data_1QQJ
# 
_entry.id   1QQJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QQJ         
RCSB  RCSB009149   
WWPDB D_1000009149 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QCO . unspecified 
PDB 1QCN . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QQJ 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Timm, D.E.'       1 
'Mueller, H.A.'    2 
'Bhanumoorthy, P.' 3 
'Harp, J.M.'       4 
'Bunick, G.J.'     5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure and mechanism of a carbon-carbon bond hydrolase.' 
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            7 
_citation.page_first                1023 
_citation.page_last                 1033 
_citation.year                      1999 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10508789 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(99)80170-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Timm, D.E.'       1 
primary 'Mueller, H.A.'    2 
primary 'Bhanumoorthy, P.' 3 
primary 'Harp, J.M.'       4 
primary 'Bunick, G.J.'     5 
# 
_cell.entry_id           1QQJ 
_cell.length_a           64.000 
_cell.length_b           109.020 
_cell.length_c           65.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.68 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QQJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'FUMARYLACETOACETATE HYDROLASE' 46152.527 2   3.7.1.2 ? ? ? 
2 non-polymer syn 'CALCIUM ION'                   40.078    2   ?       ? ? ? 
3 non-polymer syn 'ACETATE ION'                   59.044    2   ?       ? ? ? 
4 non-polymer syn 'CACODYLATE ION'                136.989   2   ?       ? ? ? 
5 water       nat water                           18.015    894 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BETADIKETONASE, FAA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPALSKHQHVFDETTLNNFMGLGQAAWKE
ARASLQNLLSASQARLRDDKELRQRAFTSQASATMHLPATIGDYTDFYSSRQHATNVGIMFRGKENALLPNWLHLPVGYH
GRASSIVVSGTPIRRPMGQMRPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAHEHIFGMVLMNDWSARDIQ
QWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVPNPKQDPKPLPYLCHSQPYTFDINLSVSLKGEGMSQAATICRSNFK
HMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDG
YRVGFGQCAGKVLPALSPA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPALSKHQHVFDETTLNNFMGLGQAAWKE
ARASLQNLLSASQARLRDDKELRQRAFTSQASATMHLPATIGDYTDFYSSRQHATNVGIMFRGKENALLPNWLHLPVGYH
GRASSIVVSGTPIRRPMGQMRPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAHEHIFGMVLMNDWSARDIQ
QWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVPNPKQDPKPLPYLCHSQPYTFDINLSVSLKGEGMSQAATICRSNFK
HMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDG
YRVGFGQCAGKVLPALSPA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   PHE n 
1 4   ILE n 
1 5   PRO n 
1 6   VAL n 
1 7   ALA n 
1 8   GLU n 
1 9   ASP n 
1 10  SER n 
1 11  ASP n 
1 12  PHE n 
1 13  PRO n 
1 14  ILE n 
1 15  GLN n 
1 16  ASN n 
1 17  LEU n 
1 18  PRO n 
1 19  TYR n 
1 20  GLY n 
1 21  VAL n 
1 22  PHE n 
1 23  SER n 
1 24  THR n 
1 25  GLN n 
1 26  SER n 
1 27  ASN n 
1 28  PRO n 
1 29  LYS n 
1 30  PRO n 
1 31  ARG n 
1 32  ILE n 
1 33  GLY n 
1 34  VAL n 
1 35  ALA n 
1 36  ILE n 
1 37  GLY n 
1 38  ASP n 
1 39  GLN n 
1 40  ILE n 
1 41  LEU n 
1 42  ASP n 
1 43  LEU n 
1 44  SER n 
1 45  VAL n 
1 46  ILE n 
1 47  LYS n 
1 48  HIS n 
1 49  LEU n 
1 50  PHE n 
1 51  THR n 
1 52  GLY n 
1 53  PRO n 
1 54  ALA n 
1 55  LEU n 
1 56  SER n 
1 57  LYS n 
1 58  HIS n 
1 59  GLN n 
1 60  HIS n 
1 61  VAL n 
1 62  PHE n 
1 63  ASP n 
1 64  GLU n 
1 65  THR n 
1 66  THR n 
1 67  LEU n 
1 68  ASN n 
1 69  ASN n 
1 70  PHE n 
1 71  MET n 
1 72  GLY n 
1 73  LEU n 
1 74  GLY n 
1 75  GLN n 
1 76  ALA n 
1 77  ALA n 
1 78  TRP n 
1 79  LYS n 
1 80  GLU n 
1 81  ALA n 
1 82  ARG n 
1 83  ALA n 
1 84  SER n 
1 85  LEU n 
1 86  GLN n 
1 87  ASN n 
1 88  LEU n 
1 89  LEU n 
1 90  SER n 
1 91  ALA n 
1 92  SER n 
1 93  GLN n 
1 94  ALA n 
1 95  ARG n 
1 96  LEU n 
1 97  ARG n 
1 98  ASP n 
1 99  ASP n 
1 100 LYS n 
1 101 GLU n 
1 102 LEU n 
1 103 ARG n 
1 104 GLN n 
1 105 ARG n 
1 106 ALA n 
1 107 PHE n 
1 108 THR n 
1 109 SER n 
1 110 GLN n 
1 111 ALA n 
1 112 SER n 
1 113 ALA n 
1 114 THR n 
1 115 MET n 
1 116 HIS n 
1 117 LEU n 
1 118 PRO n 
1 119 ALA n 
1 120 THR n 
1 121 ILE n 
1 122 GLY n 
1 123 ASP n 
1 124 TYR n 
1 125 THR n 
1 126 ASP n 
1 127 PHE n 
1 128 TYR n 
1 129 SER n 
1 130 SER n 
1 131 ARG n 
1 132 GLN n 
1 133 HIS n 
1 134 ALA n 
1 135 THR n 
1 136 ASN n 
1 137 VAL n 
1 138 GLY n 
1 139 ILE n 
1 140 MET n 
1 141 PHE n 
1 142 ARG n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 ALA n 
1 148 LEU n 
1 149 LEU n 
1 150 PRO n 
1 151 ASN n 
1 152 TRP n 
1 153 LEU n 
1 154 HIS n 
1 155 LEU n 
1 156 PRO n 
1 157 VAL n 
1 158 GLY n 
1 159 TYR n 
1 160 HIS n 
1 161 GLY n 
1 162 ARG n 
1 163 ALA n 
1 164 SER n 
1 165 SER n 
1 166 ILE n 
1 167 VAL n 
1 168 VAL n 
1 169 SER n 
1 170 GLY n 
1 171 THR n 
1 172 PRO n 
1 173 ILE n 
1 174 ARG n 
1 175 ARG n 
1 176 PRO n 
1 177 MET n 
1 178 GLY n 
1 179 GLN n 
1 180 MET n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 ASN n 
1 185 SER n 
1 186 LYS n 
1 187 PRO n 
1 188 PRO n 
1 189 VAL n 
1 190 TYR n 
1 191 GLY n 
1 192 ALA n 
1 193 CYS n 
1 194 ARG n 
1 195 LEU n 
1 196 LEU n 
1 197 ASP n 
1 198 MET n 
1 199 GLU n 
1 200 LEU n 
1 201 GLU n 
1 202 MET n 
1 203 ALA n 
1 204 PHE n 
1 205 PHE n 
1 206 VAL n 
1 207 GLY n 
1 208 PRO n 
1 209 GLY n 
1 210 ASN n 
1 211 ARG n 
1 212 PHE n 
1 213 GLY n 
1 214 GLU n 
1 215 PRO n 
1 216 ILE n 
1 217 PRO n 
1 218 ILE n 
1 219 SER n 
1 220 LYS n 
1 221 ALA n 
1 222 HIS n 
1 223 GLU n 
1 224 HIS n 
1 225 ILE n 
1 226 PHE n 
1 227 GLY n 
1 228 MET n 
1 229 VAL n 
1 230 LEU n 
1 231 MET n 
1 232 ASN n 
1 233 ASP n 
1 234 TRP n 
1 235 SER n 
1 236 ALA n 
1 237 ARG n 
1 238 ASP n 
1 239 ILE n 
1 240 GLN n 
1 241 GLN n 
1 242 TRP n 
1 243 GLU n 
1 244 TYR n 
1 245 VAL n 
1 246 PRO n 
1 247 LEU n 
1 248 GLY n 
1 249 PRO n 
1 250 PHE n 
1 251 LEU n 
1 252 GLY n 
1 253 LYS n 
1 254 SER n 
1 255 PHE n 
1 256 GLY n 
1 257 THR n 
1 258 THR n 
1 259 ILE n 
1 260 SER n 
1 261 PRO n 
1 262 TRP n 
1 263 VAL n 
1 264 VAL n 
1 265 PRO n 
1 266 MET n 
1 267 ASP n 
1 268 ALA n 
1 269 LEU n 
1 270 MET n 
1 271 PRO n 
1 272 PHE n 
1 273 VAL n 
1 274 VAL n 
1 275 PRO n 
1 276 ASN n 
1 277 PRO n 
1 278 LYS n 
1 279 GLN n 
1 280 ASP n 
1 281 PRO n 
1 282 LYS n 
1 283 PRO n 
1 284 LEU n 
1 285 PRO n 
1 286 TYR n 
1 287 LEU n 
1 288 CYS n 
1 289 HIS n 
1 290 SER n 
1 291 GLN n 
1 292 PRO n 
1 293 TYR n 
1 294 THR n 
1 295 PHE n 
1 296 ASP n 
1 297 ILE n 
1 298 ASN n 
1 299 LEU n 
1 300 SER n 
1 301 VAL n 
1 302 SER n 
1 303 LEU n 
1 304 LYS n 
1 305 GLY n 
1 306 GLU n 
1 307 GLY n 
1 308 MET n 
1 309 SER n 
1 310 GLN n 
1 311 ALA n 
1 312 ALA n 
1 313 THR n 
1 314 ILE n 
1 315 CYS n 
1 316 ARG n 
1 317 SER n 
1 318 ASN n 
1 319 PHE n 
1 320 LYS n 
1 321 HIS n 
1 322 MET n 
1 323 TYR n 
1 324 TRP n 
1 325 THR n 
1 326 MET n 
1 327 LEU n 
1 328 GLN n 
1 329 GLN n 
1 330 LEU n 
1 331 THR n 
1 332 HIS n 
1 333 HIS n 
1 334 SER n 
1 335 VAL n 
1 336 ASN n 
1 337 GLY n 
1 338 CYS n 
1 339 ASN n 
1 340 LEU n 
1 341 ARG n 
1 342 PRO n 
1 343 GLY n 
1 344 ASP n 
1 345 LEU n 
1 346 LEU n 
1 347 ALA n 
1 348 SER n 
1 349 GLY n 
1 350 THR n 
1 351 ILE n 
1 352 SER n 
1 353 GLY n 
1 354 SER n 
1 355 ASP n 
1 356 PRO n 
1 357 GLU n 
1 358 SER n 
1 359 PHE n 
1 360 GLY n 
1 361 SER n 
1 362 MET n 
1 363 LEU n 
1 364 GLU n 
1 365 LEU n 
1 366 SER n 
1 367 TRP n 
1 368 LYS n 
1 369 GLY n 
1 370 THR n 
1 371 LYS n 
1 372 ALA n 
1 373 ILE n 
1 374 ASP n 
1 375 VAL n 
1 376 GLY n 
1 377 GLN n 
1 378 GLY n 
1 379 GLN n 
1 380 THR n 
1 381 ARG n 
1 382 THR n 
1 383 PHE n 
1 384 LEU n 
1 385 LEU n 
1 386 ASP n 
1 387 GLY n 
1 388 ASP n 
1 389 GLU n 
1 390 VAL n 
1 391 ILE n 
1 392 ILE n 
1 393 THR n 
1 394 GLY n 
1 395 HIS n 
1 396 CYS n 
1 397 GLN n 
1 398 GLY n 
1 399 ASP n 
1 400 GLY n 
1 401 TYR n 
1 402 ARG n 
1 403 VAL n 
1 404 GLY n 
1 405 PHE n 
1 406 GLY n 
1 407 GLN n 
1 408 CYS n 
1 409 ALA n 
1 410 GLY n 
1 411 LYS n 
1 412 VAL n 
1 413 LEU n 
1 414 PRO n 
1 415 ALA n 
1 416 LEU n 
1 417 SER n 
1 418 PRO n 
1 419 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PLASMID 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FAAA_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPALSKHQHVFDETTLNNFMGLGQAAWKE
ARASLQNLLSASQARLRDDKELRQRAFTSQASATMHLPATIGDYTDFYSSRQHATNVGIMFRGKENALLPNWLHLPVGYH
GRASSIVVSGTPIRRPMGQMRPDNSKPPVYGACRLLDMELEMAFFVGPGNRFGEPIPISKAHEHIFGMVLMNDWSARDIQ
QWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVPNPKQDPKPLPYLCHSQPYTFDINLSVSLKGEGMSQAATICRSNFK
HMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFLLDGDEVIITGHCQGDG
YRVGFGQCAGKVLPALSPA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P35505 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QQJ A 1 ? 419 ? P35505 1 ? 419 ? 1 419 
2 1 1QQJ B 1 ? 419 ? P35505 1 ? 419 ? 1 419 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'    ?                'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE          ?                'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'    ?                'Ca 2'           40.078  
CAC non-polymer         . 'CACODYLATE ION' dimethylarsinate 'C2 H6 As O2 -1' 136.989 
CYS 'L-peptide linking' y CYSTEINE         ?                'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QQJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.83 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG8000, SODIUM CACODYLATE, NICKEL ACETATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   BRANDEIS 
_diffrn_detector.pdbx_collection_date   1997-04-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.071 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             1.071 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QQJ 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.100 
_reflns.d_resolution_high            1.550 
_reflns.number_obs                   118167 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.5 
_reflns.pdbx_Rmerge_I_obs            0.0480000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.0000 
_reflns.B_iso_Wilson_estimate        19.10 
_reflns.pdbx_redundancy              4.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.61 
_reflns_shell.percent_possible_all   49.3 
_reflns_shell.Rmerge_I_obs           0.2040000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1QQJ 
_refine.ls_number_reflns_obs                     118167 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.1 
_refine.ls_d_res_high                            1.55 
_refine.ls_percent_reflns_obs                    92.5 
_refine.ls_R_factor_obs                          0.1830000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1830000 
_refine.ls_R_factor_R_free                       0.2110000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  5952 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6448 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             894 
_refine_hist.number_atoms_total               7362 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        29.1 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.019 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QQJ 
_struct.title                     'CRYSTAL STRUCTURE OF MOUSE FUMARYLACETOACETATE HYDROLASE REFINED AT 1.55 ANGSTROM RESOLUTION' 
_struct.pdbx_descriptor           'FUMARYLACETOACETATE HYDROLASE (E.C.3.7.1.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QQJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'MIXED BETA-SANDWICH ROLL, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 43  ? LYS A 47  ? LEU A 43  LYS A 47  1 ? 5  
HELX_P HELX_P2  2  HIS A 48  ? PHE A 50  ? HIS A 48  PHE A 50  5 ? 3  
HELX_P HELX_P3  3  HIS A 58  ? GLU A 64  ? HIS A 58  GLU A 64  5 ? 7  
HELX_P HELX_P4  4  LEU A 67  ? LEU A 73  ? LEU A 67  LEU A 73  1 ? 7  
HELX_P HELX_P5  5  GLY A 74  ? SER A 90  ? GLY A 74  SER A 90  1 ? 17 
HELX_P HELX_P6  6  ASP A 99  ? ALA A 106 ? ASP A 99  ALA A 106 1 ? 8  
HELX_P HELX_P7  7  ALA A 111 ? ALA A 113 ? ALA A 111 ALA A 113 5 ? 3  
HELX_P HELX_P8  8  SER A 130 ? GLY A 143 ? SER A 130 GLY A 143 1 ? 14 
HELX_P HELX_P9  9  LYS A 144 ? ALA A 147 ? LYS A 144 ALA A 147 5 ? 4  
HELX_P HELX_P10 10 PRO A 217 ? HIS A 222 ? PRO A 217 HIS A 222 1 ? 6  
HELX_P HELX_P11 11 ARG A 237 ? TYR A 244 ? ARG A 237 TYR A 244 1 ? 8  
HELX_P HELX_P12 12 PHE A 250 ? PHE A 255 ? PHE A 250 PHE A 255 1 ? 6  
HELX_P HELX_P13 13 MET A 266 ? MET A 270 ? MET A 266 MET A 270 1 ? 5  
HELX_P HELX_P14 14 LEU A 284 ? CYS A 288 ? LEU A 284 CYS A 288 5 ? 5  
HELX_P HELX_P15 15 THR A 325 ? VAL A 335 ? THR A 325 VAL A 335 1 ? 11 
HELX_P HELX_P16 16 ASP A 355 ? PHE A 359 ? ASP A 355 PHE A 359 5 ? 5  
HELX_P HELX_P17 17 SER A 361 ? SER A 366 ? SER A 361 SER A 366 1 ? 6  
HELX_P HELX_P18 18 LEU B 43  ? LYS B 47  ? LEU B 43  LYS B 47  1 ? 5  
HELX_P HELX_P19 19 HIS B 48  ? PHE B 50  ? HIS B 48  PHE B 50  5 ? 3  
HELX_P HELX_P20 20 HIS B 58  ? GLU B 64  ? HIS B 58  GLU B 64  5 ? 7  
HELX_P HELX_P21 21 LEU B 67  ? LEU B 73  ? LEU B 67  LEU B 73  1 ? 7  
HELX_P HELX_P22 22 GLY B 74  ? LEU B 89  ? GLY B 74  LEU B 89  1 ? 16 
HELX_P HELX_P23 23 ASP B 99  ? ALA B 106 ? ASP B 99  ALA B 106 1 ? 8  
HELX_P HELX_P24 24 SER B 130 ? GLY B 143 ? SER B 130 GLY B 143 1 ? 14 
HELX_P HELX_P25 25 LYS B 144 ? ALA B 147 ? LYS B 144 ALA B 147 5 ? 4  
HELX_P HELX_P26 26 PRO B 217 ? HIS B 222 ? PRO B 217 HIS B 222 1 ? 6  
HELX_P HELX_P27 27 ARG B 237 ? TYR B 244 ? ARG B 237 TYR B 244 1 ? 8  
HELX_P HELX_P28 28 PHE B 250 ? PHE B 255 ? PHE B 250 PHE B 255 1 ? 6  
HELX_P HELX_P29 29 MET B 266 ? MET B 270 ? MET B 266 MET B 270 1 ? 5  
HELX_P HELX_P30 30 LEU B 284 ? CYS B 288 ? LEU B 284 CYS B 288 5 ? 5  
HELX_P HELX_P31 31 LYS B 320 ? MET B 322 ? LYS B 320 MET B 322 5 ? 3  
HELX_P HELX_P32 32 THR B 325 ? VAL B 335 ? THR B 325 VAL B 335 1 ? 11 
HELX_P HELX_P33 33 ASP B 355 ? PHE B 359 ? ASP B 355 PHE B 359 5 ? 5  
HELX_P HELX_P34 34 SER B 361 ? SER B 366 ? SER B 361 SER B 366 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C CA . CA ? ? ? 1_555 A GLU 199 OE1 ? ? A CA 420 A GLU 199  1_555 ? ? ? ? ? ? ? 2.613 ? 
metalc2  metalc ? ? C CA . CA ? ? ? 1_555 A ASP 233 OD2 ? ? A CA 420 A ASP 233  1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc3  metalc ? ? C CA . CA ? ? ? 1_555 I HOH .   O   ? ? A CA 420 A HOH 2068 1_555 ? ? ? ? ? ? ? 3.007 ? 
metalc4  metalc ? ? C CA . CA ? ? ? 1_555 A GLU 201 OE2 ? ? A CA 420 A GLU 201  1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc5  metalc ? ? C CA . CA ? ? ? 1_555 I HOH .   O   ? ? A CA 420 A HOH 2072 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc6  metalc ? ? C CA . CA ? ? ? 1_555 A ASP 126 OD2 ? ? A CA 420 A ASP 126  1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc7  metalc ? ? F CA . CA ? ? ? 1_555 J HOH .   O   ? ? B CA 420 B HOH 2090 1_555 ? ? ? ? ? ? ? 3.065 ? 
metalc8  metalc ? ? F CA . CA ? ? ? 1_555 B GLU 199 OE1 ? ? B CA 420 B GLU 199  1_555 ? ? ? ? ? ? ? 2.650 ? 
metalc9  metalc ? ? F CA . CA ? ? ? 1_555 B GLU 201 OE2 ? ? B CA 420 B GLU 201  1_555 ? ? ? ? ? ? ? 2.629 ? 
metalc10 metalc ? ? F CA . CA ? ? ? 1_555 B ASP 233 OD2 ? ? B CA 420 B ASP 233  1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc11 metalc ? ? F CA . CA ? ? ? 1_555 B ASP 126 OD2 ? ? B CA 420 B ASP 126  1_555 ? ? ? ? ? ? ? 2.628 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 245 A . ? VAL 245 A PRO 246 A ? PRO 246 A 1 8.68  
2 ASP 280 A . ? ASP 280 A PRO 281 A ? PRO 281 A 1 8.55  
3 VAL 245 B . ? VAL 245 B PRO 246 B ? PRO 246 B 1 10.05 
4 ASP 280 B . ? ASP 280 B PRO 281 B ? PRO 281 B 1 6.47  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 7 ? 
B1 ? 6 ? 
C  ? 5 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 2 ? 
G  ? 2 ? 
H  ? 5 ? 
I  ? 7 ? 
I1 ? 6 ? 
J  ? 4 ? 
J1 ? 5 ? 
K  ? 2 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? parallel      
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? parallel      
B1 1 2 ? anti-parallel 
B1 2 3 ? parallel      
B1 3 4 ? anti-parallel 
B1 4 5 ? anti-parallel 
B1 5 6 ? anti-parallel 
C  1 2 ? parallel      
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? parallel      
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
I  6 7 ? parallel      
I1 1 2 ? anti-parallel 
I1 2 3 ? parallel      
I1 3 4 ? anti-parallel 
I1 4 5 ? anti-parallel 
I1 5 6 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J1 1 2 ? anti-parallel 
J1 2 3 ? anti-parallel 
J1 3 4 ? anti-parallel 
J1 4 5 ? parallel      
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A 107 ? SER A 109 ? PHE A 107 SER A 109 
A  2 GLN A 39  ? ASP A 42  ? GLN A 39  ASP A 42  
A  3 ARG A 31  ? ILE A 36  ? ARG A 31  ILE A 36  
A  4 TYR A 19  ? SER A 23  ? TYR A 19  SER A 23  
A  5 THR A 114 ? HIS A 116 ? THR A 114 HIS A 116 
B  1 GLY A 158 ? HIS A 160 ? GLY A 158 HIS A 160 
B  2 TYR A 124 ? PHE A 127 ? TYR A 124 PHE A 127 
B  3 LEU A 345 ? ALA A 347 ? LEU A 345 ALA A 347 
B  4 LEU A 200 ? VAL A 206 ? LEU A 200 VAL A 206 
B  5 ILE A 225 ? ASN A 232 ? ILE A 225 ASN A 232 
B  6 THR A 257 ? ILE A 259 ? THR A 257 ILE A 259 
B  7 ILE A 166 ? VAL A 168 ? ILE A 166 VAL A 168 
B1 1 GLY A 158 ? HIS A 160 ? GLY A 158 HIS A 160 
B1 2 TYR A 124 ? PHE A 127 ? TYR A 124 PHE A 127 
B1 3 LEU A 345 ? ALA A 347 ? LEU A 345 ALA A 347 
B1 4 LEU A 200 ? VAL A 206 ? LEU A 200 VAL A 206 
B1 5 ILE A 225 ? ASN A 232 ? ILE A 225 ASN A 232 
B1 6 VAL A 264 ? PRO A 265 ? VAL A 264 PRO A 265 
C  1 ILE A 173 ? ARG A 174 ? ILE A 173 ARG A 174 
C  2 ARG A 402 ? LEU A 413 ? ARG A 402 LEU A 413 
C  3 GLU A 389 ? GLN A 397 ? GLU A 389 GLN A 397 
C  4 ASN A 298 ? LYS A 304 ? ASN A 298 LYS A 304 
C  5 ALA A 312 ? ASN A 318 ? ALA A 312 ASN A 318 
D  1 MET A 177 ? MET A 180 ? MET A 177 MET A 180 
D  2 VAL A 189 ? ALA A 192 ? VAL A 189 ALA A 192 
E  1 LEU A 196 ? ASP A 197 ? LEU A 196 ASP A 197 
E  2 SER A 235 ? ALA A 236 ? SER A 235 ALA A 236 
F  1 VAL A 273 ? VAL A 274 ? VAL A 273 VAL A 274 
F  2 THR A 294 ? PHE A 295 ? THR A 294 PHE A 295 
G  1 ILE A 373 ? ASP A 374 ? ILE A 373 ASP A 374 
G  2 THR A 380 ? ARG A 381 ? THR A 380 ARG A 381 
H  1 PHE B 107 ? SER B 109 ? PHE B 107 SER B 109 
H  2 GLN B 39  ? ASP B 42  ? GLN B 39  ASP B 42  
H  3 ASN B 27  ? ILE B 36  ? ASN B 27  ILE B 36  
H  4 TYR B 19  ? THR B 24  ? TYR B 19  THR B 24  
H  5 ALA B 113 ? HIS B 116 ? ALA B 113 HIS B 116 
I  1 GLY B 158 ? HIS B 160 ? GLY B 158 HIS B 160 
I  2 TYR B 124 ? PHE B 127 ? TYR B 124 PHE B 127 
I  3 LEU B 345 ? ALA B 347 ? LEU B 345 ALA B 347 
I  4 LEU B 200 ? VAL B 206 ? LEU B 200 VAL B 206 
I  5 ILE B 225 ? ASN B 232 ? ILE B 225 ASN B 232 
I  6 THR B 257 ? ILE B 259 ? THR B 257 ILE B 259 
I  7 ILE B 166 ? VAL B 168 ? ILE B 166 VAL B 168 
I1 1 GLY B 158 ? HIS B 160 ? GLY B 158 HIS B 160 
I1 2 TYR B 124 ? PHE B 127 ? TYR B 124 PHE B 127 
I1 3 LEU B 345 ? ALA B 347 ? LEU B 345 ALA B 347 
I1 4 LEU B 200 ? VAL B 206 ? LEU B 200 VAL B 206 
I1 5 ILE B 225 ? ASN B 232 ? ILE B 225 ASN B 232 
I1 6 VAL B 264 ? PRO B 265 ? VAL B 264 PRO B 265 
J  1 ALA B 312 ? ASN B 318 ? ALA B 312 ASN B 318 
J  2 ASN B 298 ? LYS B 304 ? ASN B 298 LYS B 304 
J  3 GLU B 389 ? GLN B 397 ? GLU B 389 GLN B 397 
J  4 ARG B 402 ? GLY B 404 ? ARG B 402 GLY B 404 
J1 1 ALA B 312 ? ASN B 318 ? ALA B 312 ASN B 318 
J1 2 ASN B 298 ? LYS B 304 ? ASN B 298 LYS B 304 
J1 3 GLU B 389 ? GLN B 397 ? GLU B 389 GLN B 397 
J1 4 CYS B 408 ? LEU B 413 ? CYS B 408 LEU B 413 
J1 5 ILE B 173 ? ARG B 174 ? ILE B 173 ARG B 174 
K  1 MET B 177 ? MET B 180 ? MET B 177 MET B 180 
K  2 VAL B 189 ? ALA B 192 ? VAL B 189 ALA B 192 
L  1 LEU B 196 ? ASP B 197 ? LEU B 196 ASP B 197 
L  2 SER B 235 ? ALA B 236 ? SER B 235 ALA B 236 
M  1 VAL B 273 ? VAL B 274 ? VAL B 273 VAL B 274 
M  2 THR B 294 ? PHE B 295 ? THR B 294 PHE B 295 
N  1 ILE B 373 ? ASP B 374 ? ILE B 373 ASP B 374 
N  2 THR B 380 ? ARG B 381 ? THR B 380 ARG B 381 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O THR A 108 ? O THR A 108 N ILE A 40  ? N ILE A 40  
A  2 3 N LEU A 41  ? N LEU A 41  O VAL A 34  ? O VAL A 34  
A  3 4 N GLY A 33  ? N GLY A 33  O GLY A 20  ? O GLY A 20  
A  4 5 O SER A 23  ? O SER A 23  N THR A 114 ? N THR A 114 
B  1 2 O TYR A 159 ? O TYR A 159 N ASP A 126 ? N ASP A 126 
B  2 3 N THR A 125 ? N THR A 125 O LEU A 345 ? O LEU A 345 
B  3 4 O LEU A 346 ? O LEU A 346 N PHE A 204 ? N PHE A 204 
B  4 5 O PHE A 205 ? O PHE A 205 N PHE A 226 ? N PHE A 226 
B  5 6 N ASN A 232 ? N ASN A 232 O THR A 258 ? O THR A 258 
B  6 7 O THR A 257 ? O THR A 257 N VAL A 167 ? N VAL A 167 
B1 1 2 O TYR A 159 ? O TYR A 159 N ASP A 126 ? N ASP A 126 
B1 2 3 N THR A 125 ? N THR A 125 O LEU A 345 ? O LEU A 345 
B1 3 4 O LEU A 346 ? O LEU A 346 N PHE A 204 ? N PHE A 204 
B1 4 5 O PHE A 205 ? O PHE A 205 N PHE A 226 ? N PHE A 226 
B1 5 6 N MET A 228 ? N MET A 228 O VAL A 264 ? O VAL A 264 
C  1 2 N ILE A 173 ? N ILE A 173 O LYS A 411 ? O LYS A 411 
C  2 3 O GLY A 410 ? O GLY A 410 N VAL A 390 ? N VAL A 390 
C  3 4 O HIS A 395 ? O HIS A 395 N ASN A 298 ? N ASN A 298 
C  4 5 O LEU A 303 ? O LEU A 303 N ALA A 312 ? N ALA A 312 
D  1 2 O MET A 180 ? O MET A 180 N VAL A 189 ? N VAL A 189 
E  1 2 N ASP A 197 ? N ASP A 197 O SER A 235 ? O SER A 235 
F  1 2 N VAL A 274 ? N VAL A 274 O THR A 294 ? O THR A 294 
G  1 2 N ILE A 373 ? N ILE A 373 O ARG A 381 ? O ARG A 381 
H  1 2 O THR B 108 ? O THR B 108 N ILE B 40  ? N ILE B 40  
H  2 3 N LEU B 41  ? N LEU B 41  O VAL B 34  ? O VAL B 34  
H  3 4 N GLY B 33  ? N GLY B 33  O GLY B 20  ? O GLY B 20  
H  4 5 O SER B 23  ? O SER B 23  N THR B 114 ? N THR B 114 
I  1 2 O TYR B 159 ? O TYR B 159 N ASP B 126 ? N ASP B 126 
I  2 3 N THR B 125 ? N THR B 125 O LEU B 345 ? O LEU B 345 
I  3 4 N LEU B 346 ? N LEU B 346 O PHE B 204 ? O PHE B 204 
I  4 5 O PHE B 205 ? O PHE B 205 N PHE B 226 ? N PHE B 226 
I  5 6 N ASN B 232 ? N ASN B 232 O THR B 258 ? O THR B 258 
I  6 7 O THR B 257 ? O THR B 257 N VAL B 167 ? N VAL B 167 
I1 1 2 O TYR B 159 ? O TYR B 159 N ASP B 126 ? N ASP B 126 
I1 2 3 N THR B 125 ? N THR B 125 O LEU B 345 ? O LEU B 345 
I1 3 4 N LEU B 346 ? N LEU B 346 O PHE B 204 ? O PHE B 204 
I1 4 5 O PHE B 205 ? O PHE B 205 N PHE B 226 ? N PHE B 226 
I1 5 6 N MET B 228 ? N MET B 228 O VAL B 264 ? O VAL B 264 
J  1 2 O SER B 317 ? O SER B 317 N LEU B 299 ? N LEU B 299 
J  2 3 O LYS B 304 ? O LYS B 304 N GLU B 389 ? N GLU B 389 
J  3 4 N CYS B 396 ? N CYS B 396 O VAL B 403 ? O VAL B 403 
J1 1 2 O SER B 317 ? O SER B 317 N LEU B 299 ? N LEU B 299 
J1 2 3 O LYS B 304 ? O LYS B 304 N GLU B 389 ? N GLU B 389 
J1 3 4 N ILE B 392 ? N ILE B 392 O CYS B 408 ? O CYS B 408 
J1 4 5 O LYS B 411 ? O LYS B 411 N ILE B 173 ? N ILE B 173 
K  1 2 O MET B 180 ? O MET B 180 N VAL B 189 ? N VAL B 189 
L  1 2 N ASP B 197 ? N ASP B 197 O SER B 235 ? O SER B 235 
M  1 2 N VAL B 274 ? N VAL B 274 O THR B 294 ? O THR B 294 
N  1 2 N ILE B 373 ? N ILE B 373 O ARG B 381 ? O ARG B 381 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 420'   
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 420'   
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT B 2000' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACT A 2001' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CAC B 2003' 
AC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CAC A 2004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP B 126 ? ASP B 126  . ? 1_555 ? 
2  AC1 5  GLU B 199 ? GLU B 199  . ? 1_555 ? 
3  AC1 5  GLU B 201 ? GLU B 201  . ? 1_555 ? 
4  AC1 5  ASP B 233 ? ASP B 233  . ? 1_555 ? 
5  AC1 5  HOH J .   ? HOH B 2090 . ? 1_555 ? 
6  AC2 7  ASP A 126 ? ASP A 126  . ? 1_555 ? 
7  AC2 7  GLU A 199 ? GLU A 199  . ? 1_555 ? 
8  AC2 7  GLU A 201 ? GLU A 201  . ? 1_555 ? 
9  AC2 7  ASP A 233 ? ASP A 233  . ? 1_555 ? 
10 AC2 7  LYS A 253 ? LYS A 253  . ? 1_555 ? 
11 AC2 7  HOH I .   ? HOH A 2068 . ? 1_555 ? 
12 AC2 7  HOH I .   ? HOH A 2072 . ? 1_555 ? 
13 AC3 6  PRO A 246 ? PRO A 246  . ? 1_555 ? 
14 AC3 6  TYR B 128 ? TYR B 128  . ? 1_555 ? 
15 AC3 6  VAL B 137 ? VAL B 137  . ? 1_555 ? 
16 AC3 6  ARG B 142 ? ARG B 142  . ? 1_555 ? 
17 AC3 6  HOH J .   ? HOH B 2054 . ? 1_555 ? 
18 AC3 6  HOH J .   ? HOH B 2061 . ? 1_555 ? 
19 AC4 7  TYR A 128 ? TYR A 128  . ? 1_555 ? 
20 AC4 7  VAL A 137 ? VAL A 137  . ? 1_555 ? 
21 AC4 7  ARG A 142 ? ARG A 142  . ? 1_555 ? 
22 AC4 7  CAC E .   ? CAC A 2004 . ? 1_555 ? 
23 AC4 7  HOH I .   ? HOH A 2032 . ? 1_555 ? 
24 AC4 7  HOH I .   ? HOH A 2033 . ? 1_555 ? 
25 AC4 7  PRO B 246 ? PRO B 246  . ? 1_555 ? 
26 AC5 7  TYR B 128 ? TYR B 128  . ? 1_555 ? 
27 AC5 7  HIS B 133 ? HIS B 133  . ? 1_555 ? 
28 AC5 7  GLU B 199 ? GLU B 199  . ? 1_555 ? 
29 AC5 7  ARG B 237 ? ARG B 237  . ? 1_555 ? 
30 AC5 7  GLN B 240 ? GLN B 240  . ? 1_555 ? 
31 AC5 7  LYS B 253 ? LYS B 253  . ? 1_555 ? 
32 AC5 7  HOH J .   ? HOH B 2090 . ? 1_555 ? 
33 AC6 12 TYR A 128 ? TYR A 128  . ? 1_555 ? 
34 AC6 12 HIS A 133 ? HIS A 133  . ? 1_555 ? 
35 AC6 12 VAL A 137 ? VAL A 137  . ? 1_555 ? 
36 AC6 12 GLU A 199 ? GLU A 199  . ? 1_555 ? 
37 AC6 12 ARG A 237 ? ARG A 237  . ? 1_555 ? 
38 AC6 12 GLN A 240 ? GLN A 240  . ? 1_555 ? 
39 AC6 12 LYS A 253 ? LYS A 253  . ? 1_555 ? 
40 AC6 12 THR A 350 ? THR A 350  . ? 1_555 ? 
41 AC6 12 ACT D .   ? ACT A 2001 . ? 1_555 ? 
42 AC6 12 HOH I .   ? HOH A 2068 . ? 1_555 ? 
43 AC6 12 HOH I .   ? HOH A 2072 . ? 1_555 ? 
44 AC6 12 LEU B 247 ? LEU B 247  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QQJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QQJ 
_atom_sites.fract_transf_matrix[1][1]   0.015625 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001554 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009173 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015404 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 5.843   33.940  55.756  1.00 37.16 ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 5.479   34.727  54.580  1.00 35.66 ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 6.544   35.697  54.096  1.00 33.34 ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 7.681   35.726  54.560  1.00 32.25 ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 4.145   35.425  54.857  1.00 37.65 ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 3.161   35.278  53.708  1.00 39.52 ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 1.510   35.901  54.049  1.00 41.58 ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 1.102   34.969  55.527  1.00 41.32 ? 1    MET A CE  1 
ATOM   9    N  N   . SER A 1 2   ? 6.176   36.499  53.095  1.00 30.32 ? 2    SER A N   1 
ATOM   10   C  CA  . SER A 1 2   ? 7.149   37.233  52.294  1.00 27.49 ? 2    SER A CA  1 
ATOM   11   C  C   . SER A 1 2   ? 7.068   38.732  52.539  1.00 25.56 ? 2    SER A C   1 
ATOM   12   O  O   . SER A 1 2   ? 6.070   39.221  53.059  1.00 25.07 ? 2    SER A O   1 
ATOM   13   C  CB  . SER A 1 2   ? 6.890   36.959  50.807  1.00 27.00 ? 2    SER A CB  1 
ATOM   14   O  OG  . SER A 1 2   ? 7.886   37.546  49.981  1.00 26.21 ? 2    SER A OG  1 
ATOM   15   N  N   . PHE A 1 3   ? 8.093   39.470  52.102  1.00 23.35 ? 3    PHE A N   1 
ATOM   16   C  CA  . PHE A 1 3   ? 7.952   40.923  51.996  1.00 22.01 ? 3    PHE A CA  1 
ATOM   17   C  C   . PHE A 1 3   ? 7.066   41.314  50.821  1.00 21.12 ? 3    PHE A C   1 
ATOM   18   O  O   . PHE A 1 3   ? 6.482   42.402  50.801  1.00 21.60 ? 3    PHE A O   1 
ATOM   19   C  CB  . PHE A 1 3   ? 9.316   41.606  51.948  1.00 21.47 ? 3    PHE A CB  1 
ATOM   20   C  CG  . PHE A 1 3   ? 10.194  41.308  50.774  1.00 20.64 ? 3    PHE A CG  1 
ATOM   21   C  CD1 . PHE A 1 3   ? 10.034  42.010  49.588  1.00 19.97 ? 3    PHE A CD1 1 
ATOM   22   C  CD2 . PHE A 1 3   ? 11.191  40.346  50.842  1.00 20.18 ? 3    PHE A CD2 1 
ATOM   23   C  CE1 . PHE A 1 3   ? 10.833  41.746  48.492  1.00 19.94 ? 3    PHE A CE1 1 
ATOM   24   C  CE2 . PHE A 1 3   ? 11.990  40.082  49.747  1.00 19.70 ? 3    PHE A CE2 1 
ATOM   25   C  CZ  . PHE A 1 3   ? 11.820  40.781  48.568  1.00 19.81 ? 3    PHE A CZ  1 
ATOM   26   N  N   . ILE A 1 4   ? 6.971   40.474  49.792  1.00 20.03 ? 4    ILE A N   1 
ATOM   27   C  CA  . ILE A 1 4   ? 5.948   40.627  48.755  1.00 19.59 ? 4    ILE A CA  1 
ATOM   28   C  C   . ILE A 1 4   ? 4.583   40.276  49.339  1.00 19.15 ? 4    ILE A C   1 
ATOM   29   O  O   . ILE A 1 4   ? 4.435   39.198  49.902  1.00 19.48 ? 4    ILE A O   1 
ATOM   30   C  CB  . ILE A 1 4   ? 6.257   39.686  47.572  1.00 19.03 ? 4    ILE A CB  1 
ATOM   31   C  CG1 . ILE A 1 4   ? 7.668   39.948  47.036  1.00 19.11 ? 4    ILE A CG1 1 
ATOM   32   C  CG2 . ILE A 1 4   ? 5.221   39.799  46.460  1.00 19.08 ? 4    ILE A CG2 1 
ATOM   33   C  CD1 . ILE A 1 4   ? 7.855   41.302  46.384  1.00 18.88 ? 4    ILE A CD1 1 
ATOM   34   N  N   . PRO A 1 5   ? 3.628   41.193  49.258  1.00 19.35 ? 5    PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 2.268   40.930  49.705  1.00 19.67 ? 5    PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 1.659   39.801  48.896  1.00 18.74 ? 5    PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 1.861   39.702  47.683  1.00 19.15 ? 5    PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 1.537   42.245  49.476  1.00 20.00 ? 5    PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 2.275   42.911  48.372  1.00 20.25 ? 5    PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 3.711   42.458  48.496  1.00 19.41 ? 5    PRO A CD  1 
ATOM   41   N  N   . VAL A 1 6   ? 0.982   38.887  49.582  1.00 19.08 ? 6    VAL A N   1 
ATOM   42   C  CA  . VAL A 1 6   ? 0.323   37.765  48.911  1.00 19.44 ? 6    VAL A CA  1 
ATOM   43   C  C   . VAL A 1 6   ? -1.124  37.658  49.397  1.00 20.60 ? 6    VAL A C   1 
ATOM   44   O  O   . VAL A 1 6   ? -1.324  37.472  50.593  1.00 21.45 ? 6    VAL A O   1 
ATOM   45   C  CB  . VAL A 1 6   ? 1.052   36.440  49.162  1.00 19.19 ? 6    VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 6   ? 0.302   35.277  48.508  1.00 18.46 ? 6    VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 6   ? 2.482   36.446  48.628  1.00 18.80 ? 6    VAL A CG2 1 
ATOM   48   N  N   . ALA A 1 7   ? -2.089  37.785  48.494  1.00 21.93 ? 7    ALA A N   1 
ATOM   49   C  CA  . ALA A 1 7   ? -3.489  37.603  48.885  1.00 22.91 ? 7    ALA A CA  1 
ATOM   50   C  C   . ALA A 1 7   ? -3.715  36.172  49.355  1.00 23.82 ? 7    ALA A C   1 
ATOM   51   O  O   . ALA A 1 7   ? -3.017  35.223  48.995  1.00 23.16 ? 7    ALA A O   1 
ATOM   52   C  CB  . ALA A 1 7   ? -4.396  37.962  47.716  1.00 22.97 ? 7    ALA A CB  1 
ATOM   53   N  N   . GLU A 1 8   ? -4.737  35.966  50.181  1.00 25.17 ? 8    GLU A N   1 
ATOM   54   C  CA  . GLU A 1 8   ? -5.056  34.675  50.762  1.00 26.03 ? 8    GLU A CA  1 
ATOM   55   C  C   . GLU A 1 8   ? -5.348  33.589  49.739  1.00 24.74 ? 8    GLU A C   1 
ATOM   56   O  O   . GLU A 1 8   ? -5.006  32.421  49.863  1.00 25.40 ? 8    GLU A O   1 
ATOM   57   C  CB  . GLU A 1 8   ? -6.336  34.857  51.614  1.00 28.53 ? 8    GLU A CB  1 
ATOM   58   C  CG  . GLU A 1 8   ? -6.240  36.133  52.455  1.00 31.32 ? 8    GLU A CG  1 
ATOM   59   C  CD  . GLU A 1 8   ? -5.169  35.978  53.516  1.00 33.17 ? 8    GLU A CD  1 
ATOM   60   O  OE1 . GLU A 1 8   ? -4.454  34.947  53.504  1.00 34.45 ? 8    GLU A OE1 1 
ATOM   61   O  OE2 . GLU A 1 8   ? -5.027  36.870  54.373  1.00 34.54 ? 8    GLU A OE2 1 
ATOM   62   N  N   . ASP A 1 9   ? -6.056  34.018  48.705  1.00 23.71 ? 9    ASP A N   1 
ATOM   63   C  CA  . ASP A 1 9   ? -6.476  33.160  47.612  1.00 22.83 ? 9    ASP A CA  1 
ATOM   64   C  C   . ASP A 1 9   ? -5.495  33.188  46.448  1.00 21.07 ? 9    ASP A C   1 
ATOM   65   O  O   . ASP A 1 9   ? -5.868  32.754  45.355  1.00 20.36 ? 9    ASP A O   1 
ATOM   66   C  CB  . ASP A 1 9   ? -7.868  33.600  47.151  1.00 24.67 ? 9    ASP A CB  1 
ATOM   67   C  CG  . ASP A 1 9   ? -7.964  35.069  46.803  1.00 26.45 ? 9    ASP A CG  1 
ATOM   68   O  OD1 . ASP A 1 9   ? -6.935  35.779  46.762  1.00 27.21 ? 9    ASP A OD1 1 
ATOM   69   O  OD2 . ASP A 1 9   ? -9.102  35.536  46.556  1.00 28.35 ? 9    ASP A OD2 1 
ATOM   70   N  N   . SER A 1 10  ? -4.289  33.718  46.653  1.00 18.41 ? 10   SER A N   1 
ATOM   71   C  CA  . SER A 1 10  ? -3.286  33.690  45.584  1.00 16.01 ? 10   SER A CA  1 
ATOM   72   C  C   . SER A 1 10  ? -2.820  32.259  45.348  1.00 14.43 ? 10   SER A C   1 
ATOM   73   O  O   . SER A 1 10  ? -2.599  31.528  46.308  1.00 14.00 ? 10   SER A O   1 
ATOM   74   C  CB  . SER A 1 10  ? -2.070  34.545  45.928  1.00 15.97 ? 10   SER A CB  1 
ATOM   75   O  OG  . SER A 1 10  ? -1.044  34.431  44.946  1.00 16.32 ? 10   SER A OG  1 
ATOM   76   N  N   . ASP A 1 11  ? -2.568  31.900  44.091  1.00 13.83 ? 11   ASP A N   1 
ATOM   77   C  CA  . ASP A 1 11  ? -1.940  30.602  43.824  1.00 13.00 ? 11   ASP A CA  1 
ATOM   78   C  C   . ASP A 1 11  ? -0.481  30.556  44.214  1.00 12.97 ? 11   ASP A C   1 
ATOM   79   O  O   . ASP A 1 11  ? 0.126   29.486  44.285  1.00 12.02 ? 11   ASP A O   1 
ATOM   80   C  CB  . ASP A 1 11  ? -2.013  30.294  42.323  1.00 14.31 ? 11   ASP A CB  1 
ATOM   81   C  CG  . ASP A 1 11  ? -3.324  29.702  41.863  1.00 15.82 ? 11   ASP A CG  1 
ATOM   82   O  OD1 . ASP A 1 11  ? -4.223  29.429  42.675  1.00 16.11 ? 11   ASP A OD1 1 
ATOM   83   O  OD2 . ASP A 1 11  ? -3.432  29.501  40.634  1.00 16.15 ? 11   ASP A OD2 1 
ATOM   84   N  N   . PHE A 1 12  ? 0.168   31.695  44.499  1.00 11.87 ? 12   PHE A N   1 
ATOM   85   C  CA  . PHE A 1 12  ? 1.612   31.825  44.566  1.00 12.90 ? 12   PHE A CA  1 
ATOM   86   C  C   . PHE A 1 12  ? 2.107   32.472  45.855  1.00 13.34 ? 12   PHE A C   1 
ATOM   87   O  O   . PHE A 1 12  ? 2.866   33.456  45.855  1.00 13.34 ? 12   PHE A O   1 
ATOM   88   C  CB  . PHE A 1 12  ? 2.105   32.650  43.349  1.00 13.08 ? 12   PHE A CB  1 
ATOM   89   C  CG  . PHE A 1 12  ? 1.590   32.186  42.014  1.00 13.08 ? 12   PHE A CG  1 
ATOM   90   C  CD1 . PHE A 1 12  ? 0.744   32.972  41.252  1.00 12.87 ? 12   PHE A CD1 1 
ATOM   91   C  CD2 . PHE A 1 12  ? 1.910   30.912  41.556  1.00 13.30 ? 12   PHE A CD2 1 
ATOM   92   C  CE1 . PHE A 1 12  ? 0.254   32.525  40.037  1.00 13.67 ? 12   PHE A CE1 1 
ATOM   93   C  CE2 . PHE A 1 12  ? 1.412   30.453  40.350  1.00 13.50 ? 12   PHE A CE2 1 
ATOM   94   C  CZ  . PHE A 1 12  ? 0.589   31.260  39.592  1.00 12.93 ? 12   PHE A CZ  1 
ATOM   95   N  N   . PRO A 1 13  ? 1.811   31.879  47.003  1.00 13.90 ? 13   PRO A N   1 
ATOM   96   C  CA  . PRO A 1 13  ? 2.418   32.283  48.267  1.00 13.69 ? 13   PRO A CA  1 
ATOM   97   C  C   . PRO A 1 13  ? 3.847   31.796  48.376  1.00 13.89 ? 13   PRO A C   1 
ATOM   98   O  O   . PRO A 1 13  ? 4.349   31.030  47.546  1.00 13.60 ? 13   PRO A O   1 
ATOM   99   C  CB  . PRO A 1 13  ? 1.501   31.620  49.294  1.00 14.45 ? 13   PRO A CB  1 
ATOM   100  C  CG  . PRO A 1 13  ? 1.187   30.298  48.653  1.00 13.77 ? 13   PRO A CG  1 
ATOM   101  C  CD  . PRO A 1 13  ? 1.028   30.634  47.193  1.00 13.51 ? 13   PRO A CD  1 
ATOM   102  N  N   . ILE A 1 14  ? 4.520   32.092  49.489  1.00 13.49 ? 14   ILE A N   1 
ATOM   103  C  CA  . ILE A 1 14  ? 5.891   31.642  49.706  1.00 14.87 ? 14   ILE A CA  1 
ATOM   104  C  C   . ILE A 1 14  ? 5.990   30.133  49.839  1.00 14.25 ? 14   ILE A C   1 
ATOM   105  O  O   . ILE A 1 14  ? 7.051   29.566  49.569  1.00 14.94 ? 14   ILE A O   1 
ATOM   106  C  CB  . ILE A 1 14  ? 6.518   32.381  50.904  1.00 15.74 ? 14   ILE A CB  1 
ATOM   107  C  CG1 . ILE A 1 14  ? 8.048   32.338  50.817  1.00 16.24 ? 14   ILE A CG1 1 
ATOM   108  C  CG2 . ILE A 1 14  ? 6.000   31.828  52.217  1.00 17.01 ? 14   ILE A CG2 1 
ATOM   109  C  CD1 . ILE A 1 14  ? 8.722   33.379  51.695  1.00 17.21 ? 14   ILE A CD1 1 
ATOM   110  N  N   . GLN A 1 15  ? 4.893   29.441  50.159  1.00 14.01 ? 15   GLN A N   1 
ATOM   111  C  CA  . GLN A 1 15  ? 4.840   27.999  50.227  1.00 13.94 ? 15   GLN A CA  1 
ATOM   112  C  C   . GLN A 1 15  ? 4.859   27.318  48.859  1.00 13.56 ? 15   GLN A C   1 
ATOM   113  O  O   . GLN A 1 15  ? 5.041   26.098  48.835  1.00 13.39 ? 15   GLN A O   1 
ATOM   114  C  CB  . GLN A 1 15  ? 3.554   27.543  50.944  1.00 14.50 ? 15   GLN A CB  1 
ATOM   115  C  CG  . GLN A 1 15  ? 3.556   27.819  52.435  1.00 16.05 ? 15   GLN A CG  1 
ATOM   116  C  CD  . GLN A 1 15  ? 3.222   29.240  52.815  1.00 17.59 ? 15   GLN A CD  1 
ATOM   117  O  OE1 . GLN A 1 15  ? 2.751   30.049  52.019  1.00 18.22 ? 15   GLN A OE1 1 
ATOM   118  N  NE2 . GLN A 1 15  ? 3.469   29.556  54.091  1.00 20.30 ? 15   GLN A NE2 1 
ATOM   119  N  N   . ASN A 1 16  ? 4.688   28.046  47.765  1.00 12.99 ? 16   ASN A N   1 
ATOM   120  C  CA  . ASN A 1 16  ? 4.675   27.445  46.430  1.00 11.87 ? 16   ASN A CA  1 
ATOM   121  C  C   . ASN A 1 16  ? 6.033   27.597  45.752  1.00 11.95 ? 16   ASN A C   1 
ATOM   122  O  O   . ASN A 1 16  ? 6.873   26.705  45.782  1.00 12.59 ? 16   ASN A O   1 
ATOM   123  C  CB  . ASN A 1 16  ? 3.566   28.073  45.583  1.00 11.76 ? 16   ASN A CB  1 
ATOM   124  C  CG  . ASN A 1 16  ? 3.346   27.365  44.255  1.00 11.63 ? 16   ASN A CG  1 
ATOM   125  O  OD1 . ASN A 1 16  ? 4.110   26.462  43.905  1.00 11.84 ? 16   ASN A OD1 1 
ATOM   126  N  ND2 . ASN A 1 16  ? 2.308   27.781  43.542  1.00 11.40 ? 16   ASN A ND2 1 
ATOM   127  N  N   . LEU A 1 17  ? 6.251   28.743  45.123  1.00 12.02 ? 17   LEU A N   1 
ATOM   128  C  CA  . LEU A 1 17  ? 7.457   29.137  44.432  1.00 11.01 ? 17   LEU A CA  1 
ATOM   129  C  C   . LEU A 1 17  ? 7.744   28.264  43.216  1.00 11.02 ? 17   LEU A C   1 
ATOM   130  O  O   . LEU A 1 17  ? 8.750   27.556  43.129  1.00 10.99 ? 17   LEU A O   1 
ATOM   131  C  CB  . LEU A 1 17  ? 8.657   29.203  45.387  1.00 11.59 ? 17   LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 17  ? 8.511   30.119  46.607  1.00 12.07 ? 17   LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 17  ? 9.746   29.998  47.497  1.00 13.04 ? 17   LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 17  ? 8.262   31.568  46.230  1.00 13.46 ? 17   LEU A CD2 1 
ATOM   135  N  N   . PRO A 1 18  ? 6.829   28.311  42.249  1.00 11.45 ? 18   PRO A N   1 
ATOM   136  C  CA  . PRO A 1 18  ? 7.005   27.566  41.004  1.00 10.94 ? 18   PRO A CA  1 
ATOM   137  C  C   . PRO A 1 18  ? 7.971   28.234  40.046  1.00 12.00 ? 18   PRO A C   1 
ATOM   138  O  O   . PRO A 1 18  ? 8.201   29.441  40.147  1.00 11.40 ? 18   PRO A O   1 
ATOM   139  C  CB  . PRO A 1 18  ? 5.589   27.600  40.413  1.00 10.55 ? 18   PRO A CB  1 
ATOM   140  C  CG  . PRO A 1 18  ? 5.120   28.973  40.767  1.00 11.20 ? 18   PRO A CG  1 
ATOM   141  C  CD  . PRO A 1 18  ? 5.645   29.193  42.177  1.00 10.79 ? 18   PRO A CD  1 
ATOM   142  N  N   . TYR A 1 19  ? 8.513   27.466  39.111  1.00 12.06 ? 19   TYR A N   1 
ATOM   143  C  CA  . TYR A 1 19  ? 9.493   27.969  38.156  1.00 12.58 ? 19   TYR A CA  1 
ATOM   144  C  C   . TYR A 1 19  ? 8.869   28.091  36.773  1.00 12.57 ? 19   TYR A C   1 
ATOM   145  O  O   . TYR A 1 19  ? 8.079   27.227  36.380  1.00 12.65 ? 19   TYR A O   1 
ATOM   146  C  CB  . TYR A 1 19  ? 10.686  27.006  38.059  1.00 12.90 ? 19   TYR A CB  1 
ATOM   147  C  CG  . TYR A 1 19  ? 11.388  26.815  39.389  1.00 12.35 ? 19   TYR A CG  1 
ATOM   148  C  CD1 . TYR A 1 19  ? 11.111  25.751  40.227  1.00 13.12 ? 19   TYR A CD1 1 
ATOM   149  C  CD2 . TYR A 1 19  ? 12.349  27.748  39.778  1.00 13.06 ? 19   TYR A CD2 1 
ATOM   150  C  CE1 . TYR A 1 19  ? 11.775  25.611  41.436  1.00 14.10 ? 19   TYR A CE1 1 
ATOM   151  C  CE2 . TYR A 1 19  ? 13.006  27.620  40.986  1.00 13.76 ? 19   TYR A CE2 1 
ATOM   152  C  CZ  . TYR A 1 19  ? 12.710  26.549  41.805  1.00 14.27 ? 19   TYR A CZ  1 
ATOM   153  O  OH  . TYR A 1 19  ? 13.371  26.429  43.011  1.00 15.64 ? 19   TYR A OH  1 
ATOM   154  N  N   . GLY A 1 20  ? 9.184   29.183  36.084  1.00 11.72 ? 20   GLY A N   1 
ATOM   155  C  CA  . GLY A 1 20  ? 8.594   29.403  34.758  1.00 12.35 ? 20   GLY A CA  1 
ATOM   156  C  C   . GLY A 1 20  ? 9.583   30.139  33.862  1.00 12.82 ? 20   GLY A C   1 
ATOM   157  O  O   . GLY A 1 20  ? 10.607  30.647  34.311  1.00 12.65 ? 20   GLY A O   1 
ATOM   158  N  N   . VAL A 1 21  ? 9.246   30.189  32.579  1.00 12.53 ? 21   VAL A N   1 
ATOM   159  C  CA  . VAL A 1 21  ? 10.007  30.950  31.595  1.00 12.94 ? 21   VAL A CA  1 
ATOM   160  C  C   . VAL A 1 21  ? 9.118   32.079  31.079  1.00 13.22 ? 21   VAL A C   1 
ATOM   161  O  O   . VAL A 1 21  ? 7.984   31.836  30.658  1.00 13.94 ? 21   VAL A O   1 
ATOM   162  C  CB  . VAL A 1 21  ? 10.449  30.046  30.436  1.00 12.96 ? 21   VAL A CB  1 
ATOM   163  C  CG1 . VAL A 1 21  ? 11.088  30.867  29.314  1.00 13.00 ? 21   VAL A CG1 1 
ATOM   164  C  CG2 . VAL A 1 21  ? 11.413  28.974  30.919  1.00 12.52 ? 21   VAL A CG2 1 
ATOM   165  N  N   . PHE A 1 22  ? 9.625   33.304  31.121  1.00 13.75 ? 22   PHE A N   1 
ATOM   166  C  CA  . PHE A 1 22  ? 8.801   34.460  30.792  1.00 13.59 ? 22   PHE A CA  1 
ATOM   167  C  C   . PHE A 1 22  ? 9.639   35.465  29.993  1.00 14.24 ? 22   PHE A C   1 
ATOM   168  O  O   . PHE A 1 22  ? 10.855  35.359  29.949  1.00 13.88 ? 22   PHE A O   1 
ATOM   169  C  CB  . PHE A 1 22  ? 8.244   35.153  32.037  1.00 14.00 ? 22   PHE A CB  1 
ATOM   170  C  CG  . PHE A 1 22  ? 9.284   35.930  32.807  1.00 13.82 ? 22   PHE A CG  1 
ATOM   171  C  CD1 . PHE A 1 22  ? 9.281   37.312  32.773  1.00 13.55 ? 22   PHE A CD1 1 
ATOM   172  C  CD2 . PHE A 1 22  ? 10.245  35.270  33.546  1.00 13.37 ? 22   PHE A CD2 1 
ATOM   173  C  CE1 . PHE A 1 22  ? 10.229  38.040  33.480  1.00 13.94 ? 22   PHE A CE1 1 
ATOM   174  C  CE2 . PHE A 1 22  ? 11.206  35.987  34.242  1.00 14.09 ? 22   PHE A CE2 1 
ATOM   175  C  CZ  . PHE A 1 22  ? 11.185  37.361  34.207  1.00 13.59 ? 22   PHE A CZ  1 
ATOM   176  N  N   . SER A 1 23  ? 8.932   36.380  29.349  1.00 16.00 ? 23   SER A N   1 
ATOM   177  C  CA  . SER A 1 23  ? 9.557   37.566  28.776  1.00 16.58 ? 23   SER A CA  1 
ATOM   178  C  C   . SER A 1 23  ? 8.622   38.756  28.939  1.00 17.15 ? 23   SER A C   1 
ATOM   179  O  O   . SER A 1 23  ? 7.492   38.640  29.416  1.00 18.43 ? 23   SER A O   1 
ATOM   180  C  CB  . SER A 1 23  ? 9.913   37.357  27.305  1.00 17.31 ? 23   SER A CB  1 
ATOM   181  O  OG  . SER A 1 23  ? 8.727   37.122  26.555  1.00 18.09 ? 23   SER A OG  1 
ATOM   182  N  N   . THR A 1 24  ? 9.107   39.943  28.571  1.00 18.68 ? 24   THR A N   1 
ATOM   183  C  CA  . THR A 1 24  ? 8.371   41.188  28.719  1.00 20.34 ? 24   THR A CA  1 
ATOM   184  C  C   . THR A 1 24  ? 8.502   42.027  27.448  1.00 22.16 ? 24   THR A C   1 
ATOM   185  O  O   . THR A 1 24  ? 9.309   41.708  26.582  1.00 21.84 ? 24   THR A O   1 
ATOM   186  C  CB  . THR A 1 24  ? 8.908   42.046  29.885  1.00 19.79 ? 24   THR A CB  1 
ATOM   187  O  OG1 . THR A 1 24  ? 10.317  42.208  29.674  1.00 19.72 ? 24   THR A OG1 1 
ATOM   188  C  CG2 . THR A 1 24  ? 8.663   41.406  31.240  1.00 20.76 ? 24   THR A CG2 1 
ATOM   189  N  N   . GLN A 1 25  ? 7.755   43.120  27.353  1.00 25.48 ? 25   GLN A N   1 
ATOM   190  C  CA  . GLN A 1 25  ? 7.856   44.002  26.191  1.00 28.11 ? 25   GLN A CA  1 
ATOM   191  C  C   . GLN A 1 25  ? 9.256   44.595  26.077  1.00 28.71 ? 25   GLN A C   1 
ATOM   192  O  O   . GLN A 1 25  ? 9.839   44.640  24.988  1.00 29.26 ? 25   GLN A O   1 
ATOM   193  C  CB  . GLN A 1 25  ? 6.816   45.116  26.265  1.00 30.20 ? 25   GLN A CB  1 
ATOM   194  C  CG  . GLN A 1 25  ? 6.729   46.018  25.049  1.00 32.35 ? 25   GLN A CG  1 
ATOM   195  C  CD  . GLN A 1 25  ? 6.093   45.375  23.836  1.00 33.53 ? 25   GLN A CD  1 
ATOM   196  O  OE1 . GLN A 1 25  ? 5.672   44.216  23.845  1.00 34.52 ? 25   GLN A OE1 1 
ATOM   197  N  NE2 . GLN A 1 25  ? 5.999   46.135  22.745  1.00 34.38 ? 25   GLN A NE2 1 
ATOM   198  N  N   . SER A 1 26  ? 9.815   45.026  27.202  1.00 29.17 ? 26   SER A N   1 
ATOM   199  C  CA  . SER A 1 26  ? 11.109  45.691  27.228  1.00 29.42 ? 26   SER A CA  1 
ATOM   200  C  C   . SER A 1 26  ? 12.282  44.740  27.048  1.00 28.80 ? 26   SER A C   1 
ATOM   201  O  O   . SER A 1 26  ? 13.373  45.151  26.637  1.00 29.07 ? 26   SER A O   1 
ATOM   202  C  CB  . SER A 1 26  ? 11.267  46.460  28.545  1.00 30.07 ? 26   SER A CB  1 
ATOM   203  O  OG  . SER A 1 26  ? 11.670  45.597  29.585  1.00 31.33 ? 26   SER A OG  1 
ATOM   204  N  N   . ASN A 1 27  ? 12.097  43.466  27.372  1.00 27.24 ? 27   ASN A N   1 
ATOM   205  C  CA  . ASN A 1 27  ? 13.126  42.457  27.153  1.00 26.05 ? 27   ASN A CA  1 
ATOM   206  C  C   . ASN A 1 27  ? 12.481  41.162  26.675  1.00 25.90 ? 27   ASN A C   1 
ATOM   207  O  O   . ASN A 1 27  ? 11.967  40.384  27.476  1.00 24.88 ? 27   ASN A O   1 
ATOM   208  C  CB  . ASN A 1 27  ? 13.923  42.211  28.430  1.00 25.86 ? 27   ASN A CB  1 
ATOM   209  C  CG  . ASN A 1 27  ? 15.000  41.159  28.297  1.00 25.79 ? 27   ASN A CG  1 
ATOM   210  O  OD1 . ASN A 1 27  ? 15.261  40.619  27.223  1.00 26.00 ? 27   ASN A OD1 1 
ATOM   211  N  ND2 . ASN A 1 27  ? 15.648  40.855  29.418  1.00 26.13 ? 27   ASN A ND2 1 
ATOM   212  N  N   . PRO A 1 28  ? 12.517  40.923  25.369  1.00 25.21 ? 28   PRO A N   1 
ATOM   213  C  CA  . PRO A 1 28  ? 11.864  39.782  24.763  1.00 24.64 ? 28   PRO A CA  1 
ATOM   214  C  C   . PRO A 1 28  ? 12.588  38.457  24.894  1.00 23.94 ? 28   PRO A C   1 
ATOM   215  O  O   . PRO A 1 28  ? 12.036  37.440  24.450  1.00 23.94 ? 28   PRO A O   1 
ATOM   216  C  CB  . PRO A 1 28  ? 11.718  40.177  23.291  1.00 25.24 ? 28   PRO A CB  1 
ATOM   217  C  CG  . PRO A 1 28  ? 12.793  41.177  23.053  1.00 25.93 ? 28   PRO A CG  1 
ATOM   218  C  CD  . PRO A 1 28  ? 12.967  41.915  24.351  1.00 25.85 ? 28   PRO A CD  1 
ATOM   219  N  N   . LYS A 1 29  ? 13.770  38.398  25.481  1.00 22.94 ? 29   LYS A N   1 
ATOM   220  C  CA  . LYS A 1 29  ? 14.504  37.162  25.697  1.00 22.19 ? 29   LYS A CA  1 
ATOM   221  C  C   . LYS A 1 29  ? 13.870  36.337  26.814  1.00 20.49 ? 29   LYS A C   1 
ATOM   222  O  O   . LYS A 1 29  ? 13.726  36.799  27.943  1.00 19.83 ? 29   LYS A O   1 
ATOM   223  C  CB  . LYS A 1 29  ? 15.959  37.470  26.067  1.00 23.78 ? 29   LYS A CB  1 
ATOM   224  C  CG  . LYS A 1 29  ? 16.842  36.252  26.266  1.00 25.58 ? 29   LYS A CG  1 
ATOM   225  C  CD  . LYS A 1 29  ? 18.236  36.633  26.743  1.00 27.06 ? 29   LYS A CD  1 
ATOM   226  C  CE  . LYS A 1 29  ? 19.124  35.412  26.911  1.00 28.25 ? 29   LYS A CE  1 
ATOM   227  N  NZ  . LYS A 1 29  ? 20.510  35.790  27.311  1.00 29.62 ? 29   LYS A NZ  1 
ATOM   228  N  N   . PRO A 1 30  ? 13.471  35.115  26.496  1.00 18.97 ? 30   PRO A N   1 
ATOM   229  C  CA  . PRO A 1 30  ? 12.896  34.217  27.485  1.00 17.76 ? 30   PRO A CA  1 
ATOM   230  C  C   . PRO A 1 30  ? 13.898  33.968  28.606  1.00 16.55 ? 30   PRO A C   1 
ATOM   231  O  O   . PRO A 1 30  ? 15.071  33.734  28.322  1.00 16.65 ? 30   PRO A O   1 
ATOM   232  C  CB  . PRO A 1 30  ? 12.593  32.941  26.727  1.00 17.95 ? 30   PRO A CB  1 
ATOM   233  C  CG  . PRO A 1 30  ? 12.808  33.220  25.285  1.00 19.11 ? 30   PRO A CG  1 
ATOM   234  C  CD  . PRO A 1 30  ? 13.652  34.455  25.185  1.00 18.86 ? 30   PRO A CD  1 
ATOM   235  N  N   . ARG A 1 31  ? 13.429  34.023  29.846  1.00 15.65 ? 31   ARG A N   1 
ATOM   236  C  CA  . ARG A 1 31  ? 14.322  33.864  30.993  1.00 15.02 ? 31   ARG A CA  1 
ATOM   237  C  C   . ARG A 1 31  ? 13.539  33.244  32.146  1.00 14.17 ? 31   ARG A C   1 
ATOM   238  O  O   . ARG A 1 31  ? 12.316  33.212  32.126  1.00 13.51 ? 31   ARG A O   1 
ATOM   239  C  CB  . ARG A 1 31  ? 14.912  35.216  31.390  1.00 15.25 ? 31   ARG A CB  1 
ATOM   240  C  CG  . ARG A 1 31  ? 13.886  36.298  31.687  1.00 15.82 ? 31   ARG A CG  1 
ATOM   241  C  CD  . ARG A 1 31  ? 14.546  37.672  31.628  1.00 16.02 ? 31   ARG A CD  1 
ATOM   242  N  NE  . ARG A 1 31  ? 13.643  38.788  31.816  1.00 16.98 ? 31   ARG A NE  1 
ATOM   243  C  CZ  . ARG A 1 31  ? 12.862  39.361  30.914  1.00 17.54 ? 31   ARG A CZ  1 
ATOM   244  N  NH1 . ARG A 1 31  ? 12.832  38.902  29.664  1.00 18.19 ? 31   ARG A NH1 1 
ATOM   245  N  NH2 . ARG A 1 31  ? 12.095  40.394  31.242  1.00 18.70 ? 31   ARG A NH2 1 
ATOM   246  N  N   . ILE A 1 32  ? 14.274  32.747  33.138  1.00 12.85 ? 32   ILE A N   1 
ATOM   247  C  CA  . ILE A 1 32  ? 13.655  32.003  34.231  1.00 12.41 ? 32   ILE A CA  1 
ATOM   248  C  C   . ILE A 1 32  ? 13.168  32.900  35.351  1.00 12.46 ? 32   ILE A C   1 
ATOM   249  O  O   . ILE A 1 32  ? 13.897  33.774  35.814  1.00 12.54 ? 32   ILE A O   1 
ATOM   250  C  CB  . ILE A 1 32  ? 14.661  30.965  34.752  1.00 11.48 ? 32   ILE A CB  1 
ATOM   251  C  CG1 . ILE A 1 32  ? 14.951  29.959  33.621  1.00 12.26 ? 32   ILE A CG1 1 
ATOM   252  C  CG2 . ILE A 1 32  ? 14.167  30.257  36.001  1.00 11.52 ? 32   ILE A CG2 1 
ATOM   253  C  CD1 . ILE A 1 32  ? 16.259  29.231  33.817  1.00 13.02 ? 32   ILE A CD1 1 
ATOM   254  N  N   . GLY A 1 33  ? 11.923  32.679  35.770  1.00 12.02 ? 33   GLY A N   1 
ATOM   255  C  CA  . GLY A 1 33  ? 11.363  33.436  36.886  1.00 11.82 ? 33   GLY A CA  1 
ATOM   256  C  C   . GLY A 1 33  ? 10.680  32.497  37.876  1.00 11.19 ? 33   GLY A C   1 
ATOM   257  O  O   . GLY A 1 33  ? 10.420  31.328  37.597  1.00 10.88 ? 33   GLY A O   1 
ATOM   258  N  N   . VAL A 1 34  ? 10.386  33.047  39.044  1.00 10.91 ? 34   VAL A N   1 
ATOM   259  C  CA  . VAL A 1 34  ? 9.620   32.366  40.084  1.00 11.81 ? 34   VAL A CA  1 
ATOM   260  C  C   . VAL A 1 34  ? 8.421   33.229  40.453  1.00 12.22 ? 34   VAL A C   1 
ATOM   261  O  O   . VAL A 1 34  ? 8.559   34.436  40.680  1.00 13.01 ? 34   VAL A O   1 
ATOM   262  C  CB  . VAL A 1 34  ? 10.502  32.101  41.319  1.00 12.22 ? 34   VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 34  ? 9.660   31.731  42.537  1.00 13.38 ? 34   VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 34  ? 11.538  31.016  41.046  1.00 12.39 ? 34   VAL A CG2 1 
ATOM   265  N  N   . ALA A 1 35  ? 7.231   32.636  40.490  1.00 11.93 ? 35   ALA A N   1 
ATOM   266  C  CA  . ALA A 1 35  ? 6.026   33.394  40.824  1.00 12.24 ? 35   ALA A CA  1 
ATOM   267  C  C   . ALA A 1 35  ? 5.916   33.606  42.329  1.00 12.67 ? 35   ALA A C   1 
ATOM   268  O  O   . ALA A 1 35  ? 6.106   32.667  43.104  1.00 12.64 ? 35   ALA A O   1 
ATOM   269  C  CB  . ALA A 1 35  ? 4.787   32.659  40.320  1.00 12.45 ? 35   ALA A CB  1 
ATOM   270  N  N   . ILE A 1 36  ? 5.620   34.838  42.729  1.00 12.80 ? 36   ILE A N   1 
ATOM   271  C  CA  . ILE A 1 36  ? 5.370   35.140  44.146  1.00 12.82 ? 36   ILE A CA  1 
ATOM   272  C  C   . ILE A 1 36  ? 4.346   36.261  44.231  1.00 13.17 ? 36   ILE A C   1 
ATOM   273  O  O   . ILE A 1 36  ? 4.549   37.336  43.650  1.00 13.47 ? 36   ILE A O   1 
ATOM   274  C  CB  . ILE A 1 36  ? 6.660   35.472  44.914  1.00 13.01 ? 36   ILE A CB  1 
ATOM   275  C  CG1 . ILE A 1 36  ? 6.357   35.899  46.359  1.00 12.61 ? 36   ILE A CG1 1 
ATOM   276  C  CG2 . ILE A 1 36  ? 7.481   36.550  44.221  1.00 13.58 ? 36   ILE A CG2 1 
ATOM   277  C  CD1 . ILE A 1 36  ? 5.881   34.758  47.240  1.00 12.30 ? 36   ILE A CD1 1 
ATOM   278  N  N   . GLY A 1 37  ? 3.212   36.010  44.894  1.00 13.84 ? 37   GLY A N   1 
ATOM   279  C  CA  . GLY A 1 37  ? 2.085   36.944  44.827  1.00 14.15 ? 37   GLY A CA  1 
ATOM   280  C  C   . GLY A 1 37  ? 1.663   37.164  43.378  1.00 15.39 ? 37   GLY A C   1 
ATOM   281  O  O   . GLY A 1 37  ? 1.433   36.218  42.621  1.00 14.55 ? 37   GLY A O   1 
ATOM   282  N  N   . ASP A 1 38  ? 1.559   38.433  42.971  1.00 15.93 ? 38   ASP A N   1 
ATOM   283  C  CA  . ASP A 1 38  ? 1.258   38.731  41.572  1.00 16.41 ? 38   ASP A CA  1 
ATOM   284  C  C   . ASP A 1 38  ? 2.499   39.189  40.810  1.00 16.18 ? 38   ASP A C   1 
ATOM   285  O  O   . ASP A 1 38  ? 2.396   39.770  39.730  1.00 15.89 ? 38   ASP A O   1 
ATOM   286  C  CB  . ASP A 1 38  ? 0.124   39.742  41.453  1.00 18.86 ? 38   ASP A CB  1 
ATOM   287  C  CG  . ASP A 1 38  ? 0.472   41.163  41.820  1.00 21.35 ? 38   ASP A CG  1 
ATOM   288  O  OD1 . ASP A 1 38  ? 1.582   41.413  42.331  1.00 21.99 ? 38   ASP A OD1 1 
ATOM   289  O  OD2 . ASP A 1 38  ? -0.372  42.063  41.590  1.00 23.37 ? 38   ASP A OD2 1 
ATOM   290  N  N   . GLN A 1 39  ? 3.674   38.877  41.350  1.00 15.41 ? 39   GLN A N   1 
ATOM   291  C  CA  . GLN A 1 39  ? 4.940   39.249  40.751  1.00 15.01 ? 39   GLN A CA  1 
ATOM   292  C  C   . GLN A 1 39  ? 5.709   38.040  40.223  1.00 15.19 ? 39   GLN A C   1 
ATOM   293  O  O   . GLN A 1 39  ? 5.418   36.884  40.526  1.00 14.23 ? 39   GLN A O   1 
ATOM   294  C  CB  . GLN A 1 39  ? 5.846   39.947  41.784  1.00 16.03 ? 39   GLN A CB  1 
ATOM   295  C  CG  . GLN A 1 39  ? 5.175   41.139  42.464  1.00 17.48 ? 39   GLN A CG  1 
ATOM   296  C  CD  . GLN A 1 39  ? 5.037   42.279  41.466  1.00 18.81 ? 39   GLN A CD  1 
ATOM   297  O  OE1 . GLN A 1 39  ? 3.933   42.685  41.103  1.00 20.78 ? 39   GLN A OE1 1 
ATOM   298  N  NE2 . GLN A 1 39  ? 6.187   42.772  41.023  1.00 19.20 ? 39   GLN A NE2 1 
ATOM   299  N  N   . ILE A 1 40  ? 6.704   38.349  39.393  1.00 14.19 ? 40   ILE A N   1 
ATOM   300  C  CA  . ILE A 1 40  ? 7.709   37.379  38.978  1.00 13.63 ? 40   ILE A CA  1 
ATOM   301  C  C   . ILE A 1 40  ? 9.078   37.817  39.492  1.00 13.70 ? 40   ILE A C   1 
ATOM   302  O  O   . ILE A 1 40  ? 9.457   38.967  39.297  1.00 14.40 ? 40   ILE A O   1 
ATOM   303  C  CB  . ILE A 1 40  ? 7.776   37.216  37.449  1.00 13.26 ? 40   ILE A CB  1 
ATOM   304  C  CG1 . ILE A 1 40  ? 6.418   36.733  36.919  1.00 13.64 ? 40   ILE A CG1 1 
ATOM   305  C  CG2 . ILE A 1 40  ? 8.876   36.242  37.041  1.00 14.08 ? 40   ILE A CG2 1 
ATOM   306  C  CD1 . ILE A 1 40  ? 6.335   36.609  35.413  1.00 12.91 ? 40   ILE A CD1 1 
ATOM   307  N  N   . LEU A 1 41  ? 9.756   36.896  40.164  1.00 13.01 ? 41   LEU A N   1 
ATOM   308  C  CA  . LEU A 1 41  ? 11.150  37.127  40.550  1.00 12.76 ? 41   LEU A CA  1 
ATOM   309  C  C   . LEU A 1 41  ? 12.060  36.551  39.476  1.00 12.51 ? 41   LEU A C   1 
ATOM   310  O  O   . LEU A 1 41  ? 12.074  35.344  39.239  1.00 12.87 ? 41   LEU A O   1 
ATOM   311  C  CB  . LEU A 1 41  ? 11.421  36.492  41.908  1.00 13.09 ? 41   LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 41  ? 12.844  36.543  42.460  1.00 13.02 ? 41   LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 41  ? 13.386  37.970  42.482  1.00 13.26 ? 41   LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 41  ? 12.868  35.977  43.877  1.00 13.82 ? 41   LEU A CD2 1 
ATOM   315  N  N   . ASP A 1 42  ? 12.830  37.415  38.829  1.00 11.57 ? 42   ASP A N   1 
ATOM   316  C  CA  . ASP A 1 42  ? 13.675  37.051  37.703  1.00 12.56 ? 42   ASP A CA  1 
ATOM   317  C  C   . ASP A 1 42  ? 14.976  36.419  38.172  1.00 12.17 ? 42   ASP A C   1 
ATOM   318  O  O   . ASP A 1 42  ? 15.855  37.103  38.719  1.00 12.37 ? 42   ASP A O   1 
ATOM   319  C  CB  . ASP A 1 42  ? 13.910  38.323  36.885  1.00 13.17 ? 42   ASP A CB  1 
ATOM   320  C  CG  . ASP A 1 42  ? 14.694  38.182  35.610  1.00 13.74 ? 42   ASP A CG  1 
ATOM   321  O  OD1 . ASP A 1 42  ? 15.464  37.210  35.461  1.00 14.80 ? 42   ASP A OD1 1 
ATOM   322  O  OD2 . ASP A 1 42  ? 14.542  39.066  34.731  1.00 14.11 ? 42   ASP A OD2 1 
ATOM   323  N  N   . LEU A 1 43  ? 15.156  35.111  37.953  1.00 11.10 ? 43   LEU A N   1 
ATOM   324  C  CA  . LEU A 1 43  ? 16.342  34.428  38.463  1.00 11.59 ? 43   LEU A CA  1 
ATOM   325  C  C   . LEU A 1 43  ? 17.607  34.762  37.696  1.00 12.60 ? 43   LEU A C   1 
ATOM   326  O  O   . LEU A 1 43  ? 18.704  34.645  38.256  1.00 13.82 ? 43   LEU A O   1 
ATOM   327  C  CB  . LEU A 1 43  ? 16.143  32.914  38.543  1.00 12.11 ? 43   LEU A CB  1 
ATOM   328  C  CG  . LEU A 1 43  ? 14.990  32.423  39.424  1.00 12.09 ? 43   LEU A CG  1 
ATOM   329  C  CD1 . LEU A 1 43  ? 15.147  30.918  39.639  1.00 12.04 ? 43   LEU A CD1 1 
ATOM   330  C  CD2 . LEU A 1 43  ? 14.929  33.142  40.765  1.00 12.43 ? 43   LEU A CD2 1 
ATOM   331  N  N   . SER A 1 44  ? 17.501  35.241  36.457  1.00 13.59 ? 44   SER A N   1 
ATOM   332  C  CA  . SER A 1 44  ? 18.689  35.700  35.730  1.00 14.26 ? 44   SER A CA  1 
ATOM   333  C  C   . SER A 1 44  ? 19.265  36.952  36.381  1.00 14.81 ? 44   SER A C   1 
ATOM   334  O  O   . SER A 1 44  ? 20.482  37.139  36.382  1.00 17.01 ? 44   SER A O   1 
ATOM   335  C  CB  . SER A 1 44  ? 18.385  35.942  34.255  1.00 14.42 ? 44   SER A CB  1 
ATOM   336  O  OG  . SER A 1 44  ? 17.614  37.106  34.014  1.00 16.08 ? 44   SER A OG  1 
ATOM   337  N  N   . VAL A 1 45  ? 18.422  37.777  36.977  1.00 13.87 ? 45   VAL A N   1 
ATOM   338  C  CA  . VAL A 1 45  ? 18.854  38.972  37.694  1.00 14.42 ? 45   VAL A CA  1 
ATOM   339  C  C   . VAL A 1 45  ? 19.461  38.625  39.046  1.00 14.09 ? 45   VAL A C   1 
ATOM   340  O  O   . VAL A 1 45  ? 20.456  39.246  39.440  1.00 15.46 ? 45   VAL A O   1 
ATOM   341  C  CB  . VAL A 1 45  ? 17.674  39.946  37.855  1.00 14.32 ? 45   VAL A CB  1 
ATOM   342  C  CG1 . VAL A 1 45  ? 18.020  41.118  38.762  1.00 15.03 ? 45   VAL A CG1 1 
ATOM   343  C  CG2 . VAL A 1 45  ? 17.223  40.473  36.491  1.00 14.92 ? 45   VAL A CG2 1 
ATOM   344  N  N   . ILE A 1 46  ? 18.913  37.635  39.758  1.00 14.13 ? 46   ILE A N   1 
ATOM   345  C  CA  . ILE A 1 46  ? 19.399  37.359  41.108  1.00 12.89 ? 46   ILE A CA  1 
ATOM   346  C  C   . ILE A 1 46  ? 20.224  36.084  41.187  1.00 13.08 ? 46   ILE A C   1 
ATOM   347  O  O   . ILE A 1 46  ? 20.472  35.585  42.294  1.00 13.47 ? 46   ILE A O   1 
ATOM   348  C  CB  . ILE A 1 46  ? 18.299  37.312  42.182  1.00 13.43 ? 46   ILE A CB  1 
ATOM   349  C  CG1 . ILE A 1 46  ? 17.305  36.169  41.911  1.00 13.36 ? 46   ILE A CG1 1 
ATOM   350  C  CG2 . ILE A 1 46  ? 17.574  38.645  42.269  1.00 13.77 ? 46   ILE A CG2 1 
ATOM   351  C  CD1 . ILE A 1 46  ? 16.567  35.739  43.165  1.00 14.65 ? 46   ILE A CD1 1 
ATOM   352  N  N   . LYS A 1 47  ? 20.760  35.601  40.076  1.00 13.10 ? 47   LYS A N   1 
ATOM   353  C  CA  . LYS A 1 47  ? 21.525  34.358  40.061  1.00 13.56 ? 47   LYS A CA  1 
ATOM   354  C  C   . LYS A 1 47  ? 22.746  34.371  40.965  1.00 14.03 ? 47   LYS A C   1 
ATOM   355  O  O   . LYS A 1 47  ? 23.132  33.326  41.512  1.00 14.30 ? 47   LYS A O   1 
ATOM   356  C  CB  . LYS A 1 47  ? 21.935  34.000  38.631  1.00 15.02 ? 47   LYS A CB  1 
ATOM   357  C  CG  . LYS A 1 47  ? 22.867  35.018  37.986  1.00 16.26 ? 47   LYS A CG  1 
ATOM   358  C  CD  . LYS A 1 47  ? 23.150  34.604  36.545  1.00 17.92 ? 47   LYS A CD  1 
ATOM   359  C  CE  . LYS A 1 47  ? 24.008  35.645  35.840  1.00 19.68 ? 47   LYS A CE  1 
ATOM   360  N  NZ  . LYS A 1 47  ? 23.224  36.868  35.531  1.00 21.89 ? 47   LYS A NZ  1 
ATOM   361  N  N   . HIS A 1 48  ? 23.351  35.532  41.184  1.00 14.09 ? 48   HIS A N   1 
ATOM   362  C  CA  . HIS A 1 48  ? 24.489  35.661  42.086  1.00 13.95 ? 48   HIS A CA  1 
ATOM   363  C  C   . HIS A 1 48  ? 24.120  35.567  43.560  1.00 14.34 ? 48   HIS A C   1 
ATOM   364  O  O   . HIS A 1 48  ? 25.029  35.501  44.404  1.00 14.92 ? 48   HIS A O   1 
ATOM   365  C  CB  . HIS A 1 48  ? 25.213  36.994  41.798  1.00 14.82 ? 48   HIS A CB  1 
ATOM   366  C  CG  . HIS A 1 48  ? 24.332  38.188  42.024  1.00 15.43 ? 48   HIS A CG  1 
ATOM   367  N  ND1 . HIS A 1 48  ? 23.325  38.544  41.149  1.00 15.69 ? 48   HIS A ND1 1 
ATOM   368  C  CD2 . HIS A 1 48  ? 24.316  39.107  43.017  1.00 16.25 ? 48   HIS A CD2 1 
ATOM   369  C  CE1 . HIS A 1 48  ? 22.719  39.622  41.609  1.00 15.80 ? 48   HIS A CE1 1 
ATOM   370  N  NE2 . HIS A 1 48  ? 23.304  39.999  42.742  1.00 16.56 ? 48   HIS A NE2 1 
ATOM   371  N  N   . LEU A 1 49  ? 22.846  35.522  43.917  1.00 13.61 ? 49   LEU A N   1 
ATOM   372  C  CA  . LEU A 1 49  ? 22.411  35.317  45.289  1.00 13.65 ? 49   LEU A CA  1 
ATOM   373  C  C   . LEU A 1 49  ? 22.356  33.838  45.656  1.00 14.16 ? 49   LEU A C   1 
ATOM   374  O  O   . LEU A 1 49  ? 22.105  33.528  46.829  1.00 15.31 ? 49   LEU A O   1 
ATOM   375  C  CB  . LEU A 1 49  ? 21.051  35.972  45.555  1.00 14.34 ? 49   LEU A CB  1 
ATOM   376  C  CG  . LEU A 1 49  ? 20.946  37.472  45.249  1.00 14.91 ? 49   LEU A CG  1 
ATOM   377  C  CD1 . LEU A 1 49  ? 19.594  38.032  45.662  1.00 15.67 ? 49   LEU A CD1 1 
ATOM   378  C  CD2 . LEU A 1 49  ? 22.070  38.242  45.931  1.00 15.38 ? 49   LEU A CD2 1 
ATOM   379  N  N   . PHE A 1 50  ? 22.577  32.939  44.708  1.00 13.63 ? 50   PHE A N   1 
ATOM   380  C  CA  . PHE A 1 50  ? 22.626  31.509  45.001  1.00 13.93 ? 50   PHE A CA  1 
ATOM   381  C  C   . PHE A 1 50  ? 24.071  31.105  45.294  1.00 14.04 ? 50   PHE A C   1 
ATOM   382  O  O   . PHE A 1 50  ? 24.838  30.680  44.439  1.00 14.28 ? 50   PHE A O   1 
ATOM   383  C  CB  . PHE A 1 50  ? 22.025  30.683  43.857  1.00 13.42 ? 50   PHE A CB  1 
ATOM   384  C  CG  . PHE A 1 50  ? 20.552  30.913  43.644  1.00 13.75 ? 50   PHE A CG  1 
ATOM   385  C  CD1 . PHE A 1 50  ? 20.108  31.779  42.657  1.00 14.41 ? 50   PHE A CD1 1 
ATOM   386  C  CD2 . PHE A 1 50  ? 19.618  30.266  44.435  1.00 13.36 ? 50   PHE A CD2 1 
ATOM   387  C  CE1 . PHE A 1 50  ? 18.753  31.986  42.467  1.00 14.83 ? 50   PHE A CE1 1 
ATOM   388  C  CE2 . PHE A 1 50  ? 18.263  30.465  44.242  1.00 13.14 ? 50   PHE A CE2 1 
ATOM   389  C  CZ  . PHE A 1 50  ? 17.829  31.332  43.258  1.00 13.93 ? 50   PHE A CZ  1 
ATOM   390  N  N   . THR A 1 51  ? 24.420  31.223  46.580  1.00 15.01 ? 51   THR A N   1 
ATOM   391  C  CA  . THR A 1 51  ? 25.816  31.107  46.991  1.00 15.93 ? 51   THR A CA  1 
ATOM   392  C  C   . THR A 1 51  ? 26.143  29.790  47.679  1.00 16.73 ? 51   THR A C   1 
ATOM   393  O  O   . THR A 1 51  ? 27.302  29.577  48.060  1.00 16.62 ? 51   THR A O   1 
ATOM   394  C  CB  . THR A 1 51  ? 26.149  32.253  47.970  1.00 16.58 ? 51   THR A CB  1 
ATOM   395  O  OG1 . THR A 1 51  ? 25.261  32.128  49.086  1.00 16.69 ? 51   THR A OG1 1 
ATOM   396  C  CG2 . THR A 1 51  ? 25.949  33.621  47.328  1.00 16.25 ? 51   THR A CG2 1 
ATOM   397  N  N   . GLY A 1 52  ? 25.167  28.899  47.834  1.00 16.10 ? 52   GLY A N   1 
ATOM   398  C  CA  . GLY A 1 52  ? 25.429  27.628  48.516  1.00 16.38 ? 52   GLY A CA  1 
ATOM   399  C  C   . GLY A 1 52  ? 26.288  26.673  47.706  1.00 15.70 ? 52   GLY A C   1 
ATOM   400  O  O   . GLY A 1 52  ? 26.634  26.891  46.546  1.00 15.22 ? 52   GLY A O   1 
ATOM   401  N  N   . PRO A 1 53  ? 26.585  25.502  48.273  1.00 15.78 ? 53   PRO A N   1 
ATOM   402  C  CA  . PRO A 1 53  ? 27.491  24.544  47.684  1.00 16.29 ? 53   PRO A CA  1 
ATOM   403  C  C   . PRO A 1 53  ? 27.010  23.931  46.380  1.00 16.62 ? 53   PRO A C   1 
ATOM   404  O  O   . PRO A 1 53  ? 27.803  23.653  45.479  1.00 17.76 ? 53   PRO A O   1 
ATOM   405  C  CB  . PRO A 1 53  ? 27.670  23.467  48.754  1.00 16.39 ? 53   PRO A CB  1 
ATOM   406  C  CG  . PRO A 1 53  ? 26.584  23.682  49.743  1.00 16.29 ? 53   PRO A CG  1 
ATOM   407  C  CD  . PRO A 1 53  ? 26.203  25.136  49.665  1.00 15.92 ? 53   PRO A CD  1 
ATOM   408  N  N   . ALA A 1 54  ? 25.704  23.717  46.244  1.00 17.57 ? 54   ALA A N   1 
ATOM   409  C  CA  . ALA A 1 54  ? 25.171  23.012  45.088  1.00 17.27 ? 54   ALA A CA  1 
ATOM   410  C  C   . ALA A 1 54  ? 24.999  23.939  43.893  1.00 17.22 ? 54   ALA A C   1 
ATOM   411  O  O   . ALA A 1 54  ? 25.014  23.461  42.756  1.00 17.99 ? 54   ALA A O   1 
ATOM   412  C  CB  . ALA A 1 54  ? 23.853  22.339  45.453  1.00 17.42 ? 54   ALA A CB  1 
ATOM   413  N  N   . LEU A 1 55  ? 24.879  25.242  44.117  1.00 16.21 ? 55   LEU A N   1 
ATOM   414  C  CA  . LEU A 1 55  ? 24.564  26.170  43.043  1.00 15.99 ? 55   LEU A CA  1 
ATOM   415  C  C   . LEU A 1 55  ? 25.655  27.191  42.779  1.00 16.65 ? 55   LEU A C   1 
ATOM   416  O  O   . LEU A 1 55  ? 25.631  27.824  41.716  1.00 16.78 ? 55   LEU A O   1 
ATOM   417  C  CB  . LEU A 1 55  ? 23.256  26.922  43.329  1.00 15.34 ? 55   LEU A CB  1 
ATOM   418  C  CG  . LEU A 1 55  ? 21.989  26.056  43.352  1.00 14.90 ? 55   LEU A CG  1 
ATOM   419  C  CD1 . LEU A 1 55  ? 20.811  26.852  43.885  1.00 14.38 ? 55   LEU A CD1 1 
ATOM   420  C  CD2 . LEU A 1 55  ? 21.703  25.506  41.960  1.00 15.35 ? 55   LEU A CD2 1 
ATOM   421  N  N   . SER A 1 56  ? 26.633  27.367  43.669  1.00 17.99 ? 56   SER A N   1 
ATOM   422  C  CA  . SER A 1 56  ? 27.570  28.474  43.497  1.00 19.31 ? 56   SER A CA  1 
ATOM   423  C  C   . SER A 1 56  ? 28.380  28.367  42.212  1.00 19.66 ? 56   SER A C   1 
ATOM   424  O  O   . SER A 1 56  ? 28.754  29.415  41.683  1.00 19.63 ? 56   SER A O   1 
ATOM   425  C  CB  . SER A 1 56  ? 28.509  28.621  44.699  1.00 20.37 ? 56   SER A CB  1 
ATOM   426  O  OG  . SER A 1 56  ? 29.433  27.552  44.727  1.00 22.65 ? 56   SER A OG  1 
ATOM   427  N  N   . LYS A 1 57  ? 28.670  27.169  41.712  1.00 19.49 ? 57   LYS A N   1 
ATOM   428  C  CA  . LYS A 1 57  ? 29.403  27.013  40.464  1.00 20.49 ? 57   LYS A CA  1 
ATOM   429  C  C   . LYS A 1 57  ? 28.482  26.678  39.297  1.00 19.88 ? 57   LYS A C   1 
ATOM   430  O  O   . LYS A 1 57  ? 28.937  26.342  38.202  1.00 20.77 ? 57   LYS A O   1 
ATOM   431  C  CB  . LYS A 1 57  ? 30.467  25.917  40.587  1.00 22.20 ? 57   LYS A CB  1 
ATOM   432  C  CG  . LYS A 1 57  ? 31.406  26.060  41.769  1.00 24.68 ? 57   LYS A CG  1 
ATOM   433  C  CD  . LYS A 1 57  ? 32.175  27.368  41.749  1.00 26.11 ? 57   LYS A CD  1 
ATOM   434  C  CE  . LYS A 1 57  ? 33.339  27.330  42.731  1.00 27.95 ? 57   LYS A CE  1 
ATOM   435  N  NZ  . LYS A 1 57  ? 34.223  28.523  42.571  1.00 29.33 ? 57   LYS A NZ  1 
ATOM   436  N  N   . HIS A 1 58  ? 27.178  26.761  39.537  1.00 18.55 ? 58   HIS A N   1 
ATOM   437  C  CA  . HIS A 1 58  ? 26.169  26.466  38.528  1.00 18.36 ? 58   HIS A CA  1 
ATOM   438  C  C   . HIS A 1 58  ? 25.168  27.589  38.332  1.00 17.16 ? 58   HIS A C   1 
ATOM   439  O  O   . HIS A 1 58  ? 24.073  27.359  37.812  1.00 15.61 ? 58   HIS A O   1 
ATOM   440  C  CB  . HIS A 1 58  ? 25.392  25.197  38.909  1.00 19.51 ? 58   HIS A CB  1 
ATOM   441  C  CG  . HIS A 1 58  ? 26.238  23.964  38.901  1.00 21.26 ? 58   HIS A CG  1 
ATOM   442  N  ND1 . HIS A 1 58  ? 26.684  23.359  40.051  1.00 22.38 ? 58   HIS A ND1 1 
ATOM   443  C  CD2 . HIS A 1 58  ? 26.740  23.243  37.870  1.00 21.71 ? 58   HIS A CD2 1 
ATOM   444  C  CE1 . HIS A 1 58  ? 27.416  22.303  39.731  1.00 22.59 ? 58   HIS A CE1 1 
ATOM   445  N  NE2 . HIS A 1 58  ? 27.465  22.212  38.420  1.00 22.97 ? 58   HIS A NE2 1 
ATOM   446  N  N   . GLN A 1 59  ? 25.530  28.832  38.638  1.00 16.19 ? 59   GLN A N   1 
ATOM   447  C  CA  . GLN A 1 59  ? 24.587  29.941  38.577  1.00 16.14 ? 59   GLN A CA  1 
ATOM   448  C  C   . GLN A 1 59  ? 24.119  30.233  37.160  1.00 16.59 ? 59   GLN A C   1 
ATOM   449  O  O   . GLN A 1 59  ? 23.036  30.784  36.939  1.00 16.15 ? 59   GLN A O   1 
ATOM   450  C  CB  . GLN A 1 59  ? 25.218  31.198  39.187  1.00 15.54 ? 59   GLN A CB  1 
ATOM   451  C  CG  . GLN A 1 59  ? 25.439  31.055  40.690  1.00 15.56 ? 59   GLN A CG  1 
ATOM   452  C  CD  . GLN A 1 59  ? 26.196  32.244  41.255  1.00 16.10 ? 59   GLN A CD  1 
ATOM   453  O  OE1 . GLN A 1 59  ? 26.713  33.064  40.495  1.00 17.24 ? 59   GLN A OE1 1 
ATOM   454  N  NE2 . GLN A 1 59  ? 26.241  32.320  42.575  1.00 15.86 ? 59   GLN A NE2 1 
ATOM   455  N  N   . HIS A 1 60  ? 24.897  29.828  36.165  1.00 17.58 ? 60   HIS A N   1 
ATOM   456  C  CA  . HIS A 1 60  ? 24.555  29.954  34.760  1.00 18.60 ? 60   HIS A CA  1 
ATOM   457  C  C   . HIS A 1 60  ? 23.263  29.243  34.396  1.00 17.41 ? 60   HIS A C   1 
ATOM   458  O  O   . HIS A 1 60  ? 22.587  29.672  33.456  1.00 17.06 ? 60   HIS A O   1 
ATOM   459  C  CB  . HIS A 1 60  ? 25.723  29.444  33.901  1.00 21.59 ? 60   HIS A CB  1 
ATOM   460  C  CG  . HIS A 1 60  ? 25.991  27.973  34.002  1.00 24.57 ? 60   HIS A CG  1 
ATOM   461  N  ND1 . HIS A 1 60  ? 27.094  27.418  34.607  1.00 26.48 ? 60   HIS A ND1 1 
ATOM   462  C  CD2 . HIS A 1 60  ? 25.281  26.920  33.545  1.00 25.86 ? 60   HIS A CD2 1 
ATOM   463  C  CE1 . HIS A 1 60  ? 27.046  26.102  34.542  1.00 26.56 ? 60   HIS A CE1 1 
ATOM   464  N  NE2 . HIS A 1 60  ? 25.941  25.771  33.894  1.00 26.32 ? 60   HIS A NE2 1 
ATOM   465  N  N   . VAL A 1 61  ? 22.833  28.220  35.139  1.00 16.00 ? 61   VAL A N   1 
ATOM   466  C  CA  . VAL A 1 61  ? 21.579  27.534  34.844  1.00 15.66 ? 61   VAL A CA  1 
ATOM   467  C  C   . VAL A 1 61  ? 20.398  28.489  34.924  1.00 15.45 ? 61   VAL A C   1 
ATOM   468  O  O   . VAL A 1 61  ? 19.386  28.292  34.237  1.00 15.80 ? 61   VAL A O   1 
ATOM   469  C  CB  . VAL A 1 61  ? 21.297  26.295  35.707  1.00 14.77 ? 61   VAL A CB  1 
ATOM   470  C  CG1 . VAL A 1 61  ? 22.401  25.252  35.589  1.00 15.18 ? 61   VAL A CG1 1 
ATOM   471  C  CG2 . VAL A 1 61  ? 21.070  26.652  37.172  1.00 15.41 ? 61   VAL A CG2 1 
ATOM   472  N  N   . PHE A 1 62  ? 20.476  29.519  35.765  1.00 15.15 ? 62   PHE A N   1 
ATOM   473  C  CA  . PHE A 1 62  ? 19.440  30.526  35.899  1.00 15.19 ? 62   PHE A CA  1 
ATOM   474  C  C   . PHE A 1 62  ? 19.481  31.611  34.835  1.00 15.72 ? 62   PHE A C   1 
ATOM   475  O  O   . PHE A 1 62  ? 18.589  32.460  34.785  1.00 15.83 ? 62   PHE A O   1 
ATOM   476  C  CB  . PHE A 1 62  ? 19.548  31.164  37.301  1.00 14.98 ? 62   PHE A CB  1 
ATOM   477  C  CG  . PHE A 1 62  ? 19.354  30.138  38.390  1.00 14.85 ? 62   PHE A CG  1 
ATOM   478  C  CD1 . PHE A 1 62  ? 20.355  29.904  39.315  1.00 15.55 ? 62   PHE A CD1 1 
ATOM   479  C  CD2 . PHE A 1 62  ? 18.191  29.389  38.464  1.00 14.56 ? 62   PHE A CD2 1 
ATOM   480  C  CE1 . PHE A 1 62  ? 20.201  28.966  40.321  1.00 15.74 ? 62   PHE A CE1 1 
ATOM   481  C  CE2 . PHE A 1 62  ? 18.035  28.444  39.461  1.00 14.87 ? 62   PHE A CE2 1 
ATOM   482  C  CZ  . PHE A 1 62  ? 19.027  28.230  40.392  1.00 15.12 ? 62   PHE A CZ  1 
ATOM   483  N  N   . ASP A 1 63  ? 20.472  31.579  33.958  1.00 16.34 ? 63   ASP A N   1 
ATOM   484  C  CA  . ASP A 1 63  ? 20.609  32.508  32.853  1.00 18.58 ? 63   ASP A CA  1 
ATOM   485  C  C   . ASP A 1 63  ? 20.133  31.894  31.540  1.00 18.41 ? 63   ASP A C   1 
ATOM   486  O  O   . ASP A 1 63  ? 20.180  32.566  30.501  1.00 19.68 ? 63   ASP A O   1 
ATOM   487  C  CB  . ASP A 1 63  ? 22.093  32.884  32.725  1.00 21.48 ? 63   ASP A CB  1 
ATOM   488  C  CG  . ASP A 1 63  ? 22.380  34.361  32.791  1.00 24.43 ? 63   ASP A CG  1 
ATOM   489  O  OD1 . ASP A 1 63  ? 21.596  35.125  33.391  1.00 26.78 ? 63   ASP A OD1 1 
ATOM   490  O  OD2 . ASP A 1 63  ? 23.429  34.793  32.255  1.00 26.78 ? 63   ASP A OD2 1 
ATOM   491  N  N   . GLU A 1 64  ? 19.645  30.652  31.559  1.00 17.06 ? 64   GLU A N   1 
ATOM   492  C  CA  . GLU A 1 64  ? 19.259  29.984  30.313  1.00 16.73 ? 64   GLU A CA  1 
ATOM   493  C  C   . GLU A 1 64  ? 17.844  30.372  29.896  1.00 16.24 ? 64   GLU A C   1 
ATOM   494  O  O   . GLU A 1 64  ? 17.060  30.888  30.692  1.00 16.32 ? 64   GLU A O   1 
ATOM   495  C  CB  . GLU A 1 64  ? 19.349  28.466  30.465  1.00 17.85 ? 64   GLU A CB  1 
ATOM   496  C  CG  . GLU A 1 64  ? 20.682  27.900  30.886  1.00 20.48 ? 64   GLU A CG  1 
ATOM   497  C  CD  . GLU A 1 64  ? 21.789  28.009  29.862  1.00 22.33 ? 64   GLU A CD  1 
ATOM   498  O  OE1 . GLU A 1 64  ? 21.513  28.202  28.664  1.00 23.29 ? 64   GLU A OE1 1 
ATOM   499  O  OE2 . GLU A 1 64  ? 22.969  27.902  30.262  1.00 23.88 ? 64   GLU A OE2 1 
ATOM   500  N  N   . THR A 1 65  ? 17.490  30.086  28.636  1.00 15.33 ? 65   THR A N   1 
ATOM   501  C  CA  . THR A 1 65  ? 16.148  30.383  28.152  1.00 15.15 ? 65   THR A CA  1 
ATOM   502  C  C   . THR A 1 65  ? 15.133  29.298  28.486  1.00 14.38 ? 65   THR A C   1 
ATOM   503  O  O   . THR A 1 65  ? 13.957  29.442  28.138  1.00 15.14 ? 65   THR A O   1 
ATOM   504  C  CB  . THR A 1 65  ? 16.159  30.567  26.614  1.00 15.67 ? 65   THR A CB  1 
ATOM   505  O  OG1 . THR A 1 65  ? 16.679  29.373  26.024  1.00 16.33 ? 65   THR A OG1 1 
ATOM   506  C  CG2 . THR A 1 65  ? 17.030  31.751  26.231  1.00 16.85 ? 65   THR A CG2 1 
ATOM   507  N  N   . THR A 1 66  ? 15.570  28.185  29.065  1.00 14.00 ? 66   THR A N   1 
ATOM   508  C  CA  . THR A 1 66  ? 14.692  27.092  29.459  1.00 14.02 ? 66   THR A CA  1 
ATOM   509  C  C   . THR A 1 66  ? 15.148  26.548  30.820  1.00 13.15 ? 66   THR A C   1 
ATOM   510  O  O   . THR A 1 66  ? 16.290  26.781  31.200  1.00 13.01 ? 66   THR A O   1 
ATOM   511  C  CB  . THR A 1 66  ? 14.683  25.897  28.489  1.00 14.24 ? 66   THR A CB  1 
ATOM   512  O  OG1 . THR A 1 66  ? 16.020  25.379  28.363  1.00 14.40 ? 66   THR A OG1 1 
ATOM   513  C  CG2 . THR A 1 66  ? 14.156  26.262  27.102  1.00 16.26 ? 66   THR A CG2 1 
ATOM   514  N  N   . LEU A 1 67  ? 14.298  25.750  31.455  1.00 12.46 ? 67   LEU A N   1 
ATOM   515  C  CA  . LEU A 1 67  ? 14.630  25.164  32.751  1.00 12.20 ? 67   LEU A CA  1 
ATOM   516  C  C   . LEU A 1 67  ? 15.429  23.877  32.670  1.00 12.18 ? 67   LEU A C   1 
ATOM   517  O  O   . LEU A 1 67  ? 15.809  23.302  33.704  1.00 12.44 ? 67   LEU A O   1 
ATOM   518  C  CB  . LEU A 1 67  ? 13.338  24.915  33.548  1.00 12.20 ? 67   LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 67  ? 12.671  26.150  34.159  1.00 13.77 ? 67   LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 67  ? 11.237  25.854  34.563  1.00 14.03 ? 67   LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 67  ? 13.459  26.644  35.369  1.00 14.39 ? 67   LEU A CD2 1 
ATOM   522  N  N   . ASN A 1 68  ? 15.751  23.377  31.479  1.00 11.84 ? 68   ASN A N   1 
ATOM   523  C  CA  . ASN A 1 68  ? 16.348  22.065  31.330  1.00 12.38 ? 68   ASN A CA  1 
ATOM   524  C  C   . ASN A 1 68  ? 17.585  21.864  32.188  1.00 12.80 ? 68   ASN A C   1 
ATOM   525  O  O   . ASN A 1 68  ? 17.712  20.839  32.859  1.00 13.08 ? 68   ASN A O   1 
ATOM   526  C  CB  . ASN A 1 68  ? 16.705  21.785  29.854  1.00 12.43 ? 68   ASN A CB  1 
ATOM   527  C  CG  . ASN A 1 68  ? 15.463  21.675  28.991  1.00 12.66 ? 68   ASN A CG  1 
ATOM   528  O  OD1 . ASN A 1 68  ? 14.688  22.615  28.842  1.00 12.50 ? 68   ASN A OD1 1 
ATOM   529  N  ND2 . ASN A 1 68  ? 15.266  20.487  28.420  1.00 13.35 ? 68   ASN A ND2 1 
ATOM   530  N  N   . ASN A 1 69  ? 18.518  22.818  32.145  1.00 13.46 ? 69   ASN A N   1 
ATOM   531  C  CA  . ASN A 1 69  ? 19.771  22.635  32.879  1.00 13.97 ? 69   ASN A CA  1 
ATOM   532  C  C   . ASN A 1 69  ? 19.560  22.652  34.385  1.00 13.58 ? 69   ASN A C   1 
ATOM   533  O  O   . ASN A 1 69  ? 20.160  21.840  35.099  1.00 13.44 ? 69   ASN A O   1 
ATOM   534  C  CB  . ASN A 1 69  ? 20.768  23.698  32.414  1.00 15.76 ? 69   ASN A CB  1 
ATOM   535  C  CG  . ASN A 1 69  ? 21.293  23.409  31.020  1.00 17.67 ? 69   ASN A CG  1 
ATOM   536  O  OD1 . ASN A 1 69  ? 20.953  22.415  30.375  1.00 19.25 ? 69   ASN A OD1 1 
ATOM   537  N  ND2 . ASN A 1 69  ? 22.143  24.296  30.525  1.00 18.48 ? 69   ASN A ND2 1 
ATOM   538  N  N   . PHE A 1 70  ? 18.684  23.520  34.887  1.00 12.91 ? 70   PHE A N   1 
ATOM   539  C  CA  . PHE A 1 70  ? 18.315  23.473  36.307  1.00 12.94 ? 70   PHE A CA  1 
ATOM   540  C  C   . PHE A 1 70  ? 17.658  22.163  36.701  1.00 13.34 ? 70   PHE A C   1 
ATOM   541  O  O   . PHE A 1 70  ? 17.983  21.570  37.745  1.00 12.94 ? 70   PHE A O   1 
ATOM   542  C  CB  . PHE A 1 70  ? 17.444  24.676  36.662  1.00 12.96 ? 70   PHE A CB  1 
ATOM   543  C  CG  . PHE A 1 70  ? 16.975  24.733  38.089  1.00 12.45 ? 70   PHE A CG  1 
ATOM   544  C  CD1 . PHE A 1 70  ? 17.874  24.682  39.137  1.00 12.89 ? 70   PHE A CD1 1 
ATOM   545  C  CD2 . PHE A 1 70  ? 15.629  24.869  38.387  1.00 12.74 ? 70   PHE A CD2 1 
ATOM   546  C  CE1 . PHE A 1 70  ? 17.441  24.743  40.449  1.00 12.42 ? 70   PHE A CE1 1 
ATOM   547  C  CE2 . PHE A 1 70  ? 15.176  24.932  39.688  1.00 13.13 ? 70   PHE A CE2 1 
ATOM   548  C  CZ  . PHE A 1 70  ? 16.093  24.869  40.728  1.00 12.82 ? 70   PHE A CZ  1 
ATOM   549  N  N   . MET A 1 71  ? 16.713  21.682  35.889  1.00 13.36 ? 71   MET A N   1 
ATOM   550  C  CA  . MET A 1 71  ? 16.138  20.359  36.098  1.00 13.52 ? 71   MET A CA  1 
ATOM   551  C  C   . MET A 1 71  ? 17.197  19.273  36.164  1.00 13.81 ? 71   MET A C   1 
ATOM   552  O  O   . MET A 1 71  ? 17.164  18.429  37.057  1.00 13.65 ? 71   MET A O   1 
ATOM   553  C  CB  . MET A 1 71  ? 15.148  20.028  34.971  1.00 12.42 ? 71   MET A CB  1 
ATOM   554  C  CG  . MET A 1 71  ? 13.884  20.880  35.045  1.00 12.09 ? 71   MET A CG  1 
ATOM   555  S  SD  . MET A 1 71  ? 12.898  20.686  33.533  1.00 10.66 ? 71   MET A SD  1 
ATOM   556  C  CE  . MET A 1 71  ? 11.432  21.610  33.980  1.00 12.79 ? 71   MET A CE  1 
ATOM   557  N  N   . GLY A 1 72  ? 18.175  19.287  35.260  1.00 13.77 ? 72   GLY A N   1 
ATOM   558  C  CA  . GLY A 1 72  ? 19.232  18.302  35.218  1.00 14.71 ? 72   GLY A CA  1 
ATOM   559  C  C   . GLY A 1 72  ? 20.178  18.283  36.404  1.00 15.50 ? 72   GLY A C   1 
ATOM   560  O  O   . GLY A 1 72  ? 20.894  17.286  36.586  1.00 17.05 ? 72   GLY A O   1 
ATOM   561  N  N   . LEU A 1 73  ? 20.225  19.342  37.208  1.00 14.79 ? 73   LEU A N   1 
ATOM   562  C  CA  . LEU A 1 73  ? 21.137  19.387  38.344  1.00 15.13 ? 73   LEU A CA  1 
ATOM   563  C  C   . LEU A 1 73  ? 20.761  18.423  39.460  1.00 15.33 ? 73   LEU A C   1 
ATOM   564  O  O   . LEU A 1 73  ? 21.647  18.018  40.230  1.00 16.63 ? 73   LEU A O   1 
ATOM   565  C  CB  . LEU A 1 73  ? 21.215  20.808  38.910  1.00 15.13 ? 73   LEU A CB  1 
ATOM   566  C  CG  . LEU A 1 73  ? 21.866  21.909  38.085  1.00 15.00 ? 73   LEU A CG  1 
ATOM   567  C  CD1 . LEU A 1 73  ? 22.033  23.167  38.938  1.00 14.44 ? 73   LEU A CD1 1 
ATOM   568  C  CD2 . LEU A 1 73  ? 23.223  21.484  37.541  1.00 15.41 ? 73   LEU A CD2 1 
ATOM   569  N  N   . GLY A 1 74  ? 19.492  18.075  39.614  1.00 14.89 ? 74   GLY A N   1 
ATOM   570  C  CA  . GLY A 1 74  ? 19.058  17.116  40.611  1.00 15.02 ? 74   GLY A CA  1 
ATOM   571  C  C   . GLY A 1 74  ? 18.651  17.702  41.949  1.00 15.52 ? 74   GLY A C   1 
ATOM   572  O  O   . GLY A 1 74  ? 18.679  18.916  42.166  1.00 14.39 ? 74   GLY A O   1 
ATOM   573  N  N   . GLN A 1 75  ? 18.210  16.836  42.862  1.00 15.79 ? 75   GLN A N   1 
ATOM   574  C  CA  . GLN A 1 75  ? 17.488  17.218  44.059  1.00 16.76 ? 75   GLN A CA  1 
ATOM   575  C  C   . GLN A 1 75  ? 18.261  18.125  45.006  1.00 15.76 ? 75   GLN A C   1 
ATOM   576  O  O   . GLN A 1 75  ? 17.653  19.023  45.585  1.00 16.15 ? 75   GLN A O   1 
ATOM   577  C  CB  . GLN A 1 75  ? 17.053  15.989  44.871  1.00 19.18 ? 75   GLN A CB  1 
ATOM   578  C  CG  . GLN A 1 75  ? 15.682  15.432  44.555  1.00 21.69 ? 75   GLN A CG  1 
ATOM   579  C  CD  . GLN A 1 75  ? 15.319  14.271  45.466  1.00 22.69 ? 75   GLN A CD  1 
ATOM   580  O  OE1 . GLN A 1 75  ? 16.192  13.550  45.946  1.00 23.01 ? 75   GLN A OE1 1 
ATOM   581  N  NE2 . GLN A 1 75  ? 14.027  14.072  45.686  1.00 23.83 ? 75   GLN A NE2 1 
ATOM   582  N  N   . ALA A 1 76  ? 19.564  17.896  45.197  1.00 15.13 ? 76   ALA A N   1 
ATOM   583  C  CA  . ALA A 1 76  ? 20.303  18.751  46.134  1.00 15.30 ? 76   ALA A CA  1 
ATOM   584  C  C   . ALA A 1 76  ? 20.284  20.197  45.656  1.00 14.40 ? 76   ALA A C   1 
ATOM   585  O  O   . ALA A 1 76  ? 20.092  21.132  46.438  1.00 14.70 ? 76   ALA A O   1 
ATOM   586  C  CB  . ALA A 1 76  ? 21.731  18.259  46.310  1.00 15.24 ? 76   ALA A CB  1 
ATOM   587  N  N   . ALA A 1 77  ? 20.462  20.397  44.353  1.00 13.96 ? 77   ALA A N   1 
ATOM   588  C  CA  . ALA A 1 77  ? 20.395  21.732  43.774  1.00 13.28 ? 77   ALA A CA  1 
ATOM   589  C  C   . ALA A 1 77  ? 19.006  22.338  43.883  1.00 13.29 ? 77   ALA A C   1 
ATOM   590  O  O   . ALA A 1 77  ? 18.865  23.524  44.181  1.00 12.46 ? 77   ALA A O   1 
ATOM   591  C  CB  . ALA A 1 77  ? 20.822  21.699  42.312  1.00 13.66 ? 77   ALA A CB  1 
ATOM   592  N  N   . TRP A 1 78  ? 17.957  21.556  43.615  1.00 12.89 ? 78   TRP A N   1 
ATOM   593  C  CA  . TRP A 1 78  ? 16.601  22.085  43.723  1.00 12.40 ? 78   TRP A CA  1 
ATOM   594  C  C   . TRP A 1 78  ? 16.294  22.502  45.161  1.00 12.85 ? 78   TRP A C   1 
ATOM   595  O  O   . TRP A 1 78  ? 15.716  23.563  45.388  1.00 13.80 ? 78   TRP A O   1 
ATOM   596  C  CB  . TRP A 1 78  ? 15.540  21.075  43.291  1.00 12.12 ? 78   TRP A CB  1 
ATOM   597  C  CG  . TRP A 1 78  ? 15.780  20.432  41.958  1.00 11.47 ? 78   TRP A CG  1 
ATOM   598  C  CD1 . TRP A 1 78  ? 16.433  20.939  40.874  1.00 11.71 ? 78   TRP A CD1 1 
ATOM   599  C  CD2 . TRP A 1 78  ? 15.329  19.123  41.578  1.00 11.19 ? 78   TRP A CD2 1 
ATOM   600  N  NE1 . TRP A 1 78  ? 16.429  20.023  39.846  1.00 11.49 ? 78   TRP A NE1 1 
ATOM   601  C  CE2 . TRP A 1 78  ? 15.750  18.901  40.255  1.00 10.57 ? 78   TRP A CE2 1 
ATOM   602  C  CE3 . TRP A 1 78  ? 14.613  18.118  42.235  1.00 10.73 ? 78   TRP A CE3 1 
ATOM   603  C  CZ2 . TRP A 1 78  ? 15.481  17.711  39.582  1.00 11.10 ? 78   TRP A CZ2 1 
ATOM   604  C  CZ3 . TRP A 1 78  ? 14.334  16.943  41.573  1.00 10.77 ? 78   TRP A CZ3 1 
ATOM   605  C  CH2 . TRP A 1 78  ? 14.770  16.751  40.251  1.00 10.80 ? 78   TRP A CH2 1 
ATOM   606  N  N   . LYS A 1 79  ? 16.676  21.663  46.124  1.00 13.11 ? 79   LYS A N   1 
ATOM   607  C  CA  . LYS A 1 79  ? 16.421  21.944  47.527  1.00 14.23 ? 79   LYS A CA  1 
ATOM   608  C  C   . LYS A 1 79  ? 17.175  23.186  47.989  1.00 14.14 ? 79   LYS A C   1 
ATOM   609  O  O   . LYS A 1 79  ? 16.613  24.006  48.712  1.00 14.90 ? 79   LYS A O   1 
ATOM   610  C  CB  . LYS A 1 79  ? 16.784  20.742  48.412  1.00 15.61 ? 79   LYS A CB  1 
ATOM   611  C  CG  . LYS A 1 79  ? 15.767  19.621  48.241  1.00 17.51 ? 79   LYS A CG  1 
ATOM   612  C  CD  . LYS A 1 79  ? 15.979  18.448  49.177  1.00 19.06 ? 79   LYS A CD  1 
ATOM   613  C  CE  . LYS A 1 79  ? 15.018  17.310  48.837  1.00 20.70 ? 79   LYS A CE  1 
ATOM   614  N  NZ  . LYS A 1 79  ? 13.622  17.634  49.234  1.00 21.63 ? 79   LYS A NZ  1 
ATOM   615  N  N   . GLU A 1 80  ? 18.424  23.321  47.551  1.00 13.41 ? 80   GLU A N   1 
ATOM   616  C  CA  . GLU A 1 80  ? 19.183  24.527  47.877  1.00 13.84 ? 80   GLU A CA  1 
ATOM   617  C  C   . GLU A 1 80  ? 18.571  25.763  47.237  1.00 13.39 ? 80   GLU A C   1 
ATOM   618  O  O   . GLU A 1 80  ? 18.470  26.812  47.891  1.00 13.63 ? 80   GLU A O   1 
ATOM   619  C  CB  . GLU A 1 80  ? 20.641  24.365  47.447  1.00 14.14 ? 80   GLU A CB  1 
ATOM   620  C  CG  . GLU A 1 80  ? 21.531  25.508  47.940  1.00 14.96 ? 80   GLU A CG  1 
ATOM   621  C  CD  . GLU A 1 80  ? 22.938  25.295  47.412  1.00 15.64 ? 80   GLU A CD  1 
ATOM   622  O  OE1 . GLU A 1 80  ? 23.369  26.036  46.509  1.00 15.17 ? 80   GLU A OE1 1 
ATOM   623  O  OE2 . GLU A 1 80  ? 23.600  24.353  47.897  1.00 17.49 ? 80   GLU A OE2 1 
ATOM   624  N  N   . ALA A 1 81  ? 18.137  25.674  45.981  1.00 12.17 ? 81   ALA A N   1 
ATOM   625  C  CA  . ALA A 1 81  ? 17.494  26.814  45.333  1.00 12.60 ? 81   ALA A CA  1 
ATOM   626  C  C   . ALA A 1 81  ? 16.260  27.264  46.107  1.00 12.92 ? 81   ALA A C   1 
ATOM   627  O  O   . ALA A 1 81  ? 16.043  28.453  46.334  1.00 12.72 ? 81   ALA A O   1 
ATOM   628  C  CB  . ALA A 1 81  ? 17.097  26.481  43.898  1.00 12.71 ? 81   ALA A CB  1 
ATOM   629  N  N   . ARG A 1 82  ? 15.429  26.287  46.484  1.00 12.43 ? 82   ARG A N   1 
ATOM   630  C  CA  . ARG A 1 82  ? 14.215  26.587  47.237  1.00 12.56 ? 82   ARG A CA  1 
ATOM   631  C  C   . ARG A 1 82  ? 14.522  27.209  48.595  1.00 12.08 ? 82   ARG A C   1 
ATOM   632  O  O   . ARG A 1 82  ? 13.894  28.203  48.956  1.00 12.39 ? 82   ARG A O   1 
ATOM   633  C  CB  . ARG A 1 82  ? 13.392  25.305  47.398  1.00 13.01 ? 82   ARG A CB  1 
ATOM   634  C  CG  . ARG A 1 82  ? 12.047  25.518  48.084  1.00 13.41 ? 82   ARG A CG  1 
ATOM   635  C  CD  . ARG A 1 82  ? 11.251  24.219  48.057  1.00 13.56 ? 82   ARG A CD  1 
ATOM   636  N  NE  . ARG A 1 82  ? 9.945   24.354  48.697  1.00 14.15 ? 82   ARG A NE  1 
ATOM   637  C  CZ  . ARG A 1 82  ? 8.901   24.938  48.110  1.00 13.71 ? 82   ARG A CZ  1 
ATOM   638  N  NH1 . ARG A 1 82  ? 8.995   25.432  46.885  1.00 13.53 ? 82   ARG A NH1 1 
ATOM   639  N  NH2 . ARG A 1 82  ? 7.737   25.028  48.752  1.00 14.64 ? 82   ARG A NH2 1 
ATOM   640  N  N   . ALA A 1 83  ? 15.503  26.671  49.308  1.00 11.97 ? 83   ALA A N   1 
ATOM   641  C  CA  . ALA A 1 83  ? 15.880  27.256  50.600  1.00 12.12 ? 83   ALA A CA  1 
ATOM   642  C  C   . ALA A 1 83  ? 16.421  28.669  50.415  1.00 12.83 ? 83   ALA A C   1 
ATOM   643  O  O   . ALA A 1 83  ? 16.043  29.575  51.162  1.00 13.79 ? 83   ALA A O   1 
ATOM   644  C  CB  . ALA A 1 83  ? 16.890  26.366  51.303  1.00 12.28 ? 83   ALA A CB  1 
ATOM   645  N  N   . SER A 1 84  ? 17.249  28.903  49.399  1.00 12.95 ? 84   SER A N   1 
ATOM   646  C  CA  . SER A 1 84  ? 17.726  30.252  49.112  1.00 13.42 ? 84   SER A CA  1 
ATOM   647  C  C   . SER A 1 84  ? 16.596  31.225  48.807  1.00 13.15 ? 84   SER A C   1 
ATOM   648  O  O   . SER A 1 84  ? 16.547  32.338  49.335  1.00 13.64 ? 84   SER A O   1 
ATOM   649  C  CB  . SER A 1 84  ? 18.711  30.263  47.936  1.00 13.81 ? 84   SER A CB  1 
ATOM   650  O  OG  . SER A 1 84  ? 19.945  29.680  48.309  1.00 15.57 ? 84   SER A OG  1 
ATOM   651  N  N   . LEU A 1 85  ? 15.637  30.795  47.986  1.00 12.99 ? 85   LEU A N   1 
ATOM   652  C  CA  . LEU A 1 85  ? 14.493  31.642  47.663  1.00 13.45 ? 85   LEU A CA  1 
ATOM   653  C  C   . LEU A 1 85  ? 13.602  31.916  48.867  1.00 12.98 ? 85   LEU A C   1 
ATOM   654  O  O   . LEU A 1 85  ? 13.144  33.046  49.060  1.00 13.22 ? 85   LEU A O   1 
ATOM   655  C  CB  . LEU A 1 85  ? 13.678  30.984  46.541  1.00 13.49 ? 85   LEU A CB  1 
ATOM   656  C  CG  . LEU A 1 85  ? 14.355  31.041  45.169  1.00 13.81 ? 85   LEU A CG  1 
ATOM   657  C  CD1 . LEU A 1 85  ? 13.735  30.031  44.212  1.00 13.86 ? 85   LEU A CD1 1 
ATOM   658  C  CD2 . LEU A 1 85  ? 14.243  32.446  44.587  1.00 14.16 ? 85   LEU A CD2 1 
ATOM   659  N  N   . GLN A 1 86  ? 13.353  30.906  49.699  1.00 14.27 ? 86   GLN A N   1 
ATOM   660  C  CA  . GLN A 1 86  ? 12.546  31.095  50.900  1.00 15.70 ? 86   GLN A CA  1 
ATOM   661  C  C   . GLN A 1 86  ? 13.207  32.097  51.850  1.00 16.37 ? 86   GLN A C   1 
ATOM   662  O  O   . GLN A 1 86  ? 12.522  32.941  52.420  1.00 16.51 ? 86   GLN A O   1 
ATOM   663  C  CB  . GLN A 1 86  ? 12.337  29.764  51.616  1.00 17.26 ? 86   GLN A CB  1 
ATOM   664  C  CG  . GLN A 1 86  ? 11.442  28.767  50.882  1.00 19.77 ? 86   GLN A CG  1 
ATOM   665  C  CD  . GLN A 1 86  ? 11.643  27.381  51.488  1.00 21.26 ? 86   GLN A CD  1 
ATOM   666  O  OE1 . GLN A 1 86  ? 12.758  27.037  51.900  1.00 23.70 ? 86   GLN A OE1 1 
ATOM   667  N  NE2 . GLN A 1 86  ? 10.612  26.568  51.558  1.00 22.21 ? 86   GLN A NE2 1 
ATOM   668  N  N   . ASN A 1 87  ? 14.522  31.996  52.010  1.00 16.88 ? 87   ASN A N   1 
ATOM   669  C  CA  . ASN A 1 87  ? 15.248  32.941  52.858  1.00 17.97 ? 87   ASN A CA  1 
ATOM   670  C  C   . ASN A 1 87  ? 15.257  34.332  52.246  1.00 17.80 ? 87   ASN A C   1 
ATOM   671  O  O   . ASN A 1 87  ? 14.972  35.321  52.932  1.00 18.13 ? 87   ASN A O   1 
ATOM   672  C  CB  . ASN A 1 87  ? 16.650  32.384  53.125  1.00 20.94 ? 87   ASN A CB  1 
ATOM   673  C  CG  . ASN A 1 87  ? 16.572  31.120  53.967  1.00 23.66 ? 87   ASN A CG  1 
ATOM   674  O  OD1 . ASN A 1 87  ? 15.764  31.002  54.897  1.00 25.77 ? 87   ASN A OD1 1 
ATOM   675  N  ND2 . ASN A 1 87  ? 17.410  30.134  53.664  1.00 25.58 ? 87   ASN A ND2 1 
ATOM   676  N  N   . LEU A 1 88  ? 15.476  34.437  50.932  1.00 15.91 ? 88   LEU A N   1 
ATOM   677  C  CA  . LEU A 1 88  ? 15.491  35.741  50.284  1.00 16.98 ? 88   LEU A CA  1 
ATOM   678  C  C   . LEU A 1 88  ? 14.127  36.409  50.286  1.00 17.90 ? 88   LEU A C   1 
ATOM   679  O  O   . LEU A 1 88  ? 14.045  37.628  50.428  1.00 19.22 ? 88   LEU A O   1 
ATOM   680  C  CB  . LEU A 1 88  ? 16.020  35.627  48.848  1.00 16.76 ? 88   LEU A CB  1 
ATOM   681  C  CG  . LEU A 1 88  ? 17.530  35.420  48.728  1.00 17.37 ? 88   LEU A CG  1 
ATOM   682  C  CD1 . LEU A 1 88  ? 17.924  35.107  47.292  1.00 18.34 ? 88   LEU A CD1 1 
ATOM   683  C  CD2 . LEU A 1 88  ? 18.288  36.644  49.231  1.00 17.87 ? 88   LEU A CD2 1 
ATOM   684  N  N   . LEU A 1 89  ? 13.055  35.628  50.142  1.00 17.60 ? 89   LEU A N   1 
ATOM   685  C  CA  . LEU A 1 89  ? 11.722  36.220  50.059  1.00 19.15 ? 89   LEU A CA  1 
ATOM   686  C  C   . LEU A 1 89  ? 11.100  36.458  51.423  1.00 20.51 ? 89   LEU A C   1 
ATOM   687  O  O   . LEU A 1 89  ? 10.084  37.154  51.508  1.00 20.53 ? 89   LEU A O   1 
ATOM   688  C  CB  . LEU A 1 89  ? 10.803  35.358  49.177  1.00 18.78 ? 89   LEU A CB  1 
ATOM   689  C  CG  . LEU A 1 89  ? 11.066  35.493  47.675  1.00 18.36 ? 89   LEU A CG  1 
ATOM   690  C  CD1 . LEU A 1 89  ? 10.371  34.373  46.908  1.00 18.34 ? 89   LEU A CD1 1 
ATOM   691  C  CD2 . LEU A 1 89  ? 10.591  36.852  47.168  1.00 18.45 ? 89   LEU A CD2 1 
ATOM   692  N  N   . SER A 1 90  ? 11.697  35.922  52.481  1.00 22.70 ? 90   SER A N   1 
ATOM   693  C  CA  . SER A 1 90  ? 11.155  36.116  53.820  1.00 25.29 ? 90   SER A CA  1 
ATOM   694  C  C   . SER A 1 90  ? 11.061  37.595  54.156  1.00 27.03 ? 90   SER A C   1 
ATOM   695  O  O   . SER A 1 90  ? 11.906  38.405  53.781  1.00 27.28 ? 90   SER A O   1 
ATOM   696  C  CB  . SER A 1 90  ? 11.990  35.371  54.862  1.00 26.62 ? 90   SER A CB  1 
ATOM   697  O  OG  . SER A 1 90  ? 11.643  35.815  56.164  1.00 28.57 ? 90   SER A OG  1 
ATOM   698  N  N   . ALA A 1 91  ? 10.034  37.968  54.921  1.00 28.17 ? 91   ALA A N   1 
ATOM   699  C  CA  . ALA A 1 91  ? 9.776   39.365  55.251  1.00 29.22 ? 91   ALA A CA  1 
ATOM   700  C  C   . ALA A 1 91  ? 10.837  39.969  56.163  1.00 30.18 ? 91   ALA A C   1 
ATOM   701  O  O   . ALA A 1 91  ? 11.025  41.189  56.179  1.00 30.15 ? 91   ALA A O   1 
ATOM   702  C  CB  . ALA A 1 91  ? 8.400   39.489  55.900  1.00 29.37 ? 91   ALA A CB  1 
ATOM   703  N  N   . SER A 1 92  ? 11.542  39.140  56.915  1.00 30.86 ? 92   SER A N   1 
ATOM   704  C  CA  . SER A 1 92  ? 12.549  39.551  57.869  1.00 31.76 ? 92   SER A CA  1 
ATOM   705  C  C   . SER A 1 92  ? 13.981  39.451  57.366  1.00 31.58 ? 92   SER A C   1 
ATOM   706  O  O   . SER A 1 92  ? 14.910  39.692  58.144  1.00 31.48 ? 92   SER A O   1 
ATOM   707  C  CB  . SER A 1 92  ? 12.408  38.679  59.129  1.00 32.30 ? 92   SER A CB  1 
ATOM   708  O  OG  . SER A 1 92  ? 12.526  37.310  58.783  1.00 33.27 ? 92   SER A OG  1 
ATOM   709  N  N   . GLN A 1 93  ? 14.189  39.083  56.105  1.00 31.63 ? 93   GLN A N   1 
ATOM   710  C  CA  . GLN A 1 93  ? 15.538  39.086  55.540  1.00 30.92 ? 93   GLN A CA  1 
ATOM   711  C  C   . GLN A 1 93  ? 15.767  40.316  54.667  1.00 29.87 ? 93   GLN A C   1 
ATOM   712  O  O   . GLN A 1 93  ? 14.927  40.678  53.844  1.00 30.20 ? 93   GLN A O   1 
ATOM   713  C  CB  . GLN A 1 93  ? 15.789  37.803  54.749  1.00 32.26 ? 93   GLN A CB  1 
ATOM   714  C  CG  . GLN A 1 93  ? 15.765  36.540  55.587  1.00 33.40 ? 93   GLN A CG  1 
ATOM   715  C  CD  . GLN A 1 93  ? 16.883  36.434  56.600  1.00 34.20 ? 93   GLN A CD  1 
ATOM   716  O  OE1 . GLN A 1 93  ? 18.035  36.807  56.369  1.00 34.59 ? 93   GLN A OE1 1 
ATOM   717  N  NE2 . GLN A 1 93  ? 16.538  35.896  57.770  1.00 34.84 ? 93   GLN A NE2 1 
ATOM   718  N  N   . ALA A 1 94  ? 16.921  40.960  54.830  1.00 28.28 ? 94   ALA A N   1 
ATOM   719  C  CA  . ALA A 1 94  ? 17.173  42.263  54.239  1.00 26.98 ? 94   ALA A CA  1 
ATOM   720  C  C   . ALA A 1 94  ? 17.725  42.246  52.822  1.00 25.64 ? 94   ALA A C   1 
ATOM   721  O  O   . ALA A 1 94  ? 17.464  43.190  52.074  1.00 25.23 ? 94   ALA A O   1 
ATOM   722  C  CB  . ALA A 1 94  ? 18.130  43.038  55.151  1.00 27.55 ? 94   ALA A CB  1 
ATOM   723  N  N   . ARG A 1 95  ? 18.463  41.235  52.393  1.00 24.05 ? 95   ARG A N   1 
ATOM   724  C  CA  . ARG A 1 95  ? 19.274  41.319  51.194  1.00 23.53 ? 95   ARG A CA  1 
ATOM   725  C  C   . ARG A 1 95  ? 18.587  41.798  49.918  1.00 22.83 ? 95   ARG A C   1 
ATOM   726  O  O   . ARG A 1 95  ? 19.028  42.716  49.234  1.00 23.17 ? 95   ARG A O   1 
ATOM   727  C  CB  . ARG A 1 95  ? 19.802  39.946  50.787  1.00 24.23 ? 95   ARG A CB  1 
ATOM   728  C  CG  . ARG A 1 95  ? 20.719  39.974  49.576  1.00 23.84 ? 95   ARG A CG  1 
ATOM   729  C  CD  . ARG A 1 95  ? 21.924  40.865  49.822  1.00 24.42 ? 95   ARG A CD  1 
ATOM   730  N  NE  . ARG A 1 95  ? 22.716  40.999  48.604  1.00 24.77 ? 95   ARG A NE  1 
ATOM   731  C  CZ  . ARG A 1 95  ? 22.494  41.888  47.648  1.00 25.58 ? 95   ARG A CZ  1 
ATOM   732  N  NH1 . ARG A 1 95  ? 21.497  42.755  47.730  1.00 26.55 ? 95   ARG A NH1 1 
ATOM   733  N  NH2 . ARG A 1 95  ? 23.301  41.896  46.596  1.00 25.46 ? 95   ARG A NH2 1 
ATOM   734  N  N   . LEU A 1 96  ? 17.616  40.985  49.483  1.00 21.44 ? 96   LEU A N   1 
ATOM   735  C  CA  . LEU A 1 96  ? 16.851  41.344  48.289  1.00 20.71 ? 96   LEU A CA  1 
ATOM   736  C  C   . LEU A 1 96  ? 15.859  42.437  48.660  1.00 20.96 ? 96   LEU A C   1 
ATOM   737  O  O   . LEU A 1 96  ? 15.687  43.432  47.955  1.00 21.47 ? 96   LEU A O   1 
ATOM   738  C  CB  . LEU A 1 96  ? 16.178  40.111  47.709  1.00 20.17 ? 96   LEU A CB  1 
ATOM   739  C  CG  . LEU A 1 96  ? 15.239  40.300  46.519  1.00 19.85 ? 96   LEU A CG  1 
ATOM   740  C  CD1 . LEU A 1 96  ? 15.957  40.937  45.339  1.00 20.29 ? 96   LEU A CD1 1 
ATOM   741  C  CD2 . LEU A 1 96  ? 14.660  38.948  46.112  1.00 19.33 ? 96   LEU A CD2 1 
ATOM   742  N  N   . ARG A 1 97  ? 15.240  42.283  49.826  1.00 20.95 ? 97   ARG A N   1 
ATOM   743  C  CA  . ARG A 1 97  ? 14.260  43.239  50.320  1.00 22.13 ? 97   ARG A CA  1 
ATOM   744  C  C   . ARG A 1 97  ? 14.785  44.673  50.342  1.00 23.22 ? 97   ARG A C   1 
ATOM   745  O  O   . ARG A 1 97  ? 14.057  45.587  49.940  1.00 22.70 ? 97   ARG A O   1 
ATOM   746  C  CB  . ARG A 1 97  ? 13.820  42.838  51.730  1.00 22.00 ? 97   ARG A CB  1 
ATOM   747  C  CG  . ARG A 1 97  ? 12.732  43.713  52.329  1.00 22.45 ? 97   ARG A CG  1 
ATOM   748  C  CD  . ARG A 1 97  ? 12.570  43.456  53.819  1.00 23.33 ? 97   ARG A CD  1 
ATOM   749  N  NE  . ARG A 1 97  ? 13.756  43.846  54.570  1.00 24.14 ? 97   ARG A NE  1 
ATOM   750  C  CZ  . ARG A 1 97  ? 14.006  43.546  55.837  1.00 25.02 ? 97   ARG A CZ  1 
ATOM   751  N  NH1 . ARG A 1 97  ? 13.148  42.828  56.549  1.00 25.53 ? 97   ARG A NH1 1 
ATOM   752  N  NH2 . ARG A 1 97  ? 15.131  43.963  56.406  1.00 25.64 ? 97   ARG A NH2 1 
ATOM   753  N  N   . ASP A 1 98  ? 16.015  44.867  50.808  1.00 24.89 ? 98   ASP A N   1 
ATOM   754  C  CA  . ASP A 1 98  ? 16.505  46.221  51.058  1.00 26.56 ? 98   ASP A CA  1 
ATOM   755  C  C   . ASP A 1 98  ? 17.464  46.729  49.991  1.00 26.78 ? 98   ASP A C   1 
ATOM   756  O  O   . ASP A 1 98  ? 17.922  47.876  50.084  1.00 26.23 ? 98   ASP A O   1 
ATOM   757  C  CB  . ASP A 1 98  ? 17.174  46.305  52.432  1.00 27.78 ? 98   ASP A CB  1 
ATOM   758  C  CG  . ASP A 1 98  ? 16.231  46.107  53.597  1.00 28.63 ? 98   ASP A CG  1 
ATOM   759  O  OD1 . ASP A 1 98  ? 14.998  46.210  53.443  1.00 29.59 ? 98   ASP A OD1 1 
ATOM   760  O  OD2 . ASP A 1 98  ? 16.726  45.842  54.715  1.00 30.33 ? 98   ASP A OD2 1 
ATOM   761  N  N   . ASP A 1 99  ? 17.790  45.910  49.000  1.00 26.47 ? 99   ASP A N   1 
ATOM   762  C  CA  . ASP A 1 99  ? 18.599  46.356  47.868  1.00 26.54 ? 99   ASP A CA  1 
ATOM   763  C  C   . ASP A 1 99  ? 17.668  46.887  46.781  1.00 26.70 ? 99   ASP A C   1 
ATOM   764  O  O   . ASP A 1 99  ? 17.218  46.185  45.879  1.00 25.89 ? 99   ASP A O   1 
ATOM   765  C  CB  . ASP A 1 99  ? 19.494  45.248  47.337  1.00 26.79 ? 99   ASP A CB  1 
ATOM   766  C  CG  . ASP A 1 99  ? 20.484  45.659  46.275  1.00 27.14 ? 99   ASP A CG  1 
ATOM   767  O  OD1 . ASP A 1 99  ? 20.285  46.692  45.593  1.00 27.05 ? 99   ASP A OD1 1 
ATOM   768  O  OD2 . ASP A 1 99  ? 21.494  44.939  46.094  1.00 27.77 ? 99   ASP A OD2 1 
ATOM   769  N  N   . LYS A 1 100 ? 17.395  48.185  46.867  1.00 27.04 ? 100  LYS A N   1 
ATOM   770  C  CA  . LYS A 1 100 ? 16.375  48.828  46.054  1.00 27.42 ? 100  LYS A CA  1 
ATOM   771  C  C   . LYS A 1 100 ? 16.651  48.701  44.564  1.00 27.05 ? 100  LYS A C   1 
ATOM   772  O  O   . LYS A 1 100 ? 15.726  48.371  43.811  1.00 27.17 ? 100  LYS A O   1 
ATOM   773  C  CB  . LYS A 1 100 ? 16.267  50.293  46.469  1.00 28.35 ? 100  LYS A CB  1 
ATOM   774  C  CG  . LYS A 1 100 ? 15.224  51.112  45.730  1.00 29.87 ? 100  LYS A CG  1 
ATOM   775  C  CD  . LYS A 1 100 ? 15.625  52.583  45.818  1.00 30.70 ? 100  LYS A CD  1 
ATOM   776  C  CE  . LYS A 1 100 ? 14.592  53.483  45.174  1.00 31.14 ? 100  LYS A CE  1 
ATOM   777  N  NZ  . LYS A 1 100 ? 15.173  54.814  44.829  1.00 32.27 ? 100  LYS A NZ  1 
ATOM   778  N  N   . GLU A 1 101 ? 17.888  48.936  44.126  1.00 26.56 ? 101  GLU A N   1 
ATOM   779  C  CA  . GLU A 1 101 ? 18.163  48.888  42.689  1.00 26.01 ? 101  GLU A CA  1 
ATOM   780  C  C   . GLU A 1 101 ? 18.079  47.452  42.182  1.00 24.53 ? 101  GLU A C   1 
ATOM   781  O  O   . GLU A 1 101 ? 17.634  47.229  41.054  1.00 24.73 ? 101  GLU A O   1 
ATOM   782  C  CB  . GLU A 1 101 ? 19.486  49.549  42.342  1.00 27.76 ? 101  GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 101 ? 20.729  48.700  42.328  1.00 29.37 ? 101  GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 101 ? 20.954  47.926  41.045  1.00 30.14 ? 101  GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 101 ? 20.742  48.468  39.942  1.00 30.60 ? 101  GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 101 ? 21.347  46.745  41.155  1.00 31.15 ? 101  GLU A OE2 1 
ATOM   787  N  N   . LEU A 1 102 ? 18.529  46.482  42.978  1.00 22.13 ? 102  LEU A N   1 
ATOM   788  C  CA  . LEU A 1 102 ? 18.409  45.086  42.558  1.00 20.79 ? 102  LEU A CA  1 
ATOM   789  C  C   . LEU A 1 102 ? 16.941  44.683  42.508  1.00 20.36 ? 102  LEU A C   1 
ATOM   790  O  O   . LEU A 1 102 ? 16.445  44.100  41.547  1.00 19.63 ? 102  LEU A O   1 
ATOM   791  C  CB  . LEU A 1 102 ? 19.194  44.153  43.481  1.00 19.62 ? 102  LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 102 ? 19.108  42.661  43.132  1.00 19.27 ? 102  LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 102 ? 19.717  42.378  41.767  1.00 19.04 ? 102  LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 102 ? 19.782  41.827  44.211  1.00 19.31 ? 102  LEU A CD2 1 
ATOM   795  N  N   . ARG A 1 103 ? 16.211  45.035  43.560  1.00 20.50 ? 103  ARG A N   1 
ATOM   796  C  CA  . ARG A 1 103 ? 14.791  44.730  43.675  1.00 21.14 ? 103  ARG A CA  1 
ATOM   797  C  C   . ARG A 1 103 ? 13.974  45.290  42.527  1.00 20.87 ? 103  ARG A C   1 
ATOM   798  O  O   . ARG A 1 103 ? 13.137  44.595  41.933  1.00 20.32 ? 103  ARG A O   1 
ATOM   799  C  CB  . ARG A 1 103 ? 14.324  45.242  45.037  1.00 22.17 ? 103  ARG A CB  1 
ATOM   800  C  CG  . ARG A 1 103 ? 12.902  44.860  45.382  1.00 22.89 ? 103  ARG A CG  1 
ATOM   801  C  CD  . ARG A 1 103 ? 12.619  45.174  46.851  1.00 23.32 ? 103  ARG A CD  1 
ATOM   802  N  NE  . ARG A 1 103 ? 11.184  45.065  47.079  1.00 23.79 ? 103  ARG A NE  1 
ATOM   803  C  CZ  . ARG A 1 103 ? 10.565  45.187  48.241  1.00 24.30 ? 103  ARG A CZ  1 
ATOM   804  N  NH1 . ARG A 1 103 ? 11.242  45.418  49.355  1.00 24.76 ? 103  ARG A NH1 1 
ATOM   805  N  NH2 . ARG A 1 103 ? 9.240   45.059  48.265  1.00 24.89 ? 103  ARG A NH2 1 
ATOM   806  N  N   . GLN A 1 104 ? 14.274  46.521  42.097  1.00 20.27 ? 104  GLN A N   1 
ATOM   807  C  CA  . GLN A 1 104 ? 13.581  47.115  40.957  1.00 20.51 ? 104  GLN A CA  1 
ATOM   808  C  C   . GLN A 1 104 ? 13.850  46.378  39.657  1.00 19.66 ? 104  GLN A C   1 
ATOM   809  O  O   . GLN A 1 104 ? 12.962  46.321  38.792  1.00 20.52 ? 104  GLN A O   1 
ATOM   810  C  CB  . GLN A 1 104 ? 13.903  48.618  40.850  1.00 21.60 ? 104  GLN A CB  1 
ATOM   811  C  CG  . GLN A 1 104 ? 13.356  49.362  42.063  1.00 23.21 ? 104  GLN A CG  1 
ATOM   812  C  CD  . GLN A 1 104 ? 13.374  50.871  41.962  1.00 24.22 ? 104  GLN A CD  1 
ATOM   813  O  OE1 . GLN A 1 104 ? 14.065  51.464  41.139  1.00 24.93 ? 104  GLN A OE1 1 
ATOM   814  N  NE2 . GLN A 1 104 ? 12.576  51.500  42.823  1.00 25.14 ? 104  GLN A NE2 1 
ATOM   815  N  N   . ARG A 1 105 ? 15.022  45.780  39.490  1.00 18.59 ? 105  ARG A N   1 
ATOM   816  C  CA  . ARG A 1 105 ? 15.349  45.000  38.316  1.00 18.75 ? 105  ARG A CA  1 
ATOM   817  C  C   . ARG A 1 105 ? 14.845  43.561  38.419  1.00 17.79 ? 105  ARG A C   1 
ATOM   818  O  O   . ARG A 1 105 ? 14.641  42.921  37.389  1.00 18.22 ? 105  ARG A O   1 
ATOM   819  C  CB  . ARG A 1 105 ? 16.860  44.962  38.054  1.00 19.92 ? 105  ARG A CB  1 
ATOM   820  C  CG  . ARG A 1 105 ? 17.419  46.328  37.683  1.00 21.33 ? 105  ARG A CG  1 
ATOM   821  C  CD  . ARG A 1 105 ? 18.868  46.274  37.252  1.00 22.30 ? 105  ARG A CD  1 
ATOM   822  N  NE  . ARG A 1 105 ? 19.787  45.978  38.336  1.00 22.82 ? 105  ARG A NE  1 
ATOM   823  C  CZ  . ARG A 1 105 ? 20.443  44.841  38.514  1.00 23.23 ? 105  ARG A CZ  1 
ATOM   824  N  NH1 . ARG A 1 105 ? 20.315  43.836  37.661  1.00 23.09 ? 105  ARG A NH1 1 
ATOM   825  N  NH2 . ARG A 1 105 ? 21.255  44.723  39.557  1.00 23.89 ? 105  ARG A NH2 1 
ATOM   826  N  N   . ALA A 1 106 ? 14.657  43.076  39.643  1.00 16.49 ? 106  ALA A N   1 
ATOM   827  C  CA  . ALA A 1 106 ? 14.399  41.655  39.841  1.00 16.18 ? 106  ALA A CA  1 
ATOM   828  C  C   . ALA A 1 106 ? 12.921  41.282  39.774  1.00 16.16 ? 106  ALA A C   1 
ATOM   829  O  O   . ALA A 1 106 ? 12.620  40.141  39.414  1.00 16.19 ? 106  ALA A O   1 
ATOM   830  C  CB  . ALA A 1 106 ? 14.950  41.217  41.194  1.00 15.90 ? 106  ALA A CB  1 
ATOM   831  N  N   . PHE A 1 107 ? 12.035  42.203  40.126  1.00 15.94 ? 107  PHE A N   1 
ATOM   832  C  CA  . PHE A 1 107 ? 10.612  41.892  40.208  1.00 16.57 ? 107  PHE A CA  1 
ATOM   833  C  C   . PHE A 1 107 ? 9.828   42.608  39.116  1.00 17.99 ? 107  PHE A C   1 
ATOM   834  O  O   . PHE A 1 107 ? 10.008  43.811  38.926  1.00 19.02 ? 107  PHE A O   1 
ATOM   835  C  CB  . PHE A 1 107 ? 10.041  42.299  41.564  1.00 15.78 ? 107  PHE A CB  1 
ATOM   836  C  CG  . PHE A 1 107 ? 10.443  41.466  42.741  1.00 15.73 ? 107  PHE A CG  1 
ATOM   837  C  CD1 . PHE A 1 107 ? 11.439  41.873  43.614  1.00 15.07 ? 107  PHE A CD1 1 
ATOM   838  C  CD2 . PHE A 1 107 ? 9.810   40.253  42.981  1.00 14.80 ? 107  PHE A CD2 1 
ATOM   839  C  CE1 . PHE A 1 107 ? 11.791  41.091  44.694  1.00 15.10 ? 107  PHE A CE1 1 
ATOM   840  C  CE2 . PHE A 1 107 ? 10.160  39.471  44.062  1.00 14.45 ? 107  PHE A CE2 1 
ATOM   841  C  CZ  . PHE A 1 107 ? 11.151  39.888  44.929  1.00 14.75 ? 107  PHE A CZ  1 
ATOM   842  N  N   . THR A 1 108 ? 8.998   41.875  38.374  1.00 17.87 ? 108  THR A N   1 
ATOM   843  C  CA  . THR A 1 108 ? 8.021   42.496  37.481  1.00 18.57 ? 108  THR A CA  1 
ATOM   844  C  C   . THR A 1 108 ? 6.642   41.875  37.708  1.00 18.71 ? 108  THR A C   1 
ATOM   845  O  O   . THR A 1 108 ? 6.527   40.862  38.399  1.00 19.15 ? 108  THR A O   1 
ATOM   846  C  CB  . THR A 1 108 ? 8.372   42.351  35.995  1.00 18.53 ? 108  THR A CB  1 
ATOM   847  O  OG1 . THR A 1 108 ? 8.475   40.961  35.651  1.00 19.30 ? 108  THR A OG1 1 
ATOM   848  C  CG2 . THR A 1 108 ? 9.676   43.050  35.639  1.00 19.39 ? 108  THR A CG2 1 
ATOM   849  N  N   . SER A 1 109 ? 5.614   42.466  37.108  1.00 19.49 ? 109  SER A N   1 
ATOM   850  C  CA  . SER A 1 109 ? 4.256   41.973  37.326  1.00 19.73 ? 109  SER A CA  1 
ATOM   851  C  C   . SER A 1 109 ? 3.960   40.772  36.445  1.00 19.32 ? 109  SER A C   1 
ATOM   852  O  O   . SER A 1 109 ? 4.264   40.753  35.250  1.00 19.60 ? 109  SER A O   1 
ATOM   853  C  CB  . SER A 1 109 ? 3.241   43.090  37.026  1.00 21.14 ? 109  SER A CB  1 
ATOM   854  O  OG  . SER A 1 109 ? 3.185   43.276  35.612  1.00 25.36 ? 109  SER A OG  1 
ATOM   855  N  N   . GLN A 1 110 ? 3.279   39.761  36.991  1.00 18.54 ? 110  GLN A N   1 
ATOM   856  C  CA  . GLN A 1 110 ? 2.728   38.692  36.162  1.00 18.58 ? 110  GLN A CA  1 
ATOM   857  C  C   . GLN A 1 110 ? 1.813   39.230  35.070  1.00 19.57 ? 110  GLN A C   1 
ATOM   858  O  O   . GLN A 1 110 ? 1.880   38.756  33.931  1.00 20.47 ? 110  GLN A O   1 
ATOM   859  C  CB  . GLN A 1 110 ? 1.944   37.695  37.018  1.00 17.69 ? 110  GLN A CB  1 
ATOM   860  C  CG  . GLN A 1 110 ? 2.832   36.821  37.891  1.00 17.12 ? 110  GLN A CG  1 
ATOM   861  C  CD  . GLN A 1 110 ? 2.033   36.140  38.984  1.00 16.52 ? 110  GLN A CD  1 
ATOM   862  O  OE1 . GLN A 1 110 ? 0.833   35.918  38.829  1.00 17.27 ? 110  GLN A OE1 1 
ATOM   863  N  NE2 . GLN A 1 110 ? 2.683   35.816  40.096  1.00 16.03 ? 110  GLN A NE2 1 
ATOM   864  N  N   . ALA A 1 111 ? 0.998   40.234  35.370  1.00 20.86 ? 111  ALA A N   1 
ATOM   865  C  CA  . ALA A 1 111 ? 0.045   40.793  34.417  1.00 22.35 ? 111  ALA A CA  1 
ATOM   866  C  C   . ALA A 1 111 ? 0.668   41.448  33.195  1.00 23.29 ? 111  ALA A C   1 
ATOM   867  O  O   . ALA A 1 111 ? -0.051  41.732  32.225  1.00 24.96 ? 111  ALA A O   1 
ATOM   868  C  CB  . ALA A 1 111 ? -0.834  41.800  35.159  1.00 22.75 ? 111  ALA A CB  1 
ATOM   869  N  N   . SER A 1 112 ? 1.959   41.744  33.190  1.00 22.55 ? 112  SER A N   1 
ATOM   870  C  CA  . SER A 1 112 ? 2.656   42.305  32.051  1.00 23.16 ? 112  SER A CA  1 
ATOM   871  C  C   . SER A 1 112 ? 3.609   41.321  31.387  1.00 22.24 ? 112  SER A C   1 
ATOM   872  O  O   . SER A 1 112 ? 4.283   41.692  30.422  1.00 23.25 ? 112  SER A O   1 
ATOM   873  C  CB  . SER A 1 112 ? 3.446   43.546  32.503  1.00 23.87 ? 112  SER A CB  1 
ATOM   874  O  OG  . SER A 1 112 ? 2.551   44.538  32.985  1.00 25.24 ? 112  SER A OG  1 
ATOM   875  N  N   . ALA A 1 113 ? 3.689   40.083  31.872  1.00 20.90 ? 113  ALA A N   1 
ATOM   876  C  CA  . ALA A 1 113 ? 4.638   39.126  31.326  1.00 19.85 ? 113  ALA A CA  1 
ATOM   877  C  C   . ALA A 1 113 ? 4.006   38.204  30.286  1.00 19.59 ? 113  ALA A C   1 
ATOM   878  O  O   . ALA A 1 113 ? 2.808   37.924  30.345  1.00 20.55 ? 113  ALA A O   1 
ATOM   879  C  CB  . ALA A 1 113 ? 5.271   38.266  32.418  1.00 19.75 ? 113  ALA A CB  1 
ATOM   880  N  N   . THR A 1 114 ? 4.816   37.751  29.352  1.00 18.57 ? 114  THR A N   1 
ATOM   881  C  CA  . THR A 1 114 ? 4.454   36.696  28.413  1.00 18.55 ? 114  THR A CA  1 
ATOM   882  C  C   . THR A 1 114 ? 5.091   35.385  28.866  1.00 17.70 ? 114  THR A C   1 
ATOM   883  O  O   . THR A 1 114 ? 6.317   35.317  28.981  1.00 17.54 ? 114  THR A O   1 
ATOM   884  C  CB  . THR A 1 114 ? 4.927   37.030  26.986  1.00 19.66 ? 114  THR A CB  1 
ATOM   885  O  OG1 . THR A 1 114 ? 4.297   38.265  26.610  1.00 20.28 ? 114  THR A OG1 1 
ATOM   886  C  CG2 . THR A 1 114 ? 4.542   35.953  25.986  1.00 20.25 ? 114  THR A CG2 1 
ATOM   887  N  N   . MET A 1 115 ? 4.272   34.359  29.091  1.00 16.96 ? 115  MET A N   1 
ATOM   888  C  CA  . MET A 1 115 ? 4.819   33.064  29.483  1.00 16.34 ? 115  MET A CA  1 
ATOM   889  C  C   . MET A 1 115 ? 5.132   32.167  28.293  1.00 16.68 ? 115  MET A C   1 
ATOM   890  O  O   . MET A 1 115 ? 4.486   32.204  27.241  1.00 17.79 ? 115  MET A O   1 
ATOM   891  C  CB  . MET A 1 115 ? 3.873   32.333  30.431  1.00 15.12 ? 115  MET A CB  1 
ATOM   892  C  CG  . MET A 1 115 ? 3.498   33.098  31.681  1.00 14.99 ? 115  MET A CG  1 
ATOM   893  S  SD  . MET A 1 115 ? 4.904   33.646  32.669  1.00 14.14 ? 115  MET A SD  1 
ATOM   894  C  CE  . MET A 1 115 ? 5.621   32.083  33.168  1.00 15.49 ? 115  MET A CE  1 
ATOM   895  N  N   . HIS A 1 116 ? 6.190   31.378  28.437  1.00 15.53 ? 116  HIS A N   1 
ATOM   896  C  CA  . HIS A 1 116 ? 6.657   30.455  27.412  1.00 16.04 ? 116  HIS A CA  1 
ATOM   897  C  C   . HIS A 1 116 ? 6.634   29.025  27.944  1.00 15.95 ? 116  HIS A C   1 
ATOM   898  O  O   . HIS A 1 116 ? 6.392   28.836  29.137  1.00 15.66 ? 116  HIS A O   1 
ATOM   899  C  CB  . HIS A 1 116 ? 8.085   30.824  26.984  1.00 17.81 ? 116  HIS A CB  1 
ATOM   900  C  CG  . HIS A 1 116 ? 8.252   32.229  26.490  1.00 18.96 ? 116  HIS A CG  1 
ATOM   901  N  ND1 . HIS A 1 116 ? 8.437   32.533  25.158  1.00 21.44 ? 116  HIS A ND1 1 
ATOM   902  C  CD2 . HIS A 1 116 ? 8.254   33.416  27.143  1.00 19.60 ? 116  HIS A CD2 1 
ATOM   903  C  CE1 . HIS A 1 116 ? 8.552   33.845  25.020  1.00 21.02 ? 116  HIS A CE1 1 
ATOM   904  N  NE2 . HIS A 1 116 ? 8.432   34.408  26.210  1.00 19.59 ? 116  HIS A NE2 1 
ATOM   905  N  N   . LEU A 1 117 ? 6.867   28.032  27.093  1.00 15.20 ? 117  LEU A N   1 
ATOM   906  C  CA  . LEU A 1 117 ? 7.064   26.666  27.597  1.00 14.62 ? 117  LEU A CA  1 
ATOM   907  C  C   . LEU A 1 117 ? 8.239   26.663  28.564  1.00 14.21 ? 117  LEU A C   1 
ATOM   908  O  O   . LEU A 1 117 ? 9.257   27.316  28.326  1.00 14.74 ? 117  LEU A O   1 
ATOM   909  C  CB  . LEU A 1 117 ? 7.332   25.694  26.453  1.00 15.36 ? 117  LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 117 ? 6.170   25.369  25.510  1.00 16.38 ? 117  LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 117 ? 6.692   24.543  24.340  1.00 17.31 ? 117  LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 117 ? 5.055   24.636  26.233  1.00 16.03 ? 117  LEU A CD2 1 
ATOM   913  N  N   . PRO A 1 118 ? 8.124   25.933  29.673  1.00 13.39 ? 118  PRO A N   1 
ATOM   914  C  CA  . PRO A 1 118 ? 9.145   25.974  30.708  1.00 13.18 ? 118  PRO A CA  1 
ATOM   915  C  C   . PRO A 1 118 ? 10.416  25.231  30.362  1.00 13.69 ? 118  PRO A C   1 
ATOM   916  O  O   . PRO A 1 118 ? 11.470  25.498  30.944  1.00 13.49 ? 118  PRO A O   1 
ATOM   917  C  CB  . PRO A 1 118 ? 8.452   25.398  31.940  1.00 13.39 ? 118  PRO A CB  1 
ATOM   918  C  CG  . PRO A 1 118 ? 7.310   24.610  31.401  1.00 12.46 ? 118  PRO A CG  1 
ATOM   919  C  CD  . PRO A 1 118 ? 6.859   25.323  30.147  1.00 13.79 ? 118  PRO A CD  1 
ATOM   920  N  N   . ALA A 1 119 ? 10.369  24.289  29.417  1.00 13.78 ? 119  ALA A N   1 
ATOM   921  C  CA  . ALA A 1 119 ? 11.511  23.485  29.042  1.00 13.29 ? 119  ALA A CA  1 
ATOM   922  C  C   . ALA A 1 119 ? 11.420  23.082  27.565  1.00 12.93 ? 119  ALA A C   1 
ATOM   923  O  O   . ALA A 1 119 ? 10.327  23.086  27.002  1.00 13.50 ? 119  ALA A O   1 
ATOM   924  C  CB  . ALA A 1 119 ? 11.594  22.215  29.885  1.00 13.34 ? 119  ALA A CB  1 
ATOM   925  N  N   . THR A 1 120 ? 12.561  22.718  27.018  1.00 13.49 ? 120  THR A N   1 
ATOM   926  C  CA  . THR A 1 120 ? 12.609  22.043  25.719  1.00 14.58 ? 120  THR A CA  1 
ATOM   927  C  C   . THR A 1 120 ? 12.331  20.565  25.963  1.00 13.95 ? 120  THR A C   1 
ATOM   928  O  O   . THR A 1 120 ? 13.136  19.863  26.575  1.00 14.95 ? 120  THR A O   1 
ATOM   929  C  CB  . THR A 1 120 ? 13.995  22.210  25.076  1.00 16.15 ? 120  THR A CB  1 
ATOM   930  O  OG1 . THR A 1 120 ? 14.260  23.609  24.919  1.00 18.01 ? 120  THR A OG1 1 
ATOM   931  C  CG2 . THR A 1 120 ? 14.044  21.512  23.727  1.00 17.06 ? 120  THR A CG2 1 
ATOM   932  N  N   . ILE A 1 121 ? 11.152  20.127  25.550  1.00 13.09 ? 121  ILE A N   1 
ATOM   933  C  CA  . ILE A 1 121 ? 10.700  18.773  25.855  1.00 12.37 ? 121  ILE A CA  1 
ATOM   934  C  C   . ILE A 1 121 ? 11.216  17.806  24.802  1.00 12.85 ? 121  ILE A C   1 
ATOM   935  O  O   . ILE A 1 121 ? 10.684  17.765  23.691  1.00 13.77 ? 121  ILE A O   1 
ATOM   936  C  CB  . ILE A 1 121 ? 9.162   18.752  25.932  1.00 11.88 ? 121  ILE A CB  1 
ATOM   937  C  CG1 . ILE A 1 121 ? 8.695   19.718  27.034  1.00 11.82 ? 121  ILE A CG1 1 
ATOM   938  C  CG2 . ILE A 1 121 ? 8.647   17.345  26.183  1.00 11.11 ? 121  ILE A CG2 1 
ATOM   939  C  CD1 . ILE A 1 121 ? 7.202   19.989  26.990  1.00 12.17 ? 121  ILE A CD1 1 
ATOM   940  N  N   . GLY A 1 122 ? 12.263  17.057  25.147  1.00 12.67 ? 122  GLY A N   1 
ATOM   941  C  CA  . GLY A 1 122 ? 12.838  16.092  24.210  1.00 12.58 ? 122  GLY A CA  1 
ATOM   942  C  C   . GLY A 1 122 ? 11.852  14.984  23.879  1.00 12.34 ? 122  GLY A C   1 
ATOM   943  O  O   . GLY A 1 122 ? 11.736  14.570  22.728  1.00 13.81 ? 122  GLY A O   1 
ATOM   944  N  N   . ASP A 1 123 ? 11.169  14.435  24.875  1.00 10.37 ? 123  ASP A N   1 
ATOM   945  C  CA  . ASP A 1 123 ? 10.182  13.386  24.671  1.00 10.07 ? 123  ASP A CA  1 
ATOM   946  C  C   . ASP A 1 123 ? 9.018   13.612  25.632  1.00 9.41  ? 123  ASP A C   1 
ATOM   947  O  O   . ASP A 1 123 ? 9.214   13.948  26.792  1.00 9.73  ? 123  ASP A O   1 
ATOM   948  C  CB  . ASP A 1 123 ? 10.749  11.987  24.902  1.00 9.90  ? 123  ASP A CB  1 
ATOM   949  C  CG  . ASP A 1 123 ? 11.512  11.422  23.720  1.00 10.99 ? 123  ASP A CG  1 
ATOM   950  O  OD1 . ASP A 1 123 ? 10.912  11.231  22.633  1.00 11.94 ? 123  ASP A OD1 1 
ATOM   951  O  OD2 . ASP A 1 123 ? 12.715  11.163  23.860  1.00 10.56 ? 123  ASP A OD2 1 
ATOM   952  N  N   . TYR A 1 124 ? 7.816   13.431  25.123  1.00 9.34  ? 124  TYR A N   1 
ATOM   953  C  CA  . TYR A 1 124 ? 6.576   13.521  25.868  1.00 9.08  ? 124  TYR A CA  1 
ATOM   954  C  C   . TYR A 1 124 ? 5.925   12.142  25.830  1.00 8.80  ? 124  TYR A C   1 
ATOM   955  O  O   . TYR A 1 124 ? 5.898   11.473  24.794  1.00 10.56 ? 124  TYR A O   1 
ATOM   956  C  CB  . TYR A 1 124 ? 5.672   14.604  25.288  1.00 9.92  ? 124  TYR A CB  1 
ATOM   957  C  CG  . TYR A 1 124 ? 4.182   14.424  25.487  1.00 8.92  ? 124  TYR A CG  1 
ATOM   958  C  CD1 . TYR A 1 124 ? 3.313   14.540  24.405  1.00 9.78  ? 124  TYR A CD1 1 
ATOM   959  C  CD2 . TYR A 1 124 ? 3.614   14.160  26.723  1.00 9.76  ? 124  TYR A CD2 1 
ATOM   960  C  CE1 . TYR A 1 124 ? 1.950   14.386  24.536  1.00 9.77  ? 124  TYR A CE1 1 
ATOM   961  C  CE2 . TYR A 1 124 ? 2.254   13.983  26.866  1.00 9.28  ? 124  TYR A CE2 1 
ATOM   962  C  CZ  . TYR A 1 124 ? 1.412   14.101  25.773  1.00 10.14 ? 124  TYR A CZ  1 
ATOM   963  O  OH  . TYR A 1 124 ? 0.062   13.919  25.955  1.00 10.28 ? 124  TYR A OH  1 
ATOM   964  N  N   . THR A 1 125 ? 5.487   11.700  27.004  1.00 9.19  ? 125  THR A N   1 
ATOM   965  C  CA  . THR A 1 125 ? 4.815   10.417  27.138  1.00 9.77  ? 125  THR A CA  1 
ATOM   966  C  C   . THR A 1 125 ? 3.472   10.615  27.823  1.00 10.05 ? 125  THR A C   1 
ATOM   967  O  O   . THR A 1 125 ? 3.392   11.387  28.779  1.00 10.32 ? 125  THR A O   1 
ATOM   968  C  CB  . THR A 1 125 ? 5.657   9.474   28.032  1.00 9.75  ? 125  THR A CB  1 
ATOM   969  O  OG1 . THR A 1 125 ? 6.922   9.352   27.374  1.00 11.68 ? 125  THR A OG1 1 
ATOM   970  C  CG2 . THR A 1 125 ? 4.950   8.143   28.214  1.00 10.74 ? 125  THR A CG2 1 
ATOM   971  N  N   . ASP A 1 126 ? 2.451   9.953   27.293  1.00 9.51  ? 126  ASP A N   1 
ATOM   972  C  CA  . ASP A 1 126 ? 1.148   10.061  27.957  1.00 10.22 ? 126  ASP A CA  1 
ATOM   973  C  C   . ASP A 1 126 ? 0.745   8.722   28.536  1.00 9.95  ? 126  ASP A C   1 
ATOM   974  O  O   . ASP A 1 126 ? 0.598   7.749   27.793  1.00 10.04 ? 126  ASP A O   1 
ATOM   975  C  CB  . ASP A 1 126 ? 0.193   10.556  26.861  1.00 11.89 ? 126  ASP A CB  1 
ATOM   976  C  CG  . ASP A 1 126 ? -1.009  11.143  27.570  1.00 14.19 ? 126  ASP A CG  1 
ATOM   977  O  OD1 . ASP A 1 126 ? -0.929  11.969  28.477  1.00 16.21 ? 126  ASP A OD1 1 
ATOM   978  O  OD2 . ASP A 1 126 ? -2.043  10.630  27.173  1.00 16.42 ? 126  ASP A OD2 1 
ATOM   979  N  N   . PHE A 1 127 ? 0.579   8.649   29.857  1.00 9.60  ? 127  PHE A N   1 
ATOM   980  C  CA  . PHE A 1 127 ? 0.157   7.397   30.478  1.00 9.48  ? 127  PHE A CA  1 
ATOM   981  C  C   . PHE A 1 127 ? -1.363  7.329   30.460  1.00 9.63  ? 127  PHE A C   1 
ATOM   982  O  O   . PHE A 1 127 ? -2.047  8.153   29.835  1.00 9.53  ? 127  PHE A O   1 
ATOM   983  C  CB  . PHE A 1 127 ? 0.775   7.303   31.881  1.00 8.77  ? 127  PHE A CB  1 
ATOM   984  C  CG  . PHE A 1 127 ? 2.244   6.966   31.848  1.00 8.76  ? 127  PHE A CG  1 
ATOM   985  C  CD1 . PHE A 1 127 ? 3.229   7.945   31.908  1.00 9.34  ? 127  PHE A CD1 1 
ATOM   986  C  CD2 . PHE A 1 127 ? 2.640   5.644   31.737  1.00 9.22  ? 127  PHE A CD2 1 
ATOM   987  C  CE1 . PHE A 1 127 ? 4.568   7.602   31.857  1.00 8.91  ? 127  PHE A CE1 1 
ATOM   988  C  CE2 . PHE A 1 127 ? 3.975   5.296   31.694  1.00 9.01  ? 127  PHE A CE2 1 
ATOM   989  C  CZ  . PHE A 1 127 ? 4.952   6.279   31.754  1.00 9.46  ? 127  PHE A CZ  1 
ATOM   990  N  N   . TYR A 1 128 ? -1.929  6.348   31.145  1.00 9.63  ? 128  TYR A N   1 
ATOM   991  C  CA  . TYR A 1 128 ? -3.357  6.064   31.088  1.00 10.30 ? 128  TYR A CA  1 
ATOM   992  C  C   . TYR A 1 128 ? -3.798  5.551   32.456  1.00 10.62 ? 128  TYR A C   1 
ATOM   993  O  O   . TYR A 1 128 ? -4.512  4.559   32.576  1.00 11.27 ? 128  TYR A O   1 
ATOM   994  C  CB  . TYR A 1 128 ? -3.560  5.014   30.007  1.00 11.50 ? 128  TYR A CB  1 
ATOM   995  C  CG  . TYR A 1 128 ? -4.918  4.839   29.390  1.00 11.70 ? 128  TYR A CG  1 
ATOM   996  C  CD1 . TYR A 1 128 ? -5.667  5.935   28.978  1.00 12.99 ? 128  TYR A CD1 1 
ATOM   997  C  CD2 . TYR A 1 128 ? -5.430  3.571   29.157  1.00 12.57 ? 128  TYR A CD2 1 
ATOM   998  C  CE1 . TYR A 1 128 ? -6.910  5.767   28.389  1.00 13.59 ? 128  TYR A CE1 1 
ATOM   999  C  CE2 . TYR A 1 128 ? -6.670  3.389   28.563  1.00 13.48 ? 128  TYR A CE2 1 
ATOM   1000 C  CZ  . TYR A 1 128 ? -7.399  4.496   28.192  1.00 14.15 ? 128  TYR A CZ  1 
ATOM   1001 O  OH  . TYR A 1 128 ? -8.629  4.331   27.584  1.00 14.86 ? 128  TYR A OH  1 
ATOM   1002 N  N   . SER A 1 129 ? -3.366  6.269   33.499  1.00 10.04 ? 129  SER A N   1 
ATOM   1003 C  CA  . SER A 1 129 ? -3.288  5.631   34.822  1.00 10.71 ? 129  SER A CA  1 
ATOM   1004 C  C   . SER A 1 129 ? -4.472  5.918   35.722  1.00 11.05 ? 129  SER A C   1 
ATOM   1005 O  O   . SER A 1 129 ? -4.494  5.443   36.869  1.00 10.86 ? 129  SER A O   1 
ATOM   1006 C  CB  . SER A 1 129 ? -1.977  6.058   35.490  1.00 10.61 ? 129  SER A CB  1 
ATOM   1007 O  OG  . SER A 1 129 ? -0.837  5.601   34.790  1.00 10.48 ? 129  SER A OG  1 
ATOM   1008 N  N   . SER A 1 130 ? -5.474  6.645   35.229  1.00 10.39 ? 130  SER A N   1 
ATOM   1009 C  CA  . SER A 1 130 ? -6.690  6.864   36.023  1.00 11.54 ? 130  SER A CA  1 
ATOM   1010 C  C   . SER A 1 130 ? -7.678  5.737   35.769  1.00 11.76 ? 130  SER A C   1 
ATOM   1011 O  O   . SER A 1 130 ? -8.181  5.555   34.656  1.00 12.40 ? 130  SER A O   1 
ATOM   1012 C  CB  . SER A 1 130 ? -7.268  8.239   35.677  1.00 12.83 ? 130  SER A CB  1 
ATOM   1013 O  OG  . SER A 1 130 ? -8.396  8.525   36.485  1.00 15.47 ? 130  SER A OG  1 
ATOM   1014 N  N   . ARG A 1 131 ? -7.955  4.923   36.799  1.00 11.99 ? 131  ARG A N   1 
ATOM   1015 C  CA  . ARG A 1 131 ? -8.748  3.711   36.600  1.00 12.02 ? 131  ARG A CA  1 
ATOM   1016 C  C   . ARG A 1 131 ? -10.148 4.009   36.095  1.00 12.16 ? 131  ARG A C   1 
ATOM   1017 O  O   . ARG A 1 131 ? -10.637 3.316   35.191  1.00 12.41 ? 131  ARG A O   1 
ATOM   1018 C  CB  . ARG A 1 131 ? -8.831  2.889   37.898  1.00 12.65 ? 131  ARG A CB  1 
ATOM   1019 C  CG  . ARG A 1 131 ? -9.512  1.535   37.680  1.00 12.66 ? 131  ARG A CG  1 
ATOM   1020 C  CD  . ARG A 1 131 ? -9.466  0.730   38.988  1.00 13.97 ? 131  ARG A CD  1 
ATOM   1021 N  NE  . ARG A 1 131 ? -9.926  -0.638  38.725  1.00 15.52 ? 131  ARG A NE  1 
ATOM   1022 C  CZ  . ARG A 1 131 ? -9.641  -1.691  39.485  1.00 16.21 ? 131  ARG A CZ  1 
ATOM   1023 N  NH1 . ARG A 1 131 ? -8.890  -1.570  40.567  1.00 16.40 ? 131  ARG A NH1 1 
ATOM   1024 N  NH2 . ARG A 1 131 ? -10.114 -2.885  39.134  1.00 17.22 ? 131  ARG A NH2 1 
ATOM   1025 N  N   . GLN A 1 132 ? -10.810 5.039   36.629  1.00 12.58 ? 132  GLN A N   1 
ATOM   1026 C  CA  . GLN A 1 132 ? -12.183 5.296   36.207  1.00 12.09 ? 132  GLN A CA  1 
ATOM   1027 C  C   . GLN A 1 132 ? -12.212 5.807   34.767  1.00 12.43 ? 132  GLN A C   1 
ATOM   1028 O  O   . GLN A 1 132 ? -13.169 5.524   34.049  1.00 12.42 ? 132  GLN A O   1 
ATOM   1029 C  CB  . GLN A 1 132 ? -12.939 6.263   37.121  1.00 12.21 ? 132  GLN A CB  1 
ATOM   1030 C  CG  . GLN A 1 132 ? -14.442 6.294   36.848  1.00 13.62 ? 132  GLN A CG  1 
ATOM   1031 C  CD  . GLN A 1 132 ? -15.098 4.956   37.147  1.00 14.05 ? 132  GLN A CD  1 
ATOM   1032 O  OE1 . GLN A 1 132 ? -14.929 4.418   38.241  1.00 15.54 ? 132  GLN A OE1 1 
ATOM   1033 N  NE2 . GLN A 1 132 ? -15.818 4.409   36.179  1.00 15.21 ? 132  GLN A NE2 1 
ATOM   1034 N  N   . HIS A 1 133 ? -11.165 6.519   34.340  1.00 11.81 ? 133  HIS A N   1 
ATOM   1035 C  CA  . HIS A 1 133 ? -11.132 6.956   32.938  1.00 12.57 ? 133  HIS A CA  1 
ATOM   1036 C  C   . HIS A 1 133 ? -11.008 5.742   32.027  1.00 12.84 ? 133  HIS A C   1 
ATOM   1037 O  O   . HIS A 1 133 ? -11.785 5.606   31.077  1.00 12.15 ? 133  HIS A O   1 
ATOM   1038 C  CB  . HIS A 1 133 ? -9.996  7.950   32.680  1.00 12.59 ? 133  HIS A CB  1 
ATOM   1039 C  CG  . HIS A 1 133 ? -9.821  8.230   31.215  1.00 12.50 ? 133  HIS A CG  1 
ATOM   1040 N  ND1 . HIS A 1 133 ? -10.704 9.035   30.521  1.00 12.39 ? 133  HIS A ND1 1 
ATOM   1041 C  CD2 . HIS A 1 133 ? -8.908  7.807   30.316  1.00 12.89 ? 133  HIS A CD2 1 
ATOM   1042 C  CE1 . HIS A 1 133 ? -10.332 9.094   29.254  1.00 12.93 ? 133  HIS A CE1 1 
ATOM   1043 N  NE2 . HIS A 1 133 ? -9.241  8.364   29.096  1.00 13.24 ? 133  HIS A NE2 1 
ATOM   1044 N  N   . ALA A 1 134 ? -10.038 4.869   32.300  1.00 12.85 ? 134  ALA A N   1 
ATOM   1045 C  CA  . ALA A 1 134 ? -9.846  3.692   31.456  1.00 13.30 ? 134  ALA A CA  1 
ATOM   1046 C  C   . ALA A 1 134 ? -11.066 2.777   31.476  1.00 13.76 ? 134  ALA A C   1 
ATOM   1047 O  O   . ALA A 1 134 ? -11.423 2.172   30.469  1.00 14.13 ? 134  ALA A O   1 
ATOM   1048 C  CB  . ALA A 1 134 ? -8.620  2.905   31.899  1.00 13.54 ? 134  ALA A CB  1 
ATOM   1049 N  N   . THR A 1 135 ? -11.691 2.655   32.640  1.00 13.65 ? 135  THR A N   1 
ATOM   1050 C  CA  . THR A 1 135 ? -12.926 1.895   32.783  1.00 13.54 ? 135  THR A CA  1 
ATOM   1051 C  C   . THR A 1 135 ? -14.068 2.473   31.966  1.00 14.29 ? 135  THR A C   1 
ATOM   1052 O  O   . THR A 1 135 ? -14.781 1.730   31.285  1.00 14.63 ? 135  THR A O   1 
ATOM   1053 C  CB  . THR A 1 135 ? -13.317 1.820   34.275  1.00 14.30 ? 135  THR A CB  1 
ATOM   1054 O  OG1 . THR A 1 135 ? -12.237 1.179   34.977  1.00 14.61 ? 135  THR A OG1 1 
ATOM   1055 C  CG2 . THR A 1 135 ? -14.593 1.022   34.457  1.00 15.35 ? 135  THR A CG2 1 
ATOM   1056 N  N   . ASN A 1 136 ? -14.251 3.789   32.015  1.00 14.56 ? 136  ASN A N   1 
ATOM   1057 C  CA  . ASN A 1 136 ? -15.325 4.439   31.275  1.00 14.20 ? 136  ASN A CA  1 
ATOM   1058 C  C   . ASN A 1 136 ? -15.150 4.250   29.773  1.00 14.42 ? 136  ASN A C   1 
ATOM   1059 O  O   . ASN A 1 136 ? -16.103 3.929   29.063  1.00 13.89 ? 136  ASN A O   1 
ATOM   1060 C  CB  . ASN A 1 136 ? -15.358 5.937   31.585  1.00 13.77 ? 136  ASN A CB  1 
ATOM   1061 C  CG  . ASN A 1 136 ? -15.993 6.270   32.915  1.00 13.90 ? 136  ASN A CG  1 
ATOM   1062 O  OD1 . ASN A 1 136 ? -16.685 5.447   33.528  1.00 14.50 ? 136  ASN A OD1 1 
ATOM   1063 N  ND2 . ASN A 1 136 ? -15.774 7.500   33.369  1.00 12.66 ? 136  ASN A ND2 1 
ATOM   1064 N  N   . VAL A 1 137 ? -13.924 4.475   29.292  1.00 13.95 ? 137  VAL A N   1 
ATOM   1065 C  CA  . VAL A 1 137 ? -13.647 4.243   27.872  1.00 14.68 ? 137  VAL A CA  1 
ATOM   1066 C  C   . VAL A 1 137 ? -13.924 2.795   27.494  1.00 15.26 ? 137  VAL A C   1 
ATOM   1067 O  O   . VAL A 1 137 ? -14.556 2.504   26.476  1.00 15.23 ? 137  VAL A O   1 
ATOM   1068 C  CB  . VAL A 1 137 ? -12.191 4.634   27.552  1.00 14.52 ? 137  VAL A CB  1 
ATOM   1069 C  CG1 . VAL A 1 137 ? -11.790 4.196   26.152  1.00 14.98 ? 137  VAL A CG1 1 
ATOM   1070 C  CG2 . VAL A 1 137 ? -12.017 6.138   27.717  1.00 14.50 ? 137  VAL A CG2 1 
ATOM   1071 N  N   . GLY A 1 138 ? -13.479 1.858   28.332  1.00 15.02 ? 138  GLY A N   1 
ATOM   1072 C  CA  . GLY A 1 138 ? -13.710 0.438   28.123  1.00 16.12 ? 138  GLY A CA  1 
ATOM   1073 C  C   . GLY A 1 138 ? -15.201 0.130   28.041  1.00 16.32 ? 138  GLY A C   1 
ATOM   1074 O  O   . GLY A 1 138 ? -15.627 -0.566  27.116  1.00 17.11 ? 138  GLY A O   1 
ATOM   1075 N  N   . ILE A 1 139 ? -15.999 0.658   28.969  1.00 16.36 ? 139  ILE A N   1 
ATOM   1076 C  CA  . ILE A 1 139 ? -17.445 0.443   28.904  1.00 16.75 ? 139  ILE A CA  1 
ATOM   1077 C  C   . ILE A 1 139 ? -18.014 0.980   27.595  1.00 17.42 ? 139  ILE A C   1 
ATOM   1078 O  O   . ILE A 1 139 ? -18.823 0.321   26.938  1.00 18.02 ? 139  ILE A O   1 
ATOM   1079 C  CB  . ILE A 1 139 ? -18.199 1.096   30.072  1.00 16.53 ? 139  ILE A CB  1 
ATOM   1080 C  CG1 . ILE A 1 139 ? -17.761 0.510   31.414  1.00 16.43 ? 139  ILE A CG1 1 
ATOM   1081 C  CG2 . ILE A 1 139 ? -19.709 0.924   29.887  1.00 16.96 ? 139  ILE A CG2 1 
ATOM   1082 C  CD1 . ILE A 1 139 ? -18.046 1.427   32.591  1.00 17.43 ? 139  ILE A CD1 1 
ATOM   1083 N  N   . MET A 1 140 ? -17.623 2.197   27.219  1.00 18.38 ? 140  MET A N   1 
ATOM   1084 C  CA  . MET A 1 140 ? -18.203 2.848   26.048  1.00 19.55 ? 140  MET A CA  1 
ATOM   1085 C  C   . MET A 1 140 ? -17.867 2.128   24.758  1.00 21.30 ? 140  MET A C   1 
ATOM   1086 O  O   . MET A 1 140 ? -18.702 2.122   23.836  1.00 23.41 ? 140  MET A O   1 
ATOM   1087 C  CB  . MET A 1 140 ? -17.791 4.326   25.990  1.00 18.99 ? 140  MET A CB  1 
ATOM   1088 C  CG  . MET A 1 140 ? -18.640 5.221   26.880  1.00 18.92 ? 140  MET A CG  1 
ATOM   1089 S  SD  . MET A 1 140 ? -18.188 6.971   26.807  1.00 18.44 ? 140  MET A SD  1 
ATOM   1090 C  CE  . MET A 1 140 ? -16.866 7.033   28.010  1.00 18.57 ? 140  MET A CE  1 
ATOM   1091 N  N   . PHE A 1 141 ? -16.686 1.528   24.651  1.00 22.16 ? 141  PHE A N   1 
ATOM   1092 C  CA  . PHE A 1 141 ? -16.254 0.970   23.377  1.00 23.54 ? 141  PHE A CA  1 
ATOM   1093 C  C   . PHE A 1 141 ? -16.206 -0.549  23.364  1.00 23.11 ? 141  PHE A C   1 
ATOM   1094 O  O   . PHE A 1 141 ? -16.228 -1.121  22.265  1.00 24.14 ? 141  PHE A O   1 
ATOM   1095 C  CB  . PHE A 1 141 ? -14.906 1.559   22.954  1.00 24.89 ? 141  PHE A CB  1 
ATOM   1096 C  CG  . PHE A 1 141 ? -15.018 3.017   22.583  1.00 26.19 ? 141  PHE A CG  1 
ATOM   1097 C  CD1 . PHE A 1 141 ? -14.765 4.004   23.518  1.00 26.59 ? 141  PHE A CD1 1 
ATOM   1098 C  CD2 . PHE A 1 141 ? -15.391 3.390   21.305  1.00 26.90 ? 141  PHE A CD2 1 
ATOM   1099 C  CE1 . PHE A 1 141 ? -14.875 5.340   23.180  1.00 27.06 ? 141  PHE A CE1 1 
ATOM   1100 C  CE2 . PHE A 1 141 ? -15.500 4.725   20.960  1.00 27.54 ? 141  PHE A CE2 1 
ATOM   1101 C  CZ  . PHE A 1 141 ? -15.245 5.704   21.903  1.00 27.28 ? 141  PHE A CZ  1 
ATOM   1102 N  N   . ARG A 1 142 ? -16.136 -1.198  24.523  1.00 22.64 ? 142  ARG A N   1 
ATOM   1103 C  CA  . ARG A 1 142 ? -16.065 -2.654  24.555  1.00 22.14 ? 142  ARG A CA  1 
ATOM   1104 C  C   . ARG A 1 142 ? -17.188 -3.294  25.366  1.00 22.40 ? 142  ARG A C   1 
ATOM   1105 O  O   . ARG A 1 142 ? -17.429 -4.498  25.240  1.00 21.51 ? 142  ARG A O   1 
ATOM   1106 C  CB  . ARG A 1 142 ? -14.723 -3.147  25.102  1.00 22.94 ? 142  ARG A CB  1 
ATOM   1107 C  CG  . ARG A 1 142 ? -13.537 -2.881  24.191  1.00 22.64 ? 142  ARG A CG  1 
ATOM   1108 C  CD  . ARG A 1 142 ? -12.270 -3.555  24.700  1.00 22.98 ? 142  ARG A CD  1 
ATOM   1109 N  NE  . ARG A 1 142 ? -11.948 -3.136  26.058  1.00 22.21 ? 142  ARG A NE  1 
ATOM   1110 C  CZ  . ARG A 1 142 ? -11.341 -1.994  26.369  1.00 22.69 ? 142  ARG A CZ  1 
ATOM   1111 N  NH1 . ARG A 1 142 ? -10.969 -1.138  25.427  1.00 22.14 ? 142  ARG A NH1 1 
ATOM   1112 N  NH2 . ARG A 1 142 ? -11.094 -1.714  27.643  1.00 22.32 ? 142  ARG A NH2 1 
ATOM   1113 N  N   . GLY A 1 143 ? -17.859 -2.511  26.201  1.00 21.79 ? 143  GLY A N   1 
ATOM   1114 C  CA  . GLY A 1 143 ? -18.932 -3.029  27.042  1.00 21.75 ? 143  GLY A CA  1 
ATOM   1115 C  C   . GLY A 1 143 ? -18.420 -3.266  28.458  1.00 22.10 ? 143  GLY A C   1 
ATOM   1116 O  O   . GLY A 1 143 ? -17.212 -3.408  28.665  1.00 21.97 ? 143  GLY A O   1 
ATOM   1117 N  N   . LYS A 1 144 ? -19.324 -3.368  29.422  1.00 23.07 ? 144  LYS A N   1 
ATOM   1118 C  CA  . LYS A 1 144 ? -18.965 -3.463  30.829  1.00 24.52 ? 144  LYS A CA  1 
ATOM   1119 C  C   . LYS A 1 144 ? -18.177 -4.709  31.197  1.00 24.49 ? 144  LYS A C   1 
ATOM   1120 O  O   . LYS A 1 144 ? -17.356 -4.672  32.116  1.00 24.79 ? 144  LYS A O   1 
ATOM   1121 C  CB  . LYS A 1 144 ? -20.227 -3.385  31.703  1.00 26.60 ? 144  LYS A CB  1 
ATOM   1122 C  CG  . LYS A 1 144 ? -20.803 -1.983  31.783  1.00 29.29 ? 144  LYS A CG  1 
ATOM   1123 C  CD  . LYS A 1 144 ? -22.049 -1.915  32.655  1.00 31.06 ? 144  LYS A CD  1 
ATOM   1124 C  CE  . LYS A 1 144 ? -22.465 -0.466  32.873  1.00 31.75 ? 144  LYS A CE  1 
ATOM   1125 N  NZ  . LYS A 1 144 ? -23.732 -0.382  33.659  1.00 33.26 ? 144  LYS A NZ  1 
ATOM   1126 N  N   . GLU A 1 145 ? -18.349 -5.811  30.477  1.00 23.97 ? 145  GLU A N   1 
ATOM   1127 C  CA  . GLU A 1 145 ? -17.643 -7.051  30.750  1.00 23.90 ? 145  GLU A CA  1 
ATOM   1128 C  C   . GLU A 1 145 ? -16.186 -7.018  30.320  1.00 22.72 ? 145  GLU A C   1 
ATOM   1129 O  O   . GLU A 1 145 ? -15.401 -7.886  30.705  1.00 22.55 ? 145  GLU A O   1 
ATOM   1130 C  CB  . GLU A 1 145 ? -18.319 -8.237  30.050  1.00 25.49 ? 145  GLU A CB  1 
ATOM   1131 C  CG  . GLU A 1 145 ? -19.761 -8.468  30.456  1.00 28.27 ? 145  GLU A CG  1 
ATOM   1132 C  CD  . GLU A 1 145 ? -20.765 -7.801  29.541  1.00 30.15 ? 145  GLU A CD  1 
ATOM   1133 O  OE1 . GLU A 1 145 ? -20.483 -6.726  28.965  1.00 31.18 ? 145  GLU A OE1 1 
ATOM   1134 O  OE2 . GLU A 1 145 ? -21.864 -8.379  29.385  1.00 31.94 ? 145  GLU A OE2 1 
ATOM   1135 N  N   . ASN A 1 146 ? -15.816 -6.079  29.460  1.00 21.24 ? 146  ASN A N   1 
ATOM   1136 C  CA  . ASN A 1 146 ? -14.449 -5.951  28.975  1.00 20.75 ? 146  ASN A CA  1 
ATOM   1137 C  C   . ASN A 1 146 ? -13.940 -4.538  29.247  1.00 19.84 ? 146  ASN A C   1 
ATOM   1138 O  O   . ASN A 1 146 ? -13.171 -3.983  28.467  1.00 19.72 ? 146  ASN A O   1 
ATOM   1139 C  CB  . ASN A 1 146 ? -14.411 -6.285  27.478  1.00 21.59 ? 146  ASN A CB  1 
ATOM   1140 C  CG  . ASN A 1 146 ? -14.727 -7.746  27.196  1.00 21.87 ? 146  ASN A CG  1 
ATOM   1141 O  OD1 . ASN A 1 146 ? -13.865 -8.609  27.347  1.00 22.78 ? 146  ASN A OD1 1 
ATOM   1142 N  ND2 . ASN A 1 146 ? -15.960 -8.045  26.810  1.00 22.31 ? 146  ASN A ND2 1 
ATOM   1143 N  N   . ALA A 1 147 ? -14.354 -3.967  30.378  1.00 19.95 ? 147  ALA A N   1 
ATOM   1144 C  CA  . ALA A 1 147 ? -14.059 -2.579  30.709  1.00 19.93 ? 147  ALA A CA  1 
ATOM   1145 C  C   . ALA A 1 147 ? -12.567 -2.271  30.745  1.00 19.97 ? 147  ALA A C   1 
ATOM   1146 O  O   . ALA A 1 147 ? -12.143 -1.217  30.257  1.00 21.08 ? 147  ALA A O   1 
ATOM   1147 C  CB  . ALA A 1 147 ? -14.678 -2.212  32.053  1.00 20.46 ? 147  ALA A CB  1 
ATOM   1148 N  N   . LEU A 1 148 ? -11.771 -3.130  31.367  1.00 18.12 ? 148  LEU A N   1 
ATOM   1149 C  CA  . LEU A 1 148 ? -10.320 -2.974  31.305  1.00 17.46 ? 148  LEU A CA  1 
ATOM   1150 C  C   . LEU A 1 148 ? -9.703  -4.084  30.467  1.00 17.03 ? 148  LEU A C   1 
ATOM   1151 O  O   . LEU A 1 148 ? -10.120 -5.242  30.555  1.00 17.13 ? 148  LEU A O   1 
ATOM   1152 C  CB  . LEU A 1 148 ? -9.719  -2.996  32.711  1.00 17.33 ? 148  LEU A CB  1 
ATOM   1153 C  CG  . LEU A 1 148 ? -10.039 -1.824  33.639  1.00 17.60 ? 148  LEU A CG  1 
ATOM   1154 C  CD1 . LEU A 1 148 ? -9.400  -2.060  35.002  1.00 17.82 ? 148  LEU A CD1 1 
ATOM   1155 C  CD2 . LEU A 1 148 ? -9.592  -0.490  33.062  1.00 16.86 ? 148  LEU A CD2 1 
ATOM   1156 N  N   . LEU A 1 149 ? -8.711  -3.724  29.663  1.00 16.03 ? 149  LEU A N   1 
ATOM   1157 C  CA  . LEU A 1 149 ? -7.923  -4.756  28.974  1.00 16.80 ? 149  LEU A CA  1 
ATOM   1158 C  C   . LEU A 1 149 ? -7.032  -5.476  29.963  1.00 16.24 ? 149  LEU A C   1 
ATOM   1159 O  O   . LEU A 1 149 ? -6.743  -4.983  31.054  1.00 15.20 ? 149  LEU A O   1 
ATOM   1160 C  CB  . LEU A 1 149 ? -7.155  -4.083  27.841  1.00 17.54 ? 149  LEU A CB  1 
ATOM   1161 C  CG  . LEU A 1 149 ? -8.105  -3.492  26.775  1.00 17.82 ? 149  LEU A CG  1 
ATOM   1162 C  CD1 . LEU A 1 149 ? -7.358  -2.522  25.883  1.00 19.31 ? 149  LEU A CD1 1 
ATOM   1163 C  CD2 . LEU A 1 149 ? -8.746  -4.607  25.966  1.00 19.03 ? 149  LEU A CD2 1 
ATOM   1164 N  N   . PRO A 1 150 ? -6.551  -6.668  29.603  1.00 16.10 ? 150  PRO A N   1 
ATOM   1165 C  CA  . PRO A 1 150 ? -5.873  -7.542  30.538  1.00 16.09 ? 150  PRO A CA  1 
ATOM   1166 C  C   . PRO A 1 150 ? -4.608  -6.971  31.141  1.00 15.33 ? 150  PRO A C   1 
ATOM   1167 O  O   . PRO A 1 150 ? -4.270  -7.348  32.269  1.00 16.59 ? 150  PRO A O   1 
ATOM   1168 C  CB  . PRO A 1 150 ? -5.555  -8.801  29.739  1.00 16.92 ? 150  PRO A CB  1 
ATOM   1169 C  CG  . PRO A 1 150 ? -6.525  -8.802  28.618  1.00 17.35 ? 150  PRO A CG  1 
ATOM   1170 C  CD  . PRO A 1 150 ? -6.927  -7.381  28.353  1.00 16.53 ? 150  PRO A CD  1 
ATOM   1171 N  N   . ASN A 1 151 ? -3.917  -6.065  30.451  1.00 14.32 ? 151  ASN A N   1 
ATOM   1172 C  CA  . ASN A 1 151 ? -2.648  -5.563  30.963  1.00 13.60 ? 151  ASN A CA  1 
ATOM   1173 C  C   . ASN A 1 151 ? -2.812  -4.384  31.917  1.00 12.99 ? 151  ASN A C   1 
ATOM   1174 O  O   . ASN A 1 151 ? -1.827  -4.024  32.565  1.00 12.02 ? 151  ASN A O   1 
ATOM   1175 C  CB  . ASN A 1 151 ? -1.708  -5.197  29.805  1.00 13.51 ? 151  ASN A CB  1 
ATOM   1176 C  CG  . ASN A 1 151 ? -2.261  -4.142  28.879  1.00 14.38 ? 151  ASN A CG  1 
ATOM   1177 O  OD1 . ASN A 1 151 ? -3.267  -3.492  29.155  1.00 14.75 ? 151  ASN A OD1 1 
ATOM   1178 N  ND2 . ASN A 1 151 ? -1.603  -3.958  27.731  1.00 14.43 ? 151  ASN A ND2 1 
ATOM   1179 N  N   . TRP A 1 152 ? -4.002  -3.801  32.044  1.00 12.35 ? 152  TRP A N   1 
ATOM   1180 C  CA  . TRP A 1 152 ? -4.119  -2.474  32.652  1.00 11.59 ? 152  TRP A CA  1 
ATOM   1181 C  C   . TRP A 1 152 ? -3.762  -2.487  34.135  1.00 11.95 ? 152  TRP A C   1 
ATOM   1182 O  O   . TRP A 1 152 ? -3.086  -1.583  34.625  1.00 11.99 ? 152  TRP A O   1 
ATOM   1183 C  CB  . TRP A 1 152 ? -5.504  -1.845  32.445  1.00 11.09 ? 152  TRP A CB  1 
ATOM   1184 C  CG  . TRP A 1 152 ? -5.514  -0.366  32.723  1.00 10.74 ? 152  TRP A CG  1 
ATOM   1185 C  CD1 . TRP A 1 152 ? -5.361  0.653   31.822  1.00 10.86 ? 152  TRP A CD1 1 
ATOM   1186 C  CD2 . TRP A 1 152 ? -5.661  0.251   34.008  1.00 10.83 ? 152  TRP A CD2 1 
ATOM   1187 N  NE1 . TRP A 1 152 ? -5.400  1.866   32.480  1.00 10.41 ? 152  TRP A NE1 1 
ATOM   1188 C  CE2 . TRP A 1 152 ? -5.593  1.641   33.817  1.00 10.27 ? 152  TRP A CE2 1 
ATOM   1189 C  CE3 . TRP A 1 152 ? -5.856  -0.247  35.304  1.00 11.38 ? 152  TRP A CE3 1 
ATOM   1190 C  CZ2 . TRP A 1 152 ? -5.703  2.548   34.867  1.00 11.00 ? 152  TRP A CZ2 1 
ATOM   1191 C  CZ3 . TRP A 1 152 ? -5.959  0.651   36.350  1.00 11.31 ? 152  TRP A CZ3 1 
ATOM   1192 C  CH2 . TRP A 1 152 ? -5.882  2.033   36.130  1.00 10.67 ? 152  TRP A CH2 1 
ATOM   1193 N  N   . LEU A 1 153 ? -4.165  -3.531  34.857  1.00 12.49 ? 153  LEU A N   1 
ATOM   1194 C  CA  . LEU A 1 153 ? -3.865  -3.641  36.277  1.00 12.60 ? 153  LEU A CA  1 
ATOM   1195 C  C   . LEU A 1 153 ? -2.478  -4.193  36.565  1.00 12.67 ? 153  LEU A C   1 
ATOM   1196 O  O   . LEU A 1 153 ? -2.084  -4.302  37.736  1.00 12.58 ? 153  LEU A O   1 
ATOM   1197 C  CB  . LEU A 1 153 ? -4.931  -4.536  36.934  1.00 13.69 ? 153  LEU A CB  1 
ATOM   1198 C  CG  . LEU A 1 153 ? -6.332  -3.919  36.982  1.00 14.23 ? 153  LEU A CG  1 
ATOM   1199 C  CD1 . LEU A 1 153 ? -7.387  -4.968  37.315  1.00 15.19 ? 153  LEU A CD1 1 
ATOM   1200 C  CD2 . LEU A 1 153 ? -6.389  -2.771  37.979  1.00 15.41 ? 153  LEU A CD2 1 
ATOM   1201 N  N   . HIS A 1 154 ? -1.691  -4.501  35.546  1.00 12.62 ? 154  HIS A N   1 
ATOM   1202 C  CA  . HIS A 1 154 ? -0.357  -5.053  35.686  1.00 13.08 ? 154  HIS A CA  1 
ATOM   1203 C  C   . HIS A 1 154 ? 0.790   -4.119  35.348  1.00 12.85 ? 154  HIS A C   1 
ATOM   1204 O  O   . HIS A 1 154 ? 1.910   -4.302  35.831  1.00 12.45 ? 154  HIS A O   1 
ATOM   1205 C  CB  . HIS A 1 154 ? -0.234  -6.315  34.799  1.00 14.23 ? 154  HIS A CB  1 
ATOM   1206 C  CG  . HIS A 1 154 ? -1.077  -7.438  35.327  1.00 15.42 ? 154  HIS A CG  1 
ATOM   1207 N  ND1 . HIS A 1 154 ? -2.235  -7.875  34.742  1.00 17.16 ? 154  HIS A ND1 1 
ATOM   1208 C  CD2 . HIS A 1 154 ? -0.896  -8.203  36.436  1.00 15.27 ? 154  HIS A CD2 1 
ATOM   1209 C  CE1 . HIS A 1 154 ? -2.739  -8.878  35.446  1.00 16.08 ? 154  HIS A CE1 1 
ATOM   1210 N  NE2 . HIS A 1 154 ? -1.950  -9.084  36.482  1.00 17.00 ? 154  HIS A NE2 1 
ATOM   1211 N  N   . LEU A 1 155 ? 0.558   -3.092  34.525  1.00 12.35 ? 155  LEU A N   1 
ATOM   1212 C  CA  . LEU A 1 155 ? 1.619   -2.120  34.240  1.00 12.52 ? 155  LEU A CA  1 
ATOM   1213 C  C   . LEU A 1 155 ? 0.970   -0.782  33.904  1.00 11.57 ? 155  LEU A C   1 
ATOM   1214 O  O   . LEU A 1 155 ? -0.188  -0.774  33.503  1.00 11.67 ? 155  LEU A O   1 
ATOM   1215 C  CB  . LEU A 1 155 ? 2.501   -2.589  33.081  1.00 13.90 ? 155  LEU A CB  1 
ATOM   1216 C  CG  . LEU A 1 155 ? 1.806   -3.129  31.832  1.00 15.74 ? 155  LEU A CG  1 
ATOM   1217 C  CD1 . LEU A 1 155 ? 1.551   -2.018  30.822  1.00 17.42 ? 155  LEU A CD1 1 
ATOM   1218 C  CD2 . LEU A 1 155 ? 2.649   -4.210  31.171  1.00 17.90 ? 155  LEU A CD2 1 
ATOM   1219 N  N   . PRO A 1 156 ? 1.692   0.310   34.114  1.00 11.34 ? 156  PRO A N   1 
ATOM   1220 C  CA  . PRO A 1 156 ? 1.196   1.618   33.708  1.00 11.25 ? 156  PRO A CA  1 
ATOM   1221 C  C   . PRO A 1 156 ? 1.328   1.800   32.201  1.00 11.18 ? 156  PRO A C   1 
ATOM   1222 O  O   . PRO A 1 156 ? 2.337   2.259   31.682  1.00 11.81 ? 156  PRO A O   1 
ATOM   1223 C  CB  . PRO A 1 156 ? 2.038   2.586   34.525  1.00 11.40 ? 156  PRO A CB  1 
ATOM   1224 C  CG  . PRO A 1 156 ? 3.322   1.855   34.761  1.00 12.12 ? 156  PRO A CG  1 
ATOM   1225 C  CD  . PRO A 1 156 ? 2.953   0.396   34.881  1.00 11.52 ? 156  PRO A CD  1 
ATOM   1226 N  N   . VAL A 1 157 ? 0.267   1.412   31.496  1.00 11.72 ? 157  VAL A N   1 
ATOM   1227 C  CA  . VAL A 1 157 ? 0.167   1.576   30.052  1.00 12.72 ? 157  VAL A CA  1 
ATOM   1228 C  C   . VAL A 1 157 ? 0.383   3.034   29.666  1.00 11.54 ? 157  VAL A C   1 
ATOM   1229 O  O   . VAL A 1 157 ? -0.072  3.940   30.362  1.00 10.87 ? 157  VAL A O   1 
ATOM   1230 C  CB  . VAL A 1 157 ? -1.219  1.079   29.592  1.00 15.02 ? 157  VAL A CB  1 
ATOM   1231 C  CG1 . VAL A 1 157 ? -1.635  1.563   28.221  1.00 17.82 ? 157  VAL A CG1 1 
ATOM   1232 C  CG2 . VAL A 1 157 ? -1.220  -0.457  29.616  1.00 16.46 ? 157  VAL A CG2 1 
ATOM   1233 N  N   . GLY A 1 158 ? 1.067   3.257   28.546  1.00 10.74 ? 158  GLY A N   1 
ATOM   1234 C  CA  . GLY A 1 158 ? 1.278   4.634   28.079  1.00 11.18 ? 158  GLY A CA  1 
ATOM   1235 C  C   . GLY A 1 158 ? 1.741   4.590   26.621  1.00 11.29 ? 158  GLY A C   1 
ATOM   1236 O  O   . GLY A 1 158 ? 1.986   3.495   26.111  1.00 11.00 ? 158  GLY A O   1 
ATOM   1237 N  N   . TYR A 1 159 ? 1.809   5.749   25.987  1.00 10.83 ? 159  TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 159 ? 2.317   5.798   24.611  1.00 10.87 ? 159  TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 159 ? 3.234   7.002   24.462  1.00 10.14 ? 159  TYR A C   1 
ATOM   1240 O  O   . TYR A 1 159 ? 3.165   7.946   25.267  1.00 9.58  ? 159  TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 159 ? 1.175   5.782   23.582  1.00 11.23 ? 159  TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 159 ? 0.304   7.018   23.649  1.00 12.61 ? 159  TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 159 ? 0.490   8.087   22.789  1.00 13.56 ? 159  TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 159 ? -0.710  7.121   24.594  1.00 12.88 ? 159  TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 159 ? -0.283  9.231   22.867  1.00 14.05 ? 159  TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 159 ? -1.509  8.249   24.663  1.00 13.74 ? 159  TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 159 ? -1.289  9.303   23.801  1.00 14.12 ? 159  TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 159 ? -2.082  10.429  23.887  1.00 14.65 ? 159  TYR A OH  1 
ATOM   1249 N  N   . HIS A 1 160 ? 4.114   6.962   23.461  1.00 9.49  ? 160  HIS A N   1 
ATOM   1250 C  CA  . HIS A 1 160 ? 4.888   8.146   23.106  1.00 9.64  ? 160  HIS A CA  1 
ATOM   1251 C  C   . HIS A 1 160 ? 3.979   9.196   22.473  1.00 9.65  ? 160  HIS A C   1 
ATOM   1252 O  O   . HIS A 1 160 ? 3.238   8.898   21.538  1.00 10.22 ? 160  HIS A O   1 
ATOM   1253 C  CB  . HIS A 1 160 ? 6.013   7.816   22.122  1.00 10.01 ? 160  HIS A CB  1 
ATOM   1254 C  CG  . HIS A 1 160 ? 6.854   6.643   22.527  1.00 10.80 ? 160  HIS A CG  1 
ATOM   1255 N  ND1 . HIS A 1 160 ? 6.895   5.499   21.754  1.00 11.59 ? 160  HIS A ND1 1 
ATOM   1256 C  CD2 . HIS A 1 160 ? 7.660   6.427   23.594  1.00 10.94 ? 160  HIS A CD2 1 
ATOM   1257 C  CE1 . HIS A 1 160 ? 7.708   4.622   22.331  1.00 12.24 ? 160  HIS A CE1 1 
ATOM   1258 N  NE2 . HIS A 1 160 ? 8.180   5.166   23.444  1.00 10.91 ? 160  HIS A NE2 1 
ATOM   1259 N  N   . GLY A 1 161 ? 4.099   10.431  22.945  1.00 8.70  ? 161  GLY A N   1 
ATOM   1260 C  CA  . GLY A 1 161 ? 3.309   11.525  22.391  1.00 9.38  ? 161  GLY A CA  1 
ATOM   1261 C  C   . GLY A 1 161 ? 4.142   12.360  21.429  1.00 8.58  ? 161  GLY A C   1 
ATOM   1262 O  O   . GLY A 1 161 ? 5.332   12.129  21.207  1.00 9.16  ? 161  GLY A O   1 
ATOM   1263 N  N   . ARG A 1 162 ? 3.478   13.387  20.894  1.00 8.98  ? 162  ARG A N   1 
ATOM   1264 C  CA  . ARG A 1 162 ? 4.136   14.316  19.975  1.00 9.56  ? 162  ARG A CA  1 
ATOM   1265 C  C   . ARG A 1 162 ? 4.621   15.525  20.767  1.00 8.29  ? 162  ARG A C   1 
ATOM   1266 O  O   . ARG A 1 162 ? 3.838   16.259  21.371  1.00 9.50  ? 162  ARG A O   1 
ATOM   1267 C  CB  . ARG A 1 162 ? 3.140   14.752  18.898  1.00 9.04  ? 162  ARG A CB  1 
ATOM   1268 C  CG  . ARG A 1 162 ? 3.717   15.735  17.898  1.00 8.71  ? 162  ARG A CG  1 
ATOM   1269 C  CD  . ARG A 1 162 ? 4.573   15.057  16.829  1.00 9.84  ? 162  ARG A CD  1 
ATOM   1270 N  NE  . ARG A 1 162 ? 5.313   16.104  16.117  1.00 9.59  ? 162  ARG A NE  1 
ATOM   1271 C  CZ  . ARG A 1 162 ? 6.248   15.891  15.200  1.00 9.98  ? 162  ARG A CZ  1 
ATOM   1272 N  NH1 . ARG A 1 162 ? 6.567   14.652  14.844  1.00 10.15 ? 162  ARG A NH1 1 
ATOM   1273 N  NH2 . ARG A 1 162 ? 6.864   16.937  14.656  1.00 9.99  ? 162  ARG A NH2 1 
ATOM   1274 N  N   . ALA A 1 163 ? 5.944   15.728  20.783  1.00 8.95  ? 163  ALA A N   1 
ATOM   1275 C  CA  . ALA A 1 163 ? 6.491   16.840  21.557  1.00 8.15  ? 163  ALA A CA  1 
ATOM   1276 C  C   . ALA A 1 163 ? 6.293   18.196  20.899  1.00 8.71  ? 163  ALA A C   1 
ATOM   1277 O  O   . ALA A 1 163 ? 6.029   19.192  21.578  1.00 9.99  ? 163  ALA A O   1 
ATOM   1278 C  CB  . ALA A 1 163 ? 7.980   16.622  21.829  1.00 9.35  ? 163  ALA A CB  1 
ATOM   1279 N  N   . SER A 1 164 ? 6.408   18.262  19.573  1.00 9.31  ? 164  SER A N   1 
ATOM   1280 C  CA  . SER A 1 164 ? 6.422   19.551  18.882  1.00 8.91  ? 164  SER A CA  1 
ATOM   1281 C  C   . SER A 1 164 ? 5.173   20.392  19.119  1.00 8.89  ? 164  SER A C   1 
ATOM   1282 O  O   . SER A 1 164 ? 5.236   21.633  19.138  1.00 9.27  ? 164  SER A O   1 
ATOM   1283 C  CB  . SER A 1 164 ? 6.597   19.334  17.367  1.00 9.05  ? 164  SER A CB  1 
ATOM   1284 O  OG  . SER A 1 164 ? 5.405   18.795  16.809  1.00 9.14  ? 164  SER A OG  1 
ATOM   1285 N  N   . SER A 1 165 ? 4.026   19.741  19.271  1.00 9.05  ? 165  SER A N   1 
ATOM   1286 C  CA  . SER A 1 165 ? 2.746   20.425  19.370  1.00 8.62  ? 165  SER A CA  1 
ATOM   1287 C  C   . SER A 1 165 ? 2.295   20.620  20.811  1.00 9.66  ? 165  SER A C   1 
ATOM   1288 O  O   . SER A 1 165 ? 1.118   20.898  21.038  1.00 9.74  ? 165  SER A O   1 
ATOM   1289 C  CB  . SER A 1 165 ? 1.698   19.639  18.577  1.00 10.06 ? 165  SER A CB  1 
ATOM   1290 O  OG  . SER A 1 165 ? 1.674   18.264  18.936  1.00 10.32 ? 165  SER A OG  1 
ATOM   1291 N  N   . ILE A 1 166 ? 3.184   20.417  21.775  1.00 9.82  ? 166  ILE A N   1 
ATOM   1292 C  CA  . ILE A 1 166 ? 2.922   20.896  23.132  1.00 9.86  ? 166  ILE A CA  1 
ATOM   1293 C  C   . ILE A 1 166 ? 3.090   22.410  23.136  1.00 10.85 ? 166  ILE A C   1 
ATOM   1294 O  O   . ILE A 1 166 ? 4.147   22.910  22.764  1.00 11.08 ? 166  ILE A O   1 
ATOM   1295 C  CB  . ILE A 1 166 ? 3.866   20.258  24.163  1.00 10.28 ? 166  ILE A CB  1 
ATOM   1296 C  CG1 . ILE A 1 166 ? 3.650   18.742  24.153  1.00 11.08 ? 166  ILE A CG1 1 
ATOM   1297 C  CG2 . ILE A 1 166 ? 3.640   20.838  25.557  1.00 10.83 ? 166  ILE A CG2 1 
ATOM   1298 C  CD1 . ILE A 1 166 ? 4.739   17.986  24.897  1.00 11.09 ? 166  ILE A CD1 1 
ATOM   1299 N  N   . VAL A 1 167 ? 2.020   23.104  23.506  1.00 10.75 ? 167  VAL A N   1 
ATOM   1300 C  CA  . VAL A 1 167 ? 1.987   24.557  23.465  1.00 10.67 ? 167  VAL A CA  1 
ATOM   1301 C  C   . VAL A 1 167 ? 1.604   25.140  24.822  1.00 9.87  ? 167  VAL A C   1 
ATOM   1302 O  O   . VAL A 1 167 ? 0.969   24.489  25.666  1.00 9.97  ? 167  VAL A O   1 
ATOM   1303 C  CB  . VAL A 1 167 ? 1.007   25.066  22.386  1.00 10.26 ? 167  VAL A CB  1 
ATOM   1304 C  CG1 . VAL A 1 167 ? 1.475   24.703  20.986  1.00 11.65 ? 167  VAL A CG1 1 
ATOM   1305 C  CG2 . VAL A 1 167 ? -0.402  24.519  22.626  1.00 10.73 ? 167  VAL A CG2 1 
ATOM   1306 N  N   . VAL A 1 168 ? 2.031   26.379  25.064  1.00 10.54 ? 168  VAL A N   1 
ATOM   1307 C  CA  . VAL A 1 168 ? 1.778   27.030  26.356  1.00 10.67 ? 168  VAL A CA  1 
ATOM   1308 C  C   . VAL A 1 168 ? 0.334   27.509  26.451  1.00 11.03 ? 168  VAL A C   1 
ATOM   1309 O  O   . VAL A 1 168 ? -0.351  27.822  25.479  1.00 10.66 ? 168  VAL A O   1 
ATOM   1310 C  CB  . VAL A 1 168 ? 2.766   28.183  26.602  1.00 11.00 ? 168  VAL A CB  1 
ATOM   1311 C  CG1 . VAL A 1 168 ? 2.403   29.421  25.784  1.00 11.85 ? 168  VAL A CG1 1 
ATOM   1312 C  CG2 . VAL A 1 168 ? 2.861   28.536  28.083  1.00 10.65 ? 168  VAL A CG2 1 
ATOM   1313 N  N   . SER A 1 169 ? -0.160  27.570  27.689  1.00 10.49 ? 169  SER A N   1 
ATOM   1314 C  CA  . SER A 1 169 ? -1.508  28.030  27.970  1.00 10.52 ? 169  SER A CA  1 
ATOM   1315 C  C   . SER A 1 169 ? -1.830  29.327  27.233  1.00 11.23 ? 169  SER A C   1 
ATOM   1316 O  O   . SER A 1 169 ? -1.005  30.245  27.217  1.00 11.71 ? 169  SER A O   1 
ATOM   1317 C  CB  . SER A 1 169 ? -1.655  28.268  29.480  1.00 10.66 ? 169  SER A CB  1 
ATOM   1318 O  OG  . SER A 1 169 ? -2.994  28.662  29.734  1.00 10.49 ? 169  SER A OG  1 
ATOM   1319 N  N   . GLY A 1 170 ? -3.015  29.386  26.645  1.00 10.85 ? 170  GLY A N   1 
ATOM   1320 C  CA  . GLY A 1 170 ? -3.481  30.527  25.883  1.00 11.80 ? 170  GLY A CA  1 
ATOM   1321 C  C   . GLY A 1 170 ? -3.325  30.398  24.378  1.00 12.50 ? 170  GLY A C   1 
ATOM   1322 O  O   . GLY A 1 170 ? -3.867  31.239  23.645  1.00 12.74 ? 170  GLY A O   1 
ATOM   1323 N  N   . THR A 1 171 ? -2.611  29.380  23.908  1.00 12.84 ? 171  THR A N   1 
ATOM   1324 C  CA  . THR A 1 171 ? -2.395  29.197  22.471  1.00 12.29 ? 171  THR A CA  1 
ATOM   1325 C  C   . THR A 1 171 ? -3.679  28.703  21.825  1.00 12.45 ? 171  THR A C   1 
ATOM   1326 O  O   . THR A 1 171 ? -4.254  27.703  22.262  1.00 11.85 ? 171  THR A O   1 
ATOM   1327 C  CB  . THR A 1 171 ? -1.282  28.161  22.213  1.00 12.44 ? 171  THR A CB  1 
ATOM   1328 O  OG1 . THR A 1 171 ? -0.071  28.598  22.844  1.00 12.30 ? 171  THR A OG1 1 
ATOM   1329 C  CG2 . THR A 1 171 ? -1.013  28.010  20.721  1.00 12.58 ? 171  THR A CG2 1 
ATOM   1330 N  N   . PRO A 1 172 ? -4.155  29.382  20.791  1.00 12.61 ? 172  PRO A N   1 
ATOM   1331 C  CA  . PRO A 1 172 ? -5.369  28.932  20.108  1.00 12.41 ? 172  PRO A CA  1 
ATOM   1332 C  C   . PRO A 1 172 ? -5.146  27.581  19.454  1.00 11.36 ? 172  PRO A C   1 
ATOM   1333 O  O   . PRO A 1 172 ? -4.035  27.288  18.996  1.00 12.14 ? 172  PRO A O   1 
ATOM   1334 C  CB  . PRO A 1 172 ? -5.657  30.027  19.094  1.00 13.01 ? 172  PRO A CB  1 
ATOM   1335 C  CG  . PRO A 1 172 ? -4.876  31.208  19.543  1.00 13.30 ? 172  PRO A CG  1 
ATOM   1336 C  CD  . PRO A 1 172 ? -3.670  30.685  20.293  1.00 13.52 ? 172  PRO A CD  1 
ATOM   1337 N  N   . ILE A 1 173 ? -6.172  26.730  19.479  1.00 11.55 ? 173  ILE A N   1 
ATOM   1338 C  CA  . ILE A 1 173 ? -6.041  25.377  18.928  1.00 11.88 ? 173  ILE A CA  1 
ATOM   1339 C  C   . ILE A 1 173 ? -6.982  25.232  17.736  1.00 12.12 ? 173  ILE A C   1 
ATOM   1340 O  O   . ILE A 1 173 ? -8.203  25.347  17.892  1.00 12.58 ? 173  ILE A O   1 
ATOM   1341 C  CB  . ILE A 1 173 ? -6.348  24.310  19.994  1.00 11.61 ? 173  ILE A CB  1 
ATOM   1342 C  CG1 . ILE A 1 173 ? -5.473  24.457  21.244  1.00 11.55 ? 173  ILE A CG1 1 
ATOM   1343 C  CG2 . ILE A 1 173 ? -6.207  22.910  19.418  1.00 12.10 ? 173  ILE A CG2 1 
ATOM   1344 C  CD1 . ILE A 1 173 ? -3.988  24.249  21.020  1.00 11.15 ? 173  ILE A CD1 1 
ATOM   1345 N  N   . ARG A 1 174 ? -6.436  24.992  16.541  1.00 12.55 ? 174  ARG A N   1 
ATOM   1346 C  CA  . ARG A 1 174 ? -7.328  24.855  15.388  1.00 13.34 ? 174  ARG A CA  1 
ATOM   1347 C  C   . ARG A 1 174 ? -7.938  23.467  15.299  1.00 12.60 ? 174  ARG A C   1 
ATOM   1348 O  O   . ARG A 1 174 ? -7.235  22.453  15.383  1.00 12.62 ? 174  ARG A O   1 
ATOM   1349 C  CB  . ARG A 1 174 ? -6.593  25.224  14.093  1.00 15.58 ? 174  ARG A CB  1 
ATOM   1350 C  CG  . ARG A 1 174 ? -7.632  25.502  13.001  1.00 18.22 ? 174  ARG A CG  1 
ATOM   1351 C  CD  . ARG A 1 174 ? -7.004  26.155  11.802  1.00 19.67 ? 174  ARG A CD  1 
ATOM   1352 N  NE  . ARG A 1 174 ? -6.512  27.502  11.942  1.00 21.14 ? 174  ARG A NE  1 
ATOM   1353 C  CZ  . ARG A 1 174 ? -7.186  28.642  11.917  1.00 21.92 ? 174  ARG A CZ  1 
ATOM   1354 N  NH1 . ARG A 1 174 ? -8.508  28.664  11.775  1.00 21.65 ? 174  ARG A NH1 1 
ATOM   1355 N  NH2 . ARG A 1 174 ? -6.533  29.796  12.029  1.00 22.95 ? 174  ARG A NH2 1 
ATOM   1356 N  N   . ARG A 1 175 ? -9.263  23.394  15.141  1.00 11.35 ? 175  ARG A N   1 
ATOM   1357 C  CA  . ARG A 1 175 ? -9.917  22.112  14.873  1.00 11.57 ? 175  ARG A CA  1 
ATOM   1358 C  C   . ARG A 1 175 ? -9.230  21.435  13.696  1.00 10.91 ? 175  ARG A C   1 
ATOM   1359 O  O   . ARG A 1 175 ? -9.127  22.040  12.628  1.00 11.53 ? 175  ARG A O   1 
ATOM   1360 C  CB  . ARG A 1 175 ? -11.391 22.339  14.522  1.00 11.46 ? 175  ARG A CB  1 
ATOM   1361 C  CG  . ARG A 1 175 ? -12.139 21.055  14.188  1.00 11.27 ? 175  ARG A CG  1 
ATOM   1362 C  CD  . ARG A 1 175 ? -13.563 21.370  13.710  1.00 11.80 ? 175  ARG A CD  1 
ATOM   1363 N  NE  . ARG A 1 175 ? -14.290 22.020  14.809  1.00 11.87 ? 175  ARG A NE  1 
ATOM   1364 C  CZ  . ARG A 1 175 ? -14.918 21.408  15.802  1.00 12.54 ? 175  ARG A CZ  1 
ATOM   1365 N  NH1 . ARG A 1 175 ? -14.978 20.084  15.879  1.00 11.49 ? 175  ARG A NH1 1 
ATOM   1366 N  NH2 . ARG A 1 175 ? -15.513 22.141  16.744  1.00 12.19 ? 175  ARG A NH2 1 
ATOM   1367 N  N   . PRO A 1 176 ? -8.772  20.204  13.850  1.00 10.43 ? 176  PRO A N   1 
ATOM   1368 C  CA  . PRO A 1 176 ? -8.010  19.539  12.802  1.00 10.87 ? 176  PRO A CA  1 
ATOM   1369 C  C   . PRO A 1 176 ? -8.864  18.938  11.699  1.00 11.56 ? 176  PRO A C   1 
ATOM   1370 O  O   . PRO A 1 176 ? -9.948  18.418  11.964  1.00 11.59 ? 176  PRO A O   1 
ATOM   1371 C  CB  . PRO A 1 176 ? -7.262  18.437  13.552  1.00 10.66 ? 176  PRO A CB  1 
ATOM   1372 C  CG  . PRO A 1 176 ? -8.169  18.115  14.699  1.00 10.82 ? 176  PRO A CG  1 
ATOM   1373 C  CD  . PRO A 1 176 ? -8.741  19.449  15.128  1.00 10.81 ? 176  PRO A CD  1 
ATOM   1374 N  N   . MET A 1 177 ? -8.355  19.001  10.470  1.00 11.28 ? 177  MET A N   1 
ATOM   1375 C  CA  . MET A 1 177 ? -8.829  18.165  9.378   1.00 12.45 ? 177  MET A CA  1 
ATOM   1376 C  C   . MET A 1 177 ? -8.167  16.791  9.439   1.00 12.11 ? 177  MET A C   1 
ATOM   1377 O  O   . MET A 1 177 ? -7.060  16.648  9.970   1.00 11.97 ? 177  MET A O   1 
ATOM   1378 C  CB  . MET A 1 177 ? -8.455  18.769  8.016   1.00 14.13 ? 177  MET A CB  1 
ATOM   1379 C  CG  . MET A 1 177 ? -8.922  20.203  7.833   1.00 15.92 ? 177  MET A CG  1 
ATOM   1380 S  SD  . MET A 1 177 ? -10.713 20.320  7.727   1.00 16.02 ? 177  MET A SD  1 
ATOM   1381 C  CE  . MET A 1 177 ? -11.013 19.669  6.080   1.00 17.06 ? 177  MET A CE  1 
ATOM   1382 N  N   . GLY A 1 178 ? -8.809  15.799  8.829   1.00 11.99 ? 178  GLY A N   1 
ATOM   1383 C  CA  . GLY A 1 178 ? -8.171  14.490  8.700   1.00 12.10 ? 178  GLY A CA  1 
ATOM   1384 C  C   . GLY A 1 178 ? -9.137  13.489  8.080   1.00 12.94 ? 178  GLY A C   1 
ATOM   1385 O  O   . GLY A 1 178 ? -10.157 13.917  7.522   1.00 13.90 ? 178  GLY A O   1 
ATOM   1386 N  N   . GLN A 1 179 ? -8.805  12.201  8.200   1.00 12.89 ? 179  GLN A N   1 
ATOM   1387 C  CA  . GLN A 1 179 ? -9.780  11.237  7.682   1.00 14.32 ? 179  GLN A CA  1 
ATOM   1388 C  C   . GLN A 1 179 ? -10.455 10.503  8.832   1.00 14.69 ? 179  GLN A C   1 
ATOM   1389 O  O   . GLN A 1 179 ? -9.966  10.352  9.948   1.00 13.96 ? 179  GLN A O   1 
ATOM   1390 C  CB  . GLN A 1 179 ? -9.218  10.349  6.596   1.00 15.55 ? 179  GLN A CB  1 
ATOM   1391 C  CG  . GLN A 1 179 ? -7.964  9.576   6.890   1.00 15.22 ? 179  GLN A CG  1 
ATOM   1392 C  CD  . GLN A 1 179 ? -7.716  8.510   5.830   1.00 13.76 ? 179  GLN A CD  1 
ATOM   1393 O  OE1 . GLN A 1 179 ? -8.422  7.496   5.789   1.00 12.51 ? 179  GLN A OE1 1 
ATOM   1394 N  NE2 . GLN A 1 179 ? -6.711  8.735   4.997   1.00 12.62 ? 179  GLN A NE2 1 
ATOM   1395 N  N   . MET A 1 180 ? -11.700 10.146  8.542   1.00 14.74 ? 180  MET A N   1 
ATOM   1396 C  CA  . MET A 1 180 ? -12.574 9.507   9.522   1.00 15.40 ? 180  MET A CA  1 
ATOM   1397 C  C   . MET A 1 180 ? -13.445 8.500   8.769   1.00 14.11 ? 180  MET A C   1 
ATOM   1398 O  O   . MET A 1 180 ? -13.558 8.607   7.547   1.00 13.94 ? 180  MET A O   1 
ATOM   1399 C  CB  . MET A 1 180 ? -13.442 10.521  10.249  1.00 18.63 ? 180  MET A CB  1 
ATOM   1400 C  CG  . MET A 1 180 ? -14.046 11.620  9.418   1.00 20.82 ? 180  MET A CG  1 
ATOM   1401 S  SD  . MET A 1 180 ? -12.920 12.937  8.943   1.00 23.34 ? 180  MET A SD  1 
ATOM   1402 C  CE  . MET A 1 180 ? -12.587 13.777  10.481  1.00 23.21 ? 180  MET A CE  1 
ATOM   1403 N  N   . ARG A 1 181 ? -14.054 7.595   9.516   1.00 13.54 ? 181  ARG A N   1 
ATOM   1404 C  CA  . ARG A 1 181 ? -14.925 6.609   8.870   1.00 14.02 ? 181  ARG A CA  1 
ATOM   1405 C  C   . ARG A 1 181 ? -16.244 6.506   9.617   1.00 14.42 ? 181  ARG A C   1 
ATOM   1406 O  O   . ARG A 1 181 ? -16.445 5.603   10.422  1.00 14.34 ? 181  ARG A O   1 
ATOM   1407 C  CB  . ARG A 1 181 ? -14.234 5.239   8.811   1.00 14.54 ? 181  ARG A CB  1 
ATOM   1408 C  CG  . ARG A 1 181 ? -14.888 4.326   7.788   1.00 15.82 ? 181  ARG A CG  1 
ATOM   1409 C  CD  . ARG A 1 181 ? -14.446 2.877   7.854   1.00 16.48 ? 181  ARG A CD  1 
ATOM   1410 N  NE  . ARG A 1 181 ? -14.749 2.221   6.584   1.00 17.39 ? 181  ARG A NE  1 
ATOM   1411 C  CZ  . ARG A 1 181 ? -14.334 1.029   6.185   1.00 17.84 ? 181  ARG A CZ  1 
ATOM   1412 N  NH1 . ARG A 1 181 ? -13.581 0.272   6.968   1.00 17.45 ? 181  ARG A NH1 1 
ATOM   1413 N  NH2 . ARG A 1 181 ? -14.686 0.599   4.978   1.00 18.73 ? 181  ARG A NH2 1 
ATOM   1414 N  N   . PRO A 1 182 ? -17.171 7.407   9.302   1.00 15.22 ? 182  PRO A N   1 
ATOM   1415 C  CA  . PRO A 1 182 ? -18.455 7.461   9.984   1.00 15.88 ? 182  PRO A CA  1 
ATOM   1416 C  C   . PRO A 1 182 ? -19.356 6.300   9.608   1.00 17.27 ? 182  PRO A C   1 
ATOM   1417 O  O   . PRO A 1 182 ? -20.239 5.915   10.373  1.00 18.19 ? 182  PRO A O   1 
ATOM   1418 C  CB  . PRO A 1 182 ? -19.048 8.788   9.550   1.00 15.67 ? 182  PRO A CB  1 
ATOM   1419 C  CG  . PRO A 1 182 ? -18.407 9.106   8.249   1.00 15.83 ? 182  PRO A CG  1 
ATOM   1420 C  CD  . PRO A 1 182 ? -17.027 8.495   8.307   1.00 15.09 ? 182  PRO A CD  1 
ATOM   1421 N  N   . ASP A 1 183 ? -19.158 5.747   8.422   1.00 17.45 ? 183  ASP A N   1 
ATOM   1422 C  CA  . ASP A 1 183 ? -19.923 4.593   7.956   1.00 19.08 ? 183  ASP A CA  1 
ATOM   1423 C  C   . ASP A 1 183 ? -18.960 3.461   7.628   1.00 20.24 ? 183  ASP A C   1 
ATOM   1424 O  O   . ASP A 1 183 ? -18.185 3.547   6.674   1.00 19.08 ? 183  ASP A O   1 
ATOM   1425 C  CB  . ASP A 1 183 ? -20.736 5.017   6.734   1.00 19.52 ? 183  ASP A CB  1 
ATOM   1426 C  CG  . ASP A 1 183 ? -21.692 3.964   6.217   1.00 20.40 ? 183  ASP A CG  1 
ATOM   1427 O  OD1 . ASP A 1 183 ? -21.521 2.770   6.534   1.00 20.82 ? 183  ASP A OD1 1 
ATOM   1428 O  OD2 . ASP A 1 183 ? -22.615 4.363   5.470   1.00 20.91 ? 183  ASP A OD2 1 
ATOM   1429 N  N   . ASN A 1 184 ? -19.037 2.354   8.357   1.00 22.24 ? 184  ASN A N   1 
ATOM   1430 C  CA  . ASN A 1 184 ? -18.147 1.222   8.159   1.00 23.98 ? 184  ASN A CA  1 
ATOM   1431 C  C   . ASN A 1 184 ? -18.352 0.450   6.866   1.00 24.71 ? 184  ASN A C   1 
ATOM   1432 O  O   . ASN A 1 184 ? -17.508 -0.392  6.536   1.00 25.24 ? 184  ASN A O   1 
ATOM   1433 C  CB  . ASN A 1 184 ? -18.267 0.215   9.308   1.00 25.12 ? 184  ASN A CB  1 
ATOM   1434 C  CG  . ASN A 1 184 ? -17.489 0.618   10.537  1.00 25.91 ? 184  ASN A CG  1 
ATOM   1435 O  OD1 . ASN A 1 184 ? -16.354 1.094   10.439  1.00 26.91 ? 184  ASN A OD1 1 
ATOM   1436 N  ND2 . ASN A 1 184 ? -18.110 0.401   11.688  1.00 26.65 ? 184  ASN A ND2 1 
ATOM   1437 N  N   . SER A 1 185 ? -19.442 0.677   6.144   1.00 24.89 ? 185  SER A N   1 
ATOM   1438 C  CA  . SER A 1 185 ? -19.637 0.023   4.856   1.00 24.66 ? 185  SER A CA  1 
ATOM   1439 C  C   . SER A 1 185 ? -19.135 0.863   3.698   1.00 24.09 ? 185  SER A C   1 
ATOM   1440 O  O   . SER A 1 185 ? -19.268 0.458   2.541   1.00 25.03 ? 185  SER A O   1 
ATOM   1441 C  CB  . SER A 1 185 ? -21.121 -0.306  4.658   1.00 25.22 ? 185  SER A CB  1 
ATOM   1442 O  OG  . SER A 1 185 ? -21.882 0.887   4.627   1.00 26.46 ? 185  SER A OG  1 
ATOM   1443 N  N   . LYS A 1 186 ? -18.568 2.039   3.970   1.00 22.47 ? 186  LYS A N   1 
ATOM   1444 C  CA  . LYS A 1 186 ? -18.109 2.940   2.921   1.00 21.09 ? 186  LYS A CA  1 
ATOM   1445 C  C   . LYS A 1 186 ? -16.664 3.348   3.194   1.00 19.67 ? 186  LYS A C   1 
ATOM   1446 O  O   . LYS A 1 186 ? -16.182 3.196   4.318   1.00 17.17 ? 186  LYS A O   1 
ATOM   1447 C  CB  . LYS A 1 186 ? -19.001 4.180   2.853   1.00 23.04 ? 186  LYS A CB  1 
ATOM   1448 C  CG  . LYS A 1 186 ? -20.423 3.947   2.355   1.00 24.48 ? 186  LYS A CG  1 
ATOM   1449 C  CD  . LYS A 1 186 ? -20.415 3.521   0.895   1.00 25.91 ? 186  LYS A CD  1 
ATOM   1450 C  CE  . LYS A 1 186 ? -21.768 3.023   0.422   1.00 27.28 ? 186  LYS A CE  1 
ATOM   1451 N  NZ  . LYS A 1 186 ? -22.236 1.833   1.188   1.00 28.81 ? 186  LYS A NZ  1 
ATOM   1452 N  N   . PRO A 1 187 ? -15.977 3.832   2.168   1.00 18.31 ? 187  PRO A N   1 
ATOM   1453 C  CA  . PRO A 1 187 ? -14.600 4.285   2.338   1.00 17.49 ? 187  PRO A CA  1 
ATOM   1454 C  C   . PRO A 1 187 ? -14.573 5.437   3.323   1.00 16.37 ? 187  PRO A C   1 
ATOM   1455 O  O   . PRO A 1 187 ? -15.583 6.106   3.548   1.00 15.13 ? 187  PRO A O   1 
ATOM   1456 C  CB  . PRO A 1 187 ? -14.161 4.681   0.939   1.00 18.39 ? 187  PRO A CB  1 
ATOM   1457 C  CG  . PRO A 1 187 ? -15.059 3.935   0.015   1.00 18.80 ? 187  PRO A CG  1 
ATOM   1458 C  CD  . PRO A 1 187 ? -16.359 3.717   0.741   1.00 19.03 ? 187  PRO A CD  1 
ATOM   1459 N  N   . PRO A 1 188 ? -13.438 5.660   3.965   1.00 15.72 ? 188  PRO A N   1 
ATOM   1460 C  CA  . PRO A 1 188 ? -13.274 6.812   4.840   1.00 15.09 ? 188  PRO A CA  1 
ATOM   1461 C  C   . PRO A 1 188 ? -13.415 8.104   4.061   1.00 14.93 ? 188  PRO A C   1 
ATOM   1462 O  O   . PRO A 1 188 ? -13.315 8.138   2.831   1.00 15.29 ? 188  PRO A O   1 
ATOM   1463 C  CB  . PRO A 1 188 ? -11.854 6.664   5.380   1.00 15.43 ? 188  PRO A CB  1 
ATOM   1464 C  CG  . PRO A 1 188 ? -11.140 5.954   4.273   1.00 15.94 ? 188  PRO A CG  1 
ATOM   1465 C  CD  . PRO A 1 188 ? -12.149 4.957   3.748   1.00 16.06 ? 188  PRO A CD  1 
ATOM   1466 N  N   . VAL A 1 189 ? -13.661 9.192   4.781   1.00 13.71 ? 189  VAL A N   1 
ATOM   1467 C  CA  . VAL A 1 189 ? -13.818 10.504  4.168   1.00 14.05 ? 189  VAL A CA  1 
ATOM   1468 C  C   . VAL A 1 189 ? -12.775 11.458  4.742   1.00 14.53 ? 189  VAL A C   1 
ATOM   1469 O  O   . VAL A 1 189 ? -12.209 11.188  5.809   1.00 13.90 ? 189  VAL A O   1 
ATOM   1470 C  CB  . VAL A 1 189 ? -15.231 11.059  4.403   1.00 14.56 ? 189  VAL A CB  1 
ATOM   1471 C  CG1 . VAL A 1 189 ? -16.290 10.161  3.777   1.00 15.52 ? 189  VAL A CG1 1 
ATOM   1472 C  CG2 . VAL A 1 189 ? -15.504 11.219  5.892   1.00 15.01 ? 189  VAL A CG2 1 
ATOM   1473 N  N   . TYR A 1 190 ? -12.529 12.550  4.044   1.00 14.00 ? 190  TYR A N   1 
ATOM   1474 C  CA  . TYR A 1 190 ? -11.688 13.632  4.532   1.00 13.70 ? 190  TYR A CA  1 
ATOM   1475 C  C   . TYR A 1 190 ? -12.549 14.822  4.933   1.00 14.34 ? 190  TYR A C   1 
ATOM   1476 O  O   . TYR A 1 190 ? -13.441 15.232  4.175   1.00 15.21 ? 190  TYR A O   1 
ATOM   1477 C  CB  . TYR A 1 190 ? -10.676 14.020  3.455   1.00 14.20 ? 190  TYR A CB  1 
ATOM   1478 C  CG  . TYR A 1 190 ? -9.927  15.306  3.731   1.00 14.16 ? 190  TYR A CG  1 
ATOM   1479 C  CD1 . TYR A 1 190 ? -8.818  15.303  4.575   1.00 14.23 ? 190  TYR A CD1 1 
ATOM   1480 C  CD2 . TYR A 1 190 ? -10.321 16.505  3.171   1.00 14.83 ? 190  TYR A CD2 1 
ATOM   1481 C  CE1 . TYR A 1 190 ? -8.127  16.469  4.845   1.00 14.87 ? 190  TYR A CE1 1 
ATOM   1482 C  CE2 . TYR A 1 190 ? -9.633  17.680  3.424   1.00 15.61 ? 190  TYR A CE2 1 
ATOM   1483 C  CZ  . TYR A 1 190 ? -8.533  17.648  4.263   1.00 15.75 ? 190  TYR A CZ  1 
ATOM   1484 O  OH  . TYR A 1 190 ? -7.856  18.815  4.522   1.00 16.28 ? 190  TYR A OH  1 
ATOM   1485 N  N   . GLY A 1 191 ? -12.284 15.405  6.099   1.00 13.20 ? 191  GLY A N   1 
ATOM   1486 C  CA  . GLY A 1 191 ? -13.070 16.561  6.524   1.00 13.55 ? 191  GLY A CA  1 
ATOM   1487 C  C   . GLY A 1 191 ? -12.641 17.041  7.906   1.00 13.70 ? 191  GLY A C   1 
ATOM   1488 O  O   . GLY A 1 191 ? -11.674 16.518  8.451   1.00 13.17 ? 191  GLY A O   1 
ATOM   1489 N  N   . ALA A 1 192 ? -13.333 18.061  8.399   1.00 13.82 ? 192  ALA A N   1 
ATOM   1490 C  CA  . ALA A 1 192 ? -13.073 18.549  9.748   1.00 13.54 ? 192  ALA A CA  1 
ATOM   1491 C  C   . ALA A 1 192 ? -13.530 17.548  10.802  1.00 13.90 ? 192  ALA A C   1 
ATOM   1492 O  O   . ALA A 1 192 ? -14.600 16.945  10.738  1.00 13.24 ? 192  ALA A O   1 
ATOM   1493 C  CB  . ALA A 1 192 ? -13.773 19.879  10.003  1.00 13.50 ? 192  ALA A CB  1 
ATOM   1494 N  N   . CYS A 1 193 ? -12.663 17.369  11.799  1.00 13.14 ? 193  CYS A N   1 
ATOM   1495 C  CA  . CYS A 1 193 ? -13.025 16.655  13.019  1.00 13.72 ? 193  CYS A CA  1 
ATOM   1496 C  C   . CYS A 1 193 ? -14.418 17.040  13.514  1.00 13.35 ? 193  CYS A C   1 
ATOM   1497 O  O   . CYS A 1 193 ? -14.701 18.236  13.643  1.00 13.15 ? 193  CYS A O   1 
ATOM   1498 C  CB  . CYS A 1 193 ? -11.967 17.014  14.070  1.00 14.60 ? 193  CYS A CB  1 
ATOM   1499 S  SG  . CYS A 1 193 ? -12.358 16.521  15.743  1.00 14.75 ? 193  CYS A SG  1 
ATOM   1500 N  N   . ARG A 1 194 ? -15.261 16.049  13.803  1.00 13.46 ? 194  ARG A N   1 
ATOM   1501 C  CA  . ARG A 1 194 ? -16.564 16.363  14.387  1.00 14.92 ? 194  ARG A CA  1 
ATOM   1502 C  C   . ARG A 1 194 ? -16.649 16.110  15.882  1.00 14.51 ? 194  ARG A C   1 
ATOM   1503 O  O   . ARG A 1 194 ? -17.576 16.611  16.526  1.00 14.34 ? 194  ARG A O   1 
ATOM   1504 C  CB  . ARG A 1 194 ? -17.651 15.537  13.682  1.00 15.93 ? 194  ARG A CB  1 
ATOM   1505 C  CG  . ARG A 1 194 ? -17.639 15.830  12.178  1.00 18.73 ? 194  ARG A CG  1 
ATOM   1506 C  CD  . ARG A 1 194 ? -18.989 15.484  11.579  1.00 20.87 ? 194  ARG A CD  1 
ATOM   1507 N  NE  . ARG A 1 194 ? -19.069 16.038  10.230  1.00 22.80 ? 194  ARG A NE  1 
ATOM   1508 C  CZ  . ARG A 1 194 ? -20.195 16.083  9.525   1.00 23.94 ? 194  ARG A CZ  1 
ATOM   1509 N  NH1 . ARG A 1 194 ? -21.317 15.621  10.057  1.00 24.92 ? 194  ARG A NH1 1 
ATOM   1510 N  NH2 . ARG A 1 194 ? -20.147 16.599  8.310   1.00 24.85 ? 194  ARG A NH2 1 
ATOM   1511 N  N   . LEU A 1 195 ? -15.719 15.330  16.428  1.00 12.73 ? 195  LEU A N   1 
ATOM   1512 C  CA  . LEU A 1 195 ? -15.731 15.012  17.851  1.00 12.94 ? 195  LEU A CA  1 
ATOM   1513 C  C   . LEU A 1 195 ? -14.462 15.546  18.519  1.00 11.31 ? 195  LEU A C   1 
ATOM   1514 O  O   . LEU A 1 195 ? -13.559 14.771  18.837  1.00 12.36 ? 195  LEU A O   1 
ATOM   1515 C  CB  . LEU A 1 195 ? -15.847 13.509  18.064  1.00 13.72 ? 195  LEU A CB  1 
ATOM   1516 C  CG  . LEU A 1 195 ? -16.998 12.774  17.376  1.00 14.86 ? 195  LEU A CG  1 
ATOM   1517 C  CD1 . LEU A 1 195 ? -16.926 11.295  17.743  1.00 15.14 ? 195  LEU A CD1 1 
ATOM   1518 C  CD2 . LEU A 1 195 ? -18.352 13.365  17.742  1.00 15.69 ? 195  LEU A CD2 1 
ATOM   1519 N  N   . LEU A 1 196 ? -14.410 16.860  18.689  1.00 10.02 ? 196  LEU A N   1 
ATOM   1520 C  CA  . LEU A 1 196 ? -13.247 17.503  19.308  1.00 10.07 ? 196  LEU A CA  1 
ATOM   1521 C  C   . LEU A 1 196 ? -13.431 17.573  20.823  1.00 10.55 ? 196  LEU A C   1 
ATOM   1522 O  O   . LEU A 1 196 ? -14.477 18.010  21.291  1.00 10.57 ? 196  LEU A O   1 
ATOM   1523 C  CB  . LEU A 1 196 ? -13.083 18.911  18.735  1.00 10.10 ? 196  LEU A CB  1 
ATOM   1524 C  CG  . LEU A 1 196 ? -11.820 19.674  19.150  1.00 11.02 ? 196  LEU A CG  1 
ATOM   1525 C  CD1 . LEU A 1 196 ? -10.580 18.931  18.683  1.00 11.39 ? 196  LEU A CD1 1 
ATOM   1526 C  CD2 . LEU A 1 196 ? -11.870 21.095  18.599  1.00 10.81 ? 196  LEU A CD2 1 
ATOM   1527 N  N   . ASP A 1 197 ? -12.405 17.176  21.577  1.00 9.61  ? 197  ASP A N   1 
ATOM   1528 C  CA  . ASP A 1 197 ? -12.545 16.997  23.019  1.00 9.57  ? 197  ASP A CA  1 
ATOM   1529 C  C   . ASP A 1 197 ? -11.314 17.514  23.761  1.00 9.98  ? 197  ASP A C   1 
ATOM   1530 O  O   . ASP A 1 197 ? -10.248 17.690  23.183  1.00 10.00 ? 197  ASP A O   1 
ATOM   1531 C  CB  . ASP A 1 197 ? -12.725 15.510  23.330  1.00 10.59 ? 197  ASP A CB  1 
ATOM   1532 C  CG  . ASP A 1 197 ? -13.338 15.174  24.669  1.00 11.29 ? 197  ASP A CG  1 
ATOM   1533 O  OD1 . ASP A 1 197 ? -13.660 16.086  25.460  1.00 10.29 ? 197  ASP A OD1 1 
ATOM   1534 O  OD2 . ASP A 1 197 ? -13.503 13.956  24.935  1.00 12.26 ? 197  ASP A OD2 1 
ATOM   1535 N  N   . MET A 1 198 ? -11.521 17.763  25.047  1.00 10.39 ? 198  MET A N   1 
ATOM   1536 C  CA  . MET A 1 198 ? -10.421 18.049  25.964  1.00 11.50 ? 198  MET A CA  1 
ATOM   1537 C  C   . MET A 1 198 ? -10.096 16.792  26.743  1.00 10.98 ? 198  MET A C   1 
ATOM   1538 O  O   . MET A 1 198 ? -10.899 15.841  26.799  1.00 11.46 ? 198  MET A O   1 
ATOM   1539 C  CB  . MET A 1 198 ? -10.841 19.194  26.889  1.00 14.76 ? 198  MET A CB  1 
ATOM   1540 C  CG  . MET A 1 198 ? -12.098 18.884  27.696  1.00 19.00 ? 198  MET A CG  1 
ATOM   1541 S  SD  . MET A 1 198 ? -11.639 18.429  29.369  1.00 23.93 ? 198  MET A SD  1 
ATOM   1542 C  CE  . MET A 1 198 ? -13.236 18.283  30.180  1.00 21.73 ? 198  MET A CE  1 
ATOM   1543 N  N   . GLU A 1 199 ? -8.886  16.703  27.295  1.00 10.06 ? 199  GLU A N   1 
ATOM   1544 C  CA  . GLU A 1 199 ? -8.585  15.697  28.311  1.00 10.37 ? 199  GLU A CA  1 
ATOM   1545 C  C   . GLU A 1 199 ? -7.835  16.354  29.465  1.00 9.53  ? 199  GLU A C   1 
ATOM   1546 O  O   . GLU A 1 199 ? -6.718  16.832  29.285  1.00 9.95  ? 199  GLU A O   1 
ATOM   1547 C  CB  . GLU A 1 199 ? -7.767  14.524  27.749  1.00 11.57 ? 199  GLU A CB  1 
ATOM   1548 C  CG  . GLU A 1 199 ? -8.694  13.625  26.913  1.00 12.72 ? 199  GLU A CG  1 
ATOM   1549 C  CD  . GLU A 1 199 ? -8.087  12.355  26.408  1.00 14.50 ? 199  GLU A CD  1 
ATOM   1550 O  OE1 . GLU A 1 199 ? -6.874  12.443  26.314  1.00 15.87 ? 199  GLU A OE1 1 
ATOM   1551 O  OE2 . GLU A 1 199 ? -8.617  11.283  26.091  1.00 14.98 ? 199  GLU A OE2 1 
ATOM   1552 N  N   . LEU A 1 200 ? -8.462  16.331  30.641  1.00 9.41  ? 200  LEU A N   1 
ATOM   1553 C  CA  . LEU A 1 200 ? -7.869  16.892  31.849  1.00 9.38  ? 200  LEU A CA  1 
ATOM   1554 C  C   . LEU A 1 200 ? -6.756  16.004  32.363  1.00 9.31  ? 200  LEU A C   1 
ATOM   1555 O  O   . LEU A 1 200 ? -6.959  14.810  32.597  1.00 9.79  ? 200  LEU A O   1 
ATOM   1556 C  CB  . LEU A 1 200 ? -8.943  16.998  32.939  1.00 10.26 ? 200  LEU A CB  1 
ATOM   1557 C  CG  . LEU A 1 200 ? -8.420  17.233  34.369  1.00 10.74 ? 200  LEU A CG  1 
ATOM   1558 C  CD1 . LEU A 1 200 ? -7.770  18.604  34.454  1.00 12.08 ? 200  LEU A CD1 1 
ATOM   1559 C  CD2 . LEU A 1 200 ? -9.554  17.065  35.365  1.00 11.50 ? 200  LEU A CD2 1 
ATOM   1560 N  N   . GLU A 1 201 ? -5.519  16.509  32.407  1.00 8.73  ? 201  GLU A N   1 
ATOM   1561 C  CA  . GLU A 1 201 ? -4.389  15.734  32.889  1.00 8.91  ? 201  GLU A CA  1 
ATOM   1562 C  C   . GLU A 1 201 ? -3.462  16.600  33.740  1.00 8.76  ? 201  GLU A C   1 
ATOM   1563 O  O   . GLU A 1 201 ? -3.589  17.816  33.783  1.00 8.78  ? 201  GLU A O   1 
ATOM   1564 C  CB  . GLU A 1 201 ? -3.497  15.231  31.750  1.00 9.64  ? 201  GLU A CB  1 
ATOM   1565 C  CG  . GLU A 1 201 ? -4.302  14.552  30.673  1.00 10.86 ? 201  GLU A CG  1 
ATOM   1566 C  CD  . GLU A 1 201 ? -3.490  13.696  29.757  1.00 12.49 ? 201  GLU A CD  1 
ATOM   1567 O  OE1 . GLU A 1 201 ? -2.358  13.261  29.926  1.00 12.03 ? 201  GLU A OE1 1 
ATOM   1568 O  OE2 . GLU A 1 201 ? -4.199  13.464  28.779  1.00 12.74 ? 201  GLU A OE2 1 
ATOM   1569 N  N   . MET A 1 202 ? -2.527  15.933  34.410  1.00 9.74  ? 202  MET A N   1 
ATOM   1570 C  CA  . MET A 1 202 ? -1.353  16.633  34.934  1.00 9.44  ? 202  MET A CA  1 
ATOM   1571 C  C   . MET A 1 202 ? -0.110  15.930  34.401  1.00 9.26  ? 202  MET A C   1 
ATOM   1572 O  O   . MET A 1 202 ? -0.176  14.763  33.991  1.00 10.07 ? 202  MET A O   1 
ATOM   1573 C  CB  . MET A 1 202 ? -1.329  16.661  36.467  1.00 9.66  ? 202  MET A CB  1 
ATOM   1574 C  CG  . MET A 1 202 ? -2.544  17.419  37.011  1.00 9.36  ? 202  MET A CG  1 
ATOM   1575 S  SD  . MET A 1 202 ? -2.388  17.794  38.763  1.00 9.53  ? 202  MET A SD  1 
ATOM   1576 C  CE  . MET A 1 202 ? -1.245  19.178  38.709  1.00 11.13 ? 202  MET A CE  1 
ATOM   1577 N  N   . ALA A 1 203 ? 1.030   16.603  34.447  1.00 9.45  ? 203  ALA A N   1 
ATOM   1578 C  CA  . ALA A 1 203 ? 2.251   15.963  33.956  1.00 9.14  ? 203  ALA A CA  1 
ATOM   1579 C  C   . ALA A 1 203 ? 3.458   16.382  34.787  1.00 9.24  ? 203  ALA A C   1 
ATOM   1580 O  O   . ALA A 1 203 ? 3.436   17.459  35.382  1.00 10.97 ? 203  ALA A O   1 
ATOM   1581 C  CB  . ALA A 1 203 ? 2.456   16.316  32.487  1.00 10.02 ? 203  ALA A CB  1 
ATOM   1582 N  N   . PHE A 1 204 ? 4.468   15.519  34.825  1.00 9.62  ? 204  PHE A N   1 
ATOM   1583 C  CA  . PHE A 1 204 ? 5.679   15.899  35.560  1.00 9.47  ? 204  PHE A CA  1 
ATOM   1584 C  C   . PHE A 1 204 ? 6.890   15.976  34.644  1.00 9.54  ? 204  PHE A C   1 
ATOM   1585 O  O   . PHE A 1 204 ? 6.990   15.273  33.644  1.00 9.19  ? 204  PHE A O   1 
ATOM   1586 C  CB  . PHE A 1 204 ? 5.961   14.976  36.732  1.00 9.53  ? 204  PHE A CB  1 
ATOM   1587 C  CG  . PHE A 1 204 ? 6.272   13.539  36.446  1.00 9.65  ? 204  PHE A CG  1 
ATOM   1588 C  CD1 . PHE A 1 204 ? 7.574   13.114  36.248  1.00 9.91  ? 204  PHE A CD1 1 
ATOM   1589 C  CD2 . PHE A 1 204 ? 5.252   12.602  36.386  1.00 9.70  ? 204  PHE A CD2 1 
ATOM   1590 C  CE1 . PHE A 1 204 ? 7.853   11.775  36.009  1.00 10.12 ? 204  PHE A CE1 1 
ATOM   1591 C  CE2 . PHE A 1 204 ? 5.513   11.263  36.151  1.00 9.47  ? 204  PHE A CE2 1 
ATOM   1592 C  CZ  . PHE A 1 204 ? 6.819   10.861  35.969  1.00 10.12 ? 204  PHE A CZ  1 
ATOM   1593 N  N   . PHE A 1 205 ? 7.790   16.887  35.011  1.00 9.40  ? 205  PHE A N   1 
ATOM   1594 C  CA  . PHE A 1 205 ? 9.053   17.029  34.295  1.00 9.46  ? 205  PHE A CA  1 
ATOM   1595 C  C   . PHE A 1 205 ? 10.134  16.170  34.941  1.00 9.67  ? 205  PHE A C   1 
ATOM   1596 O  O   . PHE A 1 205 ? 10.259  16.104  36.174  1.00 9.70  ? 205  PHE A O   1 
ATOM   1597 C  CB  . PHE A 1 205 ? 9.493   18.496  34.251  1.00 9.86  ? 205  PHE A CB  1 
ATOM   1598 C  CG  . PHE A 1 205 ? 8.736   19.326  33.253  1.00 9.50  ? 205  PHE A CG  1 
ATOM   1599 C  CD1 . PHE A 1 205 ? 7.701   20.163  33.617  1.00 10.66 ? 205  PHE A CD1 1 
ATOM   1600 C  CD2 . PHE A 1 205 ? 9.094   19.232  31.910  1.00 10.17 ? 205  PHE A CD2 1 
ATOM   1601 C  CE1 . PHE A 1 205 ? 7.022   20.899  32.658  1.00 9.56  ? 205  PHE A CE1 1 
ATOM   1602 C  CE2 . PHE A 1 205 ? 8.413   19.960  30.950  1.00 10.82 ? 205  PHE A CE2 1 
ATOM   1603 C  CZ  . PHE A 1 205 ? 7.387   20.807  31.330  1.00 11.02 ? 205  PHE A CZ  1 
ATOM   1604 N  N   . VAL A 1 206 ? 10.920  15.510  34.099  1.00 9.50  ? 206  VAL A N   1 
ATOM   1605 C  CA  . VAL A 1 206 ? 12.077  14.741  34.555  1.00 10.09 ? 206  VAL A CA  1 
ATOM   1606 C  C   . VAL A 1 206 ? 13.248  15.659  34.901  1.00 11.18 ? 206  VAL A C   1 
ATOM   1607 O  O   . VAL A 1 206 ? 13.522  16.632  34.209  1.00 10.40 ? 206  VAL A O   1 
ATOM   1608 C  CB  . VAL A 1 206 ? 12.505  13.724  33.479  1.00 10.37 ? 206  VAL A CB  1 
ATOM   1609 C  CG1 . VAL A 1 206 ? 13.756  12.947  33.860  1.00 10.30 ? 206  VAL A CG1 1 
ATOM   1610 C  CG2 . VAL A 1 206 ? 11.349  12.755  33.233  1.00 10.69 ? 206  VAL A CG2 1 
ATOM   1611 N  N   . GLY A 1 207 ? 13.933  15.286  35.978  1.00 10.96 ? 207  GLY A N   1 
ATOM   1612 C  CA  . GLY A 1 207 ? 15.168  15.932  36.420  1.00 12.47 ? 207  GLY A CA  1 
ATOM   1613 C  C   . GLY A 1 207 ? 16.373  15.290  35.753  1.00 12.80 ? 207  GLY A C   1 
ATOM   1614 O  O   . GLY A 1 207 ? 16.463  15.206  34.523  1.00 11.46 ? 207  GLY A O   1 
ATOM   1615 N  N   . PRO A 1 208 ? 17.346  14.819  36.533  1.00 12.97 ? 208  PRO A N   1 
ATOM   1616 C  CA  . PRO A 1 208 ? 18.494  14.143  35.958  1.00 14.33 ? 208  PRO A CA  1 
ATOM   1617 C  C   . PRO A 1 208 ? 18.046  12.925  35.161  1.00 14.83 ? 208  PRO A C   1 
ATOM   1618 O  O   . PRO A 1 208 ? 17.115  12.242  35.594  1.00 16.05 ? 208  PRO A O   1 
ATOM   1619 C  CB  . PRO A 1 208 ? 19.341  13.738  37.152  1.00 13.87 ? 208  PRO A CB  1 
ATOM   1620 C  CG  . PRO A 1 208 ? 18.877  14.600  38.274  1.00 14.84 ? 208  PRO A CG  1 
ATOM   1621 C  CD  . PRO A 1 208 ? 17.429  14.953  38.006  1.00 13.47 ? 208  PRO A CD  1 
ATOM   1622 N  N   . GLY A 1 209 ? 18.701  12.661  34.042  1.00 16.30 ? 209  GLY A N   1 
ATOM   1623 C  CA  . GLY A 1 209 ? 18.306  11.467  33.285  1.00 17.78 ? 209  GLY A CA  1 
ATOM   1624 C  C   . GLY A 1 209 ? 18.832  10.190  33.939  1.00 17.33 ? 209  GLY A C   1 
ATOM   1625 O  O   . GLY A 1 209 ? 19.419  10.174  35.020  1.00 19.42 ? 209  GLY A O   1 
ATOM   1626 N  N   . ASN A 1 210 ? 18.583  9.079   33.261  1.00 15.68 ? 210  ASN A N   1 
ATOM   1627 C  CA  . ASN A 1 210 ? 19.337  7.849   33.464  1.00 14.97 ? 210  ASN A CA  1 
ATOM   1628 C  C   . ASN A 1 210 ? 20.173  7.584   32.214  1.00 15.96 ? 210  ASN A C   1 
ATOM   1629 O  O   . ASN A 1 210 ? 19.817  8.034   31.124  1.00 16.54 ? 210  ASN A O   1 
ATOM   1630 C  CB  . ASN A 1 210 ? 18.411  6.670   33.755  1.00 13.91 ? 210  ASN A CB  1 
ATOM   1631 C  CG  . ASN A 1 210 ? 17.378  6.456   32.660  1.00 13.18 ? 210  ASN A CG  1 
ATOM   1632 O  OD1 . ASN A 1 210 ? 16.629  7.377   32.340  1.00 12.11 ? 210  ASN A OD1 1 
ATOM   1633 N  ND2 . ASN A 1 210 ? 17.336  5.248   32.122  1.00 12.49 ? 210  ASN A ND2 1 
ATOM   1634 N  N   . ARG A 1 211 ? 21.285  6.884   32.401  1.00 17.22 ? 211  ARG A N   1 
ATOM   1635 C  CA  . ARG A 1 211 ? 22.106  6.510   31.249  1.00 18.33 ? 211  ARG A CA  1 
ATOM   1636 C  C   . ARG A 1 211 ? 21.356  5.522   30.360  1.00 16.64 ? 211  ARG A C   1 
ATOM   1637 O  O   . ARG A 1 211 ? 20.665  4.648   30.867  1.00 16.64 ? 211  ARG A O   1 
ATOM   1638 C  CB  . ARG A 1 211 ? 23.416  5.885   31.722  1.00 21.52 ? 211  ARG A CB  1 
ATOM   1639 C  CG  . ARG A 1 211 ? 24.587  6.854   31.803  1.00 25.84 ? 211  ARG A CG  1 
ATOM   1640 C  CD  . ARG A 1 211 ? 25.839  6.136   31.278  1.00 28.45 ? 211  ARG A CD  1 
ATOM   1641 N  NE  . ARG A 1 211 ? 26.289  5.109   32.199  1.00 30.96 ? 211  ARG A NE  1 
ATOM   1642 C  CZ  . ARG A 1 211 ? 27.491  4.547   32.235  1.00 32.00 ? 211  ARG A CZ  1 
ATOM   1643 N  NH1 . ARG A 1 211 ? 28.445  4.891   31.379  1.00 33.03 ? 211  ARG A NH1 1 
ATOM   1644 N  NH2 . ARG A 1 211 ? 27.743  3.622   33.156  1.00 32.68 ? 211  ARG A NH2 1 
ATOM   1645 N  N   . PHE A 1 212 ? 21.527  5.667   29.051  1.00 15.44 ? 212  PHE A N   1 
ATOM   1646 C  CA  . PHE A 1 212 ? 21.070  4.693   28.077  1.00 14.74 ? 212  PHE A CA  1 
ATOM   1647 C  C   . PHE A 1 212 ? 21.466  3.283   28.498  1.00 14.14 ? 212  PHE A C   1 
ATOM   1648 O  O   . PHE A 1 212 ? 22.662  3.016   28.684  1.00 14.70 ? 212  PHE A O   1 
ATOM   1649 C  CB  . PHE A 1 212 ? 21.638  5.011   26.692  1.00 14.51 ? 212  PHE A CB  1 
ATOM   1650 C  CG  . PHE A 1 212 ? 21.237  4.083   25.583  1.00 14.35 ? 212  PHE A CG  1 
ATOM   1651 C  CD1 . PHE A 1 212 ? 19.948  4.087   25.075  1.00 14.73 ? 212  PHE A CD1 1 
ATOM   1652 C  CD2 . PHE A 1 212 ? 22.151  3.204   25.026  1.00 13.60 ? 212  PHE A CD2 1 
ATOM   1653 C  CE1 . PHE A 1 212 ? 19.583  3.232   24.054  1.00 14.02 ? 212  PHE A CE1 1 
ATOM   1654 C  CE2 . PHE A 1 212 ? 21.791  2.345   24.003  1.00 13.98 ? 212  PHE A CE2 1 
ATOM   1655 C  CZ  . PHE A 1 212 ? 20.499  2.357   23.510  1.00 14.66 ? 212  PHE A CZ  1 
ATOM   1656 N  N   . GLY A 1 213 ? 20.469  2.432   28.685  1.00 13.75 ? 213  GLY A N   1 
ATOM   1657 C  CA  . GLY A 1 213 ? 20.689  1.052   29.078  1.00 13.79 ? 213  GLY A CA  1 
ATOM   1658 C  C   . GLY A 1 213 ? 20.603  0.815   30.577  1.00 14.90 ? 213  GLY A C   1 
ATOM   1659 O  O   . GLY A 1 213 ? 20.681  -0.342  30.996  1.00 15.09 ? 213  GLY A O   1 
ATOM   1660 N  N   . GLU A 1 214 ? 20.437  1.857   31.379  1.00 14.84 ? 214  GLU A N   1 
ATOM   1661 C  CA  . GLU A 1 214 ? 20.464  1.711   32.834  1.00 15.96 ? 214  GLU A CA  1 
ATOM   1662 C  C   . GLU A 1 214 ? 19.131  2.126   33.458  1.00 15.24 ? 214  GLU A C   1 
ATOM   1663 O  O   . GLU A 1 214 ? 18.845  3.319   33.553  1.00 16.08 ? 214  GLU A O   1 
ATOM   1664 C  CB  . GLU A 1 214 ? 21.575  2.572   33.434  1.00 18.87 ? 214  GLU A CB  1 
ATOM   1665 C  CG  . GLU A 1 214 ? 22.977  2.071   33.137  1.00 21.89 ? 214  GLU A CG  1 
ATOM   1666 C  CD  . GLU A 1 214 ? 24.067  2.909   33.772  1.00 23.77 ? 214  GLU A CD  1 
ATOM   1667 O  OE1 . GLU A 1 214 ? 23.766  3.753   34.643  1.00 24.81 ? 214  GLU A OE1 1 
ATOM   1668 O  OE2 . GLU A 1 214 ? 25.241  2.706   33.389  1.00 25.31 ? 214  GLU A OE2 1 
ATOM   1669 N  N   . PRO A 1 215 ? 18.360  1.156   33.910  1.00 15.11 ? 215  PRO A N   1 
ATOM   1670 C  CA  . PRO A 1 215 ? 17.075  1.421   34.534  1.00 14.54 ? 215  PRO A CA  1 
ATOM   1671 C  C   . PRO A 1 215 ? 17.189  2.280   35.786  1.00 14.50 ? 215  PRO A C   1 
ATOM   1672 O  O   . PRO A 1 215 ? 18.229  2.335   36.458  1.00 15.05 ? 215  PRO A O   1 
ATOM   1673 C  CB  . PRO A 1 215 ? 16.499  0.049   34.847  1.00 15.61 ? 215  PRO A CB  1 
ATOM   1674 C  CG  . PRO A 1 215 ? 17.197  -0.885  33.926  1.00 16.12 ? 215  PRO A CG  1 
ATOM   1675 C  CD  . PRO A 1 215 ? 18.559  -0.293  33.670  1.00 15.87 ? 215  PRO A CD  1 
ATOM   1676 N  N   . ILE A 1 216 ? 16.111  2.998   36.089  1.00 13.51 ? 216  ILE A N   1 
ATOM   1677 C  CA  . ILE A 1 216 ? 15.991  3.692   37.379  1.00 13.70 ? 216  ILE A CA  1 
ATOM   1678 C  C   . ILE A 1 216 ? 15.194  2.823   38.331  1.00 13.81 ? 216  ILE A C   1 
ATOM   1679 O  O   . ILE A 1 216 ? 14.003  2.604   38.098  1.00 13.74 ? 216  ILE A O   1 
ATOM   1680 C  CB  . ILE A 1 216 ? 15.245  5.037   37.205  1.00 13.06 ? 216  ILE A CB  1 
ATOM   1681 C  CG1 . ILE A 1 216 ? 15.974  5.926   36.197  1.00 13.84 ? 216  ILE A CG1 1 
ATOM   1682 C  CG2 . ILE A 1 216 ? 15.089  5.716   38.566  1.00 13.58 ? 216  ILE A CG2 1 
ATOM   1683 C  CD1 . ILE A 1 216 ? 15.214  7.171   35.780  1.00 13.85 ? 216  ILE A CD1 1 
ATOM   1684 N  N   . PRO A 1 217 ? 15.798  2.338   39.413  1.00 14.35 ? 217  PRO A N   1 
ATOM   1685 C  CA  . PRO A 1 217 ? 15.073  1.546   40.385  1.00 14.35 ? 217  PRO A CA  1 
ATOM   1686 C  C   . PRO A 1 217 ? 13.991  2.374   41.058  1.00 13.74 ? 217  PRO A C   1 
ATOM   1687 O  O   . PRO A 1 217 ? 14.207  3.562   41.327  1.00 12.53 ? 217  PRO A O   1 
ATOM   1688 C  CB  . PRO A 1 217 ? 16.119  1.078   41.391  1.00 15.03 ? 217  PRO A CB  1 
ATOM   1689 C  CG  . PRO A 1 217 ? 17.344  1.861   41.117  1.00 16.06 ? 217  PRO A CG  1 
ATOM   1690 C  CD  . PRO A 1 217 ? 17.200  2.586   39.804  1.00 14.57 ? 217  PRO A CD  1 
ATOM   1691 N  N   . ILE A 1 218 ? 12.867  1.745   41.400  1.00 13.13 ? 218  ILE A N   1 
ATOM   1692 C  CA  . ILE A 1 218 ? 11.749  2.469   41.985  1.00 13.66 ? 218  ILE A CA  1 
ATOM   1693 C  C   . ILE A 1 218 ? 12.137  3.203   43.261  1.00 13.81 ? 218  ILE A C   1 
ATOM   1694 O  O   . ILE A 1 218 ? 11.663  4.327   43.482  1.00 13.50 ? 218  ILE A O   1 
ATOM   1695 C  CB  . ILE A 1 218 ? 10.509  1.579   42.198  1.00 13.79 ? 218  ILE A CB  1 
ATOM   1696 C  CG1 . ILE A 1 218 ? 9.304   2.458   42.528  1.00 14.32 ? 218  ILE A CG1 1 
ATOM   1697 C  CG2 . ILE A 1 218 ? 10.754  0.536   43.284  1.00 14.32 ? 218  ILE A CG2 1 
ATOM   1698 C  CD1 . ILE A 1 218 ? 7.945   1.833   42.342  1.00 15.07 ? 218  ILE A CD1 1 
ATOM   1699 N  N   . SER A 1 219 ? 13.065  2.683   44.064  1.00 15.30 ? 219  SER A N   1 
ATOM   1700 C  CA  . SER A 1 219 ? 13.501  3.405   45.257  1.00 15.08 ? 219  SER A CA  1 
ATOM   1701 C  C   . SER A 1 219 ? 14.174  4.732   44.967  1.00 15.40 ? 219  SER A C   1 
ATOM   1702 O  O   . SER A 1 219 ? 14.204  5.601   45.855  1.00 14.48 ? 219  SER A O   1 
ATOM   1703 C  CB  . SER A 1 219 ? 14.428  2.511   46.096  1.00 15.88 ? 219  SER A CB  1 
ATOM   1704 O  OG  . SER A 1 219 ? 15.650  2.301   45.421  1.00 17.44 ? 219  SER A OG  1 
ATOM   1705 N  N   . LYS A 1 220 ? 14.705  4.950   43.769  1.00 15.11 ? 220  LYS A N   1 
ATOM   1706 C  CA  . LYS A 1 220 ? 15.359  6.181   43.380  1.00 15.12 ? 220  LYS A CA  1 
ATOM   1707 C  C   . LYS A 1 220 ? 14.485  7.040   42.467  1.00 13.42 ? 220  LYS A C   1 
ATOM   1708 O  O   . LYS A 1 220 ? 14.899  8.141   42.120  1.00 12.86 ? 220  LYS A O   1 
ATOM   1709 C  CB  . LYS A 1 220 ? 16.657  5.899   42.607  1.00 16.49 ? 220  LYS A CB  1 
ATOM   1710 C  CG  . LYS A 1 220 ? 17.637  4.993   43.335  1.00 19.49 ? 220  LYS A CG  1 
ATOM   1711 C  CD  . LYS A 1 220 ? 18.237  5.703   44.538  1.00 21.86 ? 220  LYS A CD  1 
ATOM   1712 C  CE  . LYS A 1 220 ? 19.220  4.803   45.274  1.00 23.19 ? 220  LYS A CE  1 
ATOM   1713 N  NZ  . LYS A 1 220 ? 19.578  5.369   46.606  1.00 24.33 ? 220  LYS A NZ  1 
ATOM   1714 N  N   . ALA A 1 221 ? 13.291  6.562   42.130  1.00 12.47 ? 221  ALA A N   1 
ATOM   1715 C  CA  . ALA A 1 221 ? 12.458  7.298   41.170  1.00 12.40 ? 221  ALA A CA  1 
ATOM   1716 C  C   . ALA A 1 221 ? 12.146  8.706   41.636  1.00 12.90 ? 221  ALA A C   1 
ATOM   1717 O  O   . ALA A 1 221 ? 12.178  9.650   40.844  1.00 12.01 ? 221  ALA A O   1 
ATOM   1718 C  CB  . ALA A 1 221 ? 11.171  6.543   40.883  1.00 12.31 ? 221  ALA A CB  1 
ATOM   1719 N  N   . HIS A 1 222 ? 11.883  8.915   42.925  1.00 12.70 ? 222  HIS A N   1 
ATOM   1720 C  CA  . HIS A 1 222 ? 11.571  10.257  43.424  1.00 13.83 ? 222  HIS A CA  1 
ATOM   1721 C  C   . HIS A 1 222 ? 12.694  11.259  43.224  1.00 14.30 ? 222  HIS A C   1 
ATOM   1722 O  O   . HIS A 1 222 ? 12.451  12.469  43.154  1.00 14.60 ? 222  HIS A O   1 
ATOM   1723 C  CB  . HIS A 1 222 ? 11.195  10.170  44.913  1.00 14.92 ? 222  HIS A CB  1 
ATOM   1724 C  CG  . HIS A 1 222 ? 12.398  9.985   45.784  1.00 15.55 ? 222  HIS A CG  1 
ATOM   1725 N  ND1 . HIS A 1 222 ? 13.078  8.804   45.946  1.00 15.85 ? 222  HIS A ND1 1 
ATOM   1726 C  CD2 . HIS A 1 222 ? 13.030  10.906  46.552  1.00 16.12 ? 222  HIS A CD2 1 
ATOM   1727 C  CE1 . HIS A 1 222 ? 14.086  8.980   46.777  1.00 16.55 ? 222  HIS A CE1 1 
ATOM   1728 N  NE2 . HIS A 1 222 ? 14.069  10.243  47.146  1.00 16.87 ? 222  HIS A NE2 1 
ATOM   1729 N  N   . GLU A 1 223 ? 13.950  10.827  43.084  1.00 13.99 ? 223  GLU A N   1 
ATOM   1730 C  CA  . GLU A 1 223 ? 15.063  11.708  42.788  1.00 14.88 ? 223  GLU A CA  1 
ATOM   1731 C  C   . GLU A 1 223 ? 14.964  12.391  41.428  1.00 14.97 ? 223  GLU A C   1 
ATOM   1732 O  O   . GLU A 1 223 ? 15.661  13.382  41.195  1.00 15.45 ? 223  GLU A O   1 
ATOM   1733 C  CB  . GLU A 1 223 ? 16.390  10.933  42.837  1.00 15.64 ? 223  GLU A CB  1 
ATOM   1734 C  CG  . GLU A 1 223 ? 16.626  10.303  44.206  1.00 18.53 ? 223  GLU A CG  1 
ATOM   1735 C  CD  . GLU A 1 223 ? 17.982  9.634   44.335  1.00 20.38 ? 223  GLU A CD  1 
ATOM   1736 O  OE1 . GLU A 1 223 ? 18.841  9.800   43.446  1.00 22.60 ? 223  GLU A OE1 1 
ATOM   1737 O  OE2 . GLU A 1 223 ? 18.165  8.935   45.354  1.00 22.84 ? 223  GLU A OE2 1 
ATOM   1738 N  N   . HIS A 1 224 ? 14.181  11.845  40.505  1.00 13.57 ? 224  HIS A N   1 
ATOM   1739 C  CA  . HIS A 1 224 ? 14.180  12.290  39.125  1.00 13.86 ? 224  HIS A CA  1 
ATOM   1740 C  C   . HIS A 1 224 ? 12.924  13.076  38.779  1.00 13.72 ? 224  HIS A C   1 
ATOM   1741 O  O   . HIS A 1 224 ? 12.719  13.387  37.604  1.00 14.56 ? 224  HIS A O   1 
ATOM   1742 C  CB  . HIS A 1 224 ? 14.240  11.059  38.202  1.00 14.09 ? 224  HIS A CB  1 
ATOM   1743 C  CG  . HIS A 1 224 ? 15.514  10.287  38.365  1.00 15.93 ? 224  HIS A CG  1 
ATOM   1744 N  ND1 . HIS A 1 224 ? 16.586  10.441  37.514  1.00 16.27 ? 224  HIS A ND1 1 
ATOM   1745 C  CD2 . HIS A 1 224 ? 15.877  9.362   39.275  1.00 15.93 ? 224  HIS A CD2 1 
ATOM   1746 C  CE1 . HIS A 1 224 ? 17.565  9.639   37.903  1.00 17.24 ? 224  HIS A CE1 1 
ATOM   1747 N  NE2 . HIS A 1 224 ? 17.162  8.975   38.972  1.00 16.92 ? 224  HIS A NE2 1 
ATOM   1748 N  N   . ILE A 1 225 ? 12.075  13.360  39.762  1.00 12.97 ? 225  ILE A N   1 
ATOM   1749 C  CA  . ILE A 1 225 ? 10.818  14.065  39.473  1.00 12.43 ? 225  ILE A CA  1 
ATOM   1750 C  C   . ILE A 1 225 ? 10.914  15.510  39.925  1.00 12.23 ? 225  ILE A C   1 
ATOM   1751 O  O   . ILE A 1 225 ? 10.956  15.818  41.121  1.00 12.29 ? 225  ILE A O   1 
ATOM   1752 C  CB  . ILE A 1 225 ? 9.625   13.316  40.097  1.00 13.29 ? 225  ILE A CB  1 
ATOM   1753 C  CG1 . ILE A 1 225 ? 9.571   11.919  39.448  1.00 14.66 ? 225  ILE A CG1 1 
ATOM   1754 C  CG2 . ILE A 1 225 ? 8.322   14.074  39.905  1.00 13.04 ? 225  ILE A CG2 1 
ATOM   1755 C  CD1 . ILE A 1 225 ? 8.510   10.988  39.953  1.00 15.13 ? 225  ILE A CD1 1 
ATOM   1756 N  N   . PHE A 1 226 ? 10.940  16.439  38.965  1.00 10.78 ? 226  PHE A N   1 
ATOM   1757 C  CA  . PHE A 1 226 ? 11.216  17.840  39.278  1.00 10.47 ? 226  PHE A CA  1 
ATOM   1758 C  C   . PHE A 1 226 ? 9.998   18.582  39.787  1.00 10.46 ? 226  PHE A C   1 
ATOM   1759 O  O   . PHE A 1 226 ? 10.025  19.264  40.815  1.00 9.72  ? 226  PHE A O   1 
ATOM   1760 C  CB  . PHE A 1 226 ? 11.792  18.533  38.032  1.00 10.70 ? 226  PHE A CB  1 
ATOM   1761 C  CG  . PHE A 1 226 ? 11.970  20.019  38.185  1.00 11.05 ? 226  PHE A CG  1 
ATOM   1762 C  CD1 . PHE A 1 226 ? 13.133  20.521  38.749  1.00 11.79 ? 226  PHE A CD1 1 
ATOM   1763 C  CD2 . PHE A 1 226 ? 11.004  20.907  37.745  1.00 11.80 ? 226  PHE A CD2 1 
ATOM   1764 C  CE1 . PHE A 1 226 ? 13.312  21.886  38.895  1.00 12.14 ? 226  PHE A CE1 1 
ATOM   1765 C  CE2 . PHE A 1 226 ? 11.173  22.273  37.895  1.00 12.12 ? 226  PHE A CE2 1 
ATOM   1766 C  CZ  . PHE A 1 226 ? 12.339  22.760  38.462  1.00 12.33 ? 226  PHE A CZ  1 
ATOM   1767 N  N   . GLY A 1 227 ? 8.879   18.419  39.079  1.00 10.31 ? 227  GLY A N   1 
ATOM   1768 C  CA  . GLY A 1 227 ? 7.729   19.272  39.379  1.00 9.86  ? 227  GLY A CA  1 
ATOM   1769 C  C   . GLY A 1 227 ? 6.646   19.007  38.340  1.00 10.60 ? 227  GLY A C   1 
ATOM   1770 O  O   . GLY A 1 227 ? 6.857   18.224  37.415  1.00 10.39 ? 227  GLY A O   1 
ATOM   1771 N  N   . MET A 1 228 ? 5.520   19.676  38.535  1.00 9.75  ? 228  MET A N   1 
ATOM   1772 C  CA  . MET A 1 228 ? 4.312   19.364  37.789  1.00 9.43  ? 228  MET A CA  1 
ATOM   1773 C  C   . MET A 1 228 ? 3.660   20.568  37.125  1.00 9.78  ? 228  MET A C   1 
ATOM   1774 O  O   . MET A 1 228 ? 3.809   21.715  37.537  1.00 10.17 ? 228  MET A O   1 
ATOM   1775 C  CB  . MET A 1 228 ? 3.263   18.768  38.749  1.00 10.23 ? 228  MET A CB  1 
ATOM   1776 C  CG  . MET A 1 228 ? 3.689   17.421  39.318  1.00 11.44 ? 228  MET A CG  1 
ATOM   1777 S  SD  . MET A 1 228 ? 2.385   16.651  40.281  1.00 11.80 ? 228  MET A SD  1 
ATOM   1778 C  CE  . MET A 1 228 ? 1.321   16.090  38.947  1.00 13.49 ? 228  MET A CE  1 
ATOM   1779 N  N   . VAL A 1 229 ? 2.899   20.272  36.069  1.00 8.56  ? 229  VAL A N   1 
ATOM   1780 C  CA  . VAL A 1 229 ? 2.079   21.254  35.375  1.00 8.83  ? 229  VAL A CA  1 
ATOM   1781 C  C   . VAL A 1 229 ? 0.699   20.653  35.092  1.00 9.31  ? 229  VAL A C   1 
ATOM   1782 O  O   . VAL A 1 229 ? 0.524   19.439  35.177  1.00 10.63 ? 229  VAL A O   1 
ATOM   1783 C  CB  . VAL A 1 229 ? 2.656   21.739  34.029  1.00 8.73  ? 229  VAL A CB  1 
ATOM   1784 C  CG1 . VAL A 1 229 ? 3.916   22.582  34.231  1.00 8.60  ? 229  VAL A CG1 1 
ATOM   1785 C  CG2 . VAL A 1 229 ? 2.953   20.570  33.094  1.00 9.61  ? 229  VAL A CG2 1 
ATOM   1786 N  N   . LEU A 1 230 ? -0.259  21.505  34.754  1.00 9.16  ? 230  LEU A N   1 
ATOM   1787 C  CA  . LEU A 1 230 ? -1.547  21.066  34.230  1.00 8.73  ? 230  LEU A CA  1 
ATOM   1788 C  C   . LEU A 1 230 ? -1.456  20.798  32.729  1.00 9.84  ? 230  LEU A C   1 
ATOM   1789 O  O   . LEU A 1 230 ? -0.638  21.439  32.076  1.00 10.36 ? 230  LEU A O   1 
ATOM   1790 C  CB  . LEU A 1 230 ? -2.583  22.175  34.439  1.00 8.89  ? 230  LEU A CB  1 
ATOM   1791 C  CG  . LEU A 1 230 ? -2.774  22.673  35.877  1.00 9.45  ? 230  LEU A CG  1 
ATOM   1792 C  CD1 . LEU A 1 230 ? -3.578  23.970  35.843  1.00 9.71  ? 230  LEU A CD1 1 
ATOM   1793 C  CD2 . LEU A 1 230 ? -3.472  21.630  36.733  1.00 11.01 ? 230  LEU A CD2 1 
ATOM   1794 N  N   . MET A 1 231 ? -2.310  19.918  32.211  1.00 9.34  ? 231  MET A N   1 
ATOM   1795 C  CA  . MET A 1 231 ? -2.261  19.617  30.775  1.00 9.32  ? 231  MET A CA  1 
ATOM   1796 C  C   . MET A 1 231 ? -3.664  19.426  30.217  1.00 9.69  ? 231  MET A C   1 
ATOM   1797 O  O   . MET A 1 231 ? -4.517  18.833  30.874  1.00 9.39  ? 231  MET A O   1 
ATOM   1798 C  CB  . MET A 1 231 ? -1.430  18.349  30.516  1.00 10.15 ? 231  MET A CB  1 
ATOM   1799 C  CG  . MET A 1 231 ? -1.481  17.862  29.069  1.00 11.21 ? 231  MET A CG  1 
ATOM   1800 S  SD  . MET A 1 231 ? -0.415  16.432  28.781  1.00 12.24 ? 231  MET A SD  1 
ATOM   1801 C  CE  . MET A 1 231 ? 1.181   17.196  28.707  1.00 12.65 ? 231  MET A CE  1 
ATOM   1802 N  N   . ASN A 1 232 ? -3.890  19.923  28.990  1.00 9.15  ? 232  ASN A N   1 
ATOM   1803 C  CA  . ASN A 1 232 ? -5.084  19.547  28.233  1.00 9.12  ? 232  ASN A CA  1 
ATOM   1804 C  C   . ASN A 1 232 ? -4.634  18.812  26.971  1.00 9.60  ? 232  ASN A C   1 
ATOM   1805 O  O   . ASN A 1 232 ? -4.084  19.413  26.042  1.00 9.46  ? 232  ASN A O   1 
ATOM   1806 C  CB  . ASN A 1 232 ? -5.913  20.787  27.881  1.00 9.34  ? 232  ASN A CB  1 
ATOM   1807 C  CG  . ASN A 1 232 ? -7.208  20.440  27.167  1.00 9.63  ? 232  ASN A CG  1 
ATOM   1808 O  OD1 . ASN A 1 232 ? -7.411  19.311  26.726  1.00 11.10 ? 232  ASN A OD1 1 
ATOM   1809 N  ND2 . ASN A 1 232 ? -8.086  21.438  27.036  1.00 9.43  ? 232  ASN A ND2 1 
ATOM   1810 N  N   . ASP A 1 233 ? -4.834  17.488  26.959  1.00 9.41  ? 233  ASP A N   1 
ATOM   1811 C  CA  . ASP A 1 233 ? -4.491  16.727  25.762  1.00 10.29 ? 233  ASP A CA  1 
ATOM   1812 C  C   . ASP A 1 233 ? -5.654  16.738  24.771  1.00 9.47  ? 233  ASP A C   1 
ATOM   1813 O  O   . ASP A 1 233 ? -6.485  15.823  24.746  1.00 9.92  ? 233  ASP A O   1 
ATOM   1814 C  CB  . ASP A 1 233 ? -4.092  15.293  26.100  1.00 11.69 ? 233  ASP A CB  1 
ATOM   1815 C  CG  . ASP A 1 233 ? -3.643  14.546  24.880  1.00 12.29 ? 233  ASP A CG  1 
ATOM   1816 O  OD1 . ASP A 1 233 ? -3.261  15.082  23.842  1.00 11.91 ? 233  ASP A OD1 1 
ATOM   1817 O  OD2 . ASP A 1 233 ? -3.621  13.316  24.822  1.00 14.46 ? 233  ASP A OD2 1 
ATOM   1818 N  N   . TRP A 1 234 ? -5.680  17.793  23.954  1.00 9.11  ? 234  TRP A N   1 
ATOM   1819 C  CA  . TRP A 1 234 ? -6.787  17.945  23.004  1.00 9.17  ? 234  TRP A CA  1 
ATOM   1820 C  C   . TRP A 1 234 ? -6.876  16.717  22.108  1.00 8.85  ? 234  TRP A C   1 
ATOM   1821 O  O   . TRP A 1 234 ? -5.855  16.179  21.676  1.00 9.51  ? 234  TRP A O   1 
ATOM   1822 C  CB  . TRP A 1 234 ? -6.583  19.188  22.148  1.00 9.18  ? 234  TRP A CB  1 
ATOM   1823 C  CG  . TRP A 1 234 ? -6.396  20.458  22.922  1.00 9.29  ? 234  TRP A CG  1 
ATOM   1824 C  CD1 . TRP A 1 234 ? -5.203  20.999  23.314  1.00 9.21  ? 234  TRP A CD1 1 
ATOM   1825 C  CD2 . TRP A 1 234 ? -7.421  21.347  23.386  1.00 9.41  ? 234  TRP A CD2 1 
ATOM   1826 N  NE1 . TRP A 1 234 ? -5.438  22.172  23.990  1.00 9.33  ? 234  TRP A NE1 1 
ATOM   1827 C  CE2 . TRP A 1 234 ? -6.783  22.416  24.039  1.00 9.91  ? 234  TRP A CE2 1 
ATOM   1828 C  CE3 . TRP A 1 234 ? -8.815  21.352  23.281  1.00 10.26 ? 234  TRP A CE3 1 
ATOM   1829 C  CZ2 . TRP A 1 234 ? -7.488  23.476  24.605  1.00 10.49 ? 234  TRP A CZ2 1 
ATOM   1830 C  CZ3 . TRP A 1 234 ? -9.514  22.412  23.841  1.00 10.44 ? 234  TRP A CZ3 1 
ATOM   1831 C  CH2 . TRP A 1 234 ? -8.855  23.462  24.502  1.00 9.88  ? 234  TRP A CH2 1 
ATOM   1832 N  N   . SER A 1 235 ? -8.103  16.274  21.822  1.00 9.21  ? 235  SER A N   1 
ATOM   1833 C  CA  . SER A 1 235 ? -8.301  14.977  21.187  1.00 9.63  ? 235  SER A CA  1 
ATOM   1834 C  C   . SER A 1 235 ? -9.340  15.063  20.071  1.00 10.29 ? 235  SER A C   1 
ATOM   1835 O  O   . SER A 1 235 ? -10.413 15.625  20.283  1.00 11.65 ? 235  SER A O   1 
ATOM   1836 C  CB  . SER A 1 235 ? -8.803  13.955  22.225  1.00 10.80 ? 235  SER A CB  1 
ATOM   1837 O  OG  . SER A 1 235 ? -7.806  13.769  23.227  1.00 10.60 ? 235  SER A OG  1 
ATOM   1838 N  N   . ALA A 1 236 ? -9.014  14.533  18.900  1.00 10.06 ? 236  ALA A N   1 
ATOM   1839 C  CA  . ALA A 1 236 ? -9.983  14.451  17.799  1.00 9.82  ? 236  ALA A CA  1 
ATOM   1840 C  C   . ALA A 1 236 ? -10.481 13.010  17.698  1.00 10.20 ? 236  ALA A C   1 
ATOM   1841 O  O   . ALA A 1 236 ? -9.816  12.150  17.114  1.00 11.02 ? 236  ALA A O   1 
ATOM   1842 C  CB  . ALA A 1 236 ? -9.322  14.912  16.511  1.00 10.31 ? 236  ALA A CB  1 
ATOM   1843 N  N   . ARG A 1 237 ? -11.631 12.713  18.316  1.00 10.68 ? 237  ARG A N   1 
ATOM   1844 C  CA  . ARG A 1 237 ? -11.941 11.316  18.630  1.00 11.77 ? 237  ARG A CA  1 
ATOM   1845 C  C   . ARG A 1 237 ? -12.321 10.494  17.406  1.00 11.53 ? 237  ARG A C   1 
ATOM   1846 O  O   . ARG A 1 237 ? -12.087 9.289   17.398  1.00 11.75 ? 237  ARG A O   1 
ATOM   1847 C  CB  . ARG A 1 237 ? -13.106 11.270  19.626  1.00 13.57 ? 237  ARG A CB  1 
ATOM   1848 C  CG  . ARG A 1 237 ? -12.840 12.140  20.852  1.00 16.30 ? 237  ARG A CG  1 
ATOM   1849 C  CD  . ARG A 1 237 ? -12.573 11.251  22.032  1.00 17.66 ? 237  ARG A CD  1 
ATOM   1850 N  NE  . ARG A 1 237 ? -12.288 11.969  23.276  1.00 17.47 ? 237  ARG A NE  1 
ATOM   1851 C  CZ  . ARG A 1 237 ? -11.294 11.521  24.046  1.00 17.46 ? 237  ARG A CZ  1 
ATOM   1852 N  NH1 . ARG A 1 237 ? -10.598 10.458  23.655  1.00 17.21 ? 237  ARG A NH1 1 
ATOM   1853 N  NH2 . ARG A 1 237 ? -11.034 12.140  25.184  1.00 15.77 ? 237  ARG A NH2 1 
ATOM   1854 N  N   . ASP A 1 238 ? -12.977 11.136  16.443  1.00 12.24 ? 238  ASP A N   1 
ATOM   1855 C  CA  . ASP A 1 238 ? -13.313 10.462  15.190  1.00 11.63 ? 238  ASP A CA  1 
ATOM   1856 C  C   . ASP A 1 238 ? -12.079 10.152  14.355  1.00 11.06 ? 238  ASP A C   1 
ATOM   1857 O  O   . ASP A 1 238 ? -11.996 9.090   13.724  1.00 12.12 ? 238  ASP A O   1 
ATOM   1858 C  CB  . ASP A 1 238 ? -14.352 11.260  14.404  1.00 12.73 ? 238  ASP A CB  1 
ATOM   1859 C  CG  . ASP A 1 238 ? -14.156 12.739  14.251  1.00 14.79 ? 238  ASP A CG  1 
ATOM   1860 O  OD1 . ASP A 1 238 ? -13.350 13.370  14.974  1.00 16.24 ? 238  ASP A OD1 1 
ATOM   1861 O  OD2 . ASP A 1 238 ? -14.801 13.360  13.369  1.00 14.67 ? 238  ASP A OD2 1 
ATOM   1862 N  N   . ILE A 1 239 ? -11.103 11.054  14.343  1.00 10.47 ? 239  ILE A N   1 
ATOM   1863 C  CA  . ILE A 1 239 ? -9.828  10.780  13.685  1.00 10.53 ? 239  ILE A CA  1 
ATOM   1864 C  C   . ILE A 1 239 ? -9.104  9.661   14.423  1.00 10.94 ? 239  ILE A C   1 
ATOM   1865 O  O   . ILE A 1 239 ? -8.624  8.689   13.828  1.00 11.05 ? 239  ILE A O   1 
ATOM   1866 C  CB  . ILE A 1 239 ? -8.963  12.047  13.610  1.00 10.33 ? 239  ILE A CB  1 
ATOM   1867 C  CG1 . ILE A 1 239 ? -9.572  13.055  12.616  1.00 11.49 ? 239  ILE A CG1 1 
ATOM   1868 C  CG2 . ILE A 1 239 ? -7.531  11.726  13.209  1.00 10.34 ? 239  ILE A CG2 1 
ATOM   1869 C  CD1 . ILE A 1 239 ? -8.862  14.401  12.673  1.00 13.59 ? 239  ILE A CD1 1 
ATOM   1870 N  N   . GLN A 1 240 ? -9.048  9.779   15.751  1.00 11.10 ? 240  GLN A N   1 
ATOM   1871 C  CA  . GLN A 1 240 ? -8.408  8.741   16.557  1.00 12.50 ? 240  GLN A CA  1 
ATOM   1872 C  C   . GLN A 1 240 ? -9.005  7.362   16.330  1.00 12.05 ? 240  GLN A C   1 
ATOM   1873 O  O   . GLN A 1 240 ? -8.284  6.377   16.119  1.00 11.65 ? 240  GLN A O   1 
ATOM   1874 C  CB  . GLN A 1 240 ? -8.491  9.113   18.036  1.00 14.34 ? 240  GLN A CB  1 
ATOM   1875 C  CG  . GLN A 1 240 ? -7.737  8.164   18.962  1.00 18.35 ? 240  GLN A CG  1 
ATOM   1876 C  CD  . GLN A 1 240 ? -7.771  8.661   20.401  1.00 21.36 ? 240  GLN A CD  1 
ATOM   1877 O  OE1 . GLN A 1 240 ? -8.383  9.682   20.730  1.00 23.91 ? 240  GLN A OE1 1 
ATOM   1878 N  NE2 . GLN A 1 240 ? -7.114  7.937   21.294  1.00 23.13 ? 240  GLN A NE2 1 
ATOM   1879 N  N   . GLN A 1 241 ? -10.338 7.275   16.341  1.00 12.07 ? 241  GLN A N   1 
ATOM   1880 C  CA  . GLN A 1 241 ? -10.986 5.966   16.268  1.00 13.32 ? 241  GLN A CA  1 
ATOM   1881 C  C   . GLN A 1 241 ? -10.621 5.202   15.004  1.00 12.09 ? 241  GLN A C   1 
ATOM   1882 O  O   . GLN A 1 241 ? -10.392 3.993   15.071  1.00 12.02 ? 241  GLN A O   1 
ATOM   1883 C  CB  . GLN A 1 241 ? -12.507 6.106   16.384  1.00 16.15 ? 241  GLN A CB  1 
ATOM   1884 C  CG  . GLN A 1 241 ? -13.224 4.768   16.458  1.00 20.65 ? 241  GLN A CG  1 
ATOM   1885 C  CD  . GLN A 1 241 ? -12.899 3.965   17.698  1.00 23.68 ? 241  GLN A CD  1 
ATOM   1886 O  OE1 . GLN A 1 241 ? -12.691 4.485   18.798  1.00 25.95 ? 241  GLN A OE1 1 
ATOM   1887 N  NE2 . GLN A 1 241 ? -12.848 2.644   17.541  1.00 25.62 ? 241  GLN A NE2 1 
ATOM   1888 N  N   . TRP A 1 242 ? -10.522 5.891   13.869  1.00 10.95 ? 242  TRP A N   1 
ATOM   1889 C  CA  . TRP A 1 242 ? -10.219 5.237   12.605  1.00 10.16 ? 242  TRP A CA  1 
ATOM   1890 C  C   . TRP A 1 242 ? -8.744  4.866   12.479  1.00 10.25 ? 242  TRP A C   1 
ATOM   1891 O  O   . TRP A 1 242 ? -8.416  3.851   11.863  1.00 10.75 ? 242  TRP A O   1 
ATOM   1892 C  CB  . TRP A 1 242 ? -10.680 6.141   11.460  1.00 9.83  ? 242  TRP A CB  1 
ATOM   1893 C  CG  . TRP A 1 242 ? -10.342 5.738   10.064  1.00 9.81  ? 242  TRP A CG  1 
ATOM   1894 C  CD1 . TRP A 1 242 ? -9.739  6.558   9.141   1.00 9.78  ? 242  TRP A CD1 1 
ATOM   1895 C  CD2 . TRP A 1 242 ? -10.556 4.486   9.408   1.00 10.43 ? 242  TRP A CD2 1 
ATOM   1896 N  NE1 . TRP A 1 242 ? -9.580  5.887   7.949   1.00 10.37 ? 242  TRP A NE1 1 
ATOM   1897 C  CE2 . TRP A 1 242 ? -10.069 4.613   8.090   1.00 10.28 ? 242  TRP A CE2 1 
ATOM   1898 C  CE3 . TRP A 1 242 ? -11.103 3.267   9.810   1.00 10.41 ? 242  TRP A CE3 1 
ATOM   1899 C  CZ2 . TRP A 1 242 ? -10.112 3.569   7.163   1.00 10.54 ? 242  TRP A CZ2 1 
ATOM   1900 C  CZ3 . TRP A 1 242 ? -11.162 2.229   8.892   1.00 10.59 ? 242  TRP A CZ3 1 
ATOM   1901 C  CH2 . TRP A 1 242 ? -10.667 2.386   7.583   1.00 10.77 ? 242  TRP A CH2 1 
ATOM   1902 N  N   . GLU A 1 243 ? -7.856  5.652   13.083  1.00 9.62  ? 243  GLU A N   1 
ATOM   1903 C  CA  . GLU A 1 243 ? -6.432  5.441   12.889  1.00 9.93  ? 243  GLU A CA  1 
ATOM   1904 C  C   . GLU A 1 243 ? -5.768  4.494   13.880  1.00 10.59 ? 243  GLU A C   1 
ATOM   1905 O  O   . GLU A 1 243 ? -4.715  3.954   13.530  1.00 10.00 ? 243  GLU A O   1 
ATOM   1906 C  CB  . GLU A 1 243 ? -5.688  6.788   12.967  1.00 9.49  ? 243  GLU A CB  1 
ATOM   1907 C  CG  . GLU A 1 243 ? -5.447  7.247   14.403  1.00 10.14 ? 243  GLU A CG  1 
ATOM   1908 C  CD  . GLU A 1 243 ? -4.864  8.632   14.541  1.00 11.15 ? 243  GLU A CD  1 
ATOM   1909 O  OE1 . GLU A 1 243 ? -4.330  9.187   13.562  1.00 10.66 ? 243  GLU A OE1 1 
ATOM   1910 O  OE2 . GLU A 1 243 ? -4.948  9.158   15.675  1.00 10.58 ? 243  GLU A OE2 1 
ATOM   1911 N  N   . TYR A 1 244 ? -6.317  4.304   15.083  1.00 11.02 ? 244  TYR A N   1 
ATOM   1912 C  CA  . TYR A 1 244 ? -5.431  3.946   16.202  1.00 12.14 ? 244  TYR A CA  1 
ATOM   1913 C  C   . TYR A 1 244 ? -5.192  2.461   16.390  1.00 12.49 ? 244  TYR A C   1 
ATOM   1914 O  O   . TYR A 1 244 ? -4.282  2.120   17.162  1.00 12.89 ? 244  TYR A O   1 
ATOM   1915 C  CB  . TYR A 1 244 ? -5.941  4.594   17.497  1.00 12.67 ? 244  TYR A CB  1 
ATOM   1916 C  CG  . TYR A 1 244 ? -6.964  3.778   18.253  1.00 14.37 ? 244  TYR A CG  1 
ATOM   1917 C  CD1 . TYR A 1 244 ? -6.635  3.185   19.467  1.00 15.44 ? 244  TYR A CD1 1 
ATOM   1918 C  CD2 . TYR A 1 244 ? -8.242  3.589   17.749  1.00 14.49 ? 244  TYR A CD2 1 
ATOM   1919 C  CE1 . TYR A 1 244 ? -7.566  2.428   20.155  1.00 16.99 ? 244  TYR A CE1 1 
ATOM   1920 C  CE2 . TYR A 1 244 ? -9.176  2.840   18.432  1.00 16.12 ? 244  TYR A CE2 1 
ATOM   1921 C  CZ  . TYR A 1 244 ? -8.830  2.265   19.637  1.00 16.75 ? 244  TYR A CZ  1 
ATOM   1922 O  OH  . TYR A 1 244 ? -9.771  1.511   20.302  1.00 18.93 ? 244  TYR A OH  1 
ATOM   1923 N  N   . VAL A 1 245 ? -5.933  1.562   15.761  1.00 13.64 ? 245  VAL A N   1 
ATOM   1924 C  CA  . VAL A 1 245 ? -5.541  0.141   15.774  1.00 13.58 ? 245  VAL A CA  1 
ATOM   1925 C  C   . VAL A 1 245 ? -4.683  -0.151  14.559  1.00 13.19 ? 245  VAL A C   1 
ATOM   1926 O  O   . VAL A 1 245 ? -5.046  0.200   13.437  1.00 13.31 ? 245  VAL A O   1 
ATOM   1927 C  CB  . VAL A 1 245 ? -6.815  -0.717  15.811  1.00 14.65 ? 245  VAL A CB  1 
ATOM   1928 C  CG1 . VAL A 1 245 ? -6.497  -2.201  15.828  1.00 15.49 ? 245  VAL A CG1 1 
ATOM   1929 C  CG2 . VAL A 1 245 ? -7.648  -0.352  17.044  1.00 14.74 ? 245  VAL A CG2 1 
ATOM   1930 N  N   . PRO A 1 246 ? -3.501  -0.733  14.743  1.00 12.86 ? 246  PRO A N   1 
ATOM   1931 C  CA  . PRO A 1 246 ? -3.042  -1.273  15.999  1.00 13.08 ? 246  PRO A CA  1 
ATOM   1932 C  C   . PRO A 1 246 ? -1.929  -0.515  16.699  1.00 12.66 ? 246  PRO A C   1 
ATOM   1933 O  O   . PRO A 1 246 ? -1.421  -1.021  17.715  1.00 13.36 ? 246  PRO A O   1 
ATOM   1934 C  CB  . PRO A 1 246 ? -2.431  -2.601  15.508  1.00 13.01 ? 246  PRO A CB  1 
ATOM   1935 C  CG  . PRO A 1 246 ? -1.791  -2.253  14.208  1.00 13.50 ? 246  PRO A CG  1 
ATOM   1936 C  CD  . PRO A 1 246 ? -2.575  -1.107  13.633  1.00 13.70 ? 246  PRO A CD  1 
ATOM   1937 N  N   . LEU A 1 247 ? -1.478  0.616   16.166  1.00 12.04 ? 247  LEU A N   1 
ATOM   1938 C  CA  . LEU A 1 247 ? -0.246  1.235   16.644  1.00 11.33 ? 247  LEU A CA  1 
ATOM   1939 C  C   . LEU A 1 247 ? -0.439  2.422   17.579  1.00 10.22 ? 247  LEU A C   1 
ATOM   1940 O  O   . LEU A 1 247 ? 0.546   2.989   18.061  1.00 10.35 ? 247  LEU A O   1 
ATOM   1941 C  CB  . LEU A 1 247 ? 0.646   1.637   15.460  1.00 12.90 ? 247  LEU A CB  1 
ATOM   1942 C  CG  . LEU A 1 247 ? 1.010   0.488   14.515  1.00 13.51 ? 247  LEU A CG  1 
ATOM   1943 C  CD1 . LEU A 1 247 ? 1.953   0.976   13.425  1.00 14.87 ? 247  LEU A CD1 1 
ATOM   1944 C  CD2 . LEU A 1 247 ? 1.630   -0.686  15.261  1.00 14.78 ? 247  LEU A CD2 1 
ATOM   1945 N  N   . GLY A 1 248 ? -1.685  2.792   17.861  1.00 9.75  ? 248  GLY A N   1 
ATOM   1946 C  CA  . GLY A 1 248 ? -1.999  3.717   18.943  1.00 9.76  ? 248  GLY A CA  1 
ATOM   1947 C  C   . GLY A 1 248 ? -2.416  5.091   18.458  1.00 10.30 ? 248  GLY A C   1 
ATOM   1948 O  O   . GLY A 1 248 ? -2.449  5.375   17.252  1.00 10.34 ? 248  GLY A O   1 
ATOM   1949 N  N   . PRO A 1 249 ? -2.784  5.970   19.387  1.00 11.17 ? 249  PRO A N   1 
ATOM   1950 C  CA  . PRO A 1 249 ? -3.195  7.325   19.053  1.00 11.76 ? 249  PRO A CA  1 
ATOM   1951 C  C   . PRO A 1 249 ? -2.110  8.093   18.313  1.00 11.06 ? 249  PRO A C   1 
ATOM   1952 O  O   . PRO A 1 249 ? -0.927  8.022   18.661  1.00 11.92 ? 249  PRO A O   1 
ATOM   1953 C  CB  . PRO A 1 249 ? -3.520  7.980   20.387  1.00 11.97 ? 249  PRO A CB  1 
ATOM   1954 C  CG  . PRO A 1 249 ? -3.522  6.907   21.411  1.00 13.07 ? 249  PRO A CG  1 
ATOM   1955 C  CD  . PRO A 1 249 ? -2.710  5.759   20.852  1.00 11.30 ? 249  PRO A CD  1 
ATOM   1956 N  N   . PHE A 1 250 ? -2.508  8.863   17.297  1.00 10.66 ? 250  PHE A N   1 
ATOM   1957 C  CA  . PHE A 1 250 ? -1.497  9.520   16.452  1.00 9.91  ? 250  PHE A CA  1 
ATOM   1958 C  C   . PHE A 1 250 ? -1.971  10.916  16.082  1.00 9.55  ? 250  PHE A C   1 
ATOM   1959 O  O   . PHE A 1 250 ? -1.879  11.837  16.909  1.00 9.44  ? 250  PHE A O   1 
ATOM   1960 C  CB  . PHE A 1 250 ? -1.163  8.619   15.262  1.00 9.35  ? 250  PHE A CB  1 
ATOM   1961 C  CG  . PHE A 1 250 ? 0.018   9.048   14.435  1.00 10.10 ? 250  PHE A CG  1 
ATOM   1962 C  CD1 . PHE A 1 250 ? 1.274   9.256   15.003  1.00 9.80  ? 250  PHE A CD1 1 
ATOM   1963 C  CD2 . PHE A 1 250 ? -0.140  9.244   13.075  1.00 10.17 ? 250  PHE A CD2 1 
ATOM   1964 C  CE1 . PHE A 1 250 ? 2.342   9.647   14.213  1.00 11.03 ? 250  PHE A CE1 1 
ATOM   1965 C  CE2 . PHE A 1 250 ? 0.927   9.626   12.286  1.00 10.37 ? 250  PHE A CE2 1 
ATOM   1966 C  CZ  . PHE A 1 250 ? 2.167   9.848   12.860  1.00 10.99 ? 250  PHE A CZ  1 
ATOM   1967 N  N   . LEU A 1 251 ? -2.570  11.078  14.901  1.00 9.67  ? 251  LEU A N   1 
ATOM   1968 C  CA  . LEU A 1 251 ? -3.088  12.382  14.508  1.00 9.34  ? 251  LEU A CA  1 
ATOM   1969 C  C   . LEU A 1 251 ? -4.268  12.838  15.349  1.00 9.47  ? 251  LEU A C   1 
ATOM   1970 O  O   . LEU A 1 251 ? -4.540  14.043  15.460  1.00 9.61  ? 251  LEU A O   1 
ATOM   1971 C  CB  . LEU A 1 251 ? -3.501  12.362  13.033  1.00 9.88  ? 251  LEU A CB  1 
ATOM   1972 C  CG  . LEU A 1 251 ? -2.378  12.085  12.030  1.00 10.17 ? 251  LEU A CG  1 
ATOM   1973 C  CD1 . LEU A 1 251 ? -2.924  12.243  10.611  1.00 11.14 ? 251  LEU A CD1 1 
ATOM   1974 C  CD2 . LEU A 1 251 ? -1.193  13.019  12.221  1.00 11.43 ? 251  LEU A CD2 1 
ATOM   1975 N  N   . GLY A 1 252 ? -4.967  11.922  16.014  1.00 9.13  ? 252  GLY A N   1 
ATOM   1976 C  CA  . GLY A 1 252 ? -6.049  12.270  16.926  1.00 9.53  ? 252  GLY A CA  1 
ATOM   1977 C  C   . GLY A 1 252 ? -5.559  13.011  18.162  1.00 9.67  ? 252  GLY A C   1 
ATOM   1978 O  O   . GLY A 1 252 ? -6.371  13.566  18.901  1.00 11.08 ? 252  GLY A O   1 
ATOM   1979 N  N   . LYS A 1 253 ? -4.251  13.005  18.426  1.00 9.07  ? 253  LYS A N   1 
ATOM   1980 C  CA  . LYS A 1 253 ? -3.681  13.673  19.574  1.00 10.08 ? 253  LYS A CA  1 
ATOM   1981 C  C   . LYS A 1 253 ? -2.719  14.785  19.197  1.00 9.52  ? 253  LYS A C   1 
ATOM   1982 O  O   . LYS A 1 253 ? -2.586  15.757  19.941  1.00 10.67 ? 253  LYS A O   1 
ATOM   1983 C  CB  . LYS A 1 253 ? -2.885  12.638  20.403  1.00 10.16 ? 253  LYS A CB  1 
ATOM   1984 C  CG  . LYS A 1 253 ? -3.755  11.545  20.998  1.00 12.06 ? 253  LYS A CG  1 
ATOM   1985 C  CD  . LYS A 1 253 ? -4.802  12.111  21.953  1.00 12.73 ? 253  LYS A CD  1 
ATOM   1986 C  CE  . LYS A 1 253 ? -5.668  10.993  22.521  1.00 15.45 ? 253  LYS A CE  1 
ATOM   1987 N  NZ  . LYS A 1 253 ? -6.386  11.419  23.754  1.00 14.28 ? 253  LYS A NZ  1 
ATOM   1988 N  N   . SER A 1 254 ? -2.039  14.688  18.052  1.00 8.95  ? 254  SER A N   1 
ATOM   1989 C  CA  . SER A 1 254 ? -0.815  15.457  17.839  1.00 8.94  ? 254  SER A CA  1 
ATOM   1990 C  C   . SER A 1 254 ? -1.039  16.836  17.250  1.00 9.00  ? 254  SER A C   1 
ATOM   1991 O  O   . SER A 1 254 ? -0.076  17.556  16.985  1.00 10.02 ? 254  SER A O   1 
ATOM   1992 C  CB  . SER A 1 254 ? 0.127   14.683  16.900  1.00 9.70  ? 254  SER A CB  1 
ATOM   1993 O  OG  . SER A 1 254 ? -0.499  14.555  15.624  1.00 9.78  ? 254  SER A OG  1 
ATOM   1994 N  N   . PHE A 1 255 ? -2.298  17.244  17.048  1.00 8.95  ? 255  PHE A N   1 
ATOM   1995 C  CA  . PHE A 1 255 ? -2.545  18.608  16.564  1.00 9.16  ? 255  PHE A CA  1 
ATOM   1996 C  C   . PHE A 1 255 ? -2.432  19.657  17.664  1.00 10.39 ? 255  PHE A C   1 
ATOM   1997 O  O   . PHE A 1 255 ? -2.427  20.855  17.357  1.00 10.86 ? 255  PHE A O   1 
ATOM   1998 C  CB  . PHE A 1 255 ? -3.926  18.655  15.892  1.00 9.46  ? 255  PHE A CB  1 
ATOM   1999 C  CG  . PHE A 1 255 ? -5.054  18.394  16.861  1.00 9.13  ? 255  PHE A CG  1 
ATOM   2000 C  CD1 . PHE A 1 255 ? -5.688  19.451  17.492  1.00 9.11  ? 255  PHE A CD1 1 
ATOM   2001 C  CD2 . PHE A 1 255 ? -5.456  17.091  17.135  1.00 8.64  ? 255  PHE A CD2 1 
ATOM   2002 C  CE1 . PHE A 1 255 ? -6.713  19.213  18.394  1.00 9.43  ? 255  PHE A CE1 1 
ATOM   2003 C  CE2 . PHE A 1 255 ? -6.482  16.856  18.042  1.00 9.71  ? 255  PHE A CE2 1 
ATOM   2004 C  CZ  . PHE A 1 255 ? -7.111  17.921  18.657  1.00 9.33  ? 255  PHE A CZ  1 
ATOM   2005 N  N   . GLY A 1 256 ? -2.323  19.259  18.930  1.00 9.76  ? 256  GLY A N   1 
ATOM   2006 C  CA  . GLY A 1 256 ? -2.152  20.251  19.988  1.00 9.24  ? 256  GLY A CA  1 
ATOM   2007 C  C   . GLY A 1 256 ? -2.311  19.615  21.362  1.00 9.65  ? 256  GLY A C   1 
ATOM   2008 O  O   . GLY A 1 256 ? -3.220  18.810  21.563  1.00 9.42  ? 256  GLY A O   1 
ATOM   2009 N  N   . THR A 1 257 ? -1.420  19.977  22.260  1.00 8.57  ? 257  THR A N   1 
ATOM   2010 C  CA  . THR A 1 257 ? -1.497  19.549  23.662  1.00 8.58  ? 257  THR A CA  1 
ATOM   2011 C  C   . THR A 1 257 ? -1.070  20.760  24.490  1.00 8.66  ? 257  THR A C   1 
ATOM   2012 O  O   . THR A 1 257 ? 0.041   21.231  24.254  1.00 9.86  ? 257  THR A O   1 
ATOM   2013 C  CB  . THR A 1 257 ? -0.531  18.375  23.890  1.00 8.65  ? 257  THR A CB  1 
ATOM   2014 O  OG1 . THR A 1 257 ? -0.971  17.273  23.076  1.00 9.22  ? 257  THR A OG1 1 
ATOM   2015 C  CG2 . THR A 1 257 ? -0.525  17.929  25.343  1.00 8.67  ? 257  THR A CG2 1 
ATOM   2016 N  N   . THR A 1 258 ? -1.920  21.257  25.378  1.00 8.39  ? 258  THR A N   1 
ATOM   2017 C  CA  . THR A 1 258 ? -1.569  22.501  26.076  1.00 9.27  ? 258  THR A CA  1 
ATOM   2018 C  C   . THR A 1 258 ? -1.049  22.205  27.469  1.00 9.65  ? 258  THR A C   1 
ATOM   2019 O  O   . THR A 1 258 ? -1.611  21.331  28.121  1.00 11.01 ? 258  THR A O   1 
ATOM   2020 C  CB  . THR A 1 258 ? -2.803  23.418  26.172  1.00 9.57  ? 258  THR A CB  1 
ATOM   2021 O  OG1 . THR A 1 258 ? -3.213  23.710  24.824  1.00 9.83  ? 258  THR A OG1 1 
ATOM   2022 C  CG2 . THR A 1 258 ? -2.494  24.719  26.895  1.00 10.11 ? 258  THR A CG2 1 
ATOM   2023 N  N   . ILE A 1 259 ? -0.002  22.901  27.917  1.00 9.43  ? 259  ILE A N   1 
ATOM   2024 C  CA  . ILE A 1 259 ? 0.356   22.833  29.337  1.00 9.15  ? 259  ILE A CA  1 
ATOM   2025 C  C   . ILE A 1 259 ? 0.359   24.219  29.983  1.00 9.55  ? 259  ILE A C   1 
ATOM   2026 O  O   . ILE A 1 259 ? 0.575   25.218  29.306  1.00 10.08 ? 259  ILE A O   1 
ATOM   2027 C  CB  . ILE A 1 259 ? 1.726   22.181  29.596  1.00 9.07  ? 259  ILE A CB  1 
ATOM   2028 C  CG1 . ILE A 1 259 ? 2.850   22.947  28.881  1.00 8.36  ? 259  ILE A CG1 1 
ATOM   2029 C  CG2 . ILE A 1 259 ? 1.712   20.716  29.175  1.00 10.22 ? 259  ILE A CG2 1 
ATOM   2030 C  CD1 . ILE A 1 259 ? 4.240   22.488  29.324  1.00 9.65  ? 259  ILE A CD1 1 
ATOM   2031 N  N   . SER A 1 260 ? 0.106   24.257  31.287  1.00 9.68  ? 260  SER A N   1 
ATOM   2032 C  CA  . SER A 1 260 ? 0.318   25.482  32.059  1.00 9.78  ? 260  SER A CA  1 
ATOM   2033 C  C   . SER A 1 260 ? 1.806   25.800  32.137  1.00 9.85  ? 260  SER A C   1 
ATOM   2034 O  O   . SER A 1 260 ? 2.656   24.906  32.066  1.00 10.22 ? 260  SER A O   1 
ATOM   2035 C  CB  . SER A 1 260 ? -0.299  25.336  33.455  1.00 10.43 ? 260  SER A CB  1 
ATOM   2036 O  OG  . SER A 1 260 ? 0.255   24.211  34.125  1.00 9.47  ? 260  SER A OG  1 
ATOM   2037 N  N   . PRO A 1 261 ? 2.134   27.080  32.367  1.00 9.38  ? 261  PRO A N   1 
ATOM   2038 C  CA  . PRO A 1 261 ? 3.531   27.503  32.333  1.00 10.07 ? 261  PRO A CA  1 
ATOM   2039 C  C   . PRO A 1 261 ? 4.310   27.394  33.624  1.00 10.14 ? 261  PRO A C   1 
ATOM   2040 O  O   . PRO A 1 261 ? 5.542   27.272  33.575  1.00 10.81 ? 261  PRO A O   1 
ATOM   2041 C  CB  . PRO A 1 261 ? 3.462   28.966  31.879  1.00 10.80 ? 261  PRO A CB  1 
ATOM   2042 C  CG  . PRO A 1 261 ? 2.112   29.414  32.311  1.00 10.85 ? 261  PRO A CG  1 
ATOM   2043 C  CD  . PRO A 1 261 ? 1.213   28.213  32.079  1.00 10.76 ? 261  PRO A CD  1 
ATOM   2044 N  N   . TRP A 1 262 ? 3.646   27.467  34.773  1.00 10.18 ? 262  TRP A N   1 
ATOM   2045 C  CA  . TRP A 1 262 ? 4.337   27.475  36.057  1.00 11.19 ? 262  TRP A CA  1 
ATOM   2046 C  C   . TRP A 1 262 ? 4.563   26.072  36.593  1.00 10.37 ? 262  TRP A C   1 
ATOM   2047 O  O   . TRP A 1 262 ? 3.600   25.356  36.885  1.00 11.57 ? 262  TRP A O   1 
ATOM   2048 C  CB  . TRP A 1 262 ? 3.545   28.314  37.066  1.00 11.53 ? 262  TRP A CB  1 
ATOM   2049 C  CG  . TRP A 1 262 ? 3.557   29.785  36.764  1.00 12.22 ? 262  TRP A CG  1 
ATOM   2050 C  CD1 . TRP A 1 262 ? 2.522   30.566  36.349  1.00 12.44 ? 262  TRP A CD1 1 
ATOM   2051 C  CD2 . TRP A 1 262 ? 4.699   30.649  36.864  1.00 12.11 ? 262  TRP A CD2 1 
ATOM   2052 N  NE1 . TRP A 1 262 ? 2.948   31.872  36.190  1.00 13.38 ? 262  TRP A NE1 1 
ATOM   2053 C  CE2 . TRP A 1 262 ? 4.281   31.939  36.499  1.00 12.97 ? 262  TRP A CE2 1 
ATOM   2054 C  CE3 . TRP A 1 262 ? 6.037   30.440  37.218  1.00 12.76 ? 262  TRP A CE3 1 
ATOM   2055 C  CZ2 . TRP A 1 262 ? 5.158   33.028  36.486  1.00 13.29 ? 262  TRP A CZ2 1 
ATOM   2056 C  CZ3 . TRP A 1 262 ? 6.899   31.524  37.213  1.00 13.26 ? 262  TRP A CZ3 1 
ATOM   2057 C  CH2 . TRP A 1 262 ? 6.454   32.800  36.846  1.00 13.52 ? 262  TRP A CH2 1 
ATOM   2058 N  N   . VAL A 1 263 ? 5.821   25.665  36.700  1.00 10.04 ? 263  VAL A N   1 
ATOM   2059 C  CA  . VAL A 1 263 ? 6.150   24.310  37.144  1.00 9.90  ? 263  VAL A CA  1 
ATOM   2060 C  C   . VAL A 1 263 ? 6.274   24.303  38.670  1.00 10.06 ? 263  VAL A C   1 
ATOM   2061 O  O   . VAL A 1 263 ? 7.182   24.892  39.255  1.00 10.64 ? 263  VAL A O   1 
ATOM   2062 C  CB  . VAL A 1 263 ? 7.440   23.797  36.493  1.00 9.44  ? 263  VAL A CB  1 
ATOM   2063 C  CG1 . VAL A 1 263 ? 7.696   22.335  36.863  1.00 10.15 ? 263  VAL A CG1 1 
ATOM   2064 C  CG2 . VAL A 1 263 ? 7.431   23.963  34.978  1.00 8.87  ? 263  VAL A CG2 1 
ATOM   2065 N  N   . VAL A 1 264 ? 5.300   23.674  39.319  1.00 10.44 ? 264  VAL A N   1 
ATOM   2066 C  CA  . VAL A 1 264 ? 5.276   23.574  40.783  1.00 9.77  ? 264  VAL A CA  1 
ATOM   2067 C  C   . VAL A 1 264 ? 6.204   22.454  41.216  1.00 10.39 ? 264  VAL A C   1 
ATOM   2068 O  O   . VAL A 1 264 ? 6.033   21.290  40.831  1.00 10.39 ? 264  VAL A O   1 
ATOM   2069 C  CB  . VAL A 1 264 ? 3.827   23.293  41.228  1.00 9.74  ? 264  VAL A CB  1 
ATOM   2070 C  CG1 . VAL A 1 264 ? 3.763   23.105  42.741  1.00 10.07 ? 264  VAL A CG1 1 
ATOM   2071 C  CG2 . VAL A 1 264 ? 2.876   24.408  40.818  1.00 10.30 ? 264  VAL A CG2 1 
ATOM   2072 N  N   . PRO A 1 265 ? 7.233   22.769  41.993  1.00 10.61 ? 265  PRO A N   1 
ATOM   2073 C  CA  . PRO A 1 265 ? 8.234   21.781  42.360  1.00 10.82 ? 265  PRO A CA  1 
ATOM   2074 C  C   . PRO A 1 265 ? 7.646   20.729  43.282  1.00 10.94 ? 265  PRO A C   1 
ATOM   2075 O  O   . PRO A 1 265 ? 6.760   21.059  44.080  1.00 11.04 ? 265  PRO A O   1 
ATOM   2076 C  CB  . PRO A 1 265 ? 9.321   22.602  43.052  1.00 11.46 ? 265  PRO A CB  1 
ATOM   2077 C  CG  . PRO A 1 265 ? 8.622   23.811  43.568  1.00 11.39 ? 265  PRO A CG  1 
ATOM   2078 C  CD  . PRO A 1 265 ? 7.497   24.096  42.597  1.00 10.96 ? 265  PRO A CD  1 
ATOM   2079 N  N   . MET A 1 266 ? 8.146   19.493  43.243  1.00 11.33 ? 266  MET A N   1 
ATOM   2080 C  CA  . MET A 1 266 ? 7.606   18.457  44.126  1.00 11.39 ? 266  MET A CA  1 
ATOM   2081 C  C   . MET A 1 266 ? 7.707   18.834  45.596  1.00 12.12 ? 266  MET A C   1 
ATOM   2082 O  O   . MET A 1 266 ? 6.788   18.480  46.347  1.00 12.41 ? 266  MET A O   1 
ATOM   2083 C  CB  . MET A 1 266 ? 8.252   17.093  43.873  1.00 11.15 ? 266  MET A CB  1 
ATOM   2084 C  CG  . MET A 1 266 ? 8.028   16.564  42.460  1.00 11.21 ? 266  MET A CG  1 
ATOM   2085 S  SD  . MET A 1 266 ? 6.309   16.603  41.906  1.00 11.28 ? 266  MET A SD  1 
ATOM   2086 C  CE  . MET A 1 266 ? 5.516   15.630  43.198  1.00 13.04 ? 266  MET A CE  1 
ATOM   2087 N  N   . ASP A 1 267 ? 8.754   19.547  46.013  1.00 13.33 ? 267  ASP A N   1 
ATOM   2088 C  CA  . ASP A 1 267 ? 8.832   19.980  47.410  1.00 14.75 ? 267  ASP A CA  1 
ATOM   2089 C  C   . ASP A 1 267 ? 7.634   20.796  47.857  1.00 13.90 ? 267  ASP A C   1 
ATOM   2090 O  O   . ASP A 1 267 ? 7.249   20.707  49.034  1.00 14.54 ? 267  ASP A O   1 
ATOM   2091 C  CB  . ASP A 1 267 ? 10.132  20.749  47.656  1.00 17.71 ? 267  ASP A CB  1 
ATOM   2092 C  CG  . ASP A 1 267 ? 11.383  19.901  47.655  1.00 20.80 ? 267  ASP A CG  1 
ATOM   2093 O  OD1 . ASP A 1 267 ? 11.308  18.669  47.837  1.00 22.87 ? 267  ASP A OD1 1 
ATOM   2094 O  OD2 . ASP A 1 267 ? 12.491  20.447  47.463  1.00 22.62 ? 267  ASP A OD2 1 
ATOM   2095 N  N   . ALA A 1 268 ? 7.016   21.601  46.997  1.00 12.09 ? 268  ALA A N   1 
ATOM   2096 C  CA  . ALA A 1 268 ? 5.834   22.369  47.347  1.00 12.06 ? 268  ALA A CA  1 
ATOM   2097 C  C   . ALA A 1 268 ? 4.602   21.489  47.516  1.00 12.66 ? 268  ALA A C   1 
ATOM   2098 O  O   . ALA A 1 268 ? 3.664   21.894  48.206  1.00 12.87 ? 268  ALA A O   1 
ATOM   2099 C  CB  . ALA A 1 268 ? 5.571   23.428  46.278  1.00 12.09 ? 268  ALA A CB  1 
ATOM   2100 N  N   . LEU A 1 269 ? 4.613   20.307  46.909  1.00 12.71 ? 269  LEU A N   1 
ATOM   2101 C  CA  . LEU A 1 269 ? 3.451   19.434  46.898  1.00 13.29 ? 269  LEU A CA  1 
ATOM   2102 C  C   . LEU A 1 269 ? 3.513   18.353  47.963  1.00 13.72 ? 269  LEU A C   1 
ATOM   2103 O  O   . LEU A 1 269 ? 2.486   17.777  48.329  1.00 13.55 ? 269  LEU A O   1 
ATOM   2104 C  CB  . LEU A 1 269 ? 3.326   18.772  45.523  1.00 12.91 ? 269  LEU A CB  1 
ATOM   2105 C  CG  . LEU A 1 269 ? 3.054   19.721  44.352  1.00 12.42 ? 269  LEU A CG  1 
ATOM   2106 C  CD1 . LEU A 1 269 ? 3.209   18.981  43.029  1.00 13.50 ? 269  LEU A CD1 1 
ATOM   2107 C  CD2 . LEU A 1 269 ? 1.668   20.342  44.463  1.00 12.65 ? 269  LEU A CD2 1 
ATOM   2108 N  N   . MET A 1 270 ? 4.679   18.156  48.582  1.00 14.05 ? 270  MET A N   1 
ATOM   2109 C  CA  . MET A 1 270 ? 4.825   17.076  49.557  1.00 16.08 ? 270  MET A CA  1 
ATOM   2110 C  C   . MET A 1 270 ? 3.937   17.184  50.774  1.00 15.92 ? 270  MET A C   1 
ATOM   2111 O  O   . MET A 1 270 ? 3.494   16.143  51.305  1.00 16.18 ? 270  MET A O   1 
ATOM   2112 C  CB  . MET A 1 270 ? 6.291   16.860  49.936  1.00 17.95 ? 270  MET A CB  1 
ATOM   2113 C  CG  . MET A 1 270 ? 7.217   16.476  48.803  1.00 20.55 ? 270  MET A CG  1 
ATOM   2114 S  SD  . MET A 1 270 ? 6.702   15.071  47.795  1.00 24.00 ? 270  MET A SD  1 
ATOM   2115 C  CE  . MET A 1 270 ? 6.360   13.861  49.067  1.00 22.96 ? 270  MET A CE  1 
ATOM   2116 N  N   . PRO A 1 271 ? 3.536   18.374  51.227  1.00 16.30 ? 271  PRO A N   1 
ATOM   2117 C  CA  . PRO A 1 271 ? 2.601   18.520  52.324  1.00 15.96 ? 271  PRO A CA  1 
ATOM   2118 C  C   . PRO A 1 271 ? 1.205   18.008  52.032  1.00 15.79 ? 271  PRO A C   1 
ATOM   2119 O  O   . PRO A 1 271 ? 0.362   17.874  52.922  1.00 16.40 ? 271  PRO A O   1 
ATOM   2120 C  CB  . PRO A 1 271 ? 2.571   20.025  52.615  1.00 16.89 ? 271  PRO A CB  1 
ATOM   2121 C  CG  . PRO A 1 271 ? 3.911   20.500  52.186  1.00 17.09 ? 271  PRO A CG  1 
ATOM   2122 C  CD  . PRO A 1 271 ? 4.318   19.631  51.023  1.00 16.83 ? 271  PRO A CD  1 
ATOM   2123 N  N   . PHE A 1 272 ? 0.892   17.765  50.760  1.00 14.30 ? 272  PHE A N   1 
ATOM   2124 C  CA  . PHE A 1 272 ? -0.421  17.349  50.304  1.00 13.20 ? 272  PHE A CA  1 
ATOM   2125 C  C   . PHE A 1 272 ? -0.434  15.899  49.842  1.00 12.86 ? 272  PHE A C   1 
ATOM   2126 O  O   . PHE A 1 272 ? -1.353  15.459  49.151  1.00 12.23 ? 272  PHE A O   1 
ATOM   2127 C  CB  . PHE A 1 272 ? -0.856  18.290  49.156  1.00 13.51 ? 272  PHE A CB  1 
ATOM   2128 C  CG  . PHE A 1 272 ? -0.827  19.714  49.652  1.00 13.09 ? 272  PHE A CG  1 
ATOM   2129 C  CD1 . PHE A 1 272 ? 0.229   20.553  49.352  1.00 13.57 ? 272  PHE A CD1 1 
ATOM   2130 C  CD2 . PHE A 1 272 ? -1.851  20.176  50.472  1.00 14.53 ? 272  PHE A CD2 1 
ATOM   2131 C  CE1 . PHE A 1 272 ? 0.254   21.845  49.839  1.00 13.65 ? 272  PHE A CE1 1 
ATOM   2132 C  CE2 . PHE A 1 272 ? -1.824  21.467  50.956  1.00 14.07 ? 272  PHE A CE2 1 
ATOM   2133 C  CZ  . PHE A 1 272 ? -0.769  22.302  50.644  1.00 14.05 ? 272  PHE A CZ  1 
ATOM   2134 N  N   . VAL A 1 273 ? 0.606   15.165  50.234  1.00 11.98 ? 273  VAL A N   1 
ATOM   2135 C  CA  . VAL A 1 273 ? 0.723   13.758  49.868  1.00 13.52 ? 273  VAL A CA  1 
ATOM   2136 C  C   . VAL A 1 273 ? -0.300  12.936  50.640  1.00 13.38 ? 273  VAL A C   1 
ATOM   2137 O  O   . VAL A 1 273 ? -0.649  13.244  51.784  1.00 14.41 ? 273  VAL A O   1 
ATOM   2138 C  CB  . VAL A 1 273 ? 2.161   13.253  50.052  1.00 14.64 ? 273  VAL A CB  1 
ATOM   2139 C  CG1 . VAL A 1 273 ? 2.507   13.009  51.512  1.00 15.79 ? 273  VAL A CG1 1 
ATOM   2140 C  CG2 . VAL A 1 273 ? 2.392   12.002  49.212  1.00 16.31 ? 273  VAL A CG2 1 
ATOM   2141 N  N   . VAL A 1 274 ? -0.874  11.936  49.992  1.00 13.62 ? 274  VAL A N   1 
ATOM   2142 C  CA  . VAL A 1 274 ? -1.852  11.028  50.587  1.00 13.46 ? 274  VAL A CA  1 
ATOM   2143 C  C   . VAL A 1 274 ? -1.422  9.608   50.235  1.00 13.59 ? 274  VAL A C   1 
ATOM   2144 O  O   . VAL A 1 274 ? -0.561  9.417   49.377  1.00 13.28 ? 274  VAL A O   1 
ATOM   2145 C  CB  . VAL A 1 274 ? -3.288  11.278  50.102  1.00 12.50 ? 274  VAL A CB  1 
ATOM   2146 C  CG1 . VAL A 1 274 ? -3.794  12.660  50.500  1.00 12.22 ? 274  VAL A CG1 1 
ATOM   2147 C  CG2 . VAL A 1 274 ? -3.422  11.126  48.584  1.00 12.27 ? 274  VAL A CG2 1 
ATOM   2148 N  N   . PRO A 1 275 ? -1.992  8.598   50.876  1.00 13.95 ? 275  PRO A N   1 
ATOM   2149 C  CA  . PRO A 1 275 ? -1.657  7.222   50.568  1.00 13.97 ? 275  PRO A CA  1 
ATOM   2150 C  C   . PRO A 1 275 ? -1.937  6.874   49.111  1.00 13.86 ? 275  PRO A C   1 
ATOM   2151 O  O   . PRO A 1 275 ? -2.917  7.338   48.531  1.00 14.23 ? 275  PRO A O   1 
ATOM   2152 C  CB  . PRO A 1 275 ? -2.521  6.396   51.517  1.00 14.28 ? 275  PRO A CB  1 
ATOM   2153 C  CG  . PRO A 1 275 ? -3.569  7.331   52.015  1.00 15.01 ? 275  PRO A CG  1 
ATOM   2154 C  CD  . PRO A 1 275 ? -2.938  8.706   52.010  1.00 14.74 ? 275  PRO A CD  1 
ATOM   2155 N  N   . ASN A 1 276 ? -1.091  6.010   48.567  1.00 13.83 ? 276  ASN A N   1 
ATOM   2156 C  CA  . ASN A 1 276 ? -1.333  5.476   47.222  1.00 13.22 ? 276  ASN A CA  1 
ATOM   2157 C  C   . ASN A 1 276 ? -2.541  4.550   47.242  1.00 14.40 ? 276  ASN A C   1 
ATOM   2158 O  O   . ASN A 1 276 ? -2.761  3.814   48.205  1.00 14.31 ? 276  ASN A O   1 
ATOM   2159 C  CB  . ASN A 1 276 ? -0.111  4.707   46.724  1.00 13.18 ? 276  ASN A CB  1 
ATOM   2160 C  CG  . ASN A 1 276 ? 1.168   5.511   46.774  1.00 12.92 ? 276  ASN A CG  1 
ATOM   2161 O  OD1 . ASN A 1 276 ? 1.147   6.721   46.541  1.00 12.95 ? 276  ASN A OD1 1 
ATOM   2162 N  ND2 . ASN A 1 276 ? 2.271   4.844   47.087  1.00 13.46 ? 276  ASN A ND2 1 
ATOM   2163 N  N   . PRO A 1 277 ? -3.346  4.577   46.187  1.00 14.82 ? 277  PRO A N   1 
ATOM   2164 C  CA  . PRO A 1 277 ? -4.435  3.624   46.034  1.00 15.73 ? 277  PRO A CA  1 
ATOM   2165 C  C   . PRO A 1 277 ? -3.921  2.201   46.170  1.00 16.20 ? 277  PRO A C   1 
ATOM   2166 O  O   . PRO A 1 277 ? -2.825  1.864   45.696  1.00 15.18 ? 277  PRO A O   1 
ATOM   2167 C  CB  . PRO A 1 277 ? -4.999  3.929   44.650  1.00 16.33 ? 277  PRO A CB  1 
ATOM   2168 C  CG  . PRO A 1 277 ? -4.592  5.346   44.383  1.00 16.20 ? 277  PRO A CG  1 
ATOM   2169 C  CD  . PRO A 1 277 ? -3.218  5.470   45.009  1.00 15.76 ? 277  PRO A CD  1 
ATOM   2170 N  N   . LYS A 1 278 ? -4.697  1.358   46.866  1.00 16.99 ? 278  LYS A N   1 
ATOM   2171 C  CA  . LYS A 1 278 ? -4.284  -0.038  47.014  1.00 18.41 ? 278  LYS A CA  1 
ATOM   2172 C  C   . LYS A 1 278 ? -4.425  -0.732  45.660  1.00 17.80 ? 278  LYS A C   1 
ATOM   2173 O  O   . LYS A 1 278 ? -5.396  -0.512  44.948  1.00 18.01 ? 278  LYS A O   1 
ATOM   2174 C  CB  . LYS A 1 278 ? -5.065  -0.774  48.097  1.00 21.41 ? 278  LYS A CB  1 
ATOM   2175 C  CG  . LYS A 1 278 ? -4.968  -0.144  49.476  1.00 24.22 ? 278  LYS A CG  1 
ATOM   2176 C  CD  . LYS A 1 278 ? -3.559  0.223   49.886  1.00 26.17 ? 278  LYS A CD  1 
ATOM   2177 C  CE  . LYS A 1 278 ? -2.753  -0.943  50.420  1.00 27.45 ? 278  LYS A CE  1 
ATOM   2178 N  NZ  . LYS A 1 278 ? -2.893  -1.076  51.899  1.00 28.75 ? 278  LYS A NZ  1 
ATOM   2179 N  N   . GLN A 1 279 ? -3.406  -1.501  45.311  1.00 17.01 ? 279  GLN A N   1 
ATOM   2180 C  CA  . GLN A 1 279 ? -3.377  -2.168  44.013  1.00 16.94 ? 279  GLN A CA  1 
ATOM   2181 C  C   . GLN A 1 279 ? -3.608  -3.660  44.177  1.00 17.50 ? 279  GLN A C   1 
ATOM   2182 O  O   . GLN A 1 279 ? -2.932  -4.313  44.964  1.00 18.94 ? 279  GLN A O   1 
ATOM   2183 C  CB  . GLN A 1 279 ? -2.043  -1.884  43.314  1.00 15.76 ? 279  GLN A CB  1 
ATOM   2184 C  CG  . GLN A 1 279 ? -1.861  -0.384  43.058  1.00 15.17 ? 279  GLN A CG  1 
ATOM   2185 C  CD  . GLN A 1 279 ? -0.591  -0.111  42.281  1.00 14.79 ? 279  GLN A CD  1 
ATOM   2186 O  OE1 . GLN A 1 279 ? 0.470   -0.649  42.591  1.00 15.62 ? 279  GLN A OE1 1 
ATOM   2187 N  NE2 . GLN A 1 279 ? -0.703  0.717   41.247  1.00 14.75 ? 279  GLN A NE2 1 
ATOM   2188 N  N   . ASP A 1 280 ? -4.564  -4.192  43.437  1.00 18.05 ? 280  ASP A N   1 
ATOM   2189 C  CA  . ASP A 1 280 ? -4.844  -5.631  43.450  1.00 19.17 ? 280  ASP A CA  1 
ATOM   2190 C  C   . ASP A 1 280 ? -5.248  -6.019  42.036  1.00 18.84 ? 280  ASP A C   1 
ATOM   2191 O  O   . ASP A 1 280 ? -6.248  -5.503  41.536  1.00 18.34 ? 280  ASP A O   1 
ATOM   2192 C  CB  . ASP A 1 280 ? -5.955  -5.904  44.455  1.00 20.79 ? 280  ASP A CB  1 
ATOM   2193 C  CG  . ASP A 1 280 ? -6.398  -7.345  44.560  1.00 22.54 ? 280  ASP A CG  1 
ATOM   2194 O  OD1 . ASP A 1 280 ? -5.648  -8.254  44.167  1.00 23.13 ? 280  ASP A OD1 1 
ATOM   2195 O  OD2 . ASP A 1 280 ? -7.532  -7.567  45.045  1.00 24.60 ? 280  ASP A OD2 1 
ATOM   2196 N  N   . PRO A 1 281 ? -4.472  -6.887  41.404  1.00 18.86 ? 281  PRO A N   1 
ATOM   2197 C  CA  . PRO A 1 281 ? -3.388  -7.611  42.022  1.00 19.42 ? 281  PRO A CA  1 
ATOM   2198 C  C   . PRO A 1 281 ? -2.170  -6.776  42.366  1.00 19.74 ? 281  PRO A C   1 
ATOM   2199 O  O   . PRO A 1 281 ? -1.971  -5.696  41.804  1.00 18.34 ? 281  PRO A O   1 
ATOM   2200 C  CB  . PRO A 1 281 ? -3.023  -8.665  40.971  1.00 20.09 ? 281  PRO A CB  1 
ATOM   2201 C  CG  . PRO A 1 281 ? -3.400  -8.055  39.666  1.00 19.80 ? 281  PRO A CG  1 
ATOM   2202 C  CD  . PRO A 1 281 ? -4.581  -7.170  39.945  1.00 19.25 ? 281  PRO A CD  1 
ATOM   2203 N  N   . LYS A 1 282 ? -1.351  -7.238  43.317  1.00 20.98 ? 282  LYS A N   1 
ATOM   2204 C  CA  . LYS A 1 282 ? -0.141  -6.474  43.631  1.00 22.02 ? 282  LYS A CA  1 
ATOM   2205 C  C   . LYS A 1 282 ? 0.825   -6.541  42.458  1.00 20.94 ? 282  LYS A C   1 
ATOM   2206 O  O   . LYS A 1 282 ? 0.993   -7.563  41.799  1.00 21.61 ? 282  LYS A O   1 
ATOM   2207 C  CB  . LYS A 1 282 ? 0.482   -6.906  44.958  1.00 24.69 ? 282  LYS A CB  1 
ATOM   2208 C  CG  . LYS A 1 282 ? -0.181  -6.234  46.159  1.00 26.93 ? 282  LYS A CG  1 
ATOM   2209 C  CD  . LYS A 1 282 ? -0.106  -4.713  46.071  1.00 28.95 ? 282  LYS A CD  1 
ATOM   2210 C  CE  . LYS A 1 282 ? -0.931  -4.036  47.151  1.00 30.37 ? 282  LYS A CE  1 
ATOM   2211 N  NZ  . LYS A 1 282 ? -1.060  -2.562  46.937  1.00 31.82 ? 282  LYS A NZ  1 
ATOM   2212 N  N   . PRO A 1 283 ? 1.448   -5.409  42.153  1.00 20.55 ? 283  PRO A N   1 
ATOM   2213 C  CA  . PRO A 1 283 ? 2.389   -5.309  41.050  1.00 20.18 ? 283  PRO A CA  1 
ATOM   2214 C  C   . PRO A 1 283 ? 3.643   -6.134  41.280  1.00 19.05 ? 283  PRO A C   1 
ATOM   2215 O  O   . PRO A 1 283 ? 3.977   -6.507  42.409  1.00 19.07 ? 283  PRO A O   1 
ATOM   2216 C  CB  . PRO A 1 283 ? 2.702   -3.822  40.970  1.00 20.58 ? 283  PRO A CB  1 
ATOM   2217 C  CG  . PRO A 1 283 ? 2.510   -3.324  42.357  1.00 20.93 ? 283  PRO A CG  1 
ATOM   2218 C  CD  . PRO A 1 283 ? 1.375   -4.144  42.925  1.00 20.33 ? 283  PRO A CD  1 
ATOM   2219 N  N   . LEU A 1 284 ? 4.312   -6.468  40.178  1.00 17.81 ? 284  LEU A N   1 
ATOM   2220 C  CA  . LEU A 1 284 ? 5.626   -7.103  40.270  1.00 16.77 ? 284  LEU A CA  1 
ATOM   2221 C  C   . LEU A 1 284 ? 6.566   -6.252  41.107  1.00 16.27 ? 284  LEU A C   1 
ATOM   2222 O  O   . LEU A 1 284 ? 6.441   -5.030  41.228  1.00 16.55 ? 284  LEU A O   1 
ATOM   2223 C  CB  . LEU A 1 284 ? 6.181   -7.320  38.859  1.00 16.04 ? 284  LEU A CB  1 
ATOM   2224 C  CG  . LEU A 1 284 ? 5.493   -8.416  38.041  1.00 16.15 ? 284  LEU A CG  1 
ATOM   2225 C  CD1 . LEU A 1 284 ? 5.730   -8.235  36.547  1.00 15.72 ? 284  LEU A CD1 1 
ATOM   2226 C  CD2 . LEU A 1 284 ? 5.955   -9.798  38.489  1.00 16.12 ? 284  LEU A CD2 1 
ATOM   2227 N  N   . PRO A 1 285 ? 7.595   -6.879  41.679  1.00 15.60 ? 285  PRO A N   1 
ATOM   2228 C  CA  . PRO A 1 285 ? 8.514   -6.227  42.586  1.00 15.23 ? 285  PRO A CA  1 
ATOM   2229 C  C   . PRO A 1 285 ? 9.127   -4.955  42.061  1.00 14.35 ? 285  PRO A C   1 
ATOM   2230 O  O   . PRO A 1 285 ? 9.232   -3.985  42.818  1.00 14.64 ? 285  PRO A O   1 
ATOM   2231 C  CB  . PRO A 1 285 ? 9.586   -7.283  42.874  1.00 15.02 ? 285  PRO A CB  1 
ATOM   2232 C  CG  . PRO A 1 285 ? 8.846   -8.567  42.708  1.00 15.59 ? 285  PRO A CG  1 
ATOM   2233 C  CD  . PRO A 1 285 ? 7.859   -8.341  41.589  1.00 16.10 ? 285  PRO A CD  1 
ATOM   2234 N  N   . TYR A 1 286 ? 9.472   -4.854  40.766  1.00 14.10 ? 286  TYR A N   1 
ATOM   2235 C  CA  . TYR A 1 286 ? 10.087  -3.634  40.260  1.00 13.75 ? 286  TYR A CA  1 
ATOM   2236 C  C   . TYR A 1 286 ? 9.160   -2.424  40.347  1.00 13.88 ? 286  TYR A C   1 
ATOM   2237 O  O   . TYR A 1 286 ? 9.648   -1.293  40.312  1.00 14.00 ? 286  TYR A O   1 
ATOM   2238 C  CB  . TYR A 1 286 ? 10.578  -3.816  38.828  1.00 13.55 ? 286  TYR A CB  1 
ATOM   2239 C  CG  . TYR A 1 286 ? 9.597   -3.686  37.689  1.00 14.03 ? 286  TYR A CG  1 
ATOM   2240 C  CD1 . TYR A 1 286 ? 9.591   -2.521  36.923  1.00 13.63 ? 286  TYR A CD1 1 
ATOM   2241 C  CD2 . TYR A 1 286 ? 8.701   -4.692  37.358  1.00 13.62 ? 286  TYR A CD2 1 
ATOM   2242 C  CE1 . TYR A 1 286 ? 8.720   -2.372  35.853  1.00 13.37 ? 286  TYR A CE1 1 
ATOM   2243 C  CE2 . TYR A 1 286 ? 7.822   -4.549  36.294  1.00 13.97 ? 286  TYR A CE2 1 
ATOM   2244 C  CZ  . TYR A 1 286 ? 7.840   -3.383  35.557  1.00 13.62 ? 286  TYR A CZ  1 
ATOM   2245 O  OH  . TYR A 1 286 ? 6.955   -3.262  34.513  1.00 14.62 ? 286  TYR A OH  1 
ATOM   2246 N  N   . LEU A 1 287 ? 7.857   -2.617  40.465  1.00 14.45 ? 287  LEU A N   1 
ATOM   2247 C  CA  . LEU A 1 287 ? 6.890   -1.549  40.603  1.00 14.76 ? 287  LEU A CA  1 
ATOM   2248 C  C   . LEU A 1 287 ? 6.352   -1.433  42.027  1.00 15.73 ? 287  LEU A C   1 
ATOM   2249 O  O   . LEU A 1 287 ? 5.361   -0.744  42.264  1.00 15.60 ? 287  LEU A O   1 
ATOM   2250 C  CB  . LEU A 1 287 ? 5.693   -1.799  39.665  1.00 14.86 ? 287  LEU A CB  1 
ATOM   2251 C  CG  . LEU A 1 287 ? 6.023   -1.841  38.167  1.00 14.94 ? 287  LEU A CG  1 
ATOM   2252 C  CD1 . LEU A 1 287 ? 4.862   -2.422  37.377  1.00 15.40 ? 287  LEU A CD1 1 
ATOM   2253 C  CD2 . LEU A 1 287 ? 6.393   -0.451  37.672  1.00 16.86 ? 287  LEU A CD2 1 
ATOM   2254 N  N   . CYS A 1 288 ? 6.986   -2.111  42.981  1.00 16.59 ? 288  CYS A N   1 
ATOM   2255 C  CA  . CYS A 1 288 ? 6.464   -2.164  44.345  1.00 19.03 ? 288  CYS A CA  1 
ATOM   2256 C  C   . CYS A 1 288 ? 7.314   -1.326  45.286  1.00 19.77 ? 288  CYS A C   1 
ATOM   2257 O  O   . CYS A 1 288 ? 8.492   -1.626  45.494  1.00 20.83 ? 288  CYS A O   1 
ATOM   2258 C  CB  . CYS A 1 288 ? 6.422   -3.622  44.806  1.00 19.57 ? 288  CYS A CB  1 
ATOM   2259 S  SG  . CYS A 1 288 ? 5.726   -3.839  46.469  1.00 24.21 ? 288  CYS A SG  1 
ATOM   2260 N  N   . HIS A 1 289 ? 6.710   -0.296  45.871  1.00 20.34 ? 289  HIS A N   1 
ATOM   2261 C  CA  . HIS A 1 289 ? 7.436   0.588   46.787  1.00 20.40 ? 289  HIS A CA  1 
ATOM   2262 C  C   . HIS A 1 289 ? 6.469   1.214   47.781  1.00 19.28 ? 289  HIS A C   1 
ATOM   2263 O  O   . HIS A 1 289 ? 5.337   1.514   47.401  1.00 17.93 ? 289  HIS A O   1 
ATOM   2264 C  CB  . HIS A 1 289 ? 8.136   1.660   45.961  1.00 22.53 ? 289  HIS A CB  1 
ATOM   2265 C  CG  . HIS A 1 289 ? 9.198   2.436   46.659  1.00 24.13 ? 289  HIS A CG  1 
ATOM   2266 N  ND1 . HIS A 1 289 ? 10.310  1.844   47.220  1.00 25.01 ? 289  HIS A ND1 1 
ATOM   2267 C  CD2 . HIS A 1 289 ? 9.342   3.769   46.863  1.00 25.34 ? 289  HIS A CD2 1 
ATOM   2268 C  CE1 . HIS A 1 289 ? 11.085  2.767   47.754  1.00 25.38 ? 289  HIS A CE1 1 
ATOM   2269 N  NE2 . HIS A 1 289 ? 10.521  3.946   47.546  1.00 26.08 ? 289  HIS A NE2 1 
ATOM   2270 N  N   . SER A 1 290 ? 6.903   1.439   49.019  1.00 18.72 ? 290  SER A N   1 
ATOM   2271 C  CA  . SER A 1 290 ? 5.991   1.892   50.061  1.00 18.97 ? 290  SER A CA  1 
ATOM   2272 C  C   . SER A 1 290 ? 5.882   3.401   50.210  1.00 18.39 ? 290  SER A C   1 
ATOM   2273 O  O   . SER A 1 290 ? 4.994   3.867   50.939  1.00 18.64 ? 290  SER A O   1 
ATOM   2274 C  CB  . SER A 1 290 ? 6.368   1.276   51.421  1.00 18.56 ? 290  SER A CB  1 
ATOM   2275 O  OG  . SER A 1 290 ? 7.689   1.635   51.790  1.00 20.02 ? 290  SER A OG  1 
ATOM   2276 N  N   . GLN A 1 291 ? 6.719   4.189   49.552  1.00 16.75 ? 291  GLN A N   1 
ATOM   2277 C  CA  . GLN A 1 291 ? 6.649   5.643   49.682  1.00 16.05 ? 291  GLN A CA  1 
ATOM   2278 C  C   . GLN A 1 291 ? 5.327   6.202   49.192  1.00 14.81 ? 291  GLN A C   1 
ATOM   2279 O  O   . GLN A 1 291 ? 4.976   6.021   48.020  1.00 13.54 ? 291  GLN A O   1 
ATOM   2280 C  CB  . GLN A 1 291 ? 7.801   6.231   48.840  1.00 16.96 ? 291  GLN A CB  1 
ATOM   2281 C  CG  . GLN A 1 291 ? 7.929   7.732   48.898  1.00 18.38 ? 291  GLN A CG  1 
ATOM   2282 C  CD  . GLN A 1 291 ? 9.071   8.270   48.051  1.00 19.58 ? 291  GLN A CD  1 
ATOM   2283 O  OE1 . GLN A 1 291 ? 9.800   7.518   47.407  1.00 20.76 ? 291  GLN A OE1 1 
ATOM   2284 N  NE2 . GLN A 1 291 ? 9.206   9.589   48.065  1.00 21.39 ? 291  GLN A NE2 1 
ATOM   2285 N  N   . PRO A 1 292 ? 4.576   6.875   50.054  1.00 13.79 ? 292  PRO A N   1 
ATOM   2286 C  CA  . PRO A 1 292 ? 3.401   7.617   49.619  1.00 13.84 ? 292  PRO A CA  1 
ATOM   2287 C  C   . PRO A 1 292 ? 3.782   8.639   48.557  1.00 13.64 ? 292  PRO A C   1 
ATOM   2288 O  O   . PRO A 1 292 ? 4.713   9.429   48.736  1.00 12.91 ? 292  PRO A O   1 
ATOM   2289 C  CB  . PRO A 1 292 ? 2.866   8.253   50.895  1.00 14.69 ? 292  PRO A CB  1 
ATOM   2290 C  CG  . PRO A 1 292 ? 3.406   7.399   51.996  1.00 14.64 ? 292  PRO A CG  1 
ATOM   2291 C  CD  . PRO A 1 292 ? 4.764   6.944   51.523  1.00 14.21 ? 292  PRO A CD  1 
ATOM   2292 N  N   . TYR A 1 293 ? 3.049   8.622   47.433  1.00 13.22 ? 293  TYR A N   1 
ATOM   2293 C  CA  . TYR A 1 293 ? 3.387   9.520   46.331  1.00 12.90 ? 293  TYR A CA  1 
ATOM   2294 C  C   . TYR A 1 293 ? 2.172   9.783   45.455  1.00 13.18 ? 293  TYR A C   1 
ATOM   2295 O  O   . TYR A 1 293 ? 2.237   9.878   44.228  1.00 13.49 ? 293  TYR A O   1 
ATOM   2296 C  CB  . TYR A 1 293 ? 4.578   8.980   45.539  1.00 13.15 ? 293  TYR A CB  1 
ATOM   2297 C  CG  . TYR A 1 293 ? 5.481   10.067  45.013  1.00 12.45 ? 293  TYR A CG  1 
ATOM   2298 C  CD1 . TYR A 1 293 ? 6.447   10.656  45.818  1.00 12.18 ? 293  TYR A CD1 1 
ATOM   2299 C  CD2 . TYR A 1 293 ? 5.375   10.511  43.699  1.00 12.24 ? 293  TYR A CD2 1 
ATOM   2300 C  CE1 . TYR A 1 293 ? 7.278   11.647  45.339  1.00 12.58 ? 293  TYR A CE1 1 
ATOM   2301 C  CE2 . TYR A 1 293 ? 6.199   11.511  43.214  1.00 12.50 ? 293  TYR A CE2 1 
ATOM   2302 C  CZ  . TYR A 1 293 ? 7.157   12.070  44.030  1.00 13.06 ? 293  TYR A CZ  1 
ATOM   2303 O  OH  . TYR A 1 293 ? 7.984   13.061  43.555  1.00 13.56 ? 293  TYR A OH  1 
ATOM   2304 N  N   . THR A 1 294 ? 1.050   9.973   46.120  1.00 12.33 ? 294  THR A N   1 
ATOM   2305 C  CA  . THR A 1 294 ? -0.235  10.358  45.550  1.00 11.56 ? 294  THR A CA  1 
ATOM   2306 C  C   . THR A 1 294 ? -0.616  11.699  46.154  1.00 12.13 ? 294  THR A C   1 
ATOM   2307 O  O   . THR A 1 294 ? -0.306  11.977  47.321  1.00 12.03 ? 294  THR A O   1 
ATOM   2308 C  CB  . THR A 1 294 ? -1.294  9.285   45.846  1.00 11.93 ? 294  THR A CB  1 
ATOM   2309 O  OG1 . THR A 1 294 ? -0.872  8.061   45.202  1.00 12.44 ? 294  THR A OG1 1 
ATOM   2310 C  CG2 . THR A 1 294 ? -2.683  9.651   45.369  1.00 12.38 ? 294  THR A CG2 1 
ATOM   2311 N  N   . PHE A 1 295 ? -1.191  12.604  45.357  1.00 12.11 ? 295  PHE A N   1 
ATOM   2312 C  CA  . PHE A 1 295 ? -1.299  13.997  45.779  1.00 12.12 ? 295  PHE A CA  1 
ATOM   2313 C  C   . PHE A 1 295 ? -2.725  14.527  45.702  1.00 12.25 ? 295  PHE A C   1 
ATOM   2314 O  O   . PHE A 1 295 ? -3.439  14.317  44.732  1.00 13.29 ? 295  PHE A O   1 
ATOM   2315 C  CB  . PHE A 1 295 ? -0.365  14.897  44.950  1.00 12.00 ? 295  PHE A CB  1 
ATOM   2316 C  CG  . PHE A 1 295 ? 1.086   14.552  45.184  1.00 12.02 ? 295  PHE A CG  1 
ATOM   2317 C  CD1 . PHE A 1 295 ? 1.726   13.596  44.413  1.00 12.44 ? 295  PHE A CD1 1 
ATOM   2318 C  CD2 . PHE A 1 295 ? 1.786   15.158  46.215  1.00 12.65 ? 295  PHE A CD2 1 
ATOM   2319 C  CE1 . PHE A 1 295 ? 3.044   13.258  44.656  1.00 12.44 ? 295  PHE A CE1 1 
ATOM   2320 C  CE2 . PHE A 1 295 ? 3.109   14.836  46.456  1.00 12.86 ? 295  PHE A CE2 1 
ATOM   2321 C  CZ  . PHE A 1 295 ? 3.737   13.888  45.670  1.00 12.69 ? 295  PHE A CZ  1 
ATOM   2322 N  N   . ASP A 1 296 ? -3.110  15.214  46.780  1.00 11.74 ? 296  ASP A N   1 
ATOM   2323 C  CA  . ASP A 1 296 ? -4.431  15.832  46.877  1.00 12.49 ? 296  ASP A CA  1 
ATOM   2324 C  C   . ASP A 1 296 ? -4.433  17.205  46.224  1.00 12.59 ? 296  ASP A C   1 
ATOM   2325 O  O   . ASP A 1 296 ? -4.115  18.222  46.834  1.00 12.94 ? 296  ASP A O   1 
ATOM   2326 C  CB  . ASP A 1 296 ? -4.769  15.924  48.367  1.00 13.11 ? 296  ASP A CB  1 
ATOM   2327 C  CG  . ASP A 1 296 ? -6.156  16.421  48.674  1.00 14.98 ? 296  ASP A CG  1 
ATOM   2328 O  OD1 . ASP A 1 296 ? -6.976  16.666  47.776  1.00 15.12 ? 296  ASP A OD1 1 
ATOM   2329 O  OD2 . ASP A 1 296 ? -6.440  16.590  49.894  1.00 16.72 ? 296  ASP A OD2 1 
ATOM   2330 N  N   . ILE A 1 297 ? -4.670  17.214  44.908  1.00 12.23 ? 297  ILE A N   1 
ATOM   2331 C  CA  . ILE A 1 297 ? -4.651  18.425  44.097  1.00 12.42 ? 297  ILE A CA  1 
ATOM   2332 C  C   . ILE A 1 297 ? -6.039  18.592  43.479  1.00 12.26 ? 297  ILE A C   1 
ATOM   2333 O  O   . ILE A 1 297 ? -6.451  17.800  42.627  1.00 11.93 ? 297  ILE A O   1 
ATOM   2334 C  CB  . ILE A 1 297 ? -3.629  18.385  42.942  1.00 11.53 ? 297  ILE A CB  1 
ATOM   2335 C  CG1 . ILE A 1 297 ? -2.255  17.938  43.436  1.00 11.81 ? 297  ILE A CG1 1 
ATOM   2336 C  CG2 . ILE A 1 297 ? -3.558  19.754  42.263  1.00 11.06 ? 297  ILE A CG2 1 
ATOM   2337 C  CD1 . ILE A 1 297 ? -1.216  17.731  42.354  1.00 11.10 ? 297  ILE A CD1 1 
ATOM   2338 N  N   . ASN A 1 298 ? -6.757  19.607  43.933  1.00 13.02 ? 298  ASN A N   1 
ATOM   2339 C  CA  . ASN A 1 298 ? -8.068  19.932  43.389  1.00 13.42 ? 298  ASN A CA  1 
ATOM   2340 C  C   . ASN A 1 298 ? -7.942  20.407  41.948  1.00 13.10 ? 298  ASN A C   1 
ATOM   2341 O  O   . ASN A 1 298 ? -7.046  21.194  41.655  1.00 12.62 ? 298  ASN A O   1 
ATOM   2342 C  CB  . ASN A 1 298 ? -8.734  21.017  44.241  1.00 14.63 ? 298  ASN A CB  1 
ATOM   2343 C  CG  . ASN A 1 298 ? -8.789  20.572  45.695  1.00 16.30 ? 298  ASN A CG  1 
ATOM   2344 O  OD1 . ASN A 1 298 ? -9.608  19.724  46.042  1.00 18.31 ? 298  ASN A OD1 1 
ATOM   2345 N  ND2 . ASN A 1 298 ? -7.916  21.118  46.532  1.00 18.09 ? 298  ASN A ND2 1 
ATOM   2346 N  N   . LEU A 1 299 ? -8.791  19.892  41.071  1.00 11.63 ? 299  LEU A N   1 
ATOM   2347 C  CA  . LEU A 1 299 ? -8.743  20.292  39.661  1.00 12.11 ? 299  LEU A CA  1 
ATOM   2348 C  C   . LEU A 1 299 ? -10.125 20.761  39.225  1.00 12.28 ? 299  LEU A C   1 
ATOM   2349 O  O   . LEU A 1 299 ? -11.122 20.214  39.696  1.00 12.88 ? 299  LEU A O   1 
ATOM   2350 C  CB  . LEU A 1 299 ? -8.322  19.098  38.794  1.00 12.15 ? 299  LEU A CB  1 
ATOM   2351 C  CG  . LEU A 1 299 ? -6.894  18.589  39.024  1.00 12.46 ? 299  LEU A CG  1 
ATOM   2352 C  CD1 . LEU A 1 299 ? -6.704  17.225  38.384  1.00 12.80 ? 299  LEU A CD1 1 
ATOM   2353 C  CD2 . LEU A 1 299 ? -5.877  19.602  38.504  1.00 12.99 ? 299  LEU A CD2 1 
ATOM   2354 N  N   . SER A 1 300 ? -10.190 21.752  38.346  1.00 13.35 ? 300  SER A N   1 
ATOM   2355 C  CA  . SER A 1 300 ? -11.478 22.212  37.825  1.00 14.36 ? 300  SER A CA  1 
ATOM   2356 C  C   . SER A 1 300 ? -11.341 22.549  36.345  1.00 14.34 ? 300  SER A C   1 
ATOM   2357 O  O   . SER A 1 300 ? -10.276 22.976  35.893  1.00 14.13 ? 300  SER A O   1 
ATOM   2358 C  CB  . SER A 1 300 ? -11.952 23.438  38.612  1.00 16.19 ? 300  SER A CB  1 
ATOM   2359 O  OG  . SER A 1 300 ? -13.305 23.731  38.336  1.00 19.39 ? 300  SER A OG  1 
ATOM   2360 N  N   . VAL A 1 301 ? -12.403 22.295  35.577  1.00 13.67 ? 301  VAL A N   1 
ATOM   2361 C  CA  . VAL A 1 301 ? -12.419 22.612  34.154  1.00 13.44 ? 301  VAL A CA  1 
ATOM   2362 C  C   . VAL A 1 301 ? -13.644 23.470  33.829  1.00 13.15 ? 301  VAL A C   1 
ATOM   2363 O  O   . VAL A 1 301 ? -14.757 23.043  34.144  1.00 13.03 ? 301  VAL A O   1 
ATOM   2364 C  CB  . VAL A 1 301 ? -12.483 21.366  33.248  1.00 13.88 ? 301  VAL A CB  1 
ATOM   2365 C  CG1 . VAL A 1 301 ? -12.274 21.769  31.793  1.00 14.59 ? 301  VAL A CG1 1 
ATOM   2366 C  CG2 . VAL A 1 301 ? -11.450 20.317  33.647  1.00 14.99 ? 301  VAL A CG2 1 
ATOM   2367 N  N   . SER A 1 302 ? -13.430 24.604  33.181  1.00 12.30 ? 302  SER A N   1 
ATOM   2368 C  CA  . SER A 1 302 ? -14.539 25.419  32.692  1.00 13.08 ? 302  SER A CA  1 
ATOM   2369 C  C   . SER A 1 302 ? -14.602 25.446  31.166  1.00 13.07 ? 302  SER A C   1 
ATOM   2370 O  O   . SER A 1 302 ? -13.601 25.300  30.458  1.00 11.44 ? 302  SER A O   1 
ATOM   2371 C  CB  . SER A 1 302 ? -14.429 26.840  33.244  1.00 13.71 ? 302  SER A CB  1 
ATOM   2372 O  OG  . SER A 1 302 ? -13.383 27.577  32.648  1.00 13.96 ? 302  SER A OG  1 
ATOM   2373 N  N   . LEU A 1 303 ? -15.814 25.666  30.661  1.00 13.45 ? 303  LEU A N   1 
ATOM   2374 C  CA  . LEU A 1 303 ? -16.051 25.823  29.227  1.00 13.34 ? 303  LEU A CA  1 
ATOM   2375 C  C   . LEU A 1 303 ? -16.861 27.105  29.014  1.00 14.35 ? 303  LEU A C   1 
ATOM   2376 O  O   . LEU A 1 303 ? -17.833 27.318  29.737  1.00 14.15 ? 303  LEU A O   1 
ATOM   2377 C  CB  . LEU A 1 303 ? -16.801 24.630  28.637  1.00 13.78 ? 303  LEU A CB  1 
ATOM   2378 C  CG  . LEU A 1 303 ? -17.009 24.597  27.120  1.00 14.36 ? 303  LEU A CG  1 
ATOM   2379 C  CD1 . LEU A 1 303 ? -17.231 23.164  26.645  1.00 14.30 ? 303  LEU A CD1 1 
ATOM   2380 C  CD2 . LEU A 1 303 ? -18.213 25.433  26.680  1.00 15.04 ? 303  LEU A CD2 1 
ATOM   2381 N  N   . LYS A 1 304 ? -16.442 27.916  28.057  1.00 14.48 ? 304  LYS A N   1 
ATOM   2382 C  CA  . LYS A 1 304 ? -17.227 29.091  27.688  1.00 16.02 ? 304  LYS A CA  1 
ATOM   2383 C  C   . LYS A 1 304 ? -17.345 29.179  26.171  1.00 16.91 ? 304  LYS A C   1 
ATOM   2384 O  O   . LYS A 1 304 ? -16.326 29.237  25.475  1.00 15.97 ? 304  LYS A O   1 
ATOM   2385 C  CB  . LYS A 1 304 ? -16.598 30.365  28.255  1.00 16.92 ? 304  LYS A CB  1 
ATOM   2386 C  CG  . LYS A 1 304 ? -17.510 31.579  28.081  1.00 18.98 ? 304  LYS A CG  1 
ATOM   2387 C  CD  . LYS A 1 304 ? -16.870 32.839  28.642  1.00 21.35 ? 304  LYS A CD  1 
ATOM   2388 C  CE  . LYS A 1 304 ? -15.664 33.267  27.831  1.00 22.24 ? 304  LYS A CE  1 
ATOM   2389 N  NZ  . LYS A 1 304 ? -15.170 34.620  28.221  1.00 24.83 ? 304  LYS A NZ  1 
ATOM   2390 N  N   . GLY A 1 305 ? -18.575 29.224  25.672  1.00 17.79 ? 305  GLY A N   1 
ATOM   2391 C  CA  . GLY A 1 305 ? -18.787 29.358  24.227  1.00 20.67 ? 305  GLY A CA  1 
ATOM   2392 C  C   . GLY A 1 305 ? -18.682 30.823  23.815  1.00 23.10 ? 305  GLY A C   1 
ATOM   2393 O  O   . GLY A 1 305 ? -18.913 31.711  24.637  1.00 23.13 ? 305  GLY A O   1 
ATOM   2394 N  N   . GLU A 1 306 ? -18.287 31.079  22.569  1.00 25.78 ? 306  GLU A N   1 
ATOM   2395 C  CA  . GLU A 1 306 ? -18.319 32.461  22.073  1.00 29.24 ? 306  GLU A CA  1 
ATOM   2396 C  C   . GLU A 1 306 ? -19.758 32.956  22.186  1.00 30.54 ? 306  GLU A C   1 
ATOM   2397 O  O   . GLU A 1 306 ? -20.701 32.182  21.986  1.00 31.60 ? 306  GLU A O   1 
ATOM   2398 C  CB  . GLU A 1 306 ? -17.797 32.537  20.641  1.00 29.94 ? 306  GLU A CB  1 
ATOM   2399 C  CG  . GLU A 1 306 ? -18.637 31.739  19.664  1.00 31.00 ? 306  GLU A CG  1 
ATOM   2400 C  CD  . GLU A 1 306 ? -18.170 31.766  18.228  1.00 31.54 ? 306  GLU A CD  1 
ATOM   2401 O  OE1 . GLU A 1 306 ? -16.961 31.904  17.953  1.00 31.75 ? 306  GLU A OE1 1 
ATOM   2402 O  OE2 . GLU A 1 306 ? -19.045 31.637  17.343  1.00 31.85 ? 306  GLU A OE2 1 
ATOM   2403 N  N   . GLY A 1 307 ? -19.954 34.210  22.581  1.00 32.54 ? 307  GLY A N   1 
ATOM   2404 C  CA  . GLY A 1 307 ? -21.303 34.695  22.873  1.00 33.46 ? 307  GLY A CA  1 
ATOM   2405 C  C   . GLY A 1 307 ? -21.602 34.643  24.368  1.00 34.14 ? 307  GLY A C   1 
ATOM   2406 O  O   . GLY A 1 307 ? -21.945 35.660  24.976  1.00 34.76 ? 307  GLY A O   1 
ATOM   2407 N  N   . MET A 1 308 ? -21.477 33.461  24.962  1.00 33.93 ? 308  MET A N   1 
ATOM   2408 C  CA  . MET A 1 308 ? -21.733 33.250  26.377  1.00 33.56 ? 308  MET A CA  1 
ATOM   2409 C  C   . MET A 1 308 ? -21.008 34.262  27.252  1.00 33.03 ? 308  MET A C   1 
ATOM   2410 O  O   . MET A 1 308 ? -19.847 34.607  27.024  1.00 33.19 ? 308  MET A O   1 
ATOM   2411 C  CB  . MET A 1 308 ? -21.335 31.823  26.769  1.00 33.61 ? 308  MET A CB  1 
ATOM   2412 C  CG  . MET A 1 308 ? -22.264 30.752  26.226  1.00 33.80 ? 308  MET A CG  1 
ATOM   2413 S  SD  . MET A 1 308 ? -21.736 29.066  26.555  1.00 34.21 ? 308  MET A SD  1 
ATOM   2414 C  CE  . MET A 1 308 ? -21.400 29.135  28.311  1.00 34.48 ? 308  MET A CE  1 
ATOM   2415 N  N   . SER A 1 309 ? -21.698 34.737  28.291  1.00 32.76 ? 309  SER A N   1 
ATOM   2416 C  CA  . SER A 1 309 ? -21.130 35.787  29.133  1.00 32.36 ? 309  SER A CA  1 
ATOM   2417 C  C   . SER A 1 309 ? -20.233 35.198  30.209  1.00 31.70 ? 309  SER A C   1 
ATOM   2418 O  O   . SER A 1 309 ? -19.263 35.840  30.620  1.00 32.27 ? 309  SER A O   1 
ATOM   2419 C  CB  . SER A 1 309 ? -22.208 36.681  29.739  1.00 32.48 ? 309  SER A CB  1 
ATOM   2420 O  OG  . SER A 1 309 ? -23.043 35.995  30.649  1.00 33.32 ? 309  SER A OG  1 
ATOM   2421 N  N   . GLN A 1 310 ? -20.565 34.017  30.726  1.00 30.76 ? 310  GLN A N   1 
ATOM   2422 C  CA  . GLN A 1 310 ? -19.762 33.411  31.781  1.00 29.67 ? 310  GLN A CA  1 
ATOM   2423 C  C   . GLN A 1 310 ? -19.402 31.965  31.439  1.00 27.18 ? 310  GLN A C   1 
ATOM   2424 O  O   . GLN A 1 310 ? -20.172 31.273  30.778  1.00 26.74 ? 310  GLN A O   1 
ATOM   2425 C  CB  . GLN A 1 310 ? -20.458 33.430  33.137  1.00 31.76 ? 310  GLN A CB  1 
ATOM   2426 C  CG  . GLN A 1 310 ? -20.995 34.730  33.677  1.00 33.93 ? 310  GLN A CG  1 
ATOM   2427 C  CD  . GLN A 1 310 ? -20.001 35.866  33.729  1.00 35.22 ? 310  GLN A CD  1 
ATOM   2428 O  OE1 . GLN A 1 310 ? -18.807 35.683  33.471  1.00 36.17 ? 310  GLN A OE1 1 
ATOM   2429 N  NE2 . GLN A 1 310 ? -20.471 37.071  34.044  1.00 35.83 ? 310  GLN A NE2 1 
ATOM   2430 N  N   . ALA A 1 311 ? -18.242 31.527  31.918  1.00 24.53 ? 311  ALA A N   1 
ATOM   2431 C  CA  . ALA A 1 311 ? -17.846 30.132  31.753  1.00 22.36 ? 311  ALA A CA  1 
ATOM   2432 C  C   . ALA A 1 311 ? -18.600 29.226  32.719  1.00 21.23 ? 311  ALA A C   1 
ATOM   2433 O  O   . ALA A 1 311 ? -18.945 29.616  33.839  1.00 21.97 ? 311  ALA A O   1 
ATOM   2434 C  CB  . ALA A 1 311 ? -16.344 29.975  31.956  1.00 21.51 ? 311  ALA A CB  1 
ATOM   2435 N  N   . ALA A 1 312 ? -18.869 28.004  32.281  1.00 19.09 ? 312  ALA A N   1 
ATOM   2436 C  CA  . ALA A 1 312 ? -19.491 26.992  33.123  1.00 18.55 ? 312  ALA A CA  1 
ATOM   2437 C  C   . ALA A 1 312 ? -18.451 25.990  33.620  1.00 17.98 ? 312  ALA A C   1 
ATOM   2438 O  O   . ALA A 1 312 ? -17.591 25.580  32.838  1.00 17.21 ? 312  ALA A O   1 
ATOM   2439 C  CB  . ALA A 1 312 ? -20.562 26.251  32.342  1.00 19.35 ? 312  ALA A CB  1 
ATOM   2440 N  N   . THR A 1 313 ? -18.544 25.589  34.881  1.00 17.51 ? 313  THR A N   1 
ATOM   2441 C  CA  . THR A 1 313 ? -17.661 24.539  35.397  1.00 17.35 ? 313  THR A CA  1 
ATOM   2442 C  C   . THR A 1 313 ? -18.205 23.174  35.004  1.00 17.25 ? 313  THR A C   1 
ATOM   2443 O  O   . THR A 1 313 ? -19.285 22.793  35.473  1.00 18.56 ? 313  THR A O   1 
ATOM   2444 C  CB  . THR A 1 313 ? -17.515 24.664  36.925  1.00 18.15 ? 313  THR A CB  1 
ATOM   2445 O  OG1 . THR A 1 313 ? -16.907 25.937  37.205  1.00 19.96 ? 313  THR A OG1 1 
ATOM   2446 C  CG2 . THR A 1 313 ? -16.630 23.567  37.492  1.00 18.38 ? 313  THR A CG2 1 
ATOM   2447 N  N   . ILE A 1 314 ? -17.496 22.444  34.137  1.00 15.68 ? 314  ILE A N   1 
ATOM   2448 C  CA  . ILE A 1 314 ? -18.017 21.164  33.667  1.00 14.84 ? 314  ILE A CA  1 
ATOM   2449 C  C   . ILE A 1 314 ? -17.380 19.959  34.339  1.00 14.41 ? 314  ILE A C   1 
ATOM   2450 O  O   . ILE A 1 314 ? -17.855 18.836  34.163  1.00 14.70 ? 314  ILE A O   1 
ATOM   2451 C  CB  . ILE A 1 314 ? -17.909 21.025  32.133  1.00 14.86 ? 314  ILE A CB  1 
ATOM   2452 C  CG1 . ILE A 1 314 ? -16.449 21.032  31.664  1.00 14.93 ? 314  ILE A CG1 1 
ATOM   2453 C  CG2 . ILE A 1 314 ? -18.699 22.148  31.466  1.00 15.10 ? 314  ILE A CG2 1 
ATOM   2454 C  CD1 . ILE A 1 314 ? -16.314 20.696  30.184  1.00 14.66 ? 314  ILE A CD1 1 
ATOM   2455 N  N   . CYS A 1 315 ? -16.312 20.160  35.107  1.00 13.72 ? 315  CYS A N   1 
ATOM   2456 C  CA  . CYS A 1 315 ? -15.617 19.047  35.747  1.00 13.63 ? 315  CYS A CA  1 
ATOM   2457 C  C   . CYS A 1 315 ? -14.975 19.540  37.036  1.00 13.06 ? 315  CYS A C   1 
ATOM   2458 O  O   . CYS A 1 315 ? -14.337 20.585  37.011  1.00 14.01 ? 315  CYS A O   1 
ATOM   2459 C  CB  . CYS A 1 315 ? -14.525 18.475  34.829  1.00 13.40 ? 315  CYS A CB  1 
ATOM   2460 S  SG  . CYS A 1 315 ? -13.475 17.234  35.627  1.00 13.21 ? 315  CYS A SG  1 
ATOM   2461 N  N   . ARG A 1 316 ? -15.183 18.836  38.134  1.00 14.14 ? 316  ARG A N   1 
ATOM   2462 C  CA  . ARG A 1 316 ? -14.422 19.059  39.354  1.00 14.96 ? 316  ARG A CA  1 
ATOM   2463 C  C   . ARG A 1 316 ? -13.804 17.720  39.754  1.00 14.54 ? 316  ARG A C   1 
ATOM   2464 O  O   . ARG A 1 316 ? -14.539 16.760  39.978  1.00 14.31 ? 316  ARG A O   1 
ATOM   2465 C  CB  . ARG A 1 316 ? -15.304 19.583  40.486  1.00 17.27 ? 316  ARG A CB  1 
ATOM   2466 C  CG  . ARG A 1 316 ? -15.797 21.008  40.287  1.00 20.87 ? 316  ARG A CG  1 
ATOM   2467 C  CD  . ARG A 1 316 ? -16.478 21.525  41.549  1.00 23.34 ? 316  ARG A CD  1 
ATOM   2468 N  NE  . ARG A 1 316 ? -17.022 22.860  41.368  1.00 26.05 ? 316  ARG A NE  1 
ATOM   2469 C  CZ  . ARG A 1 316 ? -18.065 23.209  40.629  1.00 27.49 ? 316  ARG A CZ  1 
ATOM   2470 N  NH1 . ARG A 1 316 ? -18.766 22.325  39.929  1.00 28.44 ? 316  ARG A NH1 1 
ATOM   2471 N  NH2 . ARG A 1 316 ? -18.420 24.490  40.587  1.00 28.58 ? 316  ARG A NH2 1 
ATOM   2472 N  N   . SER A 1 317 ? -12.477 17.675  39.809  1.00 13.92 ? 317  SER A N   1 
ATOM   2473 C  CA  . SER A 1 317 ? -11.818 16.379  40.018  1.00 13.55 ? 317  SER A CA  1 
ATOM   2474 C  C   . SER A 1 317 ? -10.585 16.570  40.887  1.00 13.80 ? 317  SER A C   1 
ATOM   2475 O  O   . SER A 1 317 ? -10.431 17.597  41.559  1.00 13.70 ? 317  SER A O   1 
ATOM   2476 C  CB  . SER A 1 317 ? -11.523 15.741  38.661  1.00 13.49 ? 317  SER A CB  1 
ATOM   2477 O  OG  . SER A 1 317 ? -11.157 14.376  38.779  1.00 13.91 ? 317  SER A OG  1 
ATOM   2478 N  N   . ASN A 1 318 ? -9.745  15.545  40.944  1.00 13.09 ? 318  ASN A N   1 
ATOM   2479 C  CA  . ASN A 1 318 ? -8.580  15.600  41.834  1.00 12.45 ? 318  ASN A CA  1 
ATOM   2480 C  C   . ASN A 1 318 ? -7.527  14.661  41.274  1.00 13.35 ? 318  ASN A C   1 
ATOM   2481 O  O   . ASN A 1 318 ? -7.830  13.554  40.821  1.00 12.59 ? 318  ASN A O   1 
ATOM   2482 C  CB  . ASN A 1 318 ? -8.994  15.186  43.251  1.00 12.70 ? 318  ASN A CB  1 
ATOM   2483 C  CG  . ASN A 1 318 ? -7.989  15.558  44.317  1.00 12.52 ? 318  ASN A CG  1 
ATOM   2484 O  OD1 . ASN A 1 318 ? -6.851  15.091  44.343  1.00 12.11 ? 318  ASN A OD1 1 
ATOM   2485 N  ND2 . ASN A 1 318 ? -8.413  16.434  45.238  1.00 13.58 ? 318  ASN A ND2 1 
ATOM   2486 N  N   . PHE A 1 319 ? -6.258  15.056  41.404  1.00 12.39 ? 319  PHE A N   1 
ATOM   2487 C  CA  . PHE A 1 319 ? -5.152  14.227  40.946  1.00 13.00 ? 319  PHE A CA  1 
ATOM   2488 C  C   . PHE A 1 319 ? -4.979  12.978  41.785  1.00 12.80 ? 319  PHE A C   1 
ATOM   2489 O  O   . PHE A 1 319 ? -4.313  12.019  41.376  1.00 13.32 ? 319  PHE A O   1 
ATOM   2490 C  CB  . PHE A 1 319 ? -3.867  15.069  40.902  1.00 13.87 ? 319  PHE A CB  1 
ATOM   2491 C  CG  . PHE A 1 319 ? -2.707  14.370  40.247  1.00 14.67 ? 319  PHE A CG  1 
ATOM   2492 C  CD1 . PHE A 1 319 ? -2.787  13.979  38.914  1.00 16.23 ? 319  PHE A CD1 1 
ATOM   2493 C  CD2 . PHE A 1 319 ? -1.552  14.106  40.960  1.00 16.10 ? 319  PHE A CD2 1 
ATOM   2494 C  CE1 . PHE A 1 319 ? -1.715  13.331  38.317  1.00 16.91 ? 319  PHE A CE1 1 
ATOM   2495 C  CE2 . PHE A 1 319 ? -0.489  13.454  40.361  1.00 16.14 ? 319  PHE A CE2 1 
ATOM   2496 C  CZ  . PHE A 1 319 ? -0.574  13.068  39.042  1.00 16.49 ? 319  PHE A CZ  1 
ATOM   2497 N  N   . LYS A 1 320 ? -5.610  12.899  42.967  1.00 12.57 ? 320  LYS A N   1 
ATOM   2498 C  CA  . LYS A 1 320 ? -5.533  11.700  43.781  1.00 14.95 ? 320  LYS A CA  1 
ATOM   2499 C  C   . LYS A 1 320 ? -6.242  10.513  43.140  1.00 15.86 ? 320  LYS A C   1 
ATOM   2500 O  O   . LYS A 1 320 ? -5.927  9.388   43.529  1.00 17.34 ? 320  LYS A O   1 
ATOM   2501 C  CB  . LYS A 1 320 ? -6.048  11.981  45.194  1.00 15.98 ? 320  LYS A CB  1 
ATOM   2502 C  CG  . LYS A 1 320 ? -7.557  12.167  45.287  1.00 17.68 ? 320  LYS A CG  1 
ATOM   2503 C  CD  . LYS A 1 320 ? -7.944  12.446  46.737  1.00 19.98 ? 320  LYS A CD  1 
ATOM   2504 C  CE  . LYS A 1 320 ? -9.450  12.586  46.900  1.00 21.29 ? 320  LYS A CE  1 
ATOM   2505 N  NZ  . LYS A 1 320 ? -9.785  12.850  48.334  1.00 23.09 ? 320  LYS A NZ  1 
ATOM   2506 N  N   . HIS A 1 321 ? -7.062  10.694  42.116  1.00 16.72 ? 321  HIS A N   1 
ATOM   2507 C  CA  . HIS A 1 321 ? -7.628  9.609   41.328  1.00 17.02 ? 321  HIS A CA  1 
ATOM   2508 C  C   . HIS A 1 321 ? -6.683  9.081   40.254  1.00 17.28 ? 321  HIS A C   1 
ATOM   2509 O  O   . HIS A 1 321 ? -6.967  9.111   39.047  1.00 17.33 ? 321  HIS A O   1 
ATOM   2510 C  CB  . HIS A 1 321 ? -8.935  10.071  40.673  1.00 17.60 ? 321  HIS A CB  1 
ATOM   2511 C  CG  . HIS A 1 321 ? -9.900  10.741  41.601  1.00 17.52 ? 321  HIS A CG  1 
ATOM   2512 N  ND1 . HIS A 1 321 ? -10.327 10.183  42.783  1.00 18.07 ? 321  HIS A ND1 1 
ATOM   2513 C  CD2 . HIS A 1 321 ? -10.528 11.938  41.495  1.00 17.79 ? 321  HIS A CD2 1 
ATOM   2514 C  CE1 . HIS A 1 321 ? -11.170 11.003  43.377  1.00 17.85 ? 321  HIS A CE1 1 
ATOM   2515 N  NE2 . HIS A 1 321 ? -11.320 12.072  42.613  1.00 18.60 ? 321  HIS A NE2 1 
ATOM   2516 N  N   . MET A 1 322 ? -5.519  8.594   40.667  1.00 16.00 ? 322  MET A N   1 
ATOM   2517 C  CA  . MET A 1 322 ? -4.557  7.973   39.768  1.00 16.24 ? 322  MET A CA  1 
ATOM   2518 C  C   . MET A 1 322 ? -4.129  6.666   40.434  1.00 15.11 ? 322  MET A C   1 
ATOM   2519 O  O   . MET A 1 322 ? -3.688  6.664   41.588  1.00 17.08 ? 322  MET A O   1 
ATOM   2520 C  CB  . MET A 1 322 ? -3.355  8.856   39.425  1.00 17.31 ? 322  MET A CB  1 
ATOM   2521 C  CG  . MET A 1 322 ? -2.564  8.379   38.206  1.00 19.21 ? 322  MET A CG  1 
ATOM   2522 S  SD  . MET A 1 322 ? -1.438  9.563   37.438  1.00 21.85 ? 322  MET A SD  1 
ATOM   2523 C  CE  . MET A 1 322 ? 0.018   9.379   38.455  1.00 19.84 ? 322  MET A CE  1 
ATOM   2524 N  N   . TYR A 1 323 ? -4.299  5.564   39.726  1.00 13.30 ? 323  TYR A N   1 
ATOM   2525 C  CA  . TYR A 1 323 ? -4.052  4.242   40.297  1.00 11.98 ? 323  TYR A CA  1 
ATOM   2526 C  C   . TYR A 1 323 ? -2.574  3.890   40.286  1.00 12.12 ? 323  TYR A C   1 
ATOM   2527 O  O   . TYR A 1 323 ? -2.059  3.256   41.204  1.00 12.29 ? 323  TYR A O   1 
ATOM   2528 C  CB  . TYR A 1 323 ? -4.832  3.234   39.467  1.00 11.92 ? 323  TYR A CB  1 
ATOM   2529 C  CG  . TYR A 1 323 ? -4.818  1.797   39.924  1.00 12.29 ? 323  TYR A CG  1 
ATOM   2530 C  CD1 . TYR A 1 323 ? -5.742  1.373   40.877  1.00 12.73 ? 323  TYR A CD1 1 
ATOM   2531 C  CD2 . TYR A 1 323 ? -3.929  0.876   39.395  1.00 12.81 ? 323  TYR A CD2 1 
ATOM   2532 C  CE1 . TYR A 1 323 ? -5.754  0.052   41.297  1.00 13.32 ? 323  TYR A CE1 1 
ATOM   2533 C  CE2 . TYR A 1 323 ? -3.944  -0.449  39.803  1.00 13.76 ? 323  TYR A CE2 1 
ATOM   2534 C  CZ  . TYR A 1 323 ? -4.862  -0.843  40.759  1.00 13.66 ? 323  TYR A CZ  1 
ATOM   2535 O  OH  . TYR A 1 323 ? -4.881  -2.157  41.172  1.00 14.31 ? 323  TYR A OH  1 
ATOM   2536 N  N   . TRP A 1 324 ? -1.911  4.258   39.194  1.00 11.83 ? 324  TRP A N   1 
ATOM   2537 C  CA  . TRP A 1 324 ? -0.465  4.101   39.083  1.00 11.55 ? 324  TRP A CA  1 
ATOM   2538 C  C   . TRP A 1 324 ? 0.222   5.412   39.447  1.00 11.28 ? 324  TRP A C   1 
ATOM   2539 O  O   . TRP A 1 324 ? -0.180  6.459   38.938  1.00 11.67 ? 324  TRP A O   1 
ATOM   2540 C  CB  . TRP A 1 324 ? -0.068  3.713   37.652  1.00 11.33 ? 324  TRP A CB  1 
ATOM   2541 C  CG  . TRP A 1 324 ? -0.596  2.358   37.269  1.00 11.55 ? 324  TRP A CG  1 
ATOM   2542 C  CD1 . TRP A 1 324 ? -1.726  2.085   36.553  1.00 12.01 ? 324  TRP A CD1 1 
ATOM   2543 C  CD2 . TRP A 1 324 ? -0.007  1.097   37.600  1.00 11.70 ? 324  TRP A CD2 1 
ATOM   2544 N  NE1 . TRP A 1 324 ? -1.868  0.724   36.403  1.00 11.74 ? 324  TRP A NE1 1 
ATOM   2545 C  CE2 . TRP A 1 324 ? -0.829  0.100   37.033  1.00 11.62 ? 324  TRP A CE2 1 
ATOM   2546 C  CE3 . TRP A 1 324 ? 1.129   0.702   38.309  1.00 11.82 ? 324  TRP A CE3 1 
ATOM   2547 C  CZ2 . TRP A 1 324 ? -0.554  -1.258  37.183  1.00 12.37 ? 324  TRP A CZ2 1 
ATOM   2548 C  CZ3 . TRP A 1 324 ? 1.405   -0.650  38.443  1.00 12.47 ? 324  TRP A CZ3 1 
ATOM   2549 C  CH2 . TRP A 1 324 ? 0.556   -1.617  37.889  1.00 12.01 ? 324  TRP A CH2 1 
ATOM   2550 N  N   . THR A 1 325 ? 1.223   5.365   40.317  1.00 11.50 ? 325  THR A N   1 
ATOM   2551 C  CA  . THR A 1 325 ? 1.837   6.611   40.764  1.00 10.86 ? 325  THR A CA  1 
ATOM   2552 C  C   . THR A 1 325 ? 2.877   7.100   39.762  1.00 10.53 ? 325  THR A C   1 
ATOM   2553 O  O   . THR A 1 325 ? 3.357   6.364   38.904  1.00 10.50 ? 325  THR A O   1 
ATOM   2554 C  CB  . THR A 1 325 ? 2.542   6.456   42.128  1.00 11.25 ? 325  THR A CB  1 
ATOM   2555 O  OG1 . THR A 1 325 ? 3.680   5.607   41.969  1.00 12.14 ? 325  THR A OG1 1 
ATOM   2556 C  CG2 . THR A 1 325 ? 1.555   5.862   43.125  1.00 12.57 ? 325  THR A CG2 1 
ATOM   2557 N  N   . MET A 1 326 ? 3.316   8.342   39.973  1.00 10.16 ? 326  MET A N   1 
ATOM   2558 C  CA  . MET A 1 326 ? 4.410   8.885   39.165  1.00 10.60 ? 326  MET A CA  1 
ATOM   2559 C  C   . MET A 1 326 ? 5.687   8.082   39.353  1.00 10.52 ? 326  MET A C   1 
ATOM   2560 O  O   . MET A 1 326 ? 6.474   7.942   38.416  1.00 10.77 ? 326  MET A O   1 
ATOM   2561 C  CB  . MET A 1 326 ? 4.632   10.365  39.486  1.00 9.83  ? 326  MET A CB  1 
ATOM   2562 C  CG  . MET A 1 326 ? 3.473   11.243  39.008  1.00 10.69 ? 326  MET A CG  1 
ATOM   2563 S  SD  . MET A 1 326 ? 3.747   12.989  39.357  1.00 10.70 ? 326  MET A SD  1 
ATOM   2564 C  CE  . MET A 1 326 ? 3.331   13.061  41.099  1.00 10.77 ? 326  MET A CE  1 
ATOM   2565 N  N   . LEU A 1 327 ? 5.928   7.548   40.563  1.00 10.69 ? 327  LEU A N   1 
ATOM   2566 C  CA  . LEU A 1 327 ? 7.091   6.688   40.758  1.00 10.90 ? 327  LEU A CA  1 
ATOM   2567 C  C   . LEU A 1 327 ? 7.041   5.444   39.877  1.00 10.38 ? 327  LEU A C   1 
ATOM   2568 O  O   . LEU A 1 327 ? 8.038   5.069   39.258  1.00 11.11 ? 327  LEU A O   1 
ATOM   2569 C  CB  . LEU A 1 327 ? 7.243   6.296   42.232  1.00 11.25 ? 327  LEU A CB  1 
ATOM   2570 C  CG  . LEU A 1 327 ? 7.223   7.445   43.235  1.00 11.32 ? 327  LEU A CG  1 
ATOM   2571 C  CD1 . LEU A 1 327 ? 7.410   6.888   44.650  1.00 11.47 ? 327  LEU A CD1 1 
ATOM   2572 C  CD2 . LEU A 1 327 ? 8.297   8.486   42.948  1.00 12.22 ? 327  LEU A CD2 1 
ATOM   2573 N  N   . GLN A 1 328 ? 5.891   4.783   39.842  1.00 10.42 ? 328  GLN A N   1 
ATOM   2574 C  CA  . GLN A 1 328 ? 5.665   3.629   38.995  1.00 10.38 ? 328  GLN A CA  1 
ATOM   2575 C  C   . GLN A 1 328 ? 5.783   3.983   37.517  1.00 10.39 ? 328  GLN A C   1 
ATOM   2576 O  O   . GLN A 1 328 ? 6.368   3.205   36.769  1.00 11.20 ? 328  GLN A O   1 
ATOM   2577 C  CB  . GLN A 1 328 ? 4.312   2.975   39.309  1.00 10.38 ? 328  GLN A CB  1 
ATOM   2578 C  CG  . GLN A 1 328 ? 4.278   2.435   40.746  1.00 11.13 ? 328  GLN A CG  1 
ATOM   2579 C  CD  . GLN A 1 328 ? 2.919   1.878   41.108  1.00 11.11 ? 328  GLN A CD  1 
ATOM   2580 O  OE1 . GLN A 1 328 ? 1.895   2.555   41.024  1.00 11.43 ? 328  GLN A OE1 1 
ATOM   2581 N  NE2 . GLN A 1 328 ? 2.882   0.616   41.530  1.00 13.00 ? 328  GLN A NE2 1 
ATOM   2582 N  N   . GLN A 1 329 ? 5.231   5.114   37.076  1.00 9.64  ? 329  GLN A N   1 
ATOM   2583 C  CA  . GLN A 1 329 ? 5.369   5.516   35.680  1.00 9.93  ? 329  GLN A CA  1 
ATOM   2584 C  C   . GLN A 1 329 ? 6.824   5.722   35.291  1.00 10.40 ? 329  GLN A C   1 
ATOM   2585 O  O   . GLN A 1 329 ? 7.278   5.236   34.245  1.00 11.07 ? 329  GLN A O   1 
ATOM   2586 C  CB  . GLN A 1 329 ? 4.574   6.803   35.431  1.00 10.12 ? 329  GLN A CB  1 
ATOM   2587 C  CG  . GLN A 1 329 ? 3.078   6.616   35.554  1.00 9.44  ? 329  GLN A CG  1 
ATOM   2588 C  CD  . GLN A 1 329 ? 2.287   7.896   35.683  1.00 9.12  ? 329  GLN A CD  1 
ATOM   2589 O  OE1 . GLN A 1 329 ? 2.804   8.956   36.044  1.00 9.30  ? 329  GLN A OE1 1 
ATOM   2590 N  NE2 . GLN A 1 329 ? 0.988   7.833   35.407  1.00 9.67  ? 329  GLN A NE2 1 
ATOM   2591 N  N   . LEU A 1 330 ? 7.578   6.453   36.113  1.00 10.11 ? 330  LEU A N   1 
ATOM   2592 C  CA  . LEU A 1 330 ? 8.980   6.720   35.791  1.00 10.54 ? 330  LEU A CA  1 
ATOM   2593 C  C   . LEU A 1 330 ? 9.805   5.434   35.793  1.00 10.88 ? 330  LEU A C   1 
ATOM   2594 O  O   . LEU A 1 330 ? 10.670  5.249   34.938  1.00 9.88  ? 330  LEU A O   1 
ATOM   2595 C  CB  . LEU A 1 330 ? 9.591   7.725   36.771  1.00 11.26 ? 330  LEU A CB  1 
ATOM   2596 C  CG  . LEU A 1 330 ? 11.031  8.156   36.477  1.00 10.96 ? 330  LEU A CG  1 
ATOM   2597 C  CD1 . LEU A 1 330 ? 11.101  9.633   36.120  1.00 12.48 ? 330  LEU A CD1 1 
ATOM   2598 C  CD2 . LEU A 1 330 ? 11.974  7.841   37.629  1.00 13.13 ? 330  LEU A CD2 1 
ATOM   2599 N  N   . THR A 1 331 ? 9.562   4.573   36.779  1.00 11.40 ? 331  THR A N   1 
ATOM   2600 C  CA  . THR A 1 331 ? 10.259  3.289   36.861  1.00 11.26 ? 331  THR A CA  1 
ATOM   2601 C  C   . THR A 1 331 ? 9.968   2.417   35.651  1.00 10.92 ? 331  THR A C   1 
ATOM   2602 O  O   . THR A 1 331 ? 10.856  1.933   34.947  1.00 10.68 ? 331  THR A O   1 
ATOM   2603 C  CB  . THR A 1 331 ? 9.870   2.574   38.169  1.00 11.47 ? 331  THR A CB  1 
ATOM   2604 O  OG1 . THR A 1 331 ? 10.213  3.436   39.265  1.00 12.85 ? 331  THR A OG1 1 
ATOM   2605 C  CG2 . THR A 1 331 ? 10.611  1.256   38.327  1.00 11.44 ? 331  THR A CG2 1 
ATOM   2606 N  N   . HIS A 1 332 ? 8.685   2.253   35.336  1.00 10.68 ? 332  HIS A N   1 
ATOM   2607 C  CA  . HIS A 1 332 ? 8.279   1.462   34.181  1.00 10.03 ? 332  HIS A CA  1 
ATOM   2608 C  C   . HIS A 1 332 ? 8.875   2.031   32.901  1.00 10.08 ? 332  HIS A C   1 
ATOM   2609 O  O   . HIS A 1 332 ? 9.397   1.291   32.070  1.00 10.94 ? 332  HIS A O   1 
ATOM   2610 C  CB  . HIS A 1 332 ? 6.752   1.436   34.094  1.00 10.53 ? 332  HIS A CB  1 
ATOM   2611 C  CG  . HIS A 1 332 ? 6.254   0.511   33.021  1.00 11.48 ? 332  HIS A CG  1 
ATOM   2612 N  ND1 . HIS A 1 332 ? 6.440   -0.854  33.056  1.00 11.72 ? 332  HIS A ND1 1 
ATOM   2613 C  CD2 . HIS A 1 332 ? 5.570   0.787   31.891  1.00 11.53 ? 332  HIS A CD2 1 
ATOM   2614 C  CE1 . HIS A 1 332 ? 5.887   -1.383  31.979  1.00 11.74 ? 332  HIS A CE1 1 
ATOM   2615 N  NE2 . HIS A 1 332 ? 5.347   -0.413  31.252  1.00 11.93 ? 332  HIS A NE2 1 
ATOM   2616 N  N   . HIS A 1 333 ? 8.865   3.354   32.754  1.00 9.41  ? 333  HIS A N   1 
ATOM   2617 C  CA  . HIS A 1 333 ? 9.394   3.974   31.539  1.00 9.63  ? 333  HIS A CA  1 
ATOM   2618 C  C   . HIS A 1 333 ? 10.876  3.689   31.314  1.00 9.86  ? 333  HIS A C   1 
ATOM   2619 O  O   . HIS A 1 333 ? 11.330  3.758   30.160  1.00 10.15 ? 333  HIS A O   1 
ATOM   2620 C  CB  . HIS A 1 333 ? 9.176   5.491   31.583  1.00 10.35 ? 333  HIS A CB  1 
ATOM   2621 C  CG  . HIS A 1 333 ? 9.042   6.110   30.225  1.00 9.85  ? 333  HIS A CG  1 
ATOM   2622 N  ND1 . HIS A 1 333 ? 8.171   7.132   29.937  1.00 11.33 ? 333  HIS A ND1 1 
ATOM   2623 C  CD2 . HIS A 1 333 ? 9.678   5.805   29.062  1.00 9.78  ? 333  HIS A CD2 1 
ATOM   2624 C  CE1 . HIS A 1 333 ? 8.311   7.435   28.650  1.00 9.09  ? 333  HIS A CE1 1 
ATOM   2625 N  NE2 . HIS A 1 333 ? 9.204   6.651   28.101  1.00 11.55 ? 333  HIS A NE2 1 
ATOM   2626 N  N   . SER A 1 334 ? 11.651  3.397   32.341  1.00 10.47 ? 334  SER A N   1 
ATOM   2627 C  CA  . SER A 1 334 ? 13.078  3.172   32.222  1.00 10.53 ? 334  SER A CA  1 
ATOM   2628 C  C   . SER A 1 334 ? 13.470  1.724   32.492  1.00 10.09 ? 334  SER A C   1 
ATOM   2629 O  O   . SER A 1 334 ? 14.657  1.399   32.370  1.00 10.04 ? 334  SER A O   1 
ATOM   2630 C  CB  . SER A 1 334 ? 13.849  4.109   33.156  1.00 11.82 ? 334  SER A CB  1 
ATOM   2631 O  OG  . SER A 1 334 ? 13.423  3.917   34.505  1.00 11.20 ? 334  SER A OG  1 
ATOM   2632 N  N   . VAL A 1 335 ? 12.495  0.833   32.700  1.00 10.44 ? 335  VAL A N   1 
ATOM   2633 C  CA  . VAL A 1 335 ? 12.844  -0.539  33.115  1.00 11.77 ? 335  VAL A CA  1 
ATOM   2634 C  C   . VAL A 1 335 ? 13.587  -1.297  32.026  1.00 11.74 ? 335  VAL A C   1 
ATOM   2635 O  O   . VAL A 1 335 ? 14.430  -2.164  32.296  1.00 12.21 ? 335  VAL A O   1 
ATOM   2636 C  CB  . VAL A 1 335 ? 11.591  -1.297  33.578  1.00 12.36 ? 335  VAL A CB  1 
ATOM   2637 C  CG1 . VAL A 1 335 ? 10.644  -1.607  32.430  1.00 13.26 ? 335  VAL A CG1 1 
ATOM   2638 C  CG2 . VAL A 1 335 ? 11.966  -2.581  34.321  1.00 13.64 ? 335  VAL A CG2 1 
ATOM   2639 N  N   . ASN A 1 336 ? 13.356  -0.949  30.769  1.00 11.26 ? 336  ASN A N   1 
ATOM   2640 C  CA  . ASN A 1 336 ? 13.995  -1.546  29.608  1.00 11.91 ? 336  ASN A CA  1 
ATOM   2641 C  C   . ASN A 1 336 ? 15.299  -0.878  29.200  1.00 12.19 ? 336  ASN A C   1 
ATOM   2642 O  O   . ASN A 1 336 ? 15.876  -1.248  28.168  1.00 11.86 ? 336  ASN A O   1 
ATOM   2643 C  CB  . ASN A 1 336 ? 13.026  -1.490  28.410  1.00 12.82 ? 336  ASN A CB  1 
ATOM   2644 C  CG  . ASN A 1 336 ? 12.767  -0.063  27.965  1.00 12.11 ? 336  ASN A CG  1 
ATOM   2645 O  OD1 . ASN A 1 336 ? 13.008  0.895   28.696  1.00 11.78 ? 336  ASN A OD1 1 
ATOM   2646 N  ND2 . ASN A 1 336 ? 12.260  0.089   26.745  1.00 11.77 ? 336  ASN A ND2 1 
ATOM   2647 N  N   . GLY A 1 337 ? 15.757  0.123   29.944  1.00 11.86 ? 337  GLY A N   1 
ATOM   2648 C  CA  . GLY A 1 337 ? 16.969  0.856   29.626  1.00 11.84 ? 337  GLY A CA  1 
ATOM   2649 C  C   . GLY A 1 337 ? 16.711  2.159   28.880  1.00 11.31 ? 337  GLY A C   1 
ATOM   2650 O  O   . GLY A 1 337 ? 17.644  2.902   28.603  1.00 11.74 ? 337  GLY A O   1 
ATOM   2651 N  N   . CYS A 1 338 ? 15.450  2.454   28.569  1.00 11.13 ? 338  CYS A N   1 
ATOM   2652 C  CA  . CYS A 1 338 ? 15.148  3.737   27.927  1.00 11.16 ? 338  CYS A CA  1 
ATOM   2653 C  C   . CYS A 1 338 ? 15.702  4.889   28.759  1.00 10.90 ? 338  CYS A C   1 
ATOM   2654 O  O   . CYS A 1 338 ? 15.494  4.909   29.971  1.00 10.81 ? 338  CYS A O   1 
ATOM   2655 C  CB  . CYS A 1 338 ? 13.637  3.884   27.783  1.00 10.05 ? 338  CYS A CB  1 
ATOM   2656 S  SG  . CYS A 1 338 ? 13.112  5.397   26.937  1.00 9.49  ? 338  CYS A SG  1 
ATOM   2657 N  N   . ASN A 1 339 ? 16.333  5.854   28.105  1.00 10.29 ? 339  ASN A N   1 
ATOM   2658 C  CA  . ASN A 1 339 ? 16.990  6.969   28.757  1.00 10.95 ? 339  ASN A CA  1 
ATOM   2659 C  C   . ASN A 1 339 ? 16.104  8.204   28.852  1.00 11.10 ? 339  ASN A C   1 
ATOM   2660 O  O   . ASN A 1 339 ? 15.948  8.954   27.890  1.00 11.14 ? 339  ASN A O   1 
ATOM   2661 C  CB  . ASN A 1 339 ? 18.300  7.326   28.039  1.00 11.13 ? 339  ASN A CB  1 
ATOM   2662 C  CG  . ASN A 1 339 ? 18.196  7.587   26.552  1.00 12.02 ? 339  ASN A CG  1 
ATOM   2663 O  OD1 . ASN A 1 339 ? 17.383  6.966   25.858  1.00 12.05 ? 339  ASN A OD1 1 
ATOM   2664 N  ND2 . ASN A 1 339 ? 19.004  8.516   26.062  1.00 12.46 ? 339  ASN A ND2 1 
ATOM   2665 N  N   . LEU A 1 340 ? 15.508  8.421   30.028  1.00 10.71 ? 340  LEU A N   1 
ATOM   2666 C  CA  . LEU A 1 340 ? 14.780  9.656   30.307  1.00 10.81 ? 340  LEU A CA  1 
ATOM   2667 C  C   . LEU A 1 340 ? 15.762  10.810  30.402  1.00 10.87 ? 340  LEU A C   1 
ATOM   2668 O  O   . LEU A 1 340 ? 16.891  10.607  30.861  1.00 11.86 ? 340  LEU A O   1 
ATOM   2669 C  CB  . LEU A 1 340 ? 13.988  9.523   31.617  1.00 11.13 ? 340  LEU A CB  1 
ATOM   2670 C  CG  . LEU A 1 340 ? 12.956  8.390   31.648  1.00 11.55 ? 340  LEU A CG  1 
ATOM   2671 C  CD1 . LEU A 1 340 ? 12.320  8.299   33.026  1.00 13.49 ? 340  LEU A CD1 1 
ATOM   2672 C  CD2 . LEU A 1 340 ? 11.915  8.613   30.553  1.00 12.55 ? 340  LEU A CD2 1 
ATOM   2673 N  N   . ARG A 1 341 ? 15.390  11.991  29.925  1.00 10.82 ? 341  ARG A N   1 
ATOM   2674 C  CA  . ARG A 1 341 ? 16.305  13.136  29.874  1.00 10.83 ? 341  ARG A CA  1 
ATOM   2675 C  C   . ARG A 1 341 ? 15.665  14.336  30.550  1.00 10.88 ? 341  ARG A C   1 
ATOM   2676 O  O   . ARG A 1 341 ? 14.440  14.455  30.595  1.00 10.80 ? 341  ARG A O   1 
ATOM   2677 C  CB  . ARG A 1 341 ? 16.665  13.440  28.412  1.00 11.48 ? 341  ARG A CB  1 
ATOM   2678 C  CG  . ARG A 1 341 ? 17.436  12.335  27.714  1.00 12.76 ? 341  ARG A CG  1 
ATOM   2679 C  CD  . ARG A 1 341 ? 17.956  12.674  26.333  1.00 13.29 ? 341  ARG A CD  1 
ATOM   2680 N  NE  . ARG A 1 341 ? 16.856  12.905  25.399  1.00 14.95 ? 341  ARG A NE  1 
ATOM   2681 C  CZ  . ARG A 1 341 ? 17.023  13.203  24.115  1.00 16.10 ? 341  ARG A CZ  1 
ATOM   2682 N  NH1 . ARG A 1 341 ? 18.247  13.279  23.605  1.00 16.68 ? 341  ARG A NH1 1 
ATOM   2683 N  NH2 . ARG A 1 341 ? 15.965  13.405  23.347  1.00 16.42 ? 341  ARG A NH2 1 
ATOM   2684 N  N   . PRO A 1 342 ? 16.459  15.255  31.101  1.00 10.81 ? 342  PRO A N   1 
ATOM   2685 C  CA  . PRO A 1 342 ? 15.934  16.454  31.731  1.00 10.58 ? 342  PRO A CA  1 
ATOM   2686 C  C   . PRO A 1 342 ? 14.962  17.199  30.833  1.00 10.88 ? 342  PRO A C   1 
ATOM   2687 O  O   . PRO A 1 342 ? 15.232  17.410  29.650  1.00 11.39 ? 342  PRO A O   1 
ATOM   2688 C  CB  . PRO A 1 342 ? 17.176  17.284  32.058  1.00 11.45 ? 342  PRO A CB  1 
ATOM   2689 C  CG  . PRO A 1 342 ? 18.284  16.288  32.096  1.00 11.31 ? 342  PRO A CG  1 
ATOM   2690 C  CD  . PRO A 1 342 ? 17.944  15.219  31.089  1.00 11.34 ? 342  PRO A CD  1 
ATOM   2691 N  N   . GLY A 1 343 ? 13.777  17.511  31.359  1.00 10.33 ? 343  GLY A N   1 
ATOM   2692 C  CA  . GLY A 1 343 ? 12.793  18.270  30.591  1.00 10.19 ? 343  GLY A CA  1 
ATOM   2693 C  C   . GLY A 1 343 ? 11.788  17.369  29.882  1.00 9.43  ? 343  GLY A C   1 
ATOM   2694 O  O   . GLY A 1 343 ? 10.815  17.885  29.308  1.00 9.71  ? 343  GLY A O   1 
ATOM   2695 N  N   . ASP A 1 344 ? 12.016  16.061  29.906  1.00 9.05  ? 344  ASP A N   1 
ATOM   2696 C  CA  . ASP A 1 344 ? 10.973  15.140  29.424  1.00 9.31  ? 344  ASP A CA  1 
ATOM   2697 C  C   . ASP A 1 344 ? 9.701   15.357  30.233  1.00 9.24  ? 344  ASP A C   1 
ATOM   2698 O  O   . ASP A 1 344 ? 9.767   15.682  31.423  1.00 9.84  ? 344  ASP A O   1 
ATOM   2699 C  CB  . ASP A 1 344 ? 11.424  13.695  29.535  1.00 9.60  ? 344  ASP A CB  1 
ATOM   2700 C  CG  . ASP A 1 344 ? 12.390  13.232  28.464  1.00 10.71 ? 344  ASP A CG  1 
ATOM   2701 O  OD1 . ASP A 1 344 ? 12.651  13.978  27.497  1.00 10.78 ? 344  ASP A OD1 1 
ATOM   2702 O  OD2 . ASP A 1 344 ? 12.848  12.080  28.616  1.00 10.39 ? 344  ASP A OD2 1 
ATOM   2703 N  N   . LEU A 1 345 ? 8.564   15.149  29.576  1.00 8.91  ? 345  LEU A N   1 
ATOM   2704 C  CA  . LEU A 1 345 ? 7.261   15.375  30.203  1.00 8.98  ? 345  LEU A CA  1 
ATOM   2705 C  C   . LEU A 1 345 ? 6.438   14.098  30.202  1.00 9.96  ? 345  LEU A C   1 
ATOM   2706 O  O   . LEU A 1 345 ? 6.196   13.530  29.130  1.00 9.70  ? 345  LEU A O   1 
ATOM   2707 C  CB  . LEU A 1 345 ? 6.541   16.495  29.441  1.00 10.56 ? 345  LEU A CB  1 
ATOM   2708 C  CG  . LEU A 1 345 ? 5.257   17.013  30.097  1.00 10.40 ? 345  LEU A CG  1 
ATOM   2709 C  CD1 . LEU A 1 345 ? 5.543   17.623  31.468  1.00 10.76 ? 345  LEU A CD1 1 
ATOM   2710 C  CD2 . LEU A 1 345 ? 4.571   18.023  29.191  1.00 12.45 ? 345  LEU A CD2 1 
ATOM   2711 N  N   . LEU A 1 346 ? 6.120   13.598  31.392  1.00 9.11  ? 346  LEU A N   1 
ATOM   2712 C  CA  . LEU A 1 346 ? 5.359   12.364  31.556  1.00 9.52  ? 346  LEU A CA  1 
ATOM   2713 C  C   . LEU A 1 346 ? 3.992   12.700  32.128  1.00 9.34  ? 346  LEU A C   1 
ATOM   2714 O  O   . LEU A 1 346 ? 3.888   13.171  33.264  1.00 9.58  ? 346  LEU A O   1 
ATOM   2715 C  CB  . LEU A 1 346 ? 6.104   11.393  32.478  1.00 9.57  ? 346  LEU A CB  1 
ATOM   2716 C  CG  . LEU A 1 346 ? 7.234   10.571  31.843  1.00 10.63 ? 346  LEU A CG  1 
ATOM   2717 C  CD1 . LEU A 1 346 ? 8.367   11.430  31.326  1.00 11.55 ? 346  LEU A CD1 1 
ATOM   2718 C  CD2 . LEU A 1 346 ? 7.778   9.577   32.871  1.00 11.30 ? 346  LEU A CD2 1 
ATOM   2719 N  N   . ALA A 1 347 ? 2.933   12.503  31.344  1.00 9.03  ? 347  ALA A N   1 
ATOM   2720 C  CA  . ALA A 1 347 ? 1.600   12.936  31.737  1.00 9.69  ? 347  ALA A CA  1 
ATOM   2721 C  C   . ALA A 1 347 ? 0.760   11.753  32.208  1.00 10.18 ? 347  ALA A C   1 
ATOM   2722 O  O   . ALA A 1 347 ? 1.025   10.590  31.897  1.00 9.70  ? 347  ALA A O   1 
ATOM   2723 C  CB  . ALA A 1 347 ? 0.913   13.629  30.569  1.00 9.15  ? 347  ALA A CB  1 
ATOM   2724 N  N   . SER A 1 348 ? -0.273  12.089  32.972  1.00 9.74  ? 348  SER A N   1 
ATOM   2725 C  CA  . SER A 1 348 ? -1.040  11.124  33.743  1.00 11.12 ? 348  SER A CA  1 
ATOM   2726 C  C   . SER A 1 348 ? -2.016  10.315  32.907  1.00 11.95 ? 348  SER A C   1 
ATOM   2727 O  O   . SER A 1 348 ? -2.401  9.195   33.268  1.00 13.90 ? 348  SER A O   1 
ATOM   2728 C  CB  . SER A 1 348 ? -1.839  11.890  34.814  1.00 11.37 ? 348  SER A CB  1 
ATOM   2729 O  OG  . SER A 1 348 ? -2.689  12.854  34.214  1.00 10.77 ? 348  SER A OG  1 
ATOM   2730 N  N   . GLY A 1 349 ? -2.408  10.870  31.771  1.00 10.23 ? 349  GLY A N   1 
ATOM   2731 C  CA  . GLY A 1 349 ? -3.624  10.396  31.100  1.00 11.48 ? 349  GLY A CA  1 
ATOM   2732 C  C   . GLY A 1 349 ? -4.807  11.135  31.728  1.00 11.86 ? 349  GLY A C   1 
ATOM   2733 O  O   . GLY A 1 349 ? -4.683  11.791  32.759  1.00 11.94 ? 349  GLY A O   1 
ATOM   2734 N  N   . THR A 1 350 ? -5.941  11.057  31.048  1.00 11.29 ? 350  THR A N   1 
ATOM   2735 C  CA  . THR A 1 350 ? -7.144  11.734  31.514  1.00 11.35 ? 350  THR A CA  1 
ATOM   2736 C  C   . THR A 1 350 ? -7.455  11.342  32.954  1.00 11.34 ? 350  THR A C   1 
ATOM   2737 O  O   . THR A 1 350 ? -7.467  10.158  33.275  1.00 11.86 ? 350  THR A O   1 
ATOM   2738 C  CB  . THR A 1 350 ? -8.342  11.387  30.620  1.00 11.12 ? 350  THR A CB  1 
ATOM   2739 O  OG1 . THR A 1 350 ? -7.985  11.662  29.259  1.00 11.50 ? 350  THR A OG1 1 
ATOM   2740 C  CG2 . THR A 1 350 ? -9.568  12.188  31.008  1.00 10.99 ? 350  THR A CG2 1 
ATOM   2741 N  N   . ILE A 1 351 ? -7.720  12.340  33.777  1.00 10.99 ? 351  ILE A N   1 
ATOM   2742 C  CA  . ILE A 1 351 ? -8.056  12.119  35.180  1.00 12.11 ? 351  ILE A CA  1 
ATOM   2743 C  C   . ILE A 1 351 ? -9.569  12.033  35.324  1.00 12.71 ? 351  ILE A C   1 
ATOM   2744 O  O   . ILE A 1 351 ? -10.272 12.961  34.926  1.00 14.38 ? 351  ILE A O   1 
ATOM   2745 C  CB  . ILE A 1 351 ? -7.488  13.248  36.055  1.00 12.16 ? 351  ILE A CB  1 
ATOM   2746 C  CG1 . ILE A 1 351 ? -5.956  13.257  35.937  1.00 13.14 ? 351  ILE A CG1 1 
ATOM   2747 C  CG2 . ILE A 1 351 ? -7.887  13.103  37.517  1.00 13.73 ? 351  ILE A CG2 1 
ATOM   2748 C  CD1 . ILE A 1 351 ? -5.308  14.584  36.266  1.00 16.07 ? 351  ILE A CD1 1 
ATOM   2749 N  N   . SER A 1 352 ? -10.072 10.919  35.849  1.00 12.26 ? 352  SER A N   1 
ATOM   2750 C  CA  . SER A 1 352 ? -11.484 10.831  36.204  1.00 12.13 ? 352  SER A CA  1 
ATOM   2751 C  C   . SER A 1 352 ? -11.628 10.187  37.582  1.00 12.44 ? 352  SER A C   1 
ATOM   2752 O  O   . SER A 1 352 ? -10.950 9.187   37.801  1.00 13.08 ? 352  SER A O   1 
ATOM   2753 C  CB  . SER A 1 352 ? -12.264 9.997   35.185  1.00 12.11 ? 352  SER A CB  1 
ATOM   2754 O  OG  . SER A 1 352 ? -12.280 10.634  33.923  1.00 12.20 ? 352  SER A OG  1 
ATOM   2755 N  N   . GLY A 1 353 ? -12.433 10.771  38.462  1.00 13.35 ? 353  GLY A N   1 
ATOM   2756 C  CA  . GLY A 1 353 ? -12.818 10.043  39.679  1.00 13.77 ? 353  GLY A CA  1 
ATOM   2757 C  C   . GLY A 1 353 ? -14.055 9.187   39.407  1.00 15.43 ? 353  GLY A C   1 
ATOM   2758 O  O   . GLY A 1 353 ? -14.510 9.122   38.265  1.00 15.42 ? 353  GLY A O   1 
ATOM   2759 N  N   . SER A 1 354 ? -14.621 8.571   40.442  1.00 17.30 ? 354  SER A N   1 
ATOM   2760 C  CA  . SER A 1 354 ? -15.806 7.735   40.242  1.00 19.34 ? 354  SER A CA  1 
ATOM   2761 C  C   . SER A 1 354 ? -17.087 8.546   40.151  1.00 19.81 ? 354  SER A C   1 
ATOM   2762 O  O   . SER A 1 354 ? -18.050 8.129   39.503  1.00 20.08 ? 354  SER A O   1 
ATOM   2763 C  CB  . SER A 1 354 ? -15.918 6.707   41.376  1.00 20.64 ? 354  SER A CB  1 
ATOM   2764 O  OG  . SER A 1 354 ? -16.018 7.400   42.607  1.00 23.05 ? 354  SER A OG  1 
ATOM   2765 N  N   . ASP A 1 355 ? -17.143 9.696   40.810  1.00 19.94 ? 355  ASP A N   1 
ATOM   2766 C  CA  . ASP A 1 355 ? -18.261 10.622  40.646  1.00 20.46 ? 355  ASP A CA  1 
ATOM   2767 C  C   . ASP A 1 355 ? -18.298 11.161  39.224  1.00 19.81 ? 355  ASP A C   1 
ATOM   2768 O  O   . ASP A 1 355 ? -17.305 11.689  38.711  1.00 19.26 ? 355  ASP A O   1 
ATOM   2769 C  CB  . ASP A 1 355 ? -18.090 11.761  41.650  1.00 22.64 ? 355  ASP A CB  1 
ATOM   2770 C  CG  . ASP A 1 355 ? -19.296 12.653  41.817  1.00 24.11 ? 355  ASP A CG  1 
ATOM   2771 O  OD1 . ASP A 1 355 ? -19.983 12.970  40.826  1.00 24.68 ? 355  ASP A OD1 1 
ATOM   2772 O  OD2 . ASP A 1 355 ? -19.558 13.049  42.980  1.00 26.16 ? 355  ASP A OD2 1 
ATOM   2773 N  N   . PRO A 1 356 ? -19.460 11.117  38.579  1.00 19.06 ? 356  PRO A N   1 
ATOM   2774 C  CA  . PRO A 1 356 ? -19.615 11.594  37.219  1.00 18.46 ? 356  PRO A CA  1 
ATOM   2775 C  C   . PRO A 1 356 ? -19.308 13.064  37.034  1.00 18.01 ? 356  PRO A C   1 
ATOM   2776 O  O   . PRO A 1 356 ? -18.924 13.471  35.935  1.00 17.85 ? 356  PRO A O   1 
ATOM   2777 C  CB  . PRO A 1 356 ? -21.051 11.258  36.838  1.00 18.92 ? 356  PRO A CB  1 
ATOM   2778 C  CG  . PRO A 1 356 ? -21.457 10.169  37.770  1.00 19.24 ? 356  PRO A CG  1 
ATOM   2779 C  CD  . PRO A 1 356 ? -20.636 10.320  39.017  1.00 19.27 ? 356  PRO A CD  1 
ATOM   2780 N  N   . GLU A 1 357 ? -19.383 13.896  38.071  1.00 18.26 ? 357  GLU A N   1 
ATOM   2781 C  CA  . GLU A 1 357 ? -18.967 15.284  37.994  1.00 18.78 ? 357  GLU A CA  1 
ATOM   2782 C  C   . GLU A 1 357 ? -17.452 15.454  37.883  1.00 16.97 ? 357  GLU A C   1 
ATOM   2783 O  O   . GLU A 1 357 ? -17.003 16.580  37.658  1.00 15.22 ? 357  GLU A O   1 
ATOM   2784 C  CB  . GLU A 1 357 ? -19.459 16.077  39.211  1.00 22.21 ? 357  GLU A CB  1 
ATOM   2785 C  CG  . GLU A 1 357 ? -20.964 16.038  39.410  1.00 26.65 ? 357  GLU A CG  1 
ATOM   2786 C  CD  . GLU A 1 357 ? -21.537 17.253  40.104  1.00 29.18 ? 357  GLU A CD  1 
ATOM   2787 O  OE1 . GLU A 1 357 ? -20.783 18.177  40.475  1.00 31.80 ? 357  GLU A OE1 1 
ATOM   2788 O  OE2 . GLU A 1 357 ? -22.775 17.311  40.278  1.00 31.10 ? 357  GLU A OE2 1 
ATOM   2789 N  N   . SER A 1 358 ? -16.684 14.389  38.063  1.00 14.31 ? 358  SER A N   1 
ATOM   2790 C  CA  . SER A 1 358 ? -15.231 14.447  38.078  1.00 14.29 ? 358  SER A CA  1 
ATOM   2791 C  C   . SER A 1 358 ? -14.624 13.767  36.857  1.00 13.04 ? 358  SER A C   1 
ATOM   2792 O  O   . SER A 1 358 ? -13.409 13.523  36.819  1.00 13.28 ? 358  SER A O   1 
ATOM   2793 C  CB  . SER A 1 358 ? -14.718 13.770  39.354  1.00 13.63 ? 358  SER A CB  1 
ATOM   2794 O  OG  . SER A 1 358 ? -14.777 12.358  39.219  1.00 14.72 ? 358  SER A OG  1 
ATOM   2795 N  N   . PHE A 1 359 ? -15.459 13.434  35.878  1.00 12.34 ? 359  PHE A N   1 
ATOM   2796 C  CA  . PHE A 1 359 ? -14.941 12.797  34.669  1.00 11.87 ? 359  PHE A CA  1 
ATOM   2797 C  C   . PHE A 1 359 ? -14.193 13.820  33.817  1.00 11.95 ? 359  PHE A C   1 
ATOM   2798 O  O   . PHE A 1 359 ? -14.696 14.916  33.597  1.00 13.23 ? 359  PHE A O   1 
ATOM   2799 C  CB  . PHE A 1 359 ? -16.027 12.117  33.847  1.00 12.27 ? 359  PHE A CB  1 
ATOM   2800 C  CG  . PHE A 1 359 ? -16.733 10.958  34.484  1.00 13.72 ? 359  PHE A CG  1 
ATOM   2801 C  CD1 . PHE A 1 359 ? -17.901 10.488  33.897  1.00 14.72 ? 359  PHE A CD1 1 
ATOM   2802 C  CD2 . PHE A 1 359 ? -16.269 10.333  35.627  1.00 14.14 ? 359  PHE A CD2 1 
ATOM   2803 C  CE1 . PHE A 1 359 ? -18.574 9.406   34.442  1.00 15.13 ? 359  PHE A CE1 1 
ATOM   2804 C  CE2 . PHE A 1 359 ? -16.940 9.261   36.181  1.00 15.33 ? 359  PHE A CE2 1 
ATOM   2805 C  CZ  . PHE A 1 359 ? -18.096 8.801   35.585  1.00 15.12 ? 359  PHE A CZ  1 
ATOM   2806 N  N   . GLY A 1 360 ? -13.014 13.427  33.317  1.00 11.03 ? 360  GLY A N   1 
ATOM   2807 C  CA  . GLY A 1 360 ? -12.098 14.424  32.780  1.00 11.48 ? 360  GLY A CA  1 
ATOM   2808 C  C   . GLY A 1 360 ? -12.114 14.616  31.281  1.00 10.65 ? 360  GLY A C   1 
ATOM   2809 O  O   . GLY A 1 360 ? -11.182 15.234  30.749  1.00 10.76 ? 360  GLY A O   1 
ATOM   2810 N  N   . SER A 1 361 ? -13.123 14.097  30.581  1.00 10.41 ? 361  SER A N   1 
ATOM   2811 C  CA  . SER A 1 361 ? -13.254 14.391  29.156  1.00 10.14 ? 361  SER A CA  1 
ATOM   2812 C  C   . SER A 1 361 ? -14.734 14.610  28.840  1.00 10.41 ? 361  SER A C   1 
ATOM   2813 O  O   . SER A 1 361 ? -15.575 14.090  29.565  1.00 11.82 ? 361  SER A O   1 
ATOM   2814 C  CB  . SER A 1 361 ? -12.721 13.265  28.281  1.00 10.99 ? 361  SER A CB  1 
ATOM   2815 O  OG  . SER A 1 361 ? -13.482 12.076  28.473  1.00 11.31 ? 361  SER A OG  1 
ATOM   2816 N  N   . MET A 1 362 ? -14.998 15.308  27.739  1.00 11.17 ? 362  MET A N   1 
ATOM   2817 C  CA  . MET A 1 362 ? -16.396 15.441  27.306  1.00 11.92 ? 362  MET A CA  1 
ATOM   2818 C  C   . MET A 1 362 ? -16.890 14.145  26.689  1.00 12.88 ? 362  MET A C   1 
ATOM   2819 O  O   . MET A 1 362 ? -18.104 13.903  26.725  1.00 13.57 ? 362  MET A O   1 
ATOM   2820 C  CB  . MET A 1 362 ? -16.552 16.635  26.363  1.00 12.00 ? 362  MET A CB  1 
ATOM   2821 C  CG  . MET A 1 362 ? -16.119 17.938  27.031  1.00 11.70 ? 362  MET A CG  1 
ATOM   2822 S  SD  . MET A 1 362 ? -16.075 19.320  25.875  1.00 12.52 ? 362  MET A SD  1 
ATOM   2823 C  CE  . MET A 1 362 ? -17.828 19.667  25.726  1.00 11.97 ? 362  MET A CE  1 
ATOM   2824 N  N   . LEU A 1 363 ? -16.002 13.283  26.214  1.00 12.80 ? 363  LEU A N   1 
ATOM   2825 C  CA  . LEU A 1 363 ? -16.378 11.912  25.871  1.00 13.56 ? 363  LEU A CA  1 
ATOM   2826 C  C   . LEU A 1 363 ? -17.088 11.225  27.028  1.00 13.71 ? 363  LEU A C   1 
ATOM   2827 O  O   . LEU A 1 363 ? -18.109 10.560  26.849  1.00 14.44 ? 363  LEU A O   1 
ATOM   2828 C  CB  . LEU A 1 363 ? -15.143 11.114  25.444  1.00 13.71 ? 363  LEU A CB  1 
ATOM   2829 C  CG  . LEU A 1 363 ? -15.370 9.613   25.250  1.00 14.15 ? 363  LEU A CG  1 
ATOM   2830 C  CD1 . LEU A 1 363 ? -16.224 9.352   24.016  1.00 14.85 ? 363  LEU A CD1 1 
ATOM   2831 C  CD2 . LEU A 1 363 ? -14.044 8.876   25.167  1.00 14.67 ? 363  LEU A CD2 1 
ATOM   2832 N  N   . GLU A 1 364 ? -16.548 11.346  28.237  1.00 12.75 ? 364  GLU A N   1 
ATOM   2833 C  CA  . GLU A 1 364 ? -17.150 10.770  29.431  1.00 13.44 ? 364  GLU A CA  1 
ATOM   2834 C  C   . GLU A 1 364 ? -18.313 11.589  29.964  1.00 13.44 ? 364  GLU A C   1 
ATOM   2835 O  O   . GLU A 1 364 ? -19.364 11.039  30.324  1.00 14.04 ? 364  GLU A O   1 
ATOM   2836 C  CB  . GLU A 1 364 ? -16.076 10.651  30.518  1.00 13.09 ? 364  GLU A CB  1 
ATOM   2837 C  CG  . GLU A 1 364 ? -15.036 9.575   30.189  1.00 13.06 ? 364  GLU A CG  1 
ATOM   2838 C  CD  . GLU A 1 364 ? -13.825 9.790   31.089  1.00 13.28 ? 364  GLU A CD  1 
ATOM   2839 O  OE1 . GLU A 1 364 ? -13.758 9.125   32.134  1.00 13.38 ? 364  GLU A OE1 1 
ATOM   2840 O  OE2 . GLU A 1 364 ? -12.995 10.652  30.732  1.00 14.08 ? 364  GLU A OE2 1 
ATOM   2841 N  N   . LEU A 1 365 ? -18.167 12.914  30.013  1.00 13.42 ? 365  LEU A N   1 
ATOM   2842 C  CA  . LEU A 1 365 ? -19.221 13.768  30.553  1.00 14.43 ? 365  LEU A CA  1 
ATOM   2843 C  C   . LEU A 1 365 ? -20.502 13.694  29.729  1.00 15.38 ? 365  LEU A C   1 
ATOM   2844 O  O   . LEU A 1 365 ? -21.588 13.734  30.323  1.00 16.60 ? 365  LEU A O   1 
ATOM   2845 C  CB  . LEU A 1 365 ? -18.749 15.221  30.672  1.00 13.67 ? 365  LEU A CB  1 
ATOM   2846 C  CG  . LEU A 1 365 ? -17.654 15.445  31.726  1.00 13.80 ? 365  LEU A CG  1 
ATOM   2847 C  CD1 . LEU A 1 365 ? -16.984 16.784  31.475  1.00 13.57 ? 365  LEU A CD1 1 
ATOM   2848 C  CD2 . LEU A 1 365 ? -18.223 15.382  33.136  1.00 14.41 ? 365  LEU A CD2 1 
ATOM   2849 N  N   . SER A 1 366 ? -20.376 13.578  28.414  1.00 15.21 ? 366  SER A N   1 
ATOM   2850 C  CA  . SER A 1 366 ? -21.526 13.397  27.535  1.00 16.42 ? 366  SER A CA  1 
ATOM   2851 C  C   . SER A 1 366 ? -21.846 11.931  27.273  1.00 17.04 ? 366  SER A C   1 
ATOM   2852 O  O   . SER A 1 366 ? -22.773 11.630  26.512  1.00 16.88 ? 366  SER A O   1 
ATOM   2853 C  CB  . SER A 1 366 ? -21.266 14.094  26.194  1.00 15.88 ? 366  SER A CB  1 
ATOM   2854 O  OG  . SER A 1 366 ? -20.449 13.305  25.347  1.00 17.00 ? 366  SER A OG  1 
ATOM   2855 N  N   . TRP A 1 367 ? -21.068 11.018  27.834  1.00 17.28 ? 367  TRP A N   1 
ATOM   2856 C  CA  . TRP A 1 367 ? -21.157 9.590   27.584  1.00 17.59 ? 367  TRP A CA  1 
ATOM   2857 C  C   . TRP A 1 367 ? -21.331 9.243   26.114  1.00 19.13 ? 367  TRP A C   1 
ATOM   2858 O  O   . TRP A 1 367 ? -22.351 8.713   25.658  1.00 18.58 ? 367  TRP A O   1 
ATOM   2859 C  CB  . TRP A 1 367 ? -22.246 8.948   28.455  1.00 17.88 ? 367  TRP A CB  1 
ATOM   2860 C  CG  . TRP A 1 367 ? -21.929 7.505   28.735  1.00 18.06 ? 367  TRP A CG  1 
ATOM   2861 C  CD1 . TRP A 1 367 ? -22.534 6.408   28.194  1.00 18.56 ? 367  TRP A CD1 1 
ATOM   2862 C  CD2 . TRP A 1 367 ? -20.905 7.013   29.603  1.00 18.22 ? 367  TRP A CD2 1 
ATOM   2863 N  NE1 . TRP A 1 367 ? -21.959 5.260   28.686  1.00 18.92 ? 367  TRP A NE1 1 
ATOM   2864 C  CE2 . TRP A 1 367 ? -20.954 5.606   29.552  1.00 18.13 ? 367  TRP A CE2 1 
ATOM   2865 C  CE3 . TRP A 1 367 ? -19.961 7.624   30.438  1.00 18.06 ? 367  TRP A CE3 1 
ATOM   2866 C  CZ2 . TRP A 1 367 ? -20.096 4.797   30.294  1.00 18.08 ? 367  TRP A CZ2 1 
ATOM   2867 C  CZ3 . TRP A 1 367 ? -19.107 6.819   31.170  1.00 17.87 ? 367  TRP A CZ3 1 
ATOM   2868 C  CH2 . TRP A 1 367 ? -19.180 5.425   31.096  1.00 18.09 ? 367  TRP A CH2 1 
ATOM   2869 N  N   . LYS A 1 368 ? -20.301 9.545   25.332  1.00 19.53 ? 368  LYS A N   1 
ATOM   2870 C  CA  . LYS A 1 368 ? -20.228 9.267   23.907  1.00 21.21 ? 368  LYS A CA  1 
ATOM   2871 C  C   . LYS A 1 368 ? -21.322 10.017  23.156  1.00 21.76 ? 368  LYS A C   1 
ATOM   2872 O  O   . LYS A 1 368 ? -21.933 9.486   22.229  1.00 22.00 ? 368  LYS A O   1 
ATOM   2873 C  CB  . LYS A 1 368 ? -20.303 7.757   23.665  1.00 22.95 ? 368  LYS A CB  1 
ATOM   2874 C  CG  . LYS A 1 368 ? -19.548 7.261   22.443  1.00 25.27 ? 368  LYS A CG  1 
ATOM   2875 C  CD  . LYS A 1 368 ? -19.669 5.743   22.328  1.00 26.76 ? 368  LYS A CD  1 
ATOM   2876 C  CE  . LYS A 1 368 ? -18.913 5.235   21.111  1.00 28.43 ? 368  LYS A CE  1 
ATOM   2877 N  NZ  . LYS A 1 368 ? -18.813 3.746   21.108  1.00 29.46 ? 368  LYS A NZ  1 
ATOM   2878 N  N   . GLY A 1 369 ? -21.576 11.260  23.543  1.00 21.28 ? 369  GLY A N   1 
ATOM   2879 C  CA  . GLY A 1 369 ? -22.616 12.088  22.967  1.00 22.54 ? 369  GLY A CA  1 
ATOM   2880 C  C   . GLY A 1 369 ? -24.033 11.582  23.174  1.00 23.34 ? 369  GLY A C   1 
ATOM   2881 O  O   . GLY A 1 369 ? -24.899 11.875  22.337  1.00 24.33 ? 369  GLY A O   1 
ATOM   2882 N  N   . THR A 1 370 ? -24.328 10.884  24.264  1.00 22.87 ? 370  THR A N   1 
ATOM   2883 C  CA  . THR A 1 370 ? -25.690 10.414  24.516  1.00 23.21 ? 370  THR A CA  1 
ATOM   2884 C  C   . THR A 1 370 ? -26.390 11.263  25.567  1.00 24.13 ? 370  THR A C   1 
ATOM   2885 O  O   . THR A 1 370 ? -27.587 11.133  25.830  1.00 24.37 ? 370  THR A O   1 
ATOM   2886 C  CB  . THR A 1 370 ? -25.723 8.949   24.986  1.00 22.94 ? 370  THR A CB  1 
ATOM   2887 O  OG1 . THR A 1 370 ? -24.975 8.830   26.207  1.00 21.85 ? 370  THR A OG1 1 
ATOM   2888 C  CG2 . THR A 1 370 ? -25.125 8.028   23.940  1.00 22.63 ? 370  THR A CG2 1 
ATOM   2889 N  N   . LYS A 1 371 ? -25.614 12.101  26.236  1.00 24.44 ? 371  LYS A N   1 
ATOM   2890 C  CA  . LYS A 1 371 ? -26.084 13.002  27.274  1.00 25.03 ? 371  LYS A CA  1 
ATOM   2891 C  C   . LYS A 1 371 ? -25.614 14.417  26.940  1.00 25.42 ? 371  LYS A C   1 
ATOM   2892 O  O   . LYS A 1 371 ? -24.459 14.597  26.540  1.00 25.38 ? 371  LYS A O   1 
ATOM   2893 C  CB  . LYS A 1 371 ? -25.547 12.588  28.645  1.00 26.37 ? 371  LYS A CB  1 
ATOM   2894 C  CG  . LYS A 1 371 ? -25.980 11.214  29.119  1.00 27.53 ? 371  LYS A CG  1 
ATOM   2895 C  CD  . LYS A 1 371 ? -25.442 10.862  30.494  1.00 28.02 ? 371  LYS A CD  1 
ATOM   2896 C  CE  . LYS A 1 371 ? -26.036 9.541   30.965  1.00 28.61 ? 371  LYS A CE  1 
ATOM   2897 N  NZ  . LYS A 1 371 ? -25.657 9.236   32.371  1.00 29.35 ? 371  LYS A NZ  1 
ATOM   2898 N  N   . ALA A 1 372 ? -26.493 15.405  27.057  1.00 24.79 ? 372  ALA A N   1 
ATOM   2899 C  CA  . ALA A 1 372 ? -26.087 16.787  26.819  1.00 24.57 ? 372  ALA A CA  1 
ATOM   2900 C  C   . ALA A 1 372 ? -25.470 17.381  28.079  1.00 24.38 ? 372  ALA A C   1 
ATOM   2901 O  O   . ALA A 1 372 ? -26.039 17.269  29.163  1.00 26.03 ? 372  ALA A O   1 
ATOM   2902 C  CB  . ALA A 1 372 ? -27.269 17.634  26.364  1.00 24.45 ? 372  ALA A CB  1 
ATOM   2903 N  N   . ILE A 1 373 ? -24.297 17.987  27.935  1.00 22.93 ? 373  ILE A N   1 
ATOM   2904 C  CA  . ILE A 1 373 ? -23.659 18.693  29.041  1.00 22.32 ? 373  ILE A CA  1 
ATOM   2905 C  C   . ILE A 1 373 ? -24.263 20.088  29.171  1.00 22.93 ? 373  ILE A C   1 
ATOM   2906 O  O   . ILE A 1 373 ? -24.258 20.856  28.212  1.00 22.02 ? 373  ILE A O   1 
ATOM   2907 C  CB  . ILE A 1 373 ? -22.139 18.813  28.823  1.00 21.30 ? 373  ILE A CB  1 
ATOM   2908 C  CG1 . ILE A 1 373 ? -21.521 17.427  28.615  1.00 20.87 ? 373  ILE A CG1 1 
ATOM   2909 C  CG2 . ILE A 1 373 ? -21.486 19.531  29.994  1.00 21.45 ? 373  ILE A CG2 1 
ATOM   2910 C  CD1 . ILE A 1 373 ? -20.111 17.453  28.069  1.00 19.91 ? 373  ILE A CD1 1 
ATOM   2911 N  N   . ASP A 1 374 ? -24.768 20.402  30.358  1.00 24.00 ? 374  ASP A N   1 
ATOM   2912 C  CA  . ASP A 1 374 ? -25.302 21.738  30.633  1.00 25.98 ? 374  ASP A CA  1 
ATOM   2913 C  C   . ASP A 1 374 ? -24.161 22.725  30.828  1.00 25.77 ? 374  ASP A C   1 
ATOM   2914 O  O   . ASP A 1 374 ? -23.347 22.567  31.744  1.00 26.07 ? 374  ASP A O   1 
ATOM   2915 C  CB  . ASP A 1 374 ? -26.198 21.644  31.867  1.00 27.58 ? 374  ASP A CB  1 
ATOM   2916 C  CG  . ASP A 1 374 ? -26.960 22.903  32.210  1.00 29.20 ? 374  ASP A CG  1 
ATOM   2917 O  OD1 . ASP A 1 374 ? -27.411 23.002  33.378  1.00 30.32 ? 374  ASP A OD1 1 
ATOM   2918 O  OD2 . ASP A 1 374 ? -27.123 23.778  31.338  1.00 29.94 ? 374  ASP A OD2 1 
ATOM   2919 N  N   . VAL A 1 375 ? -24.033 23.702  29.929  1.00 25.41 ? 375  VAL A N   1 
ATOM   2920 C  CA  . VAL A 1 375 ? -22.962 24.687  30.036  1.00 25.68 ? 375  VAL A CA  1 
ATOM   2921 C  C   . VAL A 1 375 ? -23.532 26.076  30.329  1.00 26.61 ? 375  VAL A C   1 
ATOM   2922 O  O   . VAL A 1 375 ? -22.866 27.090  30.115  1.00 27.18 ? 375  VAL A O   1 
ATOM   2923 C  CB  . VAL A 1 375 ? -22.023 24.738  28.821  1.00 24.92 ? 375  VAL A CB  1 
ATOM   2924 C  CG1 . VAL A 1 375 ? -21.322 23.401  28.598  1.00 24.24 ? 375  VAL A CG1 1 
ATOM   2925 C  CG2 . VAL A 1 375 ? -22.745 25.161  27.549  1.00 24.71 ? 375  VAL A CG2 1 
ATOM   2926 N  N   . GLY A 1 376 ? -24.754 26.114  30.846  1.00 27.61 ? 376  GLY A N   1 
ATOM   2927 C  CA  . GLY A 1 376 ? -25.368 27.354  31.287  1.00 28.94 ? 376  GLY A CA  1 
ATOM   2928 C  C   . GLY A 1 376 ? -26.015 28.142  30.165  1.00 29.86 ? 376  GLY A C   1 
ATOM   2929 O  O   . GLY A 1 376 ? -25.879 27.876  28.972  1.00 29.39 ? 376  GLY A O   1 
ATOM   2930 N  N   . GLN A 1 377 ? -26.789 29.160  30.554  1.00 31.00 ? 377  GLN A N   1 
ATOM   2931 C  CA  . GLN A 1 377 ? -27.385 30.124  29.642  1.00 32.02 ? 377  GLN A CA  1 
ATOM   2932 C  C   . GLN A 1 377 ? -28.175 29.481  28.514  1.00 31.67 ? 377  GLN A C   1 
ATOM   2933 O  O   . GLN A 1 377 ? -28.116 29.907  27.356  1.00 32.78 ? 377  GLN A O   1 
ATOM   2934 C  CB  . GLN A 1 377 ? -26.303 31.040  29.057  1.00 33.32 ? 377  GLN A CB  1 
ATOM   2935 C  CG  . GLN A 1 377 ? -25.387 31.694  30.075  1.00 35.00 ? 377  GLN A CG  1 
ATOM   2936 C  CD  . GLN A 1 377 ? -24.494 32.758  29.475  1.00 36.36 ? 377  GLN A CD  1 
ATOM   2937 O  OE1 . GLN A 1 377 ? -24.797 33.320  28.421  1.00 37.56 ? 377  GLN A OE1 1 
ATOM   2938 N  NE2 . GLN A 1 377 ? -23.384 33.043  30.148  1.00 37.09 ? 377  GLN A NE2 1 
ATOM   2939 N  N   . GLY A 1 378 ? -28.908 28.411  28.796  1.00 30.78 ? 378  GLY A N   1 
ATOM   2940 C  CA  . GLY A 1 378 ? -29.647 27.644  27.823  1.00 29.72 ? 378  GLY A CA  1 
ATOM   2941 C  C   . GLY A 1 378 ? -28.824 26.880  26.803  1.00 28.41 ? 378  GLY A C   1 
ATOM   2942 O  O   . GLY A 1 378 ? -29.397 26.365  25.836  1.00 29.01 ? 378  GLY A O   1 
ATOM   2943 N  N   . GLN A 1 379 ? -27.510 26.762  26.981  1.00 26.75 ? 379  GLN A N   1 
ATOM   2944 C  CA  . GLN A 1 379 ? -26.674 26.108  25.981  1.00 25.36 ? 379  GLN A CA  1 
ATOM   2945 C  C   . GLN A 1 379 ? -26.203 24.753  26.494  1.00 22.98 ? 379  GLN A C   1 
ATOM   2946 O  O   . GLN A 1 379 ? -26.109 24.547  27.705  1.00 23.29 ? 379  GLN A O   1 
ATOM   2947 C  CB  . GLN A 1 379 ? -25.478 26.978  25.597  1.00 26.24 ? 379  GLN A CB  1 
ATOM   2948 C  CG  . GLN A 1 379 ? -25.835 28.196  24.748  1.00 28.17 ? 379  GLN A CG  1 
ATOM   2949 C  CD  . GLN A 1 379 ? -24.637 28.655  23.937  1.00 29.01 ? 379  GLN A CD  1 
ATOM   2950 O  OE1 . GLN A 1 379 ? -23.976 27.852  23.268  1.00 30.36 ? 379  GLN A OE1 1 
ATOM   2951 N  NE2 . GLN A 1 379 ? -24.338 29.947  23.993  1.00 29.72 ? 379  GLN A NE2 1 
ATOM   2952 N  N   . THR A 1 380 ? -25.978 23.820  25.581  1.00 20.77 ? 380  THR A N   1 
ATOM   2953 C  CA  . THR A 1 380 ? -25.532 22.479  25.897  1.00 19.69 ? 380  THR A CA  1 
ATOM   2954 C  C   . THR A 1 380 ? -24.405 22.074  24.935  1.00 18.23 ? 380  THR A C   1 
ATOM   2955 O  O   . THR A 1 380 ? -24.204 22.665  23.882  1.00 17.77 ? 380  THR A O   1 
ATOM   2956 C  CB  . THR A 1 380 ? -26.603 21.379  25.798  1.00 20.49 ? 380  THR A CB  1 
ATOM   2957 O  OG1 . THR A 1 380 ? -27.125 21.361  24.464  1.00 20.93 ? 380  THR A OG1 1 
ATOM   2958 C  CG2 . THR A 1 380 ? -27.741 21.570  26.791  1.00 20.87 ? 380  THR A CG2 1 
ATOM   2959 N  N   . ARG A 1 381 ? -23.653 21.058  25.347  1.00 16.12 ? 381  ARG A N   1 
ATOM   2960 C  CA  . ARG A 1 381 ? -22.583 20.505  24.532  1.00 14.94 ? 381  ARG A CA  1 
ATOM   2961 C  C   . ARG A 1 381 ? -22.587 18.976  24.606  1.00 14.12 ? 381  ARG A C   1 
ATOM   2962 O  O   . ARG A 1 381 ? -22.928 18.401  25.643  1.00 14.35 ? 381  ARG A O   1 
ATOM   2963 C  CB  . ARG A 1 381 ? -21.208 20.951  25.043  1.00 14.54 ? 381  ARG A CB  1 
ATOM   2964 C  CG  . ARG A 1 381 ? -20.889 22.432  24.931  1.00 13.50 ? 381  ARG A CG  1 
ATOM   2965 C  CD  . ARG A 1 381 ? -20.672 22.840  23.485  1.00 13.39 ? 381  ARG A CD  1 
ATOM   2966 N  NE  . ARG A 1 381 ? -20.348 24.249  23.340  1.00 13.36 ? 381  ARG A NE  1 
ATOM   2967 C  CZ  . ARG A 1 381 ? -21.218 25.253  23.366  1.00 14.62 ? 381  ARG A CZ  1 
ATOM   2968 N  NH1 . ARG A 1 381 ? -22.519 25.025  23.533  1.00 14.34 ? 381  ARG A NH1 1 
ATOM   2969 N  NH2 . ARG A 1 381 ? -20.792 26.500  23.225  1.00 15.19 ? 381  ARG A NH2 1 
ATOM   2970 N  N   . THR A 1 382 ? -22.160 18.338  23.516  1.00 13.44 ? 382  THR A N   1 
ATOM   2971 C  CA  . THR A 1 382 ? -21.608 16.983  23.656  1.00 13.61 ? 382  THR A CA  1 
ATOM   2972 C  C   . THR A 1 382 ? -20.093 17.105  23.515  1.00 13.35 ? 382  THR A C   1 
ATOM   2973 O  O   . THR A 1 382 ? -19.356 16.865  24.472  1.00 13.97 ? 382  THR A O   1 
ATOM   2974 C  CB  . THR A 1 382 ? -22.215 16.009  22.643  1.00 14.31 ? 382  THR A CB  1 
ATOM   2975 O  OG1 . THR A 1 382 ? -22.145 16.606  21.341  1.00 14.69 ? 382  THR A OG1 1 
ATOM   2976 C  CG2 . THR A 1 382 ? -23.678 15.728  22.976  1.00 15.02 ? 382  THR A CG2 1 
ATOM   2977 N  N   . PHE A 1 383 ? -19.631 17.509  22.338  1.00 13.12 ? 383  PHE A N   1 
ATOM   2978 C  CA  . PHE A 1 383 ? -18.224 17.811  22.101  1.00 12.39 ? 383  PHE A CA  1 
ATOM   2979 C  C   . PHE A 1 383 ? -18.003 19.288  21.828  1.00 12.71 ? 383  PHE A C   1 
ATOM   2980 O  O   . PHE A 1 383 ? -18.966 20.067  21.799  1.00 14.29 ? 383  PHE A O   1 
ATOM   2981 C  CB  . PHE A 1 383 ? -17.693 16.949  20.935  1.00 13.11 ? 383  PHE A CB  1 
ATOM   2982 C  CG  . PHE A 1 383 ? -17.596 15.508  21.364  1.00 13.40 ? 383  PHE A CG  1 
ATOM   2983 C  CD1 . PHE A 1 383 ? -18.637 14.620  21.165  1.00 13.17 ? 383  PHE A CD1 1 
ATOM   2984 C  CD2 . PHE A 1 383 ? -16.450 15.070  22.012  1.00 13.30 ? 383  PHE A CD2 1 
ATOM   2985 C  CE1 . PHE A 1 383 ? -18.540 13.311  21.596  1.00 13.36 ? 383  PHE A CE1 1 
ATOM   2986 C  CE2 . PHE A 1 383 ? -16.345 13.756  22.433  1.00 13.84 ? 383  PHE A CE2 1 
ATOM   2987 C  CZ  . PHE A 1 383 ? -17.390 12.873  22.228  1.00 13.44 ? 383  PHE A CZ  1 
ATOM   2988 N  N   . LEU A 1 384 ? -16.756 19.722  21.643  1.00 11.27 ? 384  LEU A N   1 
ATOM   2989 C  CA  . LEU A 1 384 ? -16.463 21.147  21.593  1.00 11.87 ? 384  LEU A CA  1 
ATOM   2990 C  C   . LEU A 1 384 ? -16.939 21.818  20.310  1.00 12.55 ? 384  LEU A C   1 
ATOM   2991 O  O   . LEU A 1 384 ? -16.773 21.264  19.225  1.00 13.80 ? 384  LEU A O   1 
ATOM   2992 C  CB  . LEU A 1 384 ? -14.942 21.378  21.701  1.00 11.96 ? 384  LEU A CB  1 
ATOM   2993 C  CG  . LEU A 1 384 ? -14.349 20.984  23.056  1.00 11.10 ? 384  LEU A CG  1 
ATOM   2994 C  CD1 . LEU A 1 384 ? -12.836 20.831  22.908  1.00 11.20 ? 384  LEU A CD1 1 
ATOM   2995 C  CD2 . LEU A 1 384 ? -14.677 22.017  24.127  1.00 12.14 ? 384  LEU A CD2 1 
ATOM   2996 N  N   . LEU A 1 385 ? -17.444 23.045  20.450  1.00 12.64 ? 385  LEU A N   1 
ATOM   2997 C  CA  . LEU A 1 385 ? -17.753 23.849  19.272  1.00 13.44 ? 385  LEU A CA  1 
ATOM   2998 C  C   . LEU A 1 385 ? -16.646 24.847  18.959  1.00 12.69 ? 385  LEU A C   1 
ATOM   2999 O  O   . LEU A 1 385 ? -15.893 25.299  19.830  1.00 12.99 ? 385  LEU A O   1 
ATOM   3000 C  CB  . LEU A 1 385 ? -19.073 24.598  19.469  1.00 14.20 ? 385  LEU A CB  1 
ATOM   3001 C  CG  . LEU A 1 385 ? -20.300 23.751  19.815  1.00 14.98 ? 385  LEU A CG  1 
ATOM   3002 C  CD1 . LEU A 1 385 ? -21.535 24.643  19.942  1.00 15.73 ? 385  LEU A CD1 1 
ATOM   3003 C  CD2 . LEU A 1 385 ? -20.544 22.668  18.779  1.00 15.57 ? 385  LEU A CD2 1 
ATOM   3004 N  N   . ASP A 1 386 ? -16.575 25.245  17.688  1.00 13.02 ? 386  ASP A N   1 
ATOM   3005 C  CA  . ASP A 1 386 ? -15.696 26.347  17.300  1.00 13.81 ? 386  ASP A CA  1 
ATOM   3006 C  C   . ASP A 1 386 ? -15.966 27.551  18.194  1.00 13.99 ? 386  ASP A C   1 
ATOM   3007 O  O   . ASP A 1 386 ? -17.126 27.897  18.435  1.00 14.55 ? 386  ASP A O   1 
ATOM   3008 C  CB  . ASP A 1 386 ? -15.903 26.722  15.837  1.00 14.39 ? 386  ASP A CB  1 
ATOM   3009 C  CG  . ASP A 1 386 ? -15.411 25.667  14.869  1.00 15.83 ? 386  ASP A CG  1 
ATOM   3010 O  OD1 . ASP A 1 386 ? -14.699 24.729  15.284  1.00 14.60 ? 386  ASP A OD1 1 
ATOM   3011 O  OD2 . ASP A 1 386 ? -15.746 25.766  13.665  1.00 16.25 ? 386  ASP A OD2 1 
ATOM   3012 N  N   . GLY A 1 387 ? -14.901 28.155  18.701  1.00 12.98 ? 387  GLY A N   1 
ATOM   3013 C  CA  . GLY A 1 387 ? -14.985 29.300  19.582  1.00 13.28 ? 387  GLY A CA  1 
ATOM   3014 C  C   . GLY A 1 387 ? -15.081 28.948  21.058  1.00 12.74 ? 387  GLY A C   1 
ATOM   3015 O  O   . GLY A 1 387 ? -15.042 29.864  21.889  1.00 14.26 ? 387  GLY A O   1 
ATOM   3016 N  N   . ASP A 1 388 ? -15.268 27.675  21.405  1.00 12.89 ? 388  ASP A N   1 
ATOM   3017 C  CA  . ASP A 1 388 ? -15.276 27.285  22.810  1.00 12.87 ? 388  ASP A CA  1 
ATOM   3018 C  C   . ASP A 1 388 ? -13.891 27.476  23.429  1.00 13.02 ? 388  ASP A C   1 
ATOM   3019 O  O   . ASP A 1 388 ? -12.872 27.144  22.821  1.00 13.88 ? 388  ASP A O   1 
ATOM   3020 C  CB  . ASP A 1 388 ? -15.730 25.855  23.036  1.00 12.28 ? 388  ASP A CB  1 
ATOM   3021 C  CG  . ASP A 1 388 ? -17.211 25.604  22.842  1.00 12.81 ? 388  ASP A CG  1 
ATOM   3022 O  OD1 . ASP A 1 388 ? -17.971 26.580  22.646  1.00 13.88 ? 388  ASP A OD1 1 
ATOM   3023 O  OD2 . ASP A 1 388 ? -17.607 24.419  22.911  1.00 12.46 ? 388  ASP A OD2 1 
ATOM   3024 N  N   . GLU A 1 389 ? -13.890 27.999  24.654  1.00 12.75 ? 389  GLU A N   1 
ATOM   3025 C  CA  . GLU A 1 389 ? -12.652 28.135  25.414  1.00 12.81 ? 389  GLU A CA  1 
ATOM   3026 C  C   . GLU A 1 389 ? -12.722 27.215  26.628  1.00 12.17 ? 389  GLU A C   1 
ATOM   3027 O  O   . GLU A 1 389 ? -13.676 27.242  27.400  1.00 12.27 ? 389  GLU A O   1 
ATOM   3028 C  CB  . GLU A 1 389 ? -12.393 29.580  25.816  1.00 13.70 ? 389  GLU A CB  1 
ATOM   3029 C  CG  . GLU A 1 389 ? -11.138 29.782  26.657  1.00 16.21 ? 389  GLU A CG  1 
ATOM   3030 C  CD  . GLU A 1 389 ? -10.815 31.257  26.803  1.00 18.05 ? 389  GLU A CD  1 
ATOM   3031 O  OE1 . GLU A 1 389 ? -11.618 31.957  27.460  1.00 19.13 ? 389  GLU A OE1 1 
ATOM   3032 O  OE2 . GLU A 1 389 ? -9.787  31.691  26.250  1.00 19.80 ? 389  GLU A OE2 1 
ATOM   3033 N  N   . VAL A 1 390 ? -11.690 26.385  26.769  1.00 11.11 ? 390  VAL A N   1 
ATOM   3034 C  CA  . VAL A 1 390 ? -11.592 25.459  27.897  1.00 11.32 ? 390  VAL A CA  1 
ATOM   3035 C  C   . VAL A 1 390 ? -10.456 25.923  28.805  1.00 11.35 ? 390  VAL A C   1 
ATOM   3036 O  O   . VAL A 1 390 ? -9.358  26.155  28.303  1.00 11.23 ? 390  VAL A O   1 
ATOM   3037 C  CB  . VAL A 1 390 ? -11.306 24.026  27.416  1.00 11.75 ? 390  VAL A CB  1 
ATOM   3038 C  CG1 . VAL A 1 390 ? -11.111 23.064  28.578  1.00 11.90 ? 390  VAL A CG1 1 
ATOM   3039 C  CG2 . VAL A 1 390 ? -12.439 23.545  26.514  1.00 12.15 ? 390  VAL A CG2 1 
ATOM   3040 N  N   . ILE A 1 391 ? -10.733 26.113  30.092  1.00 10.65 ? 391  ILE A N   1 
ATOM   3041 C  CA  . ILE A 1 391 ? -9.698  26.500  31.044  1.00 11.74 ? 391  ILE A CA  1 
ATOM   3042 C  C   . ILE A 1 391 ? -9.609  25.480  32.182  1.00 11.33 ? 391  ILE A C   1 
ATOM   3043 O  O   . ILE A 1 391 ? -10.590 25.236  32.882  1.00 11.40 ? 391  ILE A O   1 
ATOM   3044 C  CB  . ILE A 1 391 ? -9.929  27.899  31.642  1.00 12.25 ? 391  ILE A CB  1 
ATOM   3045 C  CG1 . ILE A 1 391 ? -10.082 28.958  30.549  1.00 13.30 ? 391  ILE A CG1 1 
ATOM   3046 C  CG2 . ILE A 1 391 ? -8.743  28.260  32.546  1.00 12.64 ? 391  ILE A CG2 1 
ATOM   3047 C  CD1 . ILE A 1 391 ? -10.410 30.354  31.036  1.00 14.47 ? 391  ILE A CD1 1 
ATOM   3048 N  N   . ILE A 1 392 ? -8.423  24.905  32.348  1.00 10.08 ? 392  ILE A N   1 
ATOM   3049 C  CA  . ILE A 1 392 ? -8.150  24.010  33.476  1.00 11.80 ? 392  ILE A CA  1 
ATOM   3050 C  C   . ILE A 1 392 ? -7.424  24.790  34.563  1.00 11.61 ? 392  ILE A C   1 
ATOM   3051 O  O   . ILE A 1 392 ? -6.520  25.563  34.260  1.00 11.56 ? 392  ILE A O   1 
ATOM   3052 C  CB  . ILE A 1 392 ? -7.269  22.827  33.025  1.00 11.48 ? 392  ILE A CB  1 
ATOM   3053 C  CG1 . ILE A 1 392 ? -7.996  22.012  31.957  1.00 12.07 ? 392  ILE A CG1 1 
ATOM   3054 C  CG2 . ILE A 1 392 ? -6.889  21.945  34.212  1.00 12.33 ? 392  ILE A CG2 1 
ATOM   3055 C  CD1 . ILE A 1 392 ? -7.157  20.930  31.321  1.00 12.83 ? 392  ILE A CD1 1 
ATOM   3056 N  N   . THR A 1 393 ? -7.846  24.642  35.815  1.00 11.39 ? 393  THR A N   1 
ATOM   3057 C  CA  . THR A 1 393 ? -7.144  25.238  36.952  1.00 12.63 ? 393  THR A CA  1 
ATOM   3058 C  C   . THR A 1 393 ? -6.924  24.161  38.006  1.00 12.29 ? 393  THR A C   1 
ATOM   3059 O  O   . THR A 1 393 ? -7.601  23.124  37.969  1.00 11.95 ? 393  THR A O   1 
ATOM   3060 C  CB  . THR A 1 393 ? -7.910  26.425  37.564  1.00 12.50 ? 393  THR A CB  1 
ATOM   3061 O  OG1 . THR A 1 393 ? -9.284  26.043  37.721  1.00 13.56 ? 393  THR A OG1 1 
ATOM   3062 C  CG2 . THR A 1 393 ? -7.821  27.666  36.683  1.00 13.21 ? 393  THR A CG2 1 
ATOM   3063 N  N   . GLY A 1 394 ? -5.990  24.378  38.937  1.00 12.51 ? 394  GLY A N   1 
ATOM   3064 C  CA  . GLY A 1 394 ? -5.825  23.394  40.019  1.00 12.50 ? 394  GLY A CA  1 
ATOM   3065 C  C   . GLY A 1 394 ? -5.087  24.018  41.196  1.00 12.41 ? 394  GLY A C   1 
ATOM   3066 O  O   . GLY A 1 394 ? -4.376  25.004  41.035  1.00 11.87 ? 394  GLY A O   1 
ATOM   3067 N  N   . HIS A 1 395 ? -5.288  23.428  42.376  1.00 12.77 ? 395  HIS A N   1 
ATOM   3068 C  CA  . HIS A 1 395 ? -4.569  23.923  43.549  1.00 12.64 ? 395  HIS A CA  1 
ATOM   3069 C  C   . HIS A 1 395 ? -4.607  22.897  44.673  1.00 12.63 ? 395  HIS A C   1 
ATOM   3070 O  O   . HIS A 1 395 ? -5.541  22.106  44.753  1.00 12.12 ? 395  HIS A O   1 
ATOM   3071 C  CB  . HIS A 1 395 ? -5.153  25.244  44.056  1.00 13.65 ? 395  HIS A CB  1 
ATOM   3072 C  CG  . HIS A 1 395 ? -6.478  25.098  44.742  1.00 14.29 ? 395  HIS A CG  1 
ATOM   3073 N  ND1 . HIS A 1 395 ? -7.664  24.900  44.076  1.00 15.93 ? 395  HIS A ND1 1 
ATOM   3074 C  CD2 . HIS A 1 395 ? -6.771  25.114  46.070  1.00 15.42 ? 395  HIS A CD2 1 
ATOM   3075 C  CE1 . HIS A 1 395 ? -8.637  24.800  44.967  1.00 15.71 ? 395  HIS A CE1 1 
ATOM   3076 N  NE2 . HIS A 1 395 ? -8.128  24.926  46.177  1.00 15.71 ? 395  HIS A NE2 1 
ATOM   3077 N  N   . CYS A 1 396 ? -3.601  22.977  45.525  1.00 12.43 ? 396  CYS A N   1 
ATOM   3078 C  CA  . CYS A 1 396 ? -3.627  22.297  46.825  1.00 12.96 ? 396  CYS A CA  1 
ATOM   3079 C  C   . CYS A 1 396 ? -4.084  23.290  47.888  1.00 14.25 ? 396  CYS A C   1 
ATOM   3080 O  O   . CYS A 1 396 ? -3.626  24.432  47.846  1.00 14.47 ? 396  CYS A O   1 
ATOM   3081 C  CB  . CYS A 1 396 ? -2.238  21.770  47.196  1.00 12.70 ? 396  CYS A CB  1 
ATOM   3082 S  SG  . CYS A 1 396 ? -1.627  20.516  46.044  1.00 11.56 ? 396  CYS A SG  1 
ATOM   3083 N  N   . GLN A 1 397 ? -4.941  22.849  48.800  1.00 15.33 ? 397  GLN A N   1 
ATOM   3084 C  CA  . GLN A 1 397 ? -5.479  23.781  49.793  1.00 16.60 ? 397  GLN A CA  1 
ATOM   3085 C  C   . GLN A 1 397 ? -4.861  23.555  51.171  1.00 17.26 ? 397  GLN A C   1 
ATOM   3086 O  O   . GLN A 1 397 ? -5.057  22.499  51.777  1.00 17.82 ? 397  GLN A O   1 
ATOM   3087 C  CB  . GLN A 1 397 ? -7.004  23.658  49.893  1.00 17.70 ? 397  GLN A CB  1 
ATOM   3088 C  CG  . GLN A 1 397 ? -7.626  24.665  50.856  1.00 18.49 ? 397  GLN A CG  1 
ATOM   3089 C  CD  . GLN A 1 397 ? -7.446  26.097  50.391  1.00 18.98 ? 397  GLN A CD  1 
ATOM   3090 O  OE1 . GLN A 1 397 ? -7.973  26.471  49.343  1.00 20.23 ? 397  GLN A OE1 1 
ATOM   3091 N  NE2 . GLN A 1 397 ? -6.703  26.895  51.150  1.00 18.59 ? 397  GLN A NE2 1 
ATOM   3092 N  N   . GLY A 1 398 ? -4.115  24.554  51.626  1.00 17.21 ? 398  GLY A N   1 
ATOM   3093 C  CA  . GLY A 1 398 ? -3.520  24.489  52.968  1.00 18.52 ? 398  GLY A CA  1 
ATOM   3094 C  C   . GLY A 1 398 ? -4.351  25.363  53.905  1.00 19.31 ? 398  GLY A C   1 
ATOM   3095 O  O   . GLY A 1 398 ? -5.353  25.946  53.495  1.00 19.04 ? 398  GLY A O   1 
ATOM   3096 N  N   . ASP A 1 399 ? -3.903  25.487  55.152  1.00 21.05 ? 399  ASP A N   1 
ATOM   3097 C  CA  . ASP A 1 399 ? -4.587  26.377  56.094  1.00 21.97 ? 399  ASP A CA  1 
ATOM   3098 C  C   . ASP A 1 399 ? -4.152  27.821  55.899  1.00 22.12 ? 399  ASP A C   1 
ATOM   3099 O  O   . ASP A 1 399 ? -3.072  28.228  56.335  1.00 22.54 ? 399  ASP A O   1 
ATOM   3100 C  CB  . ASP A 1 399 ? -4.308  25.895  57.524  1.00 23.17 ? 399  ASP A CB  1 
ATOM   3101 C  CG  . ASP A 1 399 ? -4.972  26.778  58.564  1.00 24.39 ? 399  ASP A CG  1 
ATOM   3102 O  OD1 . ASP A 1 399 ? -6.055  27.331  58.278  1.00 25.02 ? 399  ASP A OD1 1 
ATOM   3103 O  OD2 . ASP A 1 399 ? -4.411  26.921  59.670  1.00 26.30 ? 399  ASP A OD2 1 
ATOM   3104 N  N   . GLY A 1 400 ? -4.960  28.610  55.196  1.00 22.84 ? 400  GLY A N   1 
ATOM   3105 C  CA  . GLY A 1 400 ? -4.675  30.013  54.954  1.00 23.25 ? 400  GLY A CA  1 
ATOM   3106 C  C   . GLY A 1 400 ? -3.786  30.275  53.751  1.00 24.09 ? 400  GLY A C   1 
ATOM   3107 O  O   . GLY A 1 400 ? -3.331  31.408  53.543  1.00 25.07 ? 400  GLY A O   1 
ATOM   3108 N  N   . TYR A 1 401 ? -3.524  29.246  52.949  1.00 22.60 ? 401  TYR A N   1 
ATOM   3109 C  CA  . TYR A 1 401 ? -2.707  29.420  51.749  1.00 21.06 ? 401  TYR A CA  1 
ATOM   3110 C  C   . TYR A 1 401 ? -3.068  28.327  50.746  1.00 20.36 ? 401  TYR A C   1 
ATOM   3111 O  O   . TYR A 1 401 ? -3.604  27.293  51.139  1.00 19.59 ? 401  TYR A O   1 
ATOM   3112 C  CB  . TYR A 1 401 ? -1.220  29.378  52.080  1.00 20.53 ? 401  TYR A CB  1 
ATOM   3113 C  CG  . TYR A 1 401 ? -0.683  28.013  52.438  1.00 20.42 ? 401  TYR A CG  1 
ATOM   3114 C  CD1 . TYR A 1 401 ? -0.083  27.203  51.484  1.00 20.33 ? 401  TYR A CD1 1 
ATOM   3115 C  CD2 . TYR A 1 401 ? -0.780  27.526  53.739  1.00 20.67 ? 401  TYR A CD2 1 
ATOM   3116 C  CE1 . TYR A 1 401 ? 0.412   25.953  51.803  1.00 20.27 ? 401  TYR A CE1 1 
ATOM   3117 C  CE2 . TYR A 1 401 ? -0.292  26.277  54.064  1.00 20.76 ? 401  TYR A CE2 1 
ATOM   3118 C  CZ  . TYR A 1 401 ? 0.304   25.496  53.103  1.00 21.10 ? 401  TYR A CZ  1 
ATOM   3119 O  OH  . TYR A 1 401 ? 0.781   24.250  53.432  1.00 22.61 ? 401  TYR A OH  1 
ATOM   3120 N  N   . ARG A 1 402 ? -2.790  28.592  49.473  1.00 19.34 ? 402  ARG A N   1 
ATOM   3121 C  CA  . ARG A 1 402 ? -2.970  27.525  48.483  1.00 18.91 ? 402  ARG A CA  1 
ATOM   3122 C  C   . ARG A 1 402 ? -1.683  27.367  47.688  1.00 17.87 ? 402  ARG A C   1 
ATOM   3123 O  O   . ARG A 1 402 ? -0.933  28.335  47.547  1.00 17.91 ? 402  ARG A O   1 
ATOM   3124 C  CB  . ARG A 1 402 ? -4.188  27.767  47.612  1.00 20.55 ? 402  ARG A CB  1 
ATOM   3125 C  CG  . ARG A 1 402 ? -4.551  29.202  47.311  1.00 22.65 ? 402  ARG A CG  1 
ATOM   3126 C  CD  . ARG A 1 402 ? -5.958  29.288  46.728  1.00 23.01 ? 402  ARG A CD  1 
ATOM   3127 N  NE  . ARG A 1 402 ? -5.925  29.058  45.293  1.00 23.46 ? 402  ARG A NE  1 
ATOM   3128 C  CZ  . ARG A 1 402 ? -6.926  28.608  44.550  1.00 23.13 ? 402  ARG A CZ  1 
ATOM   3129 N  NH1 . ARG A 1 402 ? -8.111  28.310  45.071  1.00 22.93 ? 402  ARG A NH1 1 
ATOM   3130 N  NH2 . ARG A 1 402 ? -6.719  28.467  43.248  1.00 22.40 ? 402  ARG A NH2 1 
ATOM   3131 N  N   . VAL A 1 403 ? -1.409  26.146  47.246  1.00 15.43 ? 403  VAL A N   1 
ATOM   3132 C  CA  . VAL A 1 403 ? -0.321  25.918  46.295  1.00 14.85 ? 403  VAL A CA  1 
ATOM   3133 C  C   . VAL A 1 403 ? -0.993  25.722  44.939  1.00 14.15 ? 403  VAL A C   1 
ATOM   3134 O  O   . VAL A 1 403 ? -1.519  24.637  44.675  1.00 14.20 ? 403  VAL A O   1 
ATOM   3135 C  CB  . VAL A 1 403 ? 0.577   24.730  46.660  1.00 14.84 ? 403  VAL A CB  1 
ATOM   3136 C  CG1 . VAL A 1 403 ? 1.535   24.376  45.527  1.00 15.35 ? 403  VAL A CG1 1 
ATOM   3137 C  CG2 . VAL A 1 403 ? 1.367   25.034  47.931  1.00 15.67 ? 403  VAL A CG2 1 
ATOM   3138 N  N   . GLY A 1 404 ? -1.032  26.781  44.135  1.00 13.01 ? 404  GLY A N   1 
ATOM   3139 C  CA  . GLY A 1 404 ? -1.843  26.775  42.928  1.00 12.94 ? 404  GLY A CA  1 
ATOM   3140 C  C   . GLY A 1 404 ? -1.014  26.636  41.658  1.00 12.70 ? 404  GLY A C   1 
ATOM   3141 O  O   . GLY A 1 404 ? 0.181   26.908  41.613  1.00 12.51 ? 404  GLY A O   1 
ATOM   3142 N  N   . PHE A 1 405 ? -1.699  26.202  40.600  1.00 13.66 ? 405  PHE A N   1 
ATOM   3143 C  CA  . PHE A 1 405 ? -1.025  25.892  39.341  1.00 13.85 ? 405  PHE A CA  1 
ATOM   3144 C  C   . PHE A 1 405 ? -1.283  26.922  38.261  1.00 14.69 ? 405  PHE A C   1 
ATOM   3145 O  O   . PHE A 1 405 ? -0.858  26.714  37.116  1.00 14.92 ? 405  PHE A O   1 
ATOM   3146 C  CB  . PHE A 1 405 ? -1.483  24.496  38.889  1.00 13.56 ? 405  PHE A CB  1 
ATOM   3147 C  CG  . PHE A 1 405 ? -0.815  23.375  39.627  1.00 13.28 ? 405  PHE A CG  1 
ATOM   3148 C  CD1 . PHE A 1 405 ? -1.248  22.964  40.870  1.00 13.30 ? 405  PHE A CD1 1 
ATOM   3149 C  CD2 . PHE A 1 405 ? 0.283   22.736  39.057  1.00 13.67 ? 405  PHE A CD2 1 
ATOM   3150 C  CE1 . PHE A 1 405 ? -0.617  21.946  41.549  1.00 14.06 ? 405  PHE A CE1 1 
ATOM   3151 C  CE2 . PHE A 1 405 ? 0.916   21.708  39.733  1.00 13.36 ? 405  PHE A CE2 1 
ATOM   3152 C  CZ  . PHE A 1 405 ? 0.472   21.310  40.976  1.00 14.27 ? 405  PHE A CZ  1 
ATOM   3153 N  N   . GLY A 1 406 ? -1.967  28.026  38.560  1.00 14.57 ? 406  GLY A N   1 
ATOM   3154 C  CA  . GLY A 1 406 ? -2.351  28.969  37.503  1.00 14.99 ? 406  GLY A CA  1 
ATOM   3155 C  C   . GLY A 1 406 ? -3.358  28.270  36.585  1.00 15.42 ? 406  GLY A C   1 
ATOM   3156 O  O   . GLY A 1 406 ? -4.199  27.495  37.049  1.00 16.37 ? 406  GLY A O   1 
ATOM   3157 N  N   . GLN A 1 407 ? -3.258  28.552  35.292  1.00 15.99 ? 407  GLN A N   1 
ATOM   3158 C  CA  . GLN A 1 407 ? -4.251  28.004  34.373  1.00 15.41 ? 407  GLN A CA  1 
ATOM   3159 C  C   . GLN A 1 407 ? -3.623  27.372  33.141  1.00 14.16 ? 407  GLN A C   1 
ATOM   3160 O  O   . GLN A 1 407 ? -2.485  27.596  32.757  1.00 13.03 ? 407  GLN A O   1 
ATOM   3161 C  CB  . GLN A 1 407 ? -5.234  29.086  33.943  1.00 17.64 ? 407  GLN A CB  1 
ATOM   3162 C  CG  . GLN A 1 407 ? -4.620  30.154  33.060  1.00 19.13 ? 407  GLN A CG  1 
ATOM   3163 C  CD  . GLN A 1 407 ? -5.669  31.145  32.585  1.00 21.00 ? 407  GLN A CD  1 
ATOM   3164 O  OE1 . GLN A 1 407 ? -5.572  31.631  31.460  1.00 22.08 ? 407  GLN A OE1 1 
ATOM   3165 N  NE2 . GLN A 1 407 ? -6.653  31.425  33.429  1.00 22.35 ? 407  GLN A NE2 1 
ATOM   3166 N  N   . CYS A 1 408 ? -4.461  26.536  32.533  1.00 11.95 ? 408  CYS A N   1 
ATOM   3167 C  CA  . CYS A 1 408 ? -4.116  25.838  31.299  1.00 11.62 ? 408  CYS A CA  1 
ATOM   3168 C  C   . CYS A 1 408 ? -5.304  26.012  30.357  1.00 11.00 ? 408  CYS A C   1 
ATOM   3169 O  O   . CYS A 1 408 ? -6.293  25.294  30.464  1.00 11.86 ? 408  CYS A O   1 
ATOM   3170 C  CB  . CYS A 1 408 ? -3.862  24.367  31.619  1.00 11.82 ? 408  CYS A CB  1 
ATOM   3171 S  SG  . CYS A 1 408 ? -3.591  23.309  30.182  1.00 12.41 ? 408  CYS A SG  1 
ATOM   3172 N  N   . ALA A 1 409 ? -5.185  27.005  29.478  1.00 10.01 ? 409  ALA A N   1 
ATOM   3173 C  CA  . ALA A 1 409 ? -6.310  27.495  28.699  1.00 10.23 ? 409  ALA A CA  1 
ATOM   3174 C  C   . ALA A 1 409 ? -6.091  27.334  27.198  1.00 10.61 ? 409  ALA A C   1 
ATOM   3175 O  O   . ALA A 1 409 ? -4.951  27.435  26.732  1.00 10.92 ? 409  ALA A O   1 
ATOM   3176 C  CB  . ALA A 1 409 ? -6.476  28.989  28.986  1.00 11.17 ? 409  ALA A CB  1 
ATOM   3177 N  N   . GLY A 1 410 ? -7.189  27.143  26.474  1.00 10.44 ? 410  GLY A N   1 
ATOM   3178 C  CA  . GLY A 1 410 ? -7.100  27.256  25.010  1.00 10.44 ? 410  GLY A CA  1 
ATOM   3179 C  C   . GLY A 1 410 ? -8.490  27.469  24.421  1.00 10.67 ? 410  GLY A C   1 
ATOM   3180 O  O   . GLY A 1 410 ? -9.476  27.005  24.977  1.00 10.65 ? 410  GLY A O   1 
ATOM   3181 N  N   . LYS A 1 411 ? -8.523  28.158  23.285  1.00 11.20 ? 411  LYS A N   1 
ATOM   3182 C  CA  . LYS A 1 411 ? -9.774  28.381  22.565  1.00 12.27 ? 411  LYS A CA  1 
ATOM   3183 C  C   . LYS A 1 411 ? -9.686  27.726  21.188  1.00 12.04 ? 411  LYS A C   1 
ATOM   3184 O  O   . LYS A 1 411 ? -8.662  27.801  20.520  1.00 12.66 ? 411  LYS A O   1 
ATOM   3185 C  CB  . LYS A 1 411 ? -10.034 29.880  22.435  1.00 13.90 ? 411  LYS A CB  1 
ATOM   3186 C  CG  . LYS A 1 411 ? -11.322 30.222  21.693  1.00 15.91 ? 411  LYS A CG  1 
ATOM   3187 C  CD  . LYS A 1 411 ? -11.521 31.734  21.701  1.00 18.08 ? 411  LYS A CD  1 
ATOM   3188 C  CE  . LYS A 1 411 ? -12.779 32.129  20.940  1.00 19.98 ? 411  LYS A CE  1 
ATOM   3189 N  NZ  . LYS A 1 411 ? -12.901 33.618  20.917  1.00 22.49 ? 411  LYS A NZ  1 
ATOM   3190 N  N   . VAL A 1 412 ? -10.766 27.084  20.784  1.00 11.56 ? 412  VAL A N   1 
ATOM   3191 C  CA  . VAL A 1 412 ? -10.849 26.376  19.518  1.00 11.77 ? 412  VAL A CA  1 
ATOM   3192 C  C   . VAL A 1 412 ? -11.088 27.322  18.343  1.00 12.48 ? 412  VAL A C   1 
ATOM   3193 O  O   . VAL A 1 412 ? -12.067 28.074  18.329  1.00 12.49 ? 412  VAL A O   1 
ATOM   3194 C  CB  . VAL A 1 412 ? -11.995 25.347  19.552  1.00 11.27 ? 412  VAL A CB  1 
ATOM   3195 C  CG1 . VAL A 1 412 ? -12.116 24.595  18.234  1.00 11.27 ? 412  VAL A CG1 1 
ATOM   3196 C  CG2 . VAL A 1 412 ? -11.796 24.341  20.686  1.00 11.67 ? 412  VAL A CG2 1 
ATOM   3197 N  N   . LEU A 1 413 ? -10.208 27.236  17.354  1.00 12.60 ? 413  LEU A N   1 
ATOM   3198 C  CA  . LEU A 1 413 ? -10.398 27.946  16.090  1.00 13.51 ? 413  LEU A CA  1 
ATOM   3199 C  C   . LEU A 1 413 ? -11.044 27.013  15.074  1.00 13.87 ? 413  LEU A C   1 
ATOM   3200 O  O   . LEU A 1 413 ? -10.833 25.808  15.092  1.00 14.10 ? 413  LEU A O   1 
ATOM   3201 C  CB  . LEU A 1 413 ? -9.064  28.424  15.531  1.00 13.99 ? 413  LEU A CB  1 
ATOM   3202 C  CG  . LEU A 1 413 ? -8.253  29.415  16.369  1.00 15.17 ? 413  LEU A CG  1 
ATOM   3203 C  CD1 . LEU A 1 413 ? -6.958  29.740  15.636  1.00 15.70 ? 413  LEU A CD1 1 
ATOM   3204 C  CD2 . LEU A 1 413 ? -9.036  30.682  16.661  1.00 17.42 ? 413  LEU A CD2 1 
ATOM   3205 N  N   . PRO A 1 414 ? -11.835 27.576  14.165  1.00 14.76 ? 414  PRO A N   1 
ATOM   3206 C  CA  . PRO A 1 414 ? -12.450 26.793  13.113  1.00 15.47 ? 414  PRO A CA  1 
ATOM   3207 C  C   . PRO A 1 414 ? -11.392 26.122  12.247  1.00 15.92 ? 414  PRO A C   1 
ATOM   3208 O  O   . PRO A 1 414 ? -10.318 26.674  12.030  1.00 16.51 ? 414  PRO A O   1 
ATOM   3209 C  CB  . PRO A 1 414 ? -13.254 27.796  12.298  1.00 15.47 ? 414  PRO A CB  1 
ATOM   3210 C  CG  . PRO A 1 414 ? -13.338 29.026  13.116  1.00 16.51 ? 414  PRO A CG  1 
ATOM   3211 C  CD  . PRO A 1 414 ? -12.210 29.008  14.114  1.00 15.13 ? 414  PRO A CD  1 
ATOM   3212 N  N   . ALA A 1 415 ? -11.740 24.953  11.728  1.00 16.70 ? 415  ALA A N   1 
ATOM   3213 C  CA  . ALA A 1 415 ? -10.877 24.256  10.784  1.00 18.83 ? 415  ALA A CA  1 
ATOM   3214 C  C   . ALA A 1 415 ? -10.579 25.141  9.576   1.00 22.15 ? 415  ALA A C   1 
ATOM   3215 O  O   . ALA A 1 415 ? -11.319 26.048  9.209   1.00 21.44 ? 415  ALA A O   1 
ATOM   3216 C  CB  . ALA A 1 415 ? -11.504 22.947  10.344  1.00 17.91 ? 415  ALA A CB  1 
ATOM   3217 N  N   . LEU A 1 416 ? -9.460  24.831  8.944   1.00 25.85 ? 416  LEU A N   1 
ATOM   3218 C  CA  . LEU A 1 416 ? -8.875  25.681  7.906   1.00 30.88 ? 416  LEU A CA  1 
ATOM   3219 C  C   . LEU A 1 416 ? -8.437  24.811  6.740   1.00 33.29 ? 416  LEU A C   1 
ATOM   3220 O  O   . LEU A 1 416 ? -7.377  24.200  6.821   1.00 34.52 ? 416  LEU A O   1 
ATOM   3221 C  CB  . LEU A 1 416 ? -7.696  26.395  8.552   1.00 32.09 ? 416  LEU A CB  1 
ATOM   3222 C  CG  . LEU A 1 416 ? -6.584  27.037  7.743   1.00 33.03 ? 416  LEU A CG  1 
ATOM   3223 C  CD1 . LEU A 1 416 ? -6.913  28.489  7.434   1.00 33.08 ? 416  LEU A CD1 1 
ATOM   3224 C  CD2 . LEU A 1 416 ? -5.258  26.925  8.487   1.00 33.59 ? 416  LEU A CD2 1 
ATOM   3225 N  N   . MET B 1 1   ? 34.204  13.307  -11.832 1.00 30.20 ? 1    MET B N   1 
ATOM   3226 C  CA  . MET B 1 1   ? 35.114  12.733  -10.856 1.00 28.60 ? 1    MET B CA  1 
ATOM   3227 C  C   . MET B 1 1   ? 35.616  13.815  -9.899  1.00 25.82 ? 1    MET B C   1 
ATOM   3228 O  O   . MET B 1 1   ? 35.577  15.003  -10.211 1.00 25.19 ? 1    MET B O   1 
ATOM   3229 C  CB  . MET B 1 1   ? 36.337  12.088  -11.512 1.00 30.75 ? 1    MET B CB  1 
ATOM   3230 C  CG  . MET B 1 1   ? 36.082  10.861  -12.361 1.00 32.86 ? 1    MET B CG  1 
ATOM   3231 S  SD  . MET B 1 1   ? 35.601  9.419   -11.394 1.00 35.07 ? 1    MET B SD  1 
ATOM   3232 C  CE  . MET B 1 1   ? 37.221  8.802   -10.923 1.00 34.82 ? 1    MET B CE  1 
ATOM   3233 N  N   . SER B 1 2   ? 36.108  13.386  -8.744  1.00 23.60 ? 2    SER B N   1 
ATOM   3234 C  CA  . SER B 1 2   ? 36.725  14.282  -7.781  1.00 21.94 ? 2    SER B CA  1 
ATOM   3235 C  C   . SER B 1 2   ? 38.246  14.229  -7.908  1.00 21.47 ? 2    SER B C   1 
ATOM   3236 O  O   . SER B 1 2   ? 38.760  13.228  -8.405  1.00 21.87 ? 2    SER B O   1 
ATOM   3237 C  CB  . SER B 1 2   ? 36.355  13.872  -6.347  1.00 21.31 ? 2    SER B CB  1 
ATOM   3238 O  OG  . SER B 1 2   ? 36.947  14.771  -5.422  1.00 20.39 ? 2    SER B OG  1 
ATOM   3239 N  N   . PHE B 1 3   ? 38.942  15.248  -7.408  1.00 22.15 ? 3    PHE B N   1 
ATOM   3240 C  CA  . PHE B 1 3   ? 40.387  15.131  -7.209  1.00 22.19 ? 3    PHE B CA  1 
ATOM   3241 C  C   . PHE B 1 3   ? 40.712  14.129  -6.103  1.00 22.76 ? 3    PHE B C   1 
ATOM   3242 O  O   . PHE B 1 3   ? 41.792  13.523  -6.101  1.00 22.96 ? 3    PHE B O   1 
ATOM   3243 C  CB  . PHE B 1 3   ? 41.038  16.478  -6.923  1.00 22.64 ? 3    PHE B CB  1 
ATOM   3244 C  CG  . PHE B 1 3   ? 40.608  17.227  -5.700  1.00 22.09 ? 3    PHE B CG  1 
ATOM   3245 C  CD1 . PHE B 1 3   ? 41.107  16.900  -4.449  1.00 22.08 ? 3    PHE B CD1 1 
ATOM   3246 C  CD2 . PHE B 1 3   ? 39.709  18.280  -5.791  1.00 21.89 ? 3    PHE B CD2 1 
ATOM   3247 C  CE1 . PHE B 1 3   ? 40.706  17.593  -3.322  1.00 21.82 ? 3    PHE B CE1 1 
ATOM   3248 C  CE2 . PHE B 1 3   ? 39.311  18.983  -4.671  1.00 21.25 ? 3    PHE B CE2 1 
ATOM   3249 C  CZ  . PHE B 1 3   ? 39.814  18.639  -3.428  1.00 22.15 ? 3    PHE B CZ  1 
ATOM   3250 N  N   . ILE B 1 4   ? 39.817  13.964  -5.127  1.00 22.28 ? 4    ILE B N   1 
ATOM   3251 C  CA  . ILE B 1 4   ? 39.896  12.820  -4.223  1.00 22.16 ? 4    ILE B CA  1 
ATOM   3252 C  C   . ILE B 1 4   ? 39.589  11.542  -4.991  1.00 22.97 ? 4    ILE B C   1 
ATOM   3253 O  O   . ILE B 1 4   ? 38.513  11.380  -5.567  1.00 22.93 ? 4    ILE B O   1 
ATOM   3254 C  CB  . ILE B 1 4   ? 38.904  12.965  -3.052  1.00 21.40 ? 4    ILE B CB  1 
ATOM   3255 C  CG1 . ILE B 1 4   ? 39.128  14.265  -2.283  1.00 20.86 ? 4    ILE B CG1 1 
ATOM   3256 C  CG2 . ILE B 1 4   ? 38.956  11.754  -2.127  1.00 21.51 ? 4    ILE B CG2 1 
ATOM   3257 C  CD1 . ILE B 1 4   ? 40.465  14.400  -1.581  1.00 20.65 ? 4    ILE B CD1 1 
ATOM   3258 N  N   . PRO B 1 5   ? 40.550  10.627  -5.032  1.00 24.28 ? 5    PRO B N   1 
ATOM   3259 C  CA  . PRO B 1 5   ? 40.362  9.333   -5.672  1.00 24.50 ? 5    PRO B CA  1 
ATOM   3260 C  C   . PRO B 1 5   ? 39.216  8.579   -5.022  1.00 24.46 ? 5    PRO B C   1 
ATOM   3261 O  O   . PRO B 1 5   ? 39.104  8.569   -3.794  1.00 24.40 ? 5    PRO B O   1 
ATOM   3262 C  CB  . PRO B 1 5   ? 41.700  8.633   -5.481  1.00 25.24 ? 5    PRO B CB  1 
ATOM   3263 C  CG  . PRO B 1 5   ? 42.290  9.254   -4.264  1.00 25.10 ? 5    PRO B CG  1 
ATOM   3264 C  CD  . PRO B 1 5   ? 41.822  10.687  -4.266  1.00 24.43 ? 5    PRO B CD  1 
ATOM   3265 N  N   . VAL B 1 6   ? 38.317  8.012   -5.819  1.00 24.02 ? 6    VAL B N   1 
ATOM   3266 C  CA  . VAL B 1 6   ? 37.197  7.234   -5.291  1.00 24.11 ? 6    VAL B CA  1 
ATOM   3267 C  C   . VAL B 1 6   ? 37.178  5.843   -5.916  1.00 24.75 ? 6    VAL B C   1 
ATOM   3268 O  O   . VAL B 1 6   ? 37.133  5.731   -7.145  1.00 24.96 ? 6    VAL B O   1 
ATOM   3269 C  CB  . VAL B 1 6   ? 35.841  7.919   -5.535  1.00 23.97 ? 6    VAL B CB  1 
ATOM   3270 C  CG1 . VAL B 1 6   ? 34.683  7.007   -5.147  1.00 23.83 ? 6    VAL B CG1 1 
ATOM   3271 C  CG2 . VAL B 1 6   ? 35.719  9.235   -4.776  1.00 23.30 ? 6    VAL B CG2 1 
ATOM   3272 N  N   . ALA B 1 7   ? 37.195  4.802   -5.088  1.00 24.82 ? 7    ALA B N   1 
ATOM   3273 C  CA  . ALA B 1 7   ? 37.088  3.439   -5.610  1.00 25.89 ? 7    ALA B CA  1 
ATOM   3274 C  C   . ALA B 1 7   ? 35.717  3.203   -6.231  1.00 26.64 ? 7    ALA B C   1 
ATOM   3275 O  O   . ALA B 1 7   ? 34.718  3.747   -5.764  1.00 25.45 ? 7    ALA B O   1 
ATOM   3276 C  CB  . ALA B 1 7   ? 37.365  2.428   -4.509  1.00 25.93 ? 7    ALA B CB  1 
ATOM   3277 N  N   . GLU B 1 8   ? 35.635  2.349   -7.246  1.00 27.84 ? 8    GLU B N   1 
ATOM   3278 C  CA  . GLU B 1 8   ? 34.397  2.096   -7.967  1.00 29.03 ? 8    GLU B CA  1 
ATOM   3279 C  C   . GLU B 1 8   ? 33.262  1.594   -7.081  1.00 28.94 ? 8    GLU B C   1 
ATOM   3280 O  O   . GLU B 1 8   ? 32.092  1.921   -7.297  1.00 29.12 ? 8    GLU B O   1 
ATOM   3281 C  CB  . GLU B 1 8   ? 34.631  1.083   -9.098  1.00 30.70 ? 8    GLU B CB  1 
ATOM   3282 C  CG  . GLU B 1 8   ? 33.420  0.909   -10.001 1.00 32.29 ? 8    GLU B CG  1 
ATOM   3283 C  CD  . GLU B 1 8   ? 33.612  -0.089  -11.121 1.00 33.34 ? 8    GLU B CD  1 
ATOM   3284 O  OE1 . GLU B 1 8   ? 34.702  -0.687  -11.244 1.00 34.04 ? 8    GLU B OE1 1 
ATOM   3285 O  OE2 . GLU B 1 8   ? 32.655  -0.282  -11.901 1.00 33.70 ? 8    GLU B OE2 1 
ATOM   3286 N  N   . ASP B 1 9   ? 33.580  0.770   -6.095  1.00 28.28 ? 9    ASP B N   1 
ATOM   3287 C  CA  . ASP B 1 9   ? 32.619  0.266   -5.131  1.00 27.86 ? 9    ASP B CA  1 
ATOM   3288 C  C   . ASP B 1 9   ? 32.519  1.113   -3.870  1.00 25.83 ? 9    ASP B C   1 
ATOM   3289 O  O   . ASP B 1 9   ? 31.838  0.693   -2.925  1.00 26.58 ? 9    ASP B O   1 
ATOM   3290 C  CB  . ASP B 1 9   ? 32.992  -1.173  -4.748  1.00 30.03 ? 9    ASP B CB  1 
ATOM   3291 C  CG  . ASP B 1 9   ? 34.349  -1.280  -4.092  1.00 31.40 ? 9    ASP B CG  1 
ATOM   3292 O  OD1 . ASP B 1 9   ? 34.574  -2.263  -3.351  1.00 32.81 ? 9    ASP B OD1 1 
ATOM   3293 O  OD2 . ASP B 1 9   ? 35.212  -0.397  -4.291  1.00 32.90 ? 9    ASP B OD2 1 
ATOM   3294 N  N   . SER B 1 10  ? 33.167  2.267   -3.818  1.00 22.96 ? 10   SER B N   1 
ATOM   3295 C  CA  . SER B 1 10  ? 33.019  3.178   -2.686  1.00 20.34 ? 10   SER B CA  1 
ATOM   3296 C  C   . SER B 1 10  ? 31.556  3.577   -2.526  1.00 18.94 ? 10   SER B C   1 
ATOM   3297 O  O   . SER B 1 10  ? 30.874  3.828   -3.513  1.00 18.71 ? 10   SER B O   1 
ATOM   3298 C  CB  . SER B 1 10  ? 33.845  4.450   -2.879  1.00 19.99 ? 10   SER B CB  1 
ATOM   3299 O  OG  . SER B 1 10  ? 33.600  5.408   -1.858  1.00 19.74 ? 10   SER B OG  1 
ATOM   3300 N  N   . ASP B 1 11  ? 31.109  3.760   -1.282  1.00 16.99 ? 11   ASP B N   1 
ATOM   3301 C  CA  . ASP B 1 11  ? 29.773  4.316   -1.057  1.00 15.19 ? 11   ASP B CA  1 
ATOM   3302 C  C   . ASP B 1 11  ? 29.686  5.796   -1.351  1.00 15.32 ? 11   ASP B C   1 
ATOM   3303 O  O   . ASP B 1 11  ? 28.612  6.396   -1.446  1.00 14.51 ? 11   ASP B O   1 
ATOM   3304 C  CB  . ASP B 1 11  ? 29.390  4.102   0.416   1.00 15.58 ? 11   ASP B CB  1 
ATOM   3305 C  CG  . ASP B 1 11  ? 28.810  2.735   0.679   1.00 16.17 ? 11   ASP B CG  1 
ATOM   3306 O  OD1 . ASP B 1 11  ? 28.537  1.957   -0.257  1.00 16.91 ? 11   ASP B OD1 1 
ATOM   3307 O  OD2 . ASP B 1 11  ? 28.591  2.428   1.869   1.00 16.79 ? 11   ASP B OD2 1 
ATOM   3308 N  N   . PHE B 1 12  ? 30.827  6.483   -1.493  1.00 13.69 ? 12   PHE B N   1 
ATOM   3309 C  CA  . PHE B 1 12  ? 30.929  7.924   -1.436  1.00 14.24 ? 12   PHE B CA  1 
ATOM   3310 C  C   . PHE B 1 12  ? 31.662  8.566   -2.608  1.00 14.62 ? 12   PHE B C   1 
ATOM   3311 O  O   . PHE B 1 12  ? 32.598  9.354   -2.425  1.00 14.23 ? 12   PHE B O   1 
ATOM   3312 C  CB  . PHE B 1 12  ? 31.630  8.317   -0.108  1.00 14.62 ? 12   PHE B CB  1 
ATOM   3313 C  CG  . PHE B 1 12  ? 31.074  7.688   1.138   1.00 14.79 ? 12   PHE B CG  1 
ATOM   3314 C  CD1 . PHE B 1 12  ? 31.837  6.826   1.914   1.00 14.68 ? 12   PHE B CD1 1 
ATOM   3315 C  CD2 . PHE B 1 12  ? 29.761  7.922   1.528   1.00 15.09 ? 12   PHE B CD2 1 
ATOM   3316 C  CE1 . PHE B 1 12  ? 31.319  6.233   3.050   1.00 14.92 ? 12   PHE B CE1 1 
ATOM   3317 C  CE2 . PHE B 1 12  ? 29.234  7.327   2.659   1.00 14.57 ? 12   PHE B CE2 1 
ATOM   3318 C  CZ  . PHE B 1 12  ? 30.013  6.485   3.425   1.00 15.00 ? 12   PHE B CZ  1 
ATOM   3319 N  N   . PRO B 1 13  ? 31.204  8.356   -3.837  1.00 14.42 ? 13   PRO B N   1 
ATOM   3320 C  CA  . PRO B 1 13  ? 31.673  9.131   -4.977  1.00 14.99 ? 13   PRO B CA  1 
ATOM   3321 C  C   . PRO B 1 13  ? 31.157  10.549  -4.927  1.00 15.28 ? 13   PRO B C   1 
ATOM   3322 O  O   . PRO B 1 13  ? 30.319  10.933  -4.093  1.00 14.72 ? 13   PRO B O   1 
ATOM   3323 C  CB  . PRO B 1 13  ? 31.107  8.355   -6.166  1.00 14.85 ? 13   PRO B CB  1 
ATOM   3324 C  CG  . PRO B 1 13  ? 29.760  7.934   -5.656  1.00 13.84 ? 13   PRO B CG  1 
ATOM   3325 C  CD  . PRO B 1 13  ? 30.025  7.548   -4.217  1.00 14.52 ? 13   PRO B CD  1 
ATOM   3326 N  N   . ILE B 1 14  ? 31.549  11.373  -5.903  1.00 15.22 ? 14   ILE B N   1 
ATOM   3327 C  CA  . ILE B 1 14  ? 31.137  12.770  -5.967  1.00 15.76 ? 14   ILE B CA  1 
ATOM   3328 C  C   . ILE B 1 14  ? 29.650  12.902  -6.299  1.00 15.39 ? 14   ILE B C   1 
ATOM   3329 O  O   . ILE B 1 14  ? 29.031  13.924  -6.033  1.00 16.27 ? 14   ILE B O   1 
ATOM   3330 C  CB  . ILE B 1 14  ? 32.009  13.551  -6.972  1.00 16.39 ? 14   ILE B CB  1 
ATOM   3331 C  CG1 . ILE B 1 14  ? 31.871  15.058  -6.750  1.00 16.71 ? 14   ILE B CG1 1 
ATOM   3332 C  CG2 . ILE B 1 14  ? 31.692  13.155  -8.404  1.00 16.72 ? 14   ILE B CG2 1 
ATOM   3333 C  CD1 . ILE B 1 14  ? 32.889  15.884  -7.528  1.00 17.84 ? 14   ILE B CD1 1 
ATOM   3334 N  N   . GLN B 1 15  ? 29.040  11.843  -6.797  1.00 15.67 ? 15   GLN B N   1 
ATOM   3335 C  CA  . GLN B 1 15  ? 27.610  11.740  -7.024  1.00 15.54 ? 15   GLN B CA  1 
ATOM   3336 C  C   . GLN B 1 15  ? 26.801  11.574  -5.741  1.00 15.66 ? 15   GLN B C   1 
ATOM   3337 O  O   . GLN B 1 15  ? 25.572  11.726  -5.813  1.00 15.97 ? 15   GLN B O   1 
ATOM   3338 C  CB  . GLN B 1 15  ? 27.304  10.537  -7.923  1.00 15.96 ? 15   GLN B CB  1 
ATOM   3339 C  CG  . GLN B 1 15  ? 27.664  10.736  -9.379  1.00 16.95 ? 15   GLN B CG  1 
ATOM   3340 C  CD  . GLN B 1 15  ? 29.152  10.657  -9.652  1.00 18.53 ? 15   GLN B CD  1 
ATOM   3341 O  OE1 . GLN B 1 15  ? 29.912  10.003  -8.929  1.00 17.95 ? 15   GLN B OE1 1 
ATOM   3342 N  NE2 . GLN B 1 15  ? 29.555  11.348  -10.716 1.00 19.69 ? 15   GLN B NE2 1 
ATOM   3343 N  N   . ASN B 1 16  ? 27.420  11.247  -4.614  1.00 14.62 ? 16   ASN B N   1 
ATOM   3344 C  CA  . ASN B 1 16  ? 26.674  11.090  -3.360  1.00 14.10 ? 16   ASN B CA  1 
ATOM   3345 C  C   . ASN B 1 16  ? 26.763  12.353  -2.515  1.00 13.95 ? 16   ASN B C   1 
ATOM   3346 O  O   . ASN B 1 16  ? 25.863  13.201  -2.573  1.00 15.20 ? 16   ASN B O   1 
ATOM   3347 C  CB  . ASN B 1 16  ? 27.145  9.837   -2.628  1.00 13.56 ? 16   ASN B CB  1 
ATOM   3348 C  CG  . ASN B 1 16  ? 26.355  9.537   -1.367  1.00 13.15 ? 16   ASN B CG  1 
ATOM   3349 O  OD1 . ASN B 1 16  ? 25.459  10.297  -1.014  1.00 12.69 ? 16   ASN B OD1 1 
ATOM   3350 N  ND2 . ASN B 1 16  ? 26.702  8.442   -0.712  1.00 12.73 ? 16   ASN B ND2 1 
ATOM   3351 N  N   . LEU B 1 17  ? 27.839  12.532  -1.769  1.00 13.95 ? 17   LEU B N   1 
ATOM   3352 C  CA  . LEU B 1 17  ? 28.112  13.691  -0.945  1.00 13.90 ? 17   LEU B CA  1 
ATOM   3353 C  C   . LEU B 1 17  ? 27.093  13.839  0.186   1.00 13.06 ? 17   LEU B C   1 
ATOM   3354 O  O   . LEU B 1 17  ? 26.377  14.834  0.285   1.00 13.47 ? 17   LEU B O   1 
ATOM   3355 C  CB  . LEU B 1 17  ? 28.186  14.982  -1.770  1.00 15.36 ? 17   LEU B CB  1 
ATOM   3356 C  CG  . LEU B 1 17  ? 29.206  15.057  -2.908  1.00 15.86 ? 17   LEU B CG  1 
ATOM   3357 C  CD1 . LEU B 1 17  ? 29.073  16.372  -3.670  1.00 16.89 ? 17   LEU B CD1 1 
ATOM   3358 C  CD2 . LEU B 1 17  ? 30.634  14.889  -2.398  1.00 16.86 ? 17   LEU B CD2 1 
ATOM   3359 N  N   . PRO B 1 18  ? 27.065  12.862  1.084   1.00 13.41 ? 18   PRO B N   1 
ATOM   3360 C  CA  . PRO B 1 18  ? 26.195  12.889  2.247   1.00 12.75 ? 18   PRO B CA  1 
ATOM   3361 C  C   . PRO B 1 18  ? 26.730  13.765  3.365   1.00 13.28 ? 18   PRO B C   1 
ATOM   3362 O  O   . PRO B 1 18  ? 27.935  14.016  3.436   1.00 11.73 ? 18   PRO B O   1 
ATOM   3363 C  CB  . PRO B 1 18  ? 26.168  11.420  2.670   1.00 12.46 ? 18   PRO B CB  1 
ATOM   3364 C  CG  . PRO B 1 18  ? 27.565  10.959  2.376   1.00 12.36 ? 18   PRO B CG  1 
ATOM   3365 C  CD  . PRO B 1 18  ? 27.935  11.655  1.087   1.00 12.40 ? 18   PRO B CD  1 
ATOM   3366 N  N   . TYR B 1 19  ? 25.860  14.210  4.261   1.00 12.28 ? 19   TYR B N   1 
ATOM   3367 C  CA  . TYR B 1 19  ? 26.202  15.107  5.350   1.00 12.75 ? 19   TYR B CA  1 
ATOM   3368 C  C   . TYR B 1 19  ? 26.217  14.356  6.682   1.00 13.08 ? 19   TYR B C   1 
ATOM   3369 O  O   . TYR B 1 19  ? 25.362  13.502  6.914   1.00 13.28 ? 19   TYR B O   1 
ATOM   3370 C  CB  . TYR B 1 19  ? 25.175  16.243  5.458   1.00 13.66 ? 19   TYR B CB  1 
ATOM   3371 C  CG  . TYR B 1 19  ? 25.105  17.078  4.197   1.00 14.27 ? 19   TYR B CG  1 
ATOM   3372 C  CD1 . TYR B 1 19  ? 24.163  16.808  3.212   1.00 14.10 ? 19   TYR B CD1 1 
ATOM   3373 C  CD2 . TYR B 1 19  ? 26.005  18.117  3.995   1.00 14.63 ? 19   TYR B CD2 1 
ATOM   3374 C  CE1 . TYR B 1 19  ? 24.121  17.573  2.061   1.00 15.15 ? 19   TYR B CE1 1 
ATOM   3375 C  CE2 . TYR B 1 19  ? 25.966  18.879  2.843   1.00 15.16 ? 19   TYR B CE2 1 
ATOM   3376 C  CZ  . TYR B 1 19  ? 25.014  18.605  1.887   1.00 15.15 ? 19   TYR B CZ  1 
ATOM   3377 O  OH  . TYR B 1 19  ? 24.983  19.365  0.737   1.00 16.45 ? 19   TYR B OH  1 
ATOM   3378 N  N   . GLY B 1 20  ? 27.226  14.625  7.509   1.00 12.68 ? 20   GLY B N   1 
ATOM   3379 C  CA  . GLY B 1 20  ? 27.294  13.947  8.805   1.00 12.87 ? 20   GLY B CA  1 
ATOM   3380 C  C   . GLY B 1 20  ? 27.986  14.846  9.824   1.00 12.78 ? 20   GLY B C   1 
ATOM   3381 O  O   . GLY B 1 20  ? 28.447  15.944  9.515   1.00 13.66 ? 20   GLY B O   1 
ATOM   3382 N  N   . VAL B 1 21  ? 27.995  14.383  11.067  1.00 12.23 ? 21   VAL B N   1 
ATOM   3383 C  CA  . VAL B 1 21  ? 28.631  15.074  12.180  1.00 12.78 ? 21   VAL B CA  1 
ATOM   3384 C  C   . VAL B 1 21  ? 29.707  14.142  12.749  1.00 12.56 ? 21   VAL B C   1 
ATOM   3385 O  O   . VAL B 1 21  ? 29.422  12.971  13.013  1.00 12.09 ? 21   VAL B O   1 
ATOM   3386 C  CB  . VAL B 1 21  ? 27.625  15.411  13.292  1.00 12.85 ? 21   VAL B CB  1 
ATOM   3387 C  CG1 . VAL B 1 21  ? 28.289  15.978  14.531  1.00 13.50 ? 21   VAL B CG1 1 
ATOM   3388 C  CG2 . VAL B 1 21  ? 26.573  16.398  12.779  1.00 13.23 ? 21   VAL B CG2 1 
ATOM   3389 N  N   . PHE B 1 22  ? 30.922  14.662  12.868  1.00 13.31 ? 22   PHE B N   1 
ATOM   3390 C  CA  . PHE B 1 22  ? 32.040  13.833  13.318  1.00 13.29 ? 22   PHE B CA  1 
ATOM   3391 C  C   . PHE B 1 22  ? 32.937  14.611  14.275  1.00 12.71 ? 22   PHE B C   1 
ATOM   3392 O  O   . PHE B 1 22  ? 32.903  15.832  14.360  1.00 12.47 ? 22   PHE B O   1 
ATOM   3393 C  CB  . PHE B 1 22  ? 32.862  13.356  12.114  1.00 13.80 ? 22   PHE B CB  1 
ATOM   3394 C  CG  . PHE B 1 22  ? 33.682  14.441  11.471  1.00 14.38 ? 22   PHE B CG  1 
ATOM   3395 C  CD1 . PHE B 1 22  ? 35.055  14.464  11.666  1.00 15.32 ? 22   PHE B CD1 1 
ATOM   3396 C  CD2 . PHE B 1 22  ? 33.101  15.430  10.699  1.00 14.60 ? 22   PHE B CD2 1 
ATOM   3397 C  CE1 . PHE B 1 22  ? 35.827  15.453  11.085  1.00 15.67 ? 22   PHE B CE1 1 
ATOM   3398 C  CE2 . PHE B 1 22  ? 33.862  16.426  10.126  1.00 14.94 ? 22   PHE B CE2 1 
ATOM   3399 C  CZ  . PHE B 1 22  ? 35.238  16.442  10.322  1.00 15.22 ? 22   PHE B CZ  1 
ATOM   3400 N  N   . SER B 1 23  ? 33.749  13.867  15.019  1.00 12.91 ? 23   SER B N   1 
ATOM   3401 C  CA  . SER B 1 23  ? 34.870  14.457  15.752  1.00 13.22 ? 23   SER B CA  1 
ATOM   3402 C  C   . SER B 1 23  ? 36.089  13.575  15.549  1.00 13.54 ? 23   SER B C   1 
ATOM   3403 O  O   . SER B 1 23  ? 36.041  12.520  14.915  1.00 12.57 ? 23   SER B O   1 
ATOM   3404 C  CB  . SER B 1 23  ? 34.525  14.582  17.240  1.00 13.82 ? 23   SER B CB  1 
ATOM   3405 O  OG  . SER B 1 23  ? 34.301  13.290  17.783  1.00 14.86 ? 23   SER B OG  1 
ATOM   3406 N  N   . THR B 1 24  ? 37.236  14.017  16.062  1.00 13.79 ? 24   THR B N   1 
ATOM   3407 C  CA  . THR B 1 24  ? 38.493  13.292  15.899  1.00 15.41 ? 24   THR B CA  1 
ATOM   3408 C  C   . THR B 1 24  ? 39.240  13.296  17.229  1.00 15.22 ? 24   THR B C   1 
ATOM   3409 O  O   . THR B 1 24  ? 38.907  14.104  18.093  1.00 14.78 ? 24   THR B O   1 
ATOM   3410 C  CB  . THR B 1 24  ? 39.410  13.933  14.840  1.00 14.43 ? 24   THR B CB  1 
ATOM   3411 O  OG1 . THR B 1 24  ? 39.607  15.314  15.155  1.00 16.01 ? 24   THR B OG1 1 
ATOM   3412 C  CG2 . THR B 1 24  ? 38.829  13.829  13.430  1.00 15.73 ? 24   THR B CG2 1 
ATOM   3413 N  N   . GLN B 1 25  ? 40.276  12.469  17.355  1.00 16.29 ? 25   GLN B N   1 
ATOM   3414 C  CA  . GLN B 1 25  ? 41.131  12.555  18.543  1.00 18.09 ? 25   GLN B CA  1 
ATOM   3415 C  C   . GLN B 1 25  ? 41.739  13.943  18.713  1.00 17.59 ? 25   GLN B C   1 
ATOM   3416 O  O   . GLN B 1 25  ? 41.892  14.425  19.841  1.00 17.85 ? 25   GLN B O   1 
ATOM   3417 C  CB  . GLN B 1 25  ? 42.275  11.555  18.443  1.00 19.60 ? 25   GLN B CB  1 
ATOM   3418 C  CG  . GLN B 1 25  ? 41.888  10.089  18.481  1.00 22.43 ? 25   GLN B CG  1 
ATOM   3419 C  CD  . GLN B 1 25  ? 43.068  9.274   17.963  1.00 24.24 ? 25   GLN B CD  1 
ATOM   3420 O  OE1 . GLN B 1 25  ? 44.040  9.090   18.698  1.00 25.72 ? 25   GLN B OE1 1 
ATOM   3421 N  NE2 . GLN B 1 25  ? 42.994  8.842   16.711  1.00 25.04 ? 25   GLN B NE2 1 
ATOM   3422 N  N   . SER B 1 26  ? 42.113  14.592  17.624  1.00 17.08 ? 26   SER B N   1 
ATOM   3423 C  CA  . SER B 1 26  ? 42.699  15.915  17.608  1.00 17.80 ? 26   SER B CA  1 
ATOM   3424 C  C   . SER B 1 26  ? 41.750  17.029  18.020  1.00 16.96 ? 26   SER B C   1 
ATOM   3425 O  O   . SER B 1 26  ? 42.187  18.069  18.512  1.00 17.13 ? 26   SER B O   1 
ATOM   3426 C  CB  . SER B 1 26  ? 43.226  16.243  16.198  1.00 18.52 ? 26   SER B CB  1 
ATOM   3427 O  OG  . SER B 1 26  ? 42.145  16.204  15.265  1.00 20.17 ? 26   SER B OG  1 
ATOM   3428 N  N   . ASN B 1 27  ? 40.446  16.831  17.817  1.00 16.56 ? 27   ASN B N   1 
ATOM   3429 C  CA  . ASN B 1 27  ? 39.484  17.913  18.018  1.00 16.36 ? 27   ASN B CA  1 
ATOM   3430 C  C   . ASN B 1 27  ? 38.147  17.317  18.426  1.00 16.80 ? 27   ASN B C   1 
ATOM   3431 O  O   . ASN B 1 27  ? 37.457  16.705  17.611  1.00 15.87 ? 27   ASN B O   1 
ATOM   3432 C  CB  . ASN B 1 27  ? 39.368  18.730  16.733  1.00 16.89 ? 27   ASN B CB  1 
ATOM   3433 C  CG  . ASN B 1 27  ? 38.384  19.876  16.766  1.00 16.82 ? 27   ASN B CG  1 
ATOM   3434 O  OD1 . ASN B 1 27  ? 38.247  20.579  15.754  1.00 18.89 ? 27   ASN B OD1 1 
ATOM   3435 N  ND2 . ASN B 1 27  ? 37.699  20.095  17.871  1.00 15.74 ? 27   ASN B ND2 1 
ATOM   3436 N  N   . PRO B 1 28  ? 37.767  17.509  19.687  1.00 16.99 ? 28   PRO B N   1 
ATOM   3437 C  CA  . PRO B 1 28  ? 36.590  16.869  20.242  1.00 16.65 ? 28   PRO B CA  1 
ATOM   3438 C  C   . PRO B 1 28  ? 35.285  17.530  19.840  1.00 16.91 ? 28   PRO B C   1 
ATOM   3439 O  O   . PRO B 1 28  ? 34.245  16.952  20.163  1.00 16.70 ? 28   PRO B O   1 
ATOM   3440 C  CB  . PRO B 1 28  ? 36.810  16.955  21.754  1.00 16.75 ? 28   PRO B CB  1 
ATOM   3441 C  CG  . PRO B 1 28  ? 37.619  18.201  21.918  1.00 17.03 ? 28   PRO B CG  1 
ATOM   3442 C  CD  . PRO B 1 28  ? 38.549  18.222  20.729  1.00 16.71 ? 28   PRO B CD  1 
ATOM   3443 N  N   . LYS B 1 29  ? 35.309  18.689  19.192  1.00 17.55 ? 29   LYS B N   1 
ATOM   3444 C  CA  . LYS B 1 29  ? 34.062  19.348  18.812  1.00 17.61 ? 29   LYS B CA  1 
ATOM   3445 C  C   . LYS B 1 29  ? 33.372  18.597  17.680  1.00 16.91 ? 29   LYS B C   1 
ATOM   3446 O  O   . LYS B 1 29  ? 33.914  18.450  16.586  1.00 16.92 ? 29   LYS B O   1 
ATOM   3447 C  CB  . LYS B 1 29  ? 34.302  20.803  18.369  1.00 19.00 ? 29   LYS B CB  1 
ATOM   3448 C  CG  . LYS B 1 29  ? 33.007  21.454  17.897  1.00 20.89 ? 29   LYS B CG  1 
ATOM   3449 C  CD  . LYS B 1 29  ? 33.208  22.793  17.209  1.00 22.86 ? 29   LYS B CD  1 
ATOM   3450 C  CE  . LYS B 1 29  ? 31.889  23.317  16.654  1.00 23.90 ? 29   LYS B CE  1 
ATOM   3451 N  NZ  . LYS B 1 29  ? 31.448  22.573  15.437  1.00 24.92 ? 29   LYS B NZ  1 
ATOM   3452 N  N   . PRO B 1 30  ? 32.146  18.141  17.915  1.00 16.35 ? 30   PRO B N   1 
ATOM   3453 C  CA  . PRO B 1 30  ? 31.318  17.611  16.845  1.00 15.54 ? 30   PRO B CA  1 
ATOM   3454 C  C   . PRO B 1 30  ? 31.129  18.681  15.780  1.00 15.06 ? 30   PRO B C   1 
ATOM   3455 O  O   . PRO B 1 30  ? 30.796  19.829  16.077  1.00 14.79 ? 30   PRO B O   1 
ATOM   3456 C  CB  . PRO B 1 30  ? 30.017  17.219  17.511  1.00 15.96 ? 30   PRO B CB  1 
ATOM   3457 C  CG  . PRO B 1 30  ? 30.229  17.346  18.976  1.00 16.52 ? 30   PRO B CG  1 
ATOM   3458 C  CD  . PRO B 1 30  ? 31.386  18.291  19.179  1.00 16.40 ? 30   PRO B CD  1 
ATOM   3459 N  N   . ARG B 1 31  ? 31.355  18.299  14.525  1.00 14.65 ? 31   ARG B N   1 
ATOM   3460 C  CA  . ARG B 1 31  ? 31.336  19.266  13.433  1.00 15.32 ? 31   ARG B CA  1 
ATOM   3461 C  C   . ARG B 1 31  ? 30.861  18.600  12.148  1.00 15.21 ? 31   ARG B C   1 
ATOM   3462 O  O   . ARG B 1 31  ? 30.894  17.379  11.996  1.00 14.45 ? 31   ARG B O   1 
ATOM   3463 C  CB  . ARG B 1 31  ? 32.705  19.921  13.253  1.00 15.78 ? 31   ARG B CB  1 
ATOM   3464 C  CG  . ARG B 1 31  ? 33.857  18.956  13.043  1.00 15.76 ? 31   ARG B CG  1 
ATOM   3465 C  CD  . ARG B 1 31  ? 35.190  19.661  13.296  1.00 15.60 ? 31   ARG B CD  1 
ATOM   3466 N  NE  . ARG B 1 31  ? 36.335  18.782  13.147  1.00 16.69 ? 31   ARG B NE  1 
ATOM   3467 C  CZ  . ARG B 1 31  ? 36.814  17.917  14.029  1.00 16.77 ? 31   ARG B CZ  1 
ATOM   3468 N  NH1 . ARG B 1 31  ? 36.252  17.761  15.223  1.00 16.53 ? 31   ARG B NH1 1 
ATOM   3469 N  NH2 . ARG B 1 31  ? 37.886  17.196  13.712  1.00 16.82 ? 31   ARG B NH2 1 
ATOM   3470 N  N   . ILE B 1 32  ? 30.419  19.444  11.221  1.00 14.35 ? 32   ILE B N   1 
ATOM   3471 C  CA  . ILE B 1 32  ? 29.719  18.951  10.035  1.00 14.48 ? 32   ILE B CA  1 
ATOM   3472 C  C   . ILE B 1 32  ? 30.701  18.617  8.924   1.00 13.84 ? 32   ILE B C   1 
ATOM   3473 O  O   . ILE B 1 32  ? 31.575  19.419  8.596   1.00 15.49 ? 32   ILE B O   1 
ATOM   3474 C  CB  . ILE B 1 32  ? 28.688  19.993  9.559   1.00 14.35 ? 32   ILE B CB  1 
ATOM   3475 C  CG1 . ILE B 1 32  ? 27.571  20.119  10.597  1.00 14.12 ? 32   ILE B CG1 1 
ATOM   3476 C  CG2 . ILE B 1 32  ? 28.127  19.618  8.193   1.00 13.88 ? 32   ILE B CG2 1 
ATOM   3477 C  CD1 . ILE B 1 32  ? 26.764  21.392  10.465  1.00 13.79 ? 32   ILE B CD1 1 
ATOM   3478 N  N   . GLY B 1 33  ? 30.552  17.433  8.349   1.00 14.05 ? 33   GLY B N   1 
ATOM   3479 C  CA  . GLY B 1 33  ? 31.395  16.993  7.251   1.00 13.74 ? 33   GLY B CA  1 
ATOM   3480 C  C   . GLY B 1 33  ? 30.574  16.374  6.126   1.00 14.04 ? 33   GLY B C   1 
ATOM   3481 O  O   . GLY B 1 33  ? 29.393  16.054  6.271   1.00 12.87 ? 33   GLY B O   1 
ATOM   3482 N  N   . VAL B 1 34  ? 31.232  16.243  4.981   1.00 14.47 ? 34   VAL B N   1 
ATOM   3483 C  CA  . VAL B 1 34  ? 30.686  15.548  3.822   1.00 14.45 ? 34   VAL B CA  1 
ATOM   3484 C  C   . VAL B 1 34  ? 31.658  14.439  3.445   1.00 14.67 ? 34   VAL B C   1 
ATOM   3485 O  O   . VAL B 1 34  ? 32.872  14.671  3.389   1.00 15.28 ? 34   VAL B O   1 
ATOM   3486 C  CB  . VAL B 1 34  ? 30.472  16.515  2.645   1.00 14.97 ? 34   VAL B CB  1 
ATOM   3487 C  CG1 . VAL B 1 34  ? 30.243  15.798  1.326   1.00 15.43 ? 34   VAL B CG1 1 
ATOM   3488 C  CG2 . VAL B 1 34  ? 29.313  17.462  2.941   1.00 15.90 ? 34   VAL B CG2 1 
ATOM   3489 N  N   . ALA B 1 35  ? 31.155  13.232  3.258   1.00 13.76 ? 35   ALA B N   1 
ATOM   3490 C  CA  . ALA B 1 35  ? 31.982  12.093  2.898   1.00 14.47 ? 35   ALA B CA  1 
ATOM   3491 C  C   . ALA B 1 35  ? 32.325  12.140  1.406   1.00 14.91 ? 35   ALA B C   1 
ATOM   3492 O  O   . ALA B 1 35  ? 31.454  12.400  0.576   1.00 15.04 ? 35   ALA B O   1 
ATOM   3493 C  CB  . ALA B 1 35  ? 31.302  10.777  3.215   1.00 14.02 ? 35   ALA B CB  1 
ATOM   3494 N  N   . ILE B 1 36  ? 33.596  11.904  1.111   1.00 14.02 ? 36   ILE B N   1 
ATOM   3495 C  CA  . ILE B 1 36  ? 34.034  11.778  -0.284  1.00 14.85 ? 36   ILE B CA  1 
ATOM   3496 C  C   . ILE B 1 36  ? 35.182  10.777  -0.326  1.00 14.85 ? 36   ILE B C   1 
ATOM   3497 O  O   . ILE B 1 36  ? 36.184  10.943  0.378   1.00 14.54 ? 36   ILE B O   1 
ATOM   3498 C  CB  . ILE B 1 36  ? 34.426  13.133  -0.882  1.00 14.74 ? 36   ILE B CB  1 
ATOM   3499 C  CG1 . ILE B 1 36  ? 34.998  12.972  -2.300  1.00 14.72 ? 36   ILE B CG1 1 
ATOM   3500 C  CG2 . ILE B 1 36  ? 35.404  13.896  0.004   1.00 15.60 ? 36   ILE B CG2 1 
ATOM   3501 C  CD1 . ILE B 1 36  ? 33.974  12.499  -3.315  1.00 15.48 ? 36   ILE B CD1 1 
ATOM   3502 N  N   . GLY B 1 37  ? 35.020  9.710   -1.099  1.00 15.37 ? 37   GLY B N   1 
ATOM   3503 C  CA  . GLY B 1 37  ? 36.000  8.620   -1.087  1.00 16.12 ? 37   GLY B CA  1 
ATOM   3504 C  C   . GLY B 1 37  ? 36.113  8.074   0.338   1.00 16.54 ? 37   GLY B C   1 
ATOM   3505 O  O   . GLY B 1 37  ? 35.094  7.747   0.952   1.00 15.72 ? 37   GLY B O   1 
ATOM   3506 N  N   . ASP B 1 38  ? 37.347  7.996   0.838   1.00 16.96 ? 38   ASP B N   1 
ATOM   3507 C  CA  . ASP B 1 38  ? 37.557  7.526   2.211   1.00 17.42 ? 38   ASP B CA  1 
ATOM   3508 C  C   . ASP B 1 38  ? 37.876  8.689   3.141   1.00 16.75 ? 38   ASP B C   1 
ATOM   3509 O  O   . ASP B 1 38  ? 38.365  8.484   4.252   1.00 16.49 ? 38   ASP B O   1 
ATOM   3510 C  CB  . ASP B 1 38  ? 38.655  6.466   2.260   1.00 18.97 ? 38   ASP B CB  1 
ATOM   3511 C  CG  . ASP B 1 38  ? 40.045  6.975   1.955   1.00 20.31 ? 38   ASP B CG  1 
ATOM   3512 O  OD1 . ASP B 1 38  ? 40.261  8.178   1.718   1.00 20.90 ? 38   ASP B OD1 1 
ATOM   3513 O  OD2 . ASP B 1 38  ? 40.968  6.129   1.974   1.00 22.15 ? 38   ASP B OD2 1 
ATOM   3514 N  N   . GLN B 1 39  ? 37.564  9.899   2.704   1.00 15.92 ? 39   GLN B N   1 
ATOM   3515 C  CA  . GLN B 1 39  ? 37.839  11.125  3.408   1.00 15.72 ? 39   GLN B CA  1 
ATOM   3516 C  C   . GLN B 1 39  ? 36.549  11.811  3.868   1.00 15.52 ? 39   GLN B C   1 
ATOM   3517 O  O   . GLN B 1 39  ? 35.445  11.473  3.432   1.00 15.29 ? 39   GLN B O   1 
ATOM   3518 C  CB  . GLN B 1 39  ? 38.584  12.126  2.512   1.00 16.42 ? 39   GLN B CB  1 
ATOM   3519 C  CG  . GLN B 1 39  ? 39.916  11.595  1.981   1.00 16.30 ? 39   GLN B CG  1 
ATOM   3520 C  CD  . GLN B 1 39  ? 40.951  11.644  3.092   1.00 16.84 ? 39   GLN B CD  1 
ATOM   3521 O  OE1 . GLN B 1 39  ? 41.194  12.724  3.630   1.00 17.63 ? 39   GLN B OE1 1 
ATOM   3522 N  NE2 . GLN B 1 39  ? 41.512  10.495  3.444   1.00 17.88 ? 39   GLN B NE2 1 
ATOM   3523 N  N   . ILE B 1 40  ? 36.718  12.770  4.768   1.00 15.11 ? 40   ILE B N   1 
ATOM   3524 C  CA  . ILE B 1 40  ? 35.668  13.694  5.156   1.00 14.75 ? 40   ILE B CA  1 
ATOM   3525 C  C   . ILE B 1 40  ? 36.114  15.124  4.866   1.00 15.10 ? 40   ILE B C   1 
ATOM   3526 O  O   . ILE B 1 40  ? 37.203  15.532  5.278   1.00 14.52 ? 40   ILE B O   1 
ATOM   3527 C  CB  . ILE B 1 40  ? 35.290  13.594  6.652   1.00 14.42 ? 40   ILE B CB  1 
ATOM   3528 C  CG1 . ILE B 1 40  ? 34.920  12.158  7.022   1.00 13.83 ? 40   ILE B CG1 1 
ATOM   3529 C  CG2 . ILE B 1 40  ? 34.154  14.559  6.964   1.00 14.77 ? 40   ILE B CG2 1 
ATOM   3530 C  CD1 . ILE B 1 40  ? 34.597  11.932  8.489   1.00 13.47 ? 40   ILE B CD1 1 
ATOM   3531 N  N   . LEU B 1 41  ? 35.283  15.893  4.172   1.00 14.88 ? 41   LEU B N   1 
ATOM   3532 C  CA  . LEU B 1 41  ? 35.489  17.329  4.020   1.00 15.71 ? 41   LEU B CA  1 
ATOM   3533 C  C   . LEU B 1 41  ? 34.778  18.091  5.131   1.00 16.58 ? 41   LEU B C   1 
ATOM   3534 O  O   . LEU B 1 41  ? 33.554  18.012  5.253   1.00 16.04 ? 41   LEU B O   1 
ATOM   3535 C  CB  . LEU B 1 41  ? 34.972  17.800  2.660   1.00 15.38 ? 41   LEU B CB  1 
ATOM   3536 C  CG  . LEU B 1 41  ? 35.059  19.281  2.311   1.00 15.73 ? 41   LEU B CG  1 
ATOM   3537 C  CD1 . LEU B 1 41  ? 36.511  19.758  2.287   1.00 16.36 ? 41   LEU B CD1 1 
ATOM   3538 C  CD2 . LEU B 1 41  ? 34.446  19.538  0.936   1.00 16.82 ? 41   LEU B CD2 1 
ATOM   3539 N  N   . ASP B 1 42  ? 35.545  18.826  5.924   1.00 17.12 ? 42   ASP B N   1 
ATOM   3540 C  CA  . ASP B 1 42  ? 35.014  19.556  7.074   1.00 18.36 ? 42   ASP B CA  1 
ATOM   3541 C  C   . ASP B 1 42  ? 34.403  20.870  6.630   1.00 19.11 ? 42   ASP B C   1 
ATOM   3542 O  O   . ASP B 1 42  ? 35.109  21.798  6.216   1.00 19.32 ? 42   ASP B O   1 
ATOM   3543 C  CB  . ASP B 1 42  ? 36.162  19.749  8.068   1.00 19.56 ? 42   ASP B CB  1 
ATOM   3544 C  CG  . ASP B 1 42  ? 35.831  20.447  9.360   1.00 20.82 ? 42   ASP B CG  1 
ATOM   3545 O  OD1 . ASP B 1 42  ? 34.905  21.279  9.403   1.00 21.80 ? 42   ASP B OD1 1 
ATOM   3546 O  OD2 . ASP B 1 42  ? 36.526  20.191  10.375  1.00 21.87 ? 42   ASP B OD2 1 
ATOM   3547 N  N   . LEU B 1 43  ? 33.073  20.989  6.708   1.00 18.66 ? 43   LEU B N   1 
ATOM   3548 C  CA  . LEU B 1 43  ? 32.403  22.173  6.188   1.00 19.03 ? 43   LEU B CA  1 
ATOM   3549 C  C   . LEU B 1 43  ? 32.643  23.425  7.013   1.00 20.25 ? 43   LEU B C   1 
ATOM   3550 O  O   . LEU B 1 43  ? 32.559  24.533  6.465   1.00 20.76 ? 43   LEU B O   1 
ATOM   3551 C  CB  . LEU B 1 43  ? 30.901  21.920  5.999   1.00 18.67 ? 43   LEU B CB  1 
ATOM   3552 C  CG  . LEU B 1 43  ? 30.498  20.800  5.038   1.00 18.07 ? 43   LEU B CG  1 
ATOM   3553 C  CD1 . LEU B 1 43  ? 28.994  20.874  4.760   1.00 18.30 ? 43   LEU B CD1 1 
ATOM   3554 C  CD2 . LEU B 1 43  ? 31.257  20.841  3.719   1.00 18.16 ? 43   LEU B CD2 1 
ATOM   3555 N  N   . SER B 1 44  ? 32.955  23.301  8.299   1.00 21.38 ? 44   SER B N   1 
ATOM   3556 C  CA  . SER B 1 44  ? 33.291  24.479  9.102   1.00 22.60 ? 44   SER B CA  1 
ATOM   3557 C  C   . SER B 1 44  ? 34.570  25.116  8.560   1.00 22.91 ? 44   SER B C   1 
ATOM   3558 O  O   . SER B 1 44  ? 34.670  26.343  8.474   1.00 23.95 ? 44   SER B O   1 
ATOM   3559 C  CB  . SER B 1 44  ? 33.394  24.163  10.585  1.00 22.95 ? 44   SER B CB  1 
ATOM   3560 O  OG  . SER B 1 44  ? 34.451  23.293  10.936  1.00 23.86 ? 44   SER B OG  1 
ATOM   3561 N  N   . VAL B 1 45  ? 35.524  24.299  8.132   1.00 22.86 ? 45   VAL B N   1 
ATOM   3562 C  CA  . VAL B 1 45  ? 36.778  24.810  7.581   1.00 22.71 ? 45   VAL B CA  1 
ATOM   3563 C  C   . VAL B 1 45  ? 36.568  25.589  6.291   1.00 23.38 ? 45   VAL B C   1 
ATOM   3564 O  O   . VAL B 1 45  ? 37.208  26.627  6.090   1.00 23.88 ? 45   VAL B O   1 
ATOM   3565 C  CB  . VAL B 1 45  ? 37.783  23.666  7.366   1.00 22.40 ? 45   VAL B CB  1 
ATOM   3566 C  CG1 . VAL B 1 45  ? 39.076  24.142  6.715   1.00 22.42 ? 45   VAL B CG1 1 
ATOM   3567 C  CG2 . VAL B 1 45  ? 38.095  23.005  8.705   1.00 22.27 ? 45   VAL B CG2 1 
ATOM   3568 N  N   . ILE B 1 46  ? 35.693  25.113  5.405   1.00 23.17 ? 46   ILE B N   1 
ATOM   3569 C  CA  . ILE B 1 46  ? 35.507  25.765  4.114   1.00 23.45 ? 46   ILE B CA  1 
ATOM   3570 C  C   . ILE B 1 46  ? 34.212  26.553  4.008   1.00 23.41 ? 46   ILE B C   1 
ATOM   3571 O  O   . ILE B 1 46  ? 33.826  26.940  2.897   1.00 23.69 ? 46   ILE B O   1 
ATOM   3572 C  CB  . ILE B 1 46  ? 35.583  24.760  2.949   1.00 23.51 ? 46   ILE B CB  1 
ATOM   3573 C  CG1 . ILE B 1 46  ? 34.512  23.672  3.098   1.00 24.03 ? 46   ILE B CG1 1 
ATOM   3574 C  CG2 . ILE B 1 46  ? 36.967  24.133  2.858   1.00 23.43 ? 46   ILE B CG2 1 
ATOM   3575 C  CD1 . ILE B 1 46  ? 34.101  23.051  1.781   1.00 24.78 ? 46   ILE B CD1 1 
ATOM   3576 N  N   . LYS B 1 47  ? 33.579  26.916  5.119   1.00 24.08 ? 47   LYS B N   1 
ATOM   3577 C  CA  . LYS B 1 47  ? 32.274  27.569  5.100   1.00 24.92 ? 47   LYS B CA  1 
ATOM   3578 C  C   . LYS B 1 47  ? 32.287  28.917  4.395   1.00 25.25 ? 47   LYS B C   1 
ATOM   3579 O  O   . LYS B 1 47  ? 31.305  29.327  3.775   1.00 25.04 ? 47   LYS B O   1 
ATOM   3580 C  CB  . LYS B 1 47  ? 31.729  27.753  6.520   1.00 25.42 ? 47   LYS B CB  1 
ATOM   3581 C  CG  . LYS B 1 47  ? 32.600  28.609  7.425   1.00 25.76 ? 47   LYS B CG  1 
ATOM   3582 C  CD  . LYS B 1 47  ? 31.940  28.853  8.769   1.00 26.22 ? 47   LYS B CD  1 
ATOM   3583 C  CE  . LYS B 1 47  ? 32.845  29.625  9.712   1.00 26.49 ? 47   LYS B CE  1 
ATOM   3584 N  NZ  . LYS B 1 47  ? 34.018  28.819  10.144  1.00 26.55 ? 47   LYS B NZ  1 
ATOM   3585 N  N   . HIS B 1 48  ? 33.416  29.622  4.429   1.00 25.50 ? 48   HIS B N   1 
ATOM   3586 C  CA  . HIS B 1 48  ? 33.612  30.868  3.713   1.00 26.10 ? 48   HIS B CA  1 
ATOM   3587 C  C   . HIS B 1 48  ? 33.638  30.745  2.200   1.00 26.27 ? 48   HIS B C   1 
ATOM   3588 O  O   . HIS B 1 48  ? 33.568  31.769  1.506   1.00 26.61 ? 48   HIS B O   1 
ATOM   3589 C  CB  . HIS B 1 48  ? 34.926  31.511  4.198   1.00 26.28 ? 48   HIS B CB  1 
ATOM   3590 C  CG  . HIS B 1 48  ? 36.134  30.686  3.878   1.00 26.66 ? 48   HIS B CG  1 
ATOM   3591 N  ND1 . HIS B 1 48  ? 36.463  29.536  4.561   1.00 26.39 ? 48   HIS B ND1 1 
ATOM   3592 C  CD2 . HIS B 1 48  ? 37.096  30.854  2.936   1.00 26.44 ? 48   HIS B CD2 1 
ATOM   3593 C  CE1 . HIS B 1 48  ? 37.571  29.027  4.057   1.00 26.40 ? 48   HIS B CE1 1 
ATOM   3594 N  NE2 . HIS B 1 48  ? 37.980  29.808  3.071   1.00 26.50 ? 48   HIS B NE2 1 
ATOM   3595 N  N   . LEU B 1 49  ? 33.726  29.550  1.633   1.00 26.47 ? 49   LEU B N   1 
ATOM   3596 C  CA  . LEU B 1 49  ? 33.607  29.343  0.200   1.00 26.39 ? 49   LEU B CA  1 
ATOM   3597 C  C   . LEU B 1 49  ? 32.169  29.192  -0.273  1.00 26.57 ? 49   LEU B C   1 
ATOM   3598 O  O   . LEU B 1 49  ? 31.944  29.089  -1.485  1.00 26.98 ? 49   LEU B O   1 
ATOM   3599 C  CB  . LEU B 1 49  ? 34.443  28.130  -0.230  1.00 26.55 ? 49   LEU B CB  1 
ATOM   3600 C  CG  . LEU B 1 49  ? 35.915  28.169  0.211   1.00 26.75 ? 49   LEU B CG  1 
ATOM   3601 C  CD1 . LEU B 1 49  ? 36.647  26.924  -0.259  1.00 26.50 ? 49   LEU B CD1 1 
ATOM   3602 C  CD2 . LEU B 1 49  ? 36.595  29.435  -0.299  1.00 27.39 ? 49   LEU B CD2 1 
ATOM   3603 N  N   . PHE B 1 50  ? 31.197  29.213  0.636   1.00 26.06 ? 50   PHE B N   1 
ATOM   3604 C  CA  . PHE B 1 50  ? 29.793  29.240  0.218   1.00 26.10 ? 50   PHE B CA  1 
ATOM   3605 C  C   . PHE B 1 50  ? 29.354  30.689  0.035   1.00 26.28 ? 50   PHE B C   1 
ATOM   3606 O  O   . PHE B 1 50  ? 28.830  31.339  0.935   1.00 26.49 ? 50   PHE B O   1 
ATOM   3607 C  CB  . PHE B 1 50  ? 28.911  28.486  1.203   1.00 25.55 ? 50   PHE B CB  1 
ATOM   3608 C  CG  . PHE B 1 50  ? 29.176  27.014  1.317   1.00 25.27 ? 50   PHE B CG  1 
ATOM   3609 C  CD1 . PHE B 1 50  ? 29.688  26.477  2.487   1.00 25.55 ? 50   PHE B CD1 1 
ATOM   3610 C  CD2 . PHE B 1 50  ? 28.914  26.154  0.266   1.00 24.91 ? 50   PHE B CD2 1 
ATOM   3611 C  CE1 . PHE B 1 50  ? 29.934  25.121  2.600   1.00 25.27 ? 50   PHE B CE1 1 
ATOM   3612 C  CE2 . PHE B 1 50  ? 29.151  24.799  0.370   1.00 24.89 ? 50   PHE B CE2 1 
ATOM   3613 C  CZ  . PHE B 1 50  ? 29.671  24.277  1.542   1.00 24.88 ? 50   PHE B CZ  1 
ATOM   3614 N  N   . THR B 1 51  ? 29.582  31.209  -1.170  1.00 27.46 ? 51   THR B N   1 
ATOM   3615 C  CA  . THR B 1 51  ? 29.414  32.624  -1.460  1.00 28.52 ? 51   THR B CA  1 
ATOM   3616 C  C   . THR B 1 51  ? 28.154  32.938  -2.254  1.00 28.53 ? 51   THR B C   1 
ATOM   3617 O  O   . THR B 1 51  ? 27.911  34.104  -2.579  1.00 29.14 ? 51   THR B O   1 
ATOM   3618 C  CB  . THR B 1 51  ? 30.630  33.157  -2.252  1.00 28.79 ? 51   THR B CB  1 
ATOM   3619 O  OG1 . THR B 1 51  ? 30.801  32.359  -3.428  1.00 29.89 ? 51   THR B OG1 1 
ATOM   3620 C  CG2 . THR B 1 51  ? 31.884  33.083  -1.392  1.00 29.42 ? 51   THR B CG2 1 
ATOM   3621 N  N   . GLY B 1 52  ? 27.355  31.927  -2.570  1.00 28.37 ? 52   GLY B N   1 
ATOM   3622 C  CA  . GLY B 1 52  ? 26.110  32.135  -3.296  1.00 27.61 ? 52   GLY B CA  1 
ATOM   3623 C  C   . GLY B 1 52  ? 25.062  32.891  -2.496  1.00 27.27 ? 52   GLY B C   1 
ATOM   3624 O  O   . GLY B 1 52  ? 25.195  33.140  -1.300  1.00 27.27 ? 52   GLY B O   1 
ATOM   3625 N  N   . PRO B 1 53  ? 23.929  33.176  -3.139  1.00 26.83 ? 53   PRO B N   1 
ATOM   3626 C  CA  . PRO B 1 53  ? 22.863  33.966  -2.560  1.00 26.64 ? 53   PRO B CA  1 
ATOM   3627 C  C   . PRO B 1 53  ? 22.109  33.286  -1.431  1.00 26.01 ? 53   PRO B C   1 
ATOM   3628 O  O   . PRO B 1 53  ? 21.661  33.954  -0.492  1.00 26.31 ? 53   PRO B O   1 
ATOM   3629 C  CB  . PRO B 1 53  ? 21.929  34.261  -3.734  1.00 26.81 ? 53   PRO B CB  1 
ATOM   3630 C  CG  . PRO B 1 53  ? 22.245  33.246  -4.770  1.00 26.78 ? 53   PRO B CG  1 
ATOM   3631 C  CD  . PRO B 1 53  ? 23.690  32.885  -4.579  1.00 26.72 ? 53   PRO B CD  1 
ATOM   3632 N  N   . ALA B 1 54  ? 21.954  31.965  -1.499  1.00 25.04 ? 54   ALA B N   1 
ATOM   3633 C  CA  . ALA B 1 54  ? 21.201  31.247  -0.474  1.00 25.11 ? 54   ALA B CA  1 
ATOM   3634 C  C   . ALA B 1 54  ? 22.032  31.013  0.784   1.00 24.80 ? 54   ALA B C   1 
ATOM   3635 O  O   . ALA B 1 54  ? 21.461  30.927  1.877   1.00 24.94 ? 54   ALA B O   1 
ATOM   3636 C  CB  . ALA B 1 54  ? 20.683  29.924  -1.026  1.00 24.88 ? 54   ALA B CB  1 
ATOM   3637 N  N   . LEU B 1 55  ? 23.353  30.934  0.653   1.00 24.86 ? 55   LEU B N   1 
ATOM   3638 C  CA  . LEU B 1 55  ? 24.191  30.561  1.789   1.00 25.08 ? 55   LEU B CA  1 
ATOM   3639 C  C   . LEU B 1 55  ? 25.081  31.678  2.304   1.00 26.07 ? 55   LEU B C   1 
ATOM   3640 O  O   . LEU B 1 55  ? 25.575  31.574  3.435   1.00 25.81 ? 55   LEU B O   1 
ATOM   3641 C  CB  . LEU B 1 55  ? 25.069  29.355  1.430   1.00 24.38 ? 55   LEU B CB  1 
ATOM   3642 C  CG  . LEU B 1 55  ? 24.345  28.040  1.128   1.00 24.16 ? 55   LEU B CG  1 
ATOM   3643 C  CD1 . LEU B 1 55  ? 25.316  26.992  0.607   1.00 23.38 ? 55   LEU B CD1 1 
ATOM   3644 C  CD2 . LEU B 1 55  ? 23.620  27.534  2.369   1.00 24.12 ? 55   LEU B CD2 1 
ATOM   3645 N  N   . SER B 1 56  ? 25.268  32.766  1.565   1.00 27.43 ? 56   SER B N   1 
ATOM   3646 C  CA  . SER B 1 56  ? 26.249  33.776  1.977   1.00 28.72 ? 56   SER B CA  1 
ATOM   3647 C  C   . SER B 1 56  ? 25.980  34.356  3.356   1.00 29.34 ? 56   SER B C   1 
ATOM   3648 O  O   . SER B 1 56  ? 26.936  34.633  4.093   1.00 29.90 ? 56   SER B O   1 
ATOM   3649 C  CB  . SER B 1 56  ? 26.358  34.900  0.944   1.00 29.24 ? 56   SER B CB  1 
ATOM   3650 O  OG  . SER B 1 56  ? 25.119  35.563  0.778   1.00 30.27 ? 56   SER B OG  1 
ATOM   3651 N  N   . LYS B 1 57  ? 24.725  34.561  3.741   1.00 29.68 ? 57   LYS B N   1 
ATOM   3652 C  CA  . LYS B 1 57  ? 24.396  35.085  5.058   1.00 30.16 ? 57   LYS B CA  1 
ATOM   3653 C  C   . LYS B 1 57  ? 24.056  33.987  6.058   1.00 29.60 ? 57   LYS B C   1 
ATOM   3654 O  O   . LYS B 1 57  ? 23.593  34.269  7.164   1.00 29.57 ? 57   LYS B O   1 
ATOM   3655 C  CB  . LYS B 1 57  ? 23.224  36.066  4.966   1.00 31.44 ? 57   LYS B CB  1 
ATOM   3656 C  CG  . LYS B 1 57  ? 23.530  37.321  4.164   1.00 32.89 ? 57   LYS B CG  1 
ATOM   3657 C  CD  . LYS B 1 57  ? 22.321  38.246  4.146   1.00 34.05 ? 57   LYS B CD  1 
ATOM   3658 C  CE  . LYS B 1 57  ? 22.592  39.488  3.310   1.00 34.87 ? 57   LYS B CE  1 
ATOM   3659 N  NZ  . LYS B 1 57  ? 21.375  40.349  3.223   1.00 35.50 ? 57   LYS B NZ  1 
ATOM   3660 N  N   . HIS B 1 58  ? 24.247  32.732  5.670   1.00 28.67 ? 58   HIS B N   1 
ATOM   3661 C  CA  . HIS B 1 58  ? 23.905  31.591  6.503   1.00 27.89 ? 58   HIS B CA  1 
ATOM   3662 C  C   . HIS B 1 58  ? 25.086  30.644  6.668   1.00 27.13 ? 58   HIS B C   1 
ATOM   3663 O  O   . HIS B 1 58  ? 24.918  29.472  7.005   1.00 26.45 ? 58   HIS B O   1 
ATOM   3664 C  CB  . HIS B 1 58  ? 22.714  30.817  5.923   1.00 28.36 ? 58   HIS B CB  1 
ATOM   3665 C  CG  . HIS B 1 58  ? 21.418  31.564  5.994   1.00 28.63 ? 58   HIS B CG  1 
ATOM   3666 N  ND1 . HIS B 1 58  ? 20.828  32.127  4.880   1.00 29.38 ? 58   HIS B ND1 1 
ATOM   3667 C  CD2 . HIS B 1 58  ? 20.617  31.864  7.042   1.00 28.79 ? 58   HIS B CD2 1 
ATOM   3668 C  CE1 . HIS B 1 58  ? 19.706  32.727  5.240   1.00 29.34 ? 58   HIS B CE1 1 
ATOM   3669 N  NE2 . HIS B 1 58  ? 19.557  32.586  6.545   1.00 29.45 ? 58   HIS B NE2 1 
ATOM   3670 N  N   . GLN B 1 59  ? 26.304  31.160  6.510   1.00 26.28 ? 59   GLN B N   1 
ATOM   3671 C  CA  . GLN B 1 59  ? 27.501  30.333  6.619   1.00 25.69 ? 59   GLN B CA  1 
ATOM   3672 C  C   . GLN B 1 59  ? 27.687  29.719  7.996   1.00 25.08 ? 59   GLN B C   1 
ATOM   3673 O  O   . GLN B 1 59  ? 28.264  28.631  8.116   1.00 24.85 ? 59   GLN B O   1 
ATOM   3674 C  CB  . GLN B 1 59  ? 28.751  31.136  6.248   1.00 25.90 ? 59   GLN B CB  1 
ATOM   3675 C  CG  . GLN B 1 59  ? 28.892  31.362  4.751   1.00 25.75 ? 59   GLN B CG  1 
ATOM   3676 C  CD  . GLN B 1 59  ? 30.067  32.252  4.404   1.00 26.11 ? 59   GLN B CD  1 
ATOM   3677 O  OE1 . GLN B 1 59  ? 30.858  32.628  5.270   1.00 26.44 ? 59   GLN B OE1 1 
ATOM   3678 N  NE2 . GLN B 1 59  ? 30.189  32.586  3.124   1.00 26.16 ? 59   GLN B NE2 1 
ATOM   3679 N  N   . HIS B 1 60  ? 27.178  30.351  9.044   1.00 24.88 ? 60   HIS B N   1 
ATOM   3680 C  CA  . HIS B 1 60  ? 27.255  29.836  10.396  1.00 25.16 ? 60   HIS B CA  1 
ATOM   3681 C  C   . HIS B 1 60  ? 26.549  28.507  10.595  1.00 23.56 ? 60   HIS B C   1 
ATOM   3682 O  O   . HIS B 1 60  ? 26.904  27.797  11.546  1.00 23.01 ? 60   HIS B O   1 
ATOM   3683 C  CB  . HIS B 1 60  ? 26.708  30.864  11.393  1.00 27.33 ? 60   HIS B CB  1 
ATOM   3684 C  CG  . HIS B 1 60  ? 25.306  31.303  11.102  1.00 29.29 ? 60   HIS B CG  1 
ATOM   3685 N  ND1 . HIS B 1 60  ? 24.252  30.419  11.099  1.00 30.20 ? 60   HIS B ND1 1 
ATOM   3686 C  CD2 . HIS B 1 60  ? 24.773  32.513  10.815  1.00 30.18 ? 60   HIS B CD2 1 
ATOM   3687 C  CE1 . HIS B 1 60  ? 23.131  31.056  10.824  1.00 30.50 ? 60   HIS B CE1 1 
ATOM   3688 N  NE2 . HIS B 1 60  ? 23.419  32.333  10.645  1.00 30.70 ? 60   HIS B NE2 1 
ATOM   3689 N  N   . VAL B 1 61  ? 25.622  28.082  9.734   1.00 21.99 ? 61   VAL B N   1 
ATOM   3690 C  CA  . VAL B 1 61  ? 24.998  26.774  9.880   1.00 21.19 ? 61   VAL B CA  1 
ATOM   3691 C  C   . VAL B 1 61  ? 26.018  25.646  9.759   1.00 20.46 ? 61   VAL B C   1 
ATOM   3692 O  O   . VAL B 1 61  ? 25.813  24.578  10.342  1.00 19.92 ? 61   VAL B O   1 
ATOM   3693 C  CB  . VAL B 1 61  ? 23.837  26.488  8.910   1.00 20.99 ? 61   VAL B CB  1 
ATOM   3694 C  CG1 . VAL B 1 61  ? 22.746  27.549  9.035   1.00 21.43 ? 61   VAL B CG1 1 
ATOM   3695 C  CG2 . VAL B 1 61  ? 24.302  26.363  7.468   1.00 21.23 ? 61   VAL B CG2 1 
ATOM   3696 N  N   . PHE B 1 62  ? 27.121  25.839  9.046   1.00 19.90 ? 62   PHE B N   1 
ATOM   3697 C  CA  . PHE B 1 62  ? 28.146  24.828  8.880   1.00 19.56 ? 62   PHE B CA  1 
ATOM   3698 C  C   . PHE B 1 62  ? 29.139  24.780  10.038  1.00 20.24 ? 62   PHE B C   1 
ATOM   3699 O  O   . PHE B 1 62  ? 29.976  23.874  10.065  1.00 19.93 ? 62   PHE B O   1 
ATOM   3700 C  CB  . PHE B 1 62  ? 28.888  25.032  7.551   1.00 20.02 ? 62   PHE B CB  1 
ATOM   3701 C  CG  . PHE B 1 62  ? 27.961  25.007  6.367   1.00 20.23 ? 62   PHE B CG  1 
ATOM   3702 C  CD1 . PHE B 1 62  ? 27.692  26.162  5.648   1.00 20.65 ? 62   PHE B CD1 1 
ATOM   3703 C  CD2 . PHE B 1 62  ? 27.338  23.829  5.990   1.00 20.12 ? 62   PHE B CD2 1 
ATOM   3704 C  CE1 . PHE B 1 62  ? 26.833  26.132  4.564   1.00 21.26 ? 62   PHE B CE1 1 
ATOM   3705 C  CE2 . PHE B 1 62  ? 26.474  23.795  4.914   1.00 20.29 ? 62   PHE B CE2 1 
ATOM   3706 C  CZ  . PHE B 1 62  ? 26.219  24.950  4.197   1.00 20.90 ? 62   PHE B CZ  1 
ATOM   3707 N  N   . ASP B 1 63  ? 29.024  25.691  10.993  1.00 21.15 ? 63   ASP B N   1 
ATOM   3708 C  CA  . ASP B 1 63  ? 29.803  25.658  12.219  1.00 22.11 ? 63   ASP B CA  1 
ATOM   3709 C  C   . ASP B 1 63  ? 29.087  24.983  13.380  1.00 21.40 ? 63   ASP B C   1 
ATOM   3710 O  O   . ASP B 1 63  ? 29.677  24.801  14.452  1.00 21.82 ? 63   ASP B O   1 
ATOM   3711 C  CB  . ASP B 1 63  ? 30.155  27.088  12.654  1.00 24.84 ? 63   ASP B CB  1 
ATOM   3712 C  CG  . ASP B 1 63  ? 31.632  27.391  12.530  1.00 26.85 ? 63   ASP B CG  1 
ATOM   3713 O  OD1 . ASP B 1 63  ? 32.259  27.023  11.517  1.00 28.01 ? 63   ASP B OD1 1 
ATOM   3714 O  OD2 . ASP B 1 63  ? 32.159  28.007  13.484  1.00 29.28 ? 63   ASP B OD2 1 
ATOM   3715 N  N   . GLU B 1 64  ? 27.825  24.609  13.205  1.00 19.69 ? 64   GLU B N   1 
ATOM   3716 C  CA  . GLU B 1 64  ? 27.049  24.012  14.284  1.00 19.19 ? 64   GLU B CA  1 
ATOM   3717 C  C   . GLU B 1 64  ? 27.456  22.568  14.547  1.00 17.32 ? 64   GLU B C   1 
ATOM   3718 O  O   . GLU B 1 64  ? 28.019  21.874  13.704  1.00 16.79 ? 64   GLU B O   1 
ATOM   3719 C  CB  . GLU B 1 64  ? 25.552  24.048  13.949  1.00 21.04 ? 64   GLU B CB  1 
ATOM   3720 C  CG  . GLU B 1 64  ? 24.984  25.419  13.654  1.00 23.55 ? 64   GLU B CG  1 
ATOM   3721 C  CD  . GLU B 1 64  ? 24.940  26.356  14.839  1.00 25.61 ? 64   GLU B CD  1 
ATOM   3722 O  OE1 . GLU B 1 64  ? 24.807  25.903  15.993  1.00 26.82 ? 64   GLU B OE1 1 
ATOM   3723 O  OE2 . GLU B 1 64  ? 25.034  27.585  14.630  1.00 27.15 ? 64   GLU B OE2 1 
ATOM   3724 N  N   . THR B 1 65  ? 27.060  22.057  15.711  1.00 15.78 ? 65   THR B N   1 
ATOM   3725 C  CA  . THR B 1 65  ? 27.379  20.702  16.125  1.00 15.63 ? 65   THR B CA  1 
ATOM   3726 C  C   . THR B 1 65  ? 26.373  19.689  15.583  1.00 14.94 ? 65   THR B C   1 
ATOM   3727 O  O   . THR B 1 65  ? 26.532  18.487  15.787  1.00 15.75 ? 65   THR B O   1 
ATOM   3728 C  CB  . THR B 1 65  ? 27.438  20.556  17.659  1.00 15.87 ? 65   THR B CB  1 
ATOM   3729 O  OG1 . THR B 1 65  ? 26.188  20.975  18.238  1.00 16.63 ? 65   THR B OG1 1 
ATOM   3730 C  CG2 . THR B 1 65  ? 28.574  21.389  18.238  1.00 16.55 ? 65   THR B CG2 1 
ATOM   3731 N  N   . THR B 1 66  ? 25.296  20.167  14.971  1.00 14.57 ? 66   THR B N   1 
ATOM   3732 C  CA  . THR B 1 66  ? 24.277  19.323  14.380  1.00 14.18 ? 66   THR B CA  1 
ATOM   3733 C  C   . THR B 1 66  ? 23.856  19.915  13.028  1.00 13.71 ? 66   THR B C   1 
ATOM   3734 O  O   . THR B 1 66  ? 24.077  21.096  12.771  1.00 14.28 ? 66   THR B O   1 
ATOM   3735 C  CB  . THR B 1 66  ? 23.009  19.223  15.244  1.00 14.81 ? 66   THR B CB  1 
ATOM   3736 O  OG1 . THR B 1 66  ? 22.510  20.552  15.449  1.00 15.03 ? 66   THR B OG1 1 
ATOM   3737 C  CG2 . THR B 1 66  ? 23.226  18.579  16.604  1.00 15.04 ? 66   THR B CG2 1 
ATOM   3738 N  N   . LEU B 1 67  ? 23.169  19.109  12.230  1.00 13.68 ? 67   LEU B N   1 
ATOM   3739 C  CA  . LEU B 1 67  ? 22.702  19.535  10.916  1.00 12.77 ? 67   LEU B CA  1 
ATOM   3740 C  C   . LEU B 1 67  ? 21.368  20.261  10.940  1.00 13.15 ? 67   LEU B C   1 
ATOM   3741 O  O   . LEU B 1 67  ? 20.911  20.726  9.881   1.00 13.53 ? 67   LEU B O   1 
ATOM   3742 C  CB  . LEU B 1 67  ? 22.613  18.303  9.996   1.00 13.34 ? 67   LEU B CB  1 
ATOM   3743 C  CG  . LEU B 1 67  ? 23.951  17.728  9.506   1.00 14.25 ? 67   LEU B CG  1 
ATOM   3744 C  CD1 . LEU B 1 67  ? 23.733  16.358  8.880   1.00 15.16 ? 67   LEU B CD1 1 
ATOM   3745 C  CD2 . LEU B 1 67  ? 24.587  18.647  8.477   1.00 14.00 ? 67   LEU B CD2 1 
ATOM   3746 N  N   . ASN B 1 68  ? 20.735  20.439  12.097  1.00 13.63 ? 68   ASN B N   1 
ATOM   3747 C  CA  . ASN B 1 68  ? 19.388  20.995  12.154  1.00 13.57 ? 68   ASN B CA  1 
ATOM   3748 C  C   . ASN B 1 68  ? 19.239  22.316  11.414  1.00 14.48 ? 68   ASN B C   1 
ATOM   3749 O  O   . ASN B 1 68  ? 18.295  22.456  10.637  1.00 13.74 ? 68   ASN B O   1 
ATOM   3750 C  CB  . ASN B 1 68  ? 18.930  21.219  13.601  1.00 14.03 ? 68   ASN B CB  1 
ATOM   3751 C  CG  . ASN B 1 68  ? 18.785  19.898  14.329  1.00 14.07 ? 68   ASN B CG  1 
ATOM   3752 O  OD1 . ASN B 1 68  ? 19.766  19.174  14.520  1.00 14.46 ? 68   ASN B OD1 1 
ATOM   3753 N  ND2 . ASN B 1 68  ? 17.551  19.600  14.728  1.00 13.16 ? 68   ASN B ND2 1 
ATOM   3754 N  N   . ASN B 1 69  ? 20.119  23.284  11.679  1.00 14.98 ? 69   ASN B N   1 
ATOM   3755 C  CA  . ASN B 1 69  ? 19.955  24.594  11.051  1.00 15.58 ? 69   ASN B CA  1 
ATOM   3756 C  C   . ASN B 1 69  ? 20.104  24.529  9.539   1.00 15.45 ? 69   ASN B C   1 
ATOM   3757 O  O   . ASN B 1 69  ? 19.338  25.168  8.809   1.00 15.31 ? 69   ASN B O   1 
ATOM   3758 C  CB  . ASN B 1 69  ? 20.919  25.620  11.640  1.00 16.95 ? 69   ASN B CB  1 
ATOM   3759 C  CG  . ASN B 1 69  ? 20.557  26.008  13.059  1.00 18.60 ? 69   ASN B CG  1 
ATOM   3760 O  OD1 . ASN B 1 69  ? 19.535  25.573  13.588  1.00 19.33 ? 69   ASN B OD1 1 
ATOM   3761 N  ND2 . ASN B 1 69  ? 21.404  26.821  13.674  1.00 18.72 ? 69   ASN B ND2 1 
ATOM   3762 N  N   . PHE B 1 70  ? 21.057  23.748  9.037   1.00 14.38 ? 70   PHE B N   1 
ATOM   3763 C  CA  . PHE B 1 70  ? 21.197  23.556  7.593   1.00 14.19 ? 70   PHE B CA  1 
ATOM   3764 C  C   . PHE B 1 70  ? 19.965  22.881  7.002   1.00 13.83 ? 70   PHE B C   1 
ATOM   3765 O  O   . PHE B 1 70  ? 19.452  23.268  5.945   1.00 13.40 ? 70   PHE B O   1 
ATOM   3766 C  CB  . PHE B 1 70  ? 22.442  22.725  7.299   1.00 14.16 ? 70   PHE B CB  1 
ATOM   3767 C  CG  . PHE B 1 70  ? 22.683  22.415  5.849   1.00 13.89 ? 70   PHE B CG  1 
ATOM   3768 C  CD1 . PHE B 1 70  ? 22.721  23.430  4.906   1.00 14.36 ? 70   PHE B CD1 1 
ATOM   3769 C  CD2 . PHE B 1 70  ? 22.894  21.113  5.431   1.00 13.95 ? 70   PHE B CD2 1 
ATOM   3770 C  CE1 . PHE B 1 70  ? 22.951  23.143  3.573   1.00 14.13 ? 70   PHE B CE1 1 
ATOM   3771 C  CE2 . PHE B 1 70  ? 23.127  20.823  4.103   1.00 14.66 ? 70   PHE B CE2 1 
ATOM   3772 C  CZ  . PHE B 1 70  ? 23.154  21.841  3.164   1.00 14.49 ? 70   PHE B CZ  1 
ATOM   3773 N  N   . MET B 1 71  ? 19.444  21.878  7.709   1.00 13.49 ? 71   MET B N   1 
ATOM   3774 C  CA  . MET B 1 71  ? 18.212  21.223  7.257   1.00 13.47 ? 71   MET B CA  1 
ATOM   3775 C  C   . MET B 1 71  ? 17.075  22.226  7.164   1.00 14.06 ? 71   MET B C   1 
ATOM   3776 O  O   . MET B 1 71  ? 16.296  22.229  6.202   1.00 14.51 ? 71   MET B O   1 
ATOM   3777 C  CB  . MET B 1 71  ? 17.833  20.093  8.216   1.00 12.40 ? 71   MET B CB  1 
ATOM   3778 C  CG  . MET B 1 71  ? 18.753  18.880  8.137   1.00 12.65 ? 71   MET B CG  1 
ATOM   3779 S  SD  . MET B 1 71  ? 18.412  17.727  9.486   1.00 12.07 ? 71   MET B SD  1 
ATOM   3780 C  CE  . MET B 1 71  ? 19.405  16.322  9.013   1.00 12.76 ? 71   MET B CE  1 
ATOM   3781 N  N   . GLY B 1 72  ? 16.953  23.103  8.154   1.00 14.28 ? 72   GLY B N   1 
ATOM   3782 C  CA  . GLY B 1 72  ? 15.927  24.124  8.188   1.00 15.15 ? 72   GLY B CA  1 
ATOM   3783 C  C   . GLY B 1 72  ? 16.006  25.186  7.108   1.00 16.18 ? 72   GLY B C   1 
ATOM   3784 O  O   . GLY B 1 72  ? 15.000  25.875  6.896   1.00 16.83 ? 72   GLY B O   1 
ATOM   3785 N  N   . LEU B 1 73  ? 17.136  25.345  6.417   1.00 16.21 ? 73   LEU B N   1 
ATOM   3786 C  CA  . LEU B 1 73  ? 17.268  26.374  5.398   1.00 17.05 ? 73   LEU B CA  1 
ATOM   3787 C  C   . LEU B 1 73  ? 16.451  26.105  4.142   1.00 17.25 ? 73   LEU B C   1 
ATOM   3788 O  O   . LEU B 1 73  ? 16.116  27.075  3.448   1.00 17.73 ? 73   LEU B O   1 
ATOM   3789 C  CB  . LEU B 1 73  ? 18.729  26.594  4.997   1.00 17.37 ? 73   LEU B CB  1 
ATOM   3790 C  CG  . LEU B 1 73  ? 19.697  27.156  6.031   1.00 17.54 ? 73   LEU B CG  1 
ATOM   3791 C  CD1 . LEU B 1 73  ? 21.065  27.373  5.387   1.00 17.01 ? 73   LEU B CD1 1 
ATOM   3792 C  CD2 . LEU B 1 73  ? 19.214  28.462  6.644   1.00 18.28 ? 73   LEU B CD2 1 
ATOM   3793 N  N   . GLY B 1 74  ? 16.178  24.853  3.800   1.00 16.28 ? 74   GLY B N   1 
ATOM   3794 C  CA  . GLY B 1 74  ? 15.297  24.562  2.674   1.00 16.82 ? 74   GLY B CA  1 
ATOM   3795 C  C   . GLY B 1 74  ? 16.048  24.298  1.379   1.00 17.27 ? 74   GLY B C   1 
ATOM   3796 O  O   . GLY B 1 74  ? 17.278  24.383  1.326   1.00 17.03 ? 74   GLY B O   1 
ATOM   3797 N  N   . GLN B 1 75  ? 15.324  23.963  0.322   1.00 18.35 ? 75   GLN B N   1 
ATOM   3798 C  CA  . GLN B 1 75  ? 15.857  23.369  -0.884  1.00 19.34 ? 75   GLN B CA  1 
ATOM   3799 C  C   . GLN B 1 75  ? 16.841  24.235  -1.652  1.00 19.24 ? 75   GLN B C   1 
ATOM   3800 O  O   . GLN B 1 75  ? 17.831  23.710  -2.169  1.00 19.15 ? 75   GLN B O   1 
ATOM   3801 C  CB  . GLN B 1 75  ? 14.726  23.012  -1.868  1.00 20.95 ? 75   GLN B CB  1 
ATOM   3802 C  CG  . GLN B 1 75  ? 14.073  21.675  -1.599  1.00 22.54 ? 75   GLN B CG  1 
ATOM   3803 C  CD  . GLN B 1 75  ? 13.224  21.201  -2.764  1.00 23.44 ? 75   GLN B CD  1 
ATOM   3804 O  OE1 . GLN B 1 75  ? 13.423  20.093  -3.265  1.00 24.96 ? 75   GLN B OE1 1 
ATOM   3805 N  NE2 . GLN B 1 75  ? 12.291  22.045  -3.182  1.00 23.49 ? 75   GLN B NE2 1 
ATOM   3806 N  N   . ALA B 1 76  ? 16.570  25.534  -1.759  1.00 19.16 ? 76   ALA B N   1 
ATOM   3807 C  CA  . ALA B 1 76  ? 17.476  26.421  -2.485  1.00 19.39 ? 76   ALA B CA  1 
ATOM   3808 C  C   . ALA B 1 76  ? 18.854  26.411  -1.825  1.00 18.89 ? 76   ALA B C   1 
ATOM   3809 O  O   . ALA B 1 76  ? 19.859  26.374  -2.527  1.00 19.91 ? 76   ALA B O   1 
ATOM   3810 C  CB  . ALA B 1 76  ? 16.949  27.844  -2.564  1.00 19.90 ? 76   ALA B CB  1 
ATOM   3811 N  N   . ALA B 1 77  ? 18.895  26.456  -0.498  1.00 18.21 ? 77   ALA B N   1 
ATOM   3812 C  CA  . ALA B 1 77  ? 20.151  26.333  0.234   1.00 17.56 ? 77   ALA B CA  1 
ATOM   3813 C  C   . ALA B 1 77  ? 20.806  24.979  0.015   1.00 17.41 ? 77   ALA B C   1 
ATOM   3814 O  O   . ALA B 1 77  ? 22.018  24.917  -0.237  1.00 17.67 ? 77   ALA B O   1 
ATOM   3815 C  CB  . ALA B 1 77  ? 19.885  26.568  1.718   1.00 18.32 ? 77   ALA B CB  1 
ATOM   3816 N  N   . TRP B 1 78  ? 20.034  23.888  0.090   1.00 16.34 ? 78   TRP B N   1 
ATOM   3817 C  CA  . TRP B 1 78  ? 20.623  22.568  -0.099  1.00 15.62 ? 78   TRP B CA  1 
ATOM   3818 C  C   . TRP B 1 78  ? 21.190  22.439  -1.510  1.00 16.26 ? 78   TRP B C   1 
ATOM   3819 O  O   . TRP B 1 78  ? 22.288  21.917  -1.684  1.00 16.78 ? 78   TRP B O   1 
ATOM   3820 C  CB  . TRP B 1 78  ? 19.670  21.413  0.161   1.00 15.48 ? 78   TRP B CB  1 
ATOM   3821 C  CG  . TRP B 1 78  ? 18.870  21.510  1.421   1.00 14.41 ? 78   TRP B CG  1 
ATOM   3822 C  CD1 . TRP B 1 78  ? 19.203  22.104  2.601   1.00 14.01 ? 78   TRP B CD1 1 
ATOM   3823 C  CD2 . TRP B 1 78  ? 17.552  20.958  1.607   1.00 13.41 ? 78   TRP B CD2 1 
ATOM   3824 N  NE1 . TRP B 1 78  ? 18.177  21.971  3.503   1.00 13.68 ? 78   TRP B NE1 1 
ATOM   3825 C  CE2 . TRP B 1 78  ? 17.153  21.272  2.920   1.00 13.26 ? 78   TRP B CE2 1 
ATOM   3826 C  CE3 . TRP B 1 78  ? 16.682  20.237  0.786   1.00 14.13 ? 78   TRP B CE3 1 
ATOM   3827 C  CZ2 . TRP B 1 78  ? 15.918  20.887  3.434   1.00 13.26 ? 78   TRP B CZ2 1 
ATOM   3828 C  CZ3 . TRP B 1 78  ? 15.454  19.858  1.297   1.00 13.51 ? 78   TRP B CZ3 1 
ATOM   3829 C  CH2 . TRP B 1 78  ? 15.083  20.180  2.608   1.00 12.89 ? 78   TRP B CH2 1 
ATOM   3830 N  N   . LYS B 1 79  ? 20.448  22.925  -2.503  1.00 16.63 ? 79   LYS B N   1 
ATOM   3831 C  CA  . LYS B 1 79  ? 20.905  22.820  -3.884  1.00 17.34 ? 79   LYS B CA  1 
ATOM   3832 C  C   . LYS B 1 79  ? 22.162  23.651  -4.106  1.00 16.85 ? 79   LYS B C   1 
ATOM   3833 O  O   . LYS B 1 79  ? 23.069  23.201  -4.804  1.00 17.17 ? 79   LYS B O   1 
ATOM   3834 C  CB  . LYS B 1 79  ? 19.778  23.228  -4.843  1.00 18.45 ? 79   LYS B CB  1 
ATOM   3835 C  CG  . LYS B 1 79  ? 18.722  22.127  -4.926  1.00 20.15 ? 79   LYS B CG  1 
ATOM   3836 C  CD  . LYS B 1 79  ? 17.489  22.553  -5.699  1.00 21.38 ? 79   LYS B CD  1 
ATOM   3837 C  CE  . LYS B 1 79  ? 16.388  21.503  -5.618  1.00 21.72 ? 79   LYS B CE  1 
ATOM   3838 N  NZ  . LYS B 1 79  ? 16.809  20.198  -6.188  1.00 22.31 ? 79   LYS B NZ  1 
ATOM   3839 N  N   . GLU B 1 80  ? 22.217  24.837  -3.520  1.00 17.36 ? 80   GLU B N   1 
ATOM   3840 C  CA  . GLU B 1 80  ? 23.398  25.687  -3.640  1.00 17.37 ? 80   GLU B CA  1 
ATOM   3841 C  C   . GLU B 1 80  ? 24.605  25.027  -2.977  1.00 16.95 ? 80   GLU B C   1 
ATOM   3842 O  O   . GLU B 1 80  ? 25.683  24.988  -3.573  1.00 16.39 ? 80   GLU B O   1 
ATOM   3843 C  CB  . GLU B 1 80  ? 23.147  27.065  -3.038  1.00 18.20 ? 80   GLU B CB  1 
ATOM   3844 C  CG  . GLU B 1 80  ? 24.246  28.074  -3.356  1.00 19.02 ? 80   GLU B CG  1 
ATOM   3845 C  CD  . GLU B 1 80  ? 23.916  29.421  -2.743  1.00 19.88 ? 80   GLU B CD  1 
ATOM   3846 O  OE1 . GLU B 1 80  ? 24.590  29.807  -1.766  1.00 20.05 ? 80   GLU B OE1 1 
ATOM   3847 O  OE2 . GLU B 1 80  ? 22.974  30.096  -3.215  1.00 20.53 ? 80   GLU B OE2 1 
ATOM   3848 N  N   . ALA B 1 81  ? 24.412  24.456  -1.790  1.00 16.31 ? 81   ALA B N   1 
ATOM   3849 C  CA  . ALA B 1 81  ? 25.525  23.805  -1.100  1.00 16.13 ? 81   ALA B CA  1 
ATOM   3850 C  C   . ALA B 1 81  ? 26.090  22.651  -1.915  1.00 15.82 ? 81   ALA B C   1 
ATOM   3851 O  O   . ALA B 1 81  ? 27.306  22.493  -2.091  1.00 15.99 ? 81   ALA B O   1 
ATOM   3852 C  CB  . ALA B 1 81  ? 25.102  23.289  0.273   1.00 16.18 ? 81   ALA B CB  1 
ATOM   3853 N  N   . ARG B 1 82  ? 25.194  21.810  -2.422  1.00 15.48 ? 82   ARG B N   1 
ATOM   3854 C  CA  . ARG B 1 82  ? 25.554  20.681  -3.257  1.00 15.39 ? 82   ARG B CA  1 
ATOM   3855 C  C   . ARG B 1 82  ? 26.296  21.125  -4.517  1.00 15.79 ? 82   ARG B C   1 
ATOM   3856 O  O   . ARG B 1 82  ? 27.308  20.518  -4.865  1.00 15.84 ? 82   ARG B O   1 
ATOM   3857 C  CB  . ARG B 1 82  ? 24.311  19.873  -3.652  1.00 15.97 ? 82   ARG B CB  1 
ATOM   3858 C  CG  . ARG B 1 82  ? 24.630  18.621  -4.456  1.00 15.78 ? 82   ARG B CG  1 
ATOM   3859 C  CD  . ARG B 1 82  ? 23.387  17.775  -4.649  1.00 16.68 ? 82   ARG B CD  1 
ATOM   3860 N  NE  . ARG B 1 82  ? 23.606  16.519  -5.352  1.00 15.48 ? 82   ARG B NE  1 
ATOM   3861 C  CZ  . ARG B 1 82  ? 24.206  15.457  -4.817  1.00 15.59 ? 82   ARG B CZ  1 
ATOM   3862 N  NH1 . ARG B 1 82  ? 24.653  15.494  -3.564  1.00 14.91 ? 82   ARG B NH1 1 
ATOM   3863 N  NH2 . ARG B 1 82  ? 24.345  14.361  -5.543  1.00 16.06 ? 82   ARG B NH2 1 
ATOM   3864 N  N   . ALA B 1 83  ? 25.797  22.164  -5.181  1.00 16.15 ? 83   ALA B N   1 
ATOM   3865 C  CA  . ALA B 1 83  ? 26.458  22.669  -6.386  1.00 16.92 ? 83   ALA B CA  1 
ATOM   3866 C  C   . ALA B 1 83  ? 27.855  23.175  -6.043  1.00 17.16 ? 83   ALA B C   1 
ATOM   3867 O  O   . ALA B 1 83  ? 28.819  22.842  -6.734  1.00 18.80 ? 83   ALA B O   1 
ATOM   3868 C  CB  . ALA B 1 83  ? 25.629  23.777  -7.021  1.00 17.31 ? 83   ALA B CB  1 
ATOM   3869 N  N   . SER B 1 84  ? 27.963  23.925  -4.953  1.00 17.39 ? 84   SER B N   1 
ATOM   3870 C  CA  . SER B 1 84  ? 29.265  24.427  -4.515  1.00 17.95 ? 84   SER B CA  1 
ATOM   3871 C  C   . SER B 1 84  ? 30.229  23.284  -4.214  1.00 18.26 ? 84   SER B C   1 
ATOM   3872 O  O   . SER B 1 84  ? 31.403  23.333  -4.597  1.00 18.35 ? 84   SER B O   1 
ATOM   3873 C  CB  . SER B 1 84  ? 29.120  25.323  -3.290  1.00 18.53 ? 84   SER B CB  1 
ATOM   3874 O  OG  . SER B 1 84  ? 28.426  26.525  -3.565  1.00 19.97 ? 84   SER B OG  1 
ATOM   3875 N  N   . LEU B 1 85  ? 29.757  22.254  -3.513  1.00 18.19 ? 85   LEU B N   1 
ATOM   3876 C  CA  . LEU B 1 85  ? 30.587  21.104  -3.180  1.00 18.67 ? 85   LEU B CA  1 
ATOM   3877 C  C   . LEU B 1 85  ? 31.030  20.324  -4.401  1.00 18.57 ? 85   LEU B C   1 
ATOM   3878 O  O   . LEU B 1 85  ? 32.204  19.952  -4.525  1.00 18.32 ? 85   LEU B O   1 
ATOM   3879 C  CB  . LEU B 1 85  ? 29.859  20.197  -2.177  1.00 18.69 ? 85   LEU B CB  1 
ATOM   3880 C  CG  . LEU B 1 85  ? 29.714  20.779  -0.768  1.00 19.36 ? 85   LEU B CG  1 
ATOM   3881 C  CD1 . LEU B 1 85  ? 28.726  19.947  0.043   1.00 19.52 ? 85   LEU B CD1 1 
ATOM   3882 C  CD2 . LEU B 1 85  ? 31.062  20.839  -0.061  1.00 19.27 ? 85   LEU B CD2 1 
ATOM   3883 N  N   . GLN B 1 86  ? 30.123  20.080  -5.347  1.00 18.57 ? 86   GLN B N   1 
ATOM   3884 C  CA  . GLN B 1 86  ? 30.465  19.423  -6.596  1.00 19.53 ? 86   GLN B CA  1 
ATOM   3885 C  C   . GLN B 1 86  ? 31.533  20.207  -7.364  1.00 19.59 ? 86   GLN B C   1 
ATOM   3886 O  O   . GLN B 1 86  ? 32.406  19.584  -7.954  1.00 19.63 ? 86   GLN B O   1 
ATOM   3887 C  CB  . GLN B 1 86  ? 29.245  19.247  -7.495  1.00 19.83 ? 86   GLN B CB  1 
ATOM   3888 C  CG  . GLN B 1 86  ? 28.173  18.302  -6.983  1.00 21.24 ? 86   GLN B CG  1 
ATOM   3889 C  CD  . GLN B 1 86  ? 26.870  18.480  -7.741  1.00 21.68 ? 86   GLN B CD  1 
ATOM   3890 O  OE1 . GLN B 1 86  ? 26.196  17.522  -8.105  1.00 23.50 ? 86   GLN B OE1 1 
ATOM   3891 N  NE2 . GLN B 1 86  ? 26.476  19.722  -8.009  1.00 23.21 ? 86   GLN B NE2 1 
ATOM   3892 N  N   . ASN B 1 87  ? 31.441  21.528  -7.374  1.00 20.14 ? 87   ASN B N   1 
ATOM   3893 C  CA  . ASN B 1 87  ? 32.459  22.365  -8.004  1.00 20.87 ? 87   ASN B CA  1 
ATOM   3894 C  C   . ASN B 1 87  ? 33.776  22.270  -7.238  1.00 20.07 ? 87   ASN B C   1 
ATOM   3895 O  O   . ASN B 1 87  ? 34.814  21.963  -7.822  1.00 20.04 ? 87   ASN B O   1 
ATOM   3896 C  CB  . ASN B 1 87  ? 31.981  23.816  -8.055  1.00 22.19 ? 87   ASN B CB  1 
ATOM   3897 C  CG  . ASN B 1 87  ? 32.984  24.758  -8.695  1.00 23.85 ? 87   ASN B CG  1 
ATOM   3898 O  OD1 . ASN B 1 87  ? 33.487  25.663  -8.029  1.00 25.38 ? 87   ASN B OD1 1 
ATOM   3899 N  ND2 . ASN B 1 87  ? 33.265  24.545  -9.970  1.00 24.08 ? 87   ASN B ND2 1 
ATOM   3900 N  N   . LEU B 1 88  ? 33.731  22.476  -5.925  1.00 18.99 ? 88   LEU B N   1 
ATOM   3901 C  CA  . LEU B 1 88  ? 34.948  22.514  -5.119  1.00 19.67 ? 88   LEU B CA  1 
ATOM   3902 C  C   . LEU B 1 88  ? 35.689  21.188  -5.089  1.00 19.67 ? 88   LEU B C   1 
ATOM   3903 O  O   . LEU B 1 88  ? 36.921  21.168  -4.971  1.00 19.88 ? 88   LEU B O   1 
ATOM   3904 C  CB  . LEU B 1 88  ? 34.621  22.961  -3.693  1.00 20.25 ? 88   LEU B CB  1 
ATOM   3905 C  CG  . LEU B 1 88  ? 34.284  24.439  -3.497  1.00 21.10 ? 88   LEU B CG  1 
ATOM   3906 C  CD1 . LEU B 1 88  ? 33.735  24.680  -2.098  1.00 21.81 ? 88   LEU B CD1 1 
ATOM   3907 C  CD2 . LEU B 1 88  ? 35.512  25.310  -3.736  1.00 21.96 ? 88   LEU B CD2 1 
ATOM   3908 N  N   . LEU B 1 89  ? 34.977  20.070  -5.173  1.00 19.02 ? 89   LEU B N   1 
ATOM   3909 C  CA  . LEU B 1 89  ? 35.563  18.745  -5.147  1.00 18.98 ? 89   LEU B CA  1 
ATOM   3910 C  C   . LEU B 1 89  ? 35.916  18.212  -6.526  1.00 19.10 ? 89   LEU B C   1 
ATOM   3911 O  O   . LEU B 1 89  ? 36.533  17.153  -6.666  1.00 18.95 ? 89   LEU B O   1 
ATOM   3912 C  CB  . LEU B 1 89  ? 34.607  17.770  -4.437  1.00 18.51 ? 89   LEU B CB  1 
ATOM   3913 C  CG  . LEU B 1 89  ? 34.561  17.937  -2.911  1.00 18.16 ? 89   LEU B CG  1 
ATOM   3914 C  CD1 . LEU B 1 89  ? 33.402  17.145  -2.315  1.00 17.66 ? 89   LEU B CD1 1 
ATOM   3915 C  CD2 . LEU B 1 89  ? 35.890  17.498  -2.302  1.00 18.55 ? 89   LEU B CD2 1 
ATOM   3916 N  N   . SER B 1 90  ? 35.547  18.970  -7.561  1.00 19.18 ? 90   SER B N   1 
ATOM   3917 C  CA  . SER B 1 90  ? 35.798  18.533  -8.924  1.00 19.71 ? 90   SER B CA  1 
ATOM   3918 C  C   . SER B 1 90  ? 37.292  18.349  -9.181  1.00 20.32 ? 90   SER B C   1 
ATOM   3919 O  O   . SER B 1 90  ? 38.107  19.187  -8.810  1.00 20.50 ? 90   SER B O   1 
ATOM   3920 C  CB  . SER B 1 90  ? 35.257  19.547  -9.943  1.00 20.35 ? 90   SER B CB  1 
ATOM   3921 O  OG  . SER B 1 90  ? 35.583  19.095  -11.249 1.00 21.45 ? 90   SER B OG  1 
ATOM   3922 N  N   . ALA B 1 91  ? 37.622  17.307  -9.927  1.00 20.90 ? 91   ALA B N   1 
ATOM   3923 C  CA  . ALA B 1 91  ? 38.970  17.079  -10.422 1.00 23.04 ? 91   ALA B CA  1 
ATOM   3924 C  C   . ALA B 1 91  ? 39.535  18.224  -11.251 1.00 24.09 ? 91   ALA B C   1 
ATOM   3925 O  O   . ALA B 1 91  ? 40.758  18.411  -11.282 1.00 24.49 ? 91   ALA B O   1 
ATOM   3926 C  CB  . ALA B 1 91  ? 38.979  15.796  -11.254 1.00 22.73 ? 91   ALA B CB  1 
ATOM   3927 N  N   . SER B 1 92  ? 38.699  18.990  -11.933 1.00 25.17 ? 92   SER B N   1 
ATOM   3928 C  CA  . SER B 1 92  ? 39.107  20.057  -12.821 1.00 26.11 ? 92   SER B CA  1 
ATOM   3929 C  C   . SER B 1 92  ? 39.072  21.441  -12.190 1.00 26.59 ? 92   SER B C   1 
ATOM   3930 O  O   . SER B 1 92  ? 39.327  22.416  -12.906 1.00 27.04 ? 92   SER B O   1 
ATOM   3931 C  CB  . SER B 1 92  ? 38.185  20.065  -14.052 1.00 27.05 ? 92   SER B CB  1 
ATOM   3932 O  OG  . SER B 1 92  ? 38.054  18.756  -14.575 1.00 28.88 ? 92   SER B OG  1 
ATOM   3933 N  N   . GLN B 1 93  ? 38.745  21.570  -10.909 1.00 25.96 ? 93   GLN B N   1 
ATOM   3934 C  CA  . GLN B 1 93  ? 38.714  22.880  -10.268 1.00 26.01 ? 93   GLN B CA  1 
ATOM   3935 C  C   . GLN B 1 93  ? 39.899  23.087  -9.333  1.00 26.23 ? 93   GLN B C   1 
ATOM   3936 O  O   . GLN B 1 93  ? 40.252  22.200  -8.554  1.00 25.90 ? 93   GLN B O   1 
ATOM   3937 C  CB  . GLN B 1 93  ? 37.402  23.101  -9.509  1.00 26.13 ? 93   GLN B CB  1 
ATOM   3938 C  CG  . GLN B 1 93  ? 36.166  23.207  -10.382 1.00 26.10 ? 93   GLN B CG  1 
ATOM   3939 C  CD  . GLN B 1 93  ? 36.241  24.309  -11.416 1.00 26.23 ? 93   GLN B CD  1 
ATOM   3940 O  OE1 . GLN B 1 93  ? 35.850  24.110  -12.572 1.00 26.68 ? 93   GLN B OE1 1 
ATOM   3941 N  NE2 . GLN B 1 93  ? 36.743  25.471  -11.007 1.00 25.69 ? 93   GLN B NE2 1 
ATOM   3942 N  N   . ALA B 1 94  ? 40.474  24.289  -9.353  1.00 26.60 ? 94   ALA B N   1 
ATOM   3943 C  CA  . ALA B 1 94  ? 41.706  24.556  -8.622  1.00 27.08 ? 94   ALA B CA  1 
ATOM   3944 C  C   . ALA B 1 94  ? 41.499  25.040  -7.198  1.00 27.65 ? 94   ALA B C   1 
ATOM   3945 O  O   . ALA B 1 94  ? 42.368  24.801  -6.351  1.00 28.00 ? 94   ALA B O   1 
ATOM   3946 C  CB  . ALA B 1 94  ? 42.533  25.597  -9.384  1.00 27.19 ? 94   ALA B CB  1 
ATOM   3947 N  N   . ARG B 1 95  ? 40.394  25.709  -6.895  1.00 27.57 ? 95   ARG B N   1 
ATOM   3948 C  CA  . ARG B 1 95  ? 40.278  26.462  -5.653  1.00 28.11 ? 95   ARG B CA  1 
ATOM   3949 C  C   . ARG B 1 95  ? 40.697  25.670  -4.419  1.00 28.17 ? 95   ARG B C   1 
ATOM   3950 O  O   . ARG B 1 95  ? 41.559  26.126  -3.666  1.00 27.86 ? 95   ARG B O   1 
ATOM   3951 C  CB  . ARG B 1 95  ? 38.859  27.005  -5.446  1.00 29.12 ? 95   ARG B CB  1 
ATOM   3952 C  CG  . ARG B 1 95  ? 38.697  27.807  -4.158  1.00 30.00 ? 95   ARG B CG  1 
ATOM   3953 C  CD  . ARG B 1 95  ? 39.585  29.039  -4.162  1.00 30.68 ? 95   ARG B CD  1 
ATOM   3954 N  NE  . ARG B 1 95  ? 39.515  29.824  -2.944  1.00 31.46 ? 95   ARG B NE  1 
ATOM   3955 C  CZ  . ARG B 1 95  ? 40.167  29.602  -1.810  1.00 31.84 ? 95   ARG B CZ  1 
ATOM   3956 N  NH1 . ARG B 1 95  ? 40.992  28.570  -1.681  1.00 32.12 ? 95   ARG B NH1 1 
ATOM   3957 N  NH2 . ARG B 1 95  ? 39.995  30.430  -0.785  1.00 32.22 ? 95   ARG B NH2 1 
ATOM   3958 N  N   . LEU B 1 96  ? 40.058  24.532  -4.176  1.00 27.45 ? 96   LEU B N   1 
ATOM   3959 C  CA  . LEU B 1 96  ? 40.403  23.697  -3.031  1.00 27.95 ? 96   LEU B CA  1 
ATOM   3960 C  C   . LEU B 1 96  ? 41.527  22.732  -3.371  1.00 28.17 ? 96   LEU B C   1 
ATOM   3961 O  O   . LEU B 1 96  ? 42.480  22.553  -2.609  1.00 28.87 ? 96   LEU B O   1 
ATOM   3962 C  CB  . LEU B 1 96  ? 39.169  22.929  -2.554  1.00 27.58 ? 96   LEU B CB  1 
ATOM   3963 C  CG  . LEU B 1 96  ? 39.342  21.972  -1.374  1.00 27.38 ? 96   LEU B CG  1 
ATOM   3964 C  CD1 . LEU B 1 96  ? 39.903  22.685  -0.154  1.00 27.55 ? 96   LEU B CD1 1 
ATOM   3965 C  CD2 . LEU B 1 96  ? 38.008  21.305  -1.053  1.00 27.39 ? 96   LEU B CD2 1 
ATOM   3966 N  N   . ARG B 1 97  ? 41.472  22.149  -4.558  1.00 28.22 ? 97   ARG B N   1 
ATOM   3967 C  CA  . ARG B 1 97  ? 42.410  21.143  -5.015  1.00 28.57 ? 97   ARG B CA  1 
ATOM   3968 C  C   . ARG B 1 97  ? 43.872  21.571  -4.921  1.00 29.36 ? 97   ARG B C   1 
ATOM   3969 O  O   . ARG B 1 97  ? 44.734  20.757  -4.578  1.00 29.06 ? 97   ARG B O   1 
ATOM   3970 C  CB  . ARG B 1 97  ? 42.104  20.778  -6.473  1.00 28.65 ? 97   ARG B CB  1 
ATOM   3971 C  CG  . ARG B 1 97  ? 42.966  19.654  -7.027  1.00 28.54 ? 97   ARG B CG  1 
ATOM   3972 C  CD  . ARG B 1 97  ? 42.934  19.644  -8.548  1.00 28.53 ? 97   ARG B CD  1 
ATOM   3973 N  NE  . ARG B 1 97  ? 43.492  20.881  -9.090  1.00 28.64 ? 97   ARG B NE  1 
ATOM   3974 C  CZ  . ARG B 1 97  ? 43.324  21.300  -10.337 1.00 28.82 ? 97   ARG B CZ  1 
ATOM   3975 N  NH1 . ARG B 1 97  ? 42.609  20.589  -11.198 1.00 28.63 ? 97   ARG B NH1 1 
ATOM   3976 N  NH2 . ARG B 1 97  ? 43.880  22.442  -10.725 1.00 29.12 ? 97   ARG B NH2 1 
ATOM   3977 N  N   . ASP B 1 98  ? 44.159  22.820  -5.266  1.00 30.00 ? 98   ASP B N   1 
ATOM   3978 C  CA  . ASP B 1 98  ? 45.528  23.315  -5.294  1.00 31.07 ? 98   ASP B CA  1 
ATOM   3979 C  C   . ASP B 1 98  ? 45.888  24.149  -4.076  1.00 31.99 ? 98   ASP B C   1 
ATOM   3980 O  O   . ASP B 1 98  ? 46.993  24.696  -4.005  1.00 32.06 ? 98   ASP B O   1 
ATOM   3981 C  CB  . ASP B 1 98  ? 45.747  24.131  -6.572  1.00 30.80 ? 98   ASP B CB  1 
ATOM   3982 C  CG  . ASP B 1 98  ? 45.641  23.292  -7.828  1.00 30.66 ? 98   ASP B CG  1 
ATOM   3983 O  OD1 . ASP B 1 98  ? 45.686  22.047  -7.749  1.00 30.41 ? 98   ASP B OD1 1 
ATOM   3984 O  OD2 . ASP B 1 98  ? 45.513  23.889  -8.919  1.00 30.89 ? 98   ASP B OD2 1 
ATOM   3985 N  N   . ASP B 1 99  ? 44.982  24.247  -3.109  1.00 33.24 ? 99   ASP B N   1 
ATOM   3986 C  CA  . ASP B 1 99  ? 45.284  24.943  -1.859  1.00 34.06 ? 99   ASP B CA  1 
ATOM   3987 C  C   . ASP B 1 99  ? 45.747  23.942  -0.806  1.00 34.82 ? 99   ASP B C   1 
ATOM   3988 O  O   . ASP B 1 99  ? 44.968  23.465  0.019   1.00 34.37 ? 99   ASP B O   1 
ATOM   3989 C  CB  . ASP B 1 99  ? 44.074  25.740  -1.384  1.00 33.98 ? 99   ASP B CB  1 
ATOM   3990 C  CG  . ASP B 1 99  ? 44.381  26.743  -0.295  1.00 33.72 ? 99   ASP B CG  1 
ATOM   3991 O  OD1 . ASP B 1 99  ? 45.430  26.609  0.374   1.00 34.30 ? 99   ASP B OD1 1 
ATOM   3992 O  OD2 . ASP B 1 99  ? 43.570  27.671  -0.087  1.00 33.42 ? 99   ASP B OD2 1 
ATOM   3993 N  N   . LYS B 1 100 ? 47.046  23.639  -0.812  1.00 35.58 ? 100  LYS B N   1 
ATOM   3994 C  CA  . LYS B 1 100 ? 47.610  22.632  0.074   1.00 36.04 ? 100  LYS B CA  1 
ATOM   3995 C  C   . LYS B 1 100 ? 47.360  22.933  1.544   1.00 35.81 ? 100  LYS B C   1 
ATOM   3996 O  O   . LYS B 1 100 ? 46.975  22.035  2.299   1.00 35.81 ? 100  LYS B O   1 
ATOM   3997 C  CB  . LYS B 1 100 ? 49.110  22.453  -0.196  1.00 37.08 ? 100  LYS B CB  1 
ATOM   3998 C  CG  . LYS B 1 100 ? 49.388  21.730  -1.506  1.00 38.14 ? 100  LYS B CG  1 
ATOM   3999 C  CD  . LYS B 1 100 ? 50.869  21.723  -1.862  1.00 38.92 ? 100  LYS B CD  1 
ATOM   4000 C  CE  . LYS B 1 100 ? 51.079  21.101  -3.235  1.00 39.50 ? 100  LYS B CE  1 
ATOM   4001 N  NZ  . LYS B 1 100 ? 52.493  21.173  -3.689  1.00 40.13 ? 100  LYS B NZ  1 
ATOM   4002 N  N   . GLU B 1 101 ? 47.562  24.175  1.967   1.00 35.49 ? 101  GLU B N   1 
ATOM   4003 C  CA  . GLU B 1 101 ? 47.298  24.561  3.347   1.00 35.45 ? 101  GLU B CA  1 
ATOM   4004 C  C   . GLU B 1 101 ? 45.849  24.262  3.721   1.00 34.41 ? 101  GLU B C   1 
ATOM   4005 O  O   . GLU B 1 101 ? 45.596  23.513  4.665   1.00 34.51 ? 101  GLU B O   1 
ATOM   4006 C  CB  . GLU B 1 101 ? 47.627  26.034  3.573   1.00 36.23 ? 101  GLU B CB  1 
ATOM   4007 C  CG  . GLU B 1 101 ? 47.796  26.436  5.025   1.00 37.06 ? 101  GLU B CG  1 
ATOM   4008 C  CD  . GLU B 1 101 ? 46.493  26.613  5.773   1.00 37.65 ? 101  GLU B CD  1 
ATOM   4009 O  OE1 . GLU B 1 101 ? 45.506  27.084  5.164   1.00 37.86 ? 101  GLU B OE1 1 
ATOM   4010 O  OE2 . GLU B 1 101 ? 46.449  26.282  6.976   1.00 37.79 ? 101  GLU B OE2 1 
ATOM   4011 N  N   . LEU B 1 102 ? 44.903  24.835  2.987   1.00 33.10 ? 102  LEU B N   1 
ATOM   4012 C  CA  . LEU B 1 102 ? 43.483  24.598  3.226   1.00 31.96 ? 102  LEU B CA  1 
ATOM   4013 C  C   . LEU B 1 102 ? 43.107  23.126  3.161   1.00 31.26 ? 102  LEU B C   1 
ATOM   4014 O  O   . LEU B 1 102 ? 42.401  22.635  4.049   1.00 30.92 ? 102  LEU B O   1 
ATOM   4015 C  CB  . LEU B 1 102 ? 42.644  25.398  2.227   1.00 31.80 ? 102  LEU B CB  1 
ATOM   4016 C  CG  . LEU B 1 102 ? 41.135  25.471  2.461   1.00 31.78 ? 102  LEU B CG  1 
ATOM   4017 C  CD1 . LEU B 1 102 ? 40.812  26.213  3.749   1.00 31.61 ? 102  LEU B CD1 1 
ATOM   4018 C  CD2 . LEU B 1 102 ? 40.440  26.139  1.281   1.00 31.63 ? 102  LEU B CD2 1 
ATOM   4019 N  N   . ARG B 1 103 ? 43.556  22.393  2.147   1.00 30.44 ? 103  ARG B N   1 
ATOM   4020 C  CA  . ARG B 1 103 ? 43.304  20.967  2.036   1.00 30.58 ? 103  ARG B CA  1 
ATOM   4021 C  C   . ARG B 1 103 ? 43.723  20.203  3.287   1.00 30.74 ? 103  ARG B C   1 
ATOM   4022 O  O   . ARG B 1 103 ? 43.027  19.327  3.791   1.00 30.74 ? 103  ARG B O   1 
ATOM   4023 C  CB  . ARG B 1 103 ? 44.048  20.331  0.860   1.00 29.86 ? 103  ARG B CB  1 
ATOM   4024 C  CG  . ARG B 1 103 ? 43.323  20.320  -0.465  1.00 29.08 ? 103  ARG B CG  1 
ATOM   4025 C  CD  . ARG B 1 103 ? 44.152  19.661  -1.553  1.00 28.37 ? 103  ARG B CD  1 
ATOM   4026 N  NE  . ARG B 1 103 ? 44.065  18.203  -1.564  1.00 27.00 ? 103  ARG B NE  1 
ATOM   4027 C  CZ  . ARG B 1 103 ? 44.287  17.469  -2.646  1.00 26.41 ? 103  ARG B CZ  1 
ATOM   4028 N  NH1 . ARG B 1 103 ? 44.595  18.037  -3.806  1.00 26.27 ? 103  ARG B NH1 1 
ATOM   4029 N  NH2 . ARG B 1 103 ? 44.194  16.146  -2.595  1.00 26.62 ? 103  ARG B NH2 1 
ATOM   4030 N  N   . GLN B 1 104 ? 44.925  20.507  3.766   1.00 30.80 ? 104  GLN B N   1 
ATOM   4031 C  CA  . GLN B 1 104 ? 45.434  19.964  5.017   1.00 31.23 ? 104  GLN B CA  1 
ATOM   4032 C  C   . GLN B 1 104 ? 44.440  20.110  6.156   1.00 30.21 ? 104  GLN B C   1 
ATOM   4033 O  O   . GLN B 1 104 ? 44.174  19.140  6.867   1.00 30.65 ? 104  GLN B O   1 
ATOM   4034 C  CB  . GLN B 1 104 ? 46.765  20.660  5.319   1.00 32.64 ? 104  GLN B CB  1 
ATOM   4035 C  CG  . GLN B 1 104 ? 47.311  20.497  6.720   1.00 34.30 ? 104  GLN B CG  1 
ATOM   4036 C  CD  . GLN B 1 104 ? 48.738  20.995  6.838   1.00 35.34 ? 104  GLN B CD  1 
ATOM   4037 O  OE1 . GLN B 1 104 ? 49.029  22.183  6.703   1.00 36.30 ? 104  GLN B OE1 1 
ATOM   4038 N  NE2 . GLN B 1 104 ? 49.653  20.066  7.082   1.00 35.85 ? 104  GLN B NE2 1 
ATOM   4039 N  N   . ARG B 1 105 ? 43.875  21.297  6.354   1.00 29.10 ? 105  ARG B N   1 
ATOM   4040 C  CA  . ARG B 1 105 ? 42.929  21.537  7.428   1.00 28.10 ? 105  ARG B CA  1 
ATOM   4041 C  C   . ARG B 1 105 ? 41.505  21.099  7.096   1.00 26.25 ? 105  ARG B C   1 
ATOM   4042 O  O   . ARG B 1 105 ? 40.725  20.881  8.026   1.00 26.29 ? 105  ARG B O   1 
ATOM   4043 C  CB  . ARG B 1 105 ? 42.916  23.028  7.792   1.00 29.64 ? 105  ARG B CB  1 
ATOM   4044 C  CG  . ARG B 1 105 ? 44.234  23.498  8.392   1.00 31.01 ? 105  ARG B CG  1 
ATOM   4045 C  CD  . ARG B 1 105 ? 44.170  24.963  8.783   1.00 31.92 ? 105  ARG B CD  1 
ATOM   4046 N  NE  . ARG B 1 105 ? 43.988  25.848  7.650   1.00 32.47 ? 105  ARG B NE  1 
ATOM   4047 C  CZ  . ARG B 1 105 ? 42.907  26.509  7.274   1.00 32.85 ? 105  ARG B CZ  1 
ATOM   4048 N  NH1 . ARG B 1 105 ? 41.779  26.432  7.966   1.00 33.15 ? 105  ARG B NH1 1 
ATOM   4049 N  NH2 . ARG B 1 105 ? 42.959  27.276  6.191   1.00 33.22 ? 105  ARG B NH2 1 
ATOM   4050 N  N   . ALA B 1 106 ? 41.174  20.958  5.818   1.00 24.00 ? 106  ALA B N   1 
ATOM   4051 C  CA  . ALA B 1 106 ? 39.788  20.705  5.435   1.00 22.06 ? 106  ALA B CA  1 
ATOM   4052 C  C   . ALA B 1 106 ? 39.440  19.226  5.351   1.00 21.25 ? 106  ALA B C   1 
ATOM   4053 O  O   . ALA B 1 106 ? 38.259  18.889  5.486   1.00 21.15 ? 106  ALA B O   1 
ATOM   4054 C  CB  . ALA B 1 106 ? 39.472  21.376  4.105   1.00 22.39 ? 106  ALA B CB  1 
ATOM   4055 N  N   . PHE B 1 107 ? 40.405  18.345  5.129   1.00 20.21 ? 107  PHE B N   1 
ATOM   4056 C  CA  . PHE B 1 107 ? 40.137  16.925  4.990   1.00 19.48 ? 107  PHE B CA  1 
ATOM   4057 C  C   . PHE B 1 107 ? 40.601  16.123  6.203   1.00 19.62 ? 107  PHE B C   1 
ATOM   4058 O  O   . PHE B 1 107 ? 41.555  16.498  6.881   1.00 20.62 ? 107  PHE B O   1 
ATOM   4059 C  CB  . PHE B 1 107 ? 40.783  16.346  3.729   1.00 19.28 ? 107  PHE B CB  1 
ATOM   4060 C  CG  . PHE B 1 107 ? 40.077  16.753  2.465   1.00 19.25 ? 107  PHE B CG  1 
ATOM   4061 C  CD1 . PHE B 1 107 ? 40.578  17.764  1.671   1.00 19.23 ? 107  PHE B CD1 1 
ATOM   4062 C  CD2 . PHE B 1 107 ? 38.897  16.119  2.098   1.00 19.01 ? 107  PHE B CD2 1 
ATOM   4063 C  CE1 . PHE B 1 107 ? 39.933  18.145  0.511   1.00 19.67 ? 107  PHE B CE1 1 
ATOM   4064 C  CE2 . PHE B 1 107 ? 38.239  16.500  0.938   1.00 19.10 ? 107  PHE B CE2 1 
ATOM   4065 C  CZ  . PHE B 1 107 ? 38.756  17.507  0.153   1.00 19.45 ? 107  PHE B CZ  1 
ATOM   4066 N  N   . THR B 1 108 ? 39.901  15.034  6.475   1.00 19.33 ? 108  THR B N   1 
ATOM   4067 C  CA  . THR B 1 108 ? 40.252  14.057  7.494   1.00 19.47 ? 108  THR B CA  1 
ATOM   4068 C  C   . THR B 1 108 ? 39.888  12.659  7.006   1.00 18.44 ? 108  THR B C   1 
ATOM   4069 O  O   . THR B 1 108 ? 38.866  12.502  6.336   1.00 17.46 ? 108  THR B O   1 
ATOM   4070 C  CB  . THR B 1 108 ? 39.497  14.320  8.813   1.00 21.26 ? 108  THR B CB  1 
ATOM   4071 O  OG1 . THR B 1 108 ? 39.955  15.558  9.364   1.00 23.16 ? 108  THR B OG1 1 
ATOM   4072 C  CG2 . THR B 1 108 ? 39.729  13.211  9.823   1.00 23.42 ? 108  THR B CG2 1 
ATOM   4073 N  N   . SER B 1 109 ? 40.678  11.645  7.329   1.00 17.43 ? 109  SER B N   1 
ATOM   4074 C  CA  . SER B 1 109 ? 40.313  10.268  7.013   1.00 17.10 ? 109  SER B CA  1 
ATOM   4075 C  C   . SER B 1 109 ? 39.057  9.829   7.751   1.00 16.68 ? 109  SER B C   1 
ATOM   4076 O  O   . SER B 1 109 ? 38.941  10.060  8.959   1.00 16.00 ? 109  SER B O   1 
ATOM   4077 C  CB  . SER B 1 109 ? 41.482  9.348   7.399   1.00 18.00 ? 109  SER B CB  1 
ATOM   4078 O  OG  . SER B 1 109 ? 41.150  7.988   7.197   1.00 19.30 ? 109  SER B OG  1 
ATOM   4079 N  N   . GLN B 1 110 ? 38.154  9.102   7.086   1.00 15.79 ? 110  GLN B N   1 
ATOM   4080 C  CA  . GLN B 1 110 ? 37.035  8.476   7.797   1.00 15.19 ? 110  GLN B CA  1 
ATOM   4081 C  C   . GLN B 1 110 ? 37.514  7.506   8.866   1.00 15.68 ? 110  GLN B C   1 
ATOM   4082 O  O   . GLN B 1 110 ? 36.878  7.389   9.919   1.00 15.29 ? 110  GLN B O   1 
ATOM   4083 C  CB  . GLN B 1 110 ? 36.076  7.754   6.840   1.00 15.27 ? 110  GLN B CB  1 
ATOM   4084 C  CG  . GLN B 1 110 ? 35.321  8.713   5.927   1.00 14.53 ? 110  GLN B CG  1 
ATOM   4085 C  CD  . GLN B 1 110 ? 34.752  7.997   4.713   1.00 14.30 ? 110  GLN B CD  1 
ATOM   4086 O  OE1 . GLN B 1 110 ? 34.607  6.783   4.720   1.00 14.45 ? 110  GLN B OE1 1 
ATOM   4087 N  NE2 . GLN B 1 110 ? 34.469  8.752   3.657   1.00 15.09 ? 110  GLN B NE2 1 
ATOM   4088 N  N   . ALA B 1 111 ? 38.655  6.847   8.670   1.00 15.82 ? 111  ALA B N   1 
ATOM   4089 C  CA  . ALA B 1 111 ? 39.196  5.919   9.652   1.00 16.26 ? 111  ALA B CA  1 
ATOM   4090 C  C   . ALA B 1 111 ? 39.523  6.592   10.978  1.00 17.00 ? 111  ALA B C   1 
ATOM   4091 O  O   . ALA B 1 111 ? 39.496  5.924   12.018  1.00 18.81 ? 111  ALA B O   1 
ATOM   4092 C  CB  . ALA B 1 111 ? 40.445  5.244   9.086   1.00 16.52 ? 111  ALA B CB  1 
ATOM   4093 N  N   . SER B 1 112 ? 39.866  7.866   10.983  1.00 17.09 ? 112  SER B N   1 
ATOM   4094 C  CA  . SER B 1 112 ? 40.170  8.658   12.153  1.00 18.36 ? 112  SER B CA  1 
ATOM   4095 C  C   . SER B 1 112 ? 38.941  9.257   12.834  1.00 17.33 ? 112  SER B C   1 
ATOM   4096 O  O   . SER B 1 112 ? 39.065  9.843   13.917  1.00 18.60 ? 112  SER B O   1 
ATOM   4097 C  CB  . SER B 1 112 ? 41.041  9.866   11.770  1.00 19.75 ? 112  SER B CB  1 
ATOM   4098 O  OG  . SER B 1 112 ? 42.276  9.497   11.198  1.00 22.81 ? 112  SER B OG  1 
ATOM   4099 N  N   . ALA B 1 113 ? 37.783  9.185   12.184  1.00 16.30 ? 113  ALA B N   1 
ATOM   4100 C  CA  . ALA B 1 113 ? 36.647  9.983   12.646  1.00 15.66 ? 113  ALA B CA  1 
ATOM   4101 C  C   . ALA B 1 113 ? 35.698  9.151   13.497  1.00 15.91 ? 113  ALA B C   1 
ATOM   4102 O  O   . ALA B 1 113 ? 35.438  7.976   13.231  1.00 16.89 ? 113  ALA B O   1 
ATOM   4103 C  CB  . ALA B 1 113 ? 35.933  10.595  11.452  1.00 15.65 ? 113  ALA B CB  1 
ATOM   4104 N  N   . THR B 1 114 ? 35.191  9.782   14.547  1.00 14.98 ? 114  THR B N   1 
ATOM   4105 C  CA  . THR B 1 114 ? 34.066  9.227   15.298  1.00 15.08 ? 114  THR B CA  1 
ATOM   4106 C  C   . THR B 1 114 ? 32.786  9.901   14.810  1.00 13.32 ? 114  THR B C   1 
ATOM   4107 O  O   . THR B 1 114 ? 32.737  11.127  14.862  1.00 13.89 ? 114  THR B O   1 
ATOM   4108 C  CB  . THR B 1 114 ? 34.236  9.494   16.800  1.00 15.27 ? 114  THR B CB  1 
ATOM   4109 O  OG1 . THR B 1 114 ? 35.466  8.883   17.242  1.00 17.68 ? 114  THR B OG1 1 
ATOM   4110 C  CG2 . THR B 1 114 ? 33.087  8.910   17.609  1.00 16.38 ? 114  THR B CG2 1 
ATOM   4111 N  N   . MET B 1 115 ? 31.804  9.120   14.379  1.00 13.71 ? 115  MET B N   1 
ATOM   4112 C  CA  . MET B 1 115 ? 30.557  9.729   13.909  1.00 13.43 ? 115  MET B CA  1 
ATOM   4113 C  C   . MET B 1 115 ? 29.594  9.911   15.077  1.00 14.54 ? 115  MET B C   1 
ATOM   4114 O  O   . MET B 1 115 ? 29.586  9.138   16.037  1.00 15.07 ? 115  MET B O   1 
ATOM   4115 C  CB  . MET B 1 115 ? 29.900  8.881   12.822  1.00 13.16 ? 115  MET B CB  1 
ATOM   4116 C  CG  . MET B 1 115 ? 30.757  8.639   11.592  1.00 13.22 ? 115  MET B CG  1 
ATOM   4117 S  SD  . MET B 1 115 ? 31.388  10.132  10.816  1.00 12.71 ? 115  MET B SD  1 
ATOM   4118 C  CE  . MET B 1 115 ? 29.891  10.925  10.228  1.00 14.09 ? 115  MET B CE  1 
ATOM   4119 N  N   . HIS B 1 116 ? 28.808  10.972  14.994  1.00 14.39 ? 116  HIS B N   1 
ATOM   4120 C  CA  . HIS B 1 116 ? 27.777  11.295  15.967  1.00 13.77 ? 116  HIS B CA  1 
ATOM   4121 C  C   . HIS B 1 116 ? 26.409  11.287  15.277  1.00 13.51 ? 116  HIS B C   1 
ATOM   4122 O  O   . HIS B 1 116 ? 26.337  11.208  14.051  1.00 13.50 ? 116  HIS B O   1 
ATOM   4123 C  CB  . HIS B 1 116 ? 28.026  12.698  16.532  1.00 15.20 ? 116  HIS B CB  1 
ATOM   4124 C  CG  . HIS B 1 116 ? 29.345  12.890  17.218  1.00 15.87 ? 116  HIS B CG  1 
ATOM   4125 N  ND1 . HIS B 1 116 ? 29.421  13.191  18.564  1.00 17.78 ? 116  HIS B ND1 1 
ATOM   4126 C  CD2 . HIS B 1 116 ? 30.623  12.847  16.780  1.00 16.74 ? 116  HIS B CD2 1 
ATOM   4127 C  CE1 . HIS B 1 116 ? 30.694  13.299  18.919  1.00 17.82 ? 116  HIS B CE1 1 
ATOM   4128 N  NE2 . HIS B 1 116 ? 31.449  13.083  17.849  1.00 16.67 ? 116  HIS B NE2 1 
ATOM   4129 N  N   . LEU B 1 117 ? 25.338  11.345  16.066  1.00 13.24 ? 117  LEU B N   1 
ATOM   4130 C  CA  . LEU B 1 117 ? 24.021  11.535  15.433  1.00 13.01 ? 117  LEU B CA  1 
ATOM   4131 C  C   . LEU B 1 117 ? 24.047  12.798  14.599  1.00 12.49 ? 117  LEU B C   1 
ATOM   4132 O  O   . LEU B 1 117 ? 24.542  13.833  15.047  1.00 13.44 ? 117  LEU B O   1 
ATOM   4133 C  CB  . LEU B 1 117 ? 22.963  11.691  16.523  1.00 13.90 ? 117  LEU B CB  1 
ATOM   4134 C  CG  . LEU B 1 117 ? 22.565  10.436  17.295  1.00 15.83 ? 117  LEU B CG  1 
ATOM   4135 C  CD1 . LEU B 1 117 ? 21.619  10.839  18.423  1.00 17.10 ? 117  LEU B CD1 1 
ATOM   4136 C  CD2 . LEU B 1 117 ? 21.916  9.407   16.386  1.00 15.57 ? 117  LEU B CD2 1 
ATOM   4137 N  N   . PRO B 1 118 ? 23.452  12.781  13.404  1.00 11.62 ? 118  PRO B N   1 
ATOM   4138 C  CA  . PRO B 1 118 ? 23.584  13.905  12.496  1.00 12.33 ? 118  PRO B CA  1 
ATOM   4139 C  C   . PRO B 1 118 ? 22.733  15.099  12.877  1.00 12.44 ? 118  PRO B C   1 
ATOM   4140 O  O   . PRO B 1 118 ? 23.013  16.214  12.429  1.00 11.91 ? 118  PRO B O   1 
ATOM   4141 C  CB  . PRO B 1 118 ? 23.198  13.338  11.136  1.00 12.54 ? 118  PRO B CB  1 
ATOM   4142 C  CG  . PRO B 1 118 ? 22.418  12.104  11.420  1.00 11.63 ? 118  PRO B CG  1 
ATOM   4143 C  CD  . PRO B 1 118 ? 22.906  11.575  12.747  1.00 12.40 ? 118  PRO B CD  1 
ATOM   4144 N  N   . ALA B 1 119 ? 21.688  14.889  13.681  1.00 12.40 ? 119  ALA B N   1 
ATOM   4145 C  CA  . ALA B 1 119 ? 20.824  15.995  14.093  1.00 13.67 ? 119  ALA B CA  1 
ATOM   4146 C  C   . ALA B 1 119 ? 20.261  15.765  15.492  1.00 13.89 ? 119  ALA B C   1 
ATOM   4147 O  O   . ALA B 1 119 ? 20.274  14.633  15.986  1.00 14.37 ? 119  ALA B O   1 
ATOM   4148 C  CB  . ALA B 1 119 ? 19.669  16.132  13.104  1.00 13.76 ? 119  ALA B CB  1 
ATOM   4149 N  N   . THR B 1 120 ? 19.784  16.834  16.122  1.00 13.46 ? 120  THR B N   1 
ATOM   4150 C  CA  . THR B 1 120 ? 18.988  16.710  17.346  1.00 14.34 ? 120  THR B CA  1 
ATOM   4151 C  C   . THR B 1 120 ? 17.549  16.403  16.930  1.00 13.99 ? 120  THR B C   1 
ATOM   4152 O  O   . THR B 1 120 ? 16.888  17.250  16.323  1.00 15.42 ? 120  THR B O   1 
ATOM   4153 C  CB  . THR B 1 120 ? 19.046  17.997  18.179  1.00 15.48 ? 120  THR B CB  1 
ATOM   4154 O  OG1 . THR B 1 120 ? 20.415  18.262  18.522  1.00 16.87 ? 120  THR B OG1 1 
ATOM   4155 C  CG2 . THR B 1 120 ? 18.229  17.856  19.457  1.00 15.84 ? 120  THR B CG2 1 
ATOM   4156 N  N   . ILE B 1 121 ? 17.125  15.174  17.181  1.00 12.72 ? 121  ILE B N   1 
ATOM   4157 C  CA  . ILE B 1 121 ? 15.816  14.724  16.691  1.00 11.84 ? 121  ILE B CA  1 
ATOM   4158 C  C   . ILE B 1 121 ? 14.731  15.120  17.682  1.00 12.19 ? 121  ILE B C   1 
ATOM   4159 O  O   . ILE B 1 121 ? 14.622  14.514  18.748  1.00 13.12 ? 121  ILE B O   1 
ATOM   4160 C  CB  . ILE B 1 121 ? 15.821  13.204  16.458  1.00 11.43 ? 121  ILE B CB  1 
ATOM   4161 C  CG1 . ILE B 1 121 ? 16.909  12.839  15.429  1.00 11.77 ? 121  ILE B CG1 1 
ATOM   4162 C  CG2 . ILE B 1 121 ? 14.460  12.697  16.010  1.00 11.46 ? 121  ILE B CG2 1 
ATOM   4163 C  CD1 . ILE B 1 121 ? 17.233  11.359  15.381  1.00 13.02 ? 121  ILE B CD1 1 
ATOM   4164 N  N   . GLY B 1 122 ? 13.939  16.134  17.331  1.00 11.36 ? 122  GLY B N   1 
ATOM   4165 C  CA  . GLY B 1 122 ? 12.917  16.613  18.264  1.00 10.74 ? 122  GLY B CA  1 
ATOM   4166 C  C   . GLY B 1 122 ? 11.814  15.575  18.406  1.00 10.60 ? 122  GLY B C   1 
ATOM   4167 O  O   . GLY B 1 122 ? 11.306  15.312  19.501  1.00 12.02 ? 122  GLY B O   1 
ATOM   4168 N  N   . ASP B 1 123 ? 11.408  14.977  17.293  1.00 9.37  ? 123  ASP B N   1 
ATOM   4169 C  CA  . ASP B 1 123 ? 10.388  13.947  17.276  1.00 9.15  ? 123  ASP B CA  1 
ATOM   4170 C  C   . ASP B 1 123 ? 10.739  12.878  16.239  1.00 9.59  ? 123  ASP B C   1 
ATOM   4171 O  O   . ASP B 1 123 ? 11.164  13.185  15.123  1.00 10.03 ? 123  ASP B O   1 
ATOM   4172 C  CB  . ASP B 1 123 ? 8.993   14.494  16.948  1.00 9.64  ? 123  ASP B CB  1 
ATOM   4173 C  CG  . ASP B 1 123 ? 8.266   15.124  18.117  1.00 10.82 ? 123  ASP B CG  1 
ATOM   4174 O  OD1 . ASP B 1 123 ? 7.983   14.427  19.117  1.00 10.48 ? 123  ASP B OD1 1 
ATOM   4175 O  OD2 . ASP B 1 123 ? 7.963   16.337  18.072  1.00 10.65 ? 123  ASP B OD2 1 
ATOM   4176 N  N   . TYR B 1 124 ? 10.573  11.635  16.654  1.00 9.75  ? 124  TYR B N   1 
ATOM   4177 C  CA  . TYR B 1 124 ? 10.777  10.482  15.775  1.00 9.59  ? 124  TYR B CA  1 
ATOM   4178 C  C   . TYR B 1 124 ? 9.421   9.817   15.587  1.00 9.90  ? 124  TYR B C   1 
ATOM   4179 O  O   . TYR B 1 124 ? 8.692   9.648   16.557  1.00 9.97  ? 124  TYR B O   1 
ATOM   4180 C  CB  . TYR B 1 124 ? 11.808  9.539   16.397  1.00 10.75 ? 124  TYR B CB  1 
ATOM   4181 C  CG  . TYR B 1 124 ? 11.731  8.081   16.020  1.00 10.62 ? 124  TYR B CG  1 
ATOM   4182 C  CD1 . TYR B 1 124 ? 11.740  7.111   17.016  1.00 10.79 ? 124  TYR B CD1 1 
ATOM   4183 C  CD2 . TYR B 1 124 ? 11.629  7.646   14.705  1.00 10.88 ? 124  TYR B CD2 1 
ATOM   4184 C  CE1 . TYR B 1 124 ? 11.655  5.760   16.730  1.00 11.68 ? 124  TYR B CE1 1 
ATOM   4185 C  CE2 . TYR B 1 124 ? 11.539  6.307   14.397  1.00 11.31 ? 124  TYR B CE2 1 
ATOM   4186 C  CZ  . TYR B 1 124 ? 11.552  5.366   15.407  1.00 11.74 ? 124  TYR B CZ  1 
ATOM   4187 O  OH  . TYR B 1 124 ? 11.449  4.029   15.099  1.00 12.32 ? 124  TYR B OH  1 
ATOM   4188 N  N   . THR B 1 125 ? 9.101   9.491   14.342  1.00 9.81  ? 125  THR B N   1 
ATOM   4189 C  CA  . THR B 1 125 ? 7.879   8.784   14.000  1.00 10.08 ? 125  THR B CA  1 
ATOM   4190 C  C   . THR B 1 125 ? 8.212   7.521   13.218  1.00 10.76 ? 125  THR B C   1 
ATOM   4191 O  O   . THR B 1 125 ? 9.087   7.570   12.352  1.00 10.91 ? 125  THR B O   1 
ATOM   4192 C  CB  . THR B 1 125 ? 6.983   9.670   13.100  1.00 10.48 ? 125  THR B CB  1 
ATOM   4193 O  OG1 . THR B 1 125 ? 6.706   10.872  13.831  1.00 11.50 ? 125  THR B OG1 1 
ATOM   4194 C  CG2 . THR B 1 125 ? 5.694   8.976   12.710  1.00 10.61 ? 125  THR B CG2 1 
ATOM   4195 N  N   . ASP B 1 126 ? 7.521   6.443   13.551  1.00 9.73  ? 126  ASP B N   1 
ATOM   4196 C  CA  . ASP B 1 126 ? 7.735   5.207   12.796  1.00 10.78 ? 126  ASP B CA  1 
ATOM   4197 C  C   . ASP B 1 126 ? 6.481   4.800   12.052  1.00 10.09 ? 126  ASP B C   1 
ATOM   4198 O  O   . ASP B 1 126 ? 5.443   4.556   12.669  1.00 9.75  ? 126  ASP B O   1 
ATOM   4199 C  CB  . ASP B 1 126 ? 8.195   4.165   13.815  1.00 11.91 ? 126  ASP B CB  1 
ATOM   4200 C  CG  . ASP B 1 126 ? 8.805   3.019   13.037  1.00 14.47 ? 126  ASP B CG  1 
ATOM   4201 O  OD1 . ASP B 1 126 ? 9.481   3.154   12.019  1.00 16.31 ? 126  ASP B OD1 1 
ATOM   4202 O  OD2 . ASP B 1 126 ? 8.472   1.964   13.557  1.00 15.28 ? 126  ASP B OD2 1 
ATOM   4203 N  N   . PHE B 1 127 ? 6.559   4.770   10.716  1.00 10.17 ? 127  PHE B N   1 
ATOM   4204 C  CA  . PHE B 1 127 ? 5.416   4.359   9.909   1.00 10.24 ? 127  PHE B CA  1 
ATOM   4205 C  C   . PHE B 1 127 ? 5.392   2.847   9.779   1.00 10.43 ? 127  PHE B C   1 
ATOM   4206 O  O   . PHE B 1 127 ? 6.170   2.155   10.448  1.00 11.82 ? 127  PHE B O   1 
ATOM   4207 C  CB  . PHE B 1 127 ? 5.458   5.095   8.555   1.00 9.58  ? 127  PHE B CB  1 
ATOM   4208 C  CG  . PHE B 1 127 ? 5.026   6.533   8.711   1.00 8.75  ? 127  PHE B CG  1 
ATOM   4209 C  CD1 . PHE B 1 127 ? 5.937   7.558   8.879   1.00 8.83  ? 127  PHE B CD1 1 
ATOM   4210 C  CD2 . PHE B 1 127 ? 3.664   6.827   8.709   1.00 8.97  ? 127  PHE B CD2 1 
ATOM   4211 C  CE1 . PHE B 1 127 ? 5.510   8.866   9.029   1.00 8.50  ? 127  PHE B CE1 1 
ATOM   4212 C  CE2 . PHE B 1 127 ? 3.237   8.137   8.870   1.00 8.56  ? 127  PHE B CE2 1 
ATOM   4213 C  CZ  . PHE B 1 127 ? 4.158   9.159   9.018   1.00 8.55  ? 127  PHE B CZ  1 
ATOM   4214 N  N   . TYR B 1 128 ? 4.526   2.305   8.943   1.00 9.97  ? 128  TYR B N   1 
ATOM   4215 C  CA  . TYR B 1 128 ? 4.255   0.874   8.881   1.00 10.46 ? 128  TYR B CA  1 
ATOM   4216 C  C   . TYR B 1 128 ? 3.906   0.538   7.429   1.00 10.04 ? 128  TYR B C   1 
ATOM   4217 O  O   . TYR B 1 128 ? 2.948   -0.185  7.158   1.00 9.87  ? 128  TYR B O   1 
ATOM   4218 C  CB  . TYR B 1 128 ? 3.117   0.555   9.827   1.00 11.26 ? 128  TYR B CB  1 
ATOM   4219 C  CG  . TYR B 1 128 ? 2.908   -0.863  10.292  1.00 11.32 ? 128  TYR B CG  1 
ATOM   4220 C  CD1 . TYR B 1 128 ? 3.946   -1.591  10.848  1.00 12.48 ? 128  TYR B CD1 1 
ATOM   4221 C  CD2 . TYR B 1 128 ? 1.656   -1.460  10.216  1.00 12.43 ? 128  TYR B CD2 1 
ATOM   4222 C  CE1 . TYR B 1 128 ? 3.750   -2.885  11.300  1.00 13.55 ? 128  TYR B CE1 1 
ATOM   4223 C  CE2 . TYR B 1 128 ? 1.444   -2.750  10.668  1.00 13.76 ? 128  TYR B CE2 1 
ATOM   4224 C  CZ  . TYR B 1 128 ? 2.500   -3.452  11.206  1.00 14.30 ? 128  TYR B CZ  1 
ATOM   4225 O  OH  . TYR B 1 128 ? 2.331   -4.740  11.671  1.00 17.54 ? 128  TYR B OH  1 
ATOM   4226 N  N   . SER B 1 129 ? 4.708   1.082   6.510   1.00 10.28 ? 129  SER B N   1 
ATOM   4227 C  CA  . SER B 1 129 ? 4.226   1.241   5.130   1.00 9.91  ? 129  SER B CA  1 
ATOM   4228 C  C   . SER B 1 129 ? 4.613   0.110   4.194   1.00 11.17 ? 129  SER B C   1 
ATOM   4229 O  O   . SER B 1 129 ? 4.259   0.191   3.011   1.00 11.21 ? 129  SER B O   1 
ATOM   4230 C  CB  . SER B 1 129 ? 4.711   2.591   4.585   1.00 9.61  ? 129  SER B CB  1 
ATOM   4231 O  OG  . SER B 1 129 ? 4.152   3.681   5.306   1.00 10.34 ? 129  SER B OG  1 
ATOM   4232 N  N   . SER B 1 130 ? 5.281   -0.942  4.667   1.00 12.38 ? 130  SER B N   1 
ATOM   4233 C  CA  . SER B 1 130 ? 5.489   -2.107  3.803   1.00 13.56 ? 130  SER B CA  1 
ATOM   4234 C  C   . SER B 1 130 ? 4.297   -3.051  3.850   1.00 14.00 ? 130  SER B C   1 
ATOM   4235 O  O   . SER B 1 130 ? 3.938   -3.593  4.899   1.00 14.60 ? 130  SER B O   1 
ATOM   4236 C  CB  . SER B 1 130 ? 6.753   -2.884  4.190   1.00 15.52 ? 130  SER B CB  1 
ATOM   4237 O  OG  . SER B 1 130 ? 6.591   -4.249  3.792   1.00 18.01 ? 130  SER B OG  1 
ATOM   4238 N  N   . ARG B 1 131 ? 3.666   -3.296  2.693   1.00 13.19 ? 131  ARG B N   1 
ATOM   4239 C  CA  . ARG B 1 131 ? 2.470   -4.125  2.669   1.00 13.13 ? 131  ARG B CA  1 
ATOM   4240 C  C   . ARG B 1 131 ? 2.747   -5.563  3.095   1.00 13.35 ? 131  ARG B C   1 
ATOM   4241 O  O   . ARG B 1 131 ? 1.950   -6.131  3.843   1.00 13.99 ? 131  ARG B O   1 
ATOM   4242 C  CB  . ARG B 1 131 ? 1.826   -4.092  1.275   1.00 13.94 ? 131  ARG B CB  1 
ATOM   4243 C  CG  . ARG B 1 131 ? 0.479   -4.783  1.254   1.00 14.60 ? 131  ARG B CG  1 
ATOM   4244 C  CD  . ARG B 1 131 ? -0.210  -4.612  -0.095  1.00 16.32 ? 131  ARG B CD  1 
ATOM   4245 N  NE  . ARG B 1 131 ? -1.541  -5.223  -0.044  1.00 17.74 ? 131  ARG B NE  1 
ATOM   4246 C  CZ  . ARG B 1 131 ? -2.513  -4.917  -0.896  1.00 18.18 ? 131  ARG B CZ  1 
ATOM   4247 N  NH1 . ARG B 1 131 ? -2.300  -4.020  -1.849  1.00 18.55 ? 131  ARG B NH1 1 
ATOM   4248 N  NH2 . ARG B 1 131 ? -3.704  -5.497  -0.804  1.00 19.85 ? 131  ARG B NH2 1 
ATOM   4249 N  N   . GLN B 1 132 ? 3.876   -6.128  2.660   1.00 13.64 ? 132  GLN B N   1 
ATOM   4250 C  CA  . GLN B 1 132 ? 4.160   -7.521  3.005   1.00 14.08 ? 132  GLN B CA  1 
ATOM   4251 C  C   . GLN B 1 132 ? 4.483   -7.675  4.489   1.00 14.17 ? 132  GLN B C   1 
ATOM   4252 O  O   . GLN B 1 132 ? 4.043   -8.655  5.095   1.00 14.50 ? 132  GLN B O   1 
ATOM   4253 C  CB  . GLN B 1 132 ? 5.278   -8.102  2.143   1.00 13.97 ? 132  GLN B CB  1 
ATOM   4254 C  CG  . GLN B 1 132 ? 5.376   -9.622  2.261   1.00 14.89 ? 132  GLN B CG  1 
ATOM   4255 C  CD  . GLN B 1 132 ? 4.153   -10.314 1.706   1.00 16.10 ? 132  GLN B CD  1 
ATOM   4256 O  OE1 . GLN B 1 132 ? 3.728   -10.048 0.575   1.00 17.24 ? 132  GLN B OE1 1 
ATOM   4257 N  NE2 . GLN B 1 132 ? 3.537   -11.195 2.485   1.00 16.86 ? 132  GLN B NE2 1 
ATOM   4258 N  N   . HIS B 1 133 ? 5.170   -6.692  5.068   1.00 13.06 ? 133  HIS B N   1 
ATOM   4259 C  CA  . HIS B 1 133 ? 5.416   -6.741  6.510   1.00 13.79 ? 133  HIS B CA  1 
ATOM   4260 C  C   . HIS B 1 133 ? 4.113   -6.774  7.288   1.00 14.30 ? 133  HIS B C   1 
ATOM   4261 O  O   . HIS B 1 133 ? 3.903   -7.638  8.136   1.00 13.99 ? 133  HIS B O   1 
ATOM   4262 C  CB  . HIS B 1 133 ? 6.260   -5.554  6.971   1.00 13.70 ? 133  HIS B CB  1 
ATOM   4263 C  CG  . HIS B 1 133 ? 6.484   -5.552  8.455   1.00 13.70 ? 133  HIS B CG  1 
ATOM   4264 N  ND1 . HIS B 1 133 ? 7.367   -6.404  9.087   1.00 13.69 ? 133  HIS B ND1 1 
ATOM   4265 C  CD2 . HIS B 1 133 ? 5.936   -4.775  9.417   1.00 14.15 ? 133  HIS B CD2 1 
ATOM   4266 C  CE1 . HIS B 1 133 ? 7.340   -6.157  10.390  1.00 13.84 ? 133  HIS B CE1 1 
ATOM   4267 N  NE2 . HIS B 1 133 ? 6.494   -5.166  10.621  1.00 13.22 ? 133  HIS B NE2 1 
ATOM   4268 N  N   . ALA B 1 134 ? 3.207   -5.831  7.006   1.00 14.10 ? 134  ALA B N   1 
ATOM   4269 C  CA  . ALA B 1 134 ? 1.933   -5.788  7.723   1.00 14.23 ? 134  ALA B CA  1 
ATOM   4270 C  C   . ALA B 1 134 ? 1.103   -7.042  7.498   1.00 14.14 ? 134  ALA B C   1 
ATOM   4271 O  O   . ALA B 1 134 ? 0.449   -7.591  8.392   1.00 14.59 ? 134  ALA B O   1 
ATOM   4272 C  CB  . ALA B 1 134 ? 1.149   -4.551  7.292   1.00 13.60 ? 134  ALA B CB  1 
ATOM   4273 N  N   . THR B 1 135 ? 1.126   -7.532  6.255   1.00 13.93 ? 135  THR B N   1 
ATOM   4274 C  CA  . THR B 1 135 ? 0.482   -8.793  5.926   1.00 15.18 ? 135  THR B CA  1 
ATOM   4275 C  C   . THR B 1 135 ? 1.069   -9.973  6.689   1.00 15.04 ? 135  THR B C   1 
ATOM   4276 O  O   . THR B 1 135 ? 0.302   -10.781 7.209   1.00 16.19 ? 135  THR B O   1 
ATOM   4277 C  CB  . THR B 1 135 ? 0.578   -9.030  4.408   1.00 16.07 ? 135  THR B CB  1 
ATOM   4278 O  OG1 . THR B 1 135 ? -0.088  -7.923  3.771   1.00 16.87 ? 135  THR B OG1 1 
ATOM   4279 C  CG2 . THR B 1 135 ? -0.084  -10.338 4.026   1.00 17.16 ? 135  THR B CG2 1 
ATOM   4280 N  N   . ASN B 1 136 ? 2.387   -10.096 6.737   1.00 14.84 ? 136  ASN B N   1 
ATOM   4281 C  CA  . ASN B 1 136 ? 3.032   -11.178 7.463   1.00 14.57 ? 136  ASN B CA  1 
ATOM   4282 C  C   . ASN B 1 136 ? 2.658   -11.156 8.942   1.00 14.54 ? 136  ASN B C   1 
ATOM   4283 O  O   . ASN B 1 136 ? 2.281   -12.189 9.501   1.00 15.39 ? 136  ASN B O   1 
ATOM   4284 C  CB  . ASN B 1 136 ? 4.555   -11.117 7.312   1.00 14.54 ? 136  ASN B CB  1 
ATOM   4285 C  CG  . ASN B 1 136 ? 5.035   -11.542 5.941   1.00 14.25 ? 136  ASN B CG  1 
ATOM   4286 O  OD1 . ASN B 1 136 ? 4.336   -12.205 5.167   1.00 14.75 ? 136  ASN B OD1 1 
ATOM   4287 N  ND2 . ASN B 1 136 ? 6.272   -11.160 5.632   1.00 14.18 ? 136  ASN B ND2 1 
ATOM   4288 N  N   . VAL B 1 137 ? 2.748   -9.980  9.558   1.00 14.34 ? 137  VAL B N   1 
ATOM   4289 C  CA  . VAL B 1 137 ? 2.381   -9.856  10.976  1.00 14.94 ? 137  VAL B CA  1 
ATOM   4290 C  C   . VAL B 1 137 ? 0.922   -10.222 11.196  1.00 15.51 ? 137  VAL B C   1 
ATOM   4291 O  O   . VAL B 1 137 ? 0.557   -10.959 12.121  1.00 15.32 ? 137  VAL B O   1 
ATOM   4292 C  CB  . VAL B 1 137 ? 2.682   -8.435  11.478  1.00 14.42 ? 137  VAL B CB  1 
ATOM   4293 C  CG1 . VAL B 1 137 ? 2.127   -8.186  12.875  1.00 15.18 ? 137  VAL B CG1 1 
ATOM   4294 C  CG2 . VAL B 1 137 ? 4.190   -8.201  11.476  1.00 15.00 ? 137  VAL B CG2 1 
ATOM   4295 N  N   . GLY B 1 138 ? 0.044   -9.721  10.333  1.00 16.57 ? 138  GLY B N   1 
ATOM   4296 C  CA  . GLY B 1 138 ? -1.361  -10.082 10.349  1.00 17.30 ? 138  GLY B CA  1 
ATOM   4297 C  C   . GLY B 1 138 ? -1.582  -11.585 10.287  1.00 19.02 ? 138  GLY B C   1 
ATOM   4298 O  O   . GLY B 1 138 ? -2.348  -12.132 11.085  1.00 20.11 ? 138  GLY B O   1 
ATOM   4299 N  N   . ILE B 1 139 ? -0.932  -12.276 9.348   1.00 18.99 ? 139  ILE B N   1 
ATOM   4300 C  CA  . ILE B 1 139 ? -1.092  -13.725 9.242   1.00 20.01 ? 139  ILE B CA  1 
ATOM   4301 C  C   . ILE B 1 139 ? -0.626  -14.423 10.516  1.00 20.85 ? 139  ILE B C   1 
ATOM   4302 O  O   . ILE B 1 139 ? -1.339  -15.266 11.074  1.00 21.50 ? 139  ILE B O   1 
ATOM   4303 C  CB  . ILE B 1 139 ? -0.331  -14.299 8.036   1.00 19.76 ? 139  ILE B CB  1 
ATOM   4304 C  CG1 . ILE B 1 139 ? -0.869  -13.706 6.731   1.00 19.32 ? 139  ILE B CG1 1 
ATOM   4305 C  CG2 . ILE B 1 139 ? -0.436  -15.823 8.006   1.00 20.48 ? 139  ILE B CG2 1 
ATOM   4306 C  CD1 . ILE B 1 139 ? 0.056   -13.921 5.550   1.00 19.88 ? 139  ILE B CD1 1 
ATOM   4307 N  N   . MET B 1 140 ? 0.561   -14.068 10.998  1.00 21.84 ? 140  MET B N   1 
ATOM   4308 C  CA  . MET B 1 140 ? 1.147   -14.743 12.154  1.00 23.67 ? 140  MET B CA  1 
ATOM   4309 C  C   . MET B 1 140 ? 0.268   -14.597 13.388  1.00 25.05 ? 140  MET B C   1 
ATOM   4310 O  O   . MET B 1 140 ? 0.105   -15.562 14.151  1.00 26.07 ? 140  MET B O   1 
ATOM   4311 C  CB  . MET B 1 140 ? 2.576   -14.250 12.409  1.00 23.28 ? 140  MET B CB  1 
ATOM   4312 C  CG  . MET B 1 140 ? 3.622   -14.851 11.487  1.00 23.52 ? 140  MET B CG  1 
ATOM   4313 S  SD  . MET B 1 140 ? 5.316   -14.307 11.727  1.00 23.36 ? 140  MET B SD  1 
ATOM   4314 C  CE  . MET B 1 140 ? 5.343   -12.731 10.885  1.00 23.07 ? 140  MET B CE  1 
ATOM   4315 N  N   . PHE B 1 141 ? -0.344  -13.432 13.594  1.00 25.15 ? 141  PHE B N   1 
ATOM   4316 C  CA  . PHE B 1 141 ? -1.009  -13.151 14.859  1.00 25.72 ? 141  PHE B CA  1 
ATOM   4317 C  C   . PHE B 1 141 ? -2.527  -13.203 14.779  1.00 25.43 ? 141  PHE B C   1 
ATOM   4318 O  O   . PHE B 1 141 ? -3.157  -13.344 15.835  1.00 25.52 ? 141  PHE B O   1 
ATOM   4319 C  CB  . PHE B 1 141 ? -0.544  -11.798 15.408  1.00 26.13 ? 141  PHE B CB  1 
ATOM   4320 C  CG  . PHE B 1 141 ? 0.885   -11.798 15.881  1.00 26.72 ? 141  PHE B CG  1 
ATOM   4321 C  CD1 . PHE B 1 141 ? 1.188   -12.063 17.205  1.00 26.88 ? 141  PHE B CD1 1 
ATOM   4322 C  CD2 . PHE B 1 141 ? 1.922   -11.532 15.002  1.00 27.13 ? 141  PHE B CD2 1 
ATOM   4323 C  CE1 . PHE B 1 141 ? 2.498   -12.066 17.645  1.00 27.06 ? 141  PHE B CE1 1 
ATOM   4324 C  CE2 . PHE B 1 141 ? 3.236   -11.530 15.435  1.00 27.28 ? 141  PHE B CE2 1 
ATOM   4325 C  CZ  . PHE B 1 141 ? 3.524   -11.795 16.760  1.00 27.24 ? 141  PHE B CZ  1 
ATOM   4326 N  N   . ARG B 1 142 ? -3.119  -13.119 13.591  1.00 25.47 ? 142  ARG B N   1 
ATOM   4327 C  CA  . ARG B 1 142 ? -4.567  -13.097 13.473  1.00 26.33 ? 142  ARG B CA  1 
ATOM   4328 C  C   . ARG B 1 142 ? -5.127  -14.187 12.564  1.00 27.84 ? 142  ARG B C   1 
ATOM   4329 O  O   . ARG B 1 142 ? -6.311  -14.504 12.657  1.00 27.09 ? 142  ARG B O   1 
ATOM   4330 C  CB  . ARG B 1 142 ? -5.078  -11.749 12.955  1.00 25.93 ? 142  ARG B CB  1 
ATOM   4331 C  CG  . ARG B 1 142 ? -4.995  -10.587 13.928  1.00 25.37 ? 142  ARG B CG  1 
ATOM   4332 C  CD  . ARG B 1 142 ? -5.751  -9.378  13.380  1.00 25.58 ? 142  ARG B CD  1 
ATOM   4333 N  NE  . ARG B 1 142 ? -5.160  -8.862  12.151  1.00 25.26 ? 142  ARG B NE  1 
ATOM   4334 C  CZ  . ARG B 1 142 ? -4.065  -8.116  12.078  1.00 25.41 ? 142  ARG B CZ  1 
ATOM   4335 N  NH1 . ARG B 1 142 ? -3.412  -7.768  13.175  1.00 25.77 ? 142  ARG B NH1 1 
ATOM   4336 N  NH2 . ARG B 1 142 ? -3.618  -7.705  10.895  1.00 25.42 ? 142  ARG B NH2 1 
ATOM   4337 N  N   . GLY B 1 143 ? -4.301  -14.721 11.675  1.00 29.75 ? 143  GLY B N   1 
ATOM   4338 C  CA  . GLY B 1 143 ? -4.760  -15.721 10.718  1.00 32.00 ? 143  GLY B CA  1 
ATOM   4339 C  C   . GLY B 1 143 ? -4.722  -15.145 9.307   1.00 33.64 ? 143  GLY B C   1 
ATOM   4340 O  O   . GLY B 1 143 ? -4.809  -13.938 9.097   1.00 33.41 ? 143  GLY B O   1 
ATOM   4341 N  N   . LYS B 1 144 ? -4.668  -16.020 8.316   1.00 35.69 ? 144  LYS B N   1 
ATOM   4342 C  CA  . LYS B 1 144 ? -4.398  -15.676 6.934   1.00 37.65 ? 144  LYS B CA  1 
ATOM   4343 C  C   . LYS B 1 144 ? -5.497  -14.865 6.266   1.00 38.51 ? 144  LYS B C   1 
ATOM   4344 O  O   . LYS B 1 144 ? -5.209  -14.088 5.350   1.00 38.94 ? 144  LYS B O   1 
ATOM   4345 C  CB  . LYS B 1 144 ? -4.157  -16.951 6.107   1.00 38.39 ? 144  LYS B CB  1 
ATOM   4346 C  CG  . LYS B 1 144 ? -3.301  -17.992 6.813   1.00 39.07 ? 144  LYS B CG  1 
ATOM   4347 C  CD  . LYS B 1 144 ? -4.165  -18.875 7.707   1.00 39.58 ? 144  LYS B CD  1 
ATOM   4348 C  CE  . LYS B 1 144 ? -3.485  -19.112 9.047   1.00 39.81 ? 144  LYS B CE  1 
ATOM   4349 N  NZ  . LYS B 1 144 ? -4.462  -19.592 10.065  1.00 39.99 ? 144  LYS B NZ  1 
ATOM   4350 N  N   . GLU B 1 145 ? -6.744  -15.031 6.698   1.00 39.18 ? 145  GLU B N   1 
ATOM   4351 C  CA  . GLU B 1 145 ? -7.858  -14.283 6.135   1.00 39.79 ? 145  GLU B CA  1 
ATOM   4352 C  C   . GLU B 1 145 ? -7.878  -12.839 6.629   1.00 39.42 ? 145  GLU B C   1 
ATOM   4353 O  O   . GLU B 1 145 ? -8.382  -11.952 5.941   1.00 40.23 ? 145  GLU B O   1 
ATOM   4354 C  CB  . GLU B 1 145 ? -9.199  -14.952 6.439   1.00 40.70 ? 145  GLU B CB  1 
ATOM   4355 C  CG  . GLU B 1 145 ? -9.724  -14.797 7.849   1.00 41.76 ? 145  GLU B CG  1 
ATOM   4356 C  CD  . GLU B 1 145 ? -9.566  -16.013 8.733   1.00 42.63 ? 145  GLU B CD  1 
ATOM   4357 O  OE1 . GLU B 1 145 ? -8.585  -16.771 8.580   1.00 42.97 ? 145  GLU B OE1 1 
ATOM   4358 O  OE2 . GLU B 1 145 ? -10.448 -16.219 9.600   1.00 43.38 ? 145  GLU B OE2 1 
ATOM   4359 N  N   . ASN B 1 146 ? -7.346  -12.600 7.819   1.00 38.63 ? 146  ASN B N   1 
ATOM   4360 C  CA  . ASN B 1 146 ? -7.283  -11.274 8.415   1.00 37.63 ? 146  ASN B CA  1 
ATOM   4361 C  C   . ASN B 1 146 ? -5.881  -10.683 8.388   1.00 35.59 ? 146  ASN B C   1 
ATOM   4362 O  O   . ASN B 1 146 ? -5.367  -10.214 9.411   1.00 36.09 ? 146  ASN B O   1 
ATOM   4363 C  CB  . ASN B 1 146 ? -7.786  -11.355 9.865   1.00 38.74 ? 146  ASN B CB  1 
ATOM   4364 C  CG  . ASN B 1 146 ? -9.290  -11.557 9.910   1.00 39.51 ? 146  ASN B CG  1 
ATOM   4365 O  OD1 . ASN B 1 146 ? -10.018 -10.903 9.162   1.00 40.40 ? 146  ASN B OD1 1 
ATOM   4366 N  ND2 . ASN B 1 146 ? -9.736  -12.451 10.780  1.00 40.21 ? 146  ASN B ND2 1 
ATOM   4367 N  N   . ALA B 1 147 ? -5.249  -10.689 7.216   1.00 32.76 ? 147  ALA B N   1 
ATOM   4368 C  CA  . ALA B 1 147 ? -3.879  -10.195 7.107   1.00 29.92 ? 147  ALA B CA  1 
ATOM   4369 C  C   . ALA B 1 147 ? -3.813  -8.710  7.445   1.00 27.71 ? 147  ALA B C   1 
ATOM   4370 O  O   . ALA B 1 147 ? -3.072  -8.337  8.357   1.00 28.27 ? 147  ALA B O   1 
ATOM   4371 C  CB  . ALA B 1 147 ? -3.315  -10.476 5.725   1.00 30.48 ? 147  ALA B CB  1 
ATOM   4372 N  N   . LEU B 1 148 ? -4.575  -7.868  6.754   1.00 24.00 ? 148  LEU B N   1 
ATOM   4373 C  CA  . LEU B 1 148 ? -4.506  -6.431  6.994   1.00 20.82 ? 148  LEU B CA  1 
ATOM   4374 C  C   . LEU B 1 148 ? -5.697  -5.923  7.799   1.00 18.97 ? 148  LEU B C   1 
ATOM   4375 O  O   . LEU B 1 148 ? -6.826  -6.360  7.572   1.00 19.38 ? 148  LEU B O   1 
ATOM   4376 C  CB  . LEU B 1 148 ? -4.454  -5.657  5.670   1.00 19.81 ? 148  LEU B CB  1 
ATOM   4377 C  CG  . LEU B 1 148 ? -3.209  -5.844  4.808   1.00 19.78 ? 148  LEU B CG  1 
ATOM   4378 C  CD1 . LEU B 1 148 ? -3.339  -5.045  3.515   1.00 19.12 ? 148  LEU B CD1 1 
ATOM   4379 C  CD2 . LEU B 1 148 ? -1.954  -5.423  5.561   1.00 19.45 ? 148  LEU B CD2 1 
ATOM   4380 N  N   . LEU B 1 149 ? -5.445  -4.993  8.714   1.00 16.83 ? 149  LEU B N   1 
ATOM   4381 C  CA  . LEU B 1 149 ? -6.521  -4.313  9.431   1.00 15.52 ? 149  LEU B CA  1 
ATOM   4382 C  C   . LEU B 1 149 ? -7.186  -3.305  8.513   1.00 14.95 ? 149  LEU B C   1 
ATOM   4383 O  O   . LEU B 1 149 ? -6.611  -2.903  7.497   1.00 15.44 ? 149  LEU B O   1 
ATOM   4384 C  CB  . LEU B 1 149 ? -5.951  -3.658  10.704  1.00 14.45 ? 149  LEU B CB  1 
ATOM   4385 C  CG  . LEU B 1 149 ? -5.409  -4.703  11.701  1.00 14.30 ? 149  LEU B CG  1 
ATOM   4386 C  CD1 . LEU B 1 149 ? -4.487  -4.079  12.734  1.00 14.94 ? 149  LEU B CD1 1 
ATOM   4387 C  CD2 . LEU B 1 149 ? -6.576  -5.432  12.352  1.00 14.80 ? 149  LEU B CD2 1 
ATOM   4388 N  N   . PRO B 1 150 ? -8.410  -2.875  8.831   1.00 14.68 ? 150  PRO B N   1 
ATOM   4389 C  CA  . PRO B 1 150 ? -9.228  -2.145  7.882   1.00 14.50 ? 150  PRO B CA  1 
ATOM   4390 C  C   . PRO B 1 150 ? -8.664  -0.812  7.427   1.00 13.59 ? 150  PRO B C   1 
ATOM   4391 O  O   . PRO B 1 150 ? -8.988  -0.387  6.308   1.00 13.80 ? 150  PRO B O   1 
ATOM   4392 C  CB  . PRO B 1 150 ? -10.573 -1.976  8.570   1.00 15.44 ? 150  PRO B CB  1 
ATOM   4393 C  CG  . PRO B 1 150 ? -10.465 -2.556  9.924   1.00 16.10 ? 150  PRO B CG  1 
ATOM   4394 C  CD  . PRO B 1 150 ? -9.188  -3.352  9.999   1.00 15.43 ? 150  PRO B CD  1 
ATOM   4395 N  N   . ASN B 1 151 ? -7.828  -0.138  8.229   1.00 13.07 ? 151  ASN B N   1 
ATOM   4396 C  CA  . ASN B 1 151 ? -7.347  1.173   7.806   1.00 11.66 ? 151  ASN B CA  1 
ATOM   4397 C  C   . ASN B 1 151 ? -6.071  1.129   6.974   1.00 11.04 ? 151  ASN B C   1 
ATOM   4398 O  O   . ASN B 1 151 ? -5.698  2.168   6.419   1.00 10.12 ? 151  ASN B O   1 
ATOM   4399 C  CB  . ASN B 1 151 ? -7.139  2.090   9.021   1.00 12.00 ? 151  ASN B CB  1 
ATOM   4400 C  CG  . ASN B 1 151 ? -6.165  1.513   10.029  1.00 13.75 ? 151  ASN B CG  1 
ATOM   4401 O  OD1 . ASN B 1 151 ? -5.497  0.514   9.766   1.00 14.12 ? 151  ASN B OD1 1 
ATOM   4402 N  ND2 . ASN B 1 151 ? -6.094  2.129   11.206  1.00 13.24 ? 151  ASN B ND2 1 
ATOM   4403 N  N   . TRP B 1 152 ? -5.422  -0.024  6.835   1.00 10.28 ? 152  TRP B N   1 
ATOM   4404 C  CA  . TRP B 1 152 ? -4.048  -0.048  6.339   1.00 10.16 ? 152  TRP B CA  1 
ATOM   4405 C  C   . TRP B 1 152 ? -3.940  0.465   4.904   1.00 10.81 ? 152  TRP B C   1 
ATOM   4406 O  O   . TRP B 1 152 ? -3.023  1.229   4.598   1.00 10.93 ? 152  TRP B O   1 
ATOM   4407 C  CB  . TRP B 1 152 ? -3.410  -1.440  6.463   1.00 10.65 ? 152  TRP B CB  1 
ATOM   4408 C  CG  . TRP B 1 152 ? -1.911  -1.356  6.327   1.00 10.69 ? 152  TRP B CG  1 
ATOM   4409 C  CD1 . TRP B 1 152 ? -1.013  -1.246  7.348   1.00 10.79 ? 152  TRP B CD1 1 
ATOM   4410 C  CD2 . TRP B 1 152 ? -1.155  -1.324  5.111   1.00 10.69 ? 152  TRP B CD2 1 
ATOM   4411 N  NE1 . TRP B 1 152 ? 0.264   -1.172  6.842   1.00 10.67 ? 152  TRP B NE1 1 
ATOM   4412 C  CE2 . TRP B 1 152 ? 0.204   -1.213  5.474   1.00 10.56 ? 152  TRP B CE2 1 
ATOM   4413 C  CE3 . TRP B 1 152 ? -1.486  -1.394  3.754   1.00 11.61 ? 152  TRP B CE3 1 
ATOM   4414 C  CZ2 . TRP B 1 152 ? 1.222   -1.158  4.532   1.00 10.94 ? 152  TRP B CZ2 1 
ATOM   4415 C  CZ3 . TRP B 1 152 ? -0.471  -1.335  2.822   1.00 11.49 ? 152  TRP B CZ3 1 
ATOM   4416 C  CH2 . TRP B 1 152 ? 0.881   -1.219  3.209   1.00 11.28 ? 152  TRP B CH2 1 
ATOM   4417 N  N   . LEU B 1 153 ? -4.887  0.107   4.041   1.00 10.29 ? 153  LEU B N   1 
ATOM   4418 C  CA  . LEU B 1 153 ? -4.868  0.566   2.658   1.00 11.35 ? 153  LEU B CA  1 
ATOM   4419 C  C   . LEU B 1 153 ? -5.447  1.961   2.471   1.00 10.52 ? 153  LEU B C   1 
ATOM   4420 O  O   . LEU B 1 153 ? -5.422  2.481   1.348   1.00 11.20 ? 153  LEU B O   1 
ATOM   4421 C  CB  . LEU B 1 153 ? -5.653  -0.426  1.777   1.00 11.57 ? 153  LEU B CB  1 
ATOM   4422 C  CG  . LEU B 1 153 ? -4.995  -1.819  1.673   1.00 12.43 ? 153  LEU B CG  1 
ATOM   4423 C  CD1 . LEU B 1 153 ? -5.986  -2.792  1.046   1.00 13.39 ? 153  LEU B CD1 1 
ATOM   4424 C  CD2 . LEU B 1 153 ? -3.710  -1.751  0.869   1.00 13.10 ? 153  LEU B CD2 1 
ATOM   4425 N  N   . HIS B 1 154 ? -5.879  2.642   3.528   1.00 10.67 ? 154  HIS B N   1 
ATOM   4426 C  CA  . HIS B 1 154 ? -6.450  3.968   3.436   1.00 11.02 ? 154  HIS B CA  1 
ATOM   4427 C  C   . HIS B 1 154 ? -5.596  5.095   3.982   1.00 10.76 ? 154  HIS B C   1 
ATOM   4428 O  O   . HIS B 1 154 ? -5.748  6.237   3.537   1.00 10.81 ? 154  HIS B O   1 
ATOM   4429 C  CB  . HIS B 1 154 ? -7.819  4.039   4.162   1.00 11.62 ? 154  HIS B CB  1 
ATOM   4430 C  CG  . HIS B 1 154 ? -8.830  3.134   3.519   1.00 12.00 ? 154  HIS B CG  1 
ATOM   4431 N  ND1 . HIS B 1 154 ? -9.485  3.451   2.348   1.00 13.99 ? 154  HIS B ND1 1 
ATOM   4432 C  CD2 . HIS B 1 154 ? -9.272  1.914   3.892   1.00 13.06 ? 154  HIS B CD2 1 
ATOM   4433 C  CE1 . HIS B 1 154 ? -10.309 2.463   2.039   1.00 12.92 ? 154  HIS B CE1 1 
ATOM   4434 N  NE2 . HIS B 1 154 ? -10.202 1.517   2.949   1.00 12.95 ? 154  HIS B NE2 1 
ATOM   4435 N  N   . LEU B 1 155 ? -4.697  4.823   4.931   1.00 11.16 ? 155  LEU B N   1 
ATOM   4436 C  CA  . LEU B 1 155 ? -3.770  5.860   5.400   1.00 10.86 ? 155  LEU B CA  1 
ATOM   4437 C  C   . LEU B 1 155 ? -2.437  5.215   5.740   1.00 9.79  ? 155  LEU B C   1 
ATOM   4438 O  O   . LEU B 1 155 ? -2.389  4.016   6.023   1.00 10.69 ? 155  LEU B O   1 
ATOM   4439 C  CB  . LEU B 1 155 ? -4.356  6.597   6.602   1.00 12.42 ? 155  LEU B CB  1 
ATOM   4440 C  CG  . LEU B 1 155 ? -5.018  5.746   7.692   1.00 13.76 ? 155  LEU B CG  1 
ATOM   4441 C  CD1 . LEU B 1 155 ? -3.977  5.252   8.676   1.00 16.22 ? 155  LEU B CD1 1 
ATOM   4442 C  CD2 . LEU B 1 155 ? -6.089  6.546   8.427   1.00 16.49 ? 155  LEU B CD2 1 
ATOM   4443 N  N   . PRO B 1 156 ? -1.362  5.987   5.718   1.00 10.01 ? 156  PRO B N   1 
ATOM   4444 C  CA  . PRO B 1 156 ? -0.066  5.511   6.185   1.00 10.26 ? 156  PRO B CA  1 
ATOM   4445 C  C   . PRO B 1 156 ? -0.033  5.472   7.708   1.00 10.65 ? 156  PRO B C   1 
ATOM   4446 O  O   . PRO B 1 156 ? 0.321   6.442   8.368   1.00 11.57 ? 156  PRO B O   1 
ATOM   4447 C  CB  . PRO B 1 156 ? 0.920   6.511   5.607   1.00 10.64 ? 156  PRO B CB  1 
ATOM   4448 C  CG  . PRO B 1 156 ? 0.145   7.764   5.396   1.00 11.14 ? 156  PRO B CG  1 
ATOM   4449 C  CD  . PRO B 1 156 ? -1.294  7.369   5.198   1.00 10.58 ? 156  PRO B CD  1 
ATOM   4450 N  N   . VAL B 1 157 ? -0.443  4.343   8.271   1.00 11.44 ? 157  VAL B N   1 
ATOM   4451 C  CA  . VAL B 1 157 ? -0.420  4.099   9.709   1.00 11.94 ? 157  VAL B CA  1 
ATOM   4452 C  C   . VAL B 1 157 ? 0.975   4.333   10.276  1.00 10.95 ? 157  VAL B C   1 
ATOM   4453 O  O   . VAL B 1 157 ? 1.960   3.996   9.624   1.00 10.76 ? 157  VAL B O   1 
ATOM   4454 C  CB  . VAL B 1 157 ? -0.841  2.639   9.985   1.00 14.12 ? 157  VAL B CB  1 
ATOM   4455 C  CG1 . VAL B 1 157 ? -0.582  2.209   11.420  1.00 16.30 ? 157  VAL B CG1 1 
ATOM   4456 C  CG2 . VAL B 1 157 ? -2.321  2.458   9.671   1.00 15.04 ? 157  VAL B CG2 1 
ATOM   4457 N  N   . GLY B 1 158 ? 1.042   4.932   11.466  1.00 10.29 ? 158  GLY B N   1 
ATOM   4458 C  CA  . GLY B 1 158 ? 2.358   5.139   12.089  1.00 11.23 ? 158  GLY B CA  1 
ATOM   4459 C  C   . GLY B 1 158 ? 2.153   5.463   13.570  1.00 11.50 ? 158  GLY B C   1 
ATOM   4460 O  O   . GLY B 1 158 ? 1.003   5.646   13.972  1.00 12.23 ? 158  GLY B O   1 
ATOM   4461 N  N   . TYR B 1 159 ? 3.235   5.520   14.326  1.00 11.29 ? 159  TYR B N   1 
ATOM   4462 C  CA  . TYR B 1 159 ? 3.128   5.879   15.745  1.00 11.01 ? 159  TYR B CA  1 
ATOM   4463 C  C   . TYR B 1 159 ? 4.291   6.794   16.112  1.00 10.33 ? 159  TYR B C   1 
ATOM   4464 O  O   . TYR B 1 159 ? 5.307   6.815   15.417  1.00 10.04 ? 159  TYR B O   1 
ATOM   4465 C  CB  . TYR B 1 159 ? 3.089   4.628   16.635  1.00 12.46 ? 159  TYR B CB  1 
ATOM   4466 C  CG  . TYR B 1 159 ? 4.360   3.804   16.612  1.00 14.30 ? 159  TYR B CG  1 
ATOM   4467 C  CD1 . TYR B 1 159 ? 5.326   3.918   17.605  1.00 14.79 ? 159  TYR B CD1 1 
ATOM   4468 C  CD2 . TYR B 1 159 ? 4.611   2.907   15.582  1.00 15.24 ? 159  TYR B CD2 1 
ATOM   4469 C  CE1 . TYR B 1 159 ? 6.495   3.184   17.571  1.00 15.97 ? 159  TYR B CE1 1 
ATOM   4470 C  CE2 . TYR B 1 159 ? 5.763   2.148   15.548  1.00 15.54 ? 159  TYR B CE2 1 
ATOM   4471 C  CZ  . TYR B 1 159 ? 6.712   2.297   16.535  1.00 16.18 ? 159  TYR B CZ  1 
ATOM   4472 O  OH  . TYR B 1 159 ? 7.887   1.575   16.501  1.00 16.35 ? 159  TYR B OH  1 
ATOM   4473 N  N   . HIS B 1 160 ? 4.128   7.546   17.198  1.00 9.38  ? 160  HIS B N   1 
ATOM   4474 C  CA  . HIS B 1 160 ? 5.219   8.349   17.732  1.00 9.53  ? 160  HIS B CA  1 
ATOM   4475 C  C   . HIS B 1 160 ? 6.235   7.408   18.391  1.00 9.75  ? 160  HIS B C   1 
ATOM   4476 O  O   . HIS B 1 160 ? 5.832   6.529   19.159  1.00 9.55  ? 160  HIS B O   1 
ATOM   4477 C  CB  . HIS B 1 160 ? 4.719   9.334   18.795  1.00 9.97  ? 160  HIS B CB  1 
ATOM   4478 C  CG  . HIS B 1 160 ? 3.550   10.176  18.388  1.00 10.61 ? 160  HIS B CG  1 
ATOM   4479 N  ND1 . HIS B 1 160 ? 2.336   10.138  19.033  1.00 9.87  ? 160  HIS B ND1 1 
ATOM   4480 C  CD2 . HIS B 1 160 ? 3.431   11.098  17.396  1.00 11.16 ? 160  HIS B CD2 1 
ATOM   4481 C  CE1 . HIS B 1 160 ? 1.498   10.988  18.454  1.00 10.91 ? 160  HIS B CE1 1 
ATOM   4482 N  NE2 . HIS B 1 160 ? 2.139   11.572  17.450  1.00 11.35 ? 160  HIS B NE2 1 
ATOM   4483 N  N   . GLY B 1 161 ? 7.500   7.610   18.053  1.00 9.29  ? 161  GLY B N   1 
ATOM   4484 C  CA  . GLY B 1 161 ? 8.563   6.813   18.649  1.00 9.13  ? 161  GLY B CA  1 
ATOM   4485 C  C   . GLY B 1 161 ? 9.281   7.563   19.759  1.00 9.49  ? 161  GLY B C   1 
ATOM   4486 O  O   . GLY B 1 161 ? 8.981   8.709   20.081  1.00 9.95  ? 161  GLY B O   1 
ATOM   4487 N  N   . ARG B 1 162 ? 10.262  6.872   20.352  1.00 9.54  ? 162  ARG B N   1 
ATOM   4488 C  CA  . ARG B 1 162 ? 11.089  7.483   21.389  1.00 10.04 ? 162  ARG B CA  1 
ATOM   4489 C  C   . ARG B 1 162 ? 12.336  8.109   20.770  1.00 9.92  ? 162  ARG B C   1 
ATOM   4490 O  O   . ARG B 1 162 ? 13.166  7.405   20.195  1.00 9.82  ? 162  ARG B O   1 
ATOM   4491 C  CB  . ARG B 1 162 ? 11.463  6.408   22.410  1.00 9.62  ? 162  ARG B CB  1 
ATOM   4492 C  CG  . ARG B 1 162 ? 12.365  6.878   23.543  1.00 9.25  ? 162  ARG B CG  1 
ATOM   4493 C  CD  . ARG B 1 162 ? 11.544  7.627   24.597  1.00 10.37 ? 162  ARG B CD  1 
ATOM   4494 N  NE  . ARG B 1 162 ? 12.449  8.328   25.507  1.00 10.15 ? 162  ARG B NE  1 
ATOM   4495 C  CZ  . ARG B 1 162 ? 12.090  9.126   26.502  1.00 9.98  ? 162  ARG B CZ  1 
ATOM   4496 N  NH1 . ARG B 1 162 ? 10.819  9.371   26.808  1.00 10.34 ? 162  ARG B NH1 1 
ATOM   4497 N  NH2 . ARG B 1 162 ? 13.061  9.713   27.197  1.00 10.06 ? 162  ARG B NH2 1 
ATOM   4498 N  N   . ALA B 1 163 ? 12.487  9.426   20.903  1.00 9.64  ? 163  ALA B N   1 
ATOM   4499 C  CA  . ALA B 1 163 ? 13.649  10.106  20.337  1.00 10.81 ? 163  ALA B CA  1 
ATOM   4500 C  C   . ALA B 1 163 ? 14.926  9.859   21.121  1.00 10.98 ? 163  ALA B C   1 
ATOM   4501 O  O   . ALA B 1 163 ? 15.991  9.692   20.527  1.00 11.61 ? 163  ALA B O   1 
ATOM   4502 C  CB  . ALA B 1 163 ? 13.402  11.609  20.228  1.00 11.18 ? 163  ALA B CB  1 
ATOM   4503 N  N   . SER B 1 164 ? 14.867  9.818   22.456  1.00 10.80 ? 164  SER B N   1 
ATOM   4504 C  CA  . SER B 1 164 ? 16.094  9.789   23.252  1.00 10.72 ? 164  SER B CA  1 
ATOM   4505 C  C   . SER B 1 164 ? 16.991  8.594   22.971  1.00 11.14 ? 164  SER B C   1 
ATOM   4506 O  O   . SER B 1 164 ? 18.223  8.693   23.080  1.00 11.44 ? 164  SER B O   1 
ATOM   4507 C  CB  . SER B 1 164 ? 15.737  9.812   24.748  1.00 11.32 ? 164  SER B CB  1 
ATOM   4508 O  OG  . SER B 1 164 ? 15.137  8.590   25.135  1.00 11.56 ? 164  SER B OG  1 
ATOM   4509 N  N   . SER B 1 165 ? 16.414  7.456   22.609  1.00 10.66 ? 165  SER B N   1 
ATOM   4510 C  CA  . SER B 1 165 ? 17.140  6.209   22.448  1.00 10.79 ? 165  SER B CA  1 
ATOM   4511 C  C   . SER B 1 165 ? 17.484  5.915   20.994  1.00 11.31 ? 165  SER B C   1 
ATOM   4512 O  O   . SER B 1 165 ? 17.836  4.775   20.687  1.00 11.32 ? 165  SER B O   1 
ATOM   4513 C  CB  . SER B 1 165 ? 16.348  5.049   23.049  1.00 10.80 ? 165  SER B CB  1 
ATOM   4514 O  OG  . SER B 1 165 ? 15.013  5.006   22.595  1.00 11.00 ? 165  SER B OG  1 
ATOM   4515 N  N   . ILE B 1 166 ? 17.365  6.917   20.129  1.00 11.34 ? 166  ILE B N   1 
ATOM   4516 C  CA  . ILE B 1 166 ? 17.972  6.801   18.793  1.00 11.11 ? 166  ILE B CA  1 
ATOM   4517 C  C   . ILE B 1 166 ? 19.473  7.014   18.933  1.00 11.22 ? 166  ILE B C   1 
ATOM   4518 O  O   . ILE B 1 166 ? 19.919  8.045   19.447  1.00 12.13 ? 166  ILE B O   1 
ATOM   4519 C  CB  . ILE B 1 166 ? 17.385  7.810   17.800  1.00 11.35 ? 166  ILE B CB  1 
ATOM   4520 C  CG1 . ILE B 1 166 ? 15.896  7.517   17.606  1.00 12.40 ? 166  ILE B CG1 1 
ATOM   4521 C  CG2 . ILE B 1 166 ? 18.126  7.754   16.463  1.00 12.38 ? 166  ILE B CG2 1 
ATOM   4522 C  CD1 . ILE B 1 166 ? 15.163  8.624   16.883  1.00 13.59 ? 166  ILE B CD1 1 
ATOM   4523 N  N   . VAL B 1 167 ? 20.224  5.974   18.573  1.00 10.86 ? 167  VAL B N   1 
ATOM   4524 C  CA  . VAL B 1 167 ? 21.676  6.004   18.785  1.00 11.48 ? 167  VAL B CA  1 
ATOM   4525 C  C   . VAL B 1 167 ? 22.402  5.785   17.466  1.00 11.61 ? 167  VAL B C   1 
ATOM   4526 O  O   . VAL B 1 167 ? 21.860  5.159   16.548  1.00 11.56 ? 167  VAL B O   1 
ATOM   4527 C  CB  . VAL B 1 167 ? 22.112  4.945   19.809  1.00 11.65 ? 167  VAL B CB  1 
ATOM   4528 C  CG1 . VAL B 1 167 ? 21.639  5.279   21.221  1.00 12.81 ? 167  VAL B CG1 1 
ATOM   4529 C  CG2 . VAL B 1 167 ? 21.631  3.560   19.401  1.00 12.99 ? 167  VAL B CG2 1 
ATOM   4530 N  N   . VAL B 1 168 ? 23.637  6.290   17.392  1.00 11.63 ? 168  VAL B N   1 
ATOM   4531 C  CA  . VAL B 1 168 ? 24.412  6.160   16.156  1.00 11.64 ? 168  VAL B CA  1 
ATOM   4532 C  C   . VAL B 1 168 ? 24.967  4.759   15.954  1.00 12.42 ? 168  VAL B C   1 
ATOM   4533 O  O   . VAL B 1 168 ? 25.205  4.012   16.910  1.00 12.34 ? 168  VAL B O   1 
ATOM   4534 C  CB  . VAL B 1 168 ? 25.527  7.220   16.129  1.00 11.97 ? 168  VAL B CB  1 
ATOM   4535 C  CG1 . VAL B 1 168 ? 26.678  6.829   17.042  1.00 12.41 ? 168  VAL B CG1 1 
ATOM   4536 C  CG2 . VAL B 1 168 ? 25.984  7.466   14.694  1.00 13.18 ? 168  VAL B CG2 1 
ATOM   4537 N  N   . SER B 1 169 ? 25.144  4.356   14.699  1.00 12.15 ? 169  SER B N   1 
ATOM   4538 C  CA  . SER B 1 169 ? 25.738  3.081   14.340  1.00 12.42 ? 169  SER B CA  1 
ATOM   4539 C  C   . SER B 1 169 ? 26.974  2.751   15.183  1.00 12.59 ? 169  SER B C   1 
ATOM   4540 O  O   . SER B 1 169 ? 27.804  3.619   15.403  1.00 13.01 ? 169  SER B O   1 
ATOM   4541 C  CB  . SER B 1 169 ? 26.153  3.078   12.859  1.00 12.52 ? 169  SER B CB  1 
ATOM   4542 O  OG  . SER B 1 169 ? 26.655  1.801   12.488  1.00 12.79 ? 169  SER B OG  1 
ATOM   4543 N  N   . GLY B 1 170 ? 27.004  1.509   15.646  1.00 13.07 ? 170  GLY B N   1 
ATOM   4544 C  CA  . GLY B 1 170 ? 28.127  1.057   16.468  1.00 13.56 ? 170  GLY B CA  1 
ATOM   4545 C  C   . GLY B 1 170 ? 27.793  1.009   17.948  1.00 14.89 ? 170  GLY B C   1 
ATOM   4546 O  O   . GLY B 1 170 ? 28.547  0.391   18.714  1.00 14.97 ? 170  GLY B O   1 
ATOM   4547 N  N   . THR B 1 171 ? 26.716  1.640   18.377  1.00 13.83 ? 171  THR B N   1 
ATOM   4548 C  CA  . THR B 1 171 ? 26.346  1.663   19.799  1.00 13.72 ? 171  THR B CA  1 
ATOM   4549 C  C   . THR B 1 171 ? 25.851  0.297   20.224  1.00 13.94 ? 171  THR B C   1 
ATOM   4550 O  O   . THR B 1 171 ? 24.923  -0.268  19.641  1.00 13.45 ? 171  THR B O   1 
ATOM   4551 C  CB  . THR B 1 171 ? 25.219  2.694   20.021  1.00 13.21 ? 171  THR B CB  1 
ATOM   4552 O  OG1 . THR B 1 171 ? 25.671  3.995   19.627  1.00 13.47 ? 171  THR B OG1 1 
ATOM   4553 C  CG2 . THR B 1 171 ? 24.799  2.734   21.485  1.00 12.96 ? 171  THR B CG2 1 
ATOM   4554 N  N   . PRO B 1 172 ? 26.438  -0.275  21.275  1.00 14.28 ? 172  PRO B N   1 
ATOM   4555 C  CA  . PRO B 1 172 ? 25.974  -1.537  21.821  1.00 14.16 ? 172  PRO B CA  1 
ATOM   4556 C  C   . PRO B 1 172 ? 24.549  -1.399  22.343  1.00 13.89 ? 172  PRO B C   1 
ATOM   4557 O  O   . PRO B 1 172 ? 24.190  -0.361  22.902  1.00 13.55 ? 172  PRO B O   1 
ATOM   4558 C  CB  . PRO B 1 172 ? 26.989  -1.866  22.911  1.00 14.57 ? 172  PRO B CB  1 
ATOM   4559 C  CG  . PRO B 1 172 ? 28.174  -1.009  22.619  1.00 14.61 ? 172  PRO B CG  1 
ATOM   4560 C  CD  . PRO B 1 172 ? 27.621  0.254   21.997  1.00 15.01 ? 172  PRO B CD  1 
ATOM   4561 N  N   . ILE B 1 173 ? 23.733  -2.419  22.135  1.00 13.29 ? 173  ILE B N   1 
ATOM   4562 C  CA  . ILE B 1 173 ? 22.343  -2.428  22.572  1.00 13.73 ? 173  ILE B CA  1 
ATOM   4563 C  C   . ILE B 1 173 ? 22.156  -3.529  23.621  1.00 13.95 ? 173  ILE B C   1 
ATOM   4564 O  O   . ILE B 1 173 ? 22.335  -4.716  23.331  1.00 14.28 ? 173  ILE B O   1 
ATOM   4565 C  CB  . ILE B 1 173 ? 21.351  -2.664  21.423  1.00 14.48 ? 173  ILE B CB  1 
ATOM   4566 C  CG1 . ILE B 1 173 ? 21.544  -1.711  20.245  1.00 15.22 ? 173  ILE B CG1 1 
ATOM   4567 C  CG2 . ILE B 1 173 ? 19.911  -2.615  21.929  1.00 14.70 ? 173  ILE B CG2 1 
ATOM   4568 C  CD1 . ILE B 1 173 ? 21.382  -0.235  20.508  1.00 13.99 ? 173  ILE B CD1 1 
ATOM   4569 N  N   . ARG B 1 174 ? 21.777  -3.132  24.835  1.00 14.59 ? 174  ARG B N   1 
ATOM   4570 C  CA  . ARG B 1 174 ? 21.608  -4.145  25.884  1.00 15.01 ? 174  ARG B CA  1 
ATOM   4571 C  C   . ARG B 1 174 ? 20.247  -4.809  25.781  1.00 15.03 ? 174  ARG B C   1 
ATOM   4572 O  O   . ARG B 1 174 ? 19.210  -4.147  25.667  1.00 14.57 ? 174  ARG B O   1 
ATOM   4573 C  CB  . ARG B 1 174 ? 21.844  -3.533  27.273  1.00 16.77 ? 174  ARG B CB  1 
ATOM   4574 C  CG  . ARG B 1 174 ? 22.129  -4.615  28.309  1.00 19.40 ? 174  ARG B CG  1 
ATOM   4575 C  CD  . ARG B 1 174 ? 22.634  -4.075  29.623  1.00 20.45 ? 174  ARG B CD  1 
ATOM   4576 N  NE  . ARG B 1 174 ? 23.961  -3.500  29.627  1.00 22.29 ? 174  ARG B NE  1 
ATOM   4577 C  CZ  . ARG B 1 174 ? 25.124  -4.138  29.657  1.00 22.18 ? 174  ARG B CZ  1 
ATOM   4578 N  NH1 . ARG B 1 174 ? 25.178  -5.461  29.666  1.00 22.11 ? 174  ARG B NH1 1 
ATOM   4579 N  NH2 . ARG B 1 174 ? 26.255  -3.441  29.677  1.00 23.92 ? 174  ARG B NH2 1 
ATOM   4580 N  N   . ARG B 1 175 ? 20.215  -6.144  25.782  1.00 14.84 ? 175  ARG B N   1 
ATOM   4581 C  CA  . ARG B 1 175 ? 18.946  -6.863  25.873  1.00 14.69 ? 175  ARG B CA  1 
ATOM   4582 C  C   . ARG B 1 175 ? 18.132  -6.312  27.037  1.00 14.78 ? 175  ARG B C   1 
ATOM   4583 O  O   . ARG B 1 175 ? 18.615  -6.294  28.166  1.00 15.36 ? 175  ARG B O   1 
ATOM   4584 C  CB  . ARG B 1 175 ? 19.213  -8.358  26.087  1.00 15.12 ? 175  ARG B CB  1 
ATOM   4585 C  CG  . ARG B 1 175 ? 17.952  -9.189  26.247  1.00 15.27 ? 175  ARG B CG  1 
ATOM   4586 C  CD  . ARG B 1 175 ? 18.295  -10.647 26.586  1.00 15.73 ? 175  ARG B CD  1 
ATOM   4587 N  NE  . ARG B 1 175 ? 19.069  -11.215 25.482  1.00 15.55 ? 175  ARG B NE  1 
ATOM   4588 C  CZ  . ARG B 1 175 ? 18.564  -11.724 24.367  1.00 15.40 ? 175  ARG B CZ  1 
ATOM   4589 N  NH1 . ARG B 1 175 ? 17.258  -11.794 24.153  1.00 15.01 ? 175  ARG B NH1 1 
ATOM   4590 N  NH2 . ARG B 1 175 ? 19.396  -12.176 23.435  1.00 15.56 ? 175  ARG B NH2 1 
ATOM   4591 N  N   . PRO B 1 176 ? 16.908  -5.866  26.784  1.00 14.10 ? 176  PRO B N   1 
ATOM   4592 C  CA  . PRO B 1 176 ? 16.126  -5.178  27.792  1.00 13.99 ? 176  PRO B CA  1 
ATOM   4593 C  C   . PRO B 1 176 ? 15.439  -6.118  28.764  1.00 14.32 ? 176  PRO B C   1 
ATOM   4594 O  O   . PRO B 1 176 ? 14.957  -7.193  28.408  1.00 15.17 ? 176  PRO B O   1 
ATOM   4595 C  CB  . PRO B 1 176 ? 15.069  -4.412  26.989  1.00 13.60 ? 176  PRO B CB  1 
ATOM   4596 C  CG  . PRO B 1 176 ? 14.901  -5.257  25.766  1.00 13.35 ? 176  PRO B CG  1 
ATOM   4597 C  CD  . PRO B 1 176 ? 16.308  -5.712  25.434  1.00 14.04 ? 176  PRO B CD  1 
ATOM   4598 N  N   . MET B 1 177 ? 15.397  -5.700  30.026  1.00 14.74 ? 177  MET B N   1 
ATOM   4599 C  CA  . MET B 1 177 ? 14.475  -6.272  30.992  1.00 15.51 ? 177  MET B CA  1 
ATOM   4600 C  C   . MET B 1 177 ? 13.092  -5.638  30.835  1.00 15.86 ? 177  MET B C   1 
ATOM   4601 O  O   . MET B 1 177 ? 12.967  -4.500  30.386  1.00 16.06 ? 177  MET B O   1 
ATOM   4602 C  CB  . MET B 1 177 ? 14.931  -6.001  32.428  1.00 16.89 ? 177  MET B CB  1 
ATOM   4603 C  CG  . MET B 1 177 ? 16.380  -6.345  32.713  1.00 18.61 ? 177  MET B CG  1 
ATOM   4604 S  SD  . MET B 1 177 ? 16.698  -8.114  32.678  1.00 19.12 ? 177  MET B SD  1 
ATOM   4605 C  CE  . MET B 1 177 ? 15.792  -8.652  34.134  1.00 20.37 ? 177  MET B CE  1 
ATOM   4606 N  N   . GLY B 1 178 ? 12.087  -6.379  31.262  1.00 15.41 ? 178  GLY B N   1 
ATOM   4607 C  CA  . GLY B 1 178 ? 10.745  -5.812  31.335  1.00 17.20 ? 178  GLY B CA  1 
ATOM   4608 C  C   . GLY B 1 178 ? 9.745   -6.872  31.764  1.00 17.99 ? 178  GLY B C   1 
ATOM   4609 O  O   . GLY B 1 178 ? 10.061  -7.932  32.294  1.00 18.15 ? 178  GLY B O   1 
ATOM   4610 N  N   . GLN B 1 179 ? 8.494   -6.536  31.499  1.00 18.29 ? 179  GLN B N   1 
ATOM   4611 C  CA  . GLN B 1 179 ? 7.359   -7.375  31.847  1.00 19.34 ? 179  GLN B CA  1 
ATOM   4612 C  C   . GLN B 1 179 ? 6.886   -8.123  30.616  1.00 20.44 ? 179  GLN B C   1 
ATOM   4613 O  O   . GLN B 1 179 ? 6.925   -7.599  29.495  1.00 19.26 ? 179  GLN B O   1 
ATOM   4614 C  CB  . GLN B 1 179 ? 6.330   -6.423  32.471  1.00 19.93 ? 179  GLN B CB  1 
ATOM   4615 C  CG  . GLN B 1 179 ? 4.991   -7.034  32.710  1.00 20.00 ? 179  GLN B CG  1 
ATOM   4616 C  CD  . GLN B 1 179 ? 4.060   -6.277  33.622  1.00 16.81 ? 179  GLN B CD  1 
ATOM   4617 O  OE1 . GLN B 1 179 ? 2.900   -6.659  33.581  1.00 17.71 ? 179  GLN B OE1 1 
ATOM   4618 N  NE2 . GLN B 1 179 ? 4.456   -5.294  34.425  1.00 16.50 ? 179  GLN B NE2 1 
ATOM   4619 N  N   . MET B 1 180 ? 6.531   -9.392  30.783  1.00 21.71 ? 180  MET B N   1 
ATOM   4620 C  CA  . MET B 1 180 ? 6.078   -10.200 29.649  1.00 24.17 ? 180  MET B CA  1 
ATOM   4621 C  C   . MET B 1 180 ? 5.077   -11.228 30.152  1.00 24.49 ? 180  MET B C   1 
ATOM   4622 O  O   . MET B 1 180 ? 5.032   -11.493 31.359  1.00 24.07 ? 180  MET B O   1 
ATOM   4623 C  CB  . MET B 1 180 ? 7.247   -10.814 28.893  1.00 26.10 ? 180  MET B CB  1 
ATOM   4624 C  CG  . MET B 1 180 ? 8.264   -11.601 29.688  1.00 28.24 ? 180  MET B CG  1 
ATOM   4625 S  SD  . MET B 1 180 ? 9.848   -11.814 28.834  1.00 31.50 ? 180  MET B SD  1 
ATOM   4626 C  CE  . MET B 1 180 ? 10.553  -10.183 29.110  1.00 30.52 ? 180  MET B CE  1 
ATOM   4627 N  N   . ARG B 1 181 ? 4.236   -11.750 29.263  1.00 25.05 ? 181  ARG B N   1 
ATOM   4628 C  CA  . ARG B 1 181 ? 3.277   -12.763 29.691  1.00 27.00 ? 181  ARG B CA  1 
ATOM   4629 C  C   . ARG B 1 181 ? 3.357   -13.995 28.797  1.00 28.84 ? 181  ARG B C   1 
ATOM   4630 O  O   . ARG B 1 181 ? 2.514   -14.208 27.935  1.00 28.69 ? 181  ARG B O   1 
ATOM   4631 C  CB  . ARG B 1 181 ? 1.855   -12.208 29.749  1.00 26.53 ? 181  ARG B CB  1 
ATOM   4632 C  CG  . ARG B 1 181 ? 0.973   -13.071 30.653  1.00 26.65 ? 181  ARG B CG  1 
ATOM   4633 C  CD  . ARG B 1 181 ? -0.443  -12.552 30.732  1.00 26.43 ? 181  ARG B CD  1 
ATOM   4634 N  NE  . ARG B 1 181 ? -1.252  -13.284 31.710  1.00 26.65 ? 181  ARG B NE  1 
ATOM   4635 C  CZ  . ARG B 1 181 ? -2.427  -12.833 32.142  1.00 26.93 ? 181  ARG B CZ  1 
ATOM   4636 N  NH1 . ARG B 1 181 ? -2.908  -11.682 31.686  1.00 26.66 ? 181  ARG B NH1 1 
ATOM   4637 N  NH2 . ARG B 1 181 ? -3.140  -13.514 33.031  1.00 27.49 ? 181  ARG B NH2 1 
ATOM   4638 N  N   . PRO B 1 182 ? 4.376   -14.812 29.063  1.00 31.13 ? 182  PRO B N   1 
ATOM   4639 C  CA  . PRO B 1 182 ? 4.692   -15.965 28.242  1.00 33.28 ? 182  PRO B CA  1 
ATOM   4640 C  C   . PRO B 1 182 ? 3.516   -16.913 28.091  1.00 35.04 ? 182  PRO B C   1 
ATOM   4641 O  O   . PRO B 1 182 ? 3.320   -17.440 26.988  1.00 36.40 ? 182  PRO B O   1 
ATOM   4642 C  CB  . PRO B 1 182 ? 5.887   -16.622 28.903  1.00 32.72 ? 182  PRO B CB  1 
ATOM   4643 C  CG  . PRO B 1 182 ? 6.135   -15.923 30.180  1.00 32.54 ? 182  PRO B CG  1 
ATOM   4644 C  CD  . PRO B 1 182 ? 5.091   -14.869 30.363  1.00 31.98 ? 182  PRO B CD  1 
ATOM   4645 N  N   . ASP B 1 183 ? 2.740   -17.176 29.153  1.00 36.86 ? 183  ASP B N   1 
ATOM   4646 C  CA  . ASP B 1 183 ? 1.391   -17.662 28.851  1.00 37.72 ? 183  ASP B CA  1 
ATOM   4647 C  C   . ASP B 1 183 ? 0.305   -17.102 29.748  1.00 37.63 ? 183  ASP B C   1 
ATOM   4648 O  O   . ASP B 1 183 ? 0.428   -16.637 30.874  1.00 37.58 ? 183  ASP B O   1 
ATOM   4649 C  CB  . ASP B 1 183 ? 1.337   -19.189 28.752  1.00 39.14 ? 183  ASP B CB  1 
ATOM   4650 C  CG  . ASP B 1 183 ? 0.658   -19.574 27.440  1.00 40.02 ? 183  ASP B CG  1 
ATOM   4651 O  OD1 . ASP B 1 183 ? -0.375  -18.949 27.113  1.00 40.48 ? 183  ASP B OD1 1 
ATOM   4652 O  OD2 . ASP B 1 183 ? 1.163   -20.469 26.733  1.00 40.52 ? 183  ASP B OD2 1 
ATOM   4653 N  N   . ASN B 1 184 ? -0.891  -17.170 29.185  1.00 36.93 ? 184  ASN B N   1 
ATOM   4654 C  CA  . ASN B 1 184 ? -2.125  -16.538 29.561  1.00 36.54 ? 184  ASN B CA  1 
ATOM   4655 C  C   . ASN B 1 184 ? -2.809  -17.072 30.807  1.00 35.62 ? 184  ASN B C   1 
ATOM   4656 O  O   . ASN B 1 184 ? -3.813  -16.497 31.240  1.00 35.30 ? 184  ASN B O   1 
ATOM   4657 C  CB  . ASN B 1 184 ? -3.080  -16.768 28.367  1.00 37.15 ? 184  ASN B CB  1 
ATOM   4658 C  CG  . ASN B 1 184 ? -3.802  -15.517 27.927  1.00 37.41 ? 184  ASN B CG  1 
ATOM   4659 O  OD1 . ASN B 1 184 ? -4.957  -15.577 27.507  1.00 37.81 ? 184  ASN B OD1 1 
ATOM   4660 N  ND2 . ASN B 1 184 ? -3.112  -14.385 28.006  1.00 37.35 ? 184  ASN B ND2 1 
ATOM   4661 N  N   . SER B 1 185 ? -2.309  -18.166 31.370  1.00 34.52 ? 185  SER B N   1 
ATOM   4662 C  CA  . SER B 1 185 ? -2.871  -18.738 32.582  1.00 33.50 ? 185  SER B CA  1 
ATOM   4663 C  C   . SER B 1 185 ? -2.249  -18.145 33.839  1.00 32.81 ? 185  SER B C   1 
ATOM   4664 O  O   . SER B 1 185 ? -2.864  -18.175 34.906  1.00 33.15 ? 185  SER B O   1 
ATOM   4665 C  CB  . SER B 1 185 ? -2.669  -20.258 32.595  1.00 33.16 ? 185  SER B CB  1 
ATOM   4666 O  OG  . SER B 1 185 ? -3.254  -20.852 31.452  1.00 33.03 ? 185  SER B OG  1 
ATOM   4667 N  N   . LYS B 1 186 ? -1.017  -17.657 33.729  1.00 31.59 ? 186  LYS B N   1 
ATOM   4668 C  CA  . LYS B 1 186 ? -0.332  -17.085 34.878  1.00 30.50 ? 186  LYS B CA  1 
ATOM   4669 C  C   . LYS B 1 186 ? -0.220  -15.569 34.732  1.00 29.47 ? 186  LYS B C   1 
ATOM   4670 O  O   . LYS B 1 186 ? -0.349  -15.015 33.642  1.00 28.59 ? 186  LYS B O   1 
ATOM   4671 C  CB  . LYS B 1 186 ? 1.060   -17.682 35.077  1.00 30.74 ? 186  LYS B CB  1 
ATOM   4672 C  CG  . LYS B 1 186 ? 1.120   -19.132 35.510  1.00 31.15 ? 186  LYS B CG  1 
ATOM   4673 C  CD  . LYS B 1 186 ? 0.308   -19.415 36.761  1.00 31.27 ? 186  LYS B CD  1 
ATOM   4674 C  CE  . LYS B 1 186 ? 0.835   -20.636 37.499  1.00 31.32 ? 186  LYS B CE  1 
ATOM   4675 N  NZ  . LYS B 1 186 ? -0.242  -21.629 37.751  1.00 30.25 ? 186  LYS B NZ  1 
ATOM   4676 N  N   . PRO B 1 187 ? 0.012   -14.909 35.860  1.00 28.23 ? 187  PRO B N   1 
ATOM   4677 C  CA  . PRO B 1 187 ? 0.347   -13.497 35.868  1.00 27.24 ? 187  PRO B CA  1 
ATOM   4678 C  C   . PRO B 1 187 ? 1.600   -13.228 35.054  1.00 25.71 ? 187  PRO B C   1 
ATOM   4679 O  O   . PRO B 1 187 ? 2.434   -14.110 34.832  1.00 25.09 ? 187  PRO B O   1 
ATOM   4680 C  CB  . PRO B 1 187 ? 0.555   -13.179 37.342  1.00 27.94 ? 187  PRO B CB  1 
ATOM   4681 C  CG  . PRO B 1 187 ? -0.292  -14.174 38.063  1.00 28.21 ? 187  PRO B CG  1 
ATOM   4682 C  CD  . PRO B 1 187 ? -0.252  -15.425 37.227  1.00 28.65 ? 187  PRO B CD  1 
ATOM   4683 N  N   . PRO B 1 188 ? 1.745   -11.992 34.586  1.00 24.15 ? 188  PRO B N   1 
ATOM   4684 C  CA  . PRO B 1 188 ? 2.961   -11.571 33.913  1.00 23.34 ? 188  PRO B CA  1 
ATOM   4685 C  C   . PRO B 1 188 ? 4.187   -11.752 34.789  1.00 22.53 ? 188  PRO B C   1 
ATOM   4686 O  O   . PRO B 1 188 ? 4.108   -11.770 36.023  1.00 22.14 ? 188  PRO B O   1 
ATOM   4687 C  CB  . PRO B 1 188 ? 2.719   -10.099 33.594  1.00 23.14 ? 188  PRO B CB  1 
ATOM   4688 C  CG  . PRO B 1 188 ? 1.775   -9.648  34.651  1.00 23.58 ? 188  PRO B CG  1 
ATOM   4689 C  CD  . PRO B 1 188 ? 0.888   -10.832 34.944  1.00 24.16 ? 188  PRO B CD  1 
ATOM   4690 N  N   . VAL B 1 189 ? 5.341   -11.906 34.146  1.00 22.03 ? 189  VAL B N   1 
ATOM   4691 C  CA  . VAL B 1 189 ? 6.607   -12.035 34.849  1.00 21.93 ? 189  VAL B CA  1 
ATOM   4692 C  C   . VAL B 1 189 ? 7.540   -10.872 34.514  1.00 21.38 ? 189  VAL B C   1 
ATOM   4693 O  O   . VAL B 1 189 ? 7.338   -10.160 33.528  1.00 20.89 ? 189  VAL B O   1 
ATOM   4694 C  CB  . VAL B 1 189 ? 7.344   -13.347 34.516  1.00 22.87 ? 189  VAL B CB  1 
ATOM   4695 C  CG1 . VAL B 1 189 ? 6.571   -14.552 35.022  1.00 23.63 ? 189  VAL B CG1 1 
ATOM   4696 C  CG2 . VAL B 1 189 ? 7.586   -13.460 33.015  1.00 23.40 ? 189  VAL B CG2 1 
ATOM   4697 N  N   . TYR B 1 190 ? 8.557   -10.698 35.338  1.00 20.08 ? 190  TYR B N   1 
ATOM   4698 C  CA  . TYR B 1 190 ? 9.649   -9.774  35.083  1.00 19.30 ? 190  TYR B CA  1 
ATOM   4699 C  C   . TYR B 1 190 ? 10.903  -10.573 34.731  1.00 19.91 ? 190  TYR B C   1 
ATOM   4700 O  O   . TYR B 1 190 ? 11.239  -11.542 35.424  1.00 19.80 ? 190  TYR B O   1 
ATOM   4701 C  CB  . TYR B 1 190 ? 9.922   -8.874  36.287  1.00 18.56 ? 190  TYR B CB  1 
ATOM   4702 C  CG  . TYR B 1 190 ? 11.186  -8.051  36.211  1.00 17.99 ? 190  TYR B CG  1 
ATOM   4703 C  CD1 . TYR B 1 190 ? 11.193  -6.826  35.551  1.00 17.67 ? 190  TYR B CD1 1 
ATOM   4704 C  CD2 . TYR B 1 190 ? 12.379  -8.467  36.786  1.00 17.61 ? 190  TYR B CD2 1 
ATOM   4705 C  CE1 . TYR B 1 190 ? 12.332  -6.058  35.469  1.00 17.58 ? 190  TYR B CE1 1 
ATOM   4706 C  CE2 . TYR B 1 190 ? 13.530  -7.708  36.716  1.00 18.40 ? 190  TYR B CE2 1 
ATOM   4707 C  CZ  . TYR B 1 190 ? 13.504  -6.500  36.045  1.00 18.21 ? 190  TYR B CZ  1 
ATOM   4708 O  OH  . TYR B 1 190 ? 14.642  -5.733  35.962  1.00 18.91 ? 190  TYR B OH  1 
ATOM   4709 N  N   . GLY B 1 191 ? 11.583  -10.166 33.668  1.00 19.03 ? 191  GLY B N   1 
ATOM   4710 C  CA  . GLY B 1 191 ? 12.787  -10.871 33.255  1.00 18.85 ? 191  GLY B CA  1 
ATOM   4711 C  C   . GLY B 1 191 ? 13.367  -10.276 31.980  1.00 18.96 ? 191  GLY B C   1 
ATOM   4712 O  O   . GLY B 1 191 ? 12.874  -9.272  31.466  1.00 18.19 ? 191  GLY B O   1 
ATOM   4713 N  N   . ALA B 1 192 ? 14.446  -10.900 31.517  1.00 18.91 ? 192  ALA B N   1 
ATOM   4714 C  CA  . ALA B 1 192 ? 15.092  -10.475 30.280  1.00 18.09 ? 192  ALA B CA  1 
ATOM   4715 C  C   . ALA B 1 192 ? 14.252  -10.874 29.076  1.00 18.00 ? 192  ALA B C   1 
ATOM   4716 O  O   . ALA B 1 192 ? 13.635  -11.937 29.023  1.00 17.19 ? 192  ALA B O   1 
ATOM   4717 C  CB  . ALA B 1 192 ? 16.488  -11.079 30.203  1.00 18.91 ? 192  ALA B CB  1 
ATOM   4718 N  N   . CYS B 1 193 ? 14.198  -9.975  28.093  1.00 16.55 ? 193  CYS B N   1 
ATOM   4719 C  CA  . CYS B 1 193 ? 13.522  -10.264 26.833  1.00 17.18 ? 193  CYS B CA  1 
ATOM   4720 C  C   . CYS B 1 193 ? 13.998  -11.588 26.246  1.00 17.53 ? 193  CYS B C   1 
ATOM   4721 O  O   . CYS B 1 193 ? 15.207  -11.819 26.179  1.00 17.69 ? 193  CYS B O   1 
ATOM   4722 C  CB  . CYS B 1 193 ? 13.798  -9.090  25.893  1.00 17.12 ? 193  CYS B CB  1 
ATOM   4723 S  SG  . CYS B 1 193 ? 13.408  -9.372  24.163  1.00 16.66 ? 193  CYS B SG  1 
ATOM   4724 N  N   . ARG B 1 194 ? 13.066  -12.418 25.804  1.00 18.17 ? 194  ARG B N   1 
ATOM   4725 C  CA  . ARG B 1 194 ? 13.423  -13.699 25.195  1.00 20.21 ? 194  ARG B CA  1 
ATOM   4726 C  C   . ARG B 1 194 ? 13.300  -13.692 23.684  1.00 19.37 ? 194  ARG B C   1 
ATOM   4727 O  O   . ARG B 1 194 ? 13.693  -14.639 22.997  1.00 20.33 ? 194  ARG B O   1 
ATOM   4728 C  CB  . ARG B 1 194 ? 12.551  -14.810 25.794  1.00 22.32 ? 194  ARG B CB  1 
ATOM   4729 C  CG  . ARG B 1 194 ? 12.826  -15.021 27.280  1.00 25.33 ? 194  ARG B CG  1 
ATOM   4730 C  CD  . ARG B 1 194 ? 11.818  -15.994 27.886  1.00 28.39 ? 194  ARG B CD  1 
ATOM   4731 N  NE  . ARG B 1 194 ? 11.949  -16.014 29.336  1.00 31.26 ? 194  ARG B NE  1 
ATOM   4732 C  CZ  . ARG B 1 194 ? 11.117  -16.487 30.246  1.00 32.98 ? 194  ARG B CZ  1 
ATOM   4733 N  NH1 . ARG B 1 194 ? 9.958   -17.050 29.925  1.00 33.91 ? 194  ARG B NH1 1 
ATOM   4734 N  NH2 . ARG B 1 194 ? 11.448  -16.395 31.532  1.00 33.99 ? 194  ARG B NH2 1 
ATOM   4735 N  N   . LEU B 1 195 ? 12.667  -12.663 23.131  1.00 18.70 ? 195  LEU B N   1 
ATOM   4736 C  CA  . LEU B 1 195 ? 12.397  -12.586 21.699  1.00 17.44 ? 195  LEU B CA  1 
ATOM   4737 C  C   . LEU B 1 195 ? 12.881  -11.240 21.162  1.00 16.29 ? 195  LEU B C   1 
ATOM   4738 O  O   . LEU B 1 195 ? 12.097  -10.342 20.845  1.00 16.09 ? 195  LEU B O   1 
ATOM   4739 C  CB  . LEU B 1 195 ? 10.912  -12.771 21.397  1.00 18.61 ? 195  LEU B CB  1 
ATOM   4740 C  CG  . LEU B 1 195 ? 10.200  -14.009 21.955  1.00 20.21 ? 195  LEU B CG  1 
ATOM   4741 C  CD1 . LEU B 1 195 ? 8.698   -13.899 21.746  1.00 21.02 ? 195  LEU B CD1 1 
ATOM   4742 C  CD2 . LEU B 1 195 ? 10.766  -15.274 21.325  1.00 20.72 ? 195  LEU B CD2 1 
ATOM   4743 N  N   . LEU B 1 196 ? 14.194  -11.079 21.108  1.00 15.16 ? 196  LEU B N   1 
ATOM   4744 C  CA  . LEU B 1 196 ? 14.832  -9.842  20.671  1.00 14.70 ? 196  LEU B CA  1 
ATOM   4745 C  C   . LEU B 1 196 ? 15.060  -9.862  19.165  1.00 15.25 ? 196  LEU B C   1 
ATOM   4746 O  O   . LEU B 1 196 ? 15.592  -10.822 18.602  1.00 15.01 ? 196  LEU B O   1 
ATOM   4747 C  CB  . LEU B 1 196 ? 16.157  -9.668  21.408  1.00 14.64 ? 196  LEU B CB  1 
ATOM   4748 C  CG  . LEU B 1 196 ? 16.932  -8.370  21.177  1.00 14.46 ? 196  LEU B CG  1 
ATOM   4749 C  CD1 . LEU B 1 196 ? 16.137  -7.157  21.635  1.00 15.77 ? 196  LEU B CD1 1 
ATOM   4750 C  CD2 . LEU B 1 196 ? 18.273  -8.436  21.896  1.00 14.45 ? 196  LEU B CD2 1 
ATOM   4751 N  N   . ASP B 1 197 ? 14.649  -8.779  18.503  1.00 14.34 ? 197  ASP B N   1 
ATOM   4752 C  CA  . ASP B 1 197 ? 14.616  -8.759  17.046  1.00 13.84 ? 197  ASP B CA  1 
ATOM   4753 C  C   . ASP B 1 197 ? 15.189  -7.456  16.499  1.00 13.73 ? 197  ASP B C   1 
ATOM   4754 O  O   . ASP B 1 197 ? 15.311  -6.452  17.202  1.00 14.09 ? 197  ASP B O   1 
ATOM   4755 C  CB  . ASP B 1 197 ? 13.174  -8.955  16.577  1.00 14.00 ? 197  ASP B CB  1 
ATOM   4756 C  CG  . ASP B 1 197 ? 12.990  -9.410  15.151  1.00 13.94 ? 197  ASP B CG  1 
ATOM   4757 O  OD1 . ASP B 1 197 ? 13.996  -9.603  14.435  1.00 13.80 ? 197  ASP B OD1 1 
ATOM   4758 O  OD2 . ASP B 1 197 ? 11.816  -9.589  14.743  1.00 14.59 ? 197  ASP B OD2 1 
ATOM   4759 N  N   . MET B 1 198 ? 15.549  -7.500  15.220  1.00 13.54 ? 198  MET B N   1 
ATOM   4760 C  CA  . MET B 1 198 ? 15.917  -6.296  14.479  1.00 14.14 ? 198  MET B CA  1 
ATOM   4761 C  C   . MET B 1 198 ? 14.743  -5.911  13.589  1.00 12.99 ? 198  MET B C   1 
ATOM   4762 O  O   . MET B 1 198 ? 13.844  -6.735  13.401  1.00 14.19 ? 198  MET B O   1 
ATOM   4763 C  CB  . MET B 1 198 ? 17.150  -6.554  13.613  1.00 16.63 ? 198  MET B CB  1 
ATOM   4764 C  CG  . MET B 1 198 ? 16.950  -7.662  12.589  1.00 19.74 ? 198  MET B CG  1 
ATOM   4765 S  SD  . MET B 1 198 ? 16.482  -7.013  10.981  1.00 22.03 ? 198  MET B SD  1 
ATOM   4766 C  CE  . MET B 1 198 ? 16.484  -8.497  9.969   1.00 21.47 ? 198  MET B CE  1 
ATOM   4767 N  N   . GLU B 1 199 ? 14.731  -4.688  13.072  1.00 12.58 ? 199  GLU B N   1 
ATOM   4768 C  CA  . GLU B 1 199 ? 13.771  -4.336  12.021  1.00 12.44 ? 199  GLU B CA  1 
ATOM   4769 C  C   . GLU B 1 199 ? 14.462  -3.450  10.989  1.00 12.13 ? 199  GLU B C   1 
ATOM   4770 O  O   . GLU B 1 199 ? 14.936  -2.363  11.322  1.00 12.18 ? 199  GLU B O   1 
ATOM   4771 C  CB  . GLU B 1 199 ? 12.500  -3.674  12.570  1.00 13.19 ? 199  GLU B CB  1 
ATOM   4772 C  CG  . GLU B 1 199 ? 11.563  -4.692  13.213  1.00 14.14 ? 199  GLU B CG  1 
ATOM   4773 C  CD  . GLU B 1 199 ? 10.187  -4.218  13.566  1.00 15.95 ? 199  GLU B CD  1 
ATOM   4774 O  OE1 . GLU B 1 199 ? 10.159  -3.005  13.747  1.00 16.40 ? 199  GLU B OE1 1 
ATOM   4775 O  OE2 . GLU B 1 199 ? 9.157   -4.881  13.681  1.00 16.38 ? 199  GLU B OE2 1 
ATOM   4776 N  N   . LEU B 1 200 ? 14.566  -3.944  9.760   1.00 12.15 ? 200  LEU B N   1 
ATOM   4777 C  CA  . LEU B 1 200 ? 15.206  -3.215  8.669   1.00 11.54 ? 200  LEU B CA  1 
ATOM   4778 C  C   . LEU B 1 200 ? 14.360  -2.034  8.229   1.00 11.15 ? 200  LEU B C   1 
ATOM   4779 O  O   . LEU B 1 200 ? 13.217  -2.241  7.806   1.00 10.92 ? 200  LEU B O   1 
ATOM   4780 C  CB  . LEU B 1 200 ? 15.379  -4.142  7.454   1.00 11.59 ? 200  LEU B CB  1 
ATOM   4781 C  CG  . LEU B 1 200 ? 15.736  -3.479  6.117   1.00 12.58 ? 200  LEU B CG  1 
ATOM   4782 C  CD1 . LEU B 1 200 ? 17.076  -2.772  6.205   1.00 13.20 ? 200  LEU B CD1 1 
ATOM   4783 C  CD2 . LEU B 1 200 ? 15.695  -4.496  4.986   1.00 13.11 ? 200  LEU B CD2 1 
ATOM   4784 N  N   . GLU B 1 201 ? 14.852  -0.806  8.397   1.00 9.72  ? 201  GLU B N   1 
ATOM   4785 C  CA  . GLU B 1 201 ? 14.093  0.354   7.905   1.00 10.77 ? 201  GLU B CA  1 
ATOM   4786 C  C   . GLU B 1 201 ? 15.009  1.383   7.251   1.00 10.51 ? 201  GLU B C   1 
ATOM   4787 O  O   . GLU B 1 201 ? 16.227  1.308   7.342   1.00 11.20 ? 201  GLU B O   1 
ATOM   4788 C  CB  . GLU B 1 201 ? 13.411  1.138   9.035   1.00 10.91 ? 201  GLU B CB  1 
ATOM   4789 C  CG  . GLU B 1 201 ? 12.637  0.231   9.928   1.00 12.31 ? 201  GLU B CG  1 
ATOM   4790 C  CD  . GLU B 1 201 ? 11.606  0.871   10.807  1.00 14.26 ? 201  GLU B CD  1 
ATOM   4791 O  OE1 . GLU B 1 201 ? 11.139  1.990   10.667  1.00 13.81 ? 201  GLU B OE1 1 
ATOM   4792 O  OE2 . GLU B 1 201 ? 11.334  0.009   11.641  1.00 14.37 ? 201  GLU B OE2 1 
ATOM   4793 N  N   . MET B 1 202 ? 14.362  2.365   6.608   1.00 10.99 ? 202  MET B N   1 
ATOM   4794 C  CA  . MET B 1 202 ? 15.063  3.603   6.276   1.00 10.27 ? 202  MET B CA  1 
ATOM   4795 C  C   . MET B 1 202 ? 14.257  4.766   6.856   1.00 10.81 ? 202  MET B C   1 
ATOM   4796 O  O   . MET B 1 202 ? 13.062  4.599   7.138   1.00 11.74 ? 202  MET B O   1 
ATOM   4797 C  CB  . MET B 1 202 ? 15.272  3.788   4.779   1.00 11.36 ? 202  MET B CB  1 
ATOM   4798 C  CG  . MET B 1 202 ? 16.123  2.676   4.167   1.00 11.14 ? 202  MET B CG  1 
ATOM   4799 S  SD  . MET B 1 202 ? 16.543  3.047   2.458   1.00 11.39 ? 202  MET B SD  1 
ATOM   4800 C  CE  . MET B 1 202 ? 17.811  4.281   2.667   1.00 13.19 ? 202  MET B CE  1 
ATOM   4801 N  N   . ALA B 1 203 ? 14.911  5.907   7.015   1.00 10.87 ? 203  ALA B N   1 
ATOM   4802 C  CA  . ALA B 1 203 ? 14.200  7.052   7.582   1.00 11.38 ? 203  ALA B CA  1 
ATOM   4803 C  C   . ALA B 1 203 ? 14.652  8.333   6.907   1.00 11.34 ? 203  ALA B C   1 
ATOM   4804 O  O   . ALA B 1 203 ? 15.800  8.424   6.458   1.00 11.87 ? 203  ALA B O   1 
ATOM   4805 C  CB  . ALA B 1 203 ? 14.433  7.108   9.086   1.00 11.16 ? 203  ALA B CB  1 
ATOM   4806 N  N   . PHE B 1 204 ? 13.772  9.326   6.845   1.00 10.73 ? 204  PHE B N   1 
ATOM   4807 C  CA  . PHE B 1 204 ? 14.175  10.617  6.298   1.00 10.31 ? 204  PHE B CA  1 
ATOM   4808 C  C   . PHE B 1 204 ? 14.091  11.730  7.329   1.00 10.66 ? 204  PHE B C   1 
ATOM   4809 O  O   . PHE B 1 204 ? 13.251  11.694  8.236   1.00 11.91 ? 204  PHE B O   1 
ATOM   4810 C  CB  . PHE B 1 204 ? 13.337  10.987  5.081   1.00 9.68  ? 204  PHE B CB  1 
ATOM   4811 C  CG  . PHE B 1 204 ? 11.874  11.246  5.261   1.00 10.33 ? 204  PHE B CG  1 
ATOM   4812 C  CD1 . PHE B 1 204 ? 11.413  12.534  5.469   1.00 10.54 ? 204  PHE B CD1 1 
ATOM   4813 C  CD2 . PHE B 1 204 ? 10.949  10.215  5.178   1.00 10.36 ? 204  PHE B CD2 1 
ATOM   4814 C  CE1 . PHE B 1 204 ? 10.054  12.789  5.593   1.00 10.28 ? 204  PHE B CE1 1 
ATOM   4815 C  CE2 . PHE B 1 204 ? 9.595   10.459  5.304   1.00 10.50 ? 204  PHE B CE2 1 
ATOM   4816 C  CZ  . PHE B 1 204 ? 9.148   11.748  5.509   1.00 10.87 ? 204  PHE B CZ  1 
ATOM   4817 N  N   . PHE B 1 205 ? 14.978  12.702  7.188   1.00 9.65  ? 205  PHE B N   1 
ATOM   4818 C  CA  . PHE B 1 205 ? 14.983  13.895  8.024   1.00 10.27 ? 205  PHE B CA  1 
ATOM   4819 C  C   . PHE B 1 205 ? 14.170  15.022  7.393   1.00 10.84 ? 205  PHE B C   1 
ATOM   4820 O  O   . PHE B 1 205 ? 14.242  15.240  6.173   1.00 10.86 ? 205  PHE B O   1 
ATOM   4821 C  CB  . PHE B 1 205 ? 16.436  14.357  8.214   1.00 9.87  ? 205  PHE B CB  1 
ATOM   4822 C  CG  . PHE B 1 205 ? 17.177  13.554  9.251   1.00 10.61 ? 205  PHE B CG  1 
ATOM   4823 C  CD1 . PHE B 1 205 ? 18.094  12.576  8.894   1.00 10.96 ? 205  PHE B CD1 1 
ATOM   4824 C  CD2 . PHE B 1 205 ? 16.935  13.795  10.595  1.00 10.27 ? 205  PHE B CD2 1 
ATOM   4825 C  CE1 . PHE B 1 205 ? 18.766  11.870  9.881   1.00 9.86  ? 205  PHE B CE1 1 
ATOM   4826 C  CE2 . PHE B 1 205 ? 17.606  13.084  11.572  1.00 11.02 ? 205  PHE B CE2 1 
ATOM   4827 C  CZ  . PHE B 1 205 ? 18.520  12.115  11.216  1.00 10.29 ? 205  PHE B CZ  1 
ATOM   4828 N  N   . VAL B 1 206 ? 13.422  15.715  8.241   1.00 10.75 ? 206  VAL B N   1 
ATOM   4829 C  CA  . VAL B 1 206 ? 12.653  16.884  7.813   1.00 10.81 ? 206  VAL B CA  1 
ATOM   4830 C  C   . VAL B 1 206 ? 13.533  18.120  7.694   1.00 11.13 ? 206  VAL B C   1 
ATOM   4831 O  O   . VAL B 1 206 ? 14.417  18.378  8.512   1.00 11.75 ? 206  VAL B O   1 
ATOM   4832 C  CB  . VAL B 1 206 ? 11.505  17.153  8.807   1.00 10.91 ? 206  VAL B CB  1 
ATOM   4833 C  CG1 . VAL B 1 206 ? 10.743  18.432  8.483   1.00 11.45 ? 206  VAL B CG1 1 
ATOM   4834 C  CG2 . VAL B 1 206 ? 10.566  15.951  8.830   1.00 11.28 ? 206  VAL B CG2 1 
ATOM   4835 N  N   . GLY B 1 207 ? 13.287  18.877  6.628   1.00 11.72 ? 207  GLY B N   1 
ATOM   4836 C  CA  . GLY B 1 207 ? 13.909  20.186  6.424   1.00 13.31 ? 207  GLY B CA  1 
ATOM   4837 C  C   . GLY B 1 207 ? 13.109  21.280  7.109   1.00 14.46 ? 207  GLY B C   1 
ATOM   4838 O  O   . GLY B 1 207 ? 12.819  21.199  8.300   1.00 14.75 ? 207  GLY B O   1 
ATOM   4839 N  N   . PRO B 1 208 ? 12.737  22.333  6.381   1.00 14.75 ? 208  PRO B N   1 
ATOM   4840 C  CA  . PRO B 1 208 ? 11.950  23.408  6.961   1.00 15.51 ? 208  PRO B CA  1 
ATOM   4841 C  C   . PRO B 1 208 ? 10.682  22.822  7.574   1.00 15.88 ? 208  PRO B C   1 
ATOM   4842 O  O   . PRO B 1 208 ? 10.148  21.866  7.004   1.00 17.30 ? 208  PRO B O   1 
ATOM   4843 C  CB  . PRO B 1 208 ? 11.637  24.325  5.791   1.00 16.03 ? 208  PRO B CB  1 
ATOM   4844 C  CG  . PRO B 1 208 ? 12.557  23.930  4.697   1.00 16.15 ? 208  PRO B CG  1 
ATOM   4845 C  CD  . PRO B 1 208 ? 12.952  22.492  4.925   1.00 15.57 ? 208  PRO B CD  1 
ATOM   4846 N  N   . GLY B 1 209 ? 10.269  23.338  8.721   1.00 16.38 ? 209  GLY B N   1 
ATOM   4847 C  CA  . GLY B 1 209 ? 9.012   22.808  9.277   1.00 17.25 ? 209  GLY B CA  1 
ATOM   4848 C  C   . GLY B 1 209 ? 7.790   23.421  8.603   1.00 16.80 ? 209  GLY B C   1 
ATOM   4849 O  O   . GLY B 1 209 ? 7.865   24.170  7.624   1.00 18.72 ? 209  GLY B O   1 
ATOM   4850 N  N   . ASN B 1 210 ? 6.625   23.057  9.129   1.00 14.90 ? 210  ASN B N   1 
ATOM   4851 C  CA  . ASN B 1 210 ? 5.389   23.785  8.852   1.00 14.05 ? 210  ASN B CA  1 
ATOM   4852 C  C   . ASN B 1 210 ? 4.953   24.491  10.132  1.00 14.16 ? 210  ASN B C   1 
ATOM   4853 O  O   . ASN B 1 210 ? 5.273   24.019  11.220  1.00 13.71 ? 210  ASN B O   1 
ATOM   4854 C  CB  . ASN B 1 210 ? 4.289   22.853  8.362   1.00 12.82 ? 210  ASN B CB  1 
ATOM   4855 C  CG  . ASN B 1 210 ? 3.997   21.689  9.291   1.00 12.38 ? 210  ASN B CG  1 
ATOM   4856 O  OD1 . ASN B 1 210 ? 4.904   20.922  9.618   1.00 11.48 ? 210  ASN B OD1 1 
ATOM   4857 N  ND2 . ASN B 1 210 ? 2.747   21.531  9.705   1.00 12.02 ? 210  ASN B ND2 1 
ATOM   4858 N  N   . ARG B 1 211 ? 4.212   25.582  9.988   1.00 14.86 ? 211  ARG B N   1 
ATOM   4859 C  CA  . ARG B 1 211 ? 3.688   26.280  11.154  1.00 16.31 ? 211  ARG B CA  1 
ATOM   4860 C  C   . ARG B 1 211 ? 2.633   25.424  11.858  1.00 15.09 ? 211  ARG B C   1 
ATOM   4861 O  O   . ARG B 1 211 ? 1.819   24.771  11.216  1.00 14.44 ? 211  ARG B O   1 
ATOM   4862 C  CB  . ARG B 1 211 ? 3.089   27.629  10.759  1.00 19.40 ? 211  ARG B CB  1 
ATOM   4863 C  CG  . ARG B 1 211 ? 4.130   28.693  10.441  1.00 23.58 ? 211  ARG B CG  1 
ATOM   4864 C  CD  . ARG B 1 211 ? 3.473   30.066  10.322  1.00 26.58 ? 211  ARG B CD  1 
ATOM   4865 N  NE  . ARG B 1 211 ? 4.360   31.095  10.864  1.00 30.23 ? 211  ARG B NE  1 
ATOM   4866 C  CZ  . ARG B 1 211 ? 3.932   32.165  11.529  1.00 31.40 ? 211  ARG B CZ  1 
ATOM   4867 N  NH1 . ARG B 1 211 ? 2.637   32.352  11.746  1.00 32.62 ? 211  ARG B NH1 1 
ATOM   4868 N  NH2 . ARG B 1 211 ? 4.811   33.046  11.988  1.00 32.87 ? 211  ARG B NH2 1 
ATOM   4869 N  N   . PHE B 1 212 ? 2.662   25.466  13.182  1.00 14.35 ? 212  PHE B N   1 
ATOM   4870 C  CA  . PHE B 1 212 ? 1.633   24.835  14.004  1.00 13.43 ? 212  PHE B CA  1 
ATOM   4871 C  C   . PHE B 1 212 ? 0.240   25.226  13.517  1.00 13.37 ? 212  PHE B C   1 
ATOM   4872 O  O   . PHE B 1 212 ? -0.090  26.410  13.448  1.00 13.86 ? 212  PHE B O   1 
ATOM   4873 C  CB  . PHE B 1 212 ? 1.826   25.262  15.461  1.00 13.57 ? 212  PHE B CB  1 
ATOM   4874 C  CG  . PHE B 1 212 ? 0.830   24.744  16.453  1.00 13.45 ? 212  PHE B CG  1 
ATOM   4875 C  CD1 . PHE B 1 212 ? 0.855   23.421  16.869  1.00 13.40 ? 212  PHE B CD1 1 
ATOM   4876 C  CD2 . PHE B 1 212 ? -0.139  25.582  16.992  1.00 13.01 ? 212  PHE B CD2 1 
ATOM   4877 C  CE1 . PHE B 1 212 ? -0.060  22.951  17.790  1.00 14.00 ? 212  PHE B CE1 1 
ATOM   4878 C  CE2 . PHE B 1 212 ? -1.049  25.112  17.911  1.00 13.17 ? 212  PHE B CE2 1 
ATOM   4879 C  CZ  . PHE B 1 212 ? -1.029  23.792  18.318  1.00 13.74 ? 212  PHE B CZ  1 
ATOM   4880 N  N   . GLY B 1 213 ? -0.568  24.237  13.161  1.00 12.61 ? 213  GLY B N   1 
ATOM   4881 C  CA  . GLY B 1 213 ? -1.916  24.437  12.674  1.00 12.68 ? 213  GLY B CA  1 
ATOM   4882 C  C   . GLY B 1 213 ? -2.020  24.483  11.155  1.00 13.36 ? 213  GLY B C   1 
ATOM   4883 O  O   . GLY B 1 213 ? -3.136  24.585  10.646  1.00 13.61 ? 213  GLY B O   1 
ATOM   4884 N  N   . GLU B 1 214 ? -0.911  24.427  10.435  1.00 13.70 ? 214  GLU B N   1 
ATOM   4885 C  CA  . GLU B 1 214 ? -0.948  24.564  8.975   1.00 15.32 ? 214  GLU B CA  1 
ATOM   4886 C  C   . GLU B 1 214 ? -0.409  23.323  8.276   1.00 14.78 ? 214  GLU B C   1 
ATOM   4887 O  O   . GLU B 1 214 ? 0.803   23.103  8.282   1.00 15.53 ? 214  GLU B O   1 
ATOM   4888 C  CB  . GLU B 1 214 ? -0.090  25.761  8.551   1.00 17.83 ? 214  GLU B CB  1 
ATOM   4889 C  CG  . GLU B 1 214 ? -0.644  27.113  8.951   1.00 21.00 ? 214  GLU B CG  1 
ATOM   4890 C  CD  . GLU B 1 214 ? 0.172   28.282  8.436   1.00 22.72 ? 214  GLU B CD  1 
ATOM   4891 O  OE1 . GLU B 1 214 ? 1.065   28.083  7.583   1.00 23.91 ? 214  GLU B OE1 1 
ATOM   4892 O  OE2 . GLU B 1 214 ? -0.091  29.408  8.910   1.00 24.26 ? 214  GLU B OE2 1 
ATOM   4893 N  N   . PRO B 1 215 ? -1.266  22.570  7.609   1.00 13.84 ? 215  PRO B N   1 
ATOM   4894 C  CA  . PRO B 1 215 ? -0.860  21.368  6.898   1.00 13.39 ? 215  PRO B CA  1 
ATOM   4895 C  C   . PRO B 1 215 ? 0.128   21.635  5.775   1.00 13.51 ? 215  PRO B C   1 
ATOM   4896 O  O   . PRO B 1 215 ? 0.219   22.747  5.258   1.00 13.02 ? 215  PRO B O   1 
ATOM   4897 C  CB  . PRO B 1 215 ? -2.177  20.798  6.373   1.00 13.93 ? 215  PRO B CB  1 
ATOM   4898 C  CG  . PRO B 1 215 ? -3.180  21.276  7.374   1.00 15.06 ? 215  PRO B CG  1 
ATOM   4899 C  CD  . PRO B 1 215 ? -2.747  22.703  7.655   1.00 14.55 ? 215  PRO B CD  1 
ATOM   4900 N  N   . ILE B 1 216 ? 0.905   20.608  5.435   1.00 12.21 ? 216  ILE B N   1 
ATOM   4901 C  CA  . ILE B 1 216 ? 1.748   20.642  4.239   1.00 12.00 ? 216  ILE B CA  1 
ATOM   4902 C  C   . ILE B 1 216 ? 1.002   19.926  3.123   1.00 11.94 ? 216  ILE B C   1 
ATOM   4903 O  O   . ILE B 1 216 ? 0.781   18.713  3.171   1.00 11.60 ? 216  ILE B O   1 
ATOM   4904 C  CB  . ILE B 1 216 ? 3.105   19.944  4.481   1.00 11.71 ? 216  ILE B CB  1 
ATOM   4905 C  CG1 . ILE B 1 216 ? 3.842   20.578  5.656   1.00 12.93 ? 216  ILE B CG1 1 
ATOM   4906 C  CG2 . ILE B 1 216 ? 3.912   20.000  3.182   1.00 12.16 ? 216  ILE B CG2 1 
ATOM   4907 C  CD1 . ILE B 1 216 ? 5.120   19.874  6.077   1.00 12.62 ? 216  ILE B CD1 1 
ATOM   4908 N  N   . PRO B 1 217 ? 0.595   20.664  2.088   1.00 12.49 ? 217  PRO B N   1 
ATOM   4909 C  CA  . PRO B 1 217 ? -0.038  20.044  0.935   1.00 12.19 ? 217  PRO B CA  1 
ATOM   4910 C  C   . PRO B 1 217 ? 0.906   19.077  0.245   1.00 11.86 ? 217  PRO B C   1 
ATOM   4911 O  O   . PRO B 1 217 ? 2.118   19.317  0.160   1.00 11.77 ? 217  PRO B O   1 
ATOM   4912 C  CB  . PRO B 1 217 ? -0.429  21.208  0.041   1.00 13.20 ? 217  PRO B CB  1 
ATOM   4913 C  CG  . PRO B 1 217 ? -0.021  22.459  0.713   1.00 14.42 ? 217  PRO B CG  1 
ATOM   4914 C  CD  . PRO B 1 217 ? 0.840   22.098  1.897   1.00 12.50 ? 217  PRO B CD  1 
ATOM   4915 N  N   . ILE B 1 218 ? 0.379   17.977  -0.292  1.00 11.06 ? 218  ILE B N   1 
ATOM   4916 C  CA  . ILE B 1 218 ? 1.210   16.918  -0.854  1.00 12.71 ? 218  ILE B CA  1 
ATOM   4917 C  C   . ILE B 1 218 ? 2.074   17.411  -2.008  1.00 12.98 ? 218  ILE B C   1 
ATOM   4918 O  O   . ILE B 1 218 ? 3.220   16.979  -2.142  1.00 13.50 ? 218  ILE B O   1 
ATOM   4919 C  CB  . ILE B 1 218 ? 0.401   15.671  -1.250  1.00 13.16 ? 218  ILE B CB  1 
ATOM   4920 C  CG1 . ILE B 1 218 ? 1.368   14.545  -1.640  1.00 13.60 ? 218  ILE B CG1 1 
ATOM   4921 C  CG2 . ILE B 1 218 ? -0.587  15.972  -2.373  1.00 12.46 ? 218  ILE B CG2 1 
ATOM   4922 C  CD1 . ILE B 1 218 ? 0.797   13.155  -1.524  1.00 14.26 ? 218  ILE B CD1 1 
ATOM   4923 N  N   . SER B 1 219 ? 1.604   18.398  -2.770  1.00 14.32 ? 219  SER B N   1 
ATOM   4924 C  CA  . SER B 1 219 ? 2.421   18.984  -3.825  1.00 13.97 ? 219  SER B CA  1 
ATOM   4925 C  C   . SER B 1 219 ? 3.655   19.716  -3.322  1.00 13.74 ? 219  SER B C   1 
ATOM   4926 O  O   . SER B 1 219 ? 4.598   19.920  -4.098  1.00 13.94 ? 219  SER B O   1 
ATOM   4927 C  CB  . SER B 1 219 ? 1.564   19.946  -4.666  1.00 14.79 ? 219  SER B CB  1 
ATOM   4928 O  OG  . SER B 1 219 ? 1.267   21.098  -3.911  1.00 17.20 ? 219  SER B OG  1 
ATOM   4929 N  N   . LYS B 1 220 ? 3.702   20.113  -2.056  1.00 12.94 ? 220  LYS B N   1 
ATOM   4930 C  CA  . LYS B 1 220 ? 4.842   20.763  -1.455  1.00 14.04 ? 220  LYS B CA  1 
ATOM   4931 C  C   . LYS B 1 220 ? 5.630   19.832  -0.528  1.00 12.73 ? 220  LYS B C   1 
ATOM   4932 O  O   . LYS B 1 220 ? 6.676   20.238  -0.017  1.00 12.97 ? 220  LYS B O   1 
ATOM   4933 C  CB  . LYS B 1 220 ? 4.433   21.977  -0.619  1.00 15.88 ? 220  LYS B CB  1 
ATOM   4934 C  CG  . LYS B 1 220 ? 3.573   23.016  -1.302  1.00 18.84 ? 220  LYS B CG  1 
ATOM   4935 C  CD  . LYS B 1 220 ? 4.226   23.585  -2.549  1.00 21.50 ? 220  LYS B CD  1 
ATOM   4936 C  CE  . LYS B 1 220 ? 3.335   24.659  -3.168  1.00 22.93 ? 220  LYS B CE  1 
ATOM   4937 N  NZ  . LYS B 1 220 ? 3.945   25.184  -4.425  1.00 25.04 ? 220  LYS B NZ  1 
ATOM   4938 N  N   . ALA B 1 221 ? 5.180   18.590  -0.394  1.00 11.98 ? 221  ALA B N   1 
ATOM   4939 C  CA  . ALA B 1 221 ? 5.852   17.683  0.557   1.00 11.92 ? 221  ALA B CA  1 
ATOM   4940 C  C   . ALA B 1 221 ? 7.315   17.460  0.215   1.00 12.82 ? 221  ALA B C   1 
ATOM   4941 O  O   . ALA B 1 221 ? 8.179   17.420  1.103   1.00 11.84 ? 221  ALA B O   1 
ATOM   4942 C  CB  . ALA B 1 221 ? 5.093   16.367  0.607   1.00 11.26 ? 221  ALA B CB  1 
ATOM   4943 N  N   . HIS B 1 222 ? 7.663   17.380  -1.069  1.00 12.51 ? 222  HIS B N   1 
ATOM   4944 C  CA  . HIS B 1 222 ? 9.043   17.130  -1.457  1.00 14.00 ? 222  HIS B CA  1 
ATOM   4945 C  C   . HIS B 1 222 ? 9.974   18.257  -1.038  1.00 13.74 ? 222  HIS B C   1 
ATOM   4946 O  O   . HIS B 1 222 ? 11.173  18.006  -0.856  1.00 15.13 ? 222  HIS B O   1 
ATOM   4947 C  CB  . HIS B 1 222 ? 9.129   16.892  -2.968  1.00 15.18 ? 222  HIS B CB  1 
ATOM   4948 C  CG  . HIS B 1 222 ? 8.973   18.158  -3.751  1.00 16.27 ? 222  HIS B CG  1 
ATOM   4949 N  ND1 . HIS B 1 222 ? 7.769   18.792  -3.956  1.00 17.22 ? 222  HIS B ND1 1 
ATOM   4950 C  CD2 . HIS B 1 222 ? 9.926   18.904  -4.372  1.00 17.26 ? 222  HIS B CD2 1 
ATOM   4951 C  CE1 . HIS B 1 222 ? 7.973   19.881  -4.673  1.00 17.15 ? 222  HIS B CE1 1 
ATOM   4952 N  NE2 . HIS B 1 222 ? 9.260   19.960  -4.931  1.00 18.30 ? 222  HIS B NE2 1 
ATOM   4953 N  N   . GLU B 1 223 ? 9.484   19.473  -0.826  1.00 13.14 ? 223  GLU B N   1 
ATOM   4954 C  CA  . GLU B 1 223 ? 10.277  20.584  -0.338  1.00 14.31 ? 223  GLU B CA  1 
ATOM   4955 C  C   . GLU B 1 223 ? 10.762  20.398  1.095   1.00 14.73 ? 223  GLU B C   1 
ATOM   4956 O  O   . GLU B 1 223 ? 11.673  21.101  1.527   1.00 15.18 ? 223  GLU B O   1 
ATOM   4957 C  CB  . GLU B 1 223 ? 9.473   21.889  -0.403  1.00 15.57 ? 223  GLU B CB  1 
ATOM   4958 C  CG  . GLU B 1 223 ? 9.033   22.282  -1.805  1.00 18.21 ? 223  GLU B CG  1 
ATOM   4959 C  CD  . GLU B 1 223 ? 8.191   23.542  -1.815  1.00 20.22 ? 223  GLU B CD  1 
ATOM   4960 O  OE1 . GLU B 1 223 ? 8.180   24.307  -0.827  1.00 22.08 ? 223  GLU B OE1 1 
ATOM   4961 O  OE2 . GLU B 1 223 ? 7.520   23.769  -2.844  1.00 22.64 ? 223  GLU B OE2 1 
ATOM   4962 N  N   . HIS B 1 224 ? 10.175  19.475  1.843   1.00 13.43 ? 224  HIS B N   1 
ATOM   4963 C  CA  . HIS B 1 224 ? 10.466  19.346  3.262   1.00 13.88 ? 224  HIS B CA  1 
ATOM   4964 C  C   . HIS B 1 224 ? 11.300  18.111  3.554   1.00 13.56 ? 224  HIS B C   1 
ATOM   4965 O  O   . HIS B 1 224 ? 11.504  17.785  4.737   1.00 14.77 ? 224  HIS B O   1 
ATOM   4966 C  CB  . HIS B 1 224 ? 9.155   19.276  4.058   1.00 14.61 ? 224  HIS B CB  1 
ATOM   4967 C  CG  . HIS B 1 224 ? 8.357   20.537  3.943   1.00 15.67 ? 224  HIS B CG  1 
ATOM   4968 N  ND1 . HIS B 1 224 ? 8.496   21.561  4.856   1.00 15.83 ? 224  HIS B ND1 1 
ATOM   4969 C  CD2 . HIS B 1 224 ? 7.436   20.947  3.042   1.00 16.01 ? 224  HIS B CD2 1 
ATOM   4970 C  CE1 . HIS B 1 224 ? 7.679   22.549  4.529   1.00 16.81 ? 224  HIS B CE1 1 
ATOM   4971 N  NE2 . HIS B 1 224 ? 7.030   22.202  3.431   1.00 16.54 ? 224  HIS B NE2 1 
ATOM   4972 N  N   . ILE B 1 225 ? 11.734  17.396  2.523   1.00 12.18 ? 225  ILE B N   1 
ATOM   4973 C  CA  . ILE B 1 225 ? 12.462  16.146  2.767   1.00 12.60 ? 225  ILE B CA  1 
ATOM   4974 C  C   . ILE B 1 225 ? 13.934  16.346  2.448   1.00 12.44 ? 225  ILE B C   1 
ATOM   4975 O  O   . ILE B 1 225 ? 14.321  16.560  1.303   1.00 13.09 ? 225  ILE B O   1 
ATOM   4976 C  CB  . ILE B 1 225 ? 11.847  14.982  1.981   1.00 13.36 ? 225  ILE B CB  1 
ATOM   4977 C  CG1 . ILE B 1 225 ? 10.379  14.802  2.422   1.00 14.40 ? 225  ILE B CG1 1 
ATOM   4978 C  CG2 . ILE B 1 225 ? 12.625  13.688  2.185   1.00 13.62 ? 225  ILE B CG2 1 
ATOM   4979 C  CD1 . ILE B 1 225 ? 9.660   13.658  1.758   1.00 15.57 ? 225  ILE B CD1 1 
ATOM   4980 N  N   . PHE B 1 226 ? 14.772  16.271  3.487   1.00 11.71 ? 226  PHE B N   1 
ATOM   4981 C  CA  . PHE B 1 226 ? 16.182  16.624  3.351   1.00 11.65 ? 226  PHE B CA  1 
ATOM   4982 C  C   . PHE B 1 226 ? 17.004  15.477  2.789   1.00 11.82 ? 226  PHE B C   1 
ATOM   4983 O  O   . PHE B 1 226 ? 17.788  15.645  1.846   1.00 11.88 ? 226  PHE B O   1 
ATOM   4984 C  CB  . PHE B 1 226 ? 16.727  17.036  4.730   1.00 11.38 ? 226  PHE B CB  1 
ATOM   4985 C  CG  . PHE B 1 226 ? 18.210  17.292  4.736   1.00 11.19 ? 226  PHE B CG  1 
ATOM   4986 C  CD1 . PHE B 1 226 ? 18.692  18.521  4.325   1.00 12.12 ? 226  PHE B CD1 1 
ATOM   4987 C  CD2 . PHE B 1 226 ? 19.110  16.325  5.149   1.00 11.58 ? 226  PHE B CD2 1 
ATOM   4988 C  CE1 . PHE B 1 226 ? 20.049  18.790  4.314   1.00 12.16 ? 226  PHE B CE1 1 
ATOM   4989 C  CE2 . PHE B 1 226 ? 20.468  16.593  5.147   1.00 12.11 ? 226  PHE B CE2 1 
ATOM   4990 C  CZ  . PHE B 1 226 ? 20.943  17.818  4.727   1.00 11.51 ? 226  PHE B CZ  1 
ATOM   4991 N  N   . GLY B 1 227 ? 16.854  14.298  3.395   1.00 11.55 ? 227  GLY B N   1 
ATOM   4992 C  CA  . GLY B 1 227 ? 17.726  13.187  3.017   1.00 11.06 ? 227  GLY B CA  1 
ATOM   4993 C  C   . GLY B 1 227 ? 17.465  11.999  3.933   1.00 11.45 ? 227  GLY B C   1 
ATOM   4994 O  O   . GLY B 1 227 ? 16.622  12.088  4.822   1.00 11.70 ? 227  GLY B O   1 
ATOM   4995 N  N   . MET B 1 228 ? 18.187  10.905  3.679   1.00 10.38 ? 228  MET B N   1 
ATOM   4996 C  CA  . MET B 1 228 ? 17.838  9.628   4.284   1.00 10.31 ? 228  MET B CA  1 
ATOM   4997 C  C   . MET B 1 228 ? 19.016  8.949   4.987   1.00 10.40 ? 228  MET B C   1 
ATOM   4998 O  O   . MET B 1 228 ? 20.189  9.214   4.742   1.00 11.31 ? 228  MET B O   1 
ATOM   4999 C  CB  . MET B 1 228 ? 17.339  8.638   3.226   1.00 10.96 ? 228  MET B CB  1 
ATOM   5000 C  CG  . MET B 1 228 ? 16.101  9.090   2.451   1.00 11.05 ? 228  MET B CG  1 
ATOM   5001 S  SD  . MET B 1 228 ? 15.441  7.777   1.421   1.00 12.63 ? 228  MET B SD  1 
ATOM   5002 C  CE  . MET B 1 228 ? 14.673  6.735   2.659   1.00 14.26 ? 228  MET B CE  1 
ATOM   5003 N  N   . VAL B 1 229 ? 18.639  8.103   5.940   1.00 10.18 ? 229  VAL B N   1 
ATOM   5004 C  CA  . VAL B 1 229 ? 19.566  7.224   6.647   1.00 9.69  ? 229  VAL B CA  1 
ATOM   5005 C  C   . VAL B 1 229 ? 18.982  5.816   6.731   1.00 9.88  ? 229  VAL B C   1 
ATOM   5006 O  O   . VAL B 1 229 ? 17.789  5.577   6.506   1.00 9.53  ? 229  VAL B O   1 
ATOM   5007 C  CB  . VAL B 1 229 ? 19.874  7.695   8.082   1.00 10.11 ? 229  VAL B CB  1 
ATOM   5008 C  CG1 . VAL B 1 229 ? 20.592  9.034   8.095   1.00 9.97  ? 229  VAL B CG1 1 
ATOM   5009 C  CG2 . VAL B 1 229 ? 18.600  7.736   8.930   1.00 10.71 ? 229  VAL B CG2 1 
ATOM   5010 N  N   . LEU B 1 230 ? 19.823  4.841   7.073   1.00 9.78  ? 230  LEU B N   1 
ATOM   5011 C  CA  . LEU B 1 230 ? 19.399  3.501   7.416   1.00 10.17 ? 230  LEU B CA  1 
ATOM   5012 C  C   . LEU B 1 230 ? 18.997  3.434   8.896   1.00 10.30 ? 230  LEU B C   1 
ATOM   5013 O  O   . LEU B 1 230 ? 19.522  4.204   9.688   1.00 10.58 ? 230  LEU B O   1 
ATOM   5014 C  CB  . LEU B 1 230 ? 20.540  2.499   7.214   1.00 10.85 ? 230  LEU B CB  1 
ATOM   5015 C  CG  . LEU B 1 230 ? 21.157  2.446   5.819   1.00 10.99 ? 230  LEU B CG  1 
ATOM   5016 C  CD1 . LEU B 1 230 ? 22.465  1.650   5.883   1.00 11.50 ? 230  LEU B CD1 1 
ATOM   5017 C  CD2 . LEU B 1 230 ? 20.188  1.810   4.829   1.00 11.64 ? 230  LEU B CD2 1 
ATOM   5018 N  N   . MET B 1 231 ? 18.063  2.554   9.213   1.00 9.85  ? 231  MET B N   1 
ATOM   5019 C  CA  . MET B 1 231 ? 17.640  2.379   10.607  1.00 10.33 ? 231  MET B CA  1 
ATOM   5020 C  C   . MET B 1 231 ? 17.418  0.926   10.970  1.00 10.72 ? 231  MET B C   1 
ATOM   5021 O  O   . MET B 1 231 ? 16.868  0.132   10.207  1.00 11.04 ? 231  MET B O   1 
ATOM   5022 C  CB  . MET B 1 231 ? 16.353  3.193   10.862  1.00 11.04 ? 231  MET B CB  1 
ATOM   5023 C  CG  . MET B 1 231 ? 15.806  2.996   12.275  1.00 11.63 ? 231  MET B CG  1 
ATOM   5024 S  SD  . MET B 1 231 ? 14.270  3.930   12.534  1.00 12.55 ? 231  MET B SD  1 
ATOM   5025 C  CE  . MET B 1 231 ? 14.862  5.562   12.749  1.00 12.84 ? 231  MET B CE  1 
ATOM   5026 N  N   . ASN B 1 232 ? 17.813  0.552   12.194  1.00 11.27 ? 232  ASN B N   1 
ATOM   5027 C  CA  . ASN B 1 232 ? 17.424  -0.724  12.788  1.00 10.81 ? 232  ASN B CA  1 
ATOM   5028 C  C   . ASN B 1 232 ? 16.550  -0.434  14.012  1.00 11.52 ? 232  ASN B C   1 
ATOM   5029 O  O   . ASN B 1 232 ? 17.052  0.046   15.029  1.00 11.19 ? 232  ASN B O   1 
ATOM   5030 C  CB  . ASN B 1 232 ? 18.655  -1.532  13.226  1.00 10.71 ? 232  ASN B CB  1 
ATOM   5031 C  CG  . ASN B 1 232 ? 18.291  -2.891  13.790  1.00 12.02 ? 232  ASN B CG  1 
ATOM   5032 O  OD1 . ASN B 1 232 ? 17.132  -3.221  14.059  1.00 11.05 ? 232  ASN B OD1 1 
ATOM   5033 N  ND2 . ASN B 1 232 ? 19.320  -3.725  13.990  1.00 11.70 ? 232  ASN B ND2 1 
ATOM   5034 N  N   . ASP B 1 233 ? 15.253  -0.702  13.900  1.00 10.83 ? 233  ASP B N   1 
ATOM   5035 C  CA  . ASP B 1 233 ? 14.372  -0.520  15.053  1.00 11.36 ? 233  ASP B CA  1 
ATOM   5036 C  C   . ASP B 1 233 ? 14.359  -1.766  15.932  1.00 11.72 ? 233  ASP B C   1 
ATOM   5037 O  O   . ASP B 1 233 ? 13.466  -2.603  15.833  1.00 12.16 ? 233  ASP B O   1 
ATOM   5038 C  CB  . ASP B 1 233 ? 12.950  -0.163  14.600  1.00 12.60 ? 233  ASP B CB  1 
ATOM   5039 C  CG  . ASP B 1 233 ? 12.086  0.179   15.787  1.00 13.38 ? 233  ASP B CG  1 
ATOM   5040 O  OD1 . ASP B 1 233 ? 12.551  0.547   16.857  1.00 13.38 ? 233  ASP B OD1 1 
ATOM   5041 O  OD2 . ASP B 1 233 ? 10.851  0.112   15.767  1.00 15.33 ? 233  ASP B OD2 1 
ATOM   5042 N  N   . TRP B 1 234 ? 15.371  -1.861  16.798  1.00 11.42 ? 234  TRP B N   1 
ATOM   5043 C  CA  . TRP B 1 234 ? 15.440  -3.041  17.676  1.00 11.88 ? 234  TRP B CA  1 
ATOM   5044 C  C   . TRP B 1 234 ? 14.122  -3.227  18.408  1.00 12.40 ? 234  TRP B C   1 
ATOM   5045 O  O   . TRP B 1 234 ? 13.511  -2.268  18.868  1.00 12.65 ? 234  TRP B O   1 
ATOM   5046 C  CB  . TRP B 1 234 ? 16.568  -2.864  18.678  1.00 12.14 ? 234  TRP B CB  1 
ATOM   5047 C  CG  . TRP B 1 234 ? 17.892  -2.547  18.066  1.00 11.83 ? 234  TRP B CG  1 
ATOM   5048 C  CD1 . TRP B 1 234 ? 18.412  -1.300  17.867  1.00 11.18 ? 234  TRP B CD1 1 
ATOM   5049 C  CD2 . TRP B 1 234 ? 18.884  -3.477  17.606  1.00 11.80 ? 234  TRP B CD2 1 
ATOM   5050 N  NE1 . TRP B 1 234 ? 19.658  -1.401  17.295  1.00 11.91 ? 234  TRP B NE1 1 
ATOM   5051 C  CE2 . TRP B 1 234 ? 19.969  -2.724  17.134  1.00 11.76 ? 234  TRP B CE2 1 
ATOM   5052 C  CE3 . TRP B 1 234 ? 18.942  -4.874  17.559  1.00 12.63 ? 234  TRP B CE3 1 
ATOM   5053 C  CZ2 . TRP B 1 234 ? 21.126  -3.312  16.613  1.00 12.08 ? 234  TRP B CZ2 1 
ATOM   5054 C  CZ3 . TRP B 1 234 ? 20.095  -5.456  17.042  1.00 12.76 ? 234  TRP B CZ3 1 
ATOM   5055 C  CH2 . TRP B 1 234 ? 21.159  -4.678  16.575  1.00 12.41 ? 234  TRP B CH2 1 
ATOM   5056 N  N   . SER B 1 235 ? 13.645  -4.457  18.512  1.00 11.61 ? 235  SER B N   1 
ATOM   5057 C  CA  . SER B 1 235 ? 12.320  -4.752  19.027  1.00 12.51 ? 235  SER B CA  1 
ATOM   5058 C  C   . SER B 1 235 ? 12.364  -5.885  20.051  1.00 13.37 ? 235  SER B C   1 
ATOM   5059 O  O   . SER B 1 235 ? 12.971  -6.916  19.770  1.00 14.65 ? 235  SER B O   1 
ATOM   5060 C  CB  . SER B 1 235 ? 11.409  -5.174  17.870  1.00 12.95 ? 235  SER B CB  1 
ATOM   5061 O  OG  . SER B 1 235 ? 11.326  -4.111  16.927  1.00 12.43 ? 235  SER B OG  1 
ATOM   5062 N  N   . ALA B 1 236 ? 11.713  -5.687  21.184  1.00 12.94 ? 236  ALA B N   1 
ATOM   5063 C  CA  . ALA B 1 236 ? 11.571  -6.750  22.183  1.00 13.26 ? 236  ALA B CA  1 
ATOM   5064 C  C   . ALA B 1 236 ? 10.154  -7.297  22.069  1.00 13.62 ? 236  ALA B C   1 
ATOM   5065 O  O   . ALA B 1 236 ? 9.189   -6.731  22.592  1.00 14.12 ? 236  ALA B O   1 
ATOM   5066 C  CB  . ALA B 1 236 ? 11.849  -6.201  23.577  1.00 12.76 ? 236  ALA B CB  1 
ATOM   5067 N  N   . ARG B 1 237 ? 9.993   -8.401  21.335  1.00 14.72 ? 237  ARG B N   1 
ATOM   5068 C  CA  . ARG B 1 237 ? 8.669   -8.793  20.859  1.00 15.24 ? 237  ARG B CA  1 
ATOM   5069 C  C   . ARG B 1 237 ? 7.733   -9.307  21.939  1.00 15.11 ? 237  ARG B C   1 
ATOM   5070 O  O   . ARG B 1 237 ? 6.521   -9.125  21.834  1.00 14.62 ? 237  ARG B O   1 
ATOM   5071 C  CB  . ARG B 1 237 ? 8.817   -9.870  19.776  1.00 16.18 ? 237  ARG B CB  1 
ATOM   5072 C  CG  . ARG B 1 237 ? 9.705   -9.438  18.615  1.00 18.16 ? 237  ARG B CG  1 
ATOM   5073 C  CD  . ARG B 1 237 ? 8.868   -9.086  17.411  1.00 18.98 ? 237  ARG B CD  1 
ATOM   5074 N  NE  . ARG B 1 237 ? 9.667   -8.648  16.262  1.00 18.35 ? 237  ARG B NE  1 
ATOM   5075 C  CZ  . ARG B 1 237 ? 9.309   -7.563  15.575  1.00 18.23 ? 237  ARG B CZ  1 
ATOM   5076 N  NH1 . ARG B 1 237 ? 8.227   -6.888  15.951  1.00 18.15 ? 237  ARG B NH1 1 
ATOM   5077 N  NH2 . ARG B 1 237 ? 10.026  -7.179  14.535  1.00 17.02 ? 237  ARG B NH2 1 
ATOM   5078 N  N   . ASP B 1 238 ? 8.272   -9.984  22.952  1.00 15.42 ? 238  ASP B N   1 
ATOM   5079 C  CA  . ASP B 1 238 ? 7.469   -10.458 24.075  1.00 15.44 ? 238  ASP B CA  1 
ATOM   5080 C  C   . ASP B 1 238 ? 7.025   -9.307  24.973  1.00 14.32 ? 238  ASP B C   1 
ATOM   5081 O  O   . ASP B 1 238 ? 5.885   -9.295  25.431  1.00 14.42 ? 238  ASP B O   1 
ATOM   5082 C  CB  . ASP B 1 238 ? 8.225   -11.518 24.870  1.00 16.72 ? 238  ASP B CB  1 
ATOM   5083 C  CG  . ASP B 1 238 ? 9.660   -11.205 25.204  1.00 18.25 ? 238  ASP B CG  1 
ATOM   5084 O  OD1 . ASP B 1 238 ? 10.243  -10.177 24.791  1.00 18.18 ? 238  ASP B OD1 1 
ATOM   5085 O  OD2 . ASP B 1 238 ? 10.278  -12.024 25.932  1.00 18.14 ? 238  ASP B OD2 1 
ATOM   5086 N  N   . ILE B 1 239 ? 7.905   -8.332  25.191  1.00 14.25 ? 239  ILE B N   1 
ATOM   5087 C  CA  . ILE B 1 239 ? 7.541   -7.120  25.922  1.00 14.28 ? 239  ILE B CA  1 
ATOM   5088 C  C   . ILE B 1 239 ? 6.460   -6.361  25.160  1.00 14.39 ? 239  ILE B C   1 
ATOM   5089 O  O   . ILE B 1 239 ? 5.423   -5.986  25.710  1.00 14.07 ? 239  ILE B O   1 
ATOM   5090 C  CB  . ILE B 1 239 ? 8.777   -6.239  26.169  1.00 13.75 ? 239  ILE B CB  1 
ATOM   5091 C  CG1 . ILE B 1 239 ? 9.707   -6.930  27.179  1.00 14.42 ? 239  ILE B CG1 1 
ATOM   5092 C  CG2 . ILE B 1 239 ? 8.388   -4.858  26.676  1.00 13.36 ? 239  ILE B CG2 1 
ATOM   5093 C  CD1 . ILE B 1 239 ? 11.041  -6.240  27.362  1.00 14.10 ? 239  ILE B CD1 1 
ATOM   5094 N  N   . GLN B 1 240 ? 6.672   -6.192  23.854  1.00 14.37 ? 240  GLN B N   1 
ATOM   5095 C  CA  . GLN B 1 240 ? 5.713   -5.472  23.012  1.00 15.15 ? 240  GLN B CA  1 
ATOM   5096 C  C   . GLN B 1 240 ? 4.348   -6.130  22.988  1.00 14.97 ? 240  GLN B C   1 
ATOM   5097 O  O   . GLN B 1 240 ? 3.319   -5.453  23.114  1.00 14.36 ? 240  GLN B O   1 
ATOM   5098 C  CB  . GLN B 1 240 ? 6.298   -5.350  21.606  1.00 17.29 ? 240  GLN B CB  1 
ATOM   5099 C  CG  . GLN B 1 240 ? 5.445   -4.650  20.566  1.00 20.59 ? 240  GLN B CG  1 
ATOM   5100 C  CD  . GLN B 1 240 ? 6.113   -4.675  19.196  1.00 22.93 ? 240  GLN B CD  1 
ATOM   5101 O  OE1 . GLN B 1 240 ? 7.269   -5.097  19.052  1.00 25.84 ? 240  GLN B OE1 1 
ATOM   5102 N  NE2 . GLN B 1 240 ? 5.385   -4.229  18.184  1.00 24.47 ? 240  GLN B NE2 1 
ATOM   5103 N  N   . GLN B 1 241 ? 4.283   -7.460  22.863  1.00 14.31 ? 241  GLN B N   1 
ATOM   5104 C  CA  . GLN B 1 241 ? 2.990   -8.122  22.722  1.00 15.46 ? 241  GLN B CA  1 
ATOM   5105 C  C   . GLN B 1 241 ? 2.087   -7.930  23.928  1.00 14.34 ? 241  GLN B C   1 
ATOM   5106 O  O   . GLN B 1 241 ? 0.870   -7.750  23.808  1.00 13.65 ? 241  GLN B O   1 
ATOM   5107 C  CB  . GLN B 1 241 ? 3.183   -9.623  22.450  1.00 18.12 ? 241  GLN B CB  1 
ATOM   5108 C  CG  . GLN B 1 241 ? 1.914   -10.291 21.940  1.00 21.93 ? 241  GLN B CG  1 
ATOM   5109 C  CD  . GLN B 1 241 ? 1.449   -9.756  20.601  1.00 24.51 ? 241  GLN B CD  1 
ATOM   5110 O  OE1 . GLN B 1 241 ? 2.207   -9.164  19.824  1.00 26.27 ? 241  GLN B OE1 1 
ATOM   5111 N  NE2 . GLN B 1 241 ? 0.171   -9.961  20.288  1.00 25.83 ? 241  GLN B NE2 1 
ATOM   5112 N  N   . TRP B 1 242 ? 2.664   -7.966  25.127  1.00 13.87 ? 242  TRP B N   1 
ATOM   5113 C  CA  . TRP B 1 242 ? 1.907   -7.806  26.364  1.00 13.68 ? 242  TRP B CA  1 
ATOM   5114 C  C   . TRP B 1 242 ? 1.464   -6.357  26.552  1.00 12.84 ? 242  TRP B C   1 
ATOM   5115 O  O   . TRP B 1 242 ? 0.374   -6.121  27.068  1.00 13.25 ? 242  TRP B O   1 
ATOM   5116 C  CB  . TRP B 1 242 ? 2.739   -8.329  27.529  1.00 14.04 ? 242  TRP B CB  1 
ATOM   5117 C  CG  . TRP B 1 242 ? 2.198   -8.154  28.911  1.00 13.69 ? 242  TRP B CG  1 
ATOM   5118 C  CD1 . TRP B 1 242 ? 2.889   -7.639  29.969  1.00 13.18 ? 242  TRP B CD1 1 
ATOM   5119 C  CD2 . TRP B 1 242 ? 0.898   -8.487  29.401  1.00 13.73 ? 242  TRP B CD2 1 
ATOM   5120 N  NE1 . TRP B 1 242 ? 2.094   -7.623  31.094  1.00 13.48 ? 242  TRP B NE1 1 
ATOM   5121 C  CE2 . TRP B 1 242 ? 0.870   -8.142  30.772  1.00 13.35 ? 242  TRP B CE2 1 
ATOM   5122 C  CE3 . TRP B 1 242 ? -0.248  -9.038  28.828  1.00 13.86 ? 242  TRP B CE3 1 
ATOM   5123 C  CZ2 . TRP B 1 242 ? -0.262  -8.326  31.559  1.00 13.72 ? 242  TRP B CZ2 1 
ATOM   5124 C  CZ3 . TRP B 1 242 ? -1.378  -9.217  29.610  1.00 13.84 ? 242  TRP B CZ3 1 
ATOM   5125 C  CH2 . TRP B 1 242 ? -1.367  -8.869  30.974  1.00 13.96 ? 242  TRP B CH2 1 
ATOM   5126 N  N   . GLU B 1 243 ? 2.264   -5.388  26.097  1.00 12.42 ? 243  GLU B N   1 
ATOM   5127 C  CA  . GLU B 1 243 ? 2.001   -4.006  26.475  1.00 12.79 ? 243  GLU B CA  1 
ATOM   5128 C  C   . GLU B 1 243 ? 1.115   -3.258  25.479  1.00 13.05 ? 243  GLU B C   1 
ATOM   5129 O  O   . GLU B 1 243 ? 0.516   -2.263  25.879  1.00 12.62 ? 243  GLU B O   1 
ATOM   5130 C  CB  . GLU B 1 243 ? 3.326   -3.233  26.603  1.00 12.11 ? 243  GLU B CB  1 
ATOM   5131 C  CG  . GLU B 1 243 ? 3.889   -2.812  25.252  1.00 12.20 ? 243  GLU B CG  1 
ATOM   5132 C  CD  . GLU B 1 243 ? 5.251   -2.161  25.290  1.00 12.24 ? 243  GLU B CD  1 
ATOM   5133 O  OE1 . GLU B 1 243 ? 5.731   -1.743  26.370  1.00 12.80 ? 243  GLU B OE1 1 
ATOM   5134 O  OE2 . GLU B 1 243 ? 5.854   -2.065  24.198  1.00 11.65 ? 243  GLU B OE2 1 
ATOM   5135 N  N   . TYR B 1 244 ? 1.041   -3.686  24.213  1.00 13.38 ? 244  TYR B N   1 
ATOM   5136 C  CA  . TYR B 1 244 ? 0.789   -2.708  23.151  1.00 13.31 ? 244  TYR B CA  1 
ATOM   5137 C  C   . TYR B 1 244 ? -0.682  -2.437  22.878  1.00 13.60 ? 244  TYR B C   1 
ATOM   5138 O  O   . TYR B 1 244 ? -0.942  -1.431  22.213  1.00 12.72 ? 244  TYR B O   1 
ATOM   5139 C  CB  . TYR B 1 244 ? 1.512   -3.084  21.853  1.00 14.53 ? 244  TYR B CB  1 
ATOM   5140 C  CG  . TYR B 1 244 ? 0.776   -4.021  20.931  1.00 16.04 ? 244  TYR B CG  1 
ATOM   5141 C  CD1 . TYR B 1 244 ? 0.141   -3.563  19.783  1.00 16.81 ? 244  TYR B CD1 1 
ATOM   5142 C  CD2 . TYR B 1 244 ? 0.681   -5.373  21.223  1.00 16.34 ? 244  TYR B CD2 1 
ATOM   5143 C  CE1 . TYR B 1 244 ? -0.539  -4.425  18.943  1.00 17.73 ? 244  TYR B CE1 1 
ATOM   5144 C  CE2 . TYR B 1 244 ? 0.003   -6.247  20.391  1.00 17.36 ? 244  TYR B CE2 1 
ATOM   5145 C  CZ  . TYR B 1 244 ? -0.604  -5.764  19.251  1.00 17.96 ? 244  TYR B CZ  1 
ATOM   5146 O  OH  . TYR B 1 244 ? -1.286  -6.637  18.430  1.00 19.58 ? 244  TYR B OH  1 
ATOM   5147 N  N   . VAL B 1 245 ? -1.613  -3.272  23.309  1.00 14.13 ? 245  VAL B N   1 
ATOM   5148 C  CA  . VAL B 1 245 ? -3.040  -2.924  23.169  1.00 13.55 ? 245  VAL B CA  1 
ATOM   5149 C  C   . VAL B 1 245 ? -3.481  -2.219  24.436  1.00 13.55 ? 245  VAL B C   1 
ATOM   5150 O  O   . VAL B 1 245 ? -3.283  -2.750  25.541  1.00 14.23 ? 245  VAL B O   1 
ATOM   5151 C  CB  . VAL B 1 245 ? -3.887  -4.181  22.912  1.00 14.33 ? 245  VAL B CB  1 
ATOM   5152 C  CG1 . VAL B 1 245 ? -5.356  -3.807  22.735  1.00 14.29 ? 245  VAL B CG1 1 
ATOM   5153 C  CG2 . VAL B 1 245 ? -3.393  -4.921  21.673  1.00 14.69 ? 245  VAL B CG2 1 
ATOM   5154 N  N   . PRO B 1 246 ? -4.056  -1.027  24.332  1.00 13.70 ? 246  PRO B N   1 
ATOM   5155 C  CA  . PRO B 1 246 ? -4.486  -0.428  23.090  1.00 12.92 ? 246  PRO B CA  1 
ATOM   5156 C  C   . PRO B 1 246 ? -3.715  0.788   22.607  1.00 12.34 ? 246  PRO B C   1 
ATOM   5157 O  O   . PRO B 1 246 ? -4.119  1.404   21.601  1.00 12.91 ? 246  PRO B O   1 
ATOM   5158 C  CB  . PRO B 1 246 ? -5.892  0.075   23.482  1.00 13.57 ? 246  PRO B CB  1 
ATOM   5159 C  CG  . PRO B 1 246 ? -5.665  0.615   24.861  1.00 14.61 ? 246  PRO B CG  1 
ATOM   5160 C  CD  . PRO B 1 246 ? -4.710  -0.352  25.506  1.00 13.83 ? 246  PRO B CD  1 
ATOM   5161 N  N   . LEU B 1 247 ? -2.658  1.192   23.316  1.00 11.71 ? 247  LEU B N   1 
ATOM   5162 C  CA  . LEU B 1 247 ? -2.007  2.461   23.000  1.00 10.93 ? 247  LEU B CA  1 
ATOM   5163 C  C   . LEU B 1 247 ? -0.754  2.328   22.152  1.00 10.26 ? 247  LEU B C   1 
ATOM   5164 O  O   . LEU B 1 247 ? -0.185  3.381   21.813  1.00 10.85 ? 247  LEU B O   1 
ATOM   5165 C  CB  . LEU B 1 247 ? -1.715  3.273   24.272  1.00 12.19 ? 247  LEU B CB  1 
ATOM   5166 C  CG  . LEU B 1 247 ? -2.952  3.507   25.155  1.00 13.04 ? 247  LEU B CG  1 
ATOM   5167 C  CD1 . LEU B 1 247 ? -2.544  4.289   26.393  1.00 13.94 ? 247  LEU B CD1 1 
ATOM   5168 C  CD2 . LEU B 1 247 ? -4.063  4.208   24.397  1.00 13.72 ? 247  LEU B CD2 1 
ATOM   5169 N  N   . GLY B 1 248 ? -0.342  1.114   21.791  1.00 9.58  ? 248  GLY B N   1 
ATOM   5170 C  CA  . GLY B 1 248 ? 0.694   0.944   20.769  1.00 10.27 ? 248  GLY B CA  1 
ATOM   5171 C  C   . GLY B 1 248 ? 2.046   0.534   21.330  1.00 10.82 ? 248  GLY B C   1 
ATOM   5172 O  O   . GLY B 1 248 ? 2.247   0.420   22.537  1.00 10.43 ? 248  GLY B O   1 
ATOM   5173 N  N   . PRO B 1 249 ? 3.020   0.291   20.457  1.00 11.51 ? 249  PRO B N   1 
ATOM   5174 C  CA  . PRO B 1 249 ? 4.352   -0.134  20.865  1.00 11.31 ? 249  PRO B CA  1 
ATOM   5175 C  C   . PRO B 1 249 ? 5.007   0.896   21.772  1.00 11.39 ? 249  PRO B C   1 
ATOM   5176 O  O   . PRO B 1 249 ? 4.956   2.093   21.492  1.00 11.54 ? 249  PRO B O   1 
ATOM   5177 C  CB  . PRO B 1 249 ? 5.129   -0.302  19.560  1.00 12.21 ? 249  PRO B CB  1 
ATOM   5178 C  CG  . PRO B 1 249 ? 4.111   -0.295  18.471  1.00 13.22 ? 249  PRO B CG  1 
ATOM   5179 C  CD  . PRO B 1 249 ? 2.945   0.499   18.992  1.00 11.66 ? 249  PRO B CD  1 
ATOM   5180 N  N   . PHE B 1 250 ? 5.679   0.440   22.822  1.00 10.13 ? 250  PHE B N   1 
ATOM   5181 C  CA  . PHE B 1 250 ? 6.213   1.374   23.832  1.00 10.46 ? 250  PHE B CA  1 
ATOM   5182 C  C   . PHE B 1 250 ? 7.579   0.895   24.297  1.00 10.13 ? 250  PHE B C   1 
ATOM   5183 O  O   . PHE B 1 250 ? 8.561   1.081   23.562  1.00 10.30 ? 250  PHE B O   1 
ATOM   5184 C  CB  . PHE B 1 250 ? 5.172   1.541   24.936  1.00 10.42 ? 250  PHE B CB  1 
ATOM   5185 C  CG  . PHE B 1 250 ? 5.460   2.628   25.938  1.00 11.21 ? 250  PHE B CG  1 
ATOM   5186 C  CD1 . PHE B 1 250 ? 5.651   3.941   25.530  1.00 11.19 ? 250  PHE B CD1 1 
ATOM   5187 C  CD2 . PHE B 1 250 ? 5.538   2.346   27.290  1.00 11.12 ? 250  PHE B CD2 1 
ATOM   5188 C  CE1 . PHE B 1 250 ? 5.921   4.936   26.449  1.00 11.75 ? 250  PHE B CE1 1 
ATOM   5189 C  CE2 . PHE B 1 250 ? 5.802   3.339   28.216  1.00 11.58 ? 250  PHE B CE2 1 
ATOM   5190 C  CZ  . PHE B 1 250 ? 6.005   4.638   27.798  1.00 11.61 ? 250  PHE B CZ  1 
ATOM   5191 N  N   . LEU B 1 251 ? 7.662   0.201   25.445  1.00 10.42 ? 251  LEU B N   1 
ATOM   5192 C  CA  . LEU B 1 251 ? 8.937   -0.332  25.898  1.00 11.19 ? 251  LEU B CA  1 
ATOM   5193 C  C   . LEU B 1 251 ? 9.494   -1.434  25.012  1.00 11.22 ? 251  LEU B C   1 
ATOM   5194 O  O   . LEU B 1 251 ? 10.705  -1.687  25.020  1.00 11.16 ? 251  LEU B O   1 
ATOM   5195 C  CB  . LEU B 1 251 ? 8.807   -0.899  27.324  1.00 10.93 ? 251  LEU B CB  1 
ATOM   5196 C  CG  . LEU B 1 251 ? 8.334   0.102   28.381  1.00 11.84 ? 251  LEU B CG  1 
ATOM   5197 C  CD1 . LEU B 1 251 ? 8.329   -0.571  29.748  1.00 11.95 ? 251  LEU B CD1 1 
ATOM   5198 C  CD2 . LEU B 1 251 ? 9.201   1.350   28.413  1.00 12.14 ? 251  LEU B CD2 1 
ATOM   5199 N  N   . GLY B 1 252 ? 8.661   -2.058  24.187  1.00 11.06 ? 252  GLY B N   1 
ATOM   5200 C  CA  . GLY B 1 252 ? 9.109   -3.023  23.192  1.00 11.49 ? 252  GLY B CA  1 
ATOM   5201 C  C   . GLY B 1 252 ? 9.989   -2.409  22.113  1.00 11.86 ? 252  GLY B C   1 
ATOM   5202 O  O   . GLY B 1 252 ? 10.655  -3.137  21.377  1.00 11.06 ? 252  GLY B O   1 
ATOM   5203 N  N   . LYS B 1 253 ? 9.991   -1.090  21.985  1.00 11.66 ? 253  LYS B N   1 
ATOM   5204 C  CA  . LYS B 1 253 ? 10.748  -0.365  20.990  1.00 11.95 ? 253  LYS B CA  1 
ATOM   5205 C  C   . LYS B 1 253 ? 11.780  0.593   21.553  1.00 11.69 ? 253  LYS B C   1 
ATOM   5206 O  O   . LYS B 1 253 ? 12.820  0.853   20.952  1.00 11.23 ? 253  LYS B O   1 
ATOM   5207 C  CB  . LYS B 1 253 ? 9.768   0.498   20.165  1.00 12.70 ? 253  LYS B CB  1 
ATOM   5208 C  CG  . LYS B 1 253 ? 8.724   -0.285  19.396  1.00 13.77 ? 253  LYS B CG  1 
ATOM   5209 C  CD  . LYS B 1 253 ? 9.395   -1.224  18.397  1.00 14.80 ? 253  LYS B CD  1 
ATOM   5210 C  CE  . LYS B 1 253 ? 8.346   -1.992  17.605  1.00 17.02 ? 253  LYS B CE  1 
ATOM   5211 N  NZ  . LYS B 1 253 ? 8.978   -2.638  16.418  1.00 17.25 ? 253  LYS B NZ  1 
ATOM   5212 N  N   . SER B 1 254 ? 11.529  1.154   22.736  1.00 10.58 ? 254  SER B N   1 
ATOM   5213 C  CA  . SER B 1 254 ? 12.234  2.361   23.153  1.00 10.16 ? 254  SER B CA  1 
ATOM   5214 C  C   . SER B 1 254 ? 13.556  2.090   23.853  1.00 10.64 ? 254  SER B C   1 
ATOM   5215 O  O   . SER B 1 254 ? 14.219  3.046   24.243  1.00 10.74 ? 254  SER B O   1 
ATOM   5216 C  CB  . SER B 1 254 ? 11.320  3.189   24.064  1.00 10.39 ? 254  SER B CB  1 
ATOM   5217 O  OG  . SER B 1 254 ? 11.101  2.467   25.270  1.00 9.96  ? 254  SER B OG  1 
ATOM   5218 N  N   . PHE B 1 255 ? 13.965  0.830   23.981  1.00 11.05 ? 255  PHE B N   1 
ATOM   5219 C  CA  . PHE B 1 255 ? 15.283  0.549   24.553  1.00 11.19 ? 255  PHE B CA  1 
ATOM   5220 C  C   . PHE B 1 255 ? 16.416  0.819   23.579  1.00 11.72 ? 255  PHE B C   1 
ATOM   5221 O  O   . PHE B 1 255 ? 17.581  0.884   24.001  1.00 12.82 ? 255  PHE B O   1 
ATOM   5222 C  CB  . PHE B 1 255 ? 15.338  -0.890  25.090  1.00 11.27 ? 255  PHE B CB  1 
ATOM   5223 C  CG  . PHE B 1 255 ? 15.231  -1.911  23.986  1.00 10.42 ? 255  PHE B CG  1 
ATOM   5224 C  CD1 . PHE B 1 255 ? 16.375  -2.431  23.398  1.00 11.00 ? 255  PHE B CD1 1 
ATOM   5225 C  CD2 . PHE B 1 255 ? 13.982  -2.325  23.555  1.00 11.49 ? 255  PHE B CD2 1 
ATOM   5226 C  CE1 . PHE B 1 255 ? 16.253  -3.361  22.377  1.00 10.99 ? 255  PHE B CE1 1 
ATOM   5227 C  CE2 . PHE B 1 255 ? 13.864  -3.254  22.532  1.00 11.61 ? 255  PHE B CE2 1 
ATOM   5228 C  CZ  . PHE B 1 255 ? 15.009  -3.767  21.951  1.00 11.39 ? 255  PHE B CZ  1 
ATOM   5229 N  N   . GLY B 1 256 ? 16.140  1.010   22.287  1.00 11.78 ? 256  GLY B N   1 
ATOM   5230 C  CA  . GLY B 1 256 ? 17.222  1.411   21.380  1.00 11.38 ? 256  GLY B CA  1 
ATOM   5231 C  C   . GLY B 1 256 ? 16.732  1.346   19.935  1.00 11.18 ? 256  GLY B C   1 
ATOM   5232 O  O   . GLY B 1 256 ? 16.007  0.430   19.574  1.00 10.70 ? 256  GLY B O   1 
ATOM   5233 N  N   . THR B 1 257 ? 17.150  2.319   19.156  1.00 10.89 ? 257  THR B N   1 
ATOM   5234 C  CA  . THR B 1 257 ? 16.852  2.368   17.714  1.00 10.72 ? 257  THR B CA  1 
ATOM   5235 C  C   . THR B 1 257 ? 18.108  2.916   17.056  1.00 10.22 ? 257  THR B C   1 
ATOM   5236 O  O   . THR B 1 257 ? 18.556  3.991   17.458  1.00 10.45 ? 257  THR B O   1 
ATOM   5237 C  CB  . THR B 1 257 ? 15.646  3.287   17.460  1.00 10.86 ? 257  THR B CB  1 
ATOM   5238 O  OG1 . THR B 1 257 ? 14.498  2.779   18.150  1.00 11.68 ? 257  THR B OG1 1 
ATOM   5239 C  CG2 . THR B 1 257 ? 15.324  3.368   15.974  1.00 10.29 ? 257  THR B CG2 1 
ATOM   5240 N  N   . THR B 1 258 ? 18.720  2.199   16.122  1.00 10.58 ? 258  THR B N   1 
ATOM   5241 C  CA  . THR B 1 258 ? 20.013  2.631   15.593  1.00 10.97 ? 258  THR B CA  1 
ATOM   5242 C  C   . THR B 1 258 ? 19.854  3.283   14.226  1.00 10.64 ? 258  THR B C   1 
ATOM   5243 O  O   . THR B 1 258 ? 19.103  2.743   13.416  1.00 11.51 ? 258  THR B O   1 
ATOM   5244 C  CB  . THR B 1 258 ? 20.979  1.435   15.456  1.00 11.46 ? 258  THR B CB  1 
ATOM   5245 O  OG1 . THR B 1 258 ? 21.198  0.898   16.776  1.00 11.37 ? 258  THR B OG1 1 
ATOM   5246 C  CG2 . THR B 1 258 ? 22.305  1.853   14.837  1.00 12.23 ? 258  THR B CG2 1 
ATOM   5247 N  N   . ILE B 1 259 ? 20.548  4.395   13.992  1.00 10.72 ? 259  ILE B N   1 
ATOM   5248 C  CA  . ILE B 1 259 ? 20.600  4.921   12.626  1.00 10.36 ? 259  ILE B CA  1 
ATOM   5249 C  C   . ILE B 1 259 ? 22.043  5.013   12.135  1.00 10.46 ? 259  ILE B C   1 
ATOM   5250 O  O   . ILE B 1 259 ? 22.991  5.168   12.904  1.00 11.45 ? 259  ILE B O   1 
ATOM   5251 C  CB  . ILE B 1 259 ? 19.923  6.293   12.474  1.00 10.47 ? 259  ILE B CB  1 
ATOM   5252 C  CG1 . ILE B 1 259 ? 20.542  7.357   13.393  1.00 10.07 ? 259  ILE B CG1 1 
ATOM   5253 C  CG2 . ILE B 1 259 ? 18.417  6.186   12.708  1.00 11.15 ? 259  ILE B CG2 1 
ATOM   5254 C  CD1 . ILE B 1 259 ? 20.102  8.776   13.069  1.00 11.71 ? 259  ILE B CD1 1 
ATOM   5255 N  N   . SER B 1 260 ? 22.218  4.914   10.820  1.00 10.82 ? 260  SER B N   1 
ATOM   5256 C  CA  . SER B 1 260 ? 23.514  5.235   10.209  1.00 10.52 ? 260  SER B CA  1 
ATOM   5257 C  C   . SER B 1 260 ? 23.753  6.730   10.251  1.00 11.49 ? 260  SER B C   1 
ATOM   5258 O  O   . SER B 1 260 ? 22.801  7.523   10.311  1.00 11.59 ? 260  SER B O   1 
ATOM   5259 C  CB  . SER B 1 260 ? 23.535  4.675   8.783   1.00 10.86 ? 260  SER B CB  1 
ATOM   5260 O  OG  . SER B 1 260 ? 22.511  5.275   7.994   1.00 11.34 ? 260  SER B OG  1 
ATOM   5261 N  N   . PRO B 1 261 ? 25.011  7.179   10.242  1.00 10.42 ? 261  PRO B N   1 
ATOM   5262 C  CA  . PRO B 1 261 ? 25.325  8.568   10.504  1.00 10.61 ? 261  PRO B CA  1 
ATOM   5263 C  C   . PRO B 1 261 ? 25.364  9.481   9.290   1.00 10.60 ? 261  PRO B C   1 
ATOM   5264 O  O   . PRO B 1 261 ? 25.307  10.701  9.464   1.00 11.88 ? 261  PRO B O   1 
ATOM   5265 C  CB  . PRO B 1 261 ? 26.716  8.533   11.160  1.00 11.52 ? 261  PRO B CB  1 
ATOM   5266 C  CG  . PRO B 1 261 ? 27.298  7.274   10.616  1.00 11.57 ? 261  PRO B CG  1 
ATOM   5267 C  CD  . PRO B 1 261 ? 26.161  6.280   10.592  1.00 11.75 ? 261  PRO B CD  1 
ATOM   5268 N  N   . TRP B 1 262 ? 25.476  8.929   8.081   1.00 10.66 ? 262  TRP B N   1 
ATOM   5269 C  CA  . TRP B 1 262 ? 25.643  9.769   6.898   1.00 11.43 ? 262  TRP B CA  1 
ATOM   5270 C  C   . TRP B 1 262 ? 24.296  10.037  6.224   1.00 11.20 ? 262  TRP B C   1 
ATOM   5271 O  O   . TRP B 1 262 ? 23.657  9.084   5.766   1.00 11.83 ? 262  TRP B O   1 
ATOM   5272 C  CB  . TRP B 1 262 ? 26.582  9.104   5.890   1.00 12.04 ? 262  TRP B CB  1 
ATOM   5273 C  CG  . TRP B 1 262 ? 28.025  9.138   6.303   1.00 12.50 ? 262  TRP B CG  1 
ATOM   5274 C  CD1 . TRP B 1 262 ? 28.776  8.062   6.680   1.00 13.10 ? 262  TRP B CD1 1 
ATOM   5275 C  CD2 . TRP B 1 262 ? 28.876  10.283  6.401   1.00 13.42 ? 262  TRP B CD2 1 
ATOM   5276 N  NE1 . TRP B 1 262 ? 30.053  8.473   7.002   1.00 14.12 ? 262  TRP B NE1 1 
ATOM   5277 C  CE2 . TRP B 1 262 ? 30.136  9.832   6.843   1.00 13.70 ? 262  TRP B CE2 1 
ATOM   5278 C  CE3 . TRP B 1 262 ? 28.693  11.646  6.164   1.00 13.66 ? 262  TRP B CE3 1 
ATOM   5279 C  CZ2 . TRP B 1 262 ? 31.212  10.701  7.034   1.00 14.16 ? 262  TRP B CZ2 1 
ATOM   5280 C  CZ3 . TRP B 1 262 ? 29.756  12.515  6.358   1.00 13.78 ? 262  TRP B CZ3 1 
ATOM   5281 C  CH2 . TRP B 1 262 ? 31.004  12.031  6.793   1.00 14.68 ? 262  TRP B CH2 1 
ATOM   5282 N  N   . VAL B 1 263 ? 23.893  11.298  6.194   1.00 11.48 ? 263  VAL B N   1 
ATOM   5283 C  CA  . VAL B 1 263 ? 22.577  11.638  5.643   1.00 10.75 ? 263  VAL B CA  1 
ATOM   5284 C  C   . VAL B 1 263 ? 22.728  11.882  4.146   1.00 10.74 ? 263  VAL B C   1 
ATOM   5285 O  O   . VAL B 1 263 ? 23.284  12.885  3.719   1.00 11.64 ? 263  VAL B O   1 
ATOM   5286 C  CB  . VAL B 1 263 ? 21.956  12.849  6.352   1.00 10.87 ? 263  VAL B CB  1 
ATOM   5287 C  CG1 . VAL B 1 263 ? 20.529  13.078  5.861   1.00 12.13 ? 263  VAL B CG1 1 
ATOM   5288 C  CG2 . VAL B 1 263 ? 21.949  12.637  7.865   1.00 12.18 ? 263  VAL B CG2 1 
ATOM   5289 N  N   . VAL B 1 264 ? 22.210  10.941  3.357   1.00 10.61 ? 264  VAL B N   1 
ATOM   5290 C  CA  . VAL B 1 264 ? 22.274  11.062  1.895   1.00 10.84 ? 264  VAL B CA  1 
ATOM   5291 C  C   . VAL B 1 264 ? 21.194  12.026  1.438   1.00 12.01 ? 264  VAL B C   1 
ATOM   5292 O  O   . VAL B 1 264 ? 20.022  11.766  1.717   1.00 10.84 ? 264  VAL B O   1 
ATOM   5293 C  CB  . VAL B 1 264 ? 22.065  9.689   1.243   1.00 11.49 ? 264  VAL B CB  1 
ATOM   5294 C  CG1 . VAL B 1 264 ? 22.001  9.815   -0.278  1.00 11.68 ? 264  VAL B CG1 1 
ATOM   5295 C  CG2 . VAL B 1 264 ? 23.162  8.708   1.629   1.00 12.77 ? 264  VAL B CG2 1 
ATOM   5296 N  N   . PRO B 1 265 ? 21.538  13.117  0.777   1.00 12.04 ? 265  PRO B N   1 
ATOM   5297 C  CA  . PRO B 1 265 ? 20.546  14.107  0.383   1.00 12.16 ? 265  PRO B CA  1 
ATOM   5298 C  C   . PRO B 1 265 ? 19.613  13.543  -0.671  1.00 12.68 ? 265  PRO B C   1 
ATOM   5299 O  O   . PRO B 1 265 ? 20.043  12.717  -1.491  1.00 12.32 ? 265  PRO B O   1 
ATOM   5300 C  CB  . PRO B 1 265 ? 21.382  15.264  -0.143  1.00 13.15 ? 265  PRO B CB  1 
ATOM   5301 C  CG  . PRO B 1 265 ? 22.654  14.635  -0.609  1.00 13.18 ? 265  PRO B CG  1 
ATOM   5302 C  CD  . PRO B 1 265 ? 22.908  13.447  0.300   1.00 12.71 ? 265  PRO B CD  1 
ATOM   5303 N  N   . MET B 1 266 ? 18.357  14.002  -0.698  1.00 12.56 ? 266  MET B N   1 
ATOM   5304 C  CA  . MET B 1 266 ? 17.421  13.502  -1.702  1.00 12.29 ? 266  MET B CA  1 
ATOM   5305 C  C   . MET B 1 266 ? 17.917  13.724  -3.130  1.00 12.74 ? 266  MET B C   1 
ATOM   5306 O  O   . MET B 1 266 ? 17.657  12.877  -3.991  1.00 12.65 ? 266  MET B O   1 
ATOM   5307 C  CB  . MET B 1 266 ? 16.023  14.099  -1.540  1.00 12.24 ? 266  MET B CB  1 
ATOM   5308 C  CG  . MET B 1 266 ? 15.336  13.712  -0.235  1.00 12.26 ? 266  MET B CG  1 
ATOM   5309 S  SD  . MET B 1 266 ? 15.368  11.947  0.118   1.00 11.16 ? 266  MET B SD  1 
ATOM   5310 C  CE  . MET B 1 266 ? 14.642  11.257  -1.360  1.00 13.40 ? 266  MET B CE  1 
ATOM   5311 N  N   . ASP B 1 267 ? 18.634  14.811  -3.394  1.00 14.83 ? 267  ASP B N   1 
ATOM   5312 C  CA  . ASP B 1 267 ? 19.179  15.058  -4.722  1.00 15.81 ? 267  ASP B CA  1 
ATOM   5313 C  C   . ASP B 1 267 ? 20.110  13.960  -5.208  1.00 14.60 ? 267  ASP B C   1 
ATOM   5314 O  O   . ASP B 1 267 ? 20.176  13.695  -6.414  1.00 15.08 ? 267  ASP B O   1 
ATOM   5315 C  CB  . ASP B 1 267 ? 19.904  16.411  -4.756  1.00 18.44 ? 267  ASP B CB  1 
ATOM   5316 C  CG  . ASP B 1 267 ? 18.970  17.600  -4.736  1.00 21.71 ? 267  ASP B CG  1 
ATOM   5317 O  OD1 . ASP B 1 267 ? 17.760  17.429  -4.986  1.00 23.34 ? 267  ASP B OD1 1 
ATOM   5318 O  OD2 . ASP B 1 267 ? 19.420  18.736  -4.467  1.00 23.76 ? 267  ASP B OD2 1 
ATOM   5319 N  N   . ALA B 1 268 ? 20.853  13.294  -4.329  1.00 13.37 ? 268  ALA B N   1 
ATOM   5320 C  CA  . ALA B 1 268 ? 21.691  12.170  -4.691  1.00 12.81 ? 268  ALA B CA  1 
ATOM   5321 C  C   . ALA B 1 268 ? 20.881  10.931  -5.051  1.00 12.59 ? 268  ALA B C   1 
ATOM   5322 O  O   . ALA B 1 268 ? 21.367  10.054  -5.766  1.00 13.04 ? 268  ALA B O   1 
ATOM   5323 C  CB  . ALA B 1 268 ? 22.649  11.845  -3.541  1.00 12.89 ? 268  ALA B CB  1 
ATOM   5324 N  N   . LEU B 1 269 ? 19.657  10.832  -4.534  1.00 12.37 ? 269  LEU B N   1 
ATOM   5325 C  CA  . LEU B 1 269 ? 18.819  9.669   -4.745  1.00 13.53 ? 269  LEU B CA  1 
ATOM   5326 C  C   . LEU B 1 269 ? 17.861  9.806   -5.916  1.00 14.37 ? 269  LEU B C   1 
ATOM   5327 O  O   . LEU B 1 269 ? 17.387  8.789   -6.407  1.00 13.21 ? 269  LEU B O   1 
ATOM   5328 C  CB  . LEU B 1 269 ? 17.984  9.379   -3.482  1.00 13.79 ? 269  LEU B CB  1 
ATOM   5329 C  CG  . LEU B 1 269 ? 18.831  9.027   -2.247  1.00 13.54 ? 269  LEU B CG  1 
ATOM   5330 C  CD1 . LEU B 1 269 ? 17.961  9.033   -1.000  1.00 14.31 ? 269  LEU B CD1 1 
ATOM   5331 C  CD2 . LEU B 1 269 ? 19.501  7.676   -2.449  1.00 13.76 ? 269  LEU B CD2 1 
ATOM   5332 N  N   . MET B 1 270 ? 17.667  11.025  -6.423  1.00 16.26 ? 270  MET B N   1 
ATOM   5333 C  CA  . MET B 1 270 ? 16.679  11.236  -7.477  1.00 18.12 ? 270  MET B CA  1 
ATOM   5334 C  C   . MET B 1 270 ? 16.955  10.538  -8.788  1.00 17.24 ? 270  MET B C   1 
ATOM   5335 O  O   . MET B 1 270 ? 15.996  10.096  -9.455  1.00 16.87 ? 270  MET B O   1 
ATOM   5336 C  CB  . MET B 1 270 ? 16.423  12.727  -7.714  1.00 20.47 ? 270  MET B CB  1 
ATOM   5337 C  CG  . MET B 1 270 ? 15.057  13.010  -8.326  1.00 23.69 ? 270  MET B CG  1 
ATOM   5338 S  SD  . MET B 1 270 ? 13.648  12.550  -7.303  1.00 27.54 ? 270  MET B SD  1 
ATOM   5339 C  CE  . MET B 1 270 ? 14.236  12.998  -5.672  1.00 22.99 ? 270  MET B CE  1 
ATOM   5340 N  N   . PRO B 1 271 ? 18.196  10.298  -9.184  1.00 16.38 ? 271  PRO B N   1 
ATOM   5341 C  CA  . PRO B 1 271 ? 18.497  9.466   -10.335 1.00 15.71 ? 271  PRO B CA  1 
ATOM   5342 C  C   . PRO B 1 271 ? 18.000  8.038   -10.259 1.00 14.94 ? 271  PRO B C   1 
ATOM   5343 O  O   . PRO B 1 271 ? 17.992  7.296   -11.255 1.00 15.29 ? 271  PRO B O   1 
ATOM   5344 C  CB  . PRO B 1 271 ? 20.018  9.532   -10.463 1.00 16.40 ? 271  PRO B CB  1 
ATOM   5345 C  CG  . PRO B 1 271 ? 20.394  10.827  -9.830  1.00 17.03 ? 271  PRO B CG  1 
ATOM   5346 C  CD  . PRO B 1 271 ? 19.398  11.043  -8.715  1.00 16.88 ? 271  PRO B CD  1 
ATOM   5347 N  N   . PHE B 1 272 ? 17.621  7.542   -9.079  1.00 13.64 ? 272  PHE B N   1 
ATOM   5348 C  CA  . PHE B 1 272 ? 17.233  6.180   -8.815  1.00 13.56 ? 272  PHE B CA  1 
ATOM   5349 C  C   . PHE B 1 272 ? 15.748  6.067   -8.465  1.00 13.60 ? 272  PHE B C   1 
ATOM   5350 O  O   . PHE B 1 272 ? 15.289  5.051   -7.955  1.00 13.35 ? 272  PHE B O   1 
ATOM   5351 C  CB  . PHE B 1 272 ? 18.091  5.599   -7.663  1.00 13.69 ? 272  PHE B CB  1 
ATOM   5352 C  CG  . PHE B 1 272 ? 19.562  5.712   -7.999  1.00 13.42 ? 272  PHE B CG  1 
ATOM   5353 C  CD1 . PHE B 1 272 ? 20.320  6.742   -7.485  1.00 14.00 ? 272  PHE B CD1 1 
ATOM   5354 C  CD2 . PHE B 1 272 ? 20.154  4.807   -8.871  1.00 14.67 ? 272  PHE B CD2 1 
ATOM   5355 C  CE1 . PHE B 1 272 ? 21.664  6.865   -7.806  1.00 14.81 ? 272  PHE B CE1 1 
ATOM   5356 C  CE2 . PHE B 1 272 ? 21.495  4.926   -9.193  1.00 14.36 ? 272  PHE B CE2 1 
ATOM   5357 C  CZ  . PHE B 1 272 ? 22.245  5.954   -8.666  1.00 14.97 ? 272  PHE B CZ  1 
ATOM   5358 N  N   . VAL B 1 273 ? 15.013  7.120   -8.824  1.00 13.26 ? 273  VAL B N   1 
ATOM   5359 C  CA  . VAL B 1 273 ? 13.561  7.113   -8.630  1.00 14.16 ? 273  VAL B CA  1 
ATOM   5360 C  C   . VAL B 1 273 ? 12.880  6.154   -9.595  1.00 13.54 ? 273  VAL B C   1 
ATOM   5361 O  O   . VAL B 1 273 ? 13.309  5.968   -10.732 1.00 13.30 ? 273  VAL B O   1 
ATOM   5362 C  CB  . VAL B 1 273 ? 12.981  8.532   -8.694  1.00 15.11 ? 273  VAL B CB  1 
ATOM   5363 C  CG1 . VAL B 1 273 ? 12.877  9.083   -10.105 1.00 16.50 ? 273  VAL B CG1 1 
ATOM   5364 C  CG2 . VAL B 1 273 ? 11.616  8.556   -8.010  1.00 17.10 ? 273  VAL B CG2 1 
ATOM   5365 N  N   . VAL B 1 274 ? 11.861  5.469   -9.103  1.00 13.37 ? 274  VAL B N   1 
ATOM   5366 C  CA  . VAL B 1 274 ? 11.025  4.544   -9.845  1.00 13.41 ? 274  VAL B CA  1 
ATOM   5367 C  C   . VAL B 1 274 ? 9.558   4.907   -9.589  1.00 14.37 ? 274  VAL B C   1 
ATOM   5368 O  O   . VAL B 1 274 ? 9.257   5.671   -8.665  1.00 14.15 ? 274  VAL B O   1 
ATOM   5369 C  CB  . VAL B 1 274 ? 11.252  3.078   -9.444  1.00 13.28 ? 274  VAL B CB  1 
ATOM   5370 C  CG1 . VAL B 1 274 ? 12.649  2.579   -9.789  1.00 14.23 ? 274  VAL B CG1 1 
ATOM   5371 C  CG2 . VAL B 1 274 ? 10.997  2.881   -7.949  1.00 13.93 ? 274  VAL B CG2 1 
ATOM   5372 N  N   . PRO B 1 275 ? 8.646   4.380   -10.390 1.00 15.05 ? 275  PRO B N   1 
ATOM   5373 C  CA  . PRO B 1 275 ? 7.228   4.619   -10.195 1.00 15.14 ? 275  PRO B CA  1 
ATOM   5374 C  C   . PRO B 1 275 ? 6.768   4.194   -8.810  1.00 14.99 ? 275  PRO B C   1 
ATOM   5375 O  O   . PRO B 1 275 ? 7.265   3.211   -8.254  1.00 15.92 ? 275  PRO B O   1 
ATOM   5376 C  CB  . PRO B 1 275 ? 6.564   3.829   -11.315 1.00 15.55 ? 275  PRO B CB  1 
ATOM   5377 C  CG  . PRO B 1 275 ? 7.561   2.819   -11.755 1.00 15.88 ? 275  PRO B CG  1 
ATOM   5378 C  CD  . PRO B 1 275 ? 8.915   3.420   -11.493 1.00 15.50 ? 275  PRO B CD  1 
ATOM   5379 N  N   . ASN B 1 276 ? 5.836   4.947   -8.236  1.00 15.16 ? 276  ASN B N   1 
ATOM   5380 C  CA  . ASN B 1 276 ? 5.194   4.512   -6.991  1.00 14.55 ? 276  ASN B CA  1 
ATOM   5381 C  C   . ASN B 1 276 ? 4.353   3.272   -7.238  1.00 15.13 ? 276  ASN B C   1 
ATOM   5382 O  O   . ASN B 1 276 ? 3.704   3.125   -8.278  1.00 15.63 ? 276  ASN B O   1 
ATOM   5383 C  CB  . ASN B 1 276 ? 4.316   5.633   -6.427  1.00 13.83 ? 276  ASN B CB  1 
ATOM   5384 C  CG  . ASN B 1 276 ? 5.049   6.943   -6.300  1.00 13.15 ? 276  ASN B CG  1 
ATOM   5385 O  OD1 . ASN B 1 276 ? 6.236   6.994   -5.958  1.00 12.50 ? 276  ASN B OD1 1 
ATOM   5386 N  ND2 . ASN B 1 276 ? 4.382   8.059   -6.570  1.00 13.83 ? 276  ASN B ND2 1 
ATOM   5387 N  N   . PRO B 1 277 ? 4.322   2.363   -6.267  1.00 15.95 ? 277  PRO B N   1 
ATOM   5388 C  CA  . PRO B 1 277 ? 3.420   1.227   -6.298  1.00 16.02 ? 277  PRO B CA  1 
ATOM   5389 C  C   . PRO B 1 277 ? 1.986   1.674   -6.535  1.00 16.17 ? 277  PRO B C   1 
ATOM   5390 O  O   . PRO B 1 277 ? 1.554   2.709   -6.009  1.00 16.52 ? 277  PRO B O   1 
ATOM   5391 C  CB  . PRO B 1 277 ? 3.579   0.606   -4.913  1.00 16.16 ? 277  PRO B CB  1 
ATOM   5392 C  CG  . PRO B 1 277 ? 4.981   0.974   -4.522  1.00 16.59 ? 277  PRO B CG  1 
ATOM   5393 C  CD  . PRO B 1 277 ? 5.151   2.388   -5.035  1.00 16.43 ? 277  PRO B CD  1 
ATOM   5394 N  N   . LYS B 1 278 ? 1.242   0.918   -7.349  1.00 16.78 ? 278  LYS B N   1 
ATOM   5395 C  CA  . LYS B 1 278 ? -0.146  1.303   -7.603  1.00 17.84 ? 278  LYS B CA  1 
ATOM   5396 C  C   . LYS B 1 278 ? -0.983  1.059   -6.351  1.00 16.75 ? 278  LYS B C   1 
ATOM   5397 O  O   . LYS B 1 278 ? -0.802  0.041   -5.691  1.00 17.46 ? 278  LYS B O   1 
ATOM   5398 C  CB  . LYS B 1 278 ? -0.717  0.588   -8.823  1.00 20.74 ? 278  LYS B CB  1 
ATOM   5399 C  CG  . LYS B 1 278 ? -0.153  1.114   -10.140 1.00 24.14 ? 278  LYS B CG  1 
ATOM   5400 C  CD  . LYS B 1 278 ? -0.284  2.627   -10.237 1.00 26.16 ? 278  LYS B CD  1 
ATOM   5401 C  CE  . LYS B 1 278 ? 0.171   3.179   -11.574 1.00 28.28 ? 278  LYS B CE  1 
ATOM   5402 N  NZ  . LYS B 1 278 ? 0.337   4.663   -11.508 1.00 29.73 ? 278  LYS B NZ  1 
ATOM   5403 N  N   . GLN B 1 279 ? -1.828  2.023   -6.012  1.00 15.71 ? 279  GLN B N   1 
ATOM   5404 C  CA  . GLN B 1 279 ? -2.655  1.886   -4.817  1.00 15.46 ? 279  GLN B CA  1 
ATOM   5405 C  C   . GLN B 1 279 ? -4.109  1.624   -5.180  1.00 16.27 ? 279  GLN B C   1 
ATOM   5406 O  O   . GLN B 1 279 ? -4.721  2.374   -5.938  1.00 17.48 ? 279  GLN B O   1 
ATOM   5407 C  CB  . GLN B 1 279 ? -2.513  3.116   -3.924  1.00 15.05 ? 279  GLN B CB  1 
ATOM   5408 C  CG  . GLN B 1 279 ? -1.072  3.342   -3.479  1.00 13.34 ? 279  GLN B CG  1 
ATOM   5409 C  CD  . GLN B 1 279 ? -0.902  4.543   -2.588  1.00 13.76 ? 279  GLN B CD  1 
ATOM   5410 O  OE1 . GLN B 1 279 ? -1.424  5.619   -2.862  1.00 13.70 ? 279  GLN B OE1 1 
ATOM   5411 N  NE2 . GLN B 1 279 ? -0.180  4.375   -1.479  1.00 13.75 ? 279  GLN B NE2 1 
ATOM   5412 N  N   . ASP B 1 280 ? -4.663  0.585   -4.574  1.00 16.98 ? 280  ASP B N   1 
ATOM   5413 C  CA  . ASP B 1 280 ? -6.075  0.230   -4.742  1.00 17.78 ? 280  ASP B CA  1 
ATOM   5414 C  C   . ASP B 1 280 ? -6.585  -0.342  -3.425  1.00 18.24 ? 280  ASP B C   1 
ATOM   5415 O  O   . ASP B 1 280 ? -6.111  -1.388  -2.973  1.00 17.41 ? 280  ASP B O   1 
ATOM   5416 C  CB  . ASP B 1 280 ? -6.204  -0.799  -5.861  1.00 19.87 ? 280  ASP B CB  1 
ATOM   5417 C  CG  . ASP B 1 280 ? -7.617  -1.235  -6.171  1.00 22.22 ? 280  ASP B CG  1 
ATOM   5418 O  OD1 . ASP B 1 280 ? -8.578  -0.643  -5.642  1.00 22.72 ? 280  ASP B OD1 1 
ATOM   5419 O  OD2 . ASP B 1 280 ? -7.772  -2.194  -6.968  1.00 23.61 ? 280  ASP B OD2 1 
ATOM   5420 N  N   . PRO B 1 281 ? -7.544  0.334   -2.805  1.00 18.19 ? 281  PRO B N   1 
ATOM   5421 C  CA  . PRO B 1 281 ? -8.216  1.484   -3.358  1.00 18.65 ? 281  PRO B CA  1 
ATOM   5422 C  C   . PRO B 1 281 ? -7.399  2.752   -3.484  1.00 18.71 ? 281  PRO B C   1 
ATOM   5423 O  O   . PRO B 1 281 ? -6.395  2.966   -2.802  1.00 17.82 ? 281  PRO B O   1 
ATOM   5424 C  CB  . PRO B 1 281 ? -9.369  1.725   -2.375  1.00 18.84 ? 281  PRO B CB  1 
ATOM   5425 C  CG  . PRO B 1 281 ? -8.884  1.187   -1.077  1.00 19.45 ? 281  PRO B CG  1 
ATOM   5426 C  CD  . PRO B 1 281 ? -8.031  0.002   -1.438  1.00 18.46 ? 281  PRO B CD  1 
ATOM   5427 N  N   . LYS B 1 282 ? -7.815  3.625   -4.398  1.00 19.81 ? 282  LYS B N   1 
ATOM   5428 C  CA  . LYS B 1 282 ? -7.206  4.944   -4.569  1.00 20.56 ? 282  LYS B CA  1 
ATOM   5429 C  C   . LYS B 1 282 ? -7.395  5.746   -3.288  1.00 18.81 ? 282  LYS B C   1 
ATOM   5430 O  O   . LYS B 1 282 ? -8.469  5.789   -2.690  1.00 18.92 ? 282  LYS B O   1 
ATOM   5431 C  CB  . LYS B 1 282 ? -7.850  5.639   -5.767  1.00 23.09 ? 282  LYS B CB  1 
ATOM   5432 C  CG  . LYS B 1 282 ? -7.284  6.984   -6.164  1.00 25.80 ? 282  LYS B CG  1 
ATOM   5433 C  CD  . LYS B 1 282 ? -8.011  7.585   -7.360  1.00 28.22 ? 282  LYS B CD  1 
ATOM   5434 C  CE  . LYS B 1 282 ? -7.539  9.004   -7.630  1.00 29.45 ? 282  LYS B CE  1 
ATOM   5435 N  NZ  . LYS B 1 282 ? -8.136  9.575   -8.872  1.00 30.26 ? 282  LYS B NZ  1 
ATOM   5436 N  N   . PRO B 1 283 ? -6.318  6.357   -2.804  1.00 17.24 ? 283  PRO B N   1 
ATOM   5437 C  CA  . PRO B 1 283 ? -6.376  7.152   -1.586  1.00 16.30 ? 283  PRO B CA  1 
ATOM   5438 C  C   . PRO B 1 283 ? -7.186  8.422   -1.767  1.00 15.04 ? 283  PRO B C   1 
ATOM   5439 O  O   . PRO B 1 283 ? -7.438  8.839   -2.900  1.00 15.76 ? 283  PRO B O   1 
ATOM   5440 C  CB  . PRO B 1 283 ? -4.908  7.459   -1.320  1.00 17.12 ? 283  PRO B CB  1 
ATOM   5441 C  CG  . PRO B 1 283 ? -4.309  7.564   -2.677  1.00 18.43 ? 283  PRO B CG  1 
ATOM   5442 C  CD  . PRO B 1 283 ? -5.028  6.528   -3.512  1.00 17.82 ? 283  PRO B CD  1 
ATOM   5443 N  N   . LEU B 1 284 ? -7.584  9.038   -0.659  1.00 13.75 ? 284  LEU B N   1 
ATOM   5444 C  CA  . LEU B 1 284 ? -8.273  10.325  -0.712  1.00 13.59 ? 284  LEU B CA  1 
ATOM   5445 C  C   . LEU B 1 284 ? -7.392  11.374  -1.362  1.00 13.47 ? 284  LEU B C   1 
ATOM   5446 O  O   . LEU B 1 284 ? -6.159  11.269  -1.393  1.00 11.97 ? 284  LEU B O   1 
ATOM   5447 C  CB  . LEU B 1 284 ? -8.641  10.734  0.724   1.00 13.52 ? 284  LEU B CB  1 
ATOM   5448 C  CG  . LEU B 1 284 ? -9.809  9.933   1.320   1.00 13.56 ? 284  LEU B CG  1 
ATOM   5449 C  CD1 . LEU B 1 284 ? -9.805  10.011  2.837   1.00 13.42 ? 284  LEU B CD1 1 
ATOM   5450 C  CD2 . LEU B 1 284 ? -11.145 10.449  0.794   1.00 13.98 ? 284  LEU B CD2 1 
ATOM   5451 N  N   . PRO B 1 285 ? -7.995  12.440  -1.889  1.00 13.36 ? 285  PRO B N   1 
ATOM   5452 C  CA  . PRO B 1 285 ? -7.284  13.435  -2.659  1.00 13.56 ? 285  PRO B CA  1 
ATOM   5453 C  C   . PRO B 1 285 ? -6.098  14.043  -1.951  1.00 13.55 ? 285  PRO B C   1 
ATOM   5454 O  O   . PRO B 1 285 ? -5.067  14.267  -2.588  1.00 13.25 ? 285  PRO B O   1 
ATOM   5455 C  CB  . PRO B 1 285 ? -8.346  14.482  -2.995  1.00 13.82 ? 285  PRO B CB  1 
ATOM   5456 C  CG  . PRO B 1 285 ? -9.611  13.700  -3.038  1.00 13.51 ? 285  PRO B CG  1 
ATOM   5457 C  CD  . PRO B 1 285 ? -9.468  12.597  -2.013  1.00 14.08 ? 285  PRO B CD  1 
ATOM   5458 N  N   . TYR B 1 286 ? -6.141  14.255  -0.627  1.00 12.62 ? 286  TYR B N   1 
ATOM   5459 C  CA  . TYR B 1 286 ? -5.001  14.833  0.073   1.00 12.25 ? 286  TYR B CA  1 
ATOM   5460 C  C   . TYR B 1 286 ? -3.761  13.950  0.020   1.00 12.13 ? 286  TYR B C   1 
ATOM   5461 O  O   . TYR B 1 286 ? -2.651  14.463  0.206   1.00 12.24 ? 286  TYR B O   1 
ATOM   5462 C  CB  . TYR B 1 286 ? -5.348  15.190  1.517   1.00 11.46 ? 286  TYR B CB  1 
ATOM   5463 C  CG  . TYR B 1 286 ? -5.283  14.105  2.568   1.00 11.29 ? 286  TYR B CG  1 
ATOM   5464 C  CD1 . TYR B 1 286 ? -4.179  14.025  3.411   1.00 11.51 ? 286  TYR B CD1 1 
ATOM   5465 C  CD2 . TYR B 1 286 ? -6.313  13.190  2.734   1.00 11.66 ? 286  TYR B CD2 1 
ATOM   5466 C  CE1 . TYR B 1 286 ? -4.115  13.055  4.397   1.00 11.05 ? 286  TYR B CE1 1 
ATOM   5467 C  CE2 . TYR B 1 286 ? -6.239  12.199  3.709   1.00 11.54 ? 286  TYR B CE2 1 
ATOM   5468 C  CZ  . TYR B 1 286 ? -5.138  12.141  4.530   1.00 11.71 ? 286  TYR B CZ  1 
ATOM   5469 O  OH  . TYR B 1 286 ? -5.041  11.174  5.514   1.00 12.50 ? 286  TYR B OH  1 
ATOM   5470 N  N   . LEU B 1 287 ? -3.901  12.663  -0.254  1.00 12.15 ? 287  LEU B N   1 
ATOM   5471 C  CA  . LEU B 1 287 ? -2.792  11.739  -0.369  1.00 12.68 ? 287  LEU B CA  1 
ATOM   5472 C  C   . LEU B 1 287 ? -2.479  11.370  -1.815  1.00 13.70 ? 287  LEU B C   1 
ATOM   5473 O  O   . LEU B 1 287 ? -1.698  10.457  -2.065  1.00 15.38 ? 287  LEU B O   1 
ATOM   5474 C  CB  . LEU B 1 287 ? -3.117  10.449  0.404   1.00 12.92 ? 287  LEU B CB  1 
ATOM   5475 C  CG  . LEU B 1 287 ? -3.216  10.645  1.923   1.00 13.06 ? 287  LEU B CG  1 
ATOM   5476 C  CD1 . LEU B 1 287 ? -3.770  9.390   2.570   1.00 14.16 ? 287  LEU B CD1 1 
ATOM   5477 C  CD2 . LEU B 1 287 ? -1.844  11.016  2.476   1.00 14.42 ? 287  LEU B CD2 1 
ATOM   5478 N  N   . CYS B 1 288 ? -3.067  12.103  -2.757  1.00 15.56 ? 288  CYS B N   1 
ATOM   5479 C  CA  . CYS B 1 288 ? -2.962  11.745  -4.168  1.00 18.70 ? 288  CYS B CA  1 
ATOM   5480 C  C   . CYS B 1 288 ? -2.062  12.719  -4.912  1.00 19.79 ? 288  CYS B C   1 
ATOM   5481 O  O   . CYS B 1 288 ? -2.340  13.919  -5.002  1.00 21.66 ? 288  CYS B O   1 
ATOM   5482 C  CB  . CYS B 1 288 ? -4.374  11.722  -4.763  1.00 19.29 ? 288  CYS B CB  1 
ATOM   5483 S  SG  . CYS B 1 288 ? -4.433  11.201  -6.496  1.00 23.71 ? 288  CYS B SG  1 
ATOM   5484 N  N   . HIS B 1 289 ? -0.971  12.197  -5.466  1.00 20.12 ? 289  HIS B N   1 
ATOM   5485 C  CA  . HIS B 1 289 ? -0.040  13.033  -6.229  1.00 20.07 ? 289  HIS B CA  1 
ATOM   5486 C  C   . HIS B 1 289 ? 0.713   12.176  -7.235  1.00 19.41 ? 289  HIS B C   1 
ATOM   5487 O  O   . HIS B 1 289 ? 1.029   11.028  -6.919  1.00 19.12 ? 289  HIS B O   1 
ATOM   5488 C  CB  . HIS B 1 289 ? 0.916   13.741  -5.276  1.00 22.35 ? 289  HIS B CB  1 
ATOM   5489 C  CG  . HIS B 1 289 ? 1.668   14.886  -5.872  1.00 24.06 ? 289  HIS B CG  1 
ATOM   5490 N  ND1 . HIS B 1 289 ? 1.056   15.999  -6.402  1.00 24.97 ? 289  HIS B ND1 1 
ATOM   5491 C  CD2 . HIS B 1 289 ? 2.999   15.097  -5.999  1.00 25.15 ? 289  HIS B CD2 1 
ATOM   5492 C  CE1 . HIS B 1 289 ? 1.971   16.841  -6.849  1.00 25.63 ? 289  HIS B CE1 1 
ATOM   5493 N  NE2 . HIS B 1 289 ? 3.163   16.314  -6.611  1.00 26.35 ? 289  HIS B NE2 1 
ATOM   5494 N  N   . SER B 1 290 ? 0.984   12.717  -8.423  1.00 17.87 ? 290  SER B N   1 
ATOM   5495 C  CA  . SER B 1 290 ? 1.526   11.896  -9.496  1.00 18.58 ? 290  SER B CA  1 
ATOM   5496 C  C   . SER B 1 290 ? 3.047   11.850  -9.516  1.00 17.88 ? 290  SER B C   1 
ATOM   5497 O  O   . SER B 1 290 ? 3.597   11.038  -10.263 1.00 18.63 ? 290  SER B O   1 
ATOM   5498 C  CB  . SER B 1 290 ? 1.028   12.403  -10.860 1.00 18.48 ? 290  SER B CB  1 
ATOM   5499 O  OG  . SER B 1 290 ? 1.408   13.757  -11.040 1.00 19.62 ? 290  SER B OG  1 
ATOM   5500 N  N   . GLN B 1 291 ? 3.718   12.677  -8.735  1.00 16.83 ? 291  GLN B N   1 
ATOM   5501 C  CA  . GLN B 1 291 ? 5.185   12.695  -8.748  1.00 16.15 ? 291  GLN B CA  1 
ATOM   5502 C  C   . GLN B 1 291 ? 5.775   11.370  -8.303  1.00 14.94 ? 291  GLN B C   1 
ATOM   5503 O  O   . GLN B 1 291 ? 5.529   10.935  -7.179  1.00 13.95 ? 291  GLN B O   1 
ATOM   5504 C  CB  . GLN B 1 291 ? 5.614   13.785  -7.755  1.00 17.39 ? 291  GLN B CB  1 
ATOM   5505 C  CG  . GLN B 1 291 ? 7.094   13.966  -7.533  1.00 19.19 ? 291  GLN B CG  1 
ATOM   5506 C  CD  . GLN B 1 291 ? 7.389   15.040  -6.494  1.00 20.18 ? 291  GLN B CD  1 
ATOM   5507 O  OE1 . GLN B 1 291 ? 6.494   15.626  -5.883  1.00 21.03 ? 291  GLN B OE1 1 
ATOM   5508 N  NE2 . GLN B 1 291 ? 8.673   15.298  -6.301  1.00 22.00 ? 291  GLN B NE2 1 
ATOM   5509 N  N   . PRO B 1 292 ? 6.564   10.713  -9.138  1.00 14.17 ? 292  PRO B N   1 
ATOM   5510 C  CA  . PRO B 1 292 ? 7.327   9.545   -8.711  1.00 13.80 ? 292  PRO B CA  1 
ATOM   5511 C  C   . PRO B 1 292 ? 8.211   9.879   -7.519  1.00 13.20 ? 292  PRO B C   1 
ATOM   5512 O  O   . PRO B 1 292 ? 8.909   10.899  -7.512  1.00 13.94 ? 292  PRO B O   1 
ATOM   5513 C  CB  . PRO B 1 292 ? 8.139   9.163   -9.946  1.00 13.93 ? 292  PRO B CB  1 
ATOM   5514 C  CG  . PRO B 1 292 ? 7.335   9.709   -11.084 1.00 14.98 ? 292  PRO B CG  1 
ATOM   5515 C  CD  . PRO B 1 292 ? 6.803   11.027  -10.565 1.00 14.79 ? 292  PRO B CD  1 
ATOM   5516 N  N   . TYR B 1 293 ? 8.150   9.039   -6.485  1.00 12.57 ? 293  TYR B N   1 
ATOM   5517 C  CA  . TYR B 1 293 ? 8.919   9.307   -5.269  1.00 12.50 ? 293  TYR B CA  1 
ATOM   5518 C  C   . TYR B 1 293 ? 9.130   7.998   -4.520  1.00 12.82 ? 293  TYR B C   1 
ATOM   5519 O  O   . TYR B 1 293 ? 9.014   7.902   -3.301  1.00 14.08 ? 293  TYR B O   1 
ATOM   5520 C  CB  . TYR B 1 293 ? 8.228   10.342  -4.379  1.00 12.40 ? 293  TYR B CB  1 
ATOM   5521 C  CG  . TYR B 1 293 ? 9.233   11.231  -3.661  1.00 12.51 ? 293  TYR B CG  1 
ATOM   5522 C  CD1 . TYR B 1 293 ? 9.817   12.304  -4.316  1.00 12.95 ? 293  TYR B CD1 1 
ATOM   5523 C  CD2 . TYR B 1 293 ? 9.578   11.001  -2.337  1.00 12.47 ? 293  TYR B CD2 1 
ATOM   5524 C  CE1 . TYR B 1 293 ? 10.726  13.128  -3.678  1.00 13.01 ? 293  TYR B CE1 1 
ATOM   5525 C  CE2 . TYR B 1 293 ? 10.482  11.818  -1.688  1.00 12.82 ? 293  TYR B CE2 1 
ATOM   5526 C  CZ  . TYR B 1 293 ? 11.058  12.874  -2.360  1.00 13.21 ? 293  TYR B CZ  1 
ATOM   5527 O  OH  . TYR B 1 293 ? 11.966  13.683  -1.710  1.00 13.71 ? 293  TYR B OH  1 
ATOM   5528 N  N   . THR B 1 294 ? 9.439   6.968   -5.288  1.00 12.70 ? 294  THR B N   1 
ATOM   5529 C  CA  . THR B 1 294 ? 9.801   5.648   -4.778  1.00 12.42 ? 294  THR B CA  1 
ATOM   5530 C  C   . THR B 1 294 ? 11.216  5.377   -5.257  1.00 12.53 ? 294  THR B C   1 
ATOM   5531 O  O   . THR B 1 294 ? 11.579  5.854   -6.341  1.00 12.22 ? 294  THR B O   1 
ATOM   5532 C  CB  . THR B 1 294 ? 8.811   4.578   -5.249  1.00 12.57 ? 294  THR B CB  1 
ATOM   5533 O  OG1 . THR B 1 294 ? 7.529   4.860   -4.651  1.00 12.52 ? 294  THR B OG1 1 
ATOM   5534 C  CG2 . THR B 1 294 ? 9.212   3.170   -4.860  1.00 12.47 ? 294  THR B CG2 1 
ATOM   5535 N  N   . PHE B 1 295 ? 12.060  4.733   -4.452  1.00 12.54 ? 295  PHE B N   1 
ATOM   5536 C  CA  . PHE B 1 295 ? 13.497  4.756   -4.736  1.00 13.68 ? 295  PHE B CA  1 
ATOM   5537 C  C   . PHE B 1 295 ? 14.062  3.347   -4.767  1.00 13.06 ? 295  PHE B C   1 
ATOM   5538 O  O   . PHE B 1 295 ? 13.777  2.505   -3.925  1.00 13.25 ? 295  PHE B O   1 
ATOM   5539 C  CB  . PHE B 1 295 ? 14.285  5.633   -3.748  1.00 13.78 ? 295  PHE B CB  1 
ATOM   5540 C  CG  . PHE B 1 295 ? 13.891  7.085   -3.850  1.00 13.47 ? 295  PHE B CG  1 
ATOM   5541 C  CD1 . PHE B 1 295 ? 12.841  7.568   -3.078  1.00 13.87 ? 295  PHE B CD1 1 
ATOM   5542 C  CD2 . PHE B 1 295 ? 14.527  7.938   -4.731  1.00 14.24 ? 295  PHE B CD2 1 
ATOM   5543 C  CE1 . PHE B 1 295 ? 12.444  8.888   -3.189  1.00 13.41 ? 295  PHE B CE1 1 
ATOM   5544 C  CE2 . PHE B 1 295 ? 14.135  9.261   -4.840  1.00 14.65 ? 295  PHE B CE2 1 
ATOM   5545 C  CZ  . PHE B 1 295 ? 13.096  9.738   -4.062  1.00 14.44 ? 295  PHE B CZ  1 
ATOM   5546 N  N   . ASP B 1 296 ? 14.856  3.088   -5.810  1.00 13.86 ? 296  ASP B N   1 
ATOM   5547 C  CA  . ASP B 1 296 ? 15.508  1.790   -5.978  1.00 14.18 ? 296  ASP B CA  1 
ATOM   5548 C  C   . ASP B 1 296 ? 16.795  1.753   -5.168  1.00 13.51 ? 296  ASP B C   1 
ATOM   5549 O  O   . ASP B 1 296 ? 17.869  2.130   -5.626  1.00 13.27 ? 296  ASP B O   1 
ATOM   5550 C  CB  . ASP B 1 296 ? 15.788  1.612   -7.475  1.00 15.37 ? 296  ASP B CB  1 
ATOM   5551 C  CG  . ASP B 1 296 ? 16.321  0.263   -7.879  1.00 17.28 ? 296  ASP B CG  1 
ATOM   5552 O  OD1 . ASP B 1 296 ? 16.524  -0.651  -7.062  1.00 17.16 ? 296  ASP B OD1 1 
ATOM   5553 O  OD2 . ASP B 1 296 ? 16.563  0.099   -9.106  1.00 19.10 ? 296  ASP B OD2 1 
ATOM   5554 N  N   . ILE B 1 297 ? 16.663  1.404   -3.884  1.00 13.72 ? 297  ILE B N   1 
ATOM   5555 C  CA  . ILE B 1 297 ? 17.782  1.330   -2.953  1.00 13.42 ? 297  ILE B CA  1 
ATOM   5556 C  C   . ILE B 1 297 ? 17.922  -0.116  -2.477  1.00 14.00 ? 297  ILE B C   1 
ATOM   5557 O  O   . ILE B 1 297 ? 17.048  -0.633  -1.782  1.00 12.81 ? 297  ILE B O   1 
ATOM   5558 C  CB  . ILE B 1 297 ? 17.597  2.243   -1.721  1.00 13.07 ? 297  ILE B CB  1 
ATOM   5559 C  CG1 . ILE B 1 297 ? 17.177  3.657   -2.139  1.00 13.40 ? 297  ILE B CG1 1 
ATOM   5560 C  CG2 . ILE B 1 297 ? 18.879  2.284   -0.888  1.00 13.11 ? 297  ILE B CG2 1 
ATOM   5561 C  CD1 . ILE B 1 297 ? 16.848  4.586   -0.988  1.00 12.37 ? 297  ILE B CD1 1 
ATOM   5562 N  N   . ASN B 1 298 ? 18.985  -0.787  -2.898  1.00 13.78 ? 298  ASN B N   1 
ATOM   5563 C  CA  . ASN B 1 298 ? 19.283  -2.143  -2.452  1.00 14.20 ? 298  ASN B CA  1 
ATOM   5564 C  C   . ASN B 1 298 ? 19.614  -2.167  -0.963  1.00 13.78 ? 298  ASN B C   1 
ATOM   5565 O  O   . ASN B 1 298 ? 20.415  -1.347  -0.523  1.00 14.62 ? 298  ASN B O   1 
ATOM   5566 C  CB  . ASN B 1 298 ? 20.466  -2.699  -3.261  1.00 15.60 ? 298  ASN B CB  1 
ATOM   5567 C  CG  . ASN B 1 298 ? 20.198  -2.589  -4.754  1.00 17.77 ? 298  ASN B CG  1 
ATOM   5568 O  OD1 . ASN B 1 298 ? 19.451  -3.401  -5.299  1.00 18.84 ? 298  ASN B OD1 1 
ATOM   5569 N  ND2 . ASN B 1 298 ? 20.786  -1.590  -5.397  1.00 17.77 ? 298  ASN B ND2 1 
ATOM   5570 N  N   . LEU B 1 299 ? 18.996  -3.075  -0.226  1.00 12.65 ? 299  LEU B N   1 
ATOM   5571 C  CA  . LEU B 1 299 ? 19.228  -3.165  1.217   1.00 13.44 ? 299  LEU B CA  1 
ATOM   5572 C  C   . LEU B 1 299 ? 19.677  -4.570  1.596   1.00 14.20 ? 299  LEU B C   1 
ATOM   5573 O  O   . LEU B 1 299 ? 19.213  -5.564  1.036   1.00 14.62 ? 299  LEU B O   1 
ATOM   5574 C  CB  . LEU B 1 299 ? 17.954  -2.799  1.981   1.00 12.77 ? 299  LEU B CB  1 
ATOM   5575 C  CG  . LEU B 1 299 ? 17.476  -1.350  1.834   1.00 13.08 ? 299  LEU B CG  1 
ATOM   5576 C  CD1 . LEU B 1 299 ? 16.060  -1.228  2.379   1.00 13.67 ? 299  LEU B CD1 1 
ATOM   5577 C  CD2 . LEU B 1 299 ? 18.423  -0.388  2.537   1.00 13.55 ? 299  LEU B CD2 1 
ATOM   5578 N  N   . SER B 1 300 ? 20.590  -4.664  2.558   1.00 15.16 ? 300  SER B N   1 
ATOM   5579 C  CA  . SER B 1 300 ? 21.100  -5.961  2.996   1.00 16.42 ? 300  SER B CA  1 
ATOM   5580 C  C   . SER B 1 300 ? 21.259  -5.962  4.514   1.00 15.60 ? 300  SER B C   1 
ATOM   5581 O  O   . SER B 1 300 ? 21.553  -4.914  5.097   1.00 15.74 ? 300  SER B O   1 
ATOM   5582 C  CB  . SER B 1 300 ? 22.448  -6.258  2.333   1.00 18.25 ? 300  SER B CB  1 
ATOM   5583 O  OG  . SER B 1 300 ? 22.762  -7.633  2.414   1.00 21.29 ? 300  SER B OG  1 
ATOM   5584 N  N   . VAL B 1 301 ? 21.001  -7.108  5.134   1.00 15.27 ? 301  VAL B N   1 
ATOM   5585 C  CA  . VAL B 1 301 ? 21.176  -7.246  6.574   1.00 14.66 ? 301  VAL B CA  1 
ATOM   5586 C  C   . VAL B 1 301 ? 22.047  -8.479  6.857   1.00 15.31 ? 301  VAL B C   1 
ATOM   5587 O  O   . VAL B 1 301 ? 21.678  -9.569  6.417   1.00 14.57 ? 301  VAL B O   1 
ATOM   5588 C  CB  . VAL B 1 301 ? 19.881  -7.440  7.384   1.00 15.26 ? 301  VAL B CB  1 
ATOM   5589 C  CG1 . VAL B 1 301 ? 20.177  -7.335  8.876   1.00 15.53 ? 301  VAL B CG1 1 
ATOM   5590 C  CG2 . VAL B 1 301 ? 18.785  -6.451  7.005   1.00 15.57 ? 301  VAL B CG2 1 
ATOM   5591 N  N   . SER B 1 302 ? 23.117  -8.273  7.617   1.00 15.87 ? 302  SER B N   1 
ATOM   5592 C  CA  . SER B 1 302 ? 23.916  -9.424  8.037   1.00 15.93 ? 302  SER B CA  1 
ATOM   5593 C  C   . SER B 1 302 ? 23.836  -9.658  9.544   1.00 16.38 ? 302  SER B C   1 
ATOM   5594 O  O   . SER B 1 302 ? 23.639  -8.733  10.322  1.00 15.49 ? 302  SER B O   1 
ATOM   5595 C  CB  . SER B 1 302 ? 25.380  -9.259  7.648   1.00 15.92 ? 302  SER B CB  1 
ATOM   5596 O  OG  . SER B 1 302 ? 25.995  -8.224  8.384   1.00 15.76 ? 302  SER B OG  1 
ATOM   5597 N  N   . LEU B 1 303 ? 24.053  -10.916 9.920   1.00 16.24 ? 303  LEU B N   1 
ATOM   5598 C  CA  . LEU B 1 303 ? 24.132  -11.279 11.335  1.00 17.37 ? 303  LEU B CA  1 
ATOM   5599 C  C   . LEU B 1 303 ? 25.436  -12.049 11.566  1.00 17.77 ? 303  LEU B C   1 
ATOM   5600 O  O   . LEU B 1 303 ? 25.738  -12.940 10.774  1.00 17.93 ? 303  LEU B O   1 
ATOM   5601 C  CB  . LEU B 1 303 ? 22.948  -12.146 11.743  1.00 17.68 ? 303  LEU B CB  1 
ATOM   5602 C  CG  . LEU B 1 303 ? 22.786  -12.528 13.213  1.00 18.50 ? 303  LEU B CG  1 
ATOM   5603 C  CD1 . LEU B 1 303 ? 21.330  -12.903 13.488  1.00 18.60 ? 303  LEU B CD1 1 
ATOM   5604 C  CD2 . LEU B 1 303 ? 23.664  -13.707 13.616  1.00 18.54 ? 303  LEU B CD2 1 
ATOM   5605 N  N   . LYS B 1 304 ? 26.104  -11.737 12.660  1.00 18.18 ? 304  LYS B N   1 
ATOM   5606 C  CA  . LYS B 1 304 ? 27.341  -12.427 13.032  1.00 18.80 ? 304  LYS B CA  1 
ATOM   5607 C  C   . LYS B 1 304 ? 27.289  -12.727 14.531  1.00 18.38 ? 304  LYS B C   1 
ATOM   5608 O  O   . LYS B 1 304 ? 27.287  -11.797 15.337  1.00 17.59 ? 304  LYS B O   1 
ATOM   5609 C  CB  . LYS B 1 304 ? 28.545  -11.554 12.712  1.00 20.31 ? 304  LYS B CB  1 
ATOM   5610 C  CG  . LYS B 1 304 ? 29.923  -12.211 12.783  1.00 21.60 ? 304  LYS B CG  1 
ATOM   5611 C  CD  . LYS B 1 304 ? 30.990  -11.135 12.618  1.00 23.04 ? 304  LYS B CD  1 
ATOM   5612 C  CE  . LYS B 1 304 ? 32.380  -11.704 12.412  1.00 24.08 ? 304  LYS B CE  1 
ATOM   5613 N  NZ  . LYS B 1 304 ? 33.348  -10.626 12.042  1.00 25.22 ? 304  LYS B NZ  1 
ATOM   5614 N  N   . GLY B 1 305 ? 27.231  -14.007 14.872  1.00 17.94 ? 305  GLY B N   1 
ATOM   5615 C  CA  . GLY B 1 305 ? 27.327  -14.423 16.272  1.00 17.84 ? 305  GLY B CA  1 
ATOM   5616 C  C   . GLY B 1 305 ? 28.732  -14.197 16.812  1.00 18.23 ? 305  GLY B C   1 
ATOM   5617 O  O   . GLY B 1 305 ? 29.696  -14.079 16.056  1.00 17.92 ? 305  GLY B O   1 
ATOM   5618 N  N   . GLU B 1 306 ? 28.876  -14.167 18.138  1.00 17.68 ? 306  GLU B N   1 
ATOM   5619 C  CA  . GLU B 1 306 ? 30.127  -13.762 18.765  1.00 18.74 ? 306  GLU B CA  1 
ATOM   5620 C  C   . GLU B 1 306 ? 31.264  -14.751 18.510  1.00 19.48 ? 306  GLU B C   1 
ATOM   5621 O  O   . GLU B 1 306 ? 32.428  -14.351 18.553  1.00 20.75 ? 306  GLU B O   1 
ATOM   5622 C  CB  . GLU B 1 306 ? 29.945  -13.541 20.269  1.00 18.44 ? 306  GLU B CB  1 
ATOM   5623 C  CG  . GLU B 1 306 ? 29.426  -14.752 21.020  1.00 19.29 ? 306  GLU B CG  1 
ATOM   5624 C  CD  . GLU B 1 306 ? 29.197  -14.505 22.494  1.00 19.93 ? 306  GLU B CD  1 
ATOM   5625 O  OE1 . GLU B 1 306 ? 28.919  -15.479 23.228  1.00 19.89 ? 306  GLU B OE1 1 
ATOM   5626 O  OE2 . GLU B 1 306 ? 29.297  -13.342 22.946  1.00 20.84 ? 306  GLU B OE2 1 
ATOM   5627 N  N   . GLY B 1 307 ? 30.947  -16.008 18.217  1.00 19.83 ? 307  GLY B N   1 
ATOM   5628 C  CA  . GLY B 1 307 ? 31.965  -16.982 17.852  1.00 20.66 ? 307  GLY B CA  1 
ATOM   5629 C  C   . GLY B 1 307 ? 32.152  -17.174 16.359  1.00 21.54 ? 307  GLY B C   1 
ATOM   5630 O  O   . GLY B 1 307 ? 32.948  -18.029 15.933  1.00 21.55 ? 307  GLY B O   1 
ATOM   5631 N  N   . MET B 1 308 ? 31.442  -16.420 15.525  1.00 21.98 ? 308  MET B N   1 
ATOM   5632 C  CA  . MET B 1 308 ? 31.562  -16.583 14.074  1.00 22.44 ? 308  MET B CA  1 
ATOM   5633 C  C   . MET B 1 308 ? 32.665  -15.719 13.486  1.00 23.15 ? 308  MET B C   1 
ATOM   5634 O  O   . MET B 1 308 ? 32.984  -14.648 14.008  1.00 22.33 ? 308  MET B O   1 
ATOM   5635 C  CB  . MET B 1 308 ? 30.215  -16.277 13.410  1.00 23.26 ? 308  MET B CB  1 
ATOM   5636 C  CG  . MET B 1 308 ? 29.116  -17.259 13.782  1.00 23.60 ? 308  MET B CG  1 
ATOM   5637 S  SD  . MET B 1 308 ? 27.485  -16.789 13.172  1.00 25.15 ? 308  MET B SD  1 
ATOM   5638 C  CE  . MET B 1 308 ? 27.797  -16.557 11.434  1.00 25.34 ? 308  MET B CE  1 
ATOM   5639 N  N   . SER B 1 309 ? 33.277  -16.182 12.391  1.00 24.33 ? 309  SER B N   1 
ATOM   5640 C  CA  . SER B 1 309 ? 34.288  -15.369 11.717  1.00 26.25 ? 309  SER B CA  1 
ATOM   5641 C  C   . SER B 1 309 ? 33.732  -14.721 10.455  1.00 26.95 ? 309  SER B C   1 
ATOM   5642 O  O   . SER B 1 309 ? 34.331  -13.782 9.931   1.00 28.46 ? 309  SER B O   1 
ATOM   5643 C  CB  . SER B 1 309 ? 35.553  -16.167 11.404  1.00 26.74 ? 309  SER B CB  1 
ATOM   5644 O  OG  . SER B 1 309 ? 36.426  -16.129 12.530  1.00 28.09 ? 309  SER B OG  1 
ATOM   5645 N  N   . GLN B 1 310 ? 32.586  -15.204 10.000  1.00 27.21 ? 310  GLN B N   1 
ATOM   5646 C  CA  . GLN B 1 310 ? 31.931  -14.614 8.835   1.00 27.88 ? 310  GLN B CA  1 
ATOM   5647 C  C   . GLN B 1 310 ? 30.498  -14.211 9.174   1.00 26.75 ? 310  GLN B C   1 
ATOM   5648 O  O   . GLN B 1 310 ? 29.766  -15.016 9.737   1.00 26.20 ? 310  GLN B O   1 
ATOM   5649 C  CB  . GLN B 1 310 ? 31.946  -15.609 7.680   1.00 29.68 ? 310  GLN B CB  1 
ATOM   5650 C  CG  . GLN B 1 310 ? 31.555  -15.041 6.327   1.00 32.77 ? 310  GLN B CG  1 
ATOM   5651 C  CD  . GLN B 1 310 ? 32.198  -15.810 5.189   1.00 34.28 ? 310  GLN B CD  1 
ATOM   5652 O  OE1 . GLN B 1 310 ? 32.952  -16.762 5.421   1.00 36.00 ? 310  GLN B OE1 1 
ATOM   5653 N  NE2 . GLN B 1 310 ? 31.913  -15.410 3.957   1.00 35.23 ? 310  GLN B NE2 1 
ATOM   5654 N  N   . ALA B 1 311 ? 30.120  -12.983 8.831   1.00 25.69 ? 311  ALA B N   1 
ATOM   5655 C  CA  . ALA B 1 311 ? 28.717  -12.581 8.964   1.00 24.36 ? 311  ALA B CA  1 
ATOM   5656 C  C   . ALA B 1 311 ? 27.883  -13.224 7.865   1.00 23.80 ? 311  ALA B C   1 
ATOM   5657 O  O   . ALA B 1 311 ? 28.353  -13.387 6.734   1.00 24.22 ? 311  ALA B O   1 
ATOM   5658 C  CB  . ALA B 1 311 ? 28.594  -11.068 8.912   1.00 24.38 ? 311  ALA B CB  1 
ATOM   5659 N  N   . ALA B 1 312 ? 26.654  -13.596 8.191   1.00 22.66 ? 312  ALA B N   1 
ATOM   5660 C  CA  . ALA B 1 312 ? 25.731  -14.186 7.236   1.00 21.78 ? 312  ALA B CA  1 
ATOM   5661 C  C   . ALA B 1 312 ? 24.721  -13.141 6.752   1.00 21.10 ? 312  ALA B C   1 
ATOM   5662 O  O   . ALA B 1 312 ? 24.140  -12.459 7.594   1.00 20.13 ? 312  ALA B O   1 
ATOM   5663 C  CB  . ALA B 1 312 ? 24.956  -15.326 7.877   1.00 22.33 ? 312  ALA B CB  1 
ATOM   5664 N  N   . THR B 1 313 ? 24.523  -13.051 5.442   1.00 19.91 ? 313  THR B N   1 
ATOM   5665 C  CA  . THR B 1 313 ? 23.431  -12.194 4.956   1.00 20.43 ? 313  THR B CA  1 
ATOM   5666 C  C   . THR B 1 313 ? 22.101  -12.900 5.160   1.00 20.13 ? 313  THR B C   1 
ATOM   5667 O  O   . THR B 1 313 ? 21.860  -13.987 4.622   1.00 21.28 ? 313  THR B O   1 
ATOM   5668 C  CB  . THR B 1 313 ? 23.673  -11.803 3.491   1.00 20.66 ? 313  THR B CB  1 
ATOM   5669 O  OG1 . THR B 1 313 ? 24.942  -11.128 3.424   1.00 22.48 ? 313  THR B OG1 1 
ATOM   5670 C  CG2 . THR B 1 313 ? 22.588  -10.875 2.970   1.00 20.69 ? 313  THR B CG2 1 
ATOM   5671 N  N   . ILE B 1 314 ? 21.216  -12.308 5.968   1.00 18.88 ? 314  ILE B N   1 
ATOM   5672 C  CA  . ILE B 1 314 ? 19.945  -12.943 6.285   1.00 17.82 ? 314  ILE B CA  1 
ATOM   5673 C  C   . ILE B 1 314 ? 18.758  -12.280 5.589   1.00 17.08 ? 314  ILE B C   1 
ATOM   5674 O  O   . ILE B 1 314 ? 17.659  -12.825 5.613   1.00 17.40 ? 314  ILE B O   1 
ATOM   5675 C  CB  . ILE B 1 314 ? 19.669  -12.998 7.798   1.00 18.18 ? 314  ILE B CB  1 
ATOM   5676 C  CG1 . ILE B 1 314 ? 19.626  -11.601 8.422   1.00 17.57 ? 314  ILE B CG1 1 
ATOM   5677 C  CG2 . ILE B 1 314 ? 20.724  -13.856 8.501   1.00 18.81 ? 314  ILE B CG2 1 
ATOM   5678 C  CD1 . ILE B 1 314 ? 19.088  -11.613 9.845   1.00 17.86 ? 314  ILE B CD1 1 
ATOM   5679 N  N   . CYS B 1 315 ? 18.983  -11.117 4.987   1.00 16.51 ? 315  CYS B N   1 
ATOM   5680 C  CA  . CYS B 1 315 ? 17.919  -10.382 4.315   1.00 15.73 ? 315  CYS B CA  1 
ATOM   5681 C  C   . CYS B 1 315 ? 18.511  -9.581  3.160   1.00 15.39 ? 315  CYS B C   1 
ATOM   5682 O  O   . CYS B 1 315 ? 19.520  -8.888  3.339   1.00 14.23 ? 315  CYS B O   1 
ATOM   5683 C  CB  . CYS B 1 315 ? 17.214  -9.428  5.295   1.00 15.71 ? 315  CYS B CB  1 
ATOM   5684 S  SG  . CYS B 1 315 ? 16.059  -8.288  4.459   1.00 14.73 ? 315  CYS B SG  1 
ATOM   5685 N  N   . ARG B 1 316 ? 17.941  -9.732  1.967   1.00 15.62 ? 316  ARG B N   1 
ATOM   5686 C  CA  . ARG B 1 316 ? 18.233  -8.839  0.857   1.00 16.86 ? 316  ARG B CA  1 
ATOM   5687 C  C   . ARG B 1 316 ? 16.907  -8.223  0.397   1.00 15.54 ? 316  ARG B C   1 
ATOM   5688 O  O   . ARG B 1 316 ? 16.014  -8.962  -0.010  1.00 16.00 ? 316  ARG B O   1 
ATOM   5689 C  CB  . ARG B 1 316 ? 18.913  -9.552  -0.314  1.00 19.33 ? 316  ARG B CB  1 
ATOM   5690 C  CG  . ARG B 1 316 ? 20.330  -10.039 -0.027  1.00 22.22 ? 316  ARG B CG  1 
ATOM   5691 C  CD  . ARG B 1 316 ? 20.916  -10.706 -1.262  1.00 24.92 ? 316  ARG B CD  1 
ATOM   5692 N  NE  . ARG B 1 316 ? 22.225  -11.299 -1.062  1.00 27.61 ? 316  ARG B NE  1 
ATOM   5693 C  CZ  . ARG B 1 316 ? 22.549  -12.315 -0.277  1.00 29.01 ? 316  ARG B CZ  1 
ATOM   5694 N  NH1 . ARG B 1 316 ? 21.638  -12.925 0.474   1.00 30.37 ? 316  ARG B NH1 1 
ATOM   5695 N  NH2 . ARG B 1 316 ? 23.813  -12.729 -0.234  1.00 29.76 ? 316  ARG B NH2 1 
ATOM   5696 N  N   . SER B 1 317 ? 16.797  -6.909  0.520   1.00 15.15 ? 317  SER B N   1 
ATOM   5697 C  CA  . SER B 1 317 ? 15.522  -6.256  0.217   1.00 14.70 ? 317  SER B CA  1 
ATOM   5698 C  C   . SER B 1 317 ? 15.771  -4.962  -0.545  1.00 14.82 ? 317  SER B C   1 
ATOM   5699 O  O   . SER B 1 317 ? 16.862  -4.745  -1.081  1.00 15.96 ? 317  SER B O   1 
ATOM   5700 C  CB  . SER B 1 317 ? 14.744  -6.029  1.511   1.00 14.45 ? 317  SER B CB  1 
ATOM   5701 O  OG  . SER B 1 317 ? 13.373  -5.769  1.239   1.00 15.43 ? 317  SER B OG  1 
ATOM   5702 N  N   . ASN B 1 318 ? 14.755  -4.111  -0.608  1.00 14.76 ? 318  ASN B N   1 
ATOM   5703 C  CA  . ASN B 1 318 ? 14.877  -2.866  -1.368  1.00 14.35 ? 318  ASN B CA  1 
ATOM   5704 C  C   . ASN B 1 318 ? 13.829  -1.879  -0.879  1.00 14.16 ? 318  ASN B C   1 
ATOM   5705 O  O   . ASN B 1 318 ? 12.680  -2.275  -0.678  1.00 14.83 ? 318  ASN B O   1 
ATOM   5706 C  CB  . ASN B 1 318 ? 14.676  -3.167  -2.851  1.00 14.50 ? 318  ASN B CB  1 
ATOM   5707 C  CG  . ASN B 1 318 ? 15.048  -2.056  -3.798  1.00 14.98 ? 318  ASN B CG  1 
ATOM   5708 O  OD1 . ASN B 1 318 ? 14.552  -0.932  -3.738  1.00 13.75 ? 318  ASN B OD1 1 
ATOM   5709 N  ND2 . ASN B 1 318 ? 15.971  -2.353  -4.719  1.00 15.40 ? 318  ASN B ND2 1 
ATOM   5710 N  N   . PHE B 1 319 ? 14.204  -0.614  -0.749  1.00 14.43 ? 319  PHE B N   1 
ATOM   5711 C  CA  . PHE B 1 319 ? 13.261  0.423   -0.342  1.00 14.24 ? 319  PHE B CA  1 
ATOM   5712 C  C   . PHE B 1 319 ? 12.108  0.621   -1.310  1.00 14.72 ? 319  PHE B C   1 
ATOM   5713 O  O   . PHE B 1 319 ? 11.046  1.101   -0.898  1.00 14.34 ? 319  PHE B O   1 
ATOM   5714 C  CB  . PHE B 1 319 ? 14.012  1.741   -0.124  1.00 15.20 ? 319  PHE B CB  1 
ATOM   5715 C  CG  . PHE B 1 319 ? 13.224  2.837   0.544   1.00 15.43 ? 319  PHE B CG  1 
ATOM   5716 C  CD1 . PHE B 1 319 ? 12.579  2.633   1.750   1.00 17.46 ? 319  PHE B CD1 1 
ATOM   5717 C  CD2 . PHE B 1 319 ? 13.150  4.089   -0.039  1.00 16.12 ? 319  PHE B CD2 1 
ATOM   5718 C  CE1 . PHE B 1 319 ? 11.868  3.664   2.349   1.00 17.46 ? 319  PHE B CE1 1 
ATOM   5719 C  CE2 . PHE B 1 319 ? 12.449  5.123   0.552   1.00 16.67 ? 319  PHE B CE2 1 
ATOM   5720 C  CZ  . PHE B 1 319 ? 11.801  4.903   1.751   1.00 16.45 ? 319  PHE B CZ  1 
ATOM   5721 N  N   . LYS B 1 320 ? 12.204  0.215   -2.569  1.00 14.43 ? 320  LYS B N   1 
ATOM   5722 C  CA  . LYS B 1 320 ? 11.138  0.392   -3.542  1.00 16.15 ? 320  LYS B CA  1 
ATOM   5723 C  C   . LYS B 1 320 ? 9.888   -0.424  -3.253  1.00 17.46 ? 320  LYS B C   1 
ATOM   5724 O  O   . LYS B 1 320 ? 8.854   -0.188  -3.899  1.00 18.81 ? 320  LYS B O   1 
ATOM   5725 C  CB  . LYS B 1 320 ? 11.651  0.045   -4.949  1.00 16.47 ? 320  LYS B CB  1 
ATOM   5726 C  CG  . LYS B 1 320 ? 11.775  -1.449  -5.198  1.00 18.01 ? 320  LYS B CG  1 
ATOM   5727 C  CD  . LYS B 1 320 ? 12.393  -1.709  -6.567  1.00 19.02 ? 320  LYS B CD  1 
ATOM   5728 C  CE  . LYS B 1 320 ? 12.473  -3.204  -6.828  1.00 20.50 ? 320  LYS B CE  1 
ATOM   5729 N  NZ  . LYS B 1 320 ? 13.025  -3.476  -8.187  1.00 21.51 ? 320  LYS B NZ  1 
ATOM   5730 N  N   . HIS B 1 321 ? 9.912   -1.383  -2.339  1.00 18.22 ? 321  HIS B N   1 
ATOM   5731 C  CA  . HIS B 1 321 ? 8.737   -2.180  -2.022  1.00 19.72 ? 321  HIS B CA  1 
ATOM   5732 C  C   . HIS B 1 321 ? 7.646   -1.383  -1.328  1.00 19.63 ? 321  HIS B C   1 
ATOM   5733 O  O   . HIS B 1 321 ? 6.468   -1.707  -1.499  1.00 20.80 ? 321  HIS B O   1 
ATOM   5734 C  CB  . HIS B 1 321 ? 9.131   -3.416  -1.194  1.00 20.28 ? 321  HIS B CB  1 
ATOM   5735 C  CG  . HIS B 1 321 ? 9.981   -4.339  -2.023  1.00 21.09 ? 321  HIS B CG  1 
ATOM   5736 N  ND1 . HIS B 1 321 ? 11.161  -4.884  -1.577  1.00 21.55 ? 321  HIS B ND1 1 
ATOM   5737 C  CD2 . HIS B 1 321 ? 9.803   -4.776  -3.295  1.00 20.77 ? 321  HIS B CD2 1 
ATOM   5738 C  CE1 . HIS B 1 321 ? 11.669  -5.640  -2.537  1.00 21.23 ? 321  HIS B CE1 1 
ATOM   5739 N  NE2 . HIS B 1 321 ? 10.875  -5.584  -3.588  1.00 22.09 ? 321  HIS B NE2 1 
ATOM   5740 N  N   . MET B 1 322 ? 7.975   -0.307  -0.633  1.00 17.10 ? 322  MET B N   1 
ATOM   5741 C  CA  . MET B 1 322 ? 7.039   0.390   0.237   1.00 16.40 ? 322  MET B CA  1 
ATOM   5742 C  C   . MET B 1 322 ? 5.814   0.950   -0.470  1.00 15.28 ? 322  MET B C   1 
ATOM   5743 O  O   . MET B 1 322 ? 5.907   1.570   -1.523  1.00 16.01 ? 322  MET B O   1 
ATOM   5744 C  CB  . MET B 1 322 ? 7.805   1.505   0.968   1.00 16.72 ? 322  MET B CB  1 
ATOM   5745 C  CG  . MET B 1 322 ? 8.986   0.965   1.764   1.00 18.83 ? 322  MET B CG  1 
ATOM   5746 S  SD  . MET B 1 322 ? 8.538   -0.401  2.848   1.00 19.23 ? 322  MET B SD  1 
ATOM   5747 C  CE  . MET B 1 322 ? 8.356   0.405   4.441   1.00 19.63 ? 322  MET B CE  1 
ATOM   5748 N  N   . TYR B 1 323 ? 4.652   0.727   0.125   1.00 12.59 ? 323  TYR B N   1 
ATOM   5749 C  CA  . TYR B 1 323 ? 3.379   1.040   -0.519  1.00 12.29 ? 323  TYR B CA  1 
ATOM   5750 C  C   . TYR B 1 323 ? 3.010   2.510   -0.411  1.00 12.05 ? 323  TYR B C   1 
ATOM   5751 O  O   . TYR B 1 323 ? 2.411   3.073   -1.332  1.00 12.94 ? 323  TYR B O   1 
ATOM   5752 C  CB  . TYR B 1 323 ? 2.307   0.178   0.121   1.00 12.63 ? 323  TYR B CB  1 
ATOM   5753 C  CG  . TYR B 1 323 ? 0.936   0.181   -0.496  1.00 13.20 ? 323  TYR B CG  1 
ATOM   5754 C  CD1 . TYR B 1 323 ? 0.659   -0.662  -1.570  1.00 14.13 ? 323  TYR B CD1 1 
ATOM   5755 C  CD2 . TYR B 1 323 ? -0.079  0.981   0.005   1.00 13.24 ? 323  TYR B CD2 1 
ATOM   5756 C  CE1 . TYR B 1 323 ? -0.604  -0.694  -2.135  1.00 14.22 ? 323  TYR B CE1 1 
ATOM   5757 C  CE2 . TYR B 1 323 ? -1.350  0.950   -0.554  1.00 13.84 ? 323  TYR B CE2 1 
ATOM   5758 C  CZ  . TYR B 1 323 ? -1.596  0.113   -1.622  1.00 13.90 ? 323  TYR B CZ  1 
ATOM   5759 O  OH  . TYR B 1 323 ? -2.849  0.058   -2.188  1.00 13.76 ? 323  TYR B OH  1 
ATOM   5760 N  N   . TRP B 1 324 ? 3.260   3.094   0.752   1.00 11.87 ? 324  TRP B N   1 
ATOM   5761 C  CA  . TRP B 1 324 ? 3.032   4.514   0.994   1.00 10.93 ? 324  TRP B CA  1 
ATOM   5762 C  C   . TRP B 1 324 ? 4.342   5.276   0.850   1.00 11.20 ? 324  TRP B C   1 
ATOM   5763 O  O   . TRP B 1 324 ? 5.357   4.854   1.410   1.00 11.75 ? 324  TRP B O   1 
ATOM   5764 C  CB  . TRP B 1 324 ? 2.451   4.754   2.396   1.00 10.29 ? 324  TRP B CB  1 
ATOM   5765 C  CG  . TRP B 1 324 ? 1.100   4.134   2.592   1.00 10.27 ? 324  TRP B CG  1 
ATOM   5766 C  CD1 . TRP B 1 324 ? 0.820   2.932   3.176   1.00 9.86  ? 324  TRP B CD1 1 
ATOM   5767 C  CD2 . TRP B 1 324 ? -0.165  4.685   2.207   1.00 10.21 ? 324  TRP B CD2 1 
ATOM   5768 N  NE1 . TRP B 1 324 ? -0.532  2.702   3.181   1.00 10.70 ? 324  TRP B NE1 1 
ATOM   5769 C  CE2 . TRP B 1 324 ? -1.158  3.768   2.578   1.00 10.53 ? 324  TRP B CE2 1 
ATOM   5770 C  CE3 . TRP B 1 324 ? -0.526  5.877   1.564   1.00 10.37 ? 324  TRP B CE3 1 
ATOM   5771 C  CZ2 . TRP B 1 324 ? -2.506  4.000   2.337   1.00 10.79 ? 324  TRP B CZ2 1 
ATOM   5772 C  CZ3 . TRP B 1 324 ? -1.872  6.104   1.333   1.00 11.23 ? 324  TRP B CZ3 1 
ATOM   5773 C  CH2 . TRP B 1 324 ? -2.842  5.172   1.711   1.00 11.43 ? 324  TRP B CH2 1 
ATOM   5774 N  N   . THR B 1 325 ? 4.338   6.354   0.067   1.00 10.78 ? 325  THR B N   1 
ATOM   5775 C  CA  . THR B 1 325 ? 5.576   7.078   -0.182  1.00 10.57 ? 325  THR B CA  1 
ATOM   5776 C  C   . THR B 1 325 ? 5.910   8.028   0.956   1.00 10.26 ? 325  THR B C   1 
ATOM   5777 O  O   . THR B 1 325 ? 5.090   8.362   1.815   1.00 10.37 ? 325  THR B O   1 
ATOM   5778 C  CB  . THR B 1 325 ? 5.518   7.901   -1.486  1.00 10.89 ? 325  THR B CB  1 
ATOM   5779 O  OG1 . THR B 1 325 ? 4.604   8.990   -1.301  1.00 11.57 ? 325  THR B OG1 1 
ATOM   5780 C  CG2 . THR B 1 325 ? 5.033   7.020   -2.631  1.00 11.93 ? 325  THR B CG2 1 
ATOM   5781 N  N   . MET B 1 326 ? 7.145   8.533   0.919   1.00 10.22 ? 326  MET B N   1 
ATOM   5782 C  CA  . MET B 1 326 ? 7.567   9.543   1.884   1.00 9.75  ? 326  MET B CA  1 
ATOM   5783 C  C   . MET B 1 326 ? 6.714   10.798  1.750   1.00 9.98  ? 326  MET B C   1 
ATOM   5784 O  O   . MET B 1 326 ? 6.439   11.470  2.748   1.00 10.32 ? 326  MET B O   1 
ATOM   5785 C  CB  . MET B 1 326 ? 9.055   9.887   1.721   1.00 9.69  ? 326  MET B CB  1 
ATOM   5786 C  CG  . MET B 1 326 ? 9.939   8.708   2.127   1.00 9.91  ? 326  MET B CG  1 
ATOM   5787 S  SD  . MET B 1 326 ? 11.700  9.052   2.037   1.00 10.72 ? 326  MET B SD  1 
ATOM   5788 C  CE  . MET B 1 326 ? 11.994  8.836   0.285   1.00 10.62 ? 326  MET B CE  1 
ATOM   5789 N  N   . LEU B 1 327 ? 6.306   11.141  0.524   1.00 10.34 ? 327  LEU B N   1 
ATOM   5790 C  CA  . LEU B 1 327 ? 5.419   12.293  0.355   1.00 10.10 ? 327  LEU B CA  1 
ATOM   5791 C  C   . LEU B 1 327 ? 4.101   12.082  1.092   1.00 9.85  ? 327  LEU B C   1 
ATOM   5792 O  O   . LEU B 1 327 ? 3.604   12.987  1.761   1.00 10.67 ? 327  LEU B O   1 
ATOM   5793 C  CB  . LEU B 1 327 ? 5.162   12.551  -1.137  1.00 10.17 ? 327  LEU B CB  1 
ATOM   5794 C  CG  . LEU B 1 327 ? 6.397   12.683  -2.032  1.00 10.36 ? 327  LEU B CG  1 
ATOM   5795 C  CD1 . LEU B 1 327 ? 5.956   12.982  -3.465  1.00 10.93 ? 327  LEU B CD1 1 
ATOM   5796 C  CD2 . LEU B 1 327 ? 7.334   13.772  -1.529  1.00 10.96 ? 327  LEU B CD2 1 
ATOM   5797 N  N   . GLN B 1 328 ? 3.528   10.889  0.963   1.00 9.76  ? 328  GLN B N   1 
ATOM   5798 C  CA  . GLN B 1 328 ? 2.269   10.584  1.626   1.00 9.57  ? 328  GLN B CA  1 
ATOM   5799 C  C   . GLN B 1 328 ? 2.454   10.569  3.143   1.00 9.49  ? 328  GLN B C   1 
ATOM   5800 O  O   . GLN B 1 328 ? 1.578   11.075  3.846   1.00 10.10 ? 328  GLN B O   1 
ATOM   5801 C  CB  . GLN B 1 328 ? 1.708   9.256   1.119   1.00 10.31 ? 328  GLN B CB  1 
ATOM   5802 C  CG  . GLN B 1 328 ? 1.307   9.339   -0.358  1.00 10.04 ? 328  GLN B CG  1 
ATOM   5803 C  CD  . GLN B 1 328 ? 0.843   8.005   -0.893  1.00 10.27 ? 328  GLN B CD  1 
ATOM   5804 O  OE1 . GLN B 1 328 ? 1.541   6.991   -0.799  1.00 10.32 ? 328  GLN B OE1 1 
ATOM   5805 N  NE2 . GLN B 1 328 ? -0.364  7.961   -1.461  1.00 11.04 ? 328  GLN B NE2 1 
ATOM   5806 N  N   . GLN B 1 329 ? 3.576   10.024  3.612   1.00 8.46  ? 329  GLN B N   1 
ATOM   5807 C  CA  . GLN B 1 329 ? 3.828   9.999   5.056   1.00 9.46  ? 329  GLN B CA  1 
ATOM   5808 C  C   . GLN B 1 329 ? 3.919   11.398  5.639   1.00 10.15 ? 329  GLN B C   1 
ATOM   5809 O  O   . GLN B 1 329 ? 3.301   11.683  6.674   1.00 10.38 ? 329  GLN B O   1 
ATOM   5810 C  CB  . GLN B 1 329 ? 5.127   9.223   5.335   1.00 9.00  ? 329  GLN B CB  1 
ATOM   5811 C  CG  . GLN B 1 329 ? 4.976   7.748   5.011   1.00 9.34  ? 329  GLN B CG  1 
ATOM   5812 C  CD  . GLN B 1 329 ? 6.304   7.008   4.973   1.00 9.47  ? 329  GLN B CD  1 
ATOM   5813 O  OE1 . GLN B 1 329 ? 7.377   7.590   4.798   1.00 10.62 ? 329  GLN B OE1 1 
ATOM   5814 N  NE2 . GLN B 1 329 ? 6.203   5.696   5.145   1.00 9.27  ? 329  GLN B NE2 1 
ATOM   5815 N  N   . LEU B 1 330 ? 4.684   12.278  4.990   1.00 9.72  ? 330  LEU B N   1 
ATOM   5816 C  CA  . LEU B 1 330 ? 4.863   13.633  5.498   1.00 9.87  ? 330  LEU B CA  1 
ATOM   5817 C  C   . LEU B 1 330 ? 3.557   14.424  5.416   1.00 10.61 ? 330  LEU B C   1 
ATOM   5818 O  O   . LEU B 1 330 ? 3.230   15.163  6.349   1.00 10.27 ? 330  LEU B O   1 
ATOM   5819 C  CB  . LEU B 1 330 ? 5.990   14.349  4.740   1.00 11.18 ? 330  LEU B CB  1 
ATOM   5820 C  CG  . LEU B 1 330 ? 6.302   15.772  5.206   1.00 11.38 ? 330  LEU B CG  1 
ATOM   5821 C  CD1 . LEU B 1 330 ? 7.770   15.899  5.608   1.00 13.86 ? 330  LEU B CD1 1 
ATOM   5822 C  CD2 . LEU B 1 330 ? 5.989   16.805  4.132   1.00 13.80 ? 330  LEU B CD2 1 
ATOM   5823 N  N   . THR B 1 331 ? 2.844   14.260  4.309   1.00 10.07 ? 331  THR B N   1 
ATOM   5824 C  CA  . THR B 1 331 ? 1.530   14.887  4.152   1.00 10.01 ? 331  THR B CA  1 
ATOM   5825 C  C   . THR B 1 331 ? 0.564   14.430  5.230   1.00 10.58 ? 331  THR B C   1 
ATOM   5826 O  O   . THR B 1 331 ? -0.038  15.260  5.924   1.00 10.36 ? 331  THR B O   1 
ATOM   5827 C  CB  . THR B 1 331 ? 0.944   14.598  2.759   1.00 10.81 ? 331  THR B CB  1 
ATOM   5828 O  OG1 . THR B 1 331 ? 1.884   15.063  1.779   1.00 12.30 ? 331  THR B OG1 1 
ATOM   5829 C  CG2 . THR B 1 331 ? -0.394  15.302  2.586   1.00 10.93 ? 331  THR B CG2 1 
ATOM   5830 N  N   . HIS B 1 332 ? 0.435   13.114  5.404   1.00 9.68  ? 332  HIS B N   1 
ATOM   5831 C  CA  . HIS B 1 332 ? -0.455  12.595  6.445   1.00 9.44  ? 332  HIS B CA  1 
ATOM   5832 C  C   . HIS B 1 332 ? -0.030  13.086  7.818   1.00 9.24  ? 332  HIS B C   1 
ATOM   5833 O  O   . HIS B 1 332 ? -0.868  13.514  8.624   1.00 9.13  ? 332  HIS B O   1 
ATOM   5834 C  CB  . HIS B 1 332 ? -0.490  11.071  6.403   1.00 9.81  ? 332  HIS B CB  1 
ATOM   5835 C  CG  . HIS B 1 332 ? -1.483  10.440  7.324   1.00 10.02 ? 332  HIS B CG  1 
ATOM   5836 N  ND1 . HIS B 1 332 ? -2.858  10.572  7.160   1.00 10.39 ? 332  HIS B ND1 1 
ATOM   5837 C  CD2 . HIS B 1 332 ? -1.296  9.675   8.428   1.00 11.07 ? 332  HIS B CD2 1 
ATOM   5838 C  CE1 . HIS B 1 332 ? -3.463  9.898   8.119   1.00 10.12 ? 332  HIS B CE1 1 
ATOM   5839 N  NE2 . HIS B 1 332 ? -2.548  9.350   8.905   1.00 10.30 ? 332  HIS B NE2 1 
ATOM   5840 N  N   . HIS B 1 333 ? 1.281   13.118  8.090   1.00 9.08  ? 333  HIS B N   1 
ATOM   5841 C  CA  . HIS B 1 333 ? 1.761   13.535  9.405   1.00 9.55  ? 333  HIS B CA  1 
ATOM   5842 C  C   . HIS B 1 333 ? 1.386   14.967  9.744   1.00 9.07  ? 333  HIS B C   1 
ATOM   5843 O  O   . HIS B 1 333 ? 1.319   15.284  10.940  1.00 10.20 ? 333  HIS B O   1 
ATOM   5844 C  CB  . HIS B 1 333 ? 3.289   13.402  9.474   1.00 9.08  ? 333  HIS B CB  1 
ATOM   5845 C  CG  . HIS B 1 333 ? 3.811   13.107  10.849  1.00 9.09  ? 333  HIS B CG  1 
ATOM   5846 N  ND1 . HIS B 1 333 ? 3.262   13.658  11.984  1.00 9.99  ? 333  HIS B ND1 1 
ATOM   5847 C  CD2 . HIS B 1 333 ? 4.843   12.326  11.260  1.00 9.61  ? 333  HIS B CD2 1 
ATOM   5848 C  CE1 . HIS B 1 333 ? 3.924   13.218  13.043  1.00 10.26 ? 333  HIS B CE1 1 
ATOM   5849 N  NE2 . HIS B 1 333 ? 4.882   12.414  12.636  1.00 9.82  ? 333  HIS B NE2 1 
ATOM   5850 N  N   . SER B 1 334 ? 1.153   15.835  8.766   1.00 9.53  ? 334  SER B N   1 
ATOM   5851 C  CA  . SER B 1 334 ? 0.851   17.228  9.041   1.00 9.34  ? 334  SER B CA  1 
ATOM   5852 C  C   . SER B 1 334 ? -0.571  17.596  8.652   1.00 9.07  ? 334  SER B C   1 
ATOM   5853 O  O   . SER B 1 334 ? -0.956  18.752  8.840   1.00 10.10 ? 334  SER B O   1 
ATOM   5854 C  CB  . SER B 1 334 ? 1.858   18.127  8.317   1.00 9.81  ? 334  SER B CB  1 
ATOM   5855 O  OG  . SER B 1 334 ? 1.788   17.903  6.920   1.00 10.64 ? 334  SER B OG  1 
ATOM   5856 N  N   . VAL B 1 335 ? -1.411  16.642  8.231   1.00 9.24  ? 335  VAL B N   1 
ATOM   5857 C  CA  . VAL B 1 335 ? -2.735  17.015  7.724   1.00 9.89  ? 335  VAL B CA  1 
ATOM   5858 C  C   . VAL B 1 335 ? -3.610  17.624  8.809   1.00 9.74  ? 335  VAL B C   1 
ATOM   5859 O  O   . VAL B 1 335 ? -4.475  18.446  8.503   1.00 10.47 ? 335  VAL B O   1 
ATOM   5860 C  CB  . VAL B 1 335 ? -3.447  15.843  7.039   1.00 10.28 ? 335  VAL B CB  1 
ATOM   5861 C  CG1 . VAL B 1 335 ? -3.901  14.783  8.033   1.00 11.38 ? 335  VAL B CG1 1 
ATOM   5862 C  CG2 . VAL B 1 335 ? -4.636  16.348  6.220   1.00 11.08 ? 335  VAL B CG2 1 
ATOM   5863 N  N   . ASN B 1 336 ? -3.390  17.247  10.065  1.00 9.04  ? 336  ASN B N   1 
ATOM   5864 C  CA  . ASN B 1 336 ? -4.114  17.766  11.210  1.00 8.95  ? 336  ASN B CA  1 
ATOM   5865 C  C   . ASN B 1 336 ? -3.544  19.053  11.785  1.00 9.12  ? 336  ASN B C   1 
ATOM   5866 O  O   . ASN B 1 336 ? -4.046  19.518  12.818  1.00 9.63  ? 336  ASN B O   1 
ATOM   5867 C  CB  . ASN B 1 336 ? -4.149  16.669  12.302  1.00 8.81  ? 336  ASN B CB  1 
ATOM   5868 C  CG  . ASN B 1 336 ? -2.756  16.411  12.860  1.00 8.67  ? 336  ASN B CG  1 
ATOM   5869 O  OD1 . ASN B 1 336 ? -1.761  16.783  12.249  1.00 8.91  ? 336  ASN B OD1 1 
ATOM   5870 N  ND2 . ASN B 1 336 ? -2.718  15.778  14.032  1.00 8.70  ? 336  ASN B ND2 1 
ATOM   5871 N  N   . GLY B 1 337 ? -2.503  19.622  11.178  1.00 9.44  ? 337  GLY B N   1 
ATOM   5872 C  CA  . GLY B 1 337 ? -1.869  20.812  11.732  1.00 9.92  ? 337  GLY B CA  1 
ATOM   5873 C  C   . GLY B 1 337 ? -0.630  20.517  12.562  1.00 9.62  ? 337  GLY B C   1 
ATOM   5874 O  O   . GLY B 1 337 ? 0.052   21.458  12.993  1.00 9.67  ? 337  GLY B O   1 
ATOM   5875 N  N   . CYS B 1 338 ? -0.323  19.245  12.801  1.00 8.83  ? 338  CYS B N   1 
ATOM   5876 C  CA  . CYS B 1 338 ? 0.913   18.922  13.532  1.00 8.75  ? 338  CYS B CA  1 
ATOM   5877 C  C   . CYS B 1 338 ? 2.114   19.570  12.863  1.00 9.27  ? 338  CYS B C   1 
ATOM   5878 O  O   . CYS B 1 338 ? 2.248   19.472  11.648  1.00 9.74  ? 338  CYS B O   1 
ATOM   5879 C  CB  . CYS B 1 338 ? 1.079   17.408  13.592  1.00 8.77  ? 338  CYS B CB  1 
ATOM   5880 S  SG  . CYS B 1 338 ? 2.549   16.848  14.494  1.00 8.33  ? 338  CYS B SG  1 
ATOM   5881 N  N   . ASN B 1 339 ? 2.989   20.162  13.664  1.00 9.85  ? 339  ASN B N   1 
ATOM   5882 C  CA  . ASN B 1 339 ? 4.136   20.907  13.189  1.00 9.80  ? 339  ASN B CA  1 
ATOM   5883 C  C   . ASN B 1 339 ? 5.409   20.067  13.159  1.00 10.02 ? 339  ASN B C   1 
ATOM   5884 O  O   . ASN B 1 339 ? 6.073   19.883  14.176  1.00 10.31 ? 339  ASN B O   1 
ATOM   5885 C  CB  . ASN B 1 339 ? 4.364   22.164  14.036  1.00 9.67  ? 339  ASN B CB  1 
ATOM   5886 C  CG  . ASN B 1 339 ? 4.442   21.907  15.524  1.00 10.99 ? 339  ASN B CG  1 
ATOM   5887 O  OD1 . ASN B 1 339 ? 3.782   21.032  16.078  1.00 10.98 ? 339  ASN B OD1 1 
ATOM   5888 N  ND2 . ASN B 1 339 ? 5.278   22.688  16.201  1.00 10.74 ? 339  ASN B ND2 1 
ATOM   5889 N  N   . LEU B 1 340 ? 5.744   19.595  11.961  1.00 10.30 ? 340  LEU B N   1 
ATOM   5890 C  CA  . LEU B 1 340 ? 7.043   18.952  11.748  1.00 10.74 ? 340  LEU B CA  1 
ATOM   5891 C  C   . LEU B 1 340 ? 8.134   20.000  11.848  1.00 11.03 ? 340  LEU B C   1 
ATOM   5892 O  O   . LEU B 1 340 ? 7.955   21.171  11.492  1.00 10.96 ? 340  LEU B O   1 
ATOM   5893 C  CB  . LEU B 1 340 ? 7.047   18.260  10.384  1.00 11.78 ? 340  LEU B CB  1 
ATOM   5894 C  CG  . LEU B 1 340 ? 5.967   17.181  10.197  1.00 12.60 ? 340  LEU B CG  1 
ATOM   5895 C  CD1 . LEU B 1 340 ? 6.008   16.654  8.774   1.00 13.78 ? 340  LEU B CD1 1 
ATOM   5896 C  CD2 . LEU B 1 340 ? 6.155   16.059  11.215  1.00 13.24 ? 340  LEU B CD2 1 
ATOM   5897 N  N   . ARG B 1 341 ? 9.289   19.620  12.390  1.00 10.13 ? 341  ARG B N   1 
ATOM   5898 C  CA  . ARG B 1 341 ? 10.382  20.561  12.649  1.00 10.39 ? 341  ARG B CA  1 
ATOM   5899 C  C   . ARG B 1 341 ? 11.677  20.032  12.053  1.00 10.80 ? 341  ARG B C   1 
ATOM   5900 O  O   . ARG B 1 341 ? 11.829  18.826  11.893  1.00 10.56 ? 341  ARG B O   1 
ATOM   5901 C  CB  . ARG B 1 341 ? 10.532  20.797  14.159  1.00 11.85 ? 341  ARG B CB  1 
ATOM   5902 C  CG  . ARG B 1 341 ? 9.341   21.509  14.769  1.00 12.50 ? 341  ARG B CG  1 
ATOM   5903 C  CD  . ARG B 1 341 ? 9.451   21.832  16.236  1.00 13.79 ? 341  ARG B CD  1 
ATOM   5904 N  NE  . ARG B 1 341 ? 9.724   20.655  17.053  1.00 15.63 ? 341  ARG B NE  1 
ATOM   5905 C  CZ  . ARG B 1 341 ? 9.855   20.696  18.379  1.00 17.54 ? 341  ARG B CZ  1 
ATOM   5906 N  NH1 . ARG B 1 341 ? 9.716   21.852  19.021  1.00 17.96 ? 341  ARG B NH1 1 
ATOM   5907 N  NH2 . ARG B 1 341 ? 10.119  19.584  19.053  1.00 17.51 ? 341  ARG B NH2 1 
ATOM   5908 N  N   . PRO B 1 342 ? 12.610  20.922  11.724  1.00 11.24 ? 342  PRO B N   1 
ATOM   5909 C  CA  . PRO B 1 342 ? 13.890  20.509  11.161  1.00 11.86 ? 342  PRO B CA  1 
ATOM   5910 C  C   . PRO B 1 342 ? 14.557  19.464  12.038  1.00 11.72 ? 342  PRO B C   1 
ATOM   5911 O  O   . PRO B 1 342 ? 14.607  19.621  13.262  1.00 12.27 ? 342  PRO B O   1 
ATOM   5912 C  CB  . PRO B 1 342 ? 14.694  21.797  11.045  1.00 12.19 ? 342  PRO B CB  1 
ATOM   5913 C  CG  . PRO B 1 342 ? 13.663  22.890  11.053  1.00 12.40 ? 342  PRO B CG  1 
ATOM   5914 C  CD  . PRO B 1 342 ? 12.532  22.384  11.916  1.00 12.20 ? 342  PRO B CD  1 
ATOM   5915 N  N   . GLY B 1 343 ? 14.999  18.369  11.424  1.00 11.37 ? 343  GLY B N   1 
ATOM   5916 C  CA  . GLY B 1 343 ? 15.702  17.327  12.174  1.00 11.01 ? 343  GLY B CA  1 
ATOM   5917 C  C   . GLY B 1 343 ? 14.784  16.235  12.701  1.00 10.53 ? 343  GLY B C   1 
ATOM   5918 O  O   . GLY B 1 343 ? 15.246  15.217  13.230  1.00 10.30 ? 343  GLY B O   1 
ATOM   5919 N  N   . ASP B 1 344 ? 13.466  16.396  12.565  1.00 9.77  ? 344  ASP B N   1 
ATOM   5920 C  CA  . ASP B 1 344 ? 12.570  15.275  12.836  1.00 9.80  ? 344  ASP B CA  1 
ATOM   5921 C  C   . ASP B 1 344 ? 12.904  14.100  11.920  1.00 10.31 ? 344  ASP B C   1 
ATOM   5922 O  O   . ASP B 1 344 ? 13.325  14.252  10.771  1.00 9.86  ? 344  ASP B O   1 
ATOM   5923 C  CB  . ASP B 1 344 ? 11.100  15.641  12.654  1.00 9.76  ? 344  ASP B CB  1 
ATOM   5924 C  CG  . ASP B 1 344 ? 10.517  16.515  13.734  1.00 11.14 ? 344  ASP B CG  1 
ATOM   5925 O  OD1 . ASP B 1 344 ? 11.132  16.714  14.799  1.00 11.21 ? 344  ASP B OD1 1 
ATOM   5926 O  OD2 . ASP B 1 344 ? 9.389   17.010  13.501  1.00 10.97 ? 344  ASP B OD2 1 
ATOM   5927 N  N   . LEU B 1 345 ? 12.676  12.903  12.459  1.00 9.27  ? 345  LEU B N   1 
ATOM   5928 C  CA  . LEU B 1 345 ? 12.992  11.671  11.748  1.00 9.53  ? 345  LEU B CA  1 
ATOM   5929 C  C   . LEU B 1 345 ? 11.743  10.825  11.549  1.00 9.87  ? 345  LEU B C   1 
ATOM   5930 O  O   . LEU B 1 345 ? 11.051  10.434  12.487  1.00 9.86  ? 345  LEU B O   1 
ATOM   5931 C  CB  . LEU B 1 345 ? 14.081  10.914  12.508  1.00 10.06 ? 345  LEU B CB  1 
ATOM   5932 C  CG  . LEU B 1 345 ? 14.672  9.682   11.819  1.00 11.10 ? 345  LEU B CG  1 
ATOM   5933 C  CD1 . LEU B 1 345 ? 15.468  10.074  10.585  1.00 11.36 ? 345  LEU B CD1 1 
ATOM   5934 C  CD2 . LEU B 1 345 ? 15.532  8.916   12.817  1.00 12.52 ? 345  LEU B CD2 1 
ATOM   5935 N  N   . LEU B 1 346 ? 11.453  10.560  10.273  1.00 9.83  ? 346  LEU B N   1 
ATOM   5936 C  CA  . LEU B 1 346 ? 10.247  9.818   9.898   1.00 9.89  ? 346  LEU B CA  1 
ATOM   5937 C  C   . LEU B 1 346 ? 10.673  8.510   9.243   1.00 10.32 ? 346  LEU B C   1 
ATOM   5938 O  O   . LEU B 1 346 ? 11.225  8.522   8.136   1.00 10.23 ? 346  LEU B O   1 
ATOM   5939 C  CB  . LEU B 1 346 ? 9.377   10.639  8.943   1.00 9.91  ? 346  LEU B CB  1 
ATOM   5940 C  CG  . LEU B 1 346 ? 8.418   11.662  9.559   1.00 9.97  ? 346  LEU B CG  1 
ATOM   5941 C  CD1 . LEU B 1 346 ? 9.146   12.792  10.278  1.00 10.41 ? 346  LEU B CD1 1 
ATOM   5942 C  CD2 . LEU B 1 346 ? 7.495   12.243  8.496   1.00 11.00 ? 346  LEU B CD2 1 
ATOM   5943 N  N   . ALA B 1 347 ? 10.453  7.392   9.935   1.00 9.60  ? 347  ALA B N   1 
ATOM   5944 C  CA  . ALA B 1 347 ? 10.937  6.109   9.447   1.00 9.60  ? 347  ALA B CA  1 
ATOM   5945 C  C   . ALA B 1 347 ? 9.867   5.309   8.723   1.00 10.12 ? 347  ALA B C   1 
ATOM   5946 O  O   . ALA B 1 347 ? 8.664   5.510   8.877   1.00 9.86  ? 347  ALA B O   1 
ATOM   5947 C  CB  . ALA B 1 347 ? 11.544  5.301   10.595  1.00 9.38  ? 347  ALA B CB  1 
ATOM   5948 N  N   . SER B 1 348 ? 10.323  4.363   7.900   1.00 9.80  ? 348  SER B N   1 
ATOM   5949 C  CA  . SER B 1 348 ? 9.467   3.722   6.916   1.00 11.37 ? 348  SER B CA  1 
ATOM   5950 C  C   . SER B 1 348 ? 8.573   2.639   7.492   1.00 12.05 ? 348  SER B C   1 
ATOM   5951 O  O   . SER B 1 348 ? 7.508   2.346   6.938   1.00 14.36 ? 348  SER B O   1 
ATOM   5952 C  CB  . SER B 1 348 ? 10.361  3.095   5.828   1.00 10.77 ? 348  SER B CB  1 
ATOM   5953 O  OG  . SER B 1 348 ? 11.211  2.123   6.428   1.00 10.92 ? 348  SER B OG  1 
ATOM   5954 N  N   . GLY B 1 349 ? 8.980   2.046   8.606   1.00 12.40 ? 349  GLY B N   1 
ATOM   5955 C  CA  . GLY B 1 349 ? 8.441   0.746   9.019   1.00 13.47 ? 349  GLY B CA  1 
ATOM   5956 C  C   . GLY B 1 349 ? 9.338   -0.347  8.434   1.00 12.83 ? 349  GLY B C   1 
ATOM   5957 O  O   . GLY B 1 349 ? 10.138  -0.106  7.537   1.00 12.97 ? 349  GLY B O   1 
ATOM   5958 N  N   . THR B 1 350 ? 9.246   -1.534  9.014   1.00 13.38 ? 350  THR B N   1 
ATOM   5959 C  CA  . THR B 1 350 ? 10.037  -2.663  8.533   1.00 12.88 ? 350  THR B CA  1 
ATOM   5960 C  C   . THR B 1 350 ? 9.821   -2.858  7.037   1.00 13.40 ? 350  THR B C   1 
ATOM   5961 O  O   . THR B 1 350 ? 8.673   -2.904  6.598   1.00 13.61 ? 350  THR B O   1 
ATOM   5962 C  CB  . THR B 1 350 ? 9.634   -3.937  9.291   1.00 13.39 ? 350  THR B CB  1 
ATOM   5963 O  OG1 . THR B 1 350 ? 9.843   -3.729  10.693  1.00 13.04 ? 350  THR B OG1 1 
ATOM   5964 C  CG2 . THR B 1 350 ? 10.467  -5.128  8.848   1.00 14.04 ? 350  THR B CG2 1 
ATOM   5965 N  N   . ILE B 1 351 ? 10.917  -2.976  6.310   1.00 13.16 ? 351  ILE B N   1 
ATOM   5966 C  CA  . ILE B 1 351 ? 10.859  -3.147  4.855   1.00 13.95 ? 351  ILE B CA  1 
ATOM   5967 C  C   . ILE B 1 351 ? 10.876  -4.637  4.553   1.00 15.73 ? 351  ILE B C   1 
ATOM   5968 O  O   . ILE B 1 351 ? 11.810  -5.354  4.931   1.00 18.50 ? 351  ILE B O   1 
ATOM   5969 C  CB  . ILE B 1 351 ? 12.006  -2.384  4.179   1.00 13.47 ? 351  ILE B CB  1 
ATOM   5970 C  CG1 . ILE B 1 351 ? 11.944  -0.887  4.523   1.00 13.53 ? 351  ILE B CG1 1 
ATOM   5971 C  CG2 . ILE B 1 351 ? 11.974  -2.568  2.665   1.00 14.26 ? 351  ILE B CG2 1 
ATOM   5972 C  CD1 . ILE B 1 351 ? 13.260  -0.165  4.294   1.00 14.76 ? 351  ILE B CD1 1 
ATOM   5973 N  N   . SER B 1 352 ? 9.768   -5.154  4.047   1.00 14.24 ? 352  SER B N   1 
ATOM   5974 C  CA  . SER B 1 352 ? 9.717   -6.509  3.525   1.00 14.35 ? 352  SER B CA  1 
ATOM   5975 C  C   . SER B 1 352 ? 9.168   -6.471  2.096   1.00 14.83 ? 352  SER B C   1 
ATOM   5976 O  O   . SER B 1 352 ? 8.161   -5.793  1.879   1.00 14.68 ? 352  SER B O   1 
ATOM   5977 C  CB  . SER B 1 352 ? 8.815   -7.399  4.369   1.00 14.46 ? 352  SER B CB  1 
ATOM   5978 O  OG  . SER B 1 352 ? 9.324   -7.544  5.679   1.00 12.70 ? 352  SER B OG  1 
ATOM   5979 N  N   . GLY B 1 353 ? 9.826   -7.195  1.200   1.00 14.81 ? 353  GLY B N   1 
ATOM   5980 C  CA  . GLY B 1 353 ? 9.207   -7.420  -0.120  1.00 16.12 ? 353  GLY B CA  1 
ATOM   5981 C  C   . GLY B 1 353 ? 8.380   -8.704  -0.058  1.00 17.05 ? 353  GLY B C   1 
ATOM   5982 O  O   . GLY B 1 353 ? 8.208   -9.270  1.016   1.00 16.79 ? 353  GLY B O   1 
ATOM   5983 N  N   . SER B 1 354 ? 7.905   -9.181  -1.209  1.00 19.22 ? 354  SER B N   1 
ATOM   5984 C  CA  . SER B 1 354 ? 7.090   -10.395 -1.227  1.00 20.78 ? 354  SER B CA  1 
ATOM   5985 C  C   . SER B 1 354 ? 7.940   -11.658 -1.176  1.00 20.97 ? 354  SER B C   1 
ATOM   5986 O  O   . SER B 1 354 ? 7.492   -12.688 -0.662  1.00 21.27 ? 354  SER B O   1 
ATOM   5987 C  CB  . SER B 1 354 ? 6.163   -10.387 -2.444  1.00 22.18 ? 354  SER B CB  1 
ATOM   5988 O  OG  . SER B 1 354 ? 6.892   -10.265 -3.647  1.00 23.96 ? 354  SER B OG  1 
ATOM   5989 N  N   . ASP B 1 355 ? 9.159   -11.603 -1.687  1.00 21.33 ? 355  ASP B N   1 
ATOM   5990 C  CA  . ASP B 1 355 ? 10.101  -12.720 -1.576  1.00 22.62 ? 355  ASP B CA  1 
ATOM   5991 C  C   . ASP B 1 355 ? 10.508  -12.897 -0.121  1.00 22.34 ? 355  ASP B C   1 
ATOM   5992 O  O   . ASP B 1 355 ? 10.961  -11.955 0.533   1.00 22.45 ? 355  ASP B O   1 
ATOM   5993 C  CB  . ASP B 1 355 ? 11.317  -12.447 -2.453  1.00 23.99 ? 355  ASP B CB  1 
ATOM   5994 C  CG  . ASP B 1 355 ? 12.291  -13.587 -2.623  1.00 25.69 ? 355  ASP B CG  1 
ATOM   5995 O  OD1 . ASP B 1 355 ? 12.552  -14.349 -1.670  1.00 25.51 ? 355  ASP B OD1 1 
ATOM   5996 O  OD2 . ASP B 1 355 ? 12.831  -13.740 -3.750  1.00 27.41 ? 355  ASP B OD2 1 
ATOM   5997 N  N   . PRO B 1 356 ? 10.404  -14.116 0.395   1.00 22.32 ? 356  PRO B N   1 
ATOM   5998 C  CA  . PRO B 1 356 ? 10.779  -14.434 1.761   1.00 22.07 ? 356  PRO B CA  1 
ATOM   5999 C  C   . PRO B 1 356 ? 12.214  -14.128 2.119   1.00 21.87 ? 356  PRO B C   1 
ATOM   6000 O  O   . PRO B 1 356 ? 12.530  -13.888 3.292   1.00 21.49 ? 356  PRO B O   1 
ATOM   6001 C  CB  . PRO B 1 356 ? 10.489  -15.927 1.884   1.00 22.43 ? 356  PRO B CB  1 
ATOM   6002 C  CG  . PRO B 1 356 ? 9.400   -16.182 0.901   1.00 22.90 ? 356  PRO B CG  1 
ATOM   6003 C  CD  . PRO B 1 356 ? 9.676   -15.243 -0.244  1.00 22.42 ? 356  PRO B CD  1 
ATOM   6004 N  N   . GLU B 1 357 ? 13.135  -14.070 1.159   1.00 21.56 ? 357  GLU B N   1 
ATOM   6005 C  CA  . GLU B 1 357 ? 14.500  -13.629 1.381   1.00 21.97 ? 357  GLU B CA  1 
ATOM   6006 C  C   . GLU B 1 357 ? 14.616  -12.129 1.633   1.00 20.30 ? 357  GLU B C   1 
ATOM   6007 O  O   . GLU B 1 357 ? 15.694  -11.654 2.000   1.00 19.46 ? 357  GLU B O   1 
ATOM   6008 C  CB  . GLU B 1 357 ? 15.377  -14.005 0.174   1.00 24.84 ? 357  GLU B CB  1 
ATOM   6009 C  CG  . GLU B 1 357 ? 15.216  -15.457 -0.252  1.00 28.09 ? 357  GLU B CG  1 
ATOM   6010 C  CD  . GLU B 1 357 ? 16.511  -16.084 -0.724  1.00 30.17 ? 357  GLU B CD  1 
ATOM   6011 O  OE1 . GLU B 1 357 ? 17.301  -15.412 -1.420  1.00 31.73 ? 357  GLU B OE1 1 
ATOM   6012 O  OE2 . GLU B 1 357 ? 16.744  -17.268 -0.386  1.00 31.83 ? 357  GLU B OE2 1 
ATOM   6013 N  N   . SER B 1 358 ? 13.542  -11.376 1.424   1.00 19.08 ? 358  SER B N   1 
ATOM   6014 C  CA  . SER B 1 358 ? 13.528  -9.936  1.581   1.00 17.94 ? 358  SER B CA  1 
ATOM   6015 C  C   . SER B 1 358 ? 12.740  -9.487  2.809   1.00 17.41 ? 358  SER B C   1 
ATOM   6016 O  O   . SER B 1 358 ? 12.560  -8.279  2.997   1.00 17.36 ? 358  SER B O   1 
ATOM   6017 C  CB  . SER B 1 358 ? 12.933  -9.269  0.333   1.00 17.90 ? 358  SER B CB  1 
ATOM   6018 O  OG  . SER B 1 358 ? 11.525  -9.428  0.299   1.00 17.76 ? 358  SER B OG  1 
ATOM   6019 N  N   . PHE B 1 359 ? 12.278  -10.441 3.612   1.00 15.88 ? 359  PHE B N   1 
ATOM   6020 C  CA  . PHE B 1 359 ? 11.542  -10.078 4.832   1.00 15.66 ? 359  PHE B CA  1 
ATOM   6021 C  C   . PHE B 1 359 ? 12.483  -9.375  5.806   1.00 15.33 ? 359  PHE B C   1 
ATOM   6022 O  O   . PHE B 1 359 ? 13.611  -9.808  6.039   1.00 14.83 ? 359  PHE B O   1 
ATOM   6023 C  CB  . PHE B 1 359 ? 10.858  -11.286 5.452   1.00 15.27 ? 359  PHE B CB  1 
ATOM   6024 C  CG  . PHE B 1 359 ? 9.767   -11.968 4.672   1.00 15.84 ? 359  PHE B CG  1 
ATOM   6025 C  CD1 . PHE B 1 359 ? 9.271   -13.185 5.115   1.00 15.49 ? 359  PHE B CD1 1 
ATOM   6026 C  CD2 . PHE B 1 359 ? 9.238   -11.437 3.506   1.00 15.13 ? 359  PHE B CD2 1 
ATOM   6027 C  CE1 . PHE B 1 359 ? 8.271   -13.838 4.419   1.00 15.91 ? 359  PHE B CE1 1 
ATOM   6028 C  CE2 . PHE B 1 359 ? 8.233   -12.077 2.807   1.00 15.60 ? 359  PHE B CE2 1 
ATOM   6029 C  CZ  . PHE B 1 359 ? 7.748   -13.289 3.264   1.00 15.06 ? 359  PHE B CZ  1 
ATOM   6030 N  N   . GLY B 1 360 ? 12.010  -8.288  6.427   1.00 13.98 ? 360  GLY B N   1 
ATOM   6031 C  CA  . GLY B 1 360 ? 12.885  -7.363  7.112   1.00 13.27 ? 360  GLY B CA  1 
ATOM   6032 C  C   . GLY B 1 360 ? 13.031  -7.552  8.613   1.00 13.21 ? 360  GLY B C   1 
ATOM   6033 O  O   . GLY B 1 360 ? 13.592  -6.652  9.259   1.00 13.57 ? 360  GLY B O   1 
ATOM   6034 N  N   . SER B 1 361 ? 12.531  -8.632  9.185   1.00 13.00 ? 361  SER B N   1 
ATOM   6035 C  CA  . SER B 1 361 ? 12.659  -8.906  10.609  1.00 13.89 ? 361  SER B CA  1 
ATOM   6036 C  C   . SER B 1 361 ? 12.937  -10.392 10.818  1.00 13.69 ? 361  SER B C   1 
ATOM   6037 O  O   . SER B 1 361 ? 12.487  -11.201 9.996   1.00 14.74 ? 361  SER B O   1 
ATOM   6038 C  CB  . SER B 1 361 ? 11.412  -8.508  11.396  1.00 13.56 ? 361  SER B CB  1 
ATOM   6039 O  OG  . SER B 1 361 ? 10.265  -9.260  11.035  1.00 13.20 ? 361  SER B OG  1 
ATOM   6040 N  N   . MET B 1 362 ? 13.543  -10.755 11.948  1.00 14.98 ? 362  MET B N   1 
ATOM   6041 C  CA  . MET B 1 362 ? 13.704  -12.184 12.243  1.00 15.14 ? 362  MET B CA  1 
ATOM   6042 C  C   . MET B 1 362 ? 12.385  -12.814 12.648  1.00 15.40 ? 362  MET B C   1 
ATOM   6043 O  O   . MET B 1 362 ? 12.158  -14.007 12.426  1.00 15.90 ? 362  MET B O   1 
ATOM   6044 C  CB  . MET B 1 362 ? 14.798  -12.400 13.293  1.00 15.22 ? 362  MET B CB  1 
ATOM   6045 C  CG  . MET B 1 362 ? 16.121  -11.783 12.850  1.00 15.79 ? 362  MET B CG  1 
ATOM   6046 S  SD  . MET B 1 362 ? 17.416  -11.823 14.096  1.00 16.61 ? 362  MET B SD  1 
ATOM   6047 C  CE  . MET B 1 362 ? 17.798  -13.577 14.158  1.00 15.89 ? 362  MET B CE  1 
ATOM   6048 N  N   . LEU B 1 363 ? 11.437  -12.019 13.156  1.00 15.43 ? 363  LEU B N   1 
ATOM   6049 C  CA  . LEU B 1 363 ? 10.070  -12.475 13.334  1.00 15.35 ? 363  LEU B CA  1 
ATOM   6050 C  C   . LEU B 1 363 ? 9.516   -13.070 12.043  1.00 15.65 ? 363  LEU B C   1 
ATOM   6051 O  O   . LEU B 1 363 ? 8.883   -14.121 12.085  1.00 16.22 ? 363  LEU B O   1 
ATOM   6052 C  CB  . LEU B 1 363 ? 9.160   -11.335 13.804  1.00 15.64 ? 363  LEU B CB  1 
ATOM   6053 C  CG  . LEU B 1 363 ? 7.661   -11.639 13.843  1.00 15.94 ? 363  LEU B CG  1 
ATOM   6054 C  CD1 . LEU B 1 363 ? 7.330   -12.600 14.973  1.00 16.45 ? 363  LEU B CD1 1 
ATOM   6055 C  CD2 . LEU B 1 363 ? 6.870   -10.345 13.986  1.00 16.61 ? 363  LEU B CD2 1 
ATOM   6056 N  N   . GLU B 1 364 ? 9.705   -12.366 10.926  1.00 14.54 ? 364  GLU B N   1 
ATOM   6057 C  CA  . GLU B 1 364 ? 9.251   -12.873 9.637   1.00 15.15 ? 364  GLU B CA  1 
ATOM   6058 C  C   . GLU B 1 364 ? 10.172  -13.941 9.064   1.00 15.34 ? 364  GLU B C   1 
ATOM   6059 O  O   . GLU B 1 364 ? 9.677   -14.945 8.557   1.00 15.60 ? 364  GLU B O   1 
ATOM   6060 C  CB  . GLU B 1 364 ? 9.163   -11.719 8.634   1.00 14.83 ? 364  GLU B CB  1 
ATOM   6061 C  CG  . GLU B 1 364 ? 8.076   -10.709 8.994   1.00 15.00 ? 364  GLU B CG  1 
ATOM   6062 C  CD  . GLU B 1 364 ? 8.291   -9.417  8.231   1.00 14.94 ? 364  GLU B CD  1 
ATOM   6063 O  OE1 . GLU B 1 364 ? 7.691   -9.252  7.147   1.00 14.84 ? 364  GLU B OE1 1 
ATOM   6064 O  OE2 . GLU B 1 364 ? 9.084   -8.582  8.706   1.00 15.07 ? 364  GLU B OE2 1 
ATOM   6065 N  N   . LEU B 1 365 ? 11.486  -13.743 9.139   1.00 15.80 ? 365  LEU B N   1 
ATOM   6066 C  CA  . LEU B 1 365 ? 12.428  -14.698 8.560   1.00 16.27 ? 365  LEU B CA  1 
ATOM   6067 C  C   . LEU B 1 365 ? 12.382  -16.050 9.263   1.00 17.38 ? 365  LEU B C   1 
ATOM   6068 O  O   . LEU B 1 365 ? 12.582  -17.075 8.607   1.00 18.33 ? 365  LEU B O   1 
ATOM   6069 C  CB  . LEU B 1 365 ? 13.857  -14.154 8.581   1.00 16.12 ? 365  LEU B CB  1 
ATOM   6070 C  CG  . LEU B 1 365 ? 14.143  -12.952 7.675   1.00 16.27 ? 365  LEU B CG  1 
ATOM   6071 C  CD1 . LEU B 1 365 ? 15.452  -12.274 8.055   1.00 16.48 ? 365  LEU B CD1 1 
ATOM   6072 C  CD2 . LEU B 1 365 ? 14.182  -13.359 6.211   1.00 16.47 ? 365  LEU B CD2 1 
ATOM   6073 N  N   . SER B 1 366 ? 12.101  -16.062 10.563  1.00 18.00 ? 366  SER B N   1 
ATOM   6074 C  CA  . SER B 1 366 ? 11.903  -17.318 11.285  1.00 18.47 ? 366  SER B CA  1 
ATOM   6075 C  C   . SER B 1 366 ? 10.445  -17.738 11.365  1.00 19.15 ? 366  SER B C   1 
ATOM   6076 O  O   . SER B 1 366 ? 10.083  -18.710 12.031  1.00 19.08 ? 366  SER B O   1 
ATOM   6077 C  CB  . SER B 1 366 ? 12.489  -17.189 12.697  1.00 18.66 ? 366  SER B CB  1 
ATOM   6078 O  OG  . SER B 1 366 ? 11.590  -16.492 13.552  1.00 18.66 ? 366  SER B OG  1 
ATOM   6079 N  N   . TRP B 1 367 ? 9.544   -16.982 10.753  1.00 19.64 ? 367  TRP B N   1 
ATOM   6080 C  CA  . TRP B 1 367 ? 8.111   -17.177 10.799  1.00 20.17 ? 367  TRP B CA  1 
ATOM   6081 C  C   . TRP B 1 367 ? 7.604   -17.504 12.198  1.00 21.01 ? 367  TRP B C   1 
ATOM   6082 O  O   . TRP B 1 367 ? 7.005   -18.543 12.482  1.00 20.71 ? 367  TRP B O   1 
ATOM   6083 C  CB  . TRP B 1 367 ? 7.636   -18.230 9.790   1.00 20.37 ? 367  TRP B CB  1 
ATOM   6084 C  CG  . TRP B 1 367 ? 6.202   -17.988 9.406   1.00 21.00 ? 367  TRP B CG  1 
ATOM   6085 C  CD1 . TRP B 1 367 ? 5.126   -18.767 9.711   1.00 21.79 ? 367  TRP B CD1 1 
ATOM   6086 C  CD2 . TRP B 1 367 ? 5.697   -16.874 8.658   1.00 21.12 ? 367  TRP B CD2 1 
ATOM   6087 N  NE1 . TRP B 1 367 ? 3.985   -18.214 9.184   1.00 22.31 ? 367  TRP B NE1 1 
ATOM   6088 C  CE2 . TRP B 1 367 ? 4.307   -17.054 8.535   1.00 21.63 ? 367  TRP B CE2 1 
ATOM   6089 C  CE3 . TRP B 1 367 ? 6.284   -15.746 8.081   1.00 21.22 ? 367  TRP B CE3 1 
ATOM   6090 C  CZ2 . TRP B 1 367 ? 3.489   -16.148 7.860   1.00 21.22 ? 367  TRP B CZ2 1 
ATOM   6091 C  CZ3 . TRP B 1 367 ? 5.476   -14.849 7.405   1.00 21.09 ? 367  TRP B CZ3 1 
ATOM   6092 C  CH2 . TRP B 1 367 ? 4.092   -15.061 7.300   1.00 20.45 ? 367  TRP B CH2 1 
ATOM   6093 N  N   . LYS B 1 368 ? 7.862   -16.568 13.114  1.00 20.97 ? 368  LYS B N   1 
ATOM   6094 C  CA  . LYS B 1 368 ? 7.352   -16.631 14.475  1.00 22.60 ? 368  LYS B CA  1 
ATOM   6095 C  C   . LYS B 1 368 ? 8.028   -17.762 15.245  1.00 22.90 ? 368  LYS B C   1 
ATOM   6096 O  O   . LYS B 1 368 ? 7.399   -18.423 16.071  1.00 23.40 ? 368  LYS B O   1 
ATOM   6097 C  CB  . LYS B 1 368 ? 5.834   -16.814 14.462  1.00 23.26 ? 368  LYS B CB  1 
ATOM   6098 C  CG  . LYS B 1 368 ? 5.125   -16.221 15.670  1.00 24.51 ? 368  LYS B CG  1 
ATOM   6099 C  CD  . LYS B 1 368 ? 3.631   -16.484 15.597  1.00 25.14 ? 368  LYS B CD  1 
ATOM   6100 C  CE  . LYS B 1 368 ? 2.885   -15.732 16.693  1.00 26.02 ? 368  LYS B CE  1 
ATOM   6101 N  NZ  . LYS B 1 368 ? 1.483   -16.225 16.793  1.00 26.58 ? 368  LYS B NZ  1 
ATOM   6102 N  N   . GLY B 1 369 ? 9.303   -17.991 14.949  1.00 23.01 ? 369  GLY B N   1 
ATOM   6103 C  CA  . GLY B 1 369 ? 10.085  -19.024 15.600  1.00 23.97 ? 369  GLY B CA  1 
ATOM   6104 C  C   . GLY B 1 369 ? 9.812   -20.432 15.103  1.00 24.25 ? 369  GLY B C   1 
ATOM   6105 O  O   . GLY B 1 369 ? 10.247  -21.393 15.754  1.00 25.14 ? 369  GLY B O   1 
ATOM   6106 N  N   . THR B 1 370 ? 9.148   -20.593 13.965  1.00 24.28 ? 370  THR B N   1 
ATOM   6107 C  CA  . THR B 1 370 ? 8.777   -21.921 13.492  1.00 24.98 ? 370  THR B CA  1 
ATOM   6108 C  C   . THR B 1 370 ? 9.804   -22.475 12.514  1.00 25.67 ? 370  THR B C   1 
ATOM   6109 O  O   . THR B 1 370 ? 9.841   -23.680 12.257  1.00 26.67 ? 370  THR B O   1 
ATOM   6110 C  CB  . THR B 1 370 ? 7.393   -21.933 12.816  1.00 24.89 ? 370  THR B CB  1 
ATOM   6111 O  OG1 . THR B 1 370 ? 7.426   -21.087 11.659  1.00 24.38 ? 370  THR B OG1 1 
ATOM   6112 C  CG2 . THR B 1 370 ? 6.317   -21.460 13.774  1.00 24.69 ? 370  THR B CG2 1 
ATOM   6113 N  N   . LYS B 1 371 ? 10.612  -21.599 11.934  1.00 25.87 ? 371  LYS B N   1 
ATOM   6114 C  CA  . LYS B 1 371 ? 11.634  -21.959 10.969  1.00 26.35 ? 371  LYS B CA  1 
ATOM   6115 C  C   . LYS B 1 371 ? 13.006  -21.490 11.456  1.00 26.12 ? 371  LYS B C   1 
ATOM   6116 O  O   . LYS B 1 371 ? 13.129  -20.379 11.972  1.00 25.46 ? 371  LYS B O   1 
ATOM   6117 C  CB  . LYS B 1 371 ? 11.373  -21.313 9.603   1.00 27.18 ? 371  LYS B CB  1 
ATOM   6118 C  CG  . LYS B 1 371 ? 10.019  -21.602 8.987   1.00 28.24 ? 371  LYS B CG  1 
ATOM   6119 C  CD  . LYS B 1 371 ? 9.864   -20.979 7.609   1.00 28.95 ? 371  LYS B CD  1 
ATOM   6120 C  CE  . LYS B 1 371 ? 8.432   -21.140 7.112   1.00 29.87 ? 371  LYS B CE  1 
ATOM   6121 N  NZ  . LYS B 1 371 ? 8.310   -20.856 5.658   1.00 30.26 ? 371  LYS B NZ  1 
ATOM   6122 N  N   . ALA B 1 372 ? 14.031  -22.319 11.284  1.00 25.68 ? 372  ALA B N   1 
ATOM   6123 C  CA  . ALA B 1 372 ? 15.385  -21.912 11.640  1.00 25.34 ? 372  ALA B CA  1 
ATOM   6124 C  C   . ALA B 1 372 ? 15.991  -21.040 10.547  1.00 25.10 ? 372  ALA B C   1 
ATOM   6125 O  O   . ALA B 1 372 ? 15.918  -21.354 9.359   1.00 26.07 ? 372  ALA B O   1 
ATOM   6126 C  CB  . ALA B 1 372 ? 16.268  -23.127 11.888  1.00 25.62 ? 372  ALA B CB  1 
ATOM   6127 N  N   . ILE B 1 373 ? 16.566  -19.912 10.953  1.00 24.07 ? 373  ILE B N   1 
ATOM   6128 C  CA  . ILE B 1 373 ? 17.355  -19.090 10.041  1.00 23.27 ? 373  ILE B CA  1 
ATOM   6129 C  C   . ILE B 1 373 ? 18.789  -19.620 9.991   1.00 24.02 ? 373  ILE B C   1 
ATOM   6130 O  O   . ILE B 1 373 ? 19.453  -19.680 11.023  1.00 23.15 ? 373  ILE B O   1 
ATOM   6131 C  CB  . ILE B 1 373 ? 17.373  -17.619 10.490  1.00 22.21 ? 373  ILE B CB  1 
ATOM   6132 C  CG1 . ILE B 1 373 ? 15.941  -17.078 10.597  1.00 21.67 ? 373  ILE B CG1 1 
ATOM   6133 C  CG2 . ILE B 1 373 ? 18.198  -16.769 9.533   1.00 22.66 ? 373  ILE B CG2 1 
ATOM   6134 C  CD1 . ILE B 1 373 ? 15.863  -15.714 11.253  1.00 21.11 ? 373  ILE B CD1 1 
ATOM   6135 N  N   . ASP B 1 374 ? 19.237  -20.004 8.807   1.00 24.95 ? 374  ASP B N   1 
ATOM   6136 C  CA  . ASP B 1 374 ? 20.625  -20.434 8.634   1.00 25.88 ? 374  ASP B CA  1 
ATOM   6137 C  C   . ASP B 1 374 ? 21.553  -19.226 8.627   1.00 25.99 ? 374  ASP B C   1 
ATOM   6138 O  O   . ASP B 1 374 ? 21.455  -18.350 7.768   1.00 25.88 ? 374  ASP B O   1 
ATOM   6139 C  CB  . ASP B 1 374 ? 20.759  -21.232 7.339   1.00 26.72 ? 374  ASP B CB  1 
ATOM   6140 C  CG  . ASP B 1 374 ? 22.098  -21.916 7.164   1.00 27.98 ? 374  ASP B CG  1 
ATOM   6141 O  OD1 . ASP B 1 374 ? 22.936  -21.910 8.087   1.00 28.17 ? 374  ASP B OD1 1 
ATOM   6142 O  OD2 . ASP B 1 374 ? 22.328  -22.482 6.074   1.00 29.47 ? 374  ASP B OD2 1 
ATOM   6143 N  N   . VAL B 1 375 ? 22.439  -19.160 9.621   1.00 25.64 ? 375  VAL B N   1 
ATOM   6144 C  CA  . VAL B 1 375 ? 23.416  -18.078 9.686   1.00 26.14 ? 375  VAL B CA  1 
ATOM   6145 C  C   . VAL B 1 375 ? 24.820  -18.593 9.387   1.00 26.80 ? 375  VAL B C   1 
ATOM   6146 O  O   . VAL B 1 375 ? 25.806  -17.904 9.654   1.00 27.26 ? 375  VAL B O   1 
ATOM   6147 C  CB  . VAL B 1 375 ? 23.365  -17.320 11.019  1.00 26.15 ? 375  VAL B CB  1 
ATOM   6148 C  CG1 . VAL B 1 375 ? 22.018  -16.616 11.179  1.00 25.87 ? 375  VAL B CG1 1 
ATOM   6149 C  CG2 . VAL B 1 375 ? 23.598  -18.221 12.220  1.00 25.78 ? 375  VAL B CG2 1 
ATOM   6150 N  N   . GLY B 1 376 ? 24.914  -19.773 8.789   1.00 26.59 ? 376  GLY B N   1 
ATOM   6151 C  CA  . GLY B 1 376 ? 26.188  -20.293 8.307   1.00 27.08 ? 376  GLY B CA  1 
ATOM   6152 C  C   . GLY B 1 376 ? 27.024  -20.853 9.449   1.00 27.04 ? 376  GLY B C   1 
ATOM   6153 O  O   . GLY B 1 376 ? 26.692  -20.731 10.627  1.00 26.62 ? 376  GLY B O   1 
ATOM   6154 N  N   . GLN B 1 377 ? 28.111  -21.529 9.087   1.00 27.64 ? 377  GLN B N   1 
ATOM   6155 C  CA  . GLN B 1 377 ? 29.074  -22.067 10.041  1.00 28.45 ? 377  GLN B CA  1 
ATOM   6156 C  C   . GLN B 1 377 ? 28.433  -22.933 11.109  1.00 27.82 ? 377  GLN B C   1 
ATOM   6157 O  O   . GLN B 1 377 ? 28.727  -22.852 12.305  1.00 28.10 ? 377  GLN B O   1 
ATOM   6158 C  CB  . GLN B 1 377 ? 29.909  -20.915 10.624  1.00 29.41 ? 377  GLN B CB  1 
ATOM   6159 C  CG  . GLN B 1 377 ? 30.649  -20.139 9.542   1.00 30.69 ? 377  GLN B CG  1 
ATOM   6160 C  CD  . GLN B 1 377 ? 31.613  -19.090 10.035  1.00 31.57 ? 377  GLN B CD  1 
ATOM   6161 O  OE1 . GLN B 1 377 ? 31.469  -18.507 11.110  1.00 31.79 ? 377  GLN B OE1 1 
ATOM   6162 N  NE2 . GLN B 1 377 ? 32.646  -18.811 9.236   1.00 32.14 ? 377  GLN B NE2 1 
ATOM   6163 N  N   . GLY B 1 378 ? 27.513  -23.806 10.703  1.00 27.25 ? 378  GLY B N   1 
ATOM   6164 C  CA  . GLY B 1 378 ? 26.810  -24.737 11.545  1.00 26.59 ? 378  GLY B CA  1 
ATOM   6165 C  C   . GLY B 1 378 ? 25.761  -24.167 12.478  1.00 25.97 ? 378  GLY B C   1 
ATOM   6166 O  O   . GLY B 1 378 ? 25.205  -24.885 13.314  1.00 25.63 ? 378  GLY B O   1 
ATOM   6167 N  N   . GLN B 1 379 ? 25.454  -22.874 12.387  1.00 25.60 ? 379  GLN B N   1 
ATOM   6168 C  CA  . GLN B 1 379 ? 24.664  -22.192 13.416  1.00 24.71 ? 379  GLN B CA  1 
ATOM   6169 C  C   . GLN B 1 379 ? 23.326  -21.750 12.848  1.00 23.76 ? 379  GLN B C   1 
ATOM   6170 O  O   . GLN B 1 379 ? 23.214  -21.523 11.639  1.00 22.46 ? 379  GLN B O   1 
ATOM   6171 C  CB  . GLN B 1 379 ? 25.533  -21.061 14.008  1.00 25.71 ? 379  GLN B CB  1 
ATOM   6172 C  CG  . GLN B 1 379 ? 26.822  -21.582 14.588  1.00 27.11 ? 379  GLN B CG  1 
ATOM   6173 C  CD  . GLN B 1 379 ? 27.992  -20.828 15.104  1.00 28.37 ? 379  GLN B CD  1 
ATOM   6174 O  OE1 . GLN B 1 379 ? 27.955  -20.043 16.059  1.00 28.44 ? 379  GLN B OE1 1 
ATOM   6175 N  NE2 . GLN B 1 379 ? 29.183  -21.055 14.513  1.00 28.31 ? 379  GLN B NE2 1 
ATOM   6176 N  N   . THR B 1 380 ? 22.273  -21.705 13.656  1.00 22.49 ? 380  THR B N   1 
ATOM   6177 C  CA  . THR B 1 380 ? 20.981  -21.174 13.245  1.00 22.72 ? 380  THR B CA  1 
ATOM   6178 C  C   . THR B 1 380 ? 20.487  -20.124 14.244  1.00 21.97 ? 380  THR B C   1 
ATOM   6179 O  O   . THR B 1 380 ? 20.994  -19.994 15.349  1.00 22.09 ? 380  THR B O   1 
ATOM   6180 C  CB  . THR B 1 380 ? 19.844  -22.210 13.145  1.00 22.99 ? 380  THR B CB  1 
ATOM   6181 O  OG1 . THR B 1 380 ? 19.578  -22.717 14.465  1.00 24.13 ? 380  THR B OG1 1 
ATOM   6182 C  CG2 . THR B 1 380 ? 20.155  -23.354 12.201  1.00 23.50 ? 380  THR B CG2 1 
ATOM   6183 N  N   . ARG B 1 381 ? 19.459  -19.375 13.842  1.00 20.96 ? 381  ARG B N   1 
ATOM   6184 C  CA  . ARG B 1 381 ? 18.787  -18.448 14.743  1.00 20.49 ? 381  ARG B CA  1 
ATOM   6185 C  C   . ARG B 1 381 ? 17.271  -18.485 14.522  1.00 19.57 ? 381  ARG B C   1 
ATOM   6186 O  O   . ARG B 1 381 ? 16.798  -18.752 13.421  1.00 19.29 ? 381  ARG B O   1 
ATOM   6187 C  CB  . ARG B 1 381 ? 19.233  -17.005 14.515  1.00 20.18 ? 381  ARG B CB  1 
ATOM   6188 C  CG  . ARG B 1 381 ? 20.653  -16.623 14.859  1.00 19.22 ? 381  ARG B CG  1 
ATOM   6189 C  CD  . ARG B 1 381 ? 20.884  -16.592 16.366  1.00 19.29 ? 381  ARG B CD  1 
ATOM   6190 N  NE  . ARG B 1 381 ? 22.253  -16.191 16.664  1.00 19.49 ? 381  ARG B NE  1 
ATOM   6191 C  CZ  . ARG B 1 381 ? 23.306  -17.006 16.658  1.00 20.14 ? 381  ARG B CZ  1 
ATOM   6192 N  NH1 . ARG B 1 381 ? 23.141  -18.291 16.380  1.00 20.80 ? 381  ARG B NH1 1 
ATOM   6193 N  NH2 . ARG B 1 381 ? 24.508  -16.529 16.944  1.00 19.67 ? 381  ARG B NH2 1 
ATOM   6194 N  N   . THR B 1 382 ? 16.522  -18.195 15.584  1.00 19.80 ? 382  THR B N   1 
ATOM   6195 C  CA  . THR B 1 382 ? 15.162  -17.680 15.396  1.00 19.07 ? 382  THR B CA  1 
ATOM   6196 C  C   . THR B 1 382 ? 15.211  -16.191 15.740  1.00 18.25 ? 382  THR B C   1 
ATOM   6197 O  O   . THR B 1 382 ? 14.980  -15.350 14.878  1.00 17.21 ? 382  THR B O   1 
ATOM   6198 C  CB  . THR B 1 382 ? 14.125  -18.409 16.248  1.00 19.54 ? 382  THR B CB  1 
ATOM   6199 O  OG1 . THR B 1 382 ? 14.551  -18.426 17.618  1.00 20.34 ? 382  THR B OG1 1 
ATOM   6200 C  CG2 . THR B 1 382 ? 13.921  -19.837 15.754  1.00 20.78 ? 382  THR B CG2 1 
ATOM   6201 N  N   . PHE B 1 383 ? 15.554  -15.881 16.988  1.00 17.68 ? 383  PHE B N   1 
ATOM   6202 C  CA  . PHE B 1 383 ? 15.732  -14.495 17.421  1.00 17.26 ? 383  PHE B CA  1 
ATOM   6203 C  C   . PHE B 1 383 ? 17.168  -14.204 17.818  1.00 17.40 ? 383  PHE B C   1 
ATOM   6204 O  O   . PHE B 1 383 ? 18.018  -15.102 17.759  1.00 17.27 ? 383  PHE B O   1 
ATOM   6205 C  CB  . PHE B 1 383 ? 14.742  -14.158 18.549  1.00 17.35 ? 383  PHE B CB  1 
ATOM   6206 C  CG  . PHE B 1 383 ? 13.335  -14.102 18.004  1.00 17.64 ? 383  PHE B CG  1 
ATOM   6207 C  CD1 . PHE B 1 383 ? 12.502  -15.202 18.053  1.00 18.01 ? 383  PHE B CD1 1 
ATOM   6208 C  CD2 . PHE B 1 383 ? 12.887  -12.940 17.387  1.00 17.32 ? 383  PHE B CD2 1 
ATOM   6209 C  CE1 . PHE B 1 383 ? 11.222  -15.151 17.534  1.00 17.62 ? 383  PHE B CE1 1 
ATOM   6210 C  CE2 . PHE B 1 383 ? 11.608  -12.882 16.867  1.00 17.46 ? 383  PHE B CE2 1 
ATOM   6211 C  CZ  . PHE B 1 383 ? 10.777  -13.985 16.934  1.00 18.19 ? 383  PHE B CZ  1 
ATOM   6212 N  N   . LEU B 1 384 ? 17.488  -12.966 18.187  1.00 16.04 ? 384  LEU B N   1 
ATOM   6213 C  CA  . LEU B 1 384 ? 18.861  -12.576 18.464  1.00 16.16 ? 384  LEU B CA  1 
ATOM   6214 C  C   . LEU B 1 384 ? 19.400  -13.178 19.761  1.00 16.11 ? 384  LEU B C   1 
ATOM   6215 O  O   . LEU B 1 384 ? 18.707  -13.255 20.778  1.00 15.69 ? 384  LEU B O   1 
ATOM   6216 C  CB  . LEU B 1 384 ? 19.001  -11.050 18.526  1.00 15.57 ? 384  LEU B CB  1 
ATOM   6217 C  CG  . LEU B 1 384 ? 18.798  -10.325 17.187  1.00 15.79 ? 384  LEU B CG  1 
ATOM   6218 C  CD1 . LEU B 1 384 ? 18.606  -8.836  17.439  1.00 14.62 ? 384  LEU B CD1 1 
ATOM   6219 C  CD2 . LEU B 1 384 ? 19.973  -10.578 16.256  1.00 15.34 ? 384  LEU B CD2 1 
ATOM   6220 N  N   . LEU B 1 385 ? 20.668  -13.597 19.694  1.00 16.15 ? 385  LEU B N   1 
ATOM   6221 C  CA  . LEU B 1 385 ? 21.367  -14.035 20.898  1.00 16.27 ? 385  LEU B CA  1 
ATOM   6222 C  C   . LEU B 1 385 ? 22.317  -12.965 21.405  1.00 15.70 ? 385  LEU B C   1 
ATOM   6223 O  O   . LEU B 1 385 ? 22.797  -12.119 20.646  1.00 16.02 ? 385  LEU B O   1 
ATOM   6224 C  CB  . LEU B 1 385 ? 22.160  -15.320 20.638  1.00 16.74 ? 385  LEU B CB  1 
ATOM   6225 C  CG  . LEU B 1 385 ? 21.395  -16.547 20.154  1.00 18.04 ? 385  LEU B CG  1 
ATOM   6226 C  CD1 . LEU B 1 385 ? 22.337  -17.743 20.063  1.00 18.17 ? 385  LEU B CD1 1 
ATOM   6227 C  CD2 . LEU B 1 385 ? 20.208  -16.857 21.051  1.00 18.21 ? 385  LEU B CD2 1 
ATOM   6228 N  N   . ASP B 1 386 ? 22.619  -13.012 22.706  1.00 15.25 ? 386  ASP B N   1 
ATOM   6229 C  CA  . ASP B 1 386 ? 23.646  -12.135 23.254  1.00 16.31 ? 386  ASP B CA  1 
ATOM   6230 C  C   . ASP B 1 386 ? 24.933  -12.252 22.448  1.00 16.69 ? 386  ASP B C   1 
ATOM   6231 O  O   . ASP B 1 386 ? 25.376  -13.349 22.103  1.00 16.92 ? 386  ASP B O   1 
ATOM   6232 C  CB  . ASP B 1 386 ? 23.917  -12.474 24.718  1.00 17.15 ? 386  ASP B CB  1 
ATOM   6233 C  CG  . ASP B 1 386 ? 22.728  -12.195 25.609  1.00 18.29 ? 386  ASP B CG  1 
ATOM   6234 O  OD1 . ASP B 1 386 ? 21.760  -11.547 25.159  1.00 18.66 ? 386  ASP B OD1 1 
ATOM   6235 O  OD2 . ASP B 1 386 ? 22.760  -12.622 26.782  1.00 17.92 ? 386  ASP B OD2 1 
ATOM   6236 N  N   . GLY B 1 387 ? 25.523  -11.113 22.113  1.00 16.34 ? 387  GLY B N   1 
ATOM   6237 C  CA  . GLY B 1 387 ? 26.757  -11.077 21.343  1.00 16.35 ? 387  GLY B CA  1 
ATOM   6238 C  C   . GLY B 1 387 ? 26.528  -11.027 19.841  1.00 15.37 ? 387  GLY B C   1 
ATOM   6239 O  O   . GLY B 1 387 ? 27.500  -10.833 19.112  1.00 16.11 ? 387  GLY B O   1 
ATOM   6240 N  N   . ASP B 1 388 ? 25.293  -11.180 19.363  1.00 15.36 ? 388  ASP B N   1 
ATOM   6241 C  CA  . ASP B 1 388 ? 25.063  -11.086 17.917  1.00 15.35 ? 388  ASP B CA  1 
ATOM   6242 C  C   . ASP B 1 388 ? 25.239  -9.643  17.446  1.00 16.26 ? 388  ASP B C   1 
ATOM   6243 O  O   . ASP B 1 388 ? 24.801  -8.711  18.121  1.00 14.88 ? 388  ASP B O   1 
ATOM   6244 C  CB  . ASP B 1 388 ? 23.676  -11.578 17.540  1.00 15.32 ? 388  ASP B CB  1 
ATOM   6245 C  CG  . ASP B 1 388 ? 23.457  -13.065 17.576  1.00 15.96 ? 388  ASP B CG  1 
ATOM   6246 O  OD1 . ASP B 1 388 ? 24.448  -13.815 17.779  1.00 16.28 ? 388  ASP B OD1 1 
ATOM   6247 O  OD2 . ASP B 1 388 ? 22.308  -13.510 17.399  1.00 15.83 ? 388  ASP B OD2 1 
ATOM   6248 N  N   . GLU B 1 389 ? 25.870  -9.485  16.285  1.00 15.40 ? 389  GLU B N   1 
ATOM   6249 C  CA  . GLU B 1 389 ? 25.991  -8.169  15.668  1.00 16.32 ? 389  GLU B CA  1 
ATOM   6250 C  C   . GLU B 1 389 ? 25.163  -8.164  14.389  1.00 15.07 ? 389  GLU B C   1 
ATOM   6251 O  O   . GLU B 1 389 ? 25.303  -9.038  13.535  1.00 14.41 ? 389  GLU B O   1 
ATOM   6252 C  CB  . GLU B 1 389 ? 27.450  -7.818  15.391  1.00 17.09 ? 389  GLU B CB  1 
ATOM   6253 C  CG  . GLU B 1 389 ? 27.666  -6.475  14.712  1.00 18.45 ? 389  GLU B CG  1 
ATOM   6254 C  CD  . GLU B 1 389 ? 29.132  -6.093  14.644  1.00 19.90 ? 389  GLU B CD  1 
ATOM   6255 O  OE1 . GLU B 1 389 ? 29.908  -6.778  13.953  1.00 20.44 ? 389  GLU B OE1 1 
ATOM   6256 O  OE2 . GLU B 1 389 ? 29.516  -5.104  15.299  1.00 21.33 ? 389  GLU B OE2 1 
ATOM   6257 N  N   . VAL B 1 390 ? 24.242  -7.200  14.303  1.00 13.86 ? 390  VAL B N   1 
ATOM   6258 C  CA  . VAL B 1 390 ? 23.437  -7.008  13.102  1.00 13.84 ? 390  VAL B CA  1 
ATOM   6259 C  C   . VAL B 1 390 ? 23.932  -5.770  12.362  1.00 13.30 ? 390  VAL B C   1 
ATOM   6260 O  O   . VAL B 1 390 ? 24.103  -4.715  12.976  1.00 13.30 ? 390  VAL B O   1 
ATOM   6261 C  CB  . VAL B 1 390 ? 21.949  -6.827  13.462  1.00 13.21 ? 390  VAL B CB  1 
ATOM   6262 C  CG1 . VAL B 1 390 ? 21.122  -6.554  12.205  1.00 13.35 ? 390  VAL B CG1 1 
ATOM   6263 C  CG2 . VAL B 1 390 ? 21.386  -8.045  14.175  1.00 13.28 ? 390  VAL B CG2 1 
ATOM   6264 N  N   . ILE B 1 391 ? 24.225  -5.919  11.071  1.00 13.59 ? 391  ILE B N   1 
ATOM   6265 C  CA  . ILE B 1 391 ? 24.665  -4.783  10.267  1.00 14.02 ? 391  ILE B CA  1 
ATOM   6266 C  C   . ILE B 1 391 ? 23.751  -4.595  9.057   1.00 13.74 ? 391  ILE B C   1 
ATOM   6267 O  O   . ILE B 1 391 ? 23.584  -5.491  8.236   1.00 13.37 ? 391  ILE B O   1 
ATOM   6268 C  CB  . ILE B 1 391 ? 26.122  -4.879  9.767   1.00 14.47 ? 391  ILE B CB  1 
ATOM   6269 C  CG1 . ILE B 1 391 ? 27.088  -5.026  10.943  1.00 14.92 ? 391  ILE B CG1 1 
ATOM   6270 C  CG2 . ILE B 1 391 ? 26.472  -3.630  8.959   1.00 14.91 ? 391  ILE B CG2 1 
ATOM   6271 C  CD1 . ILE B 1 391 ? 28.547  -5.154  10.579  1.00 15.77 ? 391  ILE B CD1 1 
ATOM   6272 N  N   . ILE B 1 392 ? 23.142  -3.412  8.980   1.00 13.95 ? 392  ILE B N   1 
ATOM   6273 C  CA  . ILE B 1 392 ? 22.363  -3.049  7.791   1.00 14.09 ? 392  ILE B CA  1 
ATOM   6274 C  C   . ILE B 1 392 ? 23.219  -2.193  6.873   1.00 13.75 ? 392  ILE B C   1 
ATOM   6275 O  O   . ILE B 1 392 ? 23.917  -1.298  7.336   1.00 13.78 ? 392  ILE B O   1 
ATOM   6276 C  CB  . ILE B 1 392 ? 21.088  -2.287  8.183   1.00 13.93 ? 392  ILE B CB  1 
ATOM   6277 C  CG1 . ILE B 1 392 ? 20.216  -3.156  9.093   1.00 13.90 ? 392  ILE B CG1 1 
ATOM   6278 C  CG2 . ILE B 1 392 ? 20.312  -1.865  6.939   1.00 14.06 ? 392  ILE B CG2 1 
ATOM   6279 C  CD1 . ILE B 1 392 ? 19.058  -2.404  9.715   1.00 14.28 ? 392  ILE B CD1 1 
ATOM   6280 N  N   . THR B 1 393 ? 23.188  -2.495  5.579   1.00 13.97 ? 393  THR B N   1 
ATOM   6281 C  CA  . THR B 1 393 ? 23.801  -1.668  4.558   1.00 13.44 ? 393  THR B CA  1 
ATOM   6282 C  C   . THR B 1 393 ? 22.817  -1.409  3.411   1.00 12.81 ? 393  THR B C   1 
ATOM   6283 O  O   . THR B 1 393 ? 21.826  -2.122  3.256   1.00 13.39 ? 393  THR B O   1 
ATOM   6284 C  CB  . THR B 1 393 ? 25.071  -2.311  3.960   1.00 14.17 ? 393  THR B CB  1 
ATOM   6285 O  OG1 . THR B 1 393 ? 24.783  -3.674  3.627   1.00 15.71 ? 393  THR B OG1 1 
ATOM   6286 C  CG2 . THR B 1 393 ? 26.237  -2.253  4.933   1.00 14.11 ? 393  THR B CG2 1 
ATOM   6287 N  N   . GLY B 1 394 ? 23.110  -0.357  2.652   1.00 12.41 ? 394  GLY B N   1 
ATOM   6288 C  CA  . GLY B 1 394 ? 22.276  -0.035  1.489   1.00 12.49 ? 394  GLY B CA  1 
ATOM   6289 C  C   . GLY B 1 394 ? 23.030  0.771   0.443   1.00 12.46 ? 394  GLY B C   1 
ATOM   6290 O  O   . GLY B 1 394 ? 23.932  1.550   0.767   1.00 13.28 ? 394  GLY B O   1 
ATOM   6291 N  N   . HIS B 1 395 ? 22.623  0.626   -0.820  1.00 12.97 ? 395  HIS B N   1 
ATOM   6292 C  CA  . HIS B 1 395 ? 23.158  1.485   -1.865  1.00 13.31 ? 395  HIS B CA  1 
ATOM   6293 C  C   . HIS B 1 395 ? 22.272  1.520   -3.106  1.00 13.58 ? 395  HIS B C   1 
ATOM   6294 O  O   . HIS B 1 395 ? 21.540  0.573   -3.398  1.00 13.49 ? 395  HIS B O   1 
ATOM   6295 C  CB  . HIS B 1 395 ? 24.566  1.049   -2.309  1.00 14.42 ? 395  HIS B CB  1 
ATOM   6296 C  CG  . HIS B 1 395 ? 24.560  -0.210  -3.116  1.00 15.49 ? 395  HIS B CG  1 
ATOM   6297 N  ND1 . HIS B 1 395 ? 24.407  -1.459  -2.559  1.00 16.41 ? 395  HIS B ND1 1 
ATOM   6298 C  CD2 . HIS B 1 395 ? 24.682  -0.408  -4.454  1.00 15.85 ? 395  HIS B CD2 1 
ATOM   6299 C  CE1 . HIS B 1 395 ? 24.428  -2.374  -3.515  1.00 16.46 ? 395  HIS B CE1 1 
ATOM   6300 N  NE2 . HIS B 1 395 ? 24.593  -1.759  -4.669  1.00 16.23 ? 395  HIS B NE2 1 
ATOM   6301 N  N   . CYS B 1 396 ? 22.393  2.638   -3.814  1.00 13.65 ? 396  CYS B N   1 
ATOM   6302 C  CA  . CYS B 1 396 ? 21.872  2.715   -5.181  1.00 13.41 ? 396  CYS B CA  1 
ATOM   6303 C  C   . CYS B 1 396 ? 23.013  2.373   -6.147  1.00 14.13 ? 396  CYS B C   1 
ATOM   6304 O  O   . CYS B 1 396 ? 24.146  2.799   -5.922  1.00 14.42 ? 396  CYS B O   1 
ATOM   6305 C  CB  . CYS B 1 396 ? 21.349  4.115   -5.469  1.00 12.87 ? 396  CYS B CB  1 
ATOM   6306 S  SG  . CYS B 1 396 ? 19.963  4.613   -4.406  1.00 12.95 ? 396  CYS B SG  1 
ATOM   6307 N  N   . GLN B 1 397 ? 22.692  1.640   -7.210  1.00 15.00 ? 397  GLN B N   1 
ATOM   6308 C  CA  . GLN B 1 397 ? 23.743  1.213   -8.133  1.00 15.78 ? 397  GLN B CA  1 
ATOM   6309 C  C   . GLN B 1 397 ? 23.673  1.963   -9.459  1.00 16.41 ? 397  GLN B C   1 
ATOM   6310 O  O   . GLN B 1 397 ? 22.697  1.819   -10.199 1.00 17.56 ? 397  GLN B O   1 
ATOM   6311 C  CB  . GLN B 1 397 ? 23.648  -0.291  -8.388  1.00 16.39 ? 397  GLN B CB  1 
ATOM   6312 C  CG  . GLN B 1 397 ? 24.763  -0.836  -9.281  1.00 17.37 ? 397  GLN B CG  1 
ATOM   6313 C  CD  . GLN B 1 397 ? 26.122  -0.658  -8.635  1.00 18.25 ? 397  GLN B CD  1 
ATOM   6314 O  OE1 . GLN B 1 397 ? 26.387  -1.197  -7.554  1.00 19.35 ? 397  GLN B OE1 1 
ATOM   6315 N  NE2 . GLN B 1 397 ? 27.010  0.099   -9.263  1.00 17.46 ? 397  GLN B NE2 1 
ATOM   6316 N  N   . GLY B 1 398 ? 24.685  2.776   -9.721  1.00 17.43 ? 398  GLY B N   1 
ATOM   6317 C  CA  . GLY B 1 398 ? 24.789  3.495   -10.984 1.00 18.48 ? 398  GLY B CA  1 
ATOM   6318 C  C   . GLY B 1 398 ? 25.780  2.787   -11.910 1.00 19.75 ? 398  GLY B C   1 
ATOM   6319 O  O   . GLY B 1 398 ? 26.302  1.723   -11.585 1.00 19.70 ? 398  GLY B O   1 
ATOM   6320 N  N   . ASP B 1 399 ? 26.023  3.405   -13.065 1.00 20.60 ? 399  ASP B N   1 
ATOM   6321 C  CA  . ASP B 1 399 ? 27.001  2.863   -14.009 1.00 22.03 ? 399  ASP B CA  1 
ATOM   6322 C  C   . ASP B 1 399 ? 28.402  3.316   -13.632 1.00 21.66 ? 399  ASP B C   1 
ATOM   6323 O  O   . ASP B 1 399 ? 28.781  4.451   -13.908 1.00 22.37 ? 399  ASP B O   1 
ATOM   6324 C  CB  . ASP B 1 399 ? 26.656  3.308   -15.433 1.00 23.45 ? 399  ASP B CB  1 
ATOM   6325 C  CG  . ASP B 1 399 ? 27.567  2.714   -16.488 1.00 25.30 ? 399  ASP B CG  1 
ATOM   6326 O  OD1 . ASP B 1 399 ? 28.212  1.674   -16.233 1.00 26.30 ? 399  ASP B OD1 1 
ATOM   6327 O  OD2 . ASP B 1 399 ? 27.652  3.295   -17.596 1.00 26.34 ? 399  ASP B OD2 1 
ATOM   6328 N  N   . GLY B 1 400 ? 29.140  2.463   -12.921 1.00 21.78 ? 400  GLY B N   1 
ATOM   6329 C  CA  . GLY B 1 400 ? 30.496  2.782   -12.512 1.00 21.39 ? 400  GLY B CA  1 
ATOM   6330 C  C   . GLY B 1 400 ? 30.584  3.469   -11.160 1.00 21.05 ? 400  GLY B C   1 
ATOM   6331 O  O   . GLY B 1 400 ? 31.650  3.964   -10.774 1.00 22.65 ? 400  GLY B O   1 
ATOM   6332 N  N   . TYR B 1 401 ? 29.466  3.530   -10.438 1.00 19.76 ? 401  TYR B N   1 
ATOM   6333 C  CA  . TYR B 1 401 ? 29.472  4.198   -9.136  1.00 18.82 ? 401  TYR B CA  1 
ATOM   6334 C  C   . TYR B 1 401 ? 28.252  3.737   -8.341  1.00 18.31 ? 401  TYR B C   1 
ATOM   6335 O  O   . TYR B 1 401 ? 27.281  3.224   -8.897  1.00 17.53 ? 401  TYR B O   1 
ATOM   6336 C  CB  . TYR B 1 401 ? 29.467  5.722   -9.246  1.00 19.09 ? 401  TYR B CB  1 
ATOM   6337 C  CG  . TYR B 1 401 ? 28.143  6.284   -9.723  1.00 19.82 ? 401  TYR B CG  1 
ATOM   6338 C  CD1 . TYR B 1 401 ? 27.243  6.872   -8.849  1.00 19.89 ? 401  TYR B CD1 1 
ATOM   6339 C  CD2 . TYR B 1 401 ? 27.794  6.200   -11.065 1.00 20.02 ? 401  TYR B CD2 1 
ATOM   6340 C  CE1 . TYR B 1 401 ? 26.033  7.372   -9.290  1.00 20.47 ? 401  TYR B CE1 1 
ATOM   6341 C  CE2 . TYR B 1 401 ? 26.587  6.694   -11.516 1.00 20.57 ? 401  TYR B CE2 1 
ATOM   6342 C  CZ  . TYR B 1 401 ? 25.713  7.279   -10.631 1.00 20.50 ? 401  TYR B CZ  1 
ATOM   6343 O  OH  . TYR B 1 401 ? 24.507  7.766   -11.085 1.00 21.54 ? 401  TYR B OH  1 
ATOM   6344 N  N   . ARG B 1 402 ? 28.331  3.956   -7.033  1.00 18.25 ? 402  ARG B N   1 
ATOM   6345 C  CA  . ARG B 1 402 ? 27.152  3.699   -6.205  1.00 18.63 ? 402  ARG B CA  1 
ATOM   6346 C  C   . ARG B 1 402 ? 26.928  4.880   -5.272  1.00 17.50 ? 402  ARG B C   1 
ATOM   6347 O  O   . ARG B 1 402 ? 27.839  5.641   -4.980  1.00 17.49 ? 402  ARG B O   1 
ATOM   6348 C  CB  . ARG B 1 402 ? 27.289  2.388   -5.442  1.00 20.60 ? 402  ARG B CB  1 
ATOM   6349 C  CG  . ARG B 1 402 ? 28.689  2.136   -4.913  1.00 22.90 ? 402  ARG B CG  1 
ATOM   6350 C  CD  . ARG B 1 402 ? 28.822  0.673   -4.490  1.00 24.35 ? 402  ARG B CD  1 
ATOM   6351 N  NE  . ARG B 1 402 ? 28.393  0.509   -3.118  1.00 24.95 ? 402  ARG B NE  1 
ATOM   6352 C  CZ  . ARG B 1 402 ? 27.980  -0.593  -2.518  1.00 24.23 ? 402  ARG B CZ  1 
ATOM   6353 N  NH1 . ARG B 1 402 ? 27.903  -1.740  -3.174  1.00 24.52 ? 402  ARG B NH1 1 
ATOM   6354 N  NH2 . ARG B 1 402 ? 27.637  -0.526  -1.237  1.00 23.46 ? 402  ARG B NH2 1 
ATOM   6355 N  N   . VAL B 1 403 ? 25.672  5.064   -4.880  1.00 15.88 ? 403  VAL B N   1 
ATOM   6356 C  CA  . VAL B 1 403 ? 25.344  5.999   -3.803  1.00 15.26 ? 403  VAL B CA  1 
ATOM   6357 C  C   . VAL B 1 403 ? 24.988  5.166   -2.573  1.00 14.89 ? 403  VAL B C   1 
ATOM   6358 O  O   . VAL B 1 403 ? 23.910  4.576   -2.504  1.00 14.70 ? 403  VAL B O   1 
ATOM   6359 C  CB  . VAL B 1 403 ? 24.193  6.933   -4.214  1.00 15.35 ? 403  VAL B CB  1 
ATOM   6360 C  CG1 . VAL B 1 403 ? 23.726  7.796   -3.049  1.00 15.65 ? 403  VAL B CG1 1 
ATOM   6361 C  CG2 . VAL B 1 403 ? 24.625  7.824   -5.373  1.00 16.17 ? 403  VAL B CG2 1 
ATOM   6362 N  N   . GLY B 1 404 ? 25.920  5.080   -1.628  1.00 14.88 ? 404  GLY B N   1 
ATOM   6363 C  CA  . GLY B 1 404 ? 25.779  4.154   -0.510  1.00 14.63 ? 404  GLY B CA  1 
ATOM   6364 C  C   . GLY B 1 404 ? 25.609  4.879   0.821   1.00 13.75 ? 404  GLY B C   1 
ATOM   6365 O  O   . GLY B 1 404 ? 25.797  6.082   0.937   1.00 13.71 ? 404  GLY B O   1 
ATOM   6366 N  N   . PHE B 1 405 ? 25.285  4.103   1.857   1.00 15.42 ? 405  PHE B N   1 
ATOM   6367 C  CA  . PHE B 1 405 ? 24.921  4.673   3.156   1.00 16.96 ? 405  PHE B CA  1 
ATOM   6368 C  C   . PHE B 1 405 ? 25.919  4.408   4.262   1.00 17.98 ? 405  PHE B C   1 
ATOM   6369 O  O   . PHE B 1 405 ? 25.789  4.940   5.381   1.00 18.78 ? 405  PHE B O   1 
ATOM   6370 C  CB  . PHE B 1 405 ? 23.522  4.150   3.540   1.00 17.32 ? 405  PHE B CB  1 
ATOM   6371 C  CG  . PHE B 1 405 ? 22.422  4.813   2.752   1.00 17.38 ? 405  PHE B CG  1 
ATOM   6372 C  CD1 . PHE B 1 405 ? 22.107  4.411   1.471   1.00 17.55 ? 405  PHE B CD1 1 
ATOM   6373 C  CD2 . PHE B 1 405 ? 21.711  5.870   3.310   1.00 17.03 ? 405  PHE B CD2 1 
ATOM   6374 C  CE1 . PHE B 1 405 ? 21.119  5.034   0.742   1.00 17.27 ? 405  PHE B CE1 1 
ATOM   6375 C  CE2 . PHE B 1 405 ? 20.702  6.487   2.590   1.00 16.65 ? 405  PHE B CE2 1 
ATOM   6376 C  CZ  . PHE B 1 405 ? 20.402  6.079   1.305   1.00 17.19 ? 405  PHE B CZ  1 
ATOM   6377 N  N   . GLY B 1 406 ? 26.983  3.645   4.008   1.00 17.19 ? 406  GLY B N   1 
ATOM   6378 C  CA  . GLY B 1 406 ? 27.825  3.148   5.102   1.00 17.77 ? 406  GLY B CA  1 
ATOM   6379 C  C   . GLY B 1 406 ? 27.047  2.166   5.969   1.00 18.23 ? 406  GLY B C   1 
ATOM   6380 O  O   . GLY B 1 406 ? 26.027  1.632   5.562   1.00 18.55 ? 406  GLY B O   1 
ATOM   6381 N  N   . GLN B 1 407 ? 27.498  1.917   7.194   1.00 19.21 ? 407  GLN B N   1 
ATOM   6382 C  CA  . GLN B 1 407 ? 26.928  0.849   8.012   1.00 18.65 ? 407  GLN B CA  1 
ATOM   6383 C  C   . GLN B 1 407 ? 25.860  1.376   8.976   1.00 16.15 ? 407  GLN B C   1 
ATOM   6384 O  O   . GLN B 1 407 ? 25.924  2.520   9.411   1.00 15.38 ? 407  GLN B O   1 
ATOM   6385 C  CB  . GLN B 1 407 ? 28.014  0.161   8.837   1.00 20.85 ? 407  GLN B CB  1 
ATOM   6386 C  CG  . GLN B 1 407 ? 28.859  -0.872  8.102   1.00 23.76 ? 407  GLN B CG  1 
ATOM   6387 C  CD  . GLN B 1 407 ? 29.744  -1.630  9.077   1.00 24.62 ? 407  GLN B CD  1 
ATOM   6388 O  OE1 . GLN B 1 407 ? 29.871  -1.244  10.242  1.00 26.53 ? 407  GLN B OE1 1 
ATOM   6389 N  NE2 . GLN B 1 407 ? 30.345  -2.714  8.609   1.00 26.08 ? 407  GLN B NE2 1 
ATOM   6390 N  N   . CYS B 1 408 ? 24.923  0.508   9.324   1.00 13.31 ? 408  CYS B N   1 
ATOM   6391 C  CA  . CYS B 1 408 ? 24.019  0.717   10.453  1.00 13.49 ? 408  CYS B CA  1 
ATOM   6392 C  C   . CYS B 1 408 ? 24.137  -0.517  11.350  1.00 12.78 ? 408  CYS B C   1 
ATOM   6393 O  O   . CYS B 1 408 ? 23.462  -1.515  11.124  1.00 12.69 ? 408  CYS B O   1 
ATOM   6394 C  CB  . CYS B 1 408 ? 22.573  0.873   9.984   1.00 13.34 ? 408  CYS B CB  1 
ATOM   6395 S  SG  . CYS B 1 408 ? 21.330  1.105   11.284  1.00 13.85 ? 408  CYS B SG  1 
ATOM   6396 N  N   . ALA B 1 409 ? 25.044  -0.440  12.323  1.00 12.99 ? 409  ALA B N   1 
ATOM   6397 C  CA  . ALA B 1 409 ? 25.472  -1.630  13.050  1.00 12.30 ? 409  ALA B CA  1 
ATOM   6398 C  C   . ALA B 1 409 ? 25.144  -1.576  14.537  1.00 11.97 ? 409  ALA B C   1 
ATOM   6399 O  O   . ALA B 1 409 ? 25.174  -0.505  15.132  1.00 12.44 ? 409  ALA B O   1 
ATOM   6400 C  CB  . ALA B 1 409 ? 26.995  -1.752  12.915  1.00 12.63 ? 409  ALA B CB  1 
ATOM   6401 N  N   . GLY B 1 410 ? 24.933  -2.740  15.141  1.00 12.86 ? 410  GLY B N   1 
ATOM   6402 C  CA  . GLY B 1 410 ? 24.888  -2.804  16.607  1.00 13.65 ? 410  GLY B CA  1 
ATOM   6403 C  C   . GLY B 1 410 ? 25.102  -4.237  17.077  1.00 14.33 ? 410  GLY B C   1 
ATOM   6404 O  O   . GLY B 1 410 ? 24.746  -5.193  16.404  1.00 13.59 ? 410  GLY B O   1 
ATOM   6405 N  N   . LYS B 1 411 ? 25.706  -4.357  18.264  1.00 14.79 ? 411  LYS B N   1 
ATOM   6406 C  CA  . LYS B 1 411 ? 25.897  -5.645  18.910  1.00 15.89 ? 411  LYS B CA  1 
ATOM   6407 C  C   . LYS B 1 411 ? 25.050  -5.738  20.177  1.00 14.66 ? 411  LYS B C   1 
ATOM   6408 O  O   . LYS B 1 411 ? 24.995  -4.778  20.944  1.00 15.07 ? 411  LYS B O   1 
ATOM   6409 C  CB  . LYS B 1 411 ? 27.376  -5.851  19.265  1.00 17.02 ? 411  LYS B CB  1 
ATOM   6410 C  CG  . LYS B 1 411 ? 27.657  -7.173  19.967  1.00 19.84 ? 411  LYS B CG  1 
ATOM   6411 C  CD  . LYS B 1 411 ? 29.130  -7.554  19.873  1.00 21.69 ? 411  LYS B CD  1 
ATOM   6412 C  CE  . LYS B 1 411 ? 29.386  -8.848  20.633  1.00 23.17 ? 411  LYS B CE  1 
ATOM   6413 N  NZ  . LYS B 1 411 ? 30.343  -9.745  19.925  1.00 25.46 ? 411  LYS B NZ  1 
ATOM   6414 N  N   . VAL B 1 412 ? 24.421  -6.880  20.365  1.00 14.70 ? 412  VAL B N   1 
ATOM   6415 C  CA  . VAL B 1 412 ? 23.603  -7.146  21.541  1.00 14.54 ? 412  VAL B CA  1 
ATOM   6416 C  C   . VAL B 1 412 ? 24.460  -7.475  22.764  1.00 15.35 ? 412  VAL B C   1 
ATOM   6417 O  O   . VAL B 1 412 ? 25.260  -8.411  22.736  1.00 15.81 ? 412  VAL B O   1 
ATOM   6418 C  CB  . VAL B 1 412 ? 22.628  -8.312  21.294  1.00 14.78 ? 412  VAL B CB  1 
ATOM   6419 C  CG1 . VAL B 1 412 ? 21.762  -8.564  22.522  1.00 14.37 ? 412  VAL B CG1 1 
ATOM   6420 C  CG2 . VAL B 1 412 ? 21.761  -8.041  20.068  1.00 14.70 ? 412  VAL B CG2 1 
ATOM   6421 N  N   . LEU B 1 413 ? 24.246  -6.719  23.834  1.00 14.48 ? 413  LEU B N   1 
ATOM   6422 C  CA  . LEU B 1 413 ? 24.836  -7.071  25.128  1.00 16.22 ? 413  LEU B CA  1 
ATOM   6423 C  C   . LEU B 1 413 ? 23.840  -7.835  25.990  1.00 16.63 ? 413  LEU B C   1 
ATOM   6424 O  O   . LEU B 1 413 ? 22.630  -7.642  25.935  1.00 16.41 ? 413  LEU B O   1 
ATOM   6425 C  CB  . LEU B 1 413 ? 25.252  -5.806  25.865  1.00 16.85 ? 413  LEU B CB  1 
ATOM   6426 C  CG  . LEU B 1 413 ? 26.232  -4.854  25.195  1.00 18.61 ? 413  LEU B CG  1 
ATOM   6427 C  CD1 . LEU B 1 413 ? 26.495  -3.652  26.091  1.00 19.12 ? 413  LEU B CD1 1 
ATOM   6428 C  CD2 . LEU B 1 413 ? 27.530  -5.565  24.850  1.00 19.71 ? 413  LEU B CD2 1 
ATOM   6429 N  N   . PRO B 1 414 ? 24.358  -8.696  26.865  1.00 16.40 ? 414  PRO B N   1 
ATOM   6430 C  CA  . PRO B 1 414 ? 23.533  -9.423  27.810  1.00 16.79 ? 414  PRO B CA  1 
ATOM   6431 C  C   . PRO B 1 414 ? 22.720  -8.490  28.700  1.00 17.33 ? 414  PRO B C   1 
ATOM   6432 O  O   . PRO B 1 414 ? 23.171  -7.400  29.056  1.00 18.12 ? 414  PRO B O   1 
ATOM   6433 C  CB  . PRO B 1 414 ? 24.536  -10.224 28.632  1.00 16.80 ? 414  PRO B CB  1 
ATOM   6434 C  CG  . PRO B 1 414 ? 25.811  -10.218 27.872  1.00 17.47 ? 414  PRO B CG  1 
ATOM   6435 C  CD  . PRO B 1 414 ? 25.809  -8.981  27.021  1.00 16.95 ? 414  PRO B CD  1 
ATOM   6436 N  N   . ALA B 1 415 ? 21.520  -8.916  29.057  1.00 18.47 ? 415  ALA B N   1 
ATOM   6437 C  CA  . ALA B 1 415 ? 20.680  -8.197  30.006  1.00 20.06 ? 415  ALA B CA  1 
ATOM   6438 C  C   . ALA B 1 415 ? 21.385  -8.044  31.349  1.00 21.83 ? 415  ALA B C   1 
ATOM   6439 O  O   . ALA B 1 415 ? 22.268  -8.828  31.701  1.00 21.16 ? 415  ALA B O   1 
ATOM   6440 C  CB  . ALA B 1 415 ? 19.365  -8.942  30.189  1.00 19.43 ? 415  ALA B CB  1 
ATOM   6441 N  N   . LEU B 1 416 ? 20.968  -7.048  32.121  1.00 24.24 ? 416  LEU B N   1 
ATOM   6442 C  CA  . LEU B 1 416 ? 21.454  -6.886  33.490  1.00 27.32 ? 416  LEU B CA  1 
ATOM   6443 C  C   . LEU B 1 416 ? 21.091  -8.066  34.376  1.00 29.03 ? 416  LEU B C   1 
ATOM   6444 O  O   . LEU B 1 416 ? 21.871  -8.410  35.273  1.00 29.57 ? 416  LEU B O   1 
ATOM   6445 C  CB  . LEU B 1 416 ? 20.947  -5.554  34.056  1.00 28.30 ? 416  LEU B CB  1 
ATOM   6446 C  CG  . LEU B 1 416 ? 21.437  -4.324  33.276  1.00 28.94 ? 416  LEU B CG  1 
ATOM   6447 C  CD1 . LEU B 1 416 ? 20.813  -3.044  33.804  1.00 29.48 ? 416  LEU B CD1 1 
ATOM   6448 C  CD2 . LEU B 1 416 ? 22.955  -4.209  33.308  1.00 29.72 ? 416  LEU B CD2 1 
HETATM 6449 CA CA  . CA  C 2 .   ? -4.418  11.723  26.840  1.00 15.13 ? 420  CA  A CA  1 
HETATM 6450 C  C   . ACT D 3 .   ? -8.918  1.925   25.358  1.00 20.42 ? 2001 ACT A C   1 
HETATM 6451 O  O   . ACT D 3 .   ? -9.322  0.861   24.899  1.00 20.81 ? 2001 ACT A O   1 
HETATM 6452 O  OXT . ACT D 3 .   ? -9.026  2.036   26.532  1.00 19.87 ? 2001 ACT A OXT 1 
HETATM 6453 C  CH3 . ACT D 3 .   ? -8.474  3.210   24.467  1.00 20.51 ? 2001 ACT A CH3 1 
HETATM 6454 AS AS  . CAC E 4 .   ? -7.875  8.127   25.219  1.00 37.63 ? 2004 CAC A AS  1 
HETATM 6455 O  O1  . CAC E 4 .   ? -7.834  8.918   26.861  1.00 33.82 ? 2004 CAC A O1  1 
HETATM 6456 O  O2  . CAC E 4 .   ? -8.103  9.162   23.790  1.00 35.34 ? 2004 CAC A O2  1 
HETATM 6457 C  C1  . CAC E 4 .   ? -6.147  7.137   25.215  1.00 36.13 ? 2004 CAC A C1  1 
HETATM 6458 C  C2  . CAC E 4 .   ? -9.167  6.642   25.290  1.00 35.82 ? 2004 CAC A C2  1 
HETATM 6459 CA CA  . CA  F 2 .   ? 9.503   -0.452  13.471  1.00 18.96 ? 420  CA  B CA  1 
HETATM 6460 C  C   . ACT G 3 .   ? -0.285  -5.600  13.589  1.00 21.18 ? 2000 ACT B C   1 
HETATM 6461 O  O   . ACT G 3 .   ? -1.441  -5.970  13.788  1.00 20.32 ? 2000 ACT B O   1 
HETATM 6462 O  OXT . ACT G 3 .   ? -0.055  -5.330  12.449  1.00 21.30 ? 2000 ACT B OXT 1 
HETATM 6463 C  CH3 . ACT G 3 .   ? 0.619   -4.893  14.743  1.00 20.72 ? 2000 ACT B CH3 1 
HETATM 6464 AS AS  . CAC H 4 .   ? 5.939   -4.154  14.430  1.00 37.50 ? 2003 CAC B AS  1 
HETATM 6465 O  O1  . CAC H 4 .   ? 6.787   -4.617  15.964  1.00 35.23 ? 2003 CAC B O1  1 
HETATM 6466 O  O2  . CAC H 4 .   ? 6.875   -4.002  12.923  1.00 34.68 ? 2003 CAC B O2  1 
HETATM 6467 C  C1  . CAC H 4 .   ? 4.543   -5.574  14.276  1.00 36.02 ? 2003 CAC B C1  1 
HETATM 6468 C  C2  . CAC H 4 .   ? 4.800   -2.581  14.770  1.00 36.28 ? 2003 CAC B C2  1 
HETATM 6469 O  O   . HOH I 5 .   ? -13.093 33.581  25.712  1.00 39.41 ? 2005 HOH A O   1 
HETATM 6470 O  O   . HOH I 5 .   ? -17.395 34.053  24.890  1.00 51.59 ? 2006 HOH A O   1 
HETATM 6471 O  O   . HOH I 5 .   ? 1.266   -8.115  38.267  1.00 20.61 ? 2007 HOH A O   1 
HETATM 6472 O  O   . HOH I 5 .   ? 10.204  -7.334  39.343  1.00 17.68 ? 2008 HOH A O   1 
HETATM 6473 O  O   . HOH I 5 .   ? 2.902   -5.973  37.768  1.00 18.21 ? 2009 HOH A O   1 
HETATM 6474 O  O   . HOH I 5 .   ? -6.410  -5.360  33.785  1.00 26.31 ? 2010 HOH A O   1 
HETATM 6475 O  O   . HOH I 5 .   ? 12.801  -1.236  46.194  1.00 42.31 ? 2011 HOH A O   1 
HETATM 6476 O  O   . HOH I 5 .   ? -8.105  -3.707  42.154  1.00 26.43 ? 2012 HOH A O   1 
HETATM 6477 O  O   . HOH I 5 .   ? -3.174  -3.837  40.188  1.00 17.96 ? 2013 HOH A O   1 
HETATM 6478 O  O   . HOH I 5 .   ? 16.570  -3.273  30.961  1.00 13.85 ? 2014 HOH A O   1 
HETATM 6479 O  O   . HOH I 5 .   ? 1.159   -1.182  45.158  1.00 22.75 ? 2015 HOH A O   1 
HETATM 6480 O  O   . HOH I 5 .   ? 19.046  -2.416  30.056  1.00 15.67 ? 2016 HOH A O   1 
HETATM 6481 O  O   . HOH I 5 .   ? -5.562  -4.539  18.609  1.00 33.09 ? 2017 HOH A O   1 
HETATM 6482 O  O   . HOH I 5 .   ? 12.416  -0.999  40.328  1.00 15.62 ? 2018 HOH A O   1 
HETATM 6483 O  O   . HOH I 5 .   ? 4.646   0.845   44.344  1.00 32.16 ? 2019 HOH A O   1 
HETATM 6484 O  O   . HOH I 5 .   ? 14.186  -0.068  44.237  1.00 19.27 ? 2020 HOH A O   1 
HETATM 6485 O  O   . HOH I 5 .   ? -12.272 -0.809  36.911  1.00 19.12 ? 2021 HOH A O   1 
HETATM 6486 O  O   . HOH I 5 .   ? -4.790  -1.213  28.836  1.00 15.32 ? 2022 HOH A O   1 
HETATM 6487 O  O   . HOH I 5 .   ? -9.325  -2.512  13.654  1.00 25.41 ? 2023 HOH A O   1 
HETATM 6488 O  O   . HOH I 5 .   ? -8.997  0.761   42.402  1.00 24.55 ? 2024 HOH A O   1 
HETATM 6489 O  O   . HOH I 5 .   ? -7.663  -1.038  29.623  1.00 18.89 ? 2025 HOH A O   1 
HETATM 6490 O  O   . HOH I 5 .   ? -7.647  0.935   44.813  1.00 25.57 ? 2026 HOH A O   1 
HETATM 6491 O  O   . HOH I 5 .   ? -3.394  -2.124  19.475  1.00 24.65 ? 2027 HOH A O   1 
HETATM 6492 O  O   . HOH I 5 .   ? 4.361   -0.536  28.580  1.00 17.13 ? 2028 HOH A O   1 
HETATM 6493 O  O   . HOH I 5 .   ? 13.282  1.001   36.055  1.00 12.26 ? 2029 HOH A O   1 
HETATM 6494 O  O   . HOH I 5 .   ? 23.843  0.533   27.220  1.00 26.35 ? 2030 HOH A O   1 
HETATM 6495 O  O   . HOH I 5 .   ? -12.769 2.755   38.621  1.00 26.73 ? 2031 HOH A O   1 
HETATM 6496 O  O   . HOH I 5 .   ? -9.669  0.709   28.756  1.00 19.48 ? 2032 HOH A O   1 
HETATM 6497 O  O   . HOH I 5 .   ? -9.116  -0.025  22.301  1.00 22.39 ? 2033 HOH A O   1 
HETATM 6498 O  O   . HOH I 5 .   ? -2.336  0.984   33.190  1.00 10.85 ? 2034 HOH A O   1 
HETATM 6499 O  O   . HOH I 5 .   ? 1.655   2.387   44.464  1.00 23.29 ? 2035 HOH A O   1 
HETATM 6500 O  O   . HOH I 5 .   ? 7.436   44.437  43.710  1.00 40.50 ? 2036 HOH A O   1 
HETATM 6501 O  O   . HOH I 5 .   ? -7.623  -0.910  12.157  1.00 22.34 ? 2037 HOH A O   1 
HETATM 6502 O  O   . HOH I 5 .   ? 1.260   1.244   24.905  1.00 11.36 ? 2038 HOH A O   1 
HETATM 6503 O  O   . HOH I 5 .   ? -13.722 -0.028  9.830   1.00 19.92 ? 2039 HOH A O   1 
HETATM 6504 O  O   . HOH I 5 .   ? -9.275  3.371   41.749  1.00 33.76 ? 2040 HOH A O   1 
HETATM 6505 O  O   . HOH I 5 .   ? -12.953 2.756   13.127  1.00 35.49 ? 2041 HOH A O   1 
HETATM 6506 O  O   . HOH I 5 .   ? -1.370  3.697   32.843  1.00 10.75 ? 2042 HOH A O   1 
HETATM 6507 O  O   . HOH I 5 .   ? 12.732  5.798   48.231  1.00 29.64 ? 2043 HOH A O   1 
HETATM 6508 O  O   . HOH I 5 .   ? 19.876  4.664   36.496  1.00 24.82 ? 2044 HOH A O   1 
HETATM 6509 O  O   . HOH I 5 .   ? -9.370  1.173   11.985  1.00 16.41 ? 2045 HOH A O   1 
HETATM 6510 O  O   . HOH I 5 .   ? -8.762  1.864   14.501  1.00 16.11 ? 2046 HOH A O   1 
HETATM 6511 O  O   . HOH I 5 .   ? -2.437  2.292   14.075  1.00 11.83 ? 2047 HOH A O   1 
HETATM 6512 O  O   . HOH I 5 .   ? 25.137  4.020   27.947  1.00 26.96 ? 2048 HOH A O   1 
HETATM 6513 O  O   . HOH I 5 .   ? -7.527  5.760   39.488  1.00 15.11 ? 2049 HOH A O   1 
HETATM 6514 O  O   . HOH I 5 .   ? 11.228  6.763   44.788  1.00 13.95 ? 2050 HOH A O   1 
HETATM 6515 O  O   . HOH I 5 .   ? 21.884  5.839   34.975  1.00 22.58 ? 2051 HOH A O   1 
HETATM 6516 O  O   . HOH I 5 .   ? -14.229 5.144   13.168  1.00 37.57 ? 2052 HOH A O   1 
HETATM 6517 O  O   . HOH I 5 .   ? -10.051 6.795   38.844  1.00 13.32 ? 2053 HOH A O   1 
HETATM 6518 O  O   . HOH I 5 .   ? -1.331  4.668   14.909  1.00 10.66 ? 2054 HOH A O   1 
HETATM 6519 O  O   . HOH I 5 .   ? -1.295  7.808   42.490  1.00 19.37 ? 2055 HOH A O   1 
HETATM 6520 O  O   . HOH I 5 .   ? -11.556 8.219   21.763  1.00 36.01 ? 2056 HOH A O   1 
HETATM 6521 O  O   . HOH I 5 .   ? -8.550  5.732   21.235  1.00 37.05 ? 2057 HOH A O   1 
HETATM 6522 O  O   . HOH I 5 .   ? -15.634 3.315   11.795  1.00 28.06 ? 2058 HOH A O   1 
HETATM 6523 O  O   . HOH I 5 .   ? -5.610  8.125   32.741  1.00 14.66 ? 2059 HOH A O   1 
HETATM 6524 O  O   . HOH I 5 .   ? -2.320  5.430   12.451  1.00 12.02 ? 2060 HOH A O   1 
HETATM 6525 O  O   . HOH I 5 .   ? 22.816  8.065   28.000  1.00 21.74 ? 2061 HOH A O   1 
HETATM 6526 O  O   . HOH I 5 .   ? -24.655 6.157   5.821   1.00 16.98 ? 2062 HOH A O   1 
HETATM 6527 O  O   . HOH I 5 .   ? -0.630  9.735   41.250  1.00 24.48 ? 2063 HOH A O   1 
HETATM 6528 O  O   . HOH I 5 .   ? -4.989  9.887   37.351  1.00 25.10 ? 2064 HOH A O   1 
HETATM 6529 O  O   . HOH I 5 .   ? 1.738   7.173   18.881  1.00 12.32 ? 2065 HOH A O   1 
HETATM 6530 O  O   . HOH I 5 .   ? 1.847   10.061  41.725  1.00 15.55 ? 2066 HOH A O   1 
HETATM 6531 O  O   . HOH I 5 .   ? -3.454  8.334   27.616  1.00 16.68 ? 2067 HOH A O   1 
HETATM 6532 O  O   . HOH I 5 .   ? -4.380  9.501   24.814  1.00 47.26 ? 2068 HOH A O   1 
HETATM 6533 O  O   . HOH I 5 .   ? 8.408   9.151   25.129  1.00 12.23 ? 2069 HOH A O   1 
HETATM 6534 O  O   . HOH I 5 .   ? 20.651  10.119  27.710  1.00 16.67 ? 2070 HOH A O   1 
HETATM 6535 O  O   . HOH I 5 .   ? -13.999 7.629   12.404  1.00 13.47 ? 2071 HOH A O   1 
HETATM 6536 O  O   . HOH I 5 .   ? -5.744  9.703   28.389  1.00 19.95 ? 2072 HOH A O   1 
HETATM 6537 O  O   . HOH I 5 .   ? -2.870  7.985   11.430  1.00 14.74 ? 2073 HOH A O   1 
HETATM 6538 O  O   . HOH I 5 .   ? -1.868  11.505  42.678  1.00 13.36 ? 2074 HOH A O   1 
HETATM 6539 O  O   . HOH I 5 .   ? 19.474  10.453  30.078  1.00 17.73 ? 2075 HOH A O   1 
HETATM 6540 O  O   . HOH I 5 .   ? 8.561   10.219  22.549  1.00 12.62 ? 2076 HOH A O   1 
HETATM 6541 O  O   . HOH I 5 .   ? -8.055  8.812   11.098  1.00 10.97 ? 2077 HOH A O   1 
HETATM 6542 O  O   . HOH I 5 .   ? -5.519  9.670   10.777  1.00 15.38 ? 2078 HOH A O   1 
HETATM 6543 O  O   . HOH I 5 .   ? 2.240   11.628  35.207  1.00 18.90 ? 2079 HOH A O   1 
HETATM 6544 O  O   . HOH I 5 .   ? 9.693   14.151  45.445  1.00 19.99 ? 2080 HOH A O   1 
HETATM 6545 O  O   . HOH I 5 .   ? 18.163  14.101  41.778  1.00 23.34 ? 2081 HOH A O   1 
HETATM 6546 O  O   . HOH I 5 .   ? 20.594  12.953  30.800  1.00 34.03 ? 2082 HOH A O   1 
HETATM 6547 O  O   . HOH I 5 .   ? 14.154  12.906  25.416  1.00 11.95 ? 2083 HOH A O   1 
HETATM 6548 O  O   . HOH I 5 .   ? -12.828 14.545  43.071  1.00 24.16 ? 2084 HOH A O   1 
HETATM 6549 O  O   . HOH I 5 .   ? 7.815   12.887  22.184  1.00 11.67 ? 2085 HOH A O   1 
HETATM 6550 O  O   . HOH I 5 .   ? 11.546  15.062  43.674  1.00 18.13 ? 2086 HOH A O   1 
HETATM 6551 O  O   . HOH I 5 .   ? 12.371  17.252  45.212  1.00 30.22 ? 2087 HOH A O   1 
HETATM 6552 O  O   . HOH I 5 .   ? 21.123  14.026  33.234  1.00 25.69 ? 2088 HOH A O   1 
HETATM 6553 O  O   . HOH I 5 .   ? 21.305  15.635  44.095  1.00 22.80 ? 2089 HOH A O   1 
HETATM 6554 O  O   . HOH I 5 .   ? -1.146  13.087  23.474  1.00 12.88 ? 2090 HOH A O   1 
HETATM 6555 O  O   . HOH I 5 .   ? 1.213   12.631  14.942  1.00 11.35 ? 2091 HOH A O   1 
HETATM 6556 O  O   . HOH I 5 .   ? 8.599   13.079  13.598  1.00 10.70 ? 2092 HOH A O   1 
HETATM 6557 O  O   . HOH I 5 .   ? -6.216  11.890  9.422   1.00 14.10 ? 2093 HOH A O   1 
HETATM 6558 O  O   . HOH I 5 .   ? 0.611   13.839  21.198  1.00 11.60 ? 2094 HOH A O   1 
HETATM 6559 O  O   . HOH I 5 .   ? 10.119  16.476  47.185  1.00 36.36 ? 2095 HOH A O   1 
HETATM 6560 O  O   . HOH I 5 .   ? -16.576 16.021  41.625  1.00 33.05 ? 2096 HOH A O   1 
HETATM 6561 O  O   . HOH I 5 .   ? -21.801 14.217  12.518  1.00 30.32 ? 2097 HOH A O   1 
HETATM 6562 O  O   . HOH I 5 .   ? -11.233 17.337  45.251  1.00 32.94 ? 2098 HOH A O   1 
HETATM 6563 O  O   . HOH I 5 .   ? 14.200  18.667  46.032  1.00 37.39 ? 2099 HOH A O   1 
HETATM 6564 O  O   . HOH I 5 .   ? 21.854  18.137  42.906  1.00 19.21 ? 2100 HOH A O   1 
HETATM 6565 O  O   . HOH I 5 .   ? 14.068  16.294  27.335  1.00 11.30 ? 2101 HOH A O   1 
HETATM 6566 O  O   . HOH I 5 .   ? 16.361  16.323  25.707  1.00 20.67 ? 2102 HOH A O   1 
HETATM 6567 O  O   . HOH I 5 .   ? 18.826  16.448  26.912  1.00 39.14 ? 2103 HOH A O   1 
HETATM 6568 O  O   . HOH I 5 .   ? -14.003 12.825  1.544   1.00 19.30 ? 2104 HOH A O   1 
HETATM 6569 O  O   . HOH I 5 .   ? -3.411  16.505  22.087  1.00 3.88  ? 2105 HOH A O   1 
HETATM 6570 O  O   . HOH I 5 .   ? 1.098   16.824  21.273  1.00 11.80 ? 2106 HOH A O   1 
HETATM 6571 O  O   . HOH I 5 .   ? 11.325  19.657  44.201  1.00 24.32 ? 2107 HOH A O   1 
HETATM 6572 O  O   . HOH I 5 .   ? 21.160  18.733  32.257  1.00 20.45 ? 2108 HOH A O   1 
HETATM 6573 O  O   . HOH I 5 .   ? 20.610  20.880  49.091  1.00 17.82 ? 2109 HOH A O   1 
HETATM 6574 O  O   . HOH I 5 .   ? 11.459  17.557  21.110  1.00 17.93 ? 2110 HOH A O   1 
HETATM 6575 O  O   . HOH I 5 .   ? 17.575  18.371  28.625  1.00 23.52 ? 2111 HOH A O   1 
HETATM 6576 O  O   . HOH I 5 .   ? -11.862 20.390  42.457  1.00 29.29 ? 2112 HOH A O   1 
HETATM 6577 O  O   . HOH I 5 .   ? 12.102  20.730  42.081  1.00 24.50 ? 2113 HOH A O   1 
HETATM 6578 O  O   . HOH I 5 .   ? 15.497  18.816  25.061  1.00 24.55 ? 2114 HOH A O   1 
HETATM 6579 O  O   . HOH I 5 .   ? 19.883  19.850  30.162  1.00 24.09 ? 2115 HOH A O   1 
HETATM 6580 O  O   . HOH I 5 .   ? 23.119  22.205  49.319  1.00 24.12 ? 2116 HOH A O   1 
HETATM 6581 O  O   . HOH I 5 .   ? 12.229  21.958  45.002  1.00 28.52 ? 2117 HOH A O   1 
HETATM 6582 O  O   . HOH I 5 .   ? 22.297  20.422  34.220  1.00 17.62 ? 2118 HOH A O   1 
HETATM 6583 O  O   . HOH I 5 .   ? -8.011  17.515  0.172   1.00 24.95 ? 2119 HOH A O   1 
HETATM 6584 O  O   . HOH I 5 .   ? 13.508  23.967  43.943  1.00 17.67 ? 2120 HOH A O   1 
HETATM 6585 O  O   . HOH I 5 .   ? -5.715  19.639  6.080   1.00 13.80 ? 2121 HOH A O   1 
HETATM 6586 O  O   . HOH I 5 .   ? 1.845   19.266  56.480  1.00 49.92 ? 2122 HOH A O   1 
HETATM 6587 O  O   . HOH I 5 .   ? 7.048   21.512  22.811  1.00 21.73 ? 2123 HOH A O   1 
HETATM 6588 O  O   . HOH I 5 .   ? 9.444   21.990  24.190  1.00 26.15 ? 2124 HOH A O   1 
HETATM 6589 O  O   . HOH I 5 .   ? -8.959  24.313  41.306  1.00 36.94 ? 2125 HOH A O   1 
HETATM 6590 O  O   . HOH I 5 .   ? 17.061  23.345  26.597  1.00 25.46 ? 2126 HOH A O   1 
HETATM 6591 O  O   . HOH I 5 .   ? -5.095  21.840  13.878  1.00 12.78 ? 2127 HOH A O   1 
HETATM 6592 O  O   . HOH I 5 .   ? -7.410  24.047  28.158  1.00 12.87 ? 2128 HOH A O   1 
HETATM 6593 O  O   . HOH I 5 .   ? -2.710  22.512  15.226  1.00 16.01 ? 2129 HOH A O   1 
HETATM 6594 O  O   . HOH I 5 .   ? 18.493  24.888  30.057  1.00 15.34 ? 2130 HOH A O   1 
HETATM 6595 O  O   . HOH I 5 .   ? 1.004   24.771  36.484  1.00 13.56 ? 2131 HOH A O   1 
HETATM 6596 O  O   . HOH I 5 .   ? 10.881  26.503  44.804  1.00 15.83 ? 2132 HOH A O   1 
HETATM 6597 O  O   . HOH I 5 .   ? 18.095  25.954  33.322  1.00 13.36 ? 2133 HOH A O   1 
HETATM 6598 O  O   . HOH I 5 .   ? 20.386  27.546  50.501  1.00 22.48 ? 2134 HOH A O   1 
HETATM 6599 O  O   . HOH I 5 .   ? -13.489 25.911  36.734  1.00 23.47 ? 2135 HOH A O   1 
HETATM 6600 O  O   . HOH I 5 .   ? -7.704  22.941  10.344  1.00 14.54 ? 2136 HOH A O   1 
HETATM 6601 O  O   . HOH I 5 .   ? -5.472  28.181  39.514  1.00 17.33 ? 2137 HOH A O   1 
HETATM 6602 O  O   . HOH I 5 .   ? 4.116   26.321  18.078  1.00 41.03 ? 2138 HOH A O   1 
HETATM 6603 O  O   . HOH I 5 .   ? 22.914  27.877  50.500  1.00 27.98 ? 2139 HOH A O   1 
HETATM 6604 O  O   . HOH I 5 .   ? -11.013 26.319  35.507  1.00 16.00 ? 2140 HOH A O   1 
HETATM 6605 O  O   . HOH I 5 .   ? 5.296   25.540  21.705  1.00 29.29 ? 2141 HOH A O   1 
HETATM 6606 O  O   . HOH I 5 .   ? 11.753  25.551  24.457  1.00 29.55 ? 2142 HOH A O   1 
HETATM 6607 O  O   . HOH I 5 .   ? 22.514  28.680  46.758  1.00 14.63 ? 2143 HOH A O   1 
HETATM 6608 O  O   . HOH I 5 .   ? -14.616 24.139  11.818  1.00 17.45 ? 2144 HOH A O   1 
HETATM 6609 O  O   . HOH I 5 .   ? -3.699  25.034  15.902  1.00 18.31 ? 2145 HOH A O   1 
HETATM 6610 O  O   . HOH I 5 .   ? 17.852  26.760  26.745  1.00 27.40 ? 2146 HOH A O   1 
HETATM 6611 O  O   . HOH I 5 .   ? -3.728  26.312  24.474  1.00 12.92 ? 2147 HOH A O   1 
HETATM 6612 O  O   . HOH I 5 .   ? 0.638   28.102  35.337  1.00 14.42 ? 2148 HOH A O   1 
HETATM 6613 O  O   . HOH I 5 .   ? 5.454   24.361  19.297  1.00 36.89 ? 2149 HOH A O   1 
HETATM 6614 O  O   . HOH I 5 .   ? -7.634  32.227  29.830  1.00 40.37 ? 2150 HOH A O   1 
HETATM 6615 O  O   . HOH I 5 .   ? 4.004   27.472  23.077  1.00 13.80 ? 2151 HOH A O   1 
HETATM 6616 O  O   . HOH I 5 .   ? 10.448  27.627  25.880  1.00 20.01 ? 2152 HOH A O   1 
HETATM 6617 O  O   . HOH I 5 .   ? -14.625 25.412  9.408   1.00 31.38 ? 2153 HOH A O   1 
HETATM 6618 O  O   . HOH I 5 .   ? -13.620 28.481  30.020  1.00 13.99 ? 2154 HOH A O   1 
HETATM 6619 O  O   . HOH I 5 .   ? -11.015 29.172  35.479  1.00 22.80 ? 2155 HOH A O   1 
HETATM 6620 O  O   . HOH I 5 .   ? 7.077   28.603  31.768  1.00 15.27 ? 2156 HOH A O   1 
HETATM 6621 O  O   . HOH I 5 .   ? 8.478   28.325  23.919  1.00 28.85 ? 2157 HOH A O   1 
HETATM 6622 O  O   . HOH I 5 .   ? 28.370  29.919  38.973  1.00 21.47 ? 2158 HOH A O   1 
HETATM 6623 O  O   . HOH I 5 .   ? -2.326  31.410  49.064  1.00 21.10 ? 2159 HOH A O   1 
HETATM 6624 O  O   . HOH I 5 .   ? 4.756   31.076  44.794  1.00 12.49 ? 2160 HOH A O   1 
HETATM 6625 O  O   . HOH I 5 .   ? 14.291  29.194  23.870  1.00 31.30 ? 2161 HOH A O   1 
HETATM 6626 O  O   . HOH I 5 .   ? 19.812  29.522  27.060  1.00 21.93 ? 2162 HOH A O   1 
HETATM 6627 O  O   . HOH I 5 .   ? -17.043 28.462  35.969  1.00 49.63 ? 2163 HOH A O   1 
HETATM 6628 O  O   . HOH I 5 .   ? 6.037   28.997  24.179  1.00 20.05 ? 2164 HOH A O   1 
HETATM 6629 O  O   . HOH I 5 .   ? 12.328  29.591  25.882  1.00 18.54 ? 2165 HOH A O   1 
HETATM 6630 O  O   . HOH I 5 .   ? -2.462  28.702  17.170  1.00 18.02 ? 2166 HOH A O   1 
HETATM 6631 O  O   . HOH I 5 .   ? 0.179   29.194  17.388  1.00 22.11 ? 2167 HOH A O   1 
HETATM 6632 O  O   . HOH I 5 .   ? -0.914  30.111  34.513  1.00 21.10 ? 2168 HOH A O   1 
HETATM 6633 O  O   . HOH I 5 .   ? -7.315  30.633  25.779  1.00 16.71 ? 2169 HOH A O   1 
HETATM 6634 O  O   . HOH I 5 .   ? -6.560  30.486  23.112  1.00 13.36 ? 2170 HOH A O   1 
HETATM 6635 O  O   . HOH I 5 .   ? -3.241  31.251  30.048  1.00 21.67 ? 2171 HOH A O   1 
HETATM 6636 O  O   . HOH I 5 .   ? -3.609  32.133  39.384  1.00 25.99 ? 2172 HOH A O   1 
HETATM 6637 O  O   . HOH I 5 .   ? 10.469  31.046  23.995  1.00 49.11 ? 2173 HOH A O   1 
HETATM 6638 O  O   . HOH I 5 .   ? -13.432 31.051  29.409  1.00 18.91 ? 2174 HOH A O   1 
HETATM 6639 O  O   . HOH I 5 .   ? -0.833  31.254  31.439  1.00 26.83 ? 2175 HOH A O   1 
HETATM 6640 O  O   . HOH I 5 .   ? 0.691   31.315  29.115  1.00 23.02 ? 2176 HOH A O   1 
HETATM 6641 O  O   . HOH I 5 .   ? -15.272 30.586  16.183  1.00 34.24 ? 2177 HOH A O   1 
HETATM 6642 O  O   . HOH I 5 .   ? -12.718 30.600  17.341  1.00 25.56 ? 2178 HOH A O   1 
HETATM 6643 O  O   . HOH I 5 .   ? -13.236 32.344  31.749  1.00 30.20 ? 2179 HOH A O   1 
HETATM 6644 O  O   . HOH I 5 .   ? -3.336  33.580  41.925  1.00 24.04 ? 2180 HOH A O   1 
HETATM 6645 O  O   . HOH I 5 .   ? 17.137  32.853  32.618  1.00 15.03 ? 2181 HOH A O   1 
HETATM 6646 O  O   . HOH I 5 .   ? -15.281 31.439  24.257  1.00 22.26 ? 2182 HOH A O   1 
HETATM 6647 O  O   . HOH I 5 .   ? -0.207  32.269  25.266  1.00 26.22 ? 2183 HOH A O   1 
HETATM 6648 O  O   . HOH I 5 .   ? 1.190   33.838  35.014  1.00 23.96 ? 2184 HOH A O   1 
HETATM 6649 O  O   . HOH I 5 .   ? -7.595  32.771  21.983  1.00 18.78 ? 2185 HOH A O   1 
HETATM 6650 O  O   . HOH I 5 .   ? -0.587  34.869  36.809  1.00 25.90 ? 2186 HOH A O   1 
HETATM 6651 O  O   . HOH I 5 .   ? 1.526   34.123  28.430  1.00 33.58 ? 2187 HOH A O   1 
HETATM 6652 O  O   . HOH I 5 .   ? -15.149 33.568  18.779  1.00 33.06 ? 2188 HOH A O   1 
HETATM 6653 O  O   . HOH I 5 .   ? -1.570  36.660  43.537  1.00 30.34 ? 2189 HOH A O   1 
HETATM 6654 O  O   . HOH I 5 .   ? -1.375  36.129  40.365  1.00 26.09 ? 2190 HOH A O   1 
HETATM 6655 O  O   . HOH I 5 .   ? 18.533  34.948  30.927  1.00 35.60 ? 2191 HOH A O   1 
HETATM 6656 O  O   . HOH I 5 .   ? -1.345  38.385  45.654  1.00 26.39 ? 2192 HOH A O   1 
HETATM 6657 O  O   . HOH I 5 .   ? 10.043  36.264  22.929  1.00 49.88 ? 2193 HOH A O   1 
HETATM 6658 O  O   . HOH I 5 .   ? 15.588  39.709  51.150  1.00 21.15 ? 2194 HOH A O   1 
HETATM 6659 O  O   . HOH I 5 .   ? 1.964   40.633  45.062  1.00 24.38 ? 2195 HOH A O   1 
HETATM 6660 O  O   . HOH I 5 .   ? 21.136  32.648  27.842  1.00 50.76 ? 2196 HOH A O   1 
HETATM 6661 O  O   . HOH I 5 .   ? 8.113   39.185  24.947  1.00 43.84 ? 2197 HOH A O   1 
HETATM 6662 O  O   . HOH I 5 .   ? 12.923  41.393  35.822  1.00 21.88 ? 2198 HOH A O   1 
HETATM 6663 O  O   . HOH I 5 .   ? 4.846   40.751  27.725  1.00 25.66 ? 2199 HOH A O   1 
HETATM 6664 O  O   . HOH I 5 .   ? 13.869  -2.079  42.270  1.00 24.26 ? 2200 HOH A O   1 
HETATM 6665 O  O   . HOH I 5 .   ? 2.224   1.987   47.394  1.00 22.65 ? 2201 HOH A O   1 
HETATM 6666 O  O   . HOH I 5 .   ? 0.915   4.759   50.301  1.00 19.52 ? 2202 HOH A O   1 
HETATM 6667 O  O   . HOH I 5 .   ? -19.094 5.256   34.955  1.00 32.70 ? 2203 HOH A O   1 
HETATM 6668 O  O   . HOH I 5 .   ? 6.714   10.887  49.680  1.00 34.71 ? 2204 HOH A O   1 
HETATM 6669 O  O   . HOH I 5 .   ? 16.148  10.418  48.475  1.00 15.67 ? 2205 HOH A O   1 
HETATM 6670 O  O   . HOH I 5 .   ? -17.264 6.018   5.818   1.00 17.10 ? 2206 HOH A O   1 
HETATM 6671 O  O   . HOH I 5 .   ? -21.582 10.712  32.395  1.00 29.22 ? 2207 HOH A O   1 
HETATM 6672 O  O   . HOH I 5 .   ? -16.659 7.201   1.310   1.00 29.30 ? 2208 HOH A O   1 
HETATM 6673 O  O   . HOH I 5 .   ? -16.489 8.987   12.156  1.00 19.44 ? 2209 HOH A O   1 
HETATM 6674 O  O   . HOH I 5 .   ? -14.601 8.849   0.557   1.00 26.96 ? 2210 HOH A O   1 
HETATM 6675 O  O   . HOH I 5 .   ? -2.563  14.826  53.069  1.00 22.26 ? 2211 HOH A O   1 
HETATM 6676 O  O   . HOH I 5 .   ? -16.843 12.007  12.078  1.00 23.24 ? 2212 HOH A O   1 
HETATM 6677 O  O   . HOH I 5 .   ? 10.014  17.791  50.837  1.00 54.95 ? 2213 HOH A O   1 
HETATM 6678 O  O   . HOH I 5 .   ? -9.173  18.182  48.439  1.00 30.35 ? 2214 HOH A O   1 
HETATM 6679 O  O   . HOH I 5 .   ? -10.930 6.247   20.011  1.00 56.13 ? 2215 HOH A O   1 
HETATM 6680 O  O   . HOH I 5 .   ? -17.386 12.611  9.337   1.00 30.19 ? 2216 HOH A O   1 
HETATM 6681 O  O   . HOH I 5 .   ? -1.725  19.630  54.145  1.00 32.79 ? 2217 HOH A O   1 
HETATM 6682 O  O   . HOH I 5 .   ? 8.523   19.992  51.287  1.00 27.02 ? 2218 HOH A O   1 
HETATM 6683 O  O   . HOH I 5 .   ? -5.413  19.960  48.636  1.00 19.13 ? 2219 HOH A O   1 
HETATM 6684 O  O   . HOH I 5 .   ? -20.303 18.452  33.047  1.00 22.84 ? 2220 HOH A O   1 
HETATM 6685 O  O   . HOH I 5 .   ? 8.420   28.053  51.274  1.00 35.44 ? 2221 HOH A O   1 
HETATM 6686 O  O   . HOH I 5 .   ? -16.473 17.352  8.875   1.00 32.06 ? 2222 HOH A O   1 
HETATM 6687 O  O   . HOH I 5 .   ? -3.817  16.742  51.592  1.00 33.86 ? 2223 HOH A O   1 
HETATM 6688 O  O   . HOH I 5 .   ? -16.481 18.862  18.096  1.00 11.71 ? 2224 HOH A O   1 
HETATM 6689 O  O   . HOH I 5 .   ? 14.732  23.268  50.657  1.00 19.14 ? 2225 HOH A O   1 
HETATM 6690 O  O   . HOH I 5 .   ? -19.146 21.054  16.115  1.00 23.59 ? 2226 HOH A O   1 
HETATM 6691 O  O   . HOH I 5 .   ? 4.155   23.854  50.089  1.00 15.26 ? 2227 HOH A O   1 
HETATM 6692 O  O   . HOH I 5 .   ? 7.237   25.899  52.585  1.00 32.65 ? 2228 HOH A O   1 
HETATM 6693 O  O   . HOH I 5 .   ? 10.282  22.911  51.091  1.00 28.70 ? 2229 HOH A O   1 
HETATM 6694 O  O   . HOH I 5 .   ? -23.684 21.792  20.851  1.00 20.29 ? 2230 HOH A O   1 
HETATM 6695 O  O   . HOH I 5 .   ? -21.623 19.967  21.075  1.00 16.45 ? 2231 HOH A O   1 
HETATM 6696 O  O   . HOH I 5 .   ? 3.096   24.068  52.526  1.00 25.19 ? 2232 HOH A O   1 
HETATM 6697 O  O   . HOH I 5 .   ? 13.642  24.660  52.603  1.00 29.56 ? 2233 HOH A O   1 
HETATM 6698 O  O   . HOH I 5 .   ? -16.830 19.832  12.776  1.00 23.59 ? 2234 HOH A O   1 
HETATM 6699 O  O   . HOH I 5 .   ? -18.728 12.686  3.222   1.00 47.10 ? 2235 HOH A O   1 
HETATM 6700 O  O   . HOH I 5 .   ? 20.342  24.931  51.459  1.00 20.11 ? 2236 HOH A O   1 
HETATM 6701 O  O   . HOH I 5 .   ? 6.604   23.804  51.069  1.00 28.11 ? 2237 HOH A O   1 
HETATM 6702 O  O   . HOH I 5 .   ? -24.488 23.527  18.355  1.00 42.45 ? 2238 HOH A O   1 
HETATM 6703 O  O   . HOH I 5 .   ? -21.724 21.546  15.275  1.00 32.37 ? 2239 HOH A O   1 
HETATM 6704 O  O   . HOH I 5 .   ? -1.938  23.789  56.143  1.00 37.13 ? 2240 HOH A O   1 
HETATM 6705 O  O   . HOH I 5 .   ? -16.360 22.244  11.251  1.00 32.99 ? 2241 HOH A O   1 
HETATM 6706 O  O   . HOH I 5 .   ? -20.658 26.591  36.576  1.00 29.41 ? 2242 HOH A O   1 
HETATM 6707 O  O   . HOH I 5 .   ? -21.969 28.331  18.263  1.00 37.52 ? 2243 HOH A O   1 
HETATM 6708 O  O   . HOH I 5 .   ? -18.304 23.726  15.703  1.00 17.59 ? 2244 HOH A O   1 
HETATM 6709 O  O   . HOH I 5 .   ? -6.213  29.905  50.562  1.00 27.04 ? 2245 HOH A O   1 
HETATM 6710 O  O   . HOH I 5 .   ? 18.676  38.794  54.182  1.00 25.54 ? 2246 HOH A O   1 
HETATM 6711 O  O   . HOH I 5 .   ? -20.185 26.059  12.910  1.00 41.04 ? 2247 HOH A O   1 
HETATM 6712 O  O   . HOH I 5 .   ? 2.347   28.037  18.798  1.00 25.17 ? 2248 HOH A O   1 
HETATM 6713 O  O   . HOH I 5 .   ? -22.482 29.692  31.304  1.00 30.37 ? 2249 HOH A O   1 
HETATM 6714 O  O   . HOH I 5 .   ? -19.575 27.713  16.990  1.00 22.98 ? 2250 HOH A O   1 
HETATM 6715 O  O   . HOH I 5 .   ? 1.260   32.174  52.886  1.00 28.57 ? 2251 HOH A O   1 
HETATM 6716 O  O   . HOH I 5 .   ? -21.028 28.993  20.619  1.00 27.72 ? 2252 HOH A O   1 
HETATM 6717 O  O   . HOH I 5 .   ? -18.431 28.587  20.811  1.00 16.84 ? 2253 HOH A O   1 
HETATM 6718 O  O   . HOH I 5 .   ? -17.125 27.718  12.458  1.00 23.32 ? 2254 HOH A O   1 
HETATM 6719 O  O   . HOH I 5 .   ? -1.327  32.740  51.523  1.00 28.14 ? 2255 HOH A O   1 
HETATM 6720 O  O   . HOH I 5 .   ? -21.812 29.559  22.966  1.00 45.87 ? 2256 HOH A O   1 
HETATM 6721 O  O   . HOH I 5 .   ? 3.383   34.140  51.044  1.00 22.31 ? 2257 HOH A O   1 
HETATM 6722 O  O   . HOH I 5 .   ? -17.115 30.202  13.782  1.00 37.54 ? 2258 HOH A O   1 
HETATM 6723 O  O   . HOH I 5 .   ? 16.124  40.796  33.239  1.00 21.58 ? 2259 HOH A O   1 
HETATM 6724 O  O   . HOH I 5 .   ? 18.979  43.781  34.966  1.00 28.22 ? 2260 HOH A O   1 
HETATM 6725 O  O   . HOH I 5 .   ? 9.647   45.199  44.577  1.00 29.03 ? 2261 HOH A O   1 
HETATM 6726 O  O   . HOH I 5 .   ? 5.964   43.783  29.483  1.00 27.20 ? 2262 HOH A O   1 
HETATM 6727 O  O   . HOH I 5 .   ? -16.087 -6.189  23.490  1.00 26.53 ? 2263 HOH A O   1 
HETATM 6728 O  O   . HOH I 5 .   ? -12.343 -9.528  29.390  1.00 25.34 ? 2264 HOH A O   1 
HETATM 6729 O  O   . HOH I 5 .   ? 8.156   45.750  29.661  1.00 31.99 ? 2265 HOH A O   1 
HETATM 6730 O  O   . HOH I 5 .   ? -11.991 0.333   11.942  1.00 18.71 ? 2266 HOH A O   1 
HETATM 6731 O  O   . HOH I 5 .   ? -26.114 13.652  20.666  1.00 18.07 ? 2267 HOH A O   1 
HETATM 6732 O  O   . HOH I 5 .   ? -19.235 7.945   4.679   1.00 17.97 ? 2268 HOH A O   1 
HETATM 6733 O  O   . HOH I 5 .   ? -0.956  3.008   43.842  1.00 17.61 ? 2269 HOH A O   1 
HETATM 6734 O  O   . HOH I 5 .   ? 0.582   14.820  53.798  1.00 21.11 ? 2270 HOH A O   1 
HETATM 6735 O  O   . HOH I 5 .   ? 12.847  21.416  50.177  1.00 22.01 ? 2271 HOH A O   1 
HETATM 6736 O  O   . HOH I 5 .   ? 23.961  38.248  38.323  1.00 22.50 ? 2272 HOH A O   1 
HETATM 6737 O  O   . HOH I 5 .   ? 3.297   37.507  51.773  1.00 48.84 ? 2273 HOH A O   1 
HETATM 6738 O  O   . HOH I 5 .   ? 28.194  24.592  42.809  1.00 21.73 ? 2274 HOH A O   1 
HETATM 6739 O  O   . HOH I 5 .   ? 24.912  20.093  48.640  1.00 26.91 ? 2275 HOH A O   1 
HETATM 6740 O  O   . HOH I 5 .   ? -11.692 6.376   41.110  1.00 23.37 ? 2276 HOH A O   1 
HETATM 6741 O  O   . HOH I 5 .   ? -13.098 29.866  33.934  1.00 24.23 ? 2277 HOH A O   1 
HETATM 6742 O  O   . HOH I 5 .   ? 10.694  39.839  36.809  1.00 19.18 ? 2278 HOH A O   1 
HETATM 6743 O  O   . HOH I 5 .   ? -5.047  3.897   49.770  1.00 23.94 ? 2279 HOH A O   1 
HETATM 6744 O  O   . HOH I 5 .   ? -14.932 10.975  42.441  1.00 24.60 ? 2280 HOH A O   1 
HETATM 6745 O  O   . HOH I 5 .   ? 21.866  12.358  26.795  1.00 28.12 ? 2281 HOH A O   1 
HETATM 6746 O  O   . HOH I 5 .   ? 27.714  35.181  44.513  1.00 24.51 ? 2282 HOH A O   1 
HETATM 6747 O  O   . HOH I 5 .   ? -22.545 -10.997 30.098  1.00 23.77 ? 2283 HOH A O   1 
HETATM 6748 O  O   . HOH I 5 .   ? 21.758  41.432  38.412  1.00 21.96 ? 2284 HOH A O   1 
HETATM 6749 O  O   . HOH I 5 .   ? -5.431  8.008   48.340  1.00 28.01 ? 2285 HOH A O   1 
HETATM 6750 O  O   . HOH I 5 .   ? -22.820 24.192  16.106  1.00 31.46 ? 2286 HOH A O   1 
HETATM 6751 O  O   . HOH I 5 .   ? -6.381  21.961  7.356   1.00 23.89 ? 2287 HOH A O   1 
HETATM 6752 O  O   . HOH I 5 .   ? -1.290  2.830   50.256  1.00 23.08 ? 2288 HOH A O   1 
HETATM 6753 O  O   . HOH I 5 .   ? -22.731 2.281   27.784  1.00 29.03 ? 2289 HOH A O   1 
HETATM 6754 O  O   . HOH I 5 .   ? -19.650 12.455  7.129   1.00 31.87 ? 2290 HOH A O   1 
HETATM 6755 O  O   . HOH I 5 .   ? 26.659  34.356  38.023  1.00 25.78 ? 2291 HOH A O   1 
HETATM 6756 O  O   . HOH I 5 .   ? -15.379 -9.574  32.724  1.00 28.36 ? 2292 HOH A O   1 
HETATM 6757 O  O   . HOH I 5 .   ? 25.419  19.089  46.126  1.00 28.59 ? 2293 HOH A O   1 
HETATM 6758 O  O   . HOH I 5 .   ? 23.077  23.497  51.544  1.00 38.72 ? 2294 HOH A O   1 
HETATM 6759 O  O   . HOH I 5 .   ? -20.818 7.280   12.576  1.00 29.97 ? 2295 HOH A O   1 
HETATM 6760 O  O   . HOH I 5 .   ? 24.104  22.415  33.490  1.00 31.97 ? 2296 HOH A O   1 
HETATM 6761 O  O   . HOH I 5 .   ? -17.917 -6.189  27.219  1.00 26.64 ? 2297 HOH A O   1 
HETATM 6762 O  O   . HOH I 5 .   ? 10.476  12.516  47.547  1.00 25.85 ? 2298 HOH A O   1 
HETATM 6763 O  O   . HOH I 5 .   ? 20.155  18.292  49.850  1.00 29.78 ? 2299 HOH A O   1 
HETATM 6764 O  O   . HOH I 5 .   ? 21.827  31.404  48.726  1.00 24.39 ? 2300 HOH A O   1 
HETATM 6765 O  O   . HOH I 5 .   ? -7.469  30.637  52.937  1.00 53.62 ? 2301 HOH A O   1 
HETATM 6766 O  O   . HOH I 5 .   ? 2.328   28.951  21.522  1.00 22.62 ? 2302 HOH A O   1 
HETATM 6767 O  O   . HOH I 5 .   ? 27.722  29.009  36.298  1.00 32.33 ? 2303 HOH A O   1 
HETATM 6768 O  O   . HOH I 5 .   ? 29.496  27.676  48.186  1.00 29.78 ? 2304 HOH A O   1 
HETATM 6769 O  O   . HOH I 5 .   ? -7.530  27.240  41.058  1.00 31.09 ? 2305 HOH A O   1 
HETATM 6770 O  O   . HOH I 5 .   ? -6.768  8.315   45.895  1.00 25.58 ? 2306 HOH A O   1 
HETATM 6771 O  O   . HOH I 5 .   ? -17.529 2.057   36.864  1.00 28.93 ? 2307 HOH A O   1 
HETATM 6772 O  O   . HOH I 5 .   ? -1.119  32.139  36.498  1.00 24.17 ? 2308 HOH A O   1 
HETATM 6773 O  O   . HOH I 5 .   ? 24.285  19.135  43.646  1.00 27.02 ? 2309 HOH A O   1 
HETATM 6774 O  O   . HOH I 5 .   ? -7.829  28.243  54.409  1.00 29.53 ? 2310 HOH A O   1 
HETATM 6775 O  O   . HOH I 5 .   ? 29.978  31.769  42.539  1.00 28.52 ? 2311 HOH A O   1 
HETATM 6776 O  O   . HOH I 5 .   ? 26.834  37.337  38.148  1.00 32.72 ? 2312 HOH A O   1 
HETATM 6777 O  O   . HOH I 5 .   ? 19.347  22.442  50.770  1.00 27.77 ? 2313 HOH A O   1 
HETATM 6778 O  O   . HOH I 5 .   ? 12.519  42.184  33.291  1.00 25.58 ? 2314 HOH A O   1 
HETATM 6779 O  O   . HOH I 5 .   ? -18.637 18.981  14.674  1.00 27.10 ? 2315 HOH A O   1 
HETATM 6780 O  O   . HOH I 5 .   ? 7.290   -2.329  48.300  1.00 33.63 ? 2316 HOH A O   1 
HETATM 6781 O  O   . HOH I 5 .   ? -22.060 -2.331  28.720  1.00 28.07 ? 2317 HOH A O   1 
HETATM 6782 O  O   . HOH I 5 .   ? 25.245  20.833  42.064  1.00 30.21 ? 2318 HOH A O   1 
HETATM 6783 O  O   . HOH I 5 .   ? 2.686   2.801   50.103  1.00 24.38 ? 2319 HOH A O   1 
HETATM 6784 O  O   . HOH I 5 .   ? -10.866 0.436   15.665  1.00 29.92 ? 2320 HOH A O   1 
HETATM 6785 O  O   . HOH I 5 .   ? 6.700   43.733  32.962  1.00 35.91 ? 2321 HOH A O   1 
HETATM 6786 O  O   . HOH I 5 .   ? -22.032 20.572  33.733  1.00 30.39 ? 2322 HOH A O   1 
HETATM 6787 O  O   . HOH I 5 .   ? -23.630 3.382   2.897   1.00 28.44 ? 2323 HOH A O   1 
HETATM 6788 O  O   . HOH I 5 .   ? -10.720 -2.098  22.323  1.00 35.21 ? 2324 HOH A O   1 
HETATM 6789 O  O   . HOH I 5 .   ? -14.629 24.383  40.863  1.00 32.38 ? 2325 HOH A O   1 
HETATM 6790 O  O   . HOH I 5 .   ? -7.966  6.050   44.129  1.00 29.10 ? 2326 HOH A O   1 
HETATM 6791 O  O   . HOH I 5 .   ? -10.059 24.725  48.305  1.00 31.63 ? 2327 HOH A O   1 
HETATM 6792 O  O   . HOH I 5 .   ? -6.283  -5.789  16.367  1.00 33.48 ? 2328 HOH A O   1 
HETATM 6793 O  O   . HOH I 5 .   ? 9.344   -0.241  49.894  1.00 29.14 ? 2329 HOH A O   1 
HETATM 6794 O  O   . HOH I 5 .   ? -20.528 25.355  15.694  1.00 27.63 ? 2330 HOH A O   1 
HETATM 6795 O  O   . HOH I 5 .   ? -3.289  31.172  16.232  1.00 29.38 ? 2331 HOH A O   1 
HETATM 6796 O  O   . HOH I 5 .   ? -18.782 8.305   1.983   1.00 31.00 ? 2332 HOH A O   1 
HETATM 6797 O  O   . HOH I 5 .   ? -8.163  33.154  19.417  1.00 34.12 ? 2333 HOH A O   1 
HETATM 6798 O  O   . HOH I 5 .   ? -0.692  0.962   47.511  1.00 32.42 ? 2334 HOH A O   1 
HETATM 6799 O  O   . HOH I 5 .   ? 2.889   0.288   51.465  1.00 28.85 ? 2335 HOH A O   1 
HETATM 6800 O  O   . HOH I 5 .   ? -22.443 -4.855  28.013  1.00 32.36 ? 2336 HOH A O   1 
HETATM 6801 O  O   . HOH I 5 .   ? -22.969 8.549   32.276  1.00 39.08 ? 2337 HOH A O   1 
HETATM 6802 O  O   . HOH I 5 .   ? 28.936  34.564  41.044  1.00 31.20 ? 2338 HOH A O   1 
HETATM 6803 O  O   . HOH I 5 .   ? 24.113  18.711  35.254  1.00 31.82 ? 2339 HOH A O   1 
HETATM 6804 O  O   . HOH I 5 .   ? 4.982   42.078  25.228  1.00 39.03 ? 2340 HOH A O   1 
HETATM 6805 O  O   . HOH I 5 .   ? -14.834 11.287  -0.420  1.00 37.99 ? 2341 HOH A O   1 
HETATM 6806 O  O   . HOH I 5 .   ? -16.200 14.844  4.801   1.00 32.88 ? 2342 HOH A O   1 
HETATM 6807 O  O   . HOH I 5 .   ? -3.638  -5.854  47.093  1.00 42.89 ? 2343 HOH A O   1 
HETATM 6808 O  O   . HOH I 5 .   ? -21.989 16.420  32.965  1.00 33.12 ? 2344 HOH A O   1 
HETATM 6809 O  O   . HOH I 5 .   ? -0.252  -5.616  39.436  1.00 23.36 ? 2345 HOH A O   1 
HETATM 6810 O  O   . HOH I 5 .   ? 27.514  19.919  49.591  1.00 29.69 ? 2346 HOH A O   1 
HETATM 6811 O  O   . HOH I 5 .   ? -3.789  28.238  12.705  1.00 33.60 ? 2347 HOH A O   1 
HETATM 6812 O  O   . HOH I 5 .   ? -21.300 14.949  34.978  1.00 31.67 ? 2348 HOH A O   1 
HETATM 6813 O  O   . HOH I 5 .   ? -18.984 5.943   38.272  1.00 33.79 ? 2349 HOH A O   1 
HETATM 6814 O  O   . HOH I 5 .   ? 11.267  43.807  31.605  1.00 30.85 ? 2350 HOH A O   1 
HETATM 6815 O  O   . HOH I 5 .   ? -10.131 7.287   43.071  1.00 43.35 ? 2351 HOH A O   1 
HETATM 6816 O  O   . HOH I 5 .   ? 21.309  34.912  49.137  1.00 31.80 ? 2352 HOH A O   1 
HETATM 6817 O  O   . HOH I 5 .   ? 3.129   14.987  54.639  1.00 34.48 ? 2353 HOH A O   1 
HETATM 6818 O  O   . HOH I 5 .   ? 17.258  49.363  39.313  1.00 27.00 ? 2354 HOH A O   1 
HETATM 6819 O  O   . HOH I 5 .   ? 24.208  18.858  40.079  1.00 32.30 ? 2355 HOH A O   1 
HETATM 6820 O  O   . HOH I 5 .   ? 19.216  32.928  50.704  1.00 28.77 ? 2356 HOH A O   1 
HETATM 6821 O  O   . HOH I 5 .   ? -18.870 11.690  14.025  1.00 36.37 ? 2357 HOH A O   1 
HETATM 6822 O  O   . HOH I 5 .   ? -6.968  2.351   48.186  1.00 36.91 ? 2358 HOH A O   1 
HETATM 6823 O  O   . HOH I 5 .   ? -7.478  -2.296  44.513  1.00 29.43 ? 2359 HOH A O   1 
HETATM 6824 O  O   . HOH I 5 .   ? 19.873  30.335  52.038  1.00 39.27 ? 2360 HOH A O   1 
HETATM 6825 O  O   . HOH I 5 .   ? -12.910 12.208  -2.324  1.00 31.88 ? 2361 HOH A O   1 
HETATM 6826 O  O   . HOH I 5 .   ? 30.398  23.695  45.835  1.00 33.08 ? 2362 HOH A O   1 
HETATM 6827 O  O   . HOH I 5 .   ? -15.268 13.660  42.994  1.00 30.75 ? 2363 HOH A O   1 
HETATM 6828 O  O   . HOH I 5 .   ? -24.504 9.910   35.590  1.00 38.30 ? 2364 HOH A O   1 
HETATM 6829 O  O   . HOH I 5 .   ? -9.272  -4.481  21.958  1.00 38.90 ? 2365 HOH A O   1 
HETATM 6830 O  O   . HOH I 5 .   ? -0.561  40.934  45.319  1.00 34.81 ? 2366 HOH A O   1 
HETATM 6831 O  O   . HOH I 5 .   ? -5.867  19.840  51.247  1.00 36.50 ? 2367 HOH A O   1 
HETATM 6832 O  O   . HOH I 5 .   ? -7.190  5.679   32.066  1.00 30.42 ? 2368 HOH A O   1 
HETATM 6833 O  O   . HOH I 5 .   ? -15.049 30.150  35.769  1.00 40.43 ? 2369 HOH A O   1 
HETATM 6834 O  O   . HOH I 5 .   ? 20.568  14.379  47.112  1.00 36.58 ? 2370 HOH A O   1 
HETATM 6835 O  O   . HOH I 5 .   ? -13.455 -6.743  23.751  1.00 30.69 ? 2371 HOH A O   1 
HETATM 6836 O  O   . HOH I 5 .   ? -29.206 19.255  23.968  1.00 34.61 ? 2372 HOH A O   1 
HETATM 6837 O  O   . HOH I 5 .   ? -13.564 0.307   38.975  1.00 38.53 ? 2373 HOH A O   1 
HETATM 6838 O  O   . HOH I 5 .   ? 20.555  7.591   45.448  1.00 37.81 ? 2374 HOH A O   1 
HETATM 6839 O  O   . HOH I 5 .   ? -9.290  33.717  24.342  1.00 32.17 ? 2375 HOH A O   1 
HETATM 6840 O  O   . HOH I 5 .   ? -16.548 33.525  33.248  1.00 35.57 ? 2376 HOH A O   1 
HETATM 6841 O  O   . HOH I 5 .   ? 10.478  -1.195  47.356  1.00 41.27 ? 2377 HOH A O   1 
HETATM 6842 O  O   . HOH I 5 .   ? 18.699  16.478  48.653  1.00 30.68 ? 2378 HOH A O   1 
HETATM 6843 O  O   . HOH I 5 .   ? 19.930  25.497  27.736  1.00 42.50 ? 2379 HOH A O   1 
HETATM 6844 O  O   . HOH I 5 .   ? 10.243  4.700   50.910  1.00 31.39 ? 2380 HOH A O   1 
HETATM 6845 O  O   . HOH I 5 .   ? -11.310 34.572  48.181  1.00 28.82 ? 2381 HOH A O   1 
HETATM 6846 O  O   . HOH I 5 .   ? -5.806  -7.037  19.756  1.00 36.44 ? 2382 HOH A O   1 
HETATM 6847 O  O   . HOH I 5 .   ? 16.727  21.983  52.076  1.00 31.00 ? 2383 HOH A O   1 
HETATM 6848 O  O   . HOH I 5 .   ? -8.436  -7.265  40.443  1.00 35.71 ? 2384 HOH A O   1 
HETATM 6849 O  O   . HOH I 5 .   ? 29.428  20.151  47.643  1.00 36.33 ? 2385 HOH A O   1 
HETATM 6850 O  O   . HOH I 5 .   ? -6.745  19.462  1.526   1.00 37.41 ? 2386 HOH A O   1 
HETATM 6851 O  O   . HOH I 5 .   ? -11.951 6.982   0.689   1.00 27.87 ? 2387 HOH A O   1 
HETATM 6852 O  O   . HOH I 5 .   ? -11.020 34.197  28.583  1.00 35.01 ? 2388 HOH A O   1 
HETATM 6853 O  O   . HOH I 5 .   ? 25.341  34.281  50.640  1.00 28.73 ? 2389 HOH A O   1 
HETATM 6854 O  O   . HOH I 5 .   ? 14.046  48.289  48.736  1.00 34.42 ? 2390 HOH A O   1 
HETATM 6855 O  O   . HOH I 5 .   ? -12.704 -4.845  33.457  1.00 32.23 ? 2391 HOH A O   1 
HETATM 6856 O  O   . HOH I 5 .   ? 23.398  42.561  44.104  1.00 36.64 ? 2392 HOH A O   1 
HETATM 6857 O  O   . HOH I 5 .   ? -7.609  12.528  50.539  1.00 36.63 ? 2393 HOH A O   1 
HETATM 6858 O  O   . HOH I 5 .   ? 21.181  11.487  39.049  1.00 36.60 ? 2394 HOH A O   1 
HETATM 6859 O  O   . HOH I 5 .   ? -25.632 35.045  26.373  1.00 46.07 ? 2395 HOH A O   1 
HETATM 6860 O  O   . HOH I 5 .   ? -16.167 0.348   2.054   1.00 33.88 ? 2396 HOH A O   1 
HETATM 6861 O  O   . HOH I 5 .   ? -19.130 10.876  1.271   1.00 36.51 ? 2397 HOH A O   1 
HETATM 6862 O  O   . HOH I 5 .   ? -22.957 7.333   20.930  1.00 32.07 ? 2398 HOH A O   1 
HETATM 6863 O  O   . HOH I 5 .   ? -19.247 29.904  15.373  1.00 36.92 ? 2399 HOH A O   1 
HETATM 6864 O  O   . HOH I 5 .   ? -8.289  3.671   46.110  1.00 38.38 ? 2400 HOH A O   1 
HETATM 6865 O  O   . HOH I 5 .   ? 29.568  31.250  46.970  1.00 33.58 ? 2401 HOH A O   1 
HETATM 6866 O  O   . HOH I 5 .   ? -25.281 12.669  33.932  1.00 38.94 ? 2402 HOH A O   1 
HETATM 6867 O  O   . HOH I 5 .   ? 3.679   30.089  17.512  1.00 44.32 ? 2403 HOH A O   1 
HETATM 6868 O  O   . HOH I 5 .   ? 20.957  13.159  24.287  1.00 34.86 ? 2404 HOH A O   1 
HETATM 6869 O  O   . HOH I 5 .   ? -11.767 3.841   40.723  1.00 38.04 ? 2405 HOH A O   1 
HETATM 6870 O  O   . HOH I 5 .   ? -5.973  -7.860  34.706  1.00 34.28 ? 2406 HOH A O   1 
HETATM 6871 O  O   . HOH I 5 .   ? -22.455 13.406  41.084  1.00 39.51 ? 2407 HOH A O   1 
HETATM 6872 O  O   . HOH I 5 .   ? -20.844 22.298  12.314  1.00 34.99 ? 2408 HOH A O   1 
HETATM 6873 O  O   . HOH I 5 .   ? -6.331  8.778   53.665  1.00 36.98 ? 2409 HOH A O   1 
HETATM 6874 O  O   . HOH I 5 .   ? 6.480   41.142  33.871  1.00 24.12 ? 2410 HOH A O   1 
HETATM 6875 O  O   . HOH I 5 .   ? 17.496  3.064   47.086  1.00 36.35 ? 2411 HOH A O   1 
HETATM 6876 O  O   . HOH I 5 .   ? 22.949  26.136  32.164  1.00 46.01 ? 2412 HOH A O   1 
HETATM 6877 O  O   . HOH I 5 .   ? -13.720 1.104   1.656   1.00 34.84 ? 2413 HOH A O   1 
HETATM 6878 O  O   . HOH I 5 .   ? 22.854  15.459  37.674  1.00 40.16 ? 2414 HOH A O   1 
HETATM 6879 O  O   . HOH I 5 .   ? 19.693  50.047  38.005  1.00 45.23 ? 2415 HOH A O   1 
HETATM 6880 O  O   . HOH I 5 .   ? -18.662 19.628  37.854  1.00 41.81 ? 2416 HOH A O   1 
HETATM 6881 O  O   . HOH I 5 .   ? 25.306  41.992  49.058  1.00 29.47 ? 2417 HOH A O   1 
HETATM 6882 O  O   . HOH I 5 .   ? -14.398 -2.743  9.012   1.00 37.03 ? 2418 HOH A O   1 
HETATM 6883 O  O   . HOH I 5 .   ? 14.989  42.689  31.711  1.00 39.24 ? 2419 HOH A O   1 
HETATM 6884 O  O   . HOH I 5 .   ? 5.483   -7.753  44.288  1.00 37.30 ? 2420 HOH A O   1 
HETATM 6885 O  O   . HOH I 5 .   ? 2.919   -3.596  46.169  1.00 50.21 ? 2421 HOH A O   1 
HETATM 6886 O  O   . HOH I 5 .   ? -5.895  34.589  42.261  1.00 39.04 ? 2422 HOH A O   1 
HETATM 6887 O  O   . HOH I 5 .   ? 28.907  32.676  44.918  1.00 42.51 ? 2423 HOH A O   1 
HETATM 6888 O  O   . HOH I 5 .   ? -21.850 22.375  35.757  1.00 35.61 ? 2424 HOH A O   1 
HETATM 6889 O  O   . HOH I 5 .   ? -17.840 3.074   18.441  1.00 44.12 ? 2425 HOH A O   1 
HETATM 6890 O  O   . HOH I 5 .   ? 18.803  50.466  48.430  1.00 38.26 ? 2426 HOH A O   1 
HETATM 6891 O  O   . HOH I 5 .   ? -11.665 16.327  47.624  1.00 38.70 ? 2427 HOH A O   1 
HETATM 6892 O  O   . HOH I 5 .   ? 26.085  23.024  34.967  1.00 38.77 ? 2428 HOH A O   1 
HETATM 6893 O  O   . HOH I 5 .   ? 3.707   17.393  55.623  1.00 38.80 ? 2429 HOH A O   1 
HETATM 6894 O  O   . HOH I 5 .   ? 19.406  24.949  54.052  1.00 39.73 ? 2430 HOH A O   1 
HETATM 6895 O  O   . HOH I 5 .   ? -15.404 -5.992  33.449  1.00 36.98 ? 2431 HOH A O   1 
HETATM 6896 O  O   . HOH I 5 .   ? -12.450 1.327   -0.582  1.00 36.36 ? 2432 HOH A O   1 
HETATM 6897 O  O   . HOH I 5 .   ? 6.417   17.990  53.546  1.00 34.92 ? 2433 HOH A O   1 
HETATM 6898 O  O   . HOH I 5 .   ? 2.833   -3.232  48.834  1.00 42.99 ? 2434 HOH A O   1 
HETATM 6899 O  O   . HOH I 5 .   ? -6.524  10.030  50.995  1.00 46.42 ? 2435 HOH A O   1 
HETATM 6900 O  O   . HOH I 5 .   ? -13.137 -3.136  35.644  1.00 42.00 ? 2436 HOH A O   1 
HETATM 6901 O  O   . HOH I 5 .   ? 16.403  19.354  52.910  1.00 39.32 ? 2437 HOH A O   1 
HETATM 6902 O  O   . HOH I 5 .   ? -8.748  28.423  47.828  1.00 37.71 ? 2438 HOH A O   1 
HETATM 6903 O  O   . HOH I 5 .   ? 19.080  12.884  44.636  1.00 41.54 ? 2439 HOH A O   1 
HETATM 6904 O  O   . HOH I 5 .   ? -10.388 27.513  43.722  1.00 36.56 ? 2440 HOH A O   1 
HETATM 6905 O  O   . HOH I 5 .   ? -20.549 -0.284  24.986  1.00 42.10 ? 2441 HOH A O   1 
HETATM 6906 O  O   . HOH I 5 .   ? 4.758   32.303  24.271  1.00 33.11 ? 2442 HOH A O   1 
HETATM 6907 O  O   . HOH I 5 .   ? -11.724 -0.139  42.530  1.00 39.33 ? 2443 HOH A O   1 
HETATM 6908 O  O   . HOH I 5 .   ? 29.843  22.437  42.124  1.00 35.06 ? 2444 HOH A O   1 
HETATM 6909 O  O   . HOH I 5 .   ? 6.536   22.954  21.142  1.00 40.29 ? 2445 HOH A O   1 
HETATM 6910 O  O   . HOH I 5 .   ? -8.968  -6.419  34.306  1.00 36.19 ? 2446 HOH A O   1 
HETATM 6911 O  O   . HOH I 5 .   ? 17.700  20.608  25.450  1.00 46.58 ? 2447 HOH A O   1 
HETATM 6912 O  O   . HOH I 5 .   ? -18.390 23.742  12.790  1.00 37.22 ? 2448 HOH A O   1 
HETATM 6913 O  O   . HOH I 5 .   ? 20.432  14.723  28.325  1.00 40.76 ? 2449 HOH A O   1 
HETATM 6914 O  O   . HOH I 5 .   ? 7.877   -7.013  46.207  1.00 42.42 ? 2450 HOH A O   1 
HETATM 6915 O  O   . HOH I 5 .   ? -16.736 -1.685  3.940   1.00 45.37 ? 2451 HOH A O   1 
HETATM 6916 O  O   . HOH I 5 .   ? 13.922  18.645  52.408  1.00 47.82 ? 2452 HOH A O   1 
HETATM 6917 O  O   . HOH I 5 .   ? 16.619  7.430   47.130  1.00 43.01 ? 2453 HOH A O   1 
HETATM 6918 O  O   . HOH I 5 .   ? -10.761 33.307  18.315  1.00 36.54 ? 2454 HOH A O   1 
HETATM 6919 O  O   . HOH I 5 .   ? -0.681  32.280  20.737  1.00 38.15 ? 2455 HOH A O   1 
HETATM 6920 O  O   . HOH I 5 .   ? -17.962 19.685  10.186  1.00 42.08 ? 2456 HOH A O   1 
HETATM 6921 O  O   . HOH I 5 .   ? -20.068 -1.021  34.734  1.00 41.60 ? 2457 HOH A O   1 
HETATM 6922 O  O   . HOH I 5 .   ? -24.460 18.616  32.782  1.00 32.36 ? 2458 HOH A O   1 
HETATM 6923 O  O   . HOH I 5 .   ? 4.170   3.815   43.926  1.00 18.50 ? 2459 HOH A O   1 
HETATM 6924 O  O   . HOH I 5 .   ? 5.458   4.148   46.054  1.00 16.09 ? 2460 HOH A O   1 
HETATM 6925 O  O   . HOH I 5 .   ? -26.497 24.924  22.840  1.00 24.56 ? 2461 HOH A O   1 
HETATM 6926 O  O   . HOH I 5 .   ? 19.648  0.123   37.515  1.00 34.01 ? 2462 HOH A O   1 
HETATM 6927 O  O   . HOH I 5 .   ? 13.146  54.373  42.721  1.00 31.10 ? 2463 HOH A O   1 
HETATM 6928 O  O   . HOH I 5 .   ? -7.187  4.728   41.930  1.00 26.09 ? 2464 HOH A O   1 
HETATM 6929 O  O   . HOH I 5 .   ? -18.687 17.654  42.062  1.00 39.15 ? 2465 HOH A O   1 
HETATM 6930 O  O   . HOH I 5 .   ? 19.587  11.948  41.163  1.00 36.79 ? 2466 HOH A O   1 
HETATM 6931 O  O   . HOH I 5 .   ? -3.053  -11.576 38.651  1.00 28.62 ? 2467 HOH A O   1 
HETATM 6932 O  O   . HOH I 5 .   ? -8.422  33.885  32.894  1.00 34.02 ? 2468 HOH A O   1 
HETATM 6933 O  O   . HOH I 5 .   ? -5.909  14.311  11.018  1.00 24.67 ? 2469 HOH A O   1 
HETATM 6934 O  O   . HOH I 5 .   ? -28.948 13.776  24.325  1.00 35.78 ? 2470 HOH A O   1 
HETATM 6935 O  O   . HOH I 5 .   ? -10.761 33.931  31.727  1.00 32.89 ? 2471 HOH A O   1 
HETATM 6936 O  O   . HOH I 5 .   ? 19.176  39.388  33.504  1.00 35.33 ? 2472 HOH A O   1 
HETATM 6937 O  O   . HOH I 5 .   ? 19.222  7.202   49.400  1.00 33.42 ? 2473 HOH A O   1 
HETATM 6938 O  O   . HOH J 5 .   ? 23.027  -22.458 16.366  1.00 32.86 ? 2004 HOH B O   1 
HETATM 6939 O  O   . HOH J 5 .   ? 19.495  -19.862 18.546  1.00 31.65 ? 2005 HOH B O   1 
HETATM 6940 O  O   . HOH J 5 .   ? 4.548   -13.474 38.113  1.00 41.50 ? 2006 HOH B O   1 
HETATM 6941 O  O   . HOH J 5 .   ? 2.498   -10.652 38.147  1.00 31.75 ? 2007 HOH B O   1 
HETATM 6942 O  O   . HOH J 5 .   ? 18.021  -17.749 18.217  1.00 19.92 ? 2008 HOH B O   1 
HETATM 6943 O  O   . HOH J 5 .   ? 26.453  -17.065 19.043  1.00 23.19 ? 2009 HOH B O   1 
HETATM 6944 O  O   . HOH J 5 .   ? 3.699   -15.792 36.847  1.00 35.19 ? 2010 HOH B O   1 
HETATM 6945 O  O   . HOH J 5 .   ? 13.208  -14.052 30.676  1.00 32.54 ? 2011 HOH B O   1 
HETATM 6946 O  O   . HOH J 5 .   ? 2.804   -15.418 32.450  1.00 29.21 ? 2012 HOH B O   1 
HETATM 6947 O  O   . HOH J 5 .   ? 8.946   -16.449 25.459  1.00 36.27 ? 2013 HOH B O   1 
HETATM 6948 O  O   . HOH J 5 .   ? 16.340  -15.815 22.298  1.00 28.95 ? 2014 HOH B O   1 
HETATM 6949 O  O   . HOH J 5 .   ? 18.475  -15.766 24.165  1.00 37.47 ? 2015 HOH B O   1 
HETATM 6950 O  O   . HOH J 5 .   ? 25.136  -15.850 23.234  1.00 24.39 ? 2016 HOH B O   1 
HETATM 6951 O  O   . HOH J 5 .   ? 8.906   -14.767 29.502  1.00 37.55 ? 2017 HOH B O   1 
HETATM 6952 O  O   . HOH J 5 .   ? 11.097  -14.284 34.279  1.00 36.89 ? 2018 HOH B O   1 
HETATM 6953 O  O   . HOH J 5 .   ? 21.343  -14.989 24.308  1.00 24.14 ? 2019 HOH B O   1 
HETATM 6954 O  O   . HOH J 5 .   ? 8.831   -14.134 26.879  1.00 21.67 ? 2020 HOH B O   1 
HETATM 6955 O  O   . HOH J 5 .   ? 16.623  -13.956 27.225  1.00 29.88 ? 2021 HOH B O   1 
HETATM 6956 O  O   . HOH J 5 .   ? 24.694  -14.047 27.873  1.00 24.90 ? 2022 HOH B O   1 
HETATM 6957 O  O   . HOH J 5 .   ? 26.297  -14.340 19.626  1.00 16.91 ? 2023 HOH B O   1 
HETATM 6958 O  O   . HOH J 5 .   ? 6.127   -13.782 26.471  1.00 22.81 ? 2024 HOH B O   1 
HETATM 6959 O  O   . HOH J 5 .   ? 8.678   -12.328 37.764  1.00 25.50 ? 2025 HOH B O   1 
HETATM 6960 O  O   . HOH J 5 .   ? -0.207  -10.805 25.378  1.00 34.30 ? 2026 HOH B O   1 
HETATM 6961 O  O   . HOH J 5 .   ? 17.420  -15.469 6.304   1.00 24.72 ? 2027 HOH B O   1 
HETATM 6962 O  O   . HOH J 5 .   ? 16.167  -13.163 21.703  1.00 15.62 ? 2028 HOH B O   1 
HETATM 6963 O  O   . HOH J 5 .   ? 22.004  -11.677 31.105  1.00 31.27 ? 2029 HOH B O   1 
HETATM 6964 O  O   . HOH J 5 .   ? -1.538  -20.157 29.495  1.00 55.03 ? 2030 HOH B O   1 
HETATM 6965 O  O   . HOH J 5 .   ? 20.901  -11.801 28.563  1.00 19.52 ? 2031 HOH B O   1 
HETATM 6966 O  O   . HOH J 5 .   ? 2.145   -11.934 25.340  1.00 32.98 ? 2032 HOH B O   1 
HETATM 6967 O  O   . HOH J 5 .   ? 4.477   -11.444 26.470  1.00 16.08 ? 2033 HOH B O   1 
HETATM 6968 O  O   . HOH J 5 .   ? 29.239  -10.731 16.954  1.00 24.01 ? 2034 HOH B O   1 
HETATM 6969 O  O   . HOH J 5 .   ? -4.751  -10.151 33.031  1.00 38.04 ? 2035 HOH B O   1 
HETATM 6970 O  O   . HOH J 5 .   ? 27.741  -9.230  24.053  1.00 28.37 ? 2036 HOH B O   1 
HETATM 6971 O  O   . HOH J 5 .   ? -2.851  -8.155  22.808  1.00 35.89 ? 2037 HOH B O   1 
HETATM 6972 O  O   . HOH J 5 .   ? 15.423  -10.670 -2.045  1.00 28.59 ? 2038 HOH B O   1 
HETATM 6973 O  O   . HOH J 5 .   ? 26.643  -8.761  11.019  1.00 17.25 ? 2039 HOH B O   1 
HETATM 6974 O  O   . HOH J 5 .   ? 29.293  -8.391  11.710  1.00 19.63 ? 2040 HOH B O   1 
HETATM 6975 O  O   . HOH J 5 .   ? -3.042  -8.191  19.926  1.00 39.72 ? 2041 HOH B O   1 
HETATM 6976 O  O   . HOH J 5 .   ? -2.137  -7.209  26.648  1.00 21.36 ? 2042 HOH B O   1 
HETATM 6977 O  O   . HOH J 5 .   ? 30.639  -7.915  9.306   1.00 29.97 ? 2043 HOH B O   1 
HETATM 6978 O  O   . HOH J 5 .   ? -5.673  -6.902  24.650  1.00 28.23 ? 2044 HOH B O   1 
HETATM 6979 O  O   . HOH J 5 .   ? 10.739  -9.231  -2.881  1.00 26.62 ? 2045 HOH B O   1 
HETATM 6980 O  O   . HOH J 5 .   ? 24.722  -7.977  4.187   1.00 23.75 ? 2046 HOH B O   1 
HETATM 6981 O  O   . HOH J 5 .   ? 28.558  -7.726  7.394   1.00 22.43 ? 2047 HOH B O   1 
HETATM 6982 O  O   . HOH J 5 .   ? -1.335  -6.284  24.231  1.00 21.76 ? 2048 HOH B O   1 
HETATM 6983 O  O   . HOH J 5 .   ? 5.213   -5.638  28.439  1.00 14.68 ? 2049 HOH B O   1 
HETATM 6984 O  O   . HOH J 5 .   ? 19.144  -5.202  30.682  1.00 16.08 ? 2050 HOH B O   1 
HETATM 6985 O  O   . HOH J 5 .   ? -4.335  -5.386  26.429  1.00 25.19 ? 2051 HOH B O   1 
HETATM 6986 O  O   . HOH J 5 .   ? 17.947  -3.987  33.590  1.00 33.39 ? 2052 HOH B O   1 
HETATM 6987 O  O   . HOH J 5 .   ? -1.827  -7.677  1.699   1.00 21.21 ? 2053 HOH B O   1 
HETATM 6988 O  O   . HOH J 5 .   ? -2.640  -6.004  16.181  1.00 24.85 ? 2054 HOH B O   1 
HETATM 6989 O  O   . HOH J 5 .   ? 2.028   -7.862  0.161   1.00 24.65 ? 2055 HOH B O   1 
HETATM 6990 O  O   . HOH J 5 .   ? 8.053   -3.893  30.496  1.00 16.82 ? 2056 HOH B O   1 
HETATM 6991 O  O   . HOH J 5 .   ? 15.341  -2.812  37.562  1.00 28.97 ? 2057 HOH B O   1 
HETATM 6992 O  O   . HOH J 5 .   ? 15.342  -3.429  34.826  1.00 20.45 ? 2058 HOH B O   1 
HETATM 6993 O  O   . HOH J 5 .   ? 31.954  -4.793  16.591  1.00 35.86 ? 2059 HOH B O   1 
HETATM 6994 O  O   . HOH J 5 .   ? 31.932  -5.169  12.368  1.00 39.56 ? 2060 HOH B O   1 
HETATM 6995 O  O   . HOH J 5 .   ? -1.289  -6.105  10.087  1.00 20.26 ? 2061 HOH B O   1 
HETATM 6996 O  O   . HOH J 5 .   ? 2.681   -4.967  18.011  1.00 32.49 ? 2062 HOH B O   1 
HETATM 6997 O  O   . HOH J 5 .   ? 24.996  -5.510  5.744   1.00 15.80 ? 2063 HOH B O   1 
HETATM 6998 O  O   . HOH J 5 .   ? 27.785  -5.550  5.938   1.00 24.20 ? 2064 HOH B O   1 
HETATM 6999 O  O   . HOH J 5 .   ? 30.175  -3.465  20.245  1.00 26.35 ? 2065 HOH B O   1 
HETATM 7000 O  O   . HOH J 5 .   ? 5.974   -3.250  29.153  1.00 16.78 ? 2066 HOH B O   1 
HETATM 7001 O  O   . HOH J 5 .   ? 3.120   -7.514  17.908  1.00 55.57 ? 2067 HOH B O   1 
HETATM 7002 O  O   . HOH J 5 .   ? 13.270  -1.215  37.618  1.00 17.61 ? 2068 HOH B O   1 
HETATM 7003 O  O   . HOH J 5 .   ? 18.392  -2.125  27.338  1.00 15.01 ? 2069 HOH B O   1 
HETATM 7004 O  O   . HOH J 5 .   ? 28.417  -2.796  16.201  1.00 17.40 ? 2070 HOH B O   1 
HETATM 7005 O  O   . HOH J 5 .   ? 5.754   -5.185  0.595   1.00 15.94 ? 2071 HOH B O   1 
HETATM 7006 O  O   . HOH J 5 .   ? 14.196  -6.975  -3.129  1.00 24.26 ? 2072 HOH B O   1 
HETATM 7007 O  O   . HOH J 5 .   ? 21.964  -2.750  13.142  1.00 14.46 ? 2073 HOH B O   1 
HETATM 7008 O  O   . HOH J 5 .   ? 27.945  -2.401  18.875  1.00 16.31 ? 2074 HOH B O   1 
HETATM 7009 O  O   . HOH J 5 .   ? -2.754  -4.054  9.015   1.00 16.19 ? 2075 HOH B O   1 
HETATM 7010 O  O   . HOH J 5 .   ? 24.957  -0.737  29.143  1.00 36.85 ? 2076 HOH B O   1 
HETATM 7011 O  O   . HOH J 5 .   ? 30.336  -1.380  14.961  1.00 25.82 ? 2077 HOH B O   1 
HETATM 7012 O  O   . HOH J 5 .   ? 2.857   -3.782  -2.269  1.00 26.77 ? 2078 HOH B O   1 
HETATM 7013 O  O   . HOH J 5 .   ? 21.724  -0.472  25.756  1.00 20.61 ? 2079 HOH B O   1 
HETATM 7014 O  O   . HOH J 5 .   ? 24.097  -2.447  0.009   1.00 25.48 ? 2080 HOH B O   1 
HETATM 7015 O  O   . HOH J 5 .   ? 0.356   -3.834  -3.390  1.00 18.00 ? 2081 HOH B O   1 
HETATM 7016 O  O   . HOH J 5 .   ? 1.864   0.008   27.336  1.00 11.84 ? 2082 HOH B O   1 
HETATM 7017 O  O   . HOH J 5 .   ? 19.119  0.422   26.249  1.00 17.29 ? 2083 HOH B O   1 
HETATM 7018 O  O   . HOH J 5 .   ? 27.855  0.320   26.103  1.00 32.17 ? 2084 HOH B O   1 
HETATM 7019 O  O   . HOH J 5 .   ? -7.775  -3.646  -2.402  1.00 40.73 ? 2085 HOH B O   1 
HETATM 7020 O  O   . HOH J 5 .   ? -4.237  -3.180  -3.675  1.00 25.09 ? 2086 HOH B O   1 
HETATM 7021 O  O   . HOH J 5 .   ? -4.981  0.238   19.436  1.00 21.70 ? 2087 HOH B O   1 
HETATM 7022 O  O   . HOH J 5 .   ? -1.163  0.032   25.434  1.00 13.00 ? 2088 HOH B O   1 
HETATM 7023 O  O   . HOH J 5 .   ? 4.792   -2.618  0.185   1.00 15.54 ? 2089 HOH B O   1 
HETATM 7024 O  O   . HOH J 5 .   ? 7.712   -1.851  11.414  1.00 21.05 ? 2090 HOH B O   1 
HETATM 7025 O  O   . HOH J 5 .   ? 26.775  -1.989  0.962   1.00 30.38 ? 2091 HOH B O   1 
HETATM 7026 O  O   . HOH J 5 .   ? 25.306  1.017   25.017  1.00 20.55 ? 2092 HOH B O   1 
HETATM 7027 O  O   . HOH J 5 .   ? -6.573  -2.395  4.766   1.00 22.50 ? 2093 HOH B O   1 
HETATM 7028 O  O   . HOH J 5 .   ? -3.170  -1.097  10.150  1.00 20.51 ? 2094 HOH B O   1 
HETATM 7029 O  O   . HOH J 5 .   ? 6.422   -1.445  7.362   1.00 15.12 ? 2095 HOH B O   1 
HETATM 7030 O  O   . HOH J 5 .   ? 37.667  22.255  12.048  1.00 49.92 ? 2096 HOH B O   1 
HETATM 7031 O  O   . HOH J 5 .   ? 13.739  0.215   18.766  1.00 5.71  ? 2097 HOH B O   1 
HETATM 7032 O  O   . HOH J 5 .   ? 23.700  0.464   17.402  1.00 13.96 ? 2098 HOH B O   1 
HETATM 7033 O  O   . HOH J 5 .   ? -11.437 -1.380  5.215   1.00 35.20 ? 2099 HOH B O   1 
HETATM 7034 O  O   . HOH J 5 .   ? -2.672  -1.968  -5.581  1.00 35.74 ? 2100 HOH B O   1 
HETATM 7035 O  O   . HOH J 5 .   ? 6.263   0.445   12.446  1.00 18.39 ? 2101 HOH B O   1 
HETATM 7036 O  O   . HOH J 5 .   ? 27.574  -0.035  2.518   1.00 24.90 ? 2102 HOH B O   1 
HETATM 7037 O  O   . HOH J 5 .   ? 29.294  1.976   12.242  1.00 21.02 ? 2103 HOH B O   1 
HETATM 7038 O  O   . HOH J 5 .   ? 30.940  1.507   14.387  1.00 27.45 ? 2104 HOH B O   1 
HETATM 7039 O  O   . HOH J 5 .   ? 25.667  3.746   25.191  1.00 24.11 ? 2105 HOH B O   1 
HETATM 7040 O  O   . HOH J 5 .   ? 9.092   4.016   25.907  1.00 12.07 ? 2106 HOH B O   1 
HETATM 7041 O  O   . HOH J 5 .   ? 10.535  2.565   17.316  1.00 15.99 ? 2107 HOH B O   1 
HETATM 7042 O  O   . HOH J 5 .   ? -0.544  1.915   6.332   1.00 9.41  ? 2108 HOH B O   1 
HETATM 7043 O  O   . HOH J 5 .   ? 10.917  3.994   19.795  1.00 12.46 ? 2109 HOH B O   1 
HETATM 7044 O  O   . HOH J 5 .   ? 19.949  1.116   -7.416  1.00 20.15 ? 2110 HOH B O   1 
HETATM 7045 O  O   . HOH J 5 .   ? 20.182  0.865   -10.125 1.00 36.86 ? 2111 HOH B O   1 
HETATM 7046 O  O   . HOH J 5 .   ? 29.443  4.245   17.694  1.00 31.36 ? 2112 HOH B O   1 
HETATM 7047 O  O   . HOH J 5 .   ? 30.985  2.541   3.314   1.00 22.90 ? 2113 HOH B O   1 
HETATM 7048 O  O   . HOH J 5 .   ? 3.904   4.715   21.625  1.00 10.62 ? 2114 HOH B O   1 
HETATM 7049 O  O   . HOH J 5 .   ? 8.105   0.701   -8.658  1.00 32.63 ? 2115 HOH B O   1 
HETATM 7050 O  O   . HOH J 5 .   ? 13.831  4.646   20.077  1.00 11.20 ? 2116 HOH B O   1 
HETATM 7051 O  O   . HOH J 5 .   ? 32.621  3.287   1.208   1.00 21.76 ? 2117 HOH B O   1 
HETATM 7052 O  O   . HOH J 5 .   ? -4.697  1.593   -1.128  1.00 15.67 ? 2118 HOH B O   1 
HETATM 7053 O  O   . HOH J 5 .   ? 2.040   2.973   7.019   1.00 11.28 ? 2119 HOH B O   1 
HETATM 7054 O  O   . HOH J 5 .   ? 3.836   1.002   -10.155 1.00 24.44 ? 2120 HOH B O   1 
HETATM 7055 O  O   . HOH J 5 .   ? 1.562   4.600   20.092  1.00 10.97 ? 2121 HOH B O   1 
HETATM 7056 O  O   . HOH J 5 .   ? 24.579  6.001   23.820  1.00 27.57 ? 2122 HOH B O   1 
HETATM 7057 O  O   . HOH J 5 .   ? 29.810  5.137   9.123   1.00 29.28 ? 2123 HOH B O   1 
HETATM 7058 O  O   . HOH J 5 .   ? 30.067  4.673   11.691  1.00 28.83 ? 2124 HOH B O   1 
HETATM 7059 O  O   . HOH J 5 .   ? 31.572  3.329   5.728   1.00 38.24 ? 2125 HOH B O   1 
HETATM 7060 O  O   . HOH J 5 .   ? 25.716  6.239   21.208  1.00 23.71 ? 2126 HOH B O   1 
HETATM 7061 O  O   . HOH J 5 .   ? 28.991  5.650   13.801  1.00 22.71 ? 2127 HOH B O   1 
HETATM 7062 O  O   . HOH J 5 .   ? 34.805  4.789   2.631   1.00 20.04 ? 2128 HOH B O   1 
HETATM 7063 O  O   . HOH J 5 .   ? 35.667  4.682   -0.096  1.00 24.54 ? 2129 HOH B O   1 
HETATM 7064 O  O   . HOH J 5 .   ? 8.154   4.676   2.137   1.00 23.19 ? 2130 HOH B O   1 
HETATM 7065 O  O   . HOH J 5 .   ? 10.769  3.804   -2.018  1.00 13.85 ? 2131 HOH B O   1 
HETATM 7066 O  O   . HOH J 5 .   ? 30.415  6.551   16.592  1.00 47.22 ? 2132 HOH B O   1 
HETATM 7067 O  O   . HOH J 5 .   ? 31.940  6.252   14.569  1.00 34.43 ? 2133 HOH B O   1 
HETATM 7068 O  O   . HOH J 5 .   ? 6.954   4.082   -2.081  1.00 18.74 ? 2134 HOH B O   1 
HETATM 7069 O  O   . HOH J 5 .   ? 8.791   4.766   -0.346  1.00 23.93 ? 2135 HOH B O   1 
HETATM 7070 O  O   . HOH J 5 .   ? 22.686  7.916   24.407  1.00 34.68 ? 2136 HOH B O   1 
HETATM 7071 O  O   . HOH J 5 .   ? 27.582  4.661   8.056   1.00 27.83 ? 2137 HOH B O   1 
HETATM 7072 O  O   . HOH J 5 .   ? 31.112  4.577   -6.189  1.00 17.88 ? 2138 HOH B O   1 
HETATM 7073 O  O   . HOH J 5 .   ? 2.404   4.394   -3.923  1.00 18.30 ? 2139 HOH B O   1 
HETATM 7074 O  O   . HOH J 5 .   ? 9.235   5.895   4.173   1.00 20.05 ? 2140 HOH B O   1 
HETATM 7075 O  O   . HOH J 5 .   ? 24.185  6.746   6.478   1.00 19.65 ? 2141 HOH B O   1 
HETATM 7076 O  O   . HOH J 5 .   ? 24.475  7.981   19.710  1.00 15.06 ? 2142 HOH B O   1 
HETATM 7077 O  O   . HOH J 5 .   ? 31.931  6.674   8.085   1.00 23.62 ? 2143 HOH B O   1 
HETATM 7078 O  O   . HOH J 5 .   ? 33.045  5.195   -8.045  1.00 37.78 ? 2144 HOH B O   1 
HETATM 7079 O  O   . HOH J 5 .   ? 37.360  5.455   -2.031  1.00 29.43 ? 2145 HOH B O   1 
HETATM 7080 O  O   . HOH J 5 .   ? -9.332  5.649   0.824   1.00 20.01 ? 2146 HOH B O   1 
HETATM 7081 O  O   . HOH J 5 .   ? -1.824  4.535   -7.393  1.00 29.46 ? 2147 HOH B O   1 
HETATM 7082 O  O   . HOH J 5 .   ? 22.087  9.074   20.724  1.00 31.00 ? 2148 HOH B O   1 
HETATM 7083 O  O   . HOH J 5 .   ? 11.386  6.719   5.648   1.00 25.40 ? 2149 HOH B O   1 
HETATM 7084 O  O   . HOH J 5 .   ? 9.072   7.232   -0.787  1.00 12.94 ? 2150 HOH B O   1 
HETATM 7085 O  O   . HOH J 5 .   ? 15.002  4.102   -12.022 1.00 26.43 ? 2151 HOH B O   1 
HETATM 7086 O  O   . HOH J 5 .   ? 37.987  9.778   16.532  1.00 25.21 ? 2152 HOH B O   1 
HETATM 7087 O  O   . HOH J 5 .   ? -7.390  7.454   1.720   1.00 17.14 ? 2153 HOH B O   1 
HETATM 7088 O  O   . HOH J 5 .   ? -1.917  6.527   -5.421  1.00 21.28 ? 2154 HOH B O   1 
HETATM 7089 O  O   . HOH J 5 .   ? 4.487   6.804   -9.882  1.00 21.13 ? 2155 HOH B O   1 
HETATM 7090 O  O   . HOH J 5 .   ? 9.009   11.224  28.057  1.00 11.83 ? 2156 HOH B O   1 
HETATM 7091 O  O   . HOH J 5 .   ? 25.943  10.388  18.869  1.00 21.43 ? 2157 HOH B O   1 
HETATM 7092 O  O   . HOH J 5 .   ? 39.483  8.275   -1.228  1.00 26.98 ? 2158 HOH B O   1 
HETATM 7093 O  O   . HOH J 5 .   ? 1.739   7.155   -4.309  1.00 24.05 ? 2159 HOH B O   1 
HETATM 7094 O  O   . HOH J 5 .   ? 18.345  10.880  19.700  1.00 21.04 ? 2160 HOH B O   1 
HETATM 7095 O  O   . HOH J 5 .   ? 41.257  10.609  15.358  1.00 19.36 ? 2161 HOH B O   1 
HETATM 7096 O  O   . HOH J 5 .   ? 1.519   7.816   -7.337  1.00 19.57 ? 2162 HOH B O   1 
HETATM 7097 O  O   . HOH J 5 .   ? 9.677   11.347  19.470  1.00 11.61 ? 2163 HOH B O   1 
HETATM 7098 O  O   . HOH J 5 .   ? 32.479  9.438   -9.641  1.00 24.93 ? 2164 HOH B O   1 
HETATM 7099 O  O   . HOH J 5 .   ? -0.616  9.199   -4.743  1.00 35.58 ? 2165 HOH B O   1 
HETATM 7100 O  O   . HOH J 5 .   ? 7.068   11.976  18.915  1.00 12.46 ? 2166 HOH B O   1 
HETATM 7101 O  O   . HOH J 5 .   ? 30.970  -2.550  12.627  1.00 36.32 ? 2167 HOH B O   1 
HETATM 7102 O  O   . HOH J 5 .   ? 26.336  12.122  11.465  1.00 14.31 ? 2168 HOH B O   1 
HETATM 7103 O  O   . HOH J 5 .   ? 6.314   12.063  16.158  1.00 10.17 ? 2169 HOH B O   1 
HETATM 7104 O  O   . HOH J 5 .   ? 25.221  12.593  19.264  1.00 27.99 ? 2170 HOH B O   1 
HETATM 7105 O  O   . HOH J 5 .   ? 30.113  11.039  -1.368  1.00 13.59 ? 2171 HOH B O   1 
HETATM 7106 O  O   . HOH J 5 .   ? 33.794  10.497  -7.452  1.00 18.83 ? 2172 HOH B O   1 
HETATM 7107 O  O   . HOH J 5 .   ? 10.059  13.489  20.959  1.00 6.56  ? 2173 HOH B O   1 
HETATM 7108 O  O   . HOH J 5 .   ? 16.965  13.785  20.453  1.00 27.63 ? 2174 HOH B O   1 
HETATM 7109 O  O   . HOH J 5 .   ? 18.842  13.440  18.548  1.00 23.88 ? 2175 HOH B O   1 
HETATM 7110 O  O   . HOH J 5 .   ? 23.440  10.811  -7.400  1.00 17.32 ? 2176 HOH B O   1 
HETATM 7111 O  O   . HOH J 5 .   ? 42.792  12.962  15.054  1.00 24.77 ? 2177 HOH B O   1 
HETATM 7112 O  O   . HOH J 5 .   ? -4.312  8.417   -6.505  1.00 31.68 ? 2178 HOH B O   1 
HETATM 7113 O  O   . HOH J 5 .   ? 14.155  15.003  21.431  1.00 15.27 ? 2179 HOH B O   1 
HETATM 7114 O  O   . HOH J 5 .   ? 24.596  14.763  17.546  1.00 21.15 ? 2180 HOH B O   1 
HETATM 7115 O  O   . HOH J 5 .   ? 15.212  11.926  -11.444 1.00 37.14 ? 2181 HOH B O   1 
HETATM 7116 O  O   . HOH J 5 .   ? 22.318  15.898  18.922  1.00 31.53 ? 2182 HOH B O   1 
HETATM 7117 O  O   . HOH J 5 .   ? 26.489  16.715  18.053  1.00 22.41 ? 2183 HOH B O   1 
HETATM 7118 O  O   . HOH J 5 .   ? 43.873  16.220  0.665   1.00 31.07 ? 2184 HOH B O   1 
HETATM 7119 O  O   . HOH J 5 .   ? -11.722 14.316  -0.160  1.00 30.38 ? 2185 HOH B O   1 
HETATM 7120 O  O   . HOH J 5 .   ? -8.797  14.669  0.630   1.00 15.15 ? 2186 HOH B O   1 
HETATM 7121 O  O   . HOH J 5 .   ? 19.642  15.124  -8.607  1.00 30.61 ? 2187 HOH B O   1 
HETATM 7122 O  O   . HOH J 5 .   ? 45.506  16.896  2.687   1.00 47.11 ? 2188 HOH B O   1 
HETATM 7123 O  O   . HOH J 5 .   ? 3.002   9.682   -3.341  1.00 17.06 ? 2189 HOH B O   1 
HETATM 7124 O  O   . HOH J 5 .   ? 9.848   17.918  16.852  1.00 12.53 ? 2190 HOH B O   1 
HETATM 7125 O  O   . HOH J 5 .   ? 13.176  15.691  -3.260  1.00 21.13 ? 2191 HOH B O   1 
HETATM 7126 O  O   . HOH J 5 .   ? 13.412  18.153  15.353  1.00 12.17 ? 2192 HOH B O   1 
HETATM 7127 O  O   . HOH J 5 .   ? 27.356  14.694  19.865  1.00 47.49 ? 2193 HOH B O   1 
HETATM 7128 O  O   . HOH J 5 .   ? -0.876  15.219  -8.921  1.00 27.99 ? 2194 HOH B O   1 
HETATM 7129 O  O   . HOH J 5 .   ? 15.439  16.130  -4.817  1.00 35.51 ? 2195 HOH B O   1 
HETATM 7130 O  O   . HOH J 5 .   ? 25.485  17.106  -1.246  1.00 19.32 ? 2196 HOH B O   1 
HETATM 7131 O  O   . HOH J 5 .   ? 38.527  18.239  10.704  1.00 29.98 ? 2197 HOH B O   1 
HETATM 7132 O  O   . HOH J 5 .   ? 5.695   16.781  -3.199  1.00 14.41 ? 2198 HOH B O   1 
HETATM 7133 O  O   . HOH J 5 .   ? 11.872  16.799  -5.292  1.00 31.21 ? 2199 HOH B O   1 
HETATM 7134 O  O   . HOH J 5 .   ? 13.776  17.361  -1.211  1.00 20.82 ? 2200 HOH B O   1 
HETATM 7135 O  O   . HOH J 5 .   ? 18.330  17.194  -1.407  1.00 26.46 ? 2201 HOH B O   1 
HETATM 7136 O  O   . HOH J 5 .   ? 19.173  17.756  0.951   1.00 22.09 ? 2202 HOH B O   1 
HETATM 7137 O  O   . HOH J 5 .   ? 22.405  16.882  -7.970  1.00 34.00 ? 2203 HOH B O   1 
HETATM 7138 O  O   . HOH J 5 .   ? -2.947  17.772  3.181   1.00 16.14 ? 2204 HOH B O   1 
HETATM 7139 O  O   . HOH J 5 .   ? -2.397  17.219  0.553   1.00 13.53 ? 2205 HOH B O   1 
HETATM 7140 O  O   . HOH J 5 .   ? -0.916  17.804  5.046   1.00 10.68 ? 2206 HOH B O   1 
HETATM 7141 O  O   . HOH J 5 .   ? 19.443  -6.059  -1.942  1.00 30.77 ? 2207 HOH B O   1 
HETATM 7142 O  O   . HOH J 5 .   ? 13.165  20.305  17.180  1.00 20.48 ? 2208 HOH B O   1 
HETATM 7143 O  O   . HOH J 5 .   ? 20.689  18.407  -1.910  1.00 29.03 ? 2209 HOH B O   1 
HETATM 7144 O  O   . HOH J 5 .   ? -6.588  4.285   -0.344  1.00 23.07 ? 2210 HOH B O   1 
HETATM 7145 O  O   . HOH J 5 .   ? 16.053  18.481  -2.516  1.00 27.49 ? 2211 HOH B O   1 
HETATM 7146 O  O   . HOH J 5 .   ? 22.629  19.496  -0.388  1.00 20.48 ? 2212 HOH B O   1 
HETATM 7147 O  O   . HOH J 5 .   ? -4.621  19.798  3.489   1.00 21.39 ? 2213 HOH B O   1 
HETATM 7148 O  O   . HOH J 5 .   ? 20.252  21.226  17.048  1.00 28.33 ? 2214 HOH B O   1 
HETATM 7149 O  O   . HOH J 5 .   ? 36.580  25.145  11.369  1.00 33.21 ? 2215 HOH B O   1 
HETATM 7150 O  O   . HOH J 5 .   ? -5.892  20.420  9.848   1.00 11.29 ? 2216 HOH B O   1 
HETATM 7151 O  O   . HOH J 5 .   ? 9.506   22.124  -6.009  1.00 12.99 ? 2217 HOH B O   1 
HETATM 7152 O  O   . HOH J 5 .   ? 23.715  22.261  17.366  1.00 25.55 ? 2218 HOH B O   1 
HETATM 7153 O  O   . HOH J 5 .   ? -1.304  19.478  -3.043  1.00 16.58 ? 2219 HOH B O   1 
HETATM 7154 O  O   . HOH J 5 .   ? 4.978   19.007  -6.550  1.00 31.07 ? 2220 HOH B O   1 
HETATM 7155 O  O   . HOH J 5 .   ? 15.412  21.985  14.573  1.00 25.45 ? 2221 HOH B O   1 
HETATM 7156 O  O   . HOH J 5 .   ? 30.196  22.189  12.187  1.00 16.81 ? 2222 HOH B O   1 
HETATM 7157 O  O   . HOH J 5 .   ? 22.066  23.082  13.896  1.00 17.13 ? 2223 HOH B O   1 
HETATM 7158 O  O   . HOH J 5 .   ? 23.480  23.095  10.835  1.00 15.62 ? 2224 HOH B O   1 
HETATM 7159 O  O   . HOH J 5 .   ? 33.825  23.187  13.897  1.00 35.11 ? 2225 HOH B O   1 
HETATM 7160 O  O   . HOH J 5 .   ? 22.508  21.493  -6.793  1.00 28.14 ? 2226 HOH B O   1 
HETATM 7161 O  O   . HOH J 5 .   ? 26.241  24.224  17.532  1.00 23.84 ? 2227 HOH B O   1 
HETATM 7162 O  O   . HOH J 5 .   ? -5.169  22.699  11.243  1.00 12.33 ? 2228 HOH B O   1 
HETATM 7163 O  O   . HOH J 5 .   ? 7.632   23.604  12.439  1.00 14.74 ? 2229 HOH B O   1 
HETATM 7164 O  O   . HOH J 5 .   ? 38.914  22.487  -6.082  1.00 21.96 ? 2230 HOH B O   1 
HETATM 7165 O  O   . HOH J 5 .   ? 7.021   24.553  14.897  1.00 18.69 ? 2231 HOH B O   1 
HETATM 7166 O  O   . HOH J 5 .   ? 16.816  24.273  13.380  1.00 27.47 ? 2232 HOH B O   1 
HETATM 7167 O  O   . HOH J 5 .   ? 4.439   23.743  2.760   1.00 41.95 ? 2233 HOH B O   1 
HETATM 7168 O  O   . HOH J 5 .   ? 9.972   24.683  12.121  1.00 36.88 ? 2234 HOH B O   1 
HETATM 7169 O  O   . HOH J 5 .   ? 12.479  23.595  1.156   1.00 19.63 ? 2235 HOH B O   1 
HETATM 7170 O  O   . HOH J 5 .   ? -1.601  24.348  4.346   1.00 28.37 ? 2236 HOH B O   1 
HETATM 7171 O  O   . HOH J 5 .   ? 2.613   24.340  5.496   1.00 21.63 ? 2237 HOH B O   1 
HETATM 7172 O  O   . HOH J 5 .   ? 11.372  25.694  9.924   1.00 25.36 ? 2238 HOH B O   1 
HETATM 7173 O  O   . HOH J 5 .   ? 15.924  25.777  11.224  1.00 23.69 ? 2239 HOH B O   1 
HETATM 7174 O  O   . HOH J 5 .   ? 6.557   22.390  -5.052  1.00 36.78 ? 2240 HOH B O   1 
HETATM 7175 O  O   . HOH J 5 .   ? -3.309  -21.074 27.660  1.00 55.12 ? 2241 HOH B O   1 
HETATM 7176 O  O   . HOH J 5 .   ? 3.391   26.232  7.318   1.00 19.61 ? 2242 HOH B O   1 
HETATM 7177 O  O   . HOH J 5 .   ? 4.926   26.742  14.588  1.00 18.52 ? 2243 HOH B O   1 
HETATM 7178 O  O   . HOH J 5 .   ? 39.309  27.950  7.143   1.00 31.07 ? 2244 HOH B O   1 
HETATM 7179 O  O   . HOH J 5 .   ? -2.649  27.294  14.728  1.00 23.21 ? 2245 HOH B O   1 
HETATM 7180 O  O   . HOH J 5 .   ? 17.833  27.149  9.784   1.00 20.75 ? 2246 HOH B O   1 
HETATM 7181 O  O   . HOH J 5 .   ? 21.750  25.950  -6.774  1.00 30.05 ? 2247 HOH B O   1 
HETATM 7182 O  O   . HOH J 5 .   ? 32.260  26.187  -5.546  1.00 34.54 ? 2248 HOH B O   1 
HETATM 7183 O  O   . HOH J 5 .   ? 14.281  26.903  -0.848  1.00 25.99 ? 2249 HOH B O   1 
HETATM 7184 O  O   . HOH J 5 .   ? 0.887   28.854  14.352  1.00 28.16 ? 2250 HOH B O   1 
HETATM 7185 O  O   . HOH J 5 .   ? 16.453  27.622  0.772   1.00 22.02 ? 2251 HOH B O   1 
HETATM 7186 O  O   . HOH J 5 .   ? 19.917  26.978  -5.258  1.00 23.70 ? 2252 HOH B O   1 
HETATM 7187 O  O   . HOH J 5 .   ? 24.118  27.211  -7.081  1.00 28.44 ? 2253 HOH B O   1 
HETATM 7188 O  O   . HOH J 5 .   ? 26.457  27.087  -5.679  1.00 26.68 ? 2254 HOH B O   1 
HETATM 7189 O  O   . HOH J 5 .   ? 30.573  28.185  -3.942  1.00 37.40 ? 2255 HOH B O   1 
HETATM 7190 O  O   . HOH J 5 .   ? 35.749  29.915  7.455   1.00 32.32 ? 2256 HOH B O   1 
HETATM 7191 O  O   . HOH J 5 .   ? -5.939  -21.220 31.932  1.00 41.03 ? 2257 HOH B O   1 
HETATM 7192 O  O   . HOH J 5 .   ? 27.183  29.058  -1.832  1.00 27.27 ? 2258 HOH B O   1 
HETATM 7193 O  O   . HOH J 5 .   ? 36.113  27.462  -7.652  1.00 44.32 ? 2259 HOH B O   1 
HETATM 7194 O  O   . HOH J 5 .   ? 18.734  30.856  2.203   1.00 32.25 ? 2260 HOH B O   1 
HETATM 7195 O  O   . HOH J 5 .   ? -2.853  -18.836 26.234  1.00 39.36 ? 2261 HOH B O   1 
HETATM 7196 O  O   . HOH J 5 .   ? 21.090  29.677  -5.140  1.00 26.63 ? 2262 HOH B O   1 
HETATM 7197 O  O   . HOH J 5 .   ? -2.819  -21.198 36.711  1.00 31.10 ? 2263 HOH B O   1 
HETATM 7198 O  O   . HOH J 5 .   ? 16.960  29.872  3.974   1.00 31.41 ? 2264 HOH B O   1 
HETATM 7199 O  O   . HOH J 5 .   ? 27.335  34.099  6.836   1.00 32.19 ? 2265 HOH B O   1 
HETATM 7200 O  O   . HOH J 5 .   ? 32.466  34.057  2.136   1.00 41.19 ? 2266 HOH B O   1 
HETATM 7201 O  O   . HOH J 5 .   ? 10.629  13.159  -8.079  1.00 38.20 ? 2267 HOH B O   1 
HETATM 7202 O  O   . HOH J 5 .   ? 44.772  19.085  18.268  1.00 17.84 ? 2268 HOH B O   1 
HETATM 7203 O  O   . HOH J 5 .   ? -3.387  18.704  -1.329  1.00 20.77 ? 2269 HOH B O   1 
HETATM 7204 O  O   . HOH J 5 .   ? 24.109  22.972  -10.611 1.00 32.55 ? 2270 HOH B O   1 
HETATM 7205 O  O   . HOH J 5 .   ? 35.608  -17.209 14.935  1.00 42.60 ? 2271 HOH B O   1 
HETATM 7206 O  O   . HOH J 5 .   ? 44.139  10.486  5.120   1.00 21.16 ? 2272 HOH B O   1 
HETATM 7207 O  O   . HOH J 5 .   ? 2.919   4.594   -10.335 1.00 22.87 ? 2273 HOH B O   1 
HETATM 7208 O  O   . HOH J 5 .   ? 31.771  17.844  -10.028 1.00 20.30 ? 2274 HOH B O   1 
HETATM 7209 O  O   . HOH J 5 .   ? 29.941  0.601   -8.237  1.00 23.57 ? 2275 HOH B O   1 
HETATM 7210 O  O   . HOH J 5 .   ? 14.861  7.475   -12.452 1.00 18.66 ? 2276 HOH B O   1 
HETATM 7211 O  O   . HOH J 5 .   ? 28.487  -18.044 22.353  1.00 22.82 ? 2277 HOH B O   1 
HETATM 7212 O  O   . HOH J 5 .   ? 3.946   -2.773  7.621   1.00 18.92 ? 2278 HOH B O   1 
HETATM 7213 O  O   . HOH J 5 .   ? 27.602  -12.031 24.702  1.00 20.63 ? 2279 HOH B O   1 
HETATM 7214 O  O   . HOH J 5 .   ? 7.654   -18.119 5.683   1.00 29.22 ? 2280 HOH B O   1 
HETATM 7215 O  O   . HOH J 5 .   ? 33.472  5.166   6.494   1.00 22.51 ? 2281 HOH B O   1 
HETATM 7216 O  O   . HOH J 5 .   ? 0.804   -2.081  -5.570  1.00 21.51 ? 2282 HOH B O   1 
HETATM 7217 O  O   . HOH J 5 .   ? 36.691  10.723  -7.772  1.00 24.48 ? 2283 HOH B O   1 
HETATM 7218 O  O   . HOH J 5 .   ? 23.948  10.060  -10.056 1.00 23.63 ? 2284 HOH B O   1 
HETATM 7219 O  O   . HOH J 5 .   ? 44.251  16.341  5.007   1.00 25.88 ? 2285 HOH B O   1 
HETATM 7220 O  O   . HOH J 5 .   ? 44.969  10.128  20.782  1.00 29.41 ? 2286 HOH B O   1 
HETATM 7221 O  O   . HOH J 5 .   ? 33.467  8.319   9.088   1.00 21.74 ? 2287 HOH B O   1 
HETATM 7222 O  O   . HOH J 5 .   ? 35.948  -11.855 11.572  1.00 25.52 ? 2288 HOH B O   1 
HETATM 7223 O  O   . HOH J 5 .   ? 30.830  -11.061 22.492  1.00 28.58 ? 2289 HOH B O   1 
HETATM 7224 O  O   . HOH J 5 .   ? 30.907  7.999   -13.006 1.00 47.00 ? 2290 HOH B O   1 
HETATM 7225 O  O   . HOH J 5 .   ? 27.292  -13.616 26.898  1.00 28.39 ? 2291 HOH B O   1 
HETATM 7226 O  O   . HOH J 5 .   ? 33.141  14.543  20.953  1.00 32.18 ? 2292 HOH B O   1 
HETATM 7227 O  O   . HOH J 5 .   ? 38.409  26.682  -8.922  1.00 25.81 ? 2293 HOH B O   1 
HETATM 7228 O  O   . HOH J 5 .   ? 9.804   -10.398 39.726  1.00 25.51 ? 2294 HOH B O   1 
HETATM 7229 O  O   . HOH J 5 .   ? 37.563  3.963   6.254   1.00 24.93 ? 2295 HOH B O   1 
HETATM 7230 O  O   . HOH J 5 .   ? 42.080  7.270   4.517   1.00 23.91 ? 2296 HOH B O   1 
HETATM 7231 O  O   . HOH J 5 .   ? 7.951   -0.753  -6.298  1.00 33.09 ? 2297 HOH B O   1 
HETATM 7232 O  O   . HOH J 5 .   ? 32.551  22.150  -11.632 1.00 27.20 ? 2298 HOH B O   1 
HETATM 7233 O  O   . HOH J 5 .   ? -0.526  -8.785  -0.339  1.00 31.59 ? 2299 HOH B O   1 
HETATM 7234 O  O   . HOH J 5 .   ? 25.886  -18.042 21.631  1.00 27.55 ? 2300 HOH B O   1 
HETATM 7235 O  O   . HOH J 5 .   ? 31.057  -8.537  15.819  1.00 27.44 ? 2301 HOH B O   1 
HETATM 7236 O  O   . HOH J 5 .   ? 34.479  6.697   10.873  1.00 27.13 ? 2302 HOH B O   1 
HETATM 7237 O  O   . HOH J 5 .   ? 19.946  5.412   -12.262 1.00 36.12 ? 2303 HOH B O   1 
HETATM 7238 O  O   . HOH J 5 .   ? 22.866  -17.169 24.312  1.00 31.28 ? 2304 HOH B O   1 
HETATM 7239 O  O   . HOH J 5 .   ? 15.812  16.835  22.184  1.00 31.17 ? 2305 HOH B O   1 
HETATM 7240 O  O   . HOH J 5 .   ? 16.000  29.093  8.792   1.00 30.12 ? 2306 HOH B O   1 
HETATM 7241 O  O   . HOH J 5 .   ? 0.617   5.074   -7.525  1.00 26.98 ? 2307 HOH B O   1 
HETATM 7242 O  O   . HOH J 5 .   ? 15.955  -20.808 18.238  1.00 32.33 ? 2308 HOH B O   1 
HETATM 7243 O  O   . HOH J 5 .   ? 36.380  3.164   3.820   1.00 31.40 ? 2309 HOH B O   1 
HETATM 7244 O  O   . HOH J 5 .   ? 18.846  -13.725 28.629  1.00 26.51 ? 2310 HOH B O   1 
HETATM 7245 O  O   . HOH J 5 .   ? 3.152   -6.613  -1.918  1.00 33.11 ? 2311 HOH B O   1 
HETATM 7246 O  O   . HOH J 5 .   ? 42.211  21.334  -14.279 1.00 38.49 ? 2312 HOH B O   1 
HETATM 7247 O  O   . HOH J 5 .   ? 34.582  21.117  -12.898 1.00 27.39 ? 2313 HOH B O   1 
HETATM 7248 O  O   . HOH J 5 .   ? 24.612  -3.475  -6.891  1.00 30.88 ? 2314 HOH B O   1 
HETATM 7249 O  O   . HOH J 5 .   ? 3.853   -14.651 3.797   1.00 30.46 ? 2315 HOH B O   1 
HETATM 7250 O  O   . HOH J 5 .   ? 9.093   25.664  16.189  1.00 26.91 ? 2316 HOH B O   1 
HETATM 7251 O  O   . HOH J 5 .   ? 43.142  13.971  5.294   1.00 28.54 ? 2317 HOH B O   1 
HETATM 7252 O  O   . HOH J 5 .   ? 28.581  22.680  -9.467  1.00 30.94 ? 2318 HOH B O   1 
HETATM 7253 O  O   . HOH J 5 .   ? 25.632  -19.593 16.765  1.00 27.37 ? 2319 HOH B O   1 
HETATM 7254 O  O   . HOH J 5 .   ? 28.534  -17.803 17.914  1.00 25.92 ? 2320 HOH B O   1 
HETATM 7255 O  O   . HOH J 5 .   ? -10.466 2.978   -5.576  1.00 36.37 ? 2321 HOH B O   1 
HETATM 7256 O  O   . HOH J 5 .   ? 9.903   -17.014 5.971   1.00 36.18 ? 2322 HOH B O   1 
HETATM 7257 O  O   . HOH J 5 .   ? -6.807  -13.545 26.838  1.00 22.86 ? 2323 HOH B O   1 
HETATM 7258 O  O   . HOH J 5 .   ? 24.452  5.406   -14.126 1.00 24.77 ? 2324 HOH B O   1 
HETATM 7259 O  O   . HOH J 5 .   ? 14.638  -4.942  39.192  1.00 35.36 ? 2325 HOH B O   1 
HETATM 7260 O  O   . HOH J 5 .   ? 28.635  -0.675  -12.719 1.00 32.38 ? 2326 HOH B O   1 
HETATM 7261 O  O   . HOH J 5 .   ? 18.033  -19.760 6.054   1.00 32.30 ? 2327 HOH B O   1 
HETATM 7262 O  O   . HOH J 5 .   ? 36.444  22.711  14.825  1.00 28.96 ? 2328 HOH B O   1 
HETATM 7263 O  O   . HOH J 5 .   ? 23.961  20.620  -8.840  1.00 35.09 ? 2329 HOH B O   1 
HETATM 7264 O  O   . HOH J 5 .   ? 27.544  15.299  -7.814  1.00 30.41 ? 2330 HOH B O   1 
HETATM 7265 O  O   . HOH J 5 .   ? 17.180  -4.922  -4.930  1.00 31.47 ? 2331 HOH B O   1 
HETATM 7266 O  O   . HOH J 5 .   ? 25.373  1.171   3.251   1.00 23.95 ? 2332 HOH B O   1 
HETATM 7267 O  O   . HOH J 5 .   ? -2.817  -9.861  26.409  1.00 31.11 ? 2333 HOH B O   1 
HETATM 7268 O  O   . HOH J 5 .   ? 40.177  20.070  13.544  1.00 34.30 ? 2334 HOH B O   1 
HETATM 7269 O  O   . HOH J 5 .   ? -6.997  -1.176  20.768  1.00 28.92 ? 2335 HOH B O   1 
HETATM 7270 O  O   . HOH J 5 .   ? 29.614  -3.285  5.994   1.00 29.66 ? 2336 HOH B O   1 
HETATM 7271 O  O   . HOH J 5 .   ? 29.192  9.363   18.852  1.00 33.71 ? 2337 HOH B O   1 
HETATM 7272 O  O   . HOH J 5 .   ? 2.915   -11.517 -1.506  1.00 39.08 ? 2338 HOH B O   1 
HETATM 7273 O  O   . HOH J 5 .   ? -7.756  -3.416  19.687  1.00 31.02 ? 2339 HOH B O   1 
HETATM 7274 O  O   . HOH J 5 .   ? 23.410  13.570  -8.158  1.00 32.02 ? 2340 HOH B O   1 
HETATM 7275 O  O   . HOH J 5 .   ? 43.979  27.545  -4.696  1.00 38.11 ? 2341 HOH B O   1 
HETATM 7276 O  O   . HOH J 5 .   ? 33.058  17.391  -14.126 1.00 35.11 ? 2342 HOH B O   1 
HETATM 7277 O  O   . HOH J 5 .   ? 20.893  19.369  -6.940  1.00 28.54 ? 2343 HOH B O   1 
HETATM 7278 O  O   . HOH J 5 .   ? 13.352  -9.571  -3.551  1.00 34.71 ? 2344 HOH B O   1 
HETATM 7279 O  O   . HOH J 5 .   ? 43.323  6.947   0.595   1.00 28.00 ? 2345 HOH B O   1 
HETATM 7280 O  O   . HOH J 5 .   ? -4.329  21.196  -0.280  1.00 34.54 ? 2346 HOH B O   1 
HETATM 7281 O  O   . HOH J 5 .   ? 28.961  -9.320  5.209   1.00 33.53 ? 2347 HOH B O   1 
HETATM 7282 O  O   . HOH J 5 .   ? 25.105  -8.773  32.441  1.00 30.97 ? 2348 HOH B O   1 
HETATM 7283 O  O   . HOH J 5 .   ? -4.891  -7.513  0.964   1.00 41.02 ? 2349 HOH B O   1 
HETATM 7284 O  O   . HOH J 5 .   ? 19.755  -16.843 5.823   1.00 29.55 ? 2350 HOH B O   1 
HETATM 7285 O  O   . HOH J 5 .   ? 46.123  26.562  -9.057  1.00 33.08 ? 2351 HOH B O   1 
HETATM 7286 O  O   . HOH J 5 .   ? 27.547  -11.407 4.822   1.00 36.19 ? 2352 HOH B O   1 
HETATM 7287 O  O   . HOH J 5 .   ? 18.186  -2.689  -7.655  1.00 31.52 ? 2353 HOH B O   1 
HETATM 7288 O  O   . HOH J 5 .   ? -9.282  -5.568  6.720   1.00 35.83 ? 2354 HOH B O   1 
HETATM 7289 O  O   . HOH J 5 .   ? 42.919  11.902  9.109   1.00 32.03 ? 2355 HOH B O   1 
HETATM 7290 O  O   . HOH J 5 .   ? 16.191  -17.302 20.231  1.00 33.86 ? 2356 HOH B O   1 
HETATM 7291 O  O   . HOH J 5 .   ? 25.646  -15.030 3.771   1.00 30.54 ? 2357 HOH B O   1 
HETATM 7292 O  O   . HOH J 5 .   ? 28.132  -2.340  -5.923  1.00 35.33 ? 2358 HOH B O   1 
HETATM 7293 O  O   . HOH J 5 .   ? 42.792  18.361  13.934  1.00 34.98 ? 2359 HOH B O   1 
HETATM 7294 O  O   . HOH J 5 .   ? 15.698  19.457  17.909  1.00 27.20 ? 2360 HOH B O   1 
HETATM 7295 O  O   . HOH J 5 .   ? 30.598  2.525   7.842   1.00 26.63 ? 2361 HOH B O   1 
HETATM 7296 O  O   . HOH J 5 .   ? 28.603  26.548  -7.540  1.00 35.86 ? 2362 HOH B O   1 
HETATM 7297 O  O   . HOH J 5 .   ? 33.975  16.866  -11.523 1.00 31.15 ? 2363 HOH B O   1 
HETATM 7298 O  O   . HOH J 5 .   ? 6.023   -0.573  -9.977  1.00 39.74 ? 2364 HOH B O   1 
HETATM 7299 O  O   . HOH J 5 .   ? 17.025  -6.597  37.167  1.00 41.65 ? 2365 HOH B O   1 
HETATM 7300 O  O   . HOH J 5 .   ? -1.399  22.181  -3.424  1.00 37.70 ? 2366 HOH B O   1 
HETATM 7301 O  O   . HOH J 5 .   ? 23.499  28.314  12.612  1.00 34.69 ? 2367 HOH B O   1 
HETATM 7302 O  O   . HOH J 5 .   ? 6.265   26.099  -3.152  1.00 35.31 ? 2368 HOH B O   1 
HETATM 7303 O  O   . HOH J 5 .   ? 43.423  19.599  11.079  1.00 33.27 ? 2369 HOH B O   1 
HETATM 7304 O  O   . HOH J 5 .   ? 24.110  -20.654 21.304  1.00 34.87 ? 2370 HOH B O   1 
HETATM 7305 O  O   . HOH J 5 .   ? 15.848  -3.106  -8.424  1.00 37.60 ? 2371 HOH B O   1 
HETATM 7306 O  O   . HOH J 5 .   ? 5.893   -8.151  17.280  1.00 35.24 ? 2372 HOH B O   1 
HETATM 7307 O  O   . HOH J 5 .   ? 29.614  16.082  -10.060 1.00 33.07 ? 2373 HOH B O   1 
HETATM 7308 O  O   . HOH J 5 .   ? 13.216  19.559  20.491  1.00 33.25 ? 2374 HOH B O   1 
HETATM 7309 O  O   . HOH J 5 .   ? 16.490  -9.334  38.298  1.00 41.62 ? 2375 HOH B O   1 
HETATM 7310 O  O   . HOH J 5 .   ? 15.131  -17.091 6.244   1.00 34.94 ? 2376 HOH B O   1 
HETATM 7311 O  O   . HOH J 5 .   ? 40.242  25.736  -11.865 1.00 32.96 ? 2377 HOH B O   1 
HETATM 7312 O  O   . HOH J 5 .   ? 5.739   -6.397  -1.797  1.00 29.43 ? 2378 HOH B O   1 
HETATM 7313 O  O   . HOH J 5 .   ? 3.141   2.726   -12.375 1.00 28.11 ? 2379 HOH B O   1 
HETATM 7314 O  O   . HOH J 5 .   ? 15.359  -13.202 33.061  1.00 36.70 ? 2380 HOH B O   1 
HETATM 7315 O  O   . HOH J 5 .   ? 42.701  14.034  1.617   1.00 32.27 ? 2381 HOH B O   1 
HETATM 7316 O  O   . HOH J 5 .   ? 35.678  12.518  19.881  1.00 34.86 ? 2382 HOH B O   1 
HETATM 7317 O  O   . HOH J 5 .   ? 23.585  17.786  20.802  1.00 46.60 ? 2383 HOH B O   1 
HETATM 7318 O  O   . HOH J 5 .   ? 2.593   8.567   -9.759  1.00 27.95 ? 2384 HOH B O   1 
HETATM 7319 O  O   . HOH J 5 .   ? 24.537  -13.532 30.606  1.00 37.18 ? 2385 HOH B O   1 
HETATM 7320 O  O   . HOH J 5 .   ? 41.948  27.964  -12.046 1.00 31.67 ? 2386 HOH B O   1 
HETATM 7321 O  O   . HOH J 5 .   ? 17.410  26.743  -6.253  1.00 27.44 ? 2387 HOH B O   1 
HETATM 7322 O  O   . HOH J 5 .   ? 40.905  25.352  10.552  1.00 45.96 ? 2388 HOH B O   1 
HETATM 7323 O  O   . HOH J 5 .   ? 47.925  27.658  9.756   1.00 39.25 ? 2389 HOH B O   1 
HETATM 7324 O  O   . HOH J 5 .   ? 35.956  26.349  -14.420 1.00 41.93 ? 2390 HOH B O   1 
HETATM 7325 O  O   . HOH J 5 .   ? 19.028  31.350  -4.378  1.00 38.16 ? 2391 HOH B O   1 
HETATM 7326 O  O   . HOH J 5 .   ? 26.282  -24.503 8.185   1.00 42.68 ? 2392 HOH B O   1 
HETATM 7327 O  O   . HOH J 5 .   ? 33.836  26.070  14.169  1.00 49.09 ? 2393 HOH B O   1 
HETATM 7328 O  O   . HOH J 5 .   ? 32.106  -11.111 7.650   1.00 36.27 ? 2394 HOH B O   1 
HETATM 7329 O  O   . HOH J 5 .   ? 35.267  6.299   17.791  1.00 41.32 ? 2395 HOH B O   1 
HETATM 7330 O  O   . HOH J 5 .   ? -11.787 -0.784  2.672   1.00 39.35 ? 2396 HOH B O   1 
HETATM 7331 O  O   . HOH J 5 .   ? 5.662   -15.926 2.359   1.00 40.18 ? 2397 HOH B O   1 
HETATM 7332 O  O   . HOH J 5 .   ? 12.189  22.569  -5.968  1.00 50.46 ? 2398 HOH B O   1 
HETATM 7333 O  O   . HOH J 5 .   ? 17.658  21.680  17.642  1.00 41.30 ? 2399 HOH B O   1 
HETATM 7334 O  O   . HOH J 5 .   ? 27.522  -9.127  31.120  1.00 52.88 ? 2400 HOH B O   1 
HETATM 7335 O  O   . HOH J 5 .   ? 13.252  -12.208 37.081  1.00 35.86 ? 2401 HOH B O   1 
HETATM 7336 O  O   . HOH J 5 .   ? 32.779  4.897   12.329  1.00 29.72 ? 2402 HOH B O   1 
HETATM 7337 O  O   . HOH J 5 .   ? -11.150 -0.743  -4.850  1.00 40.50 ? 2403 HOH B O   1 
HETATM 7338 O  O   . HOH J 5 .   ? 15.397  24.962  -5.369  1.00 34.43 ? 2404 HOH B O   1 
HETATM 7339 O  O   . HOH J 5 .   ? 18.555  -14.387 31.455  1.00 41.70 ? 2405 HOH B O   1 
HETATM 7340 O  O   . HOH J 5 .   ? 2.471   -1.432  -8.730  1.00 37.66 ? 2406 HOH B O   1 
HETATM 7341 O  O   . HOH J 5 .   ? 0.300   -8.850  16.271  1.00 46.67 ? 2407 HOH B O   1 
HETATM 7342 O  O   . HOH J 5 .   ? 20.544  23.986  16.068  1.00 45.00 ? 2408 HOH B O   1 
HETATM 7343 O  O   . HOH J 5 .   ? 27.786  -6.892  29.585  1.00 40.49 ? 2409 HOH B O   1 
HETATM 7344 O  O   . HOH J 5 .   ? 26.929  -9.093  3.205   1.00 47.57 ? 2410 HOH B O   1 
HETATM 7345 O  O   . HOH J 5 .   ? 9.928   20.149  21.990  1.00 30.02 ? 2411 HOH B O   1 
HETATM 7346 O  O   . HOH J 5 .   ? 43.632  14.194  -0.783  1.00 32.72 ? 2412 HOH B O   1 
HETATM 7347 O  O   . HOH J 5 .   ? 18.004  -21.667 16.765  1.00 49.41 ? 2413 HOH B O   1 
HETATM 7348 O  O   . HOH J 5 .   ? 25.628  14.123  -9.640  1.00 32.30 ? 2414 HOH B O   1 
HETATM 7349 O  O   . HOH J 5 .   ? 1.692   -13.364 1.794   1.00 33.32 ? 2415 HOH B O   1 
HETATM 7350 O  O   . HOH J 5 .   ? 3.469   11.115  -5.362  1.00 17.02 ? 2416 HOH B O   1 
HETATM 7351 O  O   . HOH J 5 .   ? 42.026  9.492   -0.240  1.00 27.16 ? 2417 HOH B O   1 
HETATM 7352 O  O   . HOH J 5 .   ? 17.262  -12.844 -2.261  1.00 34.54 ? 2418 HOH B O   1 
HETATM 7353 O  O   . HOH J 5 .   ? 1.699   -18.724 10.512  1.00 40.59 ? 2419 HOH B O   1 
HETATM 7354 O  O   . HOH J 5 .   ? 12.752  -6.520  40.165  1.00 29.35 ? 2420 HOH B O   1 
HETATM 7355 O  O   . HOH J 5 .   ? -3.074  -11.711 28.239  1.00 30.68 ? 2421 HOH B O   1 
HETATM 7356 O  O   . HOH J 5 .   ? 28.579  -21.524 6.242   1.00 39.24 ? 2422 HOH B O   1 
HETATM 7357 O  O   . HOH J 5 .   ? 11.145  22.331  21.797  1.00 35.18 ? 2423 HOH B O   1 
HETATM 7358 O  O   . HOH J 5 .   ? 31.361  0.446   19.097  1.00 37.91 ? 2424 HOH B O   1 
HETATM 7359 O  O   . HOH J 5 .   ? -3.557  8.669   -9.349  1.00 38.19 ? 2425 HOH B O   1 
HETATM 7360 O  O   . HOH J 5 .   ? 17.269  2.721   -10.627 1.00 31.73 ? 2426 HOH B O   1 
HETATM 7361 O  O   . HOH J 5 .   ? 13.907  -16.305 3.972   1.00 32.26 ? 2427 HOH B O   1 
HETATM 7362 O  O   . HOH J 5 .   ? -2.768  12.646  -8.133  1.00 31.98 ? 2428 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  TRP 78  78  78  TRP TRP A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLN 93  93  93  GLN GLN A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLN 110 110 110 GLN GLN A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 MET 115 115 115 MET MET A . n 
A 1 116 HIS 116 116 116 HIS HIS A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 HIS 133 133 133 HIS HIS A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 TRP 152 152 152 TRP TRP A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 HIS 154 154 154 HIS HIS A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 MET 180 180 180 MET MET A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 CYS 193 193 193 CYS CYS A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 MET 198 198 198 MET MET A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 GLU 214 214 214 GLU GLU A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 ILE 216 216 216 ILE ILE A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 MET 228 228 228 MET MET A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 TRP 234 234 234 TRP TRP A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 ARG 237 237 237 ARG ARG A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 GLN 240 240 240 GLN GLN A . n 
A 1 241 GLN 241 241 241 GLN GLN A . n 
A 1 242 TRP 242 242 242 TRP TRP A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 TYR 244 244 244 TYR TYR A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 GLY 248 248 248 GLY GLY A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 ILE 259 259 259 ILE ILE A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 PRO 261 261 261 PRO PRO A . n 
A 1 262 TRP 262 262 262 TRP TRP A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 MET 270 270 270 MET MET A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 PHE 272 272 272 PHE PHE A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 PRO 275 275 275 PRO PRO A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 TYR 286 286 286 TYR TYR A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 CYS 288 288 288 CYS CYS A . n 
A 1 289 HIS 289 289 289 HIS HIS A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 PRO 292 292 292 PRO PRO A . n 
A 1 293 TYR 293 293 293 TYR TYR A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ASP 296 296 296 ASP ASP A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 SER 300 300 300 SER SER A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 LYS 304 304 304 LYS LYS A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 GLN 310 310 310 GLN GLN A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 CYS 315 315 315 CYS CYS A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 ASN 318 318 318 ASN ASN A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 HIS 321 321 321 HIS HIS A . n 
A 1 322 MET 322 322 322 MET MET A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 TRP 324 324 324 TRP TRP A . n 
A 1 325 THR 325 325 325 THR THR A . n 
A 1 326 MET 326 326 326 MET MET A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 GLN 328 328 328 GLN GLN A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 THR 331 331 331 THR THR A . n 
A 1 332 HIS 332 332 332 HIS HIS A . n 
A 1 333 HIS 333 333 333 HIS HIS A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 ASN 336 336 336 ASN ASN A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 CYS 338 338 338 CYS CYS A . n 
A 1 339 ASN 339 339 339 ASN ASN A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 GLY 343 343 343 GLY GLY A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 LEU 345 345 345 LEU LEU A . n 
A 1 346 LEU 346 346 346 LEU LEU A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 GLY 349 349 349 GLY GLY A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 ASP 355 355 355 ASP ASP A . n 
A 1 356 PRO 356 356 356 PRO PRO A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 SER 358 358 358 SER SER A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 MET 362 362 362 MET MET A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 SER 366 366 366 SER SER A . n 
A 1 367 TRP 367 367 367 TRP TRP A . n 
A 1 368 LYS 368 368 368 LYS LYS A . n 
A 1 369 GLY 369 369 369 GLY GLY A . n 
A 1 370 THR 370 370 370 THR THR A . n 
A 1 371 LYS 371 371 371 LYS LYS A . n 
A 1 372 ALA 372 372 372 ALA ALA A . n 
A 1 373 ILE 373 373 373 ILE ILE A . n 
A 1 374 ASP 374 374 374 ASP ASP A . n 
A 1 375 VAL 375 375 375 VAL VAL A . n 
A 1 376 GLY 376 376 376 GLY GLY A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 GLY 378 378 378 GLY GLY A . n 
A 1 379 GLN 379 379 379 GLN GLN A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 LEU 384 384 384 LEU LEU A . n 
A 1 385 LEU 385 385 385 LEU LEU A . n 
A 1 386 ASP 386 386 386 ASP ASP A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 ASP 388 388 388 ASP ASP A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 ILE 391 391 391 ILE ILE A . n 
A 1 392 ILE 392 392 392 ILE ILE A . n 
A 1 393 THR 393 393 393 THR THR A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 HIS 395 395 395 HIS HIS A . n 
A 1 396 CYS 396 396 396 CYS CYS A . n 
A 1 397 GLN 397 397 397 GLN GLN A . n 
A 1 398 GLY 398 398 398 GLY GLY A . n 
A 1 399 ASP 399 399 399 ASP ASP A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TYR 401 401 401 TYR TYR A . n 
A 1 402 ARG 402 402 402 ARG ARG A . n 
A 1 403 VAL 403 403 403 VAL VAL A . n 
A 1 404 GLY 404 404 404 GLY GLY A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 CYS 408 408 408 CYS CYS A . n 
A 1 409 ALA 409 409 409 ALA ALA A . n 
A 1 410 GLY 410 410 410 GLY GLY A . n 
A 1 411 LYS 411 411 411 LYS LYS A . n 
A 1 412 VAL 412 412 412 VAL VAL A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 PRO 414 414 414 PRO PRO A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 LEU 416 416 416 LEU LEU A . n 
A 1 417 SER 417 417 ?   ?   ?   A . n 
A 1 418 PRO 418 418 ?   ?   ?   A . n 
A 1 419 ALA 419 419 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   PHE 3   3   3   PHE PHE B . n 
B 1 4   ILE 4   4   4   ILE ILE B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   GLU 8   8   8   GLU GLU B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  SER 10  10  10  SER SER B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  PHE 12  12  12  PHE PHE B . n 
B 1 13  PRO 13  13  13  PRO PRO B . n 
B 1 14  ILE 14  14  14  ILE ILE B . n 
B 1 15  GLN 15  15  15  GLN GLN B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  TYR 19  19  19  TYR TYR B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  PHE 22  22  22  PHE PHE B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  GLN 25  25  25  GLN GLN B . n 
B 1 26  SER 26  26  26  SER SER B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  PRO 30  30  30  PRO PRO B . n 
B 1 31  ARG 31  31  31  ARG ARG B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  VAL 34  34  34  VAL VAL B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ILE 36  36  36  ILE ILE B . n 
B 1 37  GLY 37  37  37  GLY GLY B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  GLN 39  39  39  GLN GLN B . n 
B 1 40  ILE 40  40  40  ILE ILE B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  VAL 45  45  45  VAL VAL B . n 
B 1 46  ILE 46  46  46  ILE ILE B . n 
B 1 47  LYS 47  47  47  LYS LYS B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  LEU 49  49  49  LEU LEU B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  SER 56  56  56  SER SER B . n 
B 1 57  LYS 57  57  57  LYS LYS B . n 
B 1 58  HIS 58  58  58  HIS HIS B . n 
B 1 59  GLN 59  59  59  GLN GLN B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  PHE 62  62  62  PHE PHE B . n 
B 1 63  ASP 63  63  63  ASP ASP B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  THR 65  65  65  THR THR B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  MET 71  71  71  MET MET B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  GLN 75  75  75  GLN GLN B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  ALA 77  77  77  ALA ALA B . n 
B 1 78  TRP 78  78  78  TRP TRP B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  SER 84  84  84  SER SER B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  GLN 86  86  86  GLN GLN B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  SER 92  92  92  SER SER B . n 
B 1 93  GLN 93  93  93  GLN GLN B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  ARG 97  97  97  ARG ARG B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ASP 99  99  99  ASP ASP B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 GLU 101 101 101 GLU GLU B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 PHE 107 107 107 PHE PHE B . n 
B 1 108 THR 108 108 108 THR THR B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 GLN 110 110 110 GLN GLN B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 SER 112 112 112 SER SER B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 MET 115 115 115 MET MET B . n 
B 1 116 HIS 116 116 116 HIS HIS B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 PRO 118 118 118 PRO PRO B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 THR 120 120 120 THR THR B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 THR 125 125 125 THR THR B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 PHE 127 127 127 PHE PHE B . n 
B 1 128 TYR 128 128 128 TYR TYR B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 SER 130 130 130 SER SER B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 GLN 132 132 132 GLN GLN B . n 
B 1 133 HIS 133 133 133 HIS HIS B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 ASN 136 136 136 ASN ASN B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 MET 140 140 140 MET MET B . n 
B 1 141 PHE 141 141 141 PHE PHE B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 LYS 144 144 144 LYS LYS B . n 
B 1 145 GLU 145 145 145 GLU GLU B . n 
B 1 146 ASN 146 146 146 ASN ASN B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 PRO 150 150 150 PRO PRO B . n 
B 1 151 ASN 151 151 151 ASN ASN B . n 
B 1 152 TRP 152 152 152 TRP TRP B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 HIS 154 154 154 HIS HIS B . n 
B 1 155 LEU 155 155 155 LEU LEU B . n 
B 1 156 PRO 156 156 156 PRO PRO B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 GLY 158 158 158 GLY GLY B . n 
B 1 159 TYR 159 159 159 TYR TYR B . n 
B 1 160 HIS 160 160 160 HIS HIS B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 ARG 162 162 162 ARG ARG B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 SER 165 165 165 SER SER B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 THR 171 171 171 THR THR B . n 
B 1 172 PRO 172 172 172 PRO PRO B . n 
B 1 173 ILE 173 173 173 ILE ILE B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 ARG 175 175 175 ARG ARG B . n 
B 1 176 PRO 176 176 176 PRO PRO B . n 
B 1 177 MET 177 177 177 MET MET B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 GLN 179 179 179 GLN GLN B . n 
B 1 180 MET 180 180 180 MET MET B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 SER 185 185 185 SER SER B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 VAL 189 189 189 VAL VAL B . n 
B 1 190 TYR 190 190 190 TYR TYR B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
B 1 193 CYS 193 193 193 CYS CYS B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 LEU 196 196 196 LEU LEU B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 MET 198 198 198 MET MET B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 GLU 201 201 201 GLU GLU B . n 
B 1 202 MET 202 202 202 MET MET B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 PHE 204 204 204 PHE PHE B . n 
B 1 205 PHE 205 205 205 PHE PHE B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 PRO 208 208 208 PRO PRO B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 ASN 210 210 210 ASN ASN B . n 
B 1 211 ARG 211 211 211 ARG ARG B . n 
B 1 212 PHE 212 212 212 PHE PHE B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 GLU 214 214 214 GLU GLU B . n 
B 1 215 PRO 215 215 215 PRO PRO B . n 
B 1 216 ILE 216 216 216 ILE ILE B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 LYS 220 220 220 LYS LYS B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 HIS 222 222 222 HIS HIS B . n 
B 1 223 GLU 223 223 223 GLU GLU B . n 
B 1 224 HIS 224 224 224 HIS HIS B . n 
B 1 225 ILE 225 225 225 ILE ILE B . n 
B 1 226 PHE 226 226 226 PHE PHE B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 MET 228 228 228 MET MET B . n 
B 1 229 VAL 229 229 229 VAL VAL B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 MET 231 231 231 MET MET B . n 
B 1 232 ASN 232 232 232 ASN ASN B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 TRP 234 234 234 TRP TRP B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 ALA 236 236 236 ALA ALA B . n 
B 1 237 ARG 237 237 237 ARG ARG B . n 
B 1 238 ASP 238 238 238 ASP ASP B . n 
B 1 239 ILE 239 239 239 ILE ILE B . n 
B 1 240 GLN 240 240 240 GLN GLN B . n 
B 1 241 GLN 241 241 241 GLN GLN B . n 
B 1 242 TRP 242 242 242 TRP TRP B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 TYR 244 244 244 TYR TYR B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 GLY 248 248 248 GLY GLY B . n 
B 1 249 PRO 249 249 249 PRO PRO B . n 
B 1 250 PHE 250 250 250 PHE PHE B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 SER 254 254 254 SER SER B . n 
B 1 255 PHE 255 255 255 PHE PHE B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 THR 257 257 257 THR THR B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 ILE 259 259 259 ILE ILE B . n 
B 1 260 SER 260 260 260 SER SER B . n 
B 1 261 PRO 261 261 261 PRO PRO B . n 
B 1 262 TRP 262 262 262 TRP TRP B . n 
B 1 263 VAL 263 263 263 VAL VAL B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 PRO 265 265 265 PRO PRO B . n 
B 1 266 MET 266 266 266 MET MET B . n 
B 1 267 ASP 267 267 267 ASP ASP B . n 
B 1 268 ALA 268 268 268 ALA ALA B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 MET 270 270 270 MET MET B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 PHE 272 272 272 PHE PHE B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 PRO 275 275 275 PRO PRO B . n 
B 1 276 ASN 276 276 276 ASN ASN B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 LYS 278 278 278 LYS LYS B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 PRO 281 281 281 PRO PRO B . n 
B 1 282 LYS 282 282 282 LYS LYS B . n 
B 1 283 PRO 283 283 283 PRO PRO B . n 
B 1 284 LEU 284 284 284 LEU LEU B . n 
B 1 285 PRO 285 285 285 PRO PRO B . n 
B 1 286 TYR 286 286 286 TYR TYR B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 CYS 288 288 288 CYS CYS B . n 
B 1 289 HIS 289 289 289 HIS HIS B . n 
B 1 290 SER 290 290 290 SER SER B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 PRO 292 292 292 PRO PRO B . n 
B 1 293 TYR 293 293 293 TYR TYR B . n 
B 1 294 THR 294 294 294 THR THR B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ASP 296 296 296 ASP ASP B . n 
B 1 297 ILE 297 297 297 ILE ILE B . n 
B 1 298 ASN 298 298 298 ASN ASN B . n 
B 1 299 LEU 299 299 299 LEU LEU B . n 
B 1 300 SER 300 300 300 SER SER B . n 
B 1 301 VAL 301 301 301 VAL VAL B . n 
B 1 302 SER 302 302 302 SER SER B . n 
B 1 303 LEU 303 303 303 LEU LEU B . n 
B 1 304 LYS 304 304 304 LYS LYS B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 GLY 307 307 307 GLY GLY B . n 
B 1 308 MET 308 308 308 MET MET B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 GLN 310 310 310 GLN GLN B . n 
B 1 311 ALA 311 311 311 ALA ALA B . n 
B 1 312 ALA 312 312 312 ALA ALA B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 ILE 314 314 314 ILE ILE B . n 
B 1 315 CYS 315 315 315 CYS CYS B . n 
B 1 316 ARG 316 316 316 ARG ARG B . n 
B 1 317 SER 317 317 317 SER SER B . n 
B 1 318 ASN 318 318 318 ASN ASN B . n 
B 1 319 PHE 319 319 319 PHE PHE B . n 
B 1 320 LYS 320 320 320 LYS LYS B . n 
B 1 321 HIS 321 321 321 HIS HIS B . n 
B 1 322 MET 322 322 322 MET MET B . n 
B 1 323 TYR 323 323 323 TYR TYR B . n 
B 1 324 TRP 324 324 324 TRP TRP B . n 
B 1 325 THR 325 325 325 THR THR B . n 
B 1 326 MET 326 326 326 MET MET B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 GLN 328 328 328 GLN GLN B . n 
B 1 329 GLN 329 329 329 GLN GLN B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 THR 331 331 331 THR THR B . n 
B 1 332 HIS 332 332 332 HIS HIS B . n 
B 1 333 HIS 333 333 333 HIS HIS B . n 
B 1 334 SER 334 334 334 SER SER B . n 
B 1 335 VAL 335 335 335 VAL VAL B . n 
B 1 336 ASN 336 336 336 ASN ASN B . n 
B 1 337 GLY 337 337 337 GLY GLY B . n 
B 1 338 CYS 338 338 338 CYS CYS B . n 
B 1 339 ASN 339 339 339 ASN ASN B . n 
B 1 340 LEU 340 340 340 LEU LEU B . n 
B 1 341 ARG 341 341 341 ARG ARG B . n 
B 1 342 PRO 342 342 342 PRO PRO B . n 
B 1 343 GLY 343 343 343 GLY GLY B . n 
B 1 344 ASP 344 344 344 ASP ASP B . n 
B 1 345 LEU 345 345 345 LEU LEU B . n 
B 1 346 LEU 346 346 346 LEU LEU B . n 
B 1 347 ALA 347 347 347 ALA ALA B . n 
B 1 348 SER 348 348 348 SER SER B . n 
B 1 349 GLY 349 349 349 GLY GLY B . n 
B 1 350 THR 350 350 350 THR THR B . n 
B 1 351 ILE 351 351 351 ILE ILE B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 GLY 353 353 353 GLY GLY B . n 
B 1 354 SER 354 354 354 SER SER B . n 
B 1 355 ASP 355 355 355 ASP ASP B . n 
B 1 356 PRO 356 356 356 PRO PRO B . n 
B 1 357 GLU 357 357 357 GLU GLU B . n 
B 1 358 SER 358 358 358 SER SER B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 GLY 360 360 360 GLY GLY B . n 
B 1 361 SER 361 361 361 SER SER B . n 
B 1 362 MET 362 362 362 MET MET B . n 
B 1 363 LEU 363 363 363 LEU LEU B . n 
B 1 364 GLU 364 364 364 GLU GLU B . n 
B 1 365 LEU 365 365 365 LEU LEU B . n 
B 1 366 SER 366 366 366 SER SER B . n 
B 1 367 TRP 367 367 367 TRP TRP B . n 
B 1 368 LYS 368 368 368 LYS LYS B . n 
B 1 369 GLY 369 369 369 GLY GLY B . n 
B 1 370 THR 370 370 370 THR THR B . n 
B 1 371 LYS 371 371 371 LYS LYS B . n 
B 1 372 ALA 372 372 372 ALA ALA B . n 
B 1 373 ILE 373 373 373 ILE ILE B . n 
B 1 374 ASP 374 374 374 ASP ASP B . n 
B 1 375 VAL 375 375 375 VAL VAL B . n 
B 1 376 GLY 376 376 376 GLY GLY B . n 
B 1 377 GLN 377 377 377 GLN GLN B . n 
B 1 378 GLY 378 378 378 GLY GLY B . n 
B 1 379 GLN 379 379 379 GLN GLN B . n 
B 1 380 THR 380 380 380 THR THR B . n 
B 1 381 ARG 381 381 381 ARG ARG B . n 
B 1 382 THR 382 382 382 THR THR B . n 
B 1 383 PHE 383 383 383 PHE PHE B . n 
B 1 384 LEU 384 384 384 LEU LEU B . n 
B 1 385 LEU 385 385 385 LEU LEU B . n 
B 1 386 ASP 386 386 386 ASP ASP B . n 
B 1 387 GLY 387 387 387 GLY GLY B . n 
B 1 388 ASP 388 388 388 ASP ASP B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 VAL 390 390 390 VAL VAL B . n 
B 1 391 ILE 391 391 391 ILE ILE B . n 
B 1 392 ILE 392 392 392 ILE ILE B . n 
B 1 393 THR 393 393 393 THR THR B . n 
B 1 394 GLY 394 394 394 GLY GLY B . n 
B 1 395 HIS 395 395 395 HIS HIS B . n 
B 1 396 CYS 396 396 396 CYS CYS B . n 
B 1 397 GLN 397 397 397 GLN GLN B . n 
B 1 398 GLY 398 398 398 GLY GLY B . n 
B 1 399 ASP 399 399 399 ASP ASP B . n 
B 1 400 GLY 400 400 400 GLY GLY B . n 
B 1 401 TYR 401 401 401 TYR TYR B . n 
B 1 402 ARG 402 402 402 ARG ARG B . n 
B 1 403 VAL 403 403 403 VAL VAL B . n 
B 1 404 GLY 404 404 404 GLY GLY B . n 
B 1 405 PHE 405 405 405 PHE PHE B . n 
B 1 406 GLY 406 406 406 GLY GLY B . n 
B 1 407 GLN 407 407 407 GLN GLN B . n 
B 1 408 CYS 408 408 408 CYS CYS B . n 
B 1 409 ALA 409 409 409 ALA ALA B . n 
B 1 410 GLY 410 410 410 GLY GLY B . n 
B 1 411 LYS 411 411 411 LYS LYS B . n 
B 1 412 VAL 412 412 412 VAL VAL B . n 
B 1 413 LEU 413 413 413 LEU LEU B . n 
B 1 414 PRO 414 414 414 PRO PRO B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 LEU 416 416 416 LEU LEU B . n 
B 1 417 SER 417 417 ?   ?   ?   B . n 
B 1 418 PRO 418 418 ?   ?   ?   B . n 
B 1 419 ALA 419 419 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7070  ? 
1 MORE         -57   ? 
1 'SSA (A^2)'  29970 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 199 ? A GLU 199  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OD2 ? A ASP 233 ? A ASP 233  ? 1_555 88.0  ? 
2  OE1 ? A GLU 199 ? A GLU 199  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 O   ? I HOH .   ? A HOH 2068 ? 1_555 94.6  ? 
3  OD2 ? A ASP 233 ? A ASP 233  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 O   ? I HOH .   ? A HOH 2068 ? 1_555 85.9  ? 
4  OE1 ? A GLU 199 ? A GLU 199  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OE2 ? A GLU 201 ? A GLU 201  ? 1_555 92.6  ? 
5  OD2 ? A ASP 233 ? A ASP 233  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OE2 ? A GLU 201 ? A GLU 201  ? 1_555 97.9  ? 
6  O   ? I HOH .   ? A HOH 2068 ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OE2 ? A GLU 201 ? A GLU 201  ? 1_555 172.0 ? 
7  OE1 ? A GLU 199 ? A GLU 199  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 O   ? I HOH .   ? A HOH 2072 ? 1_555 82.4  ? 
8  OD2 ? A ASP 233 ? A ASP 233  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 O   ? I HOH .   ? A HOH 2072 ? 1_555 163.3 ? 
9  O   ? I HOH .   ? A HOH 2068 ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 O   ? I HOH .   ? A HOH 2072 ? 1_555 81.3  ? 
10 OE2 ? A GLU 201 ? A GLU 201  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 O   ? I HOH .   ? A HOH 2072 ? 1_555 96.1  ? 
11 OE1 ? A GLU 199 ? A GLU 199  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OD2 ? A ASP 126 ? A ASP 126  ? 1_555 170.7 ? 
12 OD2 ? A ASP 233 ? A ASP 233  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OD2 ? A ASP 126 ? A ASP 126  ? 1_555 94.2  ? 
13 O   ? I HOH .   ? A HOH 2068 ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OD2 ? A ASP 126 ? A ASP 126  ? 1_555 76.5  ? 
14 OE2 ? A GLU 201 ? A GLU 201  ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OD2 ? A ASP 126 ? A ASP 126  ? 1_555 96.1  ? 
15 O   ? I HOH .   ? A HOH 2072 ? 1_555 CA ? C CA . ? A CA 420 ? 1_555 OD2 ? A ASP 126 ? A ASP 126  ? 1_555 93.2  ? 
16 O   ? J HOH .   ? B HOH 2090 ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OE1 ? B GLU 199 ? B GLU 199  ? 1_555 77.0  ? 
17 O   ? J HOH .   ? B HOH 2090 ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OE2 ? B GLU 201 ? B GLU 201  ? 1_555 91.1  ? 
18 OE1 ? B GLU 199 ? B GLU 199  ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OE2 ? B GLU 201 ? B GLU 201  ? 1_555 94.0  ? 
19 O   ? J HOH .   ? B HOH 2090 ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 233 ? B ASP 233  ? 1_555 161.8 ? 
20 OE1 ? B GLU 199 ? B GLU 199  ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 233 ? B ASP 233  ? 1_555 89.4  ? 
21 OE2 ? B GLU 201 ? B GLU 201  ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 233 ? B ASP 233  ? 1_555 101.9 ? 
22 O   ? J HOH .   ? B HOH 2090 ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 126 ? B ASP 126  ? 1_555 102.3 ? 
23 OE1 ? B GLU 199 ? B GLU 199  ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 126 ? B ASP 126  ? 1_555 168.3 ? 
24 OE2 ? B GLU 201 ? B GLU 201  ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 126 ? B ASP 126  ? 1_555 97.7  ? 
25 OD2 ? B ASP 233 ? B ASP 233  ? 1_555 CA ? F CA . ? B CA 420 ? 1_555 OD2 ? B ASP 126 ? B ASP 126  ? 1_555 88.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-06-07 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
REFMAC    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 126 ? ? CG A ASP 126 ? ? OD2 A ASP 126 ? ? 110.93 118.30 -7.37  0.90 N 
2 1 CG A GLU 199 ? ? CD A GLU 199 ? ? OE2 A GLU 199 ? ? 130.43 118.30 12.13  2.00 N 
3 1 CB A ASP 233 ? ? CG A ASP 233 ? ? OD1 A ASP 233 ? ? 124.26 118.30 5.96   0.90 N 
4 1 CB B ASP 126 ? ? CG B ASP 126 ? ? OD1 B ASP 126 ? ? 124.34 118.30 6.04   0.90 N 
5 1 CB B ASP 126 ? ? CG B ASP 126 ? ? OD2 B ASP 126 ? ? 108.97 118.30 -9.33  0.90 N 
6 1 CG B GLU 201 ? ? CD B GLU 201 ? ? OE2 B GLU 201 ? ? 104.51 118.30 -13.79 2.00 N 
7 1 CB B GLN 379 ? ? CG B GLN 379 ? ? CD  B GLN 379 ? ? 129.24 111.60 17.64  2.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 16  ? ? -98.59  -84.40 
2  1 LEU A 17  ? ? 64.75   62.84  
3  1 TYR A 128 ? ? -146.69 47.12  
4  1 LEU A 195 ? ? -117.90 73.50  
5  1 PHE A 250 ? ? -141.56 -96.71 
6  1 TYR A 293 ? ? -155.83 41.57  
7  1 THR A 382 ? ? -104.86 -64.66 
8  1 ASN B 16  ? ? -97.97  -82.01 
9  1 LEU B 17  ? ? 64.10   63.34  
10 1 TYR B 128 ? ? -148.12 45.11  
11 1 ASN B 146 ? ? -105.94 50.96  
12 1 PHE B 250 ? ? -141.45 -98.31 
13 1 TYR B 293 ? ? -157.20 42.14  
14 1 THR B 382 ? ? -106.24 -61.93 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 417 ? A SER 417 
2 1 Y 1 A PRO 418 ? A PRO 418 
3 1 Y 1 A ALA 419 ? A ALA 419 
4 1 Y 1 B SER 417 ? B SER 417 
5 1 Y 1 B PRO 418 ? B PRO 418 
6 1 Y 1 B ALA 419 ? B ALA 419 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'    CA  
3 'ACETATE ION'    ACT 
4 'CACODYLATE ION' CAC 
5 water            HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA  1   420  420  CA  CA  A . 
D 3 ACT 1   2001 2001 ACT ACT A . 
E 4 CAC 1   2004 2004 CAC CAC A . 
F 2 CA  1   420  420  CA  CA  B . 
G 3 ACT 1   2000 2000 ACT ACT B . 
H 4 CAC 1   2003 2003 CAC CAC B . 
I 5 HOH 1   2005 3    HOH HOH A . 
I 5 HOH 2   2006 16   HOH HOH A . 
I 5 HOH 3   2007 35   HOH HOH A . 
I 5 HOH 4   2008 37   HOH HOH A . 
I 5 HOH 5   2009 1045 HOH HOH A . 
I 5 HOH 6   2010 1051 HOH HOH A . 
I 5 HOH 7   2011 1054 HOH HOH A . 
I 5 HOH 8   2012 1056 HOH HOH A . 
I 5 HOH 9   2013 1058 HOH HOH A . 
I 5 HOH 10  2014 1066 HOH HOH A . 
I 5 HOH 11  2015 1074 HOH HOH A . 
I 5 HOH 12  2016 1077 HOH HOH A . 
I 5 HOH 13  2017 1078 HOH HOH A . 
I 5 HOH 14  2018 1080 HOH HOH A . 
I 5 HOH 15  2019 1085 HOH HOH A . 
I 5 HOH 16  2020 1087 HOH HOH A . 
I 5 HOH 17  2021 1090 HOH HOH A . 
I 5 HOH 18  2022 1091 HOH HOH A . 
I 5 HOH 19  2023 1095 HOH HOH A . 
I 5 HOH 20  2024 1096 HOH HOH A . 
I 5 HOH 21  2025 1097 HOH HOH A . 
I 5 HOH 22  2026 1098 HOH HOH A . 
I 5 HOH 23  2027 1099 HOH HOH A . 
I 5 HOH 24  2028 1101 HOH HOH A . 
I 5 HOH 25  2029 1106 HOH HOH A . 
I 5 HOH 26  2030 1108 HOH HOH A . 
I 5 HOH 27  2031 1111 HOH HOH A . 
I 5 HOH 28  2032 1113 HOH HOH A . 
I 5 HOH 29  2033 1114 HOH HOH A . 
I 5 HOH 30  2034 1117 HOH HOH A . 
I 5 HOH 31  2035 1120 HOH HOH A . 
I 5 HOH 32  2036 1124 HOH HOH A . 
I 5 HOH 33  2037 1125 HOH HOH A . 
I 5 HOH 34  2038 1128 HOH HOH A . 
I 5 HOH 35  2039 1137 HOH HOH A . 
I 5 HOH 36  2040 1138 HOH HOH A . 
I 5 HOH 37  2041 1141 HOH HOH A . 
I 5 HOH 38  2042 1142 HOH HOH A . 
I 5 HOH 39  2043 1143 HOH HOH A . 
I 5 HOH 40  2044 1144 HOH HOH A . 
I 5 HOH 41  2045 1146 HOH HOH A . 
I 5 HOH 42  2046 1147 HOH HOH A . 
I 5 HOH 43  2047 1148 HOH HOH A . 
I 5 HOH 44  2048 1151 HOH HOH A . 
I 5 HOH 45  2049 1152 HOH HOH A . 
I 5 HOH 46  2050 1155 HOH HOH A . 
I 5 HOH 47  2051 1158 HOH HOH A . 
I 5 HOH 48  2052 1161 HOH HOH A . 
I 5 HOH 49  2053 1166 HOH HOH A . 
I 5 HOH 50  2054 1175 HOH HOH A . 
I 5 HOH 51  2055 1176 HOH HOH A . 
I 5 HOH 52  2056 1181 HOH HOH A . 
I 5 HOH 53  2057 1182 HOH HOH A . 
I 5 HOH 54  2058 1187 HOH HOH A . 
I 5 HOH 55  2059 1188 HOH HOH A . 
I 5 HOH 56  2060 1189 HOH HOH A . 
I 5 HOH 57  2061 1193 HOH HOH A . 
I 5 HOH 58  2062 1196 HOH HOH A . 
I 5 HOH 59  2063 1198 HOH HOH A . 
I 5 HOH 60  2064 1199 HOH HOH A . 
I 5 HOH 61  2065 1200 HOH HOH A . 
I 5 HOH 62  2066 1201 HOH HOH A . 
I 5 HOH 63  2067 1210 HOH HOH A . 
I 5 HOH 64  2068 1212 HOH HOH A . 
I 5 HOH 65  2069 1214 HOH HOH A . 
I 5 HOH 66  2070 1216 HOH HOH A . 
I 5 HOH 67  2071 1217 HOH HOH A . 
I 5 HOH 68  2072 1218 HOH HOH A . 
I 5 HOH 69  2073 1219 HOH HOH A . 
I 5 HOH 70  2074 1220 HOH HOH A . 
I 5 HOH 71  2075 1223 HOH HOH A . 
I 5 HOH 72  2076 1228 HOH HOH A . 
I 5 HOH 73  2077 1232 HOH HOH A . 
I 5 HOH 74  2078 1233 HOH HOH A . 
I 5 HOH 75  2079 1238 HOH HOH A . 
I 5 HOH 76  2080 1240 HOH HOH A . 
I 5 HOH 77  2081 1241 HOH HOH A . 
I 5 HOH 78  2082 1242 HOH HOH A . 
I 5 HOH 79  2083 1247 HOH HOH A . 
I 5 HOH 80  2084 1249 HOH HOH A . 
I 5 HOH 81  2085 1251 HOH HOH A . 
I 5 HOH 82  2086 1252 HOH HOH A . 
I 5 HOH 83  2087 1253 HOH HOH A . 
I 5 HOH 84  2088 1254 HOH HOH A . 
I 5 HOH 85  2089 1255 HOH HOH A . 
I 5 HOH 86  2090 1259 HOH HOH A . 
I 5 HOH 87  2091 1260 HOH HOH A . 
I 5 HOH 88  2092 1261 HOH HOH A . 
I 5 HOH 89  2093 1267 HOH HOH A . 
I 5 HOH 90  2094 1269 HOH HOH A . 
I 5 HOH 91  2095 1270 HOH HOH A . 
I 5 HOH 92  2096 1271 HOH HOH A . 
I 5 HOH 93  2097 1272 HOH HOH A . 
I 5 HOH 94  2098 1275 HOH HOH A . 
I 5 HOH 95  2099 1277 HOH HOH A . 
I 5 HOH 96  2100 1278 HOH HOH A . 
I 5 HOH 97  2101 1279 HOH HOH A . 
I 5 HOH 98  2102 1280 HOH HOH A . 
I 5 HOH 99  2103 1281 HOH HOH A . 
I 5 HOH 100 2104 1283 HOH HOH A . 
I 5 HOH 101 2105 1284 HOH HOH A . 
I 5 HOH 102 2106 1287 HOH HOH A . 
I 5 HOH 103 2107 1288 HOH HOH A . 
I 5 HOH 104 2108 1289 HOH HOH A . 
I 5 HOH 105 2109 1290 HOH HOH A . 
I 5 HOH 106 2110 1293 HOH HOH A . 
I 5 HOH 107 2111 1295 HOH HOH A . 
I 5 HOH 108 2112 1297 HOH HOH A . 
I 5 HOH 109 2113 1302 HOH HOH A . 
I 5 HOH 110 2114 1303 HOH HOH A . 
I 5 HOH 111 2115 1304 HOH HOH A . 
I 5 HOH 112 2116 1305 HOH HOH A . 
I 5 HOH 113 2117 1309 HOH HOH A . 
I 5 HOH 114 2118 1310 HOH HOH A . 
I 5 HOH 115 2119 1319 HOH HOH A . 
I 5 HOH 116 2120 1328 HOH HOH A . 
I 5 HOH 117 2121 1330 HOH HOH A . 
I 5 HOH 118 2122 1332 HOH HOH A . 
I 5 HOH 119 2123 1333 HOH HOH A . 
I 5 HOH 120 2124 1334 HOH HOH A . 
I 5 HOH 121 2125 1337 HOH HOH A . 
I 5 HOH 122 2126 1340 HOH HOH A . 
I 5 HOH 123 2127 1342 HOH HOH A . 
I 5 HOH 124 2128 1347 HOH HOH A . 
I 5 HOH 125 2129 1348 HOH HOH A . 
I 5 HOH 126 2130 1349 HOH HOH A . 
I 5 HOH 127 2131 1353 HOH HOH A . 
I 5 HOH 128 2132 1354 HOH HOH A . 
I 5 HOH 129 2133 1355 HOH HOH A . 
I 5 HOH 130 2134 1357 HOH HOH A . 
I 5 HOH 131 2135 1359 HOH HOH A . 
I 5 HOH 132 2136 1360 HOH HOH A . 
I 5 HOH 133 2137 1362 HOH HOH A . 
I 5 HOH 134 2138 1363 HOH HOH A . 
I 5 HOH 135 2139 1365 HOH HOH A . 
I 5 HOH 136 2140 1367 HOH HOH A . 
I 5 HOH 137 2141 1368 HOH HOH A . 
I 5 HOH 138 2142 1370 HOH HOH A . 
I 5 HOH 139 2143 1372 HOH HOH A . 
I 5 HOH 140 2144 1373 HOH HOH A . 
I 5 HOH 141 2145 1374 HOH HOH A . 
I 5 HOH 142 2146 1378 HOH HOH A . 
I 5 HOH 143 2147 1379 HOH HOH A . 
I 5 HOH 144 2148 1382 HOH HOH A . 
I 5 HOH 145 2149 1383 HOH HOH A . 
I 5 HOH 146 2150 1386 HOH HOH A . 
I 5 HOH 147 2151 1387 HOH HOH A . 
I 5 HOH 148 2152 1389 HOH HOH A . 
I 5 HOH 149 2153 1390 HOH HOH A . 
I 5 HOH 150 2154 1391 HOH HOH A . 
I 5 HOH 151 2155 1392 HOH HOH A . 
I 5 HOH 152 2156 1396 HOH HOH A . 
I 5 HOH 153 2157 1397 HOH HOH A . 
I 5 HOH 154 2158 1398 HOH HOH A . 
I 5 HOH 155 2159 1401 HOH HOH A . 
I 5 HOH 156 2160 1402 HOH HOH A . 
I 5 HOH 157 2161 1403 HOH HOH A . 
I 5 HOH 158 2162 1406 HOH HOH A . 
I 5 HOH 159 2163 1409 HOH HOH A . 
I 5 HOH 160 2164 1410 HOH HOH A . 
I 5 HOH 161 2165 1412 HOH HOH A . 
I 5 HOH 162 2166 1413 HOH HOH A . 
I 5 HOH 163 2167 1414 HOH HOH A . 
I 5 HOH 164 2168 1416 HOH HOH A . 
I 5 HOH 165 2169 1421 HOH HOH A . 
I 5 HOH 166 2170 1422 HOH HOH A . 
I 5 HOH 167 2171 1423 HOH HOH A . 
I 5 HOH 168 2172 1424 HOH HOH A . 
I 5 HOH 169 2173 1425 HOH HOH A . 
I 5 HOH 170 2174 1428 HOH HOH A . 
I 5 HOH 171 2175 1429 HOH HOH A . 
I 5 HOH 172 2176 1430 HOH HOH A . 
I 5 HOH 173 2177 1434 HOH HOH A . 
I 5 HOH 174 2178 1435 HOH HOH A . 
I 5 HOH 175 2179 1436 HOH HOH A . 
I 5 HOH 176 2180 1437 HOH HOH A . 
I 5 HOH 177 2181 1439 HOH HOH A . 
I 5 HOH 178 2182 1440 HOH HOH A . 
I 5 HOH 179 2183 1442 HOH HOH A . 
I 5 HOH 180 2184 1443 HOH HOH A . 
I 5 HOH 181 2185 1447 HOH HOH A . 
I 5 HOH 182 2186 1448 HOH HOH A . 
I 5 HOH 183 2187 1449 HOH HOH A . 
I 5 HOH 184 2188 1450 HOH HOH A . 
I 5 HOH 185 2189 1451 HOH HOH A . 
I 5 HOH 186 2190 1452 HOH HOH A . 
I 5 HOH 187 2191 1453 HOH HOH A . 
I 5 HOH 188 2192 1454 HOH HOH A . 
I 5 HOH 189 2193 1457 HOH HOH A . 
I 5 HOH 190 2194 1458 HOH HOH A . 
I 5 HOH 191 2195 1459 HOH HOH A . 
I 5 HOH 192 2196 1460 HOH HOH A . 
I 5 HOH 193 2197 1461 HOH HOH A . 
I 5 HOH 194 2198 1462 HOH HOH A . 
I 5 HOH 195 2199 1463 HOH HOH A . 
I 5 HOH 196 2200 1464 HOH HOH A . 
I 5 HOH 197 2201 1465 HOH HOH A . 
I 5 HOH 198 2202 1466 HOH HOH A . 
I 5 HOH 199 2203 1467 HOH HOH A . 
I 5 HOH 200 2204 1469 HOH HOH A . 
I 5 HOH 201 2205 1470 HOH HOH A . 
I 5 HOH 202 2206 1471 HOH HOH A . 
I 5 HOH 203 2207 1472 HOH HOH A . 
I 5 HOH 204 2208 1473 HOH HOH A . 
I 5 HOH 205 2209 1474 HOH HOH A . 
I 5 HOH 206 2210 1475 HOH HOH A . 
I 5 HOH 207 2211 1476 HOH HOH A . 
I 5 HOH 208 2212 1478 HOH HOH A . 
I 5 HOH 209 2213 1479 HOH HOH A . 
I 5 HOH 210 2214 1480 HOH HOH A . 
I 5 HOH 211 2215 1481 HOH HOH A . 
I 5 HOH 212 2216 1482 HOH HOH A . 
I 5 HOH 213 2217 1483 HOH HOH A . 
I 5 HOH 214 2218 1484 HOH HOH A . 
I 5 HOH 215 2219 1485 HOH HOH A . 
I 5 HOH 216 2220 1486 HOH HOH A . 
I 5 HOH 217 2221 1487 HOH HOH A . 
I 5 HOH 218 2222 1488 HOH HOH A . 
I 5 HOH 219 2223 1489 HOH HOH A . 
I 5 HOH 220 2224 1491 HOH HOH A . 
I 5 HOH 221 2225 1492 HOH HOH A . 
I 5 HOH 222 2226 1493 HOH HOH A . 
I 5 HOH 223 2227 1494 HOH HOH A . 
I 5 HOH 224 2228 1495 HOH HOH A . 
I 5 HOH 225 2229 1496 HOH HOH A . 
I 5 HOH 226 2230 1497 HOH HOH A . 
I 5 HOH 227 2231 1498 HOH HOH A . 
I 5 HOH 228 2232 1499 HOH HOH A . 
I 5 HOH 229 2233 1500 HOH HOH A . 
I 5 HOH 230 2234 1501 HOH HOH A . 
I 5 HOH 231 2235 1502 HOH HOH A . 
I 5 HOH 232 2236 1503 HOH HOH A . 
I 5 HOH 233 2237 1505 HOH HOH A . 
I 5 HOH 234 2238 1506 HOH HOH A . 
I 5 HOH 235 2239 1507 HOH HOH A . 
I 5 HOH 236 2240 1508 HOH HOH A . 
I 5 HOH 237 2241 1509 HOH HOH A . 
I 5 HOH 238 2242 1510 HOH HOH A . 
I 5 HOH 239 2243 1511 HOH HOH A . 
I 5 HOH 240 2244 1512 HOH HOH A . 
I 5 HOH 241 2245 1514 HOH HOH A . 
I 5 HOH 242 2246 1515 HOH HOH A . 
I 5 HOH 243 2247 1516 HOH HOH A . 
I 5 HOH 244 2248 1517 HOH HOH A . 
I 5 HOH 245 2249 1518 HOH HOH A . 
I 5 HOH 246 2250 1519 HOH HOH A . 
I 5 HOH 247 2251 1520 HOH HOH A . 
I 5 HOH 248 2252 1521 HOH HOH A . 
I 5 HOH 249 2253 1522 HOH HOH A . 
I 5 HOH 250 2254 1523 HOH HOH A . 
I 5 HOH 251 2255 1524 HOH HOH A . 
I 5 HOH 252 2256 1525 HOH HOH A . 
I 5 HOH 253 2257 1526 HOH HOH A . 
I 5 HOH 254 2258 1527 HOH HOH A . 
I 5 HOH 255 2259 1531 HOH HOH A . 
I 5 HOH 256 2260 1533 HOH HOH A . 
I 5 HOH 257 2261 1535 HOH HOH A . 
I 5 HOH 258 2262 1536 HOH HOH A . 
I 5 HOH 259 2263 1537 HOH HOH A . 
I 5 HOH 260 2264 1538 HOH HOH A . 
I 5 HOH 261 2265 1539 HOH HOH A . 
I 5 HOH 262 2266 1542 HOH HOH A . 
I 5 HOH 263 2267 1543 HOH HOH A . 
I 5 HOH 264 2268 1545 HOH HOH A . 
I 5 HOH 265 2269 1546 HOH HOH A . 
I 5 HOH 266 2270 1551 HOH HOH A . 
I 5 HOH 267 2271 1554 HOH HOH A . 
I 5 HOH 268 2272 1555 HOH HOH A . 
I 5 HOH 269 2273 1556 HOH HOH A . 
I 5 HOH 270 2274 1557 HOH HOH A . 
I 5 HOH 271 2275 1558 HOH HOH A . 
I 5 HOH 272 2276 1559 HOH HOH A . 
I 5 HOH 273 2277 1561 HOH HOH A . 
I 5 HOH 274 2278 1562 HOH HOH A . 
I 5 HOH 275 2279 1563 HOH HOH A . 
I 5 HOH 276 2280 1564 HOH HOH A . 
I 5 HOH 277 2281 1568 HOH HOH A . 
I 5 HOH 278 2282 1569 HOH HOH A . 
I 5 HOH 279 2283 1570 HOH HOH A . 
I 5 HOH 280 2284 1572 HOH HOH A . 
I 5 HOH 281 2285 1574 HOH HOH A . 
I 5 HOH 282 2286 1576 HOH HOH A . 
I 5 HOH 283 2287 1577 HOH HOH A . 
I 5 HOH 284 2288 1578 HOH HOH A . 
I 5 HOH 285 2289 1580 HOH HOH A . 
I 5 HOH 286 2290 1581 HOH HOH A . 
I 5 HOH 287 2291 1587 HOH HOH A . 
I 5 HOH 288 2292 1588 HOH HOH A . 
I 5 HOH 289 2293 1589 HOH HOH A . 
I 5 HOH 290 2294 1591 HOH HOH A . 
I 5 HOH 291 2295 1593 HOH HOH A . 
I 5 HOH 292 2296 1594 HOH HOH A . 
I 5 HOH 293 2297 1595 HOH HOH A . 
I 5 HOH 294 2298 1596 HOH HOH A . 
I 5 HOH 295 2299 1598 HOH HOH A . 
I 5 HOH 296 2300 1600 HOH HOH A . 
I 5 HOH 297 2301 1602 HOH HOH A . 
I 5 HOH 298 2302 1603 HOH HOH A . 
I 5 HOH 299 2303 1606 HOH HOH A . 
I 5 HOH 300 2304 1608 HOH HOH A . 
I 5 HOH 301 2305 1609 HOH HOH A . 
I 5 HOH 302 2306 1610 HOH HOH A . 
I 5 HOH 303 2307 1613 HOH HOH A . 
I 5 HOH 304 2308 1614 HOH HOH A . 
I 5 HOH 305 2309 1615 HOH HOH A . 
I 5 HOH 306 2310 1616 HOH HOH A . 
I 5 HOH 307 2311 1617 HOH HOH A . 
I 5 HOH 308 2312 1618 HOH HOH A . 
I 5 HOH 309 2313 1619 HOH HOH A . 
I 5 HOH 310 2314 1620 HOH HOH A . 
I 5 HOH 311 2315 1622 HOH HOH A . 
I 5 HOH 312 2316 1625 HOH HOH A . 
I 5 HOH 313 2317 1627 HOH HOH A . 
I 5 HOH 314 2318 1630 HOH HOH A . 
I 5 HOH 315 2319 1632 HOH HOH A . 
I 5 HOH 316 2320 1633 HOH HOH A . 
I 5 HOH 317 2321 1636 HOH HOH A . 
I 5 HOH 318 2322 1637 HOH HOH A . 
I 5 HOH 319 2323 1642 HOH HOH A . 
I 5 HOH 320 2324 1644 HOH HOH A . 
I 5 HOH 321 2325 1646 HOH HOH A . 
I 5 HOH 322 2326 1647 HOH HOH A . 
I 5 HOH 323 2327 1648 HOH HOH A . 
I 5 HOH 324 2328 1651 HOH HOH A . 
I 5 HOH 325 2329 1652 HOH HOH A . 
I 5 HOH 326 2330 1653 HOH HOH A . 
I 5 HOH 327 2331 1655 HOH HOH A . 
I 5 HOH 328 2332 1656 HOH HOH A . 
I 5 HOH 329 2333 1658 HOH HOH A . 
I 5 HOH 330 2334 1660 HOH HOH A . 
I 5 HOH 331 2335 1662 HOH HOH A . 
I 5 HOH 332 2336 1663 HOH HOH A . 
I 5 HOH 333 2337 1665 HOH HOH A . 
I 5 HOH 334 2338 1666 HOH HOH A . 
I 5 HOH 335 2339 1669 HOH HOH A . 
I 5 HOH 336 2340 1675 HOH HOH A . 
I 5 HOH 337 2341 1676 HOH HOH A . 
I 5 HOH 338 2342 1677 HOH HOH A . 
I 5 HOH 339 2343 1679 HOH HOH A . 
I 5 HOH 340 2344 1680 HOH HOH A . 
I 5 HOH 341 2345 1687 HOH HOH A . 
I 5 HOH 342 2346 1691 HOH HOH A . 
I 5 HOH 343 2347 1693 HOH HOH A . 
I 5 HOH 344 2348 1694 HOH HOH A . 
I 5 HOH 345 2349 1695 HOH HOH A . 
I 5 HOH 346 2350 1697 HOH HOH A . 
I 5 HOH 347 2351 1698 HOH HOH A . 
I 5 HOH 348 2352 1701 HOH HOH A . 
I 5 HOH 349 2353 1704 HOH HOH A . 
I 5 HOH 350 2354 1706 HOH HOH A . 
I 5 HOH 351 2355 1709 HOH HOH A . 
I 5 HOH 352 2356 1711 HOH HOH A . 
I 5 HOH 353 2357 1713 HOH HOH A . 
I 5 HOH 354 2358 1714 HOH HOH A . 
I 5 HOH 355 2359 1716 HOH HOH A . 
I 5 HOH 356 2360 1717 HOH HOH A . 
I 5 HOH 357 2361 1719 HOH HOH A . 
I 5 HOH 358 2362 1722 HOH HOH A . 
I 5 HOH 359 2363 1725 HOH HOH A . 
I 5 HOH 360 2364 1727 HOH HOH A . 
I 5 HOH 361 2365 1728 HOH HOH A . 
I 5 HOH 362 2366 1729 HOH HOH A . 
I 5 HOH 363 2367 1733 HOH HOH A . 
I 5 HOH 364 2368 1734 HOH HOH A . 
I 5 HOH 365 2369 1738 HOH HOH A . 
I 5 HOH 366 2370 1741 HOH HOH A . 
I 5 HOH 367 2371 1743 HOH HOH A . 
I 5 HOH 368 2372 1744 HOH HOH A . 
I 5 HOH 369 2373 1745 HOH HOH A . 
I 5 HOH 370 2374 1746 HOH HOH A . 
I 5 HOH 371 2375 1748 HOH HOH A . 
I 5 HOH 372 2376 1751 HOH HOH A . 
I 5 HOH 373 2377 1757 HOH HOH A . 
I 5 HOH 374 2378 1758 HOH HOH A . 
I 5 HOH 375 2379 1761 HOH HOH A . 
I 5 HOH 376 2380 1762 HOH HOH A . 
I 5 HOH 377 2381 1763 HOH HOH A . 
I 5 HOH 378 2382 1764 HOH HOH A . 
I 5 HOH 379 2383 1766 HOH HOH A . 
I 5 HOH 380 2384 1772 HOH HOH A . 
I 5 HOH 381 2385 1773 HOH HOH A . 
I 5 HOH 382 2386 1775 HOH HOH A . 
I 5 HOH 383 2387 1776 HOH HOH A . 
I 5 HOH 384 2388 1779 HOH HOH A . 
I 5 HOH 385 2389 1780 HOH HOH A . 
I 5 HOH 386 2390 1781 HOH HOH A . 
I 5 HOH 387 2391 1784 HOH HOH A . 
I 5 HOH 388 2392 1789 HOH HOH A . 
I 5 HOH 389 2393 1790 HOH HOH A . 
I 5 HOH 390 2394 1791 HOH HOH A . 
I 5 HOH 391 2395 1792 HOH HOH A . 
I 5 HOH 392 2396 1797 HOH HOH A . 
I 5 HOH 393 2397 1798 HOH HOH A . 
I 5 HOH 394 2398 1801 HOH HOH A . 
I 5 HOH 395 2399 1802 HOH HOH A . 
I 5 HOH 396 2400 1805 HOH HOH A . 
I 5 HOH 397 2401 1806 HOH HOH A . 
I 5 HOH 398 2402 1808 HOH HOH A . 
I 5 HOH 399 2403 1810 HOH HOH A . 
I 5 HOH 400 2404 1811 HOH HOH A . 
I 5 HOH 401 2405 1814 HOH HOH A . 
I 5 HOH 402 2406 1815 HOH HOH A . 
I 5 HOH 403 2407 1816 HOH HOH A . 
I 5 HOH 404 2408 1819 HOH HOH A . 
I 5 HOH 405 2409 1822 HOH HOH A . 
I 5 HOH 406 2410 1825 HOH HOH A . 
I 5 HOH 407 2411 1826 HOH HOH A . 
I 5 HOH 408 2412 1827 HOH HOH A . 
I 5 HOH 409 2413 1829 HOH HOH A . 
I 5 HOH 410 2414 1830 HOH HOH A . 
I 5 HOH 411 2415 1831 HOH HOH A . 
I 5 HOH 412 2416 1832 HOH HOH A . 
I 5 HOH 413 2417 1833 HOH HOH A . 
I 5 HOH 414 2418 1836 HOH HOH A . 
I 5 HOH 415 2419 1839 HOH HOH A . 
I 5 HOH 416 2420 1840 HOH HOH A . 
I 5 HOH 417 2421 1841 HOH HOH A . 
I 5 HOH 418 2422 1842 HOH HOH A . 
I 5 HOH 419 2423 1843 HOH HOH A . 
I 5 HOH 420 2424 1844 HOH HOH A . 
I 5 HOH 421 2425 1847 HOH HOH A . 
I 5 HOH 422 2426 1848 HOH HOH A . 
I 5 HOH 423 2427 1852 HOH HOH A . 
I 5 HOH 424 2428 1853 HOH HOH A . 
I 5 HOH 425 2429 1859 HOH HOH A . 
I 5 HOH 426 2430 1861 HOH HOH A . 
I 5 HOH 427 2431 1863 HOH HOH A . 
I 5 HOH 428 2432 1864 HOH HOH A . 
I 5 HOH 429 2433 1865 HOH HOH A . 
I 5 HOH 430 2434 1866 HOH HOH A . 
I 5 HOH 431 2435 1867 HOH HOH A . 
I 5 HOH 432 2436 1868 HOH HOH A . 
I 5 HOH 433 2437 1869 HOH HOH A . 
I 5 HOH 434 2438 1871 HOH HOH A . 
I 5 HOH 435 2439 1873 HOH HOH A . 
I 5 HOH 436 2440 1874 HOH HOH A . 
I 5 HOH 437 2441 1876 HOH HOH A . 
I 5 HOH 438 2442 1877 HOH HOH A . 
I 5 HOH 439 2443 1878 HOH HOH A . 
I 5 HOH 440 2444 1881 HOH HOH A . 
I 5 HOH 441 2445 1882 HOH HOH A . 
I 5 HOH 442 2446 1883 HOH HOH A . 
I 5 HOH 443 2447 1884 HOH HOH A . 
I 5 HOH 444 2448 1885 HOH HOH A . 
I 5 HOH 445 2449 1887 HOH HOH A . 
I 5 HOH 446 2450 1889 HOH HOH A . 
I 5 HOH 447 2451 1891 HOH HOH A . 
I 5 HOH 448 2452 1892 HOH HOH A . 
I 5 HOH 449 2453 1893 HOH HOH A . 
I 5 HOH 450 2454 1894 HOH HOH A . 
I 5 HOH 451 2455 1897 HOH HOH A . 
I 5 HOH 452 2456 1898 HOH HOH A . 
I 5 HOH 453 2457 1900 HOH HOH A . 
I 5 HOH 454 2458 1901 HOH HOH A . 
I 5 HOH 455 2459 1001 HOH HOH A . 
I 5 HOH 456 2460 1003 HOH HOH A . 
I 5 HOH 457 2461 1004 HOH HOH A . 
I 5 HOH 458 2462 1011 HOH HOH A . 
I 5 HOH 459 2463 1012 HOH HOH A . 
I 5 HOH 460 2464 1013 HOH HOH A . 
I 5 HOH 461 2465 1017 HOH HOH A . 
I 5 HOH 462 2466 1020 HOH HOH A . 
I 5 HOH 463 2467 1021 HOH HOH A . 
I 5 HOH 464 2468 1022 HOH HOH A . 
I 5 HOH 465 2469 1023 HOH HOH A . 
I 5 HOH 466 2470 1026 HOH HOH A . 
I 5 HOH 467 2471 1027 HOH HOH A . 
I 5 HOH 468 2472 1028 HOH HOH A . 
I 5 HOH 469 2473 1030 HOH HOH A . 
J 5 HOH 1   2004 1    HOH HOH B . 
J 5 HOH 2   2005 2    HOH HOH B . 
J 5 HOH 3   2006 4    HOH HOH B . 
J 5 HOH 4   2007 5    HOH HOH B . 
J 5 HOH 5   2008 6    HOH HOH B . 
J 5 HOH 6   2009 7    HOH HOH B . 
J 5 HOH 7   2010 8    HOH HOH B . 
J 5 HOH 8   2011 9    HOH HOH B . 
J 5 HOH 9   2012 10   HOH HOH B . 
J 5 HOH 10  2013 11   HOH HOH B . 
J 5 HOH 11  2014 12   HOH HOH B . 
J 5 HOH 12  2015 13   HOH HOH B . 
J 5 HOH 13  2016 14   HOH HOH B . 
J 5 HOH 14  2017 15   HOH HOH B . 
J 5 HOH 15  2018 17   HOH HOH B . 
J 5 HOH 16  2019 18   HOH HOH B . 
J 5 HOH 17  2020 19   HOH HOH B . 
J 5 HOH 18  2021 20   HOH HOH B . 
J 5 HOH 19  2022 21   HOH HOH B . 
J 5 HOH 20  2023 22   HOH HOH B . 
J 5 HOH 21  2024 23   HOH HOH B . 
J 5 HOH 22  2025 24   HOH HOH B . 
J 5 HOH 23  2026 25   HOH HOH B . 
J 5 HOH 24  2027 26   HOH HOH B . 
J 5 HOH 25  2028 27   HOH HOH B . 
J 5 HOH 26  2029 28   HOH HOH B . 
J 5 HOH 27  2030 29   HOH HOH B . 
J 5 HOH 28  2031 30   HOH HOH B . 
J 5 HOH 29  2032 31   HOH HOH B . 
J 5 HOH 30  2033 32   HOH HOH B . 
J 5 HOH 31  2034 33   HOH HOH B . 
J 5 HOH 32  2035 34   HOH HOH B . 
J 5 HOH 33  2036 36   HOH HOH B . 
J 5 HOH 34  2037 38   HOH HOH B . 
J 5 HOH 35  2038 39   HOH HOH B . 
J 5 HOH 36  2039 1041 HOH HOH B . 
J 5 HOH 37  2040 1042 HOH HOH B . 
J 5 HOH 38  2041 1043 HOH HOH B . 
J 5 HOH 39  2042 1044 HOH HOH B . 
J 5 HOH 40  2043 1046 HOH HOH B . 
J 5 HOH 41  2044 1047 HOH HOH B . 
J 5 HOH 42  2045 1048 HOH HOH B . 
J 5 HOH 43  2046 1049 HOH HOH B . 
J 5 HOH 44  2047 1050 HOH HOH B . 
J 5 HOH 45  2048 1052 HOH HOH B . 
J 5 HOH 46  2049 1053 HOH HOH B . 
J 5 HOH 47  2050 1055 HOH HOH B . 
J 5 HOH 48  2051 1057 HOH HOH B . 
J 5 HOH 49  2052 1059 HOH HOH B . 
J 5 HOH 50  2053 1060 HOH HOH B . 
J 5 HOH 51  2054 1061 HOH HOH B . 
J 5 HOH 52  2055 1062 HOH HOH B . 
J 5 HOH 53  2056 1063 HOH HOH B . 
J 5 HOH 54  2057 1064 HOH HOH B . 
J 5 HOH 55  2058 1065 HOH HOH B . 
J 5 HOH 56  2059 1067 HOH HOH B . 
J 5 HOH 57  2060 1068 HOH HOH B . 
J 5 HOH 58  2061 1069 HOH HOH B . 
J 5 HOH 59  2062 1070 HOH HOH B . 
J 5 HOH 60  2063 1071 HOH HOH B . 
J 5 HOH 61  2064 1072 HOH HOH B . 
J 5 HOH 62  2065 1073 HOH HOH B . 
J 5 HOH 63  2066 1076 HOH HOH B . 
J 5 HOH 64  2067 1079 HOH HOH B . 
J 5 HOH 65  2068 1081 HOH HOH B . 
J 5 HOH 66  2069 1082 HOH HOH B . 
J 5 HOH 67  2070 1083 HOH HOH B . 
J 5 HOH 68  2071 1084 HOH HOH B . 
J 5 HOH 69  2072 1086 HOH HOH B . 
J 5 HOH 70  2073 1088 HOH HOH B . 
J 5 HOH 71  2074 1089 HOH HOH B . 
J 5 HOH 72  2075 1092 HOH HOH B . 
J 5 HOH 73  2076 1093 HOH HOH B . 
J 5 HOH 74  2077 1094 HOH HOH B . 
J 5 HOH 75  2078 1100 HOH HOH B . 
J 5 HOH 76  2079 1102 HOH HOH B . 
J 5 HOH 77  2080 1103 HOH HOH B . 
J 5 HOH 78  2081 1104 HOH HOH B . 
J 5 HOH 79  2082 1105 HOH HOH B . 
J 5 HOH 80  2083 1107 HOH HOH B . 
J 5 HOH 81  2084 1109 HOH HOH B . 
J 5 HOH 82  2085 1112 HOH HOH B . 
J 5 HOH 83  2086 1115 HOH HOH B . 
J 5 HOH 84  2087 1116 HOH HOH B . 
J 5 HOH 85  2088 1118 HOH HOH B . 
J 5 HOH 86  2089 1119 HOH HOH B . 
J 5 HOH 87  2090 1121 HOH HOH B . 
J 5 HOH 88  2091 1122 HOH HOH B . 
J 5 HOH 89  2092 1123 HOH HOH B . 
J 5 HOH 90  2093 1126 HOH HOH B . 
J 5 HOH 91  2094 1127 HOH HOH B . 
J 5 HOH 92  2095 1129 HOH HOH B . 
J 5 HOH 93  2096 1130 HOH HOH B . 
J 5 HOH 94  2097 1131 HOH HOH B . 
J 5 HOH 95  2098 1132 HOH HOH B . 
J 5 HOH 96  2099 1133 HOH HOH B . 
J 5 HOH 97  2100 1134 HOH HOH B . 
J 5 HOH 98  2101 1135 HOH HOH B . 
J 5 HOH 99  2102 1136 HOH HOH B . 
J 5 HOH 100 2103 1139 HOH HOH B . 
J 5 HOH 101 2104 1140 HOH HOH B . 
J 5 HOH 102 2105 1145 HOH HOH B . 
J 5 HOH 103 2106 1149 HOH HOH B . 
J 5 HOH 104 2107 1150 HOH HOH B . 
J 5 HOH 105 2108 1153 HOH HOH B . 
J 5 HOH 106 2109 1154 HOH HOH B . 
J 5 HOH 107 2110 1156 HOH HOH B . 
J 5 HOH 108 2111 1157 HOH HOH B . 
J 5 HOH 109 2112 1159 HOH HOH B . 
J 5 HOH 110 2113 1160 HOH HOH B . 
J 5 HOH 111 2114 1162 HOH HOH B . 
J 5 HOH 112 2115 1163 HOH HOH B . 
J 5 HOH 113 2116 1164 HOH HOH B . 
J 5 HOH 114 2117 1165 HOH HOH B . 
J 5 HOH 115 2118 1167 HOH HOH B . 
J 5 HOH 116 2119 1168 HOH HOH B . 
J 5 HOH 117 2120 1169 HOH HOH B . 
J 5 HOH 118 2121 1170 HOH HOH B . 
J 5 HOH 119 2122 1171 HOH HOH B . 
J 5 HOH 120 2123 1172 HOH HOH B . 
J 5 HOH 121 2124 1173 HOH HOH B . 
J 5 HOH 122 2125 1174 HOH HOH B . 
J 5 HOH 123 2126 1177 HOH HOH B . 
J 5 HOH 124 2127 1178 HOH HOH B . 
J 5 HOH 125 2128 1179 HOH HOH B . 
J 5 HOH 126 2129 1180 HOH HOH B . 
J 5 HOH 127 2130 1183 HOH HOH B . 
J 5 HOH 128 2131 1184 HOH HOH B . 
J 5 HOH 129 2132 1185 HOH HOH B . 
J 5 HOH 130 2133 1186 HOH HOH B . 
J 5 HOH 131 2134 1190 HOH HOH B . 
J 5 HOH 132 2135 1191 HOH HOH B . 
J 5 HOH 133 2136 1192 HOH HOH B . 
J 5 HOH 134 2137 1194 HOH HOH B . 
J 5 HOH 135 2138 1195 HOH HOH B . 
J 5 HOH 136 2139 1197 HOH HOH B . 
J 5 HOH 137 2140 1202 HOH HOH B . 
J 5 HOH 138 2141 1203 HOH HOH B . 
J 5 HOH 139 2142 1204 HOH HOH B . 
J 5 HOH 140 2143 1205 HOH HOH B . 
J 5 HOH 141 2144 1206 HOH HOH B . 
J 5 HOH 142 2145 1207 HOH HOH B . 
J 5 HOH 143 2146 1208 HOH HOH B . 
J 5 HOH 144 2147 1209 HOH HOH B . 
J 5 HOH 145 2148 1211 HOH HOH B . 
J 5 HOH 146 2149 1215 HOH HOH B . 
J 5 HOH 147 2150 1221 HOH HOH B . 
J 5 HOH 148 2151 1222 HOH HOH B . 
J 5 HOH 149 2152 1224 HOH HOH B . 
J 5 HOH 150 2153 1225 HOH HOH B . 
J 5 HOH 151 2154 1226 HOH HOH B . 
J 5 HOH 152 2155 1227 HOH HOH B . 
J 5 HOH 153 2156 1229 HOH HOH B . 
J 5 HOH 154 2157 1230 HOH HOH B . 
J 5 HOH 155 2158 1231 HOH HOH B . 
J 5 HOH 156 2159 1234 HOH HOH B . 
J 5 HOH 157 2160 1235 HOH HOH B . 
J 5 HOH 158 2161 1236 HOH HOH B . 
J 5 HOH 159 2162 1237 HOH HOH B . 
J 5 HOH 160 2163 1239 HOH HOH B . 
J 5 HOH 161 2164 1243 HOH HOH B . 
J 5 HOH 162 2165 1244 HOH HOH B . 
J 5 HOH 163 2166 1245 HOH HOH B . 
J 5 HOH 164 2167 1246 HOH HOH B . 
J 5 HOH 165 2168 1248 HOH HOH B . 
J 5 HOH 166 2169 1250 HOH HOH B . 
J 5 HOH 167 2170 1256 HOH HOH B . 
J 5 HOH 168 2171 1257 HOH HOH B . 
J 5 HOH 169 2172 1258 HOH HOH B . 
J 5 HOH 170 2173 1262 HOH HOH B . 
J 5 HOH 171 2174 1263 HOH HOH B . 
J 5 HOH 172 2175 1264 HOH HOH B . 
J 5 HOH 173 2176 1265 HOH HOH B . 
J 5 HOH 174 2177 1266 HOH HOH B . 
J 5 HOH 175 2178 1268 HOH HOH B . 
J 5 HOH 176 2179 1273 HOH HOH B . 
J 5 HOH 177 2180 1274 HOH HOH B . 
J 5 HOH 178 2181 1276 HOH HOH B . 
J 5 HOH 179 2182 1282 HOH HOH B . 
J 5 HOH 180 2183 1285 HOH HOH B . 
J 5 HOH 181 2184 1286 HOH HOH B . 
J 5 HOH 182 2185 1291 HOH HOH B . 
J 5 HOH 183 2186 1292 HOH HOH B . 
J 5 HOH 184 2187 1294 HOH HOH B . 
J 5 HOH 185 2188 1296 HOH HOH B . 
J 5 HOH 186 2189 1298 HOH HOH B . 
J 5 HOH 187 2190 1299 HOH HOH B . 
J 5 HOH 188 2191 1300 HOH HOH B . 
J 5 HOH 189 2192 1301 HOH HOH B . 
J 5 HOH 190 2193 1306 HOH HOH B . 
J 5 HOH 191 2194 1307 HOH HOH B . 
J 5 HOH 192 2195 1308 HOH HOH B . 
J 5 HOH 193 2196 1311 HOH HOH B . 
J 5 HOH 194 2197 1312 HOH HOH B . 
J 5 HOH 195 2198 1313 HOH HOH B . 
J 5 HOH 196 2199 1314 HOH HOH B . 
J 5 HOH 197 2200 1315 HOH HOH B . 
J 5 HOH 198 2201 1316 HOH HOH B . 
J 5 HOH 199 2202 1317 HOH HOH B . 
J 5 HOH 200 2203 1318 HOH HOH B . 
J 5 HOH 201 2204 1320 HOH HOH B . 
J 5 HOH 202 2205 1321 HOH HOH B . 
J 5 HOH 203 2206 1322 HOH HOH B . 
J 5 HOH 204 2207 1323 HOH HOH B . 
J 5 HOH 205 2208 1324 HOH HOH B . 
J 5 HOH 206 2209 1325 HOH HOH B . 
J 5 HOH 207 2210 1326 HOH HOH B . 
J 5 HOH 208 2211 1327 HOH HOH B . 
J 5 HOH 209 2212 1329 HOH HOH B . 
J 5 HOH 210 2213 1331 HOH HOH B . 
J 5 HOH 211 2214 1335 HOH HOH B . 
J 5 HOH 212 2215 1336 HOH HOH B . 
J 5 HOH 213 2216 1338 HOH HOH B . 
J 5 HOH 214 2217 1339 HOH HOH B . 
J 5 HOH 215 2218 1341 HOH HOH B . 
J 5 HOH 216 2219 1343 HOH HOH B . 
J 5 HOH 217 2220 1344 HOH HOH B . 
J 5 HOH 218 2221 1345 HOH HOH B . 
J 5 HOH 219 2222 1346 HOH HOH B . 
J 5 HOH 220 2223 1350 HOH HOH B . 
J 5 HOH 221 2224 1351 HOH HOH B . 
J 5 HOH 222 2225 1352 HOH HOH B . 
J 5 HOH 223 2226 1356 HOH HOH B . 
J 5 HOH 224 2227 1358 HOH HOH B . 
J 5 HOH 225 2228 1361 HOH HOH B . 
J 5 HOH 226 2229 1364 HOH HOH B . 
J 5 HOH 227 2230 1366 HOH HOH B . 
J 5 HOH 228 2231 1369 HOH HOH B . 
J 5 HOH 229 2232 1371 HOH HOH B . 
J 5 HOH 230 2233 1375 HOH HOH B . 
J 5 HOH 231 2234 1376 HOH HOH B . 
J 5 HOH 232 2235 1377 HOH HOH B . 
J 5 HOH 233 2236 1380 HOH HOH B . 
J 5 HOH 234 2237 1381 HOH HOH B . 
J 5 HOH 235 2238 1384 HOH HOH B . 
J 5 HOH 236 2239 1385 HOH HOH B . 
J 5 HOH 237 2240 1388 HOH HOH B . 
J 5 HOH 238 2241 1393 HOH HOH B . 
J 5 HOH 239 2242 1394 HOH HOH B . 
J 5 HOH 240 2243 1395 HOH HOH B . 
J 5 HOH 241 2244 1399 HOH HOH B . 
J 5 HOH 242 2245 1400 HOH HOH B . 
J 5 HOH 243 2246 1404 HOH HOH B . 
J 5 HOH 244 2247 1405 HOH HOH B . 
J 5 HOH 245 2248 1407 HOH HOH B . 
J 5 HOH 246 2249 1411 HOH HOH B . 
J 5 HOH 247 2250 1415 HOH HOH B . 
J 5 HOH 248 2251 1417 HOH HOH B . 
J 5 HOH 249 2252 1418 HOH HOH B . 
J 5 HOH 250 2253 1419 HOH HOH B . 
J 5 HOH 251 2254 1420 HOH HOH B . 
J 5 HOH 252 2255 1426 HOH HOH B . 
J 5 HOH 253 2256 1427 HOH HOH B . 
J 5 HOH 254 2257 1431 HOH HOH B . 
J 5 HOH 255 2258 1432 HOH HOH B . 
J 5 HOH 256 2259 1433 HOH HOH B . 
J 5 HOH 257 2260 1438 HOH HOH B . 
J 5 HOH 258 2261 1441 HOH HOH B . 
J 5 HOH 259 2262 1444 HOH HOH B . 
J 5 HOH 260 2263 1445 HOH HOH B . 
J 5 HOH 261 2264 1446 HOH HOH B . 
J 5 HOH 262 2265 1455 HOH HOH B . 
J 5 HOH 263 2266 1456 HOH HOH B . 
J 5 HOH 264 2267 1477 HOH HOH B . 
J 5 HOH 265 2268 1490 HOH HOH B . 
J 5 HOH 266 2269 1504 HOH HOH B . 
J 5 HOH 267 2270 1513 HOH HOH B . 
J 5 HOH 268 2271 1529 HOH HOH B . 
J 5 HOH 269 2272 1544 HOH HOH B . 
J 5 HOH 270 2273 1547 HOH HOH B . 
J 5 HOH 271 2274 1548 HOH HOH B . 
J 5 HOH 272 2275 1549 HOH HOH B . 
J 5 HOH 273 2276 1550 HOH HOH B . 
J 5 HOH 274 2277 1552 HOH HOH B . 
J 5 HOH 275 2278 1553 HOH HOH B . 
J 5 HOH 276 2279 1560 HOH HOH B . 
J 5 HOH 277 2280 1565 HOH HOH B . 
J 5 HOH 278 2281 1566 HOH HOH B . 
J 5 HOH 279 2282 1567 HOH HOH B . 
J 5 HOH 280 2283 1571 HOH HOH B . 
J 5 HOH 281 2284 1573 HOH HOH B . 
J 5 HOH 282 2285 1575 HOH HOH B . 
J 5 HOH 283 2286 1579 HOH HOH B . 
J 5 HOH 284 2287 1582 HOH HOH B . 
J 5 HOH 285 2288 1584 HOH HOH B . 
J 5 HOH 286 2289 1585 HOH HOH B . 
J 5 HOH 287 2290 1586 HOH HOH B . 
J 5 HOH 288 2291 1590 HOH HOH B . 
J 5 HOH 289 2292 1592 HOH HOH B . 
J 5 HOH 290 2293 1597 HOH HOH B . 
J 5 HOH 291 2294 1599 HOH HOH B . 
J 5 HOH 292 2295 1601 HOH HOH B . 
J 5 HOH 293 2296 1604 HOH HOH B . 
J 5 HOH 294 2297 1605 HOH HOH B . 
J 5 HOH 295 2298 1607 HOH HOH B . 
J 5 HOH 296 2299 1611 HOH HOH B . 
J 5 HOH 297 2300 1612 HOH HOH B . 
J 5 HOH 298 2301 1621 HOH HOH B . 
J 5 HOH 299 2302 1623 HOH HOH B . 
J 5 HOH 300 2303 1624 HOH HOH B . 
J 5 HOH 301 2304 1626 HOH HOH B . 
J 5 HOH 302 2305 1628 HOH HOH B . 
J 5 HOH 303 2306 1629 HOH HOH B . 
J 5 HOH 304 2307 1631 HOH HOH B . 
J 5 HOH 305 2308 1634 HOH HOH B . 
J 5 HOH 306 2309 1638 HOH HOH B . 
J 5 HOH 307 2310 1639 HOH HOH B . 
J 5 HOH 308 2311 1640 HOH HOH B . 
J 5 HOH 309 2312 1641 HOH HOH B . 
J 5 HOH 310 2313 1643 HOH HOH B . 
J 5 HOH 311 2314 1645 HOH HOH B . 
J 5 HOH 312 2315 1649 HOH HOH B . 
J 5 HOH 313 2316 1650 HOH HOH B . 
J 5 HOH 314 2317 1654 HOH HOH B . 
J 5 HOH 315 2318 1657 HOH HOH B . 
J 5 HOH 316 2319 1659 HOH HOH B . 
J 5 HOH 317 2320 1664 HOH HOH B . 
J 5 HOH 318 2321 1667 HOH HOH B . 
J 5 HOH 319 2322 1668 HOH HOH B . 
J 5 HOH 320 2323 1670 HOH HOH B . 
J 5 HOH 321 2324 1671 HOH HOH B . 
J 5 HOH 322 2325 1672 HOH HOH B . 
J 5 HOH 323 2326 1673 HOH HOH B . 
J 5 HOH 324 2327 1674 HOH HOH B . 
J 5 HOH 325 2328 1678 HOH HOH B . 
J 5 HOH 326 2329 1681 HOH HOH B . 
J 5 HOH 327 2330 1682 HOH HOH B . 
J 5 HOH 328 2331 1683 HOH HOH B . 
J 5 HOH 329 2332 1684 HOH HOH B . 
J 5 HOH 330 2333 1685 HOH HOH B . 
J 5 HOH 331 2334 1686 HOH HOH B . 
J 5 HOH 332 2335 1688 HOH HOH B . 
J 5 HOH 333 2336 1689 HOH HOH B . 
J 5 HOH 334 2337 1690 HOH HOH B . 
J 5 HOH 335 2338 1692 HOH HOH B . 
J 5 HOH 336 2339 1696 HOH HOH B . 
J 5 HOH 337 2340 1699 HOH HOH B . 
J 5 HOH 338 2341 1700 HOH HOH B . 
J 5 HOH 339 2342 1702 HOH HOH B . 
J 5 HOH 340 2343 1705 HOH HOH B . 
J 5 HOH 341 2344 1708 HOH HOH B . 
J 5 HOH 342 2345 1710 HOH HOH B . 
J 5 HOH 343 2346 1712 HOH HOH B . 
J 5 HOH 344 2347 1715 HOH HOH B . 
J 5 HOH 345 2348 1718 HOH HOH B . 
J 5 HOH 346 2349 1720 HOH HOH B . 
J 5 HOH 347 2350 1721 HOH HOH B . 
J 5 HOH 348 2351 1723 HOH HOH B . 
J 5 HOH 349 2352 1726 HOH HOH B . 
J 5 HOH 350 2353 1731 HOH HOH B . 
J 5 HOH 351 2354 1732 HOH HOH B . 
J 5 HOH 352 2355 1736 HOH HOH B . 
J 5 HOH 353 2356 1739 HOH HOH B . 
J 5 HOH 354 2357 1747 HOH HOH B . 
J 5 HOH 355 2358 1749 HOH HOH B . 
J 5 HOH 356 2359 1750 HOH HOH B . 
J 5 HOH 357 2360 1752 HOH HOH B . 
J 5 HOH 358 2361 1755 HOH HOH B . 
J 5 HOH 359 2362 1756 HOH HOH B . 
J 5 HOH 360 2363 1759 HOH HOH B . 
J 5 HOH 361 2364 1765 HOH HOH B . 
J 5 HOH 362 2365 1768 HOH HOH B . 
J 5 HOH 363 2366 1770 HOH HOH B . 
J 5 HOH 364 2367 1771 HOH HOH B . 
J 5 HOH 365 2368 1778 HOH HOH B . 
J 5 HOH 366 2369 1783 HOH HOH B . 
J 5 HOH 367 2370 1785 HOH HOH B . 
J 5 HOH 368 2371 1787 HOH HOH B . 
J 5 HOH 369 2372 1788 HOH HOH B . 
J 5 HOH 370 2373 1793 HOH HOH B . 
J 5 HOH 371 2374 1794 HOH HOH B . 
J 5 HOH 372 2375 1795 HOH HOH B . 
J 5 HOH 373 2376 1796 HOH HOH B . 
J 5 HOH 374 2377 1799 HOH HOH B . 
J 5 HOH 375 2378 1800 HOH HOH B . 
J 5 HOH 376 2379 1804 HOH HOH B . 
J 5 HOH 377 2380 1809 HOH HOH B . 
J 5 HOH 378 2381 1812 HOH HOH B . 
J 5 HOH 379 2382 1813 HOH HOH B . 
J 5 HOH 380 2383 1817 HOH HOH B . 
J 5 HOH 381 2384 1818 HOH HOH B . 
J 5 HOH 382 2385 1820 HOH HOH B . 
J 5 HOH 383 2386 1823 HOH HOH B . 
J 5 HOH 384 2387 1824 HOH HOH B . 
J 5 HOH 385 2388 1828 HOH HOH B . 
J 5 HOH 386 2389 1834 HOH HOH B . 
J 5 HOH 387 2390 1835 HOH HOH B . 
J 5 HOH 388 2391 1837 HOH HOH B . 
J 5 HOH 389 2392 1838 HOH HOH B . 
J 5 HOH 390 2393 1845 HOH HOH B . 
J 5 HOH 391 2394 1846 HOH HOH B . 
J 5 HOH 392 2395 1849 HOH HOH B . 
J 5 HOH 393 2396 1850 HOH HOH B . 
J 5 HOH 394 2397 1851 HOH HOH B . 
J 5 HOH 395 2398 1854 HOH HOH B . 
J 5 HOH 396 2399 1855 HOH HOH B . 
J 5 HOH 397 2400 1856 HOH HOH B . 
J 5 HOH 398 2401 1857 HOH HOH B . 
J 5 HOH 399 2402 1858 HOH HOH B . 
J 5 HOH 400 2403 1860 HOH HOH B . 
J 5 HOH 401 2404 1862 HOH HOH B . 
J 5 HOH 402 2405 1870 HOH HOH B . 
J 5 HOH 403 2406 1872 HOH HOH B . 
J 5 HOH 404 2407 1875 HOH HOH B . 
J 5 HOH 405 2408 1879 HOH HOH B . 
J 5 HOH 406 2409 1880 HOH HOH B . 
J 5 HOH 407 2410 1886 HOH HOH B . 
J 5 HOH 408 2411 1888 HOH HOH B . 
J 5 HOH 409 2412 1890 HOH HOH B . 
J 5 HOH 410 2413 1895 HOH HOH B . 
J 5 HOH 411 2414 1896 HOH HOH B . 
J 5 HOH 412 2415 1899 HOH HOH B . 
J 5 HOH 413 2416 1002 HOH HOH B . 
J 5 HOH 414 2417 1005 HOH HOH B . 
J 5 HOH 415 2418 1007 HOH HOH B . 
J 5 HOH 416 2419 1009 HOH HOH B . 
J 5 HOH 417 2420 1010 HOH HOH B . 
J 5 HOH 418 2421 1014 HOH HOH B . 
J 5 HOH 419 2422 1015 HOH HOH B . 
J 5 HOH 420 2423 1016 HOH HOH B . 
J 5 HOH 421 2424 1018 HOH HOH B . 
J 5 HOH 422 2425 1019 HOH HOH B . 
J 5 HOH 423 2426 1024 HOH HOH B . 
J 5 HOH 424 2427 1025 HOH HOH B . 
J 5 HOH 425 2428 1029 HOH HOH B . 
#