 
ATOM   2156 C CG  . PHE B 1 67  ? 13.413  53.138 -13.277 1.00 35.49 ? 70  PHE B CG  1 
ATOM   2157 C CD1 . PHE B 1 67  ? 13.386  53.085 -11.882 1.00 36.40 ? 70  PHE B CD1 1 
ATOM   2158 C CD2 . PHE B 1 67  ? 12.485  52.398 -13.992 1.00 34.08 ? 70  PHE B CD2 1 
ATOM   2159 C CE1 . PHE B 1 67  ? 12.445  52.305 -11.208 1.00 35.09 ? 70  PHE B CE1 1 
ATOM   2160 C CE2 . PHE B 1 67  ? 11.537  51.613 -13.332 1.00 33.74 ? 70  PHE B CE2 1 
ATOM   2161 C CZ  . PHE B 1 67  ? 11.519  51.568 -11.936 1.00 33.87 ? 70  PHE B CZ  1 
ATOM   2162 N N   . ASN B 1 68  ? 16.209  51.257 -13.214 1.00 35.30 ? 71  ASN B N   1 
ATOM   2163 C CA  . ASN B 1 68  ? 16.853  50.485 -12.159 1.00 34.11 ? 71  ASN B CA  1 
ATOM   2164 C C   . ASN B 1 68  ? 17.247  49.077 -12.587 1.00 32.64 ? 71  ASN B C   1 
ATOM   2165 O O   . ASN B 1 68  ? 16.548  48.437 -13.368 1.00 32.07 ? 71  ASN B O   1 
ATOM   2166 C CB  . ASN B 1 68  ? 15.931  50.411 -10.937 1.00 36.64 ? 71  ASN B CB  1 
ATOM   2167 C CG  . ASN B 1 68  ? 16.522  49.588 -9.797  1.00 40.05 ? 71  ASN B CG  1 
ATOM   2168 O OD1 . ASN B 1 68  ? 16.122  48.449 -9.582  1.00 39.94 ? 71  ASN B OD1 1 
ATOM   2169 N ND2 . ASN B 1 68  ? 17.461  50.167 -9.058  1.00 40.84 ? 71  ASN B ND2 1 
ATOM   2170 N N   . ILE B 1 69  ? 18.392  48.615 -12.087 1.00 31.88 ? 72  ILE B N   1 
ATOM   2171 C CA  . ILE B 1 69  ? 18.887  47.269 -12.364 1.00 32.56 ? 72  ILE B CA  1 
ATOM   2172 C C   . ILE B 1 69  ? 19.252  46.639 -11.012 1.00 32.84 ? 72  ILE B C   1 
ATOM   2173 O O   . ILE B 1 69  ? 19.975  47.241 -10.228 1.00 33.18 ? 72  ILE B O   1 
ATOM   2174 C CB  . ILE B 1 69  ? 20.128  47.284 -13.314 1.00 33.21 ? 72  ILE B CB  1 
ATOM   2175 C CG1 . ILE B 1 69  ? 19.800  48.069 -14.596 1.00 32.90 ? 72  ILE B CG1 1 
ATOM   2176 C CG2 . ILE B 1 69  ? 20.566  45.845 -13.646 1.00 31.64 ? 72  ILE B CG2 1 
ATOM   2177 C CD1 . ILE B 1 69  ? 20.789  47.896 -15.741 1.00 35.60 ? 72  ILE B CD1 1 
ATOM   2178 N N   . ASN B 1 70  ? 18.722  45.450 -10.733 1.00 33.79 ? 73  ASN B N   1 
ATOM   2179 C CA  . ASN B 1 70  ? 18.973  44.737 -9.472  1.00 33.45 ? 73  ASN B CA  1 
ATOM   2180 C C   . ASN B 1 70  ? 19.224  43.236 -9.641  1.00 32.53 ? 73  ASN B C   1 
ATOM   2181 O O   . ASN B 1 70  ? 18.919  42.657 -10.687 1.00 33.52 ? 73  ASN B O   1 
ATOM   2182 C CB  . ASN B 1 70  ? 17.758  44.866 -8.543  1.00 35.84 ? 73  ASN B CB  1 
ATOM   2183 C CG  . ASN B 1 70  ? 17.757  46.146 -7.737  1.00 39.65 ? 73  ASN B CG  1 
ATOM   2184 O OD1 . ASN B 1 70  ? 18.697  46.438 -6.987  1.00 43.01 ? 73  ASN B OD1 1 
ATOM   2185 N ND2 . ASN B 1 70  ? 16.678  46.901 -7.850  1.00 38.31 ? 73  ASN B ND2 1 
ATOM   2186 N N   . LYS B 1 71  ? 19.820  42.623 -8.618  1.00 29.28 ? 74  LYS B N   1 
ATOM   2187 C CA  . LYS B 1 71  ? 20.036  41.178 -8.593  1.00 27.79 ? 74  LYS B CA  1 
ATOM   2188 C C   . LYS B 1 71  ? 18.868  40.690 -7.749  1.00 27.60 ? 74  LYS B C   1 
ATOM   2189 O O   . LYS B 1 71  ? 18.587  41.247 -6.695  1.00 29.44 ? 74  LYS B O   1 
ATOM   2190 C CB  . LYS B 1 71  ? 21.340  40.812 -7.907  1.00 26.76 ? 74  LYS B CB  1 
ATOM   2191 C CG  . LYS B 1 71  ? 22.601  41.236 -8.626  1.00 27.45 ? 74  LYS B CG  1 
ATOM   2192 C CD  . LYS B 1 71  ? 23.763  40.492 -7.995  1.00 29.05 ? 74  LYS B CD  1 
ATOM   2193 C CE  . LYS B 1 71  ? 25.079  40.880 -8.590  1.00 31.58 ? 74  LYS B CE  1 
ATOM   2194 N NZ  . LYS B 1 71  ? 25.539  42.166 -8.036  1.00 34.25 ? 74  LYS B NZ  1 
ATOM   2195 N N   . ARG B 1 72  ? 18.168  39.675 -8.222  1.00 26.99 ? 75  ARG B N   1 
ATOM   2196 C CA  . ARG B 1 72  ? 17.000  39.179 -7.519  1.00 27.26 ? 75  ARG B CA  1 
ATOM   2197 C C   . ARG B 1 72  ? 17.019  37.677 -7.377  1.00 27.84 ? 75  ARG B C   1 
ATOM   2198 O O   . ARG B 1 72  ? 17.942  37.025 -7.837  1.00 30.26 ? 75  ARG B O   1 
ATOM   2199 C CB  . ARG B 1 72  ? 15.745  39.593 -8.289  1.00 28.47 ? 75  ARG B CB  1 
ATOM   2200 C CG  . ARG B 1 72  ? 15.297  41.024 -8.055  1.00 31.63 ? 75  ARG B CG  1 
ATOM   2201 C CD  . ARG B 1 72  ? 14.589  41.117 -6.714  1.00 33.71 ? 75  ARG B CD  1 
ATOM   2202 N NE  . ARG B 1 72  ? 14.095  42.457 -6.421  1.00 32.28 ? 75  ARG B NE  1 
ATOM   2203 C CZ  . ARG B 1 72  ? 14.856  43.431 -5.963  1.00 34.72 ? 75  ARG B CZ  1 
ATOM   2204 N NH1 . ARG B 1 72  ? 16.139  43.209 -5.757  1.00 37.58 ? 75  ARG B NH1 1 
ATOM   2205 N NH2 . ARG B 1 72  ? 14.327  44.605 -5.671  1.00 36.40 ? 75  ARG B NH2 1 
ATOM   2206 N N   . ALA B 1 73  ? 15.973  37.131 -6.768  1.00 27.74 ? 76  ALA B N   1 
ATOM   2207 C CA  . ALA B 1 73  ? 15.837  35.699 -6.568  1.00 27.31 ? 76  ALA B CA  1 
ATOM   2208 C C   . ALA B 1 73  ? 14.423  35.364 -6.116  1.00 28.87 ? 76  ALA B C   1 
ATOM   2209 O O   . ALA B 1 73  ? 13.758  36.174 -5.463  1.00 29.90 ? 76  ALA B O   1 
ATOM   2210 C CB  . ALA B 1 73  ? 16.835  35.220 -5.531  1.00 25.16 ? 76  ALA B CB  1 
ATOM   2211 N N   . ASP B 1 74  ? 13.929  34.209 -6.547  1.00 30.61 ? 77  ASP B N   1 
ATOM   2212 C CA  . ASP B 1 74  ? 12.617  33.733 -6.132  1.00 32.65 ? 77  ASP B CA  1 
ATOM   2213 C C   . ASP B 1 74  ? 12.669  32.213 -5.901  1.00 34.66 ? 77  ASP B C   1 
ATOM   2214 O O   . ASP B 1 74  ? 13.756  31.618 -5.904  1.00 33.60 ? 77  ASP B O   1 
ATOM   2215 C CB  . ASP B 1 74  ? 11.500  34.159 -7.103  1.00 32.55 ? 77  ASP B CB  1 
ATOM   2216 C CG  . ASP B 1 74  ? 11.778  33.786 -8.550  1.00 32.42 ? 77  ASP B CG  1 
ATOM   2217 O OD1 . ASP B 1 74  ? 11.505  34.627 -9.413  1.00 33.48 ? 77  ASP B OD1 1 
ATOM   2218 O OD2 . ASP B 1 74  ? 12.223  32.667 -8.850  1.00 30.31 ? 77  ASP B OD2 1 
ATOM   2219 N N   . SER B 1 75  ? 11.512  31.592 -5.681  1.00 36.35 ? 78  SER B N   1 
ATOM   2220 C CA  . SER B 1 75  ? 11.468  30.156 -5.424  1.00 38.94 ? 78  SER B CA  1 
ATOM   2221 C C   . SER B 1 75  ? 11.926  29.303 -6.596  1.00 40.80 ? 78  SER B C   1 
ATOM   2222 O O   . SER B 1 75  ? 12.368  28.168 -6.413  1.00 41.63 ? 78  SER B O   1 
ATOM   2223 C CB  . SER B 1 75  ? 10.065  29.738 -5.015  1.00 38.79 ? 78  SER B CB  1 
ATOM   2224 O OG  . SER B 1 75  ? 9.154   30.048 -6.041  1.00 40.15 ? 78  SER B OG  1 
ATOM   2225 N N   . LYS B 1 76  ? 11.825  29.853 -7.798  1.00 42.31 ? 79  LYS B N   1 
ATOM   2226 C CA  . LYS B 1 76  ? 12.217  29.132 -9.001  1.00 43.49 ? 79  LYS B CA  1 
ATOM   2227 C C   . LYS B 1 76  ? 13.650  29.405 -9.461  1.00 43.09 ? 79  LYS B C   1 
ATOM   2228 O O   . LYS B 1 76  ? 14.414  28.468 -9.703  1.00 44.46 ? 79  LYS B O   1 
ATOM   2229 C CB  . LYS B 1 76  ? 11.225  29.426 -10.136 1.00 45.55 ? 79  LYS B CB  1 
ATOM   2230 C CG  . LYS B 1 76  ? 9.954   28.571 -10.104 1.00 49.99 ? 79  LYS B CG  1 
ATOM   2231 C CD  . LYS B 1 76  ? 9.313   28.568 -8.729  1.00 53.24 ? 79  LYS B CD  1 
ATOM   2232 C CE  . LYS B 1 76  ? 8.031   27.737 -8.662  1.00 53.24 ? 79  LYS B CE  1 
ATOM   2233 N NZ  . LYS B 1 76  ? 7.533   27.632 -7.240  1.00 51.18 ? 79  LYS B NZ  1 
ATOM   2234 N N   . ASN B 1 77  ? 14.022  30.680 -9.552  1.00 40.76 ? 80  ASN B N   1 
ATOM   2235 C CA  . ASN B 1 77  ? 15.351  31.065 -10.011 1.00 38.66 ? 80  ASN B CA  1 
ATOM   2236 C C   . ASN B 1 77  ? 16.152  31.765 -8.919  1.00 38.27 ? 80  ASN B C   1 
ATOM   2237 O O   . ASN B 1 77  ? 15.789  32.854 -8.477  1.00 38.73 ? 80  ASN B O   1 
ATOM   2238 C CB  . ASN B 1 77  ? 15.226  31.984 -11.231 1.00 39.04 ? 80  ASN B CB  1 
ATOM   2239 C CG  . ASN B 1 77  ? 14.177  31.500 -12.226 1.00 39.18 ? 80  ASN B CG  1 
ATOM   2240 O OD1 . ASN B 1 77  ? 14.377  30.494 -12.892 1.00 41.20 ? 80  ASN B OD1 1 
ATOM   2241 N ND2 . ASN B 1 77  ? 13.055  32.216 -12.322 1.00 37.28 ? 80  ASN B ND2 1 
ATOM   2242 N N   . LYS B 1 78  ? 17.279  31.167 -8.543  1.00 37.86 ? 81  LYS B N   1 
ATOM   2243 C CA  . LYS B 1 78  ? 18.146  31.712 -7.502  1.00 37.13 ? 81  LYS B CA  1 
ATOM   2244 C C   . LYS B 1 78  ? 19.041  32.889 -7.876  1.00 35.52 ? 81  LYS B C   1 
ATOM   2245 O O   . LYS B 1 78  ? 19.471  33.621 -6.995  1.00 35.14 ? 81  LYS B O   1 
ATOM   2246 C CB  . LYS B 1 78  ? 19.015  30.607 -6.909  1.00 39.46 ? 81  LYS B CB  1 
ATOM   2247 C CG  . LYS B 1 78  ? 18.282  29.650 -6.008  1.00 43.66 ? 81  LYS B CG  1 
ATOM   2248 C CD  . LYS B 1 78  ? 19.210  28.538 -5.564  1.00 47.63 ? 81  LYS B CD  1 
ATOM   2249 C CE  . LYS B 1 78  ? 18.528  27.606 -4.563  1.00 51.58 ? 81  LYS B CE  1 
ATOM   2250 N NZ  . LYS B 1 78  ? 19.320  26.367 -4.273  1.00 53.58 ? 81  LYS B NZ  1 
ATOM   2251 N N   . HIS B 1 79  ? 19.325  33.079 -9.164  1.00 34.73 ? 82  HIS B N   1 
ATOM   2252 C CA  . HIS B 1 79  ? 20.204  34.176 -9.590  1.00 32.40 ? 82  HIS B CA  1 
ATOM   2253 C C   . HIS B 1 79  ? 19.665  35.047 -10.720 1.00 31.55 ? 82  HIS B C   1 
ATOM   2254 O O   . HIS B 1 79  ? 20.158  34.997 -11.856 1.00 32.28 ? 82  HIS B O   1 
ATOM   2255 C CB  . HIS B 1 79  ? 21.565  33.622 -9.981  1.00 31.54 ? 82  HIS B CB  1 
ATOM   2256 C CG  . HIS B 1 79  ? 22.027  32.522 -9.089  1.00 31.77 ? 82  HIS B CG  1 
ATOM   2257 N ND1 . HIS B 1 79  ? 21.792  31.194 -9.368  1.00 31.99 ? 82  HIS B ND1 1 
ATOM   2258 C CD2 . HIS B 1 79  ? 22.668  32.551 -7.898  1.00 31.60 ? 82  HIS B CD2 1 
ATOM   2259 C CE1 . HIS B 1 79  ? 22.267  30.449 -8.386  1.00 31.75 ? 82  HIS B CE1 1 
ATOM   2260 N NE2 . HIS B 1 79  ? 22.804  31.249 -7.482  1.00 32.58 ? 82  HIS B NE2 1 
ATOM   2261 N N   . LEU B 1 80  ? 18.677  35.871 -10.395 1.00 28.24 ? 83  LEU B N   1 
ATOM   2262 C CA  . LEU B 1 80  ? 18.067  36.757 -11.369 1.00 27.50 ? 83  LEU B CA  1 
ATOM   2263 C C   . LEU B 1 80  ? 18.786  38.093 -11.497 1.00 28.17 ? 83  LEU B C   1 
ATOM   2264 O O   . LEU B 1 80  ? 19.492  38.530 -10.587 1.00 29.38 ? 83  LEU B O   1 
ATOM   2265 C CB  . LEU B 1 80  ? 16.617  37.027 -10.971 1.00 24.61 ? 83  LEU B CB  1 
ATOM   2266 C CG  . LEU B 1 80  ? 15.660  35.838 -10.964 1.00 24.19 ? 83  LEU B CG  1 
ATOM   2267 C CD1 . LEU B 1 80  ? 14.440  36.131 -10.095 1.00 22.08 ? 83  LEU B CD1 1 
ATOM   2268 C CD2 . LEU B 1 80  ? 15.243  35.523 -12.396 1.00 23.64 ? 83  LEU B CD2 1 
ATOM   2269 N N   . VAL B 1 81  ? 18.644  38.714 -12.665 1.00 27.42 ? 84  VAL B N   1 
ATOM   2270 C CA  . VAL B 1 81  ? 19.197  40.045 -12.917 1.00 26.08 ? 84  VAL B CA  1 
ATOM   2271 C C   . VAL B 1 81  ? 18.015  40.747 -13.548 1.00 26.06 ? 84  VAL B C   1 
ATOM   2272 O O   . VAL B 1 81  ? 17.600  40.393 -14.658 1.00 27.31 ? 84  VAL B O   1 
ATOM   2273 C CB  . VAL B 1 81  ? 20.353  40.038 -13.908 1.00 25.63 ? 84  VAL B CB  1 
ATOM   2274 C CG1 . VAL B 1 81  ? 20.874  41.464 -14.081 1.00 25.04 ? 84  VAL B CG1 1 
ATOM   2275 C CG2 . VAL B 1 81  ? 21.455  39.099 -13.439 1.00 25.38 ? 84  VAL B CG2 1 
ATOM   2276 N N   . ALA B 1 82  ? 17.425  41.682 -12.814 1.00 25.80 ? 85  ALA B N   1 
ATOM   2277 C CA  . ALA B 1 82  ? 16.246  42.381 -13.297 1.00 24.52 ? 85  ALA B CA  1 
ATOM   2278 C C   . ALA B 1 82  ? 16.448  43.835 -13.739 1.00 24.85 ? 85  ALA B C   1 
ATOM   2279 O O   . ALA B 1 82  ? 17.183  44.607 -13.122 1.00 26.40 ? 85  ALA B O   1 
ATOM   2280 C CB  . ALA B 1 82  ? 15.146  42.287 -12.261 1.00 25.30 ? 85  ALA B CB  1 
ATOM   2281 N N   . LEU B 1 83  ? 15.806  44.178 -14.848 1.00 24.89 ? 86  LEU B N   1 
ATOM   2282 C CA  . LEU B 1 83  ? 15.862  45.511 -15.413 1.00 24.68 ? 86  LEU B CA  1 
ATOM   2283 C C   . LEU B 1 83  ? 14.473  46.108 -15.235 1.00 24.43 ? 86  LEU B C   1 
ATOM   2284 O O   . LEU B 1 83  ? 13.461  45.439 -15.471 1.00 26.35 ? 86  LEU B O   1 
ATOM   2285 C CB  . LEU B 1 83  ? 16.199  45.453 -16.903 1.00 26.57 ? 86  LEU B CB  1 
ATOM   2286 C CG  . LEU B 1 83  ? 17.581  44.997 -17.370 1.00 24.57 ? 86  LEU B CG  1 
ATOM   2287 C CD1 . LEU B 1 83  ? 17.903  43.597 -16.859 1.00 28.41 ? 86  LEU B CD1 1 
ATOM   2288 C CD2 . LEU B 1 83  ? 17.604  45.015 -18.887 1.00 25.56 ? 86  LEU B CD2 1 
ATOM   2289 N N   . TYR B 1 84  ? 14.422  47.355 -14.799 1.00 22.88 ? 87  TYR B N   1 
ATOM   2290 C CA  . TYR B 1 84  ? 13.153  48.019 -14.603 1.00 23.24 ? 87  TYR B CA  1 
ATOM   2291 C C   . TYR B 1 84  ? 13.115  49.254 -15.475 1.00 25.46 ? 87  TYR B C   1 
ATOM   2292 O O   . TYR B 1 84  ? 13.925  50.173 -15.301 1.00 26.41 ? 87  TYR B O   1 
ATOM   2293 C CB  . TYR B 1 84  ? 12.966  48.416 -13.136 1.00 20.91 ? 87  TYR B CB  1 
ATOM   2294 C CG  . TYR B 1 84  ? 12.868  47.235 -12.209 1.00 18.89 ? 87  TYR B CG  1 
ATOM   2295 C CD1 . TYR B 1 84  ? 11.632  46.742 -11.817 1.00 21.93 ? 87  TYR B CD1 1 
ATOM   2296 C CD2 . TYR B 1 84  ? 14.016  46.599 -11.730 1.00 19.90 ? 87  TYR B CD2 1 
ATOM   2297 C CE1 . TYR B 1 84  ? 11.538  45.640 -10.971 1.00 22.20 ? 87  TYR B CE1 1 
ATOM   2298 C CE2 . TYR B 1 84  ? 13.930  45.509 -10.890 1.00 18.64 ? 87  TYR B CE2 1 
ATOM   2299 C CZ  . TYR B 1 84  ? 12.689  45.033 -10.518 1.00 20.88 ? 87  TYR B CZ  1 
ATOM   2300 O OH  . TYR B 1 84  ? 12.593  43.916 -9.727  1.00 21.98 ? 87  TYR B OH  1 
ATOM   2301 N N   . THR B 1 85  ? 12.241  49.239 -16.476 1.00 25.70 ? 88  THR B N   1 
ATOM   2302 C CA  . THR B 1 85  ? 12.109  50.401 -17.337 1.00 26.69 ? 88  THR B CA  1 
ATOM   2303 C C   . THR B 1 85  ? 10.816  51.027 -16.865 1.00 28.01 ? 88  THR B C   1 
ATOM   2304 O O   . THR B 1 85  ? 10.228  50.565 -15.898 1.00 28.91 ? 88  THR B O   1 
ATOM   2305 C CB  . THR B 1 85  ? 12.009  50.019 -18.843 1.00 26.65 ? 88  THR B CB  1 
ATOM   2306 O OG1 . THR B 1 85  ? 10.739  49.404 -19.110 1.00 29.19 ? 88  THR B OG1 1 
ATOM   2307 C CG2 . THR B 1 85  ? 13.133  49.047 -19.235 1.00 26.31 ? 88  THR B CG2 1 
ATOM   2308 N N   . ARG B 1 86  ? 10.382  52.081 -17.537 1.00 29.04 ? 89  ARG B N   1 
ATOM   2309 C CA  . ARG B 1 86  ? 9.140   52.759 -17.195 1.00 27.48 ? 89  ARG B CA  1 
ATOM   2310 C C   . ARG B 1 86  ? 7.937   51.871 -17.547 1.00 27.74 ? 89  ARG B C   1 
ATOM   2311 O O   . ARG B 1 86  ? 6.886   51.958 -16.927 1.00 28.50 ? 89  ARG B O   1 
ATOM   2312 C CB  . ARG B 1 86  ? 9.071   54.079 -17.976 1.00 27.19 ? 89  ARG B CB  1 
ATOM   2313 C CG  . ARG B 1 86  ? 7.847   54.930 -17.714 1.00 29.72 ? 89  ARG B CG  1 
ATOM   2314 C CD  . ARG B 1 86  ? 6.989   55.040 -18.963 1.00 31.49 ? 89  ARG B CD  1 
ATOM   2315 N NE  . ARG B 1 86  ? 7.533   55.972 -19.943 1.00 33.48 ? 89  ARG B NE  1 
ATOM   2316 C CZ  . ARG B 1 86  ? 7.388   55.859 -21.262 1.00 34.05 ? 89  ARG B CZ  1 
ATOM   2317 N NH1 . ARG B 1 86  ? 6.715   54.853 -21.799 1.00 34.10 ? 89  ARG B NH1 1 
ATOM   2318 N NH2 . ARG B 1 86  ? 7.942   56.759 -22.045 1.00 35.09 ? 89  ARG B NH2 1 
ATOM   2319 N N   . ASP B 1 87  ? 8.129   50.934 -18.461 1.00 28.64 ? 90  ASP B N   1 
ATOM   2320 C CA  . ASP B 1 87  ? 7.016   50.111 -18.905 1.00 29.62 ? 90  ASP B CA  1 
ATOM   2321 C C   . ASP B 1 87  ? 6.969   48.627 -18.570 1.00 29.06 ? 90  ASP B C   1 
ATOM   2322 O O   . ASP B 1 87  ? 5.930   47.984 -18.768 1.00 27.35 ? 90  ASP B O   1 
ATOM   2323 C CB  . ASP B 1 87  ? 6.857   50.310 -20.406 1.00 32.38 ? 90  ASP B CB  1 
ATOM   2324 C CG  . ASP B 1 87  ? 6.783   51.775 -20.775 1.00 34.94 ? 90  ASP B CG  1 
ATOM   2325 O OD1 . ASP B 1 87  ? 5.932   52.480 -20.187 1.00 32.89 ? 90  ASP B OD1 1 
ATOM   2326 O OD2 . ASP B 1 87  ? 7.598   52.228 -21.608 1.00 37.99 ? 90  ASP B OD2 1 
ATOM   2327 N N   . GLU B 1 88  ? 8.058   48.083 -18.039 1.00 28.71 ? 91  GLU B N   1 
ATOM   2328 C CA  . GLU B 1 88  ? 8.071   46.662 -17.719 1.00 28.93 ? 91  GLU B CA  1 
ATOM   2329 C C   . GLU B 1 88  ? 9.202   46.246 -16.789 1.00 28.51 ? 91  GLU B C   1 
ATOM   2330 O O   . GLU B 1 88  ? 10.076  47.042 -16.415 1.00 29.92 ? 91  GLU B O   1 
ATOM   2331 C CB  . GLU B 1 88  ? 8.209   45.844 -19.005 1.00 30.88 ? 91  GLU B CB  1 
ATOM   2332 C CG  . GLU B 1 88  ? 9.609   45.929 -19.569 1.00 33.73 ? 91  GLU B CG  1 
ATOM   2333 C CD  . GLU B 1 88  ? 9.769   45.225 -20.882 1.00 35.16 ? 91  GLU B CD  1 
ATOM   2334 O OE1 . GLU B 1 88  ? 9.602   45.903 -21.916 1.00 36.75 ? 91  GLU B OE1 1 
ATOM   2335 O OE2 . GLU B 1 88  ? 10.084  44.013 -20.868 1.00 36.01 ? 91  GLU B OE2 1 
ATOM   2336 N N   . HIS B 1 89  ? 9.182   44.961 -16.464 1.00 27.37 ? 92  HIS B N   1 
ATOM   2337 C CA  . HIS B 1 89  ? 10.184  44.348 -15.615 1.00 27.96 ? 92  HIS B CA  1 
ATOM   2338 C C   . HIS B 1 89  ? 10.741  43.174 -16.424 1.00 27.81 ? 92  HIS B C   1 
ATOM   2339 O O   . HIS B 1 89  ? 10.066  42.165 -16.613 1.00 28.32 ? 92  HIS B O   1 
ATOM   2340 C CB  . HIS B 1 89  ? 9.541   43.873 -14.306 1.00 26.55 ? 92  HIS B CB  1 
ATOM   2341 C CG  . HIS B 1 89  ? 10.359  42.870 -13.564 1.00 25.74 ? 92  HIS B CG  1 
ATOM   2342 N ND1 . HIS B 1 89  ? 9.896   41.608 -13.274 1.00 26.04 ? 92  HIS B ND1 1 
ATOM   2343 C CD2 . HIS B 1 89  ? 11.620  42.932 -13.073 1.00 27.60 ? 92  HIS B CD2 1 
ATOM   2344 C CE1 . HIS B 1 89  ? 10.834  40.933 -12.636 1.00 26.84 ? 92  HIS B CE1 1 
ATOM   2345 N NE2 . HIS B 1 89  ? 11.891  41.716 -12.501 1.00 27.10 ? 92  HIS B NE2 1 
ATOM   2346 N N   . PHE B 1 90  ? 11.952  43.335 -16.947 1.00 27.63 ? 93  PHE B N   1 
ATOM   2347 C CA  . PHE B 1 90  ? 12.556  42.286 -17.750 1.00 26.88 ? 93  PHE B CA  1 
ATOM   2348 C C   . PHE B 1 90  ? 13.610  41.592 -16.929 1.00 26.17 ? 93  PHE B C   1 
ATOM   2349 O O   . PHE B 1 90  ? 14.545  42.226 -16.474 1.00 26.29 ? 93  PHE B O   1 
ATOM   2350 C CB  . PHE B 1 90  ? 13.157  42.869 -19.039 1.00 27.33 ? 93  PHE B CB  1 
ATOM   2351 C CG  . PHE B 1 90  ? 13.675  41.833 -20.000 1.00 29.01 ? 93  PHE B CG  1 
ATOM   2352 C CD1 . PHE B 1 90  ? 15.026  41.496 -20.019 1.00 29.57 ? 93  PHE B CD1 1 
ATOM   2353 C CD2 . PHE B 1 90  ? 12.814  41.194 -20.889 1.00 28.41 ? 93  PHE B CD2 1 
ATOM   2354 C CE1 . PHE B 1 90  ? 15.518  40.529 -20.914 1.00 28.85 ? 93  PHE B CE1 1 
ATOM   2355 C CE2 . PHE B 1 90  ? 13.294  40.224 -21.789 1.00 26.91 ? 93  PHE B CE2 1 
ATOM   2356 C CZ  . PHE B 1 90  ? 14.645  39.895 -21.798 1.00 29.37 ? 93  PHE B CZ  1 
ATOM   2357 N N   . ALA B 1 91  ? 13.455  40.284 -16.746 1.00 25.82 ? 94  ALA B N   1 
ATOM   2358 C CA  . ALA B 1 91  ? 14.411  39.514 -15.957 1.00 26.89 ? 94  ALA B CA  1 
ATOM   2359 C C   . ALA B 1 91  ? 15.084  38.417 -16.765 1.00 26.60 ? 94  ALA B C   1 
ATOM   2360 O O   . ALA B 1 91  ? 14.534  37.938 -17.754 1.00 26.16 ? 94  ALA B O   1 
ATOM   2361 C CB  . ALA B 1 91  ? 13.733  38.925 -14.717 1.00 25.88 ? 94  ALA B CB  1 
ATOM   2362 N N   . ILE B 1 92  ? 16.303  38.072 -16.350 1.00 25.35 ? 95  ILE B N   1 
ATOM   2363 C CA  . ILE B 1 92  ? 17.107  37.030 -16.981 1.00 25.11 ? 95  ILE B CA  1 
ATOM   2364 C C   . ILE B 1 92  ? 17.683  36.144 -15.872 1.00 24.36 ? 95  ILE B C   1 
ATOM   2365 O O   . ILE B 1 92  ? 18.176  36.640 -14.859 1.00 25.17 ? 95  ILE B O   1 
ATOM   2366 C CB  . ILE B 1 92  ? 18.243  37.634 -17.853 1.00 25.51 ? 95  ILE B CB  1 
ATOM   2367 C CG1 . ILE B 1 92  ? 19.205  38.468 -16.996 1.00 25.91 ? 95  ILE B CG1 1 
ATOM   2368 C CG2 . ILE B 1 92  ? 17.642  38.520 -18.937 1.00 24.57 ? 95  ILE B CG2 1 
ATOM   2369 C CD1 . ILE B 1 92  ? 20.377  39.037 -17.745 1.00 25.85 ? 95  ILE B CD1 1 
ATOM   2370 N N   . ALA B 1 93  ? 17.587  34.831 -16.052 1.00 25.37 ? 96  ALA B N   1 
ATOM   2371 C CA  . ALA B 1 93  ? 18.065  33.870 -15.066 1.00 23.69 ? 96  ALA B CA  1 
ATOM   2372 C C   . ALA B 1 93  ? 19.455  33.307 -15.339 1.00 25.20 ? 96  ALA B C   1 
ATOM   2373 O O   . ALA B 1 93  ? 19.639  32.493 -16.256 1.00 25.55 ? 96  ALA B O   1 
ATOM   2374 C CB  . ALA B 1 93  ? 17.069  32.739 -14.944 1.00 21.08 ? 96  ALA B CB  1 
ATOM   2375 N N   . ALA B 1 94  ? 20.431  33.743 -14.536 1.00 25.10 ? 97  ALA B N   1 
ATOM   2376 C CA  . ALA B 1 94  ? 21.814  33.265 -14.650 1.00 22.01 ? 97  ALA B CA  1 
ATOM   2377 C C   . ALA B 1 94  ? 21.926  31.898 -13.956 1.00 22.39 ? 97  ALA B C   1 
ATOM   2378 O O   . ALA B 1 94  ? 21.059  31.536 -13.166 1.00 21.56 ? 97  ALA B O   1 
ATOM   2379 C CB  . ALA B 1 94  ? 22.775  34.270 -14.041 1.00 21.09 ? 97  ALA B CB  1 
ATOM   2380 N N   . ASP B 1 95  ? 22.969  31.130 -14.253 1.00 22.50 ? 98  ASP B N   1 
ATOM   2381 C CA  . ASP B 1 95  ? 23.092  29.799 -13.660 1.00 23.51 ? 98  ASP B CA  1 
ATOM   2382 C C   . ASP B 1 95  ? 23.906  29.741 -12.370 1.00 23.86 ? 98  ASP B C   1 
ATOM   2383 O O   . ASP B 1 95  ? 24.078  28.683 -11.764 1.00 22.59 ? 98  ASP B O   1 
ATOM   2384 C CB  . ASP B 1 95  ? 23.631  28.789 -14.686 1.00 23.09 ? 98  ASP B CB  1 
ATOM   2385 C CG  . ASP B 1 95  ? 25.094  29.017 -15.047 1.00 24.01 ? 98  ASP B CG  1 
ATOM   2386 O OD1 . ASP B 1 95  ? 25.748  29.934 -14.507 1.00 24.18 ? 98  ASP B OD1 1 
ATOM   2387 O OD2 . ASP B 1 95  ? 25.597  28.262 -15.901 1.00 27.43 ? 98  ASP B OD2 1 
ATOM   2388 N N   . SER B 1 96  ? 24.395  30.897 -11.956 1.00 24.48 ? 99  SER B N   1 
ATOM   2389 C CA  . SER B 1 96  ? 25.196  30.988 -10.762 1.00 26.06 ? 99  SER B CA  1 
ATOM   2390 C C   . SER B 1 96  ? 25.272  32.426 -10.305 1.00 27.25 ? 99  SER B C   1 
ATOM   2391 O O   . SER B 1 96  ? 24.865  33.343 -11.014 1.00 28.77 ? 99  SER B O   1 
ATOM   2392 C CB  . SER B 1 96  ? 26.604  30.486 -11.050 1.00 26.15 ? 99  SER B CB  1 
ATOM   2393 O OG  . SER B 1 96  ? 27.253  31.332 -11.985 1.00 28.14 ? 99  SER B OG  1 
ATOM   2394 N N   . GLU B 1 97  ? 25.767  32.602 -9.092  1.00 27.69 ? 100 GLU B N   1 
ATOM   2395 C CA  . GLU B 1 97  ? 25.949  33.910 -8.502  1.00 28.27 ? 100 GLU B CA  1 
ATOM   2396 C C   . GLU B 1 97  ? 27.051  34.642 -9.285  1.00 27.44 ? 100 GLU B C   1 
ATOM   2397 O O   . GLU B 1 97  ? 26.966  35.851 -9.540  1.00 26.98 ? 100 GLU B O   1 
ATOM   2398 C CB  . GLU B 1 97  ? 26.350  33.707 -7.042  1.00 31.39 ? 100 GLU B CB  1 
ATOM   2399 C CG  . GLU B 1 97  ? 26.734  34.942 -6.268  1.00 38.40 ? 100 GLU B CG  1 
ATOM   2400 C CD  . GLU B 1 97  ? 26.983  34.608 -4.813  1.00 42.72 ? 100 GLU B CD  1 
ATOM   2401 O OE1 . GLU B 1 97  ? 26.225  33.769 -4.272  1.00 42.47 ? 100 GLU B OE1 1 
ATOM   2402 O OE2 . GLU B 1 97  ? 27.936  35.164 -4.217  1.00 46.46 ? 100 GLU B OE2 1 
ATOM   2403 N N   . ALA B 1 98  ? 28.054  33.876 -9.709  1.00 27.36 ? 101 ALA B N   1 
ATOM   2404 C CA  . ALA B 1 98  ? 29.184  34.401 -10.462 1.00 26.01 ? 101 ALA B CA  1 
ATOM   2405 C C   . ALA B 1 98  ? 28.704  34.971 -11.793 1.00 25.89 ? 101 ALA B C   1 
ATOM   2406 O O   . ALA B 1 98  ? 29.030  36.107 -12.150 1.00 25.03 ? 101 ALA B O   1 
ATOM   2407 C CB  . ALA B 1 98  ? 30.214  33.307 -10.686 1.00 23.68 ? 101 ALA B CB  1 
ATOM   2408 N N   . GLU B 1 99  ? 27.878  34.198 -12.491 1.00 26.06 ? 102 GLU B N   1 
ATOM   2409 C CA  . GLU B 1 99  ? 27.343  34.616 -13.780 1.00 26.91 ? 102 GLU B CA  1 
ATOM   2410 C C   . GLU B 1 99  ? 26.387  35.790 -13.615 1.00 28.28 ? 102 GLU B C   1 
ATOM   2411 O O   . GLU B 1 99  ? 26.417  36.737 -14.398 1.00 29.91 ? 102 GLU B O   1 
ATOM   2412 C CB  . GLU B 1 99  ? 26.632  33.453 -14.459 1.00 26.70 ? 102 GLU B CB  1 
ATOM   2413 C CG  . GLU B 1 99  ? 26.130  33.774 -15.850 1.00 26.18 ? 102 GLU B CG  1 
ATOM   2414 C CD  . GLU B 1 99  ? 25.620  32.549 -16.552 1.00 26.21 ? 102 GLU B CD  1 
ATOM   2415 O OE1 . GLU B 1 99  ? 26.420  31.880 -17.230 1.00 26.91 ? 102 GLU B OE1 1 
ATOM   2416 O OE2 . GLU B 1 99  ? 24.430  32.233 -16.402 1.00 26.02 ? 102 GLU B OE2 1 
ATOM   2417 N N   . GLN B 1 100 ? 25.568  35.730 -12.573 1.00 27.70 ? 103 GLN B N   1 
ATOM   2418 C CA  . GLN B 1 100 ? 24.609  36.778 -12.270 1.00 26.37 ? 103 GLN B CA  1 
ATOM   2419 C C   . GLN B 1 100 ? 25.324  38.112 -12.105 1.00 26.63 ? 103 GLN B C   1 
ATOM   2420 O O   . GLN B 1 100 ? 24.882  39.128 -12.649 1.00 26.76 ? 103 GLN B O   1 
ATOM   2421 C CB  . GLN B 1 100 ? 23.871  36.420 -10.975 1.00 27.22 ? 103 GLN B CB  1 
ATOM   2422 C CG  . GLN B 1 100 ? 22.841  37.423 -10.465 1.00 26.70 ? 103 GLN B CG  1 
ATOM   2423 C CD  . GLN B 1 100 ? 22.508  37.168 -9.012  1.00 27.82 ? 103 GLN B CD  1 
ATOM   2424 O OE1 . GLN B 1 100 ? 23.392  36.884 -8.215  1.00 28.32 ? 103 GLN B OE1 1 
ATOM   2425 N NE2 . GLN B 1 100 ? 21.235  37.241 -8.666  1.00 27.53 ? 103 GLN B NE2 1 
ATOM   2426 N N   . ASP B 1 101 ? 26.444  38.096 -11.377 1.00 26.99 ? 104 ASP B N   1 
ATOM   2427 C CA  . ASP B 1 101 ? 27.228  39.311 -11.122 1.00 27.18 ? 104 ASP B CA  1 
ATOM   2428 C C   . ASP B 1 101 ? 27.948  39.839 -12.352 1.00 26.91 ? 104 ASP B C   1 
ATOM   2429 O O   . ASP B 1 101 ? 28.079  41.051 -12.513 1.00 26.09 ? 104 ASP B O   1 
ATOM   2430 C CB  . ASP B 1 101 ? 28.235  39.105 -9.985  1.00 28.41 ? 104 ASP B CB  1 
ATOM   2431 C CG  . ASP B 1 101 ? 28.901  40.412 -9.547  1.00 29.82 ? 104 ASP B CG  1 
ATOM   2432 O OD1 . ASP B 1 101 ? 28.203  41.304 -9.008  1.00 31.85 ? 104 ASP B OD1 1 
ATOM   2433 O OD2 . ASP B 1 101 ? 30.130  40.551 -9.750  1.00 32.03 ? 104 ASP B OD2 1 
ATOM   2434 N N   . SER B 1 102 ? 28.430  38.935 -13.201 1.00 27.05 ? 105 SER B N   1 
ATOM   2435 C CA  . SER B 1 102 ? 29.112  39.327 -14.434 1.00 26.97 ? 105 SER B CA  1 
ATOM   2436 C C   . SER B 1 102 ? 28.174  40.137 -15.331 1.00 25.97 ? 105 SER B C   1 
ATOM   2437 O O   . SER B 1 102 ? 28.516  41.237 -15.765 1.00 25.60 ? 105 SER B O   1 
ATOM   2438 C CB  . SER B 1 102 ? 29.592  38.105 -15.192 1.00 28.75 ? 105 SER B CB  1 
ATOM   2439 O OG  . SER B 1 102 ? 30.494  38.508 -16.202 1.00 31.95 ? 105 SER B OG  1 
ATOM   2440 N N   . TRP B 1 103 ? 26.985  39.594 -15.586 1.00 24.96 ? 106 TRP B N   1 
ATOM   2441 C CA  . TRP B 1 103 ? 25.982  40.281 -16.391 1.00 24.89 ? 106 TRP B CA  1 
ATOM   2442 C C   . TRP B 1 103 ? 25.548  41.572 -15.715 1.00 25.42 ? 106 TRP B C   1 
ATOM   2443 O O   . TRP B 1 103 ? 25.498  42.627 -16.345 1.00 27.70 ? 106 TRP B O   1 
ATOM   2444 C CB  . TRP B 1 103 ? 24.774  39.379 -16.626 1.00 24.11 ? 106 TRP B CB  1 
ATOM   2445 C CG  . TRP B 1 103 ? 25.005  38.428 -17.763 1.00 23.82 ? 106 TRP B CG  1 
ATOM   2446 C CD1 . TRP B 1 103 ? 25.456  37.144 -17.681 1.00 21.93 ? 106 TRP B CD1 1 
ATOM   2447 C CD2 . TRP B 1 103 ? 24.884  38.724 -19.164 1.00 21.67 ? 106 TRP B CD2 1 
ATOM   2448 N NE1 . TRP B 1 103 ? 25.634  36.630 -18.934 1.00 22.01 ? 106 TRP B NE1 1 
ATOM   2449 C CE2 . TRP B 1 103 ? 25.293  37.573 -19.867 1.00 20.90 ? 106 TRP B CE2 1 
ATOM   2450 C CE3 . TRP B 1 103 ? 24.472  39.856 -19.888 1.00 20.32 ? 106 TRP B CE3 1 
ATOM   2451 C CZ2 . TRP B 1 103 ? 25.306  37.509 -21.264 1.00 20.86 ? 106 TRP B CZ2 1 
ATOM   2452 C CZ3 . TRP B 1 103 ? 24.483  39.797 -21.276 1.00 21.05 ? 106 TRP B CZ3 1 
ATOM   2453 C CH2 . TRP B 1 103 ? 24.900  38.628 -21.952 1.00 20.49 ? 106 TRP B CH2 1 
ATOM   2454 N N   . TYR B 1 104 ? 25.233  41.485 -14.430 1.00 26.66 ? 107 TYR B N   1 
ATOM   2455 C CA  . TYR B 1 104 ? 24.834  42.657 -13.670 1.00 26.83 ? 107 TYR B CA  1 
ATOM   2456 C C   . TYR B 1 104 ? 25.919  43.738 -13.790 1.00 27.51 ? 107 TYR B C   1 
ATOM   2457 O O   . TYR B 1 104 ? 25.615  44.883 -14.122 1.00 27.78 ? 107 TYR B O   1 
ATOM   2458 C CB  . TYR B 1 104 ? 24.576  42.272 -12.201 1.00 28.28 ? 107 TYR B CB  1 
ATOM   2459 C CG  . TYR B 1 104 ? 24.378  43.445 -11.262 1.00 29.51 ? 107 TYR B CG  1 
ATOM   2460 C CD1 . TYR B 1 104 ? 23.153  44.111 -11.184 1.00 28.27 ? 107 TYR B CD1 1 
ATOM   2461 C CD2 . TYR B 1 104 ? 25.420  43.890 -10.453 1.00 30.79 ? 107 TYR B CD2 1 
ATOM   2462 C CE1 . TYR B 1 104 ? 22.978  45.191 -10.323 1.00 27.39 ? 107 TYR B CE1 1 
ATOM   2463 C CE2 . TYR B 1 104 ? 25.257  44.963 -9.592  1.00 29.41 ? 107 TYR B CE2 1 
ATOM   2464 C CZ  . TYR B 1 104 ? 24.042  45.609 -9.531  1.00 29.34 ? 107 TYR B CZ  1 
ATOM   2465 O OH  . TYR B 1 104 ? 23.904  46.689 -8.692  1.00 31.80 ? 107 TYR B OH  1 
ATOM   2466 N N   . GLN B 1 105 ? 27.184  43.353 -13.626 1.00 28.36 ? 108 GLN B N   1 
ATOM   2467 C CA  . GLN B 1 105 ? 28.295  44.311 -13.713 1.00 29.81 ? 108 GLN B CA  1 
ATOM   2468 C C   . GLN B 1 105 ? 28.467  44.874 -15.120 1.00 29.82 ? 108 GLN B C   1 
ATOM   2469 O O   . GLN B 1 105 ? 28.755  46.053 -15.274 1.00 30.94 ? 108 GLN B O   1 
ATOM   2470 C CB  . GLN B 1 105 ? 29.628  43.696 -13.246 1.00 31.78 ? 108 GLN B CB  1 
ATOM   2471 C CG  . GLN B 1 105 ? 29.702  43.286 -11.771 1.00 33.51 ? 108 GLN B CG  1 
ATOM   2472 C CD  . GLN B 1 105 ? 29.348  44.406 -10.819 1.00 33.93 ? 108 GLN B CD  1 
ATOM   2473 O OE1 . GLN B 1 105 ? 29.841  45.528 -10.947 1.00 35.21 ? 108 GLN B OE1 1 
ATOM   2474 N NE2 . GLN B 1 105 ? 28.480  44.108 -9.858  1.00 33.82 ? 108 GLN B NE2 1 
ATOM   2475 N N   . ALA B 1 106 ? 28.330  44.020 -16.137 1.00 30.67 ? 109 ALA B N   1 
ATOM   2476 C CA  . ALA B 1 106 ? 28.440  44.446 -17.543 1.00 29.87 ? 109 ALA B CA  1 
ATOM   2477 C C   . ALA B 1 106 ? 27.378  45.503 -17.822 1.00 29.69 ? 109 ALA B C   1 
ATOM   2478 O O   . ALA B 1 106 ? 27.686  46.577 -18.335 1.00 30.60 ? 109 ALA B O   1 
ATOM   2479 C CB  . ALA B 1 106 ? 28.248  43.256 -18.492 1.00 28.82 ? 109 ALA B CB  1 
ATOM   2480 N N   . LEU B 1 107 ? 26.138  45.196 -17.443 1.00 29.00 ? 110 LEU B N   1 
ATOM   2481 C CA  . LEU B 1 107 ? 25.027  46.115 -17.634 1.00 30.83 ? 110 LEU B CA  1 
ATOM   2482 C C   . LEU B 1 107 ? 25.303  47.507 -17.051 1.00 32.70 ? 110 LEU B C   1 
ATOM   2483 O O   . LEU B 1 107 ? 25.117  48.502 -17.751 1.00 32.37 ? 110 LEU B O   1 
ATOM   2484 C CB  . LEU B 1 107 ? 23.729  45.523 -17.074 1.00 28.65 ? 110 LEU B CB  1 
ATOM   2485 C CG  . LEU B 1 107 ? 23.061  44.405 -17.897 1.00 27.79 ? 110 LEU B CG  1 
ATOM   2486 C CD1 . LEU B 1 107 ? 22.082  43.596 -17.026 1.00 28.29 ? 110 LEU B CD1 1 
ATOM   2487 C CD2 . LEU B 1 107 ? 22.336  44.979 -19.090 1.00 28.29 ? 110 LEU B CD2 1 
ATOM   2488 N N   . LEU B 1 108 ? 25.787  47.583 -15.806 1.00 34.62 ? 111 LEU B N   1 
ATOM   2489 C CA  . LEU B 1 108 ? 26.094  48.878 -15.170 1.00 36.34 ? 111 LEU B CA  1 
ATOM   2490 C C   . LEU B 1 108 ? 27.294  49.566 -15.838 1.00 37.19 ? 111 LEU B C   1 
ATOM   2491 O O   . LEU B 1 108 ? 27.393  50.788 -15.859 1.00 36.96 ? 111 LEU B O   1 
ATOM   2492 C CB  . LEU B 1 108 ? 26.375  48.712 -13.670 1.00 35.08 ? 111 LEU B CB  1 
ATOM   2493 C CG  . LEU B 1 108 ? 25.331  48.050 -12.760 1.00 36.13 ? 111 LEU B CG  1 
ATOM   2494 C CD1 . LEU B 1 108 ? 25.955  47.812 -11.403 1.00 35.32 ? 111 LEU B CD1 1 
ATOM   2495 C CD2 . LEU B 1 108 ? 24.065  48.889 -12.636 1.00 34.90 ? 111 LEU B CD2 1 
ATOM   2496 N N   . GLN B 1 109 ? 28.206  48.765 -16.375 1.00 39.86 ? 112 GLN B N   1 
ATOM   2497 C CA  . GLN B 1 109 ? 29.384  49.278 -17.055 1.00 42.90 ? 112 GLN B CA  1 
ATOM   2498 C C   . GLN B 1 109 ? 28.961  50.090 -18.277 1.00 45.53 ? 112 GLN B C   1 
ATOM   2499 O O   . GLN B 1 109 ? 29.690  50.975 -18.727 1.00 47.60 ? 112 GLN B O   1 
ATOM   2500 C CB  . GLN B 1 109 ? 30.271  48.115 -17.507 1.00 43.70 ? 112 GLN B CB  1 
ATOM   2501 C CG  . GLN B 1 109 ? 31.544  48.532 -18.240 1.00 44.80 ? 112 GLN B CG  1 
ATOM   2502 C CD  . GLN B 1 109 ? 32.323  47.362 -18.827 1.00 45.87 ? 112 GLN B CD  1 
ATOM   2503 O OE1 . GLN B 1 109 ? 33.186  47.557 -19.681 1.00 47.53 ? 112 GLN B OE1 1 
ATOM   2504 N NE2 . GLN B 1 109 ? 32.029  46.147 -18.374 1.00 45.01 ? 112 GLN B NE2 1 
ATOM   2505 N N   . LEU B 1 110 ? 27.794  49.765 -18.827 1.00 47.44 ? 113 LEU B N   1 
ATOM   2506 C CA  . LEU B 1 110 ? 27.289  50.461 -20.004 1.00 48.53 ? 113 LEU B CA  1 
ATOM   2507 C C   . LEU B 1 110 ? 26.087  51.343 -19.684 1.00 50.57 ? 113 LEU B C   1 
ATOM   2508 O O   . LEU B 1 110 ? 25.720  52.201 -20.479 1.00 51.33 ? 113 LEU B O   1 
ATOM   2509 C CB  . LEU B 1 110 ? 26.917  49.455 -21.102 1.00 46.11 ? 113 LEU B CB  1 
ATOM   2510 C CG  . LEU B 1 110 ? 27.902  48.336 -21.454 1.00 43.36 ? 113 LEU B CG  1 
ATOM   2511 C CD1 . LEU B 1 110 ? 27.455  47.634 -22.732 1.00 40.22 ? 113 LEU B CD1 1 
ATOM   2512 C CD2 . LEU B 1 110 ? 29.293  48.898 -21.626 1.00 42.06 ? 113 LEU B CD2 1 
ATOM   2513 N N   . HIS B 1 111 ? 25.485  51.123 -18.520 1.00 53.06 ? 114 HIS B N   1 
ATOM   2514 C CA  . HIS B 1 111 ? 24.317  51.880 -18.068 1.00 55.02 ? 114 HIS B CA  1 
ATOM   2515 C C   . HIS B 1 111 ? 24.733  53.087 -17.221 1.00 55.18 ? 114 HIS B C   1 
ATOM   2516 O O   . HIS B 1 111 ? 24.715  54.221 -17.749 1.00 56.16 ? 114 HIS B O   1 
ATOM   2517 C CB  . HIS B 1 111 ? 23.399  50.953 -17.260 1.00 57.99 ? 114 HIS B CB  1 
ATOM   2518 C CG  . HIS B 1 111 ? 22.206  51.634 -16.662 1.00 61.54 ? 114 HIS B CG  1 
ATOM   2519 N ND1 . HIS B 1 111 ? 21.391  52.484 -17.380 1.00 63.38 ? 114 HIS B ND1 1 
ATOM   2520 C CD2 . HIS B 1 111 ? 21.680  51.572 -15.415 1.00 62.90 ? 114 HIS B CD2 1 
ATOM   2521 C CE1 . HIS B 1 111 ? 20.415  52.917 -16.602 1.00 63.25 ? 114 HIS B CE1 1 
ATOM   2522 N NE2 . HIS B 1 111 ? 20.567  52.377 -15.406 1.00 64.26 ? 114 HIS B NE2 1 
ATOM   2523 N N   . ALA B 1 156 ? 19.792  55.980 -7.993  1.00 57.18 ? 159 ALA B N   1 
ATOM   2524 C CA  . ALA B 1 156 ? 18.383  56.346 -7.664  1.00 56.49 ? 159 ALA B CA  1 
ATOM   2525 C C   . ALA B 1 156 ? 17.899  55.612 -6.409  1.00 55.56 ? 159 ALA B C   1 
ATOM   2526 O O   . ALA B 1 156 ? 18.158  56.053 -5.282  1.00 57.51 ? 159 ALA B O   1 
ATOM   2527 C CB  . ALA B 1 156 ? 17.464  56.050 -8.856  1.00 56.32 ? 159 ALA B CB  1 
ATOM   2528 N N   . PHE B 1 157 ? 17.237  54.474 -6.608  1.00 52.00 ? 160 PHE B N   1 
ATOM   2529 C CA  . PHE B 1 157 ? 16.707  53.685 -5.505  1.00 48.59 ? 160 PHE B CA  1 
ATOM   2530 C C   . PHE B 1 157 ? 17.596  52.489 -5.157  1.00 47.33 ? 160 PHE B C   1 
ATOM   2531 O O   . PHE B 1 157 ? 18.237  51.912 -6.033  1.00 45.66 ? 160 PHE B O   1 
ATOM   2532 C CB  . PHE B 1 157 ? 15.300  53.190 -5.856  1.00 46.80 ? 160 PHE B CB  1 
ATOM   2533 C CG  . PHE B 1 157 ? 14.347  54.288 -6.269  1.00 46.18 ? 160 PHE B CG  1 
ATOM   2534 C CD1 . PHE B 1 157 ? 13.923  54.399 -7.595  1.00 46.27 ? 160 PHE B CD1 1 
ATOM   2535 C CD2 . PHE B 1 157 ? 13.845  55.191 -5.328  1.00 45.11 ? 160 PHE B CD2 1 
ATOM   2536 C CE1 . PHE B 1 157 ? 13.011  55.389 -7.980  1.00 45.58 ? 160 PHE B CE1 1 
ATOM   2537 C CE2 . PHE B 1 157 ? 12.936  56.182 -5.699  1.00 44.57 ? 160 PHE B CE2 1 
ATOM   2538 C CZ  . PHE B 1 157 ? 12.516  56.280 -7.030  1.00 45.06 ? 160 PHE B CZ  1 
ATOM   2539 N N   . LYS B 1 158 ? 17.659  52.144 -3.869  1.00 46.18 ? 161 LYS B N   1 
ATOM   2540 C CA  . LYS B 1 158 ? 18.442  50.992 -3.414  1.00 44.80 ? 161 LYS B CA  1 
ATOM   2541 C C   . LYS B 1 158 ? 17.784  49.729 -3.952  1.00 42.81 ? 161 LYS B C   1 
ATOM   2542 O O   . LYS B 1 158 ? 18.448  48.862 -4.516  1.00 43.80 ? 161 LYS B O   1 
ATOM   2543 C CB  . LYS B 1 158 ? 18.486  50.908 -1.878  1.00 46.80 ? 161 LYS B CB  1 
ATOM   2544 C CG  . LYS B 1 158 ? 19.290  52.019 -1.194  1.00 50.01 ? 161 LYS B CG  1 
ATOM   2545 C CD  . LYS B 1 158 ? 19.721  51.650 0.237   1.00 50.89 ? 161 LYS B CD  1 
ATOM   2546 C CE  . LYS B 1 158 ? 18.548  51.576 1.224   1.00 52.72 ? 161 LYS B CE  1 
ATOM   2547 N NZ  . LYS B 1 158 ? 17.699  50.353 1.097   1.00 54.48 ? 161 LYS B NZ  1 
ATOM   2548 N N   . GLU B 1 159 ? 16.469  49.640 -3.774  1.00 39.14 ? 162 GLU B N   1 
ATOM   2549 C CA  . GLU B 1 159 ? 15.710  48.483 -4.234  1.00 35.45 ? 162 GLU B CA  1 
ATOM   2550 C C   . GLU B 1 159 ? 14.476  48.900 -5.006  1.00 32.77 ? 162 GLU B C   1 
ATOM   2551 O O   . GLU B 1 159 ? 13.928  49.984 -4.787  1.00 32.55 ? 162 GLU B O   1 
ATOM   2552 C CB  . GLU B 1 159 ? 15.243  47.637 -3.048  1.00 35.56 ? 162 GLU B CB  1 
ATOM   2553 C CG  . GLU B 1 159 ? 16.347  47.013 -2.213  1.00 37.75 ? 162 GLU B CG  1 
ATOM   2554 C CD  . GLU B 1 159 ? 17.091  45.922 -2.936  1.00 38.95 ? 162 GLU B CD  1 
ATOM   2555 O OE1 . GLU B 1 159 ? 16.575  45.401 -3.945  1.00 38.16 ? 162 GLU B OE1 1 
ATOM   2556 O OE2 . GLU B 1 159 ? 18.202  45.584 -2.488  1.00 41.80 ? 162 GLU B OE2 1 
ATOM   2557 N N   . VAL B 1 160 ? 14.051  48.030 -5.914  1.00 30.00 ? 163 VAL B N   1 
ATOM   2558 C CA  . VAL B 1 160 ? 12.853  48.254 -6.705  1.00 26.44 ? 163 VAL B CA  1 
ATOM   2559 C C   . VAL B 1 160 ? 12.155  46.915 -6.886  1.00 24.92 ? 163 VAL B C   1 
ATOM   2560 O O   . VAL B 1 160 ? 12.782  45.913 -7.227  1.00 26.15 ? 163 VAL B O   1 
ATOM   2561 C CB  . VAL B 1 160 ? 13.162  48.886 -8.102  1.00 25.23 ? 163 VAL B CB  1 
ATOM   2562 C CG1 . VAL B 1 160 ? 11.898  48.970 -8.950  1.00 22.76 ? 163 VAL B CG1 1 
ATOM   2563 C CG2 . VAL B 1 160 ? 13.714  50.282 -7.929  1.00 23.42 ? 163 VAL B CG2 1 
ATOM   2564 N N   . TRP B 1 161 ? 10.875  46.882 -6.550  1.00 22.95 ? 164 TRP B N   1 
ATOM   2565 C CA  . TRP B 1 161 ? 10.078  45.680 -6.726  1.00 22.74 ? 164 TRP B CA  1 
ATOM   2566 C C   . TRP B 1 161 ? 8.804   46.049 -7.468  1.00 22.87 ? 164 TRP B C   1 
ATOM   2567 O O   . TRP B 1 161 ? 8.196   47.083 -7.193  1.00 22.83 ? 164 TRP B O   1 
ATOM   2568 C CB  . TRP B 1 161 ? 9.674   45.068 -5.387  1.00 22.13 ? 164 TRP B CB  1 
ATOM   2569 C CG  . TRP B 1 161 ? 10.780  44.508 -4.570  1.00 23.35 ? 164 TRP B CG  1 
ATOM   2570 C CD1 . TRP B 1 161 ? 11.301  43.252 -4.650  1.00 20.88 ? 164 TRP B CD1 1 
ATOM   2571 C CD2 . TRP B 1 161 ? 11.470  45.165 -3.501  1.00 23.12 ? 164 TRP B CD2 1 
ATOM   2572 N NE1 . TRP B 1 161 ? 12.272  43.086 -3.699  1.00 21.64 ? 164 TRP B NE1 1 
ATOM   2573 C CE2 . TRP B 1 161 ? 12.398  44.243 -2.978  1.00 22.73 ? 164 TRP B CE2 1 
ATOM   2574 C CE3 . TRP B 1 161 ? 11.390  46.444 -2.933  1.00 23.78 ? 164 TRP B CE3 1 
ATOM   2575 C CZ2 . TRP B 1 161 ? 13.243  44.554 -1.910  1.00 23.76 ? 164 TRP B CZ2 1 
ATOM   2576 C CZ3 . TRP B 1 161 ? 12.230  46.755 -1.868  1.00 24.82 ? 164 TRP B CZ3 1 
ATOM   2577 C CH2 . TRP B 1 161 ? 13.145  45.808 -1.370  1.00 23.45 ? 164 TRP B CH2 1 
ATOM   2578 N N   . GLN B 1 162 ? 8.429   45.218 -8.433  1.00 24.25 ? 165 GLN B N   1 
ATOM   2579 C CA  . GLN B 1 162 ? 7.196   45.425 -9.176  1.00 24.65 ? 165 GLN B CA  1 
ATOM   2580 C C   . GLN B 1 162 ? 6.145   44.657 -8.380  1.00 23.51 ? 165 GLN B C   1 
ATOM   2581 O O   . GLN B 1 162 ? 6.269   43.455 -8.163  1.00 22.53 ? 165 GLN B O   1 
ATOM   2582 C CB  . GLN B 1 162 ? 7.310   44.866 -10.597 1.00 23.49 ? 165 GLN B CB  1 
ATOM   2583 C CG  . GLN B 1 162 ? 6.049   45.086 -11.432 1.00 24.46 ? 165 GLN B CG  1 
ATOM   2584 C CD  . GLN B 1 162 ? 6.301   44.977 -12.926 1.00 24.29 ? 165 GLN B CD  1 
ATOM   2585 O OE1 . GLN B 1 162 ? 6.892   45.864 -13.536 1.00 23.63 ? 165 GLN B OE1 1 
ATOM   2586 N NE2 . GLN B 1 162 ? 5.836   43.892 -13.519 1.00 21.42 ? 165 GLN B NE2 1 
ATOM   2587 N N   . VAL B 1 163 ? 5.106   45.345 -7.943  1.00 25.05 ? 166 VAL B N   1 
ATOM   2588 C CA  . VAL B 1 163 ? 4.094   44.695 -7.133  1.00 25.37 ? 166 VAL B CA  1 
ATOM   2589 C C   . VAL B 1 163 ? 2.712   44.921 -7.676  1.00 28.56 ? 166 VAL B C   1 
ATOM   2590 O O   . VAL B 1 163 ? 2.502   45.796 -8.529  1.00 30.49 ? 166 VAL B O   1 
ATOM   2591 C CB  . VAL B 1 163 ? 4.120   45.244 -5.672  1.00 24.02 ? 166 VAL B CB  1 
ATOM   2592 C CG1 . VAL B 1 163 ? 5.493   45.023 -5.046  1.00 22.91 ? 166 VAL B CG1 1 
ATOM   2593 C CG2 . VAL B 1 163 ? 3.767   46.743 -5.650  1.00 19.10 ? 166 VAL B CG2 1 
ATOM   2594 N N   . ILE B 1 164 ? 1.770   44.151 -7.133  1.00 29.65 ? 167 ILE B N   1 
ATOM   2595 C CA  . ILE B 1 164 ? 0.369   44.238 -7.486  1.00 30.29 ? 167 ILE B CA  1 
ATOM   2596 C C   . ILE B 1 164 ? -0.408  44.763 -6.274  1.00 30.57 ? 167 ILE B C   1 
ATOM   2597 O O   . ILE B 1 164 ? -0.763  44.007 -5.367  1.00 29.32 ? 167 ILE B O   1 
ATOM   2598 C CB  . ILE B 1 164 ? -0.178  42.873 -7.901  1.00 31.01 ? 167 ILE B CB  1 
ATOM   2599 C CG1 . ILE B 1 164 ? 0.677   42.302 -9.032  1.00 28.47 ? 167 ILE B CG1 1 
ATOM   2600 C CG2 . ILE B 1 164 ? -1.638  42.998 -8.347  1.00 28.47 ? 167 ILE B CG2 1 
ATOM   2601 C CD1 . ILE B 1 164 ? 0.350   40.856 -9.367  1.00 30.98 ? 167 ILE B CD1 1 
ATOM   2602 N N   . LEU B 1 165 ? -0.594  46.080 -6.232  1.00 31.81 ? 168 LEU B N   1 
ATOM   2603 C CA  . LEU B 1 165 ? -1.331  46.723 -5.153  1.00 33.78 ? 168 LEU B CA  1 
ATOM   2604 C C   . LEU B 1 165 ? -2.794  46.301 -5.185  1.00 34.95 ? 168 LEU B C   1 
ATOM   2605 O O   . LEU B 1 165 ? -3.514  46.585 -6.147  1.00 36.34 ? 168 LEU B O   1 
ATOM   2606 C CB  . LEU B 1 165 ? -1.220  48.258 -5.243  1.00 33.70 ? 168 LEU B CB  1 
ATOM   2607 C CG  . LEU B 1 165 ? -0.034  48.967 -4.567  1.00 33.07 ? 168 LEU B CG  1 
ATOM   2608 C CD1 . LEU B 1 165 ? -0.139  50.468 -4.753  1.00 33.11 ? 168 LEU B CD1 1 
ATOM   2609 C CD2 . LEU B 1 165 ? -0.005  48.636 -3.075  1.00 32.20 ? 168 LEU B CD2 1 
ATOM   2610 N N   . LYS B 1 166 ? -3.209  45.583 -4.146  1.00 36.55 ? 169 LYS B N   1 
ATOM   2611 C CA  . LYS B 1 166 ? -4.582  45.106 -4.022  1.00 39.68 ? 169 LYS B CA  1 
ATOM   2612 C C   . LYS B 1 166 ? -5.520  46.229 -3.561  1.00 42.37 ? 169 LYS B C   1 
ATOM   2613 O O   . LYS B 1 166 ? -5.067  47.274 -3.086  1.00 42.29 ? 169 LYS B O   1 
ATOM   2614 C CB  . LYS B 1 166 ? -4.635  43.928 -3.049  1.00 40.10 ? 169 LYS B CB  1 
ATOM   2615 C CG  . LYS B 1 166 ? -3.951  42.663 -3.559  1.00 40.41 ? 169 LYS B CG  1 
ATOM   2616 C CD  . LYS B 1 166 ? -4.652  42.131 -4.813  1.00 43.74 ? 169 LYS B CD  1 
ATOM   2617 C CE  . LYS B 1 166 ? -4.049  40.809 -5.289  1.00 47.15 ? 169 LYS B CE  1 
ATOM   2618 N NZ  . LYS B 1 166 ? -4.622  40.342 -6.592  1.00 49.23 ? 169 LYS B NZ  1 
ATOM   2619 N N   . PRO B 1 167 ? -6.841  46.057 -3.762  1.00 45.56 ? 170 PRO B N   1 
ATOM   2620 C CA  . PRO B 1 167 ? -7.811  47.078 -3.354  1.00 47.12 ? 170 PRO B CA  1 
ATOM   2621 C C   . PRO B 1 167 ? -8.123  47.082 -1.849  1.00 48.95 ? 170 PRO B C   1 
ATOM   2622 O O   . PRO B 1 167 ? -8.992  47.832 -1.402  1.00 50.23 ? 170 PRO B O   1 
ATOM   2623 C CB  . PRO B 1 167 ? -9.036  46.731 -4.201  1.00 46.18 ? 170 PRO B CB  1 
ATOM   2624 C CG  . PRO B 1 167 ? -8.965  45.259 -4.292  1.00 46.07 ? 170 PRO B CG  1 
ATOM   2625 C CD  . PRO B 1 167 ? -7.504  44.992 -4.541  1.00 45.93 ? 170 PRO B CD  1 
ATOM   2626 N N   . LYS B 1 168 ? -7.409  46.246 -1.085  1.00 49.66 ? 171 LYS B N   1 
ATOM   2627 C CA  . LYS B 1 168 ? -7.567  46.144 0.373   1.00 48.50 ? 171 LYS B CA  1 
ATOM   2628 C C   . LYS B 1 168 ? -7.037  47.412 1.053   1.00 47.98 ? 171 LYS B C   1 
ATOM   2629 O O   . LYS B 1 168 ? -6.153  48.081 0.521   1.00 49.04 ? 171 LYS B O   1 
ATOM   2630 C CB  . LYS B 1 168 ? -6.761  44.961 0.918   1.00 50.38 ? 171 LYS B CB  1 
ATOM   2631 C CG  . LYS B 1 168 ? -6.911  43.664 0.147   1.00 54.44 ? 171 LYS B CG  1 
ATOM   2632 C CD  . LYS B 1 168 ? -6.042  42.550 0.747   1.00 55.54 ? 171 LYS B CD  1 
ATOM   2633 C CE  . LYS B 1 168 ? -6.157  41.239 -0.041  1.00 56.59 ? 171 LYS B CE  1 
ATOM   2634 N NZ  . LYS B 1 168 ? -5.350  40.128 0.569   1.00 57.46 ? 171 LYS B NZ  1 
ATOM   2635 N N   . GLY B 1 169 ? -7.579  47.731 2.226   1.00 46.02 ? 172 GLY B N   1 
ATOM   2636 C CA  . GLY B 1 169 ? -7.138  48.893 2.981   1.00 42.89 ? 172 GLY B CA  1 
ATOM   2637 C C   . GLY B 1 169 ? -6.936  50.169 2.192   1.00 42.11 ? 172 GLY B C   1 
ATOM   2638 O O   . GLY B 1 169 ? -7.820  50.599 1.457   1.00 42.24 ? 172 GLY B O   1 
ATOM   2639 N N   . LEU B 1 170 ? -5.763  50.773 2.351   1.00 41.68 ? 173 LEU B N   1 
ATOM   2640 C CA  . LEU B 1 170 ? -5.421  52.008 1.656   1.00 42.34 ? 173 LEU B CA  1 
ATOM   2641 C C   . LEU B 1 170 ? -5.435  51.861 0.139   1.00 43.72 ? 173 LEU B C   1 
ATOM   2642 O O   . LEU B 1 170 ? -5.395  52.855 -0.587  1.00 43.60 ? 173 LEU B O   1 
ATOM   2643 C CB  . LEU B 1 170 ? -4.061  52.531 2.131   1.00 42.12 ? 173 LEU B CB  1 
ATOM   2644 C CG  . LEU B 1 170 ? -4.065  53.587 3.239   1.00 41.76 ? 173 LEU B CG  1 
ATOM   2645 C CD1 . LEU B 1 170 ? -5.197  53.339 4.225   1.00 42.26 ? 173 LEU B CD1 1 
ATOM   2646 C CD2 . LEU B 1 170 ? -2.709  53.591 3.941   1.00 41.42 ? 173 LEU B CD2 1 
ATOM   2647 N N   . GLY B 1 171 ? -5.453  50.616 -0.329  1.00 45.58 ? 174 GLY B N   1 
ATOM   2648 C CA  . GLY B 1 171 ? -5.520  50.362 -1.758  1.00 48.73 ? 174 GLY B CA  1 
ATOM   2649 C C   . GLY B 1 171 ? -6.795  50.989 -2.308  1.00 50.91 ? 174 GLY B C   1 
ATOM   2650 O O   . GLY B 1 171 ? -6.746  51.866 -3.180  1.00 50.03 ? 174 GLY B O   1 
ATOM   2651 N N   . GLN B 1 172 ? -7.936  50.592 -1.744  1.00 52.93 ? 175 GLN B N   1 
ATOM   2652 C CA  . GLN B 1 172 ? -9.222  51.129 -2.174  1.00 54.64 ? 175 GLN B CA  1 
ATOM   2653 C C   . GLN B 1 172 ? -9.457  52.579 -1.759  1.00 54.55 ? 175 GLN B C   1 
ATOM   2654 O O   . GLN B 1 172 ? -9.980  53.364 -2.545  1.00 55.56 ? 175 GLN B O   1 
ATOM   2655 C CB  . GLN B 1 172 ? -10.382 50.267 -1.668  1.00 56.79 ? 175 GLN B CB  1 
ATOM   2656 C CG  . GLN B 1 172 ? -11.724 50.599 -2.322  1.00 61.22 ? 175 GLN B CG  1 
ATOM   2657 C CD  . GLN B 1 172 ? -11.743 50.318 -3.827  1.00 63.55 ? 175 GLN B CD  1 
ATOM   2658 O OE1 . GLN B 1 172 ? -12.302 49.312 -4.275  1.00 64.29 ? 175 GLN B OE1 1 
ATOM   2659 N NE2 . GLN B 1 172 ? -11.137 51.210 -4.612  1.00 64.33 ? 175 GLN B NE2 1 
ATOM   2660 N N   . THR B 1 173 ? -9.070  52.937 -0.536  1.00 54.00 ? 176 THR B N   1 
ATOM   2661 C CA  . THR B 1 173 ? -9.283  54.300 -0.053  1.00 53.29 ? 176 THR B CA  1 
ATOM   2662 C C   . THR B 1 173 ? -8.447  55.358 -0.775  1.00 53.47 ? 176 THR B C   1 
ATOM   2663 O O   . THR B 1 173 ? -8.855  56.517 -0.873  1.00 53.20 ? 176 THR B O   1 
ATOM   2664 C CB  . THR B 1 173 ? -9.092  54.424 1.491   1.00 53.36 ? 176 THR B CB  1 
ATOM   2665 O OG1 . THR B 1 173 ? -7.777  53.998 1.869   1.00 55.03 ? 176 THR B OG1 1 
ATOM   2666 C CG2 . THR B 1 173 ? -10.119 53.574 2.226   1.00 53.34 ? 176 THR B CG2 1 
ATOM   2667 N N   . LYS B 1 174 ? -7.286  54.967 -1.289  1.00 52.92 ? 177 LYS B N   1 
ATOM   2668 C CA  . LYS B 1 174 ? -6.437  55.917 -2.001  1.00 52.81 ? 177 LYS B CA  1 
ATOM   2669 C C   . LYS B 1 174 ? -6.420  55.625 -3.501  1.00 52.64 ? 177 LYS B C   1 
ATOM   2670 O O   . LYS B 1 174 ? -5.754  56.313 -4.275  1.00 51.42 ? 177 LYS B O   1 
ATOM   2671 C CB  . LYS B 1 174 ? -5.024  55.905 -1.423  1.00 53.21 ? 177 LYS B CB  1 
ATOM   2672 C CG  . LYS B 1 174 ? -4.955  56.329 0.037   1.00 53.19 ? 177 LYS B CG  1 
ATOM   2673 C CD  . LYS B 1 174 ? -5.303  57.798 0.212   1.00 54.39 ? 177 LYS B CD  1 
ATOM   2674 C CE  . LYS B 1 174 ? -5.255  58.209 1.680   1.00 55.07 ? 177 LYS B CE  1 
ATOM   2675 N NZ  . LYS B 1 174 ? -5.321  59.692 1.855   1.00 54.61 ? 177 LYS B NZ  1 
ATOM   2676 N N   . ASN B 1 175 ? -7.172  54.599 -3.892  1.00 52.28 ? 178 ASN B N   1 
ATOM   2677 C CA  . ASN B 1 175 ? -7.296  54.183 -5.282  1.00 52.37 ? 178 ASN B CA  1 
ATOM   2678 C C   . ASN B 1 175 ? -5.957  53.937 -5.978  1.00 50.92 ? 178 ASN B C   1 
ATOM   2679 O O   . ASN B 1 175 ? -5.650  54.536 -7.006  1.00 51.24 ? 178 ASN B O   1 
ATOM   2680 C CB  . ASN B 1 175 ? -8.153  55.186 -6.065  1.00 54.25 ? 178 ASN B CB  1 
ATOM   2681 C CG  . ASN B 1 175 ? -8.701  54.606 -7.365  1.00 55.51 ? 178 ASN B CG  1 
ATOM   2682 O OD1 . ASN B 1 175 ? -8.637  55.251 -8.417  1.00 57.67 ? 178 ASN B OD1 1 
ATOM   2683 N ND2 . ASN B 1 175 ? -9.245  53.387 -7.299  1.00 54.79 ? 178 ASN B ND2 1 
ATOM   2684 N N   . LEU B 1 176 ? -5.142  53.091 -5.362  1.00 48.77 ? 179 LEU B N   1 
ATOM   2685 C CA  . LEU B 1 176 ? -3.849  52.709 -5.913  1.00 45.46 ? 179 LEU B CA  1 
ATOM   2686 C C   . LEU B 1 176 ? -3.942  51.191 -6.043  1.00 44.23 ? 179 LEU B C   1 
ATOM   2687 O O   . LEU B 1 176 ? -3.673  50.455 -5.082  1.00 43.96 ? 179 LEU B O   1 
ATOM   2688 C CB  . LEU B 1 176 ? -2.708  53.084 -4.964  1.00 44.22 ? 179 LEU B CB  1 
ATOM   2689 C CG  . LEU B 1 176 ? -2.598  54.525 -4.459  1.00 43.49 ? 179 LEU B CG  1 
ATOM   2690 C CD1 . LEU B 1 176 ? -1.368  54.639 -3.574  1.00 44.70 ? 179 LEU B CD1 1 
ATOM   2691 C CD2 . LEU B 1 176 ? -2.513  55.516 -5.610  1.00 43.05 ? 179 LEU B CD2 1 
ATOM   2692 N N   . ILE B 1 177 ? -4.422  50.738 -7.201  1.00 42.65 ? 180 ILE B N   1 
ATOM   2693 C CA  . ILE B 1 177 ? -4.584  49.311 -7.470  1.00 41.12 ? 180 ILE B CA  1 
ATOM   2694 C C   . ILE B 1 177 ? -3.866  48.890 -8.762  1.00 40.06 ? 180 ILE B C   1 
ATOM   2695 O O   . ILE B 1 177 ? -3.602  49.718 -9.631  1.00 40.40 ? 180 ILE B O   1 
ATOM   2696 C CB  . ILE B 1 177 ? -6.095  48.924 -7.558  1.00 40.46 ? 180 ILE B CB  1 
ATOM   2697 C CG1 . ILE B 1 177 ? -6.806  49.217 -6.235  1.00 40.86 ? 180 ILE B CG1 1 
ATOM   2698 C CG2 . ILE B 1 177 ? -6.257  47.446 -7.865  1.00 40.37 ? 180 ILE B CG2 1 
ATOM   2699 C CD1 . ILE B 1 177 ? -7.622  50.492 -6.244  1.00 42.54 ? 180 ILE B CD1 1 
ATOM   2700 N N   . GLY B 1 178 ? -3.528  47.608 -8.861  1.00 38.45 ? 181 GLY B N   1 
ATOM   2701 C CA  . GLY B 1 178 ? -2.860  47.100 -10.046 1.00 36.14 ? 181 GLY B CA  1 
ATOM   2702 C C   . GLY B 1 178 ? -1.348  47.039 -9.941  1.00 34.68 ? 181 GLY B C   1 
ATOM   2703 O O   . GLY B 1 178 ? -0.802  46.824 -8.860  1.00 35.75 ? 181 GLY B O   1 
ATOM   2704 N N   . ILE B 1 179 ? -0.675  47.306 -11.060 1.00 32.60 ? 182 ILE B N   1 
ATOM   2705 C CA  . ILE B 1 179 ? 0.785   47.263 -11.146 1.00 29.55 ? 182 ILE B CA  1 
ATOM   2706 C C   . ILE B 1 179 ? 1.516   48.572 -10.797 1.00 28.91 ? 182 ILE B C   1 
ATOM   2707 O O   . ILE B 1 179 ? 1.399   49.580 -11.486 1.00 27.40 ? 182 ILE B O   1 
ATOM   2708 C CB  . ILE B 1 179 ? 1.238   46.782 -12.560 1.00 30.09 ? 182 ILE B CB  1 
ATOM   2709 C CG1 . ILE B 1 179 ? 0.406   45.567 -13.014 1.00 29.91 ? 182 ILE B CG1 1 
ATOM   2710 C CG2 . ILE B 1 179 ? 2.723   46.451 -12.564 1.00 28.50 ? 182 ILE B CG2 1 
ATOM   2711 C CD1 . ILE B 1 179 ? 0.402   44.403 -12.062 1.00 31.22 ? 182 ILE B CD1 1 
ATOM   2712 N N   . TYR B 1 180 ? 2.281   48.539 -9.713  1.00 28.75 ? 183 TYR B N   1 
ATOM   2713 C CA  . TYR B 1 180 ? 3.065   49.700 -9.286  1.00 27.95 ? 183 TYR B CA  1 
ATOM   2714 C C   . TYR B 1 180 ? 4.471   49.201 -8.994  1.00 27.52 ? 183 TYR B C   1 
ATOM   2715 O O   . TYR B 1 180 ? 4.717   47.985 -8.950  1.00 25.99 ? 183 TYR B O   1 
ATOM   2716 C CB  . TYR B 1 180 ? 2.493   50.319 -7.996  1.00 29.10 ? 183 TYR B CB  1 
ATOM   2717 C CG  . TYR B 1 180 ? 1.302   51.230 -8.171  1.00 28.88 ? 183 TYR B CG  1 
ATOM   2718 C CD1 . TYR B 1 180 ? 0.037   50.711 -8.451  1.00 27.94 ? 183 TYR B CD1 1 
ATOM   2719 C CD2 . TYR B 1 180 ? 1.440   52.620 -8.054  1.00 29.16 ? 183 TYR B CD2 1 
ATOM   2720 C CE1 . TYR B 1 180 ? -1.062  51.552 -8.615  1.00 28.46 ? 183 TYR B CE1 1 
ATOM   2721 C CE2 . TYR B 1 180 ? 0.341   53.475 -8.219  1.00 29.42 ? 183 TYR B CE2 1 
ATOM   2722 C CZ  . TYR B 1 180 ? -0.907  52.928 -8.501  1.00 30.85 ? 183 TYR B CZ  1 
ATOM   2723 O OH  . TYR B 1 180 ? -2.005  53.748 -8.687  1.00 33.45 ? 183 TYR B OH  1 
ATOM   2724 N N   . ARG B 1 181 ? 5.389   50.134 -8.774  1.00 27.12 ? 184 ARG B N   1 
ATOM   2725 C CA  . ARG B 1 181 ? 6.761   49.770 -8.433  1.00 29.36 ? 184 ARG B CA  1 
ATOM   2726 C C   . ARG B 1 181 ? 7.129   50.330 -7.057  1.00 29.35 ? 184 ARG B C   1 
ATOM   2727 O O   . ARG B 1 181 ? 7.019   51.534 -6.827  1.00 30.83 ? 184 ARG B O   1 
ATOM   2728 C CB  . ARG B 1 181 ? 7.761   50.277 -9.477  1.00 29.45 ? 184 ARG B CB  1 
ATOM   2729 C CG  . ARG B 1 181 ? 8.358   49.173 -10.337 1.00 33.23 ? 184 ARG B CG  1 
ATOM   2730 C CD  . ARG B 1 181 ? 7.390   48.731 -11.423 1.00 35.77 ? 184 ARG B CD  1 
ATOM   2731 N NE  . ARG B 1 181 ? 7.564   49.519 -12.642 1.00 40.89 ? 184 ARG B NE  1 
ATOM   2732 C CZ  . ARG B 1 181 ? 8.167   49.073 -13.747 1.00 42.54 ? 184 ARG B CZ  1 
ATOM   2733 N NH1 . ARG B 1 181 ? 8.668   47.843 -13.799 1.00 39.26 ? 184 ARG B NH1 1 
ATOM   2734 N NH2 . ARG B 1 181 ? 8.215   49.840 -14.826 1.00 43.88 ? 184 ARG B NH2 1 
ATOM   2735 N N   . LEU B 1 182 ? 7.494   49.442 -6.131  1.00 27.83 ? 185 LEU B N   1 
ATOM   2736 C CA  . LEU B 1 182 ? 7.903   49.852 -4.799  1.00 25.53 ? 185 LEU B CA  1 
ATOM   2737 C C   . LEU B 1 182 ? 9.381   50.201 -4.852  1.00 24.95 ? 185 LEU B C   1 
ATOM   2738 O O   . LEU B 1 182 ? 10.236  49.320 -4.935  1.00 22.77 ? 185 LEU B O   1 
ATOM   2739 C CB  . LEU B 1 182 ? 7.657   48.720 -3.802  1.00 26.91 ? 185 LEU B CB  1 
ATOM   2740 C CG  . LEU B 1 182 ? 7.653   49.111 -2.315  1.00 27.79 ? 185 LEU B CG  1 
ATOM   2741 C CD1 . LEU B 1 182 ? 6.969   48.009 -1.499  1.00 26.38 ? 185 LEU B CD1 1 
ATOM   2742 C CD2 . LEU B 1 182 ? 9.082   49.400 -1.819  1.00 27.34 ? 185 LEU B CD2 1 
ATOM   2743 N N   . CYS B 1 183 ? 9.684   51.486 -4.729  1.00 25.98 ? 186 CYS B N   1 
ATOM   2744 C CA  . CYS B 1 183 ? 11.058  51.955 -4.803  1.00 26.83 ? 186 CYS B CA  1 
ATOM   2745 C C   . CYS B 1 183 ? 11.601  52.419 -3.445  1.00 27.56 ? 186 CYS B C   1 
ATOM   2746 O O   . CYS B 1 183 ? 11.150  53.422 -2.878  1.00 25.82 ? 186 CYS B O   1 
ATOM   2747 C CB  . CYS B 1 183 ? 11.123  53.052 -5.865  1.00 28.13 ? 186 CYS B CB  1 
ATOM   2748 S SG  . CYS B 1 183 ? 10.223  52.561 -7.394  1.00 31.35 ? 186 CYS B SG  1 
ATOM   2749 N N   . LEU B 1 184 ? 12.603  51.689 -2.950  1.00 27.91 ? 187 LEU B N   1 
ATOM   2750 C CA  . LEU B 1 184 ? 13.209  51.947 -1.639  1.00 29.70 ? 187 LEU B CA  1 
ATOM   2751 C C   . LEU B 1 184 ? 14.543  52.671 -1.621  1.00 32.17 ? 187 LEU B C   1 
ATOM   2752 O O   . LEU B 1 184 ? 15.475  52.287 -2.331  1.00 32.21 ? 187 LEU B O   1 
ATOM   2753 C CB  . LEU B 1 184 ? 13.378  50.620 -0.866  1.00 28.06 ? 187 LEU B CB  1 
ATOM   2754 C CG  . LEU B 1 184 ? 14.082  50.601 0.503   1.00 27.22 ? 187 LEU B CG  1 
ATOM   2755 C CD1 . LEU B 1 184 ? 13.232  51.286 1.580   1.00 24.22 ? 187 LEU B CD1 1 
ATOM   2756 C CD2 . LEU B 1 184 ? 14.371  49.175 0.914   1.00 24.26 ? 187 LEU B CD2 1 
ATOM   2757 N N   . THR B 1 185 ? 14.624  53.687 -0.762  1.00 33.47 ? 188 THR B N   1 
ATOM   2758 C CA  . THR B 1 185 ? 15.851  54.449 -0.551  1.00 34.74 ? 188 THR B CA  1 
ATOM   2759 C C   . THR B 1 185 ? 16.283  54.183 0.902   1.00 35.31 ? 188 THR B C   1 
ATOM   2760 O O   . THR B 1 185 ? 15.722  53.314 1.577   1.00 34.33 ? 188 THR B O   1 
ATOM   2761 C CB  . THR B 1 185 ? 15.644  55.987 -0.714  1.00 35.53 ? 188 THR B CB  1 
ATOM   2762 O OG1 . THR B 1 185 ? 14.786  56.474 0.328   1.00 36.12 ? 188 THR B OG1 1 
ATOM   2763 C CG2 . THR B 1 185 ? 15.064  56.331 -2.092  1.00 34.40 ? 188 THR B CG2 1 
ATOM   2764 N N   . SER B 1 186 ? 17.261  54.945 1.389   1.00 37.22 ? 189 SER B N   1 
ATOM   2765 C CA  . SER B 1 186 ? 17.727  54.785 2.765   1.00 38.11 ? 189 SER B CA  1 
ATOM   2766 C C   . SER B 1 186 ? 16.723  55.383 3.745   1.00 38.54 ? 189 SER B C   1 
ATOM   2767 O O   . SER B 1 186 ? 16.764  55.071 4.933   1.00 39.01 ? 189 SER B O   1 
ATOM   2768 C CB  . SER B 1 186 ? 19.071  55.483 2.972   1.00 38.45 ? 189 SER B CB  1 
ATOM   2769 O OG  . SER B 1 186 ? 18.891  56.880 3.149   1.00 40.19 ? 189 SER B OG  1 
ATOM   2770 N N   . LYS B 1 187 ? 15.808  56.212 3.241   1.00 39.35 ? 190 LYS B N   1 
ATOM   2771 C CA  . LYS B 1 187 ? 14.831  56.873 4.101   1.00 39.93 ? 190 LYS B CA  1 
ATOM   2772 C C   . LYS B 1 187 ? 13.363  56.898 3.659   1.00 38.49 ? 190 LYS B C   1 
ATOM   2773 O O   . LYS B 1 187 ? 12.503  57.333 4.428   1.00 37.44 ? 190 LYS B O   1 
ATOM   2774 C CB  . LYS B 1 187 ? 15.293  58.309 4.396   1.00 44.06 ? 190 LYS B CB  1 
ATOM   2775 C CG  . LYS B 1 187 ? 15.340  59.231 3.174   1.00 50.16 ? 190 LYS B CG  1 
ATOM   2776 C CD  . LYS B 1 187 ? 16.433  58.821 2.189   1.00 54.37 ? 190 LYS B CD  1 
ATOM   2777 C CE  . LYS B 1 187 ? 16.512  59.770 1.001   1.00 56.50 ? 190 LYS B CE  1 
ATOM   2778 N NZ  . LYS B 1 187 ? 17.638  59.423 0.081   1.00 58.70 ? 190 LYS B NZ  1 
ATOM   2779 N N   . THR B 1 188 ? 13.066  56.447 2.440   1.00 36.49 ? 191 THR B N   1 
ATOM   2780 C CA  . THR B 1 188 ? 11.680  56.442 1.946   1.00 34.36 ? 191 THR B CA  1 
ATOM   2781 C C   . THR B 1 188 ? 11.307  55.252 1.059   1.00 33.79 ? 191 THR B C   1 
ATOM   2782 O O   . THR B 1 188 ? 12.167  54.503 0.591   1.00 33.43 ? 191 THR B O   1 
ATOM   2783 C CB  . THR B 1 188 ? 11.372  57.686 1.102   1.00 34.52 ? 191 THR B CB  1 
ATOM   2784 O OG1 . THR B 1 188 ? 12.301  57.750 0.014   1.00 36.39 ? 191 THR B OG1 1 
ATOM   2785 C CG2 . THR B 1 188 ? 11.458  58.962 1.934   1.00 34.90 ? 191 THR B CG2 1 
ATOM   2786 N N   . ILE B 1 189 ? 10.003  55.086 0.865   1.00 32.73 ? 192 ILE B N   1 
ATOM   2787 C CA  . ILE B 1 189 ? 9.463   54.060 0.000   1.00 33.53 ? 192 ILE B CA  1 
ATOM   2788 C C   . ILE B 1 189 ? 8.446   54.782 -0.877  1.00 34.64 ? 192 ILE B C   1 
ATOM   2789 O O   . ILE B 1 189 ? 7.520   55.422 -0.367  1.00 33.77 ? 192 ILE B O   1 
ATOM   2790 C CB  . ILE B 1 189 ? 8.731   52.929 0.762   1.00 33.58 ? 192 ILE B CB  1 
ATOM   2791 C CG1 . ILE B 1 189 ? 9.723   52.005 1.451   1.00 33.43 ? 192 ILE B CG1 1 
ATOM   2792 C CG2 . ILE B 1 189 ? 7.902   52.071 -0.216  1.00 33.48 ? 192 ILE B CG2 1 
ATOM   2793 C CD1 . ILE B 1 189 ? 9.037   50.818 2.126   1.00 34.62 ? 192 ILE B CD1 1 
ATOM   2794 N N   . SER B 1 190 ? 8.632   54.700 -2.193  1.00 34.07 ? 193 SER B N   1 
ATOM   2795 C CA  . SER B 1 190 ? 7.708   55.342 -3.118  1.00 33.77 ? 193 SER B CA  1 
ATOM   2796 C C   . SER B 1 190 ? 6.940   54.289 -3.883  1.00 33.32 ? 193 SER B C   1 
ATOM   2797 O O   . SER B 1 190 ? 7.410   53.166 -4.030  1.00 33.53 ? 193 SER B O   1 
ATOM   2798 C CB  . SER B 1 190 ? 8.464   56.226 -4.103  1.00 33.23 ? 193 SER B CB  1 
ATOM   2799 O OG  . SER B 1 190 ? 9.176   57.242 -3.426  1.00 36.54 ? 193 SER B OG  1 
ATOM   2800 N N   . PHE B 1 191 ? 5.724   54.634 -4.292  1.00 33.97 ? 194 PHE B N   1 
ATOM   2801 C CA  . PHE B 1 191 ? 4.894   53.744 -5.097  1.00 33.32 ? 194 PHE B CA  1 
ATOM   2802 C C   . PHE B 1 191 ? 4.747   54.442 -6.454  1.00 32.55 ? 194 PHE B C   1 
ATOM   2803 O O   . PHE B 1 191 ? 4.075   55.471 -6.567  1.00 32.82 ? 194 PHE B O   1 
ATOM   2804 C CB  . PHE B 1 191 ? 3.526   53.514 -4.450  1.00 32.32 ? 194 PHE B CB  1 
ATOM   2805 C CG  . PHE B 1 191 ? 3.535   52.491 -3.355  1.00 33.94 ? 194 PHE B CG  1 
ATOM   2806 C CD1 . PHE B 1 191 ? 3.999   51.199 -3.597  1.00 34.18 ? 194 PHE B CD1 1 
ATOM   2807 C CD2 . PHE B 1 191 ? 3.077   52.813 -2.072  1.00 34.28 ? 194 PHE B CD2 1 
ATOM   2808 C CE1 . PHE B 1 191 ? 4.008   50.233 -2.576  1.00 35.74 ? 194 PHE B CE1 1 
ATOM   2809 C CE2 . PHE B 1 191 ? 3.080   51.858 -1.044  1.00 35.34 ? 194 PHE B CE2 1 
ATOM   2810 C CZ  . PHE B 1 191 ? 3.548   50.566 -1.297  1.00 35.20 ? 194 PHE B CZ  1 
ATOM   2811 N N   . VAL B 1 192 ? 5.470   53.933 -7.449  1.00 31.32 ? 195 VAL B N   1 
ATOM   2812 C CA  . VAL B 1 192 ? 5.450   54.484 -8.805  1.00 32.36 ? 195 VAL B CA  1 
ATOM   2813 C C   . VAL B 1 192 ? 4.664   53.566 -9.744  1.00 32.76 ? 195 VAL B C   1 
ATOM   2814 O O   . VAL B 1 192 ? 5.073   52.425 -10.001 1.00 32.30 ? 195 VAL B O   1 
ATOM   2815 C CB  . VAL B 1 192 ? 6.867   54.638 -9.378  1.00 31.77 ? 195 VAL B CB  1 
ATOM   2816 C CG1 . VAL B 1 192 ? 6.790   55.237 -10.776 1.00 32.40 ? 195 VAL B CG1 1 
ATOM   2817 C CG2 . VAL B 1 192 ? 7.722   55.495 -8.462  1.00 30.09 ? 195 VAL B CG2 1 
ATOM   2818 N N   . LYS B 1 193 ? 3.558   54.083 -10.282 1.00 33.39 ? 196 LYS B N   1 
ATOM   2819 C CA  . LYS B 1 193 ? 2.710   53.315 -11.184 1.00 33.81 ? 196 LYS B CA  1 
ATOM   2820 C C   . LYS B 1 193 ? 3.423   52.949 -12.471 1.00 33.70 ? 196 LYS B C   1 
ATOM   2821 O O   . LYS B 1 193 ? 4.220   53.728 -12.994 1.00 34.44 ? 196 LYS B O   1 
ATOM   2822 C CB  . LYS B 1 193 ? 1.440   54.083 -11.528 1.00 34.25 ? 196 LYS B CB  1 
ATOM   2823 C CG  . LYS B 1 193 ? 0.435   53.227 -12.280 1.00 36.27 ? 196 LYS B CG  1 
ATOM   2824 C CD  . LYS B 1 193 ? -0.762  54.030 -12.730 1.00 39.07 ? 196 LYS B CD  1 
ATOM   2825 C CE  . LYS B 1 193 ? -1.601  53.241 -13.722 1.00 42.79 ? 196 LYS B CE  1 
ATOM   2826 N NZ  . LYS B 1 193 ? -0.806  52.778 -14.916 1.00 43.67 ? 196 LYS B NZ  1 
ATOM   2827 N N   . LEU B 1 194 ? 3.132   51.753 -12.970 1.00 33.55 ? 197 LEU B N   1 
ATOM   2828 C CA  . LEU B 1 194 ? 3.718   51.280 -14.218 1.00 32.70 ? 197 LEU B CA  1 
ATOM   2829 C C   . LEU B 1 194 ? 3.387   52.324 -15.287 1.00 32.69 ? 197 LEU B C   1 
ATOM   2830 O O   . LEU B 1 194 ? 2.348   52.983 -15.216 1.00 33.30 ? 197 LEU B O   1 
ATOM   2831 C CB  . LEU B 1 194 ? 3.131   49.919 -14.596 1.00 29.50 ? 197 LEU B CB  1 
ATOM   2832 C CG  . LEU B 1 194 ? 3.875   49.136 -15.683 1.00 28.73 ? 197 LEU B CG  1 
ATOM   2833 C CD1 . LEU B 1 194 ? 5.169   48.583 -15.129 1.00 26.28 ? 197 LEU B CD1 1 
ATOM   2834 C CD2 . LEU B 1 194 ? 3.012   48.004 -16.184 1.00 26.94 ? 197 LEU B CD2 1 
ATOM   2835 N N   . ASN B 1 195 ? 4.301   52.515 -16.233 1.00 32.14 ? 198 ASN B N   1 
ATOM   2836 C CA  . ASN B 1 195 ? 4.142   53.488 -17.314 1.00 32.75 ? 198 ASN B CA  1 
ATOM   2837 C C   . ASN B 1 195 ? 4.263   54.928 -16.833 1.00 34.03 ? 198 ASN B C   1 
ATOM   2838 O O   . ASN B 1 195 ? 4.239   55.855 -17.632 1.00 34.22 ? 198 ASN B O   1 
ATOM   2839 C CB  . ASN B 1 195 ? 2.817   53.289 -18.051 1.00 31.10 ? 198 ASN B CB  1 
ATOM   2840 C CG  . ASN B 1 195 ? 2.577   51.842 -18.431 1.00 33.36 ? 198 ASN B CG  1 
ATOM   2841 O OD1 . ASN B 1 195 ? 3.376   51.228 -19.151 1.00 35.65 ? 198 ASN B OD1 1 
ATOM   2842 N ND2 . ASN B 1 195 ? 1.489   51.273 -17.918 1.00 32.18 ? 198 ASN B ND2 1 
ATOM   2843 N N   . SER B 1 196 ? 4.418   55.121 -15.531 1.00 35.87 ? 199 SER B N   1 
ATOM   2844 C CA  . SER B 1 196 ? 4.549   56.466 -14.985 1.00 38.90 ? 199 SER B CA  1 
ATOM   2845 C C   . SER B 1 196 ? 5.996   56.789 -14.603 1.00 40.40 ? 199 SER B C   1 
ATOM   2846 O O   . SER B 1 196 ? 6.810   55.893 -14.346 1.00 38.88 ? 199 SER B O   1 
ATOM   2847 C CB  . SER B 1 196 ? 3.641   56.637 -13.756 1.00 39.77 ? 199 SER B CB  1 
ATOM   2848 O OG  . SER B 1 196 ? 2.263   56.452 -14.065 1.00 44.35 ? 199 SER B OG  1 
ATOM   2849 N N   . GLU B 1 197 ? 6.305   58.081 -14.565 1.00 43.35 ? 200 GLU B N   1 
ATOM   2850 C CA  . GLU B 1 197 ? 7.640   58.548 -14.191 1.00 46.12 ? 200 GLU B CA  1 
ATOM   2851 C C   . GLU B 1 197 ? 7.611   59.259 -12.841 1.00 46.57 ? 200 GLU B C   1 
ATOM   2852 O O   . GLU B 1 197 ? 8.642   59.411 -12.191 1.00 47.97 ? 200 GLU B O   1 
ATOM   2853 C CB  . GLU B 1 197 ? 8.211   59.467 -15.271 1.00 48.23 ? 200 GLU B CB  1 
ATOM   2854 C CG  . GLU B 1 197 ? 9.437   58.878 -15.932 1.00 52.86 ? 200 GLU B CG  1 
ATOM   2855 C CD  . GLU B 1 197 ? 9.454   59.067 -17.433 1.00 55.41 ? 200 GLU B CD  1 
ATOM   2856 O OE1 . GLU B 1 197 ? 10.528  59.436 -17.952 1.00 56.74 ? 200 GLU B OE1 1 
ATOM   2857 O OE2 . GLU B 1 197 ? 8.412   58.829 -18.093 1.00 55.59 ? 200 GLU B OE2 1 
ATOM   2858 N N   . ALA B 1 198 ? 6.417   59.684 -12.429 1.00 46.47 ? 201 ALA B N   1 
ATOM   2859 C CA  . ALA B 1 198 ? 6.221   60.365 -11.152 1.00 45.07 ? 201 ALA B CA  1 
ATOM   2860 C C   . ALA B 1 198 ? 5.501   59.434 -10.173 1.00 44.21 ? 201 ALA B C   1 
ATOM   2861 O O   . ALA B 1 198 ? 4.719   58.566 -10.577 1.00 43.06 ? 201 ALA B O   1 
ATOM   2862 C CB  . ALA B 1 198 ? 5.435   61.660 -11.347 1.00 46.08 ? 201 ALA B CB  1 
ATOM   2863 N N   . ALA B 1 199 ? 5.782   59.640 -8.885  1.00 43.30 ? 202 ALA B N   1 
ATOM   2864 C CA  . ALA B 1 199 ? 5.227   58.835 -7.800  1.00 41.51 ? 202 ALA B CA  1 
ATOM   2865 C C   . ALA B 1 199 ? 3.797   59.148 -7.389  1.00 39.99 ? 202 ALA B C   1 
ATOM   2866 O O   . ALA B 1 199 ? 3.399   60.306 -7.304  1.00 38.33 ? 202 ALA B O   1 
ATOM   2867 C CB  . ALA B 1 199 ? 6.147   58.916 -6.579  1.00 40.57 ? 202 ALA B CB  1 
ATOM   2868 N N   . ALA B 1 200 ? 3.032   58.094 -7.128  1.00 40.00 ? 203 ALA B N   1 
ATOM   2869 C CA  . ALA B 1 200 ? 1.656   58.237 -6.691  1.00 40.61 ? 203 ALA B CA  1 
ATOM   2870 C C   . ALA B 1 200 ? 1.740   58.757 -5.264  1.00 42.40 ? 203 ALA B C   1 
ATOM   2871 O O   . ALA B 1 200 ? 1.106   59.750 -4.911  1.00 43.77 ? 203 ALA B O   1 
ATOM   2872 C CB  . ALA B 1 200 ? 0.957   56.893 -6.720  1.00 39.99 ? 203 ALA B CB  1 
ATOM   2873 N N   . VAL B 1 201 ? 2.584   58.118 -4.463  1.00 42.90 ? 204 VAL B N   1 
ATOM   2874 C CA  . VAL B 1 201 ? 2.769   58.518 -3.078  1.00 42.82 ? 204 VAL B CA  1 
ATOM   2875 C C   . VAL B 1 201 ? 4.156   58.150 -2.526  1.00 41.81 ? 204 VAL B C   1 
ATOM   2876 O O   . VAL B 1 201 ? 4.786   57.177 -2.956  1.00 40.02 ? 204 VAL B O   1 
ATOM   2877 C CB  . VAL B 1 201 ? 1.628   57.946 -2.175  1.00 43.70 ? 204 VAL B CB  1 
ATOM   2878 C CG1 . VAL B 1 201 ? 1.548   56.433 -2.289  1.00 46.10 ? 204 VAL B CG1 1 
ATOM   2879 C CG2 . VAL B 1 201 ? 1.824   58.369 -0.732  1.00 44.00 ? 204 VAL B CG2 1 
ATOM   2880 N N   . VAL B 1 202 ? 4.659   59.000 -1.633  1.00 41.77 ? 205 VAL B N   1 
ATOM   2881 C CA  . VAL B 1 202 ? 5.957   58.796 -0.987  1.00 41.32 ? 205 VAL B CA  1 
ATOM   2882 C C   . VAL B 1 202 ? 5.724   58.627 0.506   1.00 41.90 ? 205 VAL B C   1 
ATOM   2883 O O   . VAL B 1 202 ? 5.065   59.453 1.145   1.00 42.71 ? 205 VAL B O   1 
ATOM   2884 C CB  . VAL B 1 202 ? 6.932   59.992 -1.205  1.00 40.45 ? 205 VAL B CB  1 
ATOM   2885 C CG1 . VAL B 1 202 ? 8.238   59.731 -0.501  1.00 39.88 ? 205 VAL B CG1 1 
ATOM   2886 C CG2 . VAL B 1 202 ? 7.185   60.210 -2.684  1.00 40.52 ? 205 VAL B CG2 1 
ATOM   2887 N N   . LEU B 1 203 ? 6.227   57.520 1.035   1.00 41.17 ? 206 LEU B N   1 
ATOM   2888 C CA  . LEU B 1 203 ? 6.117   57.196 2.446   1.00 39.27 ? 206 LEU B CA  1 
ATOM   2889 C C   . LEU B 1 203 ? 7.499   57.327 3.073   1.00 39.16 ? 206 LEU B C   1 
ATOM   2890 O O   . LEU B 1 203 ? 8.513   57.010 2.440   1.00 39.71 ? 206 LEU B O   1 
ATOM   2891 C CB  . LEU B 1 203 ? 5.628   55.755 2.611   1.00 38.50 ? 206 LEU B CB  1 
ATOM   2892 C CG  . LEU B 1 203 ? 4.134   55.431 2.730   1.00 37.73 ? 206 LEU B CG  1 
ATOM   2893 C CD1 . LEU B 1 203 ? 3.284   56.516 2.116   1.00 39.63 ? 206 LEU B CD1 1 
ATOM   2894 C CD2 . LEU B 1 203 ? 3.839   54.071 2.114   1.00 36.52 ? 206 LEU B CD2 1 
ATOM   2895 N N   . GLN B 1 204 ? 7.549   57.857 4.292   1.00 38.29 ? 207 GLN B N   1 
ATOM   2896 C CA  . GLN B 1 204 ? 8.811   57.988 5.014   1.00 37.33 ? 207 GLN B CA  1 
ATOM   2897 C C   . GLN B 1 204 ? 8.988   56.683 5.769   1.00 36.79 ? 207 GLN B C   1 
ATOM   2898 O O   . GLN B 1 204 ? 7.999   56.128 6.267   1.00 36.70 ? 207 GLN B O   1 
ATOM   2899 C CB  . GLN B 1 204 ? 8.740   59.135 6.023   1.00 38.32 ? 207 GLN B CB  1 
ATOM   2900 C CG  . GLN B 1 204 ? 8.603   60.504 5.389   1.00 40.30 ? 207 GLN B CG  1 
ATOM   2901 C CD  . GLN B 1 204 ? 9.812   60.869 4.560   1.00 41.95 ? 207 GLN B CD  1 
ATOM   2902 O OE1 . GLN B 1 204 ? 10.918  60.395 4.814   1.00 44.18 ? 207 GLN B OE1 1 
ATOM   2903 N NE2 . GLN B 1 204 ? 9.609   61.711 3.558   1.00 42.95 ? 207 GLN B NE2 1 
ATOM   2904 N N   . LEU B 1 205 ? 10.216  56.165 5.821   1.00 35.87 ? 208 LEU B N   1 
ATOM   2905 C CA  . LEU B 1 205 ? 10.467  54.929 6.558   1.00 36.02 ? 208 LEU B CA  1 
ATOM   2906 C C   . LEU B 1 205 ? 10.061  55.117 8.031   1.00 37.01 ? 208 LEU B C   1 
ATOM   2907 O O   . LEU B 1 205 ? 9.609   54.171 8.682   1.00 36.77 ? 208 LEU B O   1 
ATOM   2908 C CB  . LEU B 1 205 ? 11.935  54.500 6.446   1.00 34.55 ? 208 LEU B CB  1 
ATOM   2909 C CG  . LEU B 1 205 ? 12.383  53.795 5.161   1.00 34.01 ? 208 LEU B CG  1 
ATOM   2910 C CD1 . LEU B 1 205 ? 13.791  53.224 5.324   1.00 32.22 ? 208 LEU B CD1 1 
ATOM   2911 C CD2 . LEU B 1 205 ? 11.403  52.675 4.830   1.00 33.78 ? 208 LEU B CD2 1 
ATOM   2912 N N   . MET B 1 206 ? 10.183  56.356 8.523   1.00 38.38 ? 209 MET B N   1 
ATOM   2913 C CA  . MET B 1 206 ? 9.817   56.721 9.895   1.00 39.99 ? 209 MET B CA  1 
ATOM   2914 C C   . MET B 1 206 ? 8.353   56.495 10.204  1.00 38.45 ? 209 MET B C   1 
ATOM   2915 O O   . MET B 1 206 ? 7.984   56.315 11.356  1.00 39.97 ? 209 MET B O   1 
ATOM   2916 C CB  . MET B 1 206 ? 10.056  58.202 10.159  1.00 42.62 ? 209 MET B CB  1 
ATOM   2917 C CG  . MET B 1 206 ? 11.481  58.641 10.328  1.00 48.43 ? 209 MET B CG  1 
ATOM   2918 S SD  . MET B 1 206 ? 11.533  60.351 10.920  1.00 55.52 ? 209 MET B SD  1 
ATOM   2919 C CE  . MET B 1 206 ? 10.119  61.119 9.995   1.00 51.28 ? 209 MET B CE  1 
ATOM   2920 N N   . ASN B 1 207 ? 7.508   56.548 9.188   1.00 36.79 ? 210 ASN B N   1 
ATOM   2921 C CA  . ASN B 1 207 ? 6.091   56.396 9.416   1.00 36.24 ? 210 ASN B CA  1 
ATOM   2922 C C   . ASN B 1 207 ? 5.497   55.014 9.262   1.00 34.75 ? 210 ASN B C   1 
ATOM   2923 O O   . ASN B 1 207 ? 4.281   54.862 9.338   1.00 34.56 ? 210 ASN B O   1 
ATOM   2924 C CB  . ASN B 1 207 ? 5.332   57.379 8.550   1.00 40.80 ? 210 ASN B CB  1 
ATOM   2925 C CG  . ASN B 1 207 ? 5.831   58.787 8.720   1.00 44.62 ? 210 ASN B CG  1 
ATOM   2926 O OD1 . ASN B 1 207 ? 5.986   59.271 9.846   1.00 45.70 ? 210 ASN B OD1 1 
ATOM   2927 N ND2 . ASN B 1 207 ? 6.115   59.454 7.599   1.00 47.64 ? 210 ASN B ND2 1 
ATOM   2928 N N   . ILE B 1 208 ? 6.332   54.004 9.058   1.00 33.91 ? 211 ILE B N   1 
ATOM   2929 C CA  . ILE B 1 208 ? 5.811   52.651 8.904   1.00 34.63 ? 211 ILE B CA  1 
ATOM   2930 C C   . ILE B 1 208 ? 5.789   51.933 10.242  1.00 35.23 ? 211 ILE B C   1 
ATOM   2931 O O   . ILE B 1 208 ? 6.840   51.574 10.777  1.00 37.99 ? 211 ILE B O   1 
ATOM   2932 C CB  . ILE B 1 208 ? 6.642   51.837 7.891   1.00 33.35 ? 211 ILE B CB  1 
ATOM   2933 C CG1 . ILE B 1 208 ? 6.685   52.566 6.545   1.00 32.60 ? 211 ILE B CG1 1 
ATOM   2934 C CG2 . ILE B 1 208 ? 6.051   50.438 7.716   1.00 31.69 ? 211 ILE B CG2 1 
ATOM   2935 C CD1 . ILE B 1 208 ? 7.626   51.930 5.552   1.00 33.72 ? 211 ILE B CD1 1 
ATOM   2936 N N   . ARG B 1 209 ? 4.592   51.741 10.788  1.00 35.59 ? 212 ARG B N   1 
ATOM   2937 C CA  . ARG B 1 209 ? 4.438   51.053 12.067  1.00 35.51 ? 212 ARG B CA  1 
ATOM   2938 C C   . ARG B 1 209 ? 4.924   49.614 11.979  1.00 36.92 ? 212 ARG B C   1 
ATOM   2939 O O   . ARG B 1 209 ? 5.586   49.131 12.891  1.00 38.77 ? 212 ARG B O   1 
ATOM   2940 C CB  . ARG B 1 209 ? 2.983   51.082 12.538  1.00 35.10 ? 212 ARG B CB  1 
ATOM   2941 C CG  . ARG B 1 209 ? 2.559   52.404 13.179  1.00 36.46 ? 212 ARG B CG  1 
ATOM   2942 C CD  . ARG B 1 209 ? 1.255   52.254 13.927  1.00 37.09 ? 212 ARG B CD  1 
ATOM   2943 N NE  . ARG B 1 209 ? 1.275   51.067 14.778  1.00 37.34 ? 212 ARG B NE  1 
ATOM   2944 C CZ  . ARG B 1 209 ? 1.308   51.085 16.108  1.00 36.57 ? 212 ARG B CZ  1 
ATOM   2945 N NH1 . ARG B 1 209 ? 1.328   52.227 16.784  1.00 32.77 ? 212 ARG B NH1 1 
ATOM   2946 N NH2 . ARG B 1 209 ? 1.308   49.939 16.763  1.00 35.42 ? 212 ARG B NH2 1 
ATOM   2947 N N   . ARG B 1 210 ? 4.611   48.941 10.875  1.00 36.70 ? 213 ARG B N   1 
ATOM   2948 C CA  . ARG B 1 210 ? 5.040   47.564 10.669  1.00 36.00 ? 213 ARG B CA  1 
ATOM   2949 C C   . ARG B 1 210 ? 4.820   47.104 9.235   1.00 34.92 ? 213 ARG B C   1 
ATOM   2950 O O   . ARG B 1 210 ? 4.090   47.720 8.479   1.00 34.51 ? 213 ARG B O   1 
ATOM   2951 C CB  . ARG B 1 210 ? 4.302   46.625 11.614  1.00 37.50 ? 213 ARG B CB  1 
ATOM   2952 C CG  . ARG B 1 210 ? 2.818   46.584 11.375  1.00 40.73 ? 213 ARG B CG  1 
ATOM   2953 C CD  . ARG B 1 210 ? 2.133   45.660 12.353  1.00 44.71 ? 213 ARG B CD  1 
ATOM   2954 N NE  . ARG B 1 210 ? 2.658   44.297 12.295  1.00 47.10 ? 213 ARG B NE  1 
ATOM   2955 C CZ  . ARG B 1 210 ? 1.903   43.227 12.067  1.00 49.30 ? 213 ARG B CZ  1 
ATOM   2956 N NH1 . ARG B 1 210 ? 0.594   43.373 11.861  1.00 50.00 ? 213 ARG B NH1 1 
ATOM   2957 N NH2 . ARG B 1 210 ? 2.442   42.011 12.089  1.00 49.57 ? 213 ARG B NH2 1 
ATOM   2958 N N   . CYS B 1 211 ? 5.483   46.015 8.873   1.00 34.77 ? 214 CYS B N   1 
ATOM   2959 C CA  . CYS B 1 211 ? 5.376   45.432 7.549   1.00 34.75 ? 214 CYS B CA  1 
ATOM   2960 C C   . CYS B 1 211 ? 5.409   43.920 7.720   1.00 35.43 ? 214 CYS B C   1 
ATOM   2961 O O   . CYS B 1 211 ? 5.898   43.406 8.727   1.00 36.48 ? 214 CYS B O   1 
ATOM   2962 C CB  . CYS B 1 211 ? 6.518   45.924 6.634   1.00 34.75 ? 214 CYS B CB  1 
ATOM   2963 S SG  . CYS B 1 211 ? 8.195   45.304 6.956   1.00 34.74 ? 214 CYS B SG  1 
ATOM   2964 N N   . GLY B 1 212 ? 4.832   43.204 6.772   1.00 34.93 ? 215 GLY B N   1 
ATOM   2965 C CA  . GLY B 1 212 ? 4.828   41.762 6.886   1.00 34.67 ? 215 GLY B CA  1 
ATOM   2966 C C   . GLY B 1 212 ? 4.458   41.050 5.603   1.00 35.09 ? 215 GLY B C   1 
ATOM   2967 O O   . GLY B 1 212 ? 4.192   41.676 4.573   1.00 32.21 ? 215 GLY B O   1 
ATOM   2968 N N   . HIS B 1 213 ? 4.427   39.726 5.675   1.00 36.25 ? 216 HIS B N   1 
ATOM   2969 C CA  . HIS B 1 213 ? 4.094   38.939 4.511   1.00 39.16 ? 216 HIS B CA  1 
ATOM   2970 C C   . HIS B 1 213 ? 3.364   37.688 4.916   1.00 39.36 ? 216 HIS B C   1 
ATOM   2971 O O   . HIS B 1 213 ? 3.571   37.170 6.009   1.00 39.82 ? 216 HIS B O   1 
ATOM   2972 C CB  . HIS B 1 213 ? 5.359   38.562 3.726   1.00 40.42 ? 216 HIS B CB  1 
ATOM   2973 C CG  . HIS B 1 213 ? 6.242   37.585 4.436   1.00 41.90 ? 216 HIS B CG  1 
ATOM   2974 N ND1 . HIS B 1 213 ? 6.886   37.883 5.618   1.00 42.13 ? 216 HIS B ND1 1 
ATOM   2975 C CD2 . HIS B 1 213 ? 6.610   36.321 4.115   1.00 44.24 ? 216 HIS B CD2 1 
ATOM   2976 C CE1 . HIS B 1 213 ? 7.615   36.847 5.993   1.00 42.42 ? 216 HIS B CE1 1 
ATOM   2977 N NE2 . HIS B 1 213 ? 7.466   35.886 5.098   1.00 44.42 ? 216 HIS B NE2 1 
ATOM   2978 N N   . SER B 1 214 ? 2.513   37.215 4.015   1.00 39.80 ? 217 SER B N   1 
ATOM   2979 C CA  . SER B 1 214 ? 1.740   36.001 4.214   1.00 40.99 ? 217 SER B CA  1 
ATOM   2980 C C   . SER B 1 214 ? 1.635   35.369 2.830   1.00 41.43 ? 217 SER B C   1 
ATOM   2981 O O   . SER B 1 214 ? 1.012   35.936 1.935   1.00 42.53 ? 217 SER B O   1 
ATOM   2982 C CB  . SER B 1 214 ? 0.350   36.343 4.765   1.00 41.28 ? 217 SER B CB  1 
ATOM   2983 O OG  . SER B 1 214 ? -0.367  35.164 5.109   1.00 42.59 ? 217 SER B OG  1 
ATOM   2984 N N   . GLU B 1 215 ? 2.273   34.216 2.651   1.00 42.96 ? 218 GLU B N   1 
ATOM   2985 C CA  . GLU B 1 215 ? 2.271   33.517 1.363   1.00 44.20 ? 218 GLU B CA  1 
ATOM   2986 C C   . GLU B 1 215 ? 3.014   34.414 0.362   1.00 43.40 ? 218 GLU B C   1 
ATOM   2987 O O   . GLU B 1 215 ? 4.152   34.830 0.631   1.00 43.66 ? 218 GLU B O   1 
ATOM   2988 C CB  . GLU B 1 215 ? 0.833   33.237 0.891   1.00 46.62 ? 218 GLU B CB  1 
ATOM   2989 C CG  . GLU B 1 215 ? 0.015   32.335 1.810   1.00 51.06 ? 218 GLU B CG  1 
ATOM   2990 C CD  . GLU B 1 215 ? -1.476  32.386 1.500   1.00 53.92 ? 218 GLU B CD  1 
ATOM   2991 O OE1 . GLU B 1 215 ? -2.104  33.437 1.777   1.00 55.69 ? 218 GLU B OE1 1 
ATOM   2992 O OE2 . GLU B 1 215 ? -2.019  31.377 0.990   1.00 55.34 ? 218 GLU B OE2 1 
ATOM   2993 N N   . ASN B 1 216 ? 2.373   34.736 -0.764  1.00 41.45 ? 219 ASN B N   1 
ATOM   2994 C CA  . ASN B 1 216 ? 2.983   35.598 -1.765  1.00 38.71 ? 219 ASN B CA  1 
ATOM   2995 C C   . ASN B 1 216 ? 2.417   37.014 -1.681  1.00 36.98 ? 219 ASN B C   1 
ATOM   2996 O O   . ASN B 1 216 ? 2.272   37.701 -2.686  1.00 36.45 ? 219 ASN B O   1 
ATOM   2997 C CB  . ASN B 1 216 ? 2.827   35.010 -3.170  1.00 39.54 ? 219 ASN B CB  1 
ATOM   2998 C CG  . ASN B 1 216 ? 1.398   35.020 -3.662  1.00 41.29 ? 219 ASN B CG  1 
ATOM   2999 O OD1 . ASN B 1 216 ? 0.470   34.698 -2.927  1.00 43.71 ? 219 ASN B OD1 1 
ATOM   3000 N ND2 . ASN B 1 216 ? 1.215   35.388 -4.923  1.00 42.78 ? 219 ASN B ND2 1 
ATOM   3001 N N   . PHE B 1 217 ? 2.102   37.437 -0.464  1.00 35.85 ? 220 PHE B N   1 
ATOM   3002 C CA  . PHE B 1 217 ? 1.578   38.776 -0.210  1.00 35.96 ? 220 PHE B CA  1 
ATOM   3003 C C   . PHE B 1 217 ? 2.510   39.518 0.739   1.00 34.49 ? 220 PHE B C   1 
ATOM   3004 O O   . PHE B 1 217 ? 3.199   38.893 1.548   1.00 35.11 ? 220 PHE B O   1 
ATOM   3005 C CB  . PHE B 1 217 ? 0.189   38.701 0.421   1.00 37.79 ? 220 PHE B CB  1 
ATOM   3006 C CG  . PHE B 1 217 ? -0.834  38.083 -0.469  1.00 39.43 ? 220 PHE B CG  1 
ATOM   3007 C CD1 . PHE B 1 217 ? -1.105  36.721 -0.392  1.00 39.80 ? 220 PHE B CD1 1 
ATOM   3008 C CD2 . PHE B 1 217 ? -1.511  38.857 -1.403  1.00 39.78 ? 220 PHE B CD2 1 
ATOM   3009 C CE1 . PHE B 1 217 ? -2.037  36.132 -1.234  1.00 40.25 ? 220 PHE B CE1 1 
ATOM   3010 C CE2 . PHE B 1 217 ? -2.442  38.286 -2.247  1.00 39.64 ? 220 PHE B CE2 1 
ATOM   3011 C CZ  . PHE B 1 217 ? -2.706  36.917 -2.163  1.00 40.63 ? 220 PHE B CZ  1 
ATOM   3012 N N   . PHE B 1 218 ? 2.530   40.844 0.634   1.00 32.61 ? 221 PHE B N   1 
ATOM   3013 C CA  . PHE B 1 218 ? 3.364   41.678 1.489   1.00 32.05 ? 221 PHE B CA  1 
ATOM   3014 C C   . PHE B 1 218 ? 2.592   42.943 1.816   1.00 32.32 ? 221 PHE B C   1 
ATOM   3015 O O   . PHE B 1 218 ? 1.994   43.550 0.933   1.00 31.72 ? 221 PHE B O   1 
ATOM   3016 C CB  . PHE B 1 218 ? 4.681   42.029 0.791   1.00 29.80 ? 221 PHE B CB  1 
ATOM   3017 C CG  . PHE B 1 218 ? 5.438   43.154 1.446   1.00 27.89 ? 221 PHE B CG  1 
ATOM   3018 C CD1 . PHE B 1 218 ? 6.116   42.959 2.640   1.00 27.59 ? 221 PHE B CD1 1 
ATOM   3019 C CD2 . PHE B 1 218 ? 5.460   44.422 0.870   1.00 26.90 ? 221 PHE B CD2 1 
ATOM   3020 C CE1 . PHE B 1 218 ? 6.806   44.017 3.257   1.00 26.56 ? 221 PHE B CE1 1 
ATOM   3021 C CE2 . PHE B 1 218 ? 6.145   45.482 1.477   1.00 25.92 ? 221 PHE B CE2 1 
ATOM   3022 C CZ  . PHE B 1 218 ? 6.815   45.275 2.670   1.00 24.25 ? 221 PHE B CZ  1 
ATOM   3023 N N   . PHE B 1 219 ? 2.575   43.319 3.090   1.00 33.10 ? 222 PHE B N   1 
ATOM   3024 C CA  . PHE B 1 219 ? 1.867   44.525 3.508   1.00 33.95 ? 222 PHE B CA  1 
ATOM   3025 C C   . PHE B 1 219 ? 2.741   45.525 4.265   1.00 33.56 ? 222 PHE B C   1 
ATOM   3026 O O   . PHE B 1 219 ? 3.776   45.173 4.838   1.00 33.11 ? 222 PHE B O   1 
ATOM   3027 C CB  . PHE B 1 219 ? 0.631   44.173 4.356   1.00 34.96 ? 222 PHE B CB  1 
ATOM   3028 C CG  . PHE B 1 219 ? 0.958   43.591 5.713   1.00 35.64 ? 222 PHE B CG  1 
ATOM   3029 C CD1 . PHE B 1 219 ? 0.946   44.396 6.855   1.00 36.38 ? 222 PHE B CD1 1 
ATOM   3030 C CD2 . PHE B 1 219 ? 1.275   42.239 5.852   1.00 35.48 ? 222 PHE B CD2 1 
ATOM   3031 C CE1 . PHE B 1 219 ? 1.246   43.860 8.105   1.00 36.19 ? 222 PHE B CE1 1 
ATOM   3032 C CE2 . PHE B 1 219 ? 1.571   41.702 7.094   1.00 34.62 ? 222 PHE B CE2 1 
ATOM   3033 C CZ  . PHE B 1 219 ? 1.559   42.513 8.223   1.00 34.95 ? 222 PHE B CZ  1 
ATOM   3034 N N   . ILE B 1 220 ? 2.280   46.768 4.275   1.00 33.21 ? 223 ILE B N   1 
ATOM   3035 C CA  . ILE B 1 220 ? 2.946   47.855 4.961   1.00 33.98 ? 223 ILE B CA  1 
ATOM   3036 C C   . ILE B 1 220 ? 1.888   48.650 5.707   1.00 33.22 ? 223 ILE B C   1 
ATOM   3037 O O   . ILE B 1 220 ? 0.989   49.218 5.095   1.00 34.17 ? 223 ILE B O   1 
ATOM   3038 C CB  . ILE B 1 220 ? 3.613   48.849 3.981   1.00 34.09 ? 223 ILE B CB  1 
ATOM   3039 C CG1 . ILE B 1 220 ? 4.723   48.181 3.177   1.00 33.97 ? 223 ILE B CG1 1 
ATOM   3040 C CG2 . ILE B 1 220 ? 4.169   50.046 4.742   1.00 34.81 ? 223 ILE B CG2 1 
ATOM   3041 C CD1 . ILE B 1 220 ? 5.479   49.167 2.297   1.00 33.07 ? 223 ILE B CD1 1 
ATOM   3042 N N   . GLU B 1 221 ? 1.965   48.647 7.028   1.00 33.87 ? 224 GLU B N   1 
ATOM   3043 C CA  . GLU B 1 221 ? 1.052   49.430 7.850   1.00 32.97 ? 224 GLU B CA  1 
ATOM   3044 C C   . GLU B 1 221 ? 1.789   50.727 8.175   1.00 32.44 ? 224 GLU B C   1 
ATOM   3045 O O   . GLU B 1 221 ? 2.946   50.708 8.597   1.00 32.22 ? 224 GLU B O   1 
ATOM   3046 C CB  . GLU B 1 221 ? 0.721   48.702 9.146   1.00 34.08 ? 224 GLU B CB  1 
ATOM   3047 C CG  . GLU B 1 221 ? -0.138  49.520 10.085  1.00 35.69 ? 224 GLU B CG  1 
ATOM   3048 C CD  . GLU B 1 221 ? -0.304  48.866 11.436  1.00 36.53 ? 224 GLU B CD  1 
ATOM   3049 O OE1 . GLU B 1 221 ? -0.506  47.634 11.481  1.00 37.65 ? 224 GLU B OE1 1 
ATOM   3050 O OE2 . GLU B 1 221 ? -0.223  49.578 12.459  1.00 37.76 ? 224 GLU B OE2 1 
ATOM   3051 N N   . VAL B 1 222 ? 1.147   51.853 7.917   1.00 33.00 ? 225 VAL B N   1 
ATOM   3052 C CA  . VAL B 1 222 ? 1.756   53.138 8.197   1.00 34.73 ? 225 VAL B CA  1 
ATOM   3053 C C   . VAL B 1 222 ? 1.013   53.798 9.354   1.00 36.69 ? 225 VAL B C   1 
ATOM   3054 O O   . VAL B 1 222 ? -0.192  53.587 9.534   1.00 36.40 ? 225 VAL B O   1 
ATOM   3055 C CB  . VAL B 1 222 ? 1.761   54.054 6.948   1.00 35.59 ? 225 VAL B CB  1 
ATOM   3056 C CG1 . VAL B 1 222 ? 2.823   53.596 5.970   1.00 35.28 ? 225 VAL B CG1 1 
ATOM   3057 C CG2 . VAL B 1 222 ? 0.393   54.053 6.271   1.00 35.69 ? 225 VAL B CG2 1 
ATOM   3058 N N   . GLY B 1 223 ? 1.744   54.574 10.149  1.00 38.04 ? 226 GLY B N   1 
ATOM   3059 C CA  . GLY B 1 223 ? 1.154   55.251 11.288  1.00 40.25 ? 226 GLY B CA  1 
ATOM   3060 C C   . GLY B 1 223 ? 0.340   56.471 10.909  1.00 42.17 ? 226 GLY B C   1 
ATOM   3061 O O   . GLY B 1 223 ? 0.263   56.848 9.738   1.00 42.55 ? 226 GLY B O   1 
ATOM   3062 N N   . ARG B 1 224 ? -0.250  57.102 11.920  1.00 43.80 ? 227 ARG B N   1 
ATOM   3063 C CA  . ARG B 1 224 ? -1.075  58.291 11.731  1.00 45.66 ? 227 ARG B CA  1 
ATOM   3064 C C   . ARG B 1 224 ? -0.283  59.470 11.169  1.00 45.95 ? 227 ARG B C   1 
ATOM   3065 O O   . ARG B 1 224 ? -0.839  60.312 10.457  1.00 45.85 ? 227 ARG B O   1 
ATOM   3066 C CB  . ARG B 1 224 ? -1.753  58.682 13.051  1.00 46.89 ? 227 ARG B CB  1 
ATOM   3067 C CG  . ARG B 1 224 ? -2.613  57.564 13.668  1.00 48.60 ? 227 ARG B CG  1 
ATOM   3068 C CD  . ARG B 1 224 ? -3.446  58.058 14.856  1.00 51.75 ? 227 ARG B CD  1 
ATOM   3069 N NE  . ARG B 1 224 ? -2.630  58.705 15.886  1.00 54.57 ? 227 ARG B NE  1 
ATOM   3070 C CZ  . ARG B 1 224 ? -2.371  60.011 15.932  1.00 56.21 ? 227 ARG B CZ  1 
ATOM   3071 N NH1 . ARG B 1 224 ? -2.865  60.828 15.007  1.00 57.69 ? 227 ARG B NH1 1 
ATOM   3072 N NH2 . ARG B 1 224 ? -1.587  60.498 16.887  1.00 56.60 ? 227 ARG B NH2 1 
ATOM   3073 N N   . SER B 1 225 ? 1.020   59.499 11.452  1.00 46.64 ? 228 SER B N   1 
ATOM   3074 C CA  . SER B 1 225 ? 1.905   60.562 10.973  1.00 47.16 ? 228 SER B CA  1 
ATOM   3075 C C   . SER B 1 225 ? 2.306   60.426 9.495   1.00 47.35 ? 228 SER B C   1 
ATOM   3076 O O   . SER B 1 225 ? 3.134   61.194 9.001   1.00 48.03 ? 228 SER B O   1 
ATOM   3077 C CB  . SER B 1 225 ? 3.167   60.614 11.832  1.00 48.25 ? 228 SER B CB  1 
ATOM   3078 O OG  . SER B 1 225 ? 4.014   59.519 11.539  1.00 51.84 ? 228 SER B OG  1 
ATOM   3079 N N   . ALA B 1 226 ? 1.757   59.431 8.806   1.00 46.69 ? 229 ALA B N   1 
ATOM   3080 C CA  . ALA B 1 226 ? 2.064   59.220 7.393   1.00 45.77 ? 229 ALA B CA  1 
ATOM   3081 C C   . ALA B 1 226 ? 1.236   60.168 6.517   1.00 45.24 ? 229 ALA B C   1 
ATOM   3082 O O   . ALA B 1 226 ? 0.159   60.624 6.924   1.00 43.63 ? 229 ALA B O   1 
ATOM   3083 C CB  . ALA B 1 226 ? 1.802   57.759 6.997   1.00 44.67 ? 229 ALA B CB  1 
ATOM   3084 N N   . VAL B 1 227 ? 1.749   60.459 5.321   1.00 44.42 ? 230 VAL B N   1 
ATOM   3085 C CA  . VAL B 1 227 ? 1.081   61.337 4.370   1.00 43.17 ? 230 VAL B CA  1 
ATOM   3086 C C   . VAL B 1 227 ? -0.287  60.804 3.965   1.00 42.86 ? 230 VAL B C   1 
ATOM   3087 O O   . VAL B 1 227 ? -1.177  61.573 3.631   1.00 44.59 ? 230 VAL B O   1 
ATOM   3088 C CB  . VAL B 1 227 ? 1.922   61.520 3.106   1.00 43.76 ? 230 VAL B CB  1 
ATOM   3089 C CG1 . VAL B 1 227 ? 1.996   60.208 2.319   1.00 42.50 ? 230 VAL B CG1 1 
ATOM   3090 C CG2 . VAL B 1 227 ? 1.352   62.646 2.256   1.00 44.55 ? 230 VAL B CG2 1 
ATOM   3091 N N   . THR B 1 228 ? -0.448  59.487 3.976   1.00 42.39 ? 231 THR B N   1 
ATOM   3092 C CA  . THR B 1 228 ? -1.724  58.868 3.628   1.00 43.00 ? 231 THR B CA  1 
ATOM   3093 C C   . THR B 1 228 ? -2.657  58.686 4.827   1.00 43.46 ? 231 THR B C   1 
ATOM   3094 O O   . THR B 1 228 ? -3.783  58.229 4.657   1.00 43.83 ? 231 THR B O   1 
ATOM   3095 C CB  . THR B 1 228 ? -1.524  57.448 3.043   1.00 42.75 ? 231 THR B CB  1 
ATOM   3096 O OG1 . THR B 1 228 ? -0.831  56.639 4.000   1.00 42.23 ? 231 THR B OG1 1 
ATOM   3097 C CG2 . THR B 1 228 ? -0.729  57.488 1.744   1.00 43.99 ? 231 THR B CG2 1 
ATOM   3098 N N   . GLY B 1 229 ? -2.202  59.039 6.029   1.00 43.01 ? 232 GLY B N   1 
ATOM   3099 C CA  . GLY B 1 229 ? -3.007  58.814 7.216   1.00 41.67 ? 232 GLY B CA  1 
ATOM   3100 C C   . GLY B 1 229 ? -2.777  57.350 7.588   1.00 41.39 ? 232 GLY B C   1 
ATOM   3101 O O   . GLY B 1 229 ? -2.078  56.644 6.850   1.00 42.68 ? 232 GLY B O   1 
ATOM   3102 N N   . PRO B 1 230 ? -3.334  56.847 8.704   1.00 41.01 ? 233 PRO B N   1 
ATOM   3103 C CA  . PRO B 1 230 ? -3.105  55.439 9.056   1.00 40.12 ? 233 PRO B CA  1 
ATOM   3104 C C   . PRO B 1 230 ? -3.760  54.440 8.096   1.00 38.89 ? 233 PRO B C   1 
ATOM   3105 O O   . PRO B 1 230 ? -4.803  54.713 7.499   1.00 38.73 ? 233 PRO B O   1 
ATOM   3106 C CB  . PRO B 1 230 ? -3.703  55.339 10.464  1.00 40.38 ? 233 PRO B CB  1 
ATOM   3107 C CG  . PRO B 1 230 ? -4.835  56.325 10.413  1.00 39.94 ? 233 PRO B CG  1 
ATOM   3108 C CD  . PRO B 1 230 ? -4.181  57.506 9.716   1.00 40.82 ? 233 PRO B CD  1 
ATOM   3109 N N   . GLY B 1 231 ? -3.132  53.286 7.941   1.00 38.17 ? 234 GLY B N   1 
ATOM   3110 C CA  . GLY B 1 231 ? -3.691  52.279 7.065   1.00 38.13 ? 234 GLY B CA  1 
ATOM   3111 C C   . GLY B 1 231 ? -2.674  51.275 6.559   1.00 38.00 ? 234 GLY B C   1 
ATOM   3112 O O   . GLY B 1 231 ? -1.467  51.435 6.749   1.00 37.58 ? 234 GLY B O   1 
ATOM   3113 N N   . GLU B 1 232 ? -3.170  50.225 5.915   1.00 37.55 ? 235 GLU B N   1 
ATOM   3114 C CA  . GLU B 1 232 ? -2.299  49.204 5.382   1.00 38.54 ? 235 GLU B CA  1 
ATOM   3115 C C   . GLU B 1 232 ? -2.229  49.274 3.858   1.00 38.80 ? 235 GLU B C   1 
ATOM   3116 O O   . GLU B 1 232 ? -3.126  49.806 3.198   1.00 39.57 ? 235 GLU B O   1 
ATOM   3117 C CB  . GLU B 1 232 ? -2.788  47.822 5.801   1.00 39.23 ? 235 GLU B CB  1 
ATOM   3118 C CG  . GLU B 1 232 ? -2.778  47.582 7.287   1.00 42.37 ? 235 GLU B CG  1 
ATOM   3119 C CD  . GLU B 1 232 ? -3.165  46.161 7.646   1.00 46.36 ? 235 GLU B CD  1 
ATOM   3120 O OE1 . GLU B 1 232 ? -4.202  45.685 7.140   1.00 45.78 ? 235 GLU B OE1 1 
ATOM   3121 O OE2 . GLU B 1 232 ? -2.443  45.519 8.443   1.00 50.11 ? 235 GLU B OE2 1 
ATOM   3122 N N   . PHE B 1 233 ? -1.134  48.755 3.317   1.00 37.44 ? 236 PHE B N   1 
ATOM   3123 C CA  . PHE B 1 233 ? -0.923  48.681 1.884   1.00 35.41 ? 236 PHE B CA  1 
ATOM   3124 C C   . PHE B 1 233 ? -0.639  47.214 1.608   1.00 34.11 ? 236 PHE B C   1 
ATOM   3125 O O   . PHE B 1 233 ? 0.313   46.650 2.142   1.00 32.86 ? 236 PHE B O   1 
ATOM   3126 C CB  . PHE B 1 233 ? 0.257   49.552 1.457   1.00 34.37 ? 236 PHE B CB  1 
ATOM   3127 C CG  . PHE B 1 233 ? -0.145  50.918 0.997   1.00 34.95 ? 236 PHE B CG  1 
ATOM   3128 C CD1 . PHE B 1 233 ? -1.052  51.070 -0.049  1.00 34.54 ? 236 PHE B CD1 1 
ATOM   3129 C CD2 . PHE B 1 233 ? 0.371   52.054 1.601   1.00 35.54 ? 236 PHE B CD2 1 
ATOM   3130 C CE1 . PHE B 1 233 ? -1.442  52.343 -0.490  1.00 34.22 ? 236 PHE B CE1 1 
ATOM   3131 C CE2 . PHE B 1 233 ? -0.010  53.328 1.174   1.00 36.10 ? 236 PHE B CE2 1 
ATOM   3132 C CZ  . PHE B 1 233 ? -0.919  53.471 0.125   1.00 35.73 ? 236 PHE B CZ  1 
ATOM   3133 N N   . TRP B 1 234 ? -1.537  46.559 0.881   1.00 34.77 ? 237 TRP B N   1 
ATOM   3134 C CA  . TRP B 1 234 ? -1.335  45.155 0.553   1.00 34.44 ? 237 TRP B CA  1 
ATOM   3135 C C   . TRP B 1 234 ? -0.945  45.014 -0.901  1.00 34.59 ? 237 TRP B C   1 
ATOM   3136 O O   . TRP B 1 234 ? -1.423  45.749 -1.762  1.00 34.68 ? 237 TRP B O   1 
ATOM   3137 C CB  . TRP B 1 234 ? -2.579  44.331 0.863   1.00 35.41 ? 237 TRP B CB  1 
ATOM   3138 C CG  . TRP B 1 234 ? -2.794  44.150 2.335   1.00 34.35 ? 237 TRP B CG  1 
ATOM   3139 C CD1 . TRP B 1 234 ? -3.393  45.031 3.187   1.00 34.25 ? 237 TRP B CD1 1 
ATOM   3140 C CD2 . TRP B 1 234 ? -2.408  43.023 3.131   1.00 33.65 ? 237 TRP B CD2 1 
ATOM   3141 N NE1 . TRP B 1 234 ? -3.401  44.525 4.458   1.00 35.07 ? 237 TRP B NE1 1 
ATOM   3142 C CE2 . TRP B 1 234 ? -2.805  43.292 4.455   1.00 34.42 ? 237 TRP B CE2 1 
ATOM   3143 C CE3 . TRP B 1 234 ? -1.760  41.817 2.853   1.00 34.10 ? 237 TRP B CE3 1 
ATOM   3144 C CZ2 . TRP B 1 234 ? -2.581  42.399 5.502   1.00 33.35 ? 237 TRP B CZ2 1 
ATOM   3145 C CZ3 . TRP B 1 234 ? -1.533  40.929 3.892   1.00 34.78 ? 237 TRP B CZ3 1 
ATOM   3146 C CH2 . TRP B 1 234 ? -1.944  41.228 5.203   1.00 34.87 ? 237 TRP B CH2 1 
ATOM   3147 N N   . MET B 1 235 ? -0.059  44.070 -1.172  1.00 35.39 ? 238 MET B N   1 
ATOM   3148 C CA  . MET B 1 235 ? 0.403   43.864 -2.525  1.00 36.34 ? 238 MET B CA  1 
ATOM   3149 C C   . MET B 1 235 ? 0.901   42.448 -2.724  1.00 36.50 ? 238 MET B C   1 
ATOM   3150 O O   . MET B 1 235 ? 1.552   41.866 -1.856  1.00 36.68 ? 238 MET B O   1 
ATOM   3151 C CB  . MET B 1 235 ? 1.500   44.874 -2.853  1.00 35.61 ? 238 MET B CB  1 
ATOM   3152 C CG  . MET B 1 235 ? 2.706   44.782 -1.952  1.00 34.12 ? 238 MET B CG  1 
ATOM   3153 S SD  . MET B 1 235 ? 3.616   46.306 -1.977  1.00 32.32 ? 238 MET B SD  1 
ATOM   3154 C CE  . MET B 1 235 ? 2.981   47.100 -0.485  1.00 31.46 ? 238 MET B CE  1 
ATOM   3155 N N   . GLN B 1 236 ? 0.590   41.903 -3.888  1.00 37.18 ? 239 GLN B N   1 
ATOM   3156 C CA  . GLN B 1 236 ? 0.976   40.546 -4.231  1.00 37.34 ? 239 GLN B CA  1 
ATOM   3157 C C   . GLN B 1 236 ? 2.294   40.538 -5.008  1.00 37.46 ? 239 GLN B C   1 
ATOM   3158 O O   . GLN B 1 236 ? 2.678   41.541 -5.604  1.00 38.91 ? 239 GLN B O   1 
ATOM   3159 C CB  . GLN B 1 236 ? -0.149  39.925 -5.057  1.00 37.81 ? 239 GLN B CB  1 
ATOM   3160 C CG  . GLN B 1 236 ? -0.008  38.461 -5.336  1.00 41.41 ? 239 GLN B CG  1 
ATOM   3161 C CD  . GLN B 1 236 ? -1.217  37.913 -6.046  1.00 43.04 ? 239 GLN B CD  1 
ATOM   3162 O OE1 . GLN B 1 236 ? -1.876  38.623 -6.811  1.00 44.92 ? 239 GLN B OE1 1 
ATOM   3163 N NE2 . GLN B 1 236 ? -1.530  36.650 -5.792  1.00 45.53 ? 239 GLN B NE2 1 
ATOM   3164 N N   . VAL B 1 237 ? 3.017   39.429 -4.941  1.00 37.57 ? 240 VAL B N   1 
ATOM   3165 C CA  . VAL B 1 237 ? 4.272   39.298 -5.666  1.00 37.29 ? 240 VAL B CA  1 
ATOM   3166 C C   . VAL B 1 237 ? 4.394   37.869 -6.174  1.00 37.48 ? 240 VAL B C   1 
ATOM   3167 O O   . VAL B 1 237 ? 3.525   37.038 -5.895  1.00 35.99 ? 240 VAL B O   1 
ATOM   3168 C CB  . VAL B 1 237 ? 5.509   39.713 -4.825  1.00 37.34 ? 240 VAL B CB  1 
ATOM   3169 C CG1 . VAL B 1 237 ? 5.484   41.225 -4.559  1.00 35.79 ? 240 VAL B CG1 1 
ATOM   3170 C CG2 . VAL B 1 237 ? 5.572   38.918 -3.527  1.00 36.91 ? 240 VAL B CG2 1 
ATOM   3171 N N   . ASP B 1 238 ? 5.462   37.587 -6.918  1.00 38.25 ? 241 ASP B N   1 
ATOM   3172 C CA  . ASP B 1 238 ? 5.657   36.270 -7.511  1.00 39.97 ? 241 ASP B CA  1 
ATOM   3173 C C   . ASP B 1 238 ? 5.406   35.073 -6.612  1.00 40.00 ? 241 ASP B C   1 
ATOM   3174 O O   . ASP B 1 238 ? 4.604   34.202 -6.951  1.00 39.98 ? 241 ASP B O   1 
ATOM   3175 C CB  . ASP B 1 238 ? 7.033   36.166 -8.167  1.00 42.17 ? 241 ASP B CB  1 
ATOM   3176 C CG  . ASP B 1 238 ? 7.101   36.883 -9.503  1.00 44.25 ? 241 ASP B CG  1 
ATOM   3177 O OD1 . ASP B 1 238 ? 6.042   37.256 -10.060 1.00 43.95 ? 241 ASP B OD1 1 
ATOM   3178 O OD2 . ASP B 1 238 ? 8.234   37.053 -10.002 1.00 47.45 ? 241 ASP B OD2 1 
ATOM   3179 N N   . ASP B 1 239 ? 6.067   35.044 -5.461  1.00 39.67 ? 242 ASP B N   1 
ATOM   3180 C CA  . ASP B 1 239 ? 5.903   33.943 -4.530  1.00 38.31 ? 242 ASP B CA  1 
ATOM   3181 C C   . ASP B 1 239 ? 6.304   34.337 -3.114  1.00 37.37 ? 242 ASP B C   1 
ATOM   3182 O O   . ASP B 1 239 ? 6.737   35.464 -2.881  1.00 36.32 ? 242 ASP B O   1 
ATOM   3183 C CB  . ASP B 1 239 ? 6.695   32.720 -5.006  1.00 38.14 ? 242 ASP B CB  1 
ATOM   3184 C CG  . ASP B 1 239 ? 8.133   33.050 -5.360  1.00 39.50 ? 242 ASP B CG  1 
ATOM   3185 O OD1 . ASP B 1 239 ? 8.621   32.533 -6.380  1.00 40.16 ? 242 ASP B OD1 1 
ATOM   3186 O OD2 . ASP B 1 239 ? 8.785   33.815 -4.626  1.00 41.70 ? 242 ASP B OD2 1 
ATOM   3187 N N   . SER B 1 240 ? 6.150   33.399 -2.178  1.00 36.72 ? 243 SER B N   1 
ATOM   3188 C CA  . SER B 1 240 ? 6.487   33.626 -0.773  1.00 36.23 ? 243 SER B CA  1 
ATOM   3189 C C   . SER B 1 240 ? 7.963   33.963 -0.573  1.00 36.78 ? 243 SER B C   1 
ATOM   3190 O O   . SER B 1 240 ? 8.328   34.622 0.400   1.00 38.71 ? 243 SER B O   1 
ATOM   3191 C CB  . SER B 1 240 ? 6.116   32.407 0.067   1.00 35.69 ? 243 SER B CB  1 
ATOM   3192 O OG  . SER B 1 240 ? 6.869   31.272 -0.322  1.00 39.61 ? 243 SER B OG  1 
ATOM   3193 N N   . VAL B 1 241 ? 8.814   33.498 -1.480  1.00 35.29 ? 244 VAL B N   1 
ATOM   3194 C CA  . VAL B 1 241 ? 10.232  33.792 -1.381  1.00 33.42 ? 244 VAL B CA  1 
ATOM   3195 C C   . VAL B 1 241 ? 10.448  35.290 -1.567  1.00 33.42 ? 244 VAL B C   1 
ATOM   3196 O O   . VAL B 1 241 ? 10.985  35.941 -0.683  1.00 34.18 ? 244 VAL B O   1 
ATOM   3197 C CB  . VAL B 1 241 ? 11.044  32.995 -2.414  1.00 33.41 ? 244 VAL B CB  1 
ATOM   3198 C CG1 . VAL B 1 241 ? 12.497  33.463 -2.446  1.00 32.68 ? 244 VAL B CG1 1 
ATOM   3199 C CG2 . VAL B 1 241 ? 10.970  31.513 -2.077  1.00 33.09 ? 244 VAL B CG2 1 
ATOM   3200 N N   . VAL B 1 242 ? 9.964   35.858 -2.667  1.00 31.41 ? 245 VAL B N   1 
ATOM   3201 C CA  . VAL B 1 242 ? 10.151  37.293 -2.889  1.00 30.02 ? 245 VAL B CA  1 
ATOM   3202 C C   . VAL B 1 242 ? 9.405   38.145 -1.851  1.00 30.09 ? 245 VAL B C   1 
ATOM   3203 O O   . VAL B 1 242 ? 9.897   39.190 -1.435  1.00 29.57 ? 245 VAL B O   1 
ATOM   3204 C CB  . VAL B 1 242 ? 9.865   37.725 -4.384  1.00 28.58 ? 245 VAL B CB  1 
ATOM   3205 C CG1 . VAL B 1 242 ? 8.695   37.005 -4.932  1.00 29.75 ? 245 VAL B CG1 1 
ATOM   3206 C CG2 . VAL B 1 242 ? 9.639   39.220 -4.497  1.00 27.05 ? 245 VAL B CG2 1 
ATOM   3207 N N   . ALA B 1 243 ? 8.256   37.662 -1.387  1.00 30.50 ? 246 ALA B N   1 
ATOM   3208 C CA  . ALA B 1 243 ? 7.478   38.382 -0.378  1.00 30.97 ? 246 ALA B CA  1 
ATOM   3209 C C   . ALA B 1 243 ? 8.292   38.459 0.920   1.00 31.95 ? 246 ALA B C   1 
ATOM   3210 O O   . ALA B 1 243 ? 8.305   39.493 1.601   1.00 31.95 ? 246 ALA B O   1 
ATOM   3211 C CB  . ALA B 1 243 ? 6.143   37.678 -0.131  1.00 29.39 ? 246 ALA B CB  1 
ATOM   3212 N N   . GLN B 1 244 ? 9.019   37.381 1.218   1.00 33.26 ? 247 GLN B N   1 
ATOM   3213 C CA  . GLN B 1 244 ? 9.834   37.321 2.419   1.00 35.79 ? 247 GLN B CA  1 
ATOM   3214 C C   . GLN B 1 244 ? 11.046  38.234 2.370   1.00 36.19 ? 247 GLN B C   1 
ATOM   3215 O O   . GLN B 1 244 ? 11.397  38.832 3.386   1.00 37.69 ? 247 GLN B O   1 
ATOM   3216 C CB  . GLN B 1 244 ? 10.271  35.892 2.708   1.00 39.42 ? 247 GLN B CB  1 
ATOM   3217 C CG  . GLN B 1 244 ? 11.125  35.771 3.959   1.00 46.15 ? 247 GLN B CG  1 
ATOM   3218 C CD  . GLN B 1 244 ? 11.473  34.330 4.292   1.00 50.93 ? 247 GLN B CD  1 
ATOM   3219 O OE1 . GLN B 1 244 ? 10.616  33.434 4.205   1.00 54.01 ? 247 GLN B OE1 1 
ATOM   3220 N NE2 . GLN B 1 244 ? 12.732  34.091 4.673   1.00 51.60 ? 247 GLN B NE2 1 
ATOM   3221 N N   . ASN B 1 245 ? 11.678  38.337 1.198   1.00 35.97 ? 248 ASN B N   1 
ATOM   3222 C CA  . ASN B 1 245 ? 12.856  39.180 1.006   1.00 34.53 ? 248 ASN B CA  1 
ATOM   3223 C C   . ASN B 1 245 ? 12.428  40.629 1.072   1.00 33.51 ? 248 ASN B C   1 
ATOM   3224 O O   . ASN B 1 245 ? 13.161  41.477 1.594   1.00 33.47 ? 248 ASN B O   1 
ATOM   3225 C CB  . ASN B 1 245 ? 13.503  38.923 -0.351  1.00 38.32 ? 248 ASN B CB  1 
ATOM   3226 C CG  . ASN B 1 245 ? 14.853  39.625 -0.511  1.00 41.76 ? 248 ASN B CG  1 
ATOM   3227 O OD1 . ASN B 1 245 ? 15.902  39.030 -0.255  1.00 42.87 ? 248 ASN B OD1 1 
ATOM   3228 N ND2 . ASN B 1 245 ? 14.832  40.887 -0.959  1.00 43.34 ? 248 ASN B ND2 1 
ATOM   3229 N N   . MET B 1 246 ? 11.256  40.914 0.509   1.00 31.29 ? 249 MET B N   1 
ATOM   3230 C CA  . MET B 1 246 ? 10.734  42.269 0.528   1.00 31.06 ? 249 MET B CA  1 
ATOM   3231 C C   . MET B 1 246 ? 10.610  42.713 1.972   1.00 31.69 ? 249 MET B C   1 
ATOM   3232 O O   . MET B 1 246 ? 11.002  43.820 2.321   1.00 32.60 ? 249 MET B O   1 
ATOM   3233 C CB  . MET B 1 246 ? 9.366   42.341 -0.133  1.00 30.17 ? 249 MET B CB  1 
ATOM   3234 C CG  . MET B 1 246 ? 9.385   42.296 -1.638  1.00 29.72 ? 249 MET B CG  1 
ATOM   3235 S SD  . MET B 1 246 ? 7.817   42.910 -2.181  1.00 32.16 ? 249 MET B SD  1 
ATOM   3236 C CE  . MET B 1 246 ? 8.042   44.677 -2.003  1.00 22.12 ? 249 MET B CE  1 
ATOM   3237 N N   . HIS B 1 247 ? 10.056  41.824 2.796   1.00 31.90 ? 250 HIS B N   1 
ATOM   3238 C CA  . HIS B 1 247 ? 9.879   42.058 4.225   1.00 32.20 ? 250 HIS B CA  1 
ATOM   3239 C C   . HIS B 1 247 ? 11.222  42.300 4.948   1.00 30.45 ? 250 HIS B C   1 
ATOM   3240 O O   . HIS B 1 247 ? 11.418  43.340 5.576   1.00 28.11 ? 250 HIS B O   1 
ATOM   3241 C CB  . HIS B 1 247 ? 9.160   40.862 4.862   1.00 33.31 ? 250 HIS B CB  1 
ATOM   3242 C CG  . HIS B 1 247 ? 9.072   40.951 6.353   1.00 36.19 ? 250 HIS B CG  1 
ATOM   3243 N ND1 . HIS B 1 247 ? 8.698   42.107 7.006   1.00 37.81 ? 250 HIS B ND1 1 
ATOM   3244 C CD2 . HIS B 1 247 ? 9.370   40.053 7.320   1.00 37.31 ? 250 HIS B CD2 1 
ATOM   3245 C CE1 . HIS B 1 247 ? 8.776   41.918 8.311   1.00 37.26 ? 250 HIS B CE1 1 
ATOM   3246 N NE2 . HIS B 1 247 ? 9.182   40.680 8.527   1.00 38.05 ? 250 HIS B NE2 1 
ATOM   3247 N N   . GLU B 1 248 ? 12.143  41.347 4.823   1.00 30.80 ? 251 GLU B N   1 
ATOM   3248 C CA  . GLU B 1 248 ? 13.459  41.424 5.449   1.00 31.98 ? 251 GLU B CA  1 
ATOM   3249 C C   . GLU B 1 248 ? 14.284  42.635 5.058   1.00 31.65 ? 251 GLU B C   1 
ATOM   3250 O O   . GLU B 1 248 ? 14.936  43.240 5.910   1.00 33.60 ? 251 GLU B O   1 
ATOM   3251 C CB  . GLU B 1 248 ? 14.252  40.158 5.155   1.00 34.51 ? 251 GLU B CB  1 
ATOM   3252 C CG  . GLU B 1 248 ? 13.672  38.917 5.801   1.00 39.26 ? 251 GLU B CG  1 
ATOM   3253 C CD  . GLU B 1 248 ? 14.443  37.660 5.440   1.00 43.78 ? 251 GLU B CD  1 
ATOM   3254 O OE1 . GLU B 1 248 ? 13.849  36.558 5.523   1.00 43.70 ? 251 GLU B OE1 1 
ATOM   3255 O OE2 . GLU B 1 248 ? 15.642  37.774 5.070   1.00 45.90 ? 251 GLU B OE2 1 
ATOM   3256 N N   . THR B 1 249 ? 14.278  42.978 3.773   1.00 30.57 ? 252 THR B N   1 
ATOM   3257 C CA  . THR B 1 249 ? 15.036  44.131 3.278   1.00 29.47 ? 252 THR B CA  1 
ATOM   3258 C C   . THR B 1 249 ? 14.466  45.448 3.816   1.00 28.57 ? 252 THR B C   1 
ATOM   3259 O O   . THR B 1 249 ? 15.205  46.306 4.295   1.00 29.26 ? 252 THR B O   1 
ATOM   3260 C CB  . THR B 1 249 ? 15.037  44.174 1.720   1.00 28.93 ? 252 THR B CB  1 
ATOM   3261 O OG1 . THR B 1 249 ? 15.616  42.968 1.204   1.00 29.98 ? 252 THR B OG1 1 
ATOM   3262 C CG2 . THR B 1 249 ? 15.826  45.361 1.196   1.00 26.49 ? 252 THR B CG2 1 
ATOM   3263 N N   . ILE B 1 250 ? 13.150  45.601 3.749   1.00 27.94 ? 253 ILE B N   1 
ATOM   3264 C CA  . ILE B 1 250 ? 12.521  46.826 4.208   1.00 27.51 ? 253 ILE B CA  1 
ATOM   3265 C C   . ILE B 1 250 ? 12.608  46.967 5.723   1.00 27.42 ? 253 ILE B C   1 
ATOM   3266 O O   . ILE B 1 250 ? 12.892  48.056 6.237   1.00 26.56 ? 253 ILE B O   1 
ATOM   3267 C CB  . ILE B 1 250 ? 11.054  46.928 3.675   1.00 27.00 ? 253 ILE B CB  1 
ATOM   3268 C CG1 . ILE B 1 250 ? 11.088  47.092 2.140   1.00 25.63 ? 253 ILE B CG1 1 
ATOM   3269 C CG2 . ILE B 1 250 ? 10.297  48.095 4.341   1.00 26.44 ? 253 ILE B CG2 1 
ATOM   3270 C CD1 . ILE B 1 250 ? 9.742   46.959 1.449   1.00 23.70 ? 253 ILE B CD1 1 
ATOM   3271 N N   . LEU B 1 251 ? 12.424  45.853 6.428   1.00 26.98 ? 254 LEU B N   1 
ATOM   3272 C CA  . LEU B 1 251 ? 12.488  45.860 7.877   1.00 27.27 ? 254 LEU B CA  1 
ATOM   3273 C C   . LEU B 1 251 ? 13.878  46.300 8.270   1.00 28.58 ? 254 LEU B C   1 
ATOM   3274 O O   . LEU B 1 251 ? 14.028  47.184 9.122   1.00 29.67 ? 254 LEU B O   1 
ATOM   3275 C CB  . LEU B 1 251 ? 12.192  44.478 8.463   1.00 25.70 ? 254 LEU B CB  1 
ATOM   3276 C CG  . LEU B 1 251 ? 12.334  44.334 9.990   1.00 24.33 ? 254 LEU B CG  1 
ATOM   3277 C CD1 . LEU B 1 251 ? 11.468  45.344 10.720  1.00 22.89 ? 254 LEU B CD1 1 
ATOM   3278 C CD2 . LEU B 1 251 ? 11.964  42.933 10.403  1.00 22.34 ? 254 LEU B CD2 1 
ATOM   3279 N N   . GLU B 1 252 ? 14.884  45.712 7.613   1.00 28.55 ? 255 GLU B N   1 
ATOM   3280 C CA  . GLU B 1 252 ? 16.285  46.037 7.871   1.00 28.00 ? 255 GLU B CA  1 
ATOM   3281 C C   . GLU B 1 252 ? 16.570  47.503 7.595   1.00 28.31 ? 255 GLU B C   1 
ATOM   3282 O O   . GLU B 1 252 ? 17.408  48.119 8.246   1.00 29.61 ? 255 GLU B O   1 
ATOM   3283 C CB  . GLU B 1 252 ? 17.196  45.178 7.009   1.00 26.29 ? 255 GLU B CB  1 
ATOM   3284 C CG  . GLU B 1 252 ? 18.663  45.572 7.085   1.00 27.54 ? 255 GLU B CG  1 
ATOM   3285 C CD  . GLU B 1 252 ? 19.170  45.685 8.514   1.00 26.97 ? 255 GLU B CD  1 
ATOM   3286 O OE1 . GLU B 1 252 ? 19.969  46.609 8.797   1.00 25.84 ? 255 GLU B OE1 1 
ATOM   3287 O OE2 . GLU B 1 252 ? 18.773  44.852 9.352   1.00 27.20 ? 255 GLU B OE2 1 
ATOM   3288 N N   . ALA B 1 253 ? 15.875  48.060 6.610   1.00 28.09 ? 256 ALA B N   1 
ATOM   3289 C CA  . ALA B 1 253 ? 16.064  49.456 6.277   1.00 28.18 ? 256 ALA B CA  1 
ATOM   3290 C C   . ALA B 1 253 ? 15.428  50.295 7.364   1.00 27.92 ? 256 ALA B C   1 
ATOM   3291 O O   . ALA B 1 253 ? 15.854  51.417 7.610   1.00 27.13 ? 256 ALA B O   1 
ATOM   3292 C CB  . ALA B 1 253 ? 15.449  49.762 4.926   1.00 29.28 ? 256 ALA B CB  1 
ATOM   3293 N N   . MET B 1 254 ? 14.393  49.746 7.999   1.00 29.02 ? 257 MET B N   1 
ATOM   3294 C CA  . MET B 1 254 ? 13.680  50.433 9.079   1.00 29.83 ? 257 MET B CA  1 
ATOM   3295 C C   . MET B 1 254 ? 14.561  50.456 10.320  1.00 29.89 ? 257 MET B C   1 
ATOM   3296 O O   . MET B 1 254 ? 14.760  51.502 10.951  1.00 31.25 ? 257 MET B O   1 
ATOM   3297 C CB  . MET B 1 254 ? 12.360  49.727 9.384   1.00 29.48 ? 257 MET B CB  1 
ATOM   3298 C CG  . MET B 1 254 ? 11.174  50.234 8.576   1.00 27.95 ? 257 MET B CG  1 
ATOM   3299 S SD  . MET B 1 254 ? 9.811   49.031 8.492   1.00 32.74 ? 257 MET B SD  1 
ATOM   3300 C CE  . MET B 1 254 ? 9.040   49.154 10.128  1.00 29.45 ? 257 MET B CE  1 
ATOM   3301 N N   . ARG B 1 255 ? 15.144  49.304 10.617  1.00 29.25 ? 258 ARG B N   1 
ATOM   3302 C CA  . ARG B 1 255 ? 16.013  49.157 11.767  1.00 28.05 ? 258 ARG B CA  1 
ATOM   3303 C C   . ARG B 1 255 ? 17.307  49.936 11.604  1.00 29.00 ? 258 ARG B C   1 
ATOM   3304 O O   . ARG B 1 255 ? 17.798  50.523 12.558  1.00 29.25 ? 258 ARG B O   1 
ATOM   3305 C CB  . ARG B 1 255 ? 16.296  47.681 11.983  1.00 26.15 ? 258 ARG B CB  1 
ATOM   3306 C CG  . ARG B 1 255 ? 15.019  46.894 12.221  1.00 24.96 ? 258 ARG B CG  1 
ATOM   3307 C CD  . ARG B 1 255 ? 15.262  45.404 12.325  1.00 26.01 ? 258 ARG B CD  1 
ATOM   3308 N NE  . ARG B 1 255 ? 14.164  44.755 13.025  1.00 25.41 ? 258 ARG B NE  1 
ATOM   3309 C CZ  . ARG B 1 255 ? 14.047  43.443 13.176  1.00 27.45 ? 258 ARG B CZ  1 
ATOM   3310 N NH1 . ARG B 1 255 ? 14.951  42.620 12.656  1.00 27.54 ? 258 ARG B NH1 1 
ATOM   3311 N NH2 . ARG B 1 255 ? 13.062  42.957 13.920  1.00 26.72 ? 258 ARG B NH2 1 
ATOM   3312 N N   . ALA B 1 256 ? 17.819  49.994 10.379  1.00 29.93 ? 259 ALA B N   1 
ATOM   3313 C CA  . ALA B 1 256 ? 19.064  50.699 10.083  1.00 30.90 ? 259 ALA B CA  1 
ATOM   3314 C C   . ALA B 1 256 ? 19.004  52.200 10.375  1.00 32.49 ? 259 ALA B C   1 
ATOM   3315 O O   . ALA B 1 256 ? 20.029  52.885 10.380  1.00 33.81 ? 259 ALA B O   1 
ATOM   3316 C CB  . ALA B 1 256 ? 19.461  50.459 8.631   1.00 30.30 ? 259 ALA B CB  1 
ATOM   3317 N N   . MET B 1 257 ? 17.800  52.708 10.608  1.00 33.88 ? 260 MET B N   1 
ATOM   3318 C CA  . MET B 1 257 ? 17.604  54.122 10.893  1.00 35.33 ? 260 MET B CA  1 
ATOM   3319 C C   . MET B 1 257 ? 18.218  54.515 12.240  1.00 35.75 ? 260 MET B C   1 
ATOM   3320 O O   . MET B 1 257 ? 18.653  55.659 12.436  1.00 36.63 ? 260 MET B O   1 
ATOM   3321 C CB  . MET B 1 257 ? 16.115  54.428 10.905  1.00 35.67 ? 260 MET B CB  1 
ATOM   3322 C CG  . MET B 1 257 ? 15.435  54.157 9.593   1.00 36.54 ? 260 MET B CG  1 
ATOM   3323 S SD  . MET B 1 257 ? 15.308  55.652 8.640   1.00 41.75 ? 260 MET B SD  1 
ATOM   3324 C CE  . MET B 1 257 ? 13.636  56.134 9.112   1.00 38.17 ? 260 MET B CE  1 
ATOM   3325 N N   . SER B 1 258 ? 18.233  53.565 13.174  1.00 36.16 ? 261 SER B N   1 
ATOM   3326 C CA  . SER B 1 258 ? 18.790  53.807 14.499  1.00 37.06 ? 261 SER B CA  1 
ATOM   3327 C C   . SER B 1 258 ? 20.312  53.798 14.459  1.00 37.57 ? 261 SER B C   1 
ATOM   3328 O O   . SER B 1 258 ? 20.969  54.049 15.468  1.00 39.47 ? 261 SER B O   1 
ATOM   3329 C CB  . SER B 1 258 ? 18.251  52.789 15.511  1.00 35.16 ? 261 SER B CB  1 
ATOM   3330 O OG  . SER B 1 258 ? 18.535  51.464 15.125  1.00 34.75 ? 261 SER B OG  1 
ATOM   3331 N N   . ASP B 1 259 ? 20.861  53.520 13.278  1.00 37.83 ? 262 ASP B N   1 
ATOM   3332 C CA  . ASP B 1 259 ? 22.304  53.507 13.076  1.00 38.48 ? 262 ASP B CA  1 
ATOM   3333 C C   . ASP B 1 259 ? 22.816  54.828 12.521  1.00 39.56 ? 262 ASP B C   1 
ATOM   3334 O O   . ASP B 1 259 ? 24.020  55.025 12.403  1.00 39.75 ? 262 ASP B O   1 
ATOM   3335 C CB  . ASP B 1 259 ? 22.708  52.367 12.154  1.00 37.13 ? 262 ASP B CB  1 
ATOM   3336 C CG  . ASP B 1 259 ? 22.456  51.021 12.765  1.00 37.56 ? 262 ASP B CG  1 
ATOM   3337 O OD1 . ASP B 1 259 ? 22.696  50.862 13.977  1.00 36.25 ? 262 ASP B OD1 1 
ATOM   3338 O OD2 . ASP B 1 259 ? 22.024  50.111 12.036  1.00 40.57 ? 262 ASP B OD2 1 
ATOM   3339 N N   . GLU B 1 260 ? 21.902  55.727 12.170  1.00 41.10 ? 263 GLU B N   1 
ATOM   3340 C CA  . GLU B 1 260 ? 22.300  57.026 11.640  1.00 44.13 ? 263 GLU B CA  1 
ATOM   3341 C C   . GLU B 1 260 ? 22.476  58.012 12.799  1.00 42.63 ? 263 GLU B C   1 
ATOM   3342 O O   . GLU B 1 260 ? 21.639  58.077 13.702  1.00 44.12 ? 263 GLU B O   1 
ATOM   3343 C CB  . GLU B 1 260 ? 21.257  57.551 10.640  1.00 47.97 ? 263 GLU B CB  1 
ATOM   3344 C CG  . GLU B 1 260 ? 20.648  56.478 9.701   1.00 57.65 ? 263 GLU B CG  1 
ATOM   3345 C CD  . GLU B 1 260 ? 21.561  55.988 8.548   1.00 61.97 ? 263 GLU B CD  1 
ATOM   3346 O OE1 . GLU B 1 260 ? 21.000  55.442 7.561   1.00 63.02 ? 263 GLU B OE1 1 
ATOM   3347 O OE2 . GLU B 1 260 ? 22.810  56.130 8.623   1.00 63.95 ? 263 GLU B OE2 1 
ATOM   3348 N N   . PHE B 1 261 ? 23.588  58.739 12.808  1.00 40.51 ? 264 PHE B N   1 
ATOM   3349 C CA  . PHE B 1 261 ? 23.834  59.712 13.863  1.00 38.96 ? 264 PHE B CA  1 
ATOM   3350 C C   . PHE B 1 261 ? 23.035  60.990 13.569  1.00 39.19 ? 264 PHE B C   1 
ATOM   3351 O O   . PHE B 1 261 ? 23.396  61.713 12.619  1.00 38.73 ? 264 PHE B O   1 
ATOM   3352 C CB  . PHE B 1 261 ? 25.327  60.035 13.963  1.00 35.74 ? 264 PHE B CB  1 
ATOM   3353 C CG  . PHE B 1 261 ? 26.195  58.845 14.242  1.00 32.12 ? 264 PHE B CG  1 
ATOM   3354 C CD1 . PHE B 1 261 ? 27.166  58.452 13.328  1.00 31.21 ? 264 PHE B CD1 1 
ATOM   3355 C CD2 . PHE B 1 261 ? 26.045  58.119 15.422  1.00 30.53 ? 264 PHE B CD2 1 
ATOM   3356 C CE1 . PHE B 1 261 ? 27.983  57.354 13.581  1.00 31.68 ? 264 PHE B CE1 1 
ATOM   3357 C CE2 . PHE B 1 261 ? 26.852  57.015 15.693  1.00 31.64 ? 264 PHE B CE2 1 
ATOM   3358 C CZ  . PHE B 1 261 ? 27.828  56.628 14.766  1.00 32.42 ? 264 PHE B CZ  1 
HETATM 3359 O O   . HOH C 2 .   ? 29.862  54.799 8.769   1.00 42.49 ? 268 HOH A O   1 
HETATM 3360 O O   . HOH C 2 .   ? 13.198  39.563 13.223  1.00 47.03 ? 269 HOH A O   1 
HETATM 3361 O O   . HOH C 2 .   ? 11.543  44.460 17.591  1.00 42.69 ? 270 HOH A O   1 
HETATM 3362 O O   . HOH C 2 .   ? 12.401  47.261 14.808  1.00 64.25 ? 271 HOH A O   1 
HETATM 3363 O O   . HOH C 2 .   ? 7.454   53.874 14.489  1.00 68.61 ? 272 HOH A O   1 
HETATM 3364 O O   . HOH C 2 .   ? 15.762  56.191 14.609  1.00 46.26 ? 273 HOH A O   1 
HETATM 3365 O O   . HOH C 2 .   ? 4.323   41.481 15.056  1.00 52.17 ? 274 HOH A O   1 
HETATM 3366 O O   . HOH C 2 .   ? 29.688  52.143 16.553  1.00 40.01 ? 275 HOH A O   1 
HETATM 3367 O O   . HOH C 2 .   ? 17.861  57.597 15.496  1.00 59.05 ? 276 HOH A O   1 
HETATM 3368 O O   . HOH C 2 .   ? 9.740   42.500 16.918  1.00 49.68 ? 277 HOH A O   1 
HETATM 3369 O O   . HOH C 2 .   ? 23.180  46.398 17.096  1.00 41.60 ? 278 HOH A O   1 
HETATM 3370 O O   . HOH C 2 .   ? 12.685  39.929 17.597  1.00 46.05 ? 279 HOH A O   1 
HETATM 3371 O O   . HOH C 2 .   ? 3.410   45.551 19.299  1.00 61.29 ? 280 HOH A O   1 
HETATM 3372 O O   . HOH C 2 .   ? 18.647  36.806 19.296  1.00 65.72 ? 281 HOH A O   1 
HETATM 3373 O O   . HOH C 2 .   ? 5.420   37.664 20.429  1.00 50.28 ? 282 HOH A O   1 
HETATM 3374 O O   . HOH C 2 .   ? 28.194  53.980 17.984  1.00 63.13 ? 283 HOH A O   1 
HETATM 3375 O O   . HOH C 2 .   ? 13.326  57.809 21.129  1.00 35.97 ? 284 HOH A O   1 
HETATM 3376 O O   . HOH C 2 .   ? -0.298  61.921 14.237  1.00 61.97 ? 285 HOH A O   1 
HETATM 3377 O O   . HOH C 2 .   ? 26.367  43.424 22.399  1.00 53.44 ? 286 HOH A O   1 
HETATM 3378 O O   . HOH C 2 .   ? 5.920   55.238 22.185  1.00 24.93 ? 287 HOH A O   1 
HETATM 3379 O O   . HOH C 2 .   ? 0.846   48.368 24.527  1.00 37.06 ? 288 HOH A O   1 
HETATM 3380 O O   . HOH C 2 .   ? 20.118  56.187 23.413  1.00 34.86 ? 289 HOH A O   1 
HETATM 3381 O O   . HOH C 2 .   ? 3.340   50.086 24.872  1.00 34.49 ? 290 HOH A O   1 
HETATM 3382 O O   . HOH C 2 .   ? 25.036  30.089 25.005  1.00 66.06 ? 291 HOH A O   1 
HETATM 3383 O O   . HOH C 2 .   ? 23.219  42.117 28.663  1.00 28.64 ? 292 HOH A O   1 
HETATM 3384 O O   . HOH C 2 .   ? 0.673   43.021 24.930  1.00 55.90 ? 293 HOH A O   1 
HETATM 3385 O O   . HOH C 2 .   ? 1.593   38.929 30.124  1.00 60.90 ? 294 HOH A O   1 
HETATM 3386 O O   . HOH C 2 .   ? 22.408  57.424 29.653  1.00 41.04 ? 295 HOH A O   1 
HETATM 3387 O O   . HOH C 2 .   ? 13.275  27.577 31.660  1.00 46.37 ? 296 HOH A O   1 
HETATM 3388 O O   . HOH C 2 .   ? 12.547  55.635 30.861  1.00 22.80 ? 297 HOH A O   1 
HETATM 3389 O O   . HOH C 2 .   ? -0.032  47.200 32.721  1.00 54.43 ? 298 HOH A O   1 
HETATM 3390 O O   . HOH C 2 .   ? -1.094  35.398 32.349  1.00 50.06 ? 299 HOH A O   1 
HETATM 3391 O O   . HOH C 2 .   ? 32.354  50.962 47.757  1.00 50.82 ? 300 HOH A O   1 
HETATM 3392 O O   . HOH C 2 .   ? -5.836  40.794 34.523  1.00 39.98 ? 301 HOH A O   1 
HETATM 3393 O O   . HOH C 2 .   ? -11.850 45.975 35.497  1.00 38.73 ? 302 HOH A O   1 
HETATM 3394 O O   . HOH C 2 .   ? -0.231  49.083 34.925  1.00 30.99 ? 303 HOH A O   1 
HETATM 3395 O O   . HOH C 2 .   ? 22.904  37.669 36.059  1.00 61.64 ? 304 HOH A O   1 
HETATM 3396 O O   . HOH C 2 .   ? -7.359  44.832 35.682  1.00 37.80 ? 305 HOH A O   1 
HETATM 3397 O O   . HOH C 2 .   ? -8.892  34.266 36.785  1.00 55.36 ? 306 HOH A O   1 
HETATM 3398 O O   . HOH C 2 .   ? 0.635   52.696 36.468  1.00 48.95 ? 307 HOH A O   1 
HETATM 3399 O O   . HOH C 2 .   ? 8.410   42.822 37.414  1.00 10.84 ? 308 HOH A O   1 
HETATM 3400 O O   . HOH C 2 .   ? 24.685  50.430 37.308  1.00 56.59 ? 309 HOH A O   1 
HETATM 3401 O O   . HOH C 2 .   ? 20.988  52.636 38.160  1.00 24.14 ? 310 HOH A O   1 
HETATM 3402 O O   . HOH C 2 .   ? -5.739  57.058 38.370  1.00 55.34 ? 311 HOH A O   1 
HETATM 3403 O O   . HOH C 2 .   ? -3.665  36.621 40.186  1.00 33.89 ? 312 HOH A O   1 
HETATM 3404 O O   . HOH C 2 .   ? -13.147 46.610 39.602  1.00 29.40 ? 313 HOH A O   1 
HETATM 3405 O O   . HOH C 2 .   ? 5.751   33.889 41.258  1.00 50.01 ? 314 HOH A O   1 
HETATM 3406 O O   . HOH C 2 .   ? 15.219  50.149 41.024  1.00 35.65 ? 315 HOH A O   1 
HETATM 3407 O O   . HOH C 2 .   ? -7.141  55.402 40.874  1.00 48.07 ? 316 HOH A O   1 
HETATM 3408 O O   . HOH C 2 .   ? 15.396  33.903 39.525  1.00 53.63 ? 317 HOH A O   1 
HETATM 3409 O O   . HOH C 2 .   ? 21.927  41.762 41.477  1.00 32.22 ? 318 HOH A O   1 
HETATM 3410 O O   . HOH C 2 .   ? 21.515  45.210 41.895  1.00 46.48 ? 319 HOH A O   1 
HETATM 3411 O O   . HOH C 2 .   ? -13.375 38.825 42.892  1.00 33.11 ? 320 HOH A O   1 
HETATM 3412 O O   . HOH C 2 .   ? -13.845 41.694 42.795  1.00 37.73 ? 321 HOH A O   1 
HETATM 3413 O O   . HOH C 2 .   ? 13.658  54.988 41.362  1.00 53.67 ? 322 HOH A O   1 
HETATM 3414 O O   . HOH C 2 .   ? -2.235  59.350 41.849  1.00 52.55 ? 323 HOH A O   1 
HETATM 3415 O O   . HOH C 2 .   ? -4.942  33.492 43.350  1.00 36.23 ? 324 HOH A O   1 
HETATM 3416 O O   . HOH C 2 .   ? -10.327 51.141 43.755  1.00 46.16 ? 325 HOH A O   1 
HETATM 3417 O O   . HOH C 2 .   ? 23.350  45.466 44.943  1.00 37.73 ? 326 HOH A O   1 
HETATM 3418 O O   . HOH C 2 .   ? 20.962  44.500 45.968  1.00 36.42 ? 327 HOH A O   1 
HETATM 3419 O O   . HOH C 2 .   ? 19.856  55.058 46.323  1.00 47.57 ? 328 HOH A O   1 
HETATM 3420 O O   . HOH C 2 .   ? 12.590  55.430 48.981  1.00 50.81 ? 329 HOH A O   1 
HETATM 3421 O O   . HOH C 2 .   ? -7.538  54.250 48.073  1.00 63.39 ? 330 HOH A O   1 
HETATM 3422 O O   . HOH C 2 .   ? 3.616   35.645 40.204  1.00 38.47 ? 331 HOH A O   1 
HETATM 3423 O O   . HOH C 2 .   ? -11.338 33.738 44.355  1.00 69.16 ? 332 HOH A O   1 
HETATM 3424 O O   . HOH C 2 .   ? 8.797   50.440 51.278  1.00 47.36 ? 333 HOH A O   1 
HETATM 3425 O O   . HOH C 2 .   ? 11.956  52.754 48.617  1.00 59.54 ? 334 HOH A O   1 
HETATM 3426 O O   . HOH C 2 .   ? 10.869  48.355 49.924  1.00 41.45 ? 335 HOH A O   1 
HETATM 3427 O O   . HOH C 2 .   ? -11.715 39.752 51.672  1.00 28.17 ? 336 HOH A O   1 
HETATM 3428 O O   . HOH C 2 .   ? -12.994 42.100 51.324  1.00 31.99 ? 337 HOH A O   1 
HETATM 3429 O O   . HOH C 2 .   ? 7.486   39.706 52.534  1.00 37.14 ? 338 HOH A O   1 
HETATM 3430 O O   . HOH C 2 .   ? 3.176   56.869 52.306  1.00 53.89 ? 339 HOH A O   1 
HETATM 3431 O O   . HOH C 2 .   ? 3.542   35.020 54.241  1.00 29.56 ? 340 HOH A O   1 
HETATM 3432 O O   . HOH C 2 .   ? -11.447 32.993 54.640  1.00 43.45 ? 341 HOH A O   1 
HETATM 3433 O O   . HOH C 2 .   ? 9.806   42.540 56.509  1.00 34.93 ? 342 HOH A O   1 
HETATM 3434 O O   . HOH C 2 .   ? -1.993  30.830 53.835  1.00 69.03 ? 343 HOH A O   1 
HETATM 3435 O O   . HOH C 2 .   ? 1.262   60.823 58.294  1.00 44.50 ? 344 HOH A O   1 
HETATM 3436 O O   . HOH C 2 .   ? 1.057   32.389 59.184  1.00 55.72 ? 345 HOH A O   1 
HETATM 3437 O O   . HOH C 2 .   ? -13.815 42.898 59.437  1.00 33.62 ? 346 HOH A O   1 
HETATM 3438 O O   . HOH C 2 .   ? -9.498  35.408 60.511  1.00 28.72 ? 347 HOH A O   1 
HETATM 3439 O O   . HOH C 2 .   ? -9.982  53.320 60.561  1.00 51.13 ? 348 HOH A O   1 
HETATM 3440 O O   . HOH C 2 .   ? -12.651 36.123 60.427  1.00 56.47 ? 349 HOH A O   1 
HETATM 3441 O O   . HOH C 2 .   ? -4.640  64.233 61.266  1.00 54.14 ? 350 HOH A O   1 
HETATM 3442 O O   . HOH C 2 .   ? 2.190   62.304 75.684  1.00 52.37 ? 351 HOH A O   1 
HETATM 3443 O O   . HOH C 2 .   ? -6.956  37.485 67.490  1.00 63.98 ? 352 HOH A O   1 
HETATM 3444 O O   . HOH C 2 .   ? -2.748  56.128 58.943  1.00 36.59 ? 353 HOH A O   1 
HETATM 3445 O O   . HOH C 2 .   ? -0.277  39.313 61.193  1.00 29.07 ? 354 HOH A O   1 
HETATM 3446 O O   . HOH C 2 .   ? -5.772  35.702 44.687  1.00 35.79 ? 355 HOH A O   1 
HETATM 3447 O O   . HOH D 2 .   ? 27.958  27.999 -38.172 1.00 50.73 ? 268 HOH B O   1 
HETATM 3448 O O   . HOH D 2 .   ? 21.874  30.901 -38.922 1.00 44.05 ? 269 HOH B O   1 
HETATM 3449 O O   . HOH D 2 .   ? 21.719  38.589 -36.093 1.00 48.89 ? 270 HOH B O   1 
HETATM 3450 O O   . HOH D 2 .   ? 27.052  38.261 -35.324 1.00 62.41 ? 271 HOH B O   1 
HETATM 3451 O O   . HOH D 2 .   ? 29.337  43.979 -34.675 1.00 59.07 ? 272 HOH B O   1 
HETATM 3452 O O   . HOH D 2 .   ? 26.216  26.905 -32.396 1.00 53.24 ? 273 HOH B O   1 
HETATM 3453 O O   . HOH D 2 .   ? 14.430  43.174 -33.179 1.00 27.11 ? 274 HOH B O   1 
HETATM 3454 O O   . HOH D 2 .   ? 23.077  28.127 -31.898 1.00 31.11 ? 275 HOH B O   1 
HETATM 3455 O O   . HOH D 2 .   ? 30.155  32.722 -31.455 1.00 39.90 ? 276 HOH B O   1 
HETATM 3456 O O   . HOH D 2 .   ? 16.961  27.003 -30.559 1.00 63.04 ? 277 HOH B O   1 
HETATM 3457 O O   . HOH D 2 .   ? 25.615  50.057 -30.933 1.00 35.02 ? 278 HOH B O   1 
HETATM 3458 O O   . HOH D 2 .   ? 18.500  27.985 -27.626 1.00 47.53 ? 279 HOH B O   1 
HETATM 3459 O O   . HOH D 2 .   ? 13.108  26.297 -26.769 1.00 67.33 ? 280 HOH B O   1 
HETATM 3460 O O   . HOH D 2 .   ? 11.554  33.469 -25.735 1.00 45.15 ? 281 HOH B O   1 
HETATM 3461 O O   . HOH D 2 .   ? 35.051  45.387 -20.328 1.00 53.56 ? 282 HOH B O   1 
HETATM 3462 O O   . HOH D 2 .   ? 30.911  37.531 -23.521 1.00 33.44 ? 283 HOH B O   1 
HETATM 3463 O O   . HOH D 2 .   ? 9.852   39.774 -23.511 1.00 22.53 ? 284 HOH B O   1 
HETATM 3464 O O   . HOH D 2 .   ? 13.062  48.965 -23.392 1.00 51.12 ? 285 HOH B O   1 
HETATM 3465 O O   . HOH D 2 .   ? 29.141  35.797 -20.948 1.00 33.17 ? 286 HOH B O   1 
HETATM 3466 O O   . HOH D 2 .   ? 26.823  34.373 -19.911 1.00 27.70 ? 287 HOH B O   1 
HETATM 3467 O O   . HOH D 2 .   ? 11.304  38.125 -19.537 1.00 43.92 ? 288 HOH B O   1 
HETATM 3468 O O   . HOH D 2 .   ? 32.636  39.728 -18.440 1.00 30.89 ? 289 HOH B O   1 
HETATM 3469 O O   . HOH D 2 .   ? 23.324  30.561 -18.127 1.00 35.57 ? 290 HOH B O   1 
HETATM 3470 O O   . HOH D 2 .   ? 8.442   41.644 -19.349 1.00 43.89 ? 291 HOH B O   1 
HETATM 3471 O O   . HOH D 2 .   ? -2.278  51.185 -17.065 1.00 55.98 ? 292 HOH B O   1 
HETATM 3472 O O   . HOH D 2 .   ? 4.775   58.605 -18.444 1.00 46.48 ? 293 HOH B O   1 
HETATM 3473 O O   . HOH D 2 .   ? 29.775  35.556 -16.748 1.00 58.03 ? 294 HOH B O   1 
HETATM 3474 O O   . HOH D 2 .   ? 18.880  55.670 -17.359 1.00 66.71 ? 295 HOH B O   1 
HETATM 3475 O O   . HOH D 2 .   ? 31.351  41.631 -16.515 1.00 43.04 ? 296 HOH B O   1 
HETATM 3476 O O   . HOH D 2 .   ? -3.342  45.064 -14.925 1.00 36.31 ? 297 HOH B O   1 
HETATM 3477 O O   . HOH D 2 .   ? 33.043  50.024 -11.414 1.00 68.03 ? 298 HOH B O   1 
HETATM 3478 O O   . HOH D 2 .   ? -2.397  47.643 -13.436 1.00 29.98 ? 299 HOH B O   1 
HETATM 3479 O O   . HOH D 2 .   ? 7.506   53.124 -13.563 1.00 34.69 ? 300 HOH B O   1 
HETATM 3480 O O   . HOH D 2 .   ? 9.223   31.735 -13.611 1.00 49.03 ? 301 HOH B O   1 
HETATM 3481 O O   . HOH D 2 .   ? -0.804  50.199 -13.258 1.00 63.83 ? 302 HOH B O   1 
HETATM 3482 O O   . HOH D 2 .   ? 18.829  32.018 -11.815 1.00 23.16 ? 303 HOH B O   1 
HETATM 3483 O O   . HOH D 2 .   ? 8.691   33.918 -12.163 1.00 54.22 ? 304 HOH B O   1 
HETATM 3484 O O   . HOH D 2 .   ? 31.322  37.208 -11.632 1.00 26.25 ? 305 HOH B O   1 
HETATM 3485 O O   . HOH D 2 .   ? 4.379   41.899 -11.908 1.00 40.46 ? 306 HOH B O   1 
HETATM 3486 O O   . HOH D 2 .   ? 13.217  39.854 -10.957 1.00 42.58 ? 307 HOH B O   1 
HETATM 3487 O O   . HOH D 2 .   ? 14.841  56.616 -10.799 1.00 52.79 ? 308 HOH B O   1 
HETATM 3488 O O   . HOH D 2 .   ? 18.349  28.669 -9.985  1.00 31.69 ? 309 HOH B O   1 
HETATM 3489 O O   . HOH D 2 .   ? 2.885   56.770 -10.052 1.00 40.54 ? 310 HOH B O   1 
HETATM 3490 O O   . HOH D 2 .   ? 24.129  27.891 -8.600  1.00 47.18 ? 311 HOH B O   1 
HETATM 3491 O O   . HOH D 2 .   ? 10.172  42.605 -9.153  1.00 17.08 ? 312 HOH B O   1 
HETATM 3492 O O   . HOH D 2 .   ? 4.626   40.481 -9.023  1.00 47.69 ? 313 HOH B O   1 
HETATM 3493 O O   . HOH D 2 .   ? -5.040  44.790 -7.952  1.00 51.21 ? 314 HOH B O   1 
HETATM 3494 O O   . HOH D 2 .   ? 21.256  47.245 -7.560  1.00 47.38 ? 315 HOH B O   1 
HETATM 3495 O O   . HOH D 2 .   ? 8.794   62.681 -14.440 1.00 64.13 ? 316 HOH B O   1 
HETATM 3496 O O   . HOH D 2 .   ? 15.391  28.223 -5.866  1.00 57.89 ? 317 HOH B O   1 
HETATM 3497 O O   . HOH D 2 .   ? 4.837   62.302 -4.005  1.00 55.11 ? 318 HOH B O   1 
HETATM 3498 O O   . HOH D 2 .   ? 6.646   29.811 -3.176  1.00 67.62 ? 319 HOH B O   1 
HETATM 3499 O O   . HOH D 2 .   ? 21.009  47.813 -3.964  1.00 45.14 ? 320 HOH B O   1 
HETATM 3500 O O   . HOH D 2 .   ? 14.304  36.416 -1.625  1.00 49.31 ? 321 HOH B O   1 
HETATM 3501 O O   . HOH D 2 .   ? 11.673  55.983 -2.409  1.00 34.78 ? 322 HOH B O   1 
HETATM 3502 O O   . HOH D 2 .   ? 3.253   61.694 -1.106  1.00 52.36 ? 323 HOH B O   1 
HETATM 3503 O O   . HOH D 2 .   ? -3.518  48.104 -0.485  1.00 40.96 ? 324 HOH B O   1 
HETATM 3504 O O   . HOH D 2 .   ? 5.287   33.295 3.745   1.00 62.56 ? 325 HOH B O   1 
HETATM 3505 O O   . HOH D 2 .   ? 17.262  41.353 2.746   1.00 64.77 ? 326 HOH B O   1 
HETATM 3506 O O   . HOH D 2 .   ? -6.488  42.506 3.695   1.00 52.35 ? 327 HOH B O   1 
HETATM 3507 O O   . HOH D 2 .   ? 17.473  47.306 3.680   1.00 31.87 ? 328 HOH B O   1 
HETATM 3508 O O   . HOH D 2 .   ? 13.299  61.645 3.971   1.00 58.59 ? 329 HOH B O   1 
HETATM 3509 O O   . HOH D 2 .   ? 4.566   59.627 5.098   1.00 21.04 ? 330 HOH B O   1 
HETATM 3510 O O   . HOH D 2 .   ? 17.573  52.711 6.071   1.00 26.91 ? 331 HOH B O   1 
HETATM 3511 O O   . HOH D 2 .   ? -5.970  57.056 5.786   1.00 54.38 ? 332 HOH B O   1 
HETATM 3512 O O   . HOH D 2 .   ? 12.032  58.411 7.073   1.00 48.37 ? 333 HOH B O   1 
HETATM 3513 O O   . HOH D 2 .   ? -1.591  34.660 7.674   1.00 51.94 ? 334 HOH B O   1 
HETATM 3514 O O   . HOH D 2 .   ? 13.595  40.131 9.532   1.00 50.83 ? 335 HOH B O   1 
HETATM 3515 O O   . HOH D 2 .   ? 15.550  41.975 8.373   1.00 55.26 ? 336 HOH B O   1 
HETATM 3516 O O   . HOH D 2 .   ? -2.269  42.254 9.573   1.00 63.14 ? 337 HOH B O   1 
HETATM 3517 O O   . HOH D 2 .   ? 16.757  43.509 10.308  1.00 31.65 ? 338 HOH B O   1 
HETATM 3518 O O   . HOH D 2 .   ? 7.604   45.251 11.098  1.00 40.41 ? 339 HOH B O   1 
HETATM 3519 O O   . HOH D 2 .   ? -1.466  52.141 11.826  1.00 31.94 ? 340 HOH B O   1 
HETATM 3520 O O   . HOH D 2 .   ? 23.678  48.396 14.537  1.00 52.04 ? 341 HOH B O   1 
HETATM 3521 O O   . HOH D 2 .   ? -2.408  48.693 14.358  1.00 37.55 ? 342 HOH B O   1 
HETATM 3522 O O   . HOH D 2 .   ? 20.259  44.568 -6.814  1.00 46.03 ? 343 HOH B O   1 
HETATM 3523 O O   . HOH D 2 .   ? 20.996  25.469 -17.611 1.00 49.37 ? 344 HOH B O   1 
HETATM 3524 O O   . HOH D 2 .   ? 16.339  35.432 -32.914 1.00 31.23 ? 345 HOH B O   1 
HETATM 3525 O O   . HOH D 2 .   ? 24.433  25.733 -16.357 1.00 38.52 ? 346 HOH B O   1 
HETATM 3526 O O   . HOH D 2 .   ? 10.054  31.295 2.146   1.00 54.36 ? 347 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   4   ?   ?   ?   A . n 
A 1 2   PRO 2   5   ?   ?   ?   A . n 
A 1 3   GLU 3   6   ?   ?   ?   A . n 
A 1 4   SER 4   7   ?   ?   ?   A . n 
A 1 5   ASP 5   8   ?   ?   ?   A . n 
A 1 6   GLY 6   9   ?   ?   ?   A . n 
A 1 7   PHE 7   10  ?   ?   ?   A . n 
A 1 8   SER 8   11  ?   ?   ?   A . n 
A 1 9   ASP 9   12  12  ASP ASP A . n 
A 1 10  VAL 10  13  13  VAL VAL A . n 
A 1 11  ARG 11  14  14  ARG ARG A . n 
A 1 12  LYS 12  15  15  LYS LYS A . n 
A 1 13  VAL 13  16  16  VAL VAL A . n 
A 1 14  GLY 14  17  17  GLY GLY A . n 
A 1 15  TYR 15  18  18  TYR TYR A . n 
A 1 16  LEU 16  19  19  LEU LEU A . n 
A 1 17  ARG 17  20  20  ARG ARG A . n 
A 1 18  LYS 18  21  21  LYS LYS A . n 
A 1 19  PRO 19  22  22  PRO PRO A . n 
A 1 20  LYS 20  23  23  LYS LYS A . n 
A 1 21  SER 21  24  24  SER SER A . n 
A 1 22  MET 22  25  25  MET MET A . n 
A 1 23  HIS 23  26  26  HIS HIS A . n 
A 1 24  LYS 24  27  27  LYS LYS A . n 
A 1 25  ARG 25  28  28  ARG ARG A . n 
A 1 26  PHE 26  29  29  PHE PHE A . n 
A 1 27  PHE 27  30  30  PHE PHE A . n 
A 1 28  VAL 28  31  31  VAL VAL A . n 
A 1 29  LEU 29  32  32  LEU LEU A . n 
A 1 30  ARG 30  33  33  ARG ARG A . n 
A 1 31  ALA 31  34  34  ALA ALA A . n 
A 1 32  ALA 32  35  35  ALA ALA A . n 
A 1 33  SER 33  36  36  SER SER A . n 
A 1 34  GLU 34  37  37  GLU GLU A . n 
A 1 35  ALA 35  38  38  ALA ALA A . n 
A 1 36  GLY 36  39  39  GLY GLY A . n 
A 1 37  GLY 37  40  40  GLY GLY A . n 
A 1 38  PRO 38  41  41  PRO PRO A . n 
A 1 39  ALA 39  42  42  ALA ALA A . n 
A 1 40  ARG 40  43  43  ARG ARG A . n 
A 1 41  LEU 41  44  44  LEU LEU A . n 
A 1 42  GLU 42  45  45  GLU GLU A . n 
A 1 43  TYR 43  46  46  TYR TYR A . n 
A 1 44  TYR 44  47  47  TYR TYR A . n 
A 1 45  GLU 45  48  48  GLU GLU A . n 
A 1 46  ASN 46  49  49  ASN ASN A . n 
A 1 47  GLU 47  50  50  GLU GLU A . n 
A 1 48  LYS 48  51  51  LYS LYS A . n 
A 1 49  LYS 49  52  52  LYS LYS A . n 
A 1 50  TRP 50  53  53  TRP TRP A . n 
A 1 51  ARG 51  54  54  ARG ARG A . n 
A 1 52  HIS 52  55  55  HIS HIS A . n 
A 1 53  LYS 53  56  56  LYS LYS A . n 
A 1 54  SER 54  57  57  SER SER A . n 
A 1 55  SER 55  58  58  SER SER A . n 
A 1 56  ALA 56  59  59  ALA ALA A . n 
A 1 57  PRO 57  60  60  PRO PRO A . n 
A 1 58  LYS 58  61  61  LYS LYS A . n 
A 1 59  ARG 59  62  62  ARG ARG A . n 
A 1 60  SER 60  63  63  SER SER A . n 
A 1 61  ILE 61  64  64  ILE ILE A . n 
A 1 62  PRO 62  65  65  PRO PRO A . n 
A 1 63  LEU 63  66  66  LEU LEU A . n 
A 1 64  GLU 64  67  67  GLU GLU A . n 
A 1 65  SER 65  68  68  SER SER A . n 
A 1 66  CYS 66  69  69  CYS CYS A . n 
A 1 67  PHE 67  70  70  PHE PHE A . n 
A 1 68  ASN 68  71  71  ASN ASN A . n 
A 1 69  ILE 69  72  72  ILE ILE A . n 
A 1 70  ASN 70  73  73  ASN ASN A . n 
A 1 71  LYS 71  74  74  LYS LYS A . n 
A 1 72  ARG 72  75  75  ARG ARG A . n 
A 1 73  ALA 73  76  76  ALA ALA A . n 
A 1 74  ASP 74  77  77  ASP ASP A . n 
A 1 75  SER 75  78  78  SER SER A . n 
A 1 76  LYS 76  79  79  LYS LYS A . n 
A 1 77  ASN 77  80  80  ASN ASN A . n 
A 1 78  LYS 78  81  81  LYS LYS A . n 
A 1 79  HIS 79  82  82  HIS HIS A . n 
A 1 80  LEU 80  83  83  LEU LEU A . n 
A 1 81  VAL 81  84  84  VAL VAL A . n 
A 1 82  ALA 82  85  85  ALA ALA A . n 
A 1 83  LEU 83  86  86  LEU LEU A . n 
A 1 84  TYR 84  87  87  TYR TYR A . n 
A 1 85  THR 85  88  88  THR THR A . n 
A 1 86  ARG 86  89  89  ARG ARG A . n 
A 1 87  ASP 87  90  90  ASP ASP A . n 
A 1 88  GLU 88  91  91  GLU GLU A . n 
A 1 89  HIS 89  92  92  HIS HIS A . n 
A 1 90  PHE 90  93  93  PHE PHE A . n 
A 1 91  ALA 91  94  94  ALA ALA A . n 
A 1 92  ILE 92  95  95  ILE ILE A . n 
A 1 93  ALA 93  96  96  ALA ALA A . n 
A 1 94  ALA 94  97  97  ALA ALA A . n 
A 1 95  ASP 95  98  98  ASP ASP A . n 
A 1 96  SER 96  99  99  SER SER A . n 
A 1 97  GLU 97  100 100 GLU GLU A . n 
A 1 98  ALA 98  101 101 ALA ALA A . n 
A 1 99  GLU 99  102 102 GLU GLU A . n 
A 1 100 GLN 100 103 103 GLN GLN A . n 
A 1 101 ASP 101 104 104 ASP ASP A . n 
A 1 102 SER 102 105 105 SER SER A . n 
A 1 103 TRP 103 106 106 TRP TRP A . n 
A 1 104 TYR 104 107 107 TYR TYR A . n 
A 1 105 GLN 105 108 108 GLN GLN A . n 
A 1 106 ALA 106 109 109 ALA ALA A . n 
A 1 107 LEU 107 110 110 LEU LEU A . n 
A 1 108 LEU 108 111 111 LEU LEU A . n 
A 1 109 GLN 109 112 112 GLN GLN A . n 
A 1 110 LEU 110 113 113 LEU LEU A . n 
A 1 111 HIS 111 114 114 HIS HIS A . n 
A 1 112 ASN 112 115 ?   ?   ?   A . n 
A 1 113 ARG 113 116 ?   ?   ?   A . n 
A 1 114 ALA 114 117 ?   ?   ?   A . n 
A 1 115 LYS 115 118 ?   ?   ?   A . n 
A 1 116 GLY 116 119 ?   ?   ?   A . n 
A 1 117 HIS 117 120 ?   ?   ?   A . n 
A 1 118 HIS 118 121 ?   ?   ?   A . n 
A 1 119 ASP 119 122 ?   ?   ?   A . n 
A 1 120 GLY 120 123 ?   ?   ?   A . n 
A 1 121 ALA 121 124 ?   ?   ?   A . n 
A 1 122 ALA 122 125 ?   ?   ?   A . n 
A 1 123 ALA 123 126 ?   ?   ?   A . n 
A 1 124 LEU 124 127 ?   ?   ?   A . n 
A 1 125 GLY 125 128 ?   ?   ?   A . n 
A 1 126 ALA 126 129 ?   ?   ?   A . n 
A 1 127 GLY 127 130 ?   ?   ?   A . n 
A 1 128 GLY 128 131 ?   ?   ?   A . n 
A 1 129 GLY 129 132 ?   ?   ?   A . n 
A 1 130 GLY 130 133 ?   ?   ?   A . n 
A 1 131 GLY 131 134 ?   ?   ?   A . n 
A 1 132 SER 132 135 ?   ?   ?   A . n 
A 1 133 CYS 133 136 ?   ?   ?   A . n 
A 1 134 SER 134 137 ?   ?   ?   A . n 
A 1 135 GLY 135 138 ?   ?   ?   A . n 
A 1 136 SER 136 139 ?   ?   ?   A . n 
A 1 137 SER 137 140 ?   ?   ?   A . n 
A 1 138 GLY 138 141 ?   ?   ?   A . n 
A 1 139 LEU 139 142 ?   ?   ?   A . n 
A 1 140 GLY 140 143 ?   ?   ?   A . n 
A 1 141 GLU 141 144 ?   ?   ?   A . n 
A 1 142 ALA 142 145 ?   ?   ?   A . n 
A 1 143 GLY 143 146 ?   ?   ?   A . n 
A 1 144 GLU 144 147 ?   ?   ?   A . n 
A 1 145 ASP 145 148 ?   ?   ?   A . n 
A 1 146 LEU 146 149 ?   ?   ?   A . n 
A 1 147 SER 147 150 ?   ?   ?   A . n 
A 1 148 TYR 148 151 ?   ?   ?   A . n 
A 1 149 GLY 149 152 ?   ?   ?   A . n 
A 1 150 ASP 150 153 ?   ?   ?   A . n 
A 1 151 VAL 151 154 ?   ?   ?   A . n 
A 1 152 PRO 152 155 ?   ?   ?   A . n 
A 1 153 PRO 153 156 ?   ?   ?   A . n 
A 1 154 GLY 154 157 ?   ?   ?   A . n 
A 1 155 PRO 155 158 ?   ?   ?   A . n 
A 1 156 ALA 156 159 159 ALA ALA A . n 
A 1 157 PHE 157 160 160 PHE PHE A . n 
A 1 158 LYS 158 161 161 LYS LYS A . n 
A 1 159 GLU 159 162 162 GLU GLU A . n 
A 1 160 VAL 160 163 163 VAL VAL A . n 
A 1 161 TRP 161 164 164 TRP TRP A . n 
A 1 162 GLN 162 165 165 GLN GLN A . n 
A 1 163 VAL 163 166 166 VAL VAL A . n 
A 1 164 ILE 164 167 167 ILE ILE A . n 
A 1 165 LEU 165 168 168 LEU LEU A . n 
A 1 166 LYS 166 169 169 LYS LYS A . n 
A 1 167 PRO 167 170 170 PRO PRO A . n 
A 1 168 LYS 168 171 171 LYS LYS A . n 
A 1 169 GLY 169 172 172 GLY GLY A . n 
A 1 170 LEU 170 173 173 LEU LEU A . n 
A 1 171 GLY 171 174 174 GLY GLY A . n 
A 1 172 GLN 172 175 175 GLN GLN A . n 
A 1 173 THR 173 176 176 THR THR A . n 
A 1 174 LYS 174 177 177 LYS LYS A . n 
A 1 175 ASN 175 178 178 ASN ASN A . n 
A 1 176 LEU 176 179 179 LEU LEU A . n 
A 1 177 ILE 177 180 180 ILE ILE A . n 
A 1 178 GLY 178 181 181 GLY GLY A . n 
A 1 179 ILE 179 182 182 ILE ILE A . n 
A 1 180 TYR 180 183 183 TYR TYR A . n 
A 1 181 ARG 181 184 184 ARG ARG A . n 
A 1 182 LEU 182 185 185 LEU LEU A . n 
A 1 183 CYS 183 186 186 CYS CYS A . n 
A 1 184 LEU 184 187 187 LEU LEU A . n 
A 1 185 THR 185 188 188 THR THR A . n 
A 1 186 SER 186 189 189 SER SER A . n 
A 1 187 LYS 187 190 190 LYS LYS A . n 
A 1 188 THR 188 191 191 THR THR A . n 
A 1 189 ILE 189 192 192 ILE ILE A . n 
A 1 190 SER 190 193 193 SER SER A . n 
A 1 191 PHE 191 194 194 PHE PHE A . n 
A 1 192 VAL 192 195 195 VAL VAL A . n 
A 1 193 LYS 193 196 196 LYS LYS A . n 
A 1 194 LEU 194 197 197 LEU LEU A . n 
A 1 195 ASN 195 198 198 ASN ASN A . n 
A 1 196 SER 196 199 199 SER SER A . n 
A 1 197 GLU 197 200 200 GLU GLU A . n 
A 1 198 ALA 198 201 201 ALA ALA A . n 
A 1 199 ALA 199 202 202 ALA ALA A . n 
A 1 200 ALA 200 203 203 ALA ALA A . n 
A 1 201 VAL 201 204 204 VAL VAL A . n 
A 1 202 VAL 202 205 205 VAL VAL A . n 
A 1 203 LEU 203 206 206 LEU LEU A . n 
A 1 204 GLN 204 207 207 GLN GLN A . n 
A 1 205 LEU 205 208 208 LEU LEU A . n 
A 1 206 MET 206 209 209 MET MET A . n 
A 1 207 ASN 207 210 210 ASN ASN A . n 
A 1 208 ILE 208 211 211 ILE ILE A . n 
A 1 209 ARG 209 212 212 ARG ARG A . n 
A 1 210 ARG 210 213 213 ARG ARG A . n 
A 1 211 CYS 211 214 214 CYS CYS A . n 
A 1 212 GLY 212 215 215 GLY GLY A . n 
A 1 213 HIS 213 216 216 HIS HIS A . n 
A 1 214 SER 214 217 217 SER SER A . n 
A 1 215 GLU 215 218 218 GLU GLU A . n 
A 1 216 ASN 216 219 219 ASN ASN A . n 
A 1 217 PHE 217 220 220 PHE PHE A . n 
A 1 218 PHE 218 221 221 PHE PHE A . n 
A 1 219 PHE 219 222 222 PHE PHE A . n 
A 1 220 ILE 220 223 223 ILE ILE A . n 
A 1 221 GLU 221 224 224 GLU GLU A . n 
A 1 222 VAL 222 225 225 VAL VAL A . n 
A 1 223 GLY 223 226 226 GLY GLY A . n 
A 1 224 ARG 224 227 227 ARG ARG A . n 
A 1 225 SER 225 228 228 SER SER A . n 
A 1 226 ALA 226 229 229 ALA ALA A . n 
A 1 227 VAL 227 230 230 VAL VAL A . n 
A 1 228 THR 228 231 231 THR THR A . n 
A 1 229 GLY 229 232 232 GLY GLY A . n 
A 1 230 PRO 230 233 233 PRO PRO A . n 
A 1 231 GLY 231 234 234 GLY GLY A . n 
A 1 232 GLU 232 235 235 GLU GLU A . n 
A 1 233 PHE 233 236 236 PHE PHE A . n 
A 1 234 TRP 234 237 237 TRP TRP A . n 
A 1 235 MET 235 238 238 MET MET A . n 
A 1 236 GLN 236 239 239 GLN GLN A . n 
A 1 237 VAL 237 240 240 VAL VAL A . n 
A 1 238 ASP 238 241 241 ASP ASP A . n 
A 1 239 ASP 239 242 242 ASP ASP A . n 
A 1 240 SER 240 243 243 SER SER A . n 
A 1 241 VAL 241 244 244 VAL VAL A . n 
A 1 242 VAL 242 245 245 VAL VAL A . n 
A 1 243 ALA 243 246 246 ALA ALA A . n 
A 1 244 GLN 244 247 247 GLN GLN A . n 
A 1 245 ASN 245 248 248 ASN ASN A . n 
A 1 246 MET 246 249 249 MET MET A . n 
A 1 247 HIS 247 250 250 HIS HIS A . n 
A 1 248 GLU 248 251 251 GLU GLU A . n 
A 1 249 THR 249 252 252 THR THR A . n 
A 1 250 ILE 250 253 253 ILE ILE A . n 
A 1 251 LEU 251 254 254 LEU LEU A . n 
A 1 252 GLU 252 255 255 GLU GLU A . n 
A 1 253 ALA 253 256 256 ALA ALA A . n 
A 1 254 MET 254 257 257 MET MET A . n 
A 1 255 ARG 255 258 258 ARG ARG A . n 
A 1 256 ALA 256 259 259 ALA ALA A . n 
A 1 257 MET 257 260 260 MET MET A . n 
A 1 258 SER 258 261 261 SER SER A . n 
A 1 259 ASP 259 262 262 ASP ASP A . n 
A 1 260 GLU 260 263 ?   ?   ?   A . n 
A 1 261 PHE 261 264 ?   ?   ?   A . n 
A 1 262 ARG 262 265 ?   ?   ?   A . n 
A 1 263 PRO 263 266 ?   ?   ?   A . n 
A 1 264 ARG 264 267 ?   ?   ?   A . n 
B 1 1   PRO 1   4   ?   ?   ?   B . n 
B 1 2   PRO 2   5   ?   ?   ?   B . n 
B 1 3   GLU 3   6   ?   ?   ?   B . n 
B 1 4   SER 4   7   ?   ?   ?   B . n 
B 1 5   ASP 5   8   ?   ?   ?   B . n 
B 1 6   GLY 6   9   ?   ?   ?   B . n 
B 1 7   PHE 7   10  ?   ?   ?   B . n 
B 1 8   SER 8   11  11  SER SER B . n 
B 1 9   ASP 9   12  12  ASP ASP B . n 
B 1 10  VAL 10  13  13  VAL VAL B . n 
B 1 11  ARG 11  14  14  ARG ARG B . n 
B 1 12  LYS 12  15  15  LYS LYS B . n 
B 1 13  VAL 13  16  16  VAL VAL B . n 
B 1 14  GLY 14  17  17  GLY GLY B . n 
B 1 15  TYR 15  18  18  TYR TYR B . n 
B 1 16  LEU 16  19  19  LEU LEU B . n 
B 1 17  ARG 17  20  20  ARG ARG B . n 
B 1 18  LYS 18  21  21  LYS LYS B . n 
B 1 19  PRO 19  22  22  PRO PRO B . n 
B 1 20  LYS 20  23  23  LYS LYS B . n 
B 1 21  SER 21  24  24  SER SER B . n 
B 1 22  MET 22  25  25  MET MET B . n 
B 1 23  HIS 23  26  26  HIS HIS B . n 
B 1 24  LYS 24  27  27  LYS LYS B . n 
B 1 25  ARG 25  28  28  ARG ARG B . n 
B 1 26  PHE 26  29  29  PHE PHE B . n 
B 1 27  PHE 27  30  30  PHE PHE B . n 
B 1 28  VAL 28  31  31  VAL VAL B . n 
B 1 29  LEU 29  32  32  LEU LEU B . n 
B 1 30  ARG 30  33  33  ARG ARG B . n 
B 1 31  ALA 31  34  34  ALA ALA B . n 
B 1 32  ALA 32  35  35  ALA ALA B . n 
B 1 33  SER 33  36  36  SER SER B . n 
B 1 34  GLU 34  37  37  GLU GLU B . n 
B 1 35  ALA 35  38  38  ALA ALA B . n 
B 1 36  GLY 36  39  39  GLY GLY B . n 
B 1 37  GLY 37  40  40  GLY GLY B . n 
B 1 38  PRO 38  41  41  PRO PRO B . n 
B 1 39  ALA 39  42  42  ALA ALA B . n 
B 1 40  ARG 40  43  43  ARG ARG B . n 
B 1 41  LEU 41  44  44  LEU LEU B . n 
B 1 42  GLU 42  45  45  GLU GLU B . n 
B 1 43  TYR 43  46  46  TYR TYR B . n 
B 1 44  TYR 44  47  47  TYR TYR B . n 
B 1 45  GLU 45  48  48  GLU GLU B . n 
B 1 46  ASN 46  49  49  ASN ASN B . n 
B 1 47  GLU 47  50  50  GLU GLU B . n 
B 1 48  LYS 48  51  51  LYS LYS B . n 
B 1 49  LYS 49  52  52  LYS LYS B . n 
B 1 50  TRP 50  53  53  TRP TRP B . n 
B 1 51  ARG 51  54  54  ARG ARG B . n 
B 1 52  HIS 52  55  55  HIS HIS B . n 
B 1 53  LYS 53  56  56  LYS LYS B . n 
B 1 54  SER 54  57  57  SER SER B . n 
B 1 55  SER 55  58  58  SER SER B . n 
B 1 56  ALA 56  59  59  ALA ALA B . n 
B 1 57  PRO 57  60  60  PRO PRO B . n 
B 1 58  LYS 58  61  61  LYS LYS B . n 
B 1 59  ARG 59  62  62  ARG ARG B . n 
B 1 60  SER 60  63  63  SER SER B . n 
B 1 61  ILE 61  64  64  ILE ILE B . n 
B 1 62  PRO 62  65  65  PRO PRO B . n 
B 1 63  LEU 63  66  66  LEU LEU B . n 
B 1 64  GLU 64  67  67  GLU GLU B . n 
B 1 65  SER 65  68  68  SER SER B . n 
B 1 66  CYS 66  69  69  CYS CYS B . n 
B 1 67  PHE 67  70  70  PHE PHE B . n 
B 1 68  ASN 68  71  71  ASN ASN B . n 
B 1 69  ILE 69  72  72  ILE ILE B . n 
B 1 70  ASN 70  73  73  ASN ASN B . n 
B 1 71  LYS 71  74  74  LYS LYS B . n 
B 1 72  ARG 72  75  75  ARG ARG B . n 
B 1 73  ALA 73  76  76  ALA ALA B . n 
B 1 74  ASP 74  77  77  ASP ASP B . n 
B 1 75  SER 75  78  78  SER SER B . n 
B 1 76  LYS 76  79  79  LYS LYS B . n 
B 1 77  ASN 77  80  80  ASN ASN B . n 
B 1 78  LYS 78  81  81  LYS LYS B . n 
B 1 79  HIS 79  82  82  HIS HIS B . n 
B 1 80  LEU 80  83  83  LEU LEU B . n 
B 1 81  VAL 81  84  84  VAL VAL B . n 
B 1 82  ALA 82  85  85  ALA ALA B . n 
B 1 83  LEU 83  86  86  LEU LEU B . n 
B 1 84  TYR 84  87  87  TYR TYR B . n 
B 1 85  THR 85  88  88  THR THR B . n 
B 1 86  ARG 86  89  89  ARG ARG B . n 
B 1 87  ASP 87  90  90  ASP ASP B . n 
B 1 88  GLU 88  91  91  GLU GLU B . n 
B 1 89  HIS 89  92  92  HIS HIS B . n 
B 1 90  PHE 90  93  93  PHE PHE B . n 
B 1 91  ALA 91  94  94  ALA ALA B . n 
B 1 92  ILE 92  95  95  ILE ILE B . n 
B 1 93  ALA 93  96  96  ALA ALA B . n 
B 1 94  ALA 94  97  97  ALA ALA B . n 
B 1 95  ASP 95  98  98  ASP ASP B . n 
B 1 96  SER 96  99  99  SER SER B . n 
B 1 97  GLU 97  100 100 GLU GLU B . n 
B 1 98  ALA 98  101 101 ALA ALA B . n 
B 1 99  GLU 99  102 102 GLU GLU B . n 
B 1 100 GLN 100 103 103 GLN GLN B . n 
B 1 101 ASP 101 104 104 ASP ASP B . n 
B 1 102 SER 102 105 105 SER SER B . n 
B 1 103 TRP 103 106 106 TRP TRP B . n 
B 1 104 TYR 104 107 107 TYR TYR B . n 
B 1 105 GLN 105 108 108 GLN GLN B . n 
B 1 106 ALA 106 109 109 ALA ALA B . n 
B 1 107 LEU 107 110 110 LEU LEU B . n 
B 1 108 LEU 108 111 111 LEU LEU B . n 
B 1 109 GLN 109 112 112 GLN GLN B . n 
B 1 110 LEU 110 113 113 LEU LEU B . n 
B 1 111 HIS 111 114 114 HIS HIS B . n 
B 1 112 ASN 112 115 ?   ?   ?   B . n 
B 1 113 ARG 113 116 ?   ?   ?   B . n 
B 1 114 ALA 114 117 ?   ?   ?   B . n 
B 1 115 LYS 115 118 ?   ?   ?   B . n 
B 1 116 GLY 116 119 ?   ?   ?   B . n 
B 1 117 HIS 117 120 ?   ?   ?   B . n 
B 1 118 HIS 118 121 ?   ?   ?   B . n 
B 1 119 ASP 119 122 ?   ?   ?   B . n 
B 1 120 GLY 120 123 ?   ?   ?   B . n 
B 1 121 ALA 121 124 ?   ?   ?   B . n 
B 1 122 ALA 122 125 ?   ?   ?   B . n 
B 1 123 ALA 123 126 ?   ?   ?   B . n 
B 1 124 LEU 124 127 ?   ?   ?   B . n 
B 1 125 GLY 125 128 ?   ?   ?   B . n 
B 1 126 ALA 126 129 ?   ?   ?   B . n 
B 1 127 GLY 127 130 ?   ?   ?   B . n 
B 1 128 GLY 128 131 ?   ?   ?   B . n 
B 1 129 GLY 129 132 ?   ?   ?   B . n 
B 1 130 GLY 130 133 ?   ?   ?   B . n 
B 1 131 GLY 131 134 ?   ?   ?   B . n 
B 1 132 SER 132 135 ?   ?   ?   B . n 
B 1 133 CYS 133 136 ?   ?   ?   B . n 
B 1 134 SER 134 137 ?   ?   ?   B . n 
B 1 135 GLY 135 138 ?   ?   ?   B . n 
B 1 136 SER 136 139 ?   ?   ?   B . n 
B 1 137 SER 137 140 ?   ?   ?   B . n 
B 1 138 GLY 138 141 ?   ?   ?   B . n 
B 1 139 LEU 139 142 ?   ?   ?   B . n 
B 1 140 GLY 140 143 ?   ?   ?   B . n 
B 1 141 GLU 141 144 ?   ?   ?   B . n 
B 1 142 ALA 142 145 ?   ?   ?   B . n 
B 1 143 GLY 143 146 ?   ?   ?   B . n 
B 1 144 GLU 144 147 ?   ?   ?   B . n 
B 1 145 ASP 145 148 ?   ?   ?   B . n 
B 1 146 LEU 146 149 ?   ?   ?   B . n 
B 1 147 SER 147 150 ?   ?   ?   B . n 
B 1 148 TYR 148 151 ?   ?   ?   B . n 
B 1 149 GLY 149 152 ?   ?   ?   B . n 
B 1 150 ASP 150 153 ?   ?   ?   B . n 
B 1 151 VAL 151 154 ?   ?   ?   B . n 
B 1 152 PRO 152 155 ?   ?   ?   B . n 
B 1 153 PRO 153 156 ?   ?   ?   B . n 
B 1 154 GLY 154 157 ?   ?   ?   B . n 
B 1 155 PRO 155 158 ?   ?   ?   B . n 
B 1 156 ALA 156 159 159 ALA ALA B . n 
B 1 157 PHE 157 160 160 PHE PHE B . n 
B 1 158 LYS 158 161 161 LYS LYS B . n 
B 1 159 GLU 159 162 162 GLU GLU B . n 
B 1 160 VAL 160 163 163 VAL VAL B . n 
B 1 161 TRP 161 164 164 TRP TRP B . n 
B 1 162 GLN 162 165 165 GLN GLN B . n 
B 1 163 VAL 163 166 166 VAL VAL B . n 
B 1 164 ILE 164 167 167 ILE ILE B . n 
B 1 165 LEU 165 168 168 LEU LEU B . n 
B 1 166 LYS 166 169 169 LYS LYS B . n 
B 1 167 PRO 167 170 170 PRO PRO B . n 
B 1 168 LYS 168 171 171 LYS LYS B . n 
B 1 169 GLY 169 172 172 GLY GLY B . n 
B 1 170 LEU 170 173 173 LEU LEU B . n 
B 1 171 GLY 171 174 174 GLY GLY B . n 
B 1 172 GLN 172 175 175 GLN GLN B . n 
B 1 173 THR 173 176 176 THR THR B . n 
B 1 174 LYS 174 177 177 LYS LYS B . n 
B 1 175 ASN 175 178 178 ASN ASN B . n 
B 1 176 LEU 176 179 179 LEU LEU B . n 
B 1 177 ILE 177 180 180 ILE ILE B . n 
B 1 178 GLY 178 181 181 GLY GLY B . n 
B 1 179 ILE 179 182 182 ILE ILE B . n 
B 1 180 TYR 180 183 183 TYR TYR B . n 
B 1 181 ARG 181 184 184 ARG ARG B . n 
B 1 182 LEU 182 185 185 LEU LEU B . n 
B 1 183 CYS 183 186 186 CYS CYS B . n 
B 1 184 LEU 184 187 187 LEU LEU B . n 
B 1 185 THR 185 188 188 THR THR B . n 
B 1 186 SER 186 189 189 SER SER B . n 
B 1 187 LYS 187 190 190 LYS LYS B . n 
B 1 188 THR 188 191 191 THR THR B . n 
B 1 189 ILE 189 192 192 ILE ILE B . n 
B 1 190 SER 190 193 193 SER SER B . n 
B 1 191 PHE 191 194 194 PHE PHE B . n 
B 1 192 VAL 192 195 195 VAL VAL B . n 
B 1 193 LYS 193 196 196 LYS LYS B . n 
B 1 194 LEU 194 197 197 LEU LEU B . n 
B 1 195 ASN 195 198 198 ASN ASN B . n 
B 1 196 SER 196 199 199 SER SER B . n 
B 1 197 GLU 197 200 200 GLU GLU B . n 
B 1 198 ALA 198 201 201 ALA ALA B . n 
B 1 199 ALA 199 202 202 ALA ALA B . n 
B 1 200 ALA 200 203 203 ALA ALA B . n 
B 1 201 VAL 201 204 204 VAL VAL B . n 
B 1 202 VAL 202 205 205 VAL VAL B . n 
B 1 203 LEU 203 206 206 LEU LEU B . n 
B 1 204 GLN 204 207 207 GLN GLN B . n 
B 1 205 LEU 205 208 208 LEU LEU B . n 
B 1 206 MET 206 209 209 MET MET B . n 
B 1 207 ASN 207 210 210 ASN ASN B . n 
B 1 208 ILE 208 211 211 ILE ILE B . n 
B 1 209 ARG 209 212 212 ARG ARG B . n 
B 1 210 ARG 210 213 213 ARG ARG B . n 
B 1 211 CYS 211 214 214 CYS CYS B . n 
B 1 212 GLY 212 215 215 GLY GLY B . n 
B 1 213 HIS 213 216 216 HIS HIS B . n 
B 1 214 SER 214 217 217 SER SER B . n 
B 1 215 GLU 215 218 218 GLU GLU B . n 
B 1 216 ASN 216 219 219 ASN ASN B . n 
B 1 217 PHE 217 220 220 PHE PHE B . n 
B 1 218 PHE 218 221 221 PHE PHE B . n 
B 1 219 PHE 219 222 222 PHE PHE B . n 
B 1 220 ILE 220 223 223 ILE ILE B . n 
B 1 221 GLU 221 224 224 GLU GLU B . n 
B 1 222 VAL 222 225 225 VAL VAL B . n 
B 1 223 GLY 223 226 226 GLY GLY B . n 
B 1 224 ARG 224 227 227 ARG ARG B . n 
B 1 225 SER 225 228 228 SER SER B . n 
B 1 226 ALA 226 229 229 ALA ALA B . n 
B 1 227 VAL 227 230 230 VAL VAL B . n 
B 1 228 THR 228 231 231 THR THR B . n 
B 1 229 GLY 229 232 232 GLY GLY B . n 
B 1 230 PRO 230 233 233 PRO PRO B . n 
B 1 231 GLY 231 234 234 GLY GLY B . n 
B 1 232 GLU 232 235 235 GLU GLU B . n 
B 1 233 PHE 233 236 236 PHE PHE B . n 
B 1 234 TRP 234 237 237 TRP TRP B . n 
B 1 235 MET 235 238 238 MET MET B . n 
B 1 236 GLN 236 239 239 GLN GLN B . n 
B 1 237 VAL 237 240 240 VAL VAL B . n 
B 1 238 ASP 238 241 241 ASP ASP B . n 
B 1 239 ASP 239 242 242 ASP ASP B . n 
B 1 240 SER 240 243 243 SER SER B . n 
B 1 241 VAL 241 244 244 VAL VAL B . n 
B 1 242 VAL 242 245 245 VAL VAL B . n 
B 1 243 ALA 243 246 246 ALA ALA B . n 
B 1 244 GLN 244 247 247 GLN GLN B . n 
B 1 245 ASN 245 248 248 ASN ASN B . n 
B 1 246 MET 246 249 249 MET MET B . n 
B 1 247 HIS 247 250 250 HIS HIS B . n 
B 1 248 GLU 248 251 251 GLU GLU B . n 
B 1 249 THR 249 252 252 THR THR B . n 
B 1 250 ILE 250 253 253 ILE ILE B . n 
B 1 251 LEU 251 254 254 LEU LEU B . n 
B 1 252 GLU 252 255 255 GLU GLU B . n 
B 1 253 ALA 253 256 256 ALA ALA B . n 
B 1 254 MET 254 257 257 MET MET B . n 
B 1 255 ARG 255 258 258 ARG ARG B . n 
B 1 256 ALA 256 259 259 ALA ALA B . n 
B 1 257 MET 257 260 260 MET MET B . n 
B 1 258 SER 258 261 261 SER SER B . n 
B 1 259 ASP 259 262 262 ASP ASP B . n 
B 1 260 GLU 260 263 263 GLU GLU B . n 
B 1 261 PHE 261 264 264 PHE PHE B . n 
B 1 262 ARG 262 265 ?   ?   ?   B . n 
B 1 263 PRO 263 266 ?   ?   ?   B . n 
B 1 264 ARG 264 267 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  268 70  HOH HOH A . 
C 2 HOH 2  269 75  HOH HOH A . 
C 2 HOH 3  270 76  HOH HOH A . 
C 2 HOH 4  271 77  HOH HOH A . 
C 2 HOH 5  272 79  HOH HOH A . 
C 2 HOH 6  273 80  HOH HOH A . 
C 2 HOH 7  274 81  HOH HOH A . 
C 2 HOH 8  275 83  HOH HOH A . 
C 2 HOH 9  276 84  HOH HOH A . 
C 2 HOH 10 277 85  HOH HOH A . 
C 2 HOH 11 278 86  HOH HOH A . 
C 2 HOH 12 279 87  HOH HOH A . 
C 2 HOH 13 280 88  HOH HOH A . 
C 2 HOH 14 281 89  HOH HOH A . 
C 2 HOH 15 282 90  HOH HOH A . 
C 2 HOH 16 283 91  HOH HOH A . 
C 2 HOH 17 284 92  HOH HOH A . 
C 2 HOH 18 285 93  HOH HOH A . 
C 2 HOH 19 286 94  HOH HOH A . 
C 2 HOH 20 287 95  HOH HOH A . 
C 2 HOH 21 288 96  HOH HOH A . 
C 2 HOH 22 289 97  HOH HOH A . 
C 2 HOH 23 290 98  HOH HOH A . 
C 2 HOH 24 291 99  HOH HOH A . 
C 2 HOH 25 292 100 HOH HOH A . 
C 2 HOH 26 293 101 HOH HOH A . 
C 2 HOH 27 294 102 HOH HOH A . 
C 2 HOH 28 295 103 HOH HOH A . 
C 2 HOH 29 296 104 HOH HOH A . 
C 2 HOH 30 297 105 HOH HOH A . 
C 2 HOH 31 298 106 HOH HOH A . 
C 2 HOH 32 299 107 HOH HOH A . 
C 2 HOH 33 300 108 HOH HOH A . 
C 2 HOH 34 301 109 HOH HOH A . 
C 2 HOH 35 302 110 HOH HOH A . 
C 2 HOH 36 303 111 HOH HOH A . 
C 2 HOH 37 304 112 HOH HOH A . 
C 2 HOH 38 305 113 HOH HOH A . 
C 2 HOH 39 306 114 HOH HOH A . 
C 2 HOH 40 307 115 HOH HOH A . 
C 2 HOH 41 308 116 HOH HOH A . 
C 2 HOH 42 309 117 HOH HOH A . 
C 2 HOH 43 310 118 HOH HOH A . 
C 2 HOH 44 311 119 HOH HOH A . 
C 2 HOH 45 312 120 HOH HOH A . 
C 2 HOH 46 313 121 HOH HOH A . 
C 2 HOH 47 314 122 HOH HOH A . 
C 2 HOH 48 315 123 HOH HOH A . 
C 2 HOH 49 316 124 HOH HOH A . 
C 2 HOH 50 317 125 HOH HOH A . 
C 2 HOH 51 318 126 HOH HOH A . 
C 2 HOH 52 319 127 HOH HOH A . 
C 2 HOH 53 320 128 HOH HOH A . 
C 2 HOH 54 321 129 HOH HOH A . 
C 2 HOH 55 322 130 HOH HOH A . 
C 2 HOH 56 323 131 HOH HOH A . 
C 2 HOH 57 324 132 HOH HOH A . 
C 2 HOH 58 325 133 HOH HOH A . 
C 2 HOH 59 326 134 HOH HOH A . 
C 2 HOH 60 327 135 HOH HOH A . 
C 2 HOH 61 328 136 HOH HOH A . 
C 2 HOH 62 329 137 HOH HOH A . 
C 2 HOH 63 330 138 HOH HOH A . 
C 2 HOH 64 331 139 HOH HOH A . 
C 2 HOH 65 332 140 HOH HOH A . 
C 2 HOH 66 333 141 HOH HOH A . 
C 2 HOH 67 334 142 HOH HOH A . 
C 2 HOH 68 335 143 HOH HOH A . 
C 2 HOH 69 336 144 HOH HOH A . 
C 2 HOH 70 337 145 HOH HOH A . 
C 2 HOH 71 338 146 HOH HOH A . 
C 2 HOH 72 339 147 HOH HOH A . 
C 2 HOH 73 340 148 HOH HOH A . 
C 2 HOH 74 341 149 HOH HOH A . 
C 2 HOH 75 342 150 HOH HOH A . 
C 2 HOH 76 343 151 HOH HOH A . 
C 2 HOH 77 344 152 HOH HOH A . 
C 2 HOH 78 345 153 HOH HOH A . 
C 2 HOH 79 346 154 HOH HOH A . 
C 2 HOH 80 347 155 HOH HOH A . 
C 2 HOH 81 348 156 HOH HOH A . 
C 2 HOH 82 349 157 HOH HOH A . 
C 2 HOH 83 350 158 HOH HOH A . 
C 2 HOH 84 351 159 HOH HOH A . 
C 2 HOH 85 352 160 HOH HOH A . 
C 2 HOH 86 353 162 HOH HOH A . 
C 2 HOH 87 354 163 HOH HOH A . 
C 2 HOH 88 355 164 HOH HOH A . 
D 2 HOH 1  268 1   HOH HOH B . 
D 2 HOH 2  269 2   HOH HOH B . 
D 2 HOH 3  270 3   HOH HOH B . 
D 2 HOH 4  271 4   HOH HOH B . 
D 2 HOH 5  272 5   HOH HOH B . 
D 2 HOH 6  273 6   HOH HOH B . 
D 2 HOH 7  274 7   HOH HOH B . 
D 2 HOH 8  275 8   HOH HOH B . 
D 2 HOH 9  276 9   HOH HOH B . 
D 2 HOH 10 277 10  HOH HOH B . 
D 2 HOH 11 278 11  HOH HOH B . 
D 2 HOH 12 279 12  HOH HOH B . 
D 2 HOH 13 280 13  HOH HOH B . 
D 2 HOH 14 281 14  HOH HOH B . 
D 2 HOH 15 282 15  HOH HOH B . 
D 2 HOH 16 283 16  HOH HOH B . 
D 2 HOH 17 284 17  HOH HOH B . 
D 2 HOH 18 285 18  HOH HOH B . 
D 2 HOH 19 286 19  HOH HOH B . 
D 2 HOH 20 287 20  HOH HOH B . 
D 2 HOH 21 288 21  HOH HOH B . 
D 2 HOH 22 289 22  HOH HOH B . 
D 2 HOH 23 290 23  HOH HOH B . 
D 2 HOH 24 291 24  HOH HOH B . 
D 2 HOH 25 292 25  HOH HOH B . 
D 2 HOH 26 293 26  HOH HOH B . 
D 2 HOH 27 294 27  HOH HOH B . 
D 2 HOH 28 295 28  HOH HOH B . 
D 2 HOH 29 296 29  HOH HOH B . 
D 2 HOH 30 297 30  HOH HOH B . 
D 2 HOH 31 298 31  HOH HOH B . 
D 2 HOH 32 299 32  HOH HOH B . 
D 2 HOH 33 300 33  HOH HOH B . 
D 2 HOH 34 301 34  HOH HOH B . 
D 2 HOH 35 302 35  HOH HOH B . 
D 2 HOH 36 303 36  HOH HOH B . 
D 2 HOH 37 304 37  HOH HOH B . 
D 2 HOH 38 305 38  HOH HOH B . 
D 2 HOH 39 306 39  HOH HOH B . 
D 2 HOH 40 307 40  HOH HOH B . 
D 2 HOH 41 308 41  HOH HOH B . 
D 2 HOH 42 309 42  HOH HOH B . 
D 2 HOH 43 310 43  HOH HOH B . 
D 2 HOH 44 311 44  HOH HOH B . 
D 2 HOH 45 312 45  HOH HOH B . 
D 2 HOH 46 313 46  HOH HOH B . 
D 2 HOH 47 314 47  HOH HOH B . 
D 2 HOH 48 315 48  HOH HOH B . 
D 2 HOH 49 316 49  HOH HOH B . 
D 2 HOH 50 317 50  HOH HOH B . 
D 2 HOH 51 318 51  HOH HOH B . 
D 2 HOH 52 319 52  HOH HOH B . 
D 2 HOH 53 320 53  HOH HOH B . 
D 2 HOH 54 321 54  HOH HOH B . 
D 2 HOH 55 322 55  HOH HOH B . 
D 2 HOH 56 323 56  HOH HOH B . 
D 2 HOH 57 324 57  HOH HOH B . 
D 2 HOH 58 325 58  HOH HOH B . 
D 2 HOH 59 326 59  HOH HOH B . 
D 2 HOH 60 327 60  HOH HOH B . 
D 2 HOH 61 328 61  HOH HOH B . 
D 2 HOH 62 329 62  HOH HOH B . 
D 2 HOH 63 330 63  HOH HOH B . 
D 2 HOH 64 331 64  HOH HOH B . 
D 2 HOH 65 332 65  HOH HOH B . 
D 2 HOH 66 333 66  HOH HOH B . 
D 2 HOH 67 334 67  HOH HOH B . 
D 2 HOH 68 335 68  HOH HOH B . 
D 2 HOH 69 336 69  HOH HOH B . 
D 2 HOH 70 337 71  HOH HOH B . 
D 2 HOH 71 338 72  HOH HOH B . 
D 2 HOH 72 339 73  HOH HOH B . 
D 2 HOH 73 340 74  HOH HOH B . 
D 2 HOH 74 341 78  HOH HOH B . 
D 2 HOH 75 342 82  HOH HOH B . 
D 2 HOH 76 343 161 HOH HOH B . 
D 2 HOH 77 344 165 HOH HOH B . 
D 2 HOH 78 345 166 HOH HOH B . 
D 2 HOH 79 346 167 HOH HOH B . 
D 2 HOH 80 347 168 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-08-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
3 5 'Structure model' '_exptl_crystal_grow.temp' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE phasing          .     ? 1 
X-PLOR  refinement       3.843 ? 2 
XDS     'data reduction' .     ? 3 
AUTOMAR 'data reduction' .     ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 38  ? ? -170.22 -56.72  
2  1 ALA A 76  ? ? -173.24 131.95  
3  1 ASP A 77  ? ? -126.25 -163.73 
4  1 ASN A 198 ? ? 78.56   -13.19  
5  1 GLU A 218 ? ? 58.15   -126.45 
6  1 ASN A 219 ? ? -98.96  31.18   
7  1 ASP B 12  ? ? 80.22   -70.88  
8  1 LYS B 23  ? ? -73.31  -78.71  
9  1 ALA B 38  ? ? 170.44  -53.59  
10 1 THR B 188 ? ? -115.00 -169.41 
11 1 ASN B 198 ? ? 71.44   -3.50   
12 1 GLU B 218 ? ? 64.98   -125.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A PRO 4   ? A PRO 1   
2   1 Y 1 A PRO 5   ? A PRO 2   
3   1 Y 1 A GLU 6   ? A GLU 3   
4   1 Y 1 A SER 7   ? A SER 4   
5   1 Y 1 A ASP 8   ? A ASP 5   
6   1 Y 1 A GLY 9   ? A GLY 6   
7   1 Y 1 A PHE 10  ? A PHE 7   
8   1 Y 1 A SER 11  ? A SER 8   
9   1 Y 1 A ASN 115 ? A ASN 112 
10  1 Y 1 A ARG 116 ? A ARG 113 
11  1 Y 1 A ALA 117 ? A ALA 114 
12  1 Y 1 A LYS 118 ? A LYS 115 
13  1 Y 1 A GLY 119 ? A GLY 116 
14  1 Y 1 A HIS 120 ? A HIS 117 
15  1 Y 1 A HIS 121 ? A HIS 118 
16  1 Y 1 A ASP 122 ? A ASP 119 
17  1 Y 1 A GLY 123 ? A GLY 120 
18  1 Y 1 A ALA 124 ? A ALA 121 
19  1 Y 1 A ALA 125 ? A ALA 122 
20  1 Y 1 A ALA 126 ? A ALA 123 
21  1 Y 1 A LEU 127 ? A LEU 124 
22  1 Y 1 A GLY 128 ? A GLY 125 
23  1 Y 1 A ALA 129 ? A ALA 126 
24  1 Y 1 A GLY 130 ? A GLY 127 
25  1 Y 1 A GLY 131 ? A GLY 128 
26  1 Y 1 A GLY 132 ? A GLY 129 
27  1 Y 1 A GLY 133 ? A GLY 130 
28  1 Y 1 A GLY 134 ? A GLY 131 
29  1 Y 1 A SER 135 ? A SER 132 
30  1 Y 1 A CYS 136 ? A CYS 133 
31  1 Y 1 A SER 137 ? A SER 134 
32  1 Y 1 A GLY 138 ? A GLY 135 
33  1 Y 1 A SER 139 ? A SER 136 
34  1 Y 1 A SER 140 ? A SER 137 
35  1 Y 1 A GLY 141 ? A GLY 138 
36  1 Y 1 A LEU 142 ? A LEU 139 
37  1 Y 1 A GLY 143 ? A GLY 140 
38  1 Y 1 A GLU 144 ? A GLU 141 
39  1 Y 1 A ALA 145 ? A ALA 142 
40  1 Y 1 A GLY 146 ? A GLY 143 
41  1 Y 1 A GLU 147 ? A GLU 144 
42  1 Y 1 A ASP 148 ? A ASP 145 
43  1 Y 1 A LEU 149 ? A LEU 146 
44  1 Y 1 A SER 150 ? A SER 147 
45  1 Y 1 A TYR 151 ? A TYR 148 
46  1 Y 1 A GLY 152 ? A GLY 149 
47  1 Y 1 A ASP 153 ? A ASP 150 
48  1 Y 1 A VAL 154 ? A VAL 151 
49  1 Y 1 A PRO 155 ? A PRO 152 
50  1 Y 1 A PRO 156 ? A PRO 153 
51  1 Y 1 A GLY 157 ? A GLY 154 
52  1 Y 1 A PRO 158 ? A PRO 155 
53  1 Y 1 A GLU 263 ? A GLU 260 
54  1 Y 1 A PHE 264 ? A PHE 261 
55  1 Y 1 A ARG 265 ? A ARG 262 
56  1 Y 1 A PRO 266 ? A PRO 263 
57  1 Y 1 A ARG 267 ? A ARG 264 
58  1 Y 1 B PRO 4   ? B PRO 1   
59  1 Y 1 B PRO 5   ? B PRO 2   
60  1 Y 1 B GLU 6   ? B GLU 3   
61  1 Y 1 B SER 7   ? B SER 4   
62  1 Y 1 B ASP 8   ? B ASP 5   
63  1 Y 1 B GLY 9   ? B GLY 6   
64  1 Y 1 B PHE 10  ? B PHE 7   
65  1 Y 1 B ASN 115 ? B ASN 112 
66  1 Y 1 B ARG 116 ? B ARG 113 
67  1 Y 1 B ALA 117 ? B ALA 114 
68  1 Y 1 B LYS 118 ? B LYS 115 
69  1 Y 1 B GLY 119 ? B GLY 116 
70  1 Y 1 B HIS 120 ? B HIS 117 
71  1 Y 1 B HIS 121 ? B HIS 118 
72  1 Y 1 B ASP 122 ? B ASP 119 
73  1 Y 1 B GLY 123 ? B GLY 120 
74  1 Y 1 B ALA 124 ? B ALA 121 
75  1 Y 1 B ALA 125 ? B ALA 122 
76  1 Y 1 B ALA 126 ? B ALA 123 
77  1 Y 1 B LEU 127 ? B LEU 124 
78  1 Y 1 B GLY 128 ? B GLY 125 
79  1 Y 1 B ALA 129 ? B ALA 126 
80  1 Y 1 B GLY 130 ? B GLY 127 
81  1 Y 1 B GLY 131 ? B GLY 128 
82  1 Y 1 B GLY 132 ? B GLY 129 
83  1 Y 1 B GLY 133 ? B GLY 130 
84  1 Y 1 B GLY 134 ? B GLY 131 
85  1 Y 1 B SER 135 ? B SER 132 
86  1 Y 1 B CYS 136 ? B CYS 133 
87  1 Y 1 B SER 137 ? B SER 134 
88  1 Y 1 B GLY 138 ? B GLY 135 
89  1 Y 1 B SER 139 ? B SER 136 
90  1 Y 1 B SER 140 ? B SER 137 
91  1 Y 1 B GLY 141 ? B GLY 138 
92  1 Y 1 B LEU 142 ? B LEU 139 
93  1 Y 1 B GLY 143 ? B GLY 140 
94  1 Y 1 B GLU 144 ? B GLU 141 
95  1 Y 1 B ALA 145 ? B ALA 142 
96  1 Y 1 B GLY 146 ? B GLY 143 
97  1 Y 1 B GLU 147 ? B GLU 144 
98  1 Y 1 B ASP 148 ? B ASP 145 
99  1 Y 1 B LEU 149 ? B LEU 146 
100 1 Y 1 B SER 150 ? B SER 147 
101 1 Y 1 B TYR 151 ? B TYR 148 
102 1 Y 1 B GLY 152 ? B GLY 149 
103 1 Y 1 B ASP 153 ? B ASP 150 
104 1 Y 1 B VAL 154 ? B VAL 151 
105 1 Y 1 B PRO 155 ? B PRO 152 
106 1 Y 1 B PRO 156 ? B PRO 153 
107 1 Y 1 B GLY 157 ? B GLY 154 
108 1 Y 1 B PRO 158 ? B PRO 155 
109 1 Y 1 B ARG 265 ? B ARG 262 
110 1 Y 1 B PRO 266 ? B PRO 263 
111 1 Y 1 B ARG 267 ? B ARG 264 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#