data_1QQW
# 
_entry.id   1QQW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QQW         
RCSB  RCSB009160   
WWPDB D_1000009160 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4BLC 
_pdbx_database_related.details        
;4BLC IS FOR BOVINE LIVER CATALASE. THE UNIT CELL AND SPACE GROUP ARE ALMOST 
IDENTICAL TO THOSE IN THIS ENTRY, AS WELL AS THE STRUCTURE OF THE CATALASE 
MOLECULES.
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QQW 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ko, T.P.'      1 
'Safo, M.K.'    2 
'Musayev, F.N.' 3 
'Wang, C.'      4 
'Wu, S.H.'      5 
'Abraham, D.J.' 6 
# 
_citation.id                        primary 
_citation.title                     'Structure of human erythrocyte catalase.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            56 
_citation.page_first                241 
_citation.page_last                 245 
_citation.year                      2000 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10666617 
_citation.pdbx_database_id_DOI      10.1107/S0907444999015930 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ko, T.P.'       1 
primary 'Safo, M.K.'     2 
primary 'Musayev, F.N.'  3 
primary 'Di Salvo, M.L.' 4 
primary 'Wang, C.'       5 
primary 'Wu, S.H.'       6 
primary 'Abraham, D.J.'  7 
# 
_cell.entry_id           1QQW 
_cell.length_a           84.904 
_cell.length_b           141.674 
_cell.length_c           232.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QQW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat CATALASE                          59836.996 4   1.11.1.6 ? ? ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4   ?        ? ? ? 
3 water       nat water                             18.015    393 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAG
AFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR
NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVK
NFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAG
AFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR
NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVK
NFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASP n 
1 4   SER n 
1 5   ARG n 
1 6   ASP n 
1 7   PRO n 
1 8   ALA n 
1 9   SER n 
1 10  ASP n 
1 11  GLN n 
1 12  MET n 
1 13  GLN n 
1 14  HIS n 
1 15  TRP n 
1 16  LYS n 
1 17  GLU n 
1 18  GLN n 
1 19  ARG n 
1 20  ALA n 
1 21  ALA n 
1 22  GLN n 
1 23  LYS n 
1 24  ALA n 
1 25  ASP n 
1 26  VAL n 
1 27  LEU n 
1 28  THR n 
1 29  THR n 
1 30  GLY n 
1 31  ALA n 
1 32  GLY n 
1 33  ASN n 
1 34  PRO n 
1 35  VAL n 
1 36  GLY n 
1 37  ASP n 
1 38  LYS n 
1 39  LEU n 
1 40  ASN n 
1 41  VAL n 
1 42  ILE n 
1 43  THR n 
1 44  VAL n 
1 45  GLY n 
1 46  PRO n 
1 47  ARG n 
1 48  GLY n 
1 49  PRO n 
1 50  LEU n 
1 51  LEU n 
1 52  VAL n 
1 53  GLN n 
1 54  ASP n 
1 55  VAL n 
1 56  VAL n 
1 57  PHE n 
1 58  THR n 
1 59  ASP n 
1 60  GLU n 
1 61  MET n 
1 62  ALA n 
1 63  HIS n 
1 64  PHE n 
1 65  ASP n 
1 66  ARG n 
1 67  GLU n 
1 68  ARG n 
1 69  ILE n 
1 70  PRO n 
1 71  GLU n 
1 72  ARG n 
1 73  VAL n 
1 74  VAL n 
1 75  HIS n 
1 76  ALA n 
1 77  LYS n 
1 78  GLY n 
1 79  ALA n 
1 80  GLY n 
1 81  ALA n 
1 82  PHE n 
1 83  GLY n 
1 84  TYR n 
1 85  PHE n 
1 86  GLU n 
1 87  VAL n 
1 88  THR n 
1 89  HIS n 
1 90  ASP n 
1 91  ILE n 
1 92  THR n 
1 93  LYS n 
1 94  TYR n 
1 95  SER n 
1 96  LYS n 
1 97  ALA n 
1 98  LYS n 
1 99  VAL n 
1 100 PHE n 
1 101 GLU n 
1 102 HIS n 
1 103 ILE n 
1 104 GLY n 
1 105 LYS n 
1 106 LYS n 
1 107 THR n 
1 108 PRO n 
1 109 ILE n 
1 110 ALA n 
1 111 VAL n 
1 112 ARG n 
1 113 PHE n 
1 114 SER n 
1 115 THR n 
1 116 VAL n 
1 117 ALA n 
1 118 GLY n 
1 119 GLU n 
1 120 SER n 
1 121 GLY n 
1 122 SER n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 VAL n 
1 127 ARG n 
1 128 ASP n 
1 129 PRO n 
1 130 ARG n 
1 131 GLY n 
1 132 PHE n 
1 133 ALA n 
1 134 VAL n 
1 135 LYS n 
1 136 PHE n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 ASP n 
1 141 GLY n 
1 142 ASN n 
1 143 TRP n 
1 144 ASP n 
1 145 LEU n 
1 146 VAL n 
1 147 GLY n 
1 148 ASN n 
1 149 ASN n 
1 150 THR n 
1 151 PRO n 
1 152 ILE n 
1 153 PHE n 
1 154 PHE n 
1 155 ILE n 
1 156 ARG n 
1 157 ASP n 
1 158 PRO n 
1 159 ILE n 
1 160 LEU n 
1 161 PHE n 
1 162 PRO n 
1 163 SER n 
1 164 PHE n 
1 165 ILE n 
1 166 HIS n 
1 167 SER n 
1 168 GLN n 
1 169 LYS n 
1 170 ARG n 
1 171 ASN n 
1 172 PRO n 
1 173 GLN n 
1 174 THR n 
1 175 HIS n 
1 176 LEU n 
1 177 LYS n 
1 178 ASP n 
1 179 PRO n 
1 180 ASP n 
1 181 MET n 
1 182 VAL n 
1 183 TRP n 
1 184 ASP n 
1 185 PHE n 
1 186 TRP n 
1 187 SER n 
1 188 LEU n 
1 189 ARG n 
1 190 PRO n 
1 191 GLU n 
1 192 SER n 
1 193 LEU n 
1 194 HIS n 
1 195 GLN n 
1 196 VAL n 
1 197 SER n 
1 198 PHE n 
1 199 LEU n 
1 200 PHE n 
1 201 SER n 
1 202 ASP n 
1 203 ARG n 
1 204 GLY n 
1 205 ILE n 
1 206 PRO n 
1 207 ASP n 
1 208 GLY n 
1 209 HIS n 
1 210 ARG n 
1 211 HIS n 
1 212 MET n 
1 213 ASN n 
1 214 GLY n 
1 215 TYR n 
1 216 GLY n 
1 217 SER n 
1 218 HIS n 
1 219 THR n 
1 220 PHE n 
1 221 LYS n 
1 222 LEU n 
1 223 VAL n 
1 224 ASN n 
1 225 ALA n 
1 226 ASN n 
1 227 GLY n 
1 228 GLU n 
1 229 ALA n 
1 230 VAL n 
1 231 TYR n 
1 232 CYS n 
1 233 LYS n 
1 234 PHE n 
1 235 HIS n 
1 236 TYR n 
1 237 LYS n 
1 238 THR n 
1 239 ASP n 
1 240 GLN n 
1 241 GLY n 
1 242 ILE n 
1 243 LYS n 
1 244 ASN n 
1 245 LEU n 
1 246 SER n 
1 247 VAL n 
1 248 GLU n 
1 249 ASP n 
1 250 ALA n 
1 251 ALA n 
1 252 ARG n 
1 253 LEU n 
1 254 SER n 
1 255 GLN n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 ASP n 
1 260 TYR n 
1 261 GLY n 
1 262 ILE n 
1 263 ARG n 
1 264 ASP n 
1 265 LEU n 
1 266 PHE n 
1 267 ASN n 
1 268 ALA n 
1 269 ILE n 
1 270 ALA n 
1 271 THR n 
1 272 GLY n 
1 273 LYS n 
1 274 TYR n 
1 275 PRO n 
1 276 SER n 
1 277 TRP n 
1 278 THR n 
1 279 PHE n 
1 280 TYR n 
1 281 ILE n 
1 282 GLN n 
1 283 VAL n 
1 284 MET n 
1 285 THR n 
1 286 PHE n 
1 287 ASN n 
1 288 GLN n 
1 289 ALA n 
1 290 GLU n 
1 291 THR n 
1 292 PHE n 
1 293 PRO n 
1 294 PHE n 
1 295 ASN n 
1 296 PRO n 
1 297 PHE n 
1 298 ASP n 
1 299 LEU n 
1 300 THR n 
1 301 LYS n 
1 302 VAL n 
1 303 TRP n 
1 304 PRO n 
1 305 HIS n 
1 306 LYS n 
1 307 ASP n 
1 308 TYR n 
1 309 PRO n 
1 310 LEU n 
1 311 ILE n 
1 312 PRO n 
1 313 VAL n 
1 314 GLY n 
1 315 LYS n 
1 316 LEU n 
1 317 VAL n 
1 318 LEU n 
1 319 ASN n 
1 320 ARG n 
1 321 ASN n 
1 322 PRO n 
1 323 VAL n 
1 324 ASN n 
1 325 TYR n 
1 326 PHE n 
1 327 ALA n 
1 328 GLU n 
1 329 VAL n 
1 330 GLU n 
1 331 GLN n 
1 332 ILE n 
1 333 ALA n 
1 334 PHE n 
1 335 ASP n 
1 336 PRO n 
1 337 SER n 
1 338 ASN n 
1 339 MET n 
1 340 PRO n 
1 341 PRO n 
1 342 GLY n 
1 343 ILE n 
1 344 GLU n 
1 345 ALA n 
1 346 SER n 
1 347 PRO n 
1 348 ASP n 
1 349 LYS n 
1 350 MET n 
1 351 LEU n 
1 352 GLN n 
1 353 GLY n 
1 354 ARG n 
1 355 LEU n 
1 356 PHE n 
1 357 ALA n 
1 358 TYR n 
1 359 PRO n 
1 360 ASP n 
1 361 THR n 
1 362 HIS n 
1 363 ARG n 
1 364 HIS n 
1 365 ARG n 
1 366 LEU n 
1 367 GLY n 
1 368 PRO n 
1 369 ASN n 
1 370 TYR n 
1 371 LEU n 
1 372 HIS n 
1 373 ILE n 
1 374 PRO n 
1 375 VAL n 
1 376 ASN n 
1 377 CYS n 
1 378 PRO n 
1 379 TYR n 
1 380 ARG n 
1 381 ALA n 
1 382 ARG n 
1 383 VAL n 
1 384 ALA n 
1 385 ASN n 
1 386 TYR n 
1 387 GLN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 PRO n 
1 392 MET n 
1 393 CYS n 
1 394 MET n 
1 395 GLN n 
1 396 ASP n 
1 397 ASN n 
1 398 GLN n 
1 399 GLY n 
1 400 GLY n 
1 401 ALA n 
1 402 PRO n 
1 403 ASN n 
1 404 TYR n 
1 405 TYR n 
1 406 PRO n 
1 407 ASN n 
1 408 SER n 
1 409 PHE n 
1 410 GLY n 
1 411 ALA n 
1 412 PRO n 
1 413 GLU n 
1 414 GLN n 
1 415 GLN n 
1 416 PRO n 
1 417 SER n 
1 418 ALA n 
1 419 LEU n 
1 420 GLU n 
1 421 HIS n 
1 422 SER n 
1 423 ILE n 
1 424 GLN n 
1 425 TYR n 
1 426 SER n 
1 427 GLY n 
1 428 GLU n 
1 429 VAL n 
1 430 ARG n 
1 431 ARG n 
1 432 PHE n 
1 433 ASN n 
1 434 THR n 
1 435 ALA n 
1 436 ASN n 
1 437 ASP n 
1 438 ASP n 
1 439 ASN n 
1 440 VAL n 
1 441 THR n 
1 442 GLN n 
1 443 VAL n 
1 444 ARG n 
1 445 ALA n 
1 446 PHE n 
1 447 TYR n 
1 448 VAL n 
1 449 ASN n 
1 450 VAL n 
1 451 LEU n 
1 452 ASN n 
1 453 GLU n 
1 454 GLU n 
1 455 GLN n 
1 456 ARG n 
1 457 LYS n 
1 458 ARG n 
1 459 LEU n 
1 460 CYS n 
1 461 GLU n 
1 462 ASN n 
1 463 ILE n 
1 464 ALA n 
1 465 GLY n 
1 466 HIS n 
1 467 LEU n 
1 468 LYS n 
1 469 ASP n 
1 470 ALA n 
1 471 GLN n 
1 472 ILE n 
1 473 PHE n 
1 474 ILE n 
1 475 GLN n 
1 476 LYS n 
1 477 LYS n 
1 478 ALA n 
1 479 VAL n 
1 480 LYS n 
1 481 ASN n 
1 482 PHE n 
1 483 THR n 
1 484 GLU n 
1 485 VAL n 
1 486 HIS n 
1 487 PRO n 
1 488 ASP n 
1 489 TYR n 
1 490 GLY n 
1 491 SER n 
1 492 HIS n 
1 493 ILE n 
1 494 GLN n 
1 495 ALA n 
1 496 LEU n 
1 497 LEU n 
1 498 ASP n 
1 499 LYS n 
1 500 TYR n 
1 501 ASN n 
1 502 ALA n 
1 503 GLU n 
1 504 LYS n 
1 505 PRO n 
1 506 LYS n 
1 507 ASN n 
1 508 ALA n 
1 509 ILE n 
1 510 HIS n 
1 511 THR n 
1 512 PHE n 
1 513 VAL n 
1 514 GLN n 
1 515 SER n 
1 516 GLY n 
1 517 SER n 
1 518 HIS n 
1 519 LEU n 
1 520 ALA n 
1 521 ALA n 
1 522 ARG n 
1 523 GLU n 
1 524 LYS n 
1 525 ALA n 
1 526 ASN n 
1 527 LEU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     BLOOD 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ERYTHROCYTE 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CATA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04040 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QQW A 1 ? 527 ? P04040 1 ? 527 ? 1 527 
2 1 1QQW B 1 ? 527 ? P04040 1 ? 527 ? 1 527 
3 1 1QQW C 1 ? 527 ? P04040 1 ? 527 ? 1 527 
4 1 1QQW D 1 ? 527 ? P04040 1 ? 527 ? 1 527 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1QQW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.density_percent_sol   57.86 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.7 
_exptl_crystal_grow.pdbx_details    
;PROTEIN SOLUTION: 8MG/ML PROTEIN, 50MM KCL, 1MM 2-MERCAPTOETHANOL, 0.2MM EDTA, 
20MM NAOAC PH 5.2; RESERVOIR: 6-7% PEG-20000, 0.1 M MES PH 6.7; DROPS WERE SET 
UP BY MIXING EQUAL VOLUMES OF PROTEIN SOLUTION AND RESERVOIR., VAPOR DIFFUSION, HANGING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1999-01-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QQW 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             240 
_reflns.d_resolution_high            2.73 
_reflns.number_obs                   64674 
_reflns.number_all                   75169 
_reflns.percent_possible_obs         86.0 
_reflns.pdbx_Rmerge_I_obs            0.1180000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        2.9 
_reflns.B_iso_Wilson_estimate        20.9 
_reflns.pdbx_redundancy              2.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.73 
_reflns_shell.d_res_low              2.82 
_reflns_shell.percent_possible_all   67.0 
_reflns_shell.Rmerge_I_obs           0.3540000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QQW 
_refine.ls_number_reflns_obs                     44450 
_refine.ls_number_reflns_all                     59969 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            2.75 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2110000 
_refine.ls_R_factor_all                          0.2630000 
_refine.ls_R_factor_R_work                       0.2060000 
_refine.ls_R_factor_R_free                       0.2720000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3582 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'NCS RESTRAINTS WERE APPLIED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16053 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             393 
_refine_hist.number_atoms_total               16618 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             0.897 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QQW 
_struct.title                     'CRYSTAL STRUCTURE OF HUMAN ERYTHROCYTE CATALASE' 
_struct.pdbx_descriptor           CATALASE 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QQW 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'HEME PROTEIN, LATTICE CONTACT, WATER, NO NADP, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  A ASP A 10  ? ALA A 20  ? ASP A 10  ALA A 20  1 ? 11 
HELX_P HELX_P2  A ASP A 54  ? ARG A 68  ? ASP A 54  ARG A 68  1 ? 15 
HELX_P HELX_P3  A ASP A 157 ? LYS A 169 ? ASP A 157 LYS A 169 1 ? 13 
HELX_P HELX_P4  A ASP A 178 ? ARG A 189 ? ASP A 178 ARG A 189 1 ? 12 
HELX_P HELX_P5  A PRO A 190 ? SER A 201 ? PRO A 190 SER A 201 1 ? 12 
HELX_P HELX_P6  A SER A 246 ? ASP A 257 ? SER A 246 ASP A 257 1 ? 12 
HELX_P HELX_P7  A ASP A 259 ? LYS A 273 ? ASP A 259 LYS A 273 1 ? 15 
HELX_P HELX_P8  A ASN A 324 ? GLU A 330 ? ASN A 324 GLU A 330 1 ? 7  
HELX_P HELX_P9  A ASP A 348 ? GLY A 367 ? ASP A 348 GLY A 367 1 ? 20 
HELX_P HELX_P10 A ASP A 438 ? VAL A 448 ? ASP A 438 VAL A 448 1 ? 11 
HELX_P HELX_P11 A ASN A 452 ? LYS A 468 ? ASN A 452 LYS A 468 1 ? 17 
HELX_P HELX_P12 A GLN A 471 ? GLU A 484 ? GLN A 471 GLU A 484 1 ? 14 
HELX_P HELX_P13 A HIS A 486 ? ASN A 501 ? HIS A 486 ASN A 501 1 ? 16 
HELX_P HELX_P14 B ASP B 10  ? ALA B 20  ? ASP B 10  ALA B 20  1 ? 11 
HELX_P HELX_P15 B ASP B 54  ? ARG B 68  ? ASP B 54  ARG B 68  1 ? 15 
HELX_P HELX_P16 B ASP B 157 ? LYS B 169 ? ASP B 157 LYS B 169 1 ? 13 
HELX_P HELX_P17 B ASP B 178 ? ARG B 189 ? ASP B 178 ARG B 189 1 ? 12 
HELX_P HELX_P18 B PRO B 190 ? SER B 201 ? PRO B 190 SER B 201 1 ? 12 
HELX_P HELX_P19 B SER B 246 ? ASP B 257 ? SER B 246 ASP B 257 1 ? 12 
HELX_P HELX_P20 B ASP B 259 ? LYS B 273 ? ASP B 259 LYS B 273 1 ? 15 
HELX_P HELX_P21 B ASN B 324 ? GLU B 330 ? ASN B 324 GLU B 330 1 ? 7  
HELX_P HELX_P22 B ASP B 348 ? GLY B 367 ? ASP B 348 GLY B 367 1 ? 20 
HELX_P HELX_P23 B ASP B 438 ? VAL B 448 ? ASP B 438 VAL B 448 1 ? 11 
HELX_P HELX_P24 B ASN B 452 ? LYS B 468 ? ASN B 452 LYS B 468 1 ? 17 
HELX_P HELX_P25 B GLN B 471 ? GLU B 484 ? GLN B 471 GLU B 484 1 ? 14 
HELX_P HELX_P26 B HIS B 486 ? ASN B 501 ? HIS B 486 ASN B 501 1 ? 16 
HELX_P HELX_P27 C ASP C 10  ? ALA C 20  ? ASP C 10  ALA C 20  1 ? 11 
HELX_P HELX_P28 C ASP C 54  ? ARG C 68  ? ASP C 54  ARG C 68  1 ? 15 
HELX_P HELX_P29 C ASP C 157 ? LYS C 169 ? ASP C 157 LYS C 169 1 ? 13 
HELX_P HELX_P30 C ASP C 178 ? ARG C 189 ? ASP C 178 ARG C 189 1 ? 12 
HELX_P HELX_P31 C PRO C 190 ? SER C 201 ? PRO C 190 SER C 201 1 ? 12 
HELX_P HELX_P32 C SER C 246 ? ASP C 257 ? SER C 246 ASP C 257 1 ? 12 
HELX_P HELX_P33 C ASP C 259 ? LYS C 273 ? ASP C 259 LYS C 273 1 ? 15 
HELX_P HELX_P34 C ASN C 324 ? GLU C 330 ? ASN C 324 GLU C 330 1 ? 7  
HELX_P HELX_P35 C ASP C 348 ? GLY C 367 ? ASP C 348 GLY C 367 1 ? 20 
HELX_P HELX_P36 C ASP C 438 ? VAL C 448 ? ASP C 438 VAL C 448 1 ? 11 
HELX_P HELX_P37 C ASN C 452 ? LYS C 468 ? ASN C 452 LYS C 468 1 ? 17 
HELX_P HELX_P38 C GLN C 471 ? GLU C 484 ? GLN C 471 GLU C 484 1 ? 14 
HELX_P HELX_P39 C HIS C 486 ? ASN C 501 ? HIS C 486 ASN C 501 1 ? 16 
HELX_P HELX_P40 D ASP D 10  ? ALA D 20  ? ASP D 10  ALA D 20  1 ? 11 
HELX_P HELX_P41 D ASP D 54  ? ARG D 68  ? ASP D 54  ARG D 68  1 ? 15 
HELX_P HELX_P42 D ASP D 157 ? LYS D 169 ? ASP D 157 LYS D 169 1 ? 13 
HELX_P HELX_P43 D ASP D 178 ? ARG D 189 ? ASP D 178 ARG D 189 1 ? 12 
HELX_P HELX_P44 D PRO D 190 ? SER D 201 ? PRO D 190 SER D 201 1 ? 12 
HELX_P HELX_P45 D SER D 246 ? ASP D 257 ? SER D 246 ASP D 257 1 ? 12 
HELX_P HELX_P46 D ASP D 259 ? LYS D 273 ? ASP D 259 LYS D 273 1 ? 15 
HELX_P HELX_P47 D ASN D 324 ? GLU D 330 ? ASN D 324 GLU D 330 1 ? 7  
HELX_P HELX_P48 D ASP D 348 ? GLY D 367 ? ASP D 348 GLY D 367 1 ? 20 
HELX_P HELX_P49 D ASP D 438 ? VAL D 448 ? ASP D 438 VAL D 448 1 ? 11 
HELX_P HELX_P50 D ASN D 452 ? LYS D 468 ? ASN D 452 LYS D 468 1 ? 17 
HELX_P HELX_P51 D GLN D 471 ? GLU D 484 ? GLN D 471 GLU D 484 1 ? 14 
HELX_P HELX_P52 D HIS D 486 ? ASN D 501 ? HIS D 486 ASN D 501 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A TYR 358 OH ? ? ? 1_555 E HEM .   FE ? ? A TYR 358 A HEM 600 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc2 metalc ? ? F HEM .   FE ? ? ? 1_555 B TYR 358 OH ? ? B HEM 600 B TYR 358 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc3 metalc ? ? G HEM .   FE ? ? ? 1_555 C TYR 358 OH ? ? C HEM 600 C TYR 358 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc4 metalc ? ? H HEM .   FE ? ? ? 1_555 D TYR 358 OH ? ? D HEM 600 D TYR 358 1_555 ? ? ? ? ? ? ? 2.770 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 405 A . ? TYR 405 A PRO 406 A ? PRO 406 A 1 0.18  
2 TYR 405 B . ? TYR 405 B PRO 406 B ? PRO 406 B 1 0.06  
3 TYR 405 C . ? TYR 405 C PRO 406 C ? PRO 406 C 1 -0.19 
4 TYR 405 D . ? TYR 405 D PRO 406 D ? PRO 406 D 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A1 ? 4 ? 
C1 ? 4 ? 
A  ? 9 ? 
B  ? 9 ? 
C  ? 9 ? 
D  ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A1 1 2 ? anti-parallel 
A1 2 3 ? anti-parallel 
A1 3 4 ? anti-parallel 
C1 1 2 ? anti-parallel 
C1 2 3 ? anti-parallel 
C1 3 4 ? anti-parallel 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
A  7 8 ? anti-parallel 
A  8 9 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
B  7 8 ? anti-parallel 
B  8 9 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
C  5 6 ? anti-parallel 
C  6 7 ? anti-parallel 
C  7 8 ? anti-parallel 
C  8 9 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
D  5 6 ? anti-parallel 
D  6 7 ? anti-parallel 
D  7 8 ? anti-parallel 
D  8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A1 1 ILE A 42  ? VAL A 44  ? ILE A 42  VAL A 44  
A1 2 ILE D 423 ? ARG D 431 ? ILE D 423 ARG D 431 
A1 3 ILE C 423 ? ARG C 430 ? ILE C 423 ARG C 430 
A1 4 ILE B 42  ? VAL B 44  ? ILE B 42  VAL B 44  
C1 1 ILE C 42  ? VAL C 44  ? ILE C 42  VAL C 44  
C1 2 ILE B 423 ? ARG B 430 ? ILE B 423 ARG B 430 
C1 3 ILE A 423 ? ARG A 430 ? ILE A 423 ARG A 430 
C1 4 ILE D 42  ? VAL D 44  ? ILE D 42  VAL D 44  
A  1 LYS A 77  ? VAL A 87  ? LYS A 77  VAL A 87  
A  2 LYS A 105 ? THR A 115 ? LYS A 105 THR A 115 
A  3 ARG A 130 ? PHE A 136 ? ARG A 130 PHE A 136 
A  4 TRP A 143 ? ASN A 149 ? TRP A 143 ASN A 149 
A  5 GLY A 214 ? ASN A 224 ? GLY A 214 ASN A 224 
A  6 GLY A 227 ? GLN A 240 ? GLY A 227 GLN A 240 
A  7 PRO A 275 ? MET A 284 ? PRO A 275 MET A 284 
A  8 GLY A 314 ? LEU A 318 ? GLY A 314 LEU A 318 
A  9 LYS A 77  ? VAL A 87  ? LYS A 77  VAL A 87  
B  1 LYS B 77  ? VAL B 87  ? LYS B 77  VAL B 87  
B  2 LYS B 105 ? THR B 115 ? LYS B 105 THR B 115 
B  3 ARG B 130 ? PHE B 136 ? ARG B 130 PHE B 136 
B  4 TRP B 143 ? ASN B 149 ? TRP B 143 ASN B 149 
B  5 GLY B 214 ? ASN B 224 ? GLY B 214 ASN B 224 
B  6 GLY B 227 ? GLN B 240 ? GLY B 227 GLN B 240 
B  7 PRO B 275 ? MET B 284 ? PRO B 275 MET B 284 
B  8 GLY B 314 ? LEU B 318 ? GLY B 314 LEU B 318 
B  9 LYS B 77  ? VAL B 87  ? LYS B 77  VAL B 87  
C  1 LYS C 77  ? VAL C 87  ? LYS C 77  VAL C 87  
C  2 LYS C 105 ? THR C 115 ? LYS C 105 THR C 115 
C  3 ARG C 130 ? PHE C 136 ? ARG C 130 PHE C 136 
C  4 TRP C 143 ? ASN C 149 ? TRP C 143 ASN C 149 
C  5 GLY C 214 ? ASN C 224 ? GLY C 214 ASN C 224 
C  6 GLY C 227 ? GLN C 240 ? GLY C 227 GLN C 240 
C  7 PRO C 275 ? MET C 284 ? PRO C 275 MET C 284 
C  8 GLY C 314 ? LEU C 318 ? GLY C 314 LEU C 318 
C  9 LYS C 77  ? VAL C 87  ? LYS C 77  VAL C 87  
D  1 LYS D 77  ? VAL D 87  ? LYS D 77  VAL D 87  
D  2 LYS D 105 ? THR D 115 ? LYS D 105 THR D 115 
D  3 ARG D 130 ? PHE D 136 ? ARG D 130 PHE D 136 
D  4 TRP D 143 ? ASN D 149 ? TRP D 143 ASN D 149 
D  5 GLY D 214 ? ASN D 224 ? GLY D 214 ASN D 224 
D  6 GLY D 227 ? GLN D 240 ? GLY D 227 GLN D 240 
D  7 PRO D 275 ? MET D 284 ? PRO D 275 MET D 284 
D  8 GLY D 314 ? LEU D 318 ? GLY D 314 LEU D 318 
D  9 LYS D 77  ? VAL D 87  ? LYS D 77  VAL D 87  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A1 1 2 N THR A 43  ? N THR A 43  O ARG D 430 ? O ARG D 430 
A1 2 3 N GLY D 427 ? N GLY D 427 O TYR C 425 ? O TYR C 425 
A1 3 4 O ARG C 430 ? O ARG C 430 N THR B 43  ? N THR B 43  
C1 1 2 N THR C 43  ? N THR C 43  O ARG B 430 ? O ARG B 430 
C1 2 3 O GLY B 427 ? O GLY B 427 N TYR A 425 ? N TYR A 425 
C1 3 4 O ARG A 430 ? O ARG A 430 N THR D 43  ? N THR D 43  
A  1 2 O GLY A 83  ? O GLY A 83  N ILE A 109 ? N ILE A 109 
A  2 3 O ARG A 112 ? O ARG A 112 N ALA A 133 ? N ALA A 133 
A  3 4 O VAL A 134 ? O VAL A 134 N LEU A 145 ? N LEU A 145 
A  4 5 O VAL A 146 ? O VAL A 146 N SER A 217 ? N SER A 217 
A  5 6 O PHE A 220 ? O PHE A 220 N TYR A 231 ? N TYR A 231 
A  6 7 O TYR A 236 ? O TYR A 236 N TYR A 280 ? N TYR A 280 
A  7 8 O TRP A 277 ? O TRP A 277 N LEU A 316 ? N LEU A 316 
A  8 9 O LYS A 315 ? O LYS A 315 N GLU A 86  ? N GLU A 86  
B  1 2 O GLY B 83  ? O GLY B 83  N ILE B 109 ? N ILE B 109 
B  2 3 O ARG B 112 ? O ARG B 112 N ALA B 133 ? N ALA B 133 
B  3 4 O VAL B 134 ? O VAL B 134 N LEU B 145 ? N LEU B 145 
B  4 5 O VAL B 146 ? O VAL B 146 N SER B 217 ? N SER B 217 
B  5 6 O PHE B 220 ? O PHE B 220 N TYR B 231 ? N TYR B 231 
B  6 7 O TYR B 236 ? O TYR B 236 N TYR B 280 ? N TYR B 280 
B  7 8 O TRP B 277 ? O TRP B 277 N LEU B 316 ? N LEU B 316 
B  8 9 O LYS B 315 ? O LYS B 315 N GLU B 86  ? N GLU B 86  
C  1 2 O GLY C 83  ? O GLY C 83  N ILE C 109 ? N ILE C 109 
C  2 3 O ARG C 112 ? O ARG C 112 N ALA C 133 ? N ALA C 133 
C  3 4 O VAL C 134 ? O VAL C 134 N LEU C 145 ? N LEU C 145 
C  4 5 O VAL C 146 ? O VAL C 146 N SER C 217 ? N SER C 217 
C  5 6 O PHE C 220 ? O PHE C 220 N TYR C 231 ? N TYR C 231 
C  6 7 O TYR C 236 ? O TYR C 236 N TYR C 280 ? N TYR C 280 
C  7 8 O TRP C 277 ? O TRP C 277 N LEU C 316 ? N LEU C 316 
C  8 9 O LYS C 315 ? O LYS C 315 N GLU C 86  ? N GLU C 86  
D  1 2 O GLY D 83  ? O GLY D 83  N ILE D 109 ? N ILE D 109 
D  2 3 O ARG D 112 ? O ARG D 112 N ALA D 133 ? N ALA D 133 
D  3 4 O VAL D 134 ? O VAL D 134 N LEU D 145 ? N LEU D 145 
D  4 5 O VAL D 146 ? O VAL D 146 N SER D 217 ? N SER D 217 
D  5 6 O PHE D 220 ? O PHE D 220 N TYR D 231 ? N TYR D 231 
D  6 7 O TYR D 236 ? O TYR D 236 N TYR D 280 ? N TYR D 280 
D  7 8 O TRP D 277 ? O TRP D 277 N LEU D 316 ? N LEU D 316 
D  8 9 O LYS D 315 ? O LYS D 315 N GLU D 86  ? N GLU D 86  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE HEM A 600' 
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE HEM B 600' 
AC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM C 600' 
AC4 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM D 600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 ARG A 72  ? ARG A 72  . ? 1_555 ? 
2  AC1 20 VAL A 73  ? VAL A 73  . ? 1_555 ? 
3  AC1 20 VAL A 74  ? VAL A 74  . ? 1_555 ? 
4  AC1 20 HIS A 75  ? HIS A 75  . ? 1_555 ? 
5  AC1 20 ARG A 112 ? ARG A 112 . ? 1_555 ? 
6  AC1 20 VAL A 146 ? VAL A 146 . ? 1_555 ? 
7  AC1 20 GLY A 147 ? GLY A 147 . ? 1_555 ? 
8  AC1 20 ASN A 148 ? ASN A 148 . ? 1_555 ? 
9  AC1 20 PHE A 153 ? PHE A 153 . ? 1_555 ? 
10 AC1 20 PHE A 161 ? PHE A 161 . ? 1_555 ? 
11 AC1 20 GLY A 216 ? GLY A 216 . ? 1_555 ? 
12 AC1 20 PHE A 334 ? PHE A 334 . ? 1_555 ? 
13 AC1 20 MET A 350 ? MET A 350 . ? 1_555 ? 
14 AC1 20 ARG A 354 ? ARG A 354 . ? 1_555 ? 
15 AC1 20 TYR A 358 ? TYR A 358 . ? 1_555 ? 
16 AC1 20 THR A 361 ? THR A 361 . ? 1_555 ? 
17 AC1 20 HIS A 362 ? HIS A 362 . ? 1_555 ? 
18 AC1 20 ARG A 365 ? ARG A 365 . ? 1_555 ? 
19 AC1 20 HOH I .   ? HOH A 616 . ? 1_555 ? 
20 AC1 20 MET D 61  ? MET D 61  . ? 1_555 ? 
21 AC2 19 ARG B 72  ? ARG B 72  . ? 1_555 ? 
22 AC2 19 VAL B 73  ? VAL B 73  . ? 1_555 ? 
23 AC2 19 VAL B 74  ? VAL B 74  . ? 1_555 ? 
24 AC2 19 HIS B 75  ? HIS B 75  . ? 1_555 ? 
25 AC2 19 ARG B 112 ? ARG B 112 . ? 1_555 ? 
26 AC2 19 VAL B 146 ? VAL B 146 . ? 1_555 ? 
27 AC2 19 ASN B 148 ? ASN B 148 . ? 1_555 ? 
28 AC2 19 PHE B 161 ? PHE B 161 . ? 1_555 ? 
29 AC2 19 GLY B 216 ? GLY B 216 . ? 1_555 ? 
30 AC2 19 PHE B 334 ? PHE B 334 . ? 1_555 ? 
31 AC2 19 MET B 350 ? MET B 350 . ? 1_555 ? 
32 AC2 19 ARG B 354 ? ARG B 354 . ? 1_555 ? 
33 AC2 19 ALA B 357 ? ALA B 357 . ? 1_555 ? 
34 AC2 19 TYR B 358 ? TYR B 358 . ? 1_555 ? 
35 AC2 19 HIS B 362 ? HIS B 362 . ? 1_555 ? 
36 AC2 19 ARG B 365 ? ARG B 365 . ? 1_555 ? 
37 AC2 19 HOH J .   ? HOH B 619 . ? 1_555 ? 
38 AC2 19 HOH J .   ? HOH B 621 . ? 1_555 ? 
39 AC2 19 MET C 61  ? MET C 61  . ? 1_555 ? 
40 AC3 22 ARG C 72  ? ARG C 72  . ? 1_555 ? 
41 AC3 22 VAL C 73  ? VAL C 73  . ? 1_555 ? 
42 AC3 22 VAL C 74  ? VAL C 74  . ? 1_555 ? 
43 AC3 22 HIS C 75  ? HIS C 75  . ? 1_555 ? 
44 AC3 22 ARG C 112 ? ARG C 112 . ? 1_555 ? 
45 AC3 22 GLY C 131 ? GLY C 131 . ? 1_555 ? 
46 AC3 22 PHE C 132 ? PHE C 132 . ? 1_555 ? 
47 AC3 22 VAL C 146 ? VAL C 146 . ? 1_555 ? 
48 AC3 22 GLY C 147 ? GLY C 147 . ? 1_555 ? 
49 AC3 22 ASN C 148 ? ASN C 148 . ? 1_555 ? 
50 AC3 22 PHE C 153 ? PHE C 153 . ? 1_555 ? 
51 AC3 22 PHE C 161 ? PHE C 161 . ? 1_555 ? 
52 AC3 22 GLY C 216 ? GLY C 216 . ? 1_555 ? 
53 AC3 22 PHE C 334 ? PHE C 334 . ? 1_555 ? 
54 AC3 22 MET C 350 ? MET C 350 . ? 1_555 ? 
55 AC3 22 ARG C 354 ? ARG C 354 . ? 1_555 ? 
56 AC3 22 ALA C 357 ? ALA C 357 . ? 1_555 ? 
57 AC3 22 TYR C 358 ? TYR C 358 . ? 1_555 ? 
58 AC3 22 THR C 361 ? THR C 361 . ? 1_555 ? 
59 AC3 22 HIS C 362 ? HIS C 362 . ? 1_555 ? 
60 AC3 22 ARG C 365 ? ARG C 365 . ? 1_555 ? 
61 AC3 22 HOH K .   ? HOH C 627 . ? 1_555 ? 
62 AC4 16 ARG D 72  ? ARG D 72  . ? 1_555 ? 
63 AC4 16 VAL D 73  ? VAL D 73  . ? 1_555 ? 
64 AC4 16 VAL D 74  ? VAL D 74  . ? 1_555 ? 
65 AC4 16 HIS D 75  ? HIS D 75  . ? 1_555 ? 
66 AC4 16 ARG D 112 ? ARG D 112 . ? 1_555 ? 
67 AC4 16 VAL D 146 ? VAL D 146 . ? 1_555 ? 
68 AC4 16 GLY D 147 ? GLY D 147 . ? 1_555 ? 
69 AC4 16 ASN D 148 ? ASN D 148 . ? 1_555 ? 
70 AC4 16 PHE D 161 ? PHE D 161 . ? 1_555 ? 
71 AC4 16 PHE D 334 ? PHE D 334 . ? 1_555 ? 
72 AC4 16 MET D 350 ? MET D 350 . ? 1_555 ? 
73 AC4 16 ARG D 354 ? ARG D 354 . ? 1_555 ? 
74 AC4 16 TYR D 358 ? TYR D 358 . ? 1_555 ? 
75 AC4 16 THR D 361 ? THR D 361 . ? 1_555 ? 
76 AC4 16 HIS D 362 ? HIS D 362 . ? 1_555 ? 
77 AC4 16 ARG D 365 ? ARG D 365 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QQW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QQW 
_atom_sites.fract_transf_matrix[1][1]   0.011778 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007058 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004302 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 4   ? 0.604   13.354  112.838 1.00 14.04 ? 4   SER A N   1 
ATOM   2     C  CA  . SER A 1 4   ? 2.095   13.329  112.773 1.00 14.04 ? 4   SER A CA  1 
ATOM   3     C  C   . SER A 1 4   ? 2.650   14.737  112.538 1.00 14.15 ? 4   SER A C   1 
ATOM   4     O  O   . SER A 1 4   ? 2.707   15.552  113.464 1.00 14.33 ? 4   SER A O   1 
ATOM   5     C  CB  . SER A 1 4   ? 2.557   12.386  111.651 1.00 13.82 ? 4   SER A CB  1 
ATOM   6     O  OG  . SER A 1 4   ? 2.575   11.037  112.093 1.00 13.21 ? 4   SER A OG  1 
ATOM   7     N  N   . ARG A 1 5   ? 3.057   15.021  111.302 1.00 13.98 ? 5   ARG A N   1 
ATOM   8     C  CA  . ARG A 1 5   ? 3.597   16.334  110.967 1.00 13.64 ? 5   ARG A CA  1 
ATOM   9     C  C   . ARG A 1 5   ? 2.755   17.034  109.903 1.00 13.61 ? 5   ARG A C   1 
ATOM   10    O  O   . ARG A 1 5   ? 1.715   16.522  109.478 1.00 13.29 ? 5   ARG A O   1 
ATOM   11    C  CB  . ARG A 1 5   ? 5.047   16.206  110.479 1.00 13.83 ? 5   ARG A CB  1 
ATOM   12    C  CG  . ARG A 1 5   ? 5.737   14.907  110.878 1.00 13.91 ? 5   ARG A CG  1 
ATOM   13    C  CD  . ARG A 1 5   ? 5.995   14.020  109.661 1.00 13.87 ? 5   ARG A CD  1 
ATOM   14    N  NE  . ARG A 1 5   ? 7.415   13.940  109.320 1.00 13.50 ? 5   ARG A NE  1 
ATOM   15    C  CZ  . ARG A 1 5   ? 7.883   13.478  108.162 1.00 13.25 ? 5   ARG A CZ  1 
ATOM   16    N  NH1 . ARG A 1 5   ? 7.045   13.053  107.228 1.00 12.67 ? 5   ARG A NH1 1 
ATOM   17    N  NH2 . ARG A 1 5   ? 9.191   13.434  107.942 1.00 13.30 ? 5   ARG A NH2 1 
ATOM   18    N  N   . ASP A 1 6   ? 3.212   18.208  109.474 1.00 13.80 ? 6   ASP A N   1 
ATOM   19    C  CA  . ASP A 1 6   ? 2.505   18.985  108.455 1.00 14.09 ? 6   ASP A CA  1 
ATOM   20    C  C   . ASP A 1 6   ? 2.466   18.256  107.111 1.00 14.22 ? 6   ASP A C   1 
ATOM   21    O  O   . ASP A 1 6   ? 3.407   17.551  106.744 1.00 14.36 ? 6   ASP A O   1 
ATOM   22    C  CB  . ASP A 1 6   ? 3.160   20.358  108.277 1.00 13.97 ? 6   ASP A CB  1 
ATOM   23    C  CG  . ASP A 1 6   ? 4.599   20.258  107.836 1.00 14.07 ? 6   ASP A CG  1 
ATOM   24    O  OD1 . ASP A 1 6   ? 5.074   21.176  107.138 1.00 14.33 ? 6   ASP A OD1 1 
ATOM   25    O  OD2 . ASP A 1 6   ? 5.256   19.258  108.187 1.00 14.12 ? 6   ASP A OD2 1 
ATOM   26    N  N   . PRO A 1 7   ? 1.374   18.432  106.355 1.00 14.38 ? 7   PRO A N   1 
ATOM   27    C  CA  . PRO A 1 7   ? 1.193   17.792  105.045 1.00 14.38 ? 7   PRO A CA  1 
ATOM   28    C  C   . PRO A 1 7   ? 2.375   17.963  104.097 1.00 14.32 ? 7   PRO A C   1 
ATOM   29    O  O   . PRO A 1 7   ? 2.630   17.106  103.249 1.00 14.31 ? 7   PRO A O   1 
ATOM   30    C  CB  . PRO A 1 7   ? -0.085  18.439  104.491 1.00 14.65 ? 7   PRO A CB  1 
ATOM   31    C  CG  . PRO A 1 7   ? -0.343  19.639  105.371 1.00 14.73 ? 7   PRO A CG  1 
ATOM   32    C  CD  . PRO A 1 7   ? 0.229   19.288  106.709 1.00 14.65 ? 7   PRO A CD  1 
ATOM   33    N  N   . ALA A 1 8   ? 3.087   19.076  104.246 1.00 14.33 ? 8   ALA A N   1 
ATOM   34    C  CA  . ALA A 1 8   ? 4.240   19.377  103.402 1.00 14.05 ? 8   ALA A CA  1 
ATOM   35    C  C   . ALA A 1 8   ? 5.422   18.456  103.693 1.00 14.00 ? 8   ALA A C   1 
ATOM   36    O  O   . ALA A 1 8   ? 6.169   18.083  102.785 1.00 14.19 ? 8   ALA A O   1 
ATOM   37    C  CB  . ALA A 1 8   ? 4.656   20.834  103.587 1.00 13.78 ? 8   ALA A CB  1 
ATOM   38    N  N   . SER A 1 9   ? 5.583   18.084  104.957 1.00 13.72 ? 9   SER A N   1 
ATOM   39    C  CA  . SER A 1 9   ? 6.686   17.221  105.353 1.00 13.66 ? 9   SER A CA  1 
ATOM   40    C  C   . SER A 1 9   ? 6.436   15.765  104.989 1.00 13.80 ? 9   SER A C   1 
ATOM   41    O  O   . SER A 1 9   ? 7.379   15.012  104.714 1.00 13.77 ? 9   SER A O   1 
ATOM   42    C  CB  . SER A 1 9   ? 6.934   17.352  106.857 1.00 13.27 ? 9   SER A CB  1 
ATOM   43    O  OG  . SER A 1 9   ? 7.460   18.635  107.158 1.00 12.47 ? 9   SER A OG  1 
ATOM   44    N  N   . ASP A 1 10  ? 5.163   15.377  104.984 1.00 14.08 ? 10  ASP A N   1 
ATOM   45    C  CA  . ASP A 1 10  ? 4.776   14.008  104.657 1.00 14.06 ? 10  ASP A CA  1 
ATOM   46    C  C   . ASP A 1 10  ? 4.408   13.867  103.191 1.00 13.88 ? 10  ASP A C   1 
ATOM   47    O  O   . ASP A 1 10  ? 3.379   13.273  102.860 1.00 13.98 ? 10  ASP A O   1 
ATOM   48    C  CB  . ASP A 1 10  ? 3.592   13.570  105.516 1.00 14.37 ? 10  ASP A CB  1 
ATOM   49    C  CG  . ASP A 1 10  ? 3.904   13.609  106.992 1.00 14.77 ? 10  ASP A CG  1 
ATOM   50    O  OD1 . ASP A 1 10  ? 3.426   14.542  107.670 1.00 15.34 ? 10  ASP A OD1 1 
ATOM   51    O  OD2 . ASP A 1 10  ? 4.625   12.709  107.475 1.00 14.64 ? 10  ASP A OD2 1 
ATOM   52    N  N   . GLN A 1 11  ? 5.236   14.423  102.315 1.00 13.37 ? 11  GLN A N   1 
ATOM   53    C  CA  . GLN A 1 11  ? 4.975   14.324  100.890 1.00 13.21 ? 11  GLN A CA  1 
ATOM   54    C  C   . GLN A 1 11  ? 5.208   12.875  100.486 1.00 13.34 ? 11  GLN A C   1 
ATOM   55    O  O   . GLN A 1 11  ? 4.261   12.130  100.215 1.00 13.23 ? 11  GLN A O   1 
ATOM   56    C  CB  . GLN A 1 11  ? 5.914   15.240  100.109 1.00 12.91 ? 11  GLN A CB  1 
ATOM   57    C  CG  . GLN A 1 11  ? 5.498   15.463  98.670  1.00 12.89 ? 11  GLN A CG  1 
ATOM   58    C  CD  . GLN A 1 11  ? 5.910   14.324  97.751  1.00 13.10 ? 11  GLN A CD  1 
ATOM   59    O  OE1 . GLN A 1 11  ? 7.018   13.782  97.856  1.00 13.04 ? 11  GLN A OE1 1 
ATOM   60    N  NE2 . GLN A 1 11  ? 5.017   13.955  96.839  1.00 13.54 ? 11  GLN A NE2 1 
ATOM   61    N  N   . MET A 1 12  ? 6.475   12.475  100.471 1.00 13.43 ? 12  MET A N   1 
ATOM   62    C  CA  . MET A 1 12  ? 6.854   11.115  100.100 1.00 13.59 ? 12  MET A CA  1 
ATOM   63    C  C   . MET A 1 12  ? 5.935   10.088  100.738 1.00 13.62 ? 12  MET A C   1 
ATOM   64    O  O   . MET A 1 12  ? 5.522   9.130   100.089 1.00 13.89 ? 12  MET A O   1 
ATOM   65    C  CB  . MET A 1 12  ? 8.296   10.827  100.523 1.00 13.64 ? 12  MET A CB  1 
ATOM   66    C  CG  . MET A 1 12  ? 9.341   11.299  99.527  1.00 13.79 ? 12  MET A CG  1 
ATOM   67    S  SD  . MET A 1 12  ? 11.008  10.717  99.924  1.00 14.03 ? 12  MET A SD  1 
ATOM   68    C  CE  . MET A 1 12  ? 11.068  11.058  101.665 1.00 13.96 ? 12  MET A CE  1 
ATOM   69    N  N   . GLN A 1 13  ? 5.612   10.293  102.008 1.00 13.65 ? 13  GLN A N   1 
ATOM   70    C  CA  . GLN A 1 13  ? 4.747   9.367   102.722 1.00 13.72 ? 13  GLN A CA  1 
ATOM   71    C  C   . GLN A 1 13  ? 3.380   9.203   102.048 1.00 13.83 ? 13  GLN A C   1 
ATOM   72    O  O   . GLN A 1 13  ? 2.959   8.079   101.743 1.00 13.52 ? 13  GLN A O   1 
ATOM   73    C  CB  . GLN A 1 13  ? 4.569   9.829   104.176 1.00 13.45 ? 13  GLN A CB  1 
ATOM   74    C  CG  . GLN A 1 13  ? 3.919   8.785   105.094 1.00 13.17 ? 13  GLN A CG  1 
ATOM   75    C  CD  . GLN A 1 13  ? 4.506   7.380   104.930 1.00 12.97 ? 13  GLN A CD  1 
ATOM   76    O  OE1 . GLN A 1 13  ? 3.775   6.389   104.903 1.00 12.59 ? 13  GLN A OE1 1 
ATOM   77    N  NE2 . GLN A 1 13  ? 5.828   7.297   104.826 1.00 12.91 ? 13  GLN A NE2 1 
ATOM   78    N  N   . HIS A 1 14  ? 2.691   10.317  101.815 1.00 13.97 ? 14  HIS A N   1 
ATOM   79    C  CA  . HIS A 1 14  ? 1.373   10.275  101.187 1.00 14.42 ? 14  HIS A CA  1 
ATOM   80    C  C   . HIS A 1 14  ? 1.425   9.723   99.768  1.00 14.56 ? 14  HIS A C   1 
ATOM   81    O  O   . HIS A 1 14  ? 0.484   9.062   99.314  1.00 14.59 ? 14  HIS A O   1 
ATOM   82    C  CB  . HIS A 1 14  ? 0.746   11.668  101.165 1.00 14.88 ? 14  HIS A CB  1 
ATOM   83    C  CG  . HIS A 1 14  ? 0.285   12.140  102.507 1.00 15.37 ? 14  HIS A CG  1 
ATOM   84    N  ND1 . HIS A 1 14  ? 0.297   13.468  102.875 1.00 15.61 ? 14  HIS A ND1 1 
ATOM   85    C  CD2 . HIS A 1 14  ? -0.183  11.456  103.578 1.00 15.48 ? 14  HIS A CD2 1 
ATOM   86    C  CE1 . HIS A 1 14  ? -0.141  13.582  104.116 1.00 15.78 ? 14  HIS A CE1 1 
ATOM   87    N  NE2 . HIS A 1 14  ? -0.439  12.376  104.565 1.00 15.71 ? 14  HIS A NE2 1 
ATOM   88    N  N   . TRP A 1 15  ? 2.516   10.004  99.060  1.00 14.30 ? 15  TRP A N   1 
ATOM   89    C  CA  . TRP A 1 15  ? 2.666   9.500   97.703  1.00 13.98 ? 15  TRP A CA  1 
ATOM   90    C  C   . TRP A 1 15  ? 2.710   7.982   97.793  1.00 13.88 ? 15  TRP A C   1 
ATOM   91    O  O   . TRP A 1 15  ? 2.028   7.282   97.044  1.00 14.01 ? 15  TRP A O   1 
ATOM   92    C  CB  . TRP A 1 15  ? 3.956   10.019  97.064  1.00 13.82 ? 15  TRP A CB  1 
ATOM   93    C  CG  . TRP A 1 15  ? 4.082   9.619   95.626  1.00 13.59 ? 15  TRP A CG  1 
ATOM   94    C  CD1 . TRP A 1 15  ? 3.645   10.319  94.537  1.00 13.31 ? 15  TRP A CD1 1 
ATOM   95    C  CD2 . TRP A 1 15  ? 4.659   8.408   95.118  1.00 13.61 ? 15  TRP A CD2 1 
ATOM   96    N  NE1 . TRP A 1 15  ? 3.913   9.620   93.386  1.00 13.36 ? 15  TRP A NE1 1 
ATOM   97    C  CE2 . TRP A 1 15  ? 4.534   8.443   93.713  1.00 13.61 ? 15  TRP A CE2 1 
ATOM   98    C  CE3 . TRP A 1 15  ? 5.268   7.295   95.716  1.00 13.91 ? 15  TRP A CE3 1 
ATOM   99    C  CZ2 . TRP A 1 15  ? 4.997   7.406   92.891  1.00 13.82 ? 15  TRP A CZ2 1 
ATOM   100   C  CZ3 . TRP A 1 15  ? 5.729   6.262   94.897  1.00 14.12 ? 15  TRP A CZ3 1 
ATOM   101   C  CH2 . TRP A 1 15  ? 5.589   6.327   93.501  1.00 14.09 ? 15  TRP A CH2 1 
ATOM   102   N  N   . LYS A 1 16  ? 3.512   7.485   98.729  1.00 13.78 ? 16  LYS A N   1 
ATOM   103   C  CA  . LYS A 1 16  ? 3.646   6.053   98.949  1.00 13.77 ? 16  LYS A CA  1 
ATOM   104   C  C   . LYS A 1 16  ? 2.296   5.471   99.361  1.00 13.57 ? 16  LYS A C   1 
ATOM   105   O  O   . LYS A 1 16  ? 1.925   4.379   98.933  1.00 13.54 ? 16  LYS A O   1 
ATOM   106   C  CB  . LYS A 1 16  ? 4.691   5.786   100.042 1.00 13.74 ? 16  LYS A CB  1 
ATOM   107   C  CG  . LYS A 1 16  ? 4.422   4.556   100.903 1.00 13.82 ? 16  LYS A CG  1 
ATOM   108   C  CD  . LYS A 1 16  ? 5.718   3.921   101.381 1.00 14.11 ? 16  LYS A CD  1 
ATOM   109   C  CE  . LYS A 1 16  ? 5.598   2.405   101.434 1.00 14.17 ? 16  LYS A CE  1 
ATOM   110   N  NZ  . LYS A 1 16  ? 6.314   1.827   102.608 1.00 14.52 ? 16  LYS A NZ  1 
ATOM   111   N  N   . GLU A 1 17  ? 1.560   6.205   100.189 1.00 13.52 ? 17  GLU A N   1 
ATOM   112   C  CA  . GLU A 1 17  ? 0.258   5.740   100.651 1.00 13.71 ? 17  GLU A CA  1 
ATOM   113   C  C   . GLU A 1 17  ? -0.742  5.617   99.508  1.00 13.81 ? 17  GLU A C   1 
ATOM   114   O  O   . GLU A 1 17  ? -1.710  4.861   99.600  1.00 13.78 ? 17  GLU A O   1 
ATOM   115   C  CB  . GLU A 1 17  ? -0.294  6.686   101.716 1.00 13.64 ? 17  GLU A CB  1 
ATOM   116   C  CG  . GLU A 1 17  ? -0.665  5.999   103.022 1.00 13.47 ? 17  GLU A CG  1 
ATOM   117   C  CD  . GLU A 1 17  ? 0.122   6.527   104.213 1.00 13.39 ? 17  GLU A CD  1 
ATOM   118   O  OE1 . GLU A 1 17  ? 0.006   7.738   104.517 1.00 13.02 ? 17  GLU A OE1 1 
ATOM   119   O  OE2 . GLU A 1 17  ? 0.851   5.727   104.843 1.00 13.45 ? 17  GLU A OE2 1 
ATOM   120   N  N   . GLN A 1 18  ? -0.499  6.358   98.430  1.00 14.20 ? 18  GLN A N   1 
ATOM   121   C  CA  . GLN A 1 18  ? -1.379  6.342   97.263  1.00 14.38 ? 18  GLN A CA  1 
ATOM   122   C  C   . GLN A 1 18  ? -1.213  5.060   96.453  1.00 14.61 ? 18  GLN A C   1 
ATOM   123   O  O   . GLN A 1 18  ? -2.122  4.644   95.726  1.00 14.83 ? 18  GLN A O   1 
ATOM   124   C  CB  . GLN A 1 18  ? -1.093  7.550   96.374  1.00 14.23 ? 18  GLN A CB  1 
ATOM   125   C  CG  . GLN A 1 18  ? -1.935  8.773   96.702  1.00 14.00 ? 18  GLN A CG  1 
ATOM   126   C  CD  . GLN A 1 18  ? -1.602  9.957   95.810  1.00 13.85 ? 18  GLN A CD  1 
ATOM   127   O  OE1 . GLN A 1 18  ? -2.395  10.888  95.676  1.00 13.95 ? 18  GLN A OE1 1 
ATOM   128   N  NE2 . GLN A 1 18  ? -0.421  9.925   95.196  1.00 13.56 ? 18  GLN A NE2 1 
ATOM   129   N  N   . ARG A 1 19  ? -0.043  4.444   96.575  1.00 14.63 ? 19  ARG A N   1 
ATOM   130   C  CA  . ARG A 1 19  ? 0.240   3.202   95.874  1.00 14.62 ? 19  ARG A CA  1 
ATOM   131   C  C   . ARG A 1 19  ? -0.113  2.036   96.796  1.00 14.76 ? 19  ARG A C   1 
ATOM   132   O  O   . ARG A 1 19  ? 0.765   1.444   97.430  1.00 14.73 ? 19  ARG A O   1 
ATOM   133   C  CB  . ARG A 1 19  ? 1.726   3.125   95.491  1.00 14.72 ? 19  ARG A CB  1 
ATOM   134   C  CG  . ARG A 1 19  ? 2.284   4.364   94.791  1.00 14.86 ? 19  ARG A CG  1 
ATOM   135   C  CD  . ARG A 1 19  ? 1.393   4.827   93.645  1.00 15.23 ? 19  ARG A CD  1 
ATOM   136   N  NE  . ARG A 1 19  ? 0.934   6.199   93.850  1.00 15.94 ? 19  ARG A NE  1 
ATOM   137   C  CZ  . ARG A 1 19  ? 1.080   7.185   92.965  1.00 16.35 ? 19  ARG A CZ  1 
ATOM   138   N  NH1 . ARG A 1 19  ? 1.680   6.956   91.797  1.00 16.79 ? 19  ARG A NH1 1 
ATOM   139   N  NH2 . ARG A 1 19  ? 0.636   8.406   93.251  1.00 16.45 ? 19  ARG A NH2 1 
ATOM   140   N  N   . ALA A 1 20  ? -1.400  1.716   96.871  1.00 14.63 ? 20  ALA A N   1 
ATOM   141   C  CA  . ALA A 1 20  ? -1.874  0.626   97.715  1.00 14.72 ? 20  ALA A CA  1 
ATOM   142   C  C   . ALA A 1 20  ? -1.133  -0.682  97.439  1.00 14.75 ? 20  ALA A C   1 
ATOM   143   O  O   . ALA A 1 20  ? 0.015   -0.863  97.860  1.00 14.66 ? 20  ALA A O   1 
ATOM   144   C  CB  . ALA A 1 20  ? -3.379  0.426   97.515  1.00 14.63 ? 20  ALA A CB  1 
ATOM   145   N  N   . ALA A 1 21  ? -1.797  -1.594  96.735  1.00 14.83 ? 21  ALA A N   1 
ATOM   146   C  CA  . ALA A 1 21  ? -1.203  -2.890  96.413  1.00 15.07 ? 21  ALA A CA  1 
ATOM   147   C  C   . ALA A 1 21  ? -0.418  -2.823  95.107  1.00 15.18 ? 21  ALA A C   1 
ATOM   148   O  O   . ALA A 1 21  ? 0.202   -3.806  94.688  1.00 15.46 ? 21  ALA A O   1 
ATOM   149   C  CB  . ALA A 1 21  ? -2.293  -3.960  96.314  1.00 14.99 ? 21  ALA A CB  1 
ATOM   150   N  N   . GLN A 1 22  ? -0.452  -1.662  94.460  1.00 15.21 ? 22  GLN A N   1 
ATOM   151   C  CA  . GLN A 1 22  ? 0.260   -1.487  93.206  1.00 14.75 ? 22  GLN A CA  1 
ATOM   152   C  C   . GLN A 1 22  ? 1.722   -1.773  93.455  1.00 14.57 ? 22  GLN A C   1 
ATOM   153   O  O   . GLN A 1 22  ? 2.287   -1.305  94.443  1.00 14.71 ? 22  GLN A O   1 
ATOM   154   C  CB  . GLN A 1 22  ? 0.115   -0.055  92.685  1.00 14.74 ? 22  GLN A CB  1 
ATOM   155   C  CG  . GLN A 1 22  ? -0.437  0.917   93.696  1.00 14.93 ? 22  GLN A CG  1 
ATOM   156   C  CD  . GLN A 1 22  ? -1.855  1.344   93.360  1.00 15.15 ? 22  GLN A CD  1 
ATOM   157   O  OE1 . GLN A 1 22  ? -2.554  0.662   92.603  1.00 15.39 ? 22  GLN A OE1 1 
ATOM   158   N  NE2 . GLN A 1 22  ? -2.289  2.477   93.919  1.00 15.35 ? 22  GLN A NE2 1 
ATOM   159   N  N   . LYS A 1 23  ? 2.322   -2.555  92.565  1.00 14.68 ? 23  LYS A N   1 
ATOM   160   C  CA  . LYS A 1 23  ? 3.735   -2.883  92.670  1.00 14.56 ? 23  LYS A CA  1 
ATOM   161   C  C   . LYS A 1 23  ? 4.521   -1.719  92.069  1.00 14.46 ? 23  LYS A C   1 
ATOM   162   O  O   . LYS A 1 23  ? 3.965   -0.897  91.333  1.00 14.22 ? 23  LYS A O   1 
ATOM   163   C  CB  . LYS A 1 23  ? 4.039   -4.175  91.909  1.00 14.66 ? 23  LYS A CB  1 
ATOM   164   C  CG  . LYS A 1 23  ? 5.157   -4.999  92.527  1.00 14.98 ? 23  LYS A CG  1 
ATOM   165   C  CD  . LYS A 1 23  ? 6.474   -4.754  91.806  1.00 15.11 ? 23  LYS A CD  1 
ATOM   166   C  CE  . LYS A 1 23  ? 7.595   -4.417  92.778  1.00 15.24 ? 23  LYS A CE  1 
ATOM   167   N  NZ  . LYS A 1 23  ? 8.908   -4.962  92.311  1.00 15.12 ? 23  LYS A NZ  1 
ATOM   168   N  N   . ALA A 1 24  ? 5.807   -1.644  92.387  1.00 14.41 ? 24  ALA A N   1 
ATOM   169   C  CA  . ALA A 1 24  ? 6.641   -0.565  91.877  1.00 14.47 ? 24  ALA A CA  1 
ATOM   170   C  C   . ALA A 1 24  ? 6.841   -0.666  90.364  1.00 14.44 ? 24  ALA A C   1 
ATOM   171   O  O   . ALA A 1 24  ? 7.033   -1.754  89.824  1.00 14.59 ? 24  ALA A O   1 
ATOM   172   C  CB  . ALA A 1 24  ? 7.992   -0.574  92.588  1.00 14.68 ? 24  ALA A CB  1 
ATOM   173   N  N   . ASP A 1 25  ? 6.782   0.474   89.687  1.00 13.95 ? 25  ASP A N   1 
ATOM   174   C  CA  . ASP A 1 25  ? 6.979   0.526   88.246  1.00 13.55 ? 25  ASP A CA  1 
ATOM   175   C  C   . ASP A 1 25  ? 8.390   0.024   87.941  1.00 13.26 ? 25  ASP A C   1 
ATOM   176   O  O   . ASP A 1 25  ? 9.276   0.097   88.791  1.00 13.14 ? 25  ASP A O   1 
ATOM   177   C  CB  . ASP A 1 25  ? 6.845   1.969   87.751  1.00 13.65 ? 25  ASP A CB  1 
ATOM   178   C  CG  . ASP A 1 25  ? 5.413   2.359   87.445  1.00 13.63 ? 25  ASP A CG  1 
ATOM   179   O  OD1 . ASP A 1 25  ? 4.978   2.175   86.286  1.00 13.75 ? 25  ASP A OD1 1 
ATOM   180   O  OD2 . ASP A 1 25  ? 4.723   2.855   88.360  1.00 13.73 ? 25  ASP A OD2 1 
ATOM   181   N  N   . VAL A 1 26  ? 8.601   -0.479  86.731  1.00 13.12 ? 26  VAL A N   1 
ATOM   182   C  CA  . VAL A 1 26  ? 9.918   -0.969  86.336  1.00 12.96 ? 26  VAL A CA  1 
ATOM   183   C  C   . VAL A 1 26  ? 10.816  0.201   85.923  1.00 13.12 ? 26  VAL A C   1 
ATOM   184   O  O   . VAL A 1 26  ? 10.440  1.032   85.087  1.00 13.35 ? 26  VAL A O   1 
ATOM   185   C  CB  . VAL A 1 26  ? 9.816   -1.955  85.158  1.00 12.71 ? 26  VAL A CB  1 
ATOM   186   C  CG1 . VAL A 1 26  ? 11.196  -2.497  84.814  1.00 12.69 ? 26  VAL A CG1 1 
ATOM   187   C  CG2 . VAL A 1 26  ? 8.875   -3.086  85.513  1.00 12.16 ? 26  VAL A CG2 1 
ATOM   188   N  N   . LEU A 1 27  ? 12.004  0.255   86.515  1.00 12.94 ? 27  LEU A N   1 
ATOM   189   C  CA  . LEU A 1 27  ? 12.971  1.315   86.240  1.00 12.90 ? 27  LEU A CA  1 
ATOM   190   C  C   . LEU A 1 27  ? 13.596  1.218   84.845  1.00 12.74 ? 27  LEU A C   1 
ATOM   191   O  O   . LEU A 1 27  ? 14.390  0.314   84.575  1.00 12.59 ? 27  LEU A O   1 
ATOM   192   C  CB  . LEU A 1 27  ? 14.070  1.281   87.304  1.00 12.82 ? 27  LEU A CB  1 
ATOM   193   C  CG  . LEU A 1 27  ? 15.194  2.311   87.220  1.00 12.80 ? 27  LEU A CG  1 
ATOM   194   C  CD1 . LEU A 1 27  ? 14.601  3.688   87.054  1.00 12.69 ? 27  LEU A CD1 1 
ATOM   195   C  CD2 . LEU A 1 27  ? 16.050  2.239   88.481  1.00 12.98 ? 27  LEU A CD2 1 
ATOM   196   N  N   . THR A 1 28  ? 13.243  2.157   83.969  1.00 12.54 ? 28  THR A N   1 
ATOM   197   C  CA  . THR A 1 28  ? 13.769  2.179   82.603  1.00 12.59 ? 28  THR A CA  1 
ATOM   198   C  C   . THR A 1 28  ? 14.773  3.302   82.371  1.00 12.69 ? 28  THR A C   1 
ATOM   199   O  O   . THR A 1 28  ? 15.020  4.140   83.248  1.00 12.71 ? 28  THR A O   1 
ATOM   200   C  CB  . THR A 1 28  ? 12.648  2.367   81.548  1.00 12.59 ? 28  THR A CB  1 
ATOM   201   O  OG1 . THR A 1 28  ? 12.390  3.768   81.365  1.00 12.09 ? 28  THR A OG1 1 
ATOM   202   C  CG2 . THR A 1 28  ? 11.370  1.672   81.982  1.00 12.96 ? 28  THR A CG2 1 
ATOM   203   N  N   . THR A 1 29  ? 15.344  3.313   81.172  1.00 12.50 ? 29  THR A N   1 
ATOM   204   C  CA  . THR A 1 29  ? 16.300  4.334   80.790  1.00 12.38 ? 29  THR A CA  1 
ATOM   205   C  C   . THR A 1 29  ? 15.489  5.502   80.256  1.00 12.27 ? 29  THR A C   1 
ATOM   206   O  O   . THR A 1 29  ? 14.318  5.648   80.595  1.00 12.49 ? 29  THR A O   1 
ATOM   207   C  CB  . THR A 1 29  ? 17.244  3.822   79.693  1.00 12.36 ? 29  THR A CB  1 
ATOM   208   O  OG1 . THR A 1 29  ? 16.484  3.448   78.537  1.00 12.17 ? 29  THR A OG1 1 
ATOM   209   C  CG2 . THR A 1 29  ? 18.015  2.612   80.193  1.00 12.28 ? 29  THR A CG2 1 
ATOM   210   N  N   . GLY A 1 30  ? 16.104  6.331   79.424  1.00 12.14 ? 30  GLY A N   1 
ATOM   211   C  CA  . GLY A 1 30  ? 15.382  7.459   78.870  1.00 11.94 ? 30  GLY A CA  1 
ATOM   212   C  C   . GLY A 1 30  ? 14.474  7.033   77.732  1.00 11.61 ? 30  GLY A C   1 
ATOM   213   O  O   . GLY A 1 30  ? 13.330  7.476   77.639  1.00 11.55 ? 30  GLY A O   1 
ATOM   214   N  N   . ALA A 1 31  ? 14.990  6.158   76.872  1.00 11.41 ? 31  ALA A N   1 
ATOM   215   C  CA  . ALA A 1 31  ? 14.249  5.665   75.716  1.00 11.36 ? 31  ALA A CA  1 
ATOM   216   C  C   . ALA A 1 31  ? 13.189  4.611   76.041  1.00 11.20 ? 31  ALA A C   1 
ATOM   217   O  O   . ALA A 1 31  ? 12.457  4.175   75.152  1.00 10.82 ? 31  ALA A O   1 
ATOM   218   C  CB  . ALA A 1 31  ? 15.227  5.118   74.676  1.00 11.52 ? 31  ALA A CB  1 
ATOM   219   N  N   . GLY A 1 32  ? 13.116  4.195   77.302  1.00 11.14 ? 32  GLY A N   1 
ATOM   220   C  CA  . GLY A 1 32  ? 12.126  3.208   77.693  1.00 11.41 ? 32  GLY A CA  1 
ATOM   221   C  C   . GLY A 1 32  ? 12.667  1.819   77.980  1.00 11.66 ? 32  GLY A C   1 
ATOM   222   O  O   . GLY A 1 32  ? 11.931  0.941   78.433  1.00 11.67 ? 32  GLY A O   1 
ATOM   223   N  N   . ASN A 1 33  ? 13.951  1.609   77.719  1.00 11.94 ? 33  ASN A N   1 
ATOM   224   C  CA  . ASN A 1 33  ? 14.565  0.307   77.960  1.00 12.34 ? 33  ASN A CA  1 
ATOM   225   C  C   . ASN A 1 33  ? 14.761  0.064   79.457  1.00 12.48 ? 33  ASN A C   1 
ATOM   226   O  O   . ASN A 1 33  ? 15.216  0.944   80.188  1.00 12.49 ? 33  ASN A O   1 
ATOM   227   C  CB  . ASN A 1 33  ? 15.909  0.215   77.233  1.00 12.30 ? 33  ASN A CB  1 
ATOM   228   C  CG  . ASN A 1 33  ? 15.856  0.803   75.839  1.00 12.34 ? 33  ASN A CG  1 
ATOM   229   O  OD1 . ASN A 1 33  ? 16.868  1.242   75.306  1.00 12.60 ? 33  ASN A OD1 1 
ATOM   230   N  ND2 . ASN A 1 33  ? 14.673  0.814   75.243  1.00 12.24 ? 33  ASN A ND2 1 
ATOM   231   N  N   . PRO A 1 34  ? 14.414  -1.143  79.929  1.00 12.58 ? 34  PRO A N   1 
ATOM   232   C  CA  . PRO A 1 34  ? 14.554  -1.490  81.347  1.00 12.43 ? 34  PRO A CA  1 
ATOM   233   C  C   . PRO A 1 34  ? 16.003  -1.512  81.828  1.00 12.40 ? 34  PRO A C   1 
ATOM   234   O  O   . PRO A 1 34  ? 16.924  -1.724  81.041  1.00 12.37 ? 34  PRO A O   1 
ATOM   235   C  CB  . PRO A 1 34  ? 13.888  -2.863  81.452  1.00 12.80 ? 34  PRO A CB  1 
ATOM   236   C  CG  . PRO A 1 34  ? 13.981  -3.430  80.077  1.00 12.93 ? 34  PRO A CG  1 
ATOM   237   C  CD  . PRO A 1 34  ? 13.866  -2.260  79.140  1.00 12.79 ? 34  PRO A CD  1 
ATOM   238   N  N   . VAL A 1 35  ? 16.188  -1.286  83.126  1.00 12.38 ? 35  VAL A N   1 
ATOM   239   C  CA  . VAL A 1 35  ? 17.512  -1.269  83.746  1.00 12.22 ? 35  VAL A CA  1 
ATOM   240   C  C   . VAL A 1 35  ? 17.671  -2.472  84.669  1.00 12.12 ? 35  VAL A C   1 
ATOM   241   O  O   . VAL A 1 35  ? 16.819  -2.727  85.516  1.00 12.03 ? 35  VAL A O   1 
ATOM   242   C  CB  . VAL A 1 35  ? 17.717  0.016   84.580  1.00 12.14 ? 35  VAL A CB  1 
ATOM   243   C  CG1 . VAL A 1 35  ? 19.195  0.213   84.893  1.00 12.18 ? 35  VAL A CG1 1 
ATOM   244   C  CG2 . VAL A 1 35  ? 17.169  1.205   83.833  1.00 12.15 ? 35  VAL A CG2 1 
ATOM   245   N  N   . GLY A 1 36  ? 18.764  -3.207  84.508  1.00 12.19 ? 36  GLY A N   1 
ATOM   246   C  CA  . GLY A 1 36  ? 18.988  -4.376  85.340  1.00 12.48 ? 36  GLY A CA  1 
ATOM   247   C  C   . GLY A 1 36  ? 19.523  -4.008  86.705  1.00 12.46 ? 36  GLY A C   1 
ATOM   248   O  O   . GLY A 1 36  ? 19.105  -4.564  87.722  1.00 12.68 ? 36  GLY A O   1 
ATOM   249   N  N   . ASP A 1 37  ? 20.454  -3.061  86.718  1.00 12.41 ? 37  ASP A N   1 
ATOM   250   C  CA  . ASP A 1 37  ? 21.076  -2.586  87.944  1.00 12.07 ? 37  ASP A CA  1 
ATOM   251   C  C   . ASP A 1 37  ? 21.502  -1.142  87.713  1.00 12.18 ? 37  ASP A C   1 
ATOM   252   O  O   . ASP A 1 37  ? 22.274  -0.855  86.798  1.00 11.98 ? 37  ASP A O   1 
ATOM   253   C  CB  . ASP A 1 37  ? 22.297  -3.453  88.282  1.00 11.70 ? 37  ASP A CB  1 
ATOM   254   C  CG  . ASP A 1 37  ? 23.078  -2.928  89.473  1.00 11.43 ? 37  ASP A CG  1 
ATOM   255   O  OD1 . ASP A 1 37  ? 24.189  -3.441  89.726  1.00 11.11 ? 37  ASP A OD1 1 
ATOM   256   O  OD2 . ASP A 1 37  ? 22.583  -2.007  90.157  1.00 11.39 ? 37  ASP A OD2 1 
ATOM   257   N  N   . LYS A 1 38  ? 20.982  -0.236  88.533  1.00 12.70 ? 38  LYS A N   1 
ATOM   258   C  CA  . LYS A 1 38  ? 21.314  1.179   88.422  1.00 12.99 ? 38  LYS A CA  1 
ATOM   259   C  C   . LYS A 1 38  ? 22.121  1.612   89.634  1.00 13.43 ? 38  LYS A C   1 
ATOM   260   O  O   . LYS A 1 38  ? 22.282  2.803   89.885  1.00 13.83 ? 38  LYS A O   1 
ATOM   261   C  CB  . LYS A 1 38  ? 20.035  2.013   88.347  1.00 13.11 ? 38  LYS A CB  1 
ATOM   262   C  CG  . LYS A 1 38  ? 20.248  3.467   87.949  1.00 13.12 ? 38  LYS A CG  1 
ATOM   263   C  CD  . LYS A 1 38  ? 19.870  4.418   89.078  1.00 13.28 ? 38  LYS A CD  1 
ATOM   264   C  CE  . LYS A 1 38  ? 21.021  5.363   89.396  1.00 13.41 ? 38  LYS A CE  1 
ATOM   265   N  NZ  . LYS A 1 38  ? 20.626  6.502   90.279  1.00 13.95 ? 38  LYS A NZ  1 
ATOM   266   N  N   . LEU A 1 39  ? 22.634  0.645   90.386  1.00 13.40 ? 39  LEU A N   1 
ATOM   267   C  CA  . LEU A 1 39  ? 23.392  0.961   91.585  1.00 13.41 ? 39  LEU A CA  1 
ATOM   268   C  C   . LEU A 1 39  ? 24.888  0.719   91.436  1.00 13.44 ? 39  LEU A C   1 
ATOM   269   O  O   . LEU A 1 39  ? 25.667  1.003   92.351  1.00 13.48 ? 39  LEU A O   1 
ATOM   270   C  CB  . LEU A 1 39  ? 22.840  0.153   92.766  1.00 13.05 ? 39  LEU A CB  1 
ATOM   271   C  CG  . LEU A 1 39  ? 21.409  0.525   93.181  1.00 12.60 ? 39  LEU A CG  1 
ATOM   272   C  CD1 . LEU A 1 39  ? 20.908  -0.441  94.239  1.00 11.91 ? 39  LEU A CD1 1 
ATOM   273   C  CD2 . LEU A 1 39  ? 21.384  1.965   93.700  1.00 12.20 ? 39  LEU A CD2 1 
ATOM   274   N  N   . ASN A 1 40  ? 25.289  0.201   90.281  1.00 13.14 ? 40  ASN A N   1 
ATOM   275   C  CA  . ASN A 1 40  ? 26.697  -0.070  90.029  1.00 12.67 ? 40  ASN A CA  1 
ATOM   276   C  C   . ASN A 1 40  ? 27.052  0.232   88.578  1.00 12.70 ? 40  ASN A C   1 
ATOM   277   O  O   . ASN A 1 40  ? 26.269  -0.033  87.660  1.00 12.73 ? 40  ASN A O   1 
ATOM   278   C  CB  . ASN A 1 40  ? 27.023  -1.535  90.346  1.00 12.40 ? 40  ASN A CB  1 
ATOM   279   C  CG  . ASN A 1 40  ? 27.238  -1.785  91.834  1.00 12.06 ? 40  ASN A CG  1 
ATOM   280   O  OD1 . ASN A 1 40  ? 28.247  -1.368  92.416  1.00 11.24 ? 40  ASN A OD1 1 
ATOM   281   N  ND2 . ASN A 1 40  ? 26.286  -2.479  92.455  1.00 12.21 ? 40  ASN A ND2 1 
ATOM   282   N  N   . VAL A 1 41  ? 28.237  0.789   88.375  1.00 12.65 ? 41  VAL A N   1 
ATOM   283   C  CA  . VAL A 1 41  ? 28.698  1.116   87.038  1.00 12.79 ? 41  VAL A CA  1 
ATOM   284   C  C   . VAL A 1 41  ? 29.400  -0.101  86.420  1.00 12.90 ? 41  VAL A C   1 
ATOM   285   O  O   . VAL A 1 41  ? 29.782  -1.031  87.133  1.00 12.99 ? 41  VAL A O   1 
ATOM   286   C  CB  . VAL A 1 41  ? 29.657  2.321   87.089  1.00 12.59 ? 41  VAL A CB  1 
ATOM   287   C  CG1 . VAL A 1 41  ? 31.106  1.853   86.984  1.00 12.30 ? 41  VAL A CG1 1 
ATOM   288   C  CG2 . VAL A 1 41  ? 29.303  3.303   85.981  1.00 12.56 ? 41  VAL A CG2 1 
ATOM   289   N  N   . ILE A 1 42  ? 29.564  -0.095  85.099  1.00 12.80 ? 42  ILE A N   1 
ATOM   290   C  CA  . ILE A 1 42  ? 30.223  -1.200  84.401  1.00 12.57 ? 42  ILE A CA  1 
ATOM   291   C  C   . ILE A 1 42  ? 31.732  -0.978  84.255  1.00 12.35 ? 42  ILE A C   1 
ATOM   292   O  O   . ILE A 1 42  ? 32.169  0.046   83.734  1.00 12.57 ? 42  ILE A O   1 
ATOM   293   C  CB  . ILE A 1 42  ? 29.628  -1.395  82.991  1.00 12.54 ? 42  ILE A CB  1 
ATOM   294   C  CG1 . ILE A 1 42  ? 28.244  -2.033  83.090  1.00 12.50 ? 42  ILE A CG1 1 
ATOM   295   C  CG2 . ILE A 1 42  ? 30.548  -2.263  82.155  1.00 12.51 ? 42  ILE A CG2 1 
ATOM   296   C  CD1 . ILE A 1 42  ? 27.605  -2.305  81.752  1.00 12.62 ? 42  ILE A CD1 1 
ATOM   297   N  N   . THR A 1 43  ? 32.526  -1.939  84.708  1.00 12.10 ? 43  THR A N   1 
ATOM   298   C  CA  . THR A 1 43  ? 33.978  -1.833  84.603  1.00 11.87 ? 43  THR A CA  1 
ATOM   299   C  C   . THR A 1 43  ? 34.579  -3.174  84.218  1.00 11.88 ? 43  THR A C   1 
ATOM   300   O  O   . THR A 1 43  ? 33.947  -4.213  84.383  1.00 11.71 ? 43  THR A O   1 
ATOM   301   C  CB  . THR A 1 43  ? 34.624  -1.400  85.938  1.00 11.76 ? 43  THR A CB  1 
ATOM   302   O  OG1 . THR A 1 43  ? 34.108  -2.202  87.011  1.00 11.51 ? 43  THR A OG1 1 
ATOM   303   C  CG2 . THR A 1 43  ? 34.341  0.060   86.215  1.00 11.80 ? 43  THR A CG2 1 
ATOM   304   N  N   . VAL A 1 44  ? 35.798  -3.151  83.699  1.00 11.84 ? 44  VAL A N   1 
ATOM   305   C  CA  . VAL A 1 44  ? 36.466  -4.393  83.331  1.00 12.05 ? 44  VAL A CA  1 
ATOM   306   C  C   . VAL A 1 44  ? 37.165  -4.915  84.583  1.00 12.31 ? 44  VAL A C   1 
ATOM   307   O  O   . VAL A 1 44  ? 38.240  -4.445  84.953  1.00 12.37 ? 44  VAL A O   1 
ATOM   308   C  CB  . VAL A 1 44  ? 37.514  -4.175  82.211  1.00 11.92 ? 44  VAL A CB  1 
ATOM   309   C  CG1 . VAL A 1 44  ? 38.270  -2.872  82.445  1.00 11.90 ? 44  VAL A CG1 1 
ATOM   310   C  CG2 . VAL A 1 44  ? 38.472  -5.366  82.158  1.00 11.74 ? 44  VAL A CG2 1 
ATOM   311   N  N   . GLY A 1 45  ? 36.547  -5.890  85.237  1.00 12.35 ? 45  GLY A N   1 
ATOM   312   C  CA  . GLY A 1 45  ? 37.126  -6.425  86.451  1.00 12.49 ? 45  GLY A CA  1 
ATOM   313   C  C   . GLY A 1 45  ? 36.632  -5.575  87.600  1.00 12.30 ? 45  GLY A C   1 
ATOM   314   O  O   . GLY A 1 45  ? 36.161  -4.464  87.370  1.00 12.55 ? 45  GLY A O   1 
ATOM   315   N  N   . PRO A 1 46  ? 36.724  -6.059  88.846  1.00 12.29 ? 46  PRO A N   1 
ATOM   316   C  CA  . PRO A 1 46  ? 36.254  -5.279  89.997  1.00 12.06 ? 46  PRO A CA  1 
ATOM   317   C  C   . PRO A 1 46  ? 36.929  -3.915  90.140  1.00 11.96 ? 46  PRO A C   1 
ATOM   318   O  O   . PRO A 1 46  ? 36.280  -2.933  90.499  1.00 11.49 ? 46  PRO A O   1 
ATOM   319   C  CB  . PRO A 1 46  ? 36.534  -6.192  91.197  1.00 12.03 ? 46  PRO A CB  1 
ATOM   320   C  CG  . PRO A 1 46  ? 36.679  -7.562  90.617  1.00 12.16 ? 46  PRO A CG  1 
ATOM   321   C  CD  . PRO A 1 46  ? 37.273  -7.362  89.252  1.00 12.20 ? 46  PRO A CD  1 
ATOM   322   N  N   . ARG A 1 47  ? 38.227  -3.865  89.853  1.00 12.05 ? 47  ARG A N   1 
ATOM   323   C  CA  . ARG A 1 47  ? 38.990  -2.625  89.958  1.00 12.39 ? 47  ARG A CA  1 
ATOM   324   C  C   . ARG A 1 47  ? 39.451  -2.101  88.602  1.00 12.79 ? 47  ARG A C   1 
ATOM   325   O  O   . ARG A 1 47  ? 40.500  -1.471  88.500  1.00 13.00 ? 47  ARG A O   1 
ATOM   326   C  CB  . ARG A 1 47  ? 40.206  -2.829  90.867  1.00 12.27 ? 47  ARG A CB  1 
ATOM   327   C  CG  . ARG A 1 47  ? 39.880  -3.483  92.203  1.00 12.26 ? 47  ARG A CG  1 
ATOM   328   C  CD  . ARG A 1 47  ? 40.625  -2.820  93.352  1.00 12.13 ? 47  ARG A CD  1 
ATOM   329   N  NE  . ARG A 1 47  ? 40.246  -3.359  94.656  1.00 12.13 ? 47  ARG A NE  1 
ATOM   330   C  CZ  . ARG A 1 47  ? 41.114  -3.647  95.621  1.00 12.15 ? 47  ARG A CZ  1 
ATOM   331   N  NH1 . ARG A 1 47  ? 42.411  -3.448  95.426  1.00 12.53 ? 47  ARG A NH1 1 
ATOM   332   N  NH2 . ARG A 1 47  ? 40.690  -4.127  96.781  1.00 11.95 ? 47  ARG A NH2 1 
ATOM   333   N  N   . GLY A 1 48  ? 38.669  -2.368  87.563  1.00 12.94 ? 48  GLY A N   1 
ATOM   334   C  CA  . GLY A 1 48  ? 39.023  -1.896  86.239  1.00 13.10 ? 48  GLY A CA  1 
ATOM   335   C  C   . GLY A 1 48  ? 38.339  -0.578  85.923  1.00 13.06 ? 48  GLY A C   1 
ATOM   336   O  O   . GLY A 1 48  ? 37.448  -0.149  86.655  1.00 13.17 ? 48  GLY A O   1 
ATOM   337   N  N   . PRO A 1 49  ? 38.748  0.102   84.843  1.00 12.84 ? 49  PRO A N   1 
ATOM   338   C  CA  . PRO A 1 49  ? 38.148  1.384   84.454  1.00 12.62 ? 49  PRO A CA  1 
ATOM   339   C  C   . PRO A 1 49  ? 36.723  1.240   83.950  1.00 12.43 ? 49  PRO A C   1 
ATOM   340   O  O   . PRO A 1 49  ? 36.242  0.130   83.718  1.00 12.31 ? 49  PRO A O   1 
ATOM   341   C  CB  . PRO A 1 49  ? 39.083  1.912   83.365  1.00 12.57 ? 49  PRO A CB  1 
ATOM   342   C  CG  . PRO A 1 49  ? 40.313  1.046   83.443  1.00 12.63 ? 49  PRO A CG  1 
ATOM   343   C  CD  . PRO A 1 49  ? 39.840  -0.281  83.939  1.00 12.72 ? 49  PRO A CD  1 
ATOM   344   N  N   . LEU A 1 50  ? 36.056  2.378   83.789  1.00 12.49 ? 50  LEU A N   1 
ATOM   345   C  CA  . LEU A 1 50  ? 34.679  2.423   83.311  1.00 12.62 ? 50  LEU A CA  1 
ATOM   346   C  C   . LEU A 1 50  ? 34.668  2.517   81.786  1.00 12.59 ? 50  LEU A C   1 
ATOM   347   O  O   . LEU A 1 50  ? 35.530  3.173   81.193  1.00 12.55 ? 50  LEU A O   1 
ATOM   348   C  CB  . LEU A 1 50  ? 33.961  3.636   83.907  1.00 12.80 ? 50  LEU A CB  1 
ATOM   349   C  CG  . LEU A 1 50  ? 32.596  3.985   83.309  1.00 13.02 ? 50  LEU A CG  1 
ATOM   350   C  CD1 . LEU A 1 50  ? 31.599  2.913   83.695  1.00 13.20 ? 50  LEU A CD1 1 
ATOM   351   C  CD2 . LEU A 1 50  ? 32.132  5.336   83.813  1.00 13.06 ? 50  LEU A CD2 1 
ATOM   352   N  N   . LEU A 1 51  ? 33.696  1.862   81.157  1.00 12.35 ? 51  LEU A N   1 
ATOM   353   C  CA  . LEU A 1 51  ? 33.590  1.882   79.701  1.00 12.30 ? 51  LEU A CA  1 
ATOM   354   C  C   . LEU A 1 51  ? 32.342  2.594   79.180  1.00 12.31 ? 51  LEU A C   1 
ATOM   355   O  O   . LEU A 1 51  ? 31.305  2.654   79.850  1.00 12.29 ? 51  LEU A O   1 
ATOM   356   C  CB  . LEU A 1 51  ? 33.633  0.459   79.134  1.00 12.19 ? 51  LEU A CB  1 
ATOM   357   C  CG  . LEU A 1 51  ? 33.182  -0.711  80.007  1.00 12.08 ? 51  LEU A CG  1 
ATOM   358   C  CD1 . LEU A 1 51  ? 32.368  -1.681  79.175  1.00 12.36 ? 51  LEU A CD1 1 
ATOM   359   C  CD2 . LEU A 1 51  ? 34.392  -1.414  80.576  1.00 11.91 ? 51  LEU A CD2 1 
ATOM   360   N  N   . VAL A 1 52  ? 32.462  3.127   77.968  1.00 12.07 ? 52  VAL A N   1 
ATOM   361   C  CA  . VAL A 1 52  ? 31.378  3.843   77.313  1.00 11.93 ? 52  VAL A CA  1 
ATOM   362   C  C   . VAL A 1 52  ? 30.152  2.959   77.116  1.00 11.88 ? 52  VAL A C   1 
ATOM   363   O  O   . VAL A 1 52  ? 29.032  3.456   76.983  1.00 11.79 ? 52  VAL A O   1 
ATOM   364   C  CB  . VAL A 1 52  ? 31.840  4.372   75.944  1.00 11.87 ? 52  VAL A CB  1 
ATOM   365   C  CG1 . VAL A 1 52  ? 30.836  5.375   75.401  1.00 11.65 ? 52  VAL A CG1 1 
ATOM   366   C  CG2 . VAL A 1 52  ? 33.216  5.010   76.081  1.00 12.05 ? 52  VAL A CG2 1 
ATOM   367   N  N   . GLN A 1 53  ? 30.369  1.647   77.100  1.00 11.95 ? 53  GLN A N   1 
ATOM   368   C  CA  . GLN A 1 53  ? 29.286  0.684   76.912  1.00 12.18 ? 53  GLN A CA  1 
ATOM   369   C  C   . GLN A 1 53  ? 28.107  0.955   77.846  1.00 12.16 ? 53  GLN A C   1 
ATOM   370   O  O   . GLN A 1 53  ? 26.952  0.820   77.448  1.00 12.36 ? 53  GLN A O   1 
ATOM   371   C  CB  . GLN A 1 53  ? 29.803  -0.742  77.131  1.00 12.08 ? 53  GLN A CB  1 
ATOM   372   C  CG  . GLN A 1 53  ? 29.638  -1.662  75.933  1.00 12.09 ? 53  GLN A CG  1 
ATOM   373   C  CD  . GLN A 1 53  ? 30.507  -2.908  76.023  1.00 12.17 ? 53  GLN A CD  1 
ATOM   374   O  OE1 . GLN A 1 53  ? 30.831  -3.372  77.117  1.00 12.52 ? 53  GLN A OE1 1 
ATOM   375   N  NE2 . GLN A 1 53  ? 30.888  -3.458  74.866  1.00 11.94 ? 53  GLN A NE2 1 
ATOM   376   N  N   . ASP A 1 54  ? 28.405  1.335   79.087  1.00 12.36 ? 54  ASP A N   1 
ATOM   377   C  CA  . ASP A 1 54  ? 27.370  1.631   80.073  1.00 12.07 ? 54  ASP A CA  1 
ATOM   378   C  C   . ASP A 1 54  ? 26.598  2.883   79.661  1.00 11.95 ? 54  ASP A C   1 
ATOM   379   O  O   . ASP A 1 54  ? 26.942  3.999   80.056  1.00 11.82 ? 54  ASP A O   1 
ATOM   380   C  CB  . ASP A 1 54  ? 28.003  1.840   81.450  1.00 12.47 ? 54  ASP A CB  1 
ATOM   381   C  CG  . ASP A 1 54  ? 27.006  1.673   82.589  1.00 12.76 ? 54  ASP A CG  1 
ATOM   382   O  OD1 . ASP A 1 54  ? 25.790  1.754   82.331  1.00 13.06 ? 54  ASP A OD1 1 
ATOM   383   O  OD2 . ASP A 1 54  ? 27.437  1.466   83.745  1.00 12.87 ? 54  ASP A OD2 1 
ATOM   384   N  N   . VAL A 1 55  ? 25.558  2.692   78.857  1.00 11.96 ? 55  VAL A N   1 
ATOM   385   C  CA  . VAL A 1 55  ? 24.736  3.804   78.396  1.00 11.92 ? 55  VAL A CA  1 
ATOM   386   C  C   . VAL A 1 55  ? 23.668  4.126   79.431  1.00 11.90 ? 55  VAL A C   1 
ATOM   387   O  O   . VAL A 1 55  ? 23.031  5.177   79.378  1.00 12.06 ? 55  VAL A O   1 
ATOM   388   C  CB  . VAL A 1 55  ? 24.053  3.478   77.054  1.00 11.79 ? 55  VAL A CB  1 
ATOM   389   C  CG1 . VAL A 1 55  ? 25.108  3.228   75.989  1.00 11.95 ? 55  VAL A CG1 1 
ATOM   390   C  CG2 . VAL A 1 55  ? 23.144  2.267   77.210  1.00 11.53 ? 55  VAL A CG2 1 
ATOM   391   N  N   . VAL A 1 56  ? 23.478  3.206   80.369  1.00 11.82 ? 56  VAL A N   1 
ATOM   392   C  CA  . VAL A 1 56  ? 22.502  3.385   81.434  1.00 11.61 ? 56  VAL A CA  1 
ATOM   393   C  C   . VAL A 1 56  ? 23.044  4.466   82.351  1.00 11.56 ? 56  VAL A C   1 
ATOM   394   O  O   . VAL A 1 56  ? 22.303  5.298   82.868  1.00 11.43 ? 56  VAL A O   1 
ATOM   395   C  CB  . VAL A 1 56  ? 22.320  2.079   82.237  1.00 11.72 ? 56  VAL A CB  1 
ATOM   396   C  CG1 . VAL A 1 56  ? 21.688  2.372   83.600  1.00 11.36 ? 56  VAL A CG1 1 
ATOM   397   C  CG2 . VAL A 1 56  ? 21.468  1.101   81.432  1.00 12.02 ? 56  VAL A CG2 1 
ATOM   398   N  N   . PHE A 1 57  ? 24.354  4.446   82.544  1.00 11.61 ? 57  PHE A N   1 
ATOM   399   C  CA  . PHE A 1 57  ? 24.999  5.433   83.382  1.00 11.88 ? 57  PHE A CA  1 
ATOM   400   C  C   . PHE A 1 57  ? 24.899  6.786   82.685  1.00 11.95 ? 57  PHE A C   1 
ATOM   401   O  O   . PHE A 1 57  ? 24.244  7.706   83.180  1.00 12.09 ? 57  PHE A O   1 
ATOM   402   C  CB  . PHE A 1 57  ? 26.467  5.055   83.602  1.00 12.00 ? 57  PHE A CB  1 
ATOM   403   C  CG  . PHE A 1 57  ? 27.311  6.188   84.093  1.00 12.27 ? 57  PHE A CG  1 
ATOM   404   C  CD1 . PHE A 1 57  ? 27.062  6.767   85.331  1.00 12.38 ? 57  PHE A CD1 1 
ATOM   405   C  CD2 . PHE A 1 57  ? 28.334  6.701   83.303  1.00 12.52 ? 57  PHE A CD2 1 
ATOM   406   C  CE1 . PHE A 1 57  ? 27.817  7.845   85.778  1.00 12.67 ? 57  PHE A CE1 1 
ATOM   407   C  CE2 . PHE A 1 57  ? 29.101  7.786   83.740  1.00 12.82 ? 57  PHE A CE2 1 
ATOM   408   C  CZ  . PHE A 1 57  ? 28.842  8.358   84.978  1.00 12.88 ? 57  PHE A CZ  1 
ATOM   409   N  N   . THR A 1 58  ? 25.541  6.891   81.525  1.00 12.02 ? 58  THR A N   1 
ATOM   410   C  CA  . THR A 1 58  ? 25.553  8.124   80.740  1.00 11.88 ? 58  THR A CA  1 
ATOM   411   C  C   . THR A 1 58  ? 24.171  8.741   80.541  1.00 12.12 ? 58  THR A C   1 
ATOM   412   O  O   . THR A 1 58  ? 24.001  9.953   80.698  1.00 12.27 ? 58  THR A O   1 
ATOM   413   C  CB  . THR A 1 58  ? 26.180  7.885   79.361  1.00 11.55 ? 58  THR A CB  1 
ATOM   414   O  OG1 . THR A 1 58  ? 27.370  7.105   79.511  1.00 10.95 ? 58  THR A OG1 1 
ATOM   415   C  CG2 . THR A 1 58  ? 26.521  9.206   78.699  1.00 11.34 ? 58  THR A CG2 1 
ATOM   416   N  N   . ASP A 1 59  ? 23.190  7.912   80.189  1.00 12.14 ? 59  ASP A N   1 
ATOM   417   C  CA  . ASP A 1 59  ? 21.829  8.395   79.975  1.00 12.25 ? 59  ASP A CA  1 
ATOM   418   C  C   . ASP A 1 59  ? 21.355  9.230   81.161  1.00 12.44 ? 59  ASP A C   1 
ATOM   419   O  O   . ASP A 1 59  ? 20.868  10.350  80.995  1.00 12.45 ? 59  ASP A O   1 
ATOM   420   C  CB  . ASP A 1 59  ? 20.871  7.223   79.768  1.00 11.91 ? 59  ASP A CB  1 
ATOM   421   C  CG  . ASP A 1 59  ? 19.508  7.671   79.280  1.00 11.71 ? 59  ASP A CG  1 
ATOM   422   O  OD1 . ASP A 1 59  ? 19.463  8.517   78.365  1.00 12.03 ? 59  ASP A OD1 1 
ATOM   423   O  OD2 . ASP A 1 59  ? 18.485  7.184   79.809  1.00 11.23 ? 59  ASP A OD2 1 
ATOM   424   N  N   . GLU A 1 60  ? 21.496  8.671   82.359  1.00 12.29 ? 60  GLU A N   1 
ATOM   425   C  CA  . GLU A 1 60  ? 21.089  9.364   83.572  1.00 12.29 ? 60  GLU A CA  1 
ATOM   426   C  C   . GLU A 1 60  ? 21.997  10.560  83.835  1.00 12.28 ? 60  GLU A C   1 
ATOM   427   O  O   . GLU A 1 60  ? 21.526  11.693  83.962  1.00 12.23 ? 60  GLU A O   1 
ATOM   428   C  CB  . GLU A 1 60  ? 21.141  8.410   84.769  1.00 12.36 ? 60  GLU A CB  1 
ATOM   429   C  CG  . GLU A 1 60  ? 20.351  8.886   85.976  1.00 12.30 ? 60  GLU A CG  1 
ATOM   430   C  CD  . GLU A 1 60  ? 20.598  8.045   87.212  1.00 12.26 ? 60  GLU A CD  1 
ATOM   431   O  OE1 . GLU A 1 60  ? 21.604  7.307   87.241  1.00 12.27 ? 60  GLU A OE1 1 
ATOM   432   O  OE2 . GLU A 1 60  ? 19.783  8.125   88.157  1.00 12.21 ? 60  GLU A OE2 1 
ATOM   433   N  N   . MET A 1 61  ? 23.301  10.303  83.904  1.00 12.39 ? 61  MET A N   1 
ATOM   434   C  CA  . MET A 1 61  ? 24.281  11.353  84.170  1.00 12.23 ? 61  MET A CA  1 
ATOM   435   C  C   . MET A 1 61  ? 24.137  12.575  83.274  1.00 12.19 ? 61  MET A C   1 
ATOM   436   O  O   . MET A 1 61  ? 24.102  13.701  83.759  1.00 12.44 ? 61  MET A O   1 
ATOM   437   C  CB  . MET A 1 61  ? 25.698  10.802  84.032  1.00 12.34 ? 61  MET A CB  1 
ATOM   438   C  CG  . MET A 1 61  ? 26.770  11.735  84.581  1.00 12.36 ? 61  MET A CG  1 
ATOM   439   S  SD  . MET A 1 61  ? 26.414  12.330  86.262  1.00 12.69 ? 61  MET A SD  1 
ATOM   440   C  CE  . MET A 1 61  ? 26.907  10.892  87.246  1.00 12.13 ? 61  MET A CE  1 
ATOM   441   N  N   . ALA A 1 62  ? 24.061  12.349  81.967  1.00 12.11 ? 62  ALA A N   1 
ATOM   442   C  CA  . ALA A 1 62  ? 23.937  13.440  81.008  1.00 11.65 ? 62  ALA A CA  1 
ATOM   443   C  C   . ALA A 1 62  ? 22.748  14.313  81.349  1.00 11.35 ? 62  ALA A C   1 
ATOM   444   O  O   . ALA A 1 62  ? 22.894  15.517  81.539  1.00 11.31 ? 62  ALA A O   1 
ATOM   445   C  CB  . ALA A 1 62  ? 23.792  12.890  79.593  1.00 11.85 ? 62  ALA A CB  1 
ATOM   446   N  N   . HIS A 1 63  ? 21.572  13.701  81.430  1.00 10.95 ? 63  HIS A N   1 
ATOM   447   C  CA  . HIS A 1 63  ? 20.360  14.436  81.751  1.00 10.58 ? 63  HIS A CA  1 
ATOM   448   C  C   . HIS A 1 63  ? 20.569  15.244  83.013  1.00 10.52 ? 63  HIS A C   1 
ATOM   449   O  O   . HIS A 1 63  ? 20.253  16.429  83.065  1.00 10.39 ? 63  HIS A O   1 
ATOM   450   C  CB  . HIS A 1 63  ? 19.187  13.482  81.954  1.00 10.42 ? 63  HIS A CB  1 
ATOM   451   C  CG  . HIS A 1 63  ? 17.863  14.172  82.009  1.00 10.18 ? 63  HIS A CG  1 
ATOM   452   N  ND1 . HIS A 1 63  ? 17.424  14.850  83.126  1.00 10.09 ? 63  HIS A ND1 1 
ATOM   453   C  CD2 . HIS A 1 63  ? 16.896  14.320  81.074  1.00 10.10 ? 63  HIS A CD2 1 
ATOM   454   C  CE1 . HIS A 1 63  ? 16.243  15.385  82.875  1.00 9.97  ? 63  HIS A CE1 1 
ATOM   455   N  NE2 . HIS A 1 63  ? 15.901  15.078  81.638  1.00 10.10 ? 63  HIS A NE2 1 
ATOM   456   N  N   . PHE A 1 64  ? 21.104  14.585  84.032  1.00 10.68 ? 64  PHE A N   1 
ATOM   457   C  CA  . PHE A 1 64  ? 21.371  15.236  85.301  1.00 10.89 ? 64  PHE A CA  1 
ATOM   458   C  C   . PHE A 1 64  ? 22.246  16.471  85.080  1.00 10.81 ? 64  PHE A C   1 
ATOM   459   O  O   . PHE A 1 64  ? 22.114  17.478  85.778  1.00 10.74 ? 64  PHE A O   1 
ATOM   460   C  CB  . PHE A 1 64  ? 22.078  14.269  86.246  1.00 11.05 ? 64  PHE A CB  1 
ATOM   461   C  CG  . PHE A 1 64  ? 22.680  14.939  87.449  1.00 11.46 ? 64  PHE A CG  1 
ATOM   462   C  CD1 . PHE A 1 64  ? 21.864  15.492  88.432  1.00 11.70 ? 64  PHE A CD1 1 
ATOM   463   C  CD2 . PHE A 1 64  ? 24.056  15.032  87.591  1.00 11.54 ? 64  PHE A CD2 1 
ATOM   464   C  CE1 . PHE A 1 64  ? 22.409  16.125  89.536  1.00 11.94 ? 64  PHE A CE1 1 
ATOM   465   C  CE2 . PHE A 1 64  ? 24.612  15.663  88.691  1.00 11.75 ? 64  PHE A CE2 1 
ATOM   466   C  CZ  . PHE A 1 64  ? 23.786  16.213  89.669  1.00 11.97 ? 64  PHE A CZ  1 
ATOM   467   N  N   . ASP A 1 65  ? 23.137  16.380  84.099  1.00 10.57 ? 65  ASP A N   1 
ATOM   468   C  CA  . ASP A 1 65  ? 24.040  17.475  83.776  1.00 10.62 ? 65  ASP A CA  1 
ATOM   469   C  C   . ASP A 1 65  ? 23.310  18.623  83.077  1.00 10.55 ? 65  ASP A C   1 
ATOM   470   O  O   . ASP A 1 65  ? 23.907  19.660  82.791  1.00 10.30 ? 65  ASP A O   1 
ATOM   471   C  CB  . ASP A 1 65  ? 25.187  16.969  82.888  1.00 10.67 ? 65  ASP A CB  1 
ATOM   472   C  CG  . ASP A 1 65  ? 26.160  16.053  83.635  1.00 10.72 ? 65  ASP A CG  1 
ATOM   473   O  OD1 . ASP A 1 65  ? 26.001  15.865  84.860  1.00 10.56 ? 65  ASP A OD1 1 
ATOM   474   O  OD2 . ASP A 1 65  ? 27.089  15.518  82.995  1.00 10.66 ? 65  ASP A OD2 1 
ATOM   475   N  N   . ARG A 1 66  ? 22.018  18.440  82.809  1.00 10.74 ? 66  ARG A N   1 
ATOM   476   C  CA  . ARG A 1 66  ? 21.227  19.471  82.139  1.00 10.78 ? 66  ARG A CA  1 
ATOM   477   C  C   . ARG A 1 66  ? 19.897  19.772  82.827  1.00 10.99 ? 66  ARG A C   1 
ATOM   478   O  O   . ARG A 1 66  ? 18.933  20.156  82.169  1.00 11.15 ? 66  ARG A O   1 
ATOM   479   C  CB  . ARG A 1 66  ? 20.959  19.066  80.688  1.00 10.62 ? 66  ARG A CB  1 
ATOM   480   C  CG  . ARG A 1 66  ? 22.211  18.837  79.869  1.00 10.44 ? 66  ARG A CG  1 
ATOM   481   C  CD  . ARG A 1 66  ? 22.155  17.530  79.084  1.00 10.08 ? 66  ARG A CD  1 
ATOM   482   N  NE  . ARG A 1 66  ? 23.132  17.536  78.002  1.00 9.91  ? 66  ARG A NE  1 
ATOM   483   C  CZ  . ARG A 1 66  ? 24.447  17.509  78.186  1.00 9.79  ? 66  ARG A CZ  1 
ATOM   484   N  NH1 . ARG A 1 66  ? 24.945  17.469  79.407  1.00 10.03 ? 66  ARG A NH1 1 
ATOM   485   N  NH2 . ARG A 1 66  ? 25.267  17.552  77.151  1.00 9.96  ? 66  ARG A NH2 1 
ATOM   486   N  N   . GLU A 1 67  ? 19.850  19.612  84.145  1.00 11.11 ? 67  GLU A N   1 
ATOM   487   C  CA  . GLU A 1 67  ? 18.628  19.867  84.902  1.00 11.40 ? 67  GLU A CA  1 
ATOM   488   C  C   . GLU A 1 67  ? 18.325  21.353  85.084  1.00 11.70 ? 67  GLU A C   1 
ATOM   489   O  O   . GLU A 1 67  ? 17.167  21.771  85.007  1.00 11.55 ? 67  GLU A O   1 
ATOM   490   C  CB  . GLU A 1 67  ? 18.718  19.213  86.280  1.00 11.09 ? 67  GLU A CB  1 
ATOM   491   C  CG  . GLU A 1 67  ? 17.888  17.962  86.421  1.00 10.62 ? 67  GLU A CG  1 
ATOM   492   C  CD  . GLU A 1 67  ? 18.408  17.053  87.500  1.00 10.36 ? 67  GLU A CD  1 
ATOM   493   O  OE1 . GLU A 1 67  ? 17.909  17.155  88.636  1.00 10.27 ? 67  GLU A OE1 1 
ATOM   494   O  OE2 . GLU A 1 67  ? 19.312  16.242  87.213  1.00 9.94  ? 67  GLU A OE2 1 
ATOM   495   N  N   . ARG A 1 68  ? 19.369  22.143  85.322  1.00 11.84 ? 68  ARG A N   1 
ATOM   496   C  CA  . ARG A 1 68  ? 19.227  23.582  85.538  1.00 12.06 ? 68  ARG A CA  1 
ATOM   497   C  C   . ARG A 1 68  ? 18.862  24.380  84.290  1.00 12.28 ? 68  ARG A C   1 
ATOM   498   O  O   . ARG A 1 68  ? 19.077  23.936  83.164  1.00 12.41 ? 68  ARG A O   1 
ATOM   499   C  CB  . ARG A 1 68  ? 20.526  24.162  86.113  1.00 12.13 ? 68  ARG A CB  1 
ATOM   500   C  CG  . ARG A 1 68  ? 20.844  23.780  87.560  1.00 11.96 ? 68  ARG A CG  1 
ATOM   501   C  CD  . ARG A 1 68  ? 19.613  23.807  88.459  1.00 11.73 ? 68  ARG A CD  1 
ATOM   502   N  NE  . ARG A 1 68  ? 19.331  22.474  88.977  1.00 11.61 ? 68  ARG A NE  1 
ATOM   503   C  CZ  . ARG A 1 68  ? 19.938  21.946  90.034  1.00 11.50 ? 68  ARG A CZ  1 
ATOM   504   N  NH1 . ARG A 1 68  ? 20.858  22.646  90.687  1.00 11.47 ? 68  ARG A NH1 1 
ATOM   505   N  NH2 . ARG A 1 68  ? 19.648  20.709  90.414  1.00 11.36 ? 68  ARG A NH2 1 
ATOM   506   N  N   . ILE A 1 69  ? 18.298  25.564  84.517  1.00 12.70 ? 69  ILE A N   1 
ATOM   507   C  CA  . ILE A 1 69  ? 17.920  26.496  83.453  1.00 12.86 ? 69  ILE A CA  1 
ATOM   508   C  C   . ILE A 1 69  ? 17.985  27.912  84.039  1.00 12.72 ? 69  ILE A C   1 
ATOM   509   O  O   . ILE A 1 69  ? 17.755  28.108  85.235  1.00 12.68 ? 69  ILE A O   1 
ATOM   510   C  CB  . ILE A 1 69  ? 16.490  26.244  82.915  1.00 13.16 ? 69  ILE A CB  1 
ATOM   511   C  CG1 . ILE A 1 69  ? 15.464  26.494  84.018  1.00 13.69 ? 69  ILE A CG1 1 
ATOM   512   C  CG2 . ILE A 1 69  ? 16.375  24.832  82.369  1.00 13.10 ? 69  ILE A CG2 1 
ATOM   513   C  CD1 . ILE A 1 69  ? 14.196  27.158  83.519  1.00 14.46 ? 69  ILE A CD1 1 
ATOM   514   N  N   . PRO A 1 70  ? 18.308  28.915  83.207  1.00 12.58 ? 70  PRO A N   1 
ATOM   515   C  CA  . PRO A 1 70  ? 18.395  30.298  83.690  1.00 12.35 ? 70  PRO A CA  1 
ATOM   516   C  C   . PRO A 1 70  ? 17.217  30.698  84.570  1.00 12.38 ? 70  PRO A C   1 
ATOM   517   O  O   . PRO A 1 70  ? 16.062  30.498  84.199  1.00 12.46 ? 70  PRO A O   1 
ATOM   518   C  CB  . PRO A 1 70  ? 18.452  31.127  82.409  1.00 12.47 ? 70  PRO A CB  1 
ATOM   519   C  CG  . PRO A 1 70  ? 19.000  30.204  81.376  1.00 12.45 ? 70  PRO A CG  1 
ATOM   520   C  CD  . PRO A 1 70  ? 18.605  28.806  81.767  1.00 12.50 ? 70  PRO A CD  1 
ATOM   521   N  N   . GLU A 1 71  ? 17.509  31.253  85.740  1.00 12.08 ? 71  GLU A N   1 
ATOM   522   C  CA  . GLU A 1 71  ? 16.447  31.681  86.639  1.00 12.02 ? 71  GLU A CA  1 
ATOM   523   C  C   . GLU A 1 71  ? 15.927  33.034  86.166  1.00 12.02 ? 71  GLU A C   1 
ATOM   524   O  O   . GLU A 1 71  ? 16.622  33.758  85.460  1.00 11.93 ? 71  GLU A O   1 
ATOM   525   C  CB  . GLU A 1 71  ? 16.972  31.788  88.077  1.00 11.85 ? 71  GLU A CB  1 
ATOM   526   C  CG  . GLU A 1 71  ? 17.626  33.129  88.433  1.00 11.24 ? 71  GLU A CG  1 
ATOM   527   C  CD  . GLU A 1 71  ? 18.206  33.148  89.840  1.00 10.80 ? 71  GLU A CD  1 
ATOM   528   O  OE1 . GLU A 1 71  ? 18.146  32.105  90.520  1.00 10.18 ? 71  GLU A OE1 1 
ATOM   529   O  OE2 . GLU A 1 71  ? 18.722  34.206  90.261  1.00 10.58 ? 71  GLU A OE2 1 
ATOM   530   N  N   . ARG A 1 72  ? 14.699  33.367  86.544  1.00 11.92 ? 72  ARG A N   1 
ATOM   531   C  CA  . ARG A 1 72  ? 14.114  34.641  86.157  1.00 11.79 ? 72  ARG A CA  1 
ATOM   532   C  C   . ARG A 1 72  ? 15.122  35.740  86.488  1.00 11.93 ? 72  ARG A C   1 
ATOM   533   O  O   . ARG A 1 72  ? 15.749  35.713  87.553  1.00 12.11 ? 72  ARG A O   1 
ATOM   534   C  CB  . ARG A 1 72  ? 12.821  34.894  86.936  1.00 11.58 ? 72  ARG A CB  1 
ATOM   535   C  CG  . ARG A 1 72  ? 11.603  34.119  86.455  1.00 11.22 ? 72  ARG A CG  1 
ATOM   536   C  CD  . ARG A 1 72  ? 10.585  33.982  87.586  1.00 10.90 ? 72  ARG A CD  1 
ATOM   537   N  NE  . ARG A 1 72  ? 9.448   33.130  87.245  1.00 10.37 ? 72  ARG A NE  1 
ATOM   538   C  CZ  . ARG A 1 72  ? 9.518   31.812  87.083  1.00 10.10 ? 72  ARG A CZ  1 
ATOM   539   N  NH1 . ARG A 1 72  ? 10.677  31.185  87.229  1.00 9.87  ? 72  ARG A NH1 1 
ATOM   540   N  NH2 . ARG A 1 72  ? 8.426   31.116  86.786  1.00 9.77  ? 72  ARG A NH2 1 
ATOM   541   N  N   . VAL A 1 73  ? 15.283  36.700  85.577  1.00 11.96 ? 73  VAL A N   1 
ATOM   542   C  CA  . VAL A 1 73  ? 16.213  37.806  85.796  1.00 11.78 ? 73  VAL A CA  1 
ATOM   543   C  C   . VAL A 1 73  ? 15.744  38.643  86.998  1.00 11.66 ? 73  VAL A C   1 
ATOM   544   O  O   . VAL A 1 73  ? 16.530  39.368  87.610  1.00 11.66 ? 73  VAL A O   1 
ATOM   545   C  CB  . VAL A 1 73  ? 16.334  38.681  84.521  1.00 11.72 ? 73  VAL A CB  1 
ATOM   546   C  CG1 . VAL A 1 73  ? 14.967  38.910  83.923  1.00 11.69 ? 73  VAL A CG1 1 
ATOM   547   C  CG2 . VAL A 1 73  ? 17.019  39.998  84.839  1.00 11.65 ? 73  VAL A CG2 1 
ATOM   548   N  N   . VAL A 1 74  ? 14.460  38.525  87.328  1.00 11.72 ? 74  VAL A N   1 
ATOM   549   C  CA  . VAL A 1 74  ? 13.866  39.221  88.472  1.00 11.66 ? 74  VAL A CA  1 
ATOM   550   C  C   . VAL A 1 74  ? 12.752  38.347  89.024  1.00 11.82 ? 74  VAL A C   1 
ATOM   551   O  O   . VAL A 1 74  ? 12.180  37.540  88.293  1.00 11.92 ? 74  VAL A O   1 
ATOM   552   C  CB  . VAL A 1 74  ? 13.264  40.588  88.097  1.00 11.42 ? 74  VAL A CB  1 
ATOM   553   C  CG1 . VAL A 1 74  ? 14.309  41.668  88.254  1.00 11.06 ? 74  VAL A CG1 1 
ATOM   554   C  CG2 . VAL A 1 74  ? 12.730  40.556  86.686  1.00 11.38 ? 74  VAL A CG2 1 
ATOM   555   N  N   . HIS A 1 75  ? 12.448  38.511  90.309  1.00 11.96 ? 75  HIS A N   1 
ATOM   556   C  CA  . HIS A 1 75  ? 11.413  37.717  90.965  1.00 11.98 ? 75  HIS A CA  1 
ATOM   557   C  C   . HIS A 1 75  ? 11.795  36.248  90.851  1.00 12.11 ? 75  HIS A C   1 
ATOM   558   O  O   . HIS A 1 75  ? 10.962  35.411  90.498  1.00 12.15 ? 75  HIS A O   1 
ATOM   559   C  CB  . HIS A 1 75  ? 10.051  37.939  90.296  1.00 11.91 ? 75  HIS A CB  1 
ATOM   560   C  CG  . HIS A 1 75  ? 9.525   39.336  90.430  1.00 12.00 ? 75  HIS A CG  1 
ATOM   561   N  ND1 . HIS A 1 75  ? 8.479   39.660  91.269  1.00 11.99 ? 75  HIS A ND1 1 
ATOM   562   C  CD2 . HIS A 1 75  ? 9.883   40.485  89.813  1.00 12.00 ? 75  HIS A CD2 1 
ATOM   563   C  CE1 . HIS A 1 75  ? 8.216   40.951  91.162  1.00 12.06 ? 75  HIS A CE1 1 
ATOM   564   N  NE2 . HIS A 1 75  ? 9.055   41.475  90.285  1.00 12.22 ? 75  HIS A NE2 1 
ATOM   565   N  N   . ALA A 1 76  ? 13.054  35.941  91.149  1.00 11.90 ? 76  ALA A N   1 
ATOM   566   C  CA  . ALA A 1 76  ? 13.550  34.570  91.056  1.00 12.00 ? 76  ALA A CA  1 
ATOM   567   C  C   . ALA A 1 76  ? 12.893  33.592  92.029  1.00 11.82 ? 76  ALA A C   1 
ATOM   568   O  O   . ALA A 1 76  ? 12.390  32.549  91.612  1.00 12.06 ? 76  ALA A O   1 
ATOM   569   C  CB  . ALA A 1 76  ? 15.066  34.550  91.249  1.00 11.78 ? 76  ALA A CB  1 
ATOM   570   N  N   . LYS A 1 77  ? 12.896  33.932  93.318  1.00 11.91 ? 77  LYS A N   1 
ATOM   571   C  CA  . LYS A 1 77  ? 12.329  33.073  94.363  1.00 11.68 ? 77  LYS A CA  1 
ATOM   572   C  C   . LYS A 1 77  ? 10.830  33.236  94.568  1.00 11.48 ? 77  LYS A C   1 
ATOM   573   O  O   . LYS A 1 77  ? 10.374  34.246  95.103  1.00 11.42 ? 77  LYS A O   1 
ATOM   574   C  CB  . LYS A 1 77  ? 13.041  33.328  95.692  1.00 11.71 ? 77  LYS A CB  1 
ATOM   575   C  CG  . LYS A 1 77  ? 13.590  32.074  96.348  1.00 11.95 ? 77  LYS A CG  1 
ATOM   576   C  CD  . LYS A 1 77  ? 12.472  31.200  96.918  1.00 12.15 ? 77  LYS A CD  1 
ATOM   577   C  CE  . LYS A 1 77  ? 12.978  30.287  98.033  1.00 11.94 ? 77  LYS A CE  1 
ATOM   578   N  NZ  . LYS A 1 77  ? 12.879  30.944  99.362  1.00 11.73 ? 77  LYS A NZ  1 
ATOM   579   N  N   . GLY A 1 78  ? 10.066  32.225  94.165  1.00 11.19 ? 78  GLY A N   1 
ATOM   580   C  CA  . GLY A 1 78  ? 8.626   32.302  94.322  1.00 11.01 ? 78  GLY A CA  1 
ATOM   581   C  C   . GLY A 1 78  ? 7.937   31.003  94.696  1.00 10.93 ? 78  GLY A C   1 
ATOM   582   O  O   . GLY A 1 78  ? 8.586   29.990  94.967  1.00 10.78 ? 78  GLY A O   1 
ATOM   583   N  N   . ALA A 1 79  ? 6.608   31.048  94.711  1.00 10.76 ? 79  ALA A N   1 
ATOM   584   C  CA  . ALA A 1 79  ? 5.781   29.895  95.044  1.00 10.86 ? 79  ALA A CA  1 
ATOM   585   C  C   . ALA A 1 79  ? 4.529   29.927  94.176  1.00 10.94 ? 79  ALA A C   1 
ATOM   586   O  O   . ALA A 1 79  ? 4.031   31.001  93.845  1.00 10.67 ? 79  ALA A O   1 
ATOM   587   C  CB  . ALA A 1 79  ? 5.398   29.935  96.513  1.00 11.04 ? 79  ALA A CB  1 
ATOM   588   N  N   . GLY A 1 80  ? 4.022   28.750  93.816  1.00 11.01 ? 80  GLY A N   1 
ATOM   589   C  CA  . GLY A 1 80  ? 2.845   28.685  92.969  1.00 11.39 ? 80  GLY A CA  1 
ATOM   590   C  C   . GLY A 1 80  ? 1.672   27.877  93.494  1.00 11.70 ? 80  GLY A C   1 
ATOM   591   O  O   . GLY A 1 80  ? 1.811   27.023  94.368  1.00 11.72 ? 80  GLY A O   1 
ATOM   592   N  N   . ALA A 1 81  ? 0.496   28.153  92.949  1.00 12.04 ? 81  ALA A N   1 
ATOM   593   C  CA  . ALA A 1 81  ? -0.707  27.447  93.354  1.00 12.53 ? 81  ALA A CA  1 
ATOM   594   C  C   . ALA A 1 81  ? -1.780  27.570  92.278  1.00 12.73 ? 81  ALA A C   1 
ATOM   595   O  O   . ALA A 1 81  ? -1.698  28.423  91.391  1.00 12.87 ? 81  ALA A O   1 
ATOM   596   C  CB  . ALA A 1 81  ? -1.217  27.998  94.682  1.00 12.39 ? 81  ALA A CB  1 
ATOM   597   N  N   . PHE A 1 82  ? -2.789  26.711  92.359  1.00 12.97 ? 82  PHE A N   1 
ATOM   598   C  CA  . PHE A 1 82  ? -3.861  26.727  91.382  1.00 13.22 ? 82  PHE A CA  1 
ATOM   599   C  C   . PHE A 1 82  ? -5.225  26.850  92.023  1.00 13.29 ? 82  PHE A C   1 
ATOM   600   O  O   . PHE A 1 82  ? -5.416  26.479  93.179  1.00 13.22 ? 82  PHE A O   1 
ATOM   601   C  CB  . PHE A 1 82  ? -3.793  25.467  90.530  1.00 13.27 ? 82  PHE A CB  1 
ATOM   602   C  CG  . PHE A 1 82  ? -2.504  25.327  89.788  1.00 13.37 ? 82  PHE A CG  1 
ATOM   603   C  CD1 . PHE A 1 82  ? -1.539  24.425  90.214  1.00 13.41 ? 82  PHE A CD1 1 
ATOM   604   C  CD2 . PHE A 1 82  ? -2.237  26.125  88.679  1.00 13.41 ? 82  PHE A CD2 1 
ATOM   605   C  CE1 . PHE A 1 82  ? -0.320  24.315  89.552  1.00 13.47 ? 82  PHE A CE1 1 
ATOM   606   C  CE2 . PHE A 1 82  ? -1.019  26.026  88.007  1.00 13.47 ? 82  PHE A CE2 1 
ATOM   607   C  CZ  . PHE A 1 82  ? -0.057  25.117  88.446  1.00 13.49 ? 82  PHE A CZ  1 
ATOM   608   N  N   . GLY A 1 83  ? -6.168  27.386  91.256  1.00 13.26 ? 83  GLY A N   1 
ATOM   609   C  CA  . GLY A 1 83  ? -7.519  27.566  91.747  1.00 13.11 ? 83  GLY A CA  1 
ATOM   610   C  C   . GLY A 1 83  ? -8.449  27.933  90.613  1.00 13.08 ? 83  GLY A C   1 
ATOM   611   O  O   . GLY A 1 83  ? -8.452  27.287  89.566  1.00 13.20 ? 83  GLY A O   1 
ATOM   612   N  N   . TYR A 1 84  ? -9.231  28.985  90.810  1.00 12.93 ? 84  TYR A N   1 
ATOM   613   C  CA  . TYR A 1 84  ? -10.170 29.417  89.790  1.00 12.70 ? 84  TYR A CA  1 
ATOM   614   C  C   . TYR A 1 84  ? -10.672 30.816  90.085  1.00 12.55 ? 84  TYR A C   1 
ATOM   615   O  O   . TYR A 1 84  ? -10.513 31.322  91.191  1.00 12.56 ? 84  TYR A O   1 
ATOM   616   C  CB  . TYR A 1 84  ? -11.358 28.470  89.757  1.00 12.51 ? 84  TYR A CB  1 
ATOM   617   C  CG  . TYR A 1 84  ? -12.210 28.577  90.995  1.00 12.53 ? 84  TYR A CG  1 
ATOM   618   C  CD1 . TYR A 1 84  ? -13.262 29.486  91.062  1.00 12.49 ? 84  TYR A CD1 1 
ATOM   619   C  CD2 . TYR A 1 84  ? -11.957 27.779  92.106  1.00 12.66 ? 84  TYR A CD2 1 
ATOM   620   C  CE1 . TYR A 1 84  ? -14.042 29.596  92.203  1.00 12.88 ? 84  TYR A CE1 1 
ATOM   621   C  CE2 . TYR A 1 84  ? -12.732 27.880  93.257  1.00 13.04 ? 84  TYR A CE2 1 
ATOM   622   C  CZ  . TYR A 1 84  ? -13.773 28.791  93.298  1.00 13.08 ? 84  TYR A CZ  1 
ATOM   623   O  OH  . TYR A 1 84  ? -14.551 28.893  94.429  1.00 13.59 ? 84  TYR A OH  1 
ATOM   624   N  N   . PHE A 1 85  ? -11.287 31.432  89.086  1.00 12.53 ? 85  PHE A N   1 
ATOM   625   C  CA  . PHE A 1 85  ? -11.841 32.762  89.254  1.00 12.77 ? 85  PHE A CA  1 
ATOM   626   C  C   . PHE A 1 85  ? -13.339 32.690  88.995  1.00 12.91 ? 85  PHE A C   1 
ATOM   627   O  O   . PHE A 1 85  ? -13.782 32.047  88.042  1.00 12.66 ? 85  PHE A O   1 
ATOM   628   C  CB  . PHE A 1 85  ? -11.198 33.742  88.284  1.00 12.65 ? 85  PHE A CB  1 
ATOM   629   C  CG  . PHE A 1 85  ? -11.912 35.056  88.204  1.00 12.54 ? 85  PHE A CG  1 
ATOM   630   C  CD1 . PHE A 1 85  ? -11.696 36.034  89.164  1.00 12.54 ? 85  PHE A CD1 1 
ATOM   631   C  CD2 . PHE A 1 85  ? -12.790 35.320  87.163  1.00 12.52 ? 85  PHE A CD2 1 
ATOM   632   C  CE1 . PHE A 1 85  ? -12.339 37.259  89.088  1.00 12.40 ? 85  PHE A CE1 1 
ATOM   633   C  CE2 . PHE A 1 85  ? -13.439 36.542  87.078  1.00 12.39 ? 85  PHE A CE2 1 
ATOM   634   C  CZ  . PHE A 1 85  ? -13.212 37.513  88.043  1.00 12.39 ? 85  PHE A CZ  1 
ATOM   635   N  N   . GLU A 1 86  ? -14.115 33.349  89.849  1.00 13.14 ? 86  GLU A N   1 
ATOM   636   C  CA  . GLU A 1 86  ? -15.564 33.347  89.711  1.00 13.37 ? 86  GLU A CA  1 
ATOM   637   C  C   . GLU A 1 86  ? -16.131 34.760  89.718  1.00 13.59 ? 86  GLU A C   1 
ATOM   638   O  O   . GLU A 1 86  ? -15.854 35.549  90.624  1.00 13.70 ? 86  GLU A O   1 
ATOM   639   C  CB  . GLU A 1 86  ? -16.188 32.535  90.845  1.00 13.71 ? 86  GLU A CB  1 
ATOM   640   C  CG  . GLU A 1 86  ? -17.706 32.516  90.836  1.00 14.53 ? 86  GLU A CG  1 
ATOM   641   C  CD  . GLU A 1 86  ? -18.292 32.240  92.216  1.00 15.05 ? 86  GLU A CD  1 
ATOM   642   O  OE1 . GLU A 1 86  ? -17.716 31.404  92.954  1.00 15.53 ? 86  GLU A OE1 1 
ATOM   643   O  OE2 . GLU A 1 86  ? -19.325 32.865  92.560  1.00 15.43 ? 86  GLU A OE2 1 
ATOM   644   N  N   . VAL A 1 87  ? -16.924 35.075  88.699  1.00 13.69 ? 87  VAL A N   1 
ATOM   645   C  CA  . VAL A 1 87  ? -17.550 36.392  88.590  1.00 13.69 ? 87  VAL A CA  1 
ATOM   646   C  C   . VAL A 1 87  ? -18.745 36.459  89.536  1.00 13.64 ? 87  VAL A C   1 
ATOM   647   O  O   . VAL A 1 87  ? -19.595 35.566  89.539  1.00 13.75 ? 87  VAL A O   1 
ATOM   648   C  CB  . VAL A 1 87  ? -18.037 36.665  87.148  1.00 13.61 ? 87  VAL A CB  1 
ATOM   649   C  CG1 . VAL A 1 87  ? -18.968 37.868  87.126  1.00 13.55 ? 87  VAL A CG1 1 
ATOM   650   C  CG2 . VAL A 1 87  ? -16.847 36.901  86.243  1.00 13.42 ? 87  VAL A CG2 1 
ATOM   651   N  N   . THR A 1 88  ? -18.801 37.521  90.334  1.00 13.52 ? 88  THR A N   1 
ATOM   652   C  CA  . THR A 1 88  ? -19.884 37.705  91.295  1.00 13.29 ? 88  THR A CA  1 
ATOM   653   C  C   . THR A 1 88  ? -20.777 38.875  90.895  1.00 13.23 ? 88  THR A C   1 
ATOM   654   O  O   . THR A 1 88  ? -21.981 38.863  91.143  1.00 13.10 ? 88  THR A O   1 
ATOM   655   C  CB  . THR A 1 88  ? -19.330 37.977  92.707  1.00 13.42 ? 88  THR A CB  1 
ATOM   656   O  OG1 . THR A 1 88  ? -18.762 39.291  92.751  1.00 13.20 ? 88  THR A OG1 1 
ATOM   657   C  CG2 . THR A 1 88  ? -18.255 36.960  93.062  1.00 13.67 ? 88  THR A CG2 1 
ATOM   658   N  N   . HIS A 1 89  ? -20.180 39.884  90.273  1.00 13.13 ? 89  HIS A N   1 
ATOM   659   C  CA  . HIS A 1 89  ? -20.931 41.058  89.848  1.00 13.28 ? 89  HIS A CA  1 
ATOM   660   C  C   . HIS A 1 89  ? -20.832 41.292  88.346  1.00 13.11 ? 89  HIS A C   1 
ATOM   661   O  O   . HIS A 1 89  ? -19.830 40.960  87.715  1.00 13.05 ? 89  HIS A O   1 
ATOM   662   C  CB  . HIS A 1 89  ? -20.443 42.293  90.606  1.00 13.27 ? 89  HIS A CB  1 
ATOM   663   C  CG  . HIS A 1 89  ? -20.707 42.232  92.077  1.00 13.44 ? 89  HIS A CG  1 
ATOM   664   N  ND1 . HIS A 1 89  ? -20.320 41.166  92.857  1.00 13.48 ? 89  HIS A ND1 1 
ATOM   665   C  CD2 . HIS A 1 89  ? -21.333 43.101  92.908  1.00 13.57 ? 89  HIS A CD2 1 
ATOM   666   C  CE1 . HIS A 1 89  ? -20.693 41.379  94.106  1.00 13.61 ? 89  HIS A CE1 1 
ATOM   667   N  NE2 . HIS A 1 89  ? -21.310 42.546  94.164  1.00 13.65 ? 89  HIS A NE2 1 
ATOM   668   N  N   . ASP A 1 90  ? -21.883 41.879  87.786  1.00 13.13 ? 90  ASP A N   1 
ATOM   669   C  CA  . ASP A 1 90  ? -21.953 42.147  86.357  1.00 13.12 ? 90  ASP A CA  1 
ATOM   670   C  C   . ASP A 1 90  ? -21.365 43.497  85.968  1.00 13.11 ? 90  ASP A C   1 
ATOM   671   O  O   . ASP A 1 90  ? -21.912 44.546  86.307  1.00 13.19 ? 90  ASP A O   1 
ATOM   672   C  CB  . ASP A 1 90  ? -23.408 42.068  85.889  1.00 13.18 ? 90  ASP A CB  1 
ATOM   673   C  CG  . ASP A 1 90  ? -23.567 42.397  84.415  1.00 13.09 ? 90  ASP A CG  1 
ATOM   674   O  OD1 . ASP A 1 90  ? -23.702 43.596  84.079  1.00 13.02 ? 90  ASP A OD1 1 
ATOM   675   O  OD2 . ASP A 1 90  ? -23.558 41.453  83.594  1.00 12.84 ? 90  ASP A OD2 1 
ATOM   676   N  N   . ILE A 1 91  ? -20.254 43.454  85.236  1.00 13.22 ? 91  ILE A N   1 
ATOM   677   C  CA  . ILE A 1 91  ? -19.566 44.659  84.775  1.00 12.95 ? 91  ILE A CA  1 
ATOM   678   C  C   . ILE A 1 91  ? -19.413 44.642  83.254  1.00 12.93 ? 91  ILE A C   1 
ATOM   679   O  O   . ILE A 1 91  ? -18.589 45.370  82.696  1.00 12.89 ? 91  ILE A O   1 
ATOM   680   C  CB  . ILE A 1 91  ? -18.157 44.770  85.396  1.00 12.66 ? 91  ILE A CB  1 
ATOM   681   C  CG1 . ILE A 1 91  ? -17.308 43.572  84.966  1.00 12.43 ? 91  ILE A CG1 1 
ATOM   682   C  CG2 . ILE A 1 91  ? -18.256 44.834  86.911  1.00 12.84 ? 91  ILE A CG2 1 
ATOM   683   C  CD1 . ILE A 1 91  ? -15.842 43.756  85.207  1.00 11.73 ? 91  ILE A CD1 1 
ATOM   684   N  N   . THR A 1 92  ? -20.206 43.805  82.591  1.00 13.10 ? 92  THR A N   1 
ATOM   685   C  CA  . THR A 1 92  ? -20.162 43.687  81.135  1.00 13.19 ? 92  THR A CA  1 
ATOM   686   C  C   . THR A 1 92  ? -20.429 45.031  80.455  1.00 13.50 ? 92  THR A C   1 
ATOM   687   O  O   . THR A 1 92  ? -20.205 45.187  79.254  1.00 13.57 ? 92  THR A O   1 
ATOM   688   C  CB  . THR A 1 92  ? -21.196 42.663  80.625  1.00 13.01 ? 92  THR A CB  1 
ATOM   689   O  OG1 . THR A 1 92  ? -22.512 43.220  80.728  1.00 13.17 ? 92  THR A OG1 1 
ATOM   690   C  CG2 . THR A 1 92  ? -21.133 41.390  81.443  1.00 12.56 ? 92  THR A CG2 1 
ATOM   691   N  N   . LYS A 1 93  ? -20.911 46.002  81.224  1.00 13.58 ? 93  LYS A N   1 
ATOM   692   C  CA  . LYS A 1 93  ? -21.186 47.325  80.682  1.00 13.67 ? 93  LYS A CA  1 
ATOM   693   C  C   . LYS A 1 93  ? -19.870 48.071  80.513  1.00 13.39 ? 93  LYS A C   1 
ATOM   694   O  O   . LYS A 1 93  ? -19.827 49.169  79.956  1.00 13.33 ? 93  LYS A O   1 
ATOM   695   C  CB  . LYS A 1 93  ? -22.112 48.104  81.622  1.00 14.12 ? 93  LYS A CB  1 
ATOM   696   C  CG  . LYS A 1 93  ? -21.401 48.802  82.777  1.00 14.56 ? 93  LYS A CG  1 
ATOM   697   C  CD  . LYS A 1 93  ? -22.288 48.885  84.018  1.00 14.64 ? 93  LYS A CD  1 
ATOM   698   C  CE  . LYS A 1 93  ? -22.492 47.511  84.656  1.00 14.60 ? 93  LYS A CE  1 
ATOM   699   N  NZ  . LYS A 1 93  ? -22.042 47.460  86.076  1.00 14.29 ? 93  LYS A NZ  1 
ATOM   700   N  N   . TYR A 1 94  ? -18.794 47.463  81.000  1.00 13.19 ? 94  TYR A N   1 
ATOM   701   C  CA  . TYR A 1 94  ? -17.470 48.064  80.907  1.00 13.03 ? 94  TYR A CA  1 
ATOM   702   C  C   . TYR A 1 94  ? -16.580 47.292  79.939  1.00 12.78 ? 94  TYR A C   1 
ATOM   703   O  O   . TYR A 1 94  ? -16.007 47.866  79.015  1.00 12.63 ? 94  TYR A O   1 
ATOM   704   C  CB  . TYR A 1 94  ? -16.812 48.102  82.290  1.00 13.20 ? 94  TYR A CB  1 
ATOM   705   C  CG  . TYR A 1 94  ? -17.385 49.144  83.228  1.00 13.54 ? 94  TYR A CG  1 
ATOM   706   C  CD1 . TYR A 1 94  ? -17.466 50.482  82.850  1.00 13.60 ? 94  TYR A CD1 1 
ATOM   707   C  CD2 . TYR A 1 94  ? -17.825 48.794  84.506  1.00 13.82 ? 94  TYR A CD2 1 
ATOM   708   C  CE1 . TYR A 1 94  ? -17.968 51.453  83.720  1.00 13.78 ? 94  TYR A CE1 1 
ATOM   709   C  CE2 . TYR A 1 94  ? -18.328 49.757  85.385  1.00 14.00 ? 94  TYR A CE2 1 
ATOM   710   C  CZ  . TYR A 1 94  ? -18.395 51.085  84.986  1.00 13.93 ? 94  TYR A CZ  1 
ATOM   711   O  OH  . TYR A 1 94  ? -18.874 52.041  85.858  1.00 14.01 ? 94  TYR A OH  1 
ATOM   712   N  N   . SER A 1 95  ? -16.468 45.986  80.153  1.00 12.78 ? 95  SER A N   1 
ATOM   713   C  CA  . SER A 1 95  ? -15.636 45.143  79.301  1.00 12.83 ? 95  SER A CA  1 
ATOM   714   C  C   . SER A 1 95  ? -16.432 43.989  78.709  1.00 12.65 ? 95  SER A C   1 
ATOM   715   O  O   . SER A 1 95  ? -17.329 43.451  79.357  1.00 12.51 ? 95  SER A O   1 
ATOM   716   C  CB  . SER A 1 95  ? -14.448 44.599  80.105  1.00 13.05 ? 95  SER A CB  1 
ATOM   717   O  OG  . SER A 1 95  ? -14.262 43.209  79.893  1.00 13.73 ? 95  SER A OG  1 
ATOM   718   N  N   . LYS A 1 96  ? -16.096 43.610  77.479  1.00 12.54 ? 96  LYS A N   1 
ATOM   719   C  CA  . LYS A 1 96  ? -16.788 42.519  76.802  1.00 12.65 ? 96  LYS A CA  1 
ATOM   720   C  C   . LYS A 1 96  ? -16.059 41.189  76.973  1.00 12.57 ? 96  LYS A C   1 
ATOM   721   O  O   . LYS A 1 96  ? -16.532 40.156  76.505  1.00 12.62 ? 96  LYS A O   1 
ATOM   722   C  CB  . LYS A 1 96  ? -16.942 42.840  75.308  1.00 12.77 ? 96  LYS A CB  1 
ATOM   723   C  CG  . LYS A 1 96  ? -15.712 42.521  74.462  1.00 12.90 ? 96  LYS A CG  1 
ATOM   724   C  CD  . LYS A 1 96  ? -15.511 43.533  73.342  1.00 12.62 ? 96  LYS A CD  1 
ATOM   725   C  CE  . LYS A 1 96  ? -14.386 43.102  72.404  1.00 12.27 ? 96  LYS A CE  1 
ATOM   726   N  NZ  . LYS A 1 96  ? -14.783 43.168  70.967  1.00 11.60 ? 96  LYS A NZ  1 
ATOM   727   N  N   . ALA A 1 97  ? -14.917 41.222  77.654  1.00 12.46 ? 97  ALA A N   1 
ATOM   728   C  CA  . ALA A 1 97  ? -14.104 40.030  77.885  1.00 12.50 ? 97  ALA A CA  1 
ATOM   729   C  C   . ALA A 1 97  ? -14.902 38.795  78.322  1.00 12.62 ? 97  ALA A C   1 
ATOM   730   O  O   . ALA A 1 97  ? -15.678 38.843  79.280  1.00 12.52 ? 97  ALA A O   1 
ATOM   731   C  CB  . ALA A 1 97  ? -13.021 40.342  78.901  1.00 12.27 ? 97  ALA A CB  1 
ATOM   732   N  N   . LYS A 1 98  ? -14.689 37.688  77.611  1.00 12.59 ? 98  LYS A N   1 
ATOM   733   C  CA  . LYS A 1 98  ? -15.384 36.437  77.884  1.00 12.73 ? 98  LYS A CA  1 
ATOM   734   C  C   . LYS A 1 98  ? -15.265 35.992  79.333  1.00 12.78 ? 98  LYS A C   1 
ATOM   735   O  O   . LYS A 1 98  ? -16.116 35.257  79.840  1.00 12.64 ? 98  LYS A O   1 
ATOM   736   C  CB  . LYS A 1 98  ? -14.850 35.336  76.970  1.00 12.98 ? 98  LYS A CB  1 
ATOM   737   C  CG  . LYS A 1 98  ? -15.934 34.603  76.196  1.00 13.19 ? 98  LYS A CG  1 
ATOM   738   C  CD  . LYS A 1 98  ? -15.868 34.930  74.709  1.00 13.18 ? 98  LYS A CD  1 
ATOM   739   C  CE  . LYS A 1 98  ? -17.081 34.382  73.977  1.00 13.15 ? 98  LYS A CE  1 
ATOM   740   N  NZ  . LYS A 1 98  ? -16.679 33.473  72.870  1.00 12.93 ? 98  LYS A NZ  1 
ATOM   741   N  N   . VAL A 1 99  ? -14.204 36.434  80.000  1.00 12.87 ? 99  VAL A N   1 
ATOM   742   C  CA  . VAL A 1 99  ? -13.984 36.074  81.392  1.00 12.94 ? 99  VAL A CA  1 
ATOM   743   C  C   . VAL A 1 99  ? -14.996 36.742  82.328  1.00 13.20 ? 99  VAL A C   1 
ATOM   744   O  O   . VAL A 1 99  ? -15.214 36.269  83.445  1.00 13.36 ? 99  VAL A O   1 
ATOM   745   C  CB  . VAL A 1 99  ? -12.556 36.450  81.847  1.00 12.71 ? 99  VAL A CB  1 
ATOM   746   C  CG1 . VAL A 1 99  ? -12.405 37.966  81.894  1.00 12.41 ? 99  VAL A CG1 1 
ATOM   747   C  CG2 . VAL A 1 99  ? -12.261 35.827  83.210  1.00 12.50 ? 99  VAL A CG2 1 
ATOM   748   N  N   . PHE A 1 100 ? -15.604 37.840  81.879  1.00 13.16 ? 100 PHE A N   1 
ATOM   749   C  CA  . PHE A 1 100 ? -16.600 38.549  82.690  1.00 13.39 ? 100 PHE A CA  1 
ATOM   750   C  C   . PHE A 1 100 ? -17.999 38.294  82.141  1.00 13.56 ? 100 PHE A C   1 
ATOM   751   O  O   . PHE A 1 100 ? -18.984 38.844  82.635  1.00 13.66 ? 100 PHE A O   1 
ATOM   752   C  CB  . PHE A 1 100 ? -16.344 40.063  82.690  1.00 13.03 ? 100 PHE A CB  1 
ATOM   753   C  CG  . PHE A 1 100 ? -14.944 40.448  83.063  1.00 12.65 ? 100 PHE A CG  1 
ATOM   754   C  CD1 . PHE A 1 100 ? -14.387 40.028  84.265  1.00 12.56 ? 100 PHE A CD1 1 
ATOM   755   C  CD2 . PHE A 1 100 ? -14.178 41.238  82.210  1.00 12.40 ? 100 PHE A CD2 1 
ATOM   756   C  CE1 . PHE A 1 100 ? -13.083 40.390  84.613  1.00 12.49 ? 100 PHE A CE1 1 
ATOM   757   C  CE2 . PHE A 1 100 ? -12.876 41.604  82.548  1.00 12.26 ? 100 PHE A CE2 1 
ATOM   758   C  CZ  . PHE A 1 100 ? -12.328 41.179  83.752  1.00 12.27 ? 100 PHE A CZ  1 
ATOM   759   N  N   . GLU A 1 101 ? -18.067 37.458  81.110  1.00 13.61 ? 101 GLU A N   1 
ATOM   760   C  CA  . GLU A 1 101 ? -19.317 37.101  80.442  1.00 13.53 ? 101 GLU A CA  1 
ATOM   761   C  C   . GLU A 1 101 ? -20.598 37.173  81.283  1.00 13.52 ? 101 GLU A C   1 
ATOM   762   O  O   . GLU A 1 101 ? -21.473 37.998  81.018  1.00 13.57 ? 101 GLU A O   1 
ATOM   763   C  CB  . GLU A 1 101 ? -19.186 35.698  79.853  1.00 13.58 ? 101 GLU A CB  1 
ATOM   764   C  CG  . GLU A 1 101 ? -19.507 35.612  78.382  1.00 13.54 ? 101 GLU A CG  1 
ATOM   765   C  CD  . GLU A 1 101 ? -20.307 34.372  78.051  1.00 13.51 ? 101 GLU A CD  1 
ATOM   766   O  OE1 . GLU A 1 101 ? -19.690 33.320  77.769  1.00 13.44 ? 101 GLU A OE1 1 
ATOM   767   O  OE2 . GLU A 1 101 ? -21.554 34.450  78.079  1.00 13.45 ? 101 GLU A OE2 1 
ATOM   768   N  N   . HIS A 1 102 ? -20.708 36.306  82.286  1.00 13.44 ? 102 HIS A N   1 
ATOM   769   C  CA  . HIS A 1 102 ? -21.897 36.267  83.137  1.00 13.42 ? 102 HIS A CA  1 
ATOM   770   C  C   . HIS A 1 102 ? -21.566 35.876  84.583  1.00 13.30 ? 102 HIS A C   1 
ATOM   771   O  O   . HIS A 1 102 ? -20.559 35.213  84.851  1.00 13.24 ? 102 HIS A O   1 
ATOM   772   C  CB  . HIS A 1 102 ? -22.898 35.264  82.563  1.00 13.47 ? 102 HIS A CB  1 
ATOM   773   C  CG  . HIS A 1 102 ? -22.404 33.854  82.593  1.00 13.73 ? 102 HIS A CG  1 
ATOM   774   N  ND1 . HIS A 1 102 ? -22.719 32.977  83.611  1.00 13.87 ? 102 HIS A ND1 1 
ATOM   775   C  CD2 . HIS A 1 102 ? -21.574 33.182  81.761  1.00 13.88 ? 102 HIS A CD2 1 
ATOM   776   C  CE1 . HIS A 1 102 ? -22.102 31.826  83.403  1.00 14.06 ? 102 HIS A CE1 1 
ATOM   777   N  NE2 . HIS A 1 102 ? -21.402 31.925  82.288  1.00 14.13 ? 102 HIS A NE2 1 
ATOM   778   N  N   . ILE A 1 103 ? -22.430 36.272  85.511  1.00 13.16 ? 103 ILE A N   1 
ATOM   779   C  CA  . ILE A 1 103 ? -22.220 35.962  86.919  1.00 13.36 ? 103 ILE A CA  1 
ATOM   780   C  C   . ILE A 1 103 ? -22.249 34.455  87.162  1.00 13.52 ? 103 ILE A C   1 
ATOM   781   O  O   . ILE A 1 103 ? -23.083 33.741  86.602  1.00 13.28 ? 103 ILE A O   1 
ATOM   782   C  CB  . ILE A 1 103 ? -23.295 36.647  87.803  1.00 13.40 ? 103 ILE A CB  1 
ATOM   783   C  CG1 . ILE A 1 103 ? -22.973 38.135  87.941  1.00 13.48 ? 103 ILE A CG1 1 
ATOM   784   C  CG2 . ILE A 1 103 ? -23.345 36.001  89.183  1.00 13.20 ? 103 ILE A CG2 1 
ATOM   785   C  CD1 . ILE A 1 103 ? -24.191 39.004  88.138  1.00 13.93 ? 103 ILE A CD1 1 
ATOM   786   N  N   . GLY A 1 104 ? -21.331 33.982  88.003  1.00 13.64 ? 104 GLY A N   1 
ATOM   787   C  CA  . GLY A 1 104 ? -21.265 32.567  88.316  1.00 13.84 ? 104 GLY A CA  1 
ATOM   788   C  C   . GLY A 1 104 ? -20.327 31.820  87.393  1.00 14.00 ? 104 GLY A C   1 
ATOM   789   O  O   . GLY A 1 104 ? -20.115 30.611  87.542  1.00 14.26 ? 104 GLY A O   1 
ATOM   790   N  N   . LYS A 1 105 ? -19.765 32.542  86.428  1.00 13.98 ? 105 LYS A N   1 
ATOM   791   C  CA  . LYS A 1 105 ? -18.836 31.947  85.477  1.00 13.66 ? 105 LYS A CA  1 
ATOM   792   C  C   . LYS A 1 105 ? -17.491 31.710  86.151  1.00 13.59 ? 105 LYS A C   1 
ATOM   793   O  O   . LYS A 1 105 ? -16.887 32.639  86.691  1.00 13.66 ? 105 LYS A O   1 
ATOM   794   C  CB  . LYS A 1 105 ? -18.654 32.871  84.273  1.00 13.37 ? 105 LYS A CB  1 
ATOM   795   C  CG  . LYS A 1 105 ? -18.353 32.150  82.973  1.00 13.01 ? 105 LYS A CG  1 
ATOM   796   C  CD  . LYS A 1 105 ? -17.507 33.018  82.055  1.00 13.03 ? 105 LYS A CD  1 
ATOM   797   C  CE  . LYS A 1 105 ? -17.003 32.228  80.867  1.00 13.21 ? 105 LYS A CE  1 
ATOM   798   N  NZ  . LYS A 1 105 ? -17.553 32.756  79.589  1.00 14.02 ? 105 LYS A NZ  1 
ATOM   799   N  N   . LYS A 1 106 ? -17.038 30.460  86.130  1.00 13.54 ? 106 LYS A N   1 
ATOM   800   C  CA  . LYS A 1 106 ? -15.755 30.097  86.723  1.00 13.65 ? 106 LYS A CA  1 
ATOM   801   C  C   . LYS A 1 106 ? -14.709 29.900  85.618  1.00 13.55 ? 106 LYS A C   1 
ATOM   802   O  O   . LYS A 1 106 ? -15.027 29.397  84.537  1.00 13.64 ? 106 LYS A O   1 
ATOM   803   C  CB  . LYS A 1 106 ? -15.899 28.808  87.541  1.00 13.57 ? 106 LYS A CB  1 
ATOM   804   C  CG  . LYS A 1 106 ? -16.732 28.963  88.804  1.00 13.60 ? 106 LYS A CG  1 
ATOM   805   C  CD  . LYS A 1 106 ? -16.217 28.076  89.931  1.00 13.76 ? 106 LYS A CD  1 
ATOM   806   C  CE  . LYS A 1 106 ? -17.331 27.219  90.523  1.00 13.97 ? 106 LYS A CE  1 
ATOM   807   N  NZ  . LYS A 1 106 ? -18.484 28.045  90.967  1.00 14.34 ? 106 LYS A NZ  1 
ATOM   808   N  N   . THR A 1 107 ? -13.470 30.305  85.888  1.00 13.21 ? 107 THR A N   1 
ATOM   809   C  CA  . THR A 1 107 ? -12.385 30.164  84.920  1.00 13.01 ? 107 THR A CA  1 
ATOM   810   C  C   . THR A 1 107 ? -11.089 29.757  85.617  1.00 12.67 ? 107 THR A C   1 
ATOM   811   O  O   . THR A 1 107 ? -10.560 30.504  86.437  1.00 12.73 ? 107 THR A O   1 
ATOM   812   C  CB  . THR A 1 107 ? -12.135 31.483  84.160  1.00 12.94 ? 107 THR A CB  1 
ATOM   813   O  OG1 . THR A 1 107 ? -13.349 31.915  83.534  1.00 12.97 ? 107 THR A OG1 1 
ATOM   814   C  CG2 . THR A 1 107 ? -11.075 31.286  83.094  1.00 12.79 ? 107 THR A CG2 1 
ATOM   815   N  N   . PRO A 1 108 ? -10.561 28.563  85.295  1.00 12.36 ? 108 PRO A N   1 
ATOM   816   C  CA  . PRO A 1 108 ? -9.321  28.057  85.897  1.00 12.31 ? 108 PRO A CA  1 
ATOM   817   C  C   . PRO A 1 108 ? -8.186  29.074  85.869  1.00 12.18 ? 108 PRO A C   1 
ATOM   818   O  O   . PRO A 1 108 ? -7.957  29.738  84.859  1.00 12.29 ? 108 PRO A O   1 
ATOM   819   C  CB  . PRO A 1 108 ? -8.996  26.806  85.077  1.00 12.19 ? 108 PRO A CB  1 
ATOM   820   C  CG  . PRO A 1 108 ? -9.932  26.828  83.904  1.00 12.13 ? 108 PRO A CG  1 
ATOM   821   C  CD  . PRO A 1 108 ? -11.122 27.612  84.322  1.00 12.27 ? 108 PRO A CD  1 
ATOM   822   N  N   . ILE A 1 109 ? -7.471  29.189  86.982  1.00 12.26 ? 109 ILE A N   1 
ATOM   823   C  CA  . ILE A 1 109 ? -6.377  30.148  87.077  1.00 12.28 ? 109 ILE A CA  1 
ATOM   824   C  C   . ILE A 1 109 ? -5.057  29.543  87.543  1.00 12.23 ? 109 ILE A C   1 
ATOM   825   O  O   . ILE A 1 109 ? -5.002  28.396  87.990  1.00 12.51 ? 109 ILE A O   1 
ATOM   826   C  CB  . ILE A 1 109 ? -6.739  31.300  88.037  1.00 12.02 ? 109 ILE A CB  1 
ATOM   827   C  CG1 . ILE A 1 109 ? -6.936  30.760  89.456  1.00 11.73 ? 109 ILE A CG1 1 
ATOM   828   C  CG2 . ILE A 1 109 ? -8.003  31.990  87.559  1.00 12.21 ? 109 ILE A CG2 1 
ATOM   829   C  CD1 . ILE A 1 109 ? -6.893  31.826  90.541  1.00 11.23 ? 109 ILE A CD1 1 
ATOM   830   N  N   . ALA A 1 110 ? -3.996  30.337  87.425  1.00 11.97 ? 110 ALA A N   1 
ATOM   831   C  CA  . ALA A 1 110 ? -2.654  29.940  87.833  1.00 11.67 ? 110 ALA A CA  1 
ATOM   832   C  C   . ALA A 1 110 ? -2.025  31.141  88.530  1.00 11.78 ? 110 ALA A C   1 
ATOM   833   O  O   . ALA A 1 110 ? -2.137  32.271  88.050  1.00 11.51 ? 110 ALA A O   1 
ATOM   834   C  CB  . ALA A 1 110 ? -1.839  29.551  86.622  1.00 11.39 ? 110 ALA A CB  1 
ATOM   835   N  N   . VAL A 1 111 ? -1.370  30.902  89.661  1.00 11.77 ? 111 VAL A N   1 
ATOM   836   C  CA  . VAL A 1 111 ? -0.761  31.989  90.412  1.00 11.98 ? 111 VAL A CA  1 
ATOM   837   C  C   . VAL A 1 111 ? 0.648   31.699  90.916  1.00 12.21 ? 111 VAL A C   1 
ATOM   838   O  O   . VAL A 1 111 ? 0.960   30.571  91.305  1.00 12.53 ? 111 VAL A O   1 
ATOM   839   C  CB  . VAL A 1 111 ? -1.627  32.355  91.627  1.00 11.95 ? 111 VAL A CB  1 
ATOM   840   C  CG1 . VAL A 1 111 ? -0.994  33.506  92.380  1.00 12.03 ? 111 VAL A CG1 1 
ATOM   841   C  CG2 . VAL A 1 111 ? -3.033  32.720  91.175  1.00 11.80 ? 111 VAL A CG2 1 
ATOM   842   N  N   . ARG A 1 112 ? 1.497   32.724  90.906  1.00 11.95 ? 112 ARG A N   1 
ATOM   843   C  CA  . ARG A 1 112 ? 2.863   32.586  91.393  1.00 12.10 ? 112 ARG A CA  1 
ATOM   844   C  C   . ARG A 1 112 ? 3.289   33.825  92.162  1.00 12.01 ? 112 ARG A C   1 
ATOM   845   O  O   . ARG A 1 112 ? 3.291   34.933  91.624  1.00 11.85 ? 112 ARG A O   1 
ATOM   846   C  CB  . ARG A 1 112 ? 3.842   32.345  90.243  1.00 11.96 ? 112 ARG A CB  1 
ATOM   847   C  CG  . ARG A 1 112 ? 5.090   31.584  90.678  1.00 11.81 ? 112 ARG A CG  1 
ATOM   848   C  CD  . ARG A 1 112 ? 6.204   31.689  89.658  1.00 11.65 ? 112 ARG A CD  1 
ATOM   849   N  NE  . ARG A 1 112 ? 7.182   32.709  90.022  1.00 11.34 ? 112 ARG A NE  1 
ATOM   850   C  CZ  . ARG A 1 112 ? 8.473   32.470  90.211  1.00 11.07 ? 112 ARG A CZ  1 
ATOM   851   N  NH1 . ARG A 1 112 ? 8.945   31.241  90.072  1.00 11.10 ? 112 ARG A NH1 1 
ATOM   852   N  NH2 . ARG A 1 112 ? 9.290   33.458  90.537  1.00 10.68 ? 112 ARG A NH2 1 
ATOM   853   N  N   . PHE A 1 113 ? 3.641   33.631  93.429  1.00 12.04 ? 113 PHE A N   1 
ATOM   854   C  CA  . PHE A 1 113 ? 4.081   34.731  94.280  1.00 12.11 ? 113 PHE A CA  1 
ATOM   855   C  C   . PHE A 1 113 ? 5.604   34.782  94.291  1.00 12.13 ? 113 PHE A C   1 
ATOM   856   O  O   . PHE A 1 113 ? 6.268   33.781  94.020  1.00 12.17 ? 113 PHE A O   1 
ATOM   857   C  CB  . PHE A 1 113 ? 3.547   34.542  95.694  1.00 12.26 ? 113 PHE A CB  1 
ATOM   858   C  CG  . PHE A 1 113 ? 2.066   34.335  95.751  1.00 12.58 ? 113 PHE A CG  1 
ATOM   859   C  CD1 . PHE A 1 113 ? 1.206   35.419  95.910  1.00 12.85 ? 113 PHE A CD1 1 
ATOM   860   C  CD2 . PHE A 1 113 ? 1.527   33.056  95.641  1.00 12.68 ? 113 PHE A CD2 1 
ATOM   861   C  CE1 . PHE A 1 113 ? -0.173  35.235  95.958  1.00 13.18 ? 113 PHE A CE1 1 
ATOM   862   C  CE2 . PHE A 1 113 ? 0.150   32.854  95.687  1.00 12.98 ? 113 PHE A CE2 1 
ATOM   863   C  CZ  . PHE A 1 113 ? -0.705  33.948  95.846  1.00 13.25 ? 113 PHE A CZ  1 
ATOM   864   N  N   . SER A 1 114 ? 6.163   35.945  94.606  1.00 12.10 ? 114 SER A N   1 
ATOM   865   C  CA  . SER A 1 114 ? 7.610   36.068  94.609  1.00 12.31 ? 114 SER A CA  1 
ATOM   866   C  C   . SER A 1 114 ? 8.150   37.330  95.262  1.00 12.39 ? 114 SER A C   1 
ATOM   867   O  O   . SER A 1 114 ? 7.398   38.213  95.692  1.00 12.25 ? 114 SER A O   1 
ATOM   868   C  CB  . SER A 1 114 ? 8.123   36.012  93.171  1.00 12.11 ? 114 SER A CB  1 
ATOM   869   O  OG  . SER A 1 114 ? 7.597   37.089  92.418  1.00 11.71 ? 114 SER A OG  1 
ATOM   870   N  N   . THR A 1 115 ? 9.477   37.383  95.337  1.00 12.48 ? 115 THR A N   1 
ATOM   871   C  CA  . THR A 1 115 ? 10.187  38.527  95.881  1.00 12.81 ? 115 THR A CA  1 
ATOM   872   C  C   . THR A 1 115 ? 10.670  39.245  94.619  1.00 13.02 ? 115 THR A C   1 
ATOM   873   O  O   . THR A 1 115 ? 9.983   39.207  93.595  1.00 13.38 ? 115 THR A O   1 
ATOM   874   C  CB  . THR A 1 115 ? 11.384  38.088  96.758  1.00 12.66 ? 115 THR A CB  1 
ATOM   875   O  OG1 . THR A 1 115 ? 12.232  37.205  96.017  1.00 12.43 ? 115 THR A OG1 1 
ATOM   876   C  CG2 . THR A 1 115 ? 10.891  37.361  98.003  1.00 12.59 ? 115 THR A CG2 1 
ATOM   877   N  N   . VAL A 1 116 ? 11.835  39.883  94.660  1.00 12.74 ? 116 VAL A N   1 
ATOM   878   C  CA  . VAL A 1 116 ? 12.310  40.576  93.471  1.00 12.14 ? 116 VAL A CA  1 
ATOM   879   C  C   . VAL A 1 116 ? 13.803  40.410  93.207  1.00 11.84 ? 116 VAL A C   1 
ATOM   880   O  O   . VAL A 1 116 ? 14.199  39.750  92.244  1.00 12.18 ? 116 VAL A O   1 
ATOM   881   C  CB  . VAL A 1 116 ? 11.973  42.084  93.544  1.00 12.02 ? 116 VAL A CB  1 
ATOM   882   C  CG1 . VAL A 1 116 ? 12.515  42.804  92.321  1.00 11.82 ? 116 VAL A CG1 1 
ATOM   883   C  CG2 . VAL A 1 116 ? 10.465  42.276  93.638  1.00 11.42 ? 116 VAL A CG2 1 
ATOM   884   N  N   . ALA A 1 117 ? 14.629  41.009  94.059  1.00 11.45 ? 117 ALA A N   1 
ATOM   885   C  CA  . ALA A 1 117 ? 16.076  40.941  93.896  1.00 10.91 ? 117 ALA A CA  1 
ATOM   886   C  C   . ALA A 1 117 ? 16.667  39.589  94.278  1.00 10.79 ? 117 ALA A C   1 
ATOM   887   O  O   . ALA A 1 117 ? 17.630  39.132  93.663  1.00 10.43 ? 117 ALA A O   1 
ATOM   888   C  CB  . ALA A 1 117 ? 16.730  42.038  94.712  1.00 10.41 ? 117 ALA A CB  1 
ATOM   889   N  N   . GLY A 1 118 ? 16.082  38.959  95.295  1.00 10.98 ? 118 GLY A N   1 
ATOM   890   C  CA  . GLY A 1 118 ? 16.565  37.674  95.774  1.00 11.24 ? 118 GLY A CA  1 
ATOM   891   C  C   . GLY A 1 118 ? 16.701  36.575  94.738  1.00 11.61 ? 118 GLY A C   1 
ATOM   892   O  O   . GLY A 1 118 ? 15.776  36.313  93.968  1.00 11.75 ? 118 GLY A O   1 
ATOM   893   N  N   . GLU A 1 119 ? 17.861  35.922  94.725  1.00 11.76 ? 119 GLU A N   1 
ATOM   894   C  CA  . GLU A 1 119 ? 18.111  34.838  93.782  1.00 11.82 ? 119 GLU A CA  1 
ATOM   895   C  C   . GLU A 1 119 ? 17.344  33.578  94.198  1.00 11.96 ? 119 GLU A C   1 
ATOM   896   O  O   . GLU A 1 119 ? 16.636  33.565  95.208  1.00 11.83 ? 119 GLU A O   1 
ATOM   897   C  CB  . GLU A 1 119 ? 19.609  34.534  93.694  1.00 11.86 ? 119 GLU A CB  1 
ATOM   898   C  CG  . GLU A 1 119 ? 20.509  35.614  94.283  1.00 12.03 ? 119 GLU A CG  1 
ATOM   899   C  CD  . GLU A 1 119 ? 21.156  36.499  93.223  1.00 12.08 ? 119 GLU A CD  1 
ATOM   900   O  OE1 . GLU A 1 119 ? 21.505  35.981  92.141  1.00 12.25 ? 119 GLU A OE1 1 
ATOM   901   O  OE2 . GLU A 1 119 ? 21.314  37.714  93.470  1.00 11.81 ? 119 GLU A OE2 1 
ATOM   902   N  N   . SER A 1 120 ? 17.497  32.520  93.412  1.00 11.91 ? 120 SER A N   1 
ATOM   903   C  CA  . SER A 1 120 ? 16.814  31.260  93.660  1.00 11.87 ? 120 SER A CA  1 
ATOM   904   C  C   . SER A 1 120 ? 16.982  30.699  95.065  1.00 12.03 ? 120 SER A C   1 
ATOM   905   O  O   . SER A 1 120 ? 16.080  30.044  95.581  1.00 12.07 ? 120 SER A O   1 
ATOM   906   C  CB  . SER A 1 120 ? 17.273  30.213  92.648  1.00 11.83 ? 120 SER A CB  1 
ATOM   907   O  OG  . SER A 1 120 ? 16.274  29.995  91.668  1.00 11.85 ? 120 SER A OG  1 
ATOM   908   N  N   . GLY A 1 121 ? 18.125  30.951  95.688  1.00 12.01 ? 121 GLY A N   1 
ATOM   909   C  CA  . GLY A 1 121 ? 18.346  30.414  97.020  1.00 12.18 ? 121 GLY A CA  1 
ATOM   910   C  C   . GLY A 1 121 ? 18.008  31.334  98.175  1.00 12.11 ? 121 GLY A C   1 
ATOM   911   O  O   . GLY A 1 121 ? 17.986  30.903  99.326  1.00 12.12 ? 121 GLY A O   1 
ATOM   912   N  N   . SER A 1 122 ? 17.731  32.597  97.870  1.00 12.20 ? 122 SER A N   1 
ATOM   913   C  CA  . SER A 1 122 ? 17.417  33.588  98.897  1.00 12.01 ? 122 SER A CA  1 
ATOM   914   C  C   . SER A 1 122 ? 16.259  33.208  99.820  1.00 11.97 ? 122 SER A C   1 
ATOM   915   O  O   . SER A 1 122 ? 15.585  32.198  99.618  1.00 12.30 ? 122 SER A O   1 
ATOM   916   C  CB  . SER A 1 122 ? 17.132  34.943  98.242  1.00 11.82 ? 122 SER A CB  1 
ATOM   917   O  OG  . SER A 1 122 ? 15.857  34.957  97.631  1.00 11.33 ? 122 SER A OG  1 
ATOM   918   N  N   . ALA A 1 123 ? 16.042  34.034  100.839 1.00 11.96 ? 123 ALA A N   1 
ATOM   919   C  CA  . ALA A 1 123 ? 14.981  33.813  101.814 1.00 11.60 ? 123 ALA A CA  1 
ATOM   920   C  C   . ALA A 1 123 ? 13.685  34.504  101.407 1.00 11.59 ? 123 ALA A C   1 
ATOM   921   O  O   . ALA A 1 123 ? 13.695  35.480  100.655 1.00 11.52 ? 123 ALA A O   1 
ATOM   922   C  CB  . ALA A 1 123 ? 15.426  34.314  103.177 1.00 11.45 ? 123 ALA A CB  1 
ATOM   923   N  N   . ASP A 1 124 ? 12.570  33.993  101.918 1.00 11.85 ? 124 ASP A N   1 
ATOM   924   C  CA  . ASP A 1 124 ? 11.251  34.545  101.617 1.00 11.95 ? 124 ASP A CA  1 
ATOM   925   C  C   . ASP A 1 124 ? 10.940  35.783  102.453 1.00 12.13 ? 124 ASP A C   1 
ATOM   926   O  O   . ASP A 1 124 ? 10.623  36.837  101.913 1.00 12.16 ? 124 ASP A O   1 
ATOM   927   C  CB  . ASP A 1 124 ? 10.172  33.490  101.869 1.00 12.06 ? 124 ASP A CB  1 
ATOM   928   C  CG  . ASP A 1 124 ? 10.086  32.464  100.761 1.00 12.17 ? 124 ASP A CG  1 
ATOM   929   O  OD1 . ASP A 1 124 ? 10.585  32.740  99.650  1.00 12.17 ? 124 ASP A OD1 1 
ATOM   930   O  OD2 . ASP A 1 124 ? 9.515   31.380  101.006 1.00 12.43 ? 124 ASP A OD2 1 
ATOM   931   N  N   . THR A 1 125 ? 11.037  35.645  103.771 1.00 12.40 ? 125 THR A N   1 
ATOM   932   C  CA  . THR A 1 125 ? 10.752  36.745  104.688 1.00 12.78 ? 125 THR A CA  1 
ATOM   933   C  C   . THR A 1 125 ? 11.773  37.884  104.624 1.00 13.18 ? 125 THR A C   1 
ATOM   934   O  O   . THR A 1 125 ? 12.539  38.088  105.570 1.00 13.47 ? 125 THR A O   1 
ATOM   935   C  CB  . THR A 1 125 ? 10.672  36.243  106.163 1.00 12.60 ? 125 THR A CB  1 
ATOM   936   O  OG1 . THR A 1 125 ? 11.973  35.827  106.610 1.00 12.15 ? 125 THR A OG1 1 
ATOM   937   C  CG2 . THR A 1 125 ? 9.687   35.077  106.281 1.00 12.33 ? 125 THR A CG2 1 
ATOM   938   N  N   . VAL A 1 126 ? 11.771  38.631  103.522 1.00 12.95 ? 126 VAL A N   1 
ATOM   939   C  CA  . VAL A 1 126 ? 12.706  39.745  103.347 1.00 12.72 ? 126 VAL A CA  1 
ATOM   940   C  C   . VAL A 1 126 ? 12.013  40.990  102.801 1.00 12.79 ? 126 VAL A C   1 
ATOM   941   O  O   . VAL A 1 126 ? 11.109  40.890  101.977 1.00 12.82 ? 126 VAL A O   1 
ATOM   942   C  CB  . VAL A 1 126 ? 13.861  39.368  102.379 1.00 12.61 ? 126 VAL A CB  1 
ATOM   943   C  CG1 . VAL A 1 126 ? 15.194  39.857  102.938 1.00 12.33 ? 126 VAL A CG1 1 
ATOM   944   C  CG2 . VAL A 1 126 ? 13.896  37.867  102.161 1.00 12.11 ? 126 VAL A CG2 1 
ATOM   945   N  N   . ARG A 1 127 ? 12.437  42.165  103.263 1.00 13.06 ? 127 ARG A N   1 
ATOM   946   C  CA  . ARG A 1 127 ? 11.841  43.414  102.792 1.00 13.13 ? 127 ARG A CA  1 
ATOM   947   C  C   . ARG A 1 127 ? 12.047  43.486  101.290 1.00 13.18 ? 127 ARG A C   1 
ATOM   948   O  O   . ARG A 1 127 ? 13.179  43.592  100.815 1.00 13.38 ? 127 ARG A O   1 
ATOM   949   C  CB  . ARG A 1 127 ? 12.498  44.627  103.456 1.00 12.96 ? 127 ARG A CB  1 
ATOM   950   C  CG  . ARG A 1 127 ? 12.129  45.949  102.792 1.00 12.87 ? 127 ARG A CG  1 
ATOM   951   C  CD  . ARG A 1 127 ? 12.397  47.133  103.703 1.00 13.04 ? 127 ARG A CD  1 
ATOM   952   N  NE  . ARG A 1 127 ? 11.283  47.385  104.610 1.00 13.26 ? 127 ARG A NE  1 
ATOM   953   C  CZ  . ARG A 1 127 ? 11.348  47.251  105.931 1.00 13.40 ? 127 ARG A CZ  1 
ATOM   954   N  NH1 . ARG A 1 127 ? 12.484  46.864  106.506 1.00 13.63 ? 127 ARG A NH1 1 
ATOM   955   N  NH2 . ARG A 1 127 ? 10.273  47.493  106.675 1.00 13.13 ? 127 ARG A NH2 1 
ATOM   956   N  N   . ASP A 1 128 ? 10.947  43.434  100.549 1.00 13.31 ? 128 ASP A N   1 
ATOM   957   C  CA  . ASP A 1 128 ? 11.002  43.458  99.094  1.00 13.31 ? 128 ASP A CA  1 
ATOM   958   C  C   . ASP A 1 128 ? 9.581   43.439  98.551  1.00 13.18 ? 128 ASP A C   1 
ATOM   959   O  O   . ASP A 1 128 ? 8.690   42.844  99.156  1.00 13.03 ? 128 ASP A O   1 
ATOM   960   C  CB  . ASP A 1 128 ? 11.742  42.216  98.593  1.00 13.72 ? 128 ASP A CB  1 
ATOM   961   C  CG  . ASP A 1 128 ? 12.684  42.516  97.449  1.00 14.12 ? 128 ASP A CG  1 
ATOM   962   O  OD1 . ASP A 1 128 ? 12.846  43.712  97.112  1.00 14.60 ? 128 ASP A OD1 1 
ATOM   963   O  OD2 . ASP A 1 128 ? 13.260  41.552  96.890  1.00 14.18 ? 128 ASP A OD2 1 
ATOM   964   N  N   . PRO A 1 129 ? 9.341   44.106  97.413  1.00 12.91 ? 129 PRO A N   1 
ATOM   965   C  CA  . PRO A 1 129 ? 7.976   44.085  96.877  1.00 12.75 ? 129 PRO A CA  1 
ATOM   966   C  C   . PRO A 1 129 ? 7.645   42.646  96.523  1.00 12.55 ? 129 PRO A C   1 
ATOM   967   O  O   . PRO A 1 129 ? 8.539   41.873  96.182  1.00 12.55 ? 129 PRO A O   1 
ATOM   968   C  CB  . PRO A 1 129 ? 8.053   44.977  95.640  1.00 12.73 ? 129 PRO A CB  1 
ATOM   969   C  CG  . PRO A 1 129 ? 9.299   45.785  95.825  1.00 12.81 ? 129 PRO A CG  1 
ATOM   970   C  CD  . PRO A 1 129 ? 10.249  44.908  96.582  1.00 12.79 ? 129 PRO A CD  1 
ATOM   971   N  N   . ARG A 1 130 ? 6.371   42.280  96.602  1.00 12.55 ? 130 ARG A N   1 
ATOM   972   C  CA  . ARG A 1 130 ? 5.976   40.910  96.298  1.00 12.54 ? 130 ARG A CA  1 
ATOM   973   C  C   . ARG A 1 130 ? 5.289   40.742  94.947  1.00 12.37 ? 130 ARG A C   1 
ATOM   974   O  O   . ARG A 1 130 ? 4.525   41.602  94.500  1.00 12.20 ? 130 ARG A O   1 
ATOM   975   C  CB  . ARG A 1 130 ? 5.074   40.369  97.407  1.00 12.62 ? 130 ARG A CB  1 
ATOM   976   C  CG  . ARG A 1 130 ? 5.730   39.310  98.277  1.00 12.61 ? 130 ARG A CG  1 
ATOM   977   C  CD  . ARG A 1 130 ? 7.085   39.765  98.803  1.00 12.31 ? 130 ARG A CD  1 
ATOM   978   N  NE  . ARG A 1 130 ? 7.193   39.575  100.247 1.00 11.97 ? 130 ARG A NE  1 
ATOM   979   C  CZ  . ARG A 1 130 ? 8.339   39.550  100.916 1.00 11.67 ? 130 ARG A CZ  1 
ATOM   980   N  NH1 . ARG A 1 130 ? 9.483   39.704  100.269 1.00 11.72 ? 130 ARG A NH1 1 
ATOM   981   N  NH2 . ARG A 1 130 ? 8.341   39.374  102.230 1.00 11.11 ? 130 ARG A NH2 1 
ATOM   982   N  N   . GLY A 1 131 ? 5.573   39.614  94.307  1.00 12.40 ? 131 GLY A N   1 
ATOM   983   C  CA  . GLY A 1 131 ? 4.994   39.326  93.009  1.00 12.08 ? 131 GLY A CA  1 
ATOM   984   C  C   . GLY A 1 131 ? 3.691   38.558  93.103  1.00 12.08 ? 131 GLY A C   1 
ATOM   985   O  O   . GLY A 1 131 ? 3.573   37.590  93.857  1.00 12.06 ? 131 GLY A O   1 
ATOM   986   N  N   . PHE A 1 132 ? 2.706   39.007  92.334  1.00 12.18 ? 132 PHE A N   1 
ATOM   987   C  CA  . PHE A 1 132 ? 1.395   38.372  92.297  1.00 11.91 ? 132 PHE A CA  1 
ATOM   988   C  C   . PHE A 1 132 ? 0.894   38.284  90.860  1.00 11.72 ? 132 PHE A C   1 
ATOM   989   O  O   . PHE A 1 132 ? 0.222   39.188  90.370  1.00 11.68 ? 132 PHE A O   1 
ATOM   990   C  CB  . PHE A 1 132 ? 0.395   39.165  93.138  1.00 12.21 ? 132 PHE A CB  1 
ATOM   991   C  CG  . PHE A 1 132 ? -0.762  38.343  93.645  1.00 12.37 ? 132 PHE A CG  1 
ATOM   992   C  CD1 . PHE A 1 132 ? -1.174  37.196  92.973  1.00 12.42 ? 132 PHE A CD1 1 
ATOM   993   C  CD2 . PHE A 1 132 ? -1.445  38.723  94.797  1.00 12.47 ? 132 PHE A CD2 1 
ATOM   994   C  CE1 . PHE A 1 132 ? -2.248  36.438  93.438  1.00 12.45 ? 132 PHE A CE1 1 
ATOM   995   C  CE2 . PHE A 1 132 ? -2.522  37.972  95.270  1.00 12.51 ? 132 PHE A CE2 1 
ATOM   996   C  CZ  . PHE A 1 132 ? -2.922  36.827  94.587  1.00 12.46 ? 132 PHE A CZ  1 
ATOM   997   N  N   . ALA A 1 133 ? 1.232   37.192  90.184  1.00 11.92 ? 133 ALA A N   1 
ATOM   998   C  CA  . ALA A 1 133 ? 0.799   36.988  88.808  1.00 11.87 ? 133 ALA A CA  1 
ATOM   999   C  C   . ALA A 1 133 ? -0.408  36.059  88.800  1.00 12.00 ? 133 ALA A C   1 
ATOM   1000  O  O   . ALA A 1 133 ? -0.542  35.195  89.664  1.00 12.04 ? 133 ALA A O   1 
ATOM   1001  C  CB  . ALA A 1 133 ? 1.931   36.382  87.986  1.00 11.71 ? 133 ALA A CB  1 
ATOM   1002  N  N   . VAL A 1 134 ? -1.294  36.248  87.829  1.00 12.17 ? 134 VAL A N   1 
ATOM   1003  C  CA  . VAL A 1 134 ? -2.479  35.406  87.706  1.00 12.43 ? 134 VAL A CA  1 
ATOM   1004  C  C   . VAL A 1 134 ? -2.703  35.067  86.241  1.00 12.46 ? 134 VAL A C   1 
ATOM   1005  O  O   . VAL A 1 134 ? -2.711  35.953  85.388  1.00 12.42 ? 134 VAL A O   1 
ATOM   1006  C  CB  . VAL A 1 134 ? -3.747  36.111  88.236  1.00 12.64 ? 134 VAL A CB  1 
ATOM   1007  C  CG1 . VAL A 1 134 ? -4.779  35.067  88.670  1.00 12.69 ? 134 VAL A CG1 1 
ATOM   1008  C  CG2 . VAL A 1 134 ? -3.392  37.031  89.400  1.00 12.94 ? 134 VAL A CG2 1 
ATOM   1009  N  N   . LYS A 1 135 ? -2.876  33.783  85.949  1.00 12.42 ? 135 LYS A N   1 
ATOM   1010  C  CA  . LYS A 1 135 ? -3.107  33.352  84.579  1.00 12.42 ? 135 LYS A CA  1 
ATOM   1011  C  C   . LYS A 1 135 ? -4.534  32.842  84.408  1.00 12.52 ? 135 LYS A C   1 
ATOM   1012  O  O   . LYS A 1 135 ? -4.940  31.869  85.041  1.00 12.62 ? 135 LYS A O   1 
ATOM   1013  C  CB  . LYS A 1 135 ? -2.113  32.252  84.182  1.00 12.20 ? 135 LYS A CB  1 
ATOM   1014  C  CG  . LYS A 1 135 ? -2.148  31.907  82.697  1.00 12.05 ? 135 LYS A CG  1 
ATOM   1015  C  CD  . LYS A 1 135 ? -1.148  30.815  82.347  1.00 12.07 ? 135 LYS A CD  1 
ATOM   1016  C  CE  . LYS A 1 135 ? 0.294   31.328  82.395  1.00 12.26 ? 135 LYS A CE  1 
ATOM   1017  N  NZ  . LYS A 1 135 ? 0.671   32.163  81.210  1.00 11.89 ? 135 LYS A NZ  1 
ATOM   1018  N  N   . PHE A 1 136 ? -5.300  33.510  83.557  1.00 12.70 ? 136 PHE A N   1 
ATOM   1019  C  CA  . PHE A 1 136 ? -6.672  33.099  83.297  1.00 12.81 ? 136 PHE A CA  1 
ATOM   1020  C  C   . PHE A 1 136 ? -6.705  32.277  82.010  1.00 12.83 ? 136 PHE A C   1 
ATOM   1021  O  O   . PHE A 1 136 ? -6.282  32.748  80.949  1.00 12.82 ? 136 PHE A O   1 
ATOM   1022  C  CB  . PHE A 1 136 ? -7.575  34.322  83.138  1.00 12.89 ? 136 PHE A CB  1 
ATOM   1023  C  CG  . PHE A 1 136 ? -7.644  35.196  84.360  1.00 12.99 ? 136 PHE A CG  1 
ATOM   1024  C  CD1 . PHE A 1 136 ? -6.640  36.121  84.629  1.00 13.14 ? 136 PHE A CD1 1 
ATOM   1025  C  CD2 . PHE A 1 136 ? -8.738  35.132  85.216  1.00 12.91 ? 136 PHE A CD2 1 
ATOM   1026  C  CE1 . PHE A 1 136 ? -6.728  36.974  85.730  1.00 13.10 ? 136 PHE A CE1 1 
ATOM   1027  C  CE2 . PHE A 1 136 ? -8.834  35.979  86.316  1.00 12.79 ? 136 PHE A CE2 1 
ATOM   1028  C  CZ  . PHE A 1 136 ? -7.827  36.902  86.572  1.00 12.91 ? 136 PHE A CZ  1 
ATOM   1029  N  N   . TYR A 1 137 ? -7.197  31.048  82.101  1.00 12.64 ? 137 TYR A N   1 
ATOM   1030  C  CA  . TYR A 1 137 ? -7.280  30.185  80.928  1.00 12.86 ? 137 TYR A CA  1 
ATOM   1031  C  C   . TYR A 1 137 ? -8.650  30.344  80.270  1.00 13.01 ? 137 TYR A C   1 
ATOM   1032  O  O   . TYR A 1 137 ? -9.455  29.406  80.242  1.00 12.91 ? 137 TYR A O   1 
ATOM   1033  C  CB  . TYR A 1 137 ? -7.069  28.729  81.330  1.00 12.61 ? 137 TYR A CB  1 
ATOM   1034  C  CG  . TYR A 1 137 ? -5.732  28.452  81.964  1.00 12.61 ? 137 TYR A CG  1 
ATOM   1035  C  CD1 . TYR A 1 137 ? -5.550  28.601  83.335  1.00 12.64 ? 137 TYR A CD1 1 
ATOM   1036  C  CD2 . TYR A 1 137 ? -4.662  27.981  81.201  1.00 12.66 ? 137 TYR A CD2 1 
ATOM   1037  C  CE1 . TYR A 1 137 ? -4.337  28.281  83.935  1.00 13.01 ? 137 TYR A CE1 1 
ATOM   1038  C  CE2 . TYR A 1 137 ? -3.446  27.657  81.785  1.00 13.01 ? 137 TYR A CE2 1 
ATOM   1039  C  CZ  . TYR A 1 137 ? -3.290  27.805  83.155  1.00 13.16 ? 137 TYR A CZ  1 
ATOM   1040  O  OH  . TYR A 1 137 ? -2.095  27.463  83.753  1.00 13.78 ? 137 TYR A OH  1 
ATOM   1041  N  N   . THR A 1 138 ? -8.901  31.537  79.734  1.00 12.96 ? 138 THR A N   1 
ATOM   1042  C  CA  . THR A 1 138 ? -10.174 31.848  79.096  1.00 13.05 ? 138 THR A CA  1 
ATOM   1043  C  C   . THR A 1 138 ? -10.339 31.263  77.694  1.00 13.29 ? 138 THR A C   1 
ATOM   1044  O  O   . THR A 1 138 ? -9.380  30.803  77.069  1.00 13.71 ? 138 THR A O   1 
ATOM   1045  C  CB  . THR A 1 138 ? -10.385 33.372  79.011  1.00 12.65 ? 138 THR A CB  1 
ATOM   1046  O  OG1 . THR A 1 138 ? -10.159 33.815  77.668  1.00 11.76 ? 138 THR A OG1 1 
ATOM   1047  C  CG2 . THR A 1 138 ? -9.420  34.094  79.943  1.00 12.59 ? 138 THR A CG2 1 
ATOM   1048  N  N   . GLU A 1 139 ? -11.577 31.295  77.214  1.00 13.37 ? 139 GLU A N   1 
ATOM   1049  C  CA  . GLU A 1 139 ? -11.931 30.792  75.898  1.00 13.08 ? 139 GLU A CA  1 
ATOM   1050  C  C   . GLU A 1 139 ? -11.268 31.625  74.805  1.00 13.00 ? 139 GLU A C   1 
ATOM   1051  O  O   . GLU A 1 139 ? -10.878 31.094  73.767  1.00 13.06 ? 139 GLU A O   1 
ATOM   1052  C  CB  . GLU A 1 139 ? -13.454 30.823  75.730  1.00 13.17 ? 139 GLU A CB  1 
ATOM   1053  C  CG  . GLU A 1 139 ? -14.209 30.069  76.825  1.00 13.35 ? 139 GLU A CG  1 
ATOM   1054  C  CD  . GLU A 1 139 ? -14.458 30.913  78.079  1.00 13.51 ? 139 GLU A CD  1 
ATOM   1055  O  OE1 . GLU A 1 139 ? -13.494 31.486  78.633  1.00 13.35 ? 139 GLU A OE1 1 
ATOM   1056  O  OE2 . GLU A 1 139 ? -15.627 30.998  78.515  1.00 13.85 ? 139 GLU A OE2 1 
ATOM   1057  N  N   . ASP A 1 140 ? -11.140 32.928  75.043  1.00 13.16 ? 140 ASP A N   1 
ATOM   1058  C  CA  . ASP A 1 140 ? -10.525 33.835  74.075  1.00 13.23 ? 140 ASP A CA  1 
ATOM   1059  C  C   . ASP A 1 140 ? -9.033  33.965  74.322  1.00 13.32 ? 140 ASP A C   1 
ATOM   1060  O  O   . ASP A 1 140 ? -8.480  35.058  74.239  1.00 13.19 ? 140 ASP A O   1 
ATOM   1061  C  CB  . ASP A 1 140 ? -11.161 35.222  74.154  1.00 13.43 ? 140 ASP A CB  1 
ATOM   1062  C  CG  . ASP A 1 140 ? -12.292 35.400  73.163  1.00 13.84 ? 140 ASP A CG  1 
ATOM   1063  O  OD1 . ASP A 1 140 ? -12.765 34.387  72.602  1.00 14.47 ? 140 ASP A OD1 1 
ATOM   1064  O  OD2 . ASP A 1 140 ? -12.711 36.556  72.944  1.00 14.03 ? 140 ASP A OD2 1 
ATOM   1065  N  N   . GLY A 1 141 ? -8.382  32.849  74.628  1.00 13.25 ? 141 GLY A N   1 
ATOM   1066  C  CA  . GLY A 1 141 ? -6.955  32.886  74.878  1.00 13.29 ? 141 GLY A CA  1 
ATOM   1067  C  C   . GLY A 1 141 ? -6.645  33.048  76.350  1.00 13.47 ? 141 GLY A C   1 
ATOM   1068  O  O   . GLY A 1 141 ? -7.551  33.214  77.172  1.00 13.58 ? 141 GLY A O   1 
ATOM   1069  N  N   . ASN A 1 142 ? -5.362  32.998  76.689  1.00 13.20 ? 142 ASN A N   1 
ATOM   1070  C  CA  . ASN A 1 142 ? -4.942  33.139  78.075  1.00 12.90 ? 142 ASN A CA  1 
ATOM   1071  C  C   . ASN A 1 142 ? -4.726  34.601  78.414  1.00 12.59 ? 142 ASN A C   1 
ATOM   1072  O  O   . ASN A 1 142 ? -4.210  35.364  77.601  1.00 12.69 ? 142 ASN A O   1 
ATOM   1073  C  CB  . ASN A 1 142 ? -3.653  32.348  78.320  1.00 12.95 ? 142 ASN A CB  1 
ATOM   1074  C  CG  . ASN A 1 142 ? -3.889  30.848  78.346  1.00 12.93 ? 142 ASN A CG  1 
ATOM   1075  O  OD1 . ASN A 1 142 ? -5.031  30.389  78.294  1.00 13.13 ? 142 ASN A OD1 1 
ATOM   1076  N  ND2 . ASN A 1 142 ? -2.813  30.076  78.425  1.00 13.00 ? 142 ASN A ND2 1 
ATOM   1077  N  N   . TRP A 1 143 ? -5.138  34.991  79.614  1.00 12.56 ? 143 TRP A N   1 
ATOM   1078  C  CA  . TRP A 1 143 ? -4.980  36.369  80.068  1.00 12.69 ? 143 TRP A CA  1 
ATOM   1079  C  C   . TRP A 1 143 ? -4.121  36.397  81.331  1.00 12.64 ? 143 TRP A C   1 
ATOM   1080  O  O   . TRP A 1 143 ? -4.509  35.856  82.369  1.00 12.45 ? 143 TRP A O   1 
ATOM   1081  C  CB  . TRP A 1 143 ? -6.347  36.997  80.353  1.00 12.64 ? 143 TRP A CB  1 
ATOM   1082  C  CG  . TRP A 1 143 ? -6.267  38.320  81.063  1.00 12.85 ? 143 TRP A CG  1 
ATOM   1083  C  CD1 . TRP A 1 143 ? -5.315  39.286  80.889  1.00 12.92 ? 143 TRP A CD1 1 
ATOM   1084  C  CD2 . TRP A 1 143 ? -7.167  38.820  82.066  1.00 12.99 ? 143 TRP A CD2 1 
ATOM   1085  N  NE1 . TRP A 1 143 ? -5.565  40.355  81.722  1.00 13.11 ? 143 TRP A NE1 1 
ATOM   1086  C  CE2 . TRP A 1 143 ? -6.694  40.096  82.454  1.00 13.16 ? 143 TRP A CE2 1 
ATOM   1087  C  CE3 . TRP A 1 143 ? -8.326  38.312  82.673  1.00 13.10 ? 143 TRP A CE3 1 
ATOM   1088  C  CZ2 . TRP A 1 143 ? -7.342  40.878  83.428  1.00 13.41 ? 143 TRP A CZ2 1 
ATOM   1089  C  CZ3 . TRP A 1 143 ? -8.973  39.088  83.642  1.00 13.40 ? 143 TRP A CZ3 1 
ATOM   1090  C  CH2 . TRP A 1 143 ? -8.476  40.360  84.009  1.00 13.42 ? 143 TRP A CH2 1 
ATOM   1091  N  N   . ASP A 1 144 ? -2.955  37.028  81.232  1.00 12.49 ? 144 ASP A N   1 
ATOM   1092  C  CA  . ASP A 1 144 ? -2.037  37.122  82.359  1.00 12.44 ? 144 ASP A CA  1 
ATOM   1093  C  C   . ASP A 1 144 ? -2.119  38.464  83.064  1.00 12.84 ? 144 ASP A C   1 
ATOM   1094  O  O   . ASP A 1 144 ? -1.953  39.520  82.442  1.00 13.22 ? 144 ASP A O   1 
ATOM   1095  C  CB  . ASP A 1 144 ? -0.601  36.904  81.893  1.00 11.85 ? 144 ASP A CB  1 
ATOM   1096  C  CG  . ASP A 1 144 ? -0.349  35.492  81.461  1.00 11.08 ? 144 ASP A CG  1 
ATOM   1097  O  OD1 . ASP A 1 144 ? 0.658   35.257  80.765  1.00 10.37 ? 144 ASP A OD1 1 
ATOM   1098  O  OD2 . ASP A 1 144 ? -1.165  34.620  81.819  1.00 10.61 ? 144 ASP A OD2 1 
ATOM   1099  N  N   . LEU A 1 145 ? -2.377  38.419  84.367  1.00 12.74 ? 145 LEU A N   1 
ATOM   1100  C  CA  . LEU A 1 145 ? -2.457  39.636  85.156  1.00 12.68 ? 145 LEU A CA  1 
ATOM   1101  C  C   . LEU A 1 145 ? -1.276  39.693  86.116  1.00 12.54 ? 145 LEU A C   1 
ATOM   1102  O  O   . LEU A 1 145 ? -1.398  39.352  87.291  1.00 12.45 ? 145 LEU A O   1 
ATOM   1103  C  CB  . LEU A 1 145 ? -3.771  39.688  85.931  1.00 12.42 ? 145 LEU A CB  1 
ATOM   1104  C  CG  . LEU A 1 145 ? -3.996  40.999  86.682  1.00 12.23 ? 145 LEU A CG  1 
ATOM   1105  C  CD1 . LEU A 1 145 ? -3.669  42.175  85.769  1.00 12.15 ? 145 LEU A CD1 1 
ATOM   1106  C  CD2 . LEU A 1 145 ? -5.435  41.070  87.173  1.00 12.09 ? 145 LEU A CD2 1 
ATOM   1107  N  N   . VAL A 1 146 ? -0.131  40.122  85.592  1.00 12.81 ? 146 VAL A N   1 
ATOM   1108  C  CA  . VAL A 1 146 ? 1.103   40.234  86.363  1.00 12.91 ? 146 VAL A CA  1 
ATOM   1109  C  C   . VAL A 1 146 ? 1.064   41.443  87.286  1.00 12.89 ? 146 VAL A C   1 
ATOM   1110  O  O   . VAL A 1 146 ? 1.244   42.575  86.839  1.00 13.05 ? 146 VAL A O   1 
ATOM   1111  C  CB  . VAL A 1 146 ? 2.311   40.383  85.429  1.00 13.08 ? 146 VAL A CB  1 
ATOM   1112  C  CG1 . VAL A 1 146 ? 3.513   39.683  86.021  1.00 13.30 ? 146 VAL A CG1 1 
ATOM   1113  C  CG2 . VAL A 1 146 ? 1.979   39.809  84.066  1.00 13.38 ? 146 VAL A CG2 1 
ATOM   1114  N  N   . GLY A 1 147 ? 0.841   41.207  88.574  1.00 12.94 ? 147 GLY A N   1 
ATOM   1115  C  CA  . GLY A 1 147 ? 0.775   42.315  89.508  1.00 12.69 ? 147 GLY A CA  1 
ATOM   1116  C  C   . GLY A 1 147 ? 1.726   42.230  90.686  1.00 12.68 ? 147 GLY A C   1 
ATOM   1117  O  O   . GLY A 1 147 ? 2.406   41.223  90.897  1.00 12.68 ? 147 GLY A O   1 
ATOM   1118  N  N   . ASN A 1 148 ? 1.775   43.313  91.450  1.00 12.74 ? 148 ASN A N   1 
ATOM   1119  C  CA  . ASN A 1 148 ? 2.623   43.402  92.628  1.00 12.87 ? 148 ASN A CA  1 
ATOM   1120  C  C   . ASN A 1 148 ? 1.710   43.418  93.851  1.00 12.85 ? 148 ASN A C   1 
ATOM   1121  O  O   . ASN A 1 148 ? 0.504   43.200  93.737  1.00 12.64 ? 148 ASN A O   1 
ATOM   1122  C  CB  . ASN A 1 148 ? 3.446   44.695  92.594  1.00 12.73 ? 148 ASN A CB  1 
ATOM   1123  C  CG  . ASN A 1 148 ? 4.738   44.549  91.815  1.00 12.92 ? 148 ASN A CG  1 
ATOM   1124  O  OD1 . ASN A 1 148 ? 5.173   43.440  91.512  1.00 13.48 ? 148 ASN A OD1 1 
ATOM   1125  N  ND2 . ASN A 1 148 ? 5.359   45.675  91.483  1.00 12.78 ? 148 ASN A ND2 1 
ATOM   1126  N  N   . ASN A 1 149 ? 2.295   43.668  95.018  1.00 12.92 ? 149 ASN A N   1 
ATOM   1127  C  CA  . ASN A 1 149 ? 1.532   43.743  96.255  1.00 13.23 ? 149 ASN A CA  1 
ATOM   1128  C  C   . ASN A 1 149 ? 1.451   45.217  96.621  1.00 13.56 ? 149 ASN A C   1 
ATOM   1129  O  O   . ASN A 1 149 ? 0.977   45.581  97.698  1.00 13.88 ? 149 ASN A O   1 
ATOM   1130  C  CB  . ASN A 1 149 ? 2.224   42.965  97.374  1.00 12.96 ? 149 ASN A CB  1 
ATOM   1131  C  CG  . ASN A 1 149 ? 3.670   43.365  97.549  1.00 12.67 ? 149 ASN A CG  1 
ATOM   1132  O  OD1 . ASN A 1 149 ? 4.272   43.972  96.663  1.00 12.25 ? 149 ASN A OD1 1 
ATOM   1133  N  ND2 . ASN A 1 149 ? 4.241   43.022  98.695  1.00 12.76 ? 149 ASN A ND2 1 
ATOM   1134  N  N   . THR A 1 150 ? 1.928   46.056  95.704  1.00 13.68 ? 150 THR A N   1 
ATOM   1135  C  CA  . THR A 1 150 ? 1.913   47.504  95.868  1.00 13.66 ? 150 THR A CA  1 
ATOM   1136  C  C   . THR A 1 150 ? 1.292   48.104  94.609  1.00 13.46 ? 150 THR A C   1 
ATOM   1137  O  O   . THR A 1 150 ? 1.568   47.648  93.498  1.00 13.53 ? 150 THR A O   1 
ATOM   1138  C  CB  . THR A 1 150 ? 3.333   48.070  96.032  1.00 13.79 ? 150 THR A CB  1 
ATOM   1139  O  OG1 . THR A 1 150 ? 3.345   49.450  95.636  1.00 13.95 ? 150 THR A OG1 1 
ATOM   1140  C  CG2 . THR A 1 150 ? 4.321   47.290  95.173  1.00 13.77 ? 150 THR A CG2 1 
ATOM   1141  N  N   . PRO A 1 151 ? 0.449   49.138  94.767  1.00 13.28 ? 151 PRO A N   1 
ATOM   1142  C  CA  . PRO A 1 151 ? -0.210  49.791  93.630  1.00 13.33 ? 151 PRO A CA  1 
ATOM   1143  C  C   . PRO A 1 151 ? 0.659   50.752  92.825  1.00 13.34 ? 151 PRO A C   1 
ATOM   1144  O  O   . PRO A 1 151 ? 0.210   51.299  91.820  1.00 13.59 ? 151 PRO A O   1 
ATOM   1145  C  CB  . PRO A 1 151 ? -1.400  50.499  94.266  1.00 13.09 ? 151 PRO A CB  1 
ATOM   1146  C  CG  . PRO A 1 151 ? -0.938  50.806  95.651  1.00 12.98 ? 151 PRO A CG  1 
ATOM   1147  C  CD  . PRO A 1 151 ? 0.061   49.748  96.051  1.00 13.11 ? 151 PRO A CD  1 
ATOM   1148  N  N   . ILE A 1 152 ? 1.895   50.969  93.256  1.00 13.19 ? 152 ILE A N   1 
ATOM   1149  C  CA  . ILE A 1 152 ? 2.780   51.870  92.527  1.00 13.12 ? 152 ILE A CA  1 
ATOM   1150  C  C   . ILE A 1 152 ? 4.181   51.290  92.361  1.00 13.15 ? 152 ILE A C   1 
ATOM   1151  O  O   . ILE A 1 152 ? 4.440   50.158  92.763  1.00 13.18 ? 152 ILE A O   1 
ATOM   1152  C  CB  . ILE A 1 152 ? 2.883   53.245  93.220  1.00 12.96 ? 152 ILE A CB  1 
ATOM   1153  C  CG1 . ILE A 1 152 ? 2.785   53.084  94.740  1.00 12.71 ? 152 ILE A CG1 1 
ATOM   1154  C  CG2 . ILE A 1 152 ? 1.781   54.155  92.710  1.00 12.88 ? 152 ILE A CG2 1 
ATOM   1155  C  CD1 . ILE A 1 152 ? 3.688   54.029  95.514  1.00 11.96 ? 152 ILE A CD1 1 
ATOM   1156  N  N   . PHE A 1 153 ? 5.078   52.064  91.754  1.00 12.85 ? 153 PHE A N   1 
ATOM   1157  C  CA  . PHE A 1 153 ? 6.445   51.608  91.540  1.00 12.79 ? 153 PHE A CA  1 
ATOM   1158  C  C   . PHE A 1 153 ? 7.479   52.722  91.710  1.00 12.76 ? 153 PHE A C   1 
ATOM   1159  O  O   . PHE A 1 153 ? 7.146   53.906  91.709  1.00 12.59 ? 153 PHE A O   1 
ATOM   1160  C  CB  . PHE A 1 153 ? 6.576   50.988  90.149  1.00 12.85 ? 153 PHE A CB  1 
ATOM   1161  C  CG  . PHE A 1 153 ? 7.605   49.891  90.065  1.00 12.93 ? 153 PHE A CG  1 
ATOM   1162  C  CD1 . PHE A 1 153 ? 7.286   48.590  90.439  1.00 12.97 ? 153 PHE A CD1 1 
ATOM   1163  C  CD2 . PHE A 1 153 ? 8.894   50.162  89.615  1.00 13.04 ? 153 PHE A CD2 1 
ATOM   1164  C  CE1 . PHE A 1 153 ? 8.233   47.573  90.368  1.00 13.03 ? 153 PHE A CE1 1 
ATOM   1165  C  CE2 . PHE A 1 153 ? 9.847   49.154  89.542  1.00 13.14 ? 153 PHE A CE2 1 
ATOM   1166  C  CZ  . PHE A 1 153 ? 9.513   47.854  89.920  1.00 13.17 ? 153 PHE A CZ  1 
ATOM   1167  N  N   . PHE A 1 154 ? 8.738   52.320  91.849  1.00 12.84 ? 154 PHE A N   1 
ATOM   1168  C  CA  . PHE A 1 154 ? 9.849   53.243  92.041  1.00 13.00 ? 154 PHE A CA  1 
ATOM   1169  C  C   . PHE A 1 154 ? 10.062  54.215  90.892  1.00 13.21 ? 154 PHE A C   1 
ATOM   1170  O  O   . PHE A 1 154 ? 10.362  55.385  91.113  1.00 13.42 ? 154 PHE A O   1 
ATOM   1171  C  CB  . PHE A 1 154 ? 11.138  52.458  92.272  1.00 12.82 ? 154 PHE A CB  1 
ATOM   1172  C  CG  . PHE A 1 154 ? 11.077  51.526  93.448  1.00 12.62 ? 154 PHE A CG  1 
ATOM   1173  C  CD1 . PHE A 1 154 ? 11.415  51.970  94.722  1.00 12.49 ? 154 PHE A CD1 1 
ATOM   1174  C  CD2 . PHE A 1 154 ? 10.693  50.198  93.281  1.00 12.53 ? 154 PHE A CD2 1 
ATOM   1175  C  CE1 . PHE A 1 154 ? 11.374  51.104  95.811  1.00 12.33 ? 154 PHE A CE1 1 
ATOM   1176  C  CE2 . PHE A 1 154 ? 10.649  49.325  94.364  1.00 12.34 ? 154 PHE A CE2 1 
ATOM   1177  C  CZ  . PHE A 1 154 ? 10.991  49.779  95.630  1.00 12.29 ? 154 PHE A CZ  1 
ATOM   1178  N  N   . ILE A 1 155 ? 9.918   53.729  89.666  1.00 13.26 ? 155 ILE A N   1 
ATOM   1179  C  CA  . ILE A 1 155 ? 10.112  54.568  88.493  1.00 13.25 ? 155 ILE A CA  1 
ATOM   1180  C  C   . ILE A 1 155 ? 8.888   54.549  87.573  1.00 13.29 ? 155 ILE A C   1 
ATOM   1181  O  O   . ILE A 1 155 ? 7.993   53.716  87.728  1.00 13.46 ? 155 ILE A O   1 
ATOM   1182  C  CB  . ILE A 1 155 ? 11.368  54.121  87.703  1.00 13.18 ? 155 ILE A CB  1 
ATOM   1183  C  CG1 . ILE A 1 155 ? 11.493  52.594  87.724  1.00 12.89 ? 155 ILE A CG1 1 
ATOM   1184  C  CG2 . ILE A 1 155 ? 12.610  54.756  88.315  1.00 13.11 ? 155 ILE A CG2 1 
ATOM   1185  C  CD1 . ILE A 1 155 ? 12.347  52.034  86.615  1.00 12.41 ? 155 ILE A CD1 1 
ATOM   1186  N  N   . ARG A 1 156 ? 8.849   55.473  86.617  1.00 13.22 ? 156 ARG A N   1 
ATOM   1187  C  CA  . ARG A 1 156 ? 7.725   55.564  85.690  1.00 13.15 ? 156 ARG A CA  1 
ATOM   1188  C  C   . ARG A 1 156 ? 8.159   55.428  84.236  1.00 12.95 ? 156 ARG A C   1 
ATOM   1189  O  O   . ARG A 1 156 ? 7.353   55.620  83.325  1.00 12.83 ? 156 ARG A O   1 
ATOM   1190  C  CB  . ARG A 1 156 ? 6.989   56.896  85.884  1.00 13.14 ? 156 ARG A CB  1 
ATOM   1191  C  CG  . ARG A 1 156 ? 7.853   58.016  86.454  1.00 13.14 ? 156 ARG A CG  1 
ATOM   1192  C  CD  . ARG A 1 156 ? 7.205   59.374  86.251  1.00 13.20 ? 156 ARG A CD  1 
ATOM   1193  N  NE  . ARG A 1 156 ? 6.818   59.984  87.518  1.00 13.26 ? 156 ARG A NE  1 
ATOM   1194  C  CZ  . ARG A 1 156 ? 7.405   61.053  88.053  1.00 13.29 ? 156 ARG A CZ  1 
ATOM   1195  N  NH1 . ARG A 1 156 ? 8.416   61.647  87.436  1.00 12.88 ? 156 ARG A NH1 1 
ATOM   1196  N  NH2 . ARG A 1 156 ? 6.974   61.535  89.210  1.00 13.54 ? 156 ARG A NH2 1 
ATOM   1197  N  N   . ASP A 1 157 ? 9.429   55.091  84.028  1.00 12.89 ? 157 ASP A N   1 
ATOM   1198  C  CA  . ASP A 1 157 ? 9.975   54.929  82.686  1.00 12.79 ? 157 ASP A CA  1 
ATOM   1199  C  C   . ASP A 1 157 ? 10.784  53.635  82.583  1.00 12.54 ? 157 ASP A C   1 
ATOM   1200  O  O   . ASP A 1 157 ? 11.798  53.466  83.254  1.00 12.63 ? 157 ASP A O   1 
ATOM   1201  C  CB  . ASP A 1 157 ? 10.859  56.129  82.338  1.00 13.23 ? 157 ASP A CB  1 
ATOM   1202  C  CG  . ASP A 1 157 ? 11.113  56.255  80.847  1.00 13.57 ? 157 ASP A CG  1 
ATOM   1203  O  OD1 . ASP A 1 157 ? 11.314  55.213  80.184  1.00 13.83 ? 157 ASP A OD1 1 
ATOM   1204  O  OD2 . ASP A 1 157 ? 11.113  57.399  80.342  1.00 13.82 ? 157 ASP A OD2 1 
ATOM   1205  N  N   . PRO A 1 158 ? 10.352  52.714  81.715  1.00 12.30 ? 158 PRO A N   1 
ATOM   1206  C  CA  . PRO A 1 158 ? 11.013  51.423  81.505  1.00 12.33 ? 158 PRO A CA  1 
ATOM   1207  C  C   . PRO A 1 158 ? 12.515  51.454  81.227  1.00 12.51 ? 158 PRO A C   1 
ATOM   1208  O  O   . PRO A 1 158 ? 13.237  50.538  81.623  1.00 12.50 ? 158 PRO A O   1 
ATOM   1209  C  CB  . PRO A 1 158 ? 10.234  50.804  80.343  1.00 12.15 ? 158 PRO A CB  1 
ATOM   1210  C  CG  . PRO A 1 158 ? 9.490   51.946  79.722  1.00 12.06 ? 158 PRO A CG  1 
ATOM   1211  C  CD  . PRO A 1 158 ? 9.177   52.870  80.845  1.00 12.18 ? 158 PRO A CD  1 
ATOM   1212  N  N   . ILE A 1 159 ? 12.989  52.500  80.556  1.00 12.63 ? 159 ILE A N   1 
ATOM   1213  C  CA  . ILE A 1 159 ? 14.410  52.596  80.221  1.00 12.77 ? 159 ILE A CA  1 
ATOM   1214  C  C   . ILE A 1 159 ? 15.344  52.623  81.432  1.00 12.70 ? 159 ILE A C   1 
ATOM   1215  O  O   . ILE A 1 159 ? 16.555  52.457  81.283  1.00 12.86 ? 159 ILE A O   1 
ATOM   1216  C  CB  . ILE A 1 159 ? 14.697  53.836  79.328  1.00 12.78 ? 159 ILE A CB  1 
ATOM   1217  C  CG1 . ILE A 1 159 ? 15.970  53.602  78.510  1.00 12.86 ? 159 ILE A CG1 1 
ATOM   1218  C  CG2 . ILE A 1 159 ? 14.841  55.089  80.183  1.00 12.76 ? 159 ILE A CG2 1 
ATOM   1219  C  CD1 . ILE A 1 159 ? 15.723  53.142  77.087  1.00 12.77 ? 159 ILE A CD1 1 
ATOM   1220  N  N   . LEU A 1 160 ? 14.784  52.823  82.624  1.00 12.77 ? 160 LEU A N   1 
ATOM   1221  C  CA  . LEU A 1 160 ? 15.583  52.863  83.850  1.00 12.63 ? 160 LEU A CA  1 
ATOM   1222  C  C   . LEU A 1 160 ? 15.558  51.523  84.585  1.00 12.60 ? 160 LEU A C   1 
ATOM   1223  O  O   . LEU A 1 160 ? 16.472  51.209  85.349  1.00 12.63 ? 160 LEU A O   1 
ATOM   1224  C  CB  . LEU A 1 160 ? 15.071  53.956  84.797  1.00 12.57 ? 160 LEU A CB  1 
ATOM   1225  C  CG  . LEU A 1 160 ? 15.274  55.429  84.423  1.00 12.65 ? 160 LEU A CG  1 
ATOM   1226  C  CD1 . LEU A 1 160 ? 13.922  56.098  84.270  1.00 13.14 ? 160 LEU A CD1 1 
ATOM   1227  C  CD2 . LEU A 1 160 ? 16.079  56.138  85.496  1.00 12.53 ? 160 LEU A CD2 1 
ATOM   1228  N  N   . PHE A 1 161 ? 14.513  50.736  84.353  1.00 12.23 ? 161 PHE A N   1 
ATOM   1229  C  CA  . PHE A 1 161 ? 14.368  49.445  85.015  1.00 12.45 ? 161 PHE A CA  1 
ATOM   1230  C  C   . PHE A 1 161 ? 15.629  48.582  85.033  1.00 12.39 ? 161 PHE A C   1 
ATOM   1231  O  O   . PHE A 1 161 ? 16.041  48.098  86.092  1.00 12.27 ? 161 PHE A O   1 
ATOM   1232  C  CB  . PHE A 1 161 ? 13.231  48.653  84.379  1.00 12.51 ? 161 PHE A CB  1 
ATOM   1233  C  CG  . PHE A 1 161 ? 12.895  47.387  85.110  1.00 12.73 ? 161 PHE A CG  1 
ATOM   1234  C  CD1 . PHE A 1 161 ? 12.059  47.414  86.223  1.00 12.94 ? 161 PHE A CD1 1 
ATOM   1235  C  CD2 . PHE A 1 161 ? 13.406  46.165  84.681  1.00 12.99 ? 161 PHE A CD2 1 
ATOM   1236  C  CE1 . PHE A 1 161 ? 11.732  46.244  86.900  1.00 13.29 ? 161 PHE A CE1 1 
ATOM   1237  C  CE2 . PHE A 1 161 ? 13.089  44.980  85.350  1.00 13.32 ? 161 PHE A CE2 1 
ATOM   1238  C  CZ  . PHE A 1 161 ? 12.250  45.018  86.463  1.00 13.51 ? 161 PHE A CZ  1 
ATOM   1239  N  N   . PRO A 1 162 ? 16.258  48.371  83.863  1.00 12.35 ? 162 PRO A N   1 
ATOM   1240  C  CA  . PRO A 1 162 ? 17.468  47.543  83.853  1.00 12.39 ? 162 PRO A CA  1 
ATOM   1241  C  C   . PRO A 1 162 ? 18.447  48.030  84.914  1.00 12.51 ? 162 PRO A C   1 
ATOM   1242  O  O   . PRO A 1 162 ? 18.935  47.248  85.734  1.00 12.76 ? 162 PRO A O   1 
ATOM   1243  C  CB  . PRO A 1 162 ? 18.017  47.722  82.440  1.00 12.13 ? 162 PRO A CB  1 
ATOM   1244  C  CG  . PRO A 1 162 ? 16.834  48.091  81.623  1.00 11.99 ? 162 PRO A CG  1 
ATOM   1245  C  CD  . PRO A 1 162 ? 15.931  48.883  82.521  1.00 12.06 ? 162 PRO A CD  1 
ATOM   1246  N  N   . SER A 1 163 ? 18.710  49.332  84.898  1.00 12.47 ? 163 SER A N   1 
ATOM   1247  C  CA  . SER A 1 163 ? 19.622  49.941  85.853  1.00 12.49 ? 163 SER A CA  1 
ATOM   1248  C  C   . SER A 1 163 ? 19.123  49.743  87.278  1.00 12.38 ? 163 SER A C   1 
ATOM   1249  O  O   . SER A 1 163 ? 19.872  49.302  88.150  1.00 12.21 ? 163 SER A O   1 
ATOM   1250  C  CB  . SER A 1 163 ? 19.773  51.437  85.562  1.00 12.65 ? 163 SER A CB  1 
ATOM   1251  O  OG  . SER A 1 163 ? 19.562  51.725  84.188  1.00 12.88 ? 163 SER A OG  1 
ATOM   1252  N  N   . PHE A 1 164 ? 17.854  50.067  87.509  1.00 12.40 ? 164 PHE A N   1 
ATOM   1253  C  CA  . PHE A 1 164 ? 17.269  49.930  88.840  1.00 12.46 ? 164 PHE A CA  1 
ATOM   1254  C  C   . PHE A 1 164 ? 17.460  48.540  89.442  1.00 12.32 ? 164 PHE A C   1 
ATOM   1255  O  O   . PHE A 1 164 ? 17.854  48.405  90.604  1.00 12.31 ? 164 PHE A O   1 
ATOM   1256  C  CB  . PHE A 1 164 ? 15.776  50.246  88.808  1.00 12.41 ? 164 PHE A CB  1 
ATOM   1257  C  CG  . PHE A 1 164 ? 15.072  49.926  90.092  1.00 12.54 ? 164 PHE A CG  1 
ATOM   1258  C  CD1 . PHE A 1 164 ? 15.322  50.675  91.239  1.00 12.68 ? 164 PHE A CD1 1 
ATOM   1259  C  CD2 . PHE A 1 164 ? 14.163  48.875  90.161  1.00 12.46 ? 164 PHE A CD2 1 
ATOM   1260  C  CE1 . PHE A 1 164 ? 14.673  50.382  92.436  1.00 12.72 ? 164 PHE A CE1 1 
ATOM   1261  C  CE2 . PHE A 1 164 ? 13.508  48.573  91.354  1.00 12.39 ? 164 PHE A CE2 1 
ATOM   1262  C  CZ  . PHE A 1 164 ? 13.764  49.330  92.493  1.00 12.61 ? 164 PHE A CZ  1 
ATOM   1263  N  N   . ILE A 1 165 ? 17.163  47.513  88.653  1.00 12.03 ? 165 ILE A N   1 
ATOM   1264  C  CA  . ILE A 1 165 ? 17.301  46.141  89.120  1.00 11.85 ? 165 ILE A CA  1 
ATOM   1265  C  C   . ILE A 1 165 ? 18.760  45.799  89.343  1.00 11.91 ? 165 ILE A C   1 
ATOM   1266  O  O   . ILE A 1 165 ? 19.081  44.930  90.148  1.00 12.01 ? 165 ILE A O   1 
ATOM   1267  C  CB  . ILE A 1 165 ? 16.712  45.136  88.113  1.00 11.59 ? 165 ILE A CB  1 
ATOM   1268  C  CG1 . ILE A 1 165 ? 15.216  45.406  87.921  1.00 11.36 ? 165 ILE A CG1 1 
ATOM   1269  C  CG2 . ILE A 1 165 ? 16.942  43.718  88.601  1.00 11.18 ? 165 ILE A CG2 1 
ATOM   1270  C  CD1 . ILE A 1 165 ? 14.411  45.434  89.204  1.00 10.86 ? 165 ILE A CD1 1 
ATOM   1271  N  N   . HIS A 1 166 ? 19.641  46.483  88.621  1.00 12.05 ? 166 HIS A N   1 
ATOM   1272  C  CA  . HIS A 1 166 ? 21.073  46.249  88.754  1.00 11.78 ? 166 HIS A CA  1 
ATOM   1273  C  C   . HIS A 1 166 ? 21.520  46.755  90.120  1.00 11.92 ? 166 HIS A C   1 
ATOM   1274  O  O   . HIS A 1 166 ? 22.215  46.051  90.852  1.00 12.04 ? 166 HIS A O   1 
ATOM   1275  C  CB  . HIS A 1 166 ? 21.841  46.988  87.650  1.00 11.49 ? 166 HIS A CB  1 
ATOM   1276  C  CG  . HIS A 1 166 ? 22.023  46.190  86.395  1.00 11.07 ? 166 HIS A CG  1 
ATOM   1277  N  ND1 . HIS A 1 166 ? 22.852  46.596  85.371  1.00 10.76 ? 166 HIS A ND1 1 
ATOM   1278  C  CD2 . HIS A 1 166 ? 21.495  45.006  86.001  1.00 10.92 ? 166 HIS A CD2 1 
ATOM   1279  C  CE1 . HIS A 1 166 ? 22.829  45.698  84.403  1.00 10.52 ? 166 HIS A CE1 1 
ATOM   1280  N  NE2 . HIS A 1 166 ? 22.013  44.723  84.760  1.00 10.64 ? 166 HIS A NE2 1 
ATOM   1281  N  N   . SER A 1 167 ? 21.101  47.973  90.459  1.00 12.08 ? 167 SER A N   1 
ATOM   1282  C  CA  . SER A 1 167 ? 21.458  48.591  91.734  1.00 12.47 ? 167 SER A CA  1 
ATOM   1283  C  C   . SER A 1 167 ? 20.909  47.799  92.914  1.00 12.37 ? 167 SER A C   1 
ATOM   1284  O  O   . SER A 1 167 ? 21.513  47.766  93.986  1.00 12.30 ? 167 SER A O   1 
ATOM   1285  C  CB  . SER A 1 167 ? 20.940  50.032  91.796  1.00 12.58 ? 167 SER A CB  1 
ATOM   1286  O  OG  . SER A 1 167 ? 19.573  50.067  92.166  1.00 13.31 ? 167 SER A OG  1 
ATOM   1287  N  N   . GLN A 1 168 ? 19.764  47.162  92.707  1.00 12.13 ? 168 GLN A N   1 
ATOM   1288  C  CA  . GLN A 1 168 ? 19.129  46.362  93.742  1.00 11.93 ? 168 GLN A CA  1 
ATOM   1289  C  C   . GLN A 1 168 ? 19.858  45.039  93.961  1.00 12.04 ? 168 GLN A C   1 
ATOM   1290  O  O   . GLN A 1 168 ? 19.711  44.403  95.009  1.00 12.00 ? 168 GLN A O   1 
ATOM   1291  C  CB  . GLN A 1 168 ? 17.682  46.070  93.352  1.00 11.97 ? 168 GLN A CB  1 
ATOM   1292  C  CG  . GLN A 1 168 ? 16.733  47.226  93.578  1.00 11.99 ? 168 GLN A CG  1 
ATOM   1293  C  CD  . GLN A 1 168 ? 16.567  47.549  95.043  1.00 12.00 ? 168 GLN A CD  1 
ATOM   1294  O  OE1 . GLN A 1 168 ? 17.004  48.601  95.510  1.00 11.89 ? 168 GLN A OE1 1 
ATOM   1295  N  NE2 . GLN A 1 168 ? 15.939  46.640  95.782  1.00 12.02 ? 168 GLN A NE2 1 
ATOM   1296  N  N   . LYS A 1 169 ? 20.650  44.625  92.976  1.00 12.02 ? 169 LYS A N   1 
ATOM   1297  C  CA  . LYS A 1 169 ? 21.359  43.358  93.076  1.00 12.20 ? 169 LYS A CA  1 
ATOM   1298  C  C   . LYS A 1 169 ? 22.793  43.436  93.581  1.00 12.03 ? 169 LYS A C   1 
ATOM   1299  O  O   . LYS A 1 169 ? 23.153  44.334  94.341  1.00 11.83 ? 169 LYS A O   1 
ATOM   1300  C  CB  . LYS A 1 169 ? 21.322  42.637  91.729  1.00 12.51 ? 169 LYS A CB  1 
ATOM   1301  C  CG  . LYS A 1 169 ? 19.913  42.330  91.246  1.00 13.15 ? 169 LYS A CG  1 
ATOM   1302  C  CD  . LYS A 1 169 ? 19.558  40.860  91.431  1.00 13.61 ? 169 LYS A CD  1 
ATOM   1303  C  CE  . LYS A 1 169 ? 18.895  40.297  90.180  1.00 13.69 ? 169 LYS A CE  1 
ATOM   1304  N  NZ  . LYS A 1 169 ? 17.946  39.206  90.489  1.00 13.35 ? 169 LYS A NZ  1 
ATOM   1305  N  N   . ARG A 1 170 ? 23.602  42.472  93.156  1.00 12.02 ? 170 ARG A N   1 
ATOM   1306  C  CA  . ARG A 1 170 ? 24.992  42.380  93.576  1.00 12.23 ? 170 ARG A CA  1 
ATOM   1307  C  C   . ARG A 1 170 ? 25.950  43.318  92.851  1.00 12.25 ? 170 ARG A C   1 
ATOM   1308  O  O   . ARG A 1 170 ? 25.696  43.762  91.730  1.00 12.20 ? 170 ARG A O   1 
ATOM   1309  C  CB  . ARG A 1 170 ? 25.482  40.942  93.410  1.00 12.40 ? 170 ARG A CB  1 
ATOM   1310  C  CG  . ARG A 1 170 ? 24.402  39.894  93.599  1.00 12.62 ? 170 ARG A CG  1 
ATOM   1311  C  CD  . ARG A 1 170 ? 24.956  38.718  94.369  1.00 12.80 ? 170 ARG A CD  1 
ATOM   1312  N  NE  . ARG A 1 170 ? 23.931  37.740  94.719  1.00 12.69 ? 170 ARG A NE  1 
ATOM   1313  C  CZ  . ARG A 1 170 ? 23.948  37.018  95.834  1.00 12.60 ? 170 ARG A CZ  1 
ATOM   1314  N  NH1 . ARG A 1 170 ? 24.938  37.169  96.703  1.00 12.46 ? 170 ARG A NH1 1 
ATOM   1315  N  NH2 . ARG A 1 170 ? 22.981  36.143  96.078  1.00 12.37 ? 170 ARG A NH2 1 
ATOM   1316  N  N   . ASN A 1 171 ? 27.060  43.616  93.517  1.00 12.21 ? 171 ASN A N   1 
ATOM   1317  C  CA  . ASN A 1 171 ? 28.083  44.479  92.958  1.00 12.14 ? 171 ASN A CA  1 
ATOM   1318  C  C   . ASN A 1 171 ? 28.770  43.669  91.866  1.00 12.10 ? 171 ASN A C   1 
ATOM   1319  O  O   . ASN A 1 171 ? 28.981  42.464  92.017  1.00 12.30 ? 171 ASN A O   1 
ATOM   1320  C  CB  . ASN A 1 171 ? 29.089  44.866  94.044  1.00 12.16 ? 171 ASN A CB  1 
ATOM   1321  C  CG  . ASN A 1 171 ? 30.032  45.968  93.603  1.00 12.10 ? 171 ASN A CG  1 
ATOM   1322  O  OD1 . ASN A 1 171 ? 31.181  45.711  93.242  1.00 12.12 ? 171 ASN A OD1 1 
ATOM   1323  N  ND2 . ASN A 1 171 ? 29.550  47.205  93.632  1.00 12.11 ? 171 ASN A ND2 1 
ATOM   1324  N  N   . PRO A 1 172 ? 29.121  44.319  90.747  1.00 11.90 ? 172 PRO A N   1 
ATOM   1325  C  CA  . PRO A 1 172 ? 29.784  43.634  89.632  1.00 11.84 ? 172 PRO A CA  1 
ATOM   1326  C  C   . PRO A 1 172 ? 31.113  42.964  89.974  1.00 11.60 ? 172 PRO A C   1 
ATOM   1327  O  O   . PRO A 1 172 ? 31.420  41.890  89.458  1.00 11.66 ? 172 PRO A O   1 
ATOM   1328  C  CB  . PRO A 1 172 ? 29.950  44.731  88.581  1.00 11.69 ? 172 PRO A CB  1 
ATOM   1329  C  CG  . PRO A 1 172 ? 29.859  46.008  89.345  1.00 11.72 ? 172 PRO A CG  1 
ATOM   1330  C  CD  . PRO A 1 172 ? 28.909  45.747  90.465  1.00 11.84 ? 172 PRO A CD  1 
ATOM   1331  N  N   . GLN A 1 173 ? 31.896  43.592  90.845  1.00 11.27 ? 173 GLN A N   1 
ATOM   1332  C  CA  . GLN A 1 173 ? 33.194  43.047  91.222  1.00 11.17 ? 173 GLN A CA  1 
ATOM   1333  C  C   . GLN A 1 173 ? 33.186  42.219  92.504  1.00 11.24 ? 173 GLN A C   1 
ATOM   1334  O  O   . GLN A 1 173 ? 33.781  41.146  92.549  1.00 10.82 ? 173 GLN A O   1 
ATOM   1335  C  CB  . GLN A 1 173 ? 34.218  44.182  91.354  1.00 11.18 ? 173 GLN A CB  1 
ATOM   1336  C  CG  . GLN A 1 173 ? 35.398  43.845  92.257  1.00 11.24 ? 173 GLN A CG  1 
ATOM   1337  C  CD  . GLN A 1 173 ? 36.643  44.629  91.919  1.00 11.25 ? 173 GLN A CD  1 
ATOM   1338  O  OE1 . GLN A 1 173 ? 36.605  45.852  91.821  1.00 11.64 ? 173 GLN A OE1 1 
ATOM   1339  N  NE2 . GLN A 1 173 ? 37.760  43.928  91.741  1.00 10.94 ? 173 GLN A NE2 1 
ATOM   1340  N  N   . THR A 1 174 ? 32.523  42.719  93.546  1.00 11.61 ? 174 THR A N   1 
ATOM   1341  C  CA  . THR A 1 174 ? 32.471  42.002  94.823  1.00 12.01 ? 174 THR A CA  1 
ATOM   1342  C  C   . THR A 1 174 ? 31.389  40.930  94.875  1.00 11.96 ? 174 THR A C   1 
ATOM   1343  O  O   . THR A 1 174 ? 31.555  39.920  95.553  1.00 12.03 ? 174 THR A O   1 
ATOM   1344  C  CB  . THR A 1 174 ? 32.250  42.961  96.016  1.00 12.20 ? 174 THR A CB  1 
ATOM   1345  O  OG1 . THR A 1 174 ? 31.052  43.722  95.813  1.00 12.92 ? 174 THR A OG1 1 
ATOM   1346  C  CG2 . THR A 1 174 ? 33.427  43.896  96.167  1.00 12.42 ? 174 THR A CG2 1 
ATOM   1347  N  N   . HIS A 1 175 ? 30.291  41.154  94.158  1.00 12.04 ? 175 HIS A N   1 
ATOM   1348  C  CA  . HIS A 1 175 ? 29.175  40.210  94.120  1.00 12.34 ? 175 HIS A CA  1 
ATOM   1349  C  C   . HIS A 1 175 ? 28.393  40.237  95.431  1.00 12.44 ? 175 HIS A C   1 
ATOM   1350  O  O   . HIS A 1 175 ? 27.710  39.276  95.790  1.00 12.31 ? 175 HIS A O   1 
ATOM   1351  C  CB  . HIS A 1 175 ? 29.684  38.792  93.841  1.00 12.27 ? 175 HIS A CB  1 
ATOM   1352  C  CG  . HIS A 1 175 ? 28.609  37.830  93.438  1.00 12.23 ? 175 HIS A CG  1 
ATOM   1353  N  ND1 . HIS A 1 175 ? 27.842  38.004  92.305  1.00 12.26 ? 175 HIS A ND1 1 
ATOM   1354  C  CD2 . HIS A 1 175 ? 28.177  36.683  94.013  1.00 12.14 ? 175 HIS A CD2 1 
ATOM   1355  C  CE1 . HIS A 1 175 ? 26.984  37.004  92.201  1.00 12.15 ? 175 HIS A CE1 1 
ATOM   1356  N  NE2 . HIS A 1 175 ? 27.167  36.189  93.224  1.00 12.07 ? 175 HIS A NE2 1 
ATOM   1357  N  N   . LEU A 1 176 ? 28.495  41.356  96.139  1.00 12.41 ? 176 LEU A N   1 
ATOM   1358  C  CA  . LEU A 1 176 ? 27.804  41.531  97.410  1.00 12.37 ? 176 LEU A CA  1 
ATOM   1359  C  C   . LEU A 1 176 ? 26.843  42.705  97.307  1.00 12.36 ? 176 LEU A C   1 
ATOM   1360  O  O   . LEU A 1 176 ? 27.102  43.653  96.570  1.00 12.60 ? 176 LEU A O   1 
ATOM   1361  C  CB  . LEU A 1 176 ? 28.819  41.800  98.520  1.00 12.18 ? 176 LEU A CB  1 
ATOM   1362  C  CG  . LEU A 1 176 ? 30.123  41.024  98.378  1.00 12.01 ? 176 LEU A CG  1 
ATOM   1363  C  CD1 . LEU A 1 176 ? 31.255  41.803  99.009  1.00 11.59 ? 176 LEU A CD1 1 
ATOM   1364  C  CD2 . LEU A 1 176 ? 29.967  39.664  99.032  1.00 12.33 ? 176 LEU A CD2 1 
ATOM   1365  N  N   . LYS A 1 177 ? 25.732  42.637  98.035  1.00 12.36 ? 177 LYS A N   1 
ATOM   1366  C  CA  . LYS A 1 177 ? 24.761  43.721  98.019  1.00 12.38 ? 177 LYS A CA  1 
ATOM   1367  C  C   . LYS A 1 177 ? 25.547  44.991  98.302  1.00 12.35 ? 177 LYS A C   1 
ATOM   1368  O  O   . LYS A 1 177 ? 26.470  44.975  99.111  1.00 12.29 ? 177 LYS A O   1 
ATOM   1369  C  CB  . LYS A 1 177 ? 23.698  43.498  99.099  1.00 12.20 ? 177 LYS A CB  1 
ATOM   1370  C  CG  . LYS A 1 177 ? 22.356  43.012  98.563  1.00 12.10 ? 177 LYS A CG  1 
ATOM   1371  C  CD  . LYS A 1 177 ? 22.429  41.565  98.111  1.00 12.12 ? 177 LYS A CD  1 
ATOM   1372  C  CE  . LYS A 1 177 ? 21.168  40.797  98.486  1.00 12.22 ? 177 LYS A CE  1 
ATOM   1373  N  NZ  . LYS A 1 177 ? 19.959  41.306  97.771  1.00 12.04 ? 177 LYS A NZ  1 
ATOM   1374  N  N   . ASP A 1 178 ? 25.193  46.086  97.642  1.00 12.64 ? 178 ASP A N   1 
ATOM   1375  C  CA  . ASP A 1 178 ? 25.922  47.334  97.835  1.00 13.10 ? 178 ASP A CA  1 
ATOM   1376  C  C   . ASP A 1 178 ? 25.009  48.521  98.131  1.00 13.21 ? 178 ASP A C   1 
ATOM   1377  O  O   . ASP A 1 178 ? 24.435  49.118  97.216  1.00 13.27 ? 178 ASP A O   1 
ATOM   1378  C  CB  . ASP A 1 178 ? 26.767  47.622  96.593  1.00 13.46 ? 178 ASP A CB  1 
ATOM   1379  C  CG  . ASP A 1 178 ? 27.676  48.815  96.772  1.00 13.84 ? 178 ASP A CG  1 
ATOM   1380  O  OD1 . ASP A 1 178 ? 28.689  48.905  96.041  1.00 13.96 ? 178 ASP A OD1 1 
ATOM   1381  O  OD2 . ASP A 1 178 ? 27.377  49.661  97.642  1.00 14.33 ? 178 ASP A OD2 1 
ATOM   1382  N  N   . PRO A 1 179 ? 24.887  48.898  99.420  1.00 13.17 ? 179 PRO A N   1 
ATOM   1383  C  CA  . PRO A 1 179 ? 24.035  50.022  99.836  1.00 13.28 ? 179 PRO A CA  1 
ATOM   1384  C  C   . PRO A 1 179 ? 24.335  51.290  99.050  1.00 13.30 ? 179 PRO A C   1 
ATOM   1385  O  O   . PRO A 1 179 ? 23.449  52.111  98.808  1.00 13.33 ? 179 PRO A O   1 
ATOM   1386  C  CB  . PRO A 1 179 ? 24.348  50.191  101.324 1.00 13.08 ? 179 PRO A CB  1 
ATOM   1387  C  CG  . PRO A 1 179 ? 24.886  48.877  101.752 1.00 13.04 ? 179 PRO A CG  1 
ATOM   1388  C  CD  . PRO A 1 179 ? 25.579  48.279  100.564 1.00 13.07 ? 179 PRO A CD  1 
ATOM   1389  N  N   . ASP A 1 180 ? 25.594  51.444  98.655  1.00 13.41 ? 180 ASP A N   1 
ATOM   1390  C  CA  . ASP A 1 180 ? 26.010  52.614  97.900  1.00 13.44 ? 180 ASP A CA  1 
ATOM   1391  C  C   . ASP A 1 180 ? 25.249  52.698  96.587  1.00 13.51 ? 180 ASP A C   1 
ATOM   1392  O  O   . ASP A 1 180 ? 24.828  53.779  96.176  1.00 13.79 ? 180 ASP A O   1 
ATOM   1393  C  CB  . ASP A 1 180 ? 27.514  52.567  97.628  1.00 13.34 ? 180 ASP A CB  1 
ATOM   1394  C  CG  . ASP A 1 180 ? 28.280  53.604  98.423  1.00 13.19 ? 180 ASP A CG  1 
ATOM   1395  O  OD1 . ASP A 1 180 ? 27.692  54.181  99.362  1.00 12.93 ? 180 ASP A OD1 1 
ATOM   1396  O  OD2 . ASP A 1 180 ? 29.468  53.843  98.111  1.00 13.41 ? 180 ASP A OD2 1 
ATOM   1397  N  N   . MET A 1 181 ? 25.073  51.557  95.927  1.00 13.38 ? 181 MET A N   1 
ATOM   1398  C  CA  . MET A 1 181 ? 24.344  51.533  94.663  1.00 13.24 ? 181 MET A CA  1 
ATOM   1399  C  C   . MET A 1 181 ? 22.874  51.814  94.952  1.00 13.08 ? 181 MET A C   1 
ATOM   1400  O  O   . MET A 1 181 ? 22.311  52.810  94.497  1.00 12.84 ? 181 MET A O   1 
ATOM   1401  C  CB  . MET A 1 181 ? 24.467  50.162  93.985  1.00 12.90 ? 181 MET A CB  1 
ATOM   1402  C  CG  . MET A 1 181 ? 25.838  49.519  94.078  1.00 12.52 ? 181 MET A CG  1 
ATOM   1403  S  SD  . MET A 1 181 ? 26.297  48.530  92.627  1.00 12.13 ? 181 MET A SD  1 
ATOM   1404  C  CE  . MET A 1 181 ? 24.705  48.069  91.955  1.00 11.83 ? 181 MET A CE  1 
ATOM   1405  N  N   . VAL A 1 182 ? 22.271  50.921  95.726  1.00 13.12 ? 182 VAL A N   1 
ATOM   1406  C  CA  . VAL A 1 182 ? 20.872  51.018  96.096  1.00 13.43 ? 182 VAL A CA  1 
ATOM   1407  C  C   . VAL A 1 182 ? 20.390  52.447  96.321  1.00 13.94 ? 182 VAL A C   1 
ATOM   1408  O  O   . VAL A 1 182 ? 19.399  52.874  95.725  1.00 14.38 ? 182 VAL A O   1 
ATOM   1409  C  CB  . VAL A 1 182 ? 20.593  50.216  97.376  1.00 13.19 ? 182 VAL A CB  1 
ATOM   1410  C  CG1 . VAL A 1 182 ? 19.121  50.269  97.703  1.00 12.83 ? 182 VAL A CG1 1 
ATOM   1411  C  CG2 . VAL A 1 182 ? 21.053  48.778  97.209  1.00 12.96 ? 182 VAL A CG2 1 
ATOM   1412  N  N   . TRP A 1 183 ? 21.092  53.188  97.173  1.00 13.92 ? 183 TRP A N   1 
ATOM   1413  C  CA  . TRP A 1 183 ? 20.689  54.550  97.490  1.00 13.84 ? 183 TRP A CA  1 
ATOM   1414  C  C   . TRP A 1 183 ? 21.172  55.621  96.529  1.00 13.83 ? 183 TRP A C   1 
ATOM   1415  O  O   . TRP A 1 183 ? 20.543  56.671  96.400  1.00 13.83 ? 183 TRP A O   1 
ATOM   1416  C  CB  . TRP A 1 183 ? 21.103  54.879  98.926  1.00 13.60 ? 183 TRP A CB  1 
ATOM   1417  C  CG  . TRP A 1 183 ? 20.253  54.131  99.893  1.00 13.28 ? 183 TRP A CG  1 
ATOM   1418  C  CD1 . TRP A 1 183 ? 20.548  52.942  100.496 1.00 13.24 ? 183 TRP A CD1 1 
ATOM   1419  C  CD2 . TRP A 1 183 ? 18.909  54.449  100.272 1.00 12.96 ? 183 TRP A CD2 1 
ATOM   1420  N  NE1 . TRP A 1 183 ? 19.468  52.497  101.220 1.00 13.13 ? 183 TRP A NE1 1 
ATOM   1421  C  CE2 . TRP A 1 183 ? 18.449  53.405  101.098 1.00 13.00 ? 183 TRP A CE2 1 
ATOM   1422  C  CE3 . TRP A 1 183 ? 18.050  55.517  99.988  1.00 12.75 ? 183 TRP A CE3 1 
ATOM   1423  C  CZ2 . TRP A 1 183 ? 17.159  53.396  101.648 1.00 12.97 ? 183 TRP A CZ2 1 
ATOM   1424  C  CZ3 . TRP A 1 183 ? 16.768  55.507  100.531 1.00 12.67 ? 183 TRP A CZ3 1 
ATOM   1425  C  CH2 . TRP A 1 183 ? 16.336  54.454  101.352 1.00 12.83 ? 183 TRP A CH2 1 
ATOM   1426  N  N   . ASP A 1 184 ? 22.277  55.367  95.844  1.00 13.79 ? 184 ASP A N   1 
ATOM   1427  C  CA  . ASP A 1 184 ? 22.771  56.355  94.901  1.00 13.79 ? 184 ASP A CA  1 
ATOM   1428  C  C   . ASP A 1 184 ? 21.731  56.532  93.800  1.00 13.75 ? 184 ASP A C   1 
ATOM   1429  O  O   . ASP A 1 184 ? 21.490  57.649  93.341  1.00 13.86 ? 184 ASP A O   1 
ATOM   1430  C  CB  . ASP A 1 184 ? 24.099  55.914  94.288  1.00 13.92 ? 184 ASP A CB  1 
ATOM   1431  C  CG  . ASP A 1 184 ? 24.657  56.943  93.335  1.00 14.03 ? 184 ASP A CG  1 
ATOM   1432  O  OD1 . ASP A 1 184 ? 24.252  58.116  93.455  1.00 14.09 ? 184 ASP A OD1 1 
ATOM   1433  O  OD2 . ASP A 1 184 ? 25.488  56.590  92.470  1.00 14.52 ? 184 ASP A OD2 1 
ATOM   1434  N  N   . PHE A 1 185 ? 21.114  55.426  93.382  1.00 13.54 ? 185 PHE A N   1 
ATOM   1435  C  CA  . PHE A 1 185 ? 20.097  55.459  92.330  1.00 13.21 ? 185 PHE A CA  1 
ATOM   1436  C  C   . PHE A 1 185 ? 18.838  56.121  92.862  1.00 13.22 ? 185 PHE A C   1 
ATOM   1437  O  O   . PHE A 1 185 ? 18.324  57.074  92.278  1.00 13.22 ? 185 PHE A O   1 
ATOM   1438  C  CB  . PHE A 1 185 ? 19.766  54.036  91.858  1.00 12.81 ? 185 PHE A CB  1 
ATOM   1439  C  CG  . PHE A 1 185 ? 18.664  53.975  90.833  1.00 12.26 ? 185 PHE A CG  1 
ATOM   1440  C  CD1 . PHE A 1 185 ? 18.944  54.131  89.478  1.00 12.04 ? 185 PHE A CD1 1 
ATOM   1441  C  CD2 . PHE A 1 185 ? 17.341  53.767  91.223  1.00 12.03 ? 185 PHE A CD2 1 
ATOM   1442  C  CE1 . PHE A 1 185 ? 17.919  54.084  88.528  1.00 11.70 ? 185 PHE A CE1 1 
ATOM   1443  C  CE2 . PHE A 1 185 ? 16.317  53.719  90.284  1.00 11.66 ? 185 PHE A CE2 1 
ATOM   1444  C  CZ  . PHE A 1 185 ? 16.606  53.878  88.935  1.00 11.61 ? 185 PHE A CZ  1 
ATOM   1445  N  N   . TRP A 1 186 ? 18.350  55.601  93.982  1.00 13.53 ? 186 TRP A N   1 
ATOM   1446  C  CA  . TRP A 1 186 ? 17.150  56.123  94.620  1.00 13.60 ? 186 TRP A CA  1 
ATOM   1447  C  C   . TRP A 1 186 ? 17.296  57.615  94.905  1.00 13.90 ? 186 TRP A C   1 
ATOM   1448  O  O   . TRP A 1 186 ? 16.336  58.373  94.757  1.00 14.22 ? 186 TRP A O   1 
ATOM   1449  C  CB  . TRP A 1 186 ? 16.889  55.384  95.934  1.00 13.37 ? 186 TRP A CB  1 
ATOM   1450  C  CG  . TRP A 1 186 ? 16.021  54.172  95.808  1.00 12.98 ? 186 TRP A CG  1 
ATOM   1451  C  CD1 . TRP A 1 186 ? 15.163  53.876  94.788  1.00 13.03 ? 186 TRP A CD1 1 
ATOM   1452  C  CD2 . TRP A 1 186 ? 15.925  53.090  96.744  1.00 12.57 ? 186 TRP A CD2 1 
ATOM   1453  N  NE1 . TRP A 1 186 ? 14.538  52.673  95.029  1.00 12.90 ? 186 TRP A NE1 1 
ATOM   1454  C  CE2 . TRP A 1 186 ? 14.988  52.169  96.223  1.00 12.62 ? 186 TRP A CE2 1 
ATOM   1455  C  CE3 . TRP A 1 186 ? 16.539  52.806  97.970  1.00 12.22 ? 186 TRP A CE3 1 
ATOM   1456  C  CZ2 . TRP A 1 186 ? 14.648  50.980  96.890  1.00 12.36 ? 186 TRP A CZ2 1 
ATOM   1457  C  CZ3 . TRP A 1 186 ? 16.201  51.621  98.636  1.00 12.03 ? 186 TRP A CZ3 1 
ATOM   1458  C  CH2 . TRP A 1 186 ? 15.263  50.724  98.090  1.00 11.95 ? 186 TRP A CH2 1 
ATOM   1459  N  N   . SER A 1 187 ? 18.494  58.031  95.314  1.00 13.41 ? 187 SER A N   1 
ATOM   1460  C  CA  . SER A 1 187 ? 18.749  59.435  95.632  1.00 13.16 ? 187 SER A CA  1 
ATOM   1461  C  C   . SER A 1 187 ? 18.779  60.318  94.392  1.00 12.66 ? 187 SER A C   1 
ATOM   1462  O  O   . SER A 1 187 ? 18.663  61.538  94.480  1.00 12.48 ? 187 SER A O   1 
ATOM   1463  C  CB  . SER A 1 187 ? 20.077  59.580  96.381  1.00 13.28 ? 187 SER A CB  1 
ATOM   1464  O  OG  . SER A 1 187 ? 21.122  59.936  95.492  1.00 13.31 ? 187 SER A OG  1 
ATOM   1465  N  N   . LEU A 1 188 ? 18.945  59.694  93.235  1.00 12.39 ? 188 LEU A N   1 
ATOM   1466  C  CA  . LEU A 1 188 ? 18.997  60.435  91.983  1.00 12.20 ? 188 LEU A CA  1 
ATOM   1467  C  C   . LEU A 1 188 ? 17.624  60.473  91.321  1.00 12.20 ? 188 LEU A C   1 
ATOM   1468  O  O   . LEU A 1 188 ? 17.357  61.322  90.471  1.00 12.13 ? 188 LEU A O   1 
ATOM   1469  C  CB  . LEU A 1 188 ? 20.020  59.796  91.038  1.00 11.77 ? 188 LEU A CB  1 
ATOM   1470  C  CG  . LEU A 1 188 ? 21.482  59.865  91.481  1.00 11.55 ? 188 LEU A CG  1 
ATOM   1471  C  CD1 . LEU A 1 188 ? 22.351  59.122  90.488  1.00 11.57 ? 188 LEU A CD1 1 
ATOM   1472  C  CD2 . LEU A 1 188 ? 21.923  61.312  91.592  1.00 11.51 ? 188 LEU A CD2 1 
ATOM   1473  N  N   . ARG A 1 189 ? 16.753  59.553  91.725  1.00 12.33 ? 189 ARG A N   1 
ATOM   1474  C  CA  . ARG A 1 189 ? 15.408  59.472  91.167  1.00 12.44 ? 189 ARG A CA  1 
ATOM   1475  C  C   . ARG A 1 189 ? 14.360  59.660  92.254  1.00 12.46 ? 189 ARG A C   1 
ATOM   1476  O  O   . ARG A 1 189 ? 13.739  58.697  92.712  1.00 12.50 ? 189 ARG A O   1 
ATOM   1477  C  CB  . ARG A 1 189 ? 15.214  58.121  90.478  1.00 12.47 ? 189 ARG A CB  1 
ATOM   1478  C  CG  . ARG A 1 189 ? 16.414  57.686  89.665  1.00 12.52 ? 189 ARG A CG  1 
ATOM   1479  C  CD  . ARG A 1 189 ? 16.626  58.616  88.484  1.00 12.78 ? 189 ARG A CD  1 
ATOM   1480  N  NE  . ARG A 1 189 ? 15.393  58.825  87.728  1.00 12.80 ? 189 ARG A NE  1 
ATOM   1481  C  CZ  . ARG A 1 189 ? 15.307  59.571  86.630  1.00 12.89 ? 189 ARG A CZ  1 
ATOM   1482  N  NH1 . ARG A 1 189 ? 16.388  60.182  86.157  1.00 12.77 ? 189 ARG A NH1 1 
ATOM   1483  N  NH2 . ARG A 1 189 ? 14.142  59.702  86.004  1.00 12.72 ? 189 ARG A NH2 1 
ATOM   1484  N  N   . PRO A 1 190 ? 14.141  60.916  92.670  1.00 12.53 ? 190 PRO A N   1 
ATOM   1485  C  CA  . PRO A 1 190 ? 13.175  61.286  93.710  1.00 12.57 ? 190 PRO A CA  1 
ATOM   1486  C  C   . PRO A 1 190 ? 11.765  60.761  93.455  1.00 12.68 ? 190 PRO A C   1 
ATOM   1487  O  O   . PRO A 1 190 ? 10.897  60.847  94.327  1.00 12.60 ? 190 PRO A O   1 
ATOM   1488  C  CB  . PRO A 1 190 ? 13.229  62.817  93.729  1.00 12.72 ? 190 PRO A CB  1 
ATOM   1489  C  CG  . PRO A 1 190 ? 13.854  63.201  92.420  1.00 12.73 ? 190 PRO A CG  1 
ATOM   1490  C  CD  . PRO A 1 190 ? 14.822  62.099  92.120  1.00 12.70 ? 190 PRO A CD  1 
ATOM   1491  N  N   . GLU A 1 191 ? 11.544  60.225  92.257  1.00 12.77 ? 191 GLU A N   1 
ATOM   1492  C  CA  . GLU A 1 191 ? 10.244  59.674  91.888  1.00 12.64 ? 191 GLU A CA  1 
ATOM   1493  C  C   . GLU A 1 191 ? 10.047  58.338  92.595  1.00 12.76 ? 191 GLU A C   1 
ATOM   1494  O  O   . GLU A 1 191 ? 8.926   57.830  92.698  1.00 12.90 ? 191 GLU A O   1 
ATOM   1495  C  CB  . GLU A 1 191 ? 10.152  59.482  90.366  1.00 12.50 ? 191 GLU A CB  1 
ATOM   1496  C  CG  . GLU A 1 191 ? 10.875  58.256  89.811  1.00 12.28 ? 191 GLU A CG  1 
ATOM   1497  C  CD  . GLU A 1 191 ? 12.104  58.612  88.985  1.00 12.19 ? 191 GLU A CD  1 
ATOM   1498  O  OE1 . GLU A 1 191 ? 12.778  59.612  89.305  1.00 12.19 ? 191 GLU A OE1 1 
ATOM   1499  O  OE2 . GLU A 1 191 ? 12.403  57.888  88.014  1.00 12.13 ? 191 GLU A OE2 1 
ATOM   1500  N  N   . SER A 1 192 ? 11.149  57.787  93.093  1.00 12.74 ? 192 SER A N   1 
ATOM   1501  C  CA  . SER A 1 192 ? 11.130  56.506  93.790  1.00 13.01 ? 192 SER A CA  1 
ATOM   1502  C  C   . SER A 1 192 ? 10.586  56.634  95.210  1.00 12.57 ? 192 SER A C   1 
ATOM   1503  O  O   . SER A 1 192 ? 10.164  55.648  95.820  1.00 12.32 ? 192 SER A O   1 
ATOM   1504  C  CB  . SER A 1 192 ? 12.547  55.919  93.836  1.00 13.35 ? 192 SER A CB  1 
ATOM   1505  O  OG  . SER A 1 192 ? 13.495  56.896  94.240  1.00 13.85 ? 192 SER A OG  1 
ATOM   1506  N  N   . LEU A 1 193 ? 10.595  57.858  95.723  1.00 12.28 ? 193 LEU A N   1 
ATOM   1507  C  CA  . LEU A 1 193 ? 10.122  58.140  97.071  1.00 12.26 ? 193 LEU A CA  1 
ATOM   1508  C  C   . LEU A 1 193 ? 8.818   57.435  97.449  1.00 12.46 ? 193 LEU A C   1 
ATOM   1509  O  O   . LEU A 1 193 ? 8.784   56.649  98.399  1.00 12.47 ? 193 LEU A O   1 
ATOM   1510  C  CB  . LEU A 1 193 ? 9.968   59.650  97.254  1.00 11.72 ? 193 LEU A CB  1 
ATOM   1511  C  CG  . LEU A 1 193 ? 11.273  60.371  97.579  1.00 11.33 ? 193 LEU A CG  1 
ATOM   1512  C  CD1 . LEU A 1 193 ? 11.047  61.869  97.560  1.00 11.35 ? 193 LEU A CD1 1 
ATOM   1513  C  CD2 . LEU A 1 193 ? 11.778  59.916  98.933  1.00 10.97 ? 193 LEU A CD2 1 
ATOM   1514  N  N   . HIS A 1 194 ? 7.751   57.720  96.710  1.00 12.69 ? 194 HIS A N   1 
ATOM   1515  C  CA  . HIS A 1 194 ? 6.454   57.118  96.981  1.00 12.83 ? 194 HIS A CA  1 
ATOM   1516  C  C   . HIS A 1 194 ? 6.590   55.643  97.357  1.00 13.14 ? 194 HIS A C   1 
ATOM   1517  O  O   . HIS A 1 194 ? 6.409   55.267  98.518  1.00 13.29 ? 194 HIS A O   1 
ATOM   1518  C  CB  . HIS A 1 194 ? 5.544   57.260  95.754  1.00 12.91 ? 194 HIS A CB  1 
ATOM   1519  C  CG  . HIS A 1 194 ? 4.077   57.235  96.076  1.00 12.81 ? 194 HIS A CG  1 
ATOM   1520  N  ND1 . HIS A 1 194 ? 3.104   57.438  95.120  1.00 12.61 ? 194 HIS A ND1 1 
ATOM   1521  C  CD2 . HIS A 1 194 ? 3.420   57.018  97.240  1.00 12.81 ? 194 HIS A CD2 1 
ATOM   1522  C  CE1 . HIS A 1 194 ? 1.910   57.348  95.681  1.00 12.53 ? 194 HIS A CE1 1 
ATOM   1523  N  NE2 . HIS A 1 194 ? 2.076   57.093  96.968  1.00 12.86 ? 194 HIS A NE2 1 
ATOM   1524  N  N   . GLN A 1 195 ? 6.920   54.815  96.373  1.00 13.36 ? 195 GLN A N   1 
ATOM   1525  C  CA  . GLN A 1 195 ? 7.071   53.382  96.590  1.00 13.17 ? 195 GLN A CA  1 
ATOM   1526  C  C   . GLN A 1 195 ? 8.056   53.055  97.715  1.00 13.32 ? 195 GLN A C   1 
ATOM   1527  O  O   . GLN A 1 195 ? 7.800   52.168  98.530  1.00 13.46 ? 195 GLN A O   1 
ATOM   1528  C  CB  . GLN A 1 195 ? 7.519   52.711  95.290  1.00 13.11 ? 195 GLN A CB  1 
ATOM   1529  C  CG  . GLN A 1 195 ? 7.961   51.264  95.444  1.00 12.98 ? 195 GLN A CG  1 
ATOM   1530  C  CD  . GLN A 1 195 ? 6.894   50.377  96.067  1.00 12.92 ? 195 GLN A CD  1 
ATOM   1531  O  OE1 . GLN A 1 195 ? 5.716   50.740  96.125  1.00 12.54 ? 195 GLN A OE1 1 
ATOM   1532  N  NE2 . GLN A 1 195 ? 7.307   49.204  96.537  1.00 13.18 ? 195 GLN A NE2 1 
ATOM   1533  N  N   . VAL A 1 196 ? 9.180   53.764  97.761  1.00 13.21 ? 196 VAL A N   1 
ATOM   1534  C  CA  . VAL A 1 196 ? 10.180  53.524  98.796  1.00 13.27 ? 196 VAL A CA  1 
ATOM   1535  C  C   . VAL A 1 196 ? 9.521   53.649  100.158 1.00 13.26 ? 196 VAL A C   1 
ATOM   1536  O  O   . VAL A 1 196 ? 9.674   52.782  101.018 1.00 13.06 ? 196 VAL A O   1 
ATOM   1537  C  CB  . VAL A 1 196 ? 11.344  54.547  98.704  1.00 13.19 ? 196 VAL A CB  1 
ATOM   1538  C  CG1 . VAL A 1 196 ? 12.064  54.661  100.051 1.00 13.09 ? 196 VAL A CG1 1 
ATOM   1539  C  CG2 . VAL A 1 196 ? 12.313  54.128  97.611  1.00 13.17 ? 196 VAL A CG2 1 
ATOM   1540  N  N   . SER A 1 197 ? 8.785   54.741  100.337 1.00 13.42 ? 197 SER A N   1 
ATOM   1541  C  CA  . SER A 1 197 ? 8.084   55.015  101.584 1.00 13.65 ? 197 SER A CA  1 
ATOM   1542  C  C   . SER A 1 197 ? 7.133   53.876  101.919 1.00 13.83 ? 197 SER A C   1 
ATOM   1543  O  O   . SER A 1 197 ? 6.900   53.567  103.089 1.00 14.09 ? 197 SER A O   1 
ATOM   1544  C  CB  . SER A 1 197 ? 7.302   56.322  101.461 1.00 13.62 ? 197 SER A CB  1 
ATOM   1545  O  OG  . SER A 1 197 ? 8.160   57.400  101.109 1.00 13.27 ? 197 SER A OG  1 
ATOM   1546  N  N   . PHE A 1 198 ? 6.584   53.254  100.882 1.00 13.76 ? 198 PHE A N   1 
ATOM   1547  C  CA  . PHE A 1 198 ? 5.667   52.145  101.067 1.00 13.53 ? 198 PHE A CA  1 
ATOM   1548  C  C   . PHE A 1 198 ? 6.458   50.896  101.414 1.00 13.32 ? 198 PHE A C   1 
ATOM   1549  O  O   . PHE A 1 198 ? 6.099   50.156  102.325 1.00 13.47 ? 198 PHE A O   1 
ATOM   1550  C  CB  . PHE A 1 198 ? 4.857   51.908  99.789  1.00 13.46 ? 198 PHE A CB  1 
ATOM   1551  C  CG  . PHE A 1 198 ? 3.828   50.816  99.912  1.00 13.32 ? 198 PHE A CG  1 
ATOM   1552  C  CD1 . PHE A 1 198 ? 4.214   49.482  100.016 1.00 13.19 ? 198 PHE A CD1 1 
ATOM   1553  C  CD2 . PHE A 1 198 ? 2.471   51.120  99.911  1.00 13.27 ? 198 PHE A CD2 1 
ATOM   1554  C  CE1 . PHE A 1 198 ? 3.261   48.466  100.116 1.00 13.24 ? 198 PHE A CE1 1 
ATOM   1555  C  CE2 . PHE A 1 198 ? 1.507   50.109  100.011 1.00 13.32 ? 198 PHE A CE2 1 
ATOM   1556  C  CZ  . PHE A 1 198 ? 1.904   48.782  100.113 1.00 13.16 ? 198 PHE A CZ  1 
ATOM   1557  N  N   . LEU A 1 199 ? 7.540   50.670  100.681 1.00 13.25 ? 199 LEU A N   1 
ATOM   1558  C  CA  . LEU A 1 199 ? 8.372   49.496  100.897 1.00 13.01 ? 199 LEU A CA  1 
ATOM   1559  C  C   . LEU A 1 199 ? 8.933   49.424  102.311 1.00 13.04 ? 199 LEU A C   1 
ATOM   1560  O  O   . LEU A 1 199 ? 8.897   48.372  102.942 1.00 13.00 ? 199 LEU A O   1 
ATOM   1561  C  CB  . LEU A 1 199 ? 9.516   49.474  99.885  1.00 12.78 ? 199 LEU A CB  1 
ATOM   1562  C  CG  . LEU A 1 199 ? 10.554  48.368  100.073 1.00 12.63 ? 199 LEU A CG  1 
ATOM   1563  C  CD1 . LEU A 1 199 ? 9.885   47.004  99.968  1.00 12.95 ? 199 LEU A CD1 1 
ATOM   1564  C  CD2 . LEU A 1 199 ? 11.639  48.511  99.025  1.00 12.38 ? 199 LEU A CD2 1 
ATOM   1565  N  N   . PHE A 1 200 ? 9.444   50.542  102.812 1.00 13.31 ? 200 PHE A N   1 
ATOM   1566  C  CA  . PHE A 1 200 ? 10.019  50.571  104.154 1.00 13.35 ? 200 PHE A CA  1 
ATOM   1567  C  C   . PHE A 1 200 ? 8.961   50.701  105.240 1.00 13.48 ? 200 PHE A C   1 
ATOM   1568  O  O   . PHE A 1 200 ? 9.287   50.862  106.419 1.00 13.78 ? 200 PHE A O   1 
ATOM   1569  C  CB  . PHE A 1 200 ? 11.030  51.713  104.275 1.00 13.20 ? 200 PHE A CB  1 
ATOM   1570  C  CG  . PHE A 1 200 ? 12.386  51.371  103.737 1.00 13.00 ? 200 PHE A CG  1 
ATOM   1571  C  CD1 . PHE A 1 200 ? 12.762  51.771  102.460 1.00 12.94 ? 200 PHE A CD1 1 
ATOM   1572  C  CD2 . PHE A 1 200 ? 13.283  50.626  104.498 1.00 12.90 ? 200 PHE A CD2 1 
ATOM   1573  C  CE1 . PHE A 1 200 ? 14.010  51.431  101.947 1.00 12.81 ? 200 PHE A CE1 1 
ATOM   1574  C  CE2 . PHE A 1 200 ? 14.534  50.280  103.995 1.00 12.73 ? 200 PHE A CE2 1 
ATOM   1575  C  CZ  . PHE A 1 200 ? 14.897  50.683  102.718 1.00 12.84 ? 200 PHE A CZ  1 
ATOM   1576  N  N   . SER A 1 201 ? 7.695   50.642  104.839 1.00 13.23 ? 201 SER A N   1 
ATOM   1577  C  CA  . SER A 1 201 ? 6.596   50.724  105.790 1.00 13.16 ? 201 SER A CA  1 
ATOM   1578  C  C   . SER A 1 201 ? 6.391   49.322  106.367 1.00 13.14 ? 201 SER A C   1 
ATOM   1579  O  O   . SER A 1 201 ? 7.186   48.417  106.100 1.00 12.82 ? 201 SER A O   1 
ATOM   1580  C  CB  . SER A 1 201 ? 5.323   51.197  105.089 1.00 12.96 ? 201 SER A CB  1 
ATOM   1581  O  OG  . SER A 1 201 ? 4.522   50.099  104.684 1.00 13.01 ? 201 SER A OG  1 
ATOM   1582  N  N   . ASP A 1 202 ? 5.335   49.135  107.153 1.00 12.90 ? 202 ASP A N   1 
ATOM   1583  C  CA  . ASP A 1 202 ? 5.073   47.826  107.746 1.00 13.22 ? 202 ASP A CA  1 
ATOM   1584  C  C   . ASP A 1 202 ? 4.627   46.804  106.692 1.00 13.41 ? 202 ASP A C   1 
ATOM   1585  O  O   . ASP A 1 202 ? 4.767   45.592  106.890 1.00 13.52 ? 202 ASP A O   1 
ATOM   1586  C  CB  . ASP A 1 202 ? 4.017   47.945  108.851 1.00 13.10 ? 202 ASP A CB  1 
ATOM   1587  C  CG  . ASP A 1 202 ? 4.573   48.571  110.118 1.00 12.92 ? 202 ASP A CG  1 
ATOM   1588  O  OD1 . ASP A 1 202 ? 5.811   48.663  110.238 1.00 12.60 ? 202 ASP A OD1 1 
ATOM   1589  O  OD2 . ASP A 1 202 ? 3.778   48.974  110.992 1.00 12.96 ? 202 ASP A OD2 1 
ATOM   1590  N  N   . ARG A 1 203 ? 4.098   47.303  105.575 1.00 13.35 ? 203 ARG A N   1 
ATOM   1591  C  CA  . ARG A 1 203 ? 3.640   46.447  104.483 1.00 13.20 ? 203 ARG A CA  1 
ATOM   1592  C  C   . ARG A 1 203 ? 4.847   45.920  103.722 1.00 13.09 ? 203 ARG A C   1 
ATOM   1593  O  O   . ARG A 1 203 ? 4.704   45.144  102.776 1.00 13.06 ? 203 ARG A O   1 
ATOM   1594  C  CB  . ARG A 1 203 ? 2.746   47.235  103.518 1.00 13.20 ? 203 ARG A CB  1 
ATOM   1595  C  CG  . ARG A 1 203 ? 1.349   47.526  104.034 1.00 13.33 ? 203 ARG A CG  1 
ATOM   1596  C  CD  . ARG A 1 203 ? 0.312   46.674  103.320 1.00 13.72 ? 203 ARG A CD  1 
ATOM   1597  N  NE  . ARG A 1 203 ? -0.896  47.422  102.977 1.00 14.27 ? 203 ARG A NE  1 
ATOM   1598  C  CZ  . ARG A 1 203 ? -1.294  47.681  101.731 1.00 14.58 ? 203 ARG A CZ  1 
ATOM   1599  N  NH1 . ARG A 1 203 ? -0.573  47.252  100.702 1.00 14.55 ? 203 ARG A NH1 1 
ATOM   1600  N  NH2 . ARG A 1 203 ? -2.412  48.370  101.514 1.00 14.75 ? 203 ARG A NH2 1 
ATOM   1601  N  N   . GLY A 1 204 ? 6.035   46.352  104.142 1.00 13.07 ? 204 GLY A N   1 
ATOM   1602  C  CA  . GLY A 1 204 ? 7.262   45.930  103.488 1.00 13.05 ? 204 GLY A CA  1 
ATOM   1603  C  C   . GLY A 1 204 ? 7.562   44.446  103.562 1.00 12.85 ? 204 GLY A C   1 
ATOM   1604  O  O   . GLY A 1 204 ? 8.197   43.890  102.669 1.00 13.00 ? 204 GLY A O   1 
ATOM   1605  N  N   . ILE A 1 205 ? 7.110   43.798  104.628 1.00 12.84 ? 205 ILE A N   1 
ATOM   1606  C  CA  . ILE A 1 205 ? 7.347   42.369  104.799 1.00 12.59 ? 205 ILE A CA  1 
ATOM   1607  C  C   . ILE A 1 205 ? 6.077   41.660  105.244 1.00 12.49 ? 205 ILE A C   1 
ATOM   1608  O  O   . ILE A 1 205 ? 5.834   41.499  106.437 1.00 12.49 ? 205 ILE A O   1 
ATOM   1609  C  CB  . ILE A 1 205 ? 8.443   42.102  105.848 1.00 12.56 ? 205 ILE A CB  1 
ATOM   1610  C  CG1 . ILE A 1 205 ? 9.637   43.033  105.606 1.00 12.37 ? 205 ILE A CG1 1 
ATOM   1611  C  CG2 . ILE A 1 205 ? 8.869   40.640  105.786 1.00 12.88 ? 205 ILE A CG2 1 
ATOM   1612  C  CD1 . ILE A 1 205 ? 10.754  42.874  106.613 1.00 11.86 ? 205 ILE A CD1 1 
ATOM   1613  N  N   . PRO A 1 206 ? 5.252   41.221  104.282 1.00 12.33 ? 206 PRO A N   1 
ATOM   1614  C  CA  . PRO A 1 206 ? 3.998   40.524  104.584 1.00 12.19 ? 206 PRO A CA  1 
ATOM   1615  C  C   . PRO A 1 206 ? 4.210   39.166  105.253 1.00 12.35 ? 206 PRO A C   1 
ATOM   1616  O  O   . PRO A 1 206 ? 5.195   38.478  104.980 1.00 12.25 ? 206 PRO A O   1 
ATOM   1617  C  CB  . PRO A 1 206 ? 3.329   40.393  103.218 1.00 12.04 ? 206 PRO A CB  1 
ATOM   1618  C  CG  . PRO A 1 206 ? 4.452   40.412  102.257 1.00 11.94 ? 206 PRO A CG  1 
ATOM   1619  C  CD  . PRO A 1 206 ? 5.468   41.349  102.831 1.00 12.08 ? 206 PRO A CD  1 
ATOM   1620  N  N   . ASP A 1 207 ? 3.285   38.784  106.129 1.00 12.27 ? 207 ASP A N   1 
ATOM   1621  C  CA  . ASP A 1 207 ? 3.383   37.499  106.815 1.00 12.58 ? 207 ASP A CA  1 
ATOM   1622  C  C   . ASP A 1 207 ? 2.804   36.399  105.931 1.00 12.56 ? 207 ASP A C   1 
ATOM   1623  O  O   . ASP A 1 207 ? 1.725   35.864  106.203 1.00 12.65 ? 207 ASP A O   1 
ATOM   1624  C  CB  . ASP A 1 207 ? 2.637   37.539  108.161 1.00 12.38 ? 207 ASP A CB  1 
ATOM   1625  C  CG  . ASP A 1 207 ? 2.839   36.267  108.986 1.00 12.26 ? 207 ASP A CG  1 
ATOM   1626  O  OD1 . ASP A 1 207 ? 2.846   36.343  110.235 1.00 12.14 ? 207 ASP A OD1 1 
ATOM   1627  O  OD2 . ASP A 1 207 ? 2.991   35.185  108.386 1.00 11.99 ? 207 ASP A OD2 1 
ATOM   1628  N  N   . GLY A 1 208 ? 3.530   36.059  104.874 1.00 12.31 ? 208 GLY A N   1 
ATOM   1629  C  CA  . GLY A 1 208 ? 3.062   35.030  103.970 1.00 12.26 ? 208 GLY A CA  1 
ATOM   1630  C  C   . GLY A 1 208 ? 2.531   35.664  102.705 1.00 12.25 ? 208 GLY A C   1 
ATOM   1631  O  O   . GLY A 1 208 ? 2.506   36.888  102.583 1.00 12.00 ? 208 GLY A O   1 
ATOM   1632  N  N   . HIS A 1 209 ? 2.106   34.836  101.760 1.00 12.34 ? 209 HIS A N   1 
ATOM   1633  C  CA  . HIS A 1 209 ? 1.583   35.336  100.499 1.00 12.50 ? 209 HIS A CA  1 
ATOM   1634  C  C   . HIS A 1 209 ? 0.078   35.529  100.590 1.00 12.52 ? 209 HIS A C   1 
ATOM   1635  O  O   . HIS A 1 209 ? -0.520  36.217  99.763  1.00 12.56 ? 209 HIS A O   1 
ATOM   1636  C  CB  . HIS A 1 209 ? 1.901   34.353  99.372  1.00 12.84 ? 209 HIS A CB  1 
ATOM   1637  C  CG  . HIS A 1 209 ? 3.359   34.049  99.228  1.00 13.17 ? 209 HIS A CG  1 
ATOM   1638  N  ND1 . HIS A 1 209 ? 4.265   34.963  98.732  1.00 13.32 ? 209 HIS A ND1 1 
ATOM   1639  C  CD2 . HIS A 1 209 ? 4.070   32.929  99.507  1.00 13.24 ? 209 HIS A CD2 1 
ATOM   1640  C  CE1 . HIS A 1 209 ? 5.469   34.420  98.711  1.00 13.34 ? 209 HIS A CE1 1 
ATOM   1641  N  NE2 . HIS A 1 209 ? 5.379   33.187  99.175  1.00 13.32 ? 209 HIS A NE2 1 
ATOM   1642  N  N   . ARG A 1 210 ? -0.529  34.926  101.604 1.00 12.24 ? 210 ARG A N   1 
ATOM   1643  C  CA  . ARG A 1 210 ? -1.967  35.016  101.774 1.00 12.23 ? 210 ARG A CA  1 
ATOM   1644  C  C   . ARG A 1 210 ? -2.449  36.250  102.534 1.00 12.25 ? 210 ARG A C   1 
ATOM   1645  O  O   . ARG A 1 210 ? -3.628  36.606  102.460 1.00 11.96 ? 210 ARG A O   1 
ATOM   1646  C  CB  . ARG A 1 210 ? -2.463  33.745  102.455 1.00 12.25 ? 210 ARG A CB  1 
ATOM   1647  C  CG  . ARG A 1 210 ? -1.983  32.490  101.764 1.00 12.35 ? 210 ARG A CG  1 
ATOM   1648  C  CD  . ARG A 1 210 ? -2.118  31.277  102.648 1.00 12.65 ? 210 ARG A CD  1 
ATOM   1649  N  NE  . ARG A 1 210 ? -1.374  31.432  103.894 1.00 12.53 ? 210 ARG A NE  1 
ATOM   1650  C  CZ  . ARG A 1 210 ? -1.940  31.484  105.095 1.00 12.53 ? 210 ARG A CZ  1 
ATOM   1651  N  NH1 . ARG A 1 210 ? -3.262  31.393  105.213 1.00 11.92 ? 210 ARG A NH1 1 
ATOM   1652  N  NH2 . ARG A 1 210 ? -1.185  31.620  106.179 1.00 12.72 ? 210 ARG A NH2 1 
ATOM   1653  N  N   . HIS A 1 211 ? -1.546  36.912  103.251 1.00 12.35 ? 211 HIS A N   1 
ATOM   1654  C  CA  . HIS A 1 211 ? -1.937  38.092  104.014 1.00 12.70 ? 211 HIS A CA  1 
ATOM   1655  C  C   . HIS A 1 211 ? -1.479  39.401  103.392 1.00 12.52 ? 211 HIS A C   1 
ATOM   1656  O  O   . HIS A 1 211 ? -0.978  40.289  104.073 1.00 12.70 ? 211 HIS A O   1 
ATOM   1657  C  CB  . HIS A 1 211 ? -1.435  37.972  105.455 1.00 12.82 ? 211 HIS A CB  1 
ATOM   1658  C  CG  . HIS A 1 211 ? -2.030  36.812  106.193 1.00 13.06 ? 211 HIS A CG  1 
ATOM   1659  N  ND1 . HIS A 1 211 ? -3.376  36.724  106.479 1.00 13.15 ? 211 HIS A ND1 1 
ATOM   1660  C  CD2 . HIS A 1 211 ? -1.472  35.669  106.660 1.00 13.16 ? 211 HIS A CD2 1 
ATOM   1661  C  CE1 . HIS A 1 211 ? -3.622  35.578  107.089 1.00 13.17 ? 211 HIS A CE1 1 
ATOM   1662  N  NE2 . HIS A 1 211 ? -2.483  34.919  107.211 1.00 13.15 ? 211 HIS A NE2 1 
ATOM   1663  N  N   . MET A 1 212 ? -1.675  39.516  102.087 1.00 12.57 ? 212 MET A N   1 
ATOM   1664  C  CA  . MET A 1 212 ? -1.293  40.719  101.363 1.00 12.47 ? 212 MET A CA  1 
ATOM   1665  C  C   . MET A 1 212 ? -2.224  40.926  100.175 1.00 12.57 ? 212 MET A C   1 
ATOM   1666  O  O   . MET A 1 212 ? -2.867  39.983  99.695  1.00 12.32 ? 212 MET A O   1 
ATOM   1667  C  CB  . MET A 1 212 ? 0.151   40.608  100.872 1.00 12.31 ? 212 MET A CB  1 
ATOM   1668  C  CG  . MET A 1 212 ? 0.439   39.333  100.105 1.00 11.95 ? 212 MET A CG  1 
ATOM   1669  S  SD  . MET A 1 212 ? 2.030   39.367  99.292  1.00 11.44 ? 212 MET A SD  1 
ATOM   1670  C  CE  . MET A 1 212 ? 1.535   39.006  97.581  1.00 11.31 ? 212 MET A CE  1 
ATOM   1671  N  N   . ASN A 1 213 ? -2.288  42.167  99.709  1.00 12.74 ? 213 ASN A N   1 
ATOM   1672  C  CA  . ASN A 1 213 ? -3.133  42.520  98.586  1.00 12.84 ? 213 ASN A CA  1 
ATOM   1673  C  C   . ASN A 1 213 ? -2.350  42.499  97.288  1.00 13.11 ? 213 ASN A C   1 
ATOM   1674  O  O   . ASN A 1 213 ? -1.121  42.403  97.285  1.00 13.12 ? 213 ASN A O   1 
ATOM   1675  C  CB  . ASN A 1 213 ? -3.732  43.908  98.789  1.00 12.98 ? 213 ASN A CB  1 
ATOM   1676  C  CG  . ASN A 1 213 ? -4.717  43.954  99.935  1.00 13.10 ? 213 ASN A CG  1 
ATOM   1677  O  OD1 . ASN A 1 213 ? -5.365  42.957  100.254 1.00 13.38 ? 213 ASN A OD1 1 
ATOM   1678  N  ND2 . ASN A 1 213 ? -4.837  45.119  100.563 1.00 13.12 ? 213 ASN A ND2 1 
ATOM   1679  N  N   . GLY A 1 214 ? -3.080  42.584  96.183  1.00 13.33 ? 214 GLY A N   1 
ATOM   1680  C  CA  . GLY A 1 214 ? -2.453  42.584  94.880  1.00 13.42 ? 214 GLY A CA  1 
ATOM   1681  C  C   . GLY A 1 214 ? -3.117  43.612  93.987  1.00 13.52 ? 214 GLY A C   1 
ATOM   1682  O  O   . GLY A 1 214 ? -4.318  43.868  94.109  1.00 13.67 ? 214 GLY A O   1 
ATOM   1683  N  N   . TYR A 1 215 ? -2.337  44.209  93.092  1.00 13.24 ? 215 TYR A N   1 
ATOM   1684  C  CA  . TYR A 1 215 ? -2.863  45.211  92.180  1.00 12.84 ? 215 TYR A CA  1 
ATOM   1685  C  C   . TYR A 1 215 ? -2.178  45.077  90.843  1.00 12.64 ? 215 TYR A C   1 
ATOM   1686  O  O   . TYR A 1 215 ? -1.025  44.661  90.777  1.00 12.74 ? 215 TYR A O   1 
ATOM   1687  C  CB  . TYR A 1 215 ? -2.610  46.620  92.719  1.00 12.96 ? 215 TYR A CB  1 
ATOM   1688  C  CG  . TYR A 1 215 ? -2.658  46.733  94.224  1.00 12.90 ? 215 TYR A CG  1 
ATOM   1689  C  CD1 . TYR A 1 215 ? -3.838  47.105  94.873  1.00 12.92 ? 215 TYR A CD1 1 
ATOM   1690  C  CD2 . TYR A 1 215 ? -1.523  46.487  94.998  1.00 12.89 ? 215 TYR A CD2 1 
ATOM   1691  C  CE1 . TYR A 1 215 ? -3.889  47.230  96.254  1.00 13.15 ? 215 TYR A CE1 1 
ATOM   1692  C  CE2 . TYR A 1 215 ? -1.563  46.610  96.384  1.00 13.16 ? 215 TYR A CE2 1 
ATOM   1693  C  CZ  . TYR A 1 215 ? -2.751  46.984  97.003  1.00 13.24 ? 215 TYR A CZ  1 
ATOM   1694  O  OH  . TYR A 1 215 ? -2.801  47.122  98.368  1.00 13.57 ? 215 TYR A OH  1 
ATOM   1695  N  N   . GLY A 1 216 ? -2.888  45.432  89.780  1.00 12.71 ? 216 GLY A N   1 
ATOM   1696  C  CA  . GLY A 1 216 ? -2.301  45.368  88.454  1.00 12.39 ? 216 GLY A CA  1 
ATOM   1697  C  C   . GLY A 1 216 ? -1.295  46.495  88.343  1.00 12.17 ? 216 GLY A C   1 
ATOM   1698  O  O   . GLY A 1 216 ? -0.435  46.509  87.468  1.00 12.28 ? 216 GLY A O   1 
ATOM   1699  N  N   . SER A 1 217 ? -1.421  47.448  89.260  1.00 12.48 ? 217 SER A N   1 
ATOM   1700  C  CA  . SER A 1 217 ? -0.547  48.610  89.325  1.00 12.31 ? 217 SER A CA  1 
ATOM   1701  C  C   . SER A 1 217 ? -0.746  49.561  88.158  1.00 12.14 ? 217 SER A C   1 
ATOM   1702  O  O   . SER A 1 217 ? -1.139  50.708  88.355  1.00 11.94 ? 217 SER A O   1 
ATOM   1703  C  CB  . SER A 1 217 ? 0.915   48.167  89.396  1.00 12.44 ? 217 SER A CB  1 
ATOM   1704  O  OG  . SER A 1 217 ? 1.256   47.813  90.725  1.00 12.66 ? 217 SER A OG  1 
ATOM   1705  N  N   . HIS A 1 218 ? -0.481  49.088  86.948  1.00 12.22 ? 218 HIS A N   1 
ATOM   1706  C  CA  . HIS A 1 218 ? -0.636  49.923  85.761  1.00 12.72 ? 218 HIS A CA  1 
ATOM   1707  C  C   . HIS A 1 218 ? -2.092  50.275  85.503  1.00 13.01 ? 218 HIS A C   1 
ATOM   1708  O  O   . HIS A 1 218 ? -3.008  49.717  86.121  1.00 13.07 ? 218 HIS A O   1 
ATOM   1709  C  CB  . HIS A 1 218 ? -0.100  49.216  84.513  1.00 12.65 ? 218 HIS A CB  1 
ATOM   1710  C  CG  . HIS A 1 218 ? 1.311   48.742  84.639  1.00 12.67 ? 218 HIS A CG  1 
ATOM   1711  N  ND1 . HIS A 1 218 ? 2.388   49.599  84.596  1.00 12.70 ? 218 HIS A ND1 1 
ATOM   1712  C  CD2 . HIS A 1 218 ? 1.823   47.499  84.786  1.00 12.69 ? 218 HIS A CD2 1 
ATOM   1713  C  CE1 . HIS A 1 218 ? 3.505   48.903  84.710  1.00 12.86 ? 218 HIS A CE1 1 
ATOM   1714  N  NE2 . HIS A 1 218 ? 3.189   47.625  84.827  1.00 12.85 ? 218 HIS A NE2 1 
ATOM   1715  N  N   . THR A 1 219 ? -2.284  51.207  84.573  1.00 12.78 ? 219 THR A N   1 
ATOM   1716  C  CA  . THR A 1 219 ? -3.611  51.637  84.166  1.00 12.63 ? 219 THR A CA  1 
ATOM   1717  C  C   . THR A 1 219 ? -3.919  50.861  82.890  1.00 12.48 ? 219 THR A C   1 
ATOM   1718  O  O   . THR A 1 219 ? -3.135  50.872  81.944  1.00 12.50 ? 219 THR A O   1 
ATOM   1719  C  CB  . THR A 1 219 ? -3.640  53.154  83.856  1.00 12.72 ? 219 THR A CB  1 
ATOM   1720  O  OG1 . THR A 1 219 ? -3.726  53.887  85.081  1.00 12.70 ? 219 THR A OG1 1 
ATOM   1721  C  CG2 . THR A 1 219 ? -4.837  53.506  82.980  1.00 12.59 ? 219 THR A CG2 1 
ATOM   1722  N  N   . PHE A 1 220 ? -5.046  50.167  82.869  1.00 12.46 ? 220 PHE A N   1 
ATOM   1723  C  CA  . PHE A 1 220 ? -5.413  49.410  81.685  1.00 12.43 ? 220 PHE A CA  1 
ATOM   1724  C  C   . PHE A 1 220 ? -6.616  50.050  81.014  1.00 12.31 ? 220 PHE A C   1 
ATOM   1725  O  O   . PHE A 1 220 ? -7.198  51.003  81.533  1.00 12.34 ? 220 PHE A O   1 
ATOM   1726  C  CB  . PHE A 1 220 ? -5.724  47.954  82.048  1.00 12.54 ? 220 PHE A CB  1 
ATOM   1727  C  CG  . PHE A 1 220 ? -4.509  47.152  82.429  1.00 12.74 ? 220 PHE A CG  1 
ATOM   1728  C  CD1 . PHE A 1 220 ? -4.076  47.105  83.753  1.00 12.77 ? 220 PHE A CD1 1 
ATOM   1729  C  CD2 . PHE A 1 220 ? -3.794  46.444  81.465  1.00 12.77 ? 220 PHE A CD2 1 
ATOM   1730  C  CE1 . PHE A 1 220 ? -2.945  46.363  84.114  1.00 12.93 ? 220 PHE A CE1 1 
ATOM   1731  C  CE2 . PHE A 1 220 ? -2.662  45.699  81.816  1.00 12.94 ? 220 PHE A CE2 1 
ATOM   1732  C  CZ  . PHE A 1 220 ? -2.237  45.659  83.145  1.00 12.88 ? 220 PHE A CZ  1 
ATOM   1733  N  N   . LYS A 1 221 ? -6.978  49.522  79.853  1.00 12.23 ? 221 LYS A N   1 
ATOM   1734  C  CA  . LYS A 1 221 ? -8.106  50.032  79.090  1.00 12.18 ? 221 LYS A CA  1 
ATOM   1735  C  C   . LYS A 1 221 ? -9.150  48.930  78.945  1.00 12.22 ? 221 LYS A C   1 
ATOM   1736  O  O   . LYS A 1 221 ? -8.813  47.767  78.711  1.00 11.92 ? 221 LYS A O   1 
ATOM   1737  C  CB  . LYS A 1 221 ? -7.625  50.495  77.712  1.00 12.12 ? 221 LYS A CB  1 
ATOM   1738  C  CG  . LYS A 1 221 ? -8.706  51.076  76.824  1.00 12.29 ? 221 LYS A CG  1 
ATOM   1739  C  CD  . LYS A 1 221 ? -8.093  51.692  75.572  1.00 12.45 ? 221 LYS A CD  1 
ATOM   1740  C  CE  . LYS A 1 221 ? -7.635  50.616  74.591  1.00 12.55 ? 221 LYS A CE  1 
ATOM   1741  N  NZ  . LYS A 1 221 ? -7.458  51.152  73.215  1.00 12.11 ? 221 LYS A NZ  1 
ATOM   1742  N  N   . LEU A 1 222 ? -10.418 49.298  79.095  1.00 12.19 ? 222 LEU A N   1 
ATOM   1743  C  CA  . LEU A 1 222 ? -11.504 48.336  78.982  1.00 12.73 ? 222 LEU A CA  1 
ATOM   1744  C  C   . LEU A 1 222 ? -12.436 48.707  77.832  1.00 13.04 ? 222 LEU A C   1 
ATOM   1745  O  O   . LEU A 1 222 ? -12.755 49.887  77.640  1.00 13.11 ? 222 LEU A O   1 
ATOM   1746  C  CB  . LEU A 1 222 ? -12.297 48.282  80.290  1.00 12.72 ? 222 LEU A CB  1 
ATOM   1747  C  CG  . LEU A 1 222 ? -11.652 47.568  81.476  1.00 12.73 ? 222 LEU A CG  1 
ATOM   1748  C  CD1 . LEU A 1 222 ? -12.645 47.514  82.617  1.00 12.60 ? 222 LEU A CD1 1 
ATOM   1749  C  CD2 . LEU A 1 222 ? -11.224 46.159  81.075  1.00 12.86 ? 222 LEU A CD2 1 
ATOM   1750  N  N   . VAL A 1 223 ? -12.871 47.704  77.070  1.00 12.86 ? 223 VAL A N   1 
ATOM   1751  C  CA  . VAL A 1 223 ? -13.765 47.945  75.945  1.00 12.92 ? 223 VAL A CA  1 
ATOM   1752  C  C   . VAL A 1 223 ? -14.992 47.037  76.003  1.00 12.94 ? 223 VAL A C   1 
ATOM   1753  O  O   . VAL A 1 223 ? -14.869 45.817  76.108  1.00 13.10 ? 223 VAL A O   1 
ATOM   1754  C  CB  . VAL A 1 223 ? -13.044 47.722  74.590  1.00 12.92 ? 223 VAL A CB  1 
ATOM   1755  C  CG1 . VAL A 1 223 ? -13.888 48.291  73.453  1.00 12.77 ? 223 VAL A CG1 1 
ATOM   1756  C  CG2 . VAL A 1 223 ? -11.670 48.385  74.606  1.00 12.71 ? 223 VAL A CG2 1 
ATOM   1757  N  N   . ASN A 1 224 ? -16.177 47.635  75.934  1.00 12.99 ? 224 ASN A N   1 
ATOM   1758  C  CA  . ASN A 1 224 ? -17.415 46.866  75.980  1.00 12.98 ? 224 ASN A CA  1 
ATOM   1759  C  C   . ASN A 1 224 ? -17.830 46.419  74.583  1.00 12.83 ? 224 ASN A C   1 
ATOM   1760  O  O   . ASN A 1 224 ? -17.157 46.722  73.595  1.00 12.96 ? 224 ASN A O   1 
ATOM   1761  C  CB  . ASN A 1 224 ? -18.542 47.687  76.631  1.00 12.87 ? 224 ASN A CB  1 
ATOM   1762  C  CG  . ASN A 1 224 ? -19.057 48.800  75.732  1.00 12.74 ? 224 ASN A CG  1 
ATOM   1763  O  OD1 . ASN A 1 224 ? -18.508 49.055  74.657  1.00 12.95 ? 224 ASN A OD1 1 
ATOM   1764  N  ND2 . ASN A 1 224 ? -20.115 49.471  76.173  1.00 12.24 ? 224 ASN A ND2 1 
ATOM   1765  N  N   . ALA A 1 225 ? -18.948 45.705  74.513  1.00 12.67 ? 225 ALA A N   1 
ATOM   1766  C  CA  . ALA A 1 225 ? -19.467 45.187  73.253  1.00 12.50 ? 225 ALA A CA  1 
ATOM   1767  C  C   . ALA A 1 225 ? -19.835 46.269  72.234  1.00 12.54 ? 225 ALA A C   1 
ATOM   1768  O  O   . ALA A 1 225 ? -20.129 45.962  71.076  1.00 12.27 ? 225 ALA A O   1 
ATOM   1769  C  CB  . ALA A 1 225 ? -20.674 44.294  73.528  1.00 12.36 ? 225 ALA A CB  1 
ATOM   1770  N  N   . ASN A 1 226 ? -19.823 47.529  72.660  1.00 12.67 ? 226 ASN A N   1 
ATOM   1771  C  CA  . ASN A 1 226 ? -20.154 48.628  71.761  1.00 12.89 ? 226 ASN A CA  1 
ATOM   1772  C  C   . ASN A 1 226 ? -18.967 49.553  71.501  1.00 13.07 ? 226 ASN A C   1 
ATOM   1773  O  O   . ASN A 1 226 ? -19.140 50.754  71.302  1.00 12.97 ? 226 ASN A O   1 
ATOM   1774  C  CB  . ASN A 1 226 ? -21.319 49.438  72.325  1.00 13.37 ? 226 ASN A CB  1 
ATOM   1775  C  CG  . ASN A 1 226 ? -22.620 48.667  72.313  1.00 13.77 ? 226 ASN A CG  1 
ATOM   1776  O  OD1 . ASN A 1 226 ? -23.428 48.770  73.240  1.00 13.84 ? 226 ASN A OD1 1 
ATOM   1777  N  ND2 . ASN A 1 226 ? -22.835 47.888  71.257  1.00 14.21 ? 226 ASN A ND2 1 
ATOM   1778  N  N   . GLY A 1 227 ? -17.762 48.993  71.512  1.00 13.07 ? 227 GLY A N   1 
ATOM   1779  C  CA  . GLY A 1 227 ? -16.576 49.788  71.245  1.00 13.28 ? 227 GLY A CA  1 
ATOM   1780  C  C   . GLY A 1 227 ? -16.272 50.930  72.196  1.00 13.33 ? 227 GLY A C   1 
ATOM   1781  O  O   . GLY A 1 227 ? -15.343 51.694  71.956  1.00 13.45 ? 227 GLY A O   1 
ATOM   1782  N  N   . GLU A 1 228 ? -17.044 51.061  73.270  1.00 13.50 ? 228 GLU A N   1 
ATOM   1783  C  CA  . GLU A 1 228 ? -16.806 52.124  74.250  1.00 13.39 ? 228 GLU A CA  1 
ATOM   1784  C  C   . GLU A 1 228 ? -15.672 51.703  75.175  1.00 13.23 ? 228 GLU A C   1 
ATOM   1785  O  O   . GLU A 1 228 ? -15.702 50.607  75.741  1.00 13.29 ? 228 GLU A O   1 
ATOM   1786  C  CB  . GLU A 1 228 ? -18.054 52.371  75.093  1.00 13.54 ? 228 GLU A CB  1 
ATOM   1787  C  CG  . GLU A 1 228 ? -19.336 52.431  74.309  1.00 13.59 ? 228 GLU A CG  1 
ATOM   1788  C  CD  . GLU A 1 228 ? -20.220 53.565  74.777  1.00 13.63 ? 228 GLU A CD  1 
ATOM   1789  O  OE1 . GLU A 1 228 ? -20.067 54.689  74.247  1.00 13.37 ? 228 GLU A OE1 1 
ATOM   1790  O  OE2 . GLU A 1 228 ? -21.059 53.333  75.678  1.00 13.79 ? 228 GLU A OE2 1 
ATOM   1791  N  N   . ALA A 1 229 ? -14.679 52.573  75.340  1.00 13.19 ? 229 ALA A N   1 
ATOM   1792  C  CA  . ALA A 1 229 ? -13.545 52.257  76.200  1.00 12.89 ? 229 ALA A CA  1 
ATOM   1793  C  C   . ALA A 1 229 ? -13.410 53.197  77.399  1.00 13.06 ? 229 ALA A C   1 
ATOM   1794  O  O   . ALA A 1 229 ? -13.726 54.388  77.316  1.00 12.93 ? 229 ALA A O   1 
ATOM   1795  C  CB  . ALA A 1 229 ? -12.266 52.264  75.387  1.00 12.65 ? 229 ALA A CB  1 
ATOM   1796  N  N   . VAL A 1 230 ? -12.943 52.634  78.512  1.00 13.20 ? 230 VAL A N   1 
ATOM   1797  C  CA  . VAL A 1 230 ? -12.730 53.371  79.756  1.00 13.48 ? 230 VAL A CA  1 
ATOM   1798  C  C   . VAL A 1 230 ? -11.471 52.813  80.415  1.00 13.68 ? 230 VAL A C   1 
ATOM   1799  O  O   . VAL A 1 230 ? -11.136 51.641  80.227  1.00 13.84 ? 230 VAL A O   1 
ATOM   1800  C  CB  . VAL A 1 230 ? -13.914 53.196  80.735  1.00 13.35 ? 230 VAL A CB  1 
ATOM   1801  C  CG1 . VAL A 1 230 ? -15.198 53.758  80.118  1.00 13.43 ? 230 VAL A CG1 1 
ATOM   1802  C  CG2 . VAL A 1 230 ? -14.090 51.727  81.080  1.00 13.06 ? 230 VAL A CG2 1 
ATOM   1803  N  N   . TYR A 1 231 ? -10.770 53.644  81.179  1.00 13.60 ? 231 TYR A N   1 
ATOM   1804  C  CA  . TYR A 1 231 ? -9.558  53.191  81.844  1.00 13.58 ? 231 TYR A CA  1 
ATOM   1805  C  C   . TYR A 1 231 ? -9.882  52.479  83.151  1.00 13.70 ? 231 TYR A C   1 
ATOM   1806  O  O   . TYR A 1 231 ? -10.982 52.616  83.683  1.00 13.37 ? 231 TYR A O   1 
ATOM   1807  C  CB  . TYR A 1 231 ? -8.629  54.375  82.080  1.00 13.64 ? 231 TYR A CB  1 
ATOM   1808  C  CG  . TYR A 1 231 ? -8.069  54.910  80.787  1.00 13.69 ? 231 TYR A CG  1 
ATOM   1809  C  CD1 . TYR A 1 231 ? -7.212  54.130  80.008  1.00 13.68 ? 231 TYR A CD1 1 
ATOM   1810  C  CD2 . TYR A 1 231 ? -8.432  56.172  80.310  1.00 13.71 ? 231 TYR A CD2 1 
ATOM   1811  C  CE1 . TYR A 1 231 ? -6.732  54.587  78.783  1.00 13.68 ? 231 TYR A CE1 1 
ATOM   1812  C  CE2 . TYR A 1 231 ? -7.956  56.639  79.083  1.00 13.72 ? 231 TYR A CE2 1 
ATOM   1813  C  CZ  . TYR A 1 231 ? -7.107  55.836  78.326  1.00 13.75 ? 231 TYR A CZ  1 
ATOM   1814  O  OH  . TYR A 1 231 ? -6.650  56.269  77.101  1.00 13.98 ? 231 TYR A OH  1 
ATOM   1815  N  N   . CYS A 1 232 ? -8.928  51.712  83.668  1.00 13.92 ? 232 CYS A N   1 
ATOM   1816  C  CA  . CYS A 1 232 ? -9.163  50.966  84.896  1.00 14.27 ? 232 CYS A CA  1 
ATOM   1817  C  C   . CYS A 1 232 ? -7.896  50.533  85.616  1.00 13.86 ? 232 CYS A C   1 
ATOM   1818  O  O   . CYS A 1 232 ? -6.794  50.604  85.074  1.00 13.92 ? 232 CYS A O   1 
ATOM   1819  C  CB  . CYS A 1 232 ? -9.988  49.723  84.582  1.00 15.01 ? 232 CYS A CB  1 
ATOM   1820  S  SG  . CYS A 1 232 ? -9.078  48.531  83.556  1.00 16.51 ? 232 CYS A SG  1 
ATOM   1821  N  N   . LYS A 1 233 ? -8.081  50.068  86.846  1.00 13.41 ? 233 LYS A N   1 
ATOM   1822  C  CA  . LYS A 1 233 ? -6.986  49.598  87.684  1.00 12.93 ? 233 LYS A CA  1 
ATOM   1823  C  C   . LYS A 1 233 ? -7.497  48.374  88.436  1.00 12.75 ? 233 LYS A C   1 
ATOM   1824  O  O   . LYS A 1 233 ? -8.608  48.388  88.961  1.00 12.80 ? 233 LYS A O   1 
ATOM   1825  C  CB  . LYS A 1 233 ? -6.571  50.690  88.673  1.00 12.54 ? 233 LYS A CB  1 
ATOM   1826  C  CG  . LYS A 1 233 ? -6.128  51.990  88.021  1.00 12.06 ? 233 LYS A CG  1 
ATOM   1827  C  CD  . LYS A 1 233 ? -4.610  52.106  88.019  1.00 11.86 ? 233 LYS A CD  1 
ATOM   1828  C  CE  . LYS A 1 233 ? -4.149  53.532  88.294  1.00 11.73 ? 233 LYS A CE  1 
ATOM   1829  N  NZ  . LYS A 1 233 ? -2.673  53.681  88.118  1.00 11.59 ? 233 LYS A NZ  1 
ATOM   1830  N  N   . PHE A 1 234 ? -6.691  47.319  88.486  1.00 12.59 ? 234 PHE A N   1 
ATOM   1831  C  CA  . PHE A 1 234 ? -7.091  46.092  89.160  1.00 12.58 ? 234 PHE A CA  1 
ATOM   1832  C  C   . PHE A 1 234 ? -6.574  45.965  90.590  1.00 12.62 ? 234 PHE A C   1 
ATOM   1833  O  O   . PHE A 1 234 ? -5.398  46.211  90.861  1.00 12.34 ? 234 PHE A O   1 
ATOM   1834  C  CB  . PHE A 1 234 ? -6.618  44.877  88.355  1.00 12.62 ? 234 PHE A CB  1 
ATOM   1835  C  CG  . PHE A 1 234 ? -7.232  44.772  86.990  1.00 12.79 ? 234 PHE A CG  1 
ATOM   1836  C  CD1 . PHE A 1 234 ? -8.566  44.410  86.838  1.00 12.84 ? 234 PHE A CD1 1 
ATOM   1837  C  CD2 . PHE A 1 234 ? -6.471  45.026  85.851  1.00 12.98 ? 234 PHE A CD2 1 
ATOM   1838  C  CE1 . PHE A 1 234 ? -9.137  44.299  85.572  1.00 12.93 ? 234 PHE A CE1 1 
ATOM   1839  C  CE2 . PHE A 1 234 ? -7.031  44.919  84.576  1.00 13.09 ? 234 PHE A CE2 1 
ATOM   1840  C  CZ  . PHE A 1 234 ? -8.368  44.554  84.437  1.00 13.15 ? 234 PHE A CZ  1 
ATOM   1841  N  N   . HIS A 1 235 ? -7.464  45.572  91.499  1.00 12.76 ? 235 HIS A N   1 
ATOM   1842  C  CA  . HIS A 1 235 ? -7.104  45.369  92.902  1.00 13.21 ? 235 HIS A CA  1 
ATOM   1843  C  C   . HIS A 1 235 ? -7.772  44.102  93.413  1.00 13.30 ? 235 HIS A C   1 
ATOM   1844  O  O   . HIS A 1 235 ? -8.963  43.891  93.183  1.00 13.68 ? 235 HIS A O   1 
ATOM   1845  C  CB  . HIS A 1 235 ? -7.566  46.537  93.784  1.00 13.13 ? 235 HIS A CB  1 
ATOM   1846  C  CG  . HIS A 1 235 ? -7.359  47.888  93.176  1.00 13.06 ? 235 HIS A CG  1 
ATOM   1847  N  ND1 . HIS A 1 235 ? -6.312  48.709  93.532  1.00 13.07 ? 235 HIS A ND1 1 
ATOM   1848  C  CD2 . HIS A 1 235 ? -8.090  48.582  92.270  1.00 13.02 ? 235 HIS A CD2 1 
ATOM   1849  C  CE1 . HIS A 1 235 ? -6.407  49.851  92.873  1.00 13.06 ? 235 HIS A CE1 1 
ATOM   1850  N  NE2 . HIS A 1 235 ? -7.477  49.800  92.102  1.00 12.94 ? 235 HIS A NE2 1 
ATOM   1851  N  N   . TYR A 1 236 ? -7.005  43.260  94.099  1.00 13.12 ? 236 TYR A N   1 
ATOM   1852  C  CA  . TYR A 1 236 ? -7.546  42.033  94.665  1.00 12.95 ? 236 TYR A CA  1 
ATOM   1853  C  C   . TYR A 1 236 ? -7.113  41.932  96.126  1.00 12.83 ? 236 TYR A C   1 
ATOM   1854  O  O   . TYR A 1 236 ? -5.944  41.673  96.427  1.00 12.59 ? 236 TYR A O   1 
ATOM   1855  C  CB  . TYR A 1 236 ? -7.083  40.798  93.873  1.00 13.00 ? 236 TYR A CB  1 
ATOM   1856  C  CG  . TYR A 1 236 ? -5.791  40.954  93.092  1.00 12.93 ? 236 TYR A CG  1 
ATOM   1857  C  CD1 . TYR A 1 236 ? -5.729  41.757  91.951  1.00 12.96 ? 236 TYR A CD1 1 
ATOM   1858  C  CD2 . TYR A 1 236 ? -4.642  40.261  93.468  1.00 12.88 ? 236 TYR A CD2 1 
ATOM   1859  C  CE1 . TYR A 1 236 ? -4.551  41.861  91.201  1.00 12.78 ? 236 TYR A CE1 1 
ATOM   1860  C  CE2 . TYR A 1 236 ? -3.463  40.358  92.729  1.00 12.71 ? 236 TYR A CE2 1 
ATOM   1861  C  CZ  . TYR A 1 236 ? -3.424  41.156  91.598  1.00 12.70 ? 236 TYR A CZ  1 
ATOM   1862  O  OH  . TYR A 1 236 ? -2.263  41.235  90.863  1.00 12.35 ? 236 TYR A OH  1 
ATOM   1863  N  N   . LYS A 1 237 ? -8.069  42.152  97.027  1.00 12.76 ? 237 LYS A N   1 
ATOM   1864  C  CA  . LYS A 1 237 ? -7.820  42.116  98.464  1.00 12.64 ? 237 LYS A CA  1 
ATOM   1865  C  C   . LYS A 1 237 ? -7.880  40.716  99.077  1.00 12.67 ? 237 LYS A C   1 
ATOM   1866  O  O   . LYS A 1 237 ? -8.725  39.893  98.719  1.00 12.78 ? 237 LYS A O   1 
ATOM   1867  C  CB  . LYS A 1 237 ? -8.817  43.023  99.182  1.00 12.64 ? 237 LYS A CB  1 
ATOM   1868  C  CG  . LYS A 1 237 ? -9.321  44.174  98.336  1.00 12.84 ? 237 LYS A CG  1 
ATOM   1869  C  CD  . LYS A 1 237 ? -8.342  45.345  98.341  1.00 13.02 ? 237 LYS A CD  1 
ATOM   1870  C  CE  . LYS A 1 237 ? -8.766  46.426  99.335  1.00 13.26 ? 237 LYS A CE  1 
ATOM   1871  N  NZ  . LYS A 1 237 ? -8.187  47.764  99.013  1.00 12.90 ? 237 LYS A NZ  1 
ATOM   1872  N  N   . THR A 1 238 ? -6.973  40.465  100.014 1.00 12.74 ? 238 THR A N   1 
ATOM   1873  C  CA  . THR A 1 238 ? -6.887  39.186  100.707 1.00 12.81 ? 238 THR A CA  1 
ATOM   1874  C  C   . THR A 1 238 ? -8.054  39.005  101.662 1.00 13.05 ? 238 THR A C   1 
ATOM   1875  O  O   . THR A 1 238 ? -8.286  39.846  102.537 1.00 13.23 ? 238 THR A O   1 
ATOM   1876  C  CB  . THR A 1 238 ? -5.594  39.092  101.538 1.00 12.60 ? 238 THR A CB  1 
ATOM   1877  O  OG1 . THR A 1 238 ? -5.727  38.058  102.520 1.00 12.24 ? 238 THR A OG1 1 
ATOM   1878  C  CG2 . THR A 1 238 ? -5.315  40.418  102.242 1.00 12.32 ? 238 THR A CG2 1 
ATOM   1879  N  N   . ASP A 1 239 ? -8.785  37.907  101.499 1.00 13.14 ? 239 ASP A N   1 
ATOM   1880  C  CA  . ASP A 1 239 ? -9.916  37.624  102.374 1.00 13.17 ? 239 ASP A CA  1 
ATOM   1881  C  C   . ASP A 1 239 ? -9.414  37.064  103.703 1.00 13.14 ? 239 ASP A C   1 
ATOM   1882  O  O   . ASP A 1 239 ? -10.196 36.691  104.570 1.00 13.32 ? 239 ASP A O   1 
ATOM   1883  C  CB  . ASP A 1 239 ? -10.860 36.625  101.709 1.00 13.19 ? 239 ASP A CB  1 
ATOM   1884  C  CG  . ASP A 1 239 ? -11.590 37.220  100.527 1.00 13.10 ? 239 ASP A CG  1 
ATOM   1885  O  OD1 . ASP A 1 239 ? -11.445 38.438  100.295 1.00 13.29 ? 239 ASP A OD1 1 
ATOM   1886  O  OD2 . ASP A 1 239 ? -12.305 36.471  99.830  1.00 12.93 ? 239 ASP A OD2 1 
ATOM   1887  N  N   . GLN A 1 240 ? -8.098  37.007  103.855 1.00 13.22 ? 240 GLN A N   1 
ATOM   1888  C  CA  . GLN A 1 240 ? -7.490  36.504  105.078 1.00 13.06 ? 240 GLN A CA  1 
ATOM   1889  C  C   . GLN A 1 240 ? -6.956  37.670  105.904 1.00 13.03 ? 240 GLN A C   1 
ATOM   1890  O  O   . GLN A 1 240 ? -6.426  37.477  107.000 1.00 12.99 ? 240 GLN A O   1 
ATOM   1891  C  CB  . GLN A 1 240 ? -6.344  35.544  104.741 1.00 13.17 ? 240 GLN A CB  1 
ATOM   1892  C  CG  . GLN A 1 240 ? -6.789  34.231  104.115 1.00 13.42 ? 240 GLN A CG  1 
ATOM   1893  C  CD  . GLN A 1 240 ? -7.101  34.371  102.640 1.00 13.60 ? 240 GLN A CD  1 
ATOM   1894  O  OE1 . GLN A 1 240 ? -8.266  34.321  102.230 1.00 13.81 ? 240 GLN A OE1 1 
ATOM   1895  N  NE2 . GLN A 1 240 ? -6.061  34.551  101.831 1.00 13.67 ? 240 GLN A NE2 1 
ATOM   1896  N  N   . GLY A 1 241 ? -7.097  38.882  105.372 1.00 12.85 ? 241 GLY A N   1 
ATOM   1897  C  CA  . GLY A 1 241 ? -6.617  40.062  106.071 1.00 12.73 ? 241 GLY A CA  1 
ATOM   1898  C  C   . GLY A 1 241 ? -5.159  40.402  105.800 1.00 12.70 ? 241 GLY A C   1 
ATOM   1899  O  O   . GLY A 1 241 ? -4.382  39.554  105.369 1.00 12.70 ? 241 GLY A O   1 
ATOM   1900  N  N   . ILE A 1 242 ? -4.784  41.650  106.054 1.00 12.69 ? 242 ILE A N   1 
ATOM   1901  C  CA  . ILE A 1 242 ? -3.411  42.099  105.846 1.00 12.67 ? 242 ILE A CA  1 
ATOM   1902  C  C   . ILE A 1 242 ? -2.594  41.864  107.113 1.00 12.79 ? 242 ILE A C   1 
ATOM   1903  O  O   . ILE A 1 242 ? -2.926  42.382  108.184 1.00 12.95 ? 242 ILE A O   1 
ATOM   1904  C  CB  . ILE A 1 242 ? -3.350  43.609  105.503 1.00 12.65 ? 242 ILE A CB  1 
ATOM   1905  C  CG1 . ILE A 1 242 ? -4.752  44.141  105.209 1.00 12.47 ? 242 ILE A CG1 1 
ATOM   1906  C  CG2 . ILE A 1 242 ? -2.448  43.838  104.301 1.00 12.62 ? 242 ILE A CG2 1 
ATOM   1907  C  CD1 . ILE A 1 242 ? -5.495  44.615  106.438 1.00 12.69 ? 242 ILE A CD1 1 
ATOM   1908  N  N   . LYS A 1 243 ? -1.528  41.081  106.993 1.00 12.85 ? 243 LYS A N   1 
ATOM   1909  C  CA  . LYS A 1 243 ? -0.674  40.786  108.139 1.00 12.66 ? 243 LYS A CA  1 
ATOM   1910  C  C   . LYS A 1 243 ? 0.790   40.932  107.761 1.00 12.31 ? 243 LYS A C   1 
ATOM   1911  O  O   . LYS A 1 243 ? 1.206   40.483  106.700 1.00 12.16 ? 243 LYS A O   1 
ATOM   1912  C  CB  . LYS A 1 243 ? -0.938  39.362  108.640 1.00 13.06 ? 243 LYS A CB  1 
ATOM   1913  C  CG  . LYS A 1 243 ? -2.161  39.236  109.535 1.00 13.50 ? 243 LYS A CG  1 
ATOM   1914  C  CD  . LYS A 1 243 ? -2.226  37.871  110.209 1.00 13.60 ? 243 LYS A CD  1 
ATOM   1915  C  CE  . LYS A 1 243 ? -1.071  37.670  111.191 1.00 13.45 ? 243 LYS A CE  1 
ATOM   1916  N  NZ  . LYS A 1 243 ? -1.189  36.386  111.951 1.00 12.85 ? 243 LYS A NZ  1 
ATOM   1917  N  N   . ASN A 1 244 ? 1.572   41.551  108.636 1.00 12.25 ? 244 ASN A N   1 
ATOM   1918  C  CA  . ASN A 1 244 ? 2.992   41.738  108.365 1.00 12.45 ? 244 ASN A CA  1 
ATOM   1919  C  C   . ASN A 1 244 ? 3.890   41.309  109.515 1.00 12.18 ? 244 ASN A C   1 
ATOM   1920  O  O   . ASN A 1 244 ? 3.586   41.549  110.682 1.00 12.05 ? 244 ASN A O   1 
ATOM   1921  C  CB  . ASN A 1 244 ? 3.269   43.202  108.024 1.00 12.68 ? 244 ASN A CB  1 
ATOM   1922  C  CG  . ASN A 1 244 ? 2.238   43.779  107.085 1.00 13.07 ? 244 ASN A CG  1 
ATOM   1923  O  OD1 . ASN A 1 244 ? 1.985   43.234  106.008 1.00 13.55 ? 244 ASN A OD1 1 
ATOM   1924  N  ND2 . ASN A 1 244 ? 1.632   44.886  107.487 1.00 13.26 ? 244 ASN A ND2 1 
ATOM   1925  N  N   . LEU A 1 245 ? 5.001   40.670  109.169 1.00 11.99 ? 245 LEU A N   1 
ATOM   1926  C  CA  . LEU A 1 245 ? 5.962   40.214  110.160 1.00 11.90 ? 245 LEU A CA  1 
ATOM   1927  C  C   . LEU A 1 245 ? 6.803   41.402  110.582 1.00 11.97 ? 245 LEU A C   1 
ATOM   1928  O  O   . LEU A 1 245 ? 7.057   42.301  109.782 1.00 12.04 ? 245 LEU A O   1 
ATOM   1929  C  CB  . LEU A 1 245 ? 6.868   39.136  109.569 1.00 11.92 ? 245 LEU A CB  1 
ATOM   1930  C  CG  . LEU A 1 245 ? 6.198   38.076  108.694 1.00 11.74 ? 245 LEU A CG  1 
ATOM   1931  C  CD1 . LEU A 1 245 ? 7.146   37.700  107.575 1.00 12.04 ? 245 LEU A CD1 1 
ATOM   1932  C  CD2 . LEU A 1 245 ? 5.844   36.855  109.527 1.00 11.39 ? 245 LEU A CD2 1 
ATOM   1933  N  N   . SER A 1 246 ? 7.228   41.410  111.840 1.00 12.18 ? 246 SER A N   1 
ATOM   1934  C  CA  . SER A 1 246 ? 8.043   42.504  112.350 1.00 12.18 ? 246 SER A CA  1 
ATOM   1935  C  C   . SER A 1 246 ? 9.487   42.335  111.895 1.00 12.10 ? 246 SER A C   1 
ATOM   1936  O  O   . SER A 1 246 ? 9.882   41.263  111.431 1.00 12.08 ? 246 SER A O   1 
ATOM   1937  C  CB  . SER A 1 246 ? 7.974   42.547  113.880 1.00 12.14 ? 246 SER A CB  1 
ATOM   1938  O  OG  . SER A 1 246 ? 9.003   41.767  114.463 1.00 12.21 ? 246 SER A OG  1 
ATOM   1939  N  N   . VAL A 1 247 ? 10.269  43.399  112.016 1.00 12.09 ? 247 VAL A N   1 
ATOM   1940  C  CA  . VAL A 1 247 ? 11.667  43.353  111.622 1.00 12.37 ? 247 VAL A CA  1 
ATOM   1941  C  C   . VAL A 1 247 ? 12.349  42.151  112.273 1.00 12.59 ? 247 VAL A C   1 
ATOM   1942  O  O   . VAL A 1 247 ? 13.017  41.361  111.604 1.00 12.52 ? 247 VAL A O   1 
ATOM   1943  C  CB  . VAL A 1 247 ? 12.403  44.635  112.057 1.00 12.55 ? 247 VAL A CB  1 
ATOM   1944  C  CG1 . VAL A 1 247 ? 13.850  44.590  111.600 1.00 12.41 ? 247 VAL A CG1 1 
ATOM   1945  C  CG2 . VAL A 1 247 ? 11.699  45.853  111.491 1.00 12.97 ? 247 VAL A CG2 1 
ATOM   1946  N  N   . GLU A 1 248 ? 12.165  42.020  113.584 1.00 12.71 ? 248 GLU A N   1 
ATOM   1947  C  CA  . GLU A 1 248 ? 12.756  40.929  114.353 1.00 13.04 ? 248 GLU A CA  1 
ATOM   1948  C  C   . GLU A 1 248 ? 12.319  39.548  113.871 1.00 12.81 ? 248 GLU A C   1 
ATOM   1949  O  O   . GLU A 1 248 ? 13.152  38.686  113.600 1.00 12.63 ? 248 GLU A O   1 
ATOM   1950  C  CB  . GLU A 1 248 ? 12.399  41.087  115.832 1.00 13.42 ? 248 GLU A CB  1 
ATOM   1951  C  CG  . GLU A 1 248 ? 13.009  42.321  116.490 1.00 14.54 ? 248 GLU A CG  1 
ATOM   1952  C  CD  . GLU A 1 248 ? 12.260  43.608  116.153 1.00 15.19 ? 248 GLU A CD  1 
ATOM   1953  O  OE1 . GLU A 1 248 ? 11.076  43.532  115.746 1.00 15.51 ? 248 GLU A OE1 1 
ATOM   1954  O  OE2 . GLU A 1 248 ? 12.859  44.700  116.295 1.00 15.75 ? 248 GLU A OE2 1 
ATOM   1955  N  N   . ASP A 1 249 ? 11.009  39.346  113.766 1.00 13.11 ? 249 ASP A N   1 
ATOM   1956  C  CA  . ASP A 1 249 ? 10.451  38.074  113.325 1.00 13.43 ? 249 ASP A CA  1 
ATOM   1957  C  C   . ASP A 1 249 ? 10.950  37.654  111.948 1.00 13.60 ? 249 ASP A C   1 
ATOM   1958  O  O   . ASP A 1 249 ? 11.425  36.528  111.764 1.00 13.50 ? 249 ASP A O   1 
ATOM   1959  C  CB  . ASP A 1 249 ? 8.927   38.157  113.307 1.00 14.11 ? 249 ASP A CB  1 
ATOM   1960  C  CG  . ASP A 1 249 ? 8.335   38.261  114.699 1.00 14.69 ? 249 ASP A CG  1 
ATOM   1961  O  OD1 . ASP A 1 249 ? 8.560   37.331  115.509 1.00 15.20 ? 249 ASP A OD1 1 
ATOM   1962  O  OD2 . ASP A 1 249 ? 7.644   39.270  114.981 1.00 14.90 ? 249 ASP A OD2 1 
ATOM   1963  N  N   . ALA A 1 250 ? 10.833  38.563  110.983 1.00 13.36 ? 250 ALA A N   1 
ATOM   1964  C  CA  . ALA A 1 250 ? 11.263  38.295  109.619 1.00 13.21 ? 250 ALA A CA  1 
ATOM   1965  C  C   . ALA A 1 250 ? 12.734  37.891  109.562 1.00 12.88 ? 250 ALA A C   1 
ATOM   1966  O  O   . ALA A 1 250 ? 13.110  36.967  108.840 1.00 12.84 ? 250 ALA A O   1 
ATOM   1967  C  CB  . ALA A 1 250 ? 11.023  39.526  108.759 1.00 13.55 ? 250 ALA A CB  1 
ATOM   1968  N  N   . ALA A 1 251 ? 13.557  38.594  110.333 1.00 12.93 ? 251 ALA A N   1 
ATOM   1969  C  CA  . ALA A 1 251 ? 14.994  38.338  110.392 1.00 12.90 ? 251 ALA A CA  1 
ATOM   1970  C  C   . ALA A 1 251 ? 15.272  36.906  110.842 1.00 12.80 ? 251 ALA A C   1 
ATOM   1971  O  O   . ALA A 1 251 ? 16.025  36.172  110.196 1.00 12.79 ? 251 ALA A O   1 
ATOM   1972  C  CB  . ALA A 1 251 ? 15.659  39.331  111.351 1.00 12.79 ? 251 ALA A CB  1 
ATOM   1973  N  N   . ARG A 1 252 ? 14.667  36.523  111.961 1.00 12.70 ? 252 ARG A N   1 
ATOM   1974  C  CA  . ARG A 1 252 ? 14.832  35.182  112.503 1.00 12.61 ? 252 ARG A CA  1 
ATOM   1975  C  C   . ARG A 1 252 ? 14.403  34.157  111.449 1.00 12.62 ? 252 ARG A C   1 
ATOM   1976  O  O   . ARG A 1 252 ? 15.185  33.295  111.051 1.00 12.44 ? 252 ARG A O   1 
ATOM   1977  C  CB  . ARG A 1 252 ? 13.987  35.047  113.772 1.00 12.71 ? 252 ARG A CB  1 
ATOM   1978  C  CG  . ARG A 1 252 ? 13.590  33.627  114.132 1.00 12.88 ? 252 ARG A CG  1 
ATOM   1979  C  CD  . ARG A 1 252 ? 12.640  33.631  115.314 1.00 13.09 ? 252 ARG A CD  1 
ATOM   1980  N  NE  . ARG A 1 252 ? 11.427  32.854  115.064 1.00 13.45 ? 252 ARG A NE  1 
ATOM   1981  C  CZ  . ARG A 1 252 ? 10.199  33.368  115.011 1.00 13.64 ? 252 ARG A CZ  1 
ATOM   1982  N  NH1 . ARG A 1 252 ? 10.004  34.673  115.189 1.00 13.64 ? 252 ARG A NH1 1 
ATOM   1983  N  NH2 . ARG A 1 252 ? 9.159   32.572  114.794 1.00 13.97 ? 252 ARG A NH2 1 
ATOM   1984  N  N   . LEU A 1 253 ? 13.159  34.275  110.993 1.00 12.49 ? 253 LEU A N   1 
ATOM   1985  C  CA  . LEU A 1 253 ? 12.607  33.384  109.979 1.00 12.58 ? 253 LEU A CA  1 
ATOM   1986  C  C   . LEU A 1 253 ? 13.429  33.409  108.688 1.00 12.69 ? 253 LEU A C   1 
ATOM   1987  O  O   . LEU A 1 253 ? 13.465  32.426  107.942 1.00 12.52 ? 253 LEU A O   1 
ATOM   1988  C  CB  . LEU A 1 253 ? 11.164  33.788  109.667 1.00 12.38 ? 253 LEU A CB  1 
ATOM   1989  C  CG  . LEU A 1 253 ? 10.122  33.467  110.737 1.00 12.26 ? 253 LEU A CG  1 
ATOM   1990  C  CD1 . LEU A 1 253 ? 8.828   34.194  110.429 1.00 12.24 ? 253 LEU A CD1 1 
ATOM   1991  C  CD2 . LEU A 1 253 ? 9.896   31.970  110.788 1.00 11.90 ? 253 LEU A CD2 1 
ATOM   1992  N  N   . SER A 1 254 ? 14.080  34.539  108.423 1.00 12.90 ? 254 SER A N   1 
ATOM   1993  C  CA  . SER A 1 254 ? 14.899  34.688  107.224 1.00 13.16 ? 254 SER A CA  1 
ATOM   1994  C  C   . SER A 1 254 ? 15.915  33.558  107.123 1.00 13.20 ? 254 SER A C   1 
ATOM   1995  O  O   . SER A 1 254 ? 16.374  33.213  106.034 1.00 13.14 ? 254 SER A O   1 
ATOM   1996  C  CB  . SER A 1 254 ? 15.637  36.030  107.245 1.00 13.40 ? 254 SER A CB  1 
ATOM   1997  O  OG  . SER A 1 254 ? 16.876  35.945  106.553 1.00 13.74 ? 254 SER A OG  1 
ATOM   1998  N  N   . GLN A 1 255 ? 16.270  32.983  108.265 1.00 13.42 ? 255 GLN A N   1 
ATOM   1999  C  CA  . GLN A 1 255 ? 17.233  31.897  108.279 1.00 13.74 ? 255 GLN A CA  1 
ATOM   2000  C  C   . GLN A 1 255 ? 16.620  30.621  108.861 1.00 13.90 ? 255 GLN A C   1 
ATOM   2001  O  O   . GLN A 1 255 ? 16.962  29.508  108.446 1.00 13.86 ? 255 GLN A O   1 
ATOM   2002  C  CB  . GLN A 1 255 ? 18.468  32.314  109.078 1.00 13.77 ? 255 GLN A CB  1 
ATOM   2003  C  CG  . GLN A 1 255 ? 18.198  32.617  110.532 1.00 13.97 ? 255 GLN A CG  1 
ATOM   2004  C  CD  . GLN A 1 255 ? 18.809  31.582  111.439 1.00 14.02 ? 255 GLN A CD  1 
ATOM   2005  O  OE1 . GLN A 1 255 ? 18.725  30.383  111.168 1.00 14.06 ? 255 GLN A OE1 1 
ATOM   2006  N  NE2 . GLN A 1 255 ? 19.435  32.034  112.524 1.00 13.99 ? 255 GLN A NE2 1 
ATOM   2007  N  N   . GLU A 1 256 ? 15.708  30.782  109.815 1.00 13.80 ? 256 GLU A N   1 
ATOM   2008  C  CA  . GLU A 1 256 ? 15.063  29.633  110.430 1.00 13.72 ? 256 GLU A CA  1 
ATOM   2009  C  C   . GLU A 1 256 ? 14.357  28.798  109.368 1.00 13.64 ? 256 GLU A C   1 
ATOM   2010  O  O   . GLU A 1 256 ? 14.456  27.574  109.366 1.00 13.91 ? 256 GLU A O   1 
ATOM   2011  C  CB  . GLU A 1 256 ? 14.056  30.096  111.480 1.00 13.84 ? 256 GLU A CB  1 
ATOM   2012  C  CG  . GLU A 1 256 ? 14.627  30.195  112.890 1.00 13.68 ? 256 GLU A CG  1 
ATOM   2013  C  CD  . GLU A 1 256 ? 13.817  29.401  113.907 1.00 13.62 ? 256 GLU A CD  1 
ATOM   2014  O  OE1 . GLU A 1 256 ? 14.365  28.421  114.466 1.00 13.75 ? 256 GLU A OE1 1 
ATOM   2015  O  OE2 . GLU A 1 256 ? 12.637  29.756  114.146 1.00 13.12 ? 256 GLU A OE2 1 
ATOM   2016  N  N   . ASP A 1 257 ? 13.656  29.469  108.460 1.00 13.36 ? 257 ASP A N   1 
ATOM   2017  C  CA  . ASP A 1 257 ? 12.925  28.795  107.393 1.00 13.01 ? 257 ASP A CA  1 
ATOM   2018  C  C   . ASP A 1 257 ? 12.816  29.694  106.161 1.00 12.74 ? 257 ASP A C   1 
ATOM   2019  O  O   . ASP A 1 257 ? 11.785  30.333  105.939 1.00 12.35 ? 257 ASP A O   1 
ATOM   2020  C  CB  . ASP A 1 257 ? 11.526  28.420  107.885 1.00 13.10 ? 257 ASP A CB  1 
ATOM   2021  C  CG  . ASP A 1 257 ? 10.841  27.402  106.991 1.00 13.25 ? 257 ASP A CG  1 
ATOM   2022  O  OD1 . ASP A 1 257 ? 11.547  26.721  106.211 1.00 13.33 ? 257 ASP A OD1 1 
ATOM   2023  O  OD2 . ASP A 1 257 ? 9.594   27.283  107.069 1.00 13.27 ? 257 ASP A OD2 1 
ATOM   2024  N  N   . PRO A 1 258 ? 13.887  29.753  105.344 1.00 12.55 ? 258 PRO A N   1 
ATOM   2025  C  CA  . PRO A 1 258 ? 13.951  30.566  104.122 1.00 12.44 ? 258 PRO A CA  1 
ATOM   2026  C  C   . PRO A 1 258 ? 12.830  30.273  103.135 1.00 12.42 ? 258 PRO A C   1 
ATOM   2027  O  O   . PRO A 1 258 ? 12.592  31.047  102.209 1.00 12.47 ? 258 PRO A O   1 
ATOM   2028  C  CB  . PRO A 1 258 ? 15.324  30.236  103.538 1.00 12.35 ? 258 PRO A CB  1 
ATOM   2029  C  CG  . PRO A 1 258 ? 16.116  29.763  104.692 1.00 12.38 ? 258 PRO A CG  1 
ATOM   2030  C  CD  . PRO A 1 258 ? 15.145  29.024  105.566 1.00 12.41 ? 258 PRO A CD  1 
ATOM   2031  N  N   . ASP A 1 259 ? 12.151  29.150  103.330 1.00 12.22 ? 259 ASP A N   1 
ATOM   2032  C  CA  . ASP A 1 259 ? 11.047  28.773  102.459 1.00 12.34 ? 259 ASP A CA  1 
ATOM   2033  C  C   . ASP A 1 259 ? 9.751   28.913  103.235 1.00 12.20 ? 259 ASP A C   1 
ATOM   2034  O  O   . ASP A 1 259 ? 8.824   28.132  103.068 1.00 12.08 ? 259 ASP A O   1 
ATOM   2035  C  CB  . ASP A 1 259 ? 11.212  27.332  101.975 1.00 12.17 ? 259 ASP A CB  1 
ATOM   2036  C  CG  . ASP A 1 259 ? 12.452  27.145  101.120 1.00 12.05 ? 259 ASP A CG  1 
ATOM   2037  O  OD1 . ASP A 1 259 ? 13.057  28.164  100.721 1.00 11.91 ? 259 ASP A OD1 1 
ATOM   2038  O  OD2 . ASP A 1 259 ? 12.818  25.980  100.849 1.00 11.93 ? 259 ASP A OD2 1 
ATOM   2039  N  N   . TYR A 1 260 ? 9.705   29.925  104.090 1.00 12.45 ? 260 TYR A N   1 
ATOM   2040  C  CA  . TYR A 1 260 ? 8.534   30.202  104.909 1.00 12.60 ? 260 TYR A CA  1 
ATOM   2041  C  C   . TYR A 1 260 ? 7.294   30.422  104.051 1.00 12.79 ? 260 TYR A C   1 
ATOM   2042  O  O   . TYR A 1 260 ? 6.249   29.813  104.281 1.00 12.96 ? 260 TYR A O   1 
ATOM   2043  C  CB  . TYR A 1 260 ? 8.788   31.444  105.767 1.00 12.79 ? 260 TYR A CB  1 
ATOM   2044  C  CG  . TYR A 1 260 ? 7.635   31.824  106.674 1.00 12.66 ? 260 TYR A CG  1 
ATOM   2045  C  CD1 . TYR A 1 260 ? 6.854   32.949  106.406 1.00 12.59 ? 260 TYR A CD1 1 
ATOM   2046  C  CD2 . TYR A 1 260 ? 7.332   31.066  107.806 1.00 12.56 ? 260 TYR A CD2 1 
ATOM   2047  C  CE1 . TYR A 1 260 ? 5.801   33.311  107.243 1.00 12.19 ? 260 TYR A CE1 1 
ATOM   2048  C  CE2 . TYR A 1 260 ? 6.283   31.420  108.648 1.00 12.15 ? 260 TYR A CE2 1 
ATOM   2049  C  CZ  . TYR A 1 260 ? 5.524   32.541  108.361 1.00 12.09 ? 260 TYR A CZ  1 
ATOM   2050  O  OH  . TYR A 1 260 ? 4.488   32.891  109.190 1.00 11.57 ? 260 TYR A OH  1 
ATOM   2051  N  N   . GLY A 1 261 ? 7.421   31.300  103.063 1.00 13.10 ? 261 GLY A N   1 
ATOM   2052  C  CA  . GLY A 1 261 ? 6.306   31.604  102.182 1.00 13.04 ? 261 GLY A CA  1 
ATOM   2053  C  C   . GLY A 1 261 ? 5.811   30.406  101.397 1.00 12.98 ? 261 GLY A C   1 
ATOM   2054  O  O   . GLY A 1 261 ? 4.608   30.243  101.194 1.00 13.16 ? 261 GLY A O   1 
ATOM   2055  N  N   . ILE A 1 262 ? 6.740   29.570  100.948 1.00 12.84 ? 262 ILE A N   1 
ATOM   2056  C  CA  . ILE A 1 262 ? 6.385   28.376  100.190 1.00 12.61 ? 262 ILE A CA  1 
ATOM   2057  C  C   . ILE A 1 262 ? 5.636   27.381  101.079 1.00 12.38 ? 262 ILE A C   1 
ATOM   2058  O  O   . ILE A 1 262 ? 4.540   26.929  100.747 1.00 12.04 ? 262 ILE A O   1 
ATOM   2059  C  CB  . ILE A 1 262 ? 7.642   27.689  99.633  1.00 12.77 ? 262 ILE A CB  1 
ATOM   2060  C  CG1 . ILE A 1 262 ? 8.284   28.576  98.565  1.00 12.87 ? 262 ILE A CG1 1 
ATOM   2061  C  CG2 . ILE A 1 262 ? 7.287   26.318  99.073  1.00 12.93 ? 262 ILE A CG2 1 
ATOM   2062  C  CD1 . ILE A 1 262 ? 9.777   28.372  98.420  1.00 13.09 ? 262 ILE A CD1 1 
ATOM   2063  N  N   . ARG A 1 263 ? 6.243   27.052  102.214 1.00 12.34 ? 263 ARG A N   1 
ATOM   2064  C  CA  . ARG A 1 263 ? 5.668   26.112  103.167 1.00 12.52 ? 263 ARG A CA  1 
ATOM   2065  C  C   . ARG A 1 263 ? 4.295   26.539  103.678 1.00 12.55 ? 263 ARG A C   1 
ATOM   2066  O  O   . ARG A 1 263 ? 3.361   25.732  103.709 1.00 12.46 ? 263 ARG A O   1 
ATOM   2067  C  CB  . ARG A 1 263 ? 6.621   25.939  104.351 1.00 12.57 ? 263 ARG A CB  1 
ATOM   2068  C  CG  . ARG A 1 263 ? 5.990   25.316  105.592 1.00 12.51 ? 263 ARG A CG  1 
ATOM   2069  C  CD  . ARG A 1 263 ? 7.033   25.166  106.676 1.00 12.25 ? 263 ARG A CD  1 
ATOM   2070  N  NE  . ARG A 1 263 ? 8.374   25.087  106.106 1.00 11.87 ? 263 ARG A NE  1 
ATOM   2071  C  CZ  . ARG A 1 263 ? 9.121   23.987  106.109 1.00 11.77 ? 263 ARG A CZ  1 
ATOM   2072  N  NH1 . ARG A 1 263 ? 8.656   22.867  106.656 1.00 11.56 ? 263 ARG A NH1 1 
ATOM   2073  N  NH2 . ARG A 1 263 ? 10.328  24.004  105.556 1.00 11.67 ? 263 ARG A NH2 1 
ATOM   2074  N  N   . ASP A 1 264 ? 4.182   27.801  104.087 1.00 12.47 ? 264 ASP A N   1 
ATOM   2075  C  CA  . ASP A 1 264 ? 2.925   28.333  104.606 1.00 12.25 ? 264 ASP A CA  1 
ATOM   2076  C  C   . ASP A 1 264 ? 1.762   28.173  103.632 1.00 12.16 ? 264 ASP A C   1 
ATOM   2077  O  O   . ASP A 1 264 ? 0.675   27.751  104.017 1.00 12.19 ? 264 ASP A O   1 
ATOM   2078  C  CB  . ASP A 1 264 ? 3.076   29.809  104.956 1.00 12.17 ? 264 ASP A CB  1 
ATOM   2079  C  CG  . ASP A 1 264 ? 1.739   30.501  105.125 1.00 12.17 ? 264 ASP A CG  1 
ATOM   2080  O  OD1 . ASP A 1 264 ? 1.292   31.182  104.177 1.00 11.85 ? 264 ASP A OD1 1 
ATOM   2081  O  OD2 . ASP A 1 264 ? 1.130   30.357  106.206 1.00 12.40 ? 264 ASP A OD2 1 
ATOM   2082  N  N   . LEU A 1 265 ? 1.996   28.517  102.371 1.00 12.09 ? 265 LEU A N   1 
ATOM   2083  C  CA  . LEU A 1 265 ? 0.965   28.427  101.345 1.00 11.91 ? 265 LEU A CA  1 
ATOM   2084  C  C   . LEU A 1 265 ? 0.590   26.987  101.005 1.00 11.80 ? 265 LEU A C   1 
ATOM   2085  O  O   . LEU A 1 265 ? -0.585  26.656  100.847 1.00 11.78 ? 265 LEU A O   1 
ATOM   2086  C  CB  . LEU A 1 265 ? 1.432   29.147  100.082 1.00 11.88 ? 265 LEU A CB  1 
ATOM   2087  C  CG  . LEU A 1 265 ? 0.558   28.973  98.843  1.00 11.82 ? 265 LEU A CG  1 
ATOM   2088  C  CD1 . LEU A 1 265 ? -0.733  29.759  99.007  1.00 11.44 ? 265 LEU A CD1 1 
ATOM   2089  C  CD2 . LEU A 1 265 ? 1.329   29.434  97.616  1.00 12.02 ? 265 LEU A CD2 1 
ATOM   2090  N  N   . PHE A 1 266 ? 1.594   26.129  100.885 1.00 11.92 ? 266 PHE A N   1 
ATOM   2091  C  CA  . PHE A 1 266 ? 1.351   24.730  100.566 1.00 11.94 ? 266 PHE A CA  1 
ATOM   2092  C  C   . PHE A 1 266 ? 0.441   24.089  101.607 1.00 11.92 ? 266 PHE A C   1 
ATOM   2093  O  O   . PHE A 1 266 ? -0.605  23.538  101.266 1.00 11.84 ? 266 PHE A O   1 
ATOM   2094  C  CB  . PHE A 1 266 ? 2.677   23.972  100.500 1.00 12.13 ? 266 PHE A CB  1 
ATOM   2095  C  CG  . PHE A 1 266 ? 2.569   22.602  99.892  1.00 12.40 ? 266 PHE A CG  1 
ATOM   2096  C  CD1 . PHE A 1 266 ? 2.257   21.500  100.681 1.00 12.46 ? 266 PHE A CD1 1 
ATOM   2097  C  CD2 . PHE A 1 266 ? 2.808   22.407  98.534  1.00 12.50 ? 266 PHE A CD2 1 
ATOM   2098  C  CE1 . PHE A 1 266 ? 2.188   20.224  100.126 1.00 12.49 ? 266 PHE A CE1 1 
ATOM   2099  C  CE2 . PHE A 1 266 ? 2.743   21.133  97.970  1.00 12.55 ? 266 PHE A CE2 1 
ATOM   2100  C  CZ  . PHE A 1 266 ? 2.433   20.040  98.767  1.00 12.49 ? 266 PHE A CZ  1 
ATOM   2101  N  N   . ASN A 1 267 ? 0.843   24.175  102.874 1.00 11.92 ? 267 ASN A N   1 
ATOM   2102  C  CA  . ASN A 1 267 ? 0.073   23.599  103.976 1.00 12.04 ? 267 ASN A CA  1 
ATOM   2103  C  C   . ASN A 1 267 ? -1.357  24.122  104.038 1.00 12.10 ? 267 ASN A C   1 
ATOM   2104  O  O   . ASN A 1 267 ? -2.304  23.345  104.172 1.00 12.09 ? 267 ASN A O   1 
ATOM   2105  C  CB  . ASN A 1 267 ? 0.777   23.867  105.305 1.00 11.88 ? 267 ASN A CB  1 
ATOM   2106  C  CG  . ASN A 1 267 ? 2.042   23.047  105.468 1.00 11.88 ? 267 ASN A CG  1 
ATOM   2107  O  OD1 . ASN A 1 267 ? 2.102   21.881  105.073 1.00 11.56 ? 267 ASN A OD1 1 
ATOM   2108  N  ND2 . ASN A 1 267 ? 3.064   23.655  106.053 1.00 12.22 ? 267 ASN A ND2 1 
ATOM   2109  N  N   . ALA A 1 268 ? -1.514  25.438  103.943 1.00 12.07 ? 268 ALA A N   1 
ATOM   2110  C  CA  . ALA A 1 268 ? -2.842  26.040  103.979 1.00 12.39 ? 268 ALA A CA  1 
ATOM   2111  C  C   . ALA A 1 268 ? -3.762  25.295  103.015 1.00 12.54 ? 268 ALA A C   1 
ATOM   2112  O  O   . ALA A 1 268 ? -4.801  24.768  103.419 1.00 12.52 ? 268 ALA A O   1 
ATOM   2113  C  CB  . ALA A 1 268 ? -2.762  27.519  103.603 1.00 12.14 ? 268 ALA A CB  1 
ATOM   2114  N  N   . ILE A 1 269 ? -3.363  25.254  101.743 1.00 12.84 ? 269 ILE A N   1 
ATOM   2115  C  CA  . ILE A 1 269 ? -4.116  24.574  100.690 1.00 12.90 ? 269 ILE A CA  1 
ATOM   2116  C  C   . ILE A 1 269 ? -4.282  23.103  101.048 1.00 12.93 ? 269 ILE A C   1 
ATOM   2117  O  O   . ILE A 1 269 ? -5.340  22.515  100.842 1.00 13.18 ? 269 ILE A O   1 
ATOM   2118  C  CB  . ILE A 1 269 ? -3.371  24.664  99.325  1.00 13.00 ? 269 ILE A CB  1 
ATOM   2119  C  CG1 . ILE A 1 269 ? -3.822  25.907  98.559  1.00 13.00 ? 269 ILE A CG1 1 
ATOM   2120  C  CG2 . ILE A 1 269 ? -3.642  23.428  98.481  1.00 13.06 ? 269 ILE A CG2 1 
ATOM   2121  C  CD1 . ILE A 1 269 ? -2.954  26.224  97.361  1.00 12.54 ? 269 ILE A CD1 1 
ATOM   2122  N  N   . ALA A 1 270 ? -3.218  22.520  101.584 1.00 12.88 ? 270 ALA A N   1 
ATOM   2123  C  CA  . ALA A 1 270 ? -3.216  21.117  101.962 1.00 12.75 ? 270 ALA A CA  1 
ATOM   2124  C  C   . ALA A 1 270 ? -4.241  20.788  103.039 1.00 12.60 ? 270 ALA A C   1 
ATOM   2125  O  O   . ALA A 1 270 ? -4.694  19.649  103.140 1.00 12.60 ? 270 ALA A O   1 
ATOM   2126  C  CB  . ALA A 1 270 ? -1.822  20.712  102.430 1.00 12.66 ? 270 ALA A CB  1 
ATOM   2127  N  N   . THR A 1 271 ? -4.607  21.782  103.839 1.00 12.54 ? 271 THR A N   1 
ATOM   2128  C  CA  . THR A 1 271 ? -5.569  21.569  104.916 1.00 12.58 ? 271 THR A CA  1 
ATOM   2129  C  C   . THR A 1 271 ? -6.914  22.258  104.680 1.00 12.78 ? 271 THR A C   1 
ATOM   2130  O  O   . THR A 1 271 ? -7.564  22.717  105.626 1.00 12.63 ? 271 THR A O   1 
ATOM   2131  C  CB  . THR A 1 271 ? -5.003  22.060  106.269 1.00 12.34 ? 271 THR A CB  1 
ATOM   2132  O  OG1 . THR A 1 271 ? -4.741  23.469  106.198 1.00 12.37 ? 271 THR A OG1 1 
ATOM   2133  C  CG2 . THR A 1 271 ? -3.713  21.322  106.603 1.00 12.10 ? 271 THR A CG2 1 
ATOM   2134  N  N   . GLY A 1 272 ? -7.327  22.337  103.423 1.00 12.51 ? 272 GLY A N   1 
ATOM   2135  C  CA  . GLY A 1 272 ? -8.601  22.965  103.116 1.00 12.88 ? 272 GLY A CA  1 
ATOM   2136  C  C   . GLY A 1 272 ? -8.775  24.406  103.577 1.00 12.86 ? 272 GLY A C   1 
ATOM   2137  O  O   . GLY A 1 272 ? -9.904  24.873  103.737 1.00 12.96 ? 272 GLY A O   1 
ATOM   2138  N  N   . LYS A 1 273 ? -7.672  25.116  103.796 1.00 12.54 ? 273 LYS A N   1 
ATOM   2139  C  CA  . LYS A 1 273 ? -7.741  26.513  104.217 1.00 12.17 ? 273 LYS A CA  1 
ATOM   2140  C  C   . LYS A 1 273 ? -7.478  27.393  103.000 1.00 11.99 ? 273 LYS A C   1 
ATOM   2141  O  O   . LYS A 1 273 ? -6.736  28.372  103.070 1.00 11.61 ? 273 LYS A O   1 
ATOM   2142  C  CB  . LYS A 1 273 ? -6.696  26.794  105.289 1.00 12.46 ? 273 LYS A CB  1 
ATOM   2143  C  CG  . LYS A 1 273 ? -7.250  27.478  106.526 1.00 12.86 ? 273 LYS A CG  1 
ATOM   2144  C  CD  . LYS A 1 273 ? -7.757  26.462  107.542 1.00 13.15 ? 273 LYS A CD  1 
ATOM   2145  C  CE  . LYS A 1 273 ? -6.726  25.366  107.821 1.00 13.39 ? 273 LYS A CE  1 
ATOM   2146  N  NZ  . LYS A 1 273 ? -5.439  25.898  108.370 1.00 13.15 ? 273 LYS A NZ  1 
ATOM   2147  N  N   . TYR A 1 274 ? -8.103  27.021  101.887 1.00 12.07 ? 274 TYR A N   1 
ATOM   2148  C  CA  . TYR A 1 274 ? -7.959  27.721  100.616 1.00 12.39 ? 274 TYR A CA  1 
ATOM   2149  C  C   . TYR A 1 274 ? -8.007  29.242  100.731 1.00 12.47 ? 274 TYR A C   1 
ATOM   2150  O  O   . TYR A 1 274 ? -9.036  29.814  101.091 1.00 12.32 ? 274 TYR A O   1 
ATOM   2151  C  CB  . TYR A 1 274 ? -9.036  27.239  99.639  1.00 12.46 ? 274 TYR A CB  1 
ATOM   2152  C  CG  . TYR A 1 274 ? -9.164  25.730  99.561  1.00 12.63 ? 274 TYR A CG  1 
ATOM   2153  C  CD1 . TYR A 1 274 ? -8.040  24.908  99.605  1.00 12.70 ? 274 TYR A CD1 1 
ATOM   2154  C  CD2 . TYR A 1 274 ? -10.413 25.125  99.446  1.00 12.79 ? 274 TYR A CD2 1 
ATOM   2155  C  CE1 . TYR A 1 274 ? -8.161  23.521  99.538  1.00 12.71 ? 274 TYR A CE1 1 
ATOM   2156  C  CE2 . TYR A 1 274 ? -10.545 23.740  99.377  1.00 12.75 ? 274 TYR A CE2 1 
ATOM   2157  C  CZ  . TYR A 1 274 ? -9.420  22.947  99.424  1.00 12.73 ? 274 TYR A CZ  1 
ATOM   2158  O  OH  . TYR A 1 274 ? -9.560  21.584  99.355  1.00 12.76 ? 274 TYR A OH  1 
ATOM   2159  N  N   . PRO A 1 275 ? -6.887  29.916  100.402 1.00 12.75 ? 275 PRO A N   1 
ATOM   2160  C  CA  . PRO A 1 275 ? -6.808  31.379  100.475 1.00 13.05 ? 275 PRO A CA  1 
ATOM   2161  C  C   . PRO A 1 275 ? -7.720  32.018  99.441  1.00 13.39 ? 275 PRO A C   1 
ATOM   2162  O  O   . PRO A 1 275 ? -7.898  31.480  98.344  1.00 13.58 ? 275 PRO A O   1 
ATOM   2163  C  CB  . PRO A 1 275 ? -5.330  31.685  100.209 1.00 12.95 ? 275 PRO A CB  1 
ATOM   2164  C  CG  . PRO A 1 275 ? -4.617  30.369  100.293 1.00 12.79 ? 275 PRO A CG  1 
ATOM   2165  C  CD  . PRO A 1 275 ? -5.626  29.334  99.913  1.00 12.77 ? 275 PRO A CD  1 
ATOM   2166  N  N   . SER A 1 276 ? -8.286  33.168  99.792  1.00 13.48 ? 276 SER A N   1 
ATOM   2167  C  CA  . SER A 1 276 ? -9.201  33.870  98.907  1.00 13.51 ? 276 SER A CA  1 
ATOM   2168  C  C   . SER A 1 276 ? -8.868  35.348  98.764  1.00 13.32 ? 276 SER A C   1 
ATOM   2169  O  O   . SER A 1 276 ? -8.294  35.958  99.670  1.00 13.20 ? 276 SER A O   1 
ATOM   2170  C  CB  . SER A 1 276 ? -10.630 33.723  99.431  1.00 13.82 ? 276 SER A CB  1 
ATOM   2171  O  OG  . SER A 1 276 ? -11.566 33.786  98.372  1.00 14.56 ? 276 SER A OG  1 
ATOM   2172  N  N   . TRP A 1 277 ? -9.235  35.911  97.617  1.00 12.99 ? 277 TRP A N   1 
ATOM   2173  C  CA  . TRP A 1 277 ? -9.013  37.326  97.331  1.00 12.91 ? 277 TRP A CA  1 
ATOM   2174  C  C   . TRP A 1 277 ? -10.239 37.861  96.599  1.00 12.91 ? 277 TRP A C   1 
ATOM   2175  O  O   . TRP A 1 277 ? -10.829 37.159  95.777  1.00 12.84 ? 277 TRP A O   1 
ATOM   2176  C  CB  . TRP A 1 277 ? -7.783  37.518  96.437  1.00 12.82 ? 277 TRP A CB  1 
ATOM   2177  C  CG  . TRP A 1 277 ? -6.467  37.514  97.161  1.00 12.73 ? 277 TRP A CG  1 
ATOM   2178  C  CD1 . TRP A 1 277 ? -5.737  38.606  97.555  1.00 12.76 ? 277 TRP A CD1 1 
ATOM   2179  C  CD2 . TRP A 1 277 ? -5.710  36.364  97.553  1.00 12.58 ? 277 TRP A CD2 1 
ATOM   2180  N  NE1 . TRP A 1 277 ? -4.573  38.202  98.169  1.00 12.68 ? 277 TRP A NE1 1 
ATOM   2181  C  CE2 . TRP A 1 277 ? -4.532  36.832  98.180  1.00 12.57 ? 277 TRP A CE2 1 
ATOM   2182  C  CE3 . TRP A 1 277 ? -5.913  34.981  97.435  1.00 12.39 ? 277 TRP A CE3 1 
ATOM   2183  C  CZ2 . TRP A 1 277 ? -3.561  35.962  98.689  1.00 12.47 ? 277 TRP A CZ2 1 
ATOM   2184  C  CZ3 . TRP A 1 277 ? -4.947  34.118  97.940  1.00 12.23 ? 277 TRP A CZ3 1 
ATOM   2185  C  CH2 . TRP A 1 277 ? -3.787  34.612  98.558  1.00 12.33 ? 277 TRP A CH2 1 
ATOM   2186  N  N   . THR A 1 278 ? -10.632 39.094  96.891  1.00 12.57 ? 278 THR A N   1 
ATOM   2187  C  CA  . THR A 1 278 ? -11.785 39.663  96.209  1.00 12.57 ? 278 THR A CA  1 
ATOM   2188  C  C   . THR A 1 278 ? -11.305 40.596  95.097  1.00 12.50 ? 278 THR A C   1 
ATOM   2189  O  O   . THR A 1 278 ? -10.395 41.397  95.295  1.00 12.30 ? 278 THR A O   1 
ATOM   2190  C  CB  . THR A 1 278 ? -12.704 40.426  97.189  1.00 12.57 ? 278 THR A CB  1 
ATOM   2191  O  OG1 . THR A 1 278 ? -13.041 39.573  98.290  1.00 12.66 ? 278 THR A OG1 1 
ATOM   2192  C  CG2 . THR A 1 278 ? -13.990 40.848  96.494  1.00 12.32 ? 278 THR A CG2 1 
ATOM   2193  N  N   . PHE A 1 279 ? -11.924 40.477  93.927  1.00 12.61 ? 279 PHE A N   1 
ATOM   2194  C  CA  . PHE A 1 279 ? -11.561 41.279  92.762  1.00 12.79 ? 279 PHE A CA  1 
ATOM   2195  C  C   . PHE A 1 279 ? -12.379 42.554  92.603  1.00 12.85 ? 279 PHE A C   1 
ATOM   2196  O  O   . PHE A 1 279 ? -13.608 42.511  92.541  1.00 12.69 ? 279 PHE A O   1 
ATOM   2197  C  CB  . PHE A 1 279 ? -11.704 40.437  91.491  1.00 12.88 ? 279 PHE A CB  1 
ATOM   2198  C  CG  . PHE A 1 279 ? -10.680 40.745  90.441  1.00 12.98 ? 279 PHE A CG  1 
ATOM   2199  C  CD1 . PHE A 1 279 ? -11.005 41.549  89.350  1.00 13.09 ? 279 PHE A CD1 1 
ATOM   2200  C  CD2 . PHE A 1 279 ? -9.387  40.225  90.535  1.00 12.98 ? 279 PHE A CD2 1 
ATOM   2201  C  CE1 . PHE A 1 279 ? -10.059 41.831  88.365  1.00 12.97 ? 279 PHE A CE1 1 
ATOM   2202  C  CE2 . PHE A 1 279 ? -8.431  40.500  89.556  1.00 12.81 ? 279 PHE A CE2 1 
ATOM   2203  C  CZ  . PHE A 1 279 ? -8.766  41.303  88.469  1.00 12.96 ? 279 PHE A CZ  1 
ATOM   2204  N  N   . TYR A 1 280 ? -11.682 43.684  92.517  1.00 13.00 ? 280 TYR A N   1 
ATOM   2205  C  CA  . TYR A 1 280 ? -12.319 44.987  92.356  1.00 13.15 ? 280 TYR A CA  1 
ATOM   2206  C  C   . TYR A 1 280 ? -11.666 45.698  91.181  1.00 13.29 ? 280 TYR A C   1 
ATOM   2207  O  O   . TYR A 1 280 ? -10.631 45.252  90.679  1.00 13.52 ? 280 TYR A O   1 
ATOM   2208  C  CB  . TYR A 1 280 ? -12.127 45.842  93.614  1.00 13.45 ? 280 TYR A CB  1 
ATOM   2209  C  CG  . TYR A 1 280 ? -12.724 45.273  94.886  1.00 13.55 ? 280 TYR A CG  1 
ATOM   2210  C  CD1 . TYR A 1 280 ? -11.965 44.467  95.739  1.00 13.45 ? 280 TYR A CD1 1 
ATOM   2211  C  CD2 . TYR A 1 280 ? -14.036 45.568  95.255  1.00 13.76 ? 280 TYR A CD2 1 
ATOM   2212  C  CE1 . TYR A 1 280 ? -12.497 43.971  96.927  1.00 13.53 ? 280 TYR A CE1 1 
ATOM   2213  C  CE2 . TYR A 1 280 ? -14.580 45.075  96.446  1.00 13.88 ? 280 TYR A CE2 1 
ATOM   2214  C  CZ  . TYR A 1 280 ? -13.801 44.278  97.274  1.00 13.74 ? 280 TYR A CZ  1 
ATOM   2215  O  OH  . TYR A 1 280 ? -14.332 43.793  98.445  1.00 13.85 ? 280 TYR A OH  1 
ATOM   2216  N  N   . ILE A 1 281 ? -12.268 46.804  90.746  1.00 13.15 ? 281 ILE A N   1 
ATOM   2217  C  CA  . ILE A 1 281 ? -11.723 47.586  89.638  1.00 12.83 ? 281 ILE A CA  1 
ATOM   2218  C  C   . ILE A 1 281 ? -12.067 49.063  89.767  1.00 12.93 ? 281 ILE A C   1 
ATOM   2219  O  O   . ILE A 1 281 ? -13.207 49.432  90.051  1.00 13.08 ? 281 ILE A O   1 
ATOM   2220  C  CB  . ILE A 1 281 ? -12.253 47.111  88.267  1.00 12.45 ? 281 ILE A CB  1 
ATOM   2221  C  CG1 . ILE A 1 281 ? -13.773 46.942  88.322  1.00 12.01 ? 281 ILE A CG1 1 
ATOM   2222  C  CG2 . ILE A 1 281 ? -11.555 45.834  87.853  1.00 12.23 ? 281 ILE A CG2 1 
ATOM   2223  C  CD1 . ILE A 1 281 ? -14.518 47.799  87.316  1.00 11.47 ? 281 ILE A CD1 1 
ATOM   2224  N  N   . GLN A 1 282 ? -11.070 49.909  89.556  1.00 12.95 ? 282 GLN A N   1 
ATOM   2225  C  CA  . GLN A 1 282 ? -11.282 51.343  89.626  1.00 13.00 ? 282 GLN A CA  1 
ATOM   2226  C  C   . GLN A 1 282 ? -11.527 51.822  88.204  1.00 12.79 ? 282 GLN A C   1 
ATOM   2227  O  O   . GLN A 1 282 ? -10.704 51.587  87.318  1.00 12.59 ? 282 GLN A O   1 
ATOM   2228  C  CB  . GLN A 1 282 ? -10.045 52.032  90.198  1.00 12.99 ? 282 GLN A CB  1 
ATOM   2229  C  CG  . GLN A 1 282 ? -10.146 52.361  91.665  1.00 13.03 ? 282 GLN A CG  1 
ATOM   2230  C  CD  . GLN A 1 282 ? -9.001  53.227  92.134  1.00 13.06 ? 282 GLN A CD  1 
ATOM   2231  O  OE1 . GLN A 1 282 ? -7.966  53.317  91.469  1.00 13.04 ? 282 GLN A OE1 1 
ATOM   2232  N  NE2 . GLN A 1 282 ? -9.177  53.874  93.285  1.00 12.86 ? 282 GLN A NE2 1 
ATOM   2233  N  N   . VAL A 1 283 ? -12.656 52.485  87.984  1.00 12.85 ? 283 VAL A N   1 
ATOM   2234  C  CA  . VAL A 1 283 ? -12.982 52.980  86.657  1.00 13.02 ? 283 VAL A CA  1 
ATOM   2235  C  C   . VAL A 1 283 ? -12.781 54.484  86.507  1.00 13.29 ? 283 VAL A C   1 
ATOM   2236  O  O   . VAL A 1 283 ? -13.024 55.261  87.437  1.00 13.52 ? 283 VAL A O   1 
ATOM   2237  C  CB  . VAL A 1 283 ? -14.434 52.650  86.276  1.00 12.86 ? 283 VAL A CB  1 
ATOM   2238  C  CG1 . VAL A 1 283 ? -14.774 53.295  84.942  1.00 12.72 ? 283 VAL A CG1 1 
ATOM   2239  C  CG2 . VAL A 1 283 ? -14.626 51.140  86.208  1.00 12.61 ? 283 VAL A CG2 1 
ATOM   2240  N  N   . MET A 1 284 ? -12.322 54.875  85.322  1.00 13.47 ? 284 MET A N   1 
ATOM   2241  C  CA  . MET A 1 284 ? -12.088 56.269  84.985  1.00 13.39 ? 284 MET A CA  1 
ATOM   2242  C  C   . MET A 1 284 ? -12.387 56.460  83.504  1.00 13.34 ? 284 MET A C   1 
ATOM   2243  O  O   . MET A 1 284 ? -11.781 55.811  82.640  1.00 13.45 ? 284 MET A O   1 
ATOM   2244  C  CB  . MET A 1 284 ? -10.639 56.665  85.266  1.00 13.37 ? 284 MET A CB  1 
ATOM   2245  C  CG  . MET A 1 284 ? -10.354 58.139  85.014  1.00 13.19 ? 284 MET A CG  1 
ATOM   2246  S  SD  . MET A 1 284 ? -8.598  58.472  84.808  1.00 13.16 ? 284 MET A SD  1 
ATOM   2247  C  CE  . MET A 1 284 ? -8.157  59.045  86.467  1.00 13.02 ? 284 MET A CE  1 
ATOM   2248  N  N   . THR A 1 285 ? -13.334 57.348  83.221  1.00 13.19 ? 285 THR A N   1 
ATOM   2249  C  CA  . THR A 1 285 ? -13.727 57.649  81.853  1.00 12.74 ? 285 THR A CA  1 
ATOM   2250  C  C   . THR A 1 285 ? -12.666 58.525  81.195  1.00 12.65 ? 285 THR A C   1 
ATOM   2251  O  O   . THR A 1 285 ? -11.817 59.109  81.871  1.00 12.65 ? 285 THR A O   1 
ATOM   2252  C  CB  . THR A 1 285 ? -15.054 58.398  81.822  1.00 12.66 ? 285 THR A CB  1 
ATOM   2253  O  OG1 . THR A 1 285 ? -14.807 59.796  82.008  1.00 12.62 ? 285 THR A OG1 1 
ATOM   2254  C  CG2 . THR A 1 285 ? -15.974 57.894  82.925  1.00 12.28 ? 285 THR A CG2 1 
ATOM   2255  N  N   . PHE A 1 286 ? -12.718 58.618  79.872  1.00 12.86 ? 286 PHE A N   1 
ATOM   2256  C  CA  . PHE A 1 286 ? -11.753 59.422  79.138  1.00 12.79 ? 286 PHE A CA  1 
ATOM   2257  C  C   . PHE A 1 286 ? -11.810 60.882  79.590  1.00 12.76 ? 286 PHE A C   1 
ATOM   2258  O  O   . PHE A 1 286 ? -10.796 61.583  79.595  1.00 12.48 ? 286 PHE A O   1 
ATOM   2259  C  CB  . PHE A 1 286 ? -12.022 59.314  77.633  1.00 12.78 ? 286 PHE A CB  1 
ATOM   2260  C  CG  . PHE A 1 286 ? -11.549 58.017  77.019  1.00 13.11 ? 286 PHE A CG  1 
ATOM   2261  C  CD1 . PHE A 1 286 ? -11.157 56.946  77.819  1.00 13.31 ? 286 PHE A CD1 1 
ATOM   2262  C  CD2 . PHE A 1 286 ? -11.483 57.873  75.634  1.00 13.27 ? 286 PHE A CD2 1 
ATOM   2263  C  CE1 . PHE A 1 286 ? -10.701 55.752  77.248  1.00 13.45 ? 286 PHE A CE1 1 
ATOM   2264  C  CE2 . PHE A 1 286 ? -11.029 56.683  75.052  1.00 13.35 ? 286 PHE A CE2 1 
ATOM   2265  C  CZ  . PHE A 1 286 ? -10.638 55.623  75.861  1.00 13.47 ? 286 PHE A CZ  1 
ATOM   2266  N  N   . ASN A 1 287 ? -12.995 61.333  79.985  1.00 12.87 ? 287 ASN A N   1 
ATOM   2267  C  CA  . ASN A 1 287 ? -13.161 62.710  80.431  1.00 13.67 ? 287 ASN A CA  1 
ATOM   2268  C  C   . ASN A 1 287 ? -12.317 63.020  81.666  1.00 13.57 ? 287 ASN A C   1 
ATOM   2269  O  O   . ASN A 1 287 ? -11.434 63.885  81.624  1.00 13.34 ? 287 ASN A O   1 
ATOM   2270  C  CB  . ASN A 1 287 ? -14.633 62.986  80.732  1.00 14.57 ? 287 ASN A CB  1 
ATOM   2271  C  CG  . ASN A 1 287 ? -15.527 62.678  79.555  1.00 15.49 ? 287 ASN A CG  1 
ATOM   2272  O  OD1 . ASN A 1 287 ? -15.921 63.580  78.806  1.00 16.28 ? 287 ASN A OD1 1 
ATOM   2273  N  ND2 . ASN A 1 287 ? -15.851 61.397  79.375  1.00 16.11 ? 287 ASN A ND2 1 
ATOM   2274  N  N   . GLN A 1 288 ? -12.597 62.318  82.762  1.00 13.03 ? 288 GLN A N   1 
ATOM   2275  C  CA  . GLN A 1 288 ? -11.858 62.526  84.000  1.00 12.85 ? 288 GLN A CA  1 
ATOM   2276  C  C   . GLN A 1 288 ? -10.363 62.319  83.766  1.00 12.90 ? 288 GLN A C   1 
ATOM   2277  O  O   . GLN A 1 288 ? -9.527  62.956  84.407  1.00 12.67 ? 288 GLN A O   1 
ATOM   2278  C  CB  . GLN A 1 288 ? -12.352 61.566  85.084  1.00 12.76 ? 288 GLN A CB  1 
ATOM   2279  C  CG  . GLN A 1 288 ? -13.197 60.413  84.574  1.00 12.42 ? 288 GLN A CG  1 
ATOM   2280  C  CD  . GLN A 1 288 ? -14.134 59.883  85.638  1.00 12.24 ? 288 GLN A CD  1 
ATOM   2281  O  OE1 . GLN A 1 288 ? -14.129 58.693  85.956  1.00 12.01 ? 288 GLN A OE1 1 
ATOM   2282  N  NE2 . GLN A 1 288 ? -14.943 60.771  86.202  1.00 12.04 ? 288 GLN A NE2 1 
ATOM   2283  N  N   . ALA A 1 289 ? -10.034 61.426  82.841  1.00 13.27 ? 289 ALA A N   1 
ATOM   2284  C  CA  . ALA A 1 289 ? -8.644  61.148  82.513  1.00 13.52 ? 289 ALA A CA  1 
ATOM   2285  C  C   . ALA A 1 289 ? -7.878  62.453  82.275  1.00 13.72 ? 289 ALA A C   1 
ATOM   2286  O  O   . ALA A 1 289 ? -6.679  62.539  82.560  1.00 14.03 ? 289 ALA A O   1 
ATOM   2287  C  CB  . ALA A 1 289 ? -8.570  60.255  81.269  1.00 13.61 ? 289 ALA A CB  1 
ATOM   2288  N  N   . GLU A 1 290 ? -8.574  63.465  81.758  1.00 13.59 ? 290 GLU A N   1 
ATOM   2289  C  CA  . GLU A 1 290 ? -7.952  64.756  81.482  1.00 13.65 ? 290 GLU A CA  1 
ATOM   2290  C  C   . GLU A 1 290 ? -7.946  65.624  82.720  1.00 13.35 ? 290 GLU A C   1 
ATOM   2291  O  O   . GLU A 1 290 ? -6.901  66.109  83.151  1.00 13.11 ? 290 GLU A O   1 
ATOM   2292  C  CB  . GLU A 1 290 ? -8.699  65.489  80.370  1.00 13.71 ? 290 GLU A CB  1 
ATOM   2293  C  CG  . GLU A 1 290 ? -8.253  65.113  78.980  1.00 14.13 ? 290 GLU A CG  1 
ATOM   2294  C  CD  . GLU A 1 290 ? -9.344  64.395  78.227  1.00 14.49 ? 290 GLU A CD  1 
ATOM   2295  O  OE1 . GLU A 1 290 ? -9.114  63.238  77.800  1.00 14.76 ? 290 GLU A OE1 1 
ATOM   2296  O  OE2 . GLU A 1 290 ? -10.437 64.991  78.072  1.00 14.58 ? 290 GLU A OE2 1 
ATOM   2297  N  N   . THR A 1 291 ? -9.129  65.828  83.280  1.00 13.17 ? 291 THR A N   1 
ATOM   2298  C  CA  . THR A 1 291 ? -9.279  66.635  84.478  1.00 13.31 ? 291 THR A CA  1 
ATOM   2299  C  C   . THR A 1 291 ? -8.284  66.213  85.566  1.00 13.51 ? 291 THR A C   1 
ATOM   2300  O  O   . THR A 1 291 ? -7.832  67.042  86.357  1.00 13.62 ? 291 THR A O   1 
ATOM   2301  C  CB  . THR A 1 291 ? -10.718 66.519  85.035  1.00 13.27 ? 291 THR A CB  1 
ATOM   2302  O  OG1 . THR A 1 291 ? -10.961 65.171  85.462  1.00 13.15 ? 291 THR A OG1 1 
ATOM   2303  C  CG2 . THR A 1 291 ? -11.735 66.891  83.961  1.00 13.06 ? 291 THR A CG2 1 
ATOM   2304  N  N   . PHE A 1 292 ? -7.938  64.927  85.592  1.00 13.86 ? 292 PHE A N   1 
ATOM   2305  C  CA  . PHE A 1 292 ? -7.005  64.388  86.582  1.00 13.74 ? 292 PHE A CA  1 
ATOM   2306  C  C   . PHE A 1 292 ? -5.766  65.258  86.787  1.00 13.65 ? 292 PHE A C   1 
ATOM   2307  O  O   . PHE A 1 292 ? -4.985  65.477  85.859  1.00 13.73 ? 292 PHE A O   1 
ATOM   2308  C  CB  . PHE A 1 292 ? -6.560  62.982  86.184  1.00 14.13 ? 292 PHE A CB  1 
ATOM   2309  C  CG  . PHE A 1 292 ? -5.940  62.207  87.312  1.00 14.48 ? 292 PHE A CG  1 
ATOM   2310  C  CD1 . PHE A 1 292 ? -6.675  61.924  88.464  1.00 14.46 ? 292 PHE A CD1 1 
ATOM   2311  C  CD2 . PHE A 1 292 ? -4.627  61.752  87.223  1.00 14.70 ? 292 PHE A CD2 1 
ATOM   2312  C  CE1 . PHE A 1 292 ? -6.116  61.197  89.515  1.00 14.52 ? 292 PHE A CE1 1 
ATOM   2313  C  CE2 . PHE A 1 292 ? -4.054  61.023  88.267  1.00 14.88 ? 292 PHE A CE2 1 
ATOM   2314  C  CZ  . PHE A 1 292 ? -4.803  60.744  89.418  1.00 14.77 ? 292 PHE A CZ  1 
ATOM   2315  N  N   . PRO A 1 293 ? -5.570  65.757  88.018  1.00 13.43 ? 293 PRO A N   1 
ATOM   2316  C  CA  . PRO A 1 293 ? -4.431  66.611  88.384  1.00 13.30 ? 293 PRO A CA  1 
ATOM   2317  C  C   . PRO A 1 293 ? -3.045  66.019  88.110  1.00 13.21 ? 293 PRO A C   1 
ATOM   2318  O  O   . PRO A 1 293 ? -2.032  66.708  88.230  1.00 13.08 ? 293 PRO A O   1 
ATOM   2319  C  CB  . PRO A 1 293 ? -4.651  66.895  89.874  1.00 13.19 ? 293 PRO A CB  1 
ATOM   2320  C  CG  . PRO A 1 293 ? -5.621  65.865  90.338  1.00 13.19 ? 293 PRO A CG  1 
ATOM   2321  C  CD  . PRO A 1 293 ? -6.479  65.540  89.155  1.00 13.31 ? 293 PRO A CD  1 
ATOM   2322  N  N   . PHE A 1 294 ? -2.999  64.746  87.745  1.00 13.21 ? 294 PHE A N   1 
ATOM   2323  C  CA  . PHE A 1 294 ? -1.727  64.094  87.460  1.00 13.32 ? 294 PHE A CA  1 
ATOM   2324  C  C   . PHE A 1 294 ? -1.807  63.360  86.134  1.00 13.43 ? 294 PHE A C   1 
ATOM   2325  O  O   . PHE A 1 294 ? -2.787  63.488  85.394  1.00 13.61 ? 294 PHE A O   1 
ATOM   2326  C  CB  . PHE A 1 294 ? -1.390  63.084  88.557  1.00 13.32 ? 294 PHE A CB  1 
ATOM   2327  C  CG  . PHE A 1 294 ? -1.143  63.703  89.895  1.00 13.44 ? 294 PHE A CG  1 
ATOM   2328  C  CD1 . PHE A 1 294 ? -0.134  64.650  90.065  1.00 13.42 ? 294 PHE A CD1 1 
ATOM   2329  C  CD2 . PHE A 1 294 ? -1.910  63.334  90.993  1.00 13.48 ? 294 PHE A CD2 1 
ATOM   2330  C  CE1 . PHE A 1 294 ? 0.108   65.218  91.314  1.00 13.47 ? 294 PHE A CE1 1 
ATOM   2331  C  CE2 . PHE A 1 294 ? -1.678  63.895  92.246  1.00 13.57 ? 294 PHE A CE2 1 
ATOM   2332  C  CZ  . PHE A 1 294 ? -0.666  64.839  92.408  1.00 13.55 ? 294 PHE A CZ  1 
ATOM   2333  N  N   . ASN A 1 295 ? -0.762  62.600  85.827  1.00 13.13 ? 295 ASN A N   1 
ATOM   2334  C  CA  . ASN A 1 295 ? -0.757  61.813  84.609  1.00 12.84 ? 295 ASN A CA  1 
ATOM   2335  C  C   . ASN A 1 295 ? -1.371  60.472  84.994  1.00 12.75 ? 295 ASN A C   1 
ATOM   2336  O  O   . ASN A 1 295 ? -0.748  59.659  85.683  1.00 12.57 ? 295 ASN A O   1 
ATOM   2337  C  CB  . ASN A 1 295 ? 0.664   61.608  84.080  1.00 12.50 ? 295 ASN A CB  1 
ATOM   2338  C  CG  . ASN A 1 295 ? 0.702   60.679  82.884  1.00 12.30 ? 295 ASN A CG  1 
ATOM   2339  O  OD1 . ASN A 1 295 ? -0.271  60.577  82.134  1.00 12.15 ? 295 ASN A OD1 1 
ATOM   2340  N  ND2 . ASN A 1 295 ? 1.821   59.990  82.701  1.00 12.27 ? 295 ASN A ND2 1 
ATOM   2341  N  N   . PRO A 1 296 ? -2.616  60.237  84.567  1.00 12.78 ? 296 PRO A N   1 
ATOM   2342  C  CA  . PRO A 1 296 ? -3.358  59.004  84.847  1.00 12.65 ? 296 PRO A CA  1 
ATOM   2343  C  C   . PRO A 1 296 ? -2.582  57.728  84.528  1.00 12.61 ? 296 PRO A C   1 
ATOM   2344  O  O   . PRO A 1 296 ? -2.943  56.640  84.977  1.00 12.32 ? 296 PRO A O   1 
ATOM   2345  C  CB  . PRO A 1 296 ? -4.619  59.137  83.992  1.00 12.87 ? 296 PRO A CB  1 
ATOM   2346  C  CG  . PRO A 1 296 ? -4.332  60.267  83.026  1.00 13.01 ? 296 PRO A CG  1 
ATOM   2347  C  CD  . PRO A 1 296 ? -3.403  61.175  83.751  1.00 12.88 ? 296 PRO A CD  1 
ATOM   2348  N  N   . PHE A 1 297 ? -1.510  57.866  83.760  1.00 12.84 ? 297 PHE A N   1 
ATOM   2349  C  CA  . PHE A 1 297 ? -0.701  56.717  83.386  1.00 13.21 ? 297 PHE A CA  1 
ATOM   2350  C  C   . PHE A 1 297 ? 0.660   56.732  84.074  1.00 13.37 ? 297 PHE A C   1 
ATOM   2351  O  O   . PHE A 1 297 ? 1.596   56.062  83.643  1.00 13.71 ? 297 PHE A O   1 
ATOM   2352  C  CB  . PHE A 1 297 ? -0.544  56.682  81.864  1.00 13.10 ? 297 PHE A CB  1 
ATOM   2353  C  CG  . PHE A 1 297 ? -1.801  57.054  81.126  1.00 13.01 ? 297 PHE A CG  1 
ATOM   2354  C  CD1 . PHE A 1 297 ? -2.909  56.216  81.150  1.00 12.88 ? 297 PHE A CD1 1 
ATOM   2355  C  CD2 . PHE A 1 297 ? -1.891  58.258  80.439  1.00 13.05 ? 297 PHE A CD2 1 
ATOM   2356  C  CE1 . PHE A 1 297 ? -4.086  56.573  80.505  1.00 12.78 ? 297 PHE A CE1 1 
ATOM   2357  C  CE2 . PHE A 1 297 ? -3.067  58.621  79.791  1.00 13.00 ? 297 PHE A CE2 1 
ATOM   2358  C  CZ  . PHE A 1 297 ? -4.166  57.775  79.826  1.00 12.85 ? 297 PHE A CZ  1 
ATOM   2359  N  N   . ASP A 1 298 ? 0.761   57.499  85.152  1.00 13.33 ? 298 ASP A N   1 
ATOM   2360  C  CA  . ASP A 1 298 ? 1.998   57.586  85.912  1.00 13.05 ? 298 ASP A CA  1 
ATOM   2361  C  C   . ASP A 1 298 ? 1.998   56.467  86.953  1.00 13.15 ? 298 ASP A C   1 
ATOM   2362  O  O   . ASP A 1 298 ? 1.231   56.503  87.922  1.00 13.19 ? 298 ASP A O   1 
ATOM   2363  C  CB  . ASP A 1 298 ? 2.093   58.951  86.595  1.00 12.82 ? 298 ASP A CB  1 
ATOM   2364  C  CG  . ASP A 1 298 ? 3.405   59.149  87.319  1.00 12.52 ? 298 ASP A CG  1 
ATOM   2365  O  OD1 . ASP A 1 298 ? 3.934   58.167  87.872  1.00 12.35 ? 298 ASP A OD1 1 
ATOM   2366  O  OD2 . ASP A 1 298 ? 3.909   60.289  87.336  1.00 12.32 ? 298 ASP A OD2 1 
ATOM   2367  N  N   . LEU A 1 299 ? 2.862   55.475  86.745  1.00 12.95 ? 299 LEU A N   1 
ATOM   2368  C  CA  . LEU A 1 299 ? 2.963   54.329  87.647  1.00 12.58 ? 299 LEU A CA  1 
ATOM   2369  C  C   . LEU A 1 299 ? 3.344   54.736  89.057  1.00 12.48 ? 299 LEU A C   1 
ATOM   2370  O  O   . LEU A 1 299 ? 3.193   53.954  89.995  1.00 12.33 ? 299 LEU A O   1 
ATOM   2371  C  CB  . LEU A 1 299 ? 3.986   53.316  87.115  1.00 12.38 ? 299 LEU A CB  1 
ATOM   2372  C  CG  . LEU A 1 299 ? 3.959   51.914  87.738  1.00 12.20 ? 299 LEU A CG  1 
ATOM   2373  C  CD1 . LEU A 1 299 ? 2.571   51.313  87.627  1.00 12.21 ? 299 LEU A CD1 1 
ATOM   2374  C  CD2 . LEU A 1 299 ? 4.965   51.028  87.044  1.00 11.86 ? 299 LEU A CD2 1 
ATOM   2375  N  N   . THR A 1 300 ? 3.840   55.958  89.207  1.00 12.80 ? 300 THR A N   1 
ATOM   2376  C  CA  . THR A 1 300 ? 4.234   56.449  90.522  1.00 13.20 ? 300 THR A CA  1 
ATOM   2377  C  C   . THR A 1 300 ? 3.095   57.224  91.175  1.00 13.09 ? 300 THR A C   1 
ATOM   2378  O  O   . THR A 1 300 ? 3.304   57.953  92.141  1.00 13.30 ? 300 THR A O   1 
ATOM   2379  C  CB  . THR A 1 300 ? 5.492   57.347  90.433  1.00 13.44 ? 300 THR A CB  1 
ATOM   2380  O  OG1 . THR A 1 300 ? 5.132   58.648  89.951  1.00 13.90 ? 300 THR A OG1 1 
ATOM   2381  C  CG2 . THR A 1 300 ? 6.517   56.725  89.489  1.00 13.62 ? 300 THR A CG2 1 
ATOM   2382  N  N   . LYS A 1 301 ? 1.887   57.052  90.644  1.00 12.91 ? 301 LYS A N   1 
ATOM   2383  C  CA  . LYS A 1 301 ? 0.704   57.727  91.170  1.00 12.50 ? 301 LYS A CA  1 
ATOM   2384  C  C   . LYS A 1 301 ? -0.392  56.719  91.504  1.00 12.59 ? 301 LYS A C   1 
ATOM   2385  O  O   . LYS A 1 301 ? -0.339  55.560  91.081  1.00 12.46 ? 301 LYS A O   1 
ATOM   2386  C  CB  . LYS A 1 301 ? 0.178   58.744  90.154  1.00 12.19 ? 301 LYS A CB  1 
ATOM   2387  C  CG  . LYS A 1 301 ? 1.207   59.768  89.727  1.00 11.85 ? 301 LYS A CG  1 
ATOM   2388  C  CD  . LYS A 1 301 ? 1.435   60.812  90.799  1.00 11.50 ? 301 LYS A CD  1 
ATOM   2389  C  CE  . LYS A 1 301 ? 2.632   61.681  90.468  1.00 11.43 ? 301 LYS A CE  1 
ATOM   2390  N  NZ  . LYS A 1 301 ? 3.898   60.909  90.491  1.00 11.18 ? 301 LYS A NZ  1 
ATOM   2391  N  N   . VAL A 1 302 ? -1.386  57.165  92.262  1.00 12.67 ? 302 VAL A N   1 
ATOM   2392  C  CA  . VAL A 1 302 ? -2.482  56.296  92.659  1.00 12.95 ? 302 VAL A CA  1 
ATOM   2393  C  C   . VAL A 1 302 ? -3.824  56.985  92.498  1.00 13.16 ? 302 VAL A C   1 
ATOM   2394  O  O   . VAL A 1 302 ? -3.933  58.203  92.657  1.00 13.32 ? 302 VAL A O   1 
ATOM   2395  C  CB  . VAL A 1 302 ? -2.340  55.859  94.138  1.00 13.05 ? 302 VAL A CB  1 
ATOM   2396  C  CG1 . VAL A 1 302 ? -0.875  55.580  94.468  1.00 13.11 ? 302 VAL A CG1 1 
ATOM   2397  C  CG2 . VAL A 1 302 ? -2.886  56.938  95.059  1.00 12.92 ? 302 VAL A CG2 1 
ATOM   2398  N  N   . TRP A 1 303 ? -4.850  56.201  92.189  1.00 13.29 ? 303 TRP A N   1 
ATOM   2399  C  CA  . TRP A 1 303 ? -6.188  56.746  92.024  1.00 13.34 ? 303 TRP A CA  1 
ATOM   2400  C  C   . TRP A 1 303 ? -6.938  56.711  93.355  1.00 13.36 ? 303 TRP A C   1 
ATOM   2401  O  O   . TRP A 1 303 ? -7.296  55.641  93.851  1.00 13.32 ? 303 TRP A O   1 
ATOM   2402  C  CB  . TRP A 1 303 ? -6.965  55.943  90.980  1.00 13.28 ? 303 TRP A CB  1 
ATOM   2403  C  CG  . TRP A 1 303 ? -6.492  56.141  89.575  1.00 13.29 ? 303 TRP A CG  1 
ATOM   2404  C  CD1 . TRP A 1 303 ? -5.386  56.824  89.170  1.00 13.32 ? 303 TRP A CD1 1 
ATOM   2405  C  CD2 . TRP A 1 303 ? -7.110  55.631  88.387  1.00 13.42 ? 303 TRP A CD2 1 
ATOM   2406  N  NE1 . TRP A 1 303 ? -5.271  56.774  87.799  1.00 13.35 ? 303 TRP A NE1 1 
ATOM   2407  C  CE2 . TRP A 1 303 ? -6.316  56.048  87.292  1.00 13.38 ? 303 TRP A CE2 1 
ATOM   2408  C  CE3 . TRP A 1 303 ? -8.257  54.863  88.138  1.00 13.41 ? 303 TRP A CE3 1 
ATOM   2409  C  CZ2 . TRP A 1 303 ? -6.630  55.723  85.967  1.00 13.52 ? 303 TRP A CZ2 1 
ATOM   2410  C  CZ3 . TRP A 1 303 ? -8.572  54.537  86.819  1.00 13.61 ? 303 TRP A CZ3 1 
ATOM   2411  C  CH2 . TRP A 1 303 ? -7.758  54.969  85.749  1.00 13.66 ? 303 TRP A CH2 1 
ATOM   2412  N  N   . PRO A 1 304 ? -7.166  57.887  93.960  1.00 13.40 ? 304 PRO A N   1 
ATOM   2413  C  CA  . PRO A 1 304 ? -7.880  57.987  95.239  1.00 13.29 ? 304 PRO A CA  1 
ATOM   2414  C  C   . PRO A 1 304 ? -9.207  57.221  95.215  1.00 13.33 ? 304 PRO A C   1 
ATOM   2415  O  O   . PRO A 1 304 ? -9.967  57.296  94.246  1.00 13.05 ? 304 PRO A O   1 
ATOM   2416  C  CB  . PRO A 1 304 ? -8.101  59.488  95.413  1.00 13.48 ? 304 PRO A CB  1 
ATOM   2417  C  CG  . PRO A 1 304 ? -7.042  60.128  94.601  1.00 13.59 ? 304 PRO A CG  1 
ATOM   2418  C  CD  . PRO A 1 304 ? -6.750  59.206  93.453  1.00 13.51 ? 304 PRO A CD  1 
ATOM   2419  N  N   . HIS A 1 305 ? -9.482  56.488  96.284  1.00 13.48 ? 305 HIS A N   1 
ATOM   2420  C  CA  . HIS A 1 305 ? -10.718 55.720  96.368  1.00 13.79 ? 305 HIS A CA  1 
ATOM   2421  C  C   . HIS A 1 305 ? -11.950 56.620  96.480  1.00 13.68 ? 305 HIS A C   1 
ATOM   2422  O  O   . HIS A 1 305 ? -13.049 56.225  96.089  1.00 13.56 ? 305 HIS A O   1 
ATOM   2423  C  CB  . HIS A 1 305 ? -10.666 54.769  97.565  1.00 14.22 ? 305 HIS A CB  1 
ATOM   2424  C  CG  . HIS A 1 305 ? -9.607  53.717  97.453  1.00 14.78 ? 305 HIS A CG  1 
ATOM   2425  N  ND1 . HIS A 1 305 ? -8.270  53.985  97.650  1.00 15.10 ? 305 HIS A ND1 1 
ATOM   2426  C  CD2 . HIS A 1 305 ? -9.689  52.398  97.159  1.00 14.94 ? 305 HIS A CD2 1 
ATOM   2427  C  CE1 . HIS A 1 305 ? -7.572  52.874  97.481  1.00 15.29 ? 305 HIS A CE1 1 
ATOM   2428  N  NE2 . HIS A 1 305 ? -8.410  51.896  97.182  1.00 15.08 ? 305 HIS A NE2 1 
ATOM   2429  N  N   . LYS A 1 306 ? -11.764 57.828  97.011  1.00 13.95 ? 306 LYS A N   1 
ATOM   2430  C  CA  . LYS A 1 306 ? -12.870 58.775  97.172  1.00 14.07 ? 306 LYS A CA  1 
ATOM   2431  C  C   . LYS A 1 306 ? -13.429 59.246  95.832  1.00 14.11 ? 306 LYS A C   1 
ATOM   2432  O  O   . LYS A 1 306 ? -14.647 59.341  95.655  1.00 14.13 ? 306 LYS A O   1 
ATOM   2433  C  CB  . LYS A 1 306 ? -12.418 59.992  97.979  1.00 14.26 ? 306 LYS A CB  1 
ATOM   2434  C  CG  . LYS A 1 306 ? -10.912 60.157  98.051  1.00 14.64 ? 306 LYS A CG  1 
ATOM   2435  C  CD  . LYS A 1 306 ? -10.343 59.476  99.285  1.00 14.75 ? 306 LYS A CD  1 
ATOM   2436  C  CE  . LYS A 1 306 ? -9.260  58.478  98.900  1.00 14.88 ? 306 LYS A CE  1 
ATOM   2437  N  NZ  . LYS A 1 306 ? -9.663  57.074  99.198  1.00 14.73 ? 306 LYS A NZ  1 
ATOM   2438  N  N   . ASP A 1 307 ? -12.539 59.547  94.894  1.00 13.94 ? 307 ASP A N   1 
ATOM   2439  C  CA  . ASP A 1 307 ? -12.958 60.001  93.574  1.00 14.11 ? 307 ASP A CA  1 
ATOM   2440  C  C   . ASP A 1 307 ? -13.268 58.817  92.660  1.00 13.99 ? 307 ASP A C   1 
ATOM   2441  O  O   . ASP A 1 307 ? -14.155 58.897  91.809  1.00 13.84 ? 307 ASP A O   1 
ATOM   2442  C  CB  . ASP A 1 307 ? -11.862 60.860  92.940  1.00 14.31 ? 307 ASP A CB  1 
ATOM   2443  C  CG  . ASP A 1 307 ? -11.502 62.059  93.786  1.00 14.47 ? 307 ASP A CG  1 
ATOM   2444  O  OD1 . ASP A 1 307 ? -12.357 62.961  93.927  1.00 14.24 ? 307 ASP A OD1 1 
ATOM   2445  O  OD2 . ASP A 1 307 ? -10.367 62.095  94.308  1.00 14.94 ? 307 ASP A OD2 1 
ATOM   2446  N  N   . TYR A 1 308 ? -12.537 57.720  92.845  1.00 13.58 ? 308 TYR A N   1 
ATOM   2447  C  CA  . TYR A 1 308 ? -12.729 56.526  92.028  1.00 13.39 ? 308 TYR A CA  1 
ATOM   2448  C  C   . TYR A 1 308 ? -12.835 55.275  92.897  1.00 13.39 ? 308 TYR A C   1 
ATOM   2449  O  O   . TYR A 1 308 ? -11.851 54.566  93.117  1.00 13.49 ? 308 TYR A O   1 
ATOM   2450  C  CB  . TYR A 1 308 ? -11.570 56.389  91.036  1.00 13.20 ? 308 TYR A CB  1 
ATOM   2451  C  CG  . TYR A 1 308 ? -11.240 57.688  90.337  1.00 12.96 ? 308 TYR A CG  1 
ATOM   2452  C  CD1 . TYR A 1 308 ? -11.790 57.991  89.091  1.00 12.81 ? 308 TYR A CD1 1 
ATOM   2453  C  CD2 . TYR A 1 308 ? -10.407 58.630  90.936  1.00 12.96 ? 308 TYR A CD2 1 
ATOM   2454  C  CE1 . TYR A 1 308 ? -11.521 59.200  88.463  1.00 13.00 ? 308 TYR A CE1 1 
ATOM   2455  C  CE2 . TYR A 1 308 ? -10.131 59.843  90.316  1.00 13.15 ? 308 TYR A CE2 1 
ATOM   2456  C  CZ  . TYR A 1 308 ? -10.691 60.121  89.081  1.00 13.21 ? 308 TYR A CZ  1 
ATOM   2457  O  OH  . TYR A 1 308 ? -10.414 61.321  88.457  1.00 13.77 ? 308 TYR A OH  1 
ATOM   2458  N  N   . PRO A 1 309 ? -14.044 54.987  93.401  1.00 13.52 ? 309 PRO A N   1 
ATOM   2459  C  CA  . PRO A 1 309 ? -14.286 53.819  94.255  1.00 13.63 ? 309 PRO A CA  1 
ATOM   2460  C  C   . PRO A 1 309 ? -14.099 52.468  93.574  1.00 13.93 ? 309 PRO A C   1 
ATOM   2461  O  O   . PRO A 1 309 ? -14.240 52.336  92.360  1.00 14.16 ? 309 PRO A O   1 
ATOM   2462  C  CB  . PRO A 1 309 ? -15.721 54.016  94.744  1.00 13.41 ? 309 PRO A CB  1 
ATOM   2463  C  CG  . PRO A 1 309 ? -16.357 54.872  93.715  1.00 13.21 ? 309 PRO A CG  1 
ATOM   2464  C  CD  . PRO A 1 309 ? -15.271 55.774  93.188  1.00 13.33 ? 309 PRO A CD  1 
ATOM   2465  N  N   . LEU A 1 310 ? -13.772 51.462  94.376  1.00 14.07 ? 310 LEU A N   1 
ATOM   2466  C  CA  . LEU A 1 310 ? -13.577 50.118  93.865  1.00 13.87 ? 310 LEU A CA  1 
ATOM   2467  C  C   . LEU A 1 310 ? -14.931 49.503  93.560  1.00 13.95 ? 310 LEU A C   1 
ATOM   2468  O  O   . LEU A 1 310 ? -15.910 49.763  94.259  1.00 14.32 ? 310 LEU A O   1 
ATOM   2469  C  CB  . LEU A 1 310 ? -12.855 49.261  94.899  1.00 13.78 ? 310 LEU A CB  1 
ATOM   2470  C  CG  . LEU A 1 310 ? -11.655 49.924  95.567  1.00 13.51 ? 310 LEU A CG  1 
ATOM   2471  C  CD1 . LEU A 1 310 ? -11.463 49.355  96.963  1.00 13.70 ? 310 LEU A CD1 1 
ATOM   2472  C  CD2 . LEU A 1 310 ? -10.420 49.694  94.714  1.00 13.21 ? 310 LEU A CD2 1 
ATOM   2473  N  N   . ILE A 1 311 ? -14.980 48.689  92.513  1.00 13.62 ? 311 ILE A N   1 
ATOM   2474  C  CA  . ILE A 1 311 ? -16.211 48.020  92.120  1.00 12.96 ? 311 ILE A CA  1 
ATOM   2475  C  C   . ILE A 1 311 ? -15.998 46.506  92.138  1.00 13.18 ? 311 ILE A C   1 
ATOM   2476  O  O   . ILE A 1 311 ? -15.118 45.977  91.449  1.00 13.30 ? 311 ILE A O   1 
ATOM   2477  C  CB  . ILE A 1 311 ? -16.644 48.439  90.703  1.00 12.41 ? 311 ILE A CB  1 
ATOM   2478  C  CG1 . ILE A 1 311 ? -16.768 49.955  90.626  1.00 11.81 ? 311 ILE A CG1 1 
ATOM   2479  C  CG2 . ILE A 1 311 ? -17.963 47.782  90.350  1.00 11.77 ? 311 ILE A CG2 1 
ATOM   2480  C  CD1 . ILE A 1 311 ? -16.404 50.511  89.279  1.00 11.74 ? 311 ILE A CD1 1 
ATOM   2481  N  N   . PRO A 1 312 ? -16.795 45.784  92.936  1.00 13.26 ? 312 PRO A N   1 
ATOM   2482  C  CA  . PRO A 1 312 ? -16.645 44.327  92.998  1.00 13.21 ? 312 PRO A CA  1 
ATOM   2483  C  C   . PRO A 1 312 ? -16.915 43.645  91.655  1.00 13.22 ? 312 PRO A C   1 
ATOM   2484  O  O   . PRO A 1 312 ? -17.897 43.948  90.975  1.00 13.24 ? 312 PRO A O   1 
ATOM   2485  C  CB  . PRO A 1 312 ? -17.654 43.904  94.068  1.00 13.37 ? 312 PRO A CB  1 
ATOM   2486  C  CG  . PRO A 1 312 ? -18.649 45.018  94.110  1.00 13.42 ? 312 PRO A CG  1 
ATOM   2487  C  CD  . PRO A 1 312 ? -17.868 46.265  93.822  1.00 13.39 ? 312 PRO A CD  1 
ATOM   2488  N  N   . VAL A 1 313 ? -16.040 42.717  91.284  1.00 13.02 ? 313 VAL A N   1 
ATOM   2489  C  CA  . VAL A 1 313 ? -16.182 41.985  90.032  1.00 12.70 ? 313 VAL A CA  1 
ATOM   2490  C  C   . VAL A 1 313 ? -16.326 40.485  90.291  1.00 12.70 ? 313 VAL A C   1 
ATOM   2491  O  O   . VAL A 1 313 ? -17.223 39.833  89.762  1.00 12.82 ? 313 VAL A O   1 
ATOM   2492  C  CB  . VAL A 1 313 ? -14.963 42.222  89.122  1.00 12.55 ? 313 VAL A CB  1 
ATOM   2493  C  CG1 . VAL A 1 313 ? -15.129 41.463  87.810  1.00 12.23 ? 313 VAL A CG1 1 
ATOM   2494  C  CG2 . VAL A 1 313 ? -14.797 43.709  88.865  1.00 12.23 ? 313 VAL A CG2 1 
ATOM   2495  N  N   . GLY A 1 314 ? -15.440 39.941  91.116  1.00 12.82 ? 314 GLY A N   1 
ATOM   2496  C  CA  . GLY A 1 314 ? -15.502 38.524  91.414  1.00 12.69 ? 314 GLY A CA  1 
ATOM   2497  C  C   . GLY A 1 314 ? -14.610 38.072  92.560  1.00 12.71 ? 314 GLY A C   1 
ATOM   2498  O  O   . GLY A 1 314 ? -14.187 38.879  93.394  1.00 12.54 ? 314 GLY A O   1 
ATOM   2499  N  N   . LYS A 1 315 ? -14.323 36.770  92.585  1.00 12.55 ? 315 LYS A N   1 
ATOM   2500  C  CA  . LYS A 1 315 ? -13.499 36.175  93.627  1.00 12.53 ? 315 LYS A CA  1 
ATOM   2501  C  C   . LYS A 1 315 ? -12.324 35.356  93.100  1.00 12.45 ? 315 LYS A C   1 
ATOM   2502  O  O   . LYS A 1 315 ? -12.388 34.753  92.023  1.00 12.24 ? 315 LYS A O   1 
ATOM   2503  C  CB  . LYS A 1 315 ? -14.361 35.292  94.531  1.00 12.75 ? 315 LYS A CB  1 
ATOM   2504  C  CG  . LYS A 1 315 ? -13.853 35.196  95.960  1.00 13.06 ? 315 LYS A CG  1 
ATOM   2505  C  CD  . LYS A 1 315 ? -14.083 36.498  96.714  1.00 13.07 ? 315 LYS A CD  1 
ATOM   2506  C  CE  . LYS A 1 315 ? -14.917 36.259  97.963  1.00 13.06 ? 315 LYS A CE  1 
ATOM   2507  N  NZ  . LYS A 1 315 ? -15.723 37.455  98.327  1.00 12.67 ? 315 LYS A NZ  1 
ATOM   2508  N  N   . LEU A 1 316 ? -11.256 35.335  93.888  1.00 12.30 ? 316 LEU A N   1 
ATOM   2509  C  CA  . LEU A 1 316 ? -10.044 34.610  93.548  1.00 12.52 ? 316 LEU A CA  1 
ATOM   2510  C  C   . LEU A 1 316 ? -9.827  33.519  94.581  1.00 12.56 ? 316 LEU A C   1 
ATOM   2511  O  O   . LEU A 1 316 ? -9.643  33.810  95.763  1.00 12.59 ? 316 LEU A O   1 
ATOM   2512  C  CB  . LEU A 1 316 ? -8.853  35.568  93.554  1.00 12.50 ? 316 LEU A CB  1 
ATOM   2513  C  CG  . LEU A 1 316 ? -7.999  35.648  92.288  1.00 12.47 ? 316 LEU A CG  1 
ATOM   2514  C  CD1 . LEU A 1 316 ? -8.873  35.956  91.080  1.00 12.54 ? 316 LEU A CD1 1 
ATOM   2515  C  CD2 . LEU A 1 316 ? -6.944  36.714  92.477  1.00 12.30 ? 316 LEU A CD2 1 
ATOM   2516  N  N   . VAL A 1 317 ? -9.839  32.266  94.136  1.00 12.70 ? 317 VAL A N   1 
ATOM   2517  C  CA  . VAL A 1 317 ? -9.664  31.138  95.040  1.00 12.79 ? 317 VAL A CA  1 
ATOM   2518  C  C   . VAL A 1 317 ? -8.537  30.208  94.637  1.00 12.96 ? 317 VAL A C   1 
ATOM   2519  O  O   . VAL A 1 317 ? -8.447  29.790  93.484  1.00 13.05 ? 317 VAL A O   1 
ATOM   2520  C  CB  . VAL A 1 317 ? -10.940 30.297  95.124  1.00 12.70 ? 317 VAL A CB  1 
ATOM   2521  C  CG1 . VAL A 1 317 ? -10.824 29.295  96.255  1.00 12.66 ? 317 VAL A CG1 1 
ATOM   2522  C  CG2 . VAL A 1 317 ? -12.136 31.197  95.332  1.00 12.62 ? 317 VAL A CG2 1 
ATOM   2523  N  N   . LEU A 1 318 ? -7.683  29.881  95.603  1.00 13.26 ? 318 LEU A N   1 
ATOM   2524  C  CA  . LEU A 1 318 ? -6.556  28.979  95.374  1.00 13.16 ? 318 LEU A CA  1 
ATOM   2525  C  C   . LEU A 1 318 ? -6.856  27.690  96.129  1.00 13.26 ? 318 LEU A C   1 
ATOM   2526  O  O   . LEU A 1 318 ? -6.745  27.645  97.353  1.00 13.69 ? 318 LEU A O   1 
ATOM   2527  C  CB  . LEU A 1 318 ? -5.254  29.608  95.895  1.00 12.87 ? 318 LEU A CB  1 
ATOM   2528  C  CG  . LEU A 1 318 ? -4.778  30.887  95.187  1.00 12.49 ? 318 LEU A CG  1 
ATOM   2529  C  CD1 . LEU A 1 318 ? -3.382  31.250  95.665  1.00 12.18 ? 318 LEU A CD1 1 
ATOM   2530  C  CD2 . LEU A 1 318 ? -4.789  30.681  93.676  1.00 12.01 ? 318 LEU A CD2 1 
ATOM   2531  N  N   . ASN A 1 319 ? -7.238  26.646  95.400  1.00 13.28 ? 319 ASN A N   1 
ATOM   2532  C  CA  . ASN A 1 319 ? -7.584  25.372  96.027  1.00 13.36 ? 319 ASN A CA  1 
ATOM   2533  C  C   . ASN A 1 319 ? -6.773  24.167  95.562  1.00 13.30 ? 319 ASN A C   1 
ATOM   2534  O  O   . ASN A 1 319 ? -7.235  23.035  95.681  1.00 13.24 ? 319 ASN A O   1 
ATOM   2535  C  CB  . ASN A 1 319 ? -9.065  25.072  95.795  1.00 13.00 ? 319 ASN A CB  1 
ATOM   2536  C  CG  . ASN A 1 319 ? -9.390  24.851  94.332  1.00 12.83 ? 319 ASN A CG  1 
ATOM   2537  O  OD1 . ASN A 1 319 ? -10.412 24.255  93.993  1.00 13.04 ? 319 ASN A OD1 1 
ATOM   2538  N  ND2 . ASN A 1 319 ? -8.519  25.330  93.454  1.00 12.83 ? 319 ASN A ND2 1 
ATOM   2539  N  N   . ARG A 1 320 ? -5.573  24.392  95.043  1.00 13.24 ? 320 ARG A N   1 
ATOM   2540  C  CA  . ARG A 1 320 ? -4.769  23.274  94.571  1.00 13.23 ? 320 ARG A CA  1 
ATOM   2541  C  C   . ARG A 1 320 ? -3.275  23.555  94.509  1.00 13.12 ? 320 ARG A C   1 
ATOM   2542  O  O   . ARG A 1 320 ? -2.838  24.550  93.931  1.00 13.20 ? 320 ARG A O   1 
ATOM   2543  C  CB  . ARG A 1 320 ? -5.256  22.824  93.188  1.00 13.66 ? 320 ARG A CB  1 
ATOM   2544  C  CG  . ARG A 1 320 ? -4.584  21.550  92.689  1.00 14.18 ? 320 ARG A CG  1 
ATOM   2545  C  CD  . ARG A 1 320 ? -5.342  20.908  91.532  1.00 14.69 ? 320 ARG A CD  1 
ATOM   2546  N  NE  . ARG A 1 320 ? -5.007  21.496  90.232  1.00 15.04 ? 320 ARG A NE  1 
ATOM   2547  C  CZ  . ARG A 1 320 ? -3.770  21.717  89.784  1.00 15.18 ? 320 ARG A CZ  1 
ATOM   2548  N  NH1 . ARG A 1 320 ? -2.708  21.404  90.526  1.00 14.84 ? 320 ARG A NH1 1 
ATOM   2549  N  NH2 . ARG A 1 320 ? -3.590  22.251  88.580  1.00 15.28 ? 320 ARG A NH2 1 
ATOM   2550  N  N   . ASN A 1 321 ? -2.497  22.659  95.109  1.00 13.03 ? 321 ASN A N   1 
ATOM   2551  C  CA  . ASN A 1 321 ? -1.045  22.775  95.122  1.00 12.81 ? 321 ASN A CA  1 
ATOM   2552  C  C   . ASN A 1 321 ? -0.494  22.121  93.860  1.00 12.49 ? 321 ASN A C   1 
ATOM   2553  O  O   . ASN A 1 321 ? -1.165  21.305  93.228  1.00 12.32 ? 321 ASN A O   1 
ATOM   2554  C  CB  . ASN A 1 321 ? -0.467  22.066  96.352  1.00 13.07 ? 321 ASN A CB  1 
ATOM   2555  C  CG  . ASN A 1 321 ? -0.382  22.973  97.565  1.00 13.44 ? 321 ASN A CG  1 
ATOM   2556  O  OD1 . ASN A 1 321 ? -0.635  22.546  98.693  1.00 13.75 ? 321 ASN A OD1 1 
ATOM   2557  N  ND2 . ASN A 1 321 ? -0.026  24.234  97.338  1.00 13.83 ? 321 ASN A ND2 1 
ATOM   2558  N  N   . PRO A 1 322 ? 0.731   22.484  93.464  1.00 12.35 ? 322 PRO A N   1 
ATOM   2559  C  CA  . PRO A 1 322 ? 1.287   21.867  92.261  1.00 12.35 ? 322 PRO A CA  1 
ATOM   2560  C  C   . PRO A 1 322 ? 1.829   20.467  92.567  1.00 12.26 ? 322 PRO A C   1 
ATOM   2561  O  O   . PRO A 1 322 ? 2.272   20.198  93.682  1.00 12.29 ? 322 PRO A O   1 
ATOM   2562  C  CB  . PRO A 1 322 ? 2.385   22.838  91.837  1.00 12.22 ? 322 PRO A CB  1 
ATOM   2563  C  CG  . PRO A 1 322 ? 2.807   23.506  93.113  1.00 12.24 ? 322 PRO A CG  1 
ATOM   2564  C  CD  . PRO A 1 322 ? 1.649   23.469  94.067  1.00 12.26 ? 322 PRO A CD  1 
ATOM   2565  N  N   . VAL A 1 323 ? 1.780   19.580  91.577  1.00 12.18 ? 323 VAL A N   1 
ATOM   2566  C  CA  . VAL A 1 323 ? 2.281   18.218  91.731  1.00 12.09 ? 323 VAL A CA  1 
ATOM   2567  C  C   . VAL A 1 323 ? 3.794   18.167  91.538  1.00 11.91 ? 323 VAL A C   1 
ATOM   2568  O  O   . VAL A 1 323 ? 4.486   17.369  92.171  1.00 11.67 ? 323 VAL A O   1 
ATOM   2569  C  CB  . VAL A 1 323 ? 1.648   17.279  90.709  1.00 12.47 ? 323 VAL A CB  1 
ATOM   2570  C  CG1 . VAL A 1 323 ? 1.942   15.838  91.095  1.00 12.77 ? 323 VAL A CG1 1 
ATOM   2571  C  CG2 . VAL A 1 323 ? 0.154   17.536  90.625  1.00 12.85 ? 323 VAL A CG2 1 
ATOM   2572  N  N   . ASN A 1 324 ? 4.295   19.012  90.642  1.00 12.01 ? 324 ASN A N   1 
ATOM   2573  C  CA  . ASN A 1 324 ? 5.723   19.097  90.371  1.00 12.35 ? 324 ASN A CA  1 
ATOM   2574  C  C   . ASN A 1 324 ? 6.128   20.561  90.255  1.00 12.31 ? 324 ASN A C   1 
ATOM   2575  O  O   . ASN A 1 324 ? 5.766   21.241  89.294  1.00 12.12 ? 324 ASN A O   1 
ATOM   2576  C  CB  . ASN A 1 324 ? 6.076   18.367  89.085  1.00 12.64 ? 324 ASN A CB  1 
ATOM   2577  C  CG  . ASN A 1 324 ? 7.564   18.165  88.940  1.00 13.25 ? 324 ASN A CG  1 
ATOM   2578  O  OD1 . ASN A 1 324 ? 8.264   18.997  88.360  1.00 13.72 ? 324 ASN A OD1 1 
ATOM   2579  N  ND2 . ASN A 1 324 ? 8.063   17.060  89.481  1.00 13.88 ? 324 ASN A ND2 1 
ATOM   2580  N  N   . TYR A 1 325 ? 6.884   21.040  91.238  1.00 12.44 ? 325 TYR A N   1 
ATOM   2581  C  CA  . TYR A 1 325 ? 7.315   22.430  91.262  1.00 12.68 ? 325 TYR A CA  1 
ATOM   2582  C  C   . TYR A 1 325 ? 7.905   22.928  89.948  1.00 12.94 ? 325 TYR A C   1 
ATOM   2583  O  O   . TYR A 1 325 ? 7.420   23.902  89.370  1.00 13.16 ? 325 TYR A O   1 
ATOM   2584  C  CB  . TYR A 1 325 ? 8.333   22.648  92.384  1.00 12.68 ? 325 TYR A CB  1 
ATOM   2585  C  CG  . TYR A 1 325 ? 8.657   24.105  92.612  1.00 12.52 ? 325 TYR A CG  1 
ATOM   2586  C  CD1 . TYR A 1 325 ? 7.838   24.902  93.401  1.00 12.39 ? 325 TYR A CD1 1 
ATOM   2587  C  CD2 . TYR A 1 325 ? 9.763   24.694  92.010  1.00 12.51 ? 325 TYR A CD2 1 
ATOM   2588  C  CE1 . TYR A 1 325 ? 8.110   26.254  93.583  1.00 12.33 ? 325 TYR A CE1 1 
ATOM   2589  C  CE2 . TYR A 1 325 ? 10.044  26.043  92.185  1.00 12.43 ? 325 TYR A CE2 1 
ATOM   2590  C  CZ  . TYR A 1 325 ? 9.214   26.819  92.970  1.00 12.32 ? 325 TYR A CZ  1 
ATOM   2591  O  OH  . TYR A 1 325 ? 9.482   28.159  93.131  1.00 12.13 ? 325 TYR A OH  1 
ATOM   2592  N  N   . PHE A 1 326 ? 8.954   22.257  89.484  1.00 13.02 ? 326 PHE A N   1 
ATOM   2593  C  CA  . PHE A 1 326 ? 9.638   22.640  88.252  1.00 12.78 ? 326 PHE A CA  1 
ATOM   2594  C  C   . PHE A 1 326 ? 8.736   22.716  87.023  1.00 12.77 ? 326 PHE A C   1 
ATOM   2595  O  O   . PHE A 1 326 ? 8.821   23.658  86.236  1.00 13.17 ? 326 PHE A O   1 
ATOM   2596  C  CB  . PHE A 1 326 ? 10.788  21.666  87.976  1.00 12.50 ? 326 PHE A CB  1 
ATOM   2597  C  CG  . PHE A 1 326 ? 11.706  22.110  86.875  1.00 12.03 ? 326 PHE A CG  1 
ATOM   2598  C  CD1 . PHE A 1 326 ? 12.893  22.772  87.168  1.00 11.80 ? 326 PHE A CD1 1 
ATOM   2599  C  CD2 . PHE A 1 326 ? 11.388  21.862  85.544  1.00 11.81 ? 326 PHE A CD2 1 
ATOM   2600  C  CE1 . PHE A 1 326 ? 13.752  23.178  86.150  1.00 11.67 ? 326 PHE A CE1 1 
ATOM   2601  C  CE2 . PHE A 1 326 ? 12.239  22.263  84.520  1.00 11.64 ? 326 PHE A CE2 1 
ATOM   2602  C  CZ  . PHE A 1 326 ? 13.424  22.923  84.824  1.00 11.60 ? 326 PHE A CZ  1 
ATOM   2603  N  N   . ALA A 1 327 ? 7.874   21.722  86.859  1.00 12.35 ? 327 ALA A N   1 
ATOM   2604  C  CA  . ALA A 1 327 ? 6.983   21.671  85.710  1.00 11.79 ? 327 ALA A CA  1 
ATOM   2605  C  C   . ALA A 1 327 ? 5.828   22.669  85.746  1.00 11.53 ? 327 ALA A C   1 
ATOM   2606  O  O   . ALA A 1 327 ? 5.496   23.278  84.726  1.00 11.18 ? 327 ALA A O   1 
ATOM   2607  C  CB  . ALA A 1 327 ? 6.437   20.261  85.555  1.00 11.73 ? 327 ALA A CB  1 
ATOM   2608  N  N   . GLU A 1 328 ? 5.219   22.844  86.915  1.00 11.30 ? 328 GLU A N   1 
ATOM   2609  C  CA  . GLU A 1 328 ? 4.078   23.742  87.036  1.00 11.15 ? 328 GLU A CA  1 
ATOM   2610  C  C   . GLU A 1 328 ? 4.359   25.138  87.567  1.00 11.13 ? 328 GLU A C   1 
ATOM   2611  O  O   . GLU A 1 328 ? 3.545   26.043  87.378  1.00 11.08 ? 328 GLU A O   1 
ATOM   2612  C  CB  . GLU A 1 328 ? 3.003   23.094  87.908  1.00 11.13 ? 328 GLU A CB  1 
ATOM   2613  C  CG  . GLU A 1 328 ? 2.425   21.818  87.341  1.00 11.19 ? 328 GLU A CG  1 
ATOM   2614  C  CD  . GLU A 1 328 ? 1.753   20.976  88.402  1.00 11.18 ? 328 GLU A CD  1 
ATOM   2615  O  OE1 . GLU A 1 328 ? 2.422   20.075  88.950  1.00 11.06 ? 328 GLU A OE1 1 
ATOM   2616  O  OE2 . GLU A 1 328 ? 0.558   21.217  88.691  1.00 11.23 ? 328 GLU A OE2 1 
ATOM   2617  N  N   . VAL A 1 329 ? 5.494   25.325  88.233  1.00 11.01 ? 329 VAL A N   1 
ATOM   2618  C  CA  . VAL A 1 329 ? 5.803   26.636  88.792  1.00 11.05 ? 329 VAL A CA  1 
ATOM   2619  C  C   . VAL A 1 329 ? 7.048   27.280  88.206  1.00 11.01 ? 329 VAL A C   1 
ATOM   2620  O  O   . VAL A 1 329 ? 6.980   28.361  87.628  1.00 11.03 ? 329 VAL A O   1 
ATOM   2621  C  CB  . VAL A 1 329 ? 5.956   26.563  90.330  1.00 11.12 ? 329 VAL A CB  1 
ATOM   2622  C  CG1 . VAL A 1 329 ? 6.278   27.941  90.893  1.00 11.09 ? 329 VAL A CG1 1 
ATOM   2623  C  CG2 . VAL A 1 329 ? 4.677   26.027  90.955  1.00 11.09 ? 329 VAL A CG2 1 
ATOM   2624  N  N   . GLU A 1 330 ? 8.189   26.626  88.363  1.00 10.99 ? 330 GLU A N   1 
ATOM   2625  C  CA  . GLU A 1 330 ? 9.429   27.171  87.836  1.00 11.02 ? 330 GLU A CA  1 
ATOM   2626  C  C   . GLU A 1 330 ? 9.339   27.430  86.332  1.00 11.01 ? 330 GLU A C   1 
ATOM   2627  O  O   . GLU A 1 330 ? 9.975   28.345  85.815  1.00 10.96 ? 330 GLU A O   1 
ATOM   2628  C  CB  . GLU A 1 330 ? 10.590  26.215  88.120  1.00 11.10 ? 330 GLU A CB  1 
ATOM   2629  C  CG  . GLU A 1 330 ? 11.950  26.793  87.776  1.00 11.17 ? 330 GLU A CG  1 
ATOM   2630  C  CD  . GLU A 1 330 ? 12.257  28.033  88.576  1.00 11.18 ? 330 GLU A CD  1 
ATOM   2631  O  OE1 . GLU A 1 330 ? 11.502  28.321  89.521  1.00 11.28 ? 330 GLU A OE1 1 
ATOM   2632  O  OE2 . GLU A 1 330 ? 13.248  28.719  88.266  1.00 11.20 ? 330 GLU A OE2 1 
ATOM   2633  N  N   . GLN A 1 331 ? 8.539   26.627  85.638  1.00 11.11 ? 331 GLN A N   1 
ATOM   2634  C  CA  . GLN A 1 331 ? 8.396   26.760  84.195  1.00 11.24 ? 331 GLN A CA  1 
ATOM   2635  C  C   . GLN A 1 331 ? 7.246   27.646  83.730  1.00 11.16 ? 331 GLN A C   1 
ATOM   2636  O  O   . GLN A 1 331 ? 7.193   28.015  82.558  1.00 11.26 ? 331 GLN A O   1 
ATOM   2637  C  CB  . GLN A 1 331 ? 8.261   25.372  83.555  1.00 11.32 ? 331 GLN A CB  1 
ATOM   2638  C  CG  . GLN A 1 331 ? 9.593   24.748  83.152  1.00 11.57 ? 331 GLN A CG  1 
ATOM   2639  C  CD  . GLN A 1 331 ? 9.446   23.461  82.347  1.00 11.65 ? 331 GLN A CD  1 
ATOM   2640  O  OE1 . GLN A 1 331 ? 10.437  22.865  81.929  1.00 11.93 ? 331 GLN A OE1 1 
ATOM   2641  N  NE2 . GLN A 1 331 ? 8.212   23.031  82.128  1.00 11.43 ? 331 GLN A NE2 1 
ATOM   2642  N  N   . ILE A 1 332 ? 6.328   27.988  84.630  1.00 10.79 ? 332 ILE A N   1 
ATOM   2643  C  CA  . ILE A 1 332 ? 5.194   28.831  84.250  1.00 10.61 ? 332 ILE A CA  1 
ATOM   2644  C  C   . ILE A 1 332 ? 5.632   30.249  83.856  1.00 10.36 ? 332 ILE A C   1 
ATOM   2645  O  O   . ILE A 1 332 ? 6.412   30.888  84.559  1.00 10.02 ? 332 ILE A O   1 
ATOM   2646  C  CB  . ILE A 1 332 ? 4.133   28.895  85.386  1.00 10.69 ? 332 ILE A CB  1 
ATOM   2647  C  CG1 . ILE A 1 332 ? 2.897   29.648  84.896  1.00 10.63 ? 332 ILE A CG1 1 
ATOM   2648  C  CG2 . ILE A 1 332 ? 4.707   29.563  86.622  1.00 11.13 ? 332 ILE A CG2 1 
ATOM   2649  C  CD1 . ILE A 1 332 ? 1.614   28.892  85.082  1.00 9.98  ? 332 ILE A CD1 1 
ATOM   2650  N  N   . ALA A 1 333 ? 5.127   30.725  82.719  1.00 10.31 ? 333 ALA A N   1 
ATOM   2651  C  CA  . ALA A 1 333 ? 5.466   32.051  82.206  1.00 10.30 ? 333 ALA A CA  1 
ATOM   2652  C  C   . ALA A 1 333 ? 4.244   32.962  82.070  1.00 10.46 ? 333 ALA A C   1 
ATOM   2653  O  O   . ALA A 1 333 ? 3.182   32.536  81.609  1.00 10.40 ? 333 ALA A O   1 
ATOM   2654  C  CB  . ALA A 1 333 ? 6.164   31.916  80.854  1.00 10.40 ? 333 ALA A CB  1 
ATOM   2655  N  N   . PHE A 1 334 ? 4.401   34.219  82.472  1.00 10.51 ? 334 PHE A N   1 
ATOM   2656  C  CA  . PHE A 1 334 ? 3.316   35.187  82.393  1.00 10.61 ? 334 PHE A CA  1 
ATOM   2657  C  C   . PHE A 1 334 ? 3.684   36.304  81.432  1.00 10.68 ? 334 PHE A C   1 
ATOM   2658  O  O   . PHE A 1 334 ? 4.772   36.870  81.520  1.00 10.78 ? 334 PHE A O   1 
ATOM   2659  C  CB  . PHE A 1 334 ? 3.028   35.791  83.772  1.00 10.60 ? 334 PHE A CB  1 
ATOM   2660  C  CG  . PHE A 1 334 ? 2.562   34.791  84.791  1.00 10.75 ? 334 PHE A CG  1 
ATOM   2661  C  CD1 . PHE A 1 334 ? 3.467   33.917  85.391  1.00 10.89 ? 334 PHE A CD1 1 
ATOM   2662  C  CD2 . PHE A 1 334 ? 1.220   34.728  85.159  1.00 10.71 ? 334 PHE A CD2 1 
ATOM   2663  C  CE1 . PHE A 1 334 ? 3.045   32.995  86.341  1.00 11.20 ? 334 PHE A CE1 1 
ATOM   2664  C  CE2 . PHE A 1 334 ? 0.785   33.814  86.107  1.00 10.98 ? 334 PHE A CE2 1 
ATOM   2665  C  CZ  . PHE A 1 334 ? 1.699   32.943  86.703  1.00 11.25 ? 334 PHE A CZ  1 
ATOM   2666  N  N   . ASP A 1 335 ? 2.775   36.619  80.517  1.00 10.80 ? 335 ASP A N   1 
ATOM   2667  C  CA  . ASP A 1 335 ? 3.007   37.683  79.551  1.00 10.88 ? 335 ASP A CA  1 
ATOM   2668  C  C   . ASP A 1 335 ? 1.944   38.762  79.681  1.00 11.11 ? 335 ASP A C   1 
ATOM   2669  O  O   . ASP A 1 335 ? 0.773   38.530  79.373  1.00 11.20 ? 335 ASP A O   1 
ATOM   2670  C  CB  . ASP A 1 335 ? 2.975   37.142  78.120  1.00 10.62 ? 335 ASP A CB  1 
ATOM   2671  C  CG  . ASP A 1 335 ? 4.016   36.083  77.874  1.00 10.34 ? 335 ASP A CG  1 
ATOM   2672  O  OD1 . ASP A 1 335 ? 5.212   36.434  77.809  1.00 10.61 ? 335 ASP A OD1 1 
ATOM   2673  O  OD2 . ASP A 1 335 ? 3.634   34.901  77.743  1.00 9.73  ? 335 ASP A OD2 1 
ATOM   2674  N  N   . PRO A 1 336 ? 2.333   39.950  80.167  1.00 11.24 ? 336 PRO A N   1 
ATOM   2675  C  CA  . PRO A 1 336 ? 1.408   41.076  80.332  1.00 11.35 ? 336 PRO A CA  1 
ATOM   2676  C  C   . PRO A 1 336 ? 0.761   41.442  79.002  1.00 11.68 ? 336 PRO A C   1 
ATOM   2677  O  O   . PRO A 1 336 ? -0.207  42.189  78.965  1.00 11.86 ? 336 PRO A O   1 
ATOM   2678  C  CB  . PRO A 1 336 ? 2.294   42.202  80.853  1.00 11.28 ? 336 PRO A CB  1 
ATOM   2679  C  CG  . PRO A 1 336 ? 3.484   41.516  81.440  1.00 11.08 ? 336 PRO A CG  1 
ATOM   2680  C  CD  . PRO A 1 336 ? 3.690   40.281  80.632  1.00 11.09 ? 336 PRO A CD  1 
ATOM   2681  N  N   . SER A 1 337 ? 1.317   40.908  77.917  1.00 12.14 ? 337 SER A N   1 
ATOM   2682  C  CA  . SER A 1 337 ? 0.829   41.149  76.565  1.00 12.38 ? 337 SER A CA  1 
ATOM   2683  C  C   . SER A 1 337 ? -0.365  40.257  76.242  1.00 12.60 ? 337 SER A C   1 
ATOM   2684  O  O   . SER A 1 337 ? -1.140  40.543  75.332  1.00 12.92 ? 337 SER A O   1 
ATOM   2685  C  CB  . SER A 1 337 ? 1.951   40.874  75.570  1.00 12.38 ? 337 SER A CB  1 
ATOM   2686  O  OG  . SER A 1 337 ? 3.193   40.755  76.244  1.00 12.48 ? 337 SER A OG  1 
ATOM   2687  N  N   . ASN A 1 338 ? -0.502  39.169  76.991  1.00 12.67 ? 338 ASN A N   1 
ATOM   2688  C  CA  . ASN A 1 338 ? -1.594  38.224  76.793  1.00 12.48 ? 338 ASN A CA  1 
ATOM   2689  C  C   . ASN A 1 338 ? -2.919  38.771  77.309  1.00 12.47 ? 338 ASN A C   1 
ATOM   2690  O  O   . ASN A 1 338 ? -3.390  38.393  78.384  1.00 12.52 ? 338 ASN A O   1 
ATOM   2691  C  CB  . ASN A 1 338 ? -1.278  36.899  77.495  1.00 12.13 ? 338 ASN A CB  1 
ATOM   2692  C  CG  . ASN A 1 338 ? -0.194  36.104  76.787  1.00 11.69 ? 338 ASN A CG  1 
ATOM   2693  O  OD1 . ASN A 1 338 ? 0.344   35.147  77.338  1.00 11.43 ? 338 ASN A OD1 1 
ATOM   2694  N  ND2 . ASN A 1 338 ? 0.129   36.499  75.561  1.00 11.08 ? 338 ASN A ND2 1 
ATOM   2695  N  N   . MET A 1 339 ? -3.514  39.670  76.534  1.00 12.59 ? 339 MET A N   1 
ATOM   2696  C  CA  . MET A 1 339 ? -4.794  40.264  76.893  1.00 12.53 ? 339 MET A CA  1 
ATOM   2697  C  C   . MET A 1 339 ? -5.808  39.977  75.788  1.00 12.61 ? 339 MET A C   1 
ATOM   2698  O  O   . MET A 1 339 ? -5.602  40.350  74.633  1.00 12.76 ? 339 MET A O   1 
ATOM   2699  C  CB  . MET A 1 339 ? -4.640  41.768  77.074  1.00 12.02 ? 339 MET A CB  1 
ATOM   2700  C  CG  . MET A 1 339 ? -3.421  42.169  77.869  1.00 11.43 ? 339 MET A CG  1 
ATOM   2701  S  SD  . MET A 1 339 ? -3.491  43.902  78.322  1.00 10.86 ? 339 MET A SD  1 
ATOM   2702  C  CE  . MET A 1 339 ? -2.209  44.589  77.290  1.00 11.08 ? 339 MET A CE  1 
ATOM   2703  N  N   . PRO A 1 340 ? -6.918  39.305  76.131  1.00 12.48 ? 340 PRO A N   1 
ATOM   2704  C  CA  . PRO A 1 340 ? -7.954  38.974  75.153  1.00 12.81 ? 340 PRO A CA  1 
ATOM   2705  C  C   . PRO A 1 340 ? -8.904  40.145  74.939  1.00 12.82 ? 340 PRO A C   1 
ATOM   2706  O  O   . PRO A 1 340 ? -8.900  41.101  75.720  1.00 13.03 ? 340 PRO A O   1 
ATOM   2707  C  CB  . PRO A 1 340 ? -8.653  37.778  75.778  1.00 12.67 ? 340 PRO A CB  1 
ATOM   2708  C  CG  . PRO A 1 340 ? -8.521  38.010  77.247  1.00 12.60 ? 340 PRO A CG  1 
ATOM   2709  C  CD  . PRO A 1 340 ? -7.270  38.826  77.479  1.00 12.69 ? 340 PRO A CD  1 
ATOM   2710  N  N   . PRO A 1 341 ? -9.725  40.090  73.871  1.00 12.62 ? 341 PRO A N   1 
ATOM   2711  C  CA  . PRO A 1 341 ? -10.681 41.160  73.573  1.00 12.88 ? 341 PRO A CA  1 
ATOM   2712  C  C   . PRO A 1 341 ? -11.416 41.621  74.827  1.00 12.98 ? 341 PRO A C   1 
ATOM   2713  O  O   . PRO A 1 341 ? -11.794 40.810  75.674  1.00 13.16 ? 341 PRO A O   1 
ATOM   2714  C  CB  . PRO A 1 341 ? -11.622 40.522  72.553  1.00 12.34 ? 341 PRO A CB  1 
ATOM   2715  C  CG  . PRO A 1 341 ? -10.788 39.520  71.863  1.00 12.10 ? 341 PRO A CG  1 
ATOM   2716  C  CD  . PRO A 1 341 ? -9.798  39.005  72.873  1.00 12.43 ? 341 PRO A CD  1 
ATOM   2717  N  N   . GLY A 1 342 ? -11.607 42.930  74.944  1.00 13.12 ? 342 GLY A N   1 
ATOM   2718  C  CA  . GLY A 1 342 ? -12.287 43.473  76.104  1.00 13.11 ? 342 GLY A CA  1 
ATOM   2719  C  C   . GLY A 1 342 ? -11.314 44.171  77.031  1.00 13.06 ? 342 GLY A C   1 
ATOM   2720  O  O   . GLY A 1 342 ? -11.707 45.046  77.804  1.00 13.16 ? 342 GLY A O   1 
ATOM   2721  N  N   . ILE A 1 343 ? -10.044 43.775  76.952  1.00 12.85 ? 343 ILE A N   1 
ATOM   2722  C  CA  . ILE A 1 343 ? -8.986  44.360  77.770  1.00 12.58 ? 343 ILE A CA  1 
ATOM   2723  C  C   . ILE A 1 343 ? -7.778  44.694  76.897  1.00 12.58 ? 343 ILE A C   1 
ATOM   2724  O  O   . ILE A 1 343 ? -7.271  43.835  76.167  1.00 12.56 ? 343 ILE A O   1 
ATOM   2725  C  CB  . ILE A 1 343 ? -8.526  43.393  78.895  1.00 12.40 ? 343 ILE A CB  1 
ATOM   2726  C  CG1 . ILE A 1 343 ? -9.724  42.951  79.740  1.00 12.15 ? 343 ILE A CG1 1 
ATOM   2727  C  CG2 . ILE A 1 343 ? -7.495  44.082  79.779  1.00 12.35 ? 343 ILE A CG2 1 
ATOM   2728  C  CD1 . ILE A 1 343 ? -9.470  41.709  80.560  1.00 11.59 ? 343 ILE A CD1 1 
ATOM   2729  N  N   . GLU A 1 344 ? -7.323  45.941  76.985  1.00 12.44 ? 344 GLU A N   1 
ATOM   2730  C  CA  . GLU A 1 344 ? -6.180  46.409  76.210  1.00 12.42 ? 344 GLU A CA  1 
ATOM   2731  C  C   . GLU A 1 344 ? -5.220  47.206  77.088  1.00 12.19 ? 344 GLU A C   1 
ATOM   2732  O  O   . GLU A 1 344 ? -5.508  47.479  78.252  1.00 11.87 ? 344 GLU A O   1 
ATOM   2733  C  CB  . GLU A 1 344 ? -6.657  47.279  75.042  1.00 12.69 ? 344 GLU A CB  1 
ATOM   2734  C  CG  . GLU A 1 344 ? -7.553  46.545  74.055  1.00 13.44 ? 344 GLU A CG  1 
ATOM   2735  C  CD  . GLU A 1 344 ? -7.794  47.326  72.767  1.00 13.91 ? 344 GLU A CD  1 
ATOM   2736  O  OE1 . GLU A 1 344 ? -6.960  48.193  72.420  1.00 14.25 ? 344 GLU A OE1 1 
ATOM   2737  O  OE2 . GLU A 1 344 ? -8.823  47.068  72.103  1.00 14.04 ? 344 GLU A OE2 1 
ATOM   2738  N  N   . ALA A 1 345 ? -4.078  47.577  76.518  1.00 12.30 ? 345 ALA A N   1 
ATOM   2739  C  CA  . ALA A 1 345 ? -3.067  48.340  77.239  1.00 12.56 ? 345 ALA A CA  1 
ATOM   2740  C  C   . ALA A 1 345 ? -3.402  49.830  77.270  1.00 12.83 ? 345 ALA A C   1 
ATOM   2741  O  O   . ALA A 1 345 ? -4.483  50.243  76.847  1.00 12.75 ? 345 ALA A O   1 
ATOM   2742  C  CB  . ALA A 1 345 ? -1.708  48.131  76.597  1.00 12.79 ? 345 ALA A CB  1 
ATOM   2743  N  N   . SER A 1 346 ? -2.464  50.629  77.773  1.00 12.77 ? 346 SER A N   1 
ATOM   2744  C  CA  . SER A 1 346 ? -2.646  52.075  77.867  1.00 12.80 ? 346 SER A CA  1 
ATOM   2745  C  C   . SER A 1 346 ? -1.325  52.805  77.619  1.00 12.89 ? 346 SER A C   1 
ATOM   2746  O  O   . SER A 1 346 ? -0.259  52.192  77.608  1.00 13.06 ? 346 SER A O   1 
ATOM   2747  C  CB  . SER A 1 346 ? -3.195  52.446  79.249  1.00 12.69 ? 346 SER A CB  1 
ATOM   2748  O  OG  . SER A 1 346 ? -2.231  53.160  80.006  1.00 12.37 ? 346 SER A OG  1 
ATOM   2749  N  N   . PRO A 1 347 ? -1.380  54.130  77.421  1.00 12.96 ? 347 PRO A N   1 
ATOM   2750  C  CA  . PRO A 1 347 ? -0.164  54.917  77.170  1.00 13.04 ? 347 PRO A CA  1 
ATOM   2751  C  C   . PRO A 1 347 ? 0.944   54.762  78.214  1.00 13.05 ? 347 PRO A C   1 
ATOM   2752  O  O   . PRO A 1 347 ? 2.052   55.268  78.025  1.00 13.14 ? 347 PRO A O   1 
ATOM   2753  C  CB  . PRO A 1 347 ? -0.669  56.357  77.096  1.00 12.96 ? 347 PRO A CB  1 
ATOM   2754  C  CG  . PRO A 1 347 ? -2.121  56.245  76.787  1.00 12.94 ? 347 PRO A CG  1 
ATOM   2755  C  CD  . PRO A 1 347 ? -2.592  54.970  77.416  1.00 12.97 ? 347 PRO A CD  1 
ATOM   2756  N  N   . ASP A 1 348 ? 0.653   54.061  79.306  1.00 12.92 ? 348 ASP A N   1 
ATOM   2757  C  CA  . ASP A 1 348 ? 1.635   53.871  80.371  1.00 12.88 ? 348 ASP A CA  1 
ATOM   2758  C  C   . ASP A 1 348 ? 2.985   53.361  79.867  1.00 12.72 ? 348 ASP A C   1 
ATOM   2759  O  O   . ASP A 1 348 ? 3.127   52.195  79.512  1.00 12.81 ? 348 ASP A O   1 
ATOM   2760  C  CB  . ASP A 1 348 ? 1.088   52.906  81.425  1.00 13.00 ? 348 ASP A CB  1 
ATOM   2761  C  CG  . ASP A 1 348 ? 2.038   52.717  82.595  1.00 13.05 ? 348 ASP A CG  1 
ATOM   2762  O  OD1 . ASP A 1 348 ? 3.215   53.131  82.498  1.00 13.36 ? 348 ASP A OD1 1 
ATOM   2763  O  OD2 . ASP A 1 348 ? 1.607   52.150  83.617  1.00 13.12 ? 348 ASP A OD2 1 
ATOM   2764  N  N   . LYS A 1 349 ? 3.979   54.243  79.854  1.00 12.60 ? 349 LYS A N   1 
ATOM   2765  C  CA  . LYS A 1 349 ? 5.315   53.888  79.395  1.00 12.49 ? 349 LYS A CA  1 
ATOM   2766  C  C   . LYS A 1 349 ? 5.800   52.592  80.030  1.00 12.37 ? 349 LYS A C   1 
ATOM   2767  O  O   . LYS A 1 349 ? 6.274   51.701  79.329  1.00 12.51 ? 349 LYS A O   1 
ATOM   2768  C  CB  . LYS A 1 349 ? 6.300   55.019  79.706  1.00 12.34 ? 349 LYS A CB  1 
ATOM   2769  C  CG  . LYS A 1 349 ? 5.971   56.328  79.017  1.00 12.22 ? 349 LYS A CG  1 
ATOM   2770  C  CD  . LYS A 1 349 ? 7.121   57.322  79.127  1.00 12.36 ? 349 LYS A CD  1 
ATOM   2771  C  CE  . LYS A 1 349 ? 6.707   58.703  78.619  1.00 12.40 ? 349 LYS A CE  1 
ATOM   2772  N  NZ  . LYS A 1 349 ? 7.780   59.716  78.800  1.00 12.38 ? 349 LYS A NZ  1 
ATOM   2773  N  N   . MET A 1 350 ? 5.673   52.487  81.350  1.00 12.05 ? 350 MET A N   1 
ATOM   2774  C  CA  . MET A 1 350 ? 6.106   51.290  82.067  1.00 11.95 ? 350 MET A CA  1 
ATOM   2775  C  C   . MET A 1 350 ? 5.451   50.036  81.506  1.00 11.89 ? 350 MET A C   1 
ATOM   2776  O  O   . MET A 1 350 ? 6.098   49.003  81.358  1.00 11.57 ? 350 MET A O   1 
ATOM   2777  C  CB  . MET A 1 350 ? 5.765   51.400  83.558  1.00 11.84 ? 350 MET A CB  1 
ATOM   2778  C  CG  . MET A 1 350 ? 6.760   52.193  84.379  1.00 11.91 ? 350 MET A CG  1 
ATOM   2779  S  SD  . MET A 1 350 ? 8.451   51.618  84.204  1.00 11.81 ? 350 MET A SD  1 
ATOM   2780  C  CE  . MET A 1 350 ? 8.942   51.486  85.896  1.00 12.35 ? 350 MET A CE  1 
ATOM   2781  N  N   . LEU A 1 351 ? 4.161   50.134  81.199  1.00 12.01 ? 351 LEU A N   1 
ATOM   2782  C  CA  . LEU A 1 351 ? 3.411   49.001  80.670  1.00 12.28 ? 351 LEU A CA  1 
ATOM   2783  C  C   . LEU A 1 351 ? 3.741   48.727  79.204  1.00 12.20 ? 351 LEU A C   1 
ATOM   2784  O  O   . LEU A 1 351 ? 3.760   47.572  78.762  1.00 12.07 ? 351 LEU A O   1 
ATOM   2785  C  CB  . LEU A 1 351 ? 1.908   49.250  80.826  1.00 12.76 ? 351 LEU A CB  1 
ATOM   2786  C  CG  . LEU A 1 351 ? 0.995   48.373  79.965  1.00 13.27 ? 351 LEU A CG  1 
ATOM   2787  C  CD1 . LEU A 1 351 ? 0.852   47.006  80.608  1.00 13.47 ? 351 LEU A CD1 1 
ATOM   2788  C  CD2 . LEU A 1 351 ? -0.365  49.033  79.809  1.00 13.67 ? 351 LEU A CD2 1 
ATOM   2789  N  N   . GLN A 1 352 ? 3.994   49.796  78.456  1.00 12.21 ? 352 GLN A N   1 
ATOM   2790  C  CA  . GLN A 1 352 ? 4.321   49.675  77.045  1.00 12.24 ? 352 GLN A CA  1 
ATOM   2791  C  C   . GLN A 1 352 ? 5.612   48.881  76.879  1.00 12.21 ? 352 GLN A C   1 
ATOM   2792  O  O   . GLN A 1 352 ? 5.702   47.992  76.028  1.00 12.27 ? 352 GLN A O   1 
ATOM   2793  C  CB  . GLN A 1 352 ? 4.474   51.064  76.423  1.00 12.40 ? 352 GLN A CB  1 
ATOM   2794  C  CG  . GLN A 1 352 ? 3.158   51.807  76.218  1.00 12.72 ? 352 GLN A CG  1 
ATOM   2795  C  CD  . GLN A 1 352 ? 2.367   51.310  75.003  1.00 12.94 ? 352 GLN A CD  1 
ATOM   2796  O  OE1 . GLN A 1 352 ? 2.899   51.204  73.891  1.00 12.98 ? 352 GLN A OE1 1 
ATOM   2797  N  NE2 . GLN A 1 352 ? 1.088   51.010  75.215  1.00 12.87 ? 352 GLN A NE2 1 
ATOM   2798  N  N   . GLY A 1 353 ? 6.604   49.201  77.704  1.00 11.86 ? 353 GLY A N   1 
ATOM   2799  C  CA  . GLY A 1 353 ? 7.875   48.506  77.633  1.00 11.91 ? 353 GLY A CA  1 
ATOM   2800  C  C   . GLY A 1 353 ? 7.801   47.064  78.108  1.00 11.81 ? 353 GLY A C   1 
ATOM   2801  O  O   . GLY A 1 353 ? 8.602   46.226  77.690  1.00 11.56 ? 353 GLY A O   1 
ATOM   2802  N  N   . ARG A 1 354 ? 6.836   46.774  78.976  1.00 11.70 ? 354 ARG A N   1 
ATOM   2803  C  CA  . ARG A 1 354 ? 6.667   45.433  79.515  1.00 12.03 ? 354 ARG A CA  1 
ATOM   2804  C  C   . ARG A 1 354 ? 6.066   44.501  78.474  1.00 12.18 ? 354 ARG A C   1 
ATOM   2805  O  O   . ARG A 1 354 ? 6.280   43.285  78.509  1.00 11.99 ? 354 ARG A O   1 
ATOM   2806  C  CB  . ARG A 1 354 ? 5.767   45.479  80.751  1.00 12.28 ? 354 ARG A CB  1 
ATOM   2807  C  CG  . ARG A 1 354 ? 6.520   45.635  82.064  1.00 12.64 ? 354 ARG A CG  1 
ATOM   2808  C  CD  . ARG A 1 354 ? 5.564   45.692  83.246  1.00 13.00 ? 354 ARG A CD  1 
ATOM   2809  N  NE  . ARG A 1 354 ? 5.511   44.421  83.967  1.00 12.87 ? 354 ARG A NE  1 
ATOM   2810  C  CZ  . ARG A 1 354 ? 4.457   43.997  84.659  1.00 12.75 ? 354 ARG A CZ  1 
ATOM   2811  N  NH1 . ARG A 1 354 ? 3.364   44.745  84.725  1.00 12.39 ? 354 ARG A NH1 1 
ATOM   2812  N  NH2 . ARG A 1 354 ? 4.490   42.823  85.279  1.00 12.56 ? 354 ARG A NH2 1 
ATOM   2813  N  N   . LEU A 1 355 ? 5.315   45.085  77.547  1.00 12.46 ? 355 LEU A N   1 
ATOM   2814  C  CA  . LEU A 1 355 ? 4.667   44.327  76.484  1.00 12.70 ? 355 LEU A CA  1 
ATOM   2815  C  C   . LEU A 1 355 ? 5.667   43.490  75.685  1.00 12.96 ? 355 LEU A C   1 
ATOM   2816  O  O   . LEU A 1 355 ? 5.303   42.471  75.093  1.00 13.39 ? 355 LEU A O   1 
ATOM   2817  C  CB  . LEU A 1 355 ? 3.929   45.280  75.534  1.00 12.44 ? 355 LEU A CB  1 
ATOM   2818  C  CG  . LEU A 1 355 ? 2.684   46.031  76.023  1.00 12.16 ? 355 LEU A CG  1 
ATOM   2819  C  CD1 . LEU A 1 355 ? 2.126   46.851  74.877  1.00 12.04 ? 355 LEU A CD1 1 
ATOM   2820  C  CD2 . LEU A 1 355 ? 1.631   45.060  76.525  1.00 11.83 ? 355 LEU A CD2 1 
ATOM   2821  N  N   . PHE A 1 356 ? 6.927   43.916  75.678  1.00 12.73 ? 356 PHE A N   1 
ATOM   2822  C  CA  . PHE A 1 356 ? 7.964   43.218  74.930  1.00 12.44 ? 356 PHE A CA  1 
ATOM   2823  C  C   . PHE A 1 356 ? 8.884   42.403  75.837  1.00 12.50 ? 356 PHE A C   1 
ATOM   2824  O  O   . PHE A 1 356 ? 9.141   41.225  75.584  1.00 12.55 ? 356 PHE A O   1 
ATOM   2825  C  CB  . PHE A 1 356 ? 8.774   44.245  74.116  1.00 12.05 ? 356 PHE A CB  1 
ATOM   2826  C  CG  . PHE A 1 356 ? 10.165  43.786  73.745  1.00 11.31 ? 356 PHE A CG  1 
ATOM   2827  C  CD1 . PHE A 1 356 ? 10.373  42.979  72.635  1.00 10.93 ? 356 PHE A CD1 1 
ATOM   2828  C  CD2 . PHE A 1 356 ? 11.265  44.160  74.510  1.00 10.97 ? 356 PHE A CD2 1 
ATOM   2829  C  CE1 . PHE A 1 356 ? 11.652  42.551  72.298  1.00 10.68 ? 356 PHE A CE1 1 
ATOM   2830  C  CE2 . PHE A 1 356 ? 12.547  43.733  74.175  1.00 10.68 ? 356 PHE A CE2 1 
ATOM   2831  C  CZ  . PHE A 1 356 ? 12.741  42.928  73.069  1.00 10.47 ? 356 PHE A CZ  1 
ATOM   2832  N  N   . ALA A 1 357 ? 9.365   43.039  76.898  1.00 12.27 ? 357 ALA A N   1 
ATOM   2833  C  CA  . ALA A 1 357 ? 10.272  42.411  77.853  1.00 12.12 ? 357 ALA A CA  1 
ATOM   2834  C  C   . ALA A 1 357 ? 9.954   40.970  78.265  1.00 11.88 ? 357 ALA A C   1 
ATOM   2835  O  O   . ALA A 1 357 ? 10.837  40.111  78.259  1.00 11.65 ? 357 ALA A O   1 
ATOM   2836  C  CB  . ALA A 1 357 ? 10.374  43.289  79.099  1.00 12.14 ? 357 ALA A CB  1 
ATOM   2837  N  N   . TYR A 1 358 ? 8.700   40.710  78.624  1.00 12.27 ? 358 TYR A N   1 
ATOM   2838  C  CA  . TYR A 1 358 ? 8.285   39.381  79.077  1.00 12.40 ? 358 TYR A CA  1 
ATOM   2839  C  C   . TYR A 1 358 ? 8.324   38.271  78.037  1.00 12.41 ? 358 TYR A C   1 
ATOM   2840  O  O   . TYR A 1 358 ? 8.982   37.249  78.242  1.00 12.81 ? 358 TYR A O   1 
ATOM   2841  C  CB  . TYR A 1 358 ? 6.892   39.457  79.694  1.00 12.50 ? 358 TYR A CB  1 
ATOM   2842  C  CG  . TYR A 1 358 ? 6.878   40.208  81.005  1.00 12.80 ? 358 TYR A CG  1 
ATOM   2843  C  CD1 . TYR A 1 358 ? 7.177   41.568  81.054  1.00 12.97 ? 358 TYR A CD1 1 
ATOM   2844  C  CD2 . TYR A 1 358 ? 6.588   39.557  82.199  1.00 12.81 ? 358 TYR A CD2 1 
ATOM   2845  C  CE1 . TYR A 1 358 ? 7.193   42.256  82.263  1.00 13.34 ? 358 TYR A CE1 1 
ATOM   2846  C  CE2 . TYR A 1 358 ? 6.602   40.238  83.409  1.00 13.18 ? 358 TYR A CE2 1 
ATOM   2847  C  CZ  . TYR A 1 358 ? 6.908   41.585  83.437  1.00 13.38 ? 358 TYR A CZ  1 
ATOM   2848  O  OH  . TYR A 1 358 ? 6.962   42.249  84.648  1.00 12.89 ? 358 TYR A OH  1 
ATOM   2849  N  N   . PRO A 1 359 ? 7.627   38.452  76.906  1.00 12.09 ? 359 PRO A N   1 
ATOM   2850  C  CA  . PRO A 1 359 ? 7.662   37.384  75.904  1.00 11.72 ? 359 PRO A CA  1 
ATOM   2851  C  C   . PRO A 1 359 ? 9.086   37.185  75.399  1.00 11.55 ? 359 PRO A C   1 
ATOM   2852  O  O   . PRO A 1 359 ? 9.500   36.074  75.072  1.00 11.09 ? 359 PRO A O   1 
ATOM   2853  C  CB  . PRO A 1 359 ? 6.726   37.883  74.803  1.00 11.84 ? 359 PRO A CB  1 
ATOM   2854  C  CG  . PRO A 1 359 ? 5.946   39.009  75.409  1.00 11.97 ? 359 PRO A CG  1 
ATOM   2855  C  CD  . PRO A 1 359 ? 6.812   39.599  76.472  1.00 12.09 ? 359 PRO A CD  1 
ATOM   2856  N  N   . ASP A 1 360 ? 9.833   38.280  75.354  1.00 11.53 ? 360 ASP A N   1 
ATOM   2857  C  CA  . ASP A 1 360 ? 11.209  38.249  74.883  1.00 11.89 ? 360 ASP A CA  1 
ATOM   2858  C  C   . ASP A 1 360 ? 12.128  37.431  75.771  1.00 11.95 ? 360 ASP A C   1 
ATOM   2859  O  O   . ASP A 1 360 ? 12.949  36.652  75.285  1.00 12.14 ? 360 ASP A O   1 
ATOM   2860  C  CB  . ASP A 1 360 ? 11.774  39.661  74.781  1.00 11.79 ? 360 ASP A CB  1 
ATOM   2861  C  CG  . ASP A 1 360 ? 13.231  39.664  74.394  1.00 11.92 ? 360 ASP A CG  1 
ATOM   2862  O  OD1 . ASP A 1 360 ? 13.533  39.246  73.257  1.00 12.29 ? 360 ASP A OD1 1 
ATOM   2863  O  OD2 . ASP A 1 360 ? 14.072  40.075  75.221  1.00 11.78 ? 360 ASP A OD2 1 
ATOM   2864  N  N   . THR A 1 361 ? 11.999  37.617  77.076  1.00 11.93 ? 361 THR A N   1 
ATOM   2865  C  CA  . THR A 1 361 ? 12.837  36.891  78.013  1.00 12.10 ? 361 THR A CA  1 
ATOM   2866  C  C   . THR A 1 361 ? 12.412  35.433  78.156  1.00 12.01 ? 361 THR A C   1 
ATOM   2867  O  O   . THR A 1 361 ? 13.235  34.562  78.438  1.00 11.62 ? 361 THR A O   1 
ATOM   2868  C  CB  . THR A 1 361 ? 12.809  37.544  79.395  1.00 12.29 ? 361 THR A CB  1 
ATOM   2869  O  OG1 . THR A 1 361 ? 13.865  36.998  80.195  1.00 12.44 ? 361 THR A OG1 1 
ATOM   2870  C  CG2 . THR A 1 361 ? 11.466  37.295  80.074  1.00 12.74 ? 361 THR A CG2 1 
ATOM   2871  N  N   . HIS A 1 362 ? 11.128  35.165  77.960  1.00 11.87 ? 362 HIS A N   1 
ATOM   2872  C  CA  . HIS A 1 362 ? 10.640  33.804  78.084  1.00 12.27 ? 362 HIS A CA  1 
ATOM   2873  C  C   . HIS A 1 362 ? 11.256  32.894  77.023  1.00 12.58 ? 362 HIS A C   1 
ATOM   2874  O  O   . HIS A 1 362 ? 11.557  31.720  77.286  1.00 12.71 ? 362 HIS A O   1 
ATOM   2875  C  CB  . HIS A 1 362 ? 9.117   33.787  77.990  1.00 12.11 ? 362 HIS A CB  1 
ATOM   2876  C  CG  . HIS A 1 362 ? 8.435   34.329  79.208  1.00 12.07 ? 362 HIS A CG  1 
ATOM   2877  N  ND1 . HIS A 1 362 ? 7.248   35.027  79.151  1.00 11.96 ? 362 HIS A ND1 1 
ATOM   2878  C  CD2 . HIS A 1 362 ? 8.782   34.283  80.517  1.00 12.08 ? 362 HIS A CD2 1 
ATOM   2879  C  CE1 . HIS A 1 362 ? 6.893   35.387  80.370  1.00 12.02 ? 362 HIS A CE1 1 
ATOM   2880  N  NE2 . HIS A 1 362 ? 7.806   34.949  81.218  1.00 12.23 ? 362 HIS A NE2 1 
ATOM   2881  N  N   . ARG A 1 363 ? 11.458  33.445  75.829  1.00 12.77 ? 363 ARG A N   1 
ATOM   2882  C  CA  . ARG A 1 363 ? 12.039  32.695  74.728  1.00 12.38 ? 363 ARG A CA  1 
ATOM   2883  C  C   . ARG A 1 363 ? 13.510  32.379  74.984  1.00 12.21 ? 363 ARG A C   1 
ATOM   2884  O  O   . ARG A 1 363 ? 14.105  31.551  74.297  1.00 12.31 ? 363 ARG A O   1 
ATOM   2885  C  CB  . ARG A 1 363 ? 11.887  33.488  73.437  1.00 12.82 ? 363 ARG A CB  1 
ATOM   2886  C  CG  . ARG A 1 363 ? 10.441  33.787  73.092  1.00 13.03 ? 363 ARG A CG  1 
ATOM   2887  C  CD  . ARG A 1 363 ? 10.341  34.670  71.866  1.00 13.14 ? 363 ARG A CD  1 
ATOM   2888  N  NE  . ARG A 1 363 ? 8.982   35.158  71.669  1.00 13.19 ? 363 ARG A NE  1 
ATOM   2889  C  CZ  . ARG A 1 363 ? 8.665   36.441  71.553  1.00 13.22 ? 363 ARG A CZ  1 
ATOM   2890  N  NH1 . ARG A 1 363 ? 9.614   37.366  71.612  1.00 13.21 ? 363 ARG A NH1 1 
ATOM   2891  N  NH2 . ARG A 1 363 ? 7.400   36.797  71.377  1.00 13.39 ? 363 ARG A NH2 1 
ATOM   2892  N  N   . HIS A 1 364 ? 14.094  33.044  75.974  1.00 12.24 ? 364 HIS A N   1 
ATOM   2893  C  CA  . HIS A 1 364 ? 15.492  32.813  76.316  1.00 12.02 ? 364 HIS A CA  1 
ATOM   2894  C  C   . HIS A 1 364 ? 15.579  31.876  77.509  1.00 12.00 ? 364 HIS A C   1 
ATOM   2895  O  O   . HIS A 1 364 ? 16.348  30.914  77.499  1.00 11.98 ? 364 HIS A O   1 
ATOM   2896  C  CB  . HIS A 1 364 ? 16.196  34.129  76.659  1.00 11.97 ? 364 HIS A CB  1 
ATOM   2897  C  CG  . HIS A 1 364 ? 17.398  33.959  77.540  1.00 12.03 ? 364 HIS A CG  1 
ATOM   2898  N  ND1 . HIS A 1 364 ? 18.604  33.483  77.072  1.00 11.99 ? 364 HIS A ND1 1 
ATOM   2899  C  CD2 . HIS A 1 364 ? 17.574  34.190  78.863  1.00 12.09 ? 364 HIS A CD2 1 
ATOM   2900  C  CE1 . HIS A 1 364 ? 19.471  33.428  78.068  1.00 11.98 ? 364 HIS A CE1 1 
ATOM   2901  N  NE2 . HIS A 1 364 ? 18.872  33.852  79.166  1.00 12.07 ? 364 HIS A NE2 1 
ATOM   2902  N  N   . ARG A 1 365 ? 14.792  32.165  78.539  1.00 11.67 ? 365 ARG A N   1 
ATOM   2903  C  CA  . ARG A 1 365 ? 14.790  31.349  79.746  1.00 11.71 ? 365 ARG A CA  1 
ATOM   2904  C  C   . ARG A 1 365 ? 14.254  29.932  79.514  1.00 11.91 ? 365 ARG A C   1 
ATOM   2905  O  O   . ARG A 1 365 ? 14.871  28.950  79.945  1.00 11.71 ? 365 ARG A O   1 
ATOM   2906  C  CB  . ARG A 1 365 ? 13.965  32.029  80.843  1.00 11.32 ? 365 ARG A CB  1 
ATOM   2907  C  CG  . ARG A 1 365 ? 13.961  31.275  82.160  1.00 10.80 ? 365 ARG A CG  1 
ATOM   2908  C  CD  . ARG A 1 365 ? 13.351  32.097  83.281  1.00 10.26 ? 365 ARG A CD  1 
ATOM   2909  N  NE  . ARG A 1 365 ? 11.906  32.242  83.134  1.00 9.34  ? 365 ARG A NE  1 
ATOM   2910  C  CZ  . ARG A 1 365 ? 11.008  31.460  83.722  1.00 8.82  ? 365 ARG A CZ  1 
ATOM   2911  N  NH1 . ARG A 1 365 ? 11.402  30.470  84.502  1.00 9.05  ? 365 ARG A NH1 1 
ATOM   2912  N  NH2 . ARG A 1 365 ? 9.714   31.668  83.533  1.00 7.78  ? 365 ARG A NH2 1 
ATOM   2913  N  N   . LEU A 1 366 ? 13.115  29.828  78.831  1.00 11.96 ? 366 LEU A N   1 
ATOM   2914  C  CA  . LEU A 1 366 ? 12.499  28.527  78.576  1.00 12.18 ? 366 LEU A CA  1 
ATOM   2915  C  C   . LEU A 1 366 ? 12.682  28.038  77.149  1.00 12.24 ? 366 LEU A C   1 
ATOM   2916  O  O   . LEU A 1 366 ? 12.970  26.863  76.919  1.00 12.49 ? 366 LEU A O   1 
ATOM   2917  C  CB  . LEU A 1 366 ? 11.001  28.574  78.899  1.00 11.85 ? 366 LEU A CB  1 
ATOM   2918  C  CG  . LEU A 1 366 ? 10.587  29.225  80.219  1.00 11.58 ? 366 LEU A CG  1 
ATOM   2919  C  CD1 . LEU A 1 366 ? 9.117   29.600  80.160  1.00 11.17 ? 366 LEU A CD1 1 
ATOM   2920  C  CD2 . LEU A 1 366 ? 10.862  28.269  81.370  1.00 11.32 ? 366 LEU A CD2 1 
ATOM   2921  N  N   . GLY A 1 367 ? 12.504  28.938  76.192  1.00 12.30 ? 367 GLY A N   1 
ATOM   2922  C  CA  . GLY A 1 367 ? 12.647  28.556  74.803  1.00 12.24 ? 367 GLY A CA  1 
ATOM   2923  C  C   . GLY A 1 367 ? 11.646  29.273  73.920  1.00 12.08 ? 367 GLY A C   1 
ATOM   2924  O  O   . GLY A 1 367 ? 10.683  29.854  74.420  1.00 12.06 ? 367 GLY A O   1 
ATOM   2925  N  N   . PRO A 1 368 ? 11.843  29.240  72.593  1.00 12.06 ? 368 PRO A N   1 
ATOM   2926  C  CA  . PRO A 1 368 ? 10.943  29.902  71.646  1.00 12.14 ? 368 PRO A CA  1 
ATOM   2927  C  C   . PRO A 1 368 ? 9.543   29.302  71.602  1.00 12.24 ? 368 PRO A C   1 
ATOM   2928  O  O   . PRO A 1 368 ? 8.591   29.973  71.208  1.00 12.38 ? 368 PRO A O   1 
ATOM   2929  C  CB  . PRO A 1 368 ? 11.668  29.770  70.305  1.00 12.06 ? 368 PRO A CB  1 
ATOM   2930  C  CG  . PRO A 1 368 ? 13.071  29.340  70.644  1.00 11.98 ? 368 PRO A CG  1 
ATOM   2931  C  CD  . PRO A 1 368 ? 12.948  28.557  71.902  1.00 12.03 ? 368 PRO A CD  1 
ATOM   2932  N  N   . ASN A 1 369 ? 9.426   28.039  72.004  1.00 12.34 ? 369 ASN A N   1 
ATOM   2933  C  CA  . ASN A 1 369 ? 8.140   27.348  72.005  1.00 12.29 ? 369 ASN A CA  1 
ATOM   2934  C  C   . ASN A 1 369 ? 7.698   27.063  73.430  1.00 12.24 ? 369 ASN A C   1 
ATOM   2935  O  O   . ASN A 1 369 ? 7.204   25.973  73.717  1.00 12.27 ? 369 ASN A O   1 
ATOM   2936  C  CB  . ASN A 1 369 ? 8.255   26.024  71.249  1.00 12.16 ? 369 ASN A CB  1 
ATOM   2937  C  CG  . ASN A 1 369 ? 8.169   26.197  69.748  1.00 12.04 ? 369 ASN A CG  1 
ATOM   2938  O  OD1 . ASN A 1 369 ? 7.713   27.228  69.257  1.00 11.76 ? 369 ASN A OD1 1 
ATOM   2939  N  ND2 . ASN A 1 369 ? 8.610   25.184  69.010  1.00 12.00 ? 369 ASN A ND2 1 
ATOM   2940  N  N   . TYR A 1 370 ? 7.870   28.042  74.317  1.00 12.15 ? 370 TYR A N   1 
ATOM   2941  C  CA  . TYR A 1 370 ? 7.510   27.863  75.722  1.00 12.18 ? 370 TYR A CA  1 
ATOM   2942  C  C   . TYR A 1 370 ? 6.011   27.818  75.955  1.00 12.17 ? 370 TYR A C   1 
ATOM   2943  O  O   . TYR A 1 370 ? 5.553   27.410  77.027  1.00 11.78 ? 370 TYR A O   1 
ATOM   2944  C  CB  . TYR A 1 370 ? 8.133   28.970  76.582  1.00 12.36 ? 370 TYR A CB  1 
ATOM   2945  C  CG  . TYR A 1 370 ? 7.536   30.347  76.377  1.00 12.50 ? 370 TYR A CG  1 
ATOM   2946  C  CD1 . TYR A 1 370 ? 6.400   30.750  77.080  1.00 12.48 ? 370 TYR A CD1 1 
ATOM   2947  C  CD2 . TYR A 1 370 ? 8.120   31.253  75.496  1.00 12.57 ? 370 TYR A CD2 1 
ATOM   2948  C  CE1 . TYR A 1 370 ? 5.863   32.019  76.912  1.00 12.43 ? 370 TYR A CE1 1 
ATOM   2949  C  CE2 . TYR A 1 370 ? 7.590   32.525  75.322  1.00 12.54 ? 370 TYR A CE2 1 
ATOM   2950  C  CZ  . TYR A 1 370 ? 6.462   32.903  76.032  1.00 12.48 ? 370 TYR A CZ  1 
ATOM   2951  O  OH  . TYR A 1 370 ? 5.937   34.167  75.860  1.00 12.48 ? 370 TYR A OH  1 
ATOM   2952  N  N   . LEU A 1 371 ? 5.249   28.238  74.949  1.00 12.33 ? 371 LEU A N   1 
ATOM   2953  C  CA  . LEU A 1 371 ? 3.802   28.239  75.061  1.00 12.50 ? 371 LEU A CA  1 
ATOM   2954  C  C   . LEU A 1 371 ? 3.285   26.827  74.843  1.00 12.95 ? 371 LEU A C   1 
ATOM   2955  O  O   . LEU A 1 371 ? 2.076   26.586  74.847  1.00 13.21 ? 371 LEU A O   1 
ATOM   2956  C  CB  . LEU A 1 371 ? 3.193   29.198  74.043  1.00 12.27 ? 371 LEU A CB  1 
ATOM   2957  C  CG  . LEU A 1 371 ? 3.442   30.683  74.340  1.00 12.16 ? 371 LEU A CG  1 
ATOM   2958  C  CD1 . LEU A 1 371 ? 3.290   31.501  73.062  1.00 12.00 ? 371 LEU A CD1 1 
ATOM   2959  C  CD2 . LEU A 1 371 ? 2.471   31.169  75.405  1.00 12.11 ? 371 LEU A CD2 1 
ATOM   2960  N  N   . HIS A 1 372 ? 4.211   25.890  74.662  1.00 13.07 ? 372 HIS A N   1 
ATOM   2961  C  CA  . HIS A 1 372 ? 3.854   24.494  74.459  1.00 13.35 ? 372 HIS A CA  1 
ATOM   2962  C  C   . HIS A 1 372 ? 3.898   23.750  75.787  1.00 13.28 ? 372 HIS A C   1 
ATOM   2963  O  O   . HIS A 1 372 ? 3.332   22.665  75.924  1.00 13.44 ? 372 HIS A O   1 
ATOM   2964  C  CB  . HIS A 1 372 ? 4.805   23.844  73.456  1.00 13.64 ? 372 HIS A CB  1 
ATOM   2965  C  CG  . HIS A 1 372 ? 4.525   24.222  72.034  1.00 13.73 ? 372 HIS A CG  1 
ATOM   2966  N  ND1 . HIS A 1 372 ? 5.178   23.643  70.967  1.00 13.77 ? 372 HIS A ND1 1 
ATOM   2967  C  CD2 . HIS A 1 372 ? 3.673   25.132  71.504  1.00 13.80 ? 372 HIS A CD2 1 
ATOM   2968  C  CE1 . HIS A 1 372 ? 4.741   24.180  69.841  1.00 13.87 ? 372 HIS A CE1 1 
ATOM   2969  N  NE2 . HIS A 1 372 ? 3.827   25.087  70.140  1.00 13.88 ? 372 HIS A NE2 1 
ATOM   2970  N  N   . ILE A 1 373 ? 4.580   24.334  76.768  1.00 13.06 ? 373 ILE A N   1 
ATOM   2971  C  CA  . ILE A 1 373 ? 4.652   23.730  78.095  1.00 12.61 ? 373 ILE A CA  1 
ATOM   2972  C  C   . ILE A 1 373 ? 3.237   23.764  78.679  1.00 12.54 ? 373 ILE A C   1 
ATOM   2973  O  O   . ILE A 1 373 ? 2.615   24.824  78.756  1.00 12.48 ? 373 ILE A O   1 
ATOM   2974  C  CB  . ILE A 1 373 ? 5.575   24.530  79.032  1.00 12.42 ? 373 ILE A CB  1 
ATOM   2975  C  CG1 . ILE A 1 373 ? 7.012   24.493  78.515  1.00 12.36 ? 373 ILE A CG1 1 
ATOM   2976  C  CG2 . ILE A 1 373 ? 5.498   23.969  80.438  1.00 12.09 ? 373 ILE A CG2 1 
ATOM   2977  C  CD1 . ILE A 1 373 ? 7.959   25.394  79.290  1.00 12.24 ? 373 ILE A CD1 1 
ATOM   2978  N  N   . PRO A 1 374 ? 2.715   22.602  79.096  1.00 12.44 ? 374 PRO A N   1 
ATOM   2979  C  CA  . PRO A 1 374 ? 1.379   22.449  79.679  1.00 12.41 ? 374 PRO A CA  1 
ATOM   2980  C  C   . PRO A 1 374 ? 0.825   23.663  80.432  1.00 12.46 ? 374 PRO A C   1 
ATOM   2981  O  O   . PRO A 1 374 ? -0.164  24.264  80.011  1.00 12.48 ? 374 PRO A O   1 
ATOM   2982  C  CB  . PRO A 1 374 ? 1.534   21.239  80.589  1.00 12.40 ? 374 PRO A CB  1 
ATOM   2983  C  CG  . PRO A 1 374 ? 2.591   20.411  79.922  1.00 12.36 ? 374 PRO A CG  1 
ATOM   2984  C  CD  . PRO A 1 374 ? 3.420   21.311  79.027  1.00 12.43 ? 374 PRO A CD  1 
ATOM   2985  N  N   . VAL A 1 375 ? 1.458   24.017  81.546  1.00 12.51 ? 375 VAL A N   1 
ATOM   2986  C  CA  . VAL A 1 375 ? 1.009   25.154  82.354  1.00 12.53 ? 375 VAL A CA  1 
ATOM   2987  C  C   . VAL A 1 375 ? 0.802   26.423  81.539  1.00 12.29 ? 375 VAL A C   1 
ATOM   2988  O  O   . VAL A 1 375 ? -0.126  27.191  81.795  1.00 12.20 ? 375 VAL A O   1 
ATOM   2989  C  CB  . VAL A 1 375 ? 2.015   25.491  83.479  1.00 12.77 ? 375 VAL A CB  1 
ATOM   2990  C  CG1 . VAL A 1 375 ? 1.446   25.076  84.827  1.00 13.00 ? 375 VAL A CG1 1 
ATOM   2991  C  CG2 . VAL A 1 375 ? 3.349   24.805  83.215  1.00 13.20 ? 375 VAL A CG2 1 
ATOM   2992  N  N   . ASN A 1 376 ? 1.670   26.636  80.556  1.00 12.20 ? 376 ASN A N   1 
ATOM   2993  C  CA  . ASN A 1 376 ? 1.603   27.828  79.725  1.00 12.15 ? 376 ASN A CA  1 
ATOM   2994  C  C   . ASN A 1 376 ? 0.644   27.714  78.542  1.00 12.37 ? 376 ASN A C   1 
ATOM   2995  O  O   . ASN A 1 376 ? 0.088   28.717  78.092  1.00 12.23 ? 376 ASN A O   1 
ATOM   2996  C  CB  . ASN A 1 376 ? 3.009   28.184  79.226  1.00 11.92 ? 376 ASN A CB  1 
ATOM   2997  C  CG  . ASN A 1 376 ? 3.985   28.459  80.364  1.00 11.71 ? 376 ASN A CG  1 
ATOM   2998  O  OD1 . ASN A 1 376 ? 3.649   29.122  81.343  1.00 11.10 ? 376 ASN A OD1 1 
ATOM   2999  N  ND2 . ASN A 1 376 ? 5.200   27.950  80.233  1.00 11.93 ? 376 ASN A ND2 1 
ATOM   3000  N  N   . CYS A 1 377 ? 0.453   26.500  78.036  1.00 12.83 ? 377 CYS A N   1 
ATOM   3001  C  CA  . CYS A 1 377 ? -0.436  26.280  76.898  1.00 13.24 ? 377 CYS A CA  1 
ATOM   3002  C  C   . CYS A 1 377 ? -1.864  26.685  77.253  1.00 13.42 ? 377 CYS A C   1 
ATOM   3003  O  O   . CYS A 1 377 ? -2.362  26.347  78.326  1.00 13.77 ? 377 CYS A O   1 
ATOM   3004  C  CB  . CYS A 1 377 ? -0.399  24.803  76.476  1.00 13.41 ? 377 CYS A CB  1 
ATOM   3005  S  SG  . CYS A 1 377 ? -1.811  24.209  75.490  1.00 13.93 ? 377 CYS A SG  1 
ATOM   3006  N  N   . PRO A 1 378 ? -2.534  27.433  76.361  1.00 13.38 ? 378 PRO A N   1 
ATOM   3007  C  CA  . PRO A 1 378 ? -3.913  27.891  76.562  1.00 13.34 ? 378 PRO A CA  1 
ATOM   3008  C  C   . PRO A 1 378 ? -4.893  26.792  76.148  1.00 13.37 ? 378 PRO A C   1 
ATOM   3009  O  O   . PRO A 1 378 ? -5.540  26.891  75.107  1.00 13.42 ? 378 PRO A O   1 
ATOM   3010  C  CB  . PRO A 1 378 ? -4.014  29.100  75.647  1.00 13.40 ? 378 PRO A CB  1 
ATOM   3011  C  CG  . PRO A 1 378 ? -3.115  28.751  74.504  1.00 13.32 ? 378 PRO A CG  1 
ATOM   3012  C  CD  . PRO A 1 378 ? -1.992  27.905  75.074  1.00 13.41 ? 378 PRO A CD  1 
ATOM   3013  N  N   . TYR A 1 379 ? -4.995  25.751  76.965  1.00 13.40 ? 379 TYR A N   1 
ATOM   3014  C  CA  . TYR A 1 379 ? -5.867  24.616  76.674  1.00 13.30 ? 379 TYR A CA  1 
ATOM   3015  C  C   . TYR A 1 379 ? -7.350  24.944  76.527  1.00 12.95 ? 379 TYR A C   1 
ATOM   3016  O  O   . TYR A 1 379 ? -8.077  24.236  75.833  1.00 12.92 ? 379 TYR A O   1 
ATOM   3017  C  CB  . TYR A 1 379 ? -5.695  23.538  77.748  1.00 13.57 ? 379 TYR A CB  1 
ATOM   3018  C  CG  . TYR A 1 379 ? -6.183  23.938  79.131  1.00 13.79 ? 379 TYR A CG  1 
ATOM   3019  C  CD1 . TYR A 1 379 ? -7.430  23.519  79.606  1.00 13.87 ? 379 TYR A CD1 1 
ATOM   3020  C  CD2 . TYR A 1 379 ? -5.379  24.699  79.980  1.00 13.87 ? 379 TYR A CD2 1 
ATOM   3021  C  CE1 . TYR A 1 379 ? -7.860  23.844  80.895  1.00 13.72 ? 379 TYR A CE1 1 
ATOM   3022  C  CE2 . TYR A 1 379 ? -5.799  25.029  81.267  1.00 13.71 ? 379 TYR A CE2 1 
ATOM   3023  C  CZ  . TYR A 1 379 ? -7.036  24.600  81.721  1.00 13.67 ? 379 TYR A CZ  1 
ATOM   3024  O  OH  . TYR A 1 379 ? -7.434  24.925  82.999  1.00 13.35 ? 379 TYR A OH  1 
ATOM   3025  N  N   . ARG A 1 380 ? -7.804  26.006  77.184  1.00 12.85 ? 380 ARG A N   1 
ATOM   3026  C  CA  . ARG A 1 380 ? -9.213  26.387  77.108  1.00 12.55 ? 380 ARG A CA  1 
ATOM   3027  C  C   . ARG A 1 380 ? -9.513  27.183  75.844  1.00 12.23 ? 380 ARG A C   1 
ATOM   3028  O  O   . ARG A 1 380 ? -10.577 27.782  75.709  1.00 12.20 ? 380 ARG A O   1 
ATOM   3029  C  CB  . ARG A 1 380 ? -9.611  27.200  78.342  1.00 12.76 ? 380 ARG A CB  1 
ATOM   3030  C  CG  . ARG A 1 380 ? -9.537  26.414  79.641  1.00 13.03 ? 380 ARG A CG  1 
ATOM   3031  C  CD  . ARG A 1 380 ? -10.832 25.665  79.911  1.00 13.29 ? 380 ARG A CD  1 
ATOM   3032  N  NE  . ARG A 1 380 ? -12.006 26.506  79.695  1.00 13.32 ? 380 ARG A NE  1 
ATOM   3033  C  CZ  . ARG A 1 380 ? -12.235 27.649  80.337  1.00 13.47 ? 380 ARG A CZ  1 
ATOM   3034  N  NH1 . ARG A 1 380 ? -11.365 28.093  81.241  1.00 13.61 ? 380 ARG A NH1 1 
ATOM   3035  N  NH2 . ARG A 1 380 ? -13.335 28.352  80.080  1.00 13.34 ? 380 ARG A NH2 1 
ATOM   3036  N  N   . ALA A 1 381 ? -8.566  27.183  74.917  1.00 11.99 ? 381 ALA A N   1 
ATOM   3037  C  CA  . ALA A 1 381 ? -8.731  27.890  73.658  1.00 11.62 ? 381 ALA A CA  1 
ATOM   3038  C  C   . ALA A 1 381 ? -8.164  27.028  72.540  1.00 11.60 ? 381 ALA A C   1 
ATOM   3039  O  O   . ALA A 1 381 ? -7.465  26.043  72.791  1.00 11.51 ? 381 ALA A O   1 
ATOM   3040  C  CB  . ALA A 1 381 ? -8.010  29.235  73.706  1.00 11.55 ? 381 ALA A CB  1 
ATOM   3041  N  N   . ARG A 1 382 ? -8.473  27.403  71.304  1.00 11.70 ? 382 ARG A N   1 
ATOM   3042  C  CA  . ARG A 1 382 ? -7.995  26.669  70.143  1.00 11.78 ? 382 ARG A CA  1 
ATOM   3043  C  C   . ARG A 1 382 ? -6.941  27.477  69.389  1.00 11.65 ? 382 ARG A C   1 
ATOM   3044  O  O   . ARG A 1 382 ? -7.249  28.483  68.746  1.00 11.34 ? 382 ARG A O   1 
ATOM   3045  C  CB  . ARG A 1 382 ? -9.170  26.337  69.223  1.00 12.15 ? 382 ARG A CB  1 
ATOM   3046  C  CG  . ARG A 1 382 ? -8.776  26.044  67.782  1.00 12.74 ? 382 ARG A CG  1 
ATOM   3047  C  CD  . ARG A 1 382 ? -8.056  24.705  67.651  1.00 12.88 ? 382 ARG A CD  1 
ATOM   3048  N  NE  . ARG A 1 382 ? -8.771  23.797  66.755  1.00 12.82 ? 382 ARG A NE  1 
ATOM   3049  C  CZ  . ARG A 1 382 ? -9.829  23.078  67.115  1.00 12.77 ? 382 ARG A CZ  1 
ATOM   3050  N  NH1 . ARG A 1 382 ? -10.297 23.159  68.354  1.00 12.50 ? 382 ARG A NH1 1 
ATOM   3051  N  NH2 . ARG A 1 382 ? -10.423 22.283  66.234  1.00 12.96 ? 382 ARG A NH2 1 
ATOM   3052  N  N   . VAL A 1 383 ? -5.692  27.035  69.480  1.00 11.66 ? 383 VAL A N   1 
ATOM   3053  C  CA  . VAL A 1 383 ? -4.600  27.717  68.799  1.00 11.81 ? 383 VAL A CA  1 
ATOM   3054  C  C   . VAL A 1 383 ? -4.573  27.298  67.334  1.00 12.12 ? 383 VAL A C   1 
ATOM   3055  O  O   . VAL A 1 383 ? -4.451  26.115  67.011  1.00 12.24 ? 383 VAL A O   1 
ATOM   3056  C  CB  . VAL A 1 383 ? -3.237  27.391  69.451  1.00 11.61 ? 383 VAL A CB  1 
ATOM   3057  C  CG1 . VAL A 1 383 ? -2.119  28.108  68.709  1.00 11.44 ? 383 VAL A CG1 1 
ATOM   3058  C  CG2 . VAL A 1 383 ? -3.251  27.801  70.916  1.00 11.46 ? 383 VAL A CG2 1 
ATOM   3059  N  N   . ALA A 1 384 ? -4.696  28.278  66.449  1.00 12.39 ? 384 ALA A N   1 
ATOM   3060  C  CA  . ALA A 1 384 ? -4.691  28.016  65.018  1.00 12.61 ? 384 ALA A CA  1 
ATOM   3061  C  C   . ALA A 1 384 ? -4.232  29.266  64.282  1.00 12.70 ? 384 ALA A C   1 
ATOM   3062  O  O   . ALA A 1 384 ? -4.980  30.242  64.179  1.00 13.09 ? 384 ALA A O   1 
ATOM   3063  C  CB  . ALA A 1 384 ? -6.091  27.614  64.557  1.00 12.47 ? 384 ALA A CB  1 
ATOM   3064  N  N   . ASN A 1 385 ? -3.002  29.235  63.777  1.00 12.43 ? 385 ASN A N   1 
ATOM   3065  C  CA  . ASN A 1 385 ? -2.444  30.372  63.055  1.00 12.21 ? 385 ASN A CA  1 
ATOM   3066  C  C   . ASN A 1 385 ? -1.568  29.929  61.885  1.00 12.18 ? 385 ASN A C   1 
ATOM   3067  O  O   . ASN A 1 385 ? -1.893  28.974  61.179  1.00 11.89 ? 385 ASN A O   1 
ATOM   3068  C  CB  . ASN A 1 385 ? -1.630  31.250  64.009  1.00 12.06 ? 385 ASN A CB  1 
ATOM   3069  C  CG  . ASN A 1 385 ? -0.626  30.453  64.826  1.00 11.95 ? 385 ASN A CG  1 
ATOM   3070  O  OD1 . ASN A 1 385 ? -0.034  29.484  64.342  1.00 11.47 ? 385 ASN A OD1 1 
ATOM   3071  N  ND2 . ASN A 1 385 ? -0.430  30.862  66.077  1.00 12.36 ? 385 ASN A ND2 1 
ATOM   3072  N  N   . TYR A 1 386 ? -0.460  30.630  61.675  1.00 12.20 ? 386 TYR A N   1 
ATOM   3073  C  CA  . TYR A 1 386 ? 0.447   30.289  60.591  1.00 12.22 ? 386 TYR A CA  1 
ATOM   3074  C  C   . TYR A 1 386 ? 1.882   30.217  61.076  1.00 12.13 ? 386 TYR A C   1 
ATOM   3075  O  O   . TYR A 1 386 ? 2.817   30.315  60.280  1.00 12.39 ? 386 TYR A O   1 
ATOM   3076  C  CB  . TYR A 1 386 ? 0.318   31.306  59.452  1.00 12.65 ? 386 TYR A CB  1 
ATOM   3077  C  CG  . TYR A 1 386 ? -1.067  31.328  58.854  1.00 12.76 ? 386 TYR A CG  1 
ATOM   3078  C  CD1 . TYR A 1 386 ? -1.989  32.312  59.212  1.00 12.78 ? 386 TYR A CD1 1 
ATOM   3079  C  CD2 . TYR A 1 386 ? -1.483  30.321  57.985  1.00 12.81 ? 386 TYR A CD2 1 
ATOM   3080  C  CE1 . TYR A 1 386 ? -3.298  32.289  58.721  1.00 12.57 ? 386 TYR A CE1 1 
ATOM   3081  C  CE2 . TYR A 1 386 ? -2.786  30.287  57.488  1.00 12.59 ? 386 TYR A CE2 1 
ATOM   3082  C  CZ  . TYR A 1 386 ? -3.689  31.273  57.862  1.00 12.51 ? 386 TYR A CZ  1 
ATOM   3083  O  OH  . TYR A 1 386 ? -4.979  31.234  57.384  1.00 12.12 ? 386 TYR A OH  1 
ATOM   3084  N  N   . GLN A 1 387 ? 2.048   30.049  62.386  1.00 11.86 ? 387 GLN A N   1 
ATOM   3085  C  CA  . GLN A 1 387 ? 3.375   29.933  62.983  1.00 11.67 ? 387 GLN A CA  1 
ATOM   3086  C  C   . GLN A 1 387 ? 3.730   28.457  62.871  1.00 11.25 ? 387 GLN A C   1 
ATOM   3087  O  O   . GLN A 1 387 ? 2.846   27.610  62.927  1.00 11.03 ? 387 GLN A O   1 
ATOM   3088  C  CB  . GLN A 1 387 ? 3.354   30.367  64.458  1.00 11.54 ? 387 GLN A CB  1 
ATOM   3089  C  CG  . GLN A 1 387 ? 2.657   31.700  64.713  1.00 12.00 ? 387 GLN A CG  1 
ATOM   3090  C  CD  . GLN A 1 387 ? 3.020   32.333  66.056  1.00 12.43 ? 387 GLN A CD  1 
ATOM   3091  O  OE1 . GLN A 1 387 ? 4.193   32.412  66.424  1.00 12.96 ? 387 GLN A OE1 1 
ATOM   3092  N  NE2 . GLN A 1 387 ? 2.008   32.793  66.789  1.00 12.59 ? 387 GLN A NE2 1 
ATOM   3093  N  N   . ARG A 1 388 ? 5.010   28.148  62.694  1.00 11.42 ? 388 ARG A N   1 
ATOM   3094  C  CA  . ARG A 1 388 ? 5.436   26.758  62.570  1.00 11.54 ? 388 ARG A CA  1 
ATOM   3095  C  C   . ARG A 1 388 ? 6.881   26.552  62.999  1.00 11.64 ? 388 ARG A C   1 
ATOM   3096  O  O   . ARG A 1 388 ? 7.631   27.512  63.194  1.00 11.77 ? 388 ARG A O   1 
ATOM   3097  C  CB  . ARG A 1 388 ? 5.293   26.269  61.121  1.00 11.70 ? 388 ARG A CB  1 
ATOM   3098  C  CG  . ARG A 1 388 ? 3.903   26.372  60.521  1.00 11.79 ? 388 ARG A CG  1 
ATOM   3099  C  CD  . ARG A 1 388 ? 2.996   25.244  60.984  1.00 11.82 ? 388 ARG A CD  1 
ATOM   3100  N  NE  . ARG A 1 388 ? 1.653   25.735  61.293  1.00 11.75 ? 388 ARG A NE  1 
ATOM   3101  C  CZ  . ARG A 1 388 ? 0.807   26.213  60.386  1.00 11.68 ? 388 ARG A CZ  1 
ATOM   3102  N  NH1 . ARG A 1 388 ? 1.159   26.264  59.111  1.00 11.50 ? 388 ARG A NH1 1 
ATOM   3103  N  NH2 . ARG A 1 388 ? -0.386  26.651  60.756  1.00 11.80 ? 388 ARG A NH2 1 
ATOM   3104  N  N   . ASP A 1 389 ? 7.249   25.278  63.139  1.00 11.64 ? 389 ASP A N   1 
ATOM   3105  C  CA  . ASP A 1 389 ? 8.596   24.864  63.508  1.00 11.32 ? 389 ASP A CA  1 
ATOM   3106  C  C   . ASP A 1 389 ? 9.077   25.431  64.838  1.00 11.47 ? 389 ASP A C   1 
ATOM   3107  O  O   . ASP A 1 389 ? 8.270   25.823  65.685  1.00 11.17 ? 389 ASP A O   1 
ATOM   3108  C  CB  . ASP A 1 389 ? 9.569   25.242  62.384  1.00 11.47 ? 389 ASP A CB  1 
ATOM   3109  C  CG  . ASP A 1 389 ? 9.362   24.407  61.122  1.00 11.50 ? 389 ASP A CG  1 
ATOM   3110  O  OD1 . ASP A 1 389 ? 8.253   23.865  60.931  1.00 11.62 ? 389 ASP A OD1 1 
ATOM   3111  O  OD2 . ASP A 1 389 ? 10.310  24.286  60.319  1.00 11.65 ? 389 ASP A OD2 1 
ATOM   3112  N  N   . GLY A 1 390 ? 10.397  25.461  65.014  1.00 11.64 ? 390 GLY A N   1 
ATOM   3113  C  CA  . GLY A 1 390 ? 10.985  25.967  66.243  1.00 11.96 ? 390 GLY A CA  1 
ATOM   3114  C  C   . GLY A 1 390 ? 11.523  24.819  67.076  1.00 12.14 ? 390 GLY A C   1 
ATOM   3115  O  O   . GLY A 1 390 ? 10.933  23.739  67.072  1.00 12.45 ? 390 GLY A O   1 
ATOM   3116  N  N   . PRO A 1 391 ? 12.638  25.012  67.804  1.00 12.00 ? 391 PRO A N   1 
ATOM   3117  C  CA  . PRO A 1 391 ? 13.203  23.934  68.626  1.00 11.84 ? 391 PRO A CA  1 
ATOM   3118  C  C   . PRO A 1 391 ? 12.169  23.321  69.559  1.00 11.76 ? 391 PRO A C   1 
ATOM   3119  O  O   . PRO A 1 391 ? 11.231  23.994  69.983  1.00 11.62 ? 391 PRO A O   1 
ATOM   3120  C  CB  . PRO A 1 391 ? 14.338  24.612  69.397  1.00 11.76 ? 391 PRO A CB  1 
ATOM   3121  C  CG  . PRO A 1 391 ? 14.106  26.082  69.239  1.00 11.85 ? 391 PRO A CG  1 
ATOM   3122  C  CD  . PRO A 1 391 ? 13.424  26.250  67.915  1.00 11.96 ? 391 PRO A CD  1 
ATOM   3123  N  N   . MET A 1 392 ? 12.338  22.040  69.866  1.00 11.92 ? 392 MET A N   1 
ATOM   3124  C  CA  . MET A 1 392 ? 11.416  21.345  70.757  1.00 12.20 ? 392 MET A CA  1 
ATOM   3125  C  C   . MET A 1 392 ? 9.984   21.662  70.348  1.00 12.03 ? 392 MET A C   1 
ATOM   3126  O  O   . MET A 1 392 ? 9.228   22.251  71.120  1.00 12.05 ? 392 MET A O   1 
ATOM   3127  C  CB  . MET A 1 392 ? 11.643  21.795  72.208  1.00 12.55 ? 392 MET A CB  1 
ATOM   3128  C  CG  . MET A 1 392 ? 12.970  21.341  72.818  1.00 13.04 ? 392 MET A CG  1 
ATOM   3129  S  SD  . MET A 1 392 ? 13.055  19.553  73.150  1.00 13.71 ? 392 MET A SD  1 
ATOM   3130  C  CE  . MET A 1 392 ? 11.315  19.168  73.543  1.00 12.95 ? 392 MET A CE  1 
ATOM   3131  N  N   . CYS A 1 393 ? 9.615   21.286  69.128  1.00 11.79 ? 393 CYS A N   1 
ATOM   3132  C  CA  . CYS A 1 393 ? 8.267   21.554  68.652  1.00 11.72 ? 393 CYS A CA  1 
ATOM   3133  C  C   . CYS A 1 393 ? 7.342   20.398  68.996  1.00 12.04 ? 393 CYS A C   1 
ATOM   3134  O  O   . CYS A 1 393 ? 7.340   19.363  68.324  1.00 12.07 ? 393 CYS A O   1 
ATOM   3135  C  CB  . CYS A 1 393 ? 8.264   21.790  67.140  1.00 11.23 ? 393 CYS A CB  1 
ATOM   3136  S  SG  . CYS A 1 393 ? 6.626   22.186  66.464  1.00 10.33 ? 393 CYS A SG  1 
ATOM   3137  N  N   . MET A 1 394 ? 6.558   20.584  70.054  1.00 12.32 ? 394 MET A N   1 
ATOM   3138  C  CA  . MET A 1 394 ? 5.617   19.565  70.500  1.00 12.59 ? 394 MET A CA  1 
ATOM   3139  C  C   . MET A 1 394 ? 4.355   19.608  69.660  1.00 12.78 ? 394 MET A C   1 
ATOM   3140  O  O   . MET A 1 394 ? 4.243   20.402  68.722  1.00 12.72 ? 394 MET A O   1 
ATOM   3141  C  CB  . MET A 1 394 ? 5.258   19.777  71.969  1.00 12.79 ? 394 MET A CB  1 
ATOM   3142  C  CG  . MET A 1 394 ? 5.872   18.753  72.906  1.00 13.06 ? 394 MET A CG  1 
ATOM   3143  S  SD  . MET A 1 394 ? 7.687   18.737  72.884  1.00 13.44 ? 394 MET A SD  1 
ATOM   3144  C  CE  . MET A 1 394 ? 8.042   20.493  72.871  1.00 13.45 ? 394 MET A CE  1 
ATOM   3145  N  N   . GLN A 1 395 ? 3.400   18.753  70.007  1.00 13.15 ? 395 GLN A N   1 
ATOM   3146  C  CA  . GLN A 1 395 ? 2.145   18.685  69.272  1.00 13.51 ? 395 GLN A CA  1 
ATOM   3147  C  C   . GLN A 1 395 ? 2.421   18.178  67.861  1.00 13.53 ? 395 GLN A C   1 
ATOM   3148  O  O   . GLN A 1 395 ? 3.320   17.360  67.652  1.00 13.51 ? 395 GLN A O   1 
ATOM   3149  C  CB  . GLN A 1 395 ? 1.489   20.068  69.213  1.00 13.76 ? 395 GLN A CB  1 
ATOM   3150  C  CG  . GLN A 1 395 ? -0.035  20.037  69.282  1.00 13.85 ? 395 GLN A CG  1 
ATOM   3151  C  CD  . GLN A 1 395 ? -0.564  19.389  70.555  1.00 13.77 ? 395 GLN A CD  1 
ATOM   3152  O  OE1 . GLN A 1 395 ? -0.050  19.632  71.653  1.00 13.73 ? 395 GLN A OE1 1 
ATOM   3153  N  NE2 . GLN A 1 395 ? -1.600  18.562  70.413  1.00 13.22 ? 395 GLN A NE2 1 
ATOM   3154  N  N   . ASP A 1 396 ? 1.662   18.686  66.897  1.00 13.46 ? 396 ASP A N   1 
ATOM   3155  C  CA  . ASP A 1 396 ? 1.804   18.273  65.507  1.00 13.37 ? 396 ASP A CA  1 
ATOM   3156  C  C   . ASP A 1 396 ? 2.200   19.425  64.583  1.00 13.17 ? 396 ASP A C   1 
ATOM   3157  O  O   . ASP A 1 396 ? 1.983   19.355  63.370  1.00 13.02 ? 396 ASP A O   1 
ATOM   3158  C  CB  . ASP A 1 396 ? 0.481   17.683  65.029  1.00 13.88 ? 396 ASP A CB  1 
ATOM   3159  C  CG  . ASP A 1 396 ? -0.639  18.713  65.009  1.00 14.25 ? 396 ASP A CG  1 
ATOM   3160  O  OD1 . ASP A 1 396 ? -0.651  19.601  65.893  1.00 14.38 ? 396 ASP A OD1 1 
ATOM   3161  O  OD2 . ASP A 1 396 ? -1.503  18.638  64.104  1.00 14.77 ? 396 ASP A OD2 1 
ATOM   3162  N  N   . ASN A 1 397 ? 2.781   20.480  65.149  1.00 13.01 ? 397 ASN A N   1 
ATOM   3163  C  CA  . ASN A 1 397 ? 3.176   21.648  64.363  1.00 12.82 ? 397 ASN A CA  1 
ATOM   3164  C  C   . ASN A 1 397 ? 2.025   22.067  63.447  1.00 12.82 ? 397 ASN A C   1 
ATOM   3165  O  O   . ASN A 1 397 ? 2.235   22.639  62.373  1.00 12.78 ? 397 ASN A O   1 
ATOM   3166  C  CB  . ASN A 1 397 ? 4.425   21.348  63.525  1.00 12.75 ? 397 ASN A CB  1 
ATOM   3167  C  CG  . ASN A 1 397 ? 5.209   22.612  63.164  1.00 12.75 ? 397 ASN A CG  1 
ATOM   3168  O  OD1 . ASN A 1 397 ? 5.203   23.599  63.907  1.00 12.76 ? 397 ASN A OD1 1 
ATOM   3169  N  ND2 . ASN A 1 397 ? 5.888   22.583  62.016  1.00 12.45 ? 397 ASN A ND2 1 
ATOM   3170  N  N   . GLN A 1 398 ? 0.807   21.763  63.891  1.00 12.60 ? 398 GLN A N   1 
ATOM   3171  C  CA  . GLN A 1 398 ? -0.416  22.091  63.168  1.00 12.53 ? 398 GLN A CA  1 
ATOM   3172  C  C   . GLN A 1 398 ? -0.624  21.260  61.909  1.00 12.34 ? 398 GLN A C   1 
ATOM   3173  O  O   . GLN A 1 398 ? -1.377  21.645  61.010  1.00 12.11 ? 398 GLN A O   1 
ATOM   3174  C  CB  . GLN A 1 398 ? -0.447  23.584  62.833  1.00 12.70 ? 398 GLN A CB  1 
ATOM   3175  C  CG  . GLN A 1 398 ? -1.380  24.379  63.736  1.00 13.12 ? 398 GLN A CG  1 
ATOM   3176  C  CD  . GLN A 1 398 ? -1.048  25.854  63.762  1.00 13.42 ? 398 GLN A CD  1 
ATOM   3177  O  OE1 . GLN A 1 398 ? -1.909  26.700  63.513  1.00 13.75 ? 398 GLN A OE1 1 
ATOM   3178  N  NE2 . GLN A 1 398 ? 0.207   26.173  64.064  1.00 13.60 ? 398 GLN A NE2 1 
ATOM   3179  N  N   . GLY A 1 399 ? 0.038   20.111  61.856  1.00 12.26 ? 399 GLY A N   1 
ATOM   3180  C  CA  . GLY A 1 399 ? -0.103  19.230  60.712  1.00 12.60 ? 399 GLY A CA  1 
ATOM   3181  C  C   . GLY A 1 399 ? 0.242   19.840  59.366  1.00 12.54 ? 399 GLY A C   1 
ATOM   3182  O  O   . GLY A 1 399 ? 1.010   20.802  59.275  1.00 12.64 ? 399 GLY A O   1 
ATOM   3183  N  N   . GLY A 1 400 ? -0.332  19.273  58.312  1.00 12.65 ? 400 GLY A N   1 
ATOM   3184  C  CA  . GLY A 1 400 ? -0.060  19.761  56.971  1.00 13.07 ? 400 GLY A CA  1 
ATOM   3185  C  C   . GLY A 1 400 ? -1.068  20.773  56.467  1.00 12.86 ? 400 GLY A C   1 
ATOM   3186  O  O   . GLY A 1 400 ? -1.727  20.547  55.454  1.00 13.07 ? 400 GLY A O   1 
ATOM   3187  N  N   . ALA A 1 401 ? -1.182  21.893  57.172  1.00 12.65 ? 401 ALA A N   1 
ATOM   3188  C  CA  . ALA A 1 401 ? -2.119  22.938  56.795  1.00 12.51 ? 401 ALA A CA  1 
ATOM   3189  C  C   . ALA A 1 401 ? -1.405  24.106  56.135  1.00 12.39 ? 401 ALA A C   1 
ATOM   3190  O  O   . ALA A 1 401 ? -0.215  24.322  56.348  1.00 12.35 ? 401 ALA A O   1 
ATOM   3191  C  CB  . ALA A 1 401 ? -2.878  23.425  58.022  1.00 12.22 ? 401 ALA A CB  1 
ATOM   3192  N  N   . PRO A 1 402 ? -2.128  24.870  55.307  1.00 12.28 ? 402 PRO A N   1 
ATOM   3193  C  CA  . PRO A 1 402 ? -1.521  26.022  54.634  1.00 12.16 ? 402 PRO A CA  1 
ATOM   3194  C  C   . PRO A 1 402 ? -0.841  26.914  55.667  1.00 12.02 ? 402 PRO A C   1 
ATOM   3195  O  O   . PRO A 1 402 ? -1.469  27.350  56.632  1.00 12.03 ? 402 PRO A O   1 
ATOM   3196  C  CB  . PRO A 1 402 ? -2.701  26.719  53.956  1.00 12.26 ? 402 PRO A CB  1 
ATOM   3197  C  CG  . PRO A 1 402 ? -3.939  26.047  54.490  1.00 12.29 ? 402 PRO A CG  1 
ATOM   3198  C  CD  . PRO A 1 402 ? -3.543  24.692  54.943  1.00 12.31 ? 402 PRO A CD  1 
ATOM   3199  N  N   . ASN A 1 403 ? 0.442   27.182  55.459  1.00 12.04 ? 403 ASN A N   1 
ATOM   3200  C  CA  . ASN A 1 403 ? 1.208   27.997  56.389  1.00 11.95 ? 403 ASN A CA  1 
ATOM   3201  C  C   . ASN A 1 403 ? 1.402   29.440  55.949  1.00 11.86 ? 403 ASN A C   1 
ATOM   3202  O  O   . ASN A 1 403 ? 2.398   30.061  56.298  1.00 11.97 ? 403 ASN A O   1 
ATOM   3203  C  CB  . ASN A 1 403 ? 2.575   27.355  56.620  1.00 11.89 ? 403 ASN A CB  1 
ATOM   3204  C  CG  . ASN A 1 403 ? 3.416   27.298  55.358  1.00 11.87 ? 403 ASN A CG  1 
ATOM   3205  O  OD1 . ASN A 1 403 ? 4.633   27.138  55.422  1.00 12.14 ? 403 ASN A OD1 1 
ATOM   3206  N  ND2 . ASN A 1 403 ? 2.769   27.427  54.201  1.00 11.55 ? 403 ASN A ND2 1 
ATOM   3207  N  N   . TYR A 1 404 ? 0.462   29.978  55.187  1.00 11.66 ? 404 TYR A N   1 
ATOM   3208  C  CA  . TYR A 1 404 ? 0.586   31.356  54.730  1.00 11.71 ? 404 TYR A CA  1 
ATOM   3209  C  C   . TYR A 1 404 ? -0.774  32.042  54.673  1.00 11.71 ? 404 TYR A C   1 
ATOM   3210  O  O   . TYR A 1 404 ? -1.803  31.398  54.455  1.00 11.24 ? 404 TYR A O   1 
ATOM   3211  C  CB  . TYR A 1 404 ? 1.248   31.395  53.353  1.00 11.83 ? 404 TYR A CB  1 
ATOM   3212  C  CG  . TYR A 1 404 ? 0.465   30.665  52.296  1.00 12.17 ? 404 TYR A CG  1 
ATOM   3213  C  CD1 . TYR A 1 404 ? 0.527   29.279  52.193  1.00 12.46 ? 404 TYR A CD1 1 
ATOM   3214  C  CD2 . TYR A 1 404 ? -0.354  31.360  51.407  1.00 12.26 ? 404 TYR A CD2 1 
ATOM   3215  C  CE1 . TYR A 1 404 ? -0.211  28.597  51.227  1.00 12.71 ? 404 TYR A CE1 1 
ATOM   3216  C  CE2 . TYR A 1 404 ? -1.095  30.693  50.439  1.00 12.51 ? 404 TYR A CE2 1 
ATOM   3217  C  CZ  . TYR A 1 404 ? -1.021  29.310  50.352  1.00 12.66 ? 404 TYR A CZ  1 
ATOM   3218  O  OH  . TYR A 1 404 ? -1.753  28.638  49.397  1.00 12.69 ? 404 TYR A OH  1 
ATOM   3219  N  N   . TYR A 1 405 ? -0.766  33.354  54.875  1.00 11.65 ? 405 TYR A N   1 
ATOM   3220  C  CA  . TYR A 1 405 ? -1.987  34.144  54.868  1.00 11.94 ? 405 TYR A CA  1 
ATOM   3221  C  C   . TYR A 1 405 ? -1.805  35.314  53.917  1.00 12.02 ? 405 TYR A C   1 
ATOM   3222  O  O   . TYR A 1 405 ? -0.823  36.047  54.008  1.00 12.41 ? 405 TYR A O   1 
ATOM   3223  C  CB  . TYR A 1 405 ? -2.278  34.658  56.284  1.00 12.14 ? 405 TYR A CB  1 
ATOM   3224  C  CG  . TYR A 1 405 ? -3.724  35.025  56.546  1.00 12.28 ? 405 TYR A CG  1 
ATOM   3225  C  CD1 . TYR A 1 405 ? -4.751  34.107  56.330  1.00 12.35 ? 405 TYR A CD1 1 
ATOM   3226  C  CD2 . TYR A 1 405 ? -4.064  36.293  57.021  1.00 12.36 ? 405 TYR A CD2 1 
ATOM   3227  C  CE1 . TYR A 1 405 ? -6.083  34.443  56.581  1.00 12.59 ? 405 TYR A CE1 1 
ATOM   3228  C  CE2 . TYR A 1 405 ? -5.389  36.640  57.275  1.00 12.57 ? 405 TYR A CE2 1 
ATOM   3229  C  CZ  . TYR A 1 405 ? -6.393  35.712  57.054  1.00 12.64 ? 405 TYR A CZ  1 
ATOM   3230  O  OH  . TYR A 1 405 ? -7.701  36.057  57.305  1.00 12.78 ? 405 TYR A OH  1 
ATOM   3231  N  N   . PRO A 1 406 ? -2.759  35.511  52.995  1.00 12.13 ? 406 PRO A N   1 
ATOM   3232  C  CA  . PRO A 1 406 ? -3.957  34.686  52.844  1.00 12.23 ? 406 PRO A CA  1 
ATOM   3233  C  C   . PRO A 1 406 ? -3.732  33.441  51.986  1.00 12.39 ? 406 PRO A C   1 
ATOM   3234  O  O   . PRO A 1 406 ? -2.613  33.141  51.563  1.00 12.26 ? 406 PRO A O   1 
ATOM   3235  C  CB  . PRO A 1 406 ? -4.948  35.636  52.199  1.00 12.06 ? 406 PRO A CB  1 
ATOM   3236  C  CG  . PRO A 1 406 ? -4.083  36.504  51.335  1.00 12.01 ? 406 PRO A CG  1 
ATOM   3237  C  CD  . PRO A 1 406 ? -2.725  36.593  51.996  1.00 12.06 ? 406 PRO A CD  1 
ATOM   3238  N  N   . ASN A 1 407 ? -4.816  32.726  51.724  1.00 12.33 ? 407 ASN A N   1 
ATOM   3239  C  CA  . ASN A 1 407 ? -4.754  31.518  50.923  1.00 12.30 ? 407 ASN A CA  1 
ATOM   3240  C  C   . ASN A 1 407 ? -6.173  31.148  50.571  1.00 12.38 ? 407 ASN A C   1 
ATOM   3241  O  O   . ASN A 1 407 ? -7.116  31.598  51.222  1.00 12.63 ? 407 ASN A O   1 
ATOM   3242  C  CB  . ASN A 1 407 ? -4.132  30.378  51.720  1.00 12.37 ? 407 ASN A CB  1 
ATOM   3243  C  CG  . ASN A 1 407 ? -5.029  29.905  52.835  1.00 12.28 ? 407 ASN A CG  1 
ATOM   3244  O  OD1 . ASN A 1 407 ? -6.028  29.225  52.600  1.00 12.05 ? 407 ASN A OD1 1 
ATOM   3245  N  ND2 . ASN A 1 407 ? -4.686  30.269  54.060  1.00 12.61 ? 407 ASN A ND2 1 
ATOM   3246  N  N   . SER A 1 408 ? -6.327  30.324  49.544  1.00 12.62 ? 408 SER A N   1 
ATOM   3247  C  CA  . SER A 1 408 ? -7.647  29.891  49.122  1.00 12.51 ? 408 SER A CA  1 
ATOM   3248  C  C   . SER A 1 408 ? -7.789  28.409  49.423  1.00 12.45 ? 408 SER A C   1 
ATOM   3249  O  O   . SER A 1 408 ? -8.207  27.633  48.567  1.00 12.39 ? 408 SER A O   1 
ATOM   3250  C  CB  . SER A 1 408 ? -7.826  30.145  47.626  1.00 12.52 ? 408 SER A CB  1 
ATOM   3251  O  OG  . SER A 1 408 ? -6.605  30.564  47.038  1.00 12.77 ? 408 SER A OG  1 
ATOM   3252  N  N   . PHE A 1 409 ? -7.443  28.014  50.647  1.00 12.57 ? 409 PHE A N   1 
ATOM   3253  C  CA  . PHE A 1 409 ? -7.538  26.609  51.017  1.00 12.66 ? 409 PHE A CA  1 
ATOM   3254  C  C   . PHE A 1 409 ? -8.190  26.280  52.354  1.00 12.55 ? 409 PHE A C   1 
ATOM   3255  O  O   . PHE A 1 409 ? -8.067  25.156  52.839  1.00 12.47 ? 409 PHE A O   1 
ATOM   3256  C  CB  . PHE A 1 409 ? -6.160  25.970  50.938  1.00 12.95 ? 409 PHE A CB  1 
ATOM   3257  C  CG  . PHE A 1 409 ? -5.674  25.794  49.536  1.00 13.34 ? 409 PHE A CG  1 
ATOM   3258  C  CD1 . PHE A 1 409 ? -5.973  24.637  48.824  1.00 13.47 ? 409 PHE A CD1 1 
ATOM   3259  C  CD2 . PHE A 1 409 ? -4.941  26.797  48.914  1.00 13.51 ? 409 PHE A CD2 1 
ATOM   3260  C  CE1 . PHE A 1 409 ? -5.552  24.484  47.510  1.00 13.57 ? 409 PHE A CE1 1 
ATOM   3261  C  CE2 . PHE A 1 409 ? -4.514  26.656  47.602  1.00 13.64 ? 409 PHE A CE2 1 
ATOM   3262  C  CZ  . PHE A 1 409 ? -4.820  25.497  46.898  1.00 13.71 ? 409 PHE A CZ  1 
ATOM   3263  N  N   . GLY A 1 410 ? -8.883  27.252  52.943  1.00 12.43 ? 410 GLY A N   1 
ATOM   3264  C  CA  . GLY A 1 410 ? -9.576  27.003  54.197  1.00 12.65 ? 410 GLY A CA  1 
ATOM   3265  C  C   . GLY A 1 410 ? -8.821  27.165  55.504  1.00 12.54 ? 410 GLY A C   1 
ATOM   3266  O  O   . GLY A 1 410 ? -9.372  26.879  56.562  1.00 12.55 ? 410 GLY A O   1 
ATOM   3267  N  N   . ALA A 1 411 ? -7.571  27.609  55.445  1.00 12.62 ? 411 ALA A N   1 
ATOM   3268  C  CA  . ALA A 1 411 ? -6.785  27.814  56.659  1.00 12.78 ? 411 ALA A CA  1 
ATOM   3269  C  C   . ALA A 1 411 ? -7.517  28.794  57.588  1.00 12.93 ? 411 ALA A C   1 
ATOM   3270  O  O   . ALA A 1 411 ? -8.518  29.397  57.199  1.00 12.92 ? 411 ALA A O   1 
ATOM   3271  C  CB  . ALA A 1 411 ? -5.410  28.360  56.298  1.00 12.67 ? 411 ALA A CB  1 
ATOM   3272  N  N   . PRO A 1 412 ? -7.040  28.948  58.834  1.00 13.19 ? 412 PRO A N   1 
ATOM   3273  C  CA  . PRO A 1 412 ? -7.695  29.873  59.770  1.00 13.10 ? 412 PRO A CA  1 
ATOM   3274  C  C   . PRO A 1 412 ? -7.802  31.306  59.232  1.00 13.03 ? 412 PRO A C   1 
ATOM   3275  O  O   . PRO A 1 412 ? -6.948  31.761  58.469  1.00 12.66 ? 412 PRO A O   1 
ATOM   3276  C  CB  . PRO A 1 412 ? -6.826  29.797  61.029  1.00 13.21 ? 412 PRO A CB  1 
ATOM   3277  C  CG  . PRO A 1 412 ? -6.083  28.516  60.915  1.00 13.41 ? 412 PRO A CG  1 
ATOM   3278  C  CD  . PRO A 1 412 ? -5.890  28.263  59.450  1.00 13.27 ? 412 PRO A CD  1 
ATOM   3279  N  N   . GLU A 1 413 ? -8.854  32.012  59.634  1.00 12.82 ? 413 GLU A N   1 
ATOM   3280  C  CA  . GLU A 1 413 ? -9.055  33.383  59.185  1.00 13.12 ? 413 GLU A CA  1 
ATOM   3281  C  C   . GLU A 1 413 ? -9.175  34.354  60.356  1.00 12.99 ? 413 GLU A C   1 
ATOM   3282  O  O   . GLU A 1 413 ? -9.532  33.963  61.471  1.00 12.92 ? 413 GLU A O   1 
ATOM   3283  C  CB  . GLU A 1 413 ? -10.311 33.476  58.315  1.00 13.45 ? 413 GLU A CB  1 
ATOM   3284  C  CG  . GLU A 1 413 ? -10.501 32.310  57.366  1.00 13.99 ? 413 GLU A CG  1 
ATOM   3285  C  CD  . GLU A 1 413 ? -9.683  32.446  56.096  1.00 14.29 ? 413 GLU A CD  1 
ATOM   3286  O  OE1 . GLU A 1 413 ? -9.271  33.584  55.777  1.00 14.41 ? 413 GLU A OE1 1 
ATOM   3287  O  OE2 . GLU A 1 413 ? -9.455  31.414  55.417  1.00 14.57 ? 413 GLU A OE2 1 
ATOM   3288  N  N   . GLN A 1 414 ? -8.875  35.623  60.093  1.00 12.87 ? 414 GLN A N   1 
ATOM   3289  C  CA  . GLN A 1 414 ? -8.951  36.659  61.114  1.00 12.67 ? 414 GLN A CA  1 
ATOM   3290  C  C   . GLN A 1 414 ? -10.407 36.989  61.411  1.00 12.99 ? 414 GLN A C   1 
ATOM   3291  O  O   . GLN A 1 414 ? -11.259 36.931  60.523  1.00 13.10 ? 414 GLN A O   1 
ATOM   3292  C  CB  . GLN A 1 414 ? -8.236  37.918  60.637  1.00 12.31 ? 414 GLN A CB  1 
ATOM   3293  C  CG  . GLN A 1 414 ? -8.806  38.481  59.353  1.00 11.67 ? 414 GLN A CG  1 
ATOM   3294  C  CD  . GLN A 1 414 ? -7.863  39.445  58.670  1.00 11.30 ? 414 GLN A CD  1 
ATOM   3295  O  OE1 . GLN A 1 414 ? -6.690  39.534  59.020  1.00 10.92 ? 414 GLN A OE1 1 
ATOM   3296  N  NE2 . GLN A 1 414 ? -8.374  40.175  57.687  1.00 11.38 ? 414 GLN A NE2 1 
ATOM   3297  N  N   . GLN A 1 415 ? -10.680 37.334  62.666  1.00 13.26 ? 415 GLN A N   1 
ATOM   3298  C  CA  . GLN A 1 415 ? -12.025 37.679  63.109  1.00 13.24 ? 415 GLN A CA  1 
ATOM   3299  C  C   . GLN A 1 415 ? -12.106 39.191  63.306  1.00 13.09 ? 415 GLN A C   1 
ATOM   3300  O  O   . GLN A 1 415 ? -11.573 39.726  64.278  1.00 13.19 ? 415 GLN A O   1 
ATOM   3301  C  CB  . GLN A 1 415 ? -12.329 36.965  64.422  1.00 13.46 ? 415 GLN A CB  1 
ATOM   3302  C  CG  . GLN A 1 415 ? -13.752 36.465  64.545  1.00 14.07 ? 415 GLN A CG  1 
ATOM   3303  C  CD  . GLN A 1 415 ? -14.107 36.096  65.978  1.00 14.49 ? 415 GLN A CD  1 
ATOM   3304  O  OE1 . GLN A 1 415 ? -13.253 35.624  66.740  1.00 14.84 ? 415 GLN A OE1 1 
ATOM   3305  N  NE2 . GLN A 1 415 ? -15.370 36.309  66.354  1.00 14.72 ? 415 GLN A NE2 1 
ATOM   3306  N  N   . PRO A 1 416 ? -12.788 39.897  62.388  1.00 13.09 ? 416 PRO A N   1 
ATOM   3307  C  CA  . PRO A 1 416 ? -12.934 41.358  62.458  1.00 13.27 ? 416 PRO A CA  1 
ATOM   3308  C  C   . PRO A 1 416 ? -13.613 41.871  63.730  1.00 13.52 ? 416 PRO A C   1 
ATOM   3309  O  O   . PRO A 1 416 ? -13.756 43.088  63.926  1.00 13.50 ? 416 PRO A O   1 
ATOM   3310  C  CB  . PRO A 1 416 ? -13.733 41.706  61.198  1.00 13.04 ? 416 PRO A CB  1 
ATOM   3311  C  CG  . PRO A 1 416 ? -14.426 40.437  60.819  1.00 12.98 ? 416 PRO A CG  1 
ATOM   3312  C  CD  . PRO A 1 416 ? -13.488 39.332  61.220  1.00 13.07 ? 416 PRO A CD  1 
ATOM   3313  N  N   . SER A 1 417 ? -14.028 40.949  64.592  1.00 13.29 ? 417 SER A N   1 
ATOM   3314  C  CA  . SER A 1 417 ? -14.686 41.333  65.833  1.00 13.24 ? 417 SER A CA  1 
ATOM   3315  C  C   . SER A 1 417 ? -13.660 41.477  66.950  1.00 13.11 ? 417 SER A C   1 
ATOM   3316  O  O   . SER A 1 417 ? -13.970 41.984  68.030  1.00 13.29 ? 417 SER A O   1 
ATOM   3317  C  CB  . SER A 1 417 ? -15.718 40.277  66.218  1.00 13.33 ? 417 SER A CB  1 
ATOM   3318  O  OG  . SER A 1 417 ? -15.129 38.987  66.226  1.00 13.16 ? 417 SER A OG  1 
ATOM   3319  N  N   . ALA A 1 418 ? -12.437 41.031  66.676  1.00 13.12 ? 418 ALA A N   1 
ATOM   3320  C  CA  . ALA A 1 418 ? -11.349 41.081  67.650  1.00 13.09 ? 418 ALA A CA  1 
ATOM   3321  C  C   . ALA A 1 418 ? -10.400 42.243  67.399  1.00 12.93 ? 418 ALA A C   1 
ATOM   3322  O  O   . ALA A 1 418 ? -9.261  42.234  67.866  1.00 12.87 ? 418 ALA A O   1 
ATOM   3323  C  CB  . ALA A 1 418 ? -10.567 39.759  67.631  1.00 12.74 ? 418 ALA A CB  1 
ATOM   3324  N  N   . LEU A 1 419 ? -10.860 43.240  66.656  1.00 12.90 ? 419 LEU A N   1 
ATOM   3325  C  CA  . LEU A 1 419 ? -10.012 44.388  66.376  1.00 13.06 ? 419 LEU A CA  1 
ATOM   3326  C  C   . LEU A 1 419 ? -9.800  45.192  67.651  1.00 13.22 ? 419 LEU A C   1 
ATOM   3327  O  O   . LEU A 1 419 ? -10.676 45.245  68.525  1.00 13.34 ? 419 LEU A O   1 
ATOM   3328  C  CB  . LEU A 1 419 ? -10.646 45.279  65.304  1.00 12.94 ? 419 LEU A CB  1 
ATOM   3329  C  CG  . LEU A 1 419 ? -10.231 45.038  63.848  1.00 12.78 ? 419 LEU A CG  1 
ATOM   3330  C  CD1 . LEU A 1 419 ? -10.299 46.358  63.092  1.00 12.77 ? 419 LEU A CD1 1 
ATOM   3331  C  CD2 . LEU A 1 419 ? -8.823  44.450  63.780  1.00 12.50 ? 419 LEU A CD2 1 
ATOM   3332  N  N   . GLU A 1 420 ? -8.632  45.812  67.762  1.00 13.15 ? 420 GLU A N   1 
ATOM   3333  C  CA  . GLU A 1 420 ? -8.322  46.617  68.931  1.00 13.08 ? 420 GLU A CA  1 
ATOM   3334  C  C   . GLU A 1 420 ? -9.074  47.946  68.887  1.00 13.01 ? 420 GLU A C   1 
ATOM   3335  O  O   . GLU A 1 420 ? -9.605  48.344  67.844  1.00 13.18 ? 420 GLU A O   1 
ATOM   3336  C  CB  . GLU A 1 420 ? -6.819  46.872  68.996  1.00 12.95 ? 420 GLU A CB  1 
ATOM   3337  C  CG  . GLU A 1 420 ? -5.993  45.602  69.074  1.00 12.94 ? 420 GLU A CG  1 
ATOM   3338  C  CD  . GLU A 1 420 ? -5.552  45.116  67.710  1.00 12.99 ? 420 GLU A CD  1 
ATOM   3339  O  OE1 . GLU A 1 420 ? -4.936  44.031  67.629  1.00 12.78 ? 420 GLU A OE1 1 
ATOM   3340  O  OE2 . GLU A 1 420 ? -5.821  45.824  66.719  1.00 13.35 ? 420 GLU A OE2 1 
ATOM   3341  N  N   . HIS A 1 421 ? -9.128  48.622  70.030  1.00 12.60 ? 421 HIS A N   1 
ATOM   3342  C  CA  . HIS A 1 421 ? -9.798  49.912  70.127  1.00 12.21 ? 421 HIS A CA  1 
ATOM   3343  C  C   . HIS A 1 421 ? -8.846  50.980  69.585  1.00 12.37 ? 421 HIS A C   1 
ATOM   3344  O  O   . HIS A 1 421 ? -7.659  50.996  69.921  1.00 12.17 ? 421 HIS A O   1 
ATOM   3345  C  CB  . HIS A 1 421 ? -10.149 50.205  71.586  1.00 11.78 ? 421 HIS A CB  1 
ATOM   3346  C  CG  . HIS A 1 421 ? -10.640 51.598  71.822  1.00 11.26 ? 421 HIS A CG  1 
ATOM   3347  N  ND1 . HIS A 1 421 ? -11.968 51.950  71.706  1.00 11.05 ? 421 HIS A ND1 1 
ATOM   3348  C  CD2 . HIS A 1 421 ? -9.981  52.726  72.178  1.00 10.98 ? 421 HIS A CD2 1 
ATOM   3349  C  CE1 . HIS A 1 421 ? -12.105 53.234  71.979  1.00 10.84 ? 421 HIS A CE1 1 
ATOM   3350  N  NE2 . HIS A 1 421 ? -10.916 53.729  72.268  1.00 10.89 ? 421 HIS A NE2 1 
ATOM   3351  N  N   . SER A 1 422 ? -9.359  51.871  68.745  1.00 12.33 ? 422 SER A N   1 
ATOM   3352  C  CA  . SER A 1 422 ? -8.517  52.910  68.175  1.00 12.41 ? 422 SER A CA  1 
ATOM   3353  C  C   . SER A 1 422 ? -8.620  54.242  68.900  1.00 12.42 ? 422 SER A C   1 
ATOM   3354  O  O   . SER A 1 422 ? -9.717  54.711  69.203  1.00 12.40 ? 422 SER A O   1 
ATOM   3355  C  CB  . SER A 1 422 ? -8.856  53.103  66.699  1.00 12.59 ? 422 SER A CB  1 
ATOM   3356  O  OG  . SER A 1 422 ? -7.672  53.174  65.926  1.00 13.11 ? 422 SER A OG  1 
ATOM   3357  N  N   . ILE A 1 423 ? -7.466  54.844  69.175  1.00 12.47 ? 423 ILE A N   1 
ATOM   3358  C  CA  . ILE A 1 423 ? -7.402  56.135  69.856  1.00 12.64 ? 423 ILE A CA  1 
ATOM   3359  C  C   . ILE A 1 423 ? -6.610  57.139  69.025  1.00 12.66 ? 423 ILE A C   1 
ATOM   3360  O  O   . ILE A 1 423 ? -5.622  56.789  68.382  1.00 12.94 ? 423 ILE A O   1 
ATOM   3361  C  CB  . ILE A 1 423 ? -6.733  56.012  71.242  1.00 12.51 ? 423 ILE A CB  1 
ATOM   3362  C  CG1 . ILE A 1 423 ? -7.558  55.088  72.136  1.00 12.37 ? 423 ILE A CG1 1 
ATOM   3363  C  CG2 . ILE A 1 423 ? -6.611  57.386  71.886  1.00 12.40 ? 423 ILE A CG2 1 
ATOM   3364  C  CD1 . ILE A 1 423 ? -6.993  54.909  73.519  1.00 12.25 ? 423 ILE A CD1 1 
ATOM   3365  N  N   . GLN A 1 424 ? -7.038  58.393  69.046  1.00 12.59 ? 424 GLN A N   1 
ATOM   3366  C  CA  . GLN A 1 424 ? -6.356  59.431  68.283  1.00 12.32 ? 424 GLN A CA  1 
ATOM   3367  C  C   . GLN A 1 424 ? -5.231  60.072  69.081  1.00 12.26 ? 424 GLN A C   1 
ATOM   3368  O  O   . GLN A 1 424 ? -5.439  60.534  70.202  1.00 12.39 ? 424 GLN A O   1 
ATOM   3369  C  CB  . GLN A 1 424 ? -7.356  60.506  67.853  1.00 12.16 ? 424 GLN A CB  1 
ATOM   3370  C  CG  . GLN A 1 424 ? -7.201  60.944  66.417  1.00 11.76 ? 424 GLN A CG  1 
ATOM   3371  C  CD  . GLN A 1 424 ? -6.413  62.227  66.290  1.00 11.57 ? 424 GLN A CD  1 
ATOM   3372  O  OE1 . GLN A 1 424 ? -6.185  62.925  67.277  1.00 11.78 ? 424 GLN A OE1 1 
ATOM   3373  N  NE2 . GLN A 1 424 ? -5.993  62.549  65.070  1.00 11.13 ? 424 GLN A NE2 1 
ATOM   3374  N  N   . TYR A 1 425 ? -4.038  60.096  68.497  1.00 12.17 ? 425 TYR A N   1 
ATOM   3375  C  CA  . TYR A 1 425 ? -2.877  60.690  69.147  1.00 11.99 ? 425 TYR A CA  1 
ATOM   3376  C  C   . TYR A 1 425 ? -2.341  61.844  68.310  1.00 11.69 ? 425 TYR A C   1 
ATOM   3377  O  O   . TYR A 1 425 ? -2.850  62.126  67.231  1.00 11.26 ? 425 TYR A O   1 
ATOM   3378  C  CB  . TYR A 1 425 ? -1.791  59.632  69.347  1.00 12.34 ? 425 TYR A CB  1 
ATOM   3379  C  CG  . TYR A 1 425 ? -2.091  58.672  70.481  1.00 12.90 ? 425 TYR A CG  1 
ATOM   3380  C  CD1 . TYR A 1 425 ? -2.972  57.605  70.302  1.00 13.11 ? 425 TYR A CD1 1 
ATOM   3381  C  CD2 . TYR A 1 425 ? -1.514  58.848  71.743  1.00 13.25 ? 425 TYR A CD2 1 
ATOM   3382  C  CE1 . TYR A 1 425 ? -3.275  56.738  71.346  1.00 13.56 ? 425 TYR A CE1 1 
ATOM   3383  C  CE2 . TYR A 1 425 ? -1.809  57.988  72.796  1.00 13.69 ? 425 TYR A CE2 1 
ATOM   3384  C  CZ  . TYR A 1 425 ? -2.691  56.936  72.592  1.00 13.75 ? 425 TYR A CZ  1 
ATOM   3385  O  OH  . TYR A 1 425 ? -2.993  56.092  73.638  1.00 14.15 ? 425 TYR A OH  1 
ATOM   3386  N  N   . SER A 1 426 ? -1.315  62.518  68.812  1.00 12.16 ? 426 SER A N   1 
ATOM   3387  C  CA  . SER A 1 426 ? -0.734  63.643  68.087  1.00 12.39 ? 426 SER A CA  1 
ATOM   3388  C  C   . SER A 1 426 ? 0.442   64.268  68.833  1.00 12.08 ? 426 SER A C   1 
ATOM   3389  O  O   . SER A 1 426 ? 0.505   64.221  70.060  1.00 12.09 ? 426 SER A O   1 
ATOM   3390  C  CB  . SER A 1 426 ? -1.800  64.715  67.829  1.00 13.17 ? 426 SER A CB  1 
ATOM   3391  O  OG  . SER A 1 426 ? -1.201  65.926  67.397  1.00 14.50 ? 426 SER A OG  1 
ATOM   3392  N  N   . GLY A 1 427 ? 1.368   64.853  68.080  1.00 11.97 ? 427 GLY A N   1 
ATOM   3393  C  CA  . GLY A 1 427 ? 2.527   65.483  68.688  1.00 11.88 ? 427 GLY A CA  1 
ATOM   3394  C  C   . GLY A 1 427 ? 3.844   65.035  68.088  1.00 11.80 ? 427 GLY A C   1 
ATOM   3395  O  O   . GLY A 1 427 ? 3.874   64.367  67.061  1.00 11.56 ? 427 GLY A O   1 
ATOM   3396  N  N   . GLU A 1 428 ? 4.941   65.415  68.731  1.00 12.17 ? 428 GLU A N   1 
ATOM   3397  C  CA  . GLU A 1 428 ? 6.267   65.039  68.260  1.00 12.80 ? 428 GLU A CA  1 
ATOM   3398  C  C   . GLU A 1 428 ? 6.616   63.631  68.730  1.00 13.26 ? 428 GLU A C   1 
ATOM   3399  O  O   . GLU A 1 428 ? 6.030   63.111  69.690  1.00 13.46 ? 428 GLU A O   1 
ATOM   3400  C  CB  . GLU A 1 428 ? 7.327   65.998  68.804  1.00 12.86 ? 428 GLU A CB  1 
ATOM   3401  C  CG  . GLU A 1 428 ? 7.116   67.456  68.467  1.00 13.02 ? 428 GLU A CG  1 
ATOM   3402  C  CD  . GLU A 1 428 ? 8.277   68.312  68.931  1.00 13.14 ? 428 GLU A CD  1 
ATOM   3403  O  OE1 . GLU A 1 428 ? 9.346   68.260  68.283  1.00 13.29 ? 428 GLU A OE1 1 
ATOM   3404  O  OE2 . GLU A 1 428 ? 8.125   69.029  69.946  1.00 13.10 ? 428 GLU A OE2 1 
ATOM   3405  N  N   . VAL A 1 429 ? 7.583   63.019  68.058  1.00 12.91 ? 429 VAL A N   1 
ATOM   3406  C  CA  . VAL A 1 429 ? 8.005   61.687  68.439  1.00 12.79 ? 429 VAL A CA  1 
ATOM   3407  C  C   . VAL A 1 429 ? 9.419   61.783  68.985  1.00 12.67 ? 429 VAL A C   1 
ATOM   3408  O  O   . VAL A 1 429 ? 10.399  61.661  68.249  1.00 12.52 ? 429 VAL A O   1 
ATOM   3409  C  CB  . VAL A 1 429 ? 7.960   60.729  67.241  1.00 12.80 ? 429 VAL A CB  1 
ATOM   3410  C  CG1 . VAL A 1 429 ? 8.255   59.307  67.698  1.00 12.50 ? 429 VAL A CG1 1 
ATOM   3411  C  CG2 . VAL A 1 429 ? 6.594   60.806  66.584  1.00 12.75 ? 429 VAL A CG2 1 
ATOM   3412  N  N   . ARG A 1 430 ? 9.511   62.021  70.288  1.00 12.70 ? 430 ARG A N   1 
ATOM   3413  C  CA  . ARG A 1 430 ? 10.801  62.149  70.953  1.00 12.75 ? 430 ARG A CA  1 
ATOM   3414  C  C   . ARG A 1 430 ? 10.727  61.607  72.367  1.00 12.61 ? 430 ARG A C   1 
ATOM   3415  O  O   . ARG A 1 430 ? 9.676   61.138  72.803  1.00 12.68 ? 430 ARG A O   1 
ATOM   3416  C  CB  . ARG A 1 430 ? 11.233  63.617  70.997  1.00 12.77 ? 430 ARG A CB  1 
ATOM   3417  C  CG  . ARG A 1 430 ? 10.119  64.582  71.345  1.00 13.21 ? 430 ARG A CG  1 
ATOM   3418  C  CD  . ARG A 1 430 ? 10.629  65.680  72.252  1.00 13.89 ? 430 ARG A CD  1 
ATOM   3419  N  NE  . ARG A 1 430 ? 9.995   66.967  71.974  1.00 14.60 ? 430 ARG A NE  1 
ATOM   3420  C  CZ  . ARG A 1 430 ? 10.551  68.147  72.241  1.00 14.99 ? 430 ARG A CZ  1 
ATOM   3421  N  NH1 . ARG A 1 430 ? 11.761  68.204  72.795  1.00 15.18 ? 430 ARG A NH1 1 
ATOM   3422  N  NH2 . ARG A 1 430 ? 9.899   69.273  71.961  1.00 15.14 ? 430 ARG A NH2 1 
ATOM   3423  N  N   . ARG A 1 431 ? 11.849  61.676  73.077  1.00 12.61 ? 431 ARG A N   1 
ATOM   3424  C  CA  . ARG A 1 431 ? 11.909  61.200  74.452  1.00 12.66 ? 431 ARG A CA  1 
ATOM   3425  C  C   . ARG A 1 431 ? 11.517  62.333  75.392  1.00 12.68 ? 431 ARG A C   1 
ATOM   3426  O  O   . ARG A 1 431 ? 12.339  63.177  75.741  1.00 12.67 ? 431 ARG A O   1 
ATOM   3427  C  CB  . ARG A 1 431 ? 13.321  60.713  74.794  1.00 12.79 ? 431 ARG A CB  1 
ATOM   3428  C  CG  . ARG A 1 431 ? 13.762  59.478  74.029  1.00 12.81 ? 431 ARG A CG  1 
ATOM   3429  C  CD  . ARG A 1 431 ? 15.256  59.490  73.784  1.00 12.91 ? 431 ARG A CD  1 
ATOM   3430  N  NE  . ARG A 1 431 ? 15.649  58.605  72.690  1.00 13.04 ? 431 ARG A NE  1 
ATOM   3431  C  CZ  . ARG A 1 431 ? 15.570  57.277  72.742  1.00 13.15 ? 431 ARG A CZ  1 
ATOM   3432  N  NH1 . ARG A 1 431 ? 15.112  56.680  73.837  1.00 13.26 ? 431 ARG A NH1 1 
ATOM   3433  N  NH2 . ARG A 1 431 ? 15.955  56.544  71.703  1.00 13.06 ? 431 ARG A NH2 1 
ATOM   3434  N  N   . PHE A 1 432 ? 10.251  62.353  75.790  1.00 12.71 ? 432 PHE A N   1 
ATOM   3435  C  CA  . PHE A 1 432 ? 9.758   63.383  76.692  1.00 12.81 ? 432 PHE A CA  1 
ATOM   3436  C  C   . PHE A 1 432 ? 10.235  63.112  78.118  1.00 12.93 ? 432 PHE A C   1 
ATOM   3437  O  O   . PHE A 1 432 ? 9.948   62.057  78.693  1.00 12.82 ? 432 PHE A O   1 
ATOM   3438  C  CB  . PHE A 1 432 ? 8.229   63.423  76.641  1.00 12.52 ? 432 PHE A CB  1 
ATOM   3439  C  CG  . PHE A 1 432 ? 7.689   63.809  75.301  1.00 12.51 ? 432 PHE A CG  1 
ATOM   3440  C  CD1 . PHE A 1 432 ? 7.450   65.142  74.993  1.00 12.46 ? 432 PHE A CD1 1 
ATOM   3441  C  CD2 . PHE A 1 432 ? 7.433   62.845  74.336  1.00 12.61 ? 432 PHE A CD2 1 
ATOM   3442  C  CE1 . PHE A 1 432 ? 6.967   65.510  73.745  1.00 12.45 ? 432 PHE A CE1 1 
ATOM   3443  C  CE2 . PHE A 1 432 ? 6.947   63.204  73.081  1.00 12.66 ? 432 PHE A CE2 1 
ATOM   3444  C  CZ  . PHE A 1 432 ? 6.715   64.539  72.787  1.00 12.55 ? 432 PHE A CZ  1 
ATOM   3445  N  N   . ASN A 1 433 ? 10.970  64.064  78.685  1.00 13.15 ? 433 ASN A N   1 
ATOM   3446  C  CA  . ASN A 1 433 ? 11.480  63.904  80.042  1.00 13.48 ? 433 ASN A CA  1 
ATOM   3447  C  C   . ASN A 1 433 ? 10.349  63.958  81.053  1.00 13.64 ? 433 ASN A C   1 
ATOM   3448  O  O   . ASN A 1 433 ? 9.627   64.952  81.144  1.00 13.70 ? 433 ASN A O   1 
ATOM   3449  C  CB  . ASN A 1 433 ? 12.506  64.985  80.370  1.00 13.87 ? 433 ASN A CB  1 
ATOM   3450  C  CG  . ASN A 1 433 ? 13.048  64.857  81.783  1.00 14.21 ? 433 ASN A CG  1 
ATOM   3451  O  OD1 . ASN A 1 433 ? 13.335  65.858  82.448  1.00 14.64 ? 433 ASN A OD1 1 
ATOM   3452  N  ND2 . ASN A 1 433 ? 13.187  63.620  82.252  1.00 14.28 ? 433 ASN A ND2 1 
ATOM   3453  N  N   . THR A 1 434 ? 10.207  62.877  81.812  1.00 13.58 ? 434 THR A N   1 
ATOM   3454  C  CA  . THR A 1 434 ? 9.164   62.761  82.823  1.00 13.43 ? 434 THR A CA  1 
ATOM   3455  C  C   . THR A 1 434 ? 9.808   62.559  84.191  1.00 13.19 ? 434 THR A C   1 
ATOM   3456  O  O   . THR A 1 434 ? 9.289   61.825  85.029  1.00 13.20 ? 434 THR A O   1 
ATOM   3457  C  CB  . THR A 1 434 ? 8.281   61.557  82.522  1.00 13.56 ? 434 THR A CB  1 
ATOM   3458  O  OG1 . THR A 1 434 ? 9.117   60.439  82.208  1.00 13.66 ? 434 THR A OG1 1 
ATOM   3459  C  CG2 . THR A 1 434 ? 7.374   61.843  81.332  1.00 13.86 ? 434 THR A CG2 1 
ATOM   3460  N  N   . ALA A 1 435 ? 10.941  63.220  84.407  1.00 13.01 ? 435 ALA A N   1 
ATOM   3461  C  CA  . ALA A 1 435 ? 11.677  63.099  85.657  1.00 12.90 ? 435 ALA A CA  1 
ATOM   3462  C  C   . ALA A 1 435 ? 11.130  63.969  86.776  1.00 12.71 ? 435 ALA A C   1 
ATOM   3463  O  O   . ALA A 1 435 ? 11.376  63.695  87.947  1.00 12.69 ? 435 ALA A O   1 
ATOM   3464  C  CB  . ALA A 1 435 ? 13.142  63.422  85.420  1.00 12.70 ? 435 ALA A CB  1 
ATOM   3465  N  N   . ASN A 1 436 ? 10.383  65.007  86.422  1.00 12.91 ? 436 ASN A N   1 
ATOM   3466  C  CA  . ASN A 1 436 ? 9.828   65.908  87.423  1.00 13.18 ? 436 ASN A CA  1 
ATOM   3467  C  C   . ASN A 1 436 ? 8.308   65.973  87.419  1.00 13.44 ? 436 ASN A C   1 
ATOM   3468  O  O   . ASN A 1 436 ? 7.729   67.051  87.569  1.00 13.40 ? 436 ASN A O   1 
ATOM   3469  C  CB  . ASN A 1 436 ? 10.392  67.312  87.222  1.00 13.23 ? 436 ASN A CB  1 
ATOM   3470  C  CG  . ASN A 1 436 ? 11.848  67.296  86.833  1.00 13.31 ? 436 ASN A CG  1 
ATOM   3471  O  OD1 . ASN A 1 436 ? 12.698  66.830  87.593  1.00 13.66 ? 436 ASN A OD1 1 
ATOM   3472  N  ND2 . ASN A 1 436 ? 12.150  67.801  85.644  1.00 13.37 ? 436 ASN A ND2 1 
ATOM   3473  N  N   . ASP A 1 437 ? 7.658   64.824  87.257  1.00 13.60 ? 437 ASP A N   1 
ATOM   3474  C  CA  . ASP A 1 437 ? 6.201   64.782  87.247  1.00 13.91 ? 437 ASP A CA  1 
ATOM   3475  C  C   . ASP A 1 437 ? 5.664   64.733  88.678  1.00 13.89 ? 437 ASP A C   1 
ATOM   3476  O  O   . ASP A 1 437 ? 4.789   63.921  88.992  1.00 14.10 ? 437 ASP A O   1 
ATOM   3477  C  CB  . ASP A 1 437 ? 5.710   63.554  86.470  1.00 14.31 ? 437 ASP A CB  1 
ATOM   3478  C  CG  . ASP A 1 437 ? 5.575   63.817  84.973  1.00 14.55 ? 437 ASP A CG  1 
ATOM   3479  O  OD1 . ASP A 1 437 ? 6.226   64.764  84.466  1.00 14.75 ? 437 ASP A OD1 1 
ATOM   3480  O  OD2 . ASP A 1 437 ? 4.820   63.070  84.303  1.00 14.52 ? 437 ASP A OD2 1 
ATOM   3481  N  N   . ASP A 1 438 ? 6.188   65.607  89.537  1.00 13.42 ? 438 ASP A N   1 
ATOM   3482  C  CA  . ASP A 1 438 ? 5.780   65.677  90.944  1.00 12.95 ? 438 ASP A CA  1 
ATOM   3483  C  C   . ASP A 1 438 ? 6.031   64.371  91.679  1.00 12.53 ? 438 ASP A C   1 
ATOM   3484  O  O   . ASP A 1 438 ? 5.317   63.392  91.483  1.00 12.33 ? 438 ASP A O   1 
ATOM   3485  C  CB  . ASP A 1 438 ? 4.298   66.032  91.074  1.00 13.04 ? 438 ASP A CB  1 
ATOM   3486  C  CG  . ASP A 1 438 ? 3.798   65.913  92.506  1.00 13.07 ? 438 ASP A CG  1 
ATOM   3487  O  OD1 . ASP A 1 438 ? 2.667   65.420  92.710  1.00 13.58 ? 438 ASP A OD1 1 
ATOM   3488  O  OD2 . ASP A 1 438 ? 4.541   66.310  93.429  1.00 12.71 ? 438 ASP A OD2 1 
ATOM   3489  N  N   . ASN A 1 439 ? 7.032   64.368  92.548  1.00 12.32 ? 439 ASN A N   1 
ATOM   3490  C  CA  . ASN A 1 439 ? 7.373   63.167  93.290  1.00 12.19 ? 439 ASN A CA  1 
ATOM   3491  C  C   . ASN A 1 439 ? 7.171   63.292  94.803  1.00 12.23 ? 439 ASN A C   1 
ATOM   3492  O  O   . ASN A 1 439 ? 7.643   62.445  95.563  1.00 12.50 ? 439 ASN A O   1 
ATOM   3493  C  CB  . ASN A 1 439 ? 8.828   62.779  92.997  1.00 11.64 ? 439 ASN A CB  1 
ATOM   3494  C  CG  . ASN A 1 439 ? 9.242   63.084  91.567  1.00 11.18 ? 439 ASN A CG  1 
ATOM   3495  O  OD1 . ASN A 1 439 ? 9.765   64.159  91.269  1.00 10.82 ? 439 ASN A OD1 1 
ATOM   3496  N  ND2 . ASN A 1 439 ? 9.014   62.132  90.678  1.00 10.74 ? 439 ASN A ND2 1 
ATOM   3497  N  N   . VAL A 1 440 ? 6.464   64.327  95.247  1.00 12.01 ? 440 VAL A N   1 
ATOM   3498  C  CA  . VAL A 1 440 ? 6.250   64.510  96.682  1.00 11.72 ? 440 VAL A CA  1 
ATOM   3499  C  C   . VAL A 1 440 ? 4.806   64.713  97.124  1.00 11.66 ? 440 VAL A C   1 
ATOM   3500  O  O   . VAL A 1 440 ? 4.435   64.311  98.223  1.00 11.64 ? 440 VAL A O   1 
ATOM   3501  C  CB  . VAL A 1 440 ? 7.061   65.704  97.226  1.00 11.67 ? 440 VAL A CB  1 
ATOM   3502  C  CG1 . VAL A 1 440 ? 8.550   65.469  97.014  1.00 11.45 ? 440 VAL A CG1 1 
ATOM   3503  C  CG2 . VAL A 1 440 ? 6.602   66.990  96.552  1.00 11.55 ? 440 VAL A CG2 1 
ATOM   3504  N  N   . THR A 1 441 ? 3.994   65.340  96.279  1.00 11.61 ? 441 THR A N   1 
ATOM   3505  C  CA  . THR A 1 441 ? 2.598   65.610  96.623  1.00 11.58 ? 441 THR A CA  1 
ATOM   3506  C  C   . THR A 1 441 ? 1.835   64.415  97.185  1.00 11.53 ? 441 THR A C   1 
ATOM   3507  O  O   . THR A 1 441 ? 1.326   64.475  98.302  1.00 11.53 ? 441 THR A O   1 
ATOM   3508  C  CB  . THR A 1 441 ? 1.828   66.166  95.415  1.00 11.47 ? 441 THR A CB  1 
ATOM   3509  O  OG1 . THR A 1 441 ? 2.190   67.537  95.218  1.00 11.86 ? 441 THR A OG1 1 
ATOM   3510  C  CG2 . THR A 1 441 ? 0.337   66.088  95.653  1.00 11.25 ? 441 THR A CG2 1 
ATOM   3511  N  N   . GLN A 1 442 ? 1.742   63.337  96.416  1.00 11.52 ? 442 GLN A N   1 
ATOM   3512  C  CA  . GLN A 1 442 ? 1.030   62.160  96.885  1.00 11.37 ? 442 GLN A CA  1 
ATOM   3513  C  C   . GLN A 1 442 ? 1.808   61.489  98.011  1.00 11.76 ? 442 GLN A C   1 
ATOM   3514  O  O   . GLN A 1 442 ? 1.222   60.947  98.949  1.00 11.90 ? 442 GLN A O   1 
ATOM   3515  C  CB  . GLN A 1 442 ? 0.801   61.185  95.729  1.00 11.03 ? 442 GLN A CB  1 
ATOM   3516  C  CG  . GLN A 1 442 ? -0.495  61.453  94.978  1.00 10.37 ? 442 GLN A CG  1 
ATOM   3517  C  CD  . GLN A 1 442 ? -0.862  60.359  94.001  1.00 10.02 ? 442 GLN A CD  1 
ATOM   3518  O  OE1 . GLN A 1 442 ? -1.912  60.409  93.366  1.00 9.49  ? 442 GLN A OE1 1 
ATOM   3519  N  NE2 . GLN A 1 442 ? 0.002   59.363  93.873  1.00 10.28 ? 442 GLN A NE2 1 
ATOM   3520  N  N   . VAL A 1 443 ? 3.132   61.541  97.920  1.00 12.02 ? 443 VAL A N   1 
ATOM   3521  C  CA  . VAL A 1 443 ? 3.992   60.948  98.939  1.00 12.16 ? 443 VAL A CA  1 
ATOM   3522  C  C   . VAL A 1 443 ? 3.713   61.590  100.291 1.00 12.10 ? 443 VAL A C   1 
ATOM   3523  O  O   . VAL A 1 443 ? 3.577   60.896  101.297 1.00 12.13 ? 443 VAL A O   1 
ATOM   3524  C  CB  . VAL A 1 443 ? 5.490   61.138  98.593  1.00 12.22 ? 443 VAL A CB  1 
ATOM   3525  C  CG1 . VAL A 1 443 ? 6.362   60.481  99.655  1.00 12.15 ? 443 VAL A CG1 1 
ATOM   3526  C  CG2 . VAL A 1 443 ? 5.784   60.536  97.224  1.00 12.41 ? 443 VAL A CG2 1 
ATOM   3527  N  N   . ARG A 1 444 ? 3.623   62.917  100.305 1.00 12.17 ? 444 ARG A N   1 
ATOM   3528  C  CA  . ARG A 1 444 ? 3.353   63.651  101.534 1.00 12.27 ? 444 ARG A CA  1 
ATOM   3529  C  C   . ARG A 1 444 ? 2.013   63.201  102.122 1.00 12.30 ? 444 ARG A C   1 
ATOM   3530  O  O   . ARG A 1 444 ? 1.906   62.943  103.323 1.00 12.30 ? 444 ARG A O   1 
ATOM   3531  C  CB  . ARG A 1 444 ? 3.326   65.155  101.252 1.00 12.29 ? 444 ARG A CB  1 
ATOM   3532  C  CG  . ARG A 1 444 ? 3.273   66.028  102.498 1.00 12.66 ? 444 ARG A CG  1 
ATOM   3533  C  CD  . ARG A 1 444 ? 3.776   67.438  102.199 1.00 13.26 ? 444 ARG A CD  1 
ATOM   3534  N  NE  . ARG A 1 444 ? 3.480   67.839  100.823 1.00 13.75 ? 444 ARG A NE  1 
ATOM   3535  C  CZ  . ARG A 1 444 ? 4.359   68.382  99.981  1.00 13.94 ? 444 ARG A CZ  1 
ATOM   3536  N  NH1 . ARG A 1 444 ? 5.612   68.598  100.365 1.00 14.13 ? 444 ARG A NH1 1 
ATOM   3537  N  NH2 . ARG A 1 444 ? 3.983   68.699  98.747  1.00 13.64 ? 444 ARG A NH2 1 
ATOM   3538  N  N   . ALA A 1 445 ? 1.003   63.099  101.262 1.00 12.20 ? 445 ALA A N   1 
ATOM   3539  C  CA  . ALA A 1 445 ? -0.335  62.682  101.677 1.00 12.27 ? 445 ALA A CA  1 
ATOM   3540  C  C   . ALA A 1 445 ? -0.328  61.290  102.308 1.00 12.11 ? 445 ALA A C   1 
ATOM   3541  O  O   . ALA A 1 445 ? -1.229  60.938  103.066 1.00 12.04 ? 445 ALA A O   1 
ATOM   3542  C  CB  . ALA A 1 445 ? -1.284  62.706  100.476 1.00 12.30 ? 445 ALA A CB  1 
ATOM   3543  N  N   . PHE A 1 446 ? 0.695   60.507  101.987 1.00 12.18 ? 446 PHE A N   1 
ATOM   3544  C  CA  . PHE A 1 446 ? 0.836   59.152  102.507 1.00 12.29 ? 446 PHE A CA  1 
ATOM   3545  C  C   . PHE A 1 446 ? 1.487   59.188  103.884 1.00 12.41 ? 446 PHE A C   1 
ATOM   3546  O  O   . PHE A 1 446 ? 0.964   58.637  104.854 1.00 12.37 ? 446 PHE A O   1 
ATOM   3547  C  CB  . PHE A 1 446 ? 1.692   58.328  101.541 1.00 12.33 ? 446 PHE A CB  1 
ATOM   3548  C  CG  . PHE A 1 446 ? 2.081   56.965  102.061 1.00 12.27 ? 446 PHE A CG  1 
ATOM   3549  C  CD1 . PHE A 1 446 ? 1.160   55.921  102.087 1.00 11.99 ? 446 PHE A CD1 1 
ATOM   3550  C  CD2 . PHE A 1 446 ? 3.389   56.710  102.471 1.00 12.41 ? 446 PHE A CD2 1 
ATOM   3551  C  CE1 . PHE A 1 446 ? 1.534   54.641  102.511 1.00 11.68 ? 446 PHE A CE1 1 
ATOM   3552  C  CE2 . PHE A 1 446 ? 3.772   55.429  102.896 1.00 12.27 ? 446 PHE A CE2 1 
ATOM   3553  C  CZ  . PHE A 1 446 ? 2.839   54.396  102.913 1.00 11.82 ? 446 PHE A CZ  1 
ATOM   3554  N  N   . TYR A 1 447 ? 2.634   59.850  103.955 1.00 12.57 ? 447 TYR A N   1 
ATOM   3555  C  CA  . TYR A 1 447 ? 3.377   59.975  105.199 1.00 12.84 ? 447 TYR A CA  1 
ATOM   3556  C  C   . TYR A 1 447 ? 2.522   60.599  106.296 1.00 12.96 ? 447 TYR A C   1 
ATOM   3557  O  O   . TYR A 1 447 ? 2.711   60.316  107.480 1.00 12.94 ? 447 TYR A O   1 
ATOM   3558  C  CB  . TYR A 1 447 ? 4.624   60.834  104.978 1.00 12.76 ? 447 TYR A CB  1 
ATOM   3559  C  CG  . TYR A 1 447 ? 5.429   61.068  106.229 1.00 12.93 ? 447 TYR A CG  1 
ATOM   3560  C  CD1 . TYR A 1 447 ? 5.456   62.319  106.840 1.00 13.03 ? 447 TYR A CD1 1 
ATOM   3561  C  CD2 . TYR A 1 447 ? 6.161   60.035  106.808 1.00 13.09 ? 447 TYR A CD2 1 
ATOM   3562  C  CE1 . TYR A 1 447 ? 6.197   62.536  108.002 1.00 13.32 ? 447 TYR A CE1 1 
ATOM   3563  C  CE2 . TYR A 1 447 ? 6.905   60.239  107.969 1.00 13.37 ? 447 TYR A CE2 1 
ATOM   3564  C  CZ  . TYR A 1 447 ? 6.919   61.491  108.559 1.00 13.39 ? 447 TYR A CZ  1 
ATOM   3565  O  OH  . TYR A 1 447 ? 7.663   61.697  109.694 1.00 13.75 ? 447 TYR A OH  1 
ATOM   3566  N  N   . VAL A 1 448 ? 1.579   61.445  105.894 1.00 12.90 ? 448 VAL A N   1 
ATOM   3567  C  CA  . VAL A 1 448 ? 0.717   62.123  106.851 1.00 13.12 ? 448 VAL A CA  1 
ATOM   3568  C  C   . VAL A 1 448 ? -0.575  61.374  107.179 1.00 13.48 ? 448 VAL A C   1 
ATOM   3569  O  O   . VAL A 1 448 ? -0.643  60.635  108.164 1.00 13.57 ? 448 VAL A O   1 
ATOM   3570  C  CB  . VAL A 1 448 ? 0.355   63.540  106.349 1.00 12.81 ? 448 VAL A CB  1 
ATOM   3571  C  CG1 . VAL A 1 448 ? -0.434  64.288  107.410 1.00 12.29 ? 448 VAL A CG1 1 
ATOM   3572  C  CG2 . VAL A 1 448 ? 1.620   64.297  105.988 1.00 12.43 ? 448 VAL A CG2 1 
ATOM   3573  N  N   . ASN A 1 449 ? -1.591  61.563  106.345 1.00 13.78 ? 449 ASN A N   1 
ATOM   3574  C  CA  . ASN A 1 449 ? -2.892  60.945  106.560 1.00 13.89 ? 449 ASN A CA  1 
ATOM   3575  C  C   . ASN A 1 449 ? -2.957  59.427  106.537 1.00 13.93 ? 449 ASN A C   1 
ATOM   3576  O  O   . ASN A 1 449 ? -3.713  58.831  107.314 1.00 13.83 ? 449 ASN A O   1 
ATOM   3577  C  CB  . ASN A 1 449 ? -3.890  61.504  105.557 1.00 14.15 ? 449 ASN A CB  1 
ATOM   3578  C  CG  . ASN A 1 449 ? -4.197  62.956  105.813 1.00 14.50 ? 449 ASN A CG  1 
ATOM   3579  O  OD1 . ASN A 1 449 ? -3.498  63.846  105.319 1.00 14.93 ? 449 ASN A OD1 1 
ATOM   3580  N  ND2 . ASN A 1 449 ? -5.240  63.212  106.599 1.00 14.56 ? 449 ASN A ND2 1 
ATOM   3581  N  N   . VAL A 1 450 ? -2.188  58.796  105.654 1.00 13.90 ? 450 VAL A N   1 
ATOM   3582  C  CA  . VAL A 1 450 ? -2.218  57.341  105.571 1.00 14.03 ? 450 VAL A CA  1 
ATOM   3583  C  C   . VAL A 1 450 ? -1.679  56.701  106.841 1.00 14.16 ? 450 VAL A C   1 
ATOM   3584  O  O   . VAL A 1 450 ? -2.339  55.854  107.447 1.00 14.26 ? 450 VAL A O   1 
ATOM   3585  C  CB  . VAL A 1 450 ? -1.405  56.823  104.382 1.00 13.88 ? 450 VAL A CB  1 
ATOM   3586  C  CG1 . VAL A 1 450 ? -1.464  55.303  104.346 1.00 13.76 ? 450 VAL A CG1 1 
ATOM   3587  C  CG2 . VAL A 1 450 ? -1.949  57.403  103.093 1.00 13.75 ? 450 VAL A CG2 1 
ATOM   3588  N  N   . LEU A 1 451 ? -0.479  57.110  107.241 1.00 14.28 ? 451 LEU A N   1 
ATOM   3589  C  CA  . LEU A 1 451 ? 0.144   56.570  108.444 1.00 14.11 ? 451 LEU A CA  1 
ATOM   3590  C  C   . LEU A 1 451 ? -0.122  57.450  109.658 1.00 13.93 ? 451 LEU A C   1 
ATOM   3591  O  O   . LEU A 1 451 ? -0.801  58.475  109.569 1.00 13.92 ? 451 LEU A O   1 
ATOM   3592  C  CB  . LEU A 1 451 ? 1.653   56.421  108.244 1.00 14.23 ? 451 LEU A CB  1 
ATOM   3593  C  CG  . LEU A 1 451 ? 2.096   55.748  106.940 1.00 14.27 ? 451 LEU A CG  1 
ATOM   3594  C  CD1 . LEU A 1 451 ? 3.125   56.632  106.237 1.00 14.29 ? 451 LEU A CD1 1 
ATOM   3595  C  CD2 . LEU A 1 451 ? 2.673   54.369  107.237 1.00 13.75 ? 451 LEU A CD2 1 
ATOM   3596  N  N   . ASN A 1 452 ? 0.420   57.038  110.796 1.00 13.86 ? 452 ASN A N   1 
ATOM   3597  C  CA  . ASN A 1 452 ? 0.245   57.778  112.036 1.00 13.84 ? 452 ASN A CA  1 
ATOM   3598  C  C   . ASN A 1 452 ? 1.582   57.908  112.756 1.00 13.76 ? 452 ASN A C   1 
ATOM   3599  O  O   . ASN A 1 452 ? 2.646   57.788  112.143 1.00 13.71 ? 452 ASN A O   1 
ATOM   3600  C  CB  . ASN A 1 452 ? -0.766  57.060  112.935 1.00 13.75 ? 452 ASN A CB  1 
ATOM   3601  C  CG  . ASN A 1 452 ? -0.362  55.627  113.240 1.00 13.82 ? 452 ASN A CG  1 
ATOM   3602  O  OD1 . ASN A 1 452 ? 0.824   55.281  113.217 1.00 13.42 ? 452 ASN A OD1 1 
ATOM   3603  N  ND2 . ASN A 1 452 ? -1.354  54.783  113.528 1.00 14.25 ? 452 ASN A ND2 1 
ATOM   3604  N  N   . GLU A 1 453 ? 1.527   58.161  114.057 1.00 13.48 ? 453 GLU A N   1 
ATOM   3605  C  CA  . GLU A 1 453 ? 2.740   58.288  114.843 1.00 13.44 ? 453 GLU A CA  1 
ATOM   3606  C  C   . GLU A 1 453 ? 3.616   57.039  114.714 1.00 13.40 ? 453 GLU A C   1 
ATOM   3607  O  O   . GLU A 1 453 ? 4.697   57.084  114.126 1.00 13.17 ? 453 GLU A O   1 
ATOM   3608  C  CB  . GLU A 1 453 ? 2.386   58.515  116.313 1.00 13.66 ? 453 GLU A CB  1 
ATOM   3609  C  CG  . GLU A 1 453 ? 3.101   59.696  116.933 1.00 14.26 ? 453 GLU A CG  1 
ATOM   3610  C  CD  . GLU A 1 453 ? 3.583   60.681  115.890 1.00 14.67 ? 453 GLU A CD  1 
ATOM   3611  O  OE1 . GLU A 1 453 ? 4.703   60.489  115.368 1.00 14.77 ? 453 GLU A OE1 1 
ATOM   3612  O  OE2 . GLU A 1 453 ? 2.838   61.643  115.588 1.00 15.38 ? 453 GLU A OE2 1 
ATOM   3613  N  N   . GLU A 1 454 ? 3.139   55.925  115.263 1.00 13.58 ? 454 GLU A N   1 
ATOM   3614  C  CA  . GLU A 1 454 ? 3.879   54.669  115.221 1.00 13.86 ? 454 GLU A CA  1 
ATOM   3615  C  C   . GLU A 1 454 ? 4.512   54.431  113.858 1.00 13.87 ? 454 GLU A C   1 
ATOM   3616  O  O   . GLU A 1 454 ? 5.729   54.540  113.700 1.00 14.15 ? 454 GLU A O   1 
ATOM   3617  C  CB  . GLU A 1 454 ? 2.957   53.495  115.575 1.00 14.05 ? 454 GLU A CB  1 
ATOM   3618  C  CG  . GLU A 1 454 ? 2.509   53.468  117.041 1.00 14.61 ? 454 GLU A CG  1 
ATOM   3619  C  CD  . GLU A 1 454 ? 3.639   53.092  118.001 1.00 14.95 ? 454 GLU A CD  1 
ATOM   3620  O  OE1 . GLU A 1 454 ? 4.757   53.639  117.861 1.00 15.10 ? 454 GLU A OE1 1 
ATOM   3621  O  OE2 . GLU A 1 454 ? 3.409   52.247  118.896 1.00 15.43 ? 454 GLU A OE2 1 
ATOM   3622  N  N   . GLN A 1 455 ? 3.678   54.115  112.874 1.00 13.71 ? 455 GLN A N   1 
ATOM   3623  C  CA  . GLN A 1 455 ? 4.147   53.845  111.521 1.00 13.52 ? 455 GLN A CA  1 
ATOM   3624  C  C   . GLN A 1 455 ? 5.198   54.839  111.028 1.00 13.45 ? 455 GLN A C   1 
ATOM   3625  O  O   . GLN A 1 455 ? 6.197   54.447  110.417 1.00 13.32 ? 455 GLN A O   1 
ATOM   3626  C  CB  . GLN A 1 455 ? 2.959   53.831  110.563 1.00 13.47 ? 455 GLN A CB  1 
ATOM   3627  C  CG  . GLN A 1 455 ? 1.921   52.769  110.899 1.00 13.19 ? 455 GLN A CG  1 
ATOM   3628  C  CD  . GLN A 1 455 ? 0.509   53.250  110.661 1.00 13.01 ? 455 GLN A CD  1 
ATOM   3629  O  OE1 . GLN A 1 455 ? 0.281   54.440  110.458 1.00 12.86 ? 455 GLN A OE1 1 
ATOM   3630  N  NE2 . GLN A 1 455 ? -0.449  52.326  110.681 1.00 12.85 ? 455 GLN A NE2 1 
ATOM   3631  N  N   . ARG A 1 456 ? 4.975   56.122  111.290 1.00 13.04 ? 456 ARG A N   1 
ATOM   3632  C  CA  . ARG A 1 456 ? 5.922   57.143  110.863 1.00 12.64 ? 456 ARG A CA  1 
ATOM   3633  C  C   . ARG A 1 456 ? 7.268   56.916  111.538 1.00 12.65 ? 456 ARG A C   1 
ATOM   3634  O  O   . ARG A 1 456 ? 8.326   57.045  110.914 1.00 12.48 ? 456 ARG A O   1 
ATOM   3635  C  CB  . ARG A 1 456 ? 5.396   58.528  111.220 1.00 12.52 ? 456 ARG A CB  1 
ATOM   3636  C  CG  . ARG A 1 456 ? 4.569   59.167  110.131 1.00 12.35 ? 456 ARG A CG  1 
ATOM   3637  C  CD  . ARG A 1 456 ? 4.156   60.571  110.517 1.00 12.37 ? 456 ARG A CD  1 
ATOM   3638  N  NE  . ARG A 1 456 ? 3.058   60.570  111.478 1.00 12.62 ? 456 ARG A NE  1 
ATOM   3639  C  CZ  . ARG A 1 456 ? 1.826   60.989  111.205 1.00 12.81 ? 456 ARG A CZ  1 
ATOM   3640  N  NH1 . ARG A 1 456 ? 1.527   61.447  109.995 1.00 12.85 ? 456 ARG A NH1 1 
ATOM   3641  N  NH2 . ARG A 1 456 ? 0.890   60.952  112.143 1.00 13.20 ? 456 ARG A NH2 1 
ATOM   3642  N  N   . LYS A 1 457 ? 7.225   56.579  112.822 1.00 12.90 ? 457 LYS A N   1 
ATOM   3643  C  CA  . LYS A 1 457 ? 8.447   56.326  113.578 1.00 13.31 ? 457 LYS A CA  1 
ATOM   3644  C  C   . LYS A 1 457 ? 9.126   55.082  113.015 1.00 13.24 ? 457 LYS A C   1 
ATOM   3645  O  O   . LYS A 1 457 ? 10.291  55.126  112.607 1.00 13.29 ? 457 LYS A O   1 
ATOM   3646  C  CB  . LYS A 1 457 ? 8.123   56.122  115.062 1.00 13.53 ? 457 LYS A CB  1 
ATOM   3647  C  CG  . LYS A 1 457 ? 9.348   55.947  115.957 1.00 14.15 ? 457 LYS A CG  1 
ATOM   3648  C  CD  . LYS A 1 457 ? 9.090   54.939  117.080 1.00 14.66 ? 457 LYS A CD  1 
ATOM   3649  C  CE  . LYS A 1 457 ? 8.939   53.512  116.537 1.00 15.20 ? 457 LYS A CE  1 
ATOM   3650  N  NZ  . LYS A 1 457 ? 8.094   52.636  117.412 1.00 15.36 ? 457 LYS A NZ  1 
ATOM   3651  N  N   . ARG A 1 458 ? 8.383   53.980  112.983 1.00 12.84 ? 458 ARG A N   1 
ATOM   3652  C  CA  . ARG A 1 458 ? 8.898   52.718  112.465 1.00 12.76 ? 458 ARG A CA  1 
ATOM   3653  C  C   . ARG A 1 458 ? 9.497   52.886  111.067 1.00 12.55 ? 458 ARG A C   1 
ATOM   3654  O  O   . ARG A 1 458 ? 10.598  52.407  110.792 1.00 12.45 ? 458 ARG A O   1 
ATOM   3655  C  CB  . ARG A 1 458 ? 7.777   51.672  112.423 1.00 12.69 ? 458 ARG A CB  1 
ATOM   3656  C  CG  . ARG A 1 458 ? 8.240   50.239  112.689 1.00 12.52 ? 458 ARG A CG  1 
ATOM   3657  C  CD  . ARG A 1 458 ? 7.344   49.540  113.698 1.00 12.41 ? 458 ARG A CD  1 
ATOM   3658  N  NE  . ARG A 1 458 ? 6.051   50.203  113.827 1.00 12.88 ? 458 ARG A NE  1 
ATOM   3659  C  CZ  . ARG A 1 458 ? 4.884   49.567  113.861 1.00 13.17 ? 458 ARG A CZ  1 
ATOM   3660  N  NH1 . ARG A 1 458 ? 4.843   48.245  113.774 1.00 13.49 ? 458 ARG A NH1 1 
ATOM   3661  N  NH2 . ARG A 1 458 ? 3.755   50.253  113.984 1.00 13.60 ? 458 ARG A NH2 1 
ATOM   3662  N  N   . LEU A 1 459 ? 8.765   53.566  110.190 1.00 12.42 ? 459 LEU A N   1 
ATOM   3663  C  CA  . LEU A 1 459 ? 9.220   53.795  108.829 1.00 12.27 ? 459 LEU A CA  1 
ATOM   3664  C  C   . LEU A 1 459 ? 10.602  54.442  108.816 1.00 12.61 ? 459 LEU A C   1 
ATOM   3665  O  O   . LEU A 1 459 ? 11.558  53.869  108.291 1.00 12.67 ? 459 LEU A O   1 
ATOM   3666  C  CB  . LEU A 1 459 ? 8.222   54.685  108.090 1.00 12.14 ? 459 LEU A CB  1 
ATOM   3667  C  CG  . LEU A 1 459 ? 8.670   55.320  106.773 1.00 11.89 ? 459 LEU A CG  1 
ATOM   3668  C  CD1 . LEU A 1 459 ? 8.861   54.251  105.718 1.00 12.05 ? 459 LEU A CD1 1 
ATOM   3669  C  CD2 . LEU A 1 459 ? 7.632   56.323  106.324 1.00 11.87 ? 459 LEU A CD2 1 
ATOM   3670  N  N   . CYS A 1 460 ? 10.715  55.636  109.388 1.00 12.89 ? 460 CYS A N   1 
ATOM   3671  C  CA  . CYS A 1 460 ? 12.000  56.321  109.415 1.00 13.12 ? 460 CYS A CA  1 
ATOM   3672  C  C   . CYS A 1 460 ? 13.060  55.394  109.975 1.00 12.89 ? 460 CYS A C   1 
ATOM   3673  O  O   . CYS A 1 460 ? 14.186  55.340  109.472 1.00 12.83 ? 460 CYS A O   1 
ATOM   3674  C  CB  . CYS A 1 460 ? 11.918  57.578  110.268 1.00 13.64 ? 460 CYS A CB  1 
ATOM   3675  S  SG  . CYS A 1 460 ? 11.129  58.937  109.411 1.00 15.11 ? 460 CYS A SG  1 
ATOM   3676  N  N   . GLU A 1 461 ? 12.695  54.661  111.021 1.00 12.74 ? 461 GLU A N   1 
ATOM   3677  C  CA  . GLU A 1 461 ? 13.625  53.727  111.636 1.00 12.64 ? 461 GLU A CA  1 
ATOM   3678  C  C   . GLU A 1 461 ? 14.135  52.786  110.561 1.00 12.38 ? 461 GLU A C   1 
ATOM   3679  O  O   . GLU A 1 461 ? 15.328  52.754  110.270 1.00 12.21 ? 461 GLU A O   1 
ATOM   3680  C  CB  . GLU A 1 461 ? 12.930  52.922  112.730 1.00 12.96 ? 461 GLU A CB  1 
ATOM   3681  C  CG  . GLU A 1 461 ? 13.549  53.087  114.102 1.00 13.61 ? 461 GLU A CG  1 
ATOM   3682  C  CD  . GLU A 1 461 ? 12.541  53.563  115.134 1.00 13.97 ? 461 GLU A CD  1 
ATOM   3683  O  OE1 . GLU A 1 461 ? 11.644  52.769  115.506 1.00 13.98 ? 461 GLU A OE1 1 
ATOM   3684  O  OE2 . GLU A 1 461 ? 12.649  54.734  115.568 1.00 14.22 ? 461 GLU A OE2 1 
ATOM   3685  N  N   . ASN A 1 462 ? 13.212  52.033  109.970 1.00 12.15 ? 462 ASN A N   1 
ATOM   3686  C  CA  . ASN A 1 462 ? 13.534  51.076  108.917 1.00 12.20 ? 462 ASN A CA  1 
ATOM   3687  C  C   . ASN A 1 462 ? 14.463  51.669  107.866 1.00 11.98 ? 462 ASN A C   1 
ATOM   3688  O  O   . ASN A 1 462 ? 15.496  51.082  107.536 1.00 11.62 ? 462 ASN A O   1 
ATOM   3689  C  CB  . ASN A 1 462 ? 12.247  50.585  108.251 1.00 12.52 ? 462 ASN A CB  1 
ATOM   3690  C  CG  . ASN A 1 462 ? 11.447  49.670  109.150 1.00 12.96 ? 462 ASN A CG  1 
ATOM   3691  O  OD1 . ASN A 1 462 ? 11.983  49.096  110.102 1.00 13.45 ? 462 ASN A OD1 1 
ATOM   3692  N  ND2 . ASN A 1 462 ? 10.159  49.523  108.855 1.00 13.16 ? 462 ASN A ND2 1 
ATOM   3693  N  N   . ILE A 1 463 ? 14.087  52.835  107.349 1.00 12.01 ? 463 ILE A N   1 
ATOM   3694  C  CA  . ILE A 1 463 ? 14.875  53.530  106.337 1.00 12.16 ? 463 ILE A CA  1 
ATOM   3695  C  C   . ILE A 1 463 ? 16.292  53.809  106.821 1.00 12.37 ? 463 ILE A C   1 
ATOM   3696  O  O   . ILE A 1 463 ? 17.263  53.320  106.241 1.00 12.54 ? 463 ILE A O   1 
ATOM   3697  C  CB  . ILE A 1 463 ? 14.226  54.877  105.962 1.00 12.23 ? 463 ILE A CB  1 
ATOM   3698  C  CG1 . ILE A 1 463 ? 12.882  54.635  105.276 1.00 12.11 ? 463 ILE A CG1 1 
ATOM   3699  C  CG2 . ILE A 1 463 ? 15.162  55.682  105.071 1.00 12.32 ? 463 ILE A CG2 1 
ATOM   3700  C  CD1 . ILE A 1 463 ? 11.959  55.826  105.327 1.00 11.83 ? 463 ILE A CD1 1 
ATOM   3701  N  N   . ALA A 1 464 ? 16.399  54.600  107.888 1.00 12.46 ? 464 ALA A N   1 
ATOM   3702  C  CA  . ALA A 1 464 ? 17.692  54.973  108.463 1.00 12.68 ? 464 ALA A CA  1 
ATOM   3703  C  C   . ALA A 1 464 ? 18.588  53.767  108.719 1.00 12.35 ? 464 ALA A C   1 
ATOM   3704  O  O   . ALA A 1 464 ? 19.785  53.802  108.445 1.00 12.43 ? 464 ALA A O   1 
ATOM   3705  C  CB  . ALA A 1 464 ? 17.483  55.759  109.768 1.00 12.56 ? 464 ALA A CB  1 
ATOM   3706  N  N   . GLY A 1 465 ? 18.003  52.702  109.252 1.00 12.43 ? 465 GLY A N   1 
ATOM   3707  C  CA  . GLY A 1 465 ? 18.778  51.509  109.525 1.00 12.66 ? 465 GLY A CA  1 
ATOM   3708  C  C   . GLY A 1 465 ? 19.521  51.040  108.289 1.00 12.59 ? 465 GLY A C   1 
ATOM   3709  O  O   . GLY A 1 465 ? 20.638  50.531  108.378 1.00 12.53 ? 465 GLY A O   1 
ATOM   3710  N  N   . HIS A 1 466 ? 18.900  51.231  107.129 1.00 12.62 ? 466 HIS A N   1 
ATOM   3711  C  CA  . HIS A 1 466 ? 19.492  50.819  105.864 1.00 12.54 ? 466 HIS A CA  1 
ATOM   3712  C  C   . HIS A 1 466 ? 20.355  51.884  105.209 1.00 12.48 ? 466 HIS A C   1 
ATOM   3713  O  O   . HIS A 1 466 ? 21.518  51.640  104.902 1.00 12.52 ? 466 HIS A O   1 
ATOM   3714  C  CB  . HIS A 1 466 ? 18.401  50.399  104.876 1.00 12.81 ? 466 HIS A CB  1 
ATOM   3715  C  CG  . HIS A 1 466 ? 18.924  49.646  103.693 1.00 12.93 ? 466 HIS A CG  1 
ATOM   3716  N  ND1 . HIS A 1 466 ? 18.306  49.672  102.462 1.00 13.03 ? 466 HIS A ND1 1 
ATOM   3717  C  CD2 . HIS A 1 466 ? 20.009  48.849  103.553 1.00 12.95 ? 466 HIS A CD2 1 
ATOM   3718  C  CE1 . HIS A 1 466 ? 18.989  48.922  101.614 1.00 13.09 ? 466 HIS A CE1 1 
ATOM   3719  N  NE2 . HIS A 1 466 ? 20.027  48.411  102.252 1.00 12.94 ? 466 HIS A NE2 1 
ATOM   3720  N  N   . LEU A 1 467 ? 19.779  53.061  104.984 1.00 12.57 ? 467 LEU A N   1 
ATOM   3721  C  CA  . LEU A 1 467 ? 20.501  54.157  104.341 1.00 12.53 ? 467 LEU A CA  1 
ATOM   3722  C  C   . LEU A 1 467 ? 21.713  54.643  105.141 1.00 12.56 ? 467 LEU A C   1 
ATOM   3723  O  O   . LEU A 1 467 ? 22.492  55.465  104.663 1.00 12.25 ? 467 LEU A O   1 
ATOM   3724  C  CB  . LEU A 1 467 ? 19.543  55.325  104.076 1.00 12.70 ? 467 LEU A CB  1 
ATOM   3725  C  CG  . LEU A 1 467 ? 20.083  56.754  104.209 1.00 12.93 ? 467 LEU A CG  1 
ATOM   3726  C  CD1 . LEU A 1 467 ? 20.835  57.144  102.945 1.00 12.98 ? 467 LEU A CD1 1 
ATOM   3727  C  CD2 . LEU A 1 467 ? 18.927  57.716  104.476 1.00 13.00 ? 467 LEU A CD2 1 
ATOM   3728  N  N   . LYS A 1 468 ? 21.881  54.125  106.351 1.00 12.70 ? 468 LYS A N   1 
ATOM   3729  C  CA  . LYS A 1 468 ? 23.010  54.529  107.184 1.00 13.31 ? 468 LYS A CA  1 
ATOM   3730  C  C   . LYS A 1 468 ? 24.312  53.925  106.665 1.00 13.13 ? 468 LYS A C   1 
ATOM   3731  O  O   . LYS A 1 468 ? 25.353  54.583  106.648 1.00 13.00 ? 468 LYS A O   1 
ATOM   3732  C  CB  . LYS A 1 468 ? 22.780  54.093  108.637 1.00 13.51 ? 468 LYS A CB  1 
ATOM   3733  C  CG  . LYS A 1 468 ? 22.866  52.589  108.854 1.00 13.86 ? 468 LYS A CG  1 
ATOM   3734  C  CD  . LYS A 1 468 ? 23.481  52.262  110.204 1.00 13.68 ? 468 LYS A CD  1 
ATOM   3735  C  CE  . LYS A 1 468 ? 23.432  50.766  110.472 1.00 13.40 ? 468 LYS A CE  1 
ATOM   3736  N  NZ  . LYS A 1 468 ? 23.461  49.987  109.206 1.00 12.84 ? 468 LYS A NZ  1 
ATOM   3737  N  N   . ASP A 1 469 ? 24.234  52.671  106.234 1.00 13.05 ? 469 ASP A N   1 
ATOM   3738  C  CA  . ASP A 1 469 ? 25.383  51.937  105.720 1.00 12.97 ? 469 ASP A CA  1 
ATOM   3739  C  C   . ASP A 1 469 ? 25.930  52.514  104.418 1.00 13.26 ? 469 ASP A C   1 
ATOM   3740  O  O   . ASP A 1 469 ? 26.867  51.967  103.835 1.00 13.22 ? 469 ASP A O   1 
ATOM   3741  C  CB  . ASP A 1 469 ? 24.996  50.475  105.494 1.00 12.75 ? 469 ASP A CB  1 
ATOM   3742  C  CG  . ASP A 1 469 ? 25.128  49.637  106.748 1.00 12.48 ? 469 ASP A CG  1 
ATOM   3743  O  OD1 . ASP A 1 469 ? 26.081  49.878  107.523 1.00 12.44 ? 469 ASP A OD1 1 
ATOM   3744  O  OD2 . ASP A 1 469 ? 24.279  48.741  106.951 1.00 11.76 ? 469 ASP A OD2 1 
ATOM   3745  N  N   . ALA A 1 470 ? 25.338  53.614  103.965 1.00 13.51 ? 470 ALA A N   1 
ATOM   3746  C  CA  . ALA A 1 470 ? 25.758  54.253  102.727 1.00 13.44 ? 470 ALA A CA  1 
ATOM   3747  C  C   . ALA A 1 470 ? 26.719  55.400  103.005 1.00 13.74 ? 470 ALA A C   1 
ATOM   3748  O  O   . ALA A 1 470 ? 26.898  55.806  104.155 1.00 13.80 ? 470 ALA A O   1 
ATOM   3749  C  CB  . ALA A 1 470 ? 24.539  54.761  101.975 1.00 13.49 ? 470 ALA A CB  1 
ATOM   3750  N  N   . GLN A 1 471 ? 27.335  55.916  101.943 1.00 14.05 ? 471 GLN A N   1 
ATOM   3751  C  CA  . GLN A 1 471 ? 28.286  57.020  102.053 1.00 14.34 ? 471 GLN A CA  1 
ATOM   3752  C  C   . GLN A 1 471 ? 27.585  58.328  102.425 1.00 14.24 ? 471 GLN A C   1 
ATOM   3753  O  O   . GLN A 1 471 ? 26.502  58.634  101.919 1.00 14.47 ? 471 GLN A O   1 
ATOM   3754  C  CB  . GLN A 1 471 ? 29.028  57.204  100.727 1.00 14.55 ? 471 GLN A CB  1 
ATOM   3755  C  CG  . GLN A 1 471 ? 30.277  56.353  100.573 1.00 14.88 ? 471 GLN A CG  1 
ATOM   3756  C  CD  . GLN A 1 471 ? 31.102  56.766  99.367  1.00 15.10 ? 471 GLN A CD  1 
ATOM   3757  O  OE1 . GLN A 1 471 ? 31.097  56.087  98.341  1.00 15.52 ? 471 GLN A OE1 1 
ATOM   3758  N  NE2 . GLN A 1 471 ? 31.811  57.891  99.482  1.00 15.10 ? 471 GLN A NE2 1 
ATOM   3759  N  N   . ILE A 1 472 ? 28.218  59.095  103.307 1.00 13.92 ? 472 ILE A N   1 
ATOM   3760  C  CA  . ILE A 1 472 ? 27.678  60.370  103.761 1.00 13.42 ? 472 ILE A CA  1 
ATOM   3761  C  C   . ILE A 1 472 ? 27.135  61.244  102.626 1.00 13.09 ? 472 ILE A C   1 
ATOM   3762  O  O   . ILE A 1 472 ? 25.979  61.678  102.672 1.00 12.81 ? 472 ILE A O   1 
ATOM   3763  C  CB  . ILE A 1 472 ? 28.750  61.167  104.549 1.00 13.56 ? 472 ILE A CB  1 
ATOM   3764  C  CG1 . ILE A 1 472 ? 28.586  60.904  106.044 1.00 13.69 ? 472 ILE A CG1 1 
ATOM   3765  C  CG2 . ILE A 1 472 ? 28.626  62.660  104.276 1.00 13.63 ? 472 ILE A CG2 1 
ATOM   3766  C  CD1 . ILE A 1 472 ? 29.027  59.523  106.465 1.00 14.19 ? 472 ILE A CD1 1 
ATOM   3767  N  N   . PHE A 1 473 ? 27.958  61.503  101.613 1.00 12.58 ? 473 PHE A N   1 
ATOM   3768  C  CA  . PHE A 1 473 ? 27.521  62.347  100.507 1.00 12.41 ? 473 PHE A CA  1 
ATOM   3769  C  C   . PHE A 1 473 ? 26.225  61.838  99.898  1.00 12.14 ? 473 PHE A C   1 
ATOM   3770  O  O   . PHE A 1 473 ? 25.408  62.624  99.417  1.00 11.96 ? 473 PHE A O   1 
ATOM   3771  C  CB  . PHE A 1 473 ? 28.623  62.458  99.439  1.00 12.59 ? 473 PHE A CB  1 
ATOM   3772  C  CG  . PHE A 1 473 ? 28.586  61.375  98.391  1.00 12.74 ? 473 PHE A CG  1 
ATOM   3773  C  CD1 . PHE A 1 473 ? 27.666  61.426  97.343  1.00 12.75 ? 473 PHE A CD1 1 
ATOM   3774  C  CD2 . PHE A 1 473 ? 29.496  60.321  98.432  1.00 12.92 ? 473 PHE A CD2 1 
ATOM   3775  C  CE1 . PHE A 1 473 ? 27.651  60.445  96.353  1.00 12.73 ? 473 PHE A CE1 1 
ATOM   3776  C  CE2 . PHE A 1 473 ? 29.492  59.336  97.448  1.00 12.97 ? 473 PHE A CE2 1 
ATOM   3777  C  CZ  . PHE A 1 473 ? 28.567  59.399  96.405  1.00 12.86 ? 473 PHE A CZ  1 
ATOM   3778  N  N   . ILE A 1 474 ? 26.043  60.520  99.927  1.00 12.17 ? 474 ILE A N   1 
ATOM   3779  C  CA  . ILE A 1 474 ? 24.830  59.901  99.398  1.00 12.16 ? 474 ILE A CA  1 
ATOM   3780  C  C   . ILE A 1 474 ? 23.715  60.092  100.421 1.00 12.22 ? 474 ILE A C   1 
ATOM   3781  O  O   . ILE A 1 474 ? 22.564  60.374  100.068 1.00 11.94 ? 474 ILE A O   1 
ATOM   3782  C  CB  . ILE A 1 474 ? 25.039  58.387  99.146  1.00 12.18 ? 474 ILE A CB  1 
ATOM   3783  C  CG1 . ILE A 1 474 ? 25.739  58.175  97.804  1.00 12.17 ? 474 ILE A CG1 1 
ATOM   3784  C  CG2 . ILE A 1 474 ? 23.706  57.661  99.143  1.00 12.62 ? 474 ILE A CG2 1 
ATOM   3785  C  CD1 . ILE A 1 474 ? 26.370  56.815  97.649  1.00 11.84 ? 474 ILE A CD1 1 
ATOM   3786  N  N   . GLN A 1 475 ? 24.077  59.942  101.692 1.00 12.45 ? 475 GLN A N   1 
ATOM   3787  C  CA  . GLN A 1 475 ? 23.129  60.096  102.787 1.00 12.96 ? 475 GLN A CA  1 
ATOM   3788  C  C   . GLN A 1 475 ? 22.443  61.451  102.731 1.00 12.95 ? 475 GLN A C   1 
ATOM   3789  O  O   . GLN A 1 475 ? 21.227  61.547  102.900 1.00 13.08 ? 475 GLN A O   1 
ATOM   3790  C  CB  . GLN A 1 475 ? 23.842  59.946  104.127 1.00 13.12 ? 475 GLN A CB  1 
ATOM   3791  C  CG  . GLN A 1 475 ? 24.048  58.509  104.551 1.00 13.24 ? 475 GLN A CG  1 
ATOM   3792  C  CD  . GLN A 1 475 ? 24.813  58.397  105.846 1.00 13.17 ? 475 GLN A CD  1 
ATOM   3793  O  OE1 . GLN A 1 475 ? 26.005  58.083  105.850 1.00 13.25 ? 475 GLN A OE1 1 
ATOM   3794  N  NE2 . GLN A 1 475 ? 24.134  58.653  106.956 1.00 12.93 ? 475 GLN A NE2 1 
ATOM   3795  N  N   . LYS A 1 476 ? 23.230  62.496  102.493 1.00 12.64 ? 476 LYS A N   1 
ATOM   3796  C  CA  . LYS A 1 476 ? 22.694  63.848  102.412 1.00 12.40 ? 476 LYS A CA  1 
ATOM   3797  C  C   . LYS A 1 476 ? 21.601  63.922  101.355 1.00 12.32 ? 476 LYS A C   1 
ATOM   3798  O  O   . LYS A 1 476 ? 20.465  64.291  101.651 1.00 12.25 ? 476 LYS A O   1 
ATOM   3799  C  CB  . LYS A 1 476 ? 23.809  64.839  102.076 1.00 12.36 ? 476 LYS A CB  1 
ATOM   3800  C  CG  . LYS A 1 476 ? 25.045  64.706  102.952 1.00 12.35 ? 476 LYS A CG  1 
ATOM   3801  C  CD  . LYS A 1 476 ? 25.220  65.931  103.843 1.00 12.49 ? 476 LYS A CD  1 
ATOM   3802  C  CE  . LYS A 1 476 ? 26.192  66.938  103.227 1.00 12.51 ? 476 LYS A CE  1 
ATOM   3803  N  NZ  . LYS A 1 476 ? 27.400  67.176  104.076 1.00 12.39 ? 476 LYS A NZ  1 
ATOM   3804  N  N   . LYS A 1 477 ? 21.953  63.559  100.125 1.00 12.19 ? 477 LYS A N   1 
ATOM   3805  C  CA  . LYS A 1 477 ? 21.008  63.584  99.017  1.00 12.31 ? 477 LYS A CA  1 
ATOM   3806  C  C   . LYS A 1 477 ? 19.642  63.052  99.435  1.00 12.13 ? 477 LYS A C   1 
ATOM   3807  O  O   . LYS A 1 477 ? 18.658  63.792  99.459  1.00 11.91 ? 477 LYS A O   1 
ATOM   3808  C  CB  . LYS A 1 477 ? 21.546  62.756  97.843  1.00 12.63 ? 477 LYS A CB  1 
ATOM   3809  C  CG  . LYS A 1 477 ? 21.286  63.378  96.476  1.00 13.27 ? 477 LYS A CG  1 
ATOM   3810  C  CD  . LYS A 1 477 ? 22.168  62.760  95.404  1.00 14.11 ? 477 LYS A CD  1 
ATOM   3811  C  CE  . LYS A 1 477 ? 23.638  63.115  95.608  1.00 14.62 ? 477 LYS A CE  1 
ATOM   3812  N  NZ  . LYS A 1 477 ? 24.537  62.148  94.915  1.00 15.43 ? 477 LYS A NZ  1 
ATOM   3813  N  N   . ALA A 1 478 ? 19.596  61.766  99.769  1.00 12.21 ? 478 ALA A N   1 
ATOM   3814  C  CA  . ALA A 1 478 ? 18.358  61.117  100.181 1.00 12.13 ? 478 ALA A CA  1 
ATOM   3815  C  C   . ALA A 1 478 ? 17.569  61.966  101.168 1.00 12.46 ? 478 ALA A C   1 
ATOM   3816  O  O   . ALA A 1 478 ? 16.359  62.159  101.004 1.00 12.52 ? 478 ALA A O   1 
ATOM   3817  C  CB  . ALA A 1 478 ? 18.663  59.758  100.793 1.00 11.97 ? 478 ALA A CB  1 
ATOM   3818  N  N   . VAL A 1 479 ? 18.254  62.475  102.191 1.00 12.67 ? 479 VAL A N   1 
ATOM   3819  C  CA  . VAL A 1 479 ? 17.602  63.292  103.207 1.00 13.06 ? 479 VAL A CA  1 
ATOM   3820  C  C   . VAL A 1 479 ? 16.985  64.552  102.591 1.00 13.15 ? 479 VAL A C   1 
ATOM   3821  O  O   . VAL A 1 479 ? 15.864  64.937  102.934 1.00 13.13 ? 479 VAL A O   1 
ATOM   3822  C  CB  . VAL A 1 479 ? 18.593  63.692  104.324 1.00 13.03 ? 479 VAL A CB  1 
ATOM   3823  C  CG1 . VAL A 1 479 ? 17.910  64.625  105.313 1.00 13.13 ? 479 VAL A CG1 1 
ATOM   3824  C  CG2 . VAL A 1 479 ? 19.088  62.452  105.048 1.00 13.02 ? 479 VAL A CG2 1 
ATOM   3825  N  N   . LYS A 1 480 ? 17.718  65.190  101.685 1.00 12.97 ? 480 LYS A N   1 
ATOM   3826  C  CA  . LYS A 1 480 ? 17.222  66.387  101.021 1.00 12.73 ? 480 LYS A CA  1 
ATOM   3827  C  C   . LYS A 1 480 ? 15.903  66.042  100.350 1.00 12.60 ? 480 LYS A C   1 
ATOM   3828  O  O   . LYS A 1 480 ? 14.966  66.841  100.342 1.00 12.43 ? 480 LYS A O   1 
ATOM   3829  C  CB  . LYS A 1 480 ? 18.220  66.861  99.963  1.00 12.99 ? 480 LYS A CB  1 
ATOM   3830  C  CG  . LYS A 1 480 ? 18.436  68.369  99.938  1.00 12.91 ? 480 LYS A CG  1 
ATOM   3831  C  CD  . LYS A 1 480 ? 19.130  68.819  98.653  1.00 12.61 ? 480 LYS A CD  1 
ATOM   3832  C  CE  . LYS A 1 480 ? 18.195  69.639  97.785  1.00 12.25 ? 480 LYS A CE  1 
ATOM   3833  N  NZ  . LYS A 1 480 ? 16.807  69.639  98.330  1.00 12.13 ? 480 LYS A NZ  1 
ATOM   3834  N  N   . ASN A 1 481 ? 15.840  64.836  99.795  1.00 12.79 ? 481 ASN A N   1 
ATOM   3835  C  CA  . ASN A 1 481 ? 14.647  64.358  99.109  1.00 12.70 ? 481 ASN A CA  1 
ATOM   3836  C  C   . ASN A 1 481 ? 13.521  64.101  100.091 1.00 12.51 ? 481 ASN A C   1 
ATOM   3837  O  O   . ASN A 1 481 ? 12.375  64.488  99.853  1.00 12.68 ? 481 ASN A O   1 
ATOM   3838  C  CB  . ASN A 1 481 ? 14.971  63.086  98.332  1.00 12.68 ? 481 ASN A CB  1 
ATOM   3839  C  CG  . ASN A 1 481 ? 15.877  63.354  97.158  1.00 12.83 ? 481 ASN A CG  1 
ATOM   3840  O  OD1 . ASN A 1 481 ? 15.613  64.248  96.354  1.00 13.17 ? 481 ASN A OD1 1 
ATOM   3841  N  ND2 . ASN A 1 481 ? 16.959  62.591  97.053  1.00 12.51 ? 481 ASN A ND2 1 
ATOM   3842  N  N   . PHE A 1 482 ? 13.846  63.452  101.202 1.00 12.35 ? 482 PHE A N   1 
ATOM   3843  C  CA  . PHE A 1 482 ? 12.837  63.171  102.217 1.00 12.24 ? 482 PHE A CA  1 
ATOM   3844  C  C   . PHE A 1 482 ? 12.320  64.461  102.843 1.00 12.07 ? 482 PHE A C   1 
ATOM   3845  O  O   . PHE A 1 482 ? 11.145  64.559  103.182 1.00 11.82 ? 482 PHE A O   1 
ATOM   3846  C  CB  . PHE A 1 482 ? 13.411  62.262  103.304 1.00 12.05 ? 482 PHE A CB  1 
ATOM   3847  C  CG  . PHE A 1 482 ? 13.591  60.840  102.867 1.00 11.90 ? 482 PHE A CG  1 
ATOM   3848  C  CD1 . PHE A 1 482 ? 12.509  60.104  102.400 1.00 11.87 ? 482 PHE A CD1 1 
ATOM   3849  C  CD2 . PHE A 1 482 ? 14.841  60.237  102.909 1.00 11.84 ? 482 PHE A CD2 1 
ATOM   3850  C  CE1 . PHE A 1 482 ? 12.671  58.786  101.981 1.00 11.72 ? 482 PHE A CE1 1 
ATOM   3851  C  CE2 . PHE A 1 482 ? 15.010  58.922  102.492 1.00 11.68 ? 482 PHE A CE2 1 
ATOM   3852  C  CZ  . PHE A 1 482 ? 13.923  58.197  102.028 1.00 11.62 ? 482 PHE A CZ  1 
ATOM   3853  N  N   . THR A 1 483 ? 13.197  65.449  102.992 1.00 12.25 ? 483 THR A N   1 
ATOM   3854  C  CA  . THR A 1 483 ? 12.808  66.728  103.571 1.00 12.50 ? 483 THR A CA  1 
ATOM   3855  C  C   . THR A 1 483 ? 11.853  67.444  102.617 1.00 12.65 ? 483 THR A C   1 
ATOM   3856  O  O   . THR A 1 483 ? 11.027  68.256  103.036 1.00 12.69 ? 483 THR A O   1 
ATOM   3857  C  CB  . THR A 1 483 ? 14.034  67.628  103.822 1.00 12.75 ? 483 THR A CB  1 
ATOM   3858  O  OG1 . THR A 1 483 ? 15.022  66.903  104.569 1.00 13.01 ? 483 THR A OG1 1 
ATOM   3859  C  CG2 . THR A 1 483 ? 13.629  68.861  104.606 1.00 12.96 ? 483 THR A CG2 1 
ATOM   3860  N  N   . GLU A 1 484 ? 11.974  67.135  101.328 1.00 12.86 ? 484 GLU A N   1 
ATOM   3861  C  CA  . GLU A 1 484 ? 11.114  67.727  100.311 1.00 12.99 ? 484 GLU A CA  1 
ATOM   3862  C  C   . GLU A 1 484 ? 9.687   67.220  100.488 1.00 12.89 ? 484 GLU A C   1 
ATOM   3863  O  O   . GLU A 1 484 ? 8.724   67.947  100.230 1.00 13.00 ? 484 GLU A O   1 
ATOM   3864  C  CB  . GLU A 1 484 ? 11.615  67.359  98.918  1.00 13.22 ? 484 GLU A CB  1 
ATOM   3865  C  CG  . GLU A 1 484 ? 13.001  67.868  98.614  1.00 13.92 ? 484 GLU A CG  1 
ATOM   3866  C  CD  . GLU A 1 484 ? 12.984  69.123  97.767  1.00 14.38 ? 484 GLU A CD  1 
ATOM   3867  O  OE1 . GLU A 1 484 ? 14.050  69.493  97.226  1.00 14.70 ? 484 GLU A OE1 1 
ATOM   3868  O  OE2 . GLU A 1 484 ? 11.902  69.740  97.641  1.00 14.87 ? 484 GLU A OE2 1 
ATOM   3869  N  N   . VAL A 1 485 ? 9.561   65.964  100.918 1.00 12.70 ? 485 VAL A N   1 
ATOM   3870  C  CA  . VAL A 1 485 ? 8.254   65.360  101.143 1.00 12.57 ? 485 VAL A CA  1 
ATOM   3871  C  C   . VAL A 1 485 ? 7.650   65.976  102.395 1.00 12.79 ? 485 VAL A C   1 
ATOM   3872  O  O   . VAL A 1 485 ? 6.486   66.371  102.408 1.00 12.66 ? 485 VAL A O   1 
ATOM   3873  C  CB  . VAL A 1 485 ? 8.355   63.839  101.354 1.00 12.36 ? 485 VAL A CB  1 
ATOM   3874  C  CG1 . VAL A 1 485 ? 6.960   63.252  101.473 1.00 12.14 ? 485 VAL A CG1 1 
ATOM   3875  C  CG2 . VAL A 1 485 ? 9.119   63.195  100.206 1.00 12.05 ? 485 VAL A CG2 1 
ATOM   3876  N  N   . HIS A 1 486 ? 8.454   66.051  103.449 1.00 12.69 ? 486 HIS A N   1 
ATOM   3877  C  CA  . HIS A 1 486 ? 8.011   66.632  104.707 1.00 13.04 ? 486 HIS A CA  1 
ATOM   3878  C  C   . HIS A 1 486 ? 9.201   66.978  105.589 1.00 12.97 ? 486 HIS A C   1 
ATOM   3879  O  O   . HIS A 1 486 ? 10.105  66.165  105.769 1.00 13.08 ? 486 HIS A O   1 
ATOM   3880  C  CB  . HIS A 1 486 ? 7.088   65.667  105.460 1.00 13.18 ? 486 HIS A CB  1 
ATOM   3881  C  CG  . HIS A 1 486 ? 6.361   66.306  106.603 1.00 13.23 ? 486 HIS A CG  1 
ATOM   3882  N  ND1 . HIS A 1 486 ? 4.996   66.488  106.609 1.00 13.30 ? 486 HIS A ND1 1 
ATOM   3883  C  CD2 . HIS A 1 486 ? 6.817   66.840  107.762 1.00 13.28 ? 486 HIS A CD2 1 
ATOM   3884  C  CE1 . HIS A 1 486 ? 4.641   67.106  107.722 1.00 13.36 ? 486 HIS A CE1 1 
ATOM   3885  N  NE2 . HIS A 1 486 ? 5.728   67.331  108.439 1.00 13.32 ? 486 HIS A NE2 1 
ATOM   3886  N  N   . PRO A 1 487 ? 9.207   68.190  106.167 1.00 12.93 ? 487 PRO A N   1 
ATOM   3887  C  CA  . PRO A 1 487 ? 10.314  68.604  107.033 1.00 12.70 ? 487 PRO A CA  1 
ATOM   3888  C  C   . PRO A 1 487 ? 10.597  67.577  108.124 1.00 12.64 ? 487 PRO A C   1 
ATOM   3889  O  O   . PRO A 1 487 ? 11.754  67.264  108.409 1.00 12.43 ? 487 PRO A O   1 
ATOM   3890  C  CB  . PRO A 1 487 ? 9.850   69.945  107.604 1.00 12.79 ? 487 PRO A CB  1 
ATOM   3891  C  CG  . PRO A 1 487 ? 8.376   69.999  107.337 1.00 12.94 ? 487 PRO A CG  1 
ATOM   3892  C  CD  . PRO A 1 487 ? 8.180   69.238  106.067 1.00 12.96 ? 487 PRO A CD  1 
ATOM   3893  N  N   . ASP A 1 488 ? 9.536   67.046  108.723 1.00 12.68 ? 488 ASP A N   1 
ATOM   3894  C  CA  . ASP A 1 488 ? 9.682   66.051  109.783 1.00 12.94 ? 488 ASP A CA  1 
ATOM   3895  C  C   . ASP A 1 488 ? 10.244  64.743  109.237 1.00 12.59 ? 488 ASP A C   1 
ATOM   3896  O  O   . ASP A 1 488 ? 11.085  64.105  109.867 1.00 12.42 ? 488 ASP A O   1 
ATOM   3897  C  CB  . ASP A 1 488 ? 8.330   65.785  110.460 1.00 13.54 ? 488 ASP A CB  1 
ATOM   3898  C  CG  . ASP A 1 488 ? 7.885   66.934  111.360 1.00 14.20 ? 488 ASP A CG  1 
ATOM   3899  O  OD1 . ASP A 1 488 ? 8.760   67.708  111.815 1.00 14.64 ? 488 ASP A OD1 1 
ATOM   3900  O  OD2 . ASP A 1 488 ? 6.661   67.061  111.608 1.00 14.52 ? 488 ASP A OD2 1 
ATOM   3901  N  N   . TYR A 1 489 ? 9.776   64.352  108.058 1.00 12.60 ? 489 TYR A N   1 
ATOM   3902  C  CA  . TYR A 1 489 ? 10.230  63.117  107.430 1.00 12.53 ? 489 TYR A CA  1 
ATOM   3903  C  C   . TYR A 1 489 ? 11.752  63.106  107.286 1.00 12.60 ? 489 TYR A C   1 
ATOM   3904  O  O   . TYR A 1 489 ? 12.419  62.127  107.627 1.00 12.57 ? 489 TYR A O   1 
ATOM   3905  C  CB  . TYR A 1 489 ? 9.576   62.963  106.055 1.00 12.48 ? 489 TYR A CB  1 
ATOM   3906  C  CG  . TYR A 1 489 ? 9.609   61.554  105.502 1.00 12.35 ? 489 TYR A CG  1 
ATOM   3907  C  CD1 . TYR A 1 489 ? 10.217  60.517  106.209 1.00 12.22 ? 489 TYR A CD1 1 
ATOM   3908  C  CD2 . TYR A 1 489 ? 9.033   61.256  104.264 1.00 12.26 ? 489 TYR A CD2 1 
ATOM   3909  C  CE1 . TYR A 1 489 ? 10.251  59.222  105.700 1.00 11.83 ? 489 TYR A CE1 1 
ATOM   3910  C  CE2 . TYR A 1 489 ? 9.062   59.962  103.747 1.00 11.85 ? 489 TYR A CE2 1 
ATOM   3911  C  CZ  . TYR A 1 489 ? 9.671   58.951  104.470 1.00 11.67 ? 489 TYR A CZ  1 
ATOM   3912  O  OH  . TYR A 1 489 ? 9.694   57.670  103.976 1.00 11.00 ? 489 TYR A OH  1 
ATOM   3913  N  N   . GLY A 1 490 ? 12.298  64.208  106.791 1.00 12.73 ? 490 GLY A N   1 
ATOM   3914  C  CA  . GLY A 1 490 ? 13.732  64.292  106.604 1.00 12.67 ? 490 GLY A CA  1 
ATOM   3915  C  C   . GLY A 1 490 ? 14.527  64.366  107.892 1.00 12.73 ? 490 GLY A C   1 
ATOM   3916  O  O   . GLY A 1 490 ? 15.468  63.600  108.087 1.00 12.78 ? 490 GLY A O   1 
ATOM   3917  N  N   . SER A 1 491 ? 14.152  65.293  108.770 1.00 13.03 ? 491 SER A N   1 
ATOM   3918  C  CA  . SER A 1 491 ? 14.845  65.487  110.043 1.00 13.07 ? 491 SER A CA  1 
ATOM   3919  C  C   . SER A 1 491 ? 14.865  64.227  110.915 1.00 12.98 ? 491 SER A C   1 
ATOM   3920  O  O   . SER A 1 491 ? 15.915  63.844  111.448 1.00 12.84 ? 491 SER A O   1 
ATOM   3921  C  CB  . SER A 1 491 ? 14.198  66.642  110.815 1.00 13.38 ? 491 SER A CB  1 
ATOM   3922  O  OG  . SER A 1 491 ? 12.810  66.412  111.013 1.00 13.76 ? 491 SER A OG  1 
ATOM   3923  N  N   . HIS A 1 492 ? 13.704  63.592  111.065 1.00 12.75 ? 492 HIS A N   1 
ATOM   3924  C  CA  . HIS A 1 492 ? 13.600  62.378  111.866 1.00 12.49 ? 492 HIS A CA  1 
ATOM   3925  C  C   . HIS A 1 492 ? 14.634  61.354  111.403 1.00 12.52 ? 492 HIS A C   1 
ATOM   3926  O  O   . HIS A 1 492 ? 15.279  60.696  112.220 1.00 12.70 ? 492 HIS A O   1 
ATOM   3927  C  CB  . HIS A 1 492 ? 12.197  61.787  111.752 1.00 12.33 ? 492 HIS A CB  1 
ATOM   3928  C  CG  . HIS A 1 492 ? 11.953  60.635  112.674 1.00 12.31 ? 492 HIS A CG  1 
ATOM   3929  N  ND1 . HIS A 1 492 ? 10.800  59.880  112.630 1.00 12.28 ? 492 HIS A ND1 1 
ATOM   3930  C  CD2 . HIS A 1 492 ? 12.711  60.107  113.664 1.00 12.34 ? 492 HIS A CD2 1 
ATOM   3931  C  CE1 . HIS A 1 492 ? 10.858  58.936  113.553 1.00 12.48 ? 492 HIS A CE1 1 
ATOM   3932  N  NE2 . HIS A 1 492 ? 12.009  59.053  114.194 1.00 12.58 ? 492 HIS A NE2 1 
ATOM   3933  N  N   . ILE A 1 493 ? 14.782  61.215  110.089 1.00 12.59 ? 493 ILE A N   1 
ATOM   3934  C  CA  . ILE A 1 493 ? 15.758  60.286  109.536 1.00 12.53 ? 493 ILE A CA  1 
ATOM   3935  C  C   . ILE A 1 493 ? 17.135  60.814  109.921 1.00 12.48 ? 493 ILE A C   1 
ATOM   3936  O  O   . ILE A 1 493 ? 17.961  60.086  110.471 1.00 12.42 ? 493 ILE A O   1 
ATOM   3937  C  CB  . ILE A 1 493 ? 15.654  60.213  107.993 1.00 12.61 ? 493 ILE A CB  1 
ATOM   3938  C  CG1 . ILE A 1 493 ? 14.724  59.075  107.582 1.00 12.72 ? 493 ILE A CG1 1 
ATOM   3939  C  CG2 . ILE A 1 493 ? 17.022  59.982  107.378 1.00 12.59 ? 493 ILE A CG2 1 
ATOM   3940  C  CD1 . ILE A 1 493 ? 14.005  59.334  106.274 1.00 13.21 ? 493 ILE A CD1 1 
ATOM   3941  N  N   . GLN A 1 494 ? 17.362  62.092  109.627 1.00 12.36 ? 494 GLN A N   1 
ATOM   3942  C  CA  . GLN A 1 494 ? 18.625  62.761  109.922 1.00 12.41 ? 494 GLN A CA  1 
ATOM   3943  C  C   . GLN A 1 494 ? 19.074  62.462  111.344 1.00 12.28 ? 494 GLN A C   1 
ATOM   3944  O  O   . GLN A 1 494 ? 20.228  62.109  111.584 1.00 12.20 ? 494 GLN A O   1 
ATOM   3945  C  CB  . GLN A 1 494 ? 18.469  64.276  109.743 1.00 12.50 ? 494 GLN A CB  1 
ATOM   3946  C  CG  . GLN A 1 494 ? 19.628  64.948  109.023 1.00 12.82 ? 494 GLN A CG  1 
ATOM   3947  C  CD  . GLN A 1 494 ? 20.889  64.102  109.018 1.00 13.05 ? 494 GLN A CD  1 
ATOM   3948  O  OE1 . GLN A 1 494 ? 21.204  63.446  108.025 1.00 13.16 ? 494 GLN A OE1 1 
ATOM   3949  N  NE2 . GLN A 1 494 ? 21.616  64.111  110.133 1.00 13.30 ? 494 GLN A NE2 1 
ATOM   3950  N  N   . ALA A 1 495 ? 18.147  62.607  112.282 1.00 12.49 ? 495 ALA A N   1 
ATOM   3951  C  CA  . ALA A 1 495 ? 18.430  62.361  113.689 1.00 12.58 ? 495 ALA A CA  1 
ATOM   3952  C  C   . ALA A 1 495 ? 18.931  60.940  113.900 1.00 12.73 ? 495 ALA A C   1 
ATOM   3953  O  O   . ALA A 1 495 ? 19.957  60.727  114.545 1.00 12.84 ? 495 ALA A O   1 
ATOM   3954  C  CB  . ALA A 1 495 ? 17.178  62.602  114.519 1.00 12.37 ? 495 ALA A CB  1 
ATOM   3955  N  N   . LEU A 1 496 ? 18.206  59.971  113.348 1.00 12.85 ? 496 LEU A N   1 
ATOM   3956  C  CA  . LEU A 1 496 ? 18.569  58.564  113.483 1.00 13.19 ? 496 LEU A CA  1 
ATOM   3957  C  C   . LEU A 1 496 ? 19.924  58.245  112.846 1.00 13.37 ? 496 LEU A C   1 
ATOM   3958  O  O   . LEU A 1 496 ? 20.685  57.414  113.351 1.00 13.21 ? 496 LEU A O   1 
ATOM   3959  C  CB  . LEU A 1 496 ? 17.488  57.690  112.847 1.00 13.20 ? 496 LEU A CB  1 
ATOM   3960  C  CG  . LEU A 1 496 ? 16.207  57.501  113.661 1.00 13.23 ? 496 LEU A CG  1 
ATOM   3961  C  CD1 . LEU A 1 496 ? 15.118  56.904  112.772 1.00 13.38 ? 496 LEU A CD1 1 
ATOM   3962  C  CD2 . LEU A 1 496 ? 16.490  56.588  114.851 1.00 13.15 ? 496 LEU A CD2 1 
ATOM   3963  N  N   . LEU A 1 497 ? 20.211  58.903  111.729 1.00 13.64 ? 497 LEU A N   1 
ATOM   3964  C  CA  . LEU A 1 497 ? 21.462  58.700  111.018 1.00 13.52 ? 497 LEU A CA  1 
ATOM   3965  C  C   . LEU A 1 497 ? 22.635  59.133  111.891 1.00 13.66 ? 497 LEU A C   1 
ATOM   3966  O  O   . LEU A 1 497 ? 23.558  58.349  112.139 1.00 13.92 ? 497 LEU A O   1 
ATOM   3967  C  CB  . LEU A 1 497 ? 21.457  59.500  109.710 1.00 13.79 ? 497 LEU A CB  1 
ATOM   3968  C  CG  . LEU A 1 497 ? 20.573  58.986  108.563 1.00 13.89 ? 497 LEU A CG  1 
ATOM   3969  C  CD1 . LEU A 1 497 ? 20.846  59.806  107.318 1.00 13.72 ? 497 LEU A CD1 1 
ATOM   3970  C  CD2 . LEU A 1 497 ? 20.849  57.503  108.290 1.00 14.13 ? 497 LEU A CD2 1 
ATOM   3971  N  N   . ASP A 1 498 ? 22.593  60.379  112.359 1.00 13.23 ? 498 ASP A N   1 
ATOM   3972  C  CA  . ASP A 1 498 ? 23.657  60.915  113.202 1.00 13.16 ? 498 ASP A CA  1 
ATOM   3973  C  C   . ASP A 1 498 ? 24.048  59.936  114.307 1.00 13.23 ? 498 ASP A C   1 
ATOM   3974  O  O   . ASP A 1 498 ? 25.199  59.910  114.741 1.00 13.17 ? 498 ASP A O   1 
ATOM   3975  C  CB  . ASP A 1 498 ? 23.223  62.238  113.838 1.00 12.42 ? 498 ASP A CB  1 
ATOM   3976  C  CG  . ASP A 1 498 ? 23.101  63.360  112.830 1.00 11.77 ? 498 ASP A CG  1 
ATOM   3977  O  OD1 . ASP A 1 498 ? 23.690  63.248  111.738 1.00 11.03 ? 498 ASP A OD1 1 
ATOM   3978  O  OD2 . ASP A 1 498 ? 22.413  64.357  113.136 1.00 11.66 ? 498 ASP A OD2 1 
ATOM   3979  N  N   . LYS A 1 499 ? 23.087  59.138  114.761 1.00 13.36 ? 499 LYS A N   1 
ATOM   3980  C  CA  . LYS A 1 499 ? 23.344  58.173  115.820 1.00 13.37 ? 499 LYS A CA  1 
ATOM   3981  C  C   . LYS A 1 499 ? 24.265  57.061  115.352 1.00 13.60 ? 499 LYS A C   1 
ATOM   3982  O  O   . LYS A 1 499 ? 25.296  56.787  115.975 1.00 13.79 ? 499 LYS A O   1 
ATOM   3983  C  CB  . LYS A 1 499 ? 22.037  57.559  116.314 1.00 13.45 ? 499 LYS A CB  1 
ATOM   3984  C  CG  . LYS A 1 499 ? 22.182  56.796  117.626 1.00 13.20 ? 499 LYS A CG  1 
ATOM   3985  C  CD  . LYS A 1 499 ? 21.726  57.643  118.813 1.00 12.92 ? 499 LYS A CD  1 
ATOM   3986  C  CE  . LYS A 1 499 ? 20.243  57.462  119.091 1.00 12.58 ? 499 LYS A CE  1 
ATOM   3987  N  NZ  . LYS A 1 499 ? 19.707  56.226  118.461 1.00 12.83 ? 499 LYS A NZ  1 
ATOM   3988  N  N   . TYR A 1 500 ? 23.886  56.415  114.254 1.00 13.63 ? 500 TYR A N   1 
ATOM   3989  C  CA  . TYR A 1 500 ? 24.682  55.323  113.709 1.00 13.56 ? 500 TYR A CA  1 
ATOM   3990  C  C   . TYR A 1 500 ? 25.994  55.870  113.165 1.00 13.43 ? 500 TYR A C   1 
ATOM   3991  O  O   . TYR A 1 500 ? 27.049  55.267  113.343 1.00 13.21 ? 500 TYR A O   1 
ATOM   3992  C  CB  . TYR A 1 500 ? 23.900  54.596  112.609 1.00 13.48 ? 500 TYR A CB  1 
ATOM   3993  C  CG  . TYR A 1 500 ? 22.457  54.309  112.981 1.00 13.50 ? 500 TYR A CG  1 
ATOM   3994  C  CD1 . TYR A 1 500 ? 22.102  53.994  114.292 1.00 13.44 ? 500 TYR A CD1 1 
ATOM   3995  C  CD2 . TYR A 1 500 ? 21.441  54.393  112.031 1.00 13.57 ? 500 TYR A CD2 1 
ATOM   3996  C  CE1 . TYR A 1 500 ? 20.776  53.776  114.648 1.00 13.59 ? 500 TYR A CE1 1 
ATOM   3997  C  CE2 . TYR A 1 500 ? 20.111  54.176  112.378 1.00 13.70 ? 500 TYR A CE2 1 
ATOM   3998  C  CZ  . TYR A 1 500 ? 19.785  53.871  113.688 1.00 13.73 ? 500 TYR A CZ  1 
ATOM   3999  O  OH  . TYR A 1 500 ? 18.465  53.677  114.038 1.00 14.23 ? 500 TYR A OH  1 
ATOM   4000  N  N   . ASN A 1 501 ? 25.922  57.026  112.515 1.00 13.67 ? 501 ASN A N   1 
ATOM   4001  C  CA  . ASN A 1 501 ? 27.106  57.662  111.954 1.00 13.95 ? 501 ASN A CA  1 
ATOM   4002  C  C   . ASN A 1 501 ? 28.134  57.958  113.047 1.00 14.04 ? 501 ASN A C   1 
ATOM   4003  O  O   . ASN A 1 501 ? 29.326  58.134  112.776 1.00 14.10 ? 501 ASN A O   1 
ATOM   4004  C  CB  . ASN A 1 501 ? 26.711  58.953  111.239 1.00 14.06 ? 501 ASN A CB  1 
ATOM   4005  C  CG  . ASN A 1 501 ? 26.466  58.738  109.760 1.00 14.27 ? 501 ASN A CG  1 
ATOM   4006  O  OD1 . ASN A 1 501 ? 26.779  57.673  109.215 1.00 13.99 ? 501 ASN A OD1 1 
ATOM   4007  N  ND2 . ASN A 1 501 ? 25.906  59.751  109.097 1.00 14.62 ? 501 ASN A ND2 1 
ATOM   4008  N  N   . ALA A 1 502 ? 27.663  58.010  114.289 1.00 14.06 ? 502 ALA A N   1 
ATOM   4009  C  CA  . ALA A 1 502 ? 28.534  58.270  115.428 1.00 14.04 ? 502 ALA A CA  1 
ATOM   4010  C  C   . ALA A 1 502 ? 29.427  57.053  115.715 1.00 14.08 ? 502 ALA A C   1 
ATOM   4011  O  O   . ALA A 1 502 ? 29.182  55.974  115.126 1.00 14.16 ? 502 ALA A O   1 
ATOM   4012  C  CB  . ALA A 1 502 ? 27.689  58.612  116.655 1.00 13.90 ? 502 ALA A CB  1 
ATOM   4013  N  N   . SER B 1 4   ? 49.313  24.198  39.076  1.00 14.12 ? 4   SER B N   1 
ATOM   4014  C  CA  . SER B 1 4   ? 48.704  25.544  39.308  1.00 13.99 ? 4   SER B CA  1 
ATOM   4015  C  C   . SER B 1 4   ? 47.327  25.695  38.654  1.00 13.70 ? 4   SER B C   1 
ATOM   4016  O  O   . SER B 1 4   ? 47.211  25.842  37.433  1.00 13.64 ? 4   SER B O   1 
ATOM   4017  C  CB  . SER B 1 4   ? 49.645  26.640  38.787  1.00 14.17 ? 4   SER B CB  1 
ATOM   4018  O  OG  . SER B 1 4   ? 50.995  26.355  39.118  1.00 14.32 ? 4   SER B OG  1 
ATOM   4019  N  N   . ARG B 1 5   ? 46.289  25.647  39.481  1.00 13.59 ? 5   ARG B N   1 
ATOM   4020  C  CA  . ARG B 1 5   ? 44.905  25.796  39.029  1.00 13.60 ? 5   ARG B CA  1 
ATOM   4021  C  C   . ARG B 1 5   ? 44.360  27.123  39.574  1.00 13.64 ? 5   ARG B C   1 
ATOM   4022  O  O   . ARG B 1 5   ? 45.125  28.037  39.882  1.00 13.42 ? 5   ARG B O   1 
ATOM   4023  C  CB  . ARG B 1 5   ? 44.054  24.632  39.545  1.00 13.57 ? 5   ARG B CB  1 
ATOM   4024  C  CG  . ARG B 1 5   ? 44.860  23.403  39.935  1.00 13.81 ? 5   ARG B CG  1 
ATOM   4025  C  CD  . ARG B 1 5   ? 44.867  23.201  41.441  1.00 14.14 ? 5   ARG B CD  1 
ATOM   4026  N  NE  . ARG B 1 5   ? 44.487  21.838  41.807  1.00 14.13 ? 5   ARG B NE  1 
ATOM   4027  C  CZ  . ARG B 1 5   ? 44.746  21.278  42.985  1.00 14.08 ? 5   ARG B CZ  1 
ATOM   4028  N  NH1 . ARG B 1 5   ? 45.388  21.970  43.920  1.00 13.77 ? 5   ARG B NH1 1 
ATOM   4029  N  NH2 . ARG B 1 5   ? 44.363  20.026  43.224  1.00 14.02 ? 5   ARG B NH2 1 
ATOM   4030  N  N   . ASP B 1 6   ? 43.044  27.240  39.697  1.00 13.76 ? 6   ASP B N   1 
ATOM   4031  C  CA  . ASP B 1 6   ? 42.482  28.479  40.214  1.00 14.23 ? 6   ASP B CA  1 
ATOM   4032  C  C   . ASP B 1 6   ? 42.889  28.646  41.672  1.00 14.39 ? 6   ASP B C   1 
ATOM   4033  O  O   . ASP B 1 6   ? 42.942  27.677  42.432  1.00 14.24 ? 6   ASP B O   1 
ATOM   4034  C  CB  . ASP B 1 6   ? 40.955  28.492  40.083  1.00 14.64 ? 6   ASP B CB  1 
ATOM   4035  C  CG  . ASP B 1 6   ? 40.302  27.284  40.718  1.00 15.09 ? 6   ASP B CG  1 
ATOM   4036  O  OD1 . ASP B 1 6   ? 39.237  27.456  41.360  1.00 15.39 ? 6   ASP B OD1 1 
ATOM   4037  O  OD2 . ASP B 1 6   ? 40.851  26.165  40.575  1.00 15.35 ? 6   ASP B OD2 1 
ATOM   4038  N  N   . PRO B 1 7   ? 43.185  29.886  42.080  1.00 14.45 ? 7   PRO B N   1 
ATOM   4039  C  CA  . PRO B 1 7   ? 43.593  30.163  43.460  1.00 14.53 ? 7   PRO B CA  1 
ATOM   4040  C  C   . PRO B 1 7   ? 42.723  29.460  44.497  1.00 14.38 ? 7   PRO B C   1 
ATOM   4041  O  O   . PRO B 1 7   ? 43.226  28.984  45.516  1.00 14.93 ? 7   PRO B O   1 
ATOM   4042  C  CB  . PRO B 1 7   ? 43.501  31.695  43.569  1.00 14.49 ? 7   PRO B CB  1 
ATOM   4043  C  CG  . PRO B 1 7   ? 42.809  32.155  42.293  1.00 14.29 ? 7   PRO B CG  1 
ATOM   4044  C  CD  . PRO B 1 7   ? 43.128  31.115  41.273  1.00 14.28 ? 7   PRO B CD  1 
ATOM   4045  N  N   . ALA B 1 8   ? 41.423  29.392  44.218  1.00 14.15 ? 8   ALA B N   1 
ATOM   4046  C  CA  . ALA B 1 8   ? 40.455  28.771  45.117  1.00 13.75 ? 8   ALA B CA  1 
ATOM   4047  C  C   . ALA B 1 8   ? 40.703  27.286  45.341  1.00 13.65 ? 8   ALA B C   1 
ATOM   4048  O  O   . ALA B 1 8   ? 40.306  26.739  46.367  1.00 13.59 ? 8   ALA B O   1 
ATOM   4049  C  CB  . ALA B 1 8   ? 39.044  28.981  44.585  1.00 13.24 ? 8   ALA B CB  1 
ATOM   4050  N  N   . SER B 1 9   ? 41.359  26.633  44.390  1.00 13.48 ? 9   SER B N   1 
ATOM   4051  C  CA  . SER B 1 9   ? 41.627  25.207  44.524  1.00 13.59 ? 9   SER B CA  1 
ATOM   4052  C  C   . SER B 1 9   ? 42.918  24.925  45.291  1.00 13.49 ? 9   SER B C   1 
ATOM   4053  O  O   . SER B 1 9   ? 43.066  23.875  45.936  1.00 13.24 ? 9   SER B O   1 
ATOM   4054  C  CB  . SER B 1 9   ? 41.702  24.560  43.139  1.00 13.76 ? 9   SER B CB  1 
ATOM   4055  O  OG  . SER B 1 9   ? 40.458  23.977  42.791  1.00 14.59 ? 9   SER B OG  1 
ATOM   4056  N  N   . ASP B 1 10  ? 43.847  25.873  45.226  1.00 13.30 ? 10  ASP B N   1 
ATOM   4057  C  CA  . ASP B 1 10  ? 45.133  25.716  45.881  1.00 13.29 ? 10  ASP B CA  1 
ATOM   4058  C  C   . ASP B 1 10  ? 45.189  26.295  47.286  1.00 13.13 ? 10  ASP B C   1 
ATOM   4059  O  O   . ASP B 1 10  ? 46.267  26.636  47.782  1.00 12.81 ? 10  ASP B O   1 
ATOM   4060  C  CB  . ASP B 1 10  ? 46.231  26.343  45.022  1.00 13.84 ? 10  ASP B CB  1 
ATOM   4061  C  CG  . ASP B 1 10  ? 46.252  25.786  43.608  1.00 14.39 ? 10  ASP B CG  1 
ATOM   4062  O  OD1 . ASP B 1 10  ? 45.869  26.530  42.676  1.00 14.64 ? 10  ASP B OD1 1 
ATOM   4063  O  OD2 . ASP B 1 10  ? 46.647  24.606  43.431  1.00 14.91 ? 10  ASP B OD2 1 
ATOM   4064  N  N   . GLN B 1 11  ? 44.033  26.399  47.933  1.00 13.11 ? 11  GLN B N   1 
ATOM   4065  C  CA  . GLN B 1 11  ? 43.982  26.924  49.294  1.00 13.36 ? 11  GLN B CA  1 
ATOM   4066  C  C   . GLN B 1 11  ? 45.009  26.209  50.178  1.00 13.42 ? 11  GLN B C   1 
ATOM   4067  O  O   . GLN B 1 11  ? 45.948  26.825  50.683  1.00 13.40 ? 11  GLN B O   1 
ATOM   4068  C  CB  . GLN B 1 11  ? 42.582  26.737  49.885  1.00 13.42 ? 11  GLN B CB  1 
ATOM   4069  C  CG  . GLN B 1 11  ? 42.293  27.600  51.113  1.00 13.53 ? 11  GLN B CG  1 
ATOM   4070  C  CD  . GLN B 1 11  ? 42.822  26.996  52.405  1.00 13.57 ? 11  GLN B CD  1 
ATOM   4071  O  OE1 . GLN B 1 11  ? 42.636  25.808  52.676  1.00 13.57 ? 11  GLN B OE1 1 
ATOM   4072  N  NE2 . GLN B 1 11  ? 43.485  27.817  53.211  1.00 13.55 ? 11  GLN B NE2 1 
ATOM   4073  N  N   . MET B 1 12  ? 44.823  24.905  50.359  1.00 13.48 ? 12  MET B N   1 
ATOM   4074  C  CA  . MET B 1 12  ? 45.724  24.104  51.181  1.00 13.51 ? 12  MET B CA  1 
ATOM   4075  C  C   . MET B 1 12  ? 47.174  24.206  50.720  1.00 13.74 ? 12  MET B C   1 
ATOM   4076  O  O   . MET B 1 12  ? 48.083  24.400  51.528  1.00 13.79 ? 12  MET B O   1 
ATOM   4077  C  CB  . MET B 1 12  ? 45.291  22.644  51.145  1.00 13.35 ? 12  MET B CB  1 
ATOM   4078  C  CG  . MET B 1 12  ? 44.084  22.339  52.000  1.00 13.10 ? 12  MET B CG  1 
ATOM   4079  S  SD  . MET B 1 12  ? 44.074  20.608  52.435  1.00 13.00 ? 12  MET B SD  1 
ATOM   4080  C  CE  . MET B 1 12  ? 43.565  19.856  50.883  1.00 13.13 ? 12  MET B CE  1 
ATOM   4081  N  N   . GLN B 1 13  ? 47.381  24.071  49.413  1.00 14.13 ? 13  GLN B N   1 
ATOM   4082  C  CA  . GLN B 1 13  ? 48.713  24.141  48.819  1.00 14.18 ? 13  GLN B CA  1 
ATOM   4083  C  C   . GLN B 1 13  ? 49.427  25.445  49.166  1.00 14.35 ? 13  GLN B C   1 
ATOM   4084  O  O   . GLN B 1 13  ? 50.625  25.448  49.473  1.00 14.46 ? 13  GLN B O   1 
ATOM   4085  C  CB  . GLN B 1 13  ? 48.616  24.004  47.297  1.00 14.38 ? 13  GLN B CB  1 
ATOM   4086  C  CG  . GLN B 1 13  ? 49.962  23.968  46.590  1.00 14.46 ? 13  GLN B CG  1 
ATOM   4087  C  CD  . GLN B 1 13  ? 50.949  23.028  47.261  1.00 14.38 ? 13  GLN B CD  1 
ATOM   4088  O  OE1 . GLN B 1 13  ? 52.132  23.345  47.396  1.00 14.10 ? 13  GLN B OE1 1 
ATOM   4089  N  NE2 . GLN B 1 13  ? 50.464  21.865  47.687  1.00 14.45 ? 13  GLN B NE2 1 
ATOM   4090  N  N   . HIS B 1 14  ? 48.694  26.554  49.105  1.00 14.11 ? 14  HIS B N   1 
ATOM   4091  C  CA  . HIS B 1 14  ? 49.266  27.858  49.422  1.00 13.94 ? 14  HIS B CA  1 
ATOM   4092  C  C   . HIS B 1 14  ? 49.490  28.005  50.926  1.00 13.58 ? 14  HIS B C   1 
ATOM   4093  O  O   . HIS B 1 14  ? 50.446  28.645  51.363  1.00 13.42 ? 14  HIS B O   1 
ATOM   4094  C  CB  . HIS B 1 14  ? 48.341  28.968  48.920  1.00 14.30 ? 14  HIS B CB  1 
ATOM   4095  C  CG  . HIS B 1 14  ? 48.248  29.041  47.428  1.00 14.82 ? 14  HIS B CG  1 
ATOM   4096  N  ND1 . HIS B 1 14  ? 47.266  29.757  46.777  1.00 15.09 ? 14  HIS B ND1 1 
ATOM   4097  C  CD2 . HIS B 1 14  ? 49.011  28.482  46.458  1.00 15.06 ? 14  HIS B CD2 1 
ATOM   4098  C  CE1 . HIS B 1 14  ? 47.428  29.635  45.470  1.00 15.30 ? 14  HIS B CE1 1 
ATOM   4099  N  NE2 . HIS B 1 14  ? 48.480  28.866  45.250  1.00 15.27 ? 14  HIS B NE2 1 
ATOM   4100  N  N   . TRP B 1 15  ? 48.607  27.399  51.714  1.00 13.55 ? 15  TRP B N   1 
ATOM   4101  C  CA  . TRP B 1 15  ? 48.708  27.458  53.169  1.00 13.40 ? 15  TRP B CA  1 
ATOM   4102  C  C   . TRP B 1 15  ? 49.944  26.718  53.634  1.00 13.22 ? 15  TRP B C   1 
ATOM   4103  O  O   . TRP B 1 15  ? 50.574  27.096  54.618  1.00 13.15 ? 15  TRP B O   1 
ATOM   4104  C  CB  . TRP B 1 15  ? 47.473  26.836  53.818  1.00 13.56 ? 15  TRP B CB  1 
ATOM   4105  C  CG  . TRP B 1 15  ? 47.452  26.977  55.304  1.00 13.80 ? 15  TRP B CG  1 
ATOM   4106  C  CD1 . TRP B 1 15  ? 46.902  28.000  56.025  1.00 13.88 ? 15  TRP B CD1 1 
ATOM   4107  C  CD2 . TRP B 1 15  ? 48.001  26.063  56.260  1.00 13.91 ? 15  TRP B CD2 1 
ATOM   4108  N  NE1 . TRP B 1 15  ? 47.075  27.778  57.370  1.00 13.84 ? 15  TRP B NE1 1 
ATOM   4109  C  CE2 . TRP B 1 15  ? 47.747  26.596  57.542  1.00 13.86 ? 15  TRP B CE2 1 
ATOM   4110  C  CE3 . TRP B 1 15  ? 48.684  24.842  56.157  1.00 13.97 ? 15  TRP B CE3 1 
ATOM   4111  C  CZ2 . TRP B 1 15  ? 48.152  25.951  58.714  1.00 13.76 ? 15  TRP B CZ2 1 
ATOM   4112  C  CZ3 . TRP B 1 15  ? 49.085  24.200  57.324  1.00 13.77 ? 15  TRP B CZ3 1 
ATOM   4113  C  CH2 . TRP B 1 15  ? 48.816  24.758  58.584  1.00 13.84 ? 15  TRP B CH2 1 
ATOM   4114  N  N   . LYS B 1 16  ? 50.282  25.652  52.920  1.00 13.41 ? 16  LYS B N   1 
ATOM   4115  C  CA  . LYS B 1 16  ? 51.457  24.859  53.253  1.00 13.49 ? 16  LYS B CA  1 
ATOM   4116  C  C   . LYS B 1 16  ? 52.699  25.618  52.792  1.00 13.39 ? 16  LYS B C   1 
ATOM   4117  O  O   . LYS B 1 16  ? 53.762  25.540  53.414  1.00 13.38 ? 16  LYS B O   1 
ATOM   4118  C  CB  . LYS B 1 16  ? 51.379  23.488  52.566  1.00 13.68 ? 16  LYS B CB  1 
ATOM   4119  C  CG  . LYS B 1 16  ? 52.719  22.901  52.151  1.00 14.05 ? 16  LYS B CG  1 
ATOM   4120  C  CD  . LYS B 1 16  ? 52.592  21.422  51.800  1.00 14.31 ? 16  LYS B CD  1 
ATOM   4121  C  CE  . LYS B 1 16  ? 53.958  20.785  51.548  1.00 14.26 ? 16  LYS B CE  1 
ATOM   4122  N  NZ  . LYS B 1 16  ? 54.382  19.914  52.685  1.00 14.19 ? 16  LYS B NZ  1 
ATOM   4123  N  N   . GLU B 1 17  ? 52.546  26.365  51.703  1.00 13.43 ? 17  GLU B N   1 
ATOM   4124  C  CA  . GLU B 1 17  ? 53.646  27.139  51.139  1.00 13.56 ? 17  GLU B CA  1 
ATOM   4125  C  C   . GLU B 1 17  ? 54.015  28.313  52.044  1.00 13.59 ? 17  GLU B C   1 
ATOM   4126  O  O   . GLU B 1 17  ? 55.126  28.848  51.973  1.00 13.48 ? 17  GLU B O   1 
ATOM   4127  C  CB  . GLU B 1 17  ? 53.272  27.641  49.736  1.00 13.52 ? 17  GLU B CB  1 
ATOM   4128  C  CG  . GLU B 1 17  ? 54.364  27.421  48.690  1.00 13.49 ? 17  GLU B CG  1 
ATOM   4129  C  CD  . GLU B 1 17  ? 53.838  26.796  47.408  1.00 13.49 ? 17  GLU B CD  1 
ATOM   4130  O  OE1 . GLU B 1 17  ? 52.844  27.316  46.854  1.00 13.69 ? 17  GLU B OE1 1 
ATOM   4131  O  OE2 . GLU B 1 17  ? 54.419  25.784  46.955  1.00 13.18 ? 17  GLU B OE2 1 
ATOM   4132  N  N   . GLN B 1 18  ? 53.078  28.714  52.894  1.00 13.60 ? 18  GLN B N   1 
ATOM   4133  C  CA  . GLN B 1 18  ? 53.334  29.810  53.821  1.00 13.90 ? 18  GLN B CA  1 
ATOM   4134  C  C   . GLN B 1 18  ? 54.237  29.308  54.948  1.00 14.06 ? 18  GLN B C   1 
ATOM   4135  O  O   . GLN B 1 18  ? 55.048  30.060  55.494  1.00 13.79 ? 18  GLN B O   1 
ATOM   4136  C  CB  . GLN B 1 18  ? 52.021  30.342  54.388  1.00 13.90 ? 18  GLN B CB  1 
ATOM   4137  C  CG  . GLN B 1 18  ? 51.202  31.110  53.370  1.00 14.17 ? 18  GLN B CG  1 
ATOM   4138  C  CD  . GLN B 1 18  ? 49.871  31.573  53.925  1.00 14.32 ? 18  GLN B CD  1 
ATOM   4139  O  OE1 . GLN B 1 18  ? 49.481  32.729  53.746  1.00 14.89 ? 18  GLN B OE1 1 
ATOM   4140  N  NE2 . GLN B 1 18  ? 49.165  30.673  54.607  1.00 13.98 ? 18  GLN B NE2 1 
ATOM   4141  N  N   . ARG B 1 19  ? 54.092  28.032  55.294  1.00 14.25 ? 19  ARG B N   1 
ATOM   4142  C  CA  . ARG B 1 19  ? 54.923  27.443  56.332  1.00 14.65 ? 19  ARG B CA  1 
ATOM   4143  C  C   . ARG B 1 19  ? 56.208  26.971  55.655  1.00 14.72 ? 19  ARG B C   1 
ATOM   4144  O  O   . ARG B 1 19  ? 56.336  25.799  55.297  1.00 14.90 ? 19  ARG B O   1 
ATOM   4145  C  CB  . ARG B 1 19  ? 54.217  26.251  56.997  1.00 14.97 ? 19  ARG B CB  1 
ATOM   4146  C  CG  . ARG B 1 19  ? 52.745  26.474  57.372  1.00 15.32 ? 19  ARG B CG  1 
ATOM   4147  C  CD  . ARG B 1 19  ? 52.521  27.740  58.199  1.00 15.45 ? 19  ARG B CD  1 
ATOM   4148  N  NE  . ARG B 1 19  ? 51.614  28.664  57.516  1.00 15.54 ? 19  ARG B NE  1 
ATOM   4149  C  CZ  . ARG B 1 19  ? 50.579  29.278  58.089  1.00 15.50 ? 19  ARG B CZ  1 
ATOM   4150  N  NH1 . ARG B 1 19  ? 50.300  29.077  59.374  1.00 15.68 ? 19  ARG B NH1 1 
ATOM   4151  N  NH2 . ARG B 1 19  ? 49.817  30.095  57.372  1.00 15.35 ? 19  ARG B NH2 1 
ATOM   4152  N  N   . ALA B 1 20  ? 57.152  27.892  55.474  1.00 14.78 ? 20  ALA B N   1 
ATOM   4153  C  CA  . ALA B 1 20  ? 58.423  27.588  54.821  1.00 14.57 ? 20  ALA B CA  1 
ATOM   4154  C  C   . ALA B 1 20  ? 59.247  26.535  55.551  1.00 14.74 ? 20  ALA B C   1 
ATOM   4155  O  O   . ALA B 1 20  ? 59.189  25.349  55.217  1.00 14.61 ? 20  ALA B O   1 
ATOM   4156  C  CB  . ALA B 1 20  ? 59.242  28.863  54.667  1.00 14.56 ? 20  ALA B CB  1 
ATOM   4157  N  N   . ALA B 1 21  ? 60.022  26.980  56.538  1.00 14.97 ? 21  ALA B N   1 
ATOM   4158  C  CA  . ALA B 1 21  ? 60.876  26.091  57.321  1.00 14.95 ? 21  ALA B CA  1 
ATOM   4159  C  C   . ALA B 1 21  ? 60.266  25.783  58.685  1.00 14.95 ? 21  ALA B C   1 
ATOM   4160  O  O   . ALA B 1 21  ? 60.826  25.005  59.461  1.00 14.95 ? 21  ALA B O   1 
ATOM   4161  C  CB  . ALA B 1 21  ? 62.251  26.720  57.503  1.00 15.41 ? 21  ALA B CB  1 
ATOM   4162  N  N   . GLN B 1 22  ? 59.122  26.396  58.974  1.00 14.84 ? 22  GLN B N   1 
ATOM   4163  C  CA  . GLN B 1 22  ? 58.448  26.182  60.252  1.00 14.87 ? 22  GLN B CA  1 
ATOM   4164  C  C   . GLN B 1 22  ? 57.969  24.741  60.397  1.00 14.57 ? 22  GLN B C   1 
ATOM   4165  O  O   . GLN B 1 22  ? 57.337  24.190  59.494  1.00 14.62 ? 22  GLN B O   1 
ATOM   4166  C  CB  . GLN B 1 22  ? 57.252  27.133  60.390  1.00 14.97 ? 22  GLN B CB  1 
ATOM   4167  C  CG  . GLN B 1 22  ? 56.617  27.530  59.071  1.00 15.46 ? 22  GLN B CG  1 
ATOM   4168  C  CD  . GLN B 1 22  ? 57.062  28.898  58.601  1.00 15.82 ? 22  GLN B CD  1 
ATOM   4169  O  OE1 . GLN B 1 22  ? 58.212  29.295  58.812  1.00 16.14 ? 22  GLN B OE1 1 
ATOM   4170  N  NE2 . GLN B 1 22  ? 56.152  29.632  57.957  1.00 16.02 ? 22  GLN B NE2 1 
ATOM   4171  N  N   . LYS B 1 23  ? 58.281  24.136  61.536  1.00 14.13 ? 23  LYS B N   1 
ATOM   4172  C  CA  . LYS B 1 23  ? 57.868  22.767  61.804  1.00 14.13 ? 23  LYS B CA  1 
ATOM   4173  C  C   . LYS B 1 23  ? 56.385  22.783  62.161  1.00 14.02 ? 23  LYS B C   1 
ATOM   4174  O  O   . LYS B 1 23  ? 55.842  23.828  62.537  1.00 13.89 ? 23  LYS B O   1 
ATOM   4175  C  CB  . LYS B 1 23  ? 58.683  22.187  62.965  1.00 14.07 ? 23  LYS B CB  1 
ATOM   4176  C  CG  . LYS B 1 23  ? 59.028  20.714  62.816  1.00 14.27 ? 23  LYS B CG  1 
ATOM   4177  C  CD  . LYS B 1 23  ? 58.163  19.850  63.710  1.00 14.77 ? 23  LYS B CD  1 
ATOM   4178  C  CE  . LYS B 1 23  ? 57.499  18.725  62.914  1.00 15.41 ? 23  LYS B CE  1 
ATOM   4179  N  NZ  . LYS B 1 23  ? 57.271  17.482  63.727  1.00 15.62 ? 23  LYS B NZ  1 
ATOM   4180  N  N   . ALA B 1 24  ? 55.735  21.628  62.040  1.00 13.91 ? 24  ALA B N   1 
ATOM   4181  C  CA  . ALA B 1 24  ? 54.311  21.509  62.349  1.00 13.62 ? 24  ALA B CA  1 
ATOM   4182  C  C   . ALA B 1 24  ? 54.034  21.799  63.826  1.00 13.62 ? 24  ALA B C   1 
ATOM   4183  O  O   . ALA B 1 24  ? 54.860  21.508  64.699  1.00 13.77 ? 24  ALA B O   1 
ATOM   4184  C  CB  . ALA B 1 24  ? 53.816  20.112  61.992  1.00 13.70 ? 24  ALA B CB  1 
ATOM   4185  N  N   . ASP B 1 25  ? 52.872  22.389  64.095  1.00 13.20 ? 25  ASP B N   1 
ATOM   4186  C  CA  . ASP B 1 25  ? 52.469  22.706  65.458  1.00 12.64 ? 25  ASP B CA  1 
ATOM   4187  C  C   . ASP B 1 25  ? 52.172  21.402  66.194  1.00 12.23 ? 25  ASP B C   1 
ATOM   4188  O  O   . ASP B 1 25  ? 51.896  20.378  65.572  1.00 12.06 ? 25  ASP B O   1 
ATOM   4189  C  CB  . ASP B 1 25  ? 51.212  23.582  65.450  1.00 12.67 ? 25  ASP B CB  1 
ATOM   4190  C  CG  . ASP B 1 25  ? 51.529  25.059  65.380  1.00 12.64 ? 25  ASP B CG  1 
ATOM   4191  O  OD1 . ASP B 1 25  ? 51.783  25.669  66.440  1.00 12.61 ? 25  ASP B OD1 1 
ATOM   4192  O  OD2 . ASP B 1 25  ? 51.522  25.613  64.264  1.00 12.70 ? 25  ASP B OD2 1 
ATOM   4193  N  N   . VAL B 1 26  ? 52.228  21.438  67.518  1.00 12.13 ? 26  VAL B N   1 
ATOM   4194  C  CA  . VAL B 1 26  ? 51.950  20.248  68.303  1.00 12.01 ? 26  VAL B CA  1 
ATOM   4195  C  C   . VAL B 1 26  ? 50.444  20.102  68.475  1.00 11.85 ? 26  VAL B C   1 
ATOM   4196  O  O   . VAL B 1 26  ? 49.764  21.030  68.911  1.00 11.60 ? 26  VAL B O   1 
ATOM   4197  C  CB  . VAL B 1 26  ? 52.620  20.323  69.683  1.00 12.10 ? 26  VAL B CB  1 
ATOM   4198  C  CG1 . VAL B 1 26  ? 52.186  19.144  70.535  1.00 12.52 ? 26  VAL B CG1 1 
ATOM   4199  C  CG2 . VAL B 1 26  ? 54.128  20.328  69.518  1.00 12.06 ? 26  VAL B CG2 1 
ATOM   4200  N  N   . LEU B 1 27  ? 49.933  18.927  68.120  1.00 11.71 ? 27  LEU B N   1 
ATOM   4201  C  CA  . LEU B 1 27  ? 48.508  18.641  68.212  1.00 11.65 ? 27  LEU B CA  1 
ATOM   4202  C  C   . LEU B 1 27  ? 48.047  18.468  69.652  1.00 11.81 ? 27  LEU B C   1 
ATOM   4203  O  O   . LEU B 1 27  ? 48.375  17.476  70.303  1.00 11.92 ? 27  LEU B O   1 
ATOM   4204  C  CB  . LEU B 1 27  ? 48.176  17.379  67.411  1.00 11.16 ? 27  LEU B CB  1 
ATOM   4205  C  CG  . LEU B 1 27  ? 46.761  16.808  67.524  1.00 10.70 ? 27  LEU B CG  1 
ATOM   4206  C  CD1 . LEU B 1 27  ? 45.727  17.895  67.304  1.00 9.98  ? 27  LEU B CD1 1 
ATOM   4207  C  CD2 . LEU B 1 27  ? 46.597  15.701  66.508  1.00 10.53 ? 27  LEU B CD2 1 
ATOM   4208  N  N   . THR B 1 28  ? 47.280  19.439  70.141  1.00 11.92 ? 28  THR B N   1 
ATOM   4209  C  CA  . THR B 1 28  ? 46.765  19.390  71.505  1.00 11.95 ? 28  THR B CA  1 
ATOM   4210  C  C   . THR B 1 28  ? 45.275  19.121  71.509  1.00 11.58 ? 28  THR B C   1 
ATOM   4211  O  O   . THR B 1 28  ? 44.657  18.939  70.463  1.00 11.50 ? 28  THR B O   1 
ATOM   4212  C  CB  . THR B 1 28  ? 46.983  20.713  72.268  1.00 12.33 ? 28  THR B CB  1 
ATOM   4213  O  OG1 . THR B 1 28  ? 45.820  21.540  72.128  1.00 12.62 ? 28  THR B OG1 1 
ATOM   4214  C  CG2 . THR B 1 28  ? 48.200  21.450  71.740  1.00 12.61 ? 28  THR B CG2 1 
ATOM   4215  N  N   . THR B 1 29  ? 44.709  19.100  72.708  1.00 11.78 ? 29  THR B N   1 
ATOM   4216  C  CA  . THR B 1 29  ? 43.285  18.866  72.881  1.00 11.43 ? 29  THR B CA  1 
ATOM   4217  C  C   . THR B 1 29  ? 42.621  20.231  72.951  1.00 11.48 ? 29  THR B C   1 
ATOM   4218  O  O   . THR B 1 29  ? 43.148  21.207  72.417  1.00 11.73 ? 29  THR B O   1 
ATOM   4219  C  CB  . THR B 1 29  ? 43.013  18.076  74.176  1.00 11.20 ? 29  THR B CB  1 
ATOM   4220  O  OG1 . THR B 1 29  ? 43.450  18.840  75.307  1.00 11.20 ? 29  THR B OG1 1 
ATOM   4221  C  CG2 . THR B 1 29  ? 43.761  16.754  74.151  1.00 10.80 ? 29  THR B CG2 1 
ATOM   4222  N  N   . GLY B 1 30  ? 41.471  20.306  73.606  1.00 11.64 ? 30  GLY B N   1 
ATOM   4223  C  CA  . GLY B 1 30  ? 40.788  21.579  73.721  1.00 11.67 ? 30  GLY B CA  1 
ATOM   4224  C  C   . GLY B 1 30  ? 41.413  22.442  74.801  1.00 11.88 ? 30  GLY B C   1 
ATOM   4225  O  O   . GLY B 1 30  ? 41.506  23.664  74.655  1.00 11.52 ? 30  GLY B O   1 
ATOM   4226  N  N   . ALA B 1 31  ? 41.848  21.800  75.883  1.00 11.96 ? 31  ALA B N   1 
ATOM   4227  C  CA  . ALA B 1 31  ? 42.454  22.499  77.011  1.00 12.41 ? 31  ALA B CA  1 
ATOM   4228  C  C   . ALA B 1 31  ? 43.924  22.850  76.788  1.00 12.59 ? 31  ALA B C   1 
ATOM   4229  O  O   . ALA B 1 31  ? 44.551  23.492  77.633  1.00 12.87 ? 31  ALA B O   1 
ATOM   4230  C  CB  . ALA B 1 31  ? 42.307  21.660  78.274  1.00 12.60 ? 31  ALA B CB  1 
ATOM   4231  N  N   . GLY B 1 32  ? 44.473  22.426  75.656  1.00 12.48 ? 32  GLY B N   1 
ATOM   4232  C  CA  . GLY B 1 32  ? 45.864  22.720  75.365  1.00 12.08 ? 32  GLY B CA  1 
ATOM   4233  C  C   . GLY B 1 32  ? 46.809  21.567  75.649  1.00 11.91 ? 32  GLY B C   1 
ATOM   4234  O  O   . GLY B 1 32  ? 48.006  21.659  75.371  1.00 11.70 ? 32  GLY B O   1 
ATOM   4235  N  N   . ASN B 1 33  ? 46.283  20.481  76.206  1.00 11.83 ? 33  ASN B N   1 
ATOM   4236  C  CA  . ASN B 1 33  ? 47.108  19.318  76.511  1.00 11.86 ? 33  ASN B CA  1 
ATOM   4237  C  C   . ASN B 1 33  ? 47.508  18.605  75.220  1.00 11.83 ? 33  ASN B C   1 
ATOM   4238  O  O   . ASN B 1 33  ? 46.685  18.409  74.325  1.00 11.58 ? 33  ASN B O   1 
ATOM   4239  C  CB  . ASN B 1 33  ? 46.351  18.349  77.422  1.00 12.20 ? 33  ASN B CB  1 
ATOM   4240  C  CG  . ASN B 1 33  ? 45.512  19.059  78.460  1.00 12.48 ? 33  ASN B CG  1 
ATOM   4241  O  OD1 . ASN B 1 33  ? 44.287  18.961  78.447  1.00 12.80 ? 33  ASN B OD1 1 
ATOM   4242  N  ND2 . ASN B 1 33  ? 46.167  19.779  79.367  1.00 12.59 ? 33  ASN B ND2 1 
ATOM   4243  N  N   . PRO B 1 34  ? 48.789  18.222  75.103  1.00 12.10 ? 34  PRO B N   1 
ATOM   4244  C  CA  . PRO B 1 34  ? 49.287  17.529  73.909  1.00 12.49 ? 34  PRO B CA  1 
ATOM   4245  C  C   . PRO B 1 34  ? 48.747  16.106  73.743  1.00 12.92 ? 34  PRO B C   1 
ATOM   4246  O  O   . PRO B 1 34  ? 48.497  15.407  74.728  1.00 13.11 ? 34  PRO B O   1 
ATOM   4247  C  CB  . PRO B 1 34  ? 50.805  17.554  74.085  1.00 12.21 ? 34  PRO B CB  1 
ATOM   4248  C  CG  . PRO B 1 34  ? 51.009  17.661  75.549  1.00 12.01 ? 34  PRO B CG  1 
ATOM   4249  C  CD  . PRO B 1 34  ? 49.856  18.454  76.092  1.00 12.00 ? 34  PRO B CD  1 
ATOM   4250  N  N   . VAL B 1 35  ? 48.578  15.686  72.490  1.00 13.00 ? 35  VAL B N   1 
ATOM   4251  C  CA  . VAL B 1 35  ? 48.066  14.353  72.177  1.00 13.16 ? 35  VAL B CA  1 
ATOM   4252  C  C   . VAL B 1 35  ? 49.174  13.443  71.644  1.00 13.06 ? 35  VAL B C   1 
ATOM   4253  O  O   . VAL B 1 35  ? 49.902  13.817  70.725  1.00 13.24 ? 35  VAL B O   1 
ATOM   4254  C  CB  . VAL B 1 35  ? 46.938  14.427  71.128  1.00 13.30 ? 35  VAL B CB  1 
ATOM   4255  C  CG1 . VAL B 1 35  ? 46.139  13.129  71.127  1.00 13.38 ? 35  VAL B CG1 1 
ATOM   4256  C  CG2 . VAL B 1 35  ? 46.030  15.614  71.426  1.00 13.09 ? 35  VAL B CG2 1 
ATOM   4257  N  N   . GLY B 1 36  ? 49.289  12.250  72.225  1.00 13.10 ? 36  GLY B N   1 
ATOM   4258  C  CA  . GLY B 1 36  ? 50.314  11.305  71.814  1.00 12.40 ? 36  GLY B CA  1 
ATOM   4259  C  C   . GLY B 1 36  ? 49.929  10.525  70.573  1.00 12.45 ? 36  GLY B C   1 
ATOM   4260  O  O   . GLY B 1 36  ? 50.785  10.156  69.764  1.00 12.27 ? 36  GLY B O   1 
ATOM   4261  N  N   . ASP B 1 37  ? 48.632  10.271  70.428  1.00 12.34 ? 37  ASP B N   1 
ATOM   4262  C  CA  . ASP B 1 37  ? 48.110  9.540   69.281  1.00 12.02 ? 37  ASP B CA  1 
ATOM   4263  C  C   . ASP B 1 37  ? 46.648  9.901   69.105  1.00 11.94 ? 37  ASP B C   1 
ATOM   4264  O  O   . ASP B 1 37  ? 45.837  9.647   69.994  1.00 12.13 ? 37  ASP B O   1 
ATOM   4265  C  CB  . ASP B 1 37  ? 48.245  8.033   69.510  1.00 12.05 ? 37  ASP B CB  1 
ATOM   4266  C  CG  . ASP B 1 37  ? 47.690  7.204   68.363  1.00 11.99 ? 37  ASP B CG  1 
ATOM   4267  O  OD1 . ASP B 1 37  ? 48.047  6.014   68.277  1.00 12.21 ? 37  ASP B OD1 1 
ATOM   4268  O  OD2 . ASP B 1 37  ? 46.903  7.724   67.549  1.00 11.83 ? 37  ASP B OD2 1 
ATOM   4269  N  N   . LYS B 1 38  ? 46.314  10.502  67.967  1.00 11.90 ? 38  LYS B N   1 
ATOM   4270  C  CA  . LYS B 1 38  ? 44.932  10.877  67.689  1.00 12.01 ? 38  LYS B CA  1 
ATOM   4271  C  C   . LYS B 1 38  ? 44.342  10.033  66.567  1.00 11.97 ? 38  LYS B C   1 
ATOM   4272  O  O   . LYS B 1 38  ? 43.294  10.370  66.027  1.00 11.72 ? 38  LYS B O   1 
ATOM   4273  C  CB  . LYS B 1 38  ? 44.840  12.359  67.316  1.00 11.92 ? 38  LYS B CB  1 
ATOM   4274  C  CG  . LYS B 1 38  ? 43.439  12.948  67.438  1.00 11.95 ? 38  LYS B CG  1 
ATOM   4275  C  CD  . LYS B 1 38  ? 42.913  13.431  66.092  1.00 11.97 ? 38  LYS B CD  1 
ATOM   4276  C  CE  . LYS B 1 38  ? 41.672  12.654  65.667  1.00 11.96 ? 38  LYS B CE  1 
ATOM   4277  N  NZ  . LYS B 1 38  ? 41.094  13.144  64.381  1.00 11.71 ? 38  LYS B NZ  1 
ATOM   4278  N  N   . LEU B 1 39  ? 45.012  8.936   66.224  1.00 12.07 ? 39  LEU B N   1 
ATOM   4279  C  CA  . LEU B 1 39  ? 44.544  8.049   65.164  1.00 12.39 ? 39  LEU B CA  1 
ATOM   4280  C  C   . LEU B 1 39  ? 44.045  6.716   65.707  1.00 12.54 ? 39  LEU B C   1 
ATOM   4281  O  O   . LEU B 1 39  ? 43.638  5.836   64.945  1.00 12.57 ? 39  LEU B O   1 
ATOM   4282  C  CB  . LEU B 1 39  ? 45.665  7.799   64.149  1.00 12.85 ? 39  LEU B CB  1 
ATOM   4283  C  CG  . LEU B 1 39  ? 46.277  9.052   63.511  1.00 13.13 ? 39  LEU B CG  1 
ATOM   4284  C  CD1 . LEU B 1 39  ? 47.502  8.671   62.697  1.00 13.39 ? 39  LEU B CD1 1 
ATOM   4285  C  CD2 . LEU B 1 39  ? 45.243  9.738   62.633  1.00 13.27 ? 39  LEU B CD2 1 
ATOM   4286  N  N   . ASN B 1 40  ? 44.073  6.565   67.025  1.00 12.61 ? 40  ASN B N   1 
ATOM   4287  C  CA  . ASN B 1 40  ? 43.616  5.327   67.642  1.00 12.80 ? 40  ASN B CA  1 
ATOM   4288  C  C   . ASN B 1 40  ? 42.909  5.552   68.979  1.00 12.55 ? 40  ASN B C   1 
ATOM   4289  O  O   . ASN B 1 40  ? 43.371  6.325   69.824  1.00 12.31 ? 40  ASN B O   1 
ATOM   4290  C  CB  . ASN B 1 40  ? 44.798  4.375   67.832  1.00 13.29 ? 40  ASN B CB  1 
ATOM   4291  C  CG  . ASN B 1 40  ? 45.004  3.462   66.641  1.00 13.85 ? 40  ASN B CG  1 
ATOM   4292  O  OD1 . ASN B 1 40  ? 44.155  2.624   66.336  1.00 14.68 ? 40  ASN B OD1 1 
ATOM   4293  N  ND2 . ASN B 1 40  ? 46.134  3.619   65.961  1.00 13.82 ? 40  ASN B ND2 1 
ATOM   4294  N  N   . VAL B 1 41  ? 41.787  4.864   69.159  1.00 12.12 ? 41  VAL B N   1 
ATOM   4295  C  CA  . VAL B 1 41  ? 40.994  4.970   70.378  1.00 11.89 ? 41  VAL B CA  1 
ATOM   4296  C  C   . VAL B 1 41  ? 41.492  3.982   71.438  1.00 12.12 ? 41  VAL B C   1 
ATOM   4297  O  O   . VAL B 1 41  ? 42.016  2.917   71.104  1.00 12.33 ? 41  VAL B O   1 
ATOM   4298  C  CB  . VAL B 1 41  ? 39.499  4.712   70.063  1.00 11.63 ? 41  VAL B CB  1 
ATOM   4299  C  CG1 . VAL B 1 41  ? 39.037  3.405   70.685  1.00 11.14 ? 41  VAL B CG1 1 
ATOM   4300  C  CG2 . VAL B 1 41  ? 38.660  5.888   70.544  1.00 11.20 ? 41  VAL B CG2 1 
ATOM   4301  N  N   . ILE B 1 42  ? 41.332  4.337   72.712  1.00 12.17 ? 42  ILE B N   1 
ATOM   4302  C  CA  . ILE B 1 42  ? 41.777  3.476   73.807  1.00 11.89 ? 42  ILE B CA  1 
ATOM   4303  C  C   . ILE B 1 42  ? 40.800  2.350   74.102  1.00 12.20 ? 42  ILE B C   1 
ATOM   4304  O  O   . ILE B 1 42  ? 39.605  2.585   74.290  1.00 12.40 ? 42  ILE B O   1 
ATOM   4305  C  CB  . ILE B 1 42  ? 41.963  4.254   75.122  1.00 11.55 ? 42  ILE B CB  1 
ATOM   4306  C  CG1 . ILE B 1 42  ? 43.022  5.337   74.955  1.00 11.24 ? 42  ILE B CG1 1 
ATOM   4307  C  CG2 . ILE B 1 42  ? 42.383  3.295   76.223  1.00 11.23 ? 42  ILE B CG2 1 
ATOM   4308  C  CD1 . ILE B 1 42  ? 43.068  6.321   76.102  1.00 10.86 ? 42  ILE B CD1 1 
ATOM   4309  N  N   . THR B 1 43  ? 41.318  1.127   74.152  1.00 12.18 ? 43  THR B N   1 
ATOM   4310  C  CA  . THR B 1 43  ? 40.498  -0.041  74.449  1.00 12.14 ? 43  THR B CA  1 
ATOM   4311  C  C   . THR B 1 43  ? 41.289  -1.021  75.306  1.00 12.39 ? 43  THR B C   1 
ATOM   4312  O  O   . THR B 1 43  ? 42.522  -0.983  75.339  1.00 12.40 ? 43  THR B O   1 
ATOM   4313  C  CB  . THR B 1 43  ? 40.043  -0.775  73.165  1.00 11.94 ? 43  THR B CB  1 
ATOM   4314  O  OG1 . THR B 1 43  ? 41.161  -1.443  72.572  1.00 11.65 ? 43  THR B OG1 1 
ATOM   4315  C  CG2 . THR B 1 43  ? 39.453  0.203   72.167  1.00 11.68 ? 43  THR B CG2 1 
ATOM   4316  N  N   . VAL B 1 44  ? 40.573  -1.890  76.010  1.00 12.42 ? 44  VAL B N   1 
ATOM   4317  C  CA  . VAL B 1 44  ? 41.219  -2.885  76.851  1.00 12.35 ? 44  VAL B CA  1 
ATOM   4318  C  C   . VAL B 1 44  ? 41.456  -4.113  75.970  1.00 12.59 ? 44  VAL B C   1 
ATOM   4319  O  O   . VAL B 1 44  ? 40.560  -4.935  75.758  1.00 12.79 ? 44  VAL B O   1 
ATOM   4320  C  CB  . VAL B 1 44  ? 40.336  -3.231  78.087  1.00 12.12 ? 44  VAL B CB  1 
ATOM   4321  C  CG1 . VAL B 1 44  ? 38.863  -3.192  77.709  1.00 11.66 ? 44  VAL B CG1 1 
ATOM   4322  C  CG2 . VAL B 1 44  ? 40.732  -4.584  78.663  1.00 11.99 ? 44  VAL B CG2 1 
ATOM   4323  N  N   . GLY B 1 45  ? 42.674  -4.216  75.444  1.00 12.53 ? 45  GLY B N   1 
ATOM   4324  C  CA  . GLY B 1 45  ? 43.017  -5.319  74.566  1.00 12.17 ? 45  GLY B CA  1 
ATOM   4325  C  C   . GLY B 1 45  ? 42.813  -4.829  73.146  1.00 12.06 ? 45  GLY B C   1 
ATOM   4326  O  O   . GLY B 1 45  ? 42.065  -3.875  72.939  1.00 11.92 ? 45  GLY B O   1 
ATOM   4327  N  N   . PRO B 1 46  ? 43.472  -5.436  72.145  1.00 12.05 ? 46  PRO B N   1 
ATOM   4328  C  CA  . PRO B 1 46  ? 43.297  -4.983  70.763  1.00 12.11 ? 46  PRO B CA  1 
ATOM   4329  C  C   . PRO B 1 46  ? 41.846  -5.063  70.285  1.00 12.25 ? 46  PRO B C   1 
ATOM   4330  O  O   . PRO B 1 46  ? 41.428  -4.298  69.411  1.00 12.29 ? 46  PRO B O   1 
ATOM   4331  C  CB  . PRO B 1 46  ? 44.225  -5.897  69.963  1.00 11.94 ? 46  PRO B CB  1 
ATOM   4332  C  CG  . PRO B 1 46  ? 45.200  -6.424  70.960  1.00 11.87 ? 46  PRO B CG  1 
ATOM   4333  C  CD  . PRO B 1 46  ? 44.429  -6.551  72.233  1.00 11.92 ? 46  PRO B CD  1 
ATOM   4334  N  N   . ARG B 1 47  ? 41.079  -5.981  70.864  1.00 12.24 ? 47  ARG B N   1 
ATOM   4335  C  CA  . ARG B 1 47  ? 39.681  -6.139  70.481  1.00 12.40 ? 47  ARG B CA  1 
ATOM   4336  C  C   . ARG B 1 47  ? 38.744  -5.938  71.665  1.00 12.53 ? 47  ARG B C   1 
ATOM   4337  O  O   . ARG B 1 47  ? 37.647  -6.494  71.699  1.00 12.50 ? 47  ARG B O   1 
ATOM   4338  C  CB  . ARG B 1 47  ? 39.456  -7.523  69.875  1.00 12.26 ? 47  ARG B CB  1 
ATOM   4339  C  CG  . ARG B 1 47  ? 40.389  -7.848  68.720  1.00 12.14 ? 47  ARG B CG  1 
ATOM   4340  C  CD  . ARG B 1 47  ? 39.759  -8.874  67.805  1.00 12.13 ? 47  ARG B CD  1 
ATOM   4341  N  NE  . ARG B 1 47  ? 40.579  -9.160  66.635  1.00 12.55 ? 47  ARG B NE  1 
ATOM   4342  C  CZ  . ARG B 1 47  ? 40.624  -10.342 66.029  1.00 12.85 ? 47  ARG B CZ  1 
ATOM   4343  N  NH1 . ARG B 1 47  ? 39.894  -11.356 66.482  1.00 12.97 ? 47  ARG B NH1 1 
ATOM   4344  N  NH2 . ARG B 1 47  ? 41.397  -10.513 64.967  1.00 13.40 ? 47  ARG B NH2 1 
ATOM   4345  N  N   . GLY B 1 48  ? 39.184  -5.143  72.635  1.00 12.69 ? 48  GLY B N   1 
ATOM   4346  C  CA  . GLY B 1 48  ? 38.361  -4.881  73.801  1.00 12.66 ? 48  GLY B CA  1 
ATOM   4347  C  C   . GLY B 1 48  ? 37.528  -3.628  73.618  1.00 12.67 ? 48  GLY B C   1 
ATOM   4348  O  O   . GLY B 1 48  ? 37.793  -2.837  72.712  1.00 12.93 ? 48  GLY B O   1 
ATOM   4349  N  N   . PRO B 1 49  ? 36.504  -3.420  74.457  1.00 12.43 ? 49  PRO B N   1 
ATOM   4350  C  CA  . PRO B 1 49  ? 35.651  -2.229  74.347  1.00 12.11 ? 49  PRO B CA  1 
ATOM   4351  C  C   . PRO B 1 49  ? 36.420  -0.929  74.567  1.00 11.75 ? 49  PRO B C   1 
ATOM   4352  O  O   . PRO B 1 49  ? 37.578  -0.942  74.979  1.00 11.69 ? 49  PRO B O   1 
ATOM   4353  C  CB  . PRO B 1 49  ? 34.581  -2.441  75.425  1.00 12.28 ? 49  PRO B CB  1 
ATOM   4354  C  CG  . PRO B 1 49  ? 34.660  -3.894  75.777  1.00 12.44 ? 49  PRO B CG  1 
ATOM   4355  C  CD  . PRO B 1 49  ? 36.081  -4.302  75.556  1.00 12.49 ? 49  PRO B CD  1 
ATOM   4356  N  N   . LEU B 1 50  ? 35.765  0.191   74.289  1.00 11.44 ? 50  LEU B N   1 
ATOM   4357  C  CA  . LEU B 1 50  ? 36.375  1.499   74.470  1.00 11.18 ? 50  LEU B CA  1 
ATOM   4358  C  C   . LEU B 1 50  ? 35.964  2.026   75.833  1.00 10.99 ? 50  LEU B C   1 
ATOM   4359  O  O   . LEU B 1 50  ? 34.804  1.917   76.221  1.00 10.45 ? 50  LEU B O   1 
ATOM   4360  C  CB  . LEU B 1 50  ? 35.900  2.464   73.384  1.00 11.44 ? 50  LEU B CB  1 
ATOM   4361  C  CG  . LEU B 1 50  ? 35.941  3.948   73.758  1.00 11.76 ? 50  LEU B CG  1 
ATOM   4362  C  CD1 . LEU B 1 50  ? 37.326  4.504   73.480  1.00 11.72 ? 50  LEU B CD1 1 
ATOM   4363  C  CD2 . LEU B 1 50  ? 34.891  4.708   72.980  1.00 12.15 ? 50  LEU B CD2 1 
ATOM   4364  N  N   . LEU B 1 51  ? 36.916  2.602   76.556  1.00 11.21 ? 51  LEU B N   1 
ATOM   4365  C  CA  . LEU B 1 51  ? 36.630  3.134   77.879  1.00 11.61 ? 51  LEU B CA  1 
ATOM   4366  C  C   . LEU B 1 51  ? 36.533  4.648   77.894  1.00 11.72 ? 51  LEU B C   1 
ATOM   4367  O  O   . LEU B 1 51  ? 37.092  5.329   77.043  1.00 12.04 ? 51  LEU B O   1 
ATOM   4368  C  CB  . LEU B 1 51  ? 37.695  2.679   78.881  1.00 11.79 ? 51  LEU B CB  1 
ATOM   4369  C  CG  . LEU B 1 51  ? 39.135  2.550   78.388  1.00 11.92 ? 51  LEU B CG  1 
ATOM   4370  C  CD1 . LEU B 1 51  ? 40.081  2.651   79.574  1.00 11.85 ? 51  LEU B CD1 1 
ATOM   4371  C  CD2 . LEU B 1 51  ? 39.315  1.225   77.664  1.00 11.95 ? 51  LEU B CD2 1 
ATOM   4372  N  N   . VAL B 1 52  ? 35.816  5.159   78.887  1.00 12.02 ? 52  VAL B N   1 
ATOM   4373  C  CA  . VAL B 1 52  ? 35.607  6.587   79.071  1.00 11.96 ? 52  VAL B CA  1 
ATOM   4374  C  C   . VAL B 1 52  ? 36.915  7.364   79.244  1.00 11.92 ? 52  VAL B C   1 
ATOM   4375  O  O   . VAL B 1 52  ? 36.981  8.551   78.943  1.00 11.84 ? 52  VAL B O   1 
ATOM   4376  C  CB  . VAL B 1 52  ? 34.710  6.821   80.298  1.00 12.09 ? 52  VAL B CB  1 
ATOM   4377  C  CG1 . VAL B 1 52  ? 34.184  8.238   80.301  1.00 12.61 ? 52  VAL B CG1 1 
ATOM   4378  C  CG2 . VAL B 1 52  ? 33.561  5.824   80.287  1.00 11.86 ? 52  VAL B CG2 1 
ATOM   4379  N  N   . GLN B 1 53  ? 37.952  6.679   79.718  1.00 11.95 ? 53  GLN B N   1 
ATOM   4380  C  CA  . GLN B 1 53  ? 39.263  7.283   79.948  1.00 12.14 ? 53  GLN B CA  1 
ATOM   4381  C  C   . GLN B 1 53  ? 39.777  8.106   78.777  1.00 12.22 ? 53  GLN B C   1 
ATOM   4382  O  O   . GLN B 1 53  ? 40.517  9.074   78.963  1.00 12.03 ? 53  GLN B O   1 
ATOM   4383  C  CB  . GLN B 1 53  ? 40.293  6.202   80.269  1.00 12.17 ? 53  GLN B CB  1 
ATOM   4384  C  CG  . GLN B 1 53  ? 40.608  6.073   81.739  1.00 12.29 ? 53  GLN B CG  1 
ATOM   4385  C  CD  . GLN B 1 53  ? 41.593  4.960   82.012  1.00 12.36 ? 53  GLN B CD  1 
ATOM   4386  O  OE1 . GLN B 1 53  ? 42.320  4.535   81.113  1.00 12.31 ? 53  GLN B OE1 1 
ATOM   4387  N  NE2 . GLN B 1 53  ? 41.627  4.482   83.256  1.00 12.14 ? 53  GLN B NE2 1 
ATOM   4388  N  N   . ASP B 1 54  ? 39.396  7.711   77.569  1.00 12.64 ? 54  ASP B N   1 
ATOM   4389  C  CA  . ASP B 1 54  ? 39.833  8.422   76.385  1.00 12.89 ? 54  ASP B CA  1 
ATOM   4390  C  C   . ASP B 1 54  ? 39.156  9.782   76.303  1.00 12.94 ? 54  ASP B C   1 
ATOM   4391  O  O   . ASP B 1 54  ? 38.130  9.949   75.643  1.00 13.13 ? 54  ASP B O   1 
ATOM   4392  C  CB  . ASP B 1 54  ? 39.529  7.608   75.128  1.00 13.41 ? 54  ASP B CB  1 
ATOM   4393  C  CG  . ASP B 1 54  ? 40.420  7.995   73.969  1.00 13.89 ? 54  ASP B CG  1 
ATOM   4394  O  OD1 . ASP B 1 54  ? 40.943  9.133   73.986  1.00 14.34 ? 54  ASP B OD1 1 
ATOM   4395  O  OD2 . ASP B 1 54  ? 40.605  7.168   73.049  1.00 14.10 ? 54  ASP B OD2 1 
ATOM   4396  N  N   . VAL B 1 55  ? 39.735  10.754  76.989  1.00 12.95 ? 55  VAL B N   1 
ATOM   4397  C  CA  . VAL B 1 55  ? 39.194  12.099  76.990  1.00 12.89 ? 55  VAL B CA  1 
ATOM   4398  C  C   . VAL B 1 55  ? 39.658  12.814  75.732  1.00 12.89 ? 55  VAL B C   1 
ATOM   4399  O  O   . VAL B 1 55  ? 39.134  13.869  75.369  1.00 12.85 ? 55  VAL B O   1 
ATOM   4400  C  CB  . VAL B 1 55  ? 39.668  12.877  78.230  1.00 12.82 ? 55  VAL B CB  1 
ATOM   4401  C  CG1 . VAL B 1 55  ? 39.431  12.038  79.475  1.00 12.89 ? 55  VAL B CG1 1 
ATOM   4402  C  CG2 . VAL B 1 55  ? 41.141  13.229  78.102  1.00 12.64 ? 55  VAL B CG2 1 
ATOM   4403  N  N   . VAL B 1 56  ? 40.655  12.234  75.073  1.00 12.72 ? 56  VAL B N   1 
ATOM   4404  C  CA  . VAL B 1 56  ? 41.174  12.815  73.847  1.00 12.68 ? 56  VAL B CA  1 
ATOM   4405  C  C   . VAL B 1 56  ? 40.124  12.592  72.764  1.00 12.70 ? 56  VAL B C   1 
ATOM   4406  O  O   . VAL B 1 56  ? 39.888  13.459  71.920  1.00 12.70 ? 56  VAL B O   1 
ATOM   4407  C  CB  . VAL B 1 56  ? 42.517  12.153  73.453  1.00 12.66 ? 56  VAL B CB  1 
ATOM   4408  C  CG1 . VAL B 1 56  ? 42.683  12.113  71.944  1.00 12.67 ? 56  VAL B CG1 1 
ATOM   4409  C  CG2 . VAL B 1 56  ? 43.662  12.924  74.084  1.00 12.56 ? 56  VAL B CG2 1 
ATOM   4410  N  N   . PHE B 1 57  ? 39.477  11.431  72.813  1.00 12.21 ? 57  PHE B N   1 
ATOM   4411  C  CA  . PHE B 1 57  ? 38.444  11.090  71.844  1.00 12.01 ? 57  PHE B CA  1 
ATOM   4412  C  C   . PHE B 1 57  ? 37.193  11.943  72.045  1.00 11.67 ? 57  PHE B C   1 
ATOM   4413  O  O   . PHE B 1 57  ? 36.751  12.638  71.137  1.00 11.63 ? 57  PHE B O   1 
ATOM   4414  C  CB  . PHE B 1 57  ? 38.078  9.608   71.963  1.00 12.02 ? 57  PHE B CB  1 
ATOM   4415  C  CG  . PHE B 1 57  ? 36.791  9.246   71.275  1.00 11.98 ? 57  PHE B CG  1 
ATOM   4416  C  CD1 . PHE B 1 57  ? 36.659  9.387   69.895  1.00 11.97 ? 57  PHE B CD1 1 
ATOM   4417  C  CD2 . PHE B 1 57  ? 35.703  8.782   72.008  1.00 12.03 ? 57  PHE B CD2 1 
ATOM   4418  C  CE1 . PHE B 1 57  ? 35.462  9.073   69.257  1.00 11.91 ? 57  PHE B CE1 1 
ATOM   4419  C  CE2 . PHE B 1 57  ? 34.499  8.465   71.378  1.00 12.02 ? 57  PHE B CE2 1 
ATOM   4420  C  CZ  . PHE B 1 57  ? 34.379  8.612   70.002  1.00 11.99 ? 57  PHE B CZ  1 
ATOM   4421  N  N   . THR B 1 58  ? 36.627  11.874  73.242  1.00 11.72 ? 58  THR B N   1 
ATOM   4422  C  CA  . THR B 1 58  ? 35.429  12.632  73.581  1.00 11.59 ? 58  THR B CA  1 
ATOM   4423  C  C   . THR B 1 58  ? 35.585  14.114  73.258  1.00 11.31 ? 58  THR B C   1 
ATOM   4424  O  O   . THR B 1 58  ? 34.773  14.697  72.540  1.00 10.97 ? 58  THR B O   1 
ATOM   4425  C  CB  . THR B 1 58  ? 35.100  12.494  75.076  1.00 11.82 ? 58  THR B CB  1 
ATOM   4426  O  OG1 . THR B 1 58  ? 35.112  11.108  75.439  1.00 12.39 ? 58  THR B OG1 1 
ATOM   4427  C  CG2 . THR B 1 58  ? 33.731  13.080  75.375  1.00 12.21 ? 58  THR B CG2 1 
ATOM   4428  N  N   . ASP B 1 59  ? 36.629  14.721  73.803  1.00 11.30 ? 59  ASP B N   1 
ATOM   4429  C  CA  . ASP B 1 59  ? 36.888  16.131  73.563  1.00 11.46 ? 59  ASP B CA  1 
ATOM   4430  C  C   . ASP B 1 59  ? 36.611  16.471  72.103  1.00 11.53 ? 59  ASP B C   1 
ATOM   4431  O  O   . ASP B 1 59  ? 35.716  17.258  71.797  1.00 11.46 ? 59  ASP B O   1 
ATOM   4432  C  CB  . ASP B 1 59  ? 38.340  16.459  73.903  1.00 11.72 ? 59  ASP B CB  1 
ATOM   4433  C  CG  . ASP B 1 59  ? 38.600  17.948  73.972  1.00 12.03 ? 59  ASP B CG  1 
ATOM   4434  O  OD1 . ASP B 1 59  ? 37.683  18.707  74.356  1.00 11.94 ? 59  ASP B OD1 1 
ATOM   4435  O  OD2 . ASP B 1 59  ? 39.732  18.358  73.643  1.00 12.54 ? 59  ASP B OD2 1 
ATOM   4436  N  N   . GLU B 1 60  ? 37.375  15.856  71.208  1.00 11.73 ? 60  GLU B N   1 
ATOM   4437  C  CA  . GLU B 1 60  ? 37.228  16.091  69.780  1.00 12.03 ? 60  GLU B CA  1 
ATOM   4438  C  C   . GLU B 1 60  ? 35.837  15.721  69.277  1.00 12.00 ? 60  GLU B C   1 
ATOM   4439  O  O   . GLU B 1 60  ? 35.191  16.507  68.580  1.00 11.73 ? 60  GLU B O   1 
ATOM   4440  C  CB  . GLU B 1 60  ? 38.281  15.296  69.011  1.00 12.66 ? 60  GLU B CB  1 
ATOM   4441  C  CG  . GLU B 1 60  ? 38.232  15.499  67.506  1.00 13.50 ? 60  GLU B CG  1 
ATOM   4442  C  CD  . GLU B 1 60  ? 39.174  14.568  66.769  1.00 13.89 ? 60  GLU B CD  1 
ATOM   4443  O  OE1 . GLU B 1 60  ? 38.991  13.335  66.880  1.00 13.89 ? 60  GLU B OE1 1 
ATOM   4444  O  OE2 . GLU B 1 60  ? 40.095  15.072  66.085  1.00 14.17 ? 60  GLU B OE2 1 
ATOM   4445  N  N   . MET B 1 61  ? 35.385  14.521  69.627  1.00 12.02 ? 61  MET B N   1 
ATOM   4446  C  CA  . MET B 1 61  ? 34.069  14.049  69.212  1.00 12.25 ? 61  MET B CA  1 
ATOM   4447  C  C   . MET B 1 61  ? 32.966  15.006  69.642  1.00 12.18 ? 61  MET B C   1 
ATOM   4448  O  O   . MET B 1 61  ? 32.211  15.514  68.814  1.00 12.29 ? 61  MET B O   1 
ATOM   4449  C  CB  . MET B 1 61  ? 33.788  12.671  69.802  1.00 12.43 ? 61  MET B CB  1 
ATOM   4450  C  CG  . MET B 1 61  ? 32.610  11.973  69.167  1.00 12.81 ? 61  MET B CG  1 
ATOM   4451  S  SD  . MET B 1 61  ? 32.562  12.257  67.392  1.00 13.47 ? 61  MET B SD  1 
ATOM   4452  C  CE  . MET B 1 61  ? 33.801  11.077  66.816  1.00 13.48 ? 61  MET B CE  1 
ATOM   4453  N  N   . ALA B 1 62  ? 32.887  15.247  70.945  1.00 12.09 ? 62  ALA B N   1 
ATOM   4454  C  CA  . ALA B 1 62  ? 31.883  16.130  71.510  1.00 11.91 ? 62  ALA B CA  1 
ATOM   4455  C  C   . ALA B 1 62  ? 31.763  17.426  70.721  1.00 11.91 ? 62  ALA B C   1 
ATOM   4456  O  O   . ALA B 1 62  ? 30.673  17.784  70.279  1.00 11.88 ? 62  ALA B O   1 
ATOM   4457  C  CB  . ALA B 1 62  ? 32.220  16.428  72.960  1.00 11.77 ? 62  ALA B CB  1 
ATOM   4458  N  N   . HIS B 1 63  ? 32.882  18.124  70.545  1.00 12.09 ? 63  HIS B N   1 
ATOM   4459  C  CA  . HIS B 1 63  ? 32.891  19.388  69.805  1.00 12.25 ? 63  HIS B CA  1 
ATOM   4460  C  C   . HIS B 1 63  ? 32.344  19.168  68.406  1.00 12.23 ? 63  HIS B C   1 
ATOM   4461  O  O   . HIS B 1 63  ? 31.477  19.908  67.949  1.00 12.43 ? 63  HIS B O   1 
ATOM   4462  C  CB  . HIS B 1 63  ? 34.312  19.963  69.715  1.00 12.28 ? 63  HIS B CB  1 
ATOM   4463  C  CG  . HIS B 1 63  ? 34.356  21.388  69.255  1.00 12.13 ? 63  HIS B CG  1 
ATOM   4464  N  ND1 . HIS B 1 63  ? 33.951  21.777  67.998  1.00 12.14 ? 63  HIS B ND1 1 
ATOM   4465  C  CD2 . HIS B 1 63  ? 34.727  22.521  69.897  1.00 12.05 ? 63  HIS B CD2 1 
ATOM   4466  C  CE1 . HIS B 1 63  ? 34.067  23.087  67.884  1.00 12.00 ? 63  HIS B CE1 1 
ATOM   4467  N  NE2 . HIS B 1 63  ? 34.537  23.564  69.024  1.00 11.87 ? 63  HIS B NE2 1 
ATOM   4468  N  N   . PHE B 1 64  ? 32.861  18.149  67.729  1.00 12.06 ? 64  PHE B N   1 
ATOM   4469  C  CA  . PHE B 1 64  ? 32.406  17.815  66.389  1.00 11.66 ? 64  PHE B CA  1 
ATOM   4470  C  C   . PHE B 1 64  ? 30.881  17.701  66.378  1.00 11.37 ? 64  PHE B C   1 
ATOM   4471  O  O   . PHE B 1 64  ? 30.228  18.011  65.377  1.00 11.17 ? 64  PHE B O   1 
ATOM   4472  C  CB  . PHE B 1 64  ? 33.024  16.482  65.950  1.00 12.00 ? 64  PHE B CB  1 
ATOM   4473  C  CG  . PHE B 1 64  ? 32.427  15.914  64.685  1.00 12.14 ? 64  PHE B CG  1 
ATOM   4474  C  CD1 . PHE B 1 64  ? 32.681  16.505  63.451  1.00 11.95 ? 64  PHE B CD1 1 
ATOM   4475  C  CD2 . PHE B 1 64  ? 31.620  14.782  64.729  1.00 12.34 ? 64  PHE B CD2 1 
ATOM   4476  C  CE1 . PHE B 1 64  ? 32.143  15.976  62.282  1.00 11.77 ? 64  PHE B CE1 1 
ATOM   4477  C  CE2 . PHE B 1 64  ? 31.079  14.249  63.565  1.00 12.30 ? 64  PHE B CE2 1 
ATOM   4478  C  CZ  . PHE B 1 64  ? 31.343  14.849  62.337  1.00 11.96 ? 64  PHE B CZ  1 
ATOM   4479  N  N   . ASP B 1 65  ? 30.325  17.257  67.503  1.00 11.19 ? 65  ASP B N   1 
ATOM   4480  C  CA  . ASP B 1 65  ? 28.885  17.082  67.645  1.00 10.98 ? 65  ASP B CA  1 
ATOM   4481  C  C   . ASP B 1 65  ? 28.164  18.423  67.770  1.00 10.91 ? 65  ASP B C   1 
ATOM   4482  O  O   . ASP B 1 65  ? 26.935  18.482  67.734  1.00 10.86 ? 65  ASP B O   1 
ATOM   4483  C  CB  . ASP B 1 65  ? 28.581  16.210  68.870  1.00 11.01 ? 65  ASP B CB  1 
ATOM   4484  C  CG  . ASP B 1 65  ? 29.044  14.769  68.696  1.00 11.14 ? 65  ASP B CG  1 
ATOM   4485  O  OD1 . ASP B 1 65  ? 29.498  14.413  67.590  1.00 11.18 ? 65  ASP B OD1 1 
ATOM   4486  O  OD2 . ASP B 1 65  ? 28.955  13.987  69.667  1.00 11.22 ? 65  ASP B OD2 1 
ATOM   4487  N  N   . ARG B 1 66  ? 28.930  19.499  67.907  1.00 10.76 ? 66  ARG B N   1 
ATOM   4488  C  CA  . ARG B 1 66  ? 28.347  20.828  68.037  1.00 10.85 ? 66  ARG B CA  1 
ATOM   4489  C  C   . ARG B 1 66  ? 28.943  21.811  67.032  1.00 10.83 ? 66  ARG B C   1 
ATOM   4490  O  O   . ARG B 1 66  ? 29.176  22.976  67.348  1.00 10.78 ? 66  ARG B O   1 
ATOM   4491  C  CB  . ARG B 1 66  ? 28.553  21.354  69.459  1.00 10.84 ? 66  ARG B CB  1 
ATOM   4492  C  CG  . ARG B 1 66  ? 27.849  20.536  70.513  1.00 11.07 ? 66  ARG B CG  1 
ATOM   4493  C  CD  . ARG B 1 66  ? 28.567  20.568  71.855  1.00 11.31 ? 66  ARG B CD  1 
ATOM   4494  N  NE  . ARG B 1 66  ? 27.752  19.907  72.869  1.00 11.46 ? 66  ARG B NE  1 
ATOM   4495  C  CZ  . ARG B 1 66  ? 27.732  18.592  73.066  1.00 11.49 ? 66  ARG B CZ  1 
ATOM   4496  N  NH1 . ARG B 1 66  ? 28.489  17.795  72.320  1.00 11.28 ? 66  ARG B NH1 1 
ATOM   4497  N  NH2 . ARG B 1 66  ? 26.929  18.070  73.984  1.00 11.51 ? 66  ARG B NH2 1 
ATOM   4498  N  N   . GLU B 1 67  ? 29.182  21.340  65.816  1.00 10.98 ? 67  GLU B N   1 
ATOM   4499  C  CA  . GLU B 1 67  ? 29.749  22.183  64.771  1.00 11.22 ? 67  GLU B CA  1 
ATOM   4500  C  C   . GLU B 1 67  ? 28.696  23.043  64.083  1.00 11.38 ? 67  GLU B C   1 
ATOM   4501  O  O   . GLU B 1 67  ? 28.975  24.172  63.682  1.00 11.33 ? 67  GLU B O   1 
ATOM   4502  C  CB  . GLU B 1 67  ? 30.441  21.319  63.719  1.00 11.29 ? 67  GLU B CB  1 
ATOM   4503  C  CG  . GLU B 1 67  ? 31.924  21.101  63.957  1.00 11.54 ? 67  GLU B CG  1 
ATOM   4504  C  CD  . GLU B 1 67  ? 32.539  20.193  62.916  1.00 11.69 ? 67  GLU B CD  1 
ATOM   4505  O  OE1 . GLU B 1 67  ? 33.605  19.607  63.190  1.00 11.54 ? 67  GLU B OE1 1 
ATOM   4506  O  OE2 . GLU B 1 67  ? 31.949  20.064  61.821  1.00 11.98 ? 67  GLU B OE2 1 
ATOM   4507  N  N   . ARG B 1 68  ? 27.489  22.500  63.951  1.00 11.63 ? 68  ARG B N   1 
ATOM   4508  C  CA  . ARG B 1 68  ? 26.392  23.195  63.293  1.00 12.01 ? 68  ARG B CA  1 
ATOM   4509  C  C   . ARG B 1 68  ? 25.615  24.153  64.180  1.00 12.16 ? 68  ARG B C   1 
ATOM   4510  O  O   . ARG B 1 68  ? 25.554  23.990  65.396  1.00 12.23 ? 68  ARG B O   1 
ATOM   4511  C  CB  . ARG B 1 68  ? 25.413  22.180  62.699  1.00 12.11 ? 68  ARG B CB  1 
ATOM   4512  C  CG  . ARG B 1 68  ? 26.052  21.177  61.778  1.00 12.40 ? 68  ARG B CG  1 
ATOM   4513  C  CD  . ARG B 1 68  ? 26.537  21.846  60.505  1.00 12.73 ? 68  ARG B CD  1 
ATOM   4514  N  NE  . ARG B 1 68  ? 27.959  21.603  60.272  1.00 12.99 ? 68  ARG B NE  1 
ATOM   4515  C  CZ  . ARG B 1 68  ? 28.471  20.420  59.949  1.00 13.06 ? 68  ARG B CZ  1 
ATOM   4516  N  NH1 . ARG B 1 68  ? 27.683  19.367  59.818  1.00 12.64 ? 68  ARG B NH1 1 
ATOM   4517  N  NH2 . ARG B 1 68  ? 29.773  20.291  59.762  1.00 13.67 ? 68  ARG B NH2 1 
ATOM   4518  N  N   . ILE B 1 69  ? 25.015  25.149  63.538  1.00 12.52 ? 69  ILE B N   1 
ATOM   4519  C  CA  . ILE B 1 69  ? 24.201  26.157  64.201  1.00 12.65 ? 69  ILE B CA  1 
ATOM   4520  C  C   . ILE B 1 69  ? 23.030  26.444  63.257  1.00 12.73 ? 69  ILE B C   1 
ATOM   4521  O  O   . ILE B 1 69  ? 23.108  26.162  62.061  1.00 13.07 ? 69  ILE B O   1 
ATOM   4522  C  CB  . ILE B 1 69  ? 25.008  27.460  64.454  1.00 12.75 ? 69  ILE B CB  1 
ATOM   4523  C  CG1 . ILE B 1 69  ? 25.432  28.094  63.124  1.00 12.90 ? 69  ILE B CG1 1 
ATOM   4524  C  CG2 . ILE B 1 69  ? 26.248  27.152  65.283  1.00 12.59 ? 69  ILE B CG2 1 
ATOM   4525  C  CD1 . ILE B 1 69  ? 25.676  29.606  63.196  1.00 12.69 ? 69  ILE B CD1 1 
ATOM   4526  N  N   . PRO B 1 70  ? 21.921  26.989  63.779  1.00 12.57 ? 70  PRO B N   1 
ATOM   4527  C  CA  . PRO B 1 70  ? 20.787  27.270  62.888  1.00 12.40 ? 70  PRO B CA  1 
ATOM   4528  C  C   . PRO B 1 70  ? 21.139  28.227  61.748  1.00 12.24 ? 70  PRO B C   1 
ATOM   4529  O  O   . PRO B 1 70  ? 21.743  29.276  61.967  1.00 12.02 ? 70  PRO B O   1 
ATOM   4530  C  CB  . PRO B 1 70  ? 19.722  27.857  63.821  1.00 12.45 ? 70  PRO B CB  1 
ATOM   4531  C  CG  . PRO B 1 70  ? 20.142  27.450  65.202  1.00 12.48 ? 70  PRO B CG  1 
ATOM   4532  C  CD  . PRO B 1 70  ? 21.638  27.364  65.174  1.00 12.58 ? 70  PRO B CD  1 
ATOM   4533  N  N   . GLU B 1 71  ? 20.761  27.850  60.532  1.00 12.24 ? 71  GLU B N   1 
ATOM   4534  C  CA  . GLU B 1 71  ? 21.026  28.671  59.356  1.00 12.33 ? 71  GLU B CA  1 
ATOM   4535  C  C   . GLU B 1 71  ? 20.043  29.837  59.279  1.00 12.25 ? 71  GLU B C   1 
ATOM   4536  O  O   . GLU B 1 71  ? 18.955  29.778  59.849  1.00 12.36 ? 71  GLU B O   1 
ATOM   4537  C  CB  . GLU B 1 71  ? 20.907  27.824  58.090  1.00 12.31 ? 71  GLU B CB  1 
ATOM   4538  C  CG  . GLU B 1 71  ? 19.474  27.610  57.631  1.00 12.27 ? 71  GLU B CG  1 
ATOM   4539  C  CD  . GLU B 1 71  ? 19.367  26.644  56.465  1.00 12.24 ? 71  GLU B CD  1 
ATOM   4540  O  OE1 . GLU B 1 71  ? 20.284  25.806  56.301  1.00 11.86 ? 71  GLU B OE1 1 
ATOM   4541  O  OE2 . GLU B 1 71  ? 18.363  26.726  55.717  1.00 12.11 ? 71  GLU B OE2 1 
ATOM   4542  N  N   . ARG B 1 72  ? 20.424  30.894  58.570  1.00 12.17 ? 72  ARG B N   1 
ATOM   4543  C  CA  . ARG B 1 72  ? 19.562  32.061  58.431  1.00 12.01 ? 72  ARG B CA  1 
ATOM   4544  C  C   . ARG B 1 72  ? 18.184  31.645  57.943  1.00 12.04 ? 72  ARG B C   1 
ATOM   4545  O  O   . ARG B 1 72  ? 18.062  30.964  56.930  1.00 12.14 ? 72  ARG B O   1 
ATOM   4546  C  CB  . ARG B 1 72  ? 20.170  33.047  57.440  1.00 11.96 ? 72  ARG B CB  1 
ATOM   4547  C  CG  . ARG B 1 72  ? 21.226  33.937  58.046  1.00 11.75 ? 72  ARG B CG  1 
ATOM   4548  C  CD  . ARG B 1 72  ? 22.497  33.915  57.236  1.00 11.47 ? 72  ARG B CD  1 
ATOM   4549  N  NE  . ARG B 1 72  ? 23.433  34.938  57.690  1.00 11.21 ? 72  ARG B NE  1 
ATOM   4550  C  CZ  . ARG B 1 72  ? 24.755  34.834  57.600  1.00 10.96 ? 72  ARG B CZ  1 
ATOM   4551  N  NH1 . ARG B 1 72  ? 25.305  33.751  57.073  1.00 10.77 ? 72  ARG B NH1 1 
ATOM   4552  N  NH2 . ARG B 1 72  ? 25.522  35.824  58.026  1.00 10.93 ? 72  ARG B NH2 1 
ATOM   4553  N  N   . VAL B 1 73  ? 17.146  32.050  58.667  1.00 12.19 ? 73  VAL B N   1 
ATOM   4554  C  CA  . VAL B 1 73  ? 15.783  31.703  58.283  1.00 12.23 ? 73  VAL B CA  1 
ATOM   4555  C  C   . VAL B 1 73  ? 15.547  32.070  56.812  1.00 12.39 ? 73  VAL B C   1 
ATOM   4556  O  O   . VAL B 1 73  ? 14.721  31.455  56.134  1.00 12.32 ? 73  VAL B O   1 
ATOM   4557  C  CB  . VAL B 1 73  ? 14.755  32.410  59.199  1.00 11.87 ? 73  VAL B CB  1 
ATOM   4558  C  CG1 . VAL B 1 73  ? 15.153  33.859  59.402  1.00 12.01 ? 73  VAL B CG1 1 
ATOM   4559  C  CG2 . VAL B 1 73  ? 13.362  32.297  58.611  1.00 11.51 ? 73  VAL B CG2 1 
ATOM   4560  N  N   . VAL B 1 74  ? 16.286  33.071  56.332  1.00 12.70 ? 74  VAL B N   1 
ATOM   4561  C  CA  . VAL B 1 74  ? 16.225  33.523  54.935  1.00 13.05 ? 74  VAL B CA  1 
ATOM   4562  C  C   . VAL B 1 74  ? 17.631  33.950  54.537  1.00 13.03 ? 74  VAL B C   1 
ATOM   4563  O  O   . VAL B 1 74  ? 18.448  34.298  55.392  1.00 13.26 ? 74  VAL B O   1 
ATOM   4564  C  CB  . VAL B 1 74  ? 15.290  34.734  54.727  1.00 13.31 ? 74  VAL B CB  1 
ATOM   4565  C  CG1 . VAL B 1 74  ? 13.942  34.263  54.208  1.00 13.47 ? 74  VAL B CG1 1 
ATOM   4566  C  CG2 . VAL B 1 74  ? 15.135  35.510  56.024  1.00 13.59 ? 74  VAL B CG2 1 
ATOM   4567  N  N   . HIS B 1 75  ? 17.912  33.939  53.241  1.00 13.12 ? 75  HIS B N   1 
ATOM   4568  C  CA  . HIS B 1 75  ? 19.239  34.303  52.759  1.00 12.75 ? 75  HIS B CA  1 
ATOM   4569  C  C   . HIS B 1 75  ? 20.259  33.376  53.426  1.00 12.29 ? 75  HIS B C   1 
ATOM   4570  O  O   . HIS B 1 75  ? 21.251  33.832  53.985  1.00 12.40 ? 75  HIS B O   1 
ATOM   4571  C  CB  . HIS B 1 75  ? 19.559  35.761  53.109  1.00 12.87 ? 75  HIS B CB  1 
ATOM   4572  C  CG  . HIS B 1 75  ? 18.672  36.760  52.431  1.00 13.02 ? 75  HIS B CG  1 
ATOM   4573  N  ND1 . HIS B 1 75  ? 19.111  37.570  51.407  1.00 13.09 ? 75  HIS B ND1 1 
ATOM   4574  C  CD2 . HIS B 1 75  ? 17.378  37.095  52.646  1.00 13.11 ? 75  HIS B CD2 1 
ATOM   4575  C  CE1 . HIS B 1 75  ? 18.126  38.362  51.019  1.00 13.08 ? 75  HIS B CE1 1 
ATOM   4576  N  NE2 . HIS B 1 75  ? 17.063  38.094  51.755  1.00 13.16 ? 75  HIS B NE2 1 
ATOM   4577  N  N   . ALA B 1 76  ? 19.999  32.074  53.378  1.00 11.97 ? 76  ALA B N   1 
ATOM   4578  C  CA  . ALA B 1 76  ? 20.906  31.101  53.978  1.00 11.69 ? 76  ALA B CA  1 
ATOM   4579  C  C   . ALA B 1 76  ? 22.192  30.959  53.163  1.00 11.39 ? 76  ALA B C   1 
ATOM   4580  O  O   . ALA B 1 76  ? 23.291  31.135  53.686  1.00 11.13 ? 76  ALA B O   1 
ATOM   4581  C  CB  . ALA B 1 76  ? 20.215  29.745  54.100  1.00 11.61 ? 76  ALA B CB  1 
ATOM   4582  N  N   . LYS B 1 77  ? 22.048  30.644  51.878  1.00 11.38 ? 77  LYS B N   1 
ATOM   4583  C  CA  . LYS B 1 77  ? 23.198  30.467  50.997  1.00 11.32 ? 77  LYS B CA  1 
ATOM   4584  C  C   . LYS B 1 77  ? 23.775  31.799  50.575  1.00 11.48 ? 77  LYS B C   1 
ATOM   4585  O  O   . LYS B 1 77  ? 23.093  32.603  49.946  1.00 11.62 ? 77  LYS B O   1 
ATOM   4586  C  CB  . LYS B 1 77  ? 22.804  29.681  49.750  1.00 11.18 ? 77  LYS B CB  1 
ATOM   4587  C  CG  . LYS B 1 77  ? 23.654  28.458  49.507  1.00 11.01 ? 77  LYS B CG  1 
ATOM   4588  C  CD  . LYS B 1 77  ? 24.996  28.827  48.921  1.00 11.05 ? 77  LYS B CD  1 
ATOM   4589  C  CE  . LYS B 1 77  ? 25.760  27.573  48.502  1.00 11.17 ? 77  LYS B CE  1 
ATOM   4590  N  NZ  . LYS B 1 77  ? 25.986  27.531  47.032  1.00 11.12 ? 77  LYS B NZ  1 
ATOM   4591  N  N   . GLY B 1 78  ? 25.038  32.028  50.921  1.00 11.72 ? 78  GLY B N   1 
ATOM   4592  C  CA  . GLY B 1 78  ? 25.684  33.274  50.555  1.00 11.59 ? 78  GLY B CA  1 
ATOM   4593  C  C   . GLY B 1 78  ? 27.199  33.192  50.554  1.00 11.68 ? 78  GLY B C   1 
ATOM   4594  O  O   . GLY B 1 78  ? 27.779  32.137  50.832  1.00 11.77 ? 78  GLY B O   1 
ATOM   4595  N  N   . ALA B 1 79  ? 27.840  34.314  50.238  1.00 11.45 ? 79  ALA B N   1 
ATOM   4596  C  CA  . ALA B 1 79  ? 29.294  34.395  50.201  1.00 11.27 ? 79  ALA B CA  1 
ATOM   4597  C  C   . ALA B 1 79  ? 29.722  35.718  50.821  1.00 11.19 ? 79  ALA B C   1 
ATOM   4598  O  O   . ALA B 1 79  ? 28.952  36.678  50.823  1.00 11.10 ? 79  ALA B O   1 
ATOM   4599  C  CB  . ALA B 1 79  ? 29.791  34.297  48.759  1.00 11.15 ? 79  ALA B CB  1 
ATOM   4600  N  N   . GLY B 1 80  ? 30.946  35.765  51.342  1.00 11.02 ? 80  GLY B N   1 
ATOM   4601  C  CA  . GLY B 1 80  ? 31.433  36.984  51.963  1.00 11.36 ? 80  GLY B CA  1 
ATOM   4602  C  C   . GLY B 1 80  ? 32.781  37.480  51.471  1.00 11.30 ? 80  GLY B C   1 
ATOM   4603  O  O   . GLY B 1 80  ? 33.525  36.756  50.815  1.00 11.32 ? 80  GLY B O   1 
ATOM   4604  N  N   . ALA B 1 81  ? 33.092  38.729  51.799  1.00 11.24 ? 81  ALA B N   1 
ATOM   4605  C  CA  . ALA B 1 81  ? 34.347  39.352  51.406  1.00 11.50 ? 81  ALA B CA  1 
ATOM   4606  C  C   . ALA B 1 81  ? 34.492  40.687  52.137  1.00 11.68 ? 81  ALA B C   1 
ATOM   4607  O  O   . ALA B 1 81  ? 33.520  41.215  52.685  1.00 11.28 ? 81  ALA B O   1 
ATOM   4608  C  CB  . ALA B 1 81  ? 34.374  39.571  49.903  1.00 11.60 ? 81  ALA B CB  1 
ATOM   4609  N  N   . PHE B 1 82  ? 35.704  41.233  52.136  1.00 11.70 ? 82  PHE B N   1 
ATOM   4610  C  CA  . PHE B 1 82  ? 35.961  42.493  52.821  1.00 12.13 ? 82  PHE B CA  1 
ATOM   4611  C  C   . PHE B 1 82  ? 36.680  43.525  51.964  1.00 12.26 ? 82  PHE B C   1 
ATOM   4612  O  O   . PHE B 1 82  ? 37.309  43.197  50.959  1.00 12.37 ? 82  PHE B O   1 
ATOM   4613  C  CB  . PHE B 1 82  ? 36.768  42.228  54.096  1.00 12.32 ? 82  PHE B CB  1 
ATOM   4614  C  CG  . PHE B 1 82  ? 36.165  41.170  54.971  1.00 12.37 ? 82  PHE B CG  1 
ATOM   4615  C  CD1 . PHE B 1 82  ? 36.490  39.828  54.786  1.00 12.31 ? 82  PHE B CD1 1 
ATOM   4616  C  CD2 . PHE B 1 82  ? 35.223  41.505  55.935  1.00 12.41 ? 82  PHE B CD2 1 
ATOM   4617  C  CE1 . PHE B 1 82  ? 35.882  38.836  55.543  1.00 11.98 ? 82  PHE B CE1 1 
ATOM   4618  C  CE2 . PHE B 1 82  ? 34.607  40.520  56.700  1.00 12.16 ? 82  PHE B CE2 1 
ATOM   4619  C  CZ  . PHE B 1 82  ? 34.937  39.182  56.502  1.00 12.07 ? 82  PHE B CZ  1 
ATOM   4620  N  N   . GLY B 1 83  ? 36.576  44.781  52.377  1.00 12.23 ? 83  GLY B N   1 
ATOM   4621  C  CA  . GLY B 1 83  ? 37.226  45.853  51.651  1.00 12.50 ? 83  GLY B CA  1 
ATOM   4622  C  C   . GLY B 1 83  ? 37.158  47.134  52.454  1.00 12.58 ? 83  GLY B C   1 
ATOM   4623  O  O   . GLY B 1 83  ? 37.502  47.158  53.635  1.00 12.46 ? 83  GLY B O   1 
ATOM   4624  N  N   . TYR B 1 84  ? 36.705  48.202  51.812  1.00 12.62 ? 84  TYR B N   1 
ATOM   4625  C  CA  . TYR B 1 84  ? 36.580  49.489  52.472  1.00 12.59 ? 84  TYR B CA  1 
ATOM   4626  C  C   . TYR B 1 84  ? 35.664  50.362  51.642  1.00 12.46 ? 84  TYR B C   1 
ATOM   4627  O  O   . TYR B 1 84  ? 35.348  50.034  50.496  1.00 12.52 ? 84  TYR B O   1 
ATOM   4628  C  CB  . TYR B 1 84  ? 37.942  50.165  52.575  1.00 13.15 ? 84  TYR B CB  1 
ATOM   4629  C  CG  . TYR B 1 84  ? 38.531  50.501  51.222  1.00 13.60 ? 84  TYR B CG  1 
ATOM   4630  C  CD1 . TYR B 1 84  ? 38.368  51.771  50.660  1.00 13.66 ? 84  TYR B CD1 1 
ATOM   4631  C  CD2 . TYR B 1 84  ? 39.216  49.532  50.480  1.00 13.80 ? 84  TYR B CD2 1 
ATOM   4632  C  CE1 . TYR B 1 84  ? 38.868  52.065  49.389  1.00 13.58 ? 84  TYR B CE1 1 
ATOM   4633  C  CE2 . TYR B 1 84  ? 39.719  49.817  49.211  1.00 13.71 ? 84  TYR B CE2 1 
ATOM   4634  C  CZ  . TYR B 1 84  ? 39.541  51.080  48.671  1.00 13.62 ? 84  TYR B CZ  1 
ATOM   4635  O  OH  . TYR B 1 84  ? 40.019  51.345  47.409  1.00 13.36 ? 84  TYR B OH  1 
ATOM   4636  N  N   . PHE B 1 85  ? 35.236  51.472  52.228  1.00 12.06 ? 85  PHE B N   1 
ATOM   4637  C  CA  . PHE B 1 85  ? 34.383  52.416  51.526  1.00 11.46 ? 85  PHE B CA  1 
ATOM   4638  C  C   . PHE B 1 85  ? 35.093  53.761  51.488  1.00 11.16 ? 85  PHE B C   1 
ATOM   4639  O  O   . PHE B 1 85  ? 35.612  54.229  52.499  1.00 11.02 ? 85  PHE B O   1 
ATOM   4640  C  CB  . PHE B 1 85  ? 33.038  52.564  52.229  1.00 11.46 ? 85  PHE B CB  1 
ATOM   4641  C  CG  . PHE B 1 85  ? 32.296  53.810  51.847  1.00 11.39 ? 85  PHE B CG  1 
ATOM   4642  C  CD1 . PHE B 1 85  ? 31.593  53.869  50.649  1.00 11.37 ? 85  PHE B CD1 1 
ATOM   4643  C  CD2 . PHE B 1 85  ? 32.312  54.929  52.678  1.00 11.34 ? 85  PHE B CD2 1 
ATOM   4644  C  CE1 . PHE B 1 85  ? 30.916  55.021  50.279  1.00 11.50 ? 85  PHE B CE1 1 
ATOM   4645  C  CE2 . PHE B 1 85  ? 31.639  56.089  52.321  1.00 11.43 ? 85  PHE B CE2 1 
ATOM   4646  C  CZ  . PHE B 1 85  ? 30.937  56.137  51.115  1.00 11.51 ? 85  PHE B CZ  1 
ATOM   4647  N  N   . GLU B 1 86  ? 35.117  54.382  50.318  1.00 11.22 ? 86  GLU B N   1 
ATOM   4648  C  CA  . GLU B 1 86  ? 35.777  55.663  50.180  1.00 11.58 ? 86  GLU B CA  1 
ATOM   4649  C  C   . GLU B 1 86  ? 34.839  56.785  49.779  1.00 11.55 ? 86  GLU B C   1 
ATOM   4650  O  O   . GLU B 1 86  ? 33.963  56.606  48.938  1.00 11.36 ? 86  GLU B O   1 
ATOM   4651  C  CB  . GLU B 1 86  ? 36.903  55.566  49.156  1.00 11.66 ? 86  GLU B CB  1 
ATOM   4652  C  CG  . GLU B 1 86  ? 37.699  56.839  49.035  1.00 12.39 ? 86  GLU B CG  1 
ATOM   4653  C  CD  . GLU B 1 86  ? 38.780  56.742  47.992  1.00 12.92 ? 86  GLU B CD  1 
ATOM   4654  O  OE1 . GLU B 1 86  ? 39.508  55.722  47.974  1.00 13.00 ? 86  GLU B OE1 1 
ATOM   4655  O  OE2 . GLU B 1 86  ? 38.902  57.693  47.191  1.00 13.63 ? 86  GLU B OE2 1 
ATOM   4656  N  N   . VAL B 1 87  ? 35.030  57.945  50.393  1.00 11.76 ? 87  VAL B N   1 
ATOM   4657  C  CA  . VAL B 1 87  ? 34.216  59.111  50.087  1.00 12.17 ? 87  VAL B CA  1 
ATOM   4658  C  C   . VAL B 1 87  ? 34.889  59.832  48.930  1.00 12.55 ? 87  VAL B C   1 
ATOM   4659  O  O   . VAL B 1 87  ? 36.072  60.155  49.005  1.00 12.72 ? 87  VAL B O   1 
ATOM   4660  C  CB  . VAL B 1 87  ? 34.128  60.075  51.297  1.00 12.16 ? 87  VAL B CB  1 
ATOM   4661  C  CG1 . VAL B 1 87  ? 33.429  61.376  50.888  1.00 11.97 ? 87  VAL B CG1 1 
ATOM   4662  C  CG2 . VAL B 1 87  ? 33.380  59.404  52.441  1.00 12.16 ? 87  VAL B CG2 1 
ATOM   4663  N  N   . THR B 1 88  ? 34.142  60.071  47.857  1.00 12.67 ? 88  THR B N   1 
ATOM   4664  C  CA  . THR B 1 88  ? 34.695  60.755  46.697  1.00 12.71 ? 88  THR B CA  1 
ATOM   4665  C  C   . THR B 1 88  ? 34.062  62.131  46.517  1.00 12.63 ? 88  THR B C   1 
ATOM   4666  O  O   . THR B 1 88  ? 34.697  63.055  46.009  1.00 12.45 ? 88  THR B O   1 
ATOM   4667  C  CB  . THR B 1 88  ? 34.492  59.925  45.418  1.00 13.05 ? 88  THR B CB  1 
ATOM   4668  O  OG1 . THR B 1 88  ? 33.110  59.950  45.037  1.00 13.82 ? 88  THR B OG1 1 
ATOM   4669  C  CG2 . THR B 1 88  ? 34.912  58.494  45.660  1.00 12.91 ? 88  THR B CG2 1 
ATOM   4670  N  N   . HIS B 1 89  ? 32.813  62.266  46.942  1.00 12.58 ? 89  HIS B N   1 
ATOM   4671  C  CA  . HIS B 1 89  ? 32.122  63.541  46.836  1.00 12.88 ? 89  HIS B CA  1 
ATOM   4672  C  C   . HIS B 1 89  ? 31.649  63.998  48.218  1.00 12.78 ? 89  HIS B C   1 
ATOM   4673  O  O   . HIS B 1 89  ? 31.408  63.179  49.108  1.00 12.55 ? 89  HIS B O   1 
ATOM   4674  C  CB  . HIS B 1 89  ? 30.930  63.419  45.883  1.00 13.13 ? 89  HIS B CB  1 
ATOM   4675  C  CG  . HIS B 1 89  ? 31.319  63.189  44.455  1.00 13.38 ? 89  HIS B CG  1 
ATOM   4676  N  ND1 . HIS B 1 89  ? 32.222  62.218  44.074  1.00 13.46 ? 89  HIS B ND1 1 
ATOM   4677  C  CD2 . HIS B 1 89  ? 30.919  63.798  43.312  1.00 13.53 ? 89  HIS B CD2 1 
ATOM   4678  C  CE1 . HIS B 1 89  ? 32.360  62.237  42.760  1.00 13.35 ? 89  HIS B CE1 1 
ATOM   4679  N  NE2 . HIS B 1 89  ? 31.581  63.187  42.274  1.00 13.48 ? 89  HIS B NE2 1 
ATOM   4680  N  N   . ASP B 1 90  ? 31.529  65.310  48.395  1.00 12.78 ? 90  ASP B N   1 
ATOM   4681  C  CA  . ASP B 1 90  ? 31.088  65.870  49.666  1.00 12.83 ? 90  ASP B CA  1 
ATOM   4682  C  C   . ASP B 1 90  ? 29.572  65.995  49.710  1.00 12.83 ? 90  ASP B C   1 
ATOM   4683  O  O   . ASP B 1 90  ? 28.973  66.712  48.905  1.00 12.75 ? 90  ASP B O   1 
ATOM   4684  C  CB  . ASP B 1 90  ? 31.716  67.249  49.886  1.00 13.07 ? 90  ASP B CB  1 
ATOM   4685  C  CG  . ASP B 1 90  ? 31.246  67.905  51.175  1.00 13.33 ? 90  ASP B CG  1 
ATOM   4686  O  OD1 . ASP B 1 90  ? 30.143  68.501  51.184  1.00 12.95 ? 90  ASP B OD1 1 
ATOM   4687  O  OD2 . ASP B 1 90  ? 31.984  67.825  52.182  1.00 13.82 ? 90  ASP B OD2 1 
ATOM   4688  N  N   . ILE B 1 91  ? 28.953  65.296  50.656  1.00 12.67 ? 91  ILE B N   1 
ATOM   4689  C  CA  . ILE B 1 91  ? 27.503  65.342  50.801  1.00 12.48 ? 91  ILE B CA  1 
ATOM   4690  C  C   . ILE B 1 91  ? 27.109  65.652  52.248  1.00 12.35 ? 91  ILE B C   1 
ATOM   4691  O  O   . ILE B 1 91  ? 26.003  65.324  52.687  1.00 12.29 ? 91  ILE B O   1 
ATOM   4692  C  CB  . ILE B 1 91  ? 26.856  63.999  50.357  1.00 12.52 ? 91  ILE B CB  1 
ATOM   4693  C  CG1 . ILE B 1 91  ? 27.308  62.862  51.270  1.00 12.56 ? 91  ILE B CG1 1 
ATOM   4694  C  CG2 . ILE B 1 91  ? 27.266  63.665  48.934  1.00 12.53 ? 91  ILE B CG2 1 
ATOM   4695  C  CD1 . ILE B 1 91  ? 26.404  61.668  51.221  1.00 12.20 ? 91  ILE B CD1 1 
ATOM   4696  N  N   . THR B 1 92  ? 28.021  66.292  52.977  1.00 12.36 ? 92  THR B N   1 
ATOM   4697  C  CA  . THR B 1 92  ? 27.791  66.652  54.379  1.00 12.41 ? 92  THR B CA  1 
ATOM   4698  C  C   . THR B 1 92  ? 26.589  67.580  54.561  1.00 12.59 ? 92  THR B C   1 
ATOM   4699  O  O   . THR B 1 92  ? 25.970  67.599  55.623  1.00 12.49 ? 92  THR B O   1 
ATOM   4700  C  CB  . THR B 1 92  ? 29.020  67.344  54.988  1.00 12.25 ? 92  THR B CB  1 
ATOM   4701  O  OG1 . THR B 1 92  ? 29.129  68.668  54.456  1.00 12.01 ? 92  THR B OG1 1 
ATOM   4702  C  CG2 . THR B 1 92  ? 30.284  66.567  54.667  1.00 12.33 ? 92  THR B CG2 1 
ATOM   4703  N  N   . LYS B 1 93  ? 26.258  68.347  53.527  1.00 12.86 ? 93  LYS B N   1 
ATOM   4704  C  CA  . LYS B 1 93  ? 25.122  69.259  53.598  1.00 13.14 ? 93  LYS B CA  1 
ATOM   4705  C  C   . LYS B 1 93  ? 23.820  68.477  53.758  1.00 13.25 ? 93  LYS B C   1 
ATOM   4706  O  O   . LYS B 1 93  ? 22.749  69.060  53.950  1.00 13.21 ? 93  LYS B O   1 
ATOM   4707  C  CB  . LYS B 1 93  ? 25.062  70.128  52.335  1.00 13.29 ? 93  LYS B CB  1 
ATOM   4708  C  CG  . LYS B 1 93  ? 24.123  69.619  51.247  1.00 13.37 ? 93  LYS B CG  1 
ATOM   4709  C  CD  . LYS B 1 93  ? 24.705  69.860  49.861  1.00 13.16 ? 93  LYS B CD  1 
ATOM   4710  C  CE  . LYS B 1 93  ? 25.586  68.697  49.403  1.00 12.91 ? 93  LYS B CE  1 
ATOM   4711  N  NZ  . LYS B 1 93  ? 27.043  68.924  49.655  1.00 11.94 ? 93  LYS B NZ  1 
ATOM   4712  N  N   . TYR B 1 94  ? 23.926  67.153  53.685  1.00 13.31 ? 94  TYR B N   1 
ATOM   4713  C  CA  . TYR B 1 94  ? 22.765  66.278  53.807  1.00 13.45 ? 94  TYR B CA  1 
ATOM   4714  C  C   . TYR B 1 94  ? 22.778  65.449  55.082  1.00 13.56 ? 94  TYR B C   1 
ATOM   4715  O  O   . TYR B 1 94  ? 21.766  65.348  55.774  1.00 13.66 ? 94  TYR B O   1 
ATOM   4716  C  CB  . TYR B 1 94  ? 22.687  65.357  52.591  1.00 13.23 ? 94  TYR B CB  1 
ATOM   4717  C  CG  . TYR B 1 94  ? 22.244  66.087  51.347  1.00 13.11 ? 94  TYR B CG  1 
ATOM   4718  C  CD1 . TYR B 1 94  ? 21.065  66.828  51.342  1.00 13.07 ? 94  TYR B CD1 1 
ATOM   4719  C  CD2 . TYR B 1 94  ? 23.014  66.061  50.184  1.00 12.92 ? 94  TYR B CD2 1 
ATOM   4720  C  CE1 . TYR B 1 94  ? 20.662  67.526  50.215  1.00 13.22 ? 94  TYR B CE1 1 
ATOM   4721  C  CE2 . TYR B 1 94  ? 22.619  66.756  49.050  1.00 13.09 ? 94  TYR B CE2 1 
ATOM   4722  C  CZ  . TYR B 1 94  ? 21.439  67.485  49.074  1.00 13.21 ? 94  TYR B CZ  1 
ATOM   4723  O  OH  . TYR B 1 94  ? 21.015  68.158  47.953  1.00 13.52 ? 94  TYR B OH  1 
ATOM   4724  N  N   . SER B 1 95  ? 23.925  64.851  55.385  1.00 13.38 ? 95  SER B N   1 
ATOM   4725  C  CA  . SER B 1 95  ? 24.066  64.038  56.585  1.00 13.25 ? 95  SER B CA  1 
ATOM   4726  C  C   . SER B 1 95  ? 25.351  64.392  57.315  1.00 13.27 ? 95  SER B C   1 
ATOM   4727  O  O   . SER B 1 95  ? 26.354  64.735  56.687  1.00 13.36 ? 95  SER B O   1 
ATOM   4728  C  CB  . SER B 1 95  ? 24.077  62.552  56.229  1.00 13.02 ? 95  SER B CB  1 
ATOM   4729  O  OG  . SER B 1 95  ? 24.928  61.836  57.108  1.00 12.55 ? 95  SER B OG  1 
ATOM   4730  N  N   . LYS B 1 96  ? 25.315  64.305  58.642  1.00 13.11 ? 96  LYS B N   1 
ATOM   4731  C  CA  . LYS B 1 96  ? 26.477  64.614  59.466  1.00 12.95 ? 96  LYS B CA  1 
ATOM   4732  C  C   . LYS B 1 96  ? 27.312  63.369  59.764  1.00 12.90 ? 96  LYS B C   1 
ATOM   4733  O  O   . LYS B 1 96  ? 28.461  63.482  60.196  1.00 12.81 ? 96  LYS B O   1 
ATOM   4734  C  CB  . LYS B 1 96  ? 26.027  65.251  60.784  1.00 13.08 ? 96  LYS B CB  1 
ATOM   4735  C  CG  . LYS B 1 96  ? 25.323  64.285  61.720  1.00 13.13 ? 96  LYS B CG  1 
ATOM   4736  C  CD  . LYS B 1 96  ? 24.351  64.999  62.646  1.00 13.17 ? 96  LYS B CD  1 
ATOM   4737  C  CE  . LYS B 1 96  ? 24.285  64.299  64.007  1.00 13.23 ? 96  LYS B CE  1 
ATOM   4738  N  NZ  . LYS B 1 96  ? 23.773  65.188  65.087  1.00 12.71 ? 96  LYS B NZ  1 
ATOM   4739  N  N   . ALA B 1 97  ? 26.727  62.192  59.533  1.00 12.82 ? 97  ALA B N   1 
ATOM   4740  C  CA  . ALA B 1 97  ? 27.390  60.910  59.782  1.00 12.54 ? 97  ALA B CA  1 
ATOM   4741  C  C   . ALA B 1 97  ? 28.898  60.945  59.563  1.00 12.59 ? 97  ALA B C   1 
ATOM   4742  O  O   . ALA B 1 97  ? 29.380  61.323  58.496  1.00 12.83 ? 97  ALA B O   1 
ATOM   4743  C  CB  . ALA B 1 97  ? 26.766  59.829  58.916  1.00 12.33 ? 97  ALA B CB  1 
ATOM   4744  N  N   . LYS B 1 98  ? 29.635  60.536  60.588  1.00 12.78 ? 98  LYS B N   1 
ATOM   4745  C  CA  . LYS B 1 98  ? 31.092  60.520  60.549  1.00 12.81 ? 98  LYS B CA  1 
ATOM   4746  C  C   . LYS B 1 98  ? 31.649  59.764  59.351  1.00 12.72 ? 98  LYS B C   1 
ATOM   4747  O  O   . LYS B 1 98  ? 32.752  60.046  58.888  1.00 12.71 ? 98  LYS B O   1 
ATOM   4748  C  CB  . LYS B 1 98  ? 31.633  59.900  61.840  1.00 12.89 ? 98  LYS B CB  1 
ATOM   4749  C  CG  . LYS B 1 98  ? 32.614  60.786  62.594  1.00 12.92 ? 98  LYS B CG  1 
ATOM   4750  C  CD  . LYS B 1 98  ? 32.041  61.243  63.928  1.00 12.61 ? 98  LYS B CD  1 
ATOM   4751  C  CE  . LYS B 1 98  ? 33.076  62.007  64.742  1.00 12.25 ? 98  LYS B CE  1 
ATOM   4752  N  NZ  . LYS B 1 98  ? 32.511  62.447  66.049  1.00 11.85 ? 98  LYS B NZ  1 
ATOM   4753  N  N   . VAL B 1 99  ? 30.884  58.802  58.851  1.00 12.68 ? 99  VAL B N   1 
ATOM   4754  C  CA  . VAL B 1 99  ? 31.312  57.997  57.715  1.00 12.50 ? 99  VAL B CA  1 
ATOM   4755  C  C   . VAL B 1 99  ? 31.472  58.839  56.451  1.00 12.30 ? 99  VAL B C   1 
ATOM   4756  O  O   . VAL B 1 99  ? 32.262  58.501  55.573  1.00 12.16 ? 99  VAL B O   1 
ATOM   4757  C  CB  . VAL B 1 99  ? 30.314  56.839  57.464  1.00 12.83 ? 99  VAL B CB  1 
ATOM   4758  C  CG1 . VAL B 1 99  ? 29.006  57.386  56.903  1.00 13.07 ? 99  VAL B CG1 1 
ATOM   4759  C  CG2 . VAL B 1 99  ? 30.928  55.813  56.529  1.00 13.09 ? 99  VAL B CG2 1 
ATOM   4760  N  N   . PHE B 1 100 ? 30.730  59.940  56.371  1.00 12.25 ? 100 PHE B N   1 
ATOM   4761  C  CA  . PHE B 1 100 ? 30.799  60.842  55.220  1.00 12.54 ? 100 PHE B CA  1 
ATOM   4762  C  C   . PHE B 1 100 ? 31.651  62.079  55.523  1.00 12.71 ? 100 PHE B C   1 
ATOM   4763  O  O   . PHE B 1 100 ? 31.773  62.974  54.689  1.00 12.65 ? 100 PHE B O   1 
ATOM   4764  C  CB  . PHE B 1 100 ? 29.391  61.300  54.817  1.00 12.20 ? 100 PHE B CB  1 
ATOM   4765  C  CG  . PHE B 1 100 ? 28.411  60.181  54.655  1.00 12.20 ? 100 PHE B CG  1 
ATOM   4766  C  CD1 . PHE B 1 100 ? 28.686  59.116  53.803  1.00 12.23 ? 100 PHE B CD1 1 
ATOM   4767  C  CD2 . PHE B 1 100 ? 27.213  60.186  55.357  1.00 12.28 ? 100 PHE B CD2 1 
ATOM   4768  C  CE1 . PHE B 1 100 ? 27.785  58.069  53.654  1.00 12.35 ? 100 PHE B CE1 1 
ATOM   4769  C  CE2 . PHE B 1 100 ? 26.300  59.144  55.217  1.00 12.43 ? 100 PHE B CE2 1 
ATOM   4770  C  CZ  . PHE B 1 100 ? 26.588  58.081  54.362  1.00 12.47 ? 100 PHE B CZ  1 
ATOM   4771  N  N   . GLU B 1 101 ? 32.229  62.119  56.718  1.00 12.79 ? 101 GLU B N   1 
ATOM   4772  C  CA  . GLU B 1 101 ? 33.056  63.237  57.170  1.00 13.12 ? 101 GLU B CA  1 
ATOM   4773  C  C   . GLU B 1 101 ? 33.702  64.098  56.088  1.00 13.09 ? 101 GLU B C   1 
ATOM   4774  O  O   . GLU B 1 101 ? 33.248  65.207  55.813  1.00 13.25 ? 101 GLU B O   1 
ATOM   4775  C  CB  . GLU B 1 101 ? 34.149  62.731  58.111  1.00 13.44 ? 101 GLU B CB  1 
ATOM   4776  C  CG  . GLU B 1 101 ? 34.176  63.442  59.450  1.00 13.58 ? 101 GLU B CG  1 
ATOM   4777  C  CD  . GLU B 1 101 ? 35.578  63.595  59.999  1.00 13.60 ? 101 GLU B CD  1 
ATOM   4778  O  OE1 . GLU B 1 101 ? 35.848  63.045  61.086  1.00 13.71 ? 101 GLU B OE1 1 
ATOM   4779  O  OE2 . GLU B 1 101 ? 36.407  64.265  59.347  1.00 13.26 ? 101 GLU B OE2 1 
ATOM   4780  N  N   . HIS B 1 102 ? 34.769  63.590  55.483  1.00 12.97 ? 102 HIS B N   1 
ATOM   4781  C  CA  . HIS B 1 102 ? 35.476  64.337  54.450  1.00 12.72 ? 102 HIS B CA  1 
ATOM   4782  C  C   . HIS B 1 102 ? 35.884  63.426  53.299  1.00 12.48 ? 102 HIS B C   1 
ATOM   4783  O  O   . HIS B 1 102 ? 35.963  62.206  53.459  1.00 12.33 ? 102 HIS B O   1 
ATOM   4784  C  CB  . HIS B 1 102 ? 36.726  64.966  55.050  1.00 12.86 ? 102 HIS B CB  1 
ATOM   4785  C  CG  . HIS B 1 102 ? 37.645  63.969  55.678  1.00 13.31 ? 102 HIS B CG  1 
ATOM   4786  N  ND1 . HIS B 1 102 ? 38.690  63.387  54.993  1.00 13.67 ? 102 HIS B ND1 1 
ATOM   4787  C  CD2 . HIS B 1 102 ? 37.648  63.414  56.913  1.00 13.39 ? 102 HIS B CD2 1 
ATOM   4788  C  CE1 . HIS B 1 102 ? 39.297  62.515  55.780  1.00 13.96 ? 102 HIS B CE1 1 
ATOM   4789  N  NE2 . HIS B 1 102 ? 38.684  62.513  56.950  1.00 13.73 ? 102 HIS B NE2 1 
ATOM   4790  N  N   . ILE B 1 103 ? 36.157  64.029  52.144  1.00 12.39 ? 103 ILE B N   1 
ATOM   4791  C  CA  . ILE B 1 103 ? 36.567  63.274  50.963  1.00 12.16 ? 103 ILE B CA  1 
ATOM   4792  C  C   . ILE B 1 103 ? 37.865  62.525  51.248  1.00 12.20 ? 103 ILE B C   1 
ATOM   4793  O  O   . ILE B 1 103 ? 38.699  62.979  52.032  1.00 12.55 ? 103 ILE B O   1 
ATOM   4794  C  CB  . ILE B 1 103 ? 36.778  64.210  49.748  1.00 11.86 ? 103 ILE B CB  1 
ATOM   4795  C  CG1 . ILE B 1 103 ? 35.423  64.633  49.174  1.00 11.51 ? 103 ILE B CG1 1 
ATOM   4796  C  CG2 . ILE B 1 103 ? 37.597  63.504  48.674  1.00 11.95 ? 103 ILE B CG2 1 
ATOM   4797  C  CD1 . ILE B 1 103 ? 35.390  66.064  48.674  1.00 10.78 ? 103 ILE B CD1 1 
ATOM   4798  N  N   . GLY B 1 104 ? 38.023  61.368  50.618  1.00 12.04 ? 104 GLY B N   1 
ATOM   4799  C  CA  . GLY B 1 104 ? 39.223  60.578  50.815  1.00 11.82 ? 104 GLY B CA  1 
ATOM   4800  C  C   . GLY B 1 104 ? 39.164  59.699  52.048  1.00 11.59 ? 104 GLY B C   1 
ATOM   4801  O  O   . GLY B 1 104 ? 40.062  58.887  52.285  1.00 11.28 ? 104 GLY B O   1 
ATOM   4802  N  N   . LYS B 1 105 ? 38.103  59.861  52.834  1.00 11.72 ? 105 LYS B N   1 
ATOM   4803  C  CA  . LYS B 1 105 ? 37.929  59.088  54.057  1.00 11.97 ? 105 LYS B CA  1 
ATOM   4804  C  C   . LYS B 1 105 ? 37.566  57.643  53.745  1.00 11.82 ? 105 LYS B C   1 
ATOM   4805  O  O   . LYS B 1 105 ? 36.533  57.367  53.141  1.00 11.81 ? 105 LYS B O   1 
ATOM   4806  C  CB  . LYS B 1 105 ? 36.848  59.724  54.938  1.00 12.18 ? 105 LYS B CB  1 
ATOM   4807  C  CG  . LYS B 1 105 ? 37.113  59.609  56.430  1.00 12.42 ? 105 LYS B CG  1 
ATOM   4808  C  CD  . LYS B 1 105 ? 35.952  58.924  57.153  1.00 12.28 ? 105 LYS B CD  1 
ATOM   4809  C  CE  . LYS B 1 105 ? 36.157  58.918  58.663  1.00 12.03 ? 105 LYS B CE  1 
ATOM   4810  N  NZ  . LYS B 1 105 ? 36.058  60.290  59.250  1.00 11.59 ? 105 LYS B NZ  1 
ATOM   4811  N  N   . LYS B 1 106 ? 38.433  56.727  54.162  1.00 12.03 ? 106 LYS B N   1 
ATOM   4812  C  CA  . LYS B 1 106 ? 38.224  55.306  53.936  1.00 12.06 ? 106 LYS B CA  1 
ATOM   4813  C  C   . LYS B 1 106 ? 37.737  54.647  55.218  1.00 12.22 ? 106 LYS B C   1 
ATOM   4814  O  O   . LYS B 1 106 ? 38.271  54.900  56.296  1.00 12.36 ? 106 LYS B O   1 
ATOM   4815  C  CB  . LYS B 1 106 ? 39.533  54.647  53.500  1.00 12.05 ? 106 LYS B CB  1 
ATOM   4816  C  CG  . LYS B 1 106 ? 39.892  54.859  52.043  1.00 12.04 ? 106 LYS B CG  1 
ATOM   4817  C  CD  . LYS B 1 106 ? 41.100  54.017  51.664  1.00 12.09 ? 106 LYS B CD  1 
ATOM   4818  C  CE  . LYS B 1 106 ? 42.318  54.889  51.399  1.00 12.31 ? 106 LYS B CE  1 
ATOM   4819  N  NZ  . LYS B 1 106 ? 42.108  55.794  50.228  1.00 12.46 ? 106 LYS B NZ  1 
ATOM   4820  N  N   . THR B 1 107 ? 36.725  53.798  55.101  1.00 12.19 ? 107 THR B N   1 
ATOM   4821  C  CA  . THR B 1 107 ? 36.187  53.103  56.265  1.00 12.27 ? 107 THR B CA  1 
ATOM   4822  C  C   . THR B 1 107 ? 36.066  51.612  55.957  1.00 12.11 ? 107 THR B C   1 
ATOM   4823  O  O   . THR B 1 107 ? 35.422  51.223  54.978  1.00 12.30 ? 107 THR B O   1 
ATOM   4824  C  CB  . THR B 1 107 ? 34.790  53.645  56.656  1.00 12.26 ? 107 THR B CB  1 
ATOM   4825  O  OG1 . THR B 1 107 ? 34.717  55.048  56.370  1.00 12.13 ? 107 THR B OG1 1 
ATOM   4826  C  CG2 . THR B 1 107 ? 34.529  53.421  58.141  1.00 12.27 ? 107 THR B CG2 1 
ATOM   4827  N  N   . PRO B 1 108 ? 36.698  50.760  56.782  1.00 11.91 ? 108 PRO B N   1 
ATOM   4828  C  CA  . PRO B 1 108 ? 36.635  49.313  56.566  1.00 11.73 ? 108 PRO B CA  1 
ATOM   4829  C  C   . PRO B 1 108 ? 35.192  48.827  56.510  1.00 11.64 ? 108 PRO B C   1 
ATOM   4830  O  O   . PRO B 1 108 ? 34.343  49.287  57.284  1.00 11.42 ? 108 PRO B O   1 
ATOM   4831  C  CB  . PRO B 1 108 ? 37.395  48.729  57.761  1.00 11.79 ? 108 PRO B CB  1 
ATOM   4832  C  CG  . PRO B 1 108 ? 37.485  49.835  58.758  1.00 11.88 ? 108 PRO B CG  1 
ATOM   4833  C  CD  . PRO B 1 108 ? 37.509  51.104  57.960  1.00 11.96 ? 108 PRO B CD  1 
ATOM   4834  N  N   . ILE B 1 109 ? 34.917  47.904  55.590  1.00 11.60 ? 109 ILE B N   1 
ATOM   4835  C  CA  . ILE B 1 109 ? 33.571  47.368  55.434  1.00 11.71 ? 109 ILE B CA  1 
ATOM   4836  C  C   . ILE B 1 109 ? 33.569  45.858  55.256  1.00 11.86 ? 109 ILE B C   1 
ATOM   4837  O  O   . ILE B 1 109 ? 34.611  45.253  55.008  1.00 12.09 ? 109 ILE B O   1 
ATOM   4838  C  CB  . ILE B 1 109 ? 32.870  47.995  54.225  1.00 11.45 ? 109 ILE B CB  1 
ATOM   4839  C  CG1 . ILE B 1 109 ? 33.722  47.789  52.969  1.00 11.67 ? 109 ILE B CG1 1 
ATOM   4840  C  CG2 . ILE B 1 109 ? 32.654  49.470  54.466  1.00 10.80 ? 109 ILE B CG2 1 
ATOM   4841  C  CD1 . ILE B 1 109 ? 32.965  47.212  51.778  1.00 12.10 ? 109 ILE B CD1 1 
ATOM   4842  N  N   . ALA B 1 110 ? 32.387  45.260  55.392  1.00 11.88 ? 110 ALA B N   1 
ATOM   4843  C  CA  . ALA B 1 110 ? 32.207  43.820  55.235  1.00 11.94 ? 110 ALA B CA  1 
ATOM   4844  C  C   . ALA B 1 110 ? 30.974  43.607  54.364  1.00 12.12 ? 110 ALA B C   1 
ATOM   4845  O  O   . ALA B 1 110 ? 29.999  44.356  54.467  1.00 12.28 ? 110 ALA B O   1 
ATOM   4846  C  CB  . ALA B 1 110 ? 32.016  43.166  56.590  1.00 11.70 ? 110 ALA B CB  1 
ATOM   4847  N  N   . VAL B 1 111 ? 31.010  42.593  53.505  1.00 11.81 ? 111 VAL B N   1 
ATOM   4848  C  CA  . VAL B 1 111 ? 29.882  42.334  52.616  1.00 11.60 ? 111 VAL B CA  1 
ATOM   4849  C  C   . VAL B 1 111 ? 29.538  40.859  52.469  1.00 11.42 ? 111 VAL B C   1 
ATOM   4850  O  O   . VAL B 1 111 ? 30.419  40.003  52.436  1.00 11.12 ? 111 VAL B O   1 
ATOM   4851  C  CB  . VAL B 1 111 ? 30.147  42.906  51.199  1.00 11.74 ? 111 VAL B CB  1 
ATOM   4852  C  CG1 . VAL B 1 111 ? 28.936  42.687  50.314  1.00 11.85 ? 111 VAL B CG1 1 
ATOM   4853  C  CG2 . VAL B 1 111 ? 30.473  44.381  51.283  1.00 11.81 ? 111 VAL B CG2 1 
ATOM   4854  N  N   . ARG B 1 112 ? 28.243  40.571  52.380  1.00 11.56 ? 112 ARG B N   1 
ATOM   4855  C  CA  . ARG B 1 112 ? 27.787  39.201  52.207  1.00 11.87 ? 112 ARG B CA  1 
ATOM   4856  C  C   . ARG B 1 112 ? 26.633  39.130  51.221  1.00 11.98 ? 112 ARG B C   1 
ATOM   4857  O  O   . ARG B 1 112 ? 25.559  39.683  51.457  1.00 12.11 ? 112 ARG B O   1 
ATOM   4858  C  CB  . ARG B 1 112 ? 27.365  38.582  53.545  1.00 11.60 ? 112 ARG B CB  1 
ATOM   4859  C  CG  . ARG B 1 112 ? 27.427  37.054  53.543  1.00 11.42 ? 112 ARG B CG  1 
ATOM   4860  C  CD  . ARG B 1 112 ? 26.625  36.442  54.680  1.00 11.38 ? 112 ARG B CD  1 
ATOM   4861  N  NE  . ARG B 1 112 ? 25.279  36.048  54.263  1.00 10.79 ? 112 ARG B NE  1 
ATOM   4862  C  CZ  . ARG B 1 112 ? 24.859  34.790  54.162  1.00 10.34 ? 112 ARG B CZ  1 
ATOM   4863  N  NH1 . ARG B 1 112 ? 25.674  33.781  54.444  1.00 9.83  ? 112 ARG B NH1 1 
ATOM   4864  N  NH2 . ARG B 1 112 ? 23.617  34.542  53.784  1.00 9.69  ? 112 ARG B NH2 1 
ATOM   4865  N  N   . PHE B 1 113 ? 26.875  38.449  50.107  1.00 12.43 ? 113 PHE B N   1 
ATOM   4866  C  CA  . PHE B 1 113 ? 25.868  38.273  49.068  1.00 12.86 ? 113 PHE B CA  1 
ATOM   4867  C  C   . PHE B 1 113 ? 25.134  36.971  49.354  1.00 12.93 ? 113 PHE B C   1 
ATOM   4868  O  O   . PHE B 1 113 ? 25.606  36.156  50.147  1.00 13.37 ? 113 PHE B O   1 
ATOM   4869  C  CB  . PHE B 1 113 ? 26.534  38.213  47.691  1.00 12.98 ? 113 PHE B CB  1 
ATOM   4870  C  CG  . PHE B 1 113 ? 27.458  39.365  47.421  1.00 12.90 ? 113 PHE B CG  1 
ATOM   4871  C  CD1 . PHE B 1 113 ? 26.949  40.624  47.125  1.00 12.98 ? 113 PHE B CD1 1 
ATOM   4872  C  CD2 . PHE B 1 113 ? 28.835  39.200  47.490  1.00 12.85 ? 113 PHE B CD2 1 
ATOM   4873  C  CE1 . PHE B 1 113 ? 27.799  41.706  46.904  1.00 12.97 ? 113 PHE B CE1 1 
ATOM   4874  C  CE2 . PHE B 1 113 ? 29.697  40.273  47.270  1.00 12.81 ? 113 PHE B CE2 1 
ATOM   4875  C  CZ  . PHE B 1 113 ? 29.178  41.530  46.977  1.00 12.92 ? 113 PHE B CZ  1 
ATOM   4876  N  N   . SER B 1 114 ? 23.988  36.767  48.716  1.00 12.70 ? 114 SER B N   1 
ATOM   4877  C  CA  . SER B 1 114 ? 23.229  35.552  48.959  1.00 12.27 ? 114 SER B CA  1 
ATOM   4878  C  C   . SER B 1 114 ? 21.956  35.466  48.134  1.00 12.09 ? 114 SER B C   1 
ATOM   4879  O  O   . SER B 1 114 ? 21.632  36.366  47.358  1.00 11.69 ? 114 SER B O   1 
ATOM   4880  C  CB  . SER B 1 114 ? 22.861  35.465  50.444  1.00 12.27 ? 114 SER B CB  1 
ATOM   4881  O  OG  . SER B 1 114 ? 22.282  36.682  50.893  1.00 12.44 ? 114 SER B OG  1 
ATOM   4882  N  N   . THR B 1 115 ? 21.247  34.358  48.319  1.00 12.11 ? 115 THR B N   1 
ATOM   4883  C  CA  . THR B 1 115 ? 19.982  34.106  47.651  1.00 12.23 ? 115 THR B CA  1 
ATOM   4884  C  C   . THR B 1 115 ? 18.924  34.352  48.724  1.00 12.13 ? 115 THR B C   1 
ATOM   4885  O  O   . THR B 1 115 ? 19.186  35.062  49.696  1.00 12.11 ? 115 THR B O   1 
ATOM   4886  C  CB  . THR B 1 115 ? 19.895  32.651  47.156  1.00 12.53 ? 115 THR B CB  1 
ATOM   4887  O  OG1 . THR B 1 115 ? 20.565  31.790  48.087  1.00 13.01 ? 115 THR B OG1 1 
ATOM   4888  C  CG2 . THR B 1 115 ? 20.545  32.515  45.781  1.00 12.56 ? 115 THR B CG2 1 
ATOM   4889  N  N   . VAL B 1 116 ? 17.738  33.772  48.575  1.00 12.15 ? 116 VAL B N   1 
ATOM   4890  C  CA  . VAL B 1 116 ? 16.701  33.997  49.574  1.00 12.16 ? 116 VAL B CA  1 
ATOM   4891  C  C   . VAL B 1 116 ? 16.094  32.733  50.170  1.00 12.25 ? 116 VAL B C   1 
ATOM   4892  O  O   . VAL B 1 116 ? 16.349  32.413  51.334  1.00 12.51 ? 116 VAL B O   1 
ATOM   4893  C  CB  . VAL B 1 116 ? 15.562  34.868  49.005  1.00 11.93 ? 116 VAL B CB  1 
ATOM   4894  C  CG1 . VAL B 1 116 ? 14.547  35.163  50.093  1.00 11.68 ? 116 VAL B CG1 1 
ATOM   4895  C  CG2 . VAL B 1 116 ? 16.128  36.158  48.446  1.00 11.65 ? 116 VAL B CG2 1 
ATOM   4896  N  N   . ALA B 1 117 ? 15.293  32.023  49.377  1.00 12.14 ? 117 ALA B N   1 
ATOM   4897  C  CA  . ALA B 1 117 ? 14.628  30.806  49.835  1.00 11.86 ? 117 ALA B CA  1 
ATOM   4898  C  C   . ALA B 1 117 ? 15.551  29.601  49.939  1.00 12.10 ? 117 ALA B C   1 
ATOM   4899  O  O   . ALA B 1 117 ? 15.334  28.723  50.769  1.00 11.84 ? 117 ALA B O   1 
ATOM   4900  C  CB  . ALA B 1 117 ? 13.458  30.481  48.918  1.00 11.52 ? 117 ALA B CB  1 
ATOM   4901  N  N   . GLY B 1 118 ? 16.582  29.567  49.101  1.00 12.72 ? 118 GLY B N   1 
ATOM   4902  C  CA  . GLY B 1 118 ? 17.511  28.449  49.108  1.00 13.48 ? 118 GLY B CA  1 
ATOM   4903  C  C   . GLY B 1 118 ? 18.105  28.113  50.465  1.00 13.95 ? 118 GLY B C   1 
ATOM   4904  O  O   . GLY B 1 118 ? 18.511  29.006  51.215  1.00 14.42 ? 118 GLY B O   1 
ATOM   4905  N  N   . GLU B 1 119 ? 18.154  26.824  50.790  1.00 13.87 ? 119 GLU B N   1 
ATOM   4906  C  CA  . GLU B 1 119 ? 18.718  26.389  52.063  1.00 13.89 ? 119 GLU B CA  1 
ATOM   4907  C  C   . GLU B 1 119 ? 20.244  26.350  51.956  1.00 13.92 ? 119 GLU B C   1 
ATOM   4908  O  O   . GLU B 1 119 ? 20.809  26.634  50.897  1.00 13.79 ? 119 GLU B O   1 
ATOM   4909  C  CB  . GLU B 1 119 ? 18.180  25.004  52.454  1.00 13.69 ? 119 GLU B CB  1 
ATOM   4910  C  CG  . GLU B 1 119 ? 17.167  24.415  51.484  1.00 13.55 ? 119 GLU B CG  1 
ATOM   4911  C  CD  . GLU B 1 119 ? 15.734  24.751  51.849  1.00 13.57 ? 119 GLU B CD  1 
ATOM   4912  O  OE1 . GLU B 1 119 ? 15.520  25.455  52.858  1.00 13.62 ? 119 GLU B OE1 1 
ATOM   4913  O  OE2 . GLU B 1 119 ? 14.817  24.311  51.122  1.00 13.74 ? 119 GLU B OE2 1 
ATOM   4914  N  N   . SER B 1 120 ? 20.902  25.988  53.054  1.00 13.63 ? 120 SER B N   1 
ATOM   4915  C  CA  . SER B 1 120 ? 22.359  25.933  53.109  1.00 13.52 ? 120 SER B CA  1 
ATOM   4916  C  C   . SER B 1 120 ? 23.047  25.132  51.998  1.00 13.47 ? 120 SER B C   1 
ATOM   4917  O  O   . SER B 1 120 ? 24.171  25.445  51.602  1.00 13.96 ? 120 SER B O   1 
ATOM   4918  C  CB  . SER B 1 120 ? 22.805  25.392  54.473  1.00 13.32 ? 120 SER B CB  1 
ATOM   4919  O  OG  . SER B 1 120 ? 22.888  26.436  55.430  1.00 12.77 ? 120 SER B OG  1 
ATOM   4920  N  N   . GLY B 1 121 ? 22.392  24.098  51.494  1.00 13.20 ? 121 GLY B N   1 
ATOM   4921  C  CA  . GLY B 1 121 ? 23.025  23.309  50.452  1.00 12.66 ? 121 GLY B CA  1 
ATOM   4922  C  C   . GLY B 1 121 ? 22.559  23.633  49.047  1.00 12.35 ? 121 GLY B C   1 
ATOM   4923  O  O   . GLY B 1 121 ? 23.017  23.010  48.090  1.00 11.85 ? 121 GLY B O   1 
ATOM   4924  N  N   . SER B 1 122 ? 21.655  24.606  48.930  1.00 12.41 ? 122 SER B N   1 
ATOM   4925  C  CA  . SER B 1 122 ? 21.098  25.019  47.642  1.00 12.60 ? 122 SER B CA  1 
ATOM   4926  C  C   . SER B 1 122 ? 22.133  25.569  46.660  1.00 12.69 ? 122 SER B C   1 
ATOM   4927  O  O   . SER B 1 122 ? 23.287  25.816  47.024  1.00 13.08 ? 122 SER B O   1 
ATOM   4928  C  CB  . SER B 1 122 ? 19.998  26.063  47.861  1.00 12.74 ? 122 SER B CB  1 
ATOM   4929  O  OG  . SER B 1 122 ? 20.516  27.264  48.410  1.00 12.74 ? 122 SER B OG  1 
ATOM   4930  N  N   . ALA B 1 123 ? 21.705  25.760  45.412  1.00 12.66 ? 123 ALA B N   1 
ATOM   4931  C  CA  . ALA B 1 123 ? 22.573  26.271  44.353  1.00 12.32 ? 123 ALA B CA  1 
ATOM   4932  C  C   . ALA B 1 123 ? 22.517  27.792  44.230  1.00 11.91 ? 123 ALA B C   1 
ATOM   4933  O  O   . ALA B 1 123 ? 21.498  28.410  44.507  1.00 11.71 ? 123 ALA B O   1 
ATOM   4934  C  CB  . ALA B 1 123 ? 22.202  25.623  43.025  1.00 12.35 ? 123 ALA B CB  1 
ATOM   4935  N  N   . ASP B 1 124 ? 23.625  28.381  43.798  1.00 11.99 ? 124 ASP B N   1 
ATOM   4936  C  CA  . ASP B 1 124 ? 23.745  29.830  43.646  1.00 12.17 ? 124 ASP B CA  1 
ATOM   4937  C  C   . ASP B 1 124 ? 23.010  30.400  42.433  1.00 12.22 ? 124 ASP B C   1 
ATOM   4938  O  O   . ASP B 1 124 ? 22.224  31.341  42.556  1.00 12.07 ? 124 ASP B O   1 
ATOM   4939  C  CB  . ASP B 1 124 ? 25.228  30.217  43.553  1.00 12.17 ? 124 ASP B CB  1 
ATOM   4940  C  CG  . ASP B 1 124 ? 25.916  30.242  44.908  1.00 12.33 ? 124 ASP B CG  1 
ATOM   4941  O  OD1 . ASP B 1 124 ? 25.217  30.196  45.945  1.00 12.31 ? 124 ASP B OD1 1 
ATOM   4942  O  OD2 . ASP B 1 124 ? 27.162  30.309  44.934  1.00 12.46 ? 124 ASP B OD2 1 
ATOM   4943  N  N   . THR B 1 125 ? 23.277  29.826  41.262  1.00 12.52 ? 125 THR B N   1 
ATOM   4944  C  CA  . THR B 1 125 ? 22.669  30.281  40.017  1.00 12.65 ? 125 THR B CA  1 
ATOM   4945  C  C   . THR B 1 125 ? 21.215  29.850  39.845  1.00 12.54 ? 125 THR B C   1 
ATOM   4946  O  O   . THR B 1 125 ? 20.918  28.912  39.105  1.00 12.87 ? 125 THR B O   1 
ATOM   4947  C  CB  . THR B 1 125 ? 23.475  29.780  38.798  1.00 12.77 ? 125 THR B CB  1 
ATOM   4948  O  OG1 . THR B 1 125 ? 23.250  28.378  38.620  1.00 13.12 ? 125 THR B OG1 1 
ATOM   4949  C  CG2 . THR B 1 125 ? 24.965  30.017  39.007  1.00 12.57 ? 125 THR B CG2 1 
ATOM   4950  N  N   . VAL B 1 126 ? 20.311  30.545  40.530  1.00 12.65 ? 126 VAL B N   1 
ATOM   4951  C  CA  . VAL B 1 126 ? 18.882  30.258  40.450  1.00 12.36 ? 126 VAL B CA  1 
ATOM   4952  C  C   . VAL B 1 126 ? 18.120  31.581  40.495  1.00 12.47 ? 126 VAL B C   1 
ATOM   4953  O  O   . VAL B 1 126 ? 18.599  32.555  41.081  1.00 12.63 ? 126 VAL B O   1 
ATOM   4954  C  CB  . VAL B 1 126 ? 18.401  29.375  41.631  1.00 11.99 ? 126 VAL B CB  1 
ATOM   4955  C  CG1 . VAL B 1 126 ? 17.248  28.506  41.181  1.00 12.00 ? 126 VAL B CG1 1 
ATOM   4956  C  CG2 . VAL B 1 126 ? 19.525  28.513  42.142  1.00 11.30 ? 126 VAL B CG2 1 
ATOM   4957  N  N   . ARG B 1 127 ? 16.945  31.623  39.867  1.00 12.49 ? 127 ARG B N   1 
ATOM   4958  C  CA  . ARG B 1 127 ? 16.137  32.841  39.870  1.00 12.41 ? 127 ARG B CA  1 
ATOM   4959  C  C   . ARG B 1 127 ? 15.704  33.091  41.303  1.00 12.67 ? 127 ARG B C   1 
ATOM   4960  O  O   . ARG B 1 127 ? 15.046  32.252  41.920  1.00 12.88 ? 127 ARG B O   1 
ATOM   4961  C  CB  . ARG B 1 127 ? 14.902  32.690  38.980  1.00 12.02 ? 127 ARG B CB  1 
ATOM   4962  C  CG  . ARG B 1 127 ? 13.725  33.556  39.414  1.00 11.46 ? 127 ARG B CG  1 
ATOM   4963  C  CD  . ARG B 1 127 ? 12.913  34.063  38.230  1.00 11.57 ? 127 ARG B CD  1 
ATOM   4964  N  NE  . ARG B 1 127 ? 13.751  34.392  37.081  1.00 11.78 ? 127 ARG B NE  1 
ATOM   4965  C  CZ  . ARG B 1 127 ? 13.789  33.676  35.962  1.00 12.03 ? 127 ARG B CZ  1 
ATOM   4966  N  NH1 . ARG B 1 127 ? 13.032  32.592  35.842  1.00 11.99 ? 127 ARG B NH1 1 
ATOM   4967  N  NH2 . ARG B 1 127 ? 14.592  34.035  34.970  1.00 12.31 ? 127 ARG B NH2 1 
ATOM   4968  N  N   . ASP B 1 128 ? 16.074  34.251  41.825  1.00 12.76 ? 128 ASP B N   1 
ATOM   4969  C  CA  . ASP B 1 128 ? 15.748  34.611  43.197  1.00 12.98 ? 128 ASP B CA  1 
ATOM   4970  C  C   . ASP B 1 128 ? 16.426  35.944  43.449  1.00 12.97 ? 128 ASP B C   1 
ATOM   4971  O  O   . ASP B 1 128 ? 17.504  36.199  42.916  1.00 13.40 ? 128 ASP B O   1 
ATOM   4972  C  CB  . ASP B 1 128 ? 16.323  33.564  44.157  1.00 12.49 ? 128 ASP B CB  1 
ATOM   4973  C  CG  . ASP B 1 128 ? 15.439  33.311  45.354  1.00 12.03 ? 128 ASP B CG  1 
ATOM   4974  O  OD1 . ASP B 1 128 ? 14.209  33.467  45.230  1.00 11.70 ? 128 ASP B OD1 1 
ATOM   4975  O  OD2 . ASP B 1 128 ? 15.981  32.943  46.419  1.00 11.73 ? 128 ASP B OD2 1 
ATOM   4976  N  N   . PRO B 1 129 ? 15.807  36.818  44.257  1.00 12.74 ? 129 PRO B N   1 
ATOM   4977  C  CA  . PRO B 1 129 ? 16.456  38.107  44.511  1.00 12.50 ? 129 PRO B CA  1 
ATOM   4978  C  C   . PRO B 1 129 ? 17.819  37.843  45.144  1.00 12.44 ? 129 PRO B C   1 
ATOM   4979  O  O   . PRO B 1 129 ? 18.089  36.723  45.599  1.00 12.25 ? 129 PRO B O   1 
ATOM   4980  C  CB  . PRO B 1 129 ? 15.499  38.816  45.465  1.00 12.37 ? 129 PRO B CB  1 
ATOM   4981  C  CG  . PRO B 1 129 ? 14.181  38.120  45.280  1.00 12.39 ? 129 PRO B CG  1 
ATOM   4982  C  CD  . PRO B 1 129 ? 14.519  36.693  44.958  1.00 12.60 ? 129 PRO B CD  1 
ATOM   4983  N  N   . ARG B 1 130 ? 18.680  38.857  45.165  1.00 12.38 ? 130 ARG B N   1 
ATOM   4984  C  CA  . ARG B 1 130 ? 20.007  38.697  45.742  1.00 12.47 ? 130 ARG B CA  1 
ATOM   4985  C  C   . ARG B 1 130 ? 20.222  39.562  46.976  1.00 12.49 ? 130 ARG B C   1 
ATOM   4986  O  O   . ARG B 1 130 ? 19.698  40.675  47.068  1.00 12.54 ? 130 ARG B O   1 
ATOM   4987  C  CB  . ARG B 1 130 ? 21.074  39.011  44.697  1.00 12.47 ? 130 ARG B CB  1 
ATOM   4988  C  CG  . ARG B 1 130 ? 21.913  37.805  44.295  1.00 12.71 ? 130 ARG B CG  1 
ATOM   4989  C  CD  . ARG B 1 130 ? 21.046  36.637  43.843  1.00 13.08 ? 130 ARG B CD  1 
ATOM   4990  N  NE  . ARG B 1 130 ? 21.657  35.910  42.735  1.00 13.57 ? 130 ARG B NE  1 
ATOM   4991  C  CZ  . ARG B 1 130 ? 21.037  34.985  42.011  1.00 13.88 ? 130 ARG B CZ  1 
ATOM   4992  N  NH1 . ARG B 1 130 ? 19.777  34.662  42.269  1.00 14.03 ? 130 ARG B NH1 1 
ATOM   4993  N  NH2 . ARG B 1 130 ? 21.682  34.383  41.021  1.00 14.19 ? 130 ARG B NH2 1 
ATOM   4994  N  N   . GLY B 1 131 ? 20.992  39.035  47.924  1.00 12.69 ? 131 GLY B N   1 
ATOM   4995  C  CA  . GLY B 1 131 ? 21.277  39.758  49.153  1.00 12.71 ? 131 GLY B CA  1 
ATOM   4996  C  C   . GLY B 1 131 ? 22.593  40.509  49.071  1.00 12.84 ? 131 GLY B C   1 
ATOM   4997  O  O   . GLY B 1 131 ? 23.615  39.954  48.651  1.00 12.85 ? 131 GLY B O   1 
ATOM   4998  N  N   . PHE B 1 132 ? 22.576  41.772  49.483  1.00 12.76 ? 132 PHE B N   1 
ATOM   4999  C  CA  . PHE B 1 132 ? 23.769  42.609  49.436  1.00 12.54 ? 132 PHE B CA  1 
ATOM   5000  C  C   . PHE B 1 132 ? 23.866  43.446  50.703  1.00 12.69 ? 132 PHE B C   1 
ATOM   5001  O  O   . PHE B 1 132 ? 23.449  44.604  50.724  1.00 12.85 ? 132 PHE B O   1 
ATOM   5002  C  CB  . PHE B 1 132 ? 23.695  43.524  48.213  1.00 12.40 ? 132 PHE B CB  1 
ATOM   5003  C  CG  . PHE B 1 132 ? 25.024  44.046  47.753  1.00 12.20 ? 132 PHE B CG  1 
ATOM   5004  C  CD1 . PHE B 1 132 ? 26.041  44.319  48.665  1.00 12.14 ? 132 PHE B CD1 1 
ATOM   5005  C  CD2 . PHE B 1 132 ? 25.252  44.291  46.403  1.00 11.97 ? 132 PHE B CD2 1 
ATOM   5006  C  CE1 . PHE B 1 132 ? 27.267  44.830  48.236  1.00 12.08 ? 132 PHE B CE1 1 
ATOM   5007  C  CE2 . PHE B 1 132 ? 26.471  44.801  45.963  1.00 11.90 ? 132 PHE B CE2 1 
ATOM   5008  C  CZ  . PHE B 1 132 ? 27.481  45.073  46.881  1.00 11.91 ? 132 PHE B CZ  1 
ATOM   5009  N  N   . ALA B 1 133 ? 24.411  42.858  51.763  1.00 12.37 ? 133 ALA B N   1 
ATOM   5010  C  CA  . ALA B 1 133 ? 24.556  43.568  53.027  1.00 12.18 ? 133 ALA B CA  1 
ATOM   5011  C  C   . ALA B 1 133 ? 25.961  44.142  53.174  1.00 12.13 ? 133 ALA B C   1 
ATOM   5012  O  O   . ALA B 1 133 ? 26.948  43.513  52.783  1.00 11.94 ? 133 ALA B O   1 
ATOM   5013  C  CB  . ALA B 1 133 ? 24.252  42.633  54.182  1.00 12.13 ? 133 ALA B CB  1 
ATOM   5014  N  N   . VAL B 1 134 ? 26.045  45.340  53.741  1.00 11.95 ? 134 VAL B N   1 
ATOM   5015  C  CA  . VAL B 1 134 ? 27.327  46.008  53.946  1.00 11.98 ? 134 VAL B CA  1 
ATOM   5016  C  C   . VAL B 1 134 ? 27.451  46.489  55.387  1.00 11.97 ? 134 VAL B C   1 
ATOM   5017  O  O   . VAL B 1 134 ? 26.566  47.172  55.893  1.00 11.85 ? 134 VAL B O   1 
ATOM   5018  C  CB  . VAL B 1 134 ? 27.477  47.243  53.022  1.00 12.01 ? 134 VAL B CB  1 
ATOM   5019  C  CG1 . VAL B 1 134 ? 28.940  47.639  52.909  1.00 12.24 ? 134 VAL B CG1 1 
ATOM   5020  C  CG2 . VAL B 1 134 ? 26.901  46.948  51.650  1.00 11.89 ? 134 VAL B CG2 1 
ATOM   5021  N  N   . LYS B 1 135 ? 28.541  46.129  56.051  1.00 12.21 ? 135 LYS B N   1 
ATOM   5022  C  CA  . LYS B 1 135 ? 28.755  46.567  57.424  1.00 12.55 ? 135 LYS B CA  1 
ATOM   5023  C  C   . LYS B 1 135 ? 29.882  47.596  57.478  1.00 12.68 ? 135 LYS B C   1 
ATOM   5024  O  O   . LYS B 1 135 ? 31.014  47.310  57.093  1.00 13.05 ? 135 LYS B O   1 
ATOM   5025  C  CB  . LYS B 1 135 ? 29.111  45.385  58.326  1.00 12.38 ? 135 LYS B CB  1 
ATOM   5026  C  CG  . LYS B 1 135 ? 29.314  45.781  59.788  1.00 12.17 ? 135 LYS B CG  1 
ATOM   5027  C  CD  . LYS B 1 135 ? 29.795  44.610  60.626  1.00 12.11 ? 135 LYS B CD  1 
ATOM   5028  C  CE  . LYS B 1 135 ? 28.689  43.583  60.851  1.00 11.82 ? 135 LYS B CE  1 
ATOM   5029  N  NZ  . LYS B 1 135 ? 27.428  44.224  61.305  1.00 11.79 ? 135 LYS B NZ  1 
ATOM   5030  N  N   . PHE B 1 136 ? 29.572  48.797  57.949  1.00 12.39 ? 136 PHE B N   1 
ATOM   5031  C  CA  . PHE B 1 136 ? 30.577  49.845  58.049  1.00 12.24 ? 136 PHE B CA  1 
ATOM   5032  C  C   . PHE B 1 136 ? 31.071  49.966  59.486  1.00 12.10 ? 136 PHE B C   1 
ATOM   5033  O  O   . PHE B 1 136 ? 30.281  50.197  60.407  1.00 11.78 ? 136 PHE B O   1 
ATOM   5034  C  CB  . PHE B 1 136 ? 29.996  51.192  57.603  1.00 12.55 ? 136 PHE B CB  1 
ATOM   5035  C  CG  . PHE B 1 136 ? 29.582  51.233  56.155  1.00 12.80 ? 136 PHE B CG  1 
ATOM   5036  C  CD1 . PHE B 1 136 ? 28.412  50.603  55.732  1.00 13.03 ? 136 PHE B CD1 1 
ATOM   5037  C  CD2 . PHE B 1 136 ? 30.361  51.903  55.213  1.00 12.79 ? 136 PHE B CD2 1 
ATOM   5038  C  CE1 . PHE B 1 136 ? 28.021  50.637  54.392  1.00 13.17 ? 136 PHE B CE1 1 
ATOM   5039  C  CE2 . PHE B 1 136 ? 29.983  51.946  53.871  1.00 12.87 ? 136 PHE B CE2 1 
ATOM   5040  C  CZ  . PHE B 1 136 ? 28.808  51.310  53.458  1.00 13.06 ? 136 PHE B CZ  1 
ATOM   5041  N  N   . TYR B 1 137 ? 32.375  49.799  59.679  1.00 11.57 ? 137 TYR B N   1 
ATOM   5042  C  CA  . TYR B 1 137 ? 32.958  49.919  61.008  1.00 11.23 ? 137 TYR B CA  1 
ATOM   5043  C  C   . TYR B 1 137 ? 33.367  51.372  61.237  1.00 11.29 ? 137 TYR B C   1 
ATOM   5044  O  O   . TYR B 1 137 ? 34.549  51.712  61.188  1.00 11.01 ? 137 TYR B O   1 
ATOM   5045  C  CB  . TYR B 1 137 ? 34.186  49.026  61.133  1.00 11.34 ? 137 TYR B CB  1 
ATOM   5046  C  CG  . TYR B 1 137 ? 33.944  47.562  60.848  1.00 11.41 ? 137 TYR B CG  1 
ATOM   5047  C  CD1 . TYR B 1 137 ? 34.066  47.053  59.557  1.00 11.40 ? 137 TYR B CD1 1 
ATOM   5048  C  CD2 . TYR B 1 137 ? 33.660  46.674  61.881  1.00 11.50 ? 137 TYR B CD2 1 
ATOM   5049  C  CE1 . TYR B 1 137 ? 33.921  45.695  59.305  1.00 11.63 ? 137 TYR B CE1 1 
ATOM   5050  C  CE2 . TYR B 1 137 ? 33.513  45.313  61.639  1.00 11.72 ? 137 TYR B CE2 1 
ATOM   5051  C  CZ  . TYR B 1 137 ? 33.648  44.830  60.352  1.00 11.78 ? 137 TYR B CZ  1 
ATOM   5052  O  OH  . TYR B 1 137 ? 33.544  43.477  60.121  1.00 12.16 ? 137 TYR B OH  1 
ATOM   5053  N  N   . THR B 1 138 ? 32.385  52.231  61.486  1.00 11.61 ? 138 THR B N   1 
ATOM   5054  C  CA  . THR B 1 138 ? 32.661  53.647  61.704  1.00 12.02 ? 138 THR B CA  1 
ATOM   5055  C  C   . THR B 1 138 ? 32.994  53.979  63.154  1.00 12.11 ? 138 THR B C   1 
ATOM   5056  O  O   . THR B 1 138 ? 32.798  53.165  64.057  1.00 12.32 ? 138 THR B O   1 
ATOM   5057  C  CB  . THR B 1 138 ? 31.474  54.521  61.278  1.00 11.83 ? 138 THR B CB  1 
ATOM   5058  O  OG1 . THR B 1 138 ? 30.574  54.666  62.382  1.00 11.74 ? 138 THR B OG1 1 
ATOM   5059  C  CG2 . THR B 1 138 ? 30.746  53.892  60.098  1.00 11.96 ? 138 THR B CG2 1 
ATOM   5060  N  N   . GLU B 1 139 ? 33.496  55.191  63.359  1.00 12.15 ? 139 GLU B N   1 
ATOM   5061  C  CA  . GLU B 1 139 ? 33.869  55.667  64.680  1.00 12.19 ? 139 GLU B CA  1 
ATOM   5062  C  C   . GLU B 1 139 ? 32.647  55.744  65.591  1.00 12.32 ? 139 GLU B C   1 
ATOM   5063  O  O   . GLU B 1 139 ? 32.706  55.354  66.758  1.00 12.28 ? 139 GLU B O   1 
ATOM   5064  C  CB  . GLU B 1 139 ? 34.530  57.044  64.563  1.00 12.33 ? 139 GLU B CB  1 
ATOM   5065  C  CG  . GLU B 1 139 ? 35.855  57.038  63.793  1.00 12.29 ? 139 GLU B CG  1 
ATOM   5066  C  CD  . GLU B 1 139 ? 35.696  57.359  62.305  1.00 12.30 ? 139 GLU B CD  1 
ATOM   5067  O  OE1 . GLU B 1 139 ? 34.945  56.647  61.601  1.00 12.05 ? 139 GLU B OE1 1 
ATOM   5068  O  OE2 . GLU B 1 139 ? 36.334  58.327  61.841  1.00 12.31 ? 139 GLU B OE2 1 
ATOM   5069  N  N   . ASP B 1 140 ? 31.536  56.238  65.055  1.00 12.31 ? 140 ASP B N   1 
ATOM   5070  C  CA  . ASP B 1 140 ? 30.309  56.354  65.833  1.00 12.21 ? 140 ASP B CA  1 
ATOM   5071  C  C   . ASP B 1 140 ? 29.510  55.057  65.828  1.00 12.29 ? 140 ASP B C   1 
ATOM   5072  O  O   . ASP B 1 140 ? 28.277  55.075  65.827  1.00 12.12 ? 140 ASP B O   1 
ATOM   5073  C  CB  . ASP B 1 140 ? 29.446  57.492  65.296  1.00 12.27 ? 140 ASP B CB  1 
ATOM   5074  C  CG  . ASP B 1 140 ? 29.898  58.841  65.799  1.00 12.45 ? 140 ASP B CG  1 
ATOM   5075  O  OD1 . ASP B 1 140 ? 31.054  58.933  66.258  1.00 12.55 ? 140 ASP B OD1 1 
ATOM   5076  O  OD2 . ASP B 1 140 ? 29.107  59.808  65.738  1.00 12.70 ? 140 ASP B OD2 1 
ATOM   5077  N  N   . GLY B 1 141 ? 30.216  53.930  65.832  1.00 12.26 ? 141 GLY B N   1 
ATOM   5078  C  CA  . GLY B 1 141 ? 29.539  52.650  65.843  1.00 12.49 ? 141 GLY B CA  1 
ATOM   5079  C  C   . GLY B 1 141 ? 29.426  52.027  64.469  1.00 12.64 ? 141 GLY B C   1 
ATOM   5080  O  O   . GLY B 1 141 ? 29.784  52.641  63.462  1.00 12.69 ? 141 GLY B O   1 
ATOM   5081  N  N   . ASN B 1 142 ? 28.924  50.798  64.429  1.00 12.46 ? 142 ASN B N   1 
ATOM   5082  C  CA  . ASN B 1 142 ? 28.769  50.076  63.176  1.00 12.19 ? 142 ASN B CA  1 
ATOM   5083  C  C   . ASN B 1 142 ? 27.504  50.502  62.446  1.00 12.02 ? 142 ASN B C   1 
ATOM   5084  O  O   . ASN B 1 142 ? 26.497  50.830  63.068  1.00 11.89 ? 142 ASN B O   1 
ATOM   5085  C  CB  . ASN B 1 142 ? 28.723  48.571  63.444  1.00 12.32 ? 142 ASN B CB  1 
ATOM   5086  C  CG  . ASN B 1 142 ? 30.099  47.972  63.636  1.00 12.39 ? 142 ASN B CG  1 
ATOM   5087  O  OD1 . ASN B 1 142 ? 31.076  48.685  63.873  1.00 12.03 ? 142 ASN B OD1 1 
ATOM   5088  N  ND2 . ASN B 1 142 ? 30.185  46.651  63.534  1.00 12.78 ? 142 ASN B ND2 1 
ATOM   5089  N  N   . TRP B 1 143 ? 27.570  50.503  61.120  1.00 11.97 ? 143 TRP B N   1 
ATOM   5090  C  CA  . TRP B 1 143 ? 26.428  50.877  60.296  1.00 11.91 ? 143 TRP B CA  1 
ATOM   5091  C  C   . TRP B 1 143 ? 26.148  49.778  59.291  1.00 11.71 ? 143 TRP B C   1 
ATOM   5092  O  O   . TRP B 1 143 ? 26.943  49.539  58.386  1.00 11.70 ? 143 TRP B O   1 
ATOM   5093  C  CB  . TRP B 1 143 ? 26.695  52.174  59.536  1.00 12.15 ? 143 TRP B CB  1 
ATOM   5094  C  CG  . TRP B 1 143 ? 25.588  52.518  58.577  1.00 12.43 ? 143 TRP B CG  1 
ATOM   5095  C  CD1 . TRP B 1 143 ? 24.255  52.256  58.735  1.00 12.48 ? 143 TRP B CD1 1 
ATOM   5096  C  CD2 . TRP B 1 143 ? 25.716  53.203  57.323  1.00 12.54 ? 143 TRP B CD2 1 
ATOM   5097  N  NE1 . TRP B 1 143 ? 23.546  52.737  57.660  1.00 12.50 ? 143 TRP B NE1 1 
ATOM   5098  C  CE2 . TRP B 1 143 ? 24.416  53.324  56.779  1.00 12.48 ? 143 TRP B CE2 1 
ATOM   5099  C  CE3 . TRP B 1 143 ? 26.800  53.729  56.607  1.00 12.62 ? 143 TRP B CE3 1 
ATOM   5100  C  CZ2 . TRP B 1 143 ? 24.173  53.949  55.552  1.00 12.40 ? 143 TRP B CZ2 1 
ATOM   5101  C  CZ3 . TRP B 1 143 ? 26.556  54.352  55.385  1.00 12.63 ? 143 TRP B CZ3 1 
ATOM   5102  C  CH2 . TRP B 1 143 ? 25.250  54.456  54.872  1.00 12.47 ? 143 TRP B CH2 1 
ATOM   5103  N  N   . ASP B 1 144 ? 25.006  49.123  59.445  1.00 11.46 ? 144 ASP B N   1 
ATOM   5104  C  CA  . ASP B 1 144 ? 24.634  48.041  58.556  1.00 11.22 ? 144 ASP B CA  1 
ATOM   5105  C  C   . ASP B 1 144 ? 23.624  48.478  57.512  1.00 11.07 ? 144 ASP B C   1 
ATOM   5106  O  O   . ASP B 1 144 ? 22.527  48.917  57.840  1.00 11.03 ? 144 ASP B O   1 
ATOM   5107  C  CB  . ASP B 1 144 ? 24.072  46.871  59.367  1.00 11.10 ? 144 ASP B CB  1 
ATOM   5108  C  CG  . ASP B 1 144 ? 25.076  46.318  60.360  1.00 11.07 ? 144 ASP B CG  1 
ATOM   5109  O  OD1 . ASP B 1 144 ? 24.668  45.553  61.254  1.00 11.23 ? 144 ASP B OD1 1 
ATOM   5110  O  OD2 . ASP B 1 144 ? 26.277  46.647  60.248  1.00 10.95 ? 144 ASP B OD2 1 
ATOM   5111  N  N   . LEU B 1 145 ? 24.012  48.363  56.248  1.00 11.27 ? 145 LEU B N   1 
ATOM   5112  C  CA  . LEU B 1 145 ? 23.141  48.709  55.137  1.00 11.41 ? 145 LEU B CA  1 
ATOM   5113  C  C   . LEU B 1 145 ? 22.769  47.402  54.452  1.00 11.51 ? 145 LEU B C   1 
ATOM   5114  O  O   . LEU B 1 145 ? 23.427  46.969  53.509  1.00 11.59 ? 145 LEU B O   1 
ATOM   5115  C  CB  . LEU B 1 145 ? 23.861  49.638  54.154  1.00 11.45 ? 145 LEU B CB  1 
ATOM   5116  C  CG  . LEU B 1 145 ? 23.067  50.177  52.957  1.00 11.45 ? 145 LEU B CG  1 
ATOM   5117  C  CD1 . LEU B 1 145 ? 21.707  50.695  53.406  1.00 11.30 ? 145 LEU B CD1 1 
ATOM   5118  C  CD2 . LEU B 1 145 ? 23.860  51.289  52.294  1.00 11.57 ? 145 LEU B CD2 1 
ATOM   5119  N  N   . VAL B 1 146 ? 21.720  46.768  54.959  1.00 12.02 ? 146 VAL B N   1 
ATOM   5120  C  CA  . VAL B 1 146 ? 21.227  45.502  54.429  1.00 12.27 ? 146 VAL B CA  1 
ATOM   5121  C  C   . VAL B 1 146 ? 20.353  45.756  53.210  1.00 12.53 ? 146 VAL B C   1 
ATOM   5122  O  O   . VAL B 1 146 ? 19.204  46.184  53.346  1.00 12.75 ? 146 VAL B O   1 
ATOM   5123  C  CB  . VAL B 1 146 ? 20.377  44.764  55.477  1.00 12.27 ? 146 VAL B CB  1 
ATOM   5124  C  CG1 . VAL B 1 146 ? 20.316  43.291  55.150  1.00 12.19 ? 146 VAL B CG1 1 
ATOM   5125  C  CG2 . VAL B 1 146 ? 20.949  44.993  56.867  1.00 12.30 ? 146 VAL B CG2 1 
ATOM   5126  N  N   . GLY B 1 147 ? 20.888  45.489  52.023  1.00 12.50 ? 147 GLY B N   1 
ATOM   5127  C  CA  . GLY B 1 147 ? 20.116  45.719  50.817  1.00 12.43 ? 147 GLY B CA  1 
ATOM   5128  C  C   . GLY B 1 147 ? 20.015  44.524  49.891  1.00 12.54 ? 147 GLY B C   1 
ATOM   5129  O  O   . GLY B 1 147 ? 20.703  43.515  50.073  1.00 12.33 ? 147 GLY B O   1 
ATOM   5130  N  N   . ASN B 1 148 ? 19.139  44.644  48.897  1.00 12.34 ? 148 ASN B N   1 
ATOM   5131  C  CA  . ASN B 1 148 ? 18.931  43.595  47.906  1.00 12.32 ? 148 ASN B CA  1 
ATOM   5132  C  C   . ASN B 1 148 ? 19.564  44.052  46.592  1.00 12.32 ? 148 ASN B C   1 
ATOM   5133  O  O   . ASN B 1 148 ? 20.298  45.045  46.553  1.00 12.22 ? 148 ASN B O   1 
ATOM   5134  C  CB  . ASN B 1 148 ? 17.432  43.359  47.685  1.00 12.55 ? 148 ASN B CB  1 
ATOM   5135  C  CG  . ASN B 1 148 ? 16.764  42.662  48.860  1.00 12.68 ? 148 ASN B CG  1 
ATOM   5136  O  OD1 . ASN B 1 148 ? 17.400  41.917  49.603  1.00 12.78 ? 148 ASN B OD1 1 
ATOM   5137  N  ND2 . ASN B 1 148 ? 15.468  42.905  49.028  1.00 12.68 ? 148 ASN B ND2 1 
ATOM   5138  N  N   . ASN B 1 149 ? 19.276  43.328  45.518  1.00 12.34 ? 149 ASN B N   1 
ATOM   5139  C  CA  . ASN B 1 149 ? 19.803  43.689  44.211  1.00 12.38 ? 149 ASN B CA  1 
ATOM   5140  C  C   . ASN B 1 149 ? 18.689  44.354  43.413  1.00 12.67 ? 149 ASN B C   1 
ATOM   5141  O  O   . ASN B 1 149 ? 18.877  44.735  42.257  1.00 12.76 ? 149 ASN B O   1 
ATOM   5142  C  CB  . ASN B 1 149 ? 20.329  42.451  43.475  1.00 12.12 ? 149 ASN B CB  1 
ATOM   5143  C  CG  . ASN B 1 149 ? 19.222  41.532  42.999  1.00 11.94 ? 149 ASN B CG  1 
ATOM   5144  O  OD1 . ASN B 1 149 ? 18.048  41.723  43.320  1.00 11.66 ? 149 ASN B OD1 1 
ATOM   5145  N  ND2 . ASN B 1 149 ? 19.595  40.525  42.228  1.00 12.24 ? 149 ASN B ND2 1 
ATOM   5146  N  N   . THR B 1 150 ? 17.526  44.482  44.048  1.00 12.78 ? 150 THR B N   1 
ATOM   5147  C  CA  . THR B 1 150 ? 16.364  45.114  43.431  1.00 13.01 ? 150 THR B CA  1 
ATOM   5148  C  C   . THR B 1 150 ? 15.912  46.280  44.320  1.00 12.97 ? 150 THR B C   1 
ATOM   5149  O  O   . THR B 1 150 ? 15.948  46.181  45.547  1.00 12.91 ? 150 THR B O   1 
ATOM   5150  C  CB  . THR B 1 150 ? 15.197  44.107  43.261  1.00 13.25 ? 150 THR B CB  1 
ATOM   5151  O  OG1 . THR B 1 150 ? 13.955  44.817  43.157  1.00 13.29 ? 150 THR B OG1 1 
ATOM   5152  C  CG2 . THR B 1 150 ? 15.137  43.156  44.448  1.00 13.64 ? 150 THR B CG2 1 
ATOM   5153  N  N   . PRO B 1 151 ? 15.486  47.400  43.707  1.00 12.86 ? 151 PRO B N   1 
ATOM   5154  C  CA  . PRO B 1 151 ? 15.032  48.595  44.430  1.00 12.59 ? 151 PRO B CA  1 
ATOM   5155  C  C   . PRO B 1 151 ? 13.631  48.530  45.019  1.00 12.49 ? 151 PRO B C   1 
ATOM   5156  O  O   . PRO B 1 151 ? 13.154  49.511  45.578  1.00 12.55 ? 151 PRO B O   1 
ATOM   5157  C  CB  . PRO B 1 151 ? 15.138  49.694  43.385  1.00 12.72 ? 151 PRO B CB  1 
ATOM   5158  C  CG  . PRO B 1 151 ? 14.832  48.989  42.115  1.00 12.75 ? 151 PRO B CG  1 
ATOM   5159  C  CD  . PRO B 1 151 ? 15.424  47.602  42.248  1.00 12.78 ? 151 PRO B CD  1 
ATOM   5160  N  N   . ILE B 1 152 ? 12.971  47.388  44.890  1.00 12.55 ? 152 ILE B N   1 
ATOM   5161  C  CA  . ILE B 1 152 ? 11.616  47.237  45.417  1.00 12.30 ? 152 ILE B CA  1 
ATOM   5162  C  C   . ILE B 1 152 ? 11.392  45.850  46.013  1.00 12.41 ? 152 ILE B C   1 
ATOM   5163  O  O   . ILE B 1 152 ? 12.324  45.052  46.117  1.00 12.53 ? 152 ILE B O   1 
ATOM   5164  C  CB  . ILE B 1 152 ? 10.567  47.474  44.317  1.00 12.08 ? 152 ILE B CB  1 
ATOM   5165  C  CG1 . ILE B 1 152 ? 11.132  47.056  42.956  1.00 11.96 ? 152 ILE B CG1 1 
ATOM   5166  C  CG2 . ILE B 1 152 ? 10.168  48.936  44.297  1.00 12.00 ? 152 ILE B CG2 1 
ATOM   5167  C  CD1 . ILE B 1 152 ? 10.250  46.099  42.186  1.00 11.84 ? 152 ILE B CD1 1 
ATOM   5168  N  N   . PHE B 1 153 ? 10.158  45.566  46.412  1.00 12.16 ? 153 PHE B N   1 
ATOM   5169  C  CA  . PHE B 1 153 ? 9.841   44.268  46.992  1.00 12.12 ? 153 PHE B CA  1 
ATOM   5170  C  C   . PHE B 1 153 ? 8.420   43.820  46.674  1.00 12.19 ? 153 PHE B C   1 
ATOM   5171  O  O   . PHE B 1 153 ? 7.607   44.585  46.152  1.00 12.16 ? 153 PHE B O   1 
ATOM   5172  C  CB  . PHE B 1 153 ? 10.045  44.303  48.506  1.00 12.08 ? 153 PHE B CB  1 
ATOM   5173  C  CG  . PHE B 1 153 ? 10.408  42.973  49.098  1.00 11.95 ? 153 PHE B CG  1 
ATOM   5174  C  CD1 . PHE B 1 153 ? 11.642  42.391  48.830  1.00 11.81 ? 153 PHE B CD1 1 
ATOM   5175  C  CD2 . PHE B 1 153 ? 9.510   42.292  49.918  1.00 11.91 ? 153 PHE B CD2 1 
ATOM   5176  C  CE1 . PHE B 1 153 ? 11.979  41.148  49.368  1.00 11.79 ? 153 PHE B CE1 1 
ATOM   5177  C  CE2 . PHE B 1 153 ? 9.839   41.045  50.460  1.00 11.93 ? 153 PHE B CE2 1 
ATOM   5178  C  CZ  . PHE B 1 153 ? 11.075  40.475  50.183  1.00 11.77 ? 153 PHE B CZ  1 
ATOM   5179  N  N   . PHE B 1 154 ? 8.131   42.567  46.998  1.00 12.16 ? 154 PHE B N   1 
ATOM   5180  C  CA  . PHE B 1 154 ? 6.820   41.987  46.747  1.00 12.23 ? 154 PHE B CA  1 
ATOM   5181  C  C   . PHE B 1 154 ? 5.707   42.613  47.586  1.00 12.34 ? 154 PHE B C   1 
ATOM   5182  O  O   . PHE B 1 154 ? 4.686   43.035  47.050  1.00 12.58 ? 154 PHE B O   1 
ATOM   5183  C  CB  . PHE B 1 154 ? 6.870   40.478  47.000  1.00 11.71 ? 154 PHE B CB  1 
ATOM   5184  C  CG  . PHE B 1 154 ? 7.987   39.784  46.278  1.00 11.45 ? 154 PHE B CG  1 
ATOM   5185  C  CD1 . PHE B 1 154 ? 7.756   39.144  45.070  1.00 11.27 ? 154 PHE B CD1 1 
ATOM   5186  C  CD2 . PHE B 1 154 ? 9.273   39.774  46.804  1.00 11.53 ? 154 PHE B CD2 1 
ATOM   5187  C  CE1 . PHE B 1 154 ? 8.788   38.504  44.396  1.00 11.33 ? 154 PHE B CE1 1 
ATOM   5188  C  CE2 . PHE B 1 154 ? 10.317  39.135  46.137  1.00 11.63 ? 154 PHE B CE2 1 
ATOM   5189  C  CZ  . PHE B 1 154 ? 10.072  38.499  44.931  1.00 11.51 ? 154 PHE B CZ  1 
ATOM   5190  N  N   . ILE B 1 155 ? 5.902   42.671  48.898  1.00 12.24 ? 155 ILE B N   1 
ATOM   5191  C  CA  . ILE B 1 155 ? 4.893   43.233  49.785  1.00 12.23 ? 155 ILE B CA  1 
ATOM   5192  C  C   . ILE B 1 155 ? 5.369   44.535  50.412  1.00 12.18 ? 155 ILE B C   1 
ATOM   5193  O  O   . ILE B 1 155 ? 6.555   44.850  50.373  1.00 12.05 ? 155 ILE B O   1 
ATOM   5194  C  CB  . ILE B 1 155 ? 4.533   42.241  50.920  1.00 12.50 ? 155 ILE B CB  1 
ATOM   5195  C  CG1 . ILE B 1 155 ? 5.698   41.285  51.178  1.00 12.37 ? 155 ILE B CG1 1 
ATOM   5196  C  CG2 . ILE B 1 155 ? 3.307   41.437  50.545  1.00 12.68 ? 155 ILE B CG2 1 
ATOM   5197  C  CD1 . ILE B 1 155 ? 5.851   40.910  52.635  1.00 12.35 ? 155 ILE B CD1 1 
ATOM   5198  N  N   . ARG B 1 156 ? 4.438   45.291  50.986  1.00 12.26 ? 156 ARG B N   1 
ATOM   5199  C  CA  . ARG B 1 156 ? 4.778   46.560  51.625  1.00 12.56 ? 156 ARG B CA  1 
ATOM   5200  C  C   . ARG B 1 156 ? 4.365   46.600  53.100  1.00 12.78 ? 156 ARG B C   1 
ATOM   5201  O  O   . ARG B 1 156 ? 4.282   47.676  53.707  1.00 12.71 ? 156 ARG B O   1 
ATOM   5202  C  CB  . ARG B 1 156 ? 4.139   47.738  50.875  1.00 12.28 ? 156 ARG B CB  1 
ATOM   5203  C  CG  . ARG B 1 156 ? 2.756   47.473  50.299  1.00 12.18 ? 156 ARG B CG  1 
ATOM   5204  C  CD  . ARG B 1 156 ? 2.387   48.562  49.295  1.00 12.21 ? 156 ARG B CD  1 
ATOM   5205  N  NE  . ARG B 1 156 ? 0.963   48.569  48.980  1.00 12.30 ? 156 ARG B NE  1 
ATOM   5206  C  CZ  . ARG B 1 156 ? 0.459   48.388  47.761  1.00 12.40 ? 156 ARG B CZ  1 
ATOM   5207  N  NH1 . ARG B 1 156 ? 1.258   48.183  46.723  1.00 11.97 ? 156 ARG B NH1 1 
ATOM   5208  N  NH2 . ARG B 1 156 ? -0.855  48.421  47.579  1.00 12.85 ? 156 ARG B NH2 1 
ATOM   5209  N  N   . ASP B 1 157 ? 4.101   45.421  53.664  1.00 12.72 ? 157 ASP B N   1 
ATOM   5210  C  CA  . ASP B 1 157 ? 3.722   45.301  55.068  1.00 12.74 ? 157 ASP B CA  1 
ATOM   5211  C  C   . ASP B 1 157 ? 4.365   44.058  55.692  1.00 12.66 ? 157 ASP B C   1 
ATOM   5212  O  O   . ASP B 1 157 ? 4.033   42.922  55.340  1.00 12.74 ? 157 ASP B O   1 
ATOM   5213  C  CB  . ASP B 1 157 ? 2.204   45.229  55.217  1.00 12.96 ? 157 ASP B CB  1 
ATOM   5214  C  CG  . ASP B 1 157 ? 1.745   45.561  56.626  1.00 13.08 ? 157 ASP B CG  1 
ATOM   5215  O  OD1 . ASP B 1 157 ? 2.464   45.198  57.582  1.00 13.13 ? 157 ASP B OD1 1 
ATOM   5216  O  OD2 . ASP B 1 157 ? 0.674   46.189  56.780  1.00 13.15 ? 157 ASP B OD2 1 
ATOM   5217  N  N   . PRO B 1 158 ? 5.285   44.265  56.646  1.00 12.48 ? 158 PRO B N   1 
ATOM   5218  C  CA  . PRO B 1 158 ? 6.016   43.204  57.352  1.00 12.28 ? 158 PRO B CA  1 
ATOM   5219  C  C   . PRO B 1 158 ? 5.170   42.052  57.886  1.00 11.98 ? 158 PRO B C   1 
ATOM   5220  O  O   . PRO B 1 158 ? 5.637   40.918  57.967  1.00 11.88 ? 158 PRO B O   1 
ATOM   5221  C  CB  . PRO B 1 158 ? 6.743   43.947  58.482  1.00 12.38 ? 158 PRO B CB  1 
ATOM   5222  C  CG  . PRO B 1 158 ? 6.123   45.318  58.530  1.00 12.49 ? 158 PRO B CG  1 
ATOM   5223  C  CD  . PRO B 1 158 ? 5.661   45.600  57.137  1.00 12.50 ? 158 PRO B CD  1 
ATOM   5224  N  N   . ILE B 1 159 ? 3.928   42.343  58.254  1.00 11.85 ? 159 ILE B N   1 
ATOM   5225  C  CA  . ILE B 1 159 ? 3.039   41.324  58.792  1.00 11.64 ? 159 ILE B CA  1 
ATOM   5226  C  C   . ILE B 1 159 ? 2.765   40.191  57.801  1.00 11.87 ? 159 ILE B C   1 
ATOM   5227  O  O   . ILE B 1 159 ? 2.236   39.145  58.168  1.00 12.06 ? 159 ILE B O   1 
ATOM   5228  C  CB  . ILE B 1 159 ? 1.700   41.948  59.234  1.00 11.12 ? 159 ILE B CB  1 
ATOM   5229  C  CG1 . ILE B 1 159 ? 1.054   41.073  60.308  1.00 10.79 ? 159 ILE B CG1 1 
ATOM   5230  C  CG2 . ILE B 1 159 ? 0.782   42.123  58.038  1.00 10.79 ? 159 ILE B CG2 1 
ATOM   5231  C  CD1 . ILE B 1 159 ? 1.390   41.494  61.707  1.00 10.16 ? 159 ILE B CD1 1 
ATOM   5232  N  N   . LEU B 1 160 ? 3.137   40.396  56.545  1.00 11.85 ? 160 LEU B N   1 
ATOM   5233  C  CA  . LEU B 1 160 ? 2.914   39.382  55.522  1.00 11.90 ? 160 LEU B CA  1 
ATOM   5234  C  C   . LEU B 1 160 ? 4.191   38.600  55.231  1.00 11.90 ? 160 LEU B C   1 
ATOM   5235  O  O   . LEU B 1 160 ? 4.145   37.480  54.719  1.00 11.87 ? 160 LEU B O   1 
ATOM   5236  C  CB  . LEU B 1 160 ? 2.418   40.039  54.227  1.00 11.98 ? 160 LEU B CB  1 
ATOM   5237  C  CG  . LEU B 1 160 ? 1.009   40.637  54.213  1.00 11.97 ? 160 LEU B CG  1 
ATOM   5238  C  CD1 . LEU B 1 160 ? 1.084   42.124  53.861  1.00 11.80 ? 160 LEU B CD1 1 
ATOM   5239  C  CD2 . LEU B 1 160 ? 0.146   39.880  53.209  1.00 11.93 ? 160 LEU B CD2 1 
ATOM   5240  N  N   . PHE B 1 161 ? 5.329   39.195  55.562  1.00 11.84 ? 161 PHE B N   1 
ATOM   5241  C  CA  . PHE B 1 161 ? 6.620   38.567  55.320  1.00 11.84 ? 161 PHE B CA  1 
ATOM   5242  C  C   . PHE B 1 161 ? 6.711   37.117  55.786  1.00 11.73 ? 161 PHE B C   1 
ATOM   5243  O  O   . PHE B 1 161 ? 6.986   36.223  54.992  1.00 11.53 ? 161 PHE B O   1 
ATOM   5244  C  CB  . PHE B 1 161 ? 7.737   39.387  55.970  1.00 12.09 ? 161 PHE B CB  1 
ATOM   5245  C  CG  . PHE B 1 161 ? 9.111   38.920  55.603  1.00 12.61 ? 161 PHE B CG  1 
ATOM   5246  C  CD1 . PHE B 1 161 ? 9.725   39.373  54.440  1.00 12.89 ? 161 PHE B CD1 1 
ATOM   5247  C  CD2 . PHE B 1 161 ? 9.787   38.009  56.409  1.00 12.92 ? 161 PHE B CD2 1 
ATOM   5248  C  CE1 . PHE B 1 161 ? 10.994  38.925  54.080  1.00 13.15 ? 161 PHE B CE1 1 
ATOM   5249  C  CE2 . PHE B 1 161 ? 11.056  37.552  56.060  1.00 13.21 ? 161 PHE B CE2 1 
ATOM   5250  C  CZ  . PHE B 1 161 ? 11.662  38.013  54.891  1.00 13.29 ? 161 PHE B CZ  1 
ATOM   5251  N  N   . PRO B 1 162 ? 6.472   36.860  57.080  1.00 11.85 ? 162 PRO B N   1 
ATOM   5252  C  CA  . PRO B 1 162 ? 6.571   35.463  57.509  1.00 11.94 ? 162 PRO B CA  1 
ATOM   5253  C  C   . PRO B 1 162 ? 5.855   34.517  56.555  1.00 11.90 ? 162 PRO B C   1 
ATOM   5254  O  O   . PRO B 1 162 ? 6.380   33.459  56.213  1.00 11.85 ? 162 PRO B O   1 
ATOM   5255  C  CB  . PRO B 1 162 ? 5.941   35.468  58.902  1.00 11.99 ? 162 PRO B CB  1 
ATOM   5256  C  CG  . PRO B 1 162 ? 6.149   36.855  59.393  1.00 12.03 ? 162 PRO B CG  1 
ATOM   5257  C  CD  . PRO B 1 162 ? 6.086   37.753  58.187  1.00 11.93 ? 162 PRO B CD  1 
ATOM   5258  N  N   . SER B 1 163 ? 4.664   34.924  56.118  1.00 11.89 ? 163 SER B N   1 
ATOM   5259  C  CA  . SER B 1 163 ? 3.837   34.128  55.213  1.00 11.56 ? 163 SER B CA  1 
ATOM   5260  C  C   . SER B 1 163 ? 4.429   34.062  53.819  1.00 11.38 ? 163 SER B C   1 
ATOM   5261  O  O   . SER B 1 163 ? 4.571   32.984  53.247  1.00 11.45 ? 163 SER B O   1 
ATOM   5262  C  CB  . SER B 1 163 ? 2.427   34.719  55.134  1.00 11.87 ? 163 SER B CB  1 
ATOM   5263  O  OG  . SER B 1 163 ? 1.786   34.701  56.400  1.00 12.01 ? 163 SER B OG  1 
ATOM   5264  N  N   . PHE B 1 164 ? 4.771   35.224  53.278  1.00 11.48 ? 164 PHE B N   1 
ATOM   5265  C  CA  . PHE B 1 164 ? 5.342   35.305  51.942  1.00 11.12 ? 164 PHE B CA  1 
ATOM   5266  C  C   . PHE B 1 164 ? 6.521   34.356  51.799  1.00 10.88 ? 164 PHE B C   1 
ATOM   5267  O  O   . PHE B 1 164 ? 6.629   33.637  50.808  1.00 10.83 ? 164 PHE B O   1 
ATOM   5268  C  CB  . PHE B 1 164 ? 5.793   36.739  51.639  1.00 11.37 ? 164 PHE B CB  1 
ATOM   5269  C  CG  . PHE B 1 164 ? 6.734   36.837  50.476  1.00 11.74 ? 164 PHE B CG  1 
ATOM   5270  C  CD1 . PHE B 1 164 ? 6.267   36.688  49.175  1.00 11.87 ? 164 PHE B CD1 1 
ATOM   5271  C  CD2 . PHE B 1 164 ? 8.099   37.025  50.679  1.00 11.83 ? 164 PHE B CD2 1 
ATOM   5272  C  CE1 . PHE B 1 164 ? 7.148   36.719  48.090  1.00 11.95 ? 164 PHE B CE1 1 
ATOM   5273  C  CE2 . PHE B 1 164 ? 8.988   37.055  49.600  1.00 11.85 ? 164 PHE B CE2 1 
ATOM   5274  C  CZ  . PHE B 1 164 ? 8.512   36.901  48.305  1.00 11.72 ? 164 PHE B CZ  1 
ATOM   5275  N  N   . ILE B 1 165 ? 7.399   34.360  52.798  1.00 10.77 ? 165 ILE B N   1 
ATOM   5276  C  CA  . ILE B 1 165 ? 8.580   33.508  52.793  1.00 10.64 ? 165 ILE B CA  1 
ATOM   5277  C  C   . ILE B 1 165 ? 8.187   32.045  52.919  1.00 10.63 ? 165 ILE B C   1 
ATOM   5278  O  O   . ILE B 1 165 ? 8.778   31.180  52.275  1.00 10.49 ? 165 ILE B O   1 
ATOM   5279  C  CB  . ILE B 1 165 ? 9.533   33.888  53.941  1.00 10.53 ? 165 ILE B CB  1 
ATOM   5280  C  CG1 . ILE B 1 165 ? 10.127  35.271  53.676  1.00 10.65 ? 165 ILE B CG1 1 
ATOM   5281  C  CG2 . ILE B 1 165 ? 10.644  32.868  54.066  1.00 10.64 ? 165 ILE B CG2 1 
ATOM   5282  C  CD1 . ILE B 1 165 ? 10.872  35.380  52.367  1.00 10.52 ? 165 ILE B CD1 1 
ATOM   5283  N  N   . HIS B 1 166 ? 7.185   31.778  53.748  1.00 10.45 ? 166 HIS B N   1 
ATOM   5284  C  CA  . HIS B 1 166 ? 6.708   30.422  53.950  1.00 10.66 ? 166 HIS B CA  1 
ATOM   5285  C  C   . HIS B 1 166 ? 6.326   29.885  52.579  1.00 11.00 ? 166 HIS B C   1 
ATOM   5286  O  O   . HIS B 1 166 ? 6.766   28.810  52.170  1.00 10.95 ? 166 HIS B O   1 
ATOM   5287  C  CB  . HIS B 1 166 ? 5.478   30.423  54.868  1.00 10.45 ? 166 HIS B CB  1 
ATOM   5288  C  CG  . HIS B 1 166 ? 5.798   30.319  56.331  1.00 10.10 ? 166 HIS B CG  1 
ATOM   5289  N  ND1 . HIS B 1 166 ? 4.820   30.252  57.301  1.00 10.02 ? 166 HIS B ND1 1 
ATOM   5290  C  CD2 . HIS B 1 166 ? 6.980   30.262  56.989  1.00 10.01 ? 166 HIS B CD2 1 
ATOM   5291  C  CE1 . HIS B 1 166 ? 5.384   30.159  58.492  1.00 9.85  ? 166 HIS B CE1 1 
ATOM   5292  N  NE2 . HIS B 1 166 ? 6.694   30.163  58.330  1.00 9.87  ? 166 HIS B NE2 1 
ATOM   5293  N  N   . SER B 1 167 ? 5.516   30.663  51.869  1.00 11.19 ? 167 SER B N   1 
ATOM   5294  C  CA  . SER B 1 167 ? 5.044   30.300  50.538  1.00 11.23 ? 167 SER B CA  1 
ATOM   5295  C  C   . SER B 1 167 ? 6.181   29.991  49.573  1.00 11.25 ? 167 SER B C   1 
ATOM   5296  O  O   . SER B 1 167 ? 6.064   29.106  48.732  1.00 11.50 ? 167 SER B O   1 
ATOM   5297  C  CB  . SER B 1 167 ? 4.193   31.432  49.965  1.00 11.34 ? 167 SER B CB  1 
ATOM   5298  O  OG  . SER B 1 167 ? 5.013   32.465  49.446  1.00 11.25 ? 167 SER B OG  1 
ATOM   5299  N  N   . GLN B 1 168 ? 7.281   30.723  49.703  1.00 11.40 ? 168 GLN B N   1 
ATOM   5300  C  CA  . GLN B 1 168 ? 8.438   30.538  48.835  1.00 11.42 ? 168 GLN B CA  1 
ATOM   5301  C  C   . GLN B 1 168 ? 9.244   29.287  49.143  1.00 11.43 ? 168 GLN B C   1 
ATOM   5302  O  O   . GLN B 1 168 ? 9.918   28.756  48.268  1.00 11.46 ? 168 GLN B O   1 
ATOM   5303  C  CB  . GLN B 1 168 ? 9.365   31.754  48.925  1.00 11.32 ? 168 GLN B CB  1 
ATOM   5304  C  CG  . GLN B 1 168 ? 8.806   33.024  48.307  1.00 11.44 ? 168 GLN B CG  1 
ATOM   5305  C  CD  . GLN B 1 168 ? 8.709   32.944  46.793  1.00 11.63 ? 168 GLN B CD  1 
ATOM   5306  O  OE1 . GLN B 1 168 ? 9.687   32.629  46.111  1.00 11.99 ? 168 GLN B OE1 1 
ATOM   5307  N  NE2 . GLN B 1 168 ? 7.524   33.228  46.260  1.00 11.56 ? 168 GLN B NE2 1 
ATOM   5308  N  N   . LYS B 1 169 ? 9.183   28.817  50.385  1.00 11.72 ? 169 LYS B N   1 
ATOM   5309  C  CA  . LYS B 1 169 ? 9.945   27.636  50.785  1.00 11.80 ? 169 LYS B CA  1 
ATOM   5310  C  C   . LYS B 1 169 ? 9.262   26.324  50.414  1.00 11.98 ? 169 LYS B C   1 
ATOM   5311  O  O   . LYS B 1 169 ? 8.533   26.252  49.426  1.00 12.19 ? 169 LYS B O   1 
ATOM   5312  C  CB  . LYS B 1 169 ? 10.221  27.665  52.292  1.00 11.80 ? 169 LYS B CB  1 
ATOM   5313  C  CG  . LYS B 1 169 ? 11.032  28.869  52.756  1.00 11.77 ? 169 LYS B CG  1 
ATOM   5314  C  CD  . LYS B 1 169 ? 12.517  28.552  52.816  1.00 11.84 ? 169 LYS B CD  1 
ATOM   5315  C  CE  . LYS B 1 169 ? 13.217  29.364  53.892  1.00 11.84 ? 169 LYS B CE  1 
ATOM   5316  N  NZ  . LYS B 1 169 ? 13.935  30.537  53.323  1.00 12.00 ? 169 LYS B NZ  1 
ATOM   5317  N  N   . ARG B 1 170 ? 9.510   25.290  51.216  1.00 11.81 ? 170 ARG B N   1 
ATOM   5318  C  CA  . ARG B 1 170 ? 8.941   23.966  50.984  1.00 11.68 ? 170 ARG B CA  1 
ATOM   5319  C  C   . ARG B 1 170 ? 7.613   23.758  51.705  1.00 11.83 ? 170 ARG B C   1 
ATOM   5320  O  O   . ARG B 1 170 ? 7.321   24.409  52.711  1.00 11.72 ? 170 ARG B O   1 
ATOM   5321  C  CB  . ARG B 1 170 ? 9.935   22.888  51.424  1.00 11.28 ? 170 ARG B CB  1 
ATOM   5322  C  CG  . ARG B 1 170 ? 11.387  23.229  51.131  1.00 11.00 ? 170 ARG B CG  1 
ATOM   5323  C  CD  . ARG B 1 170 ? 12.329  22.281  51.856  1.00 11.12 ? 170 ARG B CD  1 
ATOM   5324  N  NE  . ARG B 1 170 ? 13.592  22.067  51.150  1.00 11.35 ? 170 ARG B NE  1 
ATOM   5325  C  CZ  . ARG B 1 170 ? 13.688  21.560  49.924  1.00 11.53 ? 170 ARG B CZ  1 
ATOM   5326  N  NH1 . ARG B 1 170 ? 12.591  21.214  49.263  1.00 11.98 ? 170 ARG B NH1 1 
ATOM   5327  N  NH2 . ARG B 1 170 ? 14.877  21.382  49.362  1.00 11.25 ? 170 ARG B NH2 1 
ATOM   5328  N  N   . ASN B 1 171 ? 6.812   22.843  51.171  1.00 12.04 ? 171 ASN B N   1 
ATOM   5329  C  CA  . ASN B 1 171 ? 5.513   22.519  51.740  1.00 12.37 ? 171 ASN B CA  1 
ATOM   5330  C  C   . ASN B 1 171 ? 5.695   21.826  53.093  1.00 12.56 ? 171 ASN B C   1 
ATOM   5331  O  O   . ASN B 1 171 ? 6.579   20.985  53.258  1.00 12.81 ? 171 ASN B O   1 
ATOM   5332  C  CB  . ASN B 1 171 ? 4.758   21.607  50.779  1.00 12.39 ? 171 ASN B CB  1 
ATOM   5333  C  CG  . ASN B 1 171 ? 3.281   21.590  51.044  1.00 12.35 ? 171 ASN B CG  1 
ATOM   5334  O  OD1 . ASN B 1 171 ? 2.818   20.942  51.977  1.00 12.33 ? 171 ASN B OD1 1 
ATOM   5335  N  ND2 . ASN B 1 171 ? 2.526   22.305  50.224  1.00 12.52 ? 171 ASN B ND2 1 
ATOM   5336  N  N   . PRO B 1 172 ? 4.851   22.164  54.079  1.00 12.60 ? 172 PRO B N   1 
ATOM   5337  C  CA  . PRO B 1 172 ? 4.923   21.580  55.421  1.00 12.65 ? 172 PRO B CA  1 
ATOM   5338  C  C   . PRO B 1 172 ? 4.849   20.062  55.491  1.00 12.63 ? 172 PRO B C   1 
ATOM   5339  O  O   . PRO B 1 172 ? 5.597   19.444  56.247  1.00 12.77 ? 172 PRO B O   1 
ATOM   5340  C  CB  . PRO B 1 172 ? 3.763   22.238  56.167  1.00 12.47 ? 172 PRO B CB  1 
ATOM   5341  C  CG  . PRO B 1 172 ? 2.859   22.721  55.107  1.00 12.41 ? 172 PRO B CG  1 
ATOM   5342  C  CD  . PRO B 1 172 ? 3.750   23.130  53.979  1.00 12.54 ? 172 PRO B CD  1 
ATOM   5343  N  N   . GLN B 1 173 ? 3.954   19.461  54.713  1.00 12.47 ? 173 GLN B N   1 
ATOM   5344  C  CA  . GLN B 1 173 ? 3.797   18.012  54.740  1.00 12.49 ? 173 GLN B CA  1 
ATOM   5345  C  C   . GLN B 1 173 ? 4.765   17.275  53.818  1.00 12.33 ? 173 GLN B C   1 
ATOM   5346  O  O   . GLN B 1 173 ? 5.415   16.313  54.232  1.00 12.29 ? 173 GLN B O   1 
ATOM   5347  C  CB  . GLN B 1 173 ? 2.349   17.632  54.390  1.00 12.58 ? 173 GLN B CB  1 
ATOM   5348  C  CG  . GLN B 1 173 ? 2.167   16.182  53.931  1.00 12.94 ? 173 GLN B CG  1 
ATOM   5349  C  CD  . GLN B 1 173 ? 0.819   15.590  54.317  1.00 13.19 ? 173 GLN B CD  1 
ATOM   5350  O  OE1 . GLN B 1 173 ? -0.227  16.048  53.860  1.00 13.78 ? 173 GLN B OE1 1 
ATOM   5351  N  NE2 . GLN B 1 173 ? 0.840   14.562  55.159  1.00 13.12 ? 173 GLN B NE2 1 
ATOM   5352  N  N   . THR B 1 174 ? 4.865   17.739  52.576  1.00 12.27 ? 174 THR B N   1 
ATOM   5353  C  CA  . THR B 1 174 ? 5.721   17.112  51.571  1.00 12.01 ? 174 THR B CA  1 
ATOM   5354  C  C   . THR B 1 174 ? 7.186   17.542  51.602  1.00 11.78 ? 174 THR B C   1 
ATOM   5355  O  O   . THR B 1 174 ? 8.071   16.778  51.215  1.00 11.75 ? 174 THR B O   1 
ATOM   5356  C  CB  . THR B 1 174 ? 5.165   17.384  50.167  1.00 12.26 ? 174 THR B CB  1 
ATOM   5357  O  OG1 . THR B 1 174 ? 4.763   18.758  50.070  1.00 12.32 ? 174 THR B OG1 1 
ATOM   5358  C  CG2 . THR B 1 174 ? 3.963   16.497  49.899  1.00 12.45 ? 174 THR B CG2 1 
ATOM   5359  N  N   . HIS B 1 175 ? 7.432   18.766  52.062  1.00 11.66 ? 175 HIS B N   1 
ATOM   5360  C  CA  . HIS B 1 175 ? 8.784   19.321  52.142  1.00 11.63 ? 175 HIS B CA  1 
ATOM   5361  C  C   . HIS B 1 175 ? 9.381   19.504  50.746  1.00 11.32 ? 175 HIS B C   1 
ATOM   5362  O  O   . HIS B 1 175 ? 10.590  19.362  50.540  1.00 11.02 ? 175 HIS B O   1 
ATOM   5363  C  CB  . HIS B 1 175 ? 9.693   18.423  52.992  1.00 11.73 ? 175 HIS B CB  1 
ATOM   5364  C  CG  . HIS B 1 175 ? 10.940  19.104  53.465  1.00 11.97 ? 175 HIS B CG  1 
ATOM   5365  N  ND1 . HIS B 1 175 ? 10.925  20.123  54.392  1.00 12.03 ? 175 HIS B ND1 1 
ATOM   5366  C  CD2 . HIS B 1 175 ? 12.239  18.931  53.119  1.00 12.11 ? 175 HIS B CD2 1 
ATOM   5367  C  CE1 . HIS B 1 175 ? 12.159  20.550  54.595  1.00 11.96 ? 175 HIS B CE1 1 
ATOM   5368  N  NE2 . HIS B 1 175 ? 12.975  19.843  53.835  1.00 12.04 ? 175 HIS B NE2 1 
ATOM   5369  N  N   . LEU B 1 176 ? 8.507   19.816  49.792  1.00 11.19 ? 176 LEU B N   1 
ATOM   5370  C  CA  . LEU B 1 176 ? 8.905   20.048  48.411  1.00 11.12 ? 176 LEU B CA  1 
ATOM   5371  C  C   . LEU B 1 176 ? 8.397   21.419  48.003  1.00 11.20 ? 176 LEU B C   1 
ATOM   5372  O  O   . LEU B 1 176 ? 7.457   21.940  48.599  1.00 11.07 ? 176 LEU B O   1 
ATOM   5373  C  CB  . LEU B 1 176 ? 8.290   18.999  47.490  1.00 11.15 ? 176 LEU B CB  1 
ATOM   5374  C  CG  . LEU B 1 176 ? 8.460   17.539  47.893  1.00 11.25 ? 176 LEU B CG  1 
ATOM   5375  C  CD1 . LEU B 1 176 ? 7.257   16.741  47.407  1.00 11.56 ? 176 LEU B CD1 1 
ATOM   5376  C  CD2 . LEU B 1 176 ? 9.746   16.990  47.304  1.00 11.02 ? 176 LEU B CD2 1 
ATOM   5377  N  N   . LYS B 1 177 ? 9.029   22.011  46.998  1.00 11.40 ? 177 LYS B N   1 
ATOM   5378  C  CA  . LYS B 1 177 ? 8.599   23.311  46.520  1.00 11.70 ? 177 LYS B CA  1 
ATOM   5379  C  C   . LYS B 1 177 ? 7.173   23.128  46.024  1.00 11.88 ? 177 LYS B C   1 
ATOM   5380  O  O   . LYS B 1 177 ? 6.849   22.114  45.403  1.00 11.81 ? 177 LYS B O   1 
ATOM   5381  C  CB  . LYS B 1 177 ? 9.500   23.782  45.381  1.00 11.84 ? 177 LYS B CB  1 
ATOM   5382  C  CG  . LYS B 1 177 ? 10.643  24.667  45.831  1.00 12.05 ? 177 LYS B CG  1 
ATOM   5383  C  CD  . LYS B 1 177 ? 11.774  23.851  46.422  1.00 12.16 ? 177 LYS B CD  1 
ATOM   5384  C  CE  . LYS B 1 177 ? 13.046  24.674  46.497  1.00 12.60 ? 177 LYS B CE  1 
ATOM   5385  N  NZ  . LYS B 1 177 ? 12.762  26.141  46.617  1.00 13.02 ? 177 LYS B NZ  1 
ATOM   5386  N  N   . ASP B 1 178 ? 6.315   24.101  46.304  1.00 12.22 ? 178 ASP B N   1 
ATOM   5387  C  CA  . ASP B 1 178 ? 4.924   24.000  45.888  1.00 12.63 ? 178 ASP B CA  1 
ATOM   5388  C  C   . ASP B 1 178 ? 4.459   25.194  45.060  1.00 12.72 ? 178 ASP B C   1 
ATOM   5389  O  O   . ASP B 1 178 ? 4.072   26.221  45.609  1.00 12.89 ? 178 ASP B O   1 
ATOM   5390  C  CB  . ASP B 1 178 ? 4.027   23.855  47.116  1.00 12.83 ? 178 ASP B CB  1 
ATOM   5391  C  CG  . ASP B 1 178 ? 2.677   23.272  46.782  1.00 13.01 ? 178 ASP B CG  1 
ATOM   5392  O  OD1 . ASP B 1 178 ? 1.970   22.841  47.713  1.00 13.02 ? 178 ASP B OD1 1 
ATOM   5393  O  OD2 . ASP B 1 178 ? 2.321   23.244  45.588  1.00 13.36 ? 178 ASP B OD2 1 
ATOM   5394  N  N   . PRO B 1 179 ? 4.482   25.068  43.723  1.00 12.69 ? 179 PRO B N   1 
ATOM   5395  C  CA  . PRO B 1 179 ? 4.046   26.181  42.869  1.00 12.60 ? 179 PRO B CA  1 
ATOM   5396  C  C   . PRO B 1 179 ? 2.669   26.680  43.296  1.00 12.57 ? 179 PRO B C   1 
ATOM   5397  O  O   . PRO B 1 179 ? 2.350   27.859  43.152  1.00 12.70 ? 179 PRO B O   1 
ATOM   5398  C  CB  . PRO B 1 179 ? 4.026   25.582  41.461  1.00 12.73 ? 179 PRO B CB  1 
ATOM   5399  C  CG  . PRO B 1 179 ? 4.938   24.395  41.528  1.00 12.72 ? 179 PRO B CG  1 
ATOM   5400  C  CD  . PRO B 1 179 ? 4.903   23.889  42.942  1.00 12.75 ? 179 PRO B CD  1 
ATOM   5401  N  N   . ASP B 1 180 ? 1.861   25.766  43.827  1.00 12.43 ? 180 ASP B N   1 
ATOM   5402  C  CA  . ASP B 1 180 ? 0.514   26.094  44.283  1.00 12.10 ? 180 ASP B CA  1 
ATOM   5403  C  C   . ASP B 1 180 ? 0.563   27.178  45.360  1.00 12.02 ? 180 ASP B C   1 
ATOM   5404  O  O   . ASP B 1 180 ? -0.264  28.082  45.370  1.00 12.02 ? 180 ASP B O   1 
ATOM   5405  C  CB  . ASP B 1 180 ? -0.181  24.833  44.824  1.00 11.62 ? 180 ASP B CB  1 
ATOM   5406  C  CG  . ASP B 1 180 ? -1.325  24.359  43.931  1.00 11.30 ? 180 ASP B CG  1 
ATOM   5407  O  OD1 . ASP B 1 180 ? -1.193  24.436  42.691  1.00 11.15 ? 180 ASP B OD1 1 
ATOM   5408  O  OD2 . ASP B 1 180 ? -2.362  23.912  44.468  1.00 10.83 ? 180 ASP B OD2 1 
ATOM   5409  N  N   . MET B 1 181 ? 1.539   27.079  46.258  1.00 12.19 ? 181 MET B N   1 
ATOM   5410  C  CA  . MET B 1 181 ? 1.711   28.050  47.340  1.00 12.33 ? 181 MET B CA  1 
ATOM   5411  C  C   . MET B 1 181 ? 2.269   29.362  46.803  1.00 12.26 ? 181 MET B C   1 
ATOM   5412  O  O   . MET B 1 181 ? 1.743   30.438  47.074  1.00 12.44 ? 181 MET B O   1 
ATOM   5413  C  CB  . MET B 1 181 ? 2.683   27.507  48.393  1.00 12.37 ? 181 MET B CB  1 
ATOM   5414  C  CG  . MET B 1 181 ? 2.352   26.120  48.921  1.00 12.23 ? 181 MET B CG  1 
ATOM   5415  S  SD  . MET B 1 181 ? 3.375   25.638  50.347  1.00 12.06 ? 181 MET B SD  1 
ATOM   5416  C  CE  . MET B 1 181 ? 3.728   27.216  51.088  1.00 11.63 ? 181 MET B CE  1 
ATOM   5417  N  N   . VAL B 1 182 ? 3.353   29.248  46.048  1.00 12.34 ? 182 VAL B N   1 
ATOM   5418  C  CA  . VAL B 1 182 ? 4.037   30.385  45.451  1.00 12.14 ? 182 VAL B CA  1 
ATOM   5419  C  C   . VAL B 1 182 ? 3.113   31.348  44.727  1.00 12.41 ? 182 VAL B C   1 
ATOM   5420  O  O   . VAL B 1 182 ? 3.197   32.558  44.919  1.00 12.53 ? 182 VAL B O   1 
ATOM   5421  C  CB  . VAL B 1 182 ? 5.103   29.914  44.445  1.00 11.90 ? 182 VAL B CB  1 
ATOM   5422  C  CG1 . VAL B 1 182 ? 5.727   31.110  43.744  1.00 11.62 ? 182 VAL B CG1 1 
ATOM   5423  C  CG2 . VAL B 1 182 ? 6.161   29.096  45.162  1.00 11.47 ? 182 VAL B CG2 1 
ATOM   5424  N  N   . TRP B 1 183 ? 2.237   30.816  43.886  1.00 12.62 ? 183 TRP B N   1 
ATOM   5425  C  CA  . TRP B 1 183 ? 1.331   31.671  43.135  1.00 12.84 ? 183 TRP B CA  1 
ATOM   5426  C  C   . TRP B 1 183 ? 0.018   31.994  43.850  1.00 13.02 ? 183 TRP B C   1 
ATOM   5427  O  O   . TRP B 1 183 ? -0.588  33.032  43.580  1.00 13.14 ? 183 TRP B O   1 
ATOM   5428  C  CB  . TRP B 1 183 ? 1.060   31.054  41.759  1.00 12.77 ? 183 TRP B CB  1 
ATOM   5429  C  CG  . TRP B 1 183 ? 2.263   31.114  40.844  1.00 12.81 ? 183 TRP B CG  1 
ATOM   5430  C  CD1 . TRP B 1 183 ? 3.161   30.110  40.599  1.00 12.91 ? 183 TRP B CD1 1 
ATOM   5431  C  CD2 . TRP B 1 183 ? 2.708   32.242  40.080  1.00 12.67 ? 183 TRP B CD2 1 
ATOM   5432  N  NE1 . TRP B 1 183 ? 4.138   30.545  39.732  1.00 12.93 ? 183 TRP B NE1 1 
ATOM   5433  C  CE2 . TRP B 1 183 ? 3.884   31.849  39.397  1.00 12.81 ? 183 TRP B CE2 1 
ATOM   5434  C  CE3 . TRP B 1 183 ? 2.231   33.548  39.904  1.00 12.52 ? 183 TRP B CE3 1 
ATOM   5435  C  CZ2 . TRP B 1 183 ? 4.589   32.716  38.553  1.00 12.75 ? 183 TRP B CZ2 1 
ATOM   5436  C  CZ3 . TRP B 1 183 ? 2.932   34.414  39.062  1.00 12.47 ? 183 TRP B CZ3 1 
ATOM   5437  C  CH2 . TRP B 1 183 ? 4.099   33.991  38.397  1.00 12.55 ? 183 TRP B CH2 1 
ATOM   5438  N  N   . ASP B 1 184 ? -0.420  31.127  44.762  1.00 12.73 ? 184 ASP B N   1 
ATOM   5439  C  CA  . ASP B 1 184 ? -1.662  31.383  45.489  1.00 12.56 ? 184 ASP B CA  1 
ATOM   5440  C  C   . ASP B 1 184 ? -1.521  32.685  46.261  1.00 12.58 ? 184 ASP B C   1 
ATOM   5441  O  O   . ASP B 1 184 ? -2.450  33.494  46.316  1.00 12.25 ? 184 ASP B O   1 
ATOM   5442  C  CB  . ASP B 1 184 ? -1.977  30.251  46.472  1.00 12.66 ? 184 ASP B CB  1 
ATOM   5443  C  CG  . ASP B 1 184 ? -3.299  30.467  47.212  1.00 12.72 ? 184 ASP B CG  1 
ATOM   5444  O  OD1 . ASP B 1 184 ? -4.111  31.306  46.760  1.00 13.25 ? 184 ASP B OD1 1 
ATOM   5445  O  OD2 . ASP B 1 184 ? -3.531  29.800  48.244  1.00 12.31 ? 184 ASP B OD2 1 
ATOM   5446  N  N   . PHE B 1 185 ? -0.352  32.880  46.863  1.00 12.58 ? 185 PHE B N   1 
ATOM   5447  C  CA  . PHE B 1 185 ? -0.097  34.092  47.629  1.00 12.99 ? 185 PHE B CA  1 
ATOM   5448  C  C   . PHE B 1 185 ? 0.072   35.269  46.675  1.00 13.07 ? 185 PHE B C   1 
ATOM   5449  O  O   . PHE B 1 185 ? -0.565  36.312  46.832  1.00 13.23 ? 185 PHE B O   1 
ATOM   5450  C  CB  . PHE B 1 185 ? 1.166   33.936  48.480  1.00 12.66 ? 185 PHE B CB  1 
ATOM   5451  C  CG  . PHE B 1 185 ? 1.548   35.183  49.234  1.00 12.52 ? 185 PHE B CG  1 
ATOM   5452  C  CD1 . PHE B 1 185 ? 1.010   35.443  50.494  1.00 12.50 ? 185 PHE B CD1 1 
ATOM   5453  C  CD2 . PHE B 1 185 ? 2.447   36.092  48.690  1.00 12.31 ? 185 PHE B CD2 1 
ATOM   5454  C  CE1 . PHE B 1 185 ? 1.366   36.596  51.206  1.00 12.40 ? 185 PHE B CE1 1 
ATOM   5455  C  CE2 . PHE B 1 185 ? 2.809   37.244  49.391  1.00 12.18 ? 185 PHE B CE2 1 
ATOM   5456  C  CZ  . PHE B 1 185 ? 2.267   37.496  50.652  1.00 12.25 ? 185 PHE B CZ  1 
ATOM   5457  N  N   . TRP B 1 186 ? 0.934   35.086  45.680  1.00 12.81 ? 186 TRP B N   1 
ATOM   5458  C  CA  . TRP B 1 186 ? 1.200   36.127  44.703  1.00 12.71 ? 186 TRP B CA  1 
ATOM   5459  C  C   . TRP B 1 186 ? -0.060  36.585  43.980  1.00 12.63 ? 186 TRP B C   1 
ATOM   5460  O  O   . TRP B 1 186 ? -0.252  37.774  43.756  1.00 12.44 ? 186 TRP B O   1 
ATOM   5461  C  CB  . TRP B 1 186 ? 2.233   35.633  43.688  1.00 12.53 ? 186 TRP B CB  1 
ATOM   5462  C  CG  . TRP B 1 186 ? 3.647   35.926  44.095  1.00 12.25 ? 186 TRP B CG  1 
ATOM   5463  C  CD1 . TRP B 1 186 ? 4.055   36.747  45.108  1.00 12.13 ? 186 TRP B CD1 1 
ATOM   5464  C  CD2 . TRP B 1 186 ? 4.841   35.401  43.501  1.00 11.98 ? 186 TRP B CD2 1 
ATOM   5465  N  NE1 . TRP B 1 186 ? 5.425   36.765  45.180  1.00 11.99 ? 186 TRP B NE1 1 
ATOM   5466  C  CE2 . TRP B 1 186 ? 5.933   35.948  44.204  1.00 11.89 ? 186 TRP B CE2 1 
ATOM   5467  C  CE3 . TRP B 1 186 ? 5.092   34.524  42.441  1.00 11.83 ? 186 TRP B CE3 1 
ATOM   5468  C  CZ2 . TRP B 1 186 ? 7.259   35.643  43.883  1.00 11.62 ? 186 TRP B CZ2 1 
ATOM   5469  C  CZ3 . TRP B 1 186 ? 6.410   34.223  42.124  1.00 11.58 ? 186 TRP B CZ3 1 
ATOM   5470  C  CH2 . TRP B 1 186 ? 7.475   34.783  42.843  1.00 11.40 ? 186 TRP B CH2 1 
ATOM   5471  N  N   . SER B 1 187 ? -0.924  35.643  43.624  1.00 12.77 ? 187 SER B N   1 
ATOM   5472  C  CA  . SER B 1 187 ? -2.151  35.985  42.922  1.00 12.69 ? 187 SER B CA  1 
ATOM   5473  C  C   . SER B 1 187 ? -3.136  36.704  43.829  1.00 12.43 ? 187 SER B C   1 
ATOM   5474  O  O   . SER B 1 187 ? -4.051  37.363  43.351  1.00 12.50 ? 187 SER B O   1 
ATOM   5475  C  CB  . SER B 1 187 ? -2.800  34.728  42.341  1.00 13.24 ? 187 SER B CB  1 
ATOM   5476  O  OG  . SER B 1 187 ? -3.548  34.036  43.326  1.00 14.61 ? 187 SER B OG  1 
ATOM   5477  N  N   . LEU B 1 188 ? -2.949  36.580  45.138  1.00 12.45 ? 188 LEU B N   1 
ATOM   5478  C  CA  . LEU B 1 188 ? -3.834  37.241  46.093  1.00 12.32 ? 188 LEU B CA  1 
ATOM   5479  C  C   . LEU B 1 188 ? -3.310  38.624  46.483  1.00 12.16 ? 188 LEU B C   1 
ATOM   5480  O  O   . LEU B 1 188 ? -4.065  39.470  46.962  1.00 12.09 ? 188 LEU B O   1 
ATOM   5481  C  CB  . LEU B 1 188 ? -3.998  36.378  47.346  1.00 12.46 ? 188 LEU B CB  1 
ATOM   5482  C  CG  . LEU B 1 188 ? -4.698  35.036  47.113  1.00 12.61 ? 188 LEU B CG  1 
ATOM   5483  C  CD1 . LEU B 1 188 ? -4.740  34.239  48.412  1.00 12.39 ? 188 LEU B CD1 1 
ATOM   5484  C  CD2 . LEU B 1 188 ? -6.095  35.281  46.573  1.00 12.60 ? 188 LEU B CD2 1 
ATOM   5485  N  N   . ARG B 1 189 ? -2.016  38.848  46.271  1.00 11.98 ? 189 ARG B N   1 
ATOM   5486  C  CA  . ARG B 1 189 ? -1.396  40.125  46.600  1.00 11.94 ? 189 ARG B CA  1 
ATOM   5487  C  C   . ARG B 1 189 ? -0.846  40.791  45.344  1.00 12.02 ? 189 ARG B C   1 
ATOM   5488  O  O   . ARG B 1 189 ? 0.359   40.802  45.102  1.00 11.71 ? 189 ARG B O   1 
ATOM   5489  C  CB  . ARG B 1 189 ? -0.273  39.926  47.621  1.00 11.85 ? 189 ARG B CB  1 
ATOM   5490  C  CG  . ARG B 1 189 ? -0.601  38.939  48.738  1.00 11.80 ? 189 ARG B CG  1 
ATOM   5491  C  CD  . ARG B 1 189 ? -1.756  39.422  49.592  1.00 11.50 ? 189 ARG B CD  1 
ATOM   5492  N  NE  . ARG B 1 189 ? -1.457  40.690  50.247  1.00 11.05 ? 189 ARG B NE  1 
ATOM   5493  C  CZ  . ARG B 1 189 ? -2.355  41.416  50.899  1.00 10.65 ? 189 ARG B CZ  1 
ATOM   5494  N  NH1 . ARG B 1 189 ? -3.609  40.995  50.979  1.00 10.73 ? 189 ARG B NH1 1 
ATOM   5495  N  NH2 . ARG B 1 189 ? -2.001  42.563  51.460  1.00 10.00 ? 189 ARG B NH2 1 
ATOM   5496  N  N   . PRO B 1 190 ? -1.739  41.364  44.528  1.00 12.28 ? 190 PRO B N   1 
ATOM   5497  C  CA  . PRO B 1 190 ? -1.371  42.042  43.281  1.00 12.39 ? 190 PRO B CA  1 
ATOM   5498  C  C   . PRO B 1 190 ? -0.310  43.124  43.446  1.00 12.17 ? 190 PRO B C   1 
ATOM   5499  O  O   . PRO B 1 190 ? 0.166   43.687  42.458  1.00 11.96 ? 190 PRO B O   1 
ATOM   5500  C  CB  . PRO B 1 190 ? -2.699  42.613  42.768  1.00 12.71 ? 190 PRO B CB  1 
ATOM   5501  C  CG  . PRO B 1 190 ? -3.632  42.575  43.952  1.00 12.97 ? 190 PRO B CG  1 
ATOM   5502  C  CD  . PRO B 1 190 ? -3.193  41.396  44.759  1.00 12.65 ? 190 PRO B CD  1 
ATOM   5503  N  N   . GLU B 1 191 ? 0.053   43.415  44.692  1.00 12.09 ? 191 GLU B N   1 
ATOM   5504  C  CA  . GLU B 1 191 ? 1.062   44.430  44.971  1.00 12.02 ? 191 GLU B CA  1 
ATOM   5505  C  C   . GLU B 1 191 ? 2.448   43.900  44.632  1.00 12.11 ? 191 GLU B C   1 
ATOM   5506  O  O   . GLU B 1 191 ? 3.372   44.666  44.377  1.00 12.35 ? 191 GLU B O   1 
ATOM   5507  C  CB  . GLU B 1 191 ? 1.015   44.829  46.442  1.00 11.94 ? 191 GLU B CB  1 
ATOM   5508  C  CG  . GLU B 1 191 ? 1.468   43.726  47.383  1.00 11.80 ? 191 GLU B CG  1 
ATOM   5509  C  CD  . GLU B 1 191 ? 0.352   43.238  48.282  1.00 11.71 ? 191 GLU B CD  1 
ATOM   5510  O  OE1 . GLU B 1 191 ? -0.822  43.300  47.860  1.00 11.46 ? 191 GLU B OE1 1 
ATOM   5511  O  OE2 . GLU B 1 191 ? 0.650   42.793  49.410  1.00 11.75 ? 191 GLU B OE2 1 
ATOM   5512  N  N   . SER B 1 192 ? 2.578   42.580  44.625  1.00 12.23 ? 192 SER B N   1 
ATOM   5513  C  CA  . SER B 1 192 ? 3.846   41.926  44.324  1.00 11.97 ? 192 SER B CA  1 
ATOM   5514  C  C   . SER B 1 192 ? 4.151   41.943  42.826  1.00 12.12 ? 192 SER B C   1 
ATOM   5515  O  O   . SER B 1 192 ? 5.224   41.518  42.393  1.00 12.11 ? 192 SER B O   1 
ATOM   5516  C  CB  . SER B 1 192 ? 3.806   40.483  44.826  1.00 11.82 ? 192 SER B CB  1 
ATOM   5517  O  OG  . SER B 1 192 ? 2.600   39.844  44.432  1.00 11.34 ? 192 SER B OG  1 
ATOM   5518  N  N   . LEU B 1 193 ? 3.202   42.433  42.039  1.00 12.05 ? 193 LEU B N   1 
ATOM   5519  C  CA  . LEU B 1 193 ? 3.371   42.501  40.594  1.00 12.29 ? 193 LEU B CA  1 
ATOM   5520  C  C   . LEU B 1 193 ? 4.692   43.147  40.178  1.00 12.36 ? 193 LEU B C   1 
ATOM   5521  O  O   . LEU B 1 193 ? 5.476   42.553  39.439  1.00 12.33 ? 193 LEU B O   1 
ATOM   5522  C  CB  . LEU B 1 193 ? 2.211   43.272  39.971  1.00 12.32 ? 193 LEU B CB  1 
ATOM   5523  C  CG  . LEU B 1 193 ? 0.991   42.416  39.651  1.00 12.37 ? 193 LEU B CG  1 
ATOM   5524  C  CD1 . LEU B 1 193 ? -0.184  43.310  39.312  1.00 12.45 ? 193 LEU B CD1 1 
ATOM   5525  C  CD2 . LEU B 1 193 ? 1.314   41.486  38.494  1.00 12.63 ? 193 LEU B CD2 1 
ATOM   5526  N  N   . HIS B 1 194 ? 4.929   44.366  40.650  1.00 12.16 ? 194 HIS B N   1 
ATOM   5527  C  CA  . HIS B 1 194 ? 6.152   45.086  40.323  1.00 12.28 ? 194 HIS B CA  1 
ATOM   5528  C  C   . HIS B 1 194 ? 7.374   44.190  40.466  1.00 11.96 ? 194 HIS B C   1 
ATOM   5529  O  O   . HIS B 1 194 ? 8.029   43.864  39.480  1.00 11.71 ? 194 HIS B O   1 
ATOM   5530  C  CB  . HIS B 1 194 ? 6.306   46.313  41.229  1.00 12.60 ? 194 HIS B CB  1 
ATOM   5531  C  CG  . HIS B 1 194 ? 7.098   47.427  40.617  1.00 12.89 ? 194 HIS B CG  1 
ATOM   5532  N  ND1 . HIS B 1 194 ? 7.085   48.711  41.118  1.00 13.14 ? 194 HIS B ND1 1 
ATOM   5533  C  CD2 . HIS B 1 194 ? 7.931   47.449  39.549  1.00 13.03 ? 194 HIS B CD2 1 
ATOM   5534  C  CE1 . HIS B 1 194 ? 7.876   49.477  40.386  1.00 13.17 ? 194 HIS B CE1 1 
ATOM   5535  N  NE2 . HIS B 1 194 ? 8.401   48.735  39.427  1.00 13.10 ? 194 HIS B NE2 1 
ATOM   5536  N  N   . GLN B 1 195 ? 7.667   43.786  41.697  1.00 11.93 ? 195 GLN B N   1 
ATOM   5537  C  CA  . GLN B 1 195 ? 8.818   42.932  41.973  1.00 12.06 ? 195 GLN B CA  1 
ATOM   5538  C  C   . GLN B 1 195 ? 8.832   41.634  41.161  1.00 12.36 ? 195 GLN B C   1 
ATOM   5539  O  O   . GLN B 1 195 ? 9.885   41.197  40.693  1.00 12.32 ? 195 GLN B O   1 
ATOM   5540  C  CB  . GLN B 1 195 ? 8.875   42.602  43.467  1.00 11.80 ? 195 GLN B CB  1 
ATOM   5541  C  CG  . GLN B 1 195 ? 9.993   41.645  43.853  1.00 11.45 ? 195 GLN B CG  1 
ATOM   5542  C  CD  . GLN B 1 195 ? 11.375  42.189  43.539  1.00 11.20 ? 195 GLN B CD  1 
ATOM   5543  O  OE1 . GLN B 1 195 ? 11.638  43.381  43.700  1.00 11.32 ? 195 GLN B OE1 1 
ATOM   5544  N  NE2 . GLN B 1 195 ? 12.266  41.315  43.088  1.00 10.66 ? 195 GLN B NE2 1 
ATOM   5545  N  N   . VAL B 1 196 ? 7.666   41.014  41.000  1.00 12.69 ? 196 VAL B N   1 
ATOM   5546  C  CA  . VAL B 1 196 ? 7.569   39.768  40.241  1.00 12.87 ? 196 VAL B CA  1 
ATOM   5547  C  C   . VAL B 1 196 ? 8.035   39.991  38.813  1.00 12.86 ? 196 VAL B C   1 
ATOM   5548  O  O   . VAL B 1 196 ? 8.772   39.178  38.254  1.00 13.10 ? 196 VAL B O   1 
ATOM   5549  C  CB  . VAL B 1 196 ? 6.121   39.233  40.198  1.00 12.98 ? 196 VAL B CB  1 
ATOM   5550  C  CG1 . VAL B 1 196 ? 6.023   38.085  39.196  1.00 12.72 ? 196 VAL B CG1 1 
ATOM   5551  C  CG2 . VAL B 1 196 ? 5.693   38.765  41.596  1.00 13.20 ? 196 VAL B CG2 1 
ATOM   5552  N  N   . SER B 1 197 ? 7.587   41.095  38.226  1.00 13.02 ? 197 SER B N   1 
ATOM   5553  C  CA  . SER B 1 197 ? 7.970   41.444  36.864  1.00 12.91 ? 197 SER B CA  1 
ATOM   5554  C  C   . SER B 1 197 ? 9.487   41.583  36.796  1.00 12.96 ? 197 SER B C   1 
ATOM   5555  O  O   . SER B 1 197 ? 10.122  41.143  35.838  1.00 13.23 ? 197 SER B O   1 
ATOM   5556  C  CB  . SER B 1 197 ? 7.310   42.759  36.452  1.00 12.73 ? 197 SER B CB  1 
ATOM   5557  O  OG  . SER B 1 197 ? 5.897   42.641  36.477  1.00 12.31 ? 197 SER B OG  1 
ATOM   5558  N  N   . PHE B 1 198 ? 10.058  42.191  37.829  1.00 12.84 ? 198 PHE B N   1 
ATOM   5559  C  CA  . PHE B 1 198 ? 11.498  42.393  37.918  1.00 12.42 ? 198 PHE B CA  1 
ATOM   5560  C  C   . PHE B 1 198 ? 12.225  41.065  38.136  1.00 12.30 ? 198 PHE B C   1 
ATOM   5561  O  O   . PHE B 1 198 ? 13.276  40.823  37.548  1.00 12.19 ? 198 PHE B O   1 
ATOM   5562  C  CB  . PHE B 1 198 ? 11.814  43.353  39.073  1.00 12.38 ? 198 PHE B CB  1 
ATOM   5563  C  CG  . PHE B 1 198 ? 13.244  43.801  39.120  1.00 12.45 ? 198 PHE B CG  1 
ATOM   5564  C  CD1 . PHE B 1 198 ? 14.261  42.904  39.427  1.00 12.55 ? 198 PHE B CD1 1 
ATOM   5565  C  CD2 . PHE B 1 198 ? 13.579  45.119  38.841  1.00 12.50 ? 198 PHE B CD2 1 
ATOM   5566  C  CE1 . PHE B 1 198 ? 15.597  43.312  39.452  1.00 12.78 ? 198 PHE B CE1 1 
ATOM   5567  C  CE2 . PHE B 1 198 ? 14.910  45.541  38.863  1.00 12.73 ? 198 PHE B CE2 1 
ATOM   5568  C  CZ  . PHE B 1 198 ? 15.923  44.633  39.169  1.00 12.79 ? 198 PHE B CZ  1 
ATOM   5569  N  N   . LEU B 1 199 ? 11.665  40.207  38.980  1.00 12.28 ? 199 LEU B N   1 
ATOM   5570  C  CA  . LEU B 1 199 ? 12.293  38.922  39.273  1.00 12.62 ? 199 LEU B CA  1 
ATOM   5571  C  C   . LEU B 1 199 ? 12.355  37.984  38.078  1.00 12.73 ? 199 LEU B C   1 
ATOM   5572  O  O   . LEU B 1 199 ? 13.383  37.354  37.833  1.00 12.80 ? 199 LEU B O   1 
ATOM   5573  C  CB  . LEU B 1 199 ? 11.570  38.221  40.428  1.00 12.47 ? 199 LEU B CB  1 
ATOM   5574  C  CG  . LEU B 1 199 ? 11.980  36.771  40.709  1.00 12.35 ? 199 LEU B CG  1 
ATOM   5575  C  CD1 . LEU B 1 199 ? 13.479  36.681  40.925  1.00 12.41 ? 199 LEU B CD1 1 
ATOM   5576  C  CD2 . LEU B 1 199 ? 11.240  36.262  41.930  1.00 12.38 ? 199 LEU B CD2 1 
ATOM   5577  N  N   . PHE B 1 200 ? 11.254  37.889  37.339  1.00 12.97 ? 200 PHE B N   1 
ATOM   5578  C  CA  . PHE B 1 200 ? 11.183  37.006  36.178  1.00 12.84 ? 200 PHE B CA  1 
ATOM   5579  C  C   . PHE B 1 200 ? 11.799  37.620  34.927  1.00 12.69 ? 200 PHE B C   1 
ATOM   5580  O  O   . PHE B 1 200 ? 11.731  37.043  33.839  1.00 12.85 ? 200 PHE B O   1 
ATOM   5581  C  CB  . PHE B 1 200 ? 9.730   36.617  35.909  1.00 13.02 ? 200 PHE B CB  1 
ATOM   5582  C  CG  . PHE B 1 200 ? 9.200   35.584  36.855  1.00 12.95 ? 200 PHE B CG  1 
ATOM   5583  C  CD1 . PHE B 1 200 ? 8.517   35.961  38.005  1.00 12.91 ? 200 PHE B CD1 1 
ATOM   5584  C  CD2 . PHE B 1 200 ? 9.388   34.228  36.600  1.00 12.81 ? 200 PHE B CD2 1 
ATOM   5585  C  CE1 . PHE B 1 200 ? 8.026   35.001  38.892  1.00 12.71 ? 200 PHE B CE1 1 
ATOM   5586  C  CE2 . PHE B 1 200 ? 8.904   33.260  37.476  1.00 12.52 ? 200 PHE B CE2 1 
ATOM   5587  C  CZ  . PHE B 1 200 ? 8.220   33.647  38.626  1.00 12.52 ? 200 PHE B CZ  1 
ATOM   5588  N  N   . SER B 1 201 ? 12.394  38.795  35.083  1.00 12.38 ? 201 SER B N   1 
ATOM   5589  C  CA  . SER B 1 201 ? 13.039  39.466  33.968  1.00 12.01 ? 201 SER B CA  1 
ATOM   5590  C  C   . SER B 1 201 ? 14.430  38.854  33.787  1.00 12.42 ? 201 SER B C   1 
ATOM   5591  O  O   . SER B 1 201 ? 14.721  37.776  34.313  1.00 12.39 ? 201 SER B O   1 
ATOM   5592  C  CB  . SER B 1 201 ? 13.151  40.964  34.249  1.00 11.37 ? 201 SER B CB  1 
ATOM   5593  O  OG  . SER B 1 201 ? 14.401  41.278  34.829  1.00 10.51 ? 201 SER B OG  1 
ATOM   5594  N  N   . ASP B 1 202 ? 15.289  39.539  33.042  1.00 12.43 ? 202 ASP B N   1 
ATOM   5595  C  CA  . ASP B 1 202 ? 16.638  39.042  32.804  1.00 12.65 ? 202 ASP B CA  1 
ATOM   5596  C  C   . ASP B 1 202 ? 17.519  39.217  34.040  1.00 12.45 ? 202 ASP B C   1 
ATOM   5597  O  O   . ASP B 1 202 ? 18.380  38.386  34.321  1.00 12.51 ? 202 ASP B O   1 
ATOM   5598  C  CB  . ASP B 1 202 ? 17.265  39.774  31.614  1.00 12.91 ? 202 ASP B CB  1 
ATOM   5599  C  CG  . ASP B 1 202 ? 16.618  39.404  30.298  1.00 12.99 ? 202 ASP B CG  1 
ATOM   5600  O  OD1 . ASP B 1 202 ? 16.004  38.321  30.227  1.00 12.95 ? 202 ASP B OD1 1 
ATOM   5601  O  OD2 . ASP B 1 202 ? 16.728  40.194  29.335  1.00 13.07 ? 202 ASP B OD2 1 
ATOM   5602  N  N   . ARG B 1 203 ? 17.299  40.303  34.774  1.00 12.49 ? 203 ARG B N   1 
ATOM   5603  C  CA  . ARG B 1 203 ? 18.072  40.585  35.979  1.00 12.50 ? 203 ARG B CA  1 
ATOM   5604  C  C   . ARG B 1 203 ? 17.740  39.576  37.075  1.00 12.55 ? 203 ARG B C   1 
ATOM   5605  O  O   . ARG B 1 203 ? 18.289  39.639  38.175  1.00 12.48 ? 203 ARG B O   1 
ATOM   5606  C  CB  . ARG B 1 203 ? 17.788  42.008  36.481  1.00 12.46 ? 203 ARG B CB  1 
ATOM   5607  C  CG  . ARG B 1 203 ? 18.189  43.125  35.510  1.00 12.51 ? 203 ARG B CG  1 
ATOM   5608  C  CD  . ARG B 1 203 ? 19.281  44.014  36.092  1.00 12.71 ? 203 ARG B CD  1 
ATOM   5609  N  NE  . ARG B 1 203 ? 18.820  45.381  36.341  1.00 13.18 ? 203 ARG B NE  1 
ATOM   5610  C  CZ  . ARG B 1 203 ? 19.235  46.147  37.353  1.00 13.52 ? 203 ARG B CZ  1 
ATOM   5611  N  NH1 . ARG B 1 203 ? 20.129  45.690  38.228  1.00 13.61 ? 203 ARG B NH1 1 
ATOM   5612  N  NH2 . ARG B 1 203 ? 18.760  47.379  37.493  1.00 13.76 ? 203 ARG B NH2 1 
ATOM   5613  N  N   . GLY B 1 204 ? 16.845  38.643  36.761  1.00 12.55 ? 204 GLY B N   1 
ATOM   5614  C  CA  . GLY B 1 204 ? 16.458  37.630  37.723  1.00 12.33 ? 204 GLY B CA  1 
ATOM   5615  C  C   . GLY B 1 204 ? 17.597  36.727  38.156  1.00 12.26 ? 204 GLY B C   1 
ATOM   5616  O  O   . GLY B 1 204 ? 17.630  36.281  39.299  1.00 12.50 ? 204 GLY B O   1 
ATOM   5617  N  N   . ILE B 1 205 ? 18.533  36.451  37.253  1.00 12.22 ? 205 ILE B N   1 
ATOM   5618  C  CA  . ILE B 1 205 ? 19.663  35.585  37.575  1.00 11.88 ? 205 ILE B CA  1 
ATOM   5619  C  C   . ILE B 1 205 ? 21.000  36.218  37.203  1.00 12.04 ? 205 ILE B C   1 
ATOM   5620  O  O   . ILE B 1 205 ? 21.567  35.914  36.161  1.00 11.90 ? 205 ILE B O   1 
ATOM   5621  C  CB  . ILE B 1 205 ? 19.545  34.232  36.850  1.00 11.68 ? 205 ILE B CB  1 
ATOM   5622  C  CG1 . ILE B 1 205 ? 18.136  33.668  37.028  1.00 11.45 ? 205 ILE B CG1 1 
ATOM   5623  C  CG2 . ILE B 1 205 ? 20.566  33.255  37.407  1.00 11.65 ? 205 ILE B CG2 1 
ATOM   5624  C  CD1 . ILE B 1 205 ? 17.907  32.351  36.321  1.00 11.27 ? 205 ILE B CD1 1 
ATOM   5625  N  N   . PRO B 1 206 ? 21.530  37.101  38.064  1.00 12.28 ? 206 PRO B N   1 
ATOM   5626  C  CA  . PRO B 1 206 ? 22.812  37.745  37.761  1.00 12.50 ? 206 PRO B CA  1 
ATOM   5627  C  C   . PRO B 1 206 ? 23.934  36.742  37.516  1.00 12.80 ? 206 PRO B C   1 
ATOM   5628  O  O   . PRO B 1 206 ? 23.902  35.625  38.025  1.00 12.99 ? 206 PRO B O   1 
ATOM   5629  C  CB  . PRO B 1 206 ? 23.079  38.623  38.984  1.00 12.41 ? 206 PRO B CB  1 
ATOM   5630  C  CG  . PRO B 1 206 ? 22.195  38.086  40.053  1.00 12.30 ? 206 PRO B CG  1 
ATOM   5631  C  CD  . PRO B 1 206 ? 20.988  37.544  39.359  1.00 12.28 ? 206 PRO B CD  1 
ATOM   5632  N  N   . ASP B 1 207 ? 24.919  37.151  36.726  1.00 12.84 ? 207 ASP B N   1 
ATOM   5633  C  CA  . ASP B 1 207 ? 26.054  36.297  36.409  1.00 12.93 ? 207 ASP B CA  1 
ATOM   5634  C  C   . ASP B 1 207 ? 27.151  36.515  37.440  1.00 13.08 ? 207 ASP B C   1 
ATOM   5635  O  O   . ASP B 1 207 ? 28.254  36.958  37.112  1.00 13.23 ? 207 ASP B O   1 
ATOM   5636  C  CB  . ASP B 1 207 ? 26.584  36.621  35.008  1.00 12.72 ? 207 ASP B CB  1 
ATOM   5637  C  CG  . ASP B 1 207 ? 27.794  35.790  34.635  1.00 12.48 ? 207 ASP B CG  1 
ATOM   5638  O  OD1 . ASP B 1 207 ? 28.288  35.946  33.497  1.00 12.31 ? 207 ASP B OD1 1 
ATOM   5639  O  OD2 . ASP B 1 207 ? 28.248  34.984  35.476  1.00 12.51 ? 207 ASP B OD2 1 
ATOM   5640  N  N   . GLY B 1 208 ? 26.843  36.194  38.689  1.00 12.85 ? 208 GLY B N   1 
ATOM   5641  C  CA  . GLY B 1 208 ? 27.810  36.373  39.754  1.00 12.84 ? 208 GLY B CA  1 
ATOM   5642  C  C   . GLY B 1 208 ? 27.344  37.473  40.683  1.00 12.78 ? 208 GLY B C   1 
ATOM   5643  O  O   . GLY B 1 208 ? 26.278  38.057  40.470  1.00 12.57 ? 208 GLY B O   1 
ATOM   5644  N  N   . HIS B 1 209 ? 28.131  37.762  41.713  1.00 12.49 ? 209 HIS B N   1 
ATOM   5645  C  CA  . HIS B 1 209 ? 27.762  38.803  42.664  1.00 12.61 ? 209 HIS B CA  1 
ATOM   5646  C  C   . HIS B 1 209 ? 28.320  40.156  42.240  1.00 12.53 ? 209 HIS B C   1 
ATOM   5647  O  O   . HIS B 1 209 ? 27.837  41.203  42.667  1.00 12.58 ? 209 HIS B O   1 
ATOM   5648  C  CB  . HIS B 1 209 ? 28.285  38.455  44.058  1.00 12.55 ? 209 HIS B CB  1 
ATOM   5649  C  CG  . HIS B 1 209 ? 27.768  37.156  44.595  1.00 12.44 ? 209 HIS B CG  1 
ATOM   5650  N  ND1 . HIS B 1 209 ? 26.430  36.932  44.842  1.00 12.51 ? 209 HIS B ND1 1 
ATOM   5651  C  CD2 . HIS B 1 209 ? 28.414  36.024  44.964  1.00 12.28 ? 209 HIS B CD2 1 
ATOM   5652  C  CE1 . HIS B 1 209 ? 26.274  35.718  45.341  1.00 12.41 ? 209 HIS B CE1 1 
ATOM   5653  N  NE2 . HIS B 1 209 ? 27.463  35.147  45.426  1.00 12.24 ? 209 HIS B NE2 1 
ATOM   5654  N  N   . ARG B 1 210 ? 29.334  40.125  41.385  1.00 12.21 ? 210 ARG B N   1 
ATOM   5655  C  CA  . ARG B 1 210 ? 29.971  41.345  40.928  1.00 11.96 ? 210 ARG B CA  1 
ATOM   5656  C  C   . ARG B 1 210 ? 29.272  42.000  39.743  1.00 11.77 ? 210 ARG B C   1 
ATOM   5657  O  O   . ARG B 1 210 ? 29.542  43.156  39.419  1.00 11.53 ? 210 ARG B O   1 
ATOM   5658  C  CB  . ARG B 1 210 ? 31.429  41.057  40.576  1.00 12.04 ? 210 ARG B CB  1 
ATOM   5659  C  CG  . ARG B 1 210 ? 32.221  40.449  41.716  1.00 11.94 ? 210 ARG B CG  1 
ATOM   5660  C  CD  . ARG B 1 210 ? 33.598  40.030  41.257  1.00 11.87 ? 210 ARG B CD  1 
ATOM   5661  N  NE  . ARG B 1 210 ? 33.554  38.872  40.368  1.00 11.73 ? 210 ARG B NE  1 
ATOM   5662  C  CZ  . ARG B 1 210 ? 34.043  38.862  39.133  1.00 11.62 ? 210 ARG B CZ  1 
ATOM   5663  N  NH1 . ARG B 1 210 ? 34.614  39.949  38.634  1.00 11.22 ? 210 ARG B NH1 1 
ATOM   5664  N  NH2 . ARG B 1 210 ? 33.957  37.765  38.397  1.00 11.67 ? 210 ARG B NH2 1 
ATOM   5665  N  N   . HIS B 1 211 ? 28.367  41.270  39.104  1.00 11.92 ? 211 HIS B N   1 
ATOM   5666  C  CA  . HIS B 1 211 ? 27.656  41.811  37.955  1.00 11.98 ? 211 HIS B CA  1 
ATOM   5667  C  C   . HIS B 1 211 ? 26.223  42.228  38.266  1.00 12.12 ? 211 HIS B C   1 
ATOM   5668  O  O   . HIS B 1 211 ? 25.350  42.186  37.398  1.00 12.48 ? 211 HIS B O   1 
ATOM   5669  C  CB  . HIS B 1 211 ? 27.672  40.793  36.825  1.00 11.75 ? 211 HIS B CB  1 
ATOM   5670  C  CG  . HIS B 1 211 ? 29.027  40.587  36.231  1.00 11.60 ? 211 HIS B CG  1 
ATOM   5671  N  ND1 . HIS B 1 211 ? 29.895  41.631  35.994  1.00 11.53 ? 211 HIS B ND1 1 
ATOM   5672  C  CD2 . HIS B 1 211 ? 29.669  39.464  35.836  1.00 11.48 ? 211 HIS B CD2 1 
ATOM   5673  C  CE1 . HIS B 1 211 ? 31.015  41.158  35.476  1.00 11.61 ? 211 HIS B CE1 1 
ATOM   5674  N  NE2 . HIS B 1 211 ? 30.903  39.846  35.370  1.00 11.57 ? 211 HIS B NE2 1 
ATOM   5675  N  N   . MET B 1 212 ? 25.987  42.640  39.505  1.00 11.91 ? 212 MET B N   1 
ATOM   5676  C  CA  . MET B 1 212 ? 24.664  43.073  39.916  1.00 11.50 ? 212 MET B CA  1 
ATOM   5677  C  C   . MET B 1 212 ? 24.764  44.380  40.687  1.00 11.85 ? 212 MET B C   1 
ATOM   5678  O  O   . MET B 1 212 ? 25.817  44.712  41.229  1.00 11.97 ? 212 MET B O   1 
ATOM   5679  C  CB  . MET B 1 212 ? 24.003  42.002  40.785  1.00 10.77 ? 212 MET B CB  1 
ATOM   5680  C  CG  . MET B 1 212 ? 24.685  41.760  42.130  1.00 9.72  ? 212 MET B CG  1 
ATOM   5681  S  SD  . MET B 1 212 ? 23.949  40.386  43.064  1.00 8.57  ? 212 MET B SD  1 
ATOM   5682  C  CE  . MET B 1 212 ? 24.849  40.473  44.576  1.00 8.87  ? 212 MET B CE  1 
ATOM   5683  N  N   . ASN B 1 213 ? 23.665  45.125  40.726  1.00 12.14 ? 213 ASN B N   1 
ATOM   5684  C  CA  . ASN B 1 213 ? 23.637  46.391  41.442  1.00 12.23 ? 213 ASN B CA  1 
ATOM   5685  C  C   . ASN B 1 213 ? 23.130  46.156  42.854  1.00 12.42 ? 213 ASN B C   1 
ATOM   5686  O  O   . ASN B 1 213 ? 22.782  45.030  43.223  1.00 12.47 ? 213 ASN B O   1 
ATOM   5687  C  CB  . ASN B 1 213 ? 22.728  47.393  40.729  1.00 11.93 ? 213 ASN B CB  1 
ATOM   5688  C  CG  . ASN B 1 213 ? 23.440  48.142  39.617  1.00 11.72 ? 213 ASN B CG  1 
ATOM   5689  O  OD1 . ASN B 1 213 ? 24.649  47.992  39.424  1.00 11.15 ? 213 ASN B OD1 1 
ATOM   5690  N  ND2 . ASN B 1 213 ? 22.689  48.954  38.877  1.00 11.72 ? 213 ASN B ND2 1 
ATOM   5691  N  N   . GLY B 1 214 ? 23.102  47.221  43.642  1.00 12.60 ? 214 GLY B N   1 
ATOM   5692  C  CA  . GLY B 1 214 ? 22.631  47.109  45.005  1.00 12.92 ? 214 GLY B CA  1 
ATOM   5693  C  C   . GLY B 1 214 ? 21.877  48.358  45.398  1.00 13.12 ? 214 GLY B C   1 
ATOM   5694  O  O   . GLY B 1 214 ? 22.246  49.464  45.003  1.00 13.18 ? 214 GLY B O   1 
ATOM   5695  N  N   . TYR B 1 215 ? 20.807  48.184  46.165  1.00 13.14 ? 215 TYR B N   1 
ATOM   5696  C  CA  . TYR B 1 215 ? 20.008  49.314  46.617  1.00 13.11 ? 215 TYR B CA  1 
ATOM   5697  C  C   . TYR B 1 215 ? 19.673  49.118  48.090  1.00 13.03 ? 215 TYR B C   1 
ATOM   5698  O  O   . TYR B 1 215 ? 19.698  47.992  48.589  1.00 13.12 ? 215 TYR B O   1 
ATOM   5699  C  CB  . TYR B 1 215 ? 18.715  49.414  45.800  1.00 13.14 ? 215 TYR B CB  1 
ATOM   5700  C  CG  . TYR B 1 215 ? 18.904  49.179  44.316  1.00 13.27 ? 215 TYR B CG  1 
ATOM   5701  C  CD1 . TYR B 1 215 ? 19.150  50.242  43.449  1.00 13.51 ? 215 TYR B CD1 1 
ATOM   5702  C  CD2 . TYR B 1 215 ? 18.853  47.894  43.780  1.00 13.14 ? 215 TYR B CD2 1 
ATOM   5703  C  CE1 . TYR B 1 215 ? 19.346  50.031  42.082  1.00 13.63 ? 215 TYR B CE1 1 
ATOM   5704  C  CE2 . TYR B 1 215 ? 19.047  47.672  42.423  1.00 13.27 ? 215 TYR B CE2 1 
ATOM   5705  C  CZ  . TYR B 1 215 ? 19.295  48.743  41.579  1.00 13.52 ? 215 TYR B CZ  1 
ATOM   5706  O  OH  . TYR B 1 215 ? 19.508  48.529  40.234  1.00 13.76 ? 215 TYR B OH  1 
ATOM   5707  N  N   . GLY B 1 216 ? 19.385  50.215  48.786  1.00 12.75 ? 216 GLY B N   1 
ATOM   5708  C  CA  . GLY B 1 216 ? 19.021  50.111  50.185  1.00 12.52 ? 216 GLY B CA  1 
ATOM   5709  C  C   . GLY B 1 216 ? 17.586  49.623  50.221  1.00 12.30 ? 216 GLY B C   1 
ATOM   5710  O  O   . GLY B 1 216 ? 17.134  49.036  51.207  1.00 12.18 ? 216 GLY B O   1 
ATOM   5711  N  N   . SER B 1 217 ? 16.882  49.879  49.119  1.00 11.99 ? 217 SER B N   1 
ATOM   5712  C  CA  . SER B 1 217 ? 15.491  49.486  48.933  1.00 11.64 ? 217 SER B CA  1 
ATOM   5713  C  C   . SER B 1 217 ? 14.491  50.378  49.643  1.00 11.48 ? 217 SER B C   1 
ATOM   5714  O  O   . SER B 1 217 ? 13.577  50.902  49.014  1.00 11.49 ? 217 SER B O   1 
ATOM   5715  C  CB  . SER B 1 217 ? 15.284  48.040  49.371  1.00 11.81 ? 217 SER B CB  1 
ATOM   5716  O  OG  . SER B 1 217 ? 15.144  47.195  48.243  1.00 12.23 ? 217 SER B OG  1 
ATOM   5717  N  N   . HIS B 1 218 ? 14.658  50.549  50.952  1.00 11.58 ? 218 HIS B N   1 
ATOM   5718  C  CA  . HIS B 1 218 ? 13.748  51.384  51.731  1.00 11.33 ? 218 HIS B CA  1 
ATOM   5719  C  C   . HIS B 1 218 ? 14.075  52.865  51.629  1.00 11.24 ? 218 HIS B C   1 
ATOM   5720  O  O   . HIS B 1 218 ? 15.072  53.266  51.030  1.00 11.24 ? 218 HIS B O   1 
ATOM   5721  C  CB  . HIS B 1 218 ? 13.776  50.991  53.210  1.00 11.33 ? 218 HIS B CB  1 
ATOM   5722  C  CG  . HIS B 1 218 ? 13.556  49.533  53.460  1.00 11.47 ? 218 HIS B CG  1 
ATOM   5723  N  ND1 . HIS B 1 218 ? 12.300  48.970  53.516  1.00 11.50 ? 218 HIS B ND1 1 
ATOM   5724  C  CD2 . HIS B 1 218 ? 14.432  48.526  53.691  1.00 11.55 ? 218 HIS B CD2 1 
ATOM   5725  C  CE1 . HIS B 1 218 ? 12.411  47.678  53.773  1.00 11.66 ? 218 HIS B CE1 1 
ATOM   5726  N  NE2 . HIS B 1 218 ? 13.695  47.383  53.884  1.00 11.64 ? 218 HIS B NE2 1 
ATOM   5727  N  N   . THR B 1 219 ? 13.211  53.672  52.228  1.00 11.55 ? 219 THR B N   1 
ATOM   5728  C  CA  . THR B 1 219 ? 13.389  55.114  52.259  1.00 11.76 ? 219 THR B CA  1 
ATOM   5729  C  C   . THR B 1 219 ? 13.970  55.479  53.620  1.00 11.77 ? 219 THR B C   1 
ATOM   5730  O  O   . THR B 1 219 ? 13.296  55.365  54.643  1.00 11.64 ? 219 THR B O   1 
ATOM   5731  C  CB  . THR B 1 219 ? 12.048  55.850  52.092  1.00 11.91 ? 219 THR B CB  1 
ATOM   5732  O  OG1 . THR B 1 219 ? 11.613  55.745  50.732  1.00 12.58 ? 219 THR B OG1 1 
ATOM   5733  C  CG2 . THR B 1 219 ? 12.200  57.317  52.459  1.00 12.00 ? 219 THR B CG2 1 
ATOM   5734  N  N   . PHE B 1 220 ? 15.223  55.905  53.638  1.00 11.56 ? 220 PHE B N   1 
ATOM   5735  C  CA  . PHE B 1 220 ? 15.844  56.289  54.889  1.00 11.65 ? 220 PHE B CA  1 
ATOM   5736  C  C   . PHE B 1 220 ? 15.755  57.798  55.071  1.00 11.77 ? 220 PHE B C   1 
ATOM   5737  O  O   . PHE B 1 220 ? 15.264  58.514  54.194  1.00 11.71 ? 220 PHE B O   1 
ATOM   5738  C  CB  . PHE B 1 220 ? 17.300  55.823  54.916  1.00 11.55 ? 220 PHE B CB  1 
ATOM   5739  C  CG  . PHE B 1 220 ? 17.449  54.328  54.958  1.00 11.40 ? 220 PHE B CG  1 
ATOM   5740  C  CD1 . PHE B 1 220 ? 17.571  53.595  53.781  1.00 11.21 ? 220 PHE B CD1 1 
ATOM   5741  C  CD2 . PHE B 1 220 ? 17.437  53.645  56.175  1.00 11.46 ? 220 PHE B CD2 1 
ATOM   5742  C  CE1 . PHE B 1 220 ? 17.674  52.203  53.811  1.00 11.13 ? 220 PHE B CE1 1 
ATOM   5743  C  CE2 . PHE B 1 220 ? 17.541  52.249  56.217  1.00 11.44 ? 220 PHE B CE2 1 
ATOM   5744  C  CZ  . PHE B 1 220 ? 17.658  51.529  55.030  1.00 11.26 ? 220 PHE B CZ  1 
ATOM   5745  N  N   . LYS B 1 221 ? 16.215  58.271  56.223  1.00 12.10 ? 221 LYS B N   1 
ATOM   5746  C  CA  . LYS B 1 221 ? 16.191  59.692  56.537  1.00 12.20 ? 221 LYS B CA  1 
ATOM   5747  C  C   . LYS B 1 221 ? 17.600  60.136  56.879  1.00 12.17 ? 221 LYS B C   1 
ATOM   5748  O  O   . LYS B 1 221 ? 18.330  59.422  57.563  1.00 12.38 ? 221 LYS B O   1 
ATOM   5749  C  CB  . LYS B 1 221 ? 15.256  59.944  57.720  1.00 12.37 ? 221 LYS B CB  1 
ATOM   5750  C  CG  . LYS B 1 221 ? 15.310  61.348  58.291  1.00 12.50 ? 221 LYS B CG  1 
ATOM   5751  C  CD  . LYS B 1 221 ? 14.179  61.571  59.294  1.00 12.41 ? 221 LYS B CD  1 
ATOM   5752  C  CE  . LYS B 1 221 ? 14.710  61.701  60.715  1.00 12.39 ? 221 LYS B CE  1 
ATOM   5753  N  NZ  . LYS B 1 221 ? 13.632  61.524  61.735  1.00 12.43 ? 221 LYS B NZ  1 
ATOM   5754  N  N   . LEU B 1 222 ? 17.983  61.311  56.392  1.00 12.13 ? 222 LEU B N   1 
ATOM   5755  C  CA  . LEU B 1 222 ? 19.314  61.845  56.646  1.00 11.93 ? 222 LEU B CA  1 
ATOM   5756  C  C   . LEU B 1 222 ? 19.200  63.150  57.423  1.00 12.04 ? 222 LEU B C   1 
ATOM   5757  O  O   . LEU B 1 222 ? 18.257  63.917  57.215  1.00 11.85 ? 222 LEU B O   1 
ATOM   5758  C  CB  . LEU B 1 222 ? 20.037  62.090  55.323  1.00 12.07 ? 222 LEU B CB  1 
ATOM   5759  C  CG  . LEU B 1 222 ? 20.386  60.857  54.484  1.00 12.11 ? 222 LEU B CG  1 
ATOM   5760  C  CD1 . LEU B 1 222 ? 20.952  61.294  53.155  1.00 12.08 ? 222 LEU B CD1 1 
ATOM   5761  C  CD2 . LEU B 1 222 ? 21.394  59.995  55.226  1.00 12.36 ? 222 LEU B CD2 1 
ATOM   5762  N  N   . VAL B 1 223 ? 20.157  63.391  58.320  1.00 11.84 ? 223 VAL B N   1 
ATOM   5763  C  CA  . VAL B 1 223 ? 20.164  64.603  59.132  1.00 11.86 ? 223 VAL B CA  1 
ATOM   5764  C  C   . VAL B 1 223 ? 21.541  65.267  59.127  1.00 11.94 ? 223 VAL B C   1 
ATOM   5765  O  O   . VAL B 1 223 ? 22.559  64.623  59.388  1.00 11.99 ? 223 VAL B O   1 
ATOM   5766  C  CB  . VAL B 1 223 ? 19.771  64.297  60.595  1.00 11.79 ? 223 VAL B CB  1 
ATOM   5767  C  CG1 . VAL B 1 223 ? 19.802  65.572  61.424  1.00 11.92 ? 223 VAL B CG1 1 
ATOM   5768  C  CG2 . VAL B 1 223 ? 18.394  63.676  60.642  1.00 11.59 ? 223 VAL B CG2 1 
ATOM   5769  N  N   . ASN B 1 224 ? 21.566  66.563  58.838  1.00 11.91 ? 224 ASN B N   1 
ATOM   5770  C  CA  . ASN B 1 224 ? 22.817  67.309  58.799  1.00 12.21 ? 224 ASN B CA  1 
ATOM   5771  C  C   . ASN B 1 224 ? 23.153  67.971  60.141  1.00 12.39 ? 224 ASN B C   1 
ATOM   5772  O  O   . ASN B 1 224 ? 22.298  68.092  61.020  1.00 12.44 ? 224 ASN B O   1 
ATOM   5773  C  CB  . ASN B 1 224 ? 22.762  68.363  57.682  1.00 11.90 ? 224 ASN B CB  1 
ATOM   5774  C  CG  . ASN B 1 224 ? 21.896  69.555  58.040  1.00 11.64 ? 224 ASN B CG  1 
ATOM   5775  O  OD1 . ASN B 1 224 ? 21.182  69.543  59.041  1.00 11.60 ? 224 ASN B OD1 1 
ATOM   5776  N  ND2 . ASN B 1 224 ? 21.957  70.596  57.217  1.00 11.58 ? 224 ASN B ND2 1 
ATOM   5777  N  N   . ALA B 1 225 ? 24.401  68.404  60.285  1.00 12.53 ? 225 ALA B N   1 
ATOM   5778  C  CA  . ALA B 1 225 ? 24.875  69.044  61.510  1.00 12.78 ? 225 ALA B CA  1 
ATOM   5779  C  C   . ALA B 1 225 ? 23.965  70.147  62.043  1.00 12.94 ? 225 ALA B C   1 
ATOM   5780  O  O   . ALA B 1 225 ? 24.174  70.639  63.154  1.00 12.92 ? 225 ALA B O   1 
ATOM   5781  C  CB  . ALA B 1 225 ? 26.274  69.594  61.295  1.00 12.65 ? 225 ALA B CB  1 
ATOM   5782  N  N   . ASN B 1 226 ? 22.962  70.539  61.262  1.00 13.04 ? 226 ASN B N   1 
ATOM   5783  C  CA  . ASN B 1 226 ? 22.037  71.585  61.700  1.00 13.51 ? 226 ASN B CA  1 
ATOM   5784  C  C   . ASN B 1 226 ? 20.637  71.031  61.983  1.00 13.57 ? 226 ASN B C   1 
ATOM   5785  O  O   . ASN B 1 226 ? 19.648  71.763  61.927  1.00 13.71 ? 226 ASN B O   1 
ATOM   5786  C  CB  . ASN B 1 226 ? 21.948  72.697  60.646  1.00 13.32 ? 226 ASN B CB  1 
ATOM   5787  C  CG  . ASN B 1 226 ? 23.239  73.488  60.517  1.00 13.28 ? 226 ASN B CG  1 
ATOM   5788  O  OD1 . ASN B 1 226 ? 23.610  73.914  59.424  1.00 13.17 ? 226 ASN B OD1 1 
ATOM   5789  N  ND2 . ASN B 1 226 ? 23.930  73.688  61.636  1.00 13.35 ? 226 ASN B ND2 1 
ATOM   5790  N  N   . GLY B 1 227 ? 20.558  69.737  62.281  1.00 13.45 ? 227 GLY B N   1 
ATOM   5791  C  CA  . GLY B 1 227 ? 19.272  69.126  62.564  1.00 13.26 ? 227 GLY B CA  1 
ATOM   5792  C  C   . GLY B 1 227 ? 18.296  69.152  61.403  1.00 13.09 ? 227 GLY B C   1 
ATOM   5793  O  O   . GLY B 1 227 ? 17.098  68.941  61.596  1.00 13.14 ? 227 GLY B O   1 
ATOM   5794  N  N   . GLU B 1 228 ? 18.796  69.421  60.200  1.00 12.88 ? 228 GLU B N   1 
ATOM   5795  C  CA  . GLU B 1 228 ? 17.944  69.452  59.014  1.00 12.78 ? 228 GLU B CA  1 
ATOM   5796  C  C   . GLU B 1 228 ? 17.845  68.038  58.459  1.00 12.46 ? 228 GLU B C   1 
ATOM   5797  O  O   . GLU B 1 228 ? 18.849  67.348  58.300  1.00 11.87 ? 228 GLU B O   1 
ATOM   5798  C  CB  . GLU B 1 228 ? 18.521  70.403  57.966  1.00 13.22 ? 228 GLU B CB  1 
ATOM   5799  C  CG  . GLU B 1 228 ? 18.995  71.725  58.566  1.00 14.29 ? 228 GLU B CG  1 
ATOM   5800  C  CD  . GLU B 1 228 ? 18.775  72.919  57.645  1.00 14.89 ? 228 GLU B CD  1 
ATOM   5801  O  OE1 . GLU B 1 228 ? 17.898  73.764  57.955  1.00 15.09 ? 228 GLU B OE1 1 
ATOM   5802  O  OE2 . GLU B 1 228 ? 19.487  73.013  56.618  1.00 15.25 ? 228 GLU B OE2 1 
ATOM   5803  N  N   . ALA B 1 229 ? 16.625  67.603  58.177  1.00 12.29 ? 229 ALA B N   1 
ATOM   5804  C  CA  . ALA B 1 229 ? 16.419  66.262  57.667  1.00 12.81 ? 229 ALA B CA  1 
ATOM   5805  C  C   . ALA B 1 229 ? 15.908  66.227  56.230  1.00 13.14 ? 229 ALA B C   1 
ATOM   5806  O  O   . ALA B 1 229 ? 15.272  67.168  55.750  1.00 13.38 ? 229 ALA B O   1 
ATOM   5807  C  CB  . ALA B 1 229 ? 15.462  65.504  58.583  1.00 12.46 ? 229 ALA B CB  1 
ATOM   5808  N  N   . VAL B 1 230 ? 16.210  65.124  55.555  1.00 13.34 ? 230 VAL B N   1 
ATOM   5809  C  CA  . VAL B 1 230 ? 15.794  64.886  54.177  1.00 13.38 ? 230 VAL B CA  1 
ATOM   5810  C  C   . VAL B 1 230 ? 15.741  63.379  53.995  1.00 13.29 ? 230 VAL B C   1 
ATOM   5811  O  O   . VAL B 1 230 ? 16.456  62.645  54.678  1.00 13.41 ? 230 VAL B O   1 
ATOM   5812  C  CB  . VAL B 1 230 ? 16.797  65.465  53.162  1.00 13.36 ? 230 VAL B CB  1 
ATOM   5813  C  CG1 . VAL B 1 230 ? 16.640  66.973  53.091  1.00 13.54 ? 230 VAL B CG1 1 
ATOM   5814  C  CG2 . VAL B 1 230 ? 18.220  65.084  53.555  1.00 13.16 ? 230 VAL B CG2 1 
ATOM   5815  N  N   . TYR B 1 231 ? 14.890  62.915  53.090  1.00 13.14 ? 231 TYR B N   1 
ATOM   5816  C  CA  . TYR B 1 231 ? 14.772  61.487  52.846  1.00 12.98 ? 231 TYR B CA  1 
ATOM   5817  C  C   . TYR B 1 231 ? 15.729  61.060  51.736  1.00 12.83 ? 231 TYR B C   1 
ATOM   5818  O  O   . TYR B 1 231 ? 16.246  61.899  50.996  1.00 12.73 ? 231 TYR B O   1 
ATOM   5819  C  CB  . TYR B 1 231 ? 13.334  61.145  52.480  1.00 13.03 ? 231 TYR B CB  1 
ATOM   5820  C  CG  . TYR B 1 231 ? 12.364  61.365  53.617  1.00 13.19 ? 231 TYR B CG  1 
ATOM   5821  C  CD1 . TYR B 1 231 ? 12.281  60.457  54.671  1.00 13.35 ? 231 TYR B CD1 1 
ATOM   5822  C  CD2 . TYR B 1 231 ? 11.522  62.475  53.638  1.00 13.25 ? 231 TYR B CD2 1 
ATOM   5823  C  CE1 . TYR B 1 231 ? 11.382  60.648  55.718  1.00 13.63 ? 231 TYR B CE1 1 
ATOM   5824  C  CE2 . TYR B 1 231 ? 10.621  62.677  54.675  1.00 13.51 ? 231 TYR B CE2 1 
ATOM   5825  C  CZ  . TYR B 1 231 ? 10.553  61.762  55.713  1.00 13.66 ? 231 TYR B CZ  1 
ATOM   5826  O  OH  . TYR B 1 231 ? 9.655   61.953  56.743  1.00 14.04 ? 231 TYR B OH  1 
ATOM   5827  N  N   . CYS B 1 232 ? 15.971  59.759  51.620  1.00 12.70 ? 232 CYS B N   1 
ATOM   5828  C  CA  . CYS B 1 232 ? 16.886  59.275  50.599  1.00 12.52 ? 232 CYS B CA  1 
ATOM   5829  C  C   . CYS B 1 232 ? 16.754  57.795  50.308  1.00 12.51 ? 232 CYS B C   1 
ATOM   5830  O  O   . CYS B 1 232 ? 16.008  57.076  50.974  1.00 12.51 ? 232 CYS B O   1 
ATOM   5831  C  CB  . CYS B 1 232 ? 18.326  59.561  51.019  1.00 12.63 ? 232 CYS B CB  1 
ATOM   5832  S  SG  . CYS B 1 232 ? 19.119  58.210  51.944  1.00 12.38 ? 232 CYS B SG  1 
ATOM   5833  N  N   . LYS B 1 233 ? 17.496  57.359  49.292  1.00 12.33 ? 233 LYS B N   1 
ATOM   5834  C  CA  . LYS B 1 233 ? 17.541  55.966  48.864  1.00 12.11 ? 233 LYS B CA  1 
ATOM   5835  C  C   . LYS B 1 233 ? 18.995  55.699  48.491  1.00 12.02 ? 233 LYS B C   1 
ATOM   5836  O  O   . LYS B 1 233 ? 19.647  56.548  47.891  1.00 12.01 ? 233 LYS B O   1 
ATOM   5837  C  CB  . LYS B 1 233 ? 16.633  55.744  47.651  1.00 11.94 ? 233 LYS B CB  1 
ATOM   5838  C  CG  . LYS B 1 233 ? 15.159  56.019  47.914  1.00 11.80 ? 233 LYS B CG  1 
ATOM   5839  C  CD  . LYS B 1 233 ? 14.311  54.764  47.764  1.00 11.74 ? 233 LYS B CD  1 
ATOM   5840  C  CE  . LYS B 1 233 ? 12.839  55.062  48.014  1.00 11.82 ? 233 LYS B CE  1 
ATOM   5841  N  NZ  . LYS B 1 233 ? 12.125  53.915  48.648  1.00 11.64 ? 233 LYS B NZ  1 
ATOM   5842  N  N   . PHE B 1 234 ? 19.504  54.528  48.854  1.00 12.20 ? 234 PHE B N   1 
ATOM   5843  C  CA  . PHE B 1 234 ? 20.888  54.180  48.568  1.00 12.24 ? 234 PHE B CA  1 
ATOM   5844  C  C   . PHE B 1 234 ? 21.038  53.242  47.379  1.00 12.39 ? 234 PHE B C   1 
ATOM   5845  O  O   . PHE B 1 234 ? 20.354  52.224  47.292  1.00 12.46 ? 234 PHE B O   1 
ATOM   5846  C  CB  . PHE B 1 234 ? 21.523  53.541  49.800  1.00 12.28 ? 234 PHE B CB  1 
ATOM   5847  C  CG  . PHE B 1 234 ? 21.607  54.462  50.985  1.00 12.34 ? 234 PHE B CG  1 
ATOM   5848  C  CD1 . PHE B 1 234 ? 22.427  55.582  50.953  1.00 12.37 ? 234 PHE B CD1 1 
ATOM   5849  C  CD2 . PHE B 1 234 ? 20.871  54.206  52.137  1.00 12.34 ? 234 PHE B CD2 1 
ATOM   5850  C  CE1 . PHE B 1 234 ? 22.515  56.430  52.050  1.00 12.27 ? 234 PHE B CE1 1 
ATOM   5851  C  CE2 . PHE B 1 234 ? 20.951  55.048  53.238  1.00 12.22 ? 234 PHE B CE2 1 
ATOM   5852  C  CZ  . PHE B 1 234 ? 21.775  56.162  53.194  1.00 12.29 ? 234 PHE B CZ  1 
ATOM   5853  N  N   . HIS B 1 235 ? 21.944  53.589  46.468  1.00 12.45 ? 235 HIS B N   1 
ATOM   5854  C  CA  . HIS B 1 235 ? 22.193  52.777  45.279  1.00 12.52 ? 235 HIS B CA  1 
ATOM   5855  C  C   . HIS B 1 235 ? 23.686  52.637  45.018  1.00 12.55 ? 235 HIS B C   1 
ATOM   5856  O  O   . HIS B 1 235 ? 24.422  53.626  45.047  1.00 12.58 ? 235 HIS B O   1 
ATOM   5857  C  CB  . HIS B 1 235 ? 21.545  53.406  44.040  1.00 12.39 ? 235 HIS B CB  1 
ATOM   5858  C  CG  . HIS B 1 235 ? 20.190  53.994  44.290  1.00 12.31 ? 235 HIS B CG  1 
ATOM   5859  N  ND1 . HIS B 1 235 ? 19.029  53.258  44.184  1.00 12.28 ? 235 HIS B ND1 1 
ATOM   5860  C  CD2 . HIS B 1 235 ? 19.812  55.251  44.620  1.00 12.19 ? 235 HIS B CD2 1 
ATOM   5861  C  CE1 . HIS B 1 235 ? 17.994  54.038  44.438  1.00 12.22 ? 235 HIS B CE1 1 
ATOM   5862  N  NE2 . HIS B 1 235 ? 18.441  55.252  44.706  1.00 12.07 ? 235 HIS B NE2 1 
ATOM   5863  N  N   . TYR B 1 236 ? 24.131  51.411  44.758  1.00 12.37 ? 236 TYR B N   1 
ATOM   5864  C  CA  . TYR B 1 236 ? 25.537  51.169  44.472  1.00 12.36 ? 236 TYR B CA  1 
ATOM   5865  C  C   . TYR B 1 236 ? 25.687  50.355  43.191  1.00 12.39 ? 236 TYR B C   1 
ATOM   5866  O  O   . TYR B 1 236 ? 25.447  49.144  43.171  1.00 12.27 ? 236 TYR B O   1 
ATOM   5867  C  CB  . TYR B 1 236 ? 26.232  50.455  45.639  1.00 12.60 ? 236 TYR B CB  1 
ATOM   5868  C  CG  . TYR B 1 236 ? 25.327  49.714  46.607  1.00 12.85 ? 236 TYR B CG  1 
ATOM   5869  C  CD1 . TYR B 1 236 ? 24.395  50.396  47.394  1.00 12.89 ? 236 TYR B CD1 1 
ATOM   5870  C  CD2 . TYR B 1 236 ? 25.433  48.331  46.762  1.00 12.98 ? 236 TYR B CD2 1 
ATOM   5871  C  CE1 . TYR B 1 236 ? 23.596  49.721  48.307  1.00 13.23 ? 236 TYR B CE1 1 
ATOM   5872  C  CE2 . TYR B 1 236 ? 24.638  47.645  47.672  1.00 13.34 ? 236 TYR B CE2 1 
ATOM   5873  C  CZ  . TYR B 1 236 ? 23.721  48.345  48.441  1.00 13.48 ? 236 TYR B CZ  1 
ATOM   5874  O  OH  . TYR B 1 236 ? 22.930  47.659  49.338  1.00 14.17 ? 236 TYR B OH  1 
ATOM   5875  N  N   . LYS B 1 237 ? 26.092  51.038  42.123  1.00 12.03 ? 237 LYS B N   1 
ATOM   5876  C  CA  . LYS B 1 237 ? 26.261  50.416  40.818  1.00 11.89 ? 237 LYS B CA  1 
ATOM   5877  C  C   . LYS B 1 237 ? 27.553  49.635  40.651  1.00 11.80 ? 237 LYS B C   1 
ATOM   5878  O  O   . LYS B 1 237 ? 28.633  50.112  40.988  1.00 11.85 ? 237 LYS B O   1 
ATOM   5879  C  CB  . LYS B 1 237 ? 26.182  51.480  39.721  1.00 11.76 ? 237 LYS B CB  1 
ATOM   5880  C  CG  . LYS B 1 237 ? 25.337  52.675  40.089  1.00 11.70 ? 237 LYS B CG  1 
ATOM   5881  C  CD  . LYS B 1 237 ? 23.872  52.312  40.092  1.00 11.95 ? 237 LYS B CD  1 
ATOM   5882  C  CE  . LYS B 1 237 ? 23.276  52.430  38.700  1.00 12.58 ? 237 LYS B CE  1 
ATOM   5883  N  NZ  . LYS B 1 237 ? 23.290  53.838  38.171  1.00 12.79 ? 237 LYS B NZ  1 
ATOM   5884  N  N   . THR B 1 238 ? 27.429  48.431  40.106  1.00 12.08 ? 238 THR B N   1 
ATOM   5885  C  CA  . THR B 1 238 ? 28.574  47.568  39.861  1.00 12.18 ? 238 THR B CA  1 
ATOM   5886  C  C   . THR B 1 238 ? 29.450  48.167  38.761  1.00 11.94 ? 238 THR B C   1 
ATOM   5887  O  O   . THR B 1 238 ? 28.981  48.422  37.650  1.00 11.89 ? 238 THR B O   1 
ATOM   5888  C  CB  . THR B 1 238 ? 28.116  46.170  39.410  1.00 12.47 ? 238 THR B CB  1 
ATOM   5889  O  OG1 . THR B 1 238 ? 29.176  45.523  38.695  1.00 12.78 ? 238 THR B OG1 1 
ATOM   5890  C  CG2 . THR B 1 238 ? 26.901  46.279  38.505  1.00 12.84 ? 238 THR B CG2 1 
ATOM   5891  N  N   . ASP B 1 239 ? 30.721  48.395  39.075  1.00 11.87 ? 239 ASP B N   1 
ATOM   5892  C  CA  . ASP B 1 239 ? 31.649  48.960  38.105  1.00 11.81 ? 239 ASP B CA  1 
ATOM   5893  C  C   . ASP B 1 239 ? 32.120  47.858  37.162  1.00 11.99 ? 239 ASP B C   1 
ATOM   5894  O  O   . ASP B 1 239 ? 32.912  48.096  36.258  1.00 12.03 ? 239 ASP B O   1 
ATOM   5895  C  CB  . ASP B 1 239 ? 32.846  49.595  38.823  1.00 11.34 ? 239 ASP B CB  1 
ATOM   5896  C  CG  . ASP B 1 239 ? 32.427  50.588  39.900  1.00 10.99 ? 239 ASP B CG  1 
ATOM   5897  O  OD1 . ASP B 1 239 ? 31.213  50.849  40.040  1.00 10.67 ? 239 ASP B OD1 1 
ATOM   5898  O  OD2 . ASP B 1 239 ? 33.312  51.110  40.609  1.00 10.62 ? 239 ASP B OD2 1 
ATOM   5899  N  N   . GLN B 1 240 ? 31.620  46.646  37.381  1.00 12.34 ? 240 GLN B N   1 
ATOM   5900  C  CA  . GLN B 1 240 ? 31.976  45.508  36.547  1.00 12.36 ? 240 GLN B CA  1 
ATOM   5901  C  C   . GLN B 1 240 ? 30.864  45.222  35.554  1.00 12.50 ? 240 GLN B C   1 
ATOM   5902  O  O   . GLN B 1 240 ? 30.888  44.206  34.871  1.00 12.54 ? 240 GLN B O   1 
ATOM   5903  C  CB  . GLN B 1 240 ? 32.213  44.268  37.406  1.00 12.85 ? 240 GLN B CB  1 
ATOM   5904  C  CG  . GLN B 1 240 ? 33.353  44.406  38.394  1.00 13.55 ? 240 GLN B CG  1 
ATOM   5905  C  CD  . GLN B 1 240 ? 32.927  45.093  39.677  1.00 13.95 ? 240 GLN B CD  1 
ATOM   5906  O  OE1 . GLN B 1 240 ? 32.851  46.323  39.748  1.00 14.29 ? 240 GLN B OE1 1 
ATOM   5907  N  NE2 . GLN B 1 240 ? 32.642  44.299  40.699  1.00 14.17 ? 240 GLN B NE2 1 
ATOM   5908  N  N   . GLY B 1 241 ? 29.881  46.115  35.496  1.00 12.73 ? 241 GLY B N   1 
ATOM   5909  C  CA  . GLY B 1 241 ? 28.773  45.956  34.570  1.00 12.93 ? 241 GLY B CA  1 
ATOM   5910  C  C   . GLY B 1 241 ? 27.709  44.933  34.937  1.00 13.18 ? 241 GLY B C   1 
ATOM   5911  O  O   . GLY B 1 241 ? 27.987  43.916  35.583  1.00 13.22 ? 241 GLY B O   1 
ATOM   5912  N  N   . ILE B 1 242 ? 26.481  45.209  34.506  1.00 12.95 ? 242 ILE B N   1 
ATOM   5913  C  CA  . ILE B 1 242 ? 25.342  44.334  34.763  1.00 12.96 ? 242 ILE B CA  1 
ATOM   5914  C  C   . ILE B 1 242 ? 25.364  43.158  33.793  1.00 12.90 ? 242 ILE B C   1 
ATOM   5915  O  O   . ILE B 1 242 ? 25.245  43.340  32.581  1.00 12.85 ? 242 ILE B O   1 
ATOM   5916  C  CB  . ILE B 1 242 ? 24.005  45.100  34.585  1.00 12.95 ? 242 ILE B CB  1 
ATOM   5917  C  CG1 . ILE B 1 242 ? 24.216  46.594  34.844  1.00 12.76 ? 242 ILE B CG1 1 
ATOM   5918  C  CG2 . ILE B 1 242 ? 22.957  44.558  35.541  1.00 13.08 ? 242 ILE B CG2 1 
ATOM   5919  C  CD1 . ILE B 1 242 ? 24.364  47.415  33.582  1.00 12.74 ? 242 ILE B CD1 1 
ATOM   5920  N  N   . LYS B 1 243 ? 25.515  41.951  34.326  1.00 12.87 ? 243 LYS B N   1 
ATOM   5921  C  CA  . LYS B 1 243 ? 25.557  40.756  33.490  1.00 12.89 ? 243 LYS B CA  1 
ATOM   5922  C  C   . LYS B 1 243 ? 24.711  39.647  34.084  1.00 12.89 ? 243 LYS B C   1 
ATOM   5923  O  O   . LYS B 1 243 ? 24.824  39.336  35.266  1.00 12.84 ? 243 LYS B O   1 
ATOM   5924  C  CB  . LYS B 1 243 ? 26.995  40.270  33.338  1.00 13.02 ? 243 LYS B CB  1 
ATOM   5925  C  CG  . LYS B 1 243 ? 27.810  41.074  32.341  1.00 13.42 ? 243 LYS B CG  1 
ATOM   5926  C  CD  . LYS B 1 243 ? 29.103  40.359  31.975  1.00 14.08 ? 243 LYS B CD  1 
ATOM   5927  C  CE  . LYS B 1 243 ? 28.842  38.926  31.507  1.00 14.47 ? 243 LYS B CE  1 
ATOM   5928  N  NZ  . LYS B 1 243 ? 30.115  38.160  31.403  1.00 15.15 ? 243 LYS B NZ  1 
ATOM   5929  N  N   . ASN B 1 244 ? 23.869  39.043  33.251  1.00 13.06 ? 244 ASN B N   1 
ATOM   5930  C  CA  . ASN B 1 244 ? 22.991  37.970  33.697  1.00 13.22 ? 244 ASN B CA  1 
ATOM   5931  C  C   . ASN B 1 244 ? 23.232  36.676  32.930  1.00 13.04 ? 244 ASN B C   1 
ATOM   5932  O  O   . ASN B 1 244 ? 23.706  36.695  31.793  1.00 12.98 ? 244 ASN B O   1 
ATOM   5933  C  CB  . ASN B 1 244 ? 21.533  38.405  33.541  1.00 13.43 ? 244 ASN B CB  1 
ATOM   5934  C  CG  . ASN B 1 244 ? 21.294  39.823  34.040  1.00 13.80 ? 244 ASN B CG  1 
ATOM   5935  O  OD1 . ASN B 1 244 ? 21.870  40.245  35.046  1.00 13.93 ? 244 ASN B OD1 1 
ATOM   5936  N  ND2 . ASN B 1 244 ? 20.441  40.566  33.336  1.00 13.94 ? 244 ASN B ND2 1 
ATOM   5937  N  N   . LEU B 1 245 ? 22.916  35.555  33.572  1.00 12.81 ? 245 LEU B N   1 
ATOM   5938  C  CA  . LEU B 1 245 ? 23.070  34.240  32.964  1.00 12.79 ? 245 LEU B CA  1 
ATOM   5939  C  C   . LEU B 1 245 ? 21.726  33.829  32.383  1.00 12.78 ? 245 LEU B C   1 
ATOM   5940  O  O   . LEU B 1 245 ? 20.687  34.067  32.992  1.00 12.61 ? 245 LEU B O   1 
ATOM   5941  C  CB  . LEU B 1 245 ? 23.503  33.204  34.004  1.00 12.70 ? 245 LEU B CB  1 
ATOM   5942  C  CG  . LEU B 1 245 ? 24.772  33.471  34.817  1.00 12.58 ? 245 LEU B CG  1 
ATOM   5943  C  CD1 . LEU B 1 245 ? 24.496  33.170  36.288  1.00 12.43 ? 245 LEU B CD1 1 
ATOM   5944  C  CD2 . LEU B 1 245 ? 25.916  32.607  34.296  1.00 12.31 ? 245 LEU B CD2 1 
ATOM   5945  N  N   . SER B 1 246 ? 21.754  33.214  31.205  1.00 13.06 ? 246 SER B N   1 
ATOM   5946  C  CA  . SER B 1 246 ? 20.534  32.772  30.550  1.00 13.08 ? 246 SER B CA  1 
ATOM   5947  C  C   . SER B 1 246 ? 19.917  31.622  31.338  1.00 13.38 ? 246 SER B C   1 
ATOM   5948  O  O   . SER B 1 246 ? 20.609  30.945  32.102  1.00 13.58 ? 246 SER B O   1 
ATOM   5949  C  CB  . SER B 1 246 ? 20.845  32.315  29.126  1.00 13.07 ? 246 SER B CB  1 
ATOM   5950  O  OG  . SER B 1 246 ? 21.064  30.918  29.072  1.00 12.92 ? 246 SER B OG  1 
ATOM   5951  N  N   . VAL B 1 247 ? 18.620  31.398  31.156  1.00 13.41 ? 247 VAL B N   1 
ATOM   5952  C  CA  . VAL B 1 247 ? 17.946  30.316  31.862  1.00 13.37 ? 247 VAL B CA  1 
ATOM   5953  C  C   . VAL B 1 247 ? 18.664  28.987  31.625  1.00 13.58 ? 247 VAL B C   1 
ATOM   5954  O  O   . VAL B 1 247 ? 18.738  28.148  32.520  1.00 13.82 ? 247 VAL B O   1 
ATOM   5955  C  CB  . VAL B 1 247 ? 16.479  30.169  31.404  1.00 13.23 ? 247 VAL B CB  1 
ATOM   5956  C  CG1 . VAL B 1 247 ? 15.845  28.957  32.065  1.00 12.74 ? 247 VAL B CG1 1 
ATOM   5957  C  CG2 . VAL B 1 247 ? 15.699  31.417  31.756  1.00 13.12 ? 247 VAL B CG2 1 
ATOM   5958  N  N   . GLU B 1 248 ? 19.197  28.805  30.421  1.00 13.54 ? 248 GLU B N   1 
ATOM   5959  C  CA  . GLU B 1 248 ? 19.900  27.573  30.074  1.00 13.73 ? 248 GLU B CA  1 
ATOM   5960  C  C   . GLU B 1 248 ? 21.205  27.418  30.842  1.00 13.22 ? 248 GLU B C   1 
ATOM   5961  O  O   . GLU B 1 248 ? 21.511  26.337  31.343  1.00 12.96 ? 248 GLU B O   1 
ATOM   5962  C  CB  . GLU B 1 248 ? 20.201  27.525  28.567  1.00 14.09 ? 248 GLU B CB  1 
ATOM   5963  C  CG  . GLU B 1 248 ? 18.996  27.215  27.688  1.00 15.32 ? 248 GLU B CG  1 
ATOM   5964  C  CD  . GLU B 1 248 ? 18.104  28.432  27.477  1.00 16.14 ? 248 GLU B CD  1 
ATOM   5965  O  OE1 . GLU B 1 248 ? 18.641  29.568  27.448  1.00 16.66 ? 248 GLU B OE1 1 
ATOM   5966  O  OE2 . GLU B 1 248 ? 16.868  28.252  27.346  1.00 16.72 ? 248 GLU B OE2 1 
ATOM   5967  N  N   . ASP B 1 249 ? 21.973  28.496  30.930  1.00 12.98 ? 249 ASP B N   1 
ATOM   5968  C  CA  . ASP B 1 249 ? 23.254  28.448  31.621  1.00 13.11 ? 249 ASP B CA  1 
ATOM   5969  C  C   . ASP B 1 249 ? 23.099  28.325  33.133  1.00 13.31 ? 249 ASP B C   1 
ATOM   5970  O  O   . ASP B 1 249 ? 23.794  27.531  33.773  1.00 13.42 ? 249 ASP B O   1 
ATOM   5971  C  CB  . ASP B 1 249 ? 24.082  29.686  31.281  1.00 13.19 ? 249 ASP B CB  1 
ATOM   5972  C  CG  . ASP B 1 249 ? 24.597  29.666  29.855  1.00 13.19 ? 249 ASP B CG  1 
ATOM   5973  O  OD1 . ASP B 1 249 ? 25.191  28.642  29.451  1.00 13.08 ? 249 ASP B OD1 1 
ATOM   5974  O  OD2 . ASP B 1 249 ? 24.402  30.672  29.137  1.00 13.49 ? 249 ASP B OD2 1 
ATOM   5975  N  N   . ALA B 1 250 ? 22.188  29.105  33.705  1.00 13.24 ? 250 ALA B N   1 
ATOM   5976  C  CA  . ALA B 1 250 ? 21.955  29.064  35.143  1.00 12.82 ? 250 ALA B CA  1 
ATOM   5977  C  C   . ALA B 1 250 ? 21.543  27.662  35.568  1.00 12.97 ? 250 ALA B C   1 
ATOM   5978  O  O   . ALA B 1 250 ? 21.995  27.161  36.601  1.00 12.98 ? 250 ALA B O   1 
ATOM   5979  C  CB  . ALA B 1 250 ? 20.876  30.055  35.525  1.00 12.76 ? 250 ALA B CB  1 
ATOM   5980  N  N   . ALA B 1 251 ? 20.683  27.031  34.772  1.00 12.94 ? 251 ALA B N   1 
ATOM   5981  C  CA  . ALA B 1 251 ? 20.205  25.685  35.075  1.00 12.85 ? 251 ALA B CA  1 
ATOM   5982  C  C   . ALA B 1 251 ? 21.341  24.672  35.018  1.00 12.98 ? 251 ALA B C   1 
ATOM   5983  O  O   . ALA B 1 251 ? 21.419  23.767  35.851  1.00 12.96 ? 251 ALA B O   1 
ATOM   5984  C  CB  . ALA B 1 251 ? 19.105  25.290  34.107  1.00 12.77 ? 251 ALA B CB  1 
ATOM   5985  N  N   . ARG B 1 252 ? 22.222  24.827  34.034  1.00 12.88 ? 252 ARG B N   1 
ATOM   5986  C  CA  . ARG B 1 252 ? 23.355  23.923  33.880  1.00 13.11 ? 252 ARG B CA  1 
ATOM   5987  C  C   . ARG B 1 252 ? 24.329  24.123  35.039  1.00 12.80 ? 252 ARG B C   1 
ATOM   5988  O  O   . ARG B 1 252 ? 24.717  23.169  35.721  1.00 12.56 ? 252 ARG B O   1 
ATOM   5989  C  CB  . ARG B 1 252 ? 24.057  24.202  32.551  1.00 13.53 ? 252 ARG B CB  1 
ATOM   5990  C  CG  . ARG B 1 252 ? 25.421  23.546  32.397  1.00 14.10 ? 252 ARG B CG  1 
ATOM   5991  C  CD  . ARG B 1 252 ? 26.143  24.099  31.169  1.00 14.50 ? 252 ARG B CD  1 
ATOM   5992  N  NE  . ARG B 1 252 ? 26.563  25.486  31.368  1.00 14.25 ? 252 ARG B NE  1 
ATOM   5993  C  CZ  . ARG B 1 252 ? 27.817  25.855  31.608  1.00 14.09 ? 252 ARG B CZ  1 
ATOM   5994  N  NH1 . ARG B 1 252 ? 28.775  24.936  31.674  1.00 13.48 ? 252 ARG B NH1 1 
ATOM   5995  N  NH2 . ARG B 1 252 ? 28.114  27.138  31.794  1.00 13.89 ? 252 ARG B NH2 1 
ATOM   5996  N  N   . LEU B 1 253 ? 24.713  25.377  35.253  1.00 12.64 ? 253 LEU B N   1 
ATOM   5997  C  CA  . LEU B 1 253 ? 25.633  25.731  36.327  1.00 12.48 ? 253 LEU B CA  1 
ATOM   5998  C  C   . LEU B 1 253 ? 25.011  25.351  37.660  1.00 12.54 ? 253 LEU B C   1 
ATOM   5999  O  O   . LEU B 1 253 ? 25.708  24.971  38.603  1.00 12.53 ? 253 LEU B O   1 
ATOM   6000  C  CB  . LEU B 1 253 ? 25.909  27.233  36.307  1.00 12.34 ? 253 LEU B CB  1 
ATOM   6001  C  CG  . LEU B 1 253 ? 26.829  27.754  35.209  1.00 12.21 ? 253 LEU B CG  1 
ATOM   6002  C  CD1 . LEU B 1 253 ? 26.925  29.262  35.317  1.00 12.29 ? 253 LEU B CD1 1 
ATOM   6003  C  CD2 . LEU B 1 253 ? 28.203  27.118  35.343  1.00 12.20 ? 253 LEU B CD2 1 
ATOM   6004  N  N   . SER B 1 254 ? 23.686  25.453  37.720  1.00 12.71 ? 254 SER B N   1 
ATOM   6005  C  CA  . SER B 1 254 ? 22.943  25.131  38.927  1.00 12.59 ? 254 SER B CA  1 
ATOM   6006  C  C   . SER B 1 254 ? 23.401  23.810  39.517  1.00 12.54 ? 254 SER B C   1 
ATOM   6007  O  O   . SER B 1 254 ? 23.395  23.641  40.731  1.00 12.88 ? 254 SER B O   1 
ATOM   6008  C  CB  . SER B 1 254 ? 21.447  25.065  38.627  1.00 12.58 ? 254 SER B CB  1 
ATOM   6009  O  OG  . SER B 1 254 ? 20.885  23.893  39.188  1.00 12.60 ? 254 SER B OG  1 
ATOM   6010  N  N   . GLN B 1 255 ? 23.795  22.877  38.657  1.00 12.74 ? 255 GLN B N   1 
ATOM   6011  C  CA  . GLN B 1 255 ? 24.260  21.569  39.112  1.00 12.88 ? 255 GLN B CA  1 
ATOM   6012  C  C   . GLN B 1 255 ? 25.744  21.347  38.810  1.00 13.05 ? 255 GLN B C   1 
ATOM   6013  O  O   . GLN B 1 255 ? 26.416  20.574  39.502  1.00 12.71 ? 255 GLN B O   1 
ATOM   6014  C  CB  . GLN B 1 255 ? 23.428  20.454  38.471  1.00 12.54 ? 255 GLN B CB  1 
ATOM   6015  C  CG  . GLN B 1 255 ? 23.430  20.470  36.954  1.00 12.62 ? 255 GLN B CG  1 
ATOM   6016  C  CD  . GLN B 1 255 ? 24.435  19.500  36.358  1.00 12.66 ? 255 GLN B CD  1 
ATOM   6017  O  OE1 . GLN B 1 255 ? 25.477  19.212  36.955  1.00 12.55 ? 255 GLN B OE1 1 
ATOM   6018  N  NE2 . GLN B 1 255 ? 24.127  18.994  35.168  1.00 12.88 ? 255 GLN B NE2 1 
ATOM   6019  N  N   . GLU B 1 256 ? 26.249  22.015  37.775  1.00 12.83 ? 256 GLU B N   1 
ATOM   6020  C  CA  . GLU B 1 256 ? 27.654  21.884  37.411  1.00 13.29 ? 256 GLU B CA  1 
ATOM   6021  C  C   . GLU B 1 256 ? 28.516  22.463  38.530  1.00 13.42 ? 256 GLU B C   1 
ATOM   6022  O  O   . GLU B 1 256 ? 29.572  21.920  38.862  1.00 13.53 ? 256 GLU B O   1 
ATOM   6023  C  CB  . GLU B 1 256 ? 27.942  22.623  36.099  1.00 13.77 ? 256 GLU B CB  1 
ATOM   6024  C  CG  . GLU B 1 256 ? 27.483  21.876  34.849  1.00 14.26 ? 256 GLU B CG  1 
ATOM   6025  C  CD  . GLU B 1 256 ? 28.503  21.929  33.719  1.00 14.59 ? 256 GLU B CD  1 
ATOM   6026  O  OE1 . GLU B 1 256 ? 29.621  21.386  33.884  1.00 14.56 ? 256 GLU B OE1 1 
ATOM   6027  O  OE2 . GLU B 1 256 ? 28.182  22.514  32.661  1.00 14.93 ? 256 GLU B OE2 1 
ATOM   6028  N  N   . ASP B 1 257 ? 28.058  23.570  39.111  1.00 13.38 ? 257 ASP B N   1 
ATOM   6029  C  CA  . ASP B 1 257 ? 28.776  24.218  40.199  1.00 12.88 ? 257 ASP B CA  1 
ATOM   6030  C  C   . ASP B 1 257 ? 27.834  25.055  41.063  1.00 12.45 ? 257 ASP B C   1 
ATOM   6031  O  O   . ASP B 1 257 ? 27.719  26.269  40.882  1.00 12.29 ? 257 ASP B O   1 
ATOM   6032  C  CB  . ASP B 1 257 ? 29.888  25.105  39.646  1.00 13.49 ? 257 ASP B CB  1 
ATOM   6033  C  CG  . ASP B 1 257 ? 30.690  25.784  40.743  1.00 14.09 ? 257 ASP B CG  1 
ATOM   6034  O  OD1 . ASP B 1 257 ? 30.823  25.194  41.845  1.00 14.07 ? 257 ASP B OD1 1 
ATOM   6035  O  OD2 . ASP B 1 257 ? 31.184  26.910  40.500  1.00 14.89 ? 257 ASP B OD2 1 
ATOM   6036  N  N   . PRO B 1 258 ? 27.131  24.406  42.005  1.00 12.08 ? 258 PRO B N   1 
ATOM   6037  C  CA  . PRO B 1 258 ? 26.189  25.069  42.916  1.00 11.95 ? 258 PRO B CA  1 
ATOM   6038  C  C   . PRO B 1 258 ? 26.800  26.249  43.679  1.00 11.72 ? 258 PRO B C   1 
ATOM   6039  O  O   . PRO B 1 258 ? 26.094  27.167  44.095  1.00 11.48 ? 258 PRO B O   1 
ATOM   6040  C  CB  . PRO B 1 258 ? 25.747  23.945  43.856  1.00 11.81 ? 258 PRO B CB  1 
ATOM   6041  C  CG  . PRO B 1 258 ? 25.951  22.702  43.069  1.00 11.92 ? 258 PRO B CG  1 
ATOM   6042  C  CD  . PRO B 1 258 ? 27.175  22.952  42.235  1.00 12.00 ? 258 PRO B CD  1 
ATOM   6043  N  N   . ASP B 1 259 ? 28.115  26.210  43.863  1.00 11.79 ? 259 ASP B N   1 
ATOM   6044  C  CA  . ASP B 1 259 ? 28.820  27.271  44.566  1.00 11.87 ? 259 ASP B CA  1 
ATOM   6045  C  C   . ASP B 1 259 ? 29.541  28.174  43.568  1.00 11.93 ? 259 ASP B C   1 
ATOM   6046  O  O   . ASP B 1 259 ? 30.622  28.689  43.844  1.00 11.85 ? 259 ASP B O   1 
ATOM   6047  C  CB  . ASP B 1 259 ? 29.816  26.658  45.555  1.00 12.17 ? 259 ASP B CB  1 
ATOM   6048  C  CG  . ASP B 1 259 ? 29.157  25.668  46.502  1.00 12.49 ? 259 ASP B CG  1 
ATOM   6049  O  OD1 . ASP B 1 259 ? 28.156  26.029  47.152  1.00 12.63 ? 259 ASP B OD1 1 
ATOM   6050  O  OD2 . ASP B 1 259 ? 29.629  24.520  46.597  1.00 13.01 ? 259 ASP B OD2 1 
ATOM   6051  N  N   . TYR B 1 260 ? 28.924  28.358  42.404  1.00 12.45 ? 260 TYR B N   1 
ATOM   6052  C  CA  . TYR B 1 260 ? 29.474  29.188  41.341  1.00 12.59 ? 260 TYR B CA  1 
ATOM   6053  C  C   . TYR B 1 260 ? 29.724  30.602  41.862  1.00 12.93 ? 260 TYR B C   1 
ATOM   6054  O  O   . TYR B 1 260 ? 30.845  31.113  41.788  1.00 12.96 ? 260 TYR B O   1 
ATOM   6055  C  CB  . TYR B 1 260 ? 28.502  29.214  40.156  1.00 12.83 ? 260 TYR B CB  1 
ATOM   6056  C  CG  . TYR B 1 260 ? 28.862  30.191  39.060  1.00 13.07 ? 260 TYR B CG  1 
ATOM   6057  C  CD1 . TYR B 1 260 ? 28.078  31.322  38.825  1.00 13.16 ? 260 TYR B CD1 1 
ATOM   6058  C  CD2 . TYR B 1 260 ? 29.991  29.996  38.263  1.00 13.03 ? 260 TYR B CD2 1 
ATOM   6059  C  CE1 . TYR B 1 260 ? 28.409  32.238  37.824  1.00 12.96 ? 260 TYR B CE1 1 
ATOM   6060  C  CE2 . TYR B 1 260 ? 30.331  30.906  37.259  1.00 12.83 ? 260 TYR B CE2 1 
ATOM   6061  C  CZ  . TYR B 1 260 ? 29.534  32.025  37.048  1.00 12.85 ? 260 TYR B CZ  1 
ATOM   6062  O  OH  . TYR B 1 260 ? 29.854  32.934  36.066  1.00 12.51 ? 260 TYR B OH  1 
ATOM   6063  N  N   . GLY B 1 261 ? 28.679  31.226  42.398  1.00 12.95 ? 261 GLY B N   1 
ATOM   6064  C  CA  . GLY B 1 261 ? 28.820  32.574  42.926  1.00 13.00 ? 261 GLY B CA  1 
ATOM   6065  C  C   . GLY B 1 261 ? 29.955  32.697  43.928  1.00 12.91 ? 261 GLY B C   1 
ATOM   6066  O  O   . GLY B 1 261 ? 30.710  33.676  43.919  1.00 13.15 ? 261 GLY B O   1 
ATOM   6067  N  N   . ILE B 1 262 ? 30.072  31.701  44.799  1.00 12.37 ? 262 ILE B N   1 
ATOM   6068  C  CA  . ILE B 1 262 ? 31.116  31.679  45.813  1.00 12.11 ? 262 ILE B CA  1 
ATOM   6069  C  C   . ILE B 1 262 ? 32.494  31.711  45.158  1.00 11.81 ? 262 ILE B C   1 
ATOM   6070  O  O   . ILE B 1 262 ? 33.264  32.655  45.340  1.00 11.39 ? 262 ILE B O   1 
ATOM   6071  C  CB  . ILE B 1 262 ? 31.002  30.404  46.674  1.00 12.07 ? 262 ILE B CB  1 
ATOM   6072  C  CG1 . ILE B 1 262 ? 29.789  30.517  47.599  1.00 11.92 ? 262 ILE B CG1 1 
ATOM   6073  C  CG2 . ILE B 1 262 ? 32.278  30.190  47.470  1.00 12.35 ? 262 ILE B CG2 1 
ATOM   6074  C  CD1 . ILE B 1 262 ? 29.286  29.197  48.127  1.00 11.39 ? 262 ILE B CD1 1 
ATOM   6075  N  N   . ARG B 1 263 ? 32.785  30.665  44.392  1.00 11.83 ? 263 ARG B N   1 
ATOM   6076  C  CA  . ARG B 1 263 ? 34.056  30.525  43.693  1.00 11.88 ? 263 ARG B CA  1 
ATOM   6077  C  C   . ARG B 1 263 ? 34.419  31.766  42.878  1.00 12.01 ? 263 ARG B C   1 
ATOM   6078  O  O   . ARG B 1 263 ? 35.524  32.299  43.007  1.00 11.99 ? 263 ARG B O   1 
ATOM   6079  C  CB  . ARG B 1 263 ? 34.008  29.300  42.775  1.00 11.93 ? 263 ARG B CB  1 
ATOM   6080  C  CG  . ARG B 1 263 ? 35.348  28.925  42.174  1.00 12.17 ? 263 ARG B CG  1 
ATOM   6081  C  CD  . ARG B 1 263 ? 35.208  27.850  41.110  1.00 12.31 ? 263 ARG B CD  1 
ATOM   6082  N  NE  . ARG B 1 263 ? 34.297  26.786  41.523  1.00 12.41 ? 263 ARG B NE  1 
ATOM   6083  C  CZ  . ARG B 1 263 ? 34.593  25.844  42.416  1.00 12.45 ? 263 ARG B CZ  1 
ATOM   6084  N  NH1 . ARG B 1 263 ? 35.784  25.824  43.004  1.00 12.30 ? 263 ARG B NH1 1 
ATOM   6085  N  NH2 . ARG B 1 263 ? 33.693  24.918  42.718  1.00 12.48 ? 263 ARG B NH2 1 
ATOM   6086  N  N   . ASP B 1 264 ? 33.488  32.223  42.044  1.00 12.13 ? 264 ASP B N   1 
ATOM   6087  C  CA  . ASP B 1 264 ? 33.720  33.398  41.212  1.00 12.18 ? 264 ASP B CA  1 
ATOM   6088  C  C   . ASP B 1 264 ? 34.287  34.567  42.003  1.00 12.27 ? 264 ASP B C   1 
ATOM   6089  O  O   . ASP B 1 264 ? 35.343  35.105  41.677  1.00 12.36 ? 264 ASP B O   1 
ATOM   6090  C  CB  . ASP B 1 264 ? 32.427  33.858  40.553  1.00 12.51 ? 264 ASP B CB  1 
ATOM   6091  C  CG  . ASP B 1 264 ? 32.604  35.162  39.807  1.00 12.68 ? 264 ASP B CG  1 
ATOM   6092  O  OD1 . ASP B 1 264 ? 31.899  36.150  40.120  1.00 12.68 ? 264 ASP B OD1 1 
ATOM   6093  O  OD2 . ASP B 1 264 ? 33.469  35.196  38.905  1.00 12.94 ? 264 ASP B OD2 1 
ATOM   6094  N  N   . LEU B 1 265 ? 33.561  34.966  43.039  1.00 12.38 ? 265 LEU B N   1 
ATOM   6095  C  CA  . LEU B 1 265 ? 33.969  36.073  43.888  1.00 12.15 ? 265 LEU B CA  1 
ATOM   6096  C  C   . LEU B 1 265 ? 35.354  35.870  44.497  1.00 12.11 ? 265 LEU B C   1 
ATOM   6097  O  O   . LEU B 1 265 ? 36.200  36.766  44.450  1.00 12.26 ? 265 LEU B O   1 
ATOM   6098  C  CB  . LEU B 1 265 ? 32.942  36.262  45.003  1.00 12.16 ? 265 LEU B CB  1 
ATOM   6099  C  CG  . LEU B 1 265 ? 33.285  37.264  46.108  1.00 12.03 ? 265 LEU B CG  1 
ATOM   6100  C  CD1 . LEU B 1 265 ? 33.509  38.643  45.493  1.00 12.11 ? 265 LEU B CD1 1 
ATOM   6101  C  CD2 . LEU B 1 265 ? 32.156  37.291  47.142  1.00 11.44 ? 265 LEU B CD2 1 
ATOM   6102  N  N   . PHE B 1 266 ? 35.585  34.691  45.066  1.00 12.09 ? 266 PHE B N   1 
ATOM   6103  C  CA  . PHE B 1 266 ? 36.867  34.382  45.693  1.00 12.03 ? 266 PHE B CA  1 
ATOM   6104  C  C   . PHE B 1 266 ? 38.055  34.484  44.738  1.00 12.06 ? 266 PHE B C   1 
ATOM   6105  O  O   . PHE B 1 266 ? 39.057  35.138  45.044  1.00 11.89 ? 266 PHE B O   1 
ATOM   6106  C  CB  . PHE B 1 266 ? 36.829  32.980  46.302  1.00 11.74 ? 266 PHE B CB  1 
ATOM   6107  C  CG  . PHE B 1 266 ? 37.980  32.688  47.220  1.00 11.71 ? 266 PHE B CG  1 
ATOM   6108  C  CD1 . PHE B 1 266 ? 39.225  32.337  46.708  1.00 11.72 ? 266 PHE B CD1 1 
ATOM   6109  C  CD2 . PHE B 1 266 ? 37.817  32.748  48.599  1.00 11.70 ? 266 PHE B CD2 1 
ATOM   6110  C  CE1 . PHE B 1 266 ? 40.292  32.049  47.554  1.00 11.72 ? 266 PHE B CE1 1 
ATOM   6111  C  CE2 . PHE B 1 266 ? 38.876  32.462  49.460  1.00 11.69 ? 266 PHE B CE2 1 
ATOM   6112  C  CZ  . PHE B 1 266 ? 40.117  32.110  48.935  1.00 11.73 ? 266 PHE B CZ  1 
ATOM   6113  N  N   . ASN B 1 267 ? 37.945  33.834  43.583  1.00 11.74 ? 267 ASN B N   1 
ATOM   6114  C  CA  . ASN B 1 267 ? 39.024  33.853  42.603  1.00 11.48 ? 267 ASN B CA  1 
ATOM   6115  C  C   . ASN B 1 267 ? 39.290  35.245  42.050  1.00 11.15 ? 267 ASN B C   1 
ATOM   6116  O  O   . ASN B 1 267 ? 40.431  35.598  41.770  1.00 11.09 ? 267 ASN B O   1 
ATOM   6117  C  CB  . ASN B 1 267 ? 38.712  32.882  41.465  1.00 11.86 ? 267 ASN B CB  1 
ATOM   6118  C  CG  . ASN B 1 267 ? 38.947  31.435  41.861  1.00 12.05 ? 267 ASN B CG  1 
ATOM   6119  O  OD1 . ASN B 1 267 ? 39.965  31.108  42.469  1.00 12.07 ? 267 ASN B OD1 1 
ATOM   6120  N  ND2 . ASN B 1 267 ? 38.004  30.564  41.522  1.00 12.20 ? 267 ASN B ND2 1 
ATOM   6121  N  N   . ALA B 1 268 ? 38.237  36.038  41.896  1.00 11.15 ? 268 ALA B N   1 
ATOM   6122  C  CA  . ALA B 1 268 ? 38.387  37.395  41.383  1.00 11.12 ? 268 ALA B CA  1 
ATOM   6123  C  C   . ALA B 1 268 ? 39.295  38.187  42.312  1.00 10.89 ? 268 ALA B C   1 
ATOM   6124  O  O   . ALA B 1 268 ? 40.255  38.813  41.869  1.00 10.72 ? 268 ALA B O   1 
ATOM   6125  C  CB  . ALA B 1 268 ? 37.023  38.071  41.278  1.00 11.13 ? 268 ALA B CB  1 
ATOM   6126  N  N   . ILE B 1 269 ? 38.984  38.136  43.605  1.00 10.99 ? 269 ILE B N   1 
ATOM   6127  C  CA  . ILE B 1 269 ? 39.741  38.844  44.633  1.00 11.02 ? 269 ILE B CA  1 
ATOM   6128  C  C   . ILE B 1 269 ? 41.168  38.318  44.757  1.00 11.38 ? 269 ILE B C   1 
ATOM   6129  O  O   . ILE B 1 269 ? 42.122  39.097  44.860  1.00 11.56 ? 269 ILE B O   1 
ATOM   6130  C  CB  . ILE B 1 269 ? 39.026  38.727  46.004  1.00 10.73 ? 269 ILE B CB  1 
ATOM   6131  C  CG1 . ILE B 1 269 ? 37.812  39.660  46.022  1.00 10.51 ? 269 ILE B CG1 1 
ATOM   6132  C  CG2 . ILE B 1 269 ? 39.997  39.031  47.142  1.00 10.42 ? 269 ILE B CG2 1 
ATOM   6133  C  CD1 . ILE B 1 269 ? 37.171  39.831  47.376  1.00 10.32 ? 269 ILE B CD1 1 
ATOM   6134  N  N   . ALA B 1 270 ? 41.306  36.996  44.744  1.00 11.49 ? 270 ALA B N   1 
ATOM   6135  C  CA  . ALA B 1 270 ? 42.610  36.357  44.858  1.00 11.60 ? 270 ALA B CA  1 
ATOM   6136  C  C   . ALA B 1 270 ? 43.537  36.723  43.709  1.00 11.72 ? 270 ALA B C   1 
ATOM   6137  O  O   . ALA B 1 270 ? 44.748  36.529  43.797  1.00 11.60 ? 270 ALA B O   1 
ATOM   6138  C  CB  . ALA B 1 270 ? 42.446  34.844  44.919  1.00 11.70 ? 270 ALA B CB  1 
ATOM   6139  N  N   . THR B 1 271 ? 42.975  37.254  42.630  1.00 11.93 ? 271 THR B N   1 
ATOM   6140  C  CA  . THR B 1 271 ? 43.782  37.613  41.475  1.00 12.09 ? 271 THR B CA  1 
ATOM   6141  C  C   . THR B 1 271 ? 43.814  39.103  41.171  1.00 12.34 ? 271 THR B C   1 
ATOM   6142  O  O   . THR B 1 271 ? 43.855  39.498  40.008  1.00 12.92 ? 271 THR B O   1 
ATOM   6143  C  CB  . THR B 1 271 ? 43.297  36.880  40.221  1.00 11.86 ? 271 THR B CB  1 
ATOM   6144  O  OG1 . THR B 1 271 ? 41.927  37.210  39.977  1.00 11.53 ? 271 THR B OG1 1 
ATOM   6145  C  CG2 . THR B 1 271 ? 43.432  35.376  40.405  1.00 11.73 ? 271 THR B CG2 1 
ATOM   6146  N  N   . GLY B 1 272 ? 43.793  39.931  42.209  1.00 12.28 ? 272 GLY B N   1 
ATOM   6147  C  CA  . GLY B 1 272 ? 43.841  41.369  42.002  1.00 12.02 ? 272 GLY B CA  1 
ATOM   6148  C  C   . GLY B 1 272 ? 42.737  41.971  41.149  1.00 11.87 ? 272 GLY B C   1 
ATOM   6149  O  O   . GLY B 1 272 ? 42.856  43.105  40.682  1.00 11.54 ? 272 GLY B O   1 
ATOM   6150  N  N   . LYS B 1 273 ? 41.664  41.222  40.934  1.00 11.94 ? 273 LYS B N   1 
ATOM   6151  C  CA  . LYS B 1 273 ? 40.541  41.725  40.154  1.00 12.04 ? 273 LYS B CA  1 
ATOM   6152  C  C   . LYS B 1 273 ? 39.469  42.217  41.120  1.00 11.95 ? 273 LYS B C   1 
ATOM   6153  O  O   . LYS B 1 273 ? 38.291  41.889  40.975  1.00 11.91 ? 273 LYS B O   1 
ATOM   6154  C  CB  . LYS B 1 273 ? 39.970  40.621  39.262  1.00 12.76 ? 273 LYS B CB  1 
ATOM   6155  C  CG  . LYS B 1 273 ? 39.788  41.020  37.803  1.00 13.47 ? 273 LYS B CG  1 
ATOM   6156  C  CD  . LYS B 1 273 ? 41.108  40.920  37.033  1.00 14.11 ? 273 LYS B CD  1 
ATOM   6157  C  CE  . LYS B 1 273 ? 41.716  39.530  37.142  1.00 14.29 ? 273 LYS B CE  1 
ATOM   6158  N  NZ  . LYS B 1 273 ? 40.821  38.495  36.533  1.00 14.71 ? 273 LYS B NZ  1 
ATOM   6159  N  N   . TYR B 1 274 ? 39.895  42.996  42.113  1.00 11.92 ? 274 TYR B N   1 
ATOM   6160  C  CA  . TYR B 1 274 ? 38.994  43.547  43.121  1.00 11.88 ? 274 TYR B CA  1 
ATOM   6161  C  C   . TYR B 1 274 ? 37.745  44.192  42.509  1.00 11.86 ? 274 TYR B C   1 
ATOM   6162  O  O   . TYR B 1 274 ? 37.843  45.122  41.709  1.00 11.52 ? 274 TYR B O   1 
ATOM   6163  C  CB  . TYR B 1 274 ? 39.730  44.585  43.963  1.00 11.97 ? 274 TYR B CB  1 
ATOM   6164  C  CG  . TYR B 1 274 ? 41.103  44.160  44.433  1.00 12.23 ? 274 TYR B CG  1 
ATOM   6165  C  CD1 . TYR B 1 274 ? 41.277  43.030  45.234  1.00 12.42 ? 274 TYR B CD1 1 
ATOM   6166  C  CD2 . TYR B 1 274 ? 42.226  44.908  44.104  1.00 12.33 ? 274 TYR B CD2 1 
ATOM   6167  C  CE1 . TYR B 1 274 ? 42.544  42.660  45.699  1.00 12.35 ? 274 TYR B CE1 1 
ATOM   6168  C  CE2 . TYR B 1 274 ? 43.493  44.551  44.560  1.00 12.29 ? 274 TYR B CE2 1 
ATOM   6169  C  CZ  . TYR B 1 274 ? 43.648  43.429  45.357  1.00 12.24 ? 274 TYR B CZ  1 
ATOM   6170  O  OH  . TYR B 1 274 ? 44.907  43.089  45.800  1.00 11.74 ? 274 TYR B OH  1 
ATOM   6171  N  N   . PRO B 1 275 ? 36.553  43.704  42.891  1.00 12.06 ? 275 PRO B N   1 
ATOM   6172  C  CA  . PRO B 1 275 ? 35.272  44.216  42.392  1.00 12.15 ? 275 PRO B CA  1 
ATOM   6173  C  C   . PRO B 1 275 ? 34.908  45.574  42.983  1.00 12.18 ? 275 PRO B C   1 
ATOM   6174  O  O   . PRO B 1 275 ? 35.122  45.823  44.170  1.00 12.22 ? 275 PRO B O   1 
ATOM   6175  C  CB  . PRO B 1 275 ? 34.256  43.137  42.790  1.00 12.33 ? 275 PRO B CB  1 
ATOM   6176  C  CG  . PRO B 1 275 ? 35.028  42.061  43.474  1.00 12.43 ? 275 PRO B CG  1 
ATOM   6177  C  CD  . PRO B 1 275 ? 36.363  42.610  43.853  1.00 12.26 ? 275 PRO B CD  1 
ATOM   6178  N  N   . SER B 1 276 ? 34.342  46.444  42.152  1.00 12.11 ? 276 SER B N   1 
ATOM   6179  C  CA  . SER B 1 276 ? 33.960  47.772  42.605  1.00 12.03 ? 276 SER B CA  1 
ATOM   6180  C  C   . SER B 1 276 ? 32.476  48.093  42.450  1.00 11.98 ? 276 SER B C   1 
ATOM   6181  O  O   . SER B 1 276 ? 31.755  47.458  41.679  1.00 11.63 ? 276 SER B O   1 
ATOM   6182  C  CB  . SER B 1 276 ? 34.783  48.820  41.870  1.00 12.11 ? 276 SER B CB  1 
ATOM   6183  O  OG  . SER B 1 276 ? 35.211  49.824  42.767  1.00 12.78 ? 276 SER B OG  1 
ATOM   6184  N  N   . TRP B 1 277 ? 32.035  49.089  43.211  1.00 12.23 ? 277 TRP B N   1 
ATOM   6185  C  CA  . TRP B 1 277 ? 30.652  49.554  43.200  1.00 12.60 ? 277 TRP B CA  1 
ATOM   6186  C  C   . TRP B 1 277 ? 30.695  51.055  43.462  1.00 12.87 ? 277 TRP B C   1 
ATOM   6187  O  O   . TRP B 1 277 ? 31.507  51.522  44.260  1.00 13.43 ? 277 TRP B O   1 
ATOM   6188  C  CB  . TRP B 1 277 ? 29.845  48.876  44.313  1.00 12.46 ? 277 TRP B CB  1 
ATOM   6189  C  CG  . TRP B 1 277 ? 29.195  47.584  43.918  1.00 12.40 ? 277 TRP B CG  1 
ATOM   6190  C  CD1 . TRP B 1 277 ? 27.910  47.412  43.491  1.00 12.33 ? 277 TRP B CD1 1 
ATOM   6191  C  CD2 . TRP B 1 277 ? 29.798  46.282  43.910  1.00 12.30 ? 277 TRP B CD2 1 
ATOM   6192  N  NE1 . TRP B 1 277 ? 27.673  46.083  43.215  1.00 12.34 ? 277 TRP B NE1 1 
ATOM   6193  C  CE2 . TRP B 1 277 ? 28.815  45.368  43.461  1.00 12.26 ? 277 TRP B CE2 1 
ATOM   6194  C  CE3 . TRP B 1 277 ? 31.074  45.799  44.235  1.00 12.27 ? 277 TRP B CE3 1 
ATOM   6195  C  CZ2 . TRP B 1 277 ? 29.067  44.000  43.329  1.00 12.21 ? 277 TRP B CZ2 1 
ATOM   6196  C  CZ3 . TRP B 1 277 ? 31.325  44.436  44.104  1.00 12.28 ? 277 TRP B CZ3 1 
ATOM   6197  C  CH2 . TRP B 1 277 ? 30.323  43.553  43.653  1.00 12.20 ? 277 TRP B CH2 1 
ATOM   6198  N  N   . THR B 1 278 ? 29.845  51.820  42.792  1.00 12.85 ? 278 THR B N   1 
ATOM   6199  C  CA  . THR B 1 278 ? 29.825  53.259  43.019  1.00 12.75 ? 278 THR B CA  1 
ATOM   6200  C  C   . THR B 1 278 ? 28.616  53.595  43.888  1.00 12.92 ? 278 THR B C   1 
ATOM   6201  O  O   . THR B 1 278 ? 27.515  53.085  43.662  1.00 12.99 ? 278 THR B O   1 
ATOM   6202  C  CB  . THR B 1 278 ? 29.753  54.046  41.696  1.00 12.42 ? 278 THR B CB  1 
ATOM   6203  O  OG1 . THR B 1 278 ? 30.890  53.723  40.887  1.00 12.01 ? 278 THR B OG1 1 
ATOM   6204  C  CG2 . THR B 1 278 ? 29.765  55.535  41.969  1.00 12.14 ? 278 THR B CG2 1 
ATOM   6205  N  N   . PHE B 1 279 ? 28.823  54.450  44.883  1.00 12.47 ? 279 PHE B N   1 
ATOM   6206  C  CA  . PHE B 1 279 ? 27.748  54.819  45.796  1.00 12.25 ? 279 PHE B CA  1 
ATOM   6207  C  C   . PHE B 1 279 ? 27.022  56.093  45.417  1.00 12.28 ? 279 PHE B C   1 
ATOM   6208  O  O   . PHE B 1 279 ? 27.642  57.135  45.213  1.00 12.11 ? 279 PHE B O   1 
ATOM   6209  C  CB  . PHE B 1 279 ? 28.292  54.966  47.219  1.00 11.96 ? 279 PHE B CB  1 
ATOM   6210  C  CG  . PHE B 1 279 ? 27.318  54.552  48.283  1.00 11.60 ? 279 PHE B CG  1 
ATOM   6211  C  CD1 . PHE B 1 279 ? 26.566  55.502  48.964  1.00 11.46 ? 279 PHE B CD1 1 
ATOM   6212  C  CD2 . PHE B 1 279 ? 27.147  53.209  48.603  1.00 11.42 ? 279 PHE B CD2 1 
ATOM   6213  C  CE1 . PHE B 1 279 ? 25.661  55.121  49.948  1.00 11.30 ? 279 PHE B CE1 1 
ATOM   6214  C  CE2 . PHE B 1 279 ? 26.244  52.822  49.584  1.00 11.23 ? 279 PHE B CE2 1 
ATOM   6215  C  CZ  . PHE B 1 279 ? 25.500  53.780  50.257  1.00 11.20 ? 279 PHE B CZ  1 
ATOM   6216  N  N   . TYR B 1 280 ? 25.699  56.001  45.334  1.00 12.49 ? 280 TYR B N   1 
ATOM   6217  C  CA  . TYR B 1 280 ? 24.864  57.151  45.004  1.00 12.59 ? 280 TYR B CA  1 
ATOM   6218  C  C   . TYR B 1 280 ? 23.700  57.215  45.975  1.00 12.55 ? 280 TYR B C   1 
ATOM   6219  O  O   . TYR B 1 280 ? 23.361  56.223  46.622  1.00 12.69 ? 280 TYR B O   1 
ATOM   6220  C  CB  . TYR B 1 280 ? 24.280  57.034  43.591  1.00 12.86 ? 280 TYR B CB  1 
ATOM   6221  C  CG  . TYR B 1 280 ? 25.278  57.030  42.461  1.00 13.13 ? 280 TYR B CG  1 
ATOM   6222  C  CD1 . TYR B 1 280 ? 25.821  55.832  41.993  1.00 13.18 ? 280 TYR B CD1 1 
ATOM   6223  C  CD2 . TYR B 1 280 ? 25.629  58.214  41.811  1.00 13.30 ? 280 TYR B CD2 1 
ATOM   6224  C  CE1 . TYR B 1 280 ? 26.682  55.810  40.902  1.00 13.38 ? 280 TYR B CE1 1 
ATOM   6225  C  CE2 . TYR B 1 280 ? 26.494  58.206  40.714  1.00 13.50 ? 280 TYR B CE2 1 
ATOM   6226  C  CZ  . TYR B 1 280 ? 27.013  57.000  40.264  1.00 13.52 ? 280 TYR B CZ  1 
ATOM   6227  O  OH  . TYR B 1 280 ? 27.848  56.977  39.167  1.00 13.89 ? 280 TYR B OH  1 
ATOM   6228  N  N   . ILE B 1 281 ? 23.084  58.389  46.067  1.00 12.85 ? 281 ILE B N   1 
ATOM   6229  C  CA  . ILE B 1 281 ? 21.919  58.578  46.924  1.00 12.78 ? 281 ILE B CA  1 
ATOM   6230  C  C   . ILE B 1 281 ? 20.903  59.455  46.216  1.00 12.80 ? 281 ILE B C   1 
ATOM   6231  O  O   . ILE B 1 281 ? 21.264  60.430  45.556  1.00 12.90 ? 281 ILE B O   1 
ATOM   6232  C  CB  . ILE B 1 281 ? 22.272  59.250  48.264  1.00 12.63 ? 281 ILE B CB  1 
ATOM   6233  C  CG1 . ILE B 1 281 ? 22.983  60.582  48.016  1.00 12.61 ? 281 ILE B CG1 1 
ATOM   6234  C  CG2 . ILE B 1 281 ? 23.117  58.312  49.104  1.00 12.74 ? 281 ILE B CG2 1 
ATOM   6235  C  CD1 . ILE B 1 281 ? 22.746  61.605  49.109  1.00 12.30 ? 281 ILE B CD1 1 
ATOM   6236  N  N   . GLN B 1 282 ? 19.635  59.080  46.334  1.00 12.65 ? 282 GLN B N   1 
ATOM   6237  C  CA  . GLN B 1 282 ? 18.554  59.848  45.742  1.00 12.44 ? 282 GLN B CA  1 
ATOM   6238  C  C   . GLN B 1 282 ? 18.008  60.675  46.893  1.00 12.31 ? 282 GLN B C   1 
ATOM   6239  O  O   . GLN B 1 282 ? 17.692  60.127  47.948  1.00 12.39 ? 282 GLN B O   1 
ATOM   6240  C  CB  . GLN B 1 282 ? 17.469  58.917  45.190  1.00 12.42 ? 282 GLN B CB  1 
ATOM   6241  C  CG  . GLN B 1 282 ? 17.383  58.918  43.671  1.00 12.58 ? 282 GLN B CG  1 
ATOM   6242  C  CD  . GLN B 1 282 ? 16.406  57.891  43.117  1.00 12.74 ? 282 GLN B CD  1 
ATOM   6243  O  OE1 . GLN B 1 282 ? 16.174  56.844  43.717  1.00 12.94 ? 282 GLN B OE1 1 
ATOM   6244  N  NE2 . GLN B 1 282 ? 15.833  58.190  41.958  1.00 13.05 ? 282 GLN B NE2 1 
ATOM   6245  N  N   . VAL B 1 283 ? 17.914  61.987  46.706  1.00 12.07 ? 283 VAL B N   1 
ATOM   6246  C  CA  . VAL B 1 283 ? 17.412  62.856  47.763  1.00 12.02 ? 283 VAL B CA  1 
ATOM   6247  C  C   . VAL B 1 283 ? 16.000  63.372  47.501  1.00 12.03 ? 283 VAL B C   1 
ATOM   6248  O  O   . VAL B 1 283 ? 15.632  63.655  46.363  1.00 11.92 ? 283 VAL B O   1 
ATOM   6249  C  CB  . VAL B 1 283 ? 18.353  64.056  47.974  1.00 11.94 ? 283 VAL B CB  1 
ATOM   6250  C  CG1 . VAL B 1 283 ? 17.688  65.101  48.856  1.00 12.07 ? 283 VAL B CG1 1 
ATOM   6251  C  CG2 . VAL B 1 283 ? 19.645  63.582  48.602  1.00 11.77 ? 283 VAL B CG2 1 
ATOM   6252  N  N   . MET B 1 284 ? 15.211  63.473  48.568  1.00 12.12 ? 284 MET B N   1 
ATOM   6253  C  CA  . MET B 1 284 ? 13.840  63.972  48.484  1.00 12.26 ? 284 MET B CA  1 
ATOM   6254  C  C   . MET B 1 284 ? 13.504  64.759  49.744  1.00 12.34 ? 284 MET B C   1 
ATOM   6255  O  O   . MET B 1 284 ? 13.431  64.201  50.836  1.00 12.48 ? 284 MET B O   1 
ATOM   6256  C  CB  . MET B 1 284 ? 12.838  62.826  48.331  1.00 12.19 ? 284 MET B CB  1 
ATOM   6257  C  CG  . MET B 1 284 ? 11.401  63.308  48.224  1.00 12.24 ? 284 MET B CG  1 
ATOM   6258  S  SD  . MET B 1 284 ? 10.163  62.025  48.489  1.00 12.47 ? 284 MET B SD  1 
ATOM   6259  C  CE  . MET B 1 284 ? 9.550   61.814  46.824  1.00 12.31 ? 284 MET B CE  1 
ATOM   6260  N  N   . THR B 1 285 ? 13.306  66.060  49.583  1.00 12.57 ? 285 THR B N   1 
ATOM   6261  C  CA  . THR B 1 285 ? 12.981  66.927  50.702  1.00 12.57 ? 285 THR B CA  1 
ATOM   6262  C  C   . THR B 1 285 ? 11.635  66.530  51.289  1.00 12.83 ? 285 THR B C   1 
ATOM   6263  O  O   . THR B 1 285 ? 10.933  65.681  50.736  1.00 12.77 ? 285 THR B O   1 
ATOM   6264  C  CB  . THR B 1 285 ? 12.912  68.383  50.251  1.00 12.45 ? 285 THR B CB  1 
ATOM   6265  O  OG1 . THR B 1 285 ? 11.646  68.627  49.624  1.00 12.57 ? 285 THR B OG1 1 
ATOM   6266  C  CG2 . THR B 1 285 ? 14.027  68.674  49.262  1.00 12.08 ? 285 THR B CG2 1 
ATOM   6267  N  N   . PHE B 1 286 ? 11.281  67.143  52.413  1.00 13.15 ? 286 PHE B N   1 
ATOM   6268  C  CA  . PHE B 1 286 ? 10.010  66.850  53.062  1.00 13.64 ? 286 PHE B CA  1 
ATOM   6269  C  C   . PHE B 1 286 ? 8.863   67.340  52.181  1.00 13.74 ? 286 PHE B C   1 
ATOM   6270  O  O   . PHE B 1 286 ? 7.833   66.673  52.052  1.00 13.73 ? 286 PHE B O   1 
ATOM   6271  C  CB  . PHE B 1 286 ? 9.937   67.538  54.432  1.00 13.90 ? 286 PHE B CB  1 
ATOM   6272  C  CG  . PHE B 1 286 ? 10.724  66.846  55.508  1.00 14.33 ? 286 PHE B CG  1 
ATOM   6273  C  CD1 . PHE B 1 286 ? 11.633  65.839  55.192  1.00 14.65 ? 286 PHE B CD1 1 
ATOM   6274  C  CD2 . PHE B 1 286 ? 10.567  67.216  56.840  1.00 14.51 ? 286 PHE B CD2 1 
ATOM   6275  C  CE1 . PHE B 1 286 ? 12.378  65.206  56.189  1.00 14.92 ? 286 PHE B CE1 1 
ATOM   6276  C  CE2 . PHE B 1 286 ? 11.306  66.592  57.849  1.00 14.74 ? 286 PHE B CE2 1 
ATOM   6277  C  CZ  . PHE B 1 286 ? 12.213  65.585  57.522  1.00 14.96 ? 286 PHE B CZ  1 
ATOM   6278  N  N   . ASN B 1 287 ? 9.049   68.510  51.577  1.00 13.78 ? 287 ASN B N   1 
ATOM   6279  C  CA  . ASN B 1 287 ? 8.026   69.083  50.717  1.00 14.01 ? 287 ASN B CA  1 
ATOM   6280  C  C   . ASN B 1 287 ? 7.652   68.120  49.600  1.00 14.09 ? 287 ASN B C   1 
ATOM   6281  O  O   . ASN B 1 287 ? 6.502   67.678  49.523  1.00 14.00 ? 287 ASN B O   1 
ATOM   6282  C  CB  . ASN B 1 287 ? 8.507   70.411  50.135  1.00 14.23 ? 287 ASN B CB  1 
ATOM   6283  C  CG  . ASN B 1 287 ? 8.979   71.375  51.205  1.00 14.41 ? 287 ASN B CG  1 
ATOM   6284  O  OD1 . ASN B 1 287 ? 8.249   72.283  51.612  1.00 14.29 ? 287 ASN B OD1 1 
ATOM   6285  N  ND2 . ASN B 1 287 ? 10.209  71.178  51.672  1.00 14.80 ? 287 ASN B ND2 1 
ATOM   6286  N  N   . GLN B 1 288 ? 8.617   67.788  48.744  1.00 13.93 ? 288 GLN B N   1 
ATOM   6287  C  CA  . GLN B 1 288 ? 8.348   66.871  47.647  1.00 14.07 ? 288 GLN B CA  1 
ATOM   6288  C  C   . GLN B 1 288 ? 7.774   65.569  48.189  1.00 14.08 ? 288 GLN B C   1 
ATOM   6289  O  O   . GLN B 1 288 ? 7.012   64.882  47.500  1.00 14.07 ? 288 GLN B O   1 
ATOM   6290  C  CB  . GLN B 1 288 ? 9.620   66.568  46.844  1.00 14.12 ? 288 GLN B CB  1 
ATOM   6291  C  CG  . GLN B 1 288 ? 10.918  66.951  47.524  1.00 14.14 ? 288 GLN B CG  1 
ATOM   6292  C  CD  . GLN B 1 288 ? 12.062  67.099  46.537  1.00 14.16 ? 288 GLN B CD  1 
ATOM   6293  O  OE1 . GLN B 1 288 ? 12.909  66.213  46.409  1.00 14.05 ? 288 GLN B OE1 1 
ATOM   6294  N  NE2 . GLN B 1 288 ? 12.091  68.226  45.830  1.00 14.21 ? 288 GLN B NE2 1 
ATOM   6295  N  N   . ALA B 1 289 ? 8.133   65.239  49.427  1.00 13.89 ? 289 ALA B N   1 
ATOM   6296  C  CA  . ALA B 1 289 ? 7.652   64.013  50.054  1.00 13.85 ? 289 ALA B CA  1 
ATOM   6297  C  C   . ALA B 1 289 ? 6.133   63.978  50.061  1.00 13.73 ? 289 ALA B C   1 
ATOM   6298  O  O   . ALA B 1 289 ? 5.534   62.908  49.970  1.00 13.50 ? 289 ALA B O   1 
ATOM   6299  C  CB  . ALA B 1 289 ? 8.186   63.903  51.475  1.00 13.94 ? 289 ALA B CB  1 
ATOM   6300  N  N   . GLU B 1 290 ? 5.517   65.152  50.168  1.00 13.87 ? 290 GLU B N   1 
ATOM   6301  C  CA  . GLU B 1 290 ? 4.064   65.255  50.177  1.00 14.42 ? 290 GLU B CA  1 
ATOM   6302  C  C   . GLU B 1 290 ? 3.513   65.197  48.755  1.00 14.40 ? 290 GLU B C   1 
ATOM   6303  O  O   . GLU B 1 290 ? 2.686   64.336  48.428  1.00 14.61 ? 290 GLU B O   1 
ATOM   6304  C  CB  . GLU B 1 290 ? 3.628   66.567  50.833  1.00 14.65 ? 290 GLU B CB  1 
ATOM   6305  C  CG  . GLU B 1 290 ? 3.368   66.456  52.329  1.00 15.44 ? 290 GLU B CG  1 
ATOM   6306  C  CD  . GLU B 1 290 ? 4.211   67.435  53.149  1.00 15.97 ? 290 GLU B CD  1 
ATOM   6307  O  OE1 . GLU B 1 290 ? 5.306   67.035  53.616  1.00 16.59 ? 290 GLU B OE1 1 
ATOM   6308  O  OE2 . GLU B 1 290 ? 3.781   68.603  53.326  1.00 16.19 ? 290 GLU B OE2 1 
ATOM   6309  N  N   . THR B 1 291 ? 3.988   66.112  47.915  1.00 14.04 ? 291 THR B N   1 
ATOM   6310  C  CA  . THR B 1 291 ? 3.551   66.205  46.524  1.00 13.46 ? 291 THR B CA  1 
ATOM   6311  C  C   . THR B 1 291 ? 3.634   64.885  45.769  1.00 13.33 ? 291 THR B C   1 
ATOM   6312  O  O   . THR B 1 291 ? 2.973   64.707  44.748  1.00 13.45 ? 291 THR B O   1 
ATOM   6313  C  CB  . THR B 1 291 ? 4.375   67.265  45.768  1.00 13.34 ? 291 THR B CB  1 
ATOM   6314  O  OG1 . THR B 1 291 ? 5.738   66.832  45.668  1.00 12.82 ? 291 THR B OG1 1 
ATOM   6315  C  CG2 . THR B 1 291 ? 4.314   68.603  46.502  1.00 13.01 ? 291 THR B CG2 1 
ATOM   6316  N  N   . PHE B 1 292 ? 4.450   63.966  46.273  1.00 13.25 ? 292 PHE B N   1 
ATOM   6317  C  CA  . PHE B 1 292 ? 4.623   62.655  45.652  1.00 13.13 ? 292 PHE B CA  1 
ATOM   6318  C  C   . PHE B 1 292 ? 3.275   61.979  45.378  1.00 12.91 ? 292 PHE B C   1 
ATOM   6319  O  O   . PHE B 1 292 ? 2.456   61.820  46.286  1.00 12.70 ? 292 PHE B O   1 
ATOM   6320  C  CB  . PHE B 1 292 ? 5.476   61.761  46.554  1.00 13.17 ? 292 PHE B CB  1 
ATOM   6321  C  CG  . PHE B 1 292 ? 6.114   60.610  45.838  1.00 13.41 ? 292 PHE B CG  1 
ATOM   6322  C  CD1 . PHE B 1 292 ? 7.097   60.831  44.879  1.00 13.41 ? 292 PHE B CD1 1 
ATOM   6323  C  CD2 . PHE B 1 292 ? 5.733   59.299  46.122  1.00 13.66 ? 292 PHE B CD2 1 
ATOM   6324  C  CE1 . PHE B 1 292 ? 7.697   59.761  44.206  1.00 13.51 ? 292 PHE B CE1 1 
ATOM   6325  C  CE2 . PHE B 1 292 ? 6.325   58.217  45.456  1.00 13.82 ? 292 PHE B CE2 1 
ATOM   6326  C  CZ  . PHE B 1 292 ? 7.310   58.451  44.495  1.00 13.68 ? 292 PHE B CZ  1 
ATOM   6327  N  N   . PRO B 1 293 ? 3.042   61.558  44.118  1.00 12.81 ? 293 PRO B N   1 
ATOM   6328  C  CA  . PRO B 1 293 ? 1.801   60.896  43.689  1.00 12.81 ? 293 PRO B CA  1 
ATOM   6329  C  C   . PRO B 1 293 ? 1.558   59.535  44.347  1.00 12.96 ? 293 PRO B C   1 
ATOM   6330  O  O   . PRO B 1 293 ? 0.522   58.902  44.134  1.00 12.83 ? 293 PRO B O   1 
ATOM   6331  C  CB  . PRO B 1 293 ? 1.962   60.777  42.172  1.00 12.58 ? 293 PRO B CB  1 
ATOM   6332  C  CG  . PRO B 1 293 ? 3.430   60.770  41.953  1.00 12.52 ? 293 PRO B CG  1 
ATOM   6333  C  CD  . PRO B 1 293 ? 3.999   61.686  43.003  1.00 12.60 ? 293 PRO B CD  1 
ATOM   6334  N  N   . PHE B 1 294 ? 2.521   59.086  45.140  1.00 13.12 ? 294 PHE B N   1 
ATOM   6335  C  CA  . PHE B 1 294 ? 2.406   57.810  45.829  1.00 13.34 ? 294 PHE B CA  1 
ATOM   6336  C  C   . PHE B 1 294 ? 2.881   57.966  47.268  1.00 13.52 ? 294 PHE B C   1 
ATOM   6337  O  O   . PHE B 1 294 ? 3.098   59.086  47.745  1.00 13.42 ? 294 PHE B O   1 
ATOM   6338  C  CB  . PHE B 1 294 ? 3.257   56.740  45.130  1.00 13.58 ? 294 PHE B CB  1 
ATOM   6339  C  CG  . PHE B 1 294 ? 2.956   56.581  43.666  1.00 13.63 ? 294 PHE B CG  1 
ATOM   6340  C  CD1 . PHE B 1 294 ? 1.678   56.224  43.238  1.00 13.76 ? 294 PHE B CD1 1 
ATOM   6341  C  CD2 . PHE B 1 294 ? 3.944   56.802  42.712  1.00 13.39 ? 294 PHE B CD2 1 
ATOM   6342  C  CE1 . PHE B 1 294 ? 1.390   56.092  41.884  1.00 13.55 ? 294 PHE B CE1 1 
ATOM   6343  C  CE2 . PHE B 1 294 ? 3.662   56.673  41.359  1.00 13.09 ? 294 PHE B CE2 1 
ATOM   6344  C  CZ  . PHE B 1 294 ? 2.384   56.319  40.944  1.00 13.24 ? 294 PHE B CZ  1 
ATOM   6345  N  N   . ASN B 1 295 ? 3.025   56.834  47.953  1.00 13.53 ? 295 ASN B N   1 
ATOM   6346  C  CA  . ASN B 1 295 ? 3.502   56.817  49.328  1.00 13.32 ? 295 ASN B CA  1 
ATOM   6347  C  C   . ASN B 1 295 ? 5.020   56.696  49.244  1.00 13.14 ? 295 ASN B C   1 
ATOM   6348  O  O   . ASN B 1 295 ? 5.554   55.628  48.935  1.00 13.27 ? 295 ASN B O   1 
ATOM   6349  C  CB  . ASN B 1 295 ? 2.926   55.618  50.083  1.00 13.63 ? 295 ASN B CB  1 
ATOM   6350  C  CG  . ASN B 1 295 ? 3.530   55.459  51.468  1.00 13.79 ? 295 ASN B CG  1 
ATOM   6351  O  OD1 . ASN B 1 295 ? 4.328   56.288  51.903  1.00 14.29 ? 295 ASN B OD1 1 
ATOM   6352  N  ND2 . ASN B 1 295 ? 3.155   54.391  52.166  1.00 13.51 ? 295 ASN B ND2 1 
ATOM   6353  N  N   . PRO B 1 296 ? 5.736   57.794  49.521  1.00 13.03 ? 296 PRO B N   1 
ATOM   6354  C  CA  . PRO B 1 296 ? 7.199   57.768  49.457  1.00 13.04 ? 296 PRO B CA  1 
ATOM   6355  C  C   . PRO B 1 296 ? 7.804   56.580  50.202  1.00 13.16 ? 296 PRO B C   1 
ATOM   6356  O  O   . PRO B 1 296 ? 8.903   56.123  49.885  1.00 13.12 ? 296 PRO B O   1 
ATOM   6357  C  CB  . PRO B 1 296 ? 7.609   59.097  50.079  1.00 12.85 ? 296 PRO B CB  1 
ATOM   6358  C  CG  . PRO B 1 296 ? 6.433   59.980  49.908  1.00 12.79 ? 296 PRO B CG  1 
ATOM   6359  C  CD  . PRO B 1 296 ? 5.220   59.109  49.933  1.00 12.94 ? 296 PRO B CD  1 
ATOM   6360  N  N   . PHE B 1 297 ? 7.068   56.072  51.182  1.00 13.10 ? 297 PHE B N   1 
ATOM   6361  C  CA  . PHE B 1 297 ? 7.538   54.960  51.997  1.00 13.04 ? 297 PHE B CA  1 
ATOM   6362  C  C   . PHE B 1 297 ? 6.983   53.615  51.565  1.00 13.16 ? 297 PHE B C   1 
ATOM   6363  O  O   . PHE B 1 297 ? 7.056   52.637  52.307  1.00 13.27 ? 297 PHE B O   1 
ATOM   6364  C  CB  . PHE B 1 297 ? 7.202   55.242  53.459  1.00 12.93 ? 297 PHE B CB  1 
ATOM   6365  C  CG  . PHE B 1 297 ? 7.339   56.693  53.823  1.00 12.88 ? 297 PHE B CG  1 
ATOM   6366  C  CD1 . PHE B 1 297 ? 8.595   57.286  53.895  1.00 12.75 ? 297 PHE B CD1 1 
ATOM   6367  C  CD2 . PHE B 1 297 ? 6.213   57.483  54.033  1.00 12.92 ? 297 PHE B CD2 1 
ATOM   6368  C  CE1 . PHE B 1 297 ? 8.731   58.640  54.164  1.00 12.85 ? 297 PHE B CE1 1 
ATOM   6369  C  CE2 . PHE B 1 297 ? 6.338   58.843  54.304  1.00 13.08 ? 297 PHE B CE2 1 
ATOM   6370  C  CZ  . PHE B 1 297 ? 7.602   59.423  54.368  1.00 13.06 ? 297 PHE B CZ  1 
ATOM   6371  N  N   . ASP B 1 298 ? 6.433   53.569  50.357  1.00 13.18 ? 298 ASP B N   1 
ATOM   6372  C  CA  . ASP B 1 298 ? 5.890   52.329  49.820  1.00 13.01 ? 298 ASP B CA  1 
ATOM   6373  C  C   . ASP B 1 298 ? 7.038   51.544  49.181  1.00 12.91 ? 298 ASP B C   1 
ATOM   6374  O  O   . ASP B 1 298 ? 7.558   51.929  48.131  1.00 12.89 ? 298 ASP B O   1 
ATOM   6375  C  CB  . ASP B 1 298 ? 4.811   52.628  48.775  1.00 13.03 ? 298 ASP B CB  1 
ATOM   6376  C  CG  . ASP B 1 298 ? 4.102   51.373  48.295  1.00 13.10 ? 298 ASP B CG  1 
ATOM   6377  O  OD1 . ASP B 1 298 ? 4.619   50.257  48.546  1.00 12.66 ? 298 ASP B OD1 1 
ATOM   6378  O  OD2 . ASP B 1 298 ? 3.027   51.500  47.666  1.00 13.53 ? 298 ASP B OD2 1 
ATOM   6379  N  N   . LEU B 1 299 ? 7.437   50.451  49.822  1.00 12.81 ? 299 LEU B N   1 
ATOM   6380  C  CA  . LEU B 1 299 ? 8.530   49.635  49.315  1.00 12.92 ? 299 LEU B CA  1 
ATOM   6381  C  C   . LEU B 1 299 ? 8.251   49.091  47.917  1.00 13.04 ? 299 LEU B C   1 
ATOM   6382  O  O   . LEU B 1 299 ? 9.173   48.700  47.203  1.00 12.83 ? 299 LEU B O   1 
ATOM   6383  C  CB  . LEU B 1 299 ? 8.815   48.477  50.277  1.00 12.85 ? 299 LEU B CB  1 
ATOM   6384  C  CG  . LEU B 1 299 ? 10.086  47.657  50.011  1.00 12.81 ? 299 LEU B CG  1 
ATOM   6385  C  CD1 . LEU B 1 299 ? 11.323  48.546  50.094  1.00 12.73 ? 299 LEU B CD1 1 
ATOM   6386  C  CD2 . LEU B 1 299 ? 10.173  46.527  51.023  1.00 12.72 ? 299 LEU B CD2 1 
ATOM   6387  N  N   . THR B 1 300 ? 6.981   49.066  47.523  1.00 13.25 ? 300 THR B N   1 
ATOM   6388  C  CA  . THR B 1 300 ? 6.614   48.570  46.200  1.00 13.58 ? 300 THR B CA  1 
ATOM   6389  C  C   . THR B 1 300 ? 6.582   49.699  45.168  1.00 13.46 ? 300 THR B C   1 
ATOM   6390  O  O   . THR B 1 300 ? 5.875   49.615  44.164  1.00 13.60 ? 300 THR B O   1 
ATOM   6391  C  CB  . THR B 1 300 ? 5.231   47.876  46.220  1.00 13.82 ? 300 THR B CB  1 
ATOM   6392  O  OG1 . THR B 1 300 ? 4.205   48.853  46.423  1.00 14.17 ? 300 THR B OG1 1 
ATOM   6393  C  CG2 . THR B 1 300 ? 5.167   46.848  47.340  1.00 14.04 ? 300 THR B CG2 1 
ATOM   6394  N  N   . LYS B 1 301 ? 7.352   50.752  45.423  1.00 13.34 ? 301 LYS B N   1 
ATOM   6395  C  CA  . LYS B 1 301 ? 7.421   51.890  44.515  1.00 13.19 ? 301 LYS B CA  1 
ATOM   6396  C  C   . LYS B 1 301 ? 8.861   52.344  44.398  1.00 13.18 ? 301 LYS B C   1 
ATOM   6397  O  O   . LYS B 1 301 ? 9.683   52.044  45.262  1.00 13.09 ? 301 LYS B O   1 
ATOM   6398  C  CB  . LYS B 1 301 ? 6.568   53.043  45.033  1.00 13.13 ? 301 LYS B CB  1 
ATOM   6399  C  CG  . LYS B 1 301 ? 5.123   52.672  45.269  1.00 13.18 ? 301 LYS B CG  1 
ATOM   6400  C  CD  . LYS B 1 301 ? 4.281   52.887  44.029  1.00 12.97 ? 301 LYS B CD  1 
ATOM   6401  C  CE  . LYS B 1 301 ? 3.011   52.065  44.110  1.00 13.15 ? 301 LYS B CE  1 
ATOM   6402  N  NZ  . LYS B 1 301 ? 3.223   50.802  44.875  1.00 12.44 ? 301 LYS B NZ  1 
ATOM   6403  N  N   . VAL B 1 302 ? 9.165   53.070  43.327  1.00 13.02 ? 302 VAL B N   1 
ATOM   6404  C  CA  . VAL B 1 302 ? 10.517  53.556  43.103  1.00 12.99 ? 302 VAL B CA  1 
ATOM   6405  C  C   . VAL B 1 302 ? 10.496  55.055  42.899  1.00 13.07 ? 302 VAL B C   1 
ATOM   6406  O  O   . VAL B 1 302 ? 9.440   55.635  42.654  1.00 13.29 ? 302 VAL B O   1 
ATOM   6407  C  CB  . VAL B 1 302 ? 11.148  52.900  41.855  1.00 12.85 ? 302 VAL B CB  1 
ATOM   6408  C  CG1 . VAL B 1 302 ? 10.984  51.383  41.920  1.00 12.71 ? 302 VAL B CG1 1 
ATOM   6409  C  CG2 . VAL B 1 302 ? 10.500  53.446  40.596  1.00 12.53 ? 302 VAL B CG2 1 
ATOM   6410  N  N   . TRP B 1 303 ? 11.664  55.678  43.015  1.00 13.29 ? 303 TRP B N   1 
ATOM   6411  C  CA  . TRP B 1 303 ? 11.792  57.118  42.817  1.00 13.26 ? 303 TRP B CA  1 
ATOM   6412  C  C   . TRP B 1 303 ? 12.406  57.351  41.429  1.00 13.34 ? 303 TRP B C   1 
ATOM   6413  O  O   . TRP B 1 303 ? 13.579  57.045  41.196  1.00 13.27 ? 303 TRP B O   1 
ATOM   6414  C  CB  . TRP B 1 303 ? 12.697  57.732  43.893  1.00 13.26 ? 303 TRP B CB  1 
ATOM   6415  C  CG  . TRP B 1 303 ? 12.064  57.854  45.252  1.00 13.44 ? 303 TRP B CG  1 
ATOM   6416  C  CD1 . TRP B 1 303 ? 10.848  57.369  45.639  1.00 13.56 ? 303 TRP B CD1 1 
ATOM   6417  C  CD2 . TRP B 1 303 ? 12.629  58.485  46.411  1.00 13.46 ? 303 TRP B CD2 1 
ATOM   6418  N  NE1 . TRP B 1 303 ? 10.621  57.656  46.966  1.00 13.68 ? 303 TRP B NE1 1 
ATOM   6419  C  CE2 . TRP B 1 303 ? 11.698  58.341  47.463  1.00 13.59 ? 303 TRP B CE2 1 
ATOM   6420  C  CE3 . TRP B 1 303 ? 13.834  59.159  46.663  1.00 13.46 ? 303 TRP B CE3 1 
ATOM   6421  C  CZ2 . TRP B 1 303 ? 11.931  58.845  48.750  1.00 13.68 ? 303 TRP B CZ2 1 
ATOM   6422  C  CZ3 . TRP B 1 303 ? 14.069  59.663  47.948  1.00 13.47 ? 303 TRP B CZ3 1 
ATOM   6423  C  CH2 . TRP B 1 303 ? 13.118  59.501  48.972  1.00 13.56 ? 303 TRP B CH2 1 
ATOM   6424  N  N   . PRO B 1 304 ? 11.609  57.870  40.481  1.00 13.43 ? 304 PRO B N   1 
ATOM   6425  C  CA  . PRO B 1 304 ? 12.120  58.126  39.128  1.00 13.50 ? 304 PRO B CA  1 
ATOM   6426  C  C   . PRO B 1 304 ? 13.395  58.963  39.144  1.00 13.59 ? 304 PRO B C   1 
ATOM   6427  O  O   . PRO B 1 304 ? 13.475  59.973  39.845  1.00 13.73 ? 304 PRO B O   1 
ATOM   6428  C  CB  . PRO B 1 304 ? 10.967  58.850  38.439  1.00 13.54 ? 304 PRO B CB  1 
ATOM   6429  C  CG  . PRO B 1 304 ? 9.749   58.393  39.179  1.00 13.53 ? 304 PRO B CG  1 
ATOM   6430  C  CD  . PRO B 1 304 ? 10.185  58.225  40.608  1.00 13.45 ? 304 PRO B CD  1 
ATOM   6431  N  N   . HIS B 1 305 ? 14.387  58.540  38.369  1.00 13.49 ? 305 HIS B N   1 
ATOM   6432  C  CA  . HIS B 1 305 ? 15.660  59.248  38.309  1.00 13.62 ? 305 HIS B CA  1 
ATOM   6433  C  C   . HIS B 1 305 ? 15.548  60.617  37.642  1.00 13.69 ? 305 HIS B C   1 
ATOM   6434  O  O   . HIS B 1 305 ? 16.444  61.456  37.771  1.00 13.48 ? 305 HIS B O   1 
ATOM   6435  C  CB  . HIS B 1 305 ? 16.690  58.391  37.572  1.00 13.59 ? 305 HIS B CB  1 
ATOM   6436  C  CG  . HIS B 1 305 ? 17.039  57.125  38.291  1.00 13.66 ? 305 HIS B CG  1 
ATOM   6437  N  ND1 . HIS B 1 305 ? 16.211  56.021  38.299  1.00 13.76 ? 305 HIS B ND1 1 
ATOM   6438  C  CD2 . HIS B 1 305 ? 18.118  56.791  39.036  1.00 13.67 ? 305 HIS B CD2 1 
ATOM   6439  C  CE1 . HIS B 1 305 ? 16.768  55.062  39.020  1.00 13.82 ? 305 HIS B CE1 1 
ATOM   6440  N  NE2 . HIS B 1 305 ? 17.925  55.505  39.478  1.00 13.76 ? 305 HIS B NE2 1 
ATOM   6441  N  N   . LYS B 1 306 ? 14.449  60.844  36.930  1.00 13.73 ? 306 LYS B N   1 
ATOM   6442  C  CA  . LYS B 1 306 ? 14.241  62.115  36.252  1.00 14.05 ? 306 LYS B CA  1 
ATOM   6443  C  C   . LYS B 1 306 ? 13.843  63.206  37.243  1.00 14.09 ? 306 LYS B C   1 
ATOM   6444  O  O   . LYS B 1 306 ? 14.290  64.351  37.137  1.00 13.90 ? 306 LYS B O   1 
ATOM   6445  C  CB  . LYS B 1 306 ? 13.162  61.970  35.175  1.00 14.36 ? 306 LYS B CB  1 
ATOM   6446  C  CG  . LYS B 1 306 ? 12.315  60.717  35.324  1.00 14.77 ? 306 LYS B CG  1 
ATOM   6447  C  CD  . LYS B 1 306 ? 12.737  59.641  34.335  1.00 14.93 ? 306 LYS B CD  1 
ATOM   6448  C  CE  . LYS B 1 306 ? 12.694  58.262  34.968  1.00 14.86 ? 306 LYS B CE  1 
ATOM   6449  N  NZ  . LYS B 1 306 ? 14.067  57.751  35.257  1.00 15.18 ? 306 LYS B NZ  1 
ATOM   6450  N  N   . ASP B 1 307 ? 12.998  62.853  38.204  1.00 14.14 ? 307 ASP B N   1 
ATOM   6451  C  CA  . ASP B 1 307 ? 12.555  63.817  39.203  1.00 14.51 ? 307 ASP B CA  1 
ATOM   6452  C  C   . ASP B 1 307 ? 13.484  63.806  40.413  1.00 14.44 ? 307 ASP B C   1 
ATOM   6453  O  O   . ASP B 1 307 ? 13.537  64.774  41.179  1.00 14.34 ? 307 ASP B O   1 
ATOM   6454  C  CB  . ASP B 1 307 ? 11.127  63.497  39.644  1.00 15.05 ? 307 ASP B CB  1 
ATOM   6455  C  CG  . ASP B 1 307 ? 10.159  63.428  38.473  1.00 15.66 ? 307 ASP B CG  1 
ATOM   6456  O  OD1 . ASP B 1 307 ? 9.644   64.491  38.048  1.00 15.67 ? 307 ASP B OD1 1 
ATOM   6457  O  OD2 . ASP B 1 307 ? 9.918   62.306  37.974  1.00 16.55 ? 307 ASP B OD2 1 
ATOM   6458  N  N   . TYR B 1 308 ? 14.219  62.707  40.570  1.00 14.13 ? 308 TYR B N   1 
ATOM   6459  C  CA  . TYR B 1 308 ? 15.147  62.546  41.682  1.00 13.71 ? 308 TYR B CA  1 
ATOM   6460  C  C   . TYR B 1 308 ? 16.418  61.856  41.209  1.00 13.65 ? 308 TYR B C   1 
ATOM   6461  O  O   . TYR B 1 308 ? 16.569  60.642  41.349  1.00 14.09 ? 308 TYR B O   1 
ATOM   6462  C  CB  . TYR B 1 308 ? 14.484  61.729  42.792  1.00 13.31 ? 308 TYR B CB  1 
ATOM   6463  C  CG  . TYR B 1 308 ? 13.131  62.270  43.190  1.00 12.73 ? 308 TYR B CG  1 
ATOM   6464  C  CD1 . TYR B 1 308 ? 13.026  63.424  43.971  1.00 12.30 ? 308 TYR B CD1 1 
ATOM   6465  C  CD2 . TYR B 1 308 ? 11.956  61.652  42.762  1.00 12.51 ? 308 TYR B CD2 1 
ATOM   6466  C  CE1 . TYR B 1 308 ? 11.789  63.952  44.317  1.00 11.91 ? 308 TYR B CE1 1 
ATOM   6467  C  CE2 . TYR B 1 308 ? 10.704  62.176  43.105  1.00 12.14 ? 308 TYR B CE2 1 
ATOM   6468  C  CZ  . TYR B 1 308 ? 10.634  63.328  43.881  1.00 11.91 ? 308 TYR B CZ  1 
ATOM   6469  O  OH  . TYR B 1 308 ? 9.415   63.865  44.218  1.00 11.59 ? 308 TYR B OH  1 
ATOM   6470  N  N   . PRO B 1 309 ? 17.347  62.626  40.625  1.00 13.26 ? 309 PRO B N   1 
ATOM   6471  C  CA  . PRO B 1 309 ? 18.623  62.101  40.118  1.00 13.05 ? 309 PRO B CA  1 
ATOM   6472  C  C   . PRO B 1 309 ? 19.592  61.587  41.186  1.00 12.80 ? 309 PRO B C   1 
ATOM   6473  O  O   . PRO B 1 309 ? 19.638  62.102  42.304  1.00 12.63 ? 309 PRO B O   1 
ATOM   6474  C  CB  . PRO B 1 309 ? 19.212  63.278  39.345  1.00 12.82 ? 309 PRO B CB  1 
ATOM   6475  C  CG  . PRO B 1 309 ? 18.596  64.486  39.990  1.00 12.79 ? 309 PRO B CG  1 
ATOM   6476  C  CD  . PRO B 1 309 ? 17.211  64.075  40.390  1.00 12.99 ? 309 PRO B CD  1 
ATOM   6477  N  N   . LEU B 1 310 ? 20.366  60.568  40.823  1.00 12.99 ? 310 LEU B N   1 
ATOM   6478  C  CA  . LEU B 1 310 ? 21.347  59.986  41.729  1.00 13.08 ? 310 LEU B CA  1 
ATOM   6479  C  C   . LEU B 1 310 ? 22.463  60.991  41.983  1.00 13.03 ? 310 LEU B C   1 
ATOM   6480  O  O   . LEU B 1 310 ? 22.840  61.748  41.097  1.00 13.13 ? 310 LEU B O   1 
ATOM   6481  C  CB  . LEU B 1 310 ? 21.952  58.712  41.128  1.00 13.28 ? 310 LEU B CB  1 
ATOM   6482  C  CG  . LEU B 1 310 ? 21.025  57.634  40.555  1.00 13.52 ? 310 LEU B CG  1 
ATOM   6483  C  CD1 . LEU B 1 310 ? 21.846  56.646  39.736  1.00 13.86 ? 310 LEU B CD1 1 
ATOM   6484  C  CD2 . LEU B 1 310 ? 20.312  56.899  41.674  1.00 13.66 ? 310 LEU B CD2 1 
ATOM   6485  N  N   . ILE B 1 311 ? 22.991  60.994  43.199  1.00 13.38 ? 311 ILE B N   1 
ATOM   6486  C  CA  . ILE B 1 311 ? 24.074  61.899  43.556  1.00 13.59 ? 311 ILE B CA  1 
ATOM   6487  C  C   . ILE B 1 311 ? 25.267  61.056  43.986  1.00 13.58 ? 311 ILE B C   1 
ATOM   6488  O  O   . ILE B 1 311 ? 25.158  60.234  44.900  1.00 13.74 ? 311 ILE B O   1 
ATOM   6489  C  CB  . ILE B 1 311 ? 23.669  62.830  44.722  1.00 13.40 ? 311 ILE B CB  1 
ATOM   6490  C  CG1 . ILE B 1 311 ? 22.657  63.868  44.237  1.00 13.27 ? 311 ILE B CG1 1 
ATOM   6491  C  CG2 . ILE B 1 311 ? 24.895  63.528  45.285  1.00 13.66 ? 311 ILE B CG2 1 
ATOM   6492  C  CD1 . ILE B 1 311 ? 21.571  64.178  45.247  1.00 12.58 ? 311 ILE B CD1 1 
ATOM   6493  N  N   . PRO B 1 312 ? 26.426  61.249  43.333  1.00 13.46 ? 312 PRO B N   1 
ATOM   6494  C  CA  . PRO B 1 312 ? 27.627  60.479  43.683  1.00 13.69 ? 312 PRO B CA  1 
ATOM   6495  C  C   . PRO B 1 312 ? 28.062  60.773  45.109  1.00 13.48 ? 312 PRO B C   1 
ATOM   6496  O  O   . PRO B 1 312 ? 27.983  61.915  45.563  1.00 13.69 ? 312 PRO B O   1 
ATOM   6497  C  CB  . PRO B 1 312 ? 28.670  60.943  42.669  1.00 13.49 ? 312 PRO B CB  1 
ATOM   6498  C  CG  . PRO B 1 312 ? 28.186  62.286  42.216  1.00 13.45 ? 312 PRO B CG  1 
ATOM   6499  C  CD  . PRO B 1 312 ? 26.684  62.214  42.252  1.00 13.55 ? 312 PRO B CD  1 
ATOM   6500  N  N   . VAL B 1 313 ? 28.509  59.740  45.814  1.00 13.46 ? 313 VAL B N   1 
ATOM   6501  C  CA  . VAL B 1 313 ? 28.961  59.899  47.188  1.00 13.11 ? 313 VAL B CA  1 
ATOM   6502  C  C   . VAL B 1 313 ? 30.343  59.285  47.372  1.00 12.94 ? 313 VAL B C   1 
ATOM   6503  O  O   . VAL B 1 313 ? 31.250  59.940  47.886  1.00 13.05 ? 313 VAL B O   1 
ATOM   6504  C  CB  . VAL B 1 313 ? 27.976  59.245  48.180  1.00 12.99 ? 313 VAL B CB  1 
ATOM   6505  C  CG1 . VAL B 1 313 ? 28.389  59.555  49.610  1.00 12.99 ? 313 VAL B CG1 1 
ATOM   6506  C  CG2 . VAL B 1 313 ? 26.568  59.753  47.918  1.00 12.81 ? 313 VAL B CG2 1 
ATOM   6507  N  N   . GLY B 1 314 ? 30.502  58.035  46.941  1.00 12.80 ? 314 GLY B N   1 
ATOM   6508  C  CA  . GLY B 1 314 ? 31.786  57.371  47.082  1.00 12.57 ? 314 GLY B CA  1 
ATOM   6509  C  C   . GLY B 1 314 ? 31.933  56.065  46.322  1.00 12.38 ? 314 GLY B C   1 
ATOM   6510  O  O   . GLY B 1 314 ? 31.193  55.785  45.378  1.00 12.39 ? 314 GLY B O   1 
ATOM   6511  N  N   . LYS B 1 315 ? 32.898  55.255  46.738  1.00 12.09 ? 315 LYS B N   1 
ATOM   6512  C  CA  . LYS B 1 315 ? 33.151  53.984  46.079  1.00 11.96 ? 315 LYS B CA  1 
ATOM   6513  C  C   . LYS B 1 315 ? 33.194  52.818  47.067  1.00 12.03 ? 315 LYS B C   1 
ATOM   6514  O  O   . LYS B 1 315 ? 33.589  52.978  48.223  1.00 11.82 ? 315 LYS B O   1 
ATOM   6515  C  CB  . LYS B 1 315 ? 34.470  54.066  45.302  1.00 11.89 ? 315 LYS B CB  1 
ATOM   6516  C  CG  . LYS B 1 315 ? 34.678  52.951  44.284  1.00 11.76 ? 315 LYS B CG  1 
ATOM   6517  C  CD  . LYS B 1 315 ? 34.109  53.319  42.926  1.00 11.73 ? 315 LYS B CD  1 
ATOM   6518  C  CE  . LYS B 1 315 ? 34.795  54.542  42.344  1.00 11.78 ? 315 LYS B CE  1 
ATOM   6519  N  NZ  . LYS B 1 315 ? 33.842  55.348  41.536  1.00 11.83 ? 315 LYS B NZ  1 
ATOM   6520  N  N   . LEU B 1 316 ? 32.779  51.648  46.593  1.00 11.91 ? 316 LEU B N   1 
ATOM   6521  C  CA  . LEU B 1 316 ? 32.755  50.433  47.399  1.00 12.00 ? 316 LEU B CA  1 
ATOM   6522  C  C   . LEU B 1 316 ? 33.708  49.437  46.760  1.00 11.92 ? 316 LEU B C   1 
ATOM   6523  O  O   . LEU B 1 316 ? 33.494  49.012  45.627  1.00 12.14 ? 316 LEU B O   1 
ATOM   6524  C  CB  . LEU B 1 316 ? 31.345  49.843  47.414  1.00 11.96 ? 316 LEU B CB  1 
ATOM   6525  C  CG  . LEU B 1 316 ? 30.687  49.466  48.743  1.00 11.84 ? 316 LEU B CG  1 
ATOM   6526  C  CD1 . LEU B 1 316 ? 30.872  50.575  49.760  1.00 11.81 ? 316 LEU B CD1 1 
ATOM   6527  C  CD2 . LEU B 1 316 ? 29.207  49.202  48.499  1.00 11.50 ? 316 LEU B CD2 1 
ATOM   6528  N  N   . VAL B 1 317 ? 34.752  49.059  47.487  1.00 11.90 ? 317 VAL B N   1 
ATOM   6529  C  CA  . VAL B 1 317 ? 35.737  48.131  46.955  1.00 11.70 ? 317 VAL B CA  1 
ATOM   6530  C  C   . VAL B 1 317 ? 35.963  46.917  47.841  1.00 11.80 ? 317 VAL B C   1 
ATOM   6531  O  O   . VAL B 1 317 ? 36.077  47.042  49.060  1.00 11.86 ? 317 VAL B O   1 
ATOM   6532  C  CB  . VAL B 1 317 ? 37.083  48.840  46.745  1.00 11.46 ? 317 VAL B CB  1 
ATOM   6533  C  CG1 . VAL B 1 317 ? 38.122  47.856  46.227  1.00 11.18 ? 317 VAL B CG1 1 
ATOM   6534  C  CG2 . VAL B 1 317 ? 36.904  50.003  45.775  1.00 11.25 ? 317 VAL B CG2 1 
ATOM   6535  N  N   . LEU B 1 318 ? 36.033  45.747  47.210  1.00 11.75 ? 318 LEU B N   1 
ATOM   6536  C  CA  . LEU B 1 318 ? 36.256  44.486  47.908  1.00 11.67 ? 318 LEU B CA  1 
ATOM   6537  C  C   . LEU B 1 318 ? 37.623  43.927  47.536  1.00 11.76 ? 318 LEU B C   1 
ATOM   6538  O  O   . LEU B 1 318 ? 37.813  43.423  46.431  1.00 11.78 ? 318 LEU B O   1 
ATOM   6539  C  CB  . LEU B 1 318 ? 35.179  43.478  47.523  1.00 11.68 ? 318 LEU B CB  1 
ATOM   6540  C  CG  . LEU B 1 318 ? 33.758  43.791  47.986  1.00 11.61 ? 318 LEU B CG  1 
ATOM   6541  C  CD1 . LEU B 1 318 ? 32.835  42.649  47.583  1.00 11.77 ? 318 LEU B CD1 1 
ATOM   6542  C  CD2 . LEU B 1 318 ? 33.741  43.995  49.490  1.00 11.40 ? 318 LEU B CD2 1 
ATOM   6543  N  N   . ASN B 1 319 ? 38.571  44.000  48.463  1.00 11.83 ? 319 ASN B N   1 
ATOM   6544  C  CA  . ASN B 1 319 ? 39.916  43.510  48.195  1.00 12.06 ? 319 ASN B CA  1 
ATOM   6545  C  C   . ASN B 1 319 ? 40.438  42.477  49.188  1.00 11.97 ? 319 ASN B C   1 
ATOM   6546  O  O   . ASN B 1 319 ? 41.647  42.374  49.387  1.00 11.75 ? 319 ASN B O   1 
ATOM   6547  C  CB  . ASN B 1 319 ? 40.888  44.687  48.154  1.00 12.27 ? 319 ASN B CB  1 
ATOM   6548  C  CG  . ASN B 1 319 ? 41.032  45.365  49.503  1.00 12.58 ? 319 ASN B CG  1 
ATOM   6549  O  OD1 . ASN B 1 319 ? 41.689  46.398  49.623  1.00 12.82 ? 319 ASN B OD1 1 
ATOM   6550  N  ND2 . ASN B 1 319 ? 40.413  44.786  50.528  1.00 12.83 ? 319 ASN B ND2 1 
ATOM   6551  N  N   . ARG B 1 320 ? 39.549  41.715  49.814  1.00 12.10 ? 320 ARG B N   1 
ATOM   6552  C  CA  . ARG B 1 320 ? 39.997  40.711  50.771  1.00 12.43 ? 320 ARG B CA  1 
ATOM   6553  C  C   . ARG B 1 320 ? 38.999  39.601  51.069  1.00 12.76 ? 320 ARG B C   1 
ATOM   6554  O  O   . ARG B 1 320 ? 37.908  39.849  51.594  1.00 12.98 ? 320 ARG B O   1 
ATOM   6555  C  CB  . ARG B 1 320 ? 40.389  41.377  52.085  1.00 12.58 ? 320 ARG B CB  1 
ATOM   6556  C  CG  . ARG B 1 320 ? 40.923  40.407  53.123  1.00 12.77 ? 320 ARG B CG  1 
ATOM   6557  C  CD  . ARG B 1 320 ? 41.503  41.149  54.319  1.00 13.19 ? 320 ARG B CD  1 
ATOM   6558  N  NE  . ARG B 1 320 ? 40.505  41.412  55.356  1.00 13.52 ? 320 ARG B NE  1 
ATOM   6559  C  CZ  . ARG B 1 320 ? 39.830  40.465  56.008  1.00 13.71 ? 320 ARG B CZ  1 
ATOM   6560  N  NH1 . ARG B 1 320 ? 40.038  39.179  55.736  1.00 13.38 ? 320 ARG B NH1 1 
ATOM   6561  N  NH2 . ARG B 1 320 ? 38.948  40.803  56.940  1.00 13.98 ? 320 ARG B NH2 1 
ATOM   6562  N  N   . ASN B 1 321 ? 39.393  38.372  50.745  1.00 12.74 ? 321 ASN B N   1 
ATOM   6563  C  CA  . ASN B 1 321 ? 38.560  37.201  50.983  1.00 12.45 ? 321 ASN B CA  1 
ATOM   6564  C  C   . ASN B 1 321 ? 38.621  36.852  52.464  1.00 12.44 ? 321 ASN B C   1 
ATOM   6565  O  O   . ASN B 1 321 ? 39.477  37.351  53.192  1.00 12.61 ? 321 ASN B O   1 
ATOM   6566  C  CB  . ASN B 1 321 ? 39.084  36.011  50.177  1.00 12.40 ? 321 ASN B CB  1 
ATOM   6567  C  CG  . ASN B 1 321 ? 38.803  36.136  48.697  1.00 12.16 ? 321 ASN B CG  1 
ATOM   6568  O  OD1 . ASN B 1 321 ? 39.696  35.953  47.872  1.00 12.04 ? 321 ASN B OD1 1 
ATOM   6569  N  ND2 . ASN B 1 321 ? 37.558  36.442  48.351  1.00 11.95 ? 321 ASN B ND2 1 
ATOM   6570  N  N   . PRO B 1 322 ? 37.698  36.007  52.937  1.00 12.48 ? 322 PRO B N   1 
ATOM   6571  C  CA  . PRO B 1 322 ? 37.720  35.629  54.353  1.00 12.63 ? 322 PRO B CA  1 
ATOM   6572  C  C   . PRO B 1 322 ? 38.769  34.540  54.597  1.00 12.82 ? 322 PRO B C   1 
ATOM   6573  O  O   . PRO B 1 322 ? 39.159  33.828  53.671  1.00 13.09 ? 322 PRO B O   1 
ATOM   6574  C  CB  . PRO B 1 322 ? 36.299  35.121  54.620  1.00 12.31 ? 322 PRO B CB  1 
ATOM   6575  C  CG  . PRO B 1 322 ? 35.545  35.277  53.314  1.00 12.13 ? 322 PRO B CG  1 
ATOM   6576  C  CD  . PRO B 1 322 ? 36.566  35.394  52.231  1.00 12.28 ? 322 PRO B CD  1 
ATOM   6577  N  N   . VAL B 1 323 ? 39.235  34.419  55.836  1.00 12.77 ? 323 VAL B N   1 
ATOM   6578  C  CA  . VAL B 1 323 ? 40.221  33.396  56.174  1.00 12.72 ? 323 VAL B CA  1 
ATOM   6579  C  C   . VAL B 1 323 ? 39.493  32.102  56.546  1.00 12.60 ? 323 VAL B C   1 
ATOM   6580  O  O   . VAL B 1 323 ? 39.864  31.004  56.110  1.00 12.30 ? 323 VAL B O   1 
ATOM   6581  C  CB  . VAL B 1 323 ? 41.095  33.834  57.364  1.00 12.89 ? 323 VAL B CB  1 
ATOM   6582  C  CG1 . VAL B 1 323 ? 42.148  32.780  57.649  1.00 13.01 ? 323 VAL B CG1 1 
ATOM   6583  C  CG2 . VAL B 1 323 ? 41.755  35.173  57.058  1.00 13.26 ? 323 VAL B CG2 1 
ATOM   6584  N  N   . ASN B 1 324 ? 38.449  32.247  57.355  1.00 12.22 ? 324 ASN B N   1 
ATOM   6585  C  CA  . ASN B 1 324 ? 37.645  31.119  57.794  1.00 11.94 ? 324 ASN B CA  1 
ATOM   6586  C  C   . ASN B 1 324 ? 36.200  31.476  57.511  1.00 11.74 ? 324 ASN B C   1 
ATOM   6587  O  O   . ASN B 1 324 ? 35.653  32.391  58.119  1.00 11.77 ? 324 ASN B O   1 
ATOM   6588  C  CB  . ASN B 1 324 ? 37.845  30.879  59.292  1.00 12.19 ? 324 ASN B CB  1 
ATOM   6589  C  CG  . ASN B 1 324 ? 37.265  29.561  59.754  1.00 12.37 ? 324 ASN B CG  1 
ATOM   6590  O  OD1 . ASN B 1 324 ? 36.169  29.512  60.310  1.00 12.60 ? 324 ASN B OD1 1 
ATOM   6591  N  ND2 . ASN B 1 324 ? 38.001  28.481  59.525  1.00 12.66 ? 324 ASN B ND2 1 
ATOM   6592  N  N   . TYR B 1 325 ? 35.586  30.757  56.581  1.00 11.73 ? 325 TYR B N   1 
ATOM   6593  C  CA  . TYR B 1 325 ? 34.202  31.019  56.199  1.00 11.77 ? 325 TYR B CA  1 
ATOM   6594  C  C   . TYR B 1 325 ? 33.238  31.088  57.377  1.00 11.82 ? 325 TYR B C   1 
ATOM   6595  O  O   . TYR B 1 325 ? 32.500  32.063  57.528  1.00 11.83 ? 325 TYR B O   1 
ATOM   6596  C  CB  . TYR B 1 325 ? 33.717  29.951  55.212  1.00 11.63 ? 325 TYR B CB  1 
ATOM   6597  C  CG  . TYR B 1 325 ? 32.341  30.234  54.656  1.00 11.39 ? 325 TYR B CG  1 
ATOM   6598  C  CD1 . TYR B 1 325 ? 32.174  31.049  53.533  1.00 11.22 ? 325 TYR B CD1 1 
ATOM   6599  C  CD2 . TYR B 1 325 ? 31.200  29.713  55.267  1.00 11.34 ? 325 TYR B CD2 1 
ATOM   6600  C  CE1 . TYR B 1 325 ? 30.911  31.340  53.035  1.00 10.96 ? 325 TYR B CE1 1 
ATOM   6601  C  CE2 . TYR B 1 325 ? 29.927  30.000  54.775  1.00 11.10 ? 325 TYR B CE2 1 
ATOM   6602  C  CZ  . TYR B 1 325 ? 29.791  30.815  53.661  1.00 10.94 ? 325 TYR B CZ  1 
ATOM   6603  O  OH  . TYR B 1 325 ? 28.537  31.111  53.181  1.00 10.57 ? 325 TYR B OH  1 
ATOM   6604  N  N   . PHE B 1 326 ? 33.244  30.046  58.202  1.00 12.01 ? 326 PHE B N   1 
ATOM   6605  C  CA  . PHE B 1 326 ? 32.355  29.971  59.356  1.00 12.05 ? 326 PHE B CA  1 
ATOM   6606  C  C   . PHE B 1 326 ? 32.488  31.165  60.285  1.00 12.09 ? 326 PHE B C   1 
ATOM   6607  O  O   . PHE B 1 326 ? 31.489  31.780  60.659  1.00 12.19 ? 326 PHE B O   1 
ATOM   6608  C  CB  . PHE B 1 326 ? 32.615  28.683  60.149  1.00 12.09 ? 326 PHE B CB  1 
ATOM   6609  C  CG  . PHE B 1 326 ? 31.647  28.462  61.286  1.00 12.14 ? 326 PHE B CG  1 
ATOM   6610  C  CD1 . PHE B 1 326 ? 30.434  27.813  61.070  1.00 12.20 ? 326 PHE B CD1 1 
ATOM   6611  C  CD2 . PHE B 1 326 ? 31.941  28.918  62.571  1.00 12.19 ? 326 PHE B CD2 1 
ATOM   6612  C  CE1 . PHE B 1 326 ? 29.526  27.623  62.116  1.00 12.26 ? 326 PHE B CE1 1 
ATOM   6613  C  CE2 . PHE B 1 326 ? 31.040  28.735  63.626  1.00 12.23 ? 326 PHE B CE2 1 
ATOM   6614  C  CZ  . PHE B 1 326 ? 29.832  28.088  63.397  1.00 12.36 ? 326 PHE B CZ  1 
ATOM   6615  N  N   . ALA B 1 327 ? 33.724  31.494  60.646  1.00 11.86 ? 327 ALA B N   1 
ATOM   6616  C  CA  . ALA B 1 327 ? 33.990  32.595  61.565  1.00 11.89 ? 327 ALA B CA  1 
ATOM   6617  C  C   . ALA B 1 327 ? 33.762  34.012  61.025  1.00 11.90 ? 327 ALA B C   1 
ATOM   6618  O  O   . ALA B 1 327 ? 33.307  34.890  61.763  1.00 11.73 ? 327 ALA B O   1 
ATOM   6619  C  CB  . ALA B 1 327 ? 35.417  32.473  62.102  1.00 11.77 ? 327 ALA B CB  1 
ATOM   6620  N  N   . GLU B 1 328 ? 34.072  34.234  59.751  1.00 11.87 ? 328 GLU B N   1 
ATOM   6621  C  CA  . GLU B 1 328 ? 33.931  35.556  59.156  1.00 12.06 ? 328 GLU B CA  1 
ATOM   6622  C  C   . GLU B 1 328 ? 32.704  35.771  58.271  1.00 12.05 ? 328 GLU B C   1 
ATOM   6623  O  O   . GLU B 1 328 ? 32.350  36.912  57.967  1.00 12.07 ? 328 GLU B O   1 
ATOM   6624  C  CB  . GLU B 1 328 ? 35.187  35.892  58.350  1.00 12.01 ? 328 GLU B CB  1 
ATOM   6625  C  CG  . GLU B 1 328 ? 36.432  36.113  59.183  1.00 12.22 ? 328 GLU B CG  1 
ATOM   6626  C  CD  . GLU B 1 328 ? 37.697  35.986  58.360  1.00 12.36 ? 328 GLU B CD  1 
ATOM   6627  O  OE1 . GLU B 1 328 ? 38.318  34.905  58.399  1.00 13.26 ? 328 GLU B OE1 1 
ATOM   6628  O  OE2 . GLU B 1 328 ? 38.070  36.958  57.670  1.00 11.83 ? 328 GLU B OE2 1 
ATOM   6629  N  N   . VAL B 1 329 ? 32.057  34.694  57.844  1.00 11.81 ? 329 VAL B N   1 
ATOM   6630  C  CA  . VAL B 1 329 ? 30.886  34.845  56.989  1.00 11.94 ? 329 VAL B CA  1 
ATOM   6631  C  C   . VAL B 1 329 ? 29.634  34.293  57.651  1.00 12.19 ? 329 VAL B C   1 
ATOM   6632  O  O   . VAL B 1 329 ? 28.744  35.045  58.050  1.00 12.20 ? 329 VAL B O   1 
ATOM   6633  C  CB  . VAL B 1 329 ? 31.089  34.136  55.634  1.00 11.75 ? 329 VAL B CB  1 
ATOM   6634  C  CG1 . VAL B 1 329 ? 29.813  34.199  54.811  1.00 11.06 ? 329 VAL B CG1 1 
ATOM   6635  C  CG2 . VAL B 1 329 ? 32.239  34.789  54.885  1.00 11.78 ? 329 VAL B CG2 1 
ATOM   6636  N  N   . GLU B 1 330 ? 29.578  32.972  57.769  1.00 12.00 ? 330 GLU B N   1 
ATOM   6637  C  CA  . GLU B 1 330 ? 28.441  32.301  58.379  1.00 11.71 ? 330 GLU B CA  1 
ATOM   6638  C  C   . GLU B 1 330 ? 28.051  32.945  59.710  1.00 11.59 ? 330 GLU B C   1 
ATOM   6639  O  O   . GLU B 1 330 ? 26.879  32.946  60.085  1.00 11.75 ? 330 GLU B O   1 
ATOM   6640  C  CB  . GLU B 1 330 ? 28.778  30.818  58.584  1.00 11.66 ? 330 GLU B CB  1 
ATOM   6641  C  CG  . GLU B 1 330 ? 27.658  29.971  59.165  1.00 11.32 ? 330 GLU B CG  1 
ATOM   6642  C  CD  . GLU B 1 330 ? 26.351  30.138  58.426  1.00 11.19 ? 330 GLU B CD  1 
ATOM   6643  O  OE1 . GLU B 1 330 ? 26.389  30.423  57.208  1.00 11.40 ? 330 GLU B OE1 1 
ATOM   6644  O  OE2 . GLU B 1 330 ? 25.285  29.987  59.065  1.00 10.93 ? 330 GLU B OE2 1 
ATOM   6645  N  N   . GLN B 1 331 ? 29.032  33.510  60.411  1.00 11.48 ? 331 GLN B N   1 
ATOM   6646  C  CA  . GLN B 1 331 ? 28.789  34.130  61.716  1.00 11.17 ? 331 GLN B CA  1 
ATOM   6647  C  C   . GLN B 1 331 ? 28.494  35.625  61.685  1.00 10.78 ? 331 GLN B C   1 
ATOM   6648  O  O   . GLN B 1 331 ? 28.072  36.193  62.692  1.00 10.56 ? 331 GLN B O   1 
ATOM   6649  C  CB  . GLN B 1 331 ? 29.982  33.874  62.649  1.00 11.21 ? 331 GLN B CB  1 
ATOM   6650  C  CG  . GLN B 1 331 ? 30.081  32.446  63.159  1.00 11.13 ? 331 GLN B CG  1 
ATOM   6651  C  CD  . GLN B 1 331 ? 30.516  32.366  64.608  1.00 11.08 ? 331 GLN B CD  1 
ATOM   6652  O  OE1 . GLN B 1 331 ? 29.689  32.215  65.504  1.00 11.25 ? 331 GLN B OE1 1 
ATOM   6653  N  NE2 . GLN B 1 331 ? 31.818  32.464  64.845  1.00 10.57 ? 331 GLN B NE2 1 
ATOM   6654  N  N   . ILE B 1 332 ? 28.711  36.265  60.542  1.00 10.64 ? 332 ILE B N   1 
ATOM   6655  C  CA  . ILE B 1 332 ? 28.458  37.699  60.443  1.00 10.66 ? 332 ILE B CA  1 
ATOM   6656  C  C   . ILE B 1 332 ? 26.972  38.017  60.581  1.00 10.58 ? 332 ILE B C   1 
ATOM   6657  O  O   . ILE B 1 332 ? 26.118  37.281  60.083  1.00 10.40 ? 332 ILE B O   1 
ATOM   6658  C  CB  . ILE B 1 332 ? 28.977  38.274  59.105  1.00 10.80 ? 332 ILE B CB  1 
ATOM   6659  C  CG1 . ILE B 1 332 ? 28.924  39.800  59.148  1.00 10.93 ? 332 ILE B CG1 1 
ATOM   6660  C  CG2 . ILE B 1 332 ? 28.146  37.748  57.943  1.00 11.00 ? 332 ILE B CG2 1 
ATOM   6661  C  CD1 . ILE B 1 332 ? 30.198  40.457  58.697  1.00 11.16 ? 332 ILE B CD1 1 
ATOM   6662  N  N   . ALA B 1 333 ? 26.665  39.112  61.269  1.00 10.32 ? 333 ALA B N   1 
ATOM   6663  C  CA  . ALA B 1 333 ? 25.281  39.516  61.464  1.00 10.29 ? 333 ALA B CA  1 
ATOM   6664  C  C   . ALA B 1 333 ? 25.093  40.998  61.172  1.00 10.38 ? 333 ALA B C   1 
ATOM   6665  O  O   . ALA B 1 333 ? 25.819  41.842  61.693  1.00 10.23 ? 333 ALA B O   1 
ATOM   6666  C  CB  . ALA B 1 333 ? 24.838  39.203  62.889  1.00 10.22 ? 333 ALA B CB  1 
ATOM   6667  N  N   . PHE B 1 334 ? 24.112  41.305  60.330  1.00 10.74 ? 334 PHE B N   1 
ATOM   6668  C  CA  . PHE B 1 334 ? 23.809  42.682  59.960  1.00 11.03 ? 334 PHE B CA  1 
ATOM   6669  C  C   . PHE B 1 334 ? 22.473  43.101  60.564  1.00 11.34 ? 334 PHE B C   1 
ATOM   6670  O  O   . PHE B 1 334 ? 21.479  42.376  60.463  1.00 11.66 ? 334 PHE B O   1 
ATOM   6671  C  CB  . PHE B 1 334 ? 23.764  42.817  58.437  1.00 11.00 ? 334 PHE B CB  1 
ATOM   6672  C  CG  . PHE B 1 334 ? 25.030  42.377  57.748  1.00 10.95 ? 334 PHE B CG  1 
ATOM   6673  C  CD1 . PHE B 1 334 ? 25.254  41.033  57.466  1.00 11.05 ? 334 PHE B CD1 1 
ATOM   6674  C  CD2 . PHE B 1 334 ? 25.996  43.306  57.385  1.00 10.83 ? 334 PHE B CD2 1 
ATOM   6675  C  CE1 . PHE B 1 334 ? 26.423  40.622  56.833  1.00 11.20 ? 334 PHE B CE1 1 
ATOM   6676  C  CE2 . PHE B 1 334 ? 27.168  42.906  56.751  1.00 10.93 ? 334 PHE B CE2 1 
ATOM   6677  C  CZ  . PHE B 1 334 ? 27.382  41.561  56.475  1.00 11.13 ? 334 PHE B CZ  1 
ATOM   6678  N  N   . ASP B 1 335 ? 22.458  44.269  61.197  1.00 11.65 ? 335 ASP B N   1 
ATOM   6679  C  CA  . ASP B 1 335 ? 21.253  44.786  61.837  1.00 11.73 ? 335 ASP B CA  1 
ATOM   6680  C  C   . ASP B 1 335 ? 20.888  46.144  61.272  1.00 11.90 ? 335 ASP B C   1 
ATOM   6681  O  O   . ASP B 1 335 ? 21.619  47.117  61.465  1.00 12.11 ? 335 ASP B O   1 
ATOM   6682  C  CB  . ASP B 1 335 ? 21.462  44.917  63.348  1.00 11.49 ? 335 ASP B CB  1 
ATOM   6683  C  CG  . ASP B 1 335 ? 21.736  43.587  64.016  1.00 11.33 ? 335 ASP B CG  1 
ATOM   6684  O  OD1 . ASP B 1 335 ? 20.807  42.751  64.098  1.00 11.07 ? 335 ASP B OD1 1 
ATOM   6685  O  OD2 . ASP B 1 335 ? 22.885  43.378  64.460  1.00 11.51 ? 335 ASP B OD2 1 
ATOM   6686  N  N   . PRO B 1 336 ? 19.745  46.231  60.570  1.00 11.93 ? 336 PRO B N   1 
ATOM   6687  C  CA  . PRO B 1 336 ? 19.281  47.486  59.973  1.00 11.97 ? 336 PRO B CA  1 
ATOM   6688  C  C   . PRO B 1 336 ? 19.126  48.614  60.999  1.00 12.07 ? 336 PRO B C   1 
ATOM   6689  O  O   . PRO B 1 336 ? 19.135  49.792  60.643  1.00 12.03 ? 336 PRO B O   1 
ATOM   6690  C  CB  . PRO B 1 336 ? 17.949  47.105  59.323  1.00 11.90 ? 336 PRO B CB  1 
ATOM   6691  C  CG  . PRO B 1 336 ? 18.026  45.621  59.136  1.00 11.85 ? 336 PRO B CG  1 
ATOM   6692  C  CD  . PRO B 1 336 ? 18.814  45.122  60.301  1.00 11.92 ? 336 PRO B CD  1 
ATOM   6693  N  N   . SER B 1 337 ? 18.984  48.254  62.270  1.00 12.07 ? 337 SER B N   1 
ATOM   6694  C  CA  . SER B 1 337 ? 18.838  49.261  63.315  1.00 12.24 ? 337 SER B CA  1 
ATOM   6695  C  C   . SER B 1 337 ? 20.174  49.934  63.604  1.00 12.17 ? 337 SER B C   1 
ATOM   6696  O  O   . SER B 1 337 ? 20.217  51.043  64.140  1.00 12.21 ? 337 SER B O   1 
ATOM   6697  C  CB  . SER B 1 337 ? 18.298  48.634  64.600  1.00 12.37 ? 337 SER B CB  1 
ATOM   6698  O  OG  . SER B 1 337 ? 18.347  47.224  64.538  1.00 13.07 ? 337 SER B OG  1 
ATOM   6699  N  N   . ASN B 1 338 ? 21.265  49.260  63.252  1.00 12.22 ? 338 ASN B N   1 
ATOM   6700  C  CA  . ASN B 1 338 ? 22.598  49.808  63.474  1.00 12.30 ? 338 ASN B CA  1 
ATOM   6701  C  C   . ASN B 1 338 ? 22.823  51.006  62.563  1.00 12.23 ? 338 ASN B C   1 
ATOM   6702  O  O   . ASN B 1 338 ? 23.382  50.873  61.472  1.00 12.00 ? 338 ASN B O   1 
ATOM   6703  C  CB  . ASN B 1 338 ? 23.663  48.750  63.195  1.00 12.70 ? 338 ASN B CB  1 
ATOM   6704  C  CG  . ASN B 1 338 ? 23.591  47.585  64.158  1.00 13.18 ? 338 ASN B CG  1 
ATOM   6705  O  OD1 . ASN B 1 338 ? 24.009  46.474  63.834  1.00 13.80 ? 338 ASN B OD1 1 
ATOM   6706  N  ND2 . ASN B 1 338 ? 23.062  47.831  65.352  1.00 13.37 ? 338 ASN B ND2 1 
ATOM   6707  N  N   . MET B 1 339 ? 22.381  52.173  63.019  1.00 12.00 ? 339 MET B N   1 
ATOM   6708  C  CA  . MET B 1 339 ? 22.527  53.410  62.257  1.00 12.03 ? 339 MET B CA  1 
ATOM   6709  C  C   . MET B 1 339 ? 23.142  54.494  63.129  1.00 12.25 ? 339 MET B C   1 
ATOM   6710  O  O   . MET B 1 339 ? 22.562  54.894  64.136  1.00 12.64 ? 339 MET B O   1 
ATOM   6711  C  CB  . MET B 1 339 ? 21.165  53.896  61.752  1.00 11.50 ? 339 MET B CB  1 
ATOM   6712  C  CG  . MET B 1 339 ? 20.513  53.001  60.721  1.00 10.77 ? 339 MET B CG  1 
ATOM   6713  S  SD  . MET B 1 339 ? 18.978  53.717  60.131  1.00 9.99  ? 339 MET B SD  1 
ATOM   6714  C  CE  . MET B 1 339 ? 17.829  53.074  61.321  1.00 10.67 ? 339 MET B CE  1 
ATOM   6715  N  N   . PRO B 1 340 ? 24.331  54.984  62.754  1.00 12.32 ? 340 PRO B N   1 
ATOM   6716  C  CA  . PRO B 1 340 ? 24.979  56.032  63.546  1.00 12.06 ? 340 PRO B CA  1 
ATOM   6717  C  C   . PRO B 1 340 ? 24.362  57.400  63.262  1.00 12.09 ? 340 PRO B C   1 
ATOM   6718  O  O   . PRO B 1 340 ? 23.626  57.562  62.289  1.00 12.01 ? 340 PRO B O   1 
ATOM   6719  C  CB  . PRO B 1 340 ? 26.437  55.958  63.105  1.00 12.02 ? 340 PRO B CB  1 
ATOM   6720  C  CG  . PRO B 1 340 ? 26.375  55.446  61.707  1.00 11.98 ? 340 PRO B CG  1 
ATOM   6721  C  CD  . PRO B 1 340 ? 25.139  54.592  61.585  1.00 12.11 ? 340 PRO B CD  1 
ATOM   6722  N  N   . PRO B 1 341 ? 24.652  58.400  64.112  1.00 12.11 ? 341 PRO B N   1 
ATOM   6723  C  CA  . PRO B 1 341 ? 24.119  59.757  63.937  1.00 12.04 ? 341 PRO B CA  1 
ATOM   6724  C  C   . PRO B 1 341 ? 24.261  60.279  62.507  1.00 12.08 ? 341 PRO B C   1 
ATOM   6725  O  O   . PRO B 1 341 ? 25.327  60.185  61.905  1.00 12.34 ? 341 PRO B O   1 
ATOM   6726  C  CB  . PRO B 1 341 ? 24.920  60.584  64.933  1.00 12.17 ? 341 PRO B CB  1 
ATOM   6727  C  CG  . PRO B 1 341 ? 25.270  59.614  66.006  1.00 12.13 ? 341 PRO B CG  1 
ATOM   6728  C  CD  . PRO B 1 341 ? 25.499  58.298  65.312  1.00 12.11 ? 341 PRO B CD  1 
ATOM   6729  N  N   . GLY B 1 342 ? 23.177  60.833  61.972  1.00 11.95 ? 342 GLY B N   1 
ATOM   6730  C  CA  . GLY B 1 342 ? 23.196  61.345  60.613  1.00 11.48 ? 342 GLY B CA  1 
ATOM   6731  C  C   . GLY B 1 342 ? 22.284  60.521  59.724  1.00 11.26 ? 342 GLY B C   1 
ATOM   6732  O  O   . GLY B 1 342 ? 21.779  61.007  58.711  1.00 11.09 ? 342 GLY B O   1 
ATOM   6733  N  N   . ILE B 1 343 ? 22.084  59.263  60.113  1.00 11.36 ? 343 ILE B N   1 
ATOM   6734  C  CA  . ILE B 1 343 ? 21.225  58.329  59.385  1.00 11.40 ? 343 ILE B CA  1 
ATOM   6735  C  C   . ILE B 1 343 ? 20.179  57.764  60.345  1.00 11.36 ? 343 ILE B C   1 
ATOM   6736  O  O   . ILE B 1 343 ? 20.511  57.275  61.426  1.00 11.34 ? 343 ILE B O   1 
ATOM   6737  C  CB  . ILE B 1 343 ? 22.034  57.143  58.795  1.00 11.53 ? 343 ILE B CB  1 
ATOM   6738  C  CG1 . ILE B 1 343 ? 23.087  57.654  57.810  1.00 11.74 ? 343 ILE B CG1 1 
ATOM   6739  C  CG2 . ILE B 1 343 ? 21.102  56.177  58.092  1.00 11.53 ? 343 ILE B CG2 1 
ATOM   6740  C  CD1 . ILE B 1 343 ? 24.333  56.810  57.767  1.00 11.96 ? 343 ILE B CD1 1 
ATOM   6741  N  N   . GLU B 1 344 ? 18.916  57.836  59.946  1.00 11.49 ? 344 GLU B N   1 
ATOM   6742  C  CA  . GLU B 1 344 ? 17.829  57.338  60.775  1.00 11.65 ? 344 GLU B CA  1 
ATOM   6743  C  C   . GLU B 1 344 ? 16.850  56.525  59.933  1.00 11.96 ? 344 GLU B C   1 
ATOM   6744  O  O   . GLU B 1 344 ? 17.059  56.335  58.731  1.00 12.07 ? 344 GLU B O   1 
ATOM   6745  C  CB  . GLU B 1 344 ? 17.095  58.511  61.430  1.00 11.74 ? 344 GLU B CB  1 
ATOM   6746  C  CG  . GLU B 1 344 ? 17.878  59.219  62.527  1.00 11.86 ? 344 GLU B CG  1 
ATOM   6747  C  CD  . GLU B 1 344 ? 17.101  60.366  63.160  1.00 11.98 ? 344 GLU B CD  1 
ATOM   6748  O  OE1 . GLU B 1 344 ? 15.851  60.345  63.119  1.00 11.89 ? 344 GLU B OE1 1 
ATOM   6749  O  OE2 . GLU B 1 344 ? 17.741  61.293  63.701  1.00 12.35 ? 344 GLU B OE2 1 
ATOM   6750  N  N   . ALA B 1 345 ? 15.782  56.045  60.562  1.00 11.80 ? 345 ALA B N   1 
ATOM   6751  C  CA  . ALA B 1 345 ? 14.772  55.266  59.854  1.00 12.05 ? 345 ALA B CA  1 
ATOM   6752  C  C   . ALA B 1 345 ? 13.706  56.179  59.250  1.00 12.02 ? 345 ALA B C   1 
ATOM   6753  O  O   . ALA B 1 345 ? 13.884  57.391  59.182  1.00 12.17 ? 345 ALA B O   1 
ATOM   6754  C  CB  . ALA B 1 345 ? 14.127  54.266  60.799  1.00 11.77 ? 345 ALA B CB  1 
ATOM   6755  N  N   . SER B 1 346 ? 12.603  55.587  58.808  1.00 11.76 ? 346 SER B N   1 
ATOM   6756  C  CA  . SER B 1 346 ? 11.505  56.343  58.219  1.00 11.83 ? 346 SER B CA  1 
ATOM   6757  C  C   . SER B 1 346 ? 10.205  55.603  58.497  1.00 11.93 ? 346 SER B C   1 
ATOM   6758  O  O   . SER B 1 346 ? 10.223  54.457  58.949  1.00 12.12 ? 346 SER B O   1 
ATOM   6759  C  CB  . SER B 1 346 ? 11.705  56.492  56.710  1.00 11.39 ? 346 SER B CB  1 
ATOM   6760  O  OG  . SER B 1 346 ? 10.985  55.505  55.994  1.00 10.53 ? 346 SER B OG  1 
ATOM   6761  N  N   . PRO B 1 347 ? 9.059   56.245  58.229  1.00 11.89 ? 347 PRO B N   1 
ATOM   6762  C  CA  . PRO B 1 347 ? 7.756   55.618  58.464  1.00 11.81 ? 347 PRO B CA  1 
ATOM   6763  C  C   . PRO B 1 347 ? 7.455   54.395  57.593  1.00 11.81 ? 347 PRO B C   1 
ATOM   6764  O  O   . PRO B 1 347 ? 6.308   53.946  57.531  1.00 11.98 ? 347 PRO B O   1 
ATOM   6765  C  CB  . PRO B 1 347 ? 6.755   56.748  58.217  1.00 11.85 ? 347 PRO B CB  1 
ATOM   6766  C  CG  . PRO B 1 347 ? 7.560   58.002  58.203  1.00 11.82 ? 347 PRO B CG  1 
ATOM   6767  C  CD  . PRO B 1 347 ? 8.914   57.609  57.703  1.00 11.86 ? 347 PRO B CD  1 
ATOM   6768  N  N   . ASP B 1 348 ? 8.467   53.858  56.918  1.00 11.76 ? 348 ASP B N   1 
ATOM   6769  C  CA  . ASP B 1 348 ? 8.262   52.678  56.080  1.00 11.88 ? 348 ASP B CA  1 
ATOM   6770  C  C   . ASP B 1 348 ? 7.911   51.492  56.975  1.00 11.78 ? 348 ASP B C   1 
ATOM   6771  O  O   . ASP B 1 348 ? 8.683   51.127  57.853  1.00 11.70 ? 348 ASP B O   1 
ATOM   6772  C  CB  . ASP B 1 348 ? 9.530   52.359  55.283  1.00 11.89 ? 348 ASP B CB  1 
ATOM   6773  C  CG  . ASP B 1 348 ? 9.404   51.081  54.466  1.00 11.94 ? 348 ASP B CG  1 
ATOM   6774  O  OD1 . ASP B 1 348 ? 8.327   50.448  54.489  1.00 11.90 ? 348 ASP B OD1 1 
ATOM   6775  O  OD2 . ASP B 1 348 ? 10.387  50.709  53.799  1.00 12.31 ? 348 ASP B OD2 1 
ATOM   6776  N  N   . LYS B 1 349 ? 6.750   50.887  56.749  1.00 11.87 ? 349 LYS B N   1 
ATOM   6777  C  CA  . LYS B 1 349 ? 6.321   49.759  57.567  1.00 11.84 ? 349 LYS B CA  1 
ATOM   6778  C  C   . LYS B 1 349 ? 7.308   48.601  57.499  1.00 11.92 ? 349 LYS B C   1 
ATOM   6779  O  O   . LYS B 1 349 ? 7.695   48.041  58.524  1.00 12.27 ? 349 LYS B O   1 
ATOM   6780  C  CB  . LYS B 1 349 ? 4.930   49.280  57.132  1.00 11.72 ? 349 LYS B CB  1 
ATOM   6781  C  CG  . LYS B 1 349 ? 3.783   49.901  57.918  1.00 11.47 ? 349 LYS B CG  1 
ATOM   6782  C  CD  . LYS B 1 349 ? 2.447   49.721  57.204  1.00 11.51 ? 349 LYS B CD  1 
ATOM   6783  C  CE  . LYS B 1 349 ? 1.573   50.965  57.312  1.00 11.37 ? 349 LYS B CE  1 
ATOM   6784  N  NZ  . LYS B 1 349 ? 0.340   50.725  58.113  1.00 11.47 ? 349 LYS B NZ  1 
ATOM   6785  N  N   . MET B 1 350 ? 7.723   48.246  56.291  1.00 12.12 ? 350 MET B N   1 
ATOM   6786  C  CA  . MET B 1 350 ? 8.657   47.142  56.114  1.00 11.85 ? 350 MET B CA  1 
ATOM   6787  C  C   . MET B 1 350 ? 9.976   47.410  56.816  1.00 12.03 ? 350 MET B C   1 
ATOM   6788  O  O   . MET B 1 350 ? 10.641  46.481  57.276  1.00 12.18 ? 350 MET B O   1 
ATOM   6789  C  CB  . MET B 1 350 ? 8.900   46.892  54.626  1.00 11.33 ? 350 MET B CB  1 
ATOM   6790  C  CG  . MET B 1 350 ? 7.646   46.490  53.869  1.00 10.57 ? 350 MET B CG  1 
ATOM   6791  S  SD  . MET B 1 350 ? 7.151   44.795  54.217  1.00 9.74  ? 350 MET B SD  1 
ATOM   6792  C  CE  . MET B 1 350 ? 8.619   43.896  53.728  1.00 9.67  ? 350 MET B CE  1 
ATOM   6793  N  N   . LEU B 1 351 ? 10.355  48.682  56.894  1.00 12.09 ? 351 LEU B N   1 
ATOM   6794  C  CA  . LEU B 1 351 ? 11.602  49.059  57.550  1.00 12.19 ? 351 LEU B CA  1 
ATOM   6795  C  C   . LEU B 1 351 ? 11.426  49.039  59.063  1.00 12.06 ? 351 LEU B C   1 
ATOM   6796  O  O   . LEU B 1 351 ? 12.311  48.596  59.794  1.00 11.79 ? 351 LEU B O   1 
ATOM   6797  C  CB  . LEU B 1 351 ? 12.044  50.454  57.103  1.00 12.51 ? 351 LEU B CB  1 
ATOM   6798  C  CG  . LEU B 1 351 ? 13.262  51.033  57.829  1.00 12.89 ? 351 LEU B CG  1 
ATOM   6799  C  CD1 . LEU B 1 351 ? 14.467  50.108  57.678  1.00 12.84 ? 351 LEU B CD1 1 
ATOM   6800  C  CD2 . LEU B 1 351 ? 13.573  52.408  57.263  1.00 13.40 ? 351 LEU B CD2 1 
ATOM   6801  N  N   . GLN B 1 352 ? 10.277  49.528  59.522  1.00 11.89 ? 352 GLN B N   1 
ATOM   6802  C  CA  . GLN B 1 352 ? 9.967   49.567  60.945  1.00 11.92 ? 352 GLN B CA  1 
ATOM   6803  C  C   . GLN B 1 352 ? 9.995   48.150  61.501  1.00 11.96 ? 352 GLN B C   1 
ATOM   6804  O  O   . GLN B 1 352 ? 10.590  47.893  62.546  1.00 12.03 ? 352 GLN B O   1 
ATOM   6805  C  CB  . GLN B 1 352 ? 8.584   50.180  61.171  1.00 11.92 ? 352 GLN B CB  1 
ATOM   6806  C  CG  . GLN B 1 352 ? 8.467   51.634  60.741  1.00 11.98 ? 352 GLN B CG  1 
ATOM   6807  C  CD  . GLN B 1 352 ? 9.017   52.592  61.777  1.00 12.05 ? 352 GLN B CD  1 
ATOM   6808  O  OE1 . GLN B 1 352 ? 8.625   52.550  62.945  1.00 12.77 ? 352 GLN B OE1 1 
ATOM   6809  N  NE2 . GLN B 1 352 ? 9.931   53.460  61.358  1.00 11.70 ? 352 GLN B NE2 1 
ATOM   6810  N  N   . GLY B 1 353 ? 9.355   47.233  60.784  1.00 11.91 ? 353 GLY B N   1 
ATOM   6811  C  CA  . GLY B 1 353 ? 9.316   45.849  61.218  1.00 11.79 ? 353 GLY B CA  1 
ATOM   6812  C  C   . GLY B 1 353 ? 10.671  45.170  61.155  1.00 11.61 ? 353 GLY B C   1 
ATOM   6813  O  O   . GLY B 1 353 ? 10.894  44.158  61.817  1.00 11.68 ? 353 GLY B O   1 
ATOM   6814  N  N   . ARG B 1 354 ? 11.580  45.721  60.360  1.00 11.48 ? 354 ARG B N   1 
ATOM   6815  C  CA  . ARG B 1 354 ? 12.909  45.138  60.221  1.00 11.37 ? 354 ARG B CA  1 
ATOM   6816  C  C   . ARG B 1 354 ? 13.815  45.571  61.362  1.00 11.00 ? 354 ARG B C   1 
ATOM   6817  O  O   . ARG B 1 354 ? 14.802  44.908  61.672  1.00 10.94 ? 354 ARG B O   1 
ATOM   6818  C  CB  . ARG B 1 354 ? 13.530  45.547  58.879  1.00 11.53 ? 354 ARG B CB  1 
ATOM   6819  C  CG  . ARG B 1 354 ? 13.234  44.591  57.733  1.00 11.82 ? 354 ARG B CG  1 
ATOM   6820  C  CD  . ARG B 1 354 ? 13.796  45.117  56.422  1.00 12.13 ? 354 ARG B CD  1 
ATOM   6821  N  NE  . ARG B 1 354 ? 15.012  44.407  56.034  1.00 12.31 ? 354 ARG B NE  1 
ATOM   6822  C  CZ  . ARG B 1 354 ? 16.107  44.997  55.564  1.00 12.41 ? 354 ARG B CZ  1 
ATOM   6823  N  NH1 . ARG B 1 354 ? 16.144  46.314  55.419  1.00 12.61 ? 354 ARG B NH1 1 
ATOM   6824  N  NH2 . ARG B 1 354 ? 17.175  44.268  55.261  1.00 12.27 ? 354 ARG B NH2 1 
ATOM   6825  N  N   . LEU B 1 355 ? 13.473  46.689  61.986  1.00 10.86 ? 355 LEU B N   1 
ATOM   6826  C  CA  . LEU B 1 355 ? 14.264  47.214  63.091  1.00 10.82 ? 355 LEU B CA  1 
ATOM   6827  C  C   . LEU B 1 355 ? 14.294  46.248  64.271  1.00 11.01 ? 355 LEU B C   1 
ATOM   6828  O  O   . LEU B 1 355 ? 15.173  46.330  65.128  1.00 11.09 ? 355 LEU B O   1 
ATOM   6829  C  CB  . LEU B 1 355 ? 13.693  48.556  63.553  1.00 10.35 ? 355 LEU B CB  1 
ATOM   6830  C  CG  . LEU B 1 355 ? 13.770  49.732  62.583  1.00 9.95  ? 355 LEU B CG  1 
ATOM   6831  C  CD1 . LEU B 1 355 ? 13.012  50.914  63.140  1.00 9.77  ? 355 LEU B CD1 1 
ATOM   6832  C  CD2 . LEU B 1 355 ? 15.213  50.087  62.353  1.00 10.13 ? 355 LEU B CD2 1 
ATOM   6833  N  N   . PHE B 1 356 ? 13.334  45.330  64.307  1.00 11.21 ? 356 PHE B N   1 
ATOM   6834  C  CA  . PHE B 1 356 ? 13.230  44.372  65.396  1.00 11.26 ? 356 PHE B CA  1 
ATOM   6835  C  C   . PHE B 1 356 ? 13.598  42.952  65.001  1.00 11.52 ? 356 PHE B C   1 
ATOM   6836  O  O   . PHE B 1 356 ? 14.334  42.271  65.714  1.00 11.70 ? 356 PHE B O   1 
ATOM   6837  C  CB  . PHE B 1 356 ? 11.803  44.401  65.956  1.00 11.37 ? 356 PHE B CB  1 
ATOM   6838  C  CG  . PHE B 1 356 ? 11.449  43.211  66.805  1.00 11.27 ? 356 PHE B CG  1 
ATOM   6839  C  CD1 . PHE B 1 356 ? 11.926  43.099  68.103  1.00 11.22 ? 356 PHE B CD1 1 
ATOM   6840  C  CD2 . PHE B 1 356 ? 10.632  42.205  66.306  1.00 11.21 ? 356 PHE B CD2 1 
ATOM   6841  C  CE1 . PHE B 1 356 ? 11.596  42.001  68.893  1.00 11.29 ? 356 PHE B CE1 1 
ATOM   6842  C  CE2 . PHE B 1 356 ? 10.296  41.103  67.089  1.00 11.29 ? 356 PHE B CE2 1 
ATOM   6843  C  CZ  . PHE B 1 356 ? 10.778  41.000  68.384  1.00 11.27 ? 356 PHE B CZ  1 
ATOM   6844  N  N   . ALA B 1 357 ? 13.088  42.505  63.862  1.00 11.59 ? 357 ALA B N   1 
ATOM   6845  C  CA  . ALA B 1 357 ? 13.341  41.147  63.398  1.00 11.67 ? 357 ALA B CA  1 
ATOM   6846  C  C   . ALA B 1 357 ? 14.797  40.687  63.440  1.00 11.59 ? 357 ALA B C   1 
ATOM   6847  O  O   . ALA B 1 357 ? 15.089  39.606  63.948  1.00 11.55 ? 357 ALA B O   1 
ATOM   6848  C  CB  . ALA B 1 357 ? 12.786  40.973  61.990  1.00 11.74 ? 357 ALA B CB  1 
ATOM   6849  N  N   . TYR B 1 358 ? 15.709  41.498  62.917  1.00 11.47 ? 358 TYR B N   1 
ATOM   6850  C  CA  . TYR B 1 358 ? 17.117  41.118  62.877  1.00 11.53 ? 358 TYR B CA  1 
ATOM   6851  C  C   . TYR B 1 358 ? 17.815  40.946  64.222  1.00 11.44 ? 358 TYR B C   1 
ATOM   6852  O  O   . TYR B 1 358 ? 18.275  39.851  64.546  1.00 11.37 ? 358 TYR B O   1 
ATOM   6853  C  CB  . TYR B 1 358 ? 17.898  42.103  62.011  1.00 11.83 ? 358 TYR B CB  1 
ATOM   6854  C  CG  . TYR B 1 358 ? 17.489  42.074  60.561  1.00 12.03 ? 358 TYR B CG  1 
ATOM   6855  C  CD1 . TYR B 1 358 ? 16.246  42.565  60.161  1.00 12.14 ? 358 TYR B CD1 1 
ATOM   6856  C  CD2 . TYR B 1 358 ? 18.352  41.581  59.583  1.00 12.03 ? 358 TYR B CD2 1 
ATOM   6857  C  CE1 . TYR B 1 358 ? 15.874  42.573  58.824  1.00 12.08 ? 358 TYR B CE1 1 
ATOM   6858  C  CE2 . TYR B 1 358 ? 17.988  41.585  58.243  1.00 11.99 ? 358 TYR B CE2 1 
ATOM   6859  C  CZ  . TYR B 1 358 ? 16.750  42.086  57.872  1.00 12.01 ? 358 TYR B CZ  1 
ATOM   6860  O  OH  . TYR B 1 358 ? 16.404  42.145  56.547  1.00 11.70 ? 358 TYR B OH  1 
ATOM   6861  N  N   . PRO B 1 359 ? 17.929  42.020  65.018  1.00 11.43 ? 359 PRO B N   1 
ATOM   6862  C  CA  . PRO B 1 359 ? 18.604  41.824  66.308  1.00 11.32 ? 359 PRO B CA  1 
ATOM   6863  C  C   . PRO B 1 359 ? 18.004  40.662  67.095  1.00 11.33 ? 359 PRO B C   1 
ATOM   6864  O  O   . PRO B 1 359 ? 18.723  39.883  67.720  1.00 11.04 ? 359 PRO B O   1 
ATOM   6865  C  CB  . PRO B 1 359 ? 18.416  43.163  67.022  1.00 11.29 ? 359 PRO B CB  1 
ATOM   6866  C  CG  . PRO B 1 359 ? 18.223  44.150  65.918  1.00 11.33 ? 359 PRO B CG  1 
ATOM   6867  C  CD  . PRO B 1 359 ? 17.493  43.415  64.830  1.00 11.33 ? 359 PRO B CD  1 
ATOM   6868  N  N   . ASP B 1 360 ? 16.681  40.549  67.042  1.00 11.61 ? 360 ASP B N   1 
ATOM   6869  C  CA  . ASP B 1 360 ? 15.972  39.495  67.753  1.00 11.87 ? 360 ASP B CA  1 
ATOM   6870  C  C   . ASP B 1 360 ? 16.358  38.101  67.277  1.00 12.11 ? 360 ASP B C   1 
ATOM   6871  O  O   . ASP B 1 360 ? 16.571  37.201  68.089  1.00 12.36 ? 360 ASP B O   1 
ATOM   6872  C  CB  . ASP B 1 360 ? 14.464  39.675  67.603  1.00 11.89 ? 360 ASP B CB  1 
ATOM   6873  C  CG  . ASP B 1 360 ? 13.688  38.451  68.055  1.00 11.87 ? 360 ASP B CG  1 
ATOM   6874  O  OD1 . ASP B 1 360 ? 13.326  38.370  69.247  1.00 11.64 ? 360 ASP B OD1 1 
ATOM   6875  O  OD2 . ASP B 1 360 ? 13.444  37.566  67.213  1.00 11.87 ? 360 ASP B OD2 1 
ATOM   6876  N  N   . THR B 1 361 ? 16.443  37.926  65.961  1.00 12.15 ? 361 THR B N   1 
ATOM   6877  C  CA  . THR B 1 361 ? 16.801  36.637  65.383  1.00 11.92 ? 361 THR B CA  1 
ATOM   6878  C  C   . THR B 1 361 ? 18.270  36.289  65.609  1.00 11.66 ? 361 THR B C   1 
ATOM   6879  O  O   . THR B 1 361 ? 18.626  35.116  65.710  1.00 11.53 ? 361 THR B O   1 
ATOM   6880  C  CB  . THR B 1 361 ? 16.510  36.610  63.863  1.00 12.02 ? 361 THR B CB  1 
ATOM   6881  O  OG1 . THR B 1 361 ? 16.509  35.254  63.397  1.00 12.45 ? 361 THR B OG1 1 
ATOM   6882  C  CG2 . THR B 1 361 ? 17.559  37.396  63.100  1.00 11.88 ? 361 THR B CG2 1 
ATOM   6883  N  N   . HIS B 1 362 ? 19.118  37.306  65.692  1.00 11.67 ? 362 HIS B N   1 
ATOM   6884  C  CA  . HIS B 1 362 ? 20.542  37.077  65.892  1.00 11.84 ? 362 HIS B CA  1 
ATOM   6885  C  C   . HIS B 1 362 ? 20.813  36.485  67.271  1.00 11.68 ? 362 HIS B C   1 
ATOM   6886  O  O   . HIS B 1 362 ? 21.700  35.645  67.434  1.00 11.44 ? 362 HIS B O   1 
ATOM   6887  C  CB  . HIS B 1 362 ? 21.317  38.384  65.714  1.00 12.37 ? 362 HIS B CB  1 
ATOM   6888  C  CG  . HIS B 1 362 ? 21.396  38.851  64.291  1.00 13.10 ? 362 HIS B CG  1 
ATOM   6889  N  ND1 . HIS B 1 362 ? 21.504  40.183  63.946  1.00 13.38 ? 362 HIS B ND1 1 
ATOM   6890  C  CD2 . HIS B 1 362 ? 21.372  38.161  63.125  1.00 13.36 ? 362 HIS B CD2 1 
ATOM   6891  C  CE1 . HIS B 1 362 ? 21.542  40.292  62.630  1.00 13.55 ? 362 HIS B CE1 1 
ATOM   6892  N  NE2 . HIS B 1 362 ? 21.464  39.081  62.107  1.00 13.58 ? 362 HIS B NE2 1 
ATOM   6893  N  N   . ARG B 1 363 ? 20.037  36.922  68.258  1.00 11.39 ? 363 ARG B N   1 
ATOM   6894  C  CA  . ARG B 1 363 ? 20.183  36.437  69.624  1.00 11.11 ? 363 ARG B CA  1 
ATOM   6895  C  C   . ARG B 1 363 ? 19.835  34.959  69.703  1.00 11.26 ? 363 ARG B C   1 
ATOM   6896  O  O   . ARG B 1 363 ? 20.196  34.270  70.660  1.00 11.20 ? 363 ARG B O   1 
ATOM   6897  C  CB  . ARG B 1 363 ? 19.269  37.223  70.558  1.00 10.92 ? 363 ARG B CB  1 
ATOM   6898  C  CG  . ARG B 1 363 ? 19.772  38.607  70.878  1.00 10.67 ? 363 ARG B CG  1 
ATOM   6899  C  CD  . ARG B 1 363 ? 18.680  39.467  71.472  1.00 10.37 ? 363 ARG B CD  1 
ATOM   6900  N  NE  . ARG B 1 363 ? 18.922  40.878  71.201  1.00 10.32 ? 363 ARG B NE  1 
ATOM   6901  C  CZ  . ARG B 1 363 ? 18.009  41.708  70.716  1.00 10.29 ? 363 ARG B CZ  1 
ATOM   6902  N  NH1 . ARG B 1 363 ? 16.789  41.264  70.448  1.00 10.33 ? 363 ARG B NH1 1 
ATOM   6903  N  NH2 . ARG B 1 363 ? 18.321  42.977  70.494  1.00 10.33 ? 363 ARG B NH2 1 
ATOM   6904  N  N   . HIS B 1 364 ? 19.128  34.484  68.684  1.00 11.45 ? 364 HIS B N   1 
ATOM   6905  C  CA  . HIS B 1 364 ? 18.700  33.095  68.603  1.00 11.42 ? 364 HIS B CA  1 
ATOM   6906  C  C   . HIS B 1 364 ? 19.696  32.280  67.794  1.00 11.30 ? 364 HIS B C   1 
ATOM   6907  O  O   . HIS B 1 364 ? 20.215  31.276  68.264  1.00 11.27 ? 364 HIS B O   1 
ATOM   6908  C  CB  . HIS B 1 364 ? 17.309  33.030  67.956  1.00 11.75 ? 364 HIS B CB  1 
ATOM   6909  C  CG  . HIS B 1 364 ? 16.953  31.687  67.396  1.00 11.97 ? 364 HIS B CG  1 
ATOM   6910  N  ND1 . HIS B 1 364 ? 16.317  30.715  68.138  1.00 12.02 ? 364 HIS B ND1 1 
ATOM   6911  C  CD2 . HIS B 1 364 ? 17.123  31.162  66.159  1.00 12.03 ? 364 HIS B CD2 1 
ATOM   6912  C  CE1 . HIS B 1 364 ? 16.111  29.651  67.384  1.00 11.89 ? 364 HIS B CE1 1 
ATOM   6913  N  NE2 . HIS B 1 364 ? 16.590  29.896  66.178  1.00 11.93 ? 364 HIS B NE2 1 
ATOM   6914  N  N   . ARG B 1 365 ? 19.965  32.731  66.576  1.00 11.36 ? 365 ARG B N   1 
ATOM   6915  C  CA  . ARG B 1 365 ? 20.885  32.043  65.681  1.00 11.49 ? 365 ARG B CA  1 
ATOM   6916  C  C   . ARG B 1 365 ? 22.321  31.964  66.195  1.00 11.62 ? 365 ARG B C   1 
ATOM   6917  O  O   . ARG B 1 365 ? 22.957  30.909  66.137  1.00 11.56 ? 365 ARG B O   1 
ATOM   6918  C  CB  . ARG B 1 365 ? 20.867  32.728  64.314  1.00 11.30 ? 365 ARG B CB  1 
ATOM   6919  C  CG  . ARG B 1 365 ? 21.532  31.942  63.202  1.00 11.04 ? 365 ARG B CG  1 
ATOM   6920  C  CD  . ARG B 1 365 ? 21.388  32.668  61.873  1.00 10.94 ? 365 ARG B CD  1 
ATOM   6921  N  NE  . ARG B 1 365 ? 22.288  33.811  61.777  1.00 10.73 ? 365 ARG B NE  1 
ATOM   6922  C  CZ  . ARG B 1 365 ? 23.533  33.745  61.313  1.00 10.77 ? 365 ARG B CZ  1 
ATOM   6923  N  NH1 . ARG B 1 365 ? 24.029  32.586  60.900  1.00 10.85 ? 365 ARG B NH1 1 
ATOM   6924  N  NH2 . ARG B 1 365 ? 24.286  34.839  61.260  1.00 10.67 ? 365 ARG B NH2 1 
ATOM   6925  N  N   . LEU B 1 366 ? 22.828  33.082  66.701  1.00 11.65 ? 366 LEU B N   1 
ATOM   6926  C  CA  . LEU B 1 366 ? 24.195  33.137  67.205  1.00 11.64 ? 366 LEU B CA  1 
ATOM   6927  C  C   . LEU B 1 366 ? 24.281  33.145  68.732  1.00 11.73 ? 366 LEU B C   1 
ATOM   6928  O  O   . LEU B 1 366 ? 25.067  32.411  69.332  1.00 11.97 ? 366 LEU B O   1 
ATOM   6929  C  CB  . LEU B 1 366 ? 24.889  34.376  66.643  1.00 11.32 ? 366 LEU B CB  1 
ATOM   6930  C  CG  . LEU B 1 366 ? 24.761  34.532  65.131  1.00 11.02 ? 366 LEU B CG  1 
ATOM   6931  C  CD1 . LEU B 1 366 ? 24.959  35.974  64.741  1.00 10.63 ? 366 LEU B CD1 1 
ATOM   6932  C  CD2 . LEU B 1 366 ? 25.788  33.653  64.457  1.00 11.21 ? 366 LEU B CD2 1 
ATOM   6933  N  N   . GLY B 1 367 ? 23.467  33.985  69.356  1.00 11.79 ? 367 GLY B N   1 
ATOM   6934  C  CA  . GLY B 1 367 ? 23.477  34.080  70.799  1.00 11.52 ? 367 GLY B CA  1 
ATOM   6935  C  C   . GLY B 1 367 ? 23.289  35.516  71.227  1.00 11.55 ? 367 GLY B C   1 
ATOM   6936  O  O   . GLY B 1 367 ? 23.531  36.430  70.440  1.00 11.31 ? 367 GLY B O   1 
ATOM   6937  N  N   . PRO B 1 368 ? 22.883  35.744  72.484  1.00 11.58 ? 368 PRO B N   1 
ATOM   6938  C  CA  . PRO B 1 368 ? 22.655  37.085  73.029  1.00 11.72 ? 368 PRO B CA  1 
ATOM   6939  C  C   . PRO B 1 368 ? 23.839  38.030  72.862  1.00 11.76 ? 368 PRO B C   1 
ATOM   6940  O  O   . PRO B 1 368 ? 23.666  39.198  72.522  1.00 11.83 ? 368 PRO B O   1 
ATOM   6941  C  CB  . PRO B 1 368 ? 22.336  36.826  74.499  1.00 11.94 ? 368 PRO B CB  1 
ATOM   6942  C  CG  . PRO B 1 368 ? 21.876  35.407  74.550  1.00 11.99 ? 368 PRO B CG  1 
ATOM   6943  C  CD  . PRO B 1 368 ? 22.648  34.694  73.491  1.00 11.83 ? 368 PRO B CD  1 
ATOM   6944  N  N   . ASN B 1 369 ? 25.041  37.519  73.102  1.00 11.86 ? 369 ASN B N   1 
ATOM   6945  C  CA  . ASN B 1 369 ? 26.253  38.320  72.991  1.00 11.81 ? 369 ASN B CA  1 
ATOM   6946  C  C   . ASN B 1 369 ? 26.919  38.141  71.636  1.00 11.82 ? 369 ASN B C   1 
ATOM   6947  O  O   . ASN B 1 369 ? 28.143  38.100  71.551  1.00 11.88 ? 369 ASN B O   1 
ATOM   6948  C  CB  . ASN B 1 369 ? 27.249  37.930  74.092  1.00 11.67 ? 369 ASN B CB  1 
ATOM   6949  C  CG  . ASN B 1 369 ? 26.906  38.540  75.443  1.00 11.52 ? 369 ASN B CG  1 
ATOM   6950  O  OD1 . ASN B 1 369 ? 26.411  39.662  75.527  1.00 11.67 ? 369 ASN B OD1 1 
ATOM   6951  N  ND2 . ASN B 1 369 ? 27.174  37.798  76.508  1.00 11.06 ? 369 ASN B ND2 1 
ATOM   6952  N  N   . TYR B 1 370 ? 26.115  38.035  70.580  1.00 12.10 ? 370 TYR B N   1 
ATOM   6953  C  CA  . TYR B 1 370 ? 26.649  37.858  69.228  1.00 12.21 ? 370 TYR B CA  1 
ATOM   6954  C  C   . TYR B 1 370 ? 27.499  39.046  68.765  1.00 12.10 ? 370 TYR B C   1 
ATOM   6955  O  O   . TYR B 1 370 ? 28.286  38.923  67.827  1.00 11.97 ? 370 TYR B O   1 
ATOM   6956  C  CB  . TYR B 1 370 ? 25.507  37.593  68.224  1.00 12.48 ? 370 TYR B CB  1 
ATOM   6957  C  CG  . TYR B 1 370 ? 24.574  38.765  67.958  1.00 12.74 ? 370 TYR B CG  1 
ATOM   6958  C  CD1 . TYR B 1 370 ? 24.726  39.559  66.821  1.00 12.92 ? 370 TYR B CD1 1 
ATOM   6959  C  CD2 . TYR B 1 370 ? 23.527  39.066  68.832  1.00 12.76 ? 370 TYR B CD2 1 
ATOM   6960  C  CE1 . TYR B 1 370 ? 23.858  40.624  66.560  1.00 12.74 ? 370 TYR B CE1 1 
ATOM   6961  C  CE2 . TYR B 1 370 ? 22.654  40.128  68.581  1.00 12.56 ? 370 TYR B CE2 1 
ATOM   6962  C  CZ  . TYR B 1 370 ? 22.824  40.903  67.445  1.00 12.56 ? 370 TYR B CZ  1 
ATOM   6963  O  OH  . TYR B 1 370 ? 21.969  41.956  67.193  1.00 12.08 ? 370 TYR B OH  1 
ATOM   6964  N  N   . LEU B 1 371 ? 27.346  40.188  69.432  1.00 12.13 ? 371 LEU B N   1 
ATOM   6965  C  CA  . LEU B 1 371 ? 28.109  41.384  69.089  1.00 12.24 ? 371 LEU B CA  1 
ATOM   6966  C  C   . LEU B 1 371 ? 29.534  41.308  69.627  1.00 12.29 ? 371 LEU B C   1 
ATOM   6967  O  O   . LEU B 1 371 ? 30.264  42.295  69.613  1.00 12.19 ? 371 LEU B O   1 
ATOM   6968  C  CB  . LEU B 1 371 ? 27.427  42.635  69.646  1.00 12.48 ? 371 LEU B CB  1 
ATOM   6969  C  CG  . LEU B 1 371 ? 26.154  43.109  68.944  1.00 12.75 ? 371 LEU B CG  1 
ATOM   6970  C  CD1 . LEU B 1 371 ? 25.402  44.082  69.840  1.00 12.69 ? 371 LEU B CD1 1 
ATOM   6971  C  CD2 . LEU B 1 371 ? 26.515  43.767  67.622  1.00 13.09 ? 371 LEU B CD2 1 
ATOM   6972  N  N   . HIS B 1 372 ? 29.926  40.137  70.111  1.00 12.38 ? 372 HIS B N   1 
ATOM   6973  C  CA  . HIS B 1 372 ? 31.272  39.965  70.632  1.00 12.46 ? 372 HIS B CA  1 
ATOM   6974  C  C   . HIS B 1 372 ? 32.112  39.258  69.587  1.00 12.56 ? 372 HIS B C   1 
ATOM   6975  O  O   . HIS B 1 372 ? 33.325  39.437  69.534  1.00 12.72 ? 372 HIS B O   1 
ATOM   6976  C  CB  . HIS B 1 372 ? 31.253  39.163  71.933  1.00 12.48 ? 372 HIS B CB  1 
ATOM   6977  C  CG  . HIS B 1 372 ? 30.802  39.956  73.121  1.00 12.50 ? 372 HIS B CG  1 
ATOM   6978  N  ND1 . HIS B 1 372 ? 31.037  39.555  74.419  1.00 12.56 ? 372 HIS B ND1 1 
ATOM   6979  C  CD2 . HIS B 1 372 ? 30.106  41.115  73.205  1.00 12.38 ? 372 HIS B CD2 1 
ATOM   6980  C  CE1 . HIS B 1 372 ? 30.502  40.431  75.251  1.00 12.57 ? 372 HIS B CE1 1 
ATOM   6981  N  NE2 . HIS B 1 372 ? 29.931  41.387  74.539  1.00 12.37 ? 372 HIS B NE2 1 
ATOM   6982  N  N   . ILE B 1 373 ? 31.466  38.449  68.753  1.00 12.57 ? 373 ILE B N   1 
ATOM   6983  C  CA  . ILE B 1 373 ? 32.179  37.753  67.690  1.00 12.42 ? 373 ILE B CA  1 
ATOM   6984  C  C   . ILE B 1 373 ? 32.895  38.824  66.859  1.00 12.37 ? 373 ILE B C   1 
ATOM   6985  O  O   . ILE B 1 373 ? 32.257  39.733  66.326  1.00 12.47 ? 373 ILE B O   1 
ATOM   6986  C  CB  . ILE B 1 373 ? 31.208  36.976  66.765  1.00 12.34 ? 373 ILE B CB  1 
ATOM   6987  C  CG1 . ILE B 1 373 ? 30.376  35.987  67.582  1.00 12.14 ? 373 ILE B CG1 1 
ATOM   6988  C  CG2 . ILE B 1 373 ? 31.987  36.242  65.685  1.00 12.39 ? 373 ILE B CG2 1 
ATOM   6989  C  CD1 . ILE B 1 373 ? 29.218  35.375  66.804  1.00 11.75 ? 373 ILE B CD1 1 
ATOM   6990  N  N   . PRO B 1 374 ? 34.228  38.735  66.752  1.00 12.32 ? 374 PRO B N   1 
ATOM   6991  C  CA  . PRO B 1 374 ? 35.057  39.676  65.997  1.00 12.25 ? 374 PRO B CA  1 
ATOM   6992  C  C   . PRO B 1 374 ? 34.356  40.373  64.834  1.00 12.35 ? 374 PRO B C   1 
ATOM   6993  O  O   . PRO B 1 374 ? 34.146  41.585  64.871  1.00 12.11 ? 374 PRO B O   1 
ATOM   6994  C  CB  . PRO B 1 374 ? 36.225  38.818  65.534  1.00 12.32 ? 374 PRO B CB  1 
ATOM   6995  C  CG  . PRO B 1 374 ? 36.360  37.767  66.605  1.00 12.39 ? 374 PRO B CG  1 
ATOM   6996  C  CD  . PRO B 1 374 ? 35.050  37.686  67.374  1.00 12.40 ? 374 PRO B CD  1 
ATOM   6997  N  N   . VAL B 1 375 ? 33.995  39.608  63.806  1.00 12.50 ? 375 VAL B N   1 
ATOM   6998  C  CA  . VAL B 1 375 ? 33.319  40.158  62.629  1.00 12.95 ? 375 VAL B CA  1 
ATOM   6999  C  C   . VAL B 1 375 ? 32.181  41.125  62.964  1.00 12.83 ? 375 VAL B C   1 
ATOM   7000  O  O   . VAL B 1 375 ? 31.951  42.097  62.243  1.00 12.80 ? 375 VAL B O   1 
ATOM   7001  C  CB  . VAL B 1 375 ? 32.725  39.042  61.749  1.00 13.26 ? 375 VAL B CB  1 
ATOM   7002  C  CG1 . VAL B 1 375 ? 33.529  38.904  60.467  1.00 13.70 ? 375 VAL B CG1 1 
ATOM   7003  C  CG2 . VAL B 1 375 ? 32.701  37.733  62.516  1.00 13.75 ? 375 VAL B CG2 1 
ATOM   7004  N  N   . ASN B 1 376 ? 31.469  40.852  64.053  1.00 12.82 ? 376 ASN B N   1 
ATOM   7005  C  CA  . ASN B 1 376 ? 30.345  41.686  64.464  1.00 12.71 ? 376 ASN B CA  1 
ATOM   7006  C  C   . ASN B 1 376 ? 30.732  42.784  65.449  1.00 12.67 ? 376 ASN B C   1 
ATOM   7007  O  O   . ASN B 1 376 ? 30.049  43.806  65.539  1.00 12.75 ? 376 ASN B O   1 
ATOM   7008  C  CB  . ASN B 1 376 ? 29.242  40.814  65.073  1.00 12.82 ? 376 ASN B CB  1 
ATOM   7009  C  CG  . ASN B 1 376 ? 28.797  39.703  64.142  1.00 12.89 ? 376 ASN B CG  1 
ATOM   7010  O  OD1 . ASN B 1 376 ? 28.854  39.845  62.919  1.00 13.15 ? 376 ASN B OD1 1 
ATOM   7011  N  ND2 . ASN B 1 376 ? 28.351  38.587  64.713  1.00 12.85 ? 376 ASN B ND2 1 
ATOM   7012  N  N   . CYS B 1 377 ? 31.818  42.570  66.187  1.00 12.86 ? 377 CYS B N   1 
ATOM   7013  C  CA  . CYS B 1 377 ? 32.299  43.548  67.166  1.00 12.93 ? 377 CYS B CA  1 
ATOM   7014  C  C   . CYS B 1 377 ? 32.687  44.853  66.463  1.00 12.57 ? 377 CYS B C   1 
ATOM   7015  O  O   . CYS B 1 377 ? 33.422  44.840  65.476  1.00 12.48 ? 377 CYS B O   1 
ATOM   7016  C  CB  . CYS B 1 377 ? 33.508  42.972  67.920  1.00 13.29 ? 377 CYS B CB  1 
ATOM   7017  S  SG  . CYS B 1 377 ? 34.299  44.087  69.116  1.00 14.35 ? 377 CYS B SG  1 
ATOM   7018  N  N   . PRO B 1 378 ? 32.190  45.996  66.962  1.00 12.37 ? 378 PRO B N   1 
ATOM   7019  C  CA  . PRO B 1 378 ? 32.483  47.312  66.384  1.00 12.20 ? 378 PRO B CA  1 
ATOM   7020  C  C   . PRO B 1 378 ? 33.826  47.863  66.842  1.00 12.25 ? 378 PRO B C   1 
ATOM   7021  O  O   . PRO B 1 378 ? 33.884  48.895  67.506  1.00 12.01 ? 378 PRO B O   1 
ATOM   7022  C  CB  . PRO B 1 378 ? 31.328  48.173  66.868  1.00 12.31 ? 378 PRO B CB  1 
ATOM   7023  C  CG  . PRO B 1 378 ? 30.953  47.570  68.185  1.00 12.42 ? 378 PRO B CG  1 
ATOM   7024  C  CD  . PRO B 1 378 ? 31.298  46.098  68.131  1.00 12.42 ? 378 PRO B CD  1 
ATOM   7025  N  N   . TYR B 1 379 ? 34.900  47.180  66.459  1.00 12.27 ? 379 TYR B N   1 
ATOM   7026  C  CA  . TYR B 1 379 ? 36.254  47.561  66.845  1.00 12.63 ? 379 TYR B CA  1 
ATOM   7027  C  C   . TYR B 1 379 ? 36.718  48.993  66.570  1.00 12.56 ? 379 TYR B C   1 
ATOM   7028  O  O   . TYR B 1 379 ? 37.651  49.472  67.215  1.00 12.55 ? 379 TYR B O   1 
ATOM   7029  C  CB  . TYR B 1 379 ? 37.252  46.585  66.222  1.00 12.93 ? 379 TYR B CB  1 
ATOM   7030  C  CG  . TYR B 1 379 ? 37.427  46.720  64.727  1.00 13.32 ? 379 TYR B CG  1 
ATOM   7031  C  CD1 . TYR B 1 379 ? 38.384  47.583  64.193  1.00 13.45 ? 379 TYR B CD1 1 
ATOM   7032  C  CD2 . TYR B 1 379 ? 36.679  45.941  63.844  1.00 13.58 ? 379 TYR B CD2 1 
ATOM   7033  C  CE1 . TYR B 1 379 ? 38.598  47.660  62.818  1.00 13.49 ? 379 TYR B CE1 1 
ATOM   7034  C  CE2 . TYR B 1 379 ? 36.885  46.011  62.469  1.00 13.62 ? 379 TYR B CE2 1 
ATOM   7035  C  CZ  . TYR B 1 379 ? 37.850  46.870  61.964  1.00 13.57 ? 379 TYR B CZ  1 
ATOM   7036  O  OH  . TYR B 1 379 ? 38.088  46.918  60.610  1.00 13.48 ? 379 TYR B OH  1 
ATOM   7037  N  N   . ARG B 1 380 ? 36.096  49.677  65.616  1.00 12.63 ? 380 ARG B N   1 
ATOM   7038  C  CA  . ARG B 1 380 ? 36.506  51.044  65.312  1.00 12.76 ? 380 ARG B CA  1 
ATOM   7039  C  C   . ARG B 1 380 ? 35.764  52.035  66.196  1.00 12.87 ? 380 ARG B C   1 
ATOM   7040  O  O   . ARG B 1 380 ? 35.761  53.241  65.938  1.00 12.55 ? 380 ARG B O   1 
ATOM   7041  C  CB  . ARG B 1 380 ? 36.251  51.368  63.838  1.00 12.86 ? 380 ARG B CB  1 
ATOM   7042  C  CG  . ARG B 1 380 ? 37.006  50.476  62.856  1.00 12.96 ? 380 ARG B CG  1 
ATOM   7043  C  CD  . ARG B 1 380 ? 38.441  50.938  62.627  1.00 12.91 ? 380 ARG B CD  1 
ATOM   7044  N  NE  . ARG B 1 380 ? 38.562  52.383  62.453  1.00 13.17 ? 380 ARG B NE  1 
ATOM   7045  C  CZ  . ARG B 1 380 ? 37.812  53.117  61.634  1.00 13.33 ? 380 ARG B CZ  1 
ATOM   7046  N  NH1 . ARG B 1 380 ? 36.869  52.542  60.900  1.00 13.55 ? 380 ARG B NH1 1 
ATOM   7047  N  NH2 . ARG B 1 380 ? 38.007  54.427  61.547  1.00 13.32 ? 380 ARG B NH2 1 
ATOM   7048  N  N   . ALA B 1 381 ? 35.131  51.509  67.240  1.00 13.09 ? 381 ALA B N   1 
ATOM   7049  C  CA  . ALA B 1 381 ? 34.384  52.325  68.186  1.00 13.29 ? 381 ALA B CA  1 
ATOM   7050  C  C   . ALA B 1 381 ? 34.803  51.968  69.607  1.00 13.63 ? 381 ALA B C   1 
ATOM   7051  O  O   . ALA B 1 381 ? 35.770  51.229  69.815  1.00 13.65 ? 381 ALA B O   1 
ATOM   7052  C  CB  . ALA B 1 381 ? 32.883  52.104  68.005  1.00 13.39 ? 381 ALA B CB  1 
ATOM   7053  N  N   . ARG B 1 382 ? 34.071  52.495  70.582  1.00 13.81 ? 382 ARG B N   1 
ATOM   7054  C  CA  . ARG B 1 382 ? 34.369  52.235  71.984  1.00 14.18 ? 382 ARG B CA  1 
ATOM   7055  C  C   . ARG B 1 382 ? 33.082  51.934  72.746  1.00 14.15 ? 382 ARG B C   1 
ATOM   7056  O  O   . ARG B 1 382 ? 32.414  52.843  73.246  1.00 14.12 ? 382 ARG B O   1 
ATOM   7057  C  CB  . ARG B 1 382 ? 35.064  53.449  72.596  1.00 14.45 ? 382 ARG B CB  1 
ATOM   7058  C  CG  . ARG B 1 382 ? 35.073  53.447  74.108  1.00 14.93 ? 382 ARG B CG  1 
ATOM   7059  C  CD  . ARG B 1 382 ? 36.007  52.377  74.630  1.00 15.18 ? 382 ARG B CD  1 
ATOM   7060  N  NE  . ARG B 1 382 ? 36.663  52.782  75.872  1.00 15.13 ? 382 ARG B NE  1 
ATOM   7061  C  CZ  . ARG B 1 382 ? 37.575  53.748  75.958  1.00 15.02 ? 382 ARG B CZ  1 
ATOM   7062  N  NH1 . ARG B 1 382 ? 37.946  54.417  74.870  1.00 14.85 ? 382 ARG B NH1 1 
ATOM   7063  N  NH2 . ARG B 1 382 ? 38.118  54.042  77.135  1.00 14.72 ? 382 ARG B NH2 1 
ATOM   7064  N  N   . VAL B 1 383 ? 32.733  50.656  72.838  1.00 13.86 ? 383 VAL B N   1 
ATOM   7065  C  CA  . VAL B 1 383 ? 31.511  50.278  73.532  1.00 13.80 ? 383 VAL B CA  1 
ATOM   7066  C  C   . VAL B 1 383 ? 31.648  50.473  75.037  1.00 13.72 ? 383 VAL B C   1 
ATOM   7067  O  O   . VAL B 1 383 ? 32.543  49.913  75.669  1.00 13.77 ? 383 VAL B O   1 
ATOM   7068  C  CB  . VAL B 1 383 ? 31.121  48.809  73.231  1.00 13.64 ? 383 VAL B CB  1 
ATOM   7069  C  CG1 . VAL B 1 383 ? 29.889  48.411  74.039  1.00 13.54 ? 383 VAL B CG1 1 
ATOM   7070  C  CG2 . VAL B 1 383 ? 30.839  48.648  71.747  1.00 13.26 ? 383 VAL B CG2 1 
ATOM   7071  N  N   . ALA B 1 384 ? 30.750  51.278  75.598  1.00 13.70 ? 384 ALA B N   1 
ATOM   7072  C  CA  . ALA B 1 384 ? 30.737  51.565  77.028  1.00 13.39 ? 384 ALA B CA  1 
ATOM   7073  C  C   . ALA B 1 384 ? 29.323  51.958  77.453  1.00 13.43 ? 384 ALA B C   1 
ATOM   7074  O  O   . ALA B 1 384 ? 28.892  53.091  77.228  1.00 13.55 ? 384 ALA B O   1 
ATOM   7075  C  CB  . ALA B 1 384 ? 31.710  52.691  77.340  1.00 13.50 ? 384 ALA B CB  1 
ATOM   7076  N  N   . ASN B 1 385 ? 28.610  51.014  78.066  1.00 13.25 ? 385 ASN B N   1 
ATOM   7077  C  CA  . ASN B 1 385 ? 27.239  51.241  78.521  1.00 12.77 ? 385 ASN B CA  1 
ATOM   7078  C  C   . ASN B 1 385 ? 26.977  50.615  79.888  1.00 12.56 ? 385 ASN B C   1 
ATOM   7079  O  O   . ASN B 1 385 ? 27.867  50.537  80.733  1.00 12.69 ? 385 ASN B O   1 
ATOM   7080  C  CB  . ASN B 1 385 ? 26.262  50.650  77.514  1.00 12.58 ? 385 ASN B CB  1 
ATOM   7081  C  CG  . ASN B 1 385 ? 26.637  49.253  77.118  1.00 12.42 ? 385 ASN B CG  1 
ATOM   7082  O  OD1 . ASN B 1 385 ? 26.842  48.392  77.969  1.00 12.16 ? 385 ASN B OD1 1 
ATOM   7083  N  ND2 . ASN B 1 385 ? 26.739  49.014  75.821  1.00 13.00 ? 385 ASN B ND2 1 
ATOM   7084  N  N   . TYR B 1 386 ? 25.747  50.150  80.087  1.00 12.32 ? 386 TYR B N   1 
ATOM   7085  C  CA  . TYR B 1 386 ? 25.348  49.537  81.350  1.00 12.11 ? 386 TYR B CA  1 
ATOM   7086  C  C   . TYR B 1 386 ? 24.786  48.126  81.193  1.00 12.01 ? 386 TYR B C   1 
ATOM   7087  O  O   . TYR B 1 386 ? 23.980  47.678  82.009  1.00 11.76 ? 386 TYR B O   1 
ATOM   7088  C  CB  . TYR B 1 386 ? 24.315  50.426  82.046  1.00 12.08 ? 386 TYR B CB  1 
ATOM   7089  C  CG  . TYR B 1 386 ? 24.862  51.784  82.406  1.00 12.19 ? 386 TYR B CG  1 
ATOM   7090  C  CD1 . TYR B 1 386 ? 24.689  52.875  81.558  1.00 12.08 ? 386 TYR B CD1 1 
ATOM   7091  C  CD2 . TYR B 1 386 ? 25.592  51.967  83.578  1.00 12.43 ? 386 TYR B CD2 1 
ATOM   7092  C  CE1 . TYR B 1 386 ? 25.228  54.110  81.865  1.00 12.55 ? 386 TYR B CE1 1 
ATOM   7093  C  CE2 . TYR B 1 386 ? 26.137  53.200  83.896  1.00 12.88 ? 386 TYR B CE2 1 
ATOM   7094  C  CZ  . TYR B 1 386 ? 25.954  54.265  83.036  1.00 12.87 ? 386 TYR B CZ  1 
ATOM   7095  O  OH  . TYR B 1 386 ? 26.512  55.480  83.349  1.00 13.61 ? 386 TYR B OH  1 
ATOM   7096  N  N   . GLN B 1 387 ? 25.209  47.435  80.140  1.00 11.92 ? 387 GLN B N   1 
ATOM   7097  C  CA  . GLN B 1 387 ? 24.755  46.076  79.895  1.00 11.72 ? 387 GLN B CA  1 
ATOM   7098  C  C   . GLN B 1 387 ? 25.827  45.138  80.421  1.00 11.68 ? 387 GLN B C   1 
ATOM   7099  O  O   . GLN B 1 387 ? 27.014  45.434  80.320  1.00 11.73 ? 387 GLN B O   1 
ATOM   7100  C  CB  . GLN B 1 387 ? 24.540  45.847  78.398  1.00 11.92 ? 387 GLN B CB  1 
ATOM   7101  C  CG  . GLN B 1 387 ? 23.625  46.866  77.727  1.00 11.83 ? 387 GLN B CG  1 
ATOM   7102  C  CD  . GLN B 1 387 ? 23.332  46.512  76.285  1.00 11.76 ? 387 GLN B CD  1 
ATOM   7103  O  OE1 . GLN B 1 387 ? 23.149  45.342  75.953  1.00 11.78 ? 387 GLN B OE1 1 
ATOM   7104  N  NE2 . GLN B 1 387 ? 23.290  47.519  75.417  1.00 11.55 ? 387 GLN B NE2 1 
ATOM   7105  N  N   . ARG B 1 388 ? 25.410  44.014  80.991  1.00 11.68 ? 388 ARG B N   1 
ATOM   7106  C  CA  . ARG B 1 388 ? 26.358  43.048  81.536  1.00 11.74 ? 388 ARG B CA  1 
ATOM   7107  C  C   . ARG B 1 388 ? 25.873  41.609  81.414  1.00 11.86 ? 388 ARG B C   1 
ATOM   7108  O  O   . ARG B 1 388 ? 24.711  41.349  81.101  1.00 11.65 ? 388 ARG B O   1 
ATOM   7109  C  CB  . ARG B 1 388 ? 26.639  43.347  83.014  1.00 11.38 ? 388 ARG B CB  1 
ATOM   7110  C  CG  . ARG B 1 388 ? 27.078  44.773  83.297  1.00 11.17 ? 388 ARG B CG  1 
ATOM   7111  C  CD  . ARG B 1 388 ? 28.512  45.019  82.863  1.00 11.02 ? 388 ARG B CD  1 
ATOM   7112  N  NE  . ARG B 1 388 ? 28.748  46.438  82.632  1.00 11.05 ? 388 ARG B NE  1 
ATOM   7113  C  CZ  . ARG B 1 388 ? 29.022  47.311  83.595  1.00 11.13 ? 388 ARG B CZ  1 
ATOM   7114  N  NH1 . ARG B 1 388 ? 29.094  46.899  84.854  1.00 11.40 ? 388 ARG B NH1 1 
ATOM   7115  N  NH2 . ARG B 1 388 ? 29.205  48.594  83.306  1.00 11.09 ? 388 ARG B NH2 1 
ATOM   7116  N  N   . ASP B 1 389 ? 26.787  40.680  81.673  1.00 11.84 ? 389 ASP B N   1 
ATOM   7117  C  CA  . ASP B 1 389 ? 26.494  39.253  81.633  1.00 12.40 ? 389 ASP B CA  1 
ATOM   7118  C  C   . ASP B 1 389 ? 26.020  38.700  80.299  1.00 12.34 ? 389 ASP B C   1 
ATOM   7119  O  O   . ASP B 1 389 ? 26.252  39.284  79.248  1.00 12.40 ? 389 ASP B O   1 
ATOM   7120  C  CB  . ASP B 1 389 ? 25.474  38.910  82.718  1.00 12.75 ? 389 ASP B CB  1 
ATOM   7121  C  CG  . ASP B 1 389 ? 26.040  39.077  84.110  1.00 13.03 ? 389 ASP B CG  1 
ATOM   7122  O  OD1 . ASP B 1 389 ? 27.147  39.650  84.225  1.00 12.85 ? 389 ASP B OD1 1 
ATOM   7123  O  OD2 . ASP B 1 389 ? 25.381  38.639  85.080  1.00 13.55 ? 389 ASP B OD2 1 
ATOM   7124  N  N   . GLY B 1 390 ? 25.346  37.560  80.360  1.00 12.30 ? 390 GLY B N   1 
ATOM   7125  C  CA  . GLY B 1 390 ? 24.859  36.924  79.156  1.00 12.26 ? 390 GLY B CA  1 
ATOM   7126  C  C   . GLY B 1 390 ? 25.736  35.729  78.841  1.00 12.36 ? 390 GLY B C   1 
ATOM   7127  O  O   . GLY B 1 390 ? 26.947  35.771  79.081  1.00 12.39 ? 390 GLY B O   1 
ATOM   7128  N  N   . PRO B 1 391 ? 25.160  34.642  78.302  1.00 12.04 ? 391 PRO B N   1 
ATOM   7129  C  CA  . PRO B 1 391 ? 25.959  33.455  77.977  1.00 11.81 ? 391 PRO B CA  1 
ATOM   7130  C  C   . PRO B 1 391 ? 27.130  33.787  77.065  1.00 11.51 ? 391 PRO B C   1 
ATOM   7131  O  O   . PRO B 1 391 ? 27.039  34.677  76.222  1.00 11.49 ? 391 PRO B O   1 
ATOM   7132  C  CB  . PRO B 1 391 ? 24.960  32.509  77.304  1.00 11.71 ? 391 PRO B CB  1 
ATOM   7133  C  CG  . PRO B 1 391 ? 23.797  33.367  76.929  1.00 11.78 ? 391 PRO B CG  1 
ATOM   7134  C  CD  . PRO B 1 391 ? 23.742  34.463  77.951  1.00 11.88 ? 391 PRO B CD  1 
ATOM   7135  N  N   . MET B 1 392 ? 28.229  33.063  77.240  1.00 11.62 ? 392 MET B N   1 
ATOM   7136  C  CA  . MET B 1 392 ? 29.420  33.271  76.430  1.00 11.55 ? 392 MET B CA  1 
ATOM   7137  C  C   . MET B 1 392 ? 29.776  34.749  76.408  1.00 11.78 ? 392 MET B C   1 
ATOM   7138  O  O   . MET B 1 392 ? 29.734  35.397  75.367  1.00 12.06 ? 392 MET B O   1 
ATOM   7139  C  CB  . MET B 1 392 ? 29.179  32.763  75.009  1.00 10.86 ? 392 MET B CB  1 
ATOM   7140  C  CG  . MET B 1 392 ? 28.952  31.257  74.930  1.00 9.91  ? 392 MET B CG  1 
ATOM   7141  S  SD  . MET B 1 392 ? 30.463  30.268  75.120  1.00 8.77  ? 392 MET B SD  1 
ATOM   7142  C  CE  . MET B 1 392 ? 31.739  31.418  74.550  1.00 8.51  ? 392 MET B CE  1 
ATOM   7143  N  N   . CYS B 1 393 ? 30.112  35.276  77.579  1.00 12.06 ? 393 CYS B N   1 
ATOM   7144  C  CA  . CYS B 1 393 ? 30.479  36.671  77.716  1.00 12.11 ? 393 CYS B CA  1 
ATOM   7145  C  C   . CYS B 1 393 ? 31.991  36.802  77.591  1.00 12.15 ? 393 CYS B C   1 
ATOM   7146  O  O   . CYS B 1 393 ? 32.741  36.422  78.494  1.00 11.89 ? 393 CYS B O   1 
ATOM   7147  C  CB  . CYS B 1 393 ? 30.016  37.201  79.072  1.00 12.40 ? 393 CYS B CB  1 
ATOM   7148  S  SG  . CYS B 1 393 ? 30.617  38.856  79.461  1.00 13.24 ? 393 CYS B SG  1 
ATOM   7149  N  N   . MET B 1 394 ? 32.435  37.333  76.457  1.00 12.19 ? 394 MET B N   1 
ATOM   7150  C  CA  . MET B 1 394 ? 33.856  37.517  76.216  1.00 11.95 ? 394 MET B CA  1 
ATOM   7151  C  C   . MET B 1 394 ? 34.300  38.833  76.824  1.00 12.25 ? 394 MET B C   1 
ATOM   7152  O  O   . MET B 1 394 ? 33.540  39.486  77.543  1.00 12.60 ? 394 MET B O   1 
ATOM   7153  C  CB  . MET B 1 394 ? 34.137  37.520  74.716  1.00 11.55 ? 394 MET B CB  1 
ATOM   7154  C  CG  . MET B 1 394 ? 34.883  36.291  74.231  1.00 10.84 ? 394 MET B CG  1 
ATOM   7155  S  SD  . MET B 1 394 ? 34.075  34.739  74.687  1.00 10.17 ? 394 MET B SD  1 
ATOM   7156  C  CE  . MET B 1 394 ? 32.391  35.062  74.235  1.00 9.84  ? 394 MET B CE  1 
ATOM   7157  N  N   . GLN B 1 395 ? 35.533  39.229  76.535  1.00 12.50 ? 395 GLN B N   1 
ATOM   7158  C  CA  . GLN B 1 395 ? 36.054  40.483  77.062  1.00 12.69 ? 395 GLN B CA  1 
ATOM   7159  C  C   . GLN B 1 395 ? 36.130  40.429  78.588  1.00 12.68 ? 395 GLN B C   1 
ATOM   7160  O  O   . GLN B 1 395 ? 36.317  39.358  79.177  1.00 12.57 ? 395 GLN B O   1 
ATOM   7161  C  CB  . GLN B 1 395 ? 35.157  41.648  76.626  1.00 12.64 ? 395 GLN B CB  1 
ATOM   7162  C  CG  . GLN B 1 395 ? 35.539  42.272  75.296  1.00 13.05 ? 395 GLN B CG  1 
ATOM   7163  C  CD  . GLN B 1 395 ? 37.045  42.363  75.094  1.00 13.39 ? 395 GLN B CD  1 
ATOM   7164  O  OE1 . GLN B 1 395 ? 37.691  41.391  74.691  1.00 14.31 ? 395 GLN B OE1 1 
ATOM   7165  N  NE2 . GLN B 1 395 ? 37.612  43.533  75.373  1.00 13.04 ? 395 GLN B NE2 1 
ATOM   7166  N  N   . ASP B 1 396 ? 35.978  41.587  79.220  1.00 12.31 ? 396 ASP B N   1 
ATOM   7167  C  CA  . ASP B 1 396 ? 36.038  41.681  80.671  1.00 12.42 ? 396 ASP B CA  1 
ATOM   7168  C  C   . ASP B 1 396 ? 34.674  42.040  81.241  1.00 12.47 ? 396 ASP B C   1 
ATOM   7169  O  O   . ASP B 1 396 ? 34.558  42.394  82.413  1.00 12.23 ? 396 ASP B O   1 
ATOM   7170  C  CB  . ASP B 1 396 ? 37.058  42.746  81.080  1.00 12.55 ? 396 ASP B CB  1 
ATOM   7171  C  CG  . ASP B 1 396 ? 36.801  44.095  80.410  1.00 12.61 ? 396 ASP B CG  1 
ATOM   7172  O  OD1 . ASP B 1 396 ? 35.898  44.178  79.543  1.00 12.64 ? 396 ASP B OD1 1 
ATOM   7173  O  OD2 . ASP B 1 396 ? 37.506  45.073  80.750  1.00 12.69 ? 396 ASP B OD2 1 
ATOM   7174  N  N   . ASN B 1 397 ? 33.645  41.945  80.405  1.00 12.58 ? 397 ASN B N   1 
ATOM   7175  C  CA  . ASN B 1 397 ? 32.285  42.281  80.814  1.00 12.78 ? 397 ASN B CA  1 
ATOM   7176  C  C   . ASN B 1 397 ? 32.239  43.711  81.347  1.00 12.97 ? 397 ASN B C   1 
ATOM   7177  O  O   . ASN B 1 397 ? 31.399  44.049  82.187  1.00 13.17 ? 397 ASN B O   1 
ATOM   7178  C  CB  . ASN B 1 397 ? 31.791  41.317  81.892  1.00 12.60 ? 397 ASN B CB  1 
ATOM   7179  C  CG  . ASN B 1 397 ? 30.283  41.277  81.977  1.00 12.53 ? 397 ASN B CG  1 
ATOM   7180  O  OD1 . ASN B 1 397 ? 29.594  41.843  81.132  1.00 12.09 ? 397 ASN B OD1 1 
ATOM   7181  N  ND2 . ASN B 1 397 ? 29.759  40.606  82.998  1.00 12.84 ? 397 ASN B ND2 1 
ATOM   7182  N  N   . GLN B 1 398 ? 33.149  44.540  80.839  1.00 13.05 ? 398 GLN B N   1 
ATOM   7183  C  CA  . GLN B 1 398 ? 33.266  45.942  81.232  1.00 13.11 ? 398 GLN B CA  1 
ATOM   7184  C  C   . GLN B 1 398 ? 33.849  46.091  82.635  1.00 13.17 ? 398 GLN B C   1 
ATOM   7185  O  O   . GLN B 1 398 ? 33.721  47.145  83.269  1.00 13.30 ? 398 GLN B O   1 
ATOM   7186  C  CB  . GLN B 1 398 ? 31.910  46.650  81.145  1.00 12.82 ? 398 GLN B CB  1 
ATOM   7187  C  CG  . GLN B 1 398 ? 31.885  47.753  80.100  1.00 12.56 ? 398 GLN B CG  1 
ATOM   7188  C  CD  . GLN B 1 398 ? 30.561  47.844  79.368  1.00 12.56 ? 398 GLN B CD  1 
ATOM   7189  O  OE1 . GLN B 1 398 ? 30.102  48.938  79.033  1.00 12.65 ? 398 GLN B OE1 1 
ATOM   7190  N  NE2 . GLN B 1 398 ? 29.938  46.693  79.115  1.00 12.43 ? 398 GLN B NE2 1 
ATOM   7191  N  N   . GLY B 1 399 ? 34.484  45.021  83.107  1.00 13.19 ? 399 GLY B N   1 
ATOM   7192  C  CA  . GLY B 1 399 ? 35.116  45.025  84.415  1.00 13.42 ? 399 GLY B CA  1 
ATOM   7193  C  C   . GLY B 1 399 ? 34.226  45.351  85.597  1.00 13.24 ? 399 GLY B C   1 
ATOM   7194  O  O   . GLY B 1 399 ? 33.058  44.965  85.636  1.00 13.37 ? 399 GLY B O   1 
ATOM   7195  N  N   . GLY B 1 400 ? 34.787  46.064  86.568  1.00 13.01 ? 400 GLY B N   1 
ATOM   7196  C  CA  . GLY B 1 400 ? 34.027  46.423  87.748  1.00 13.01 ? 400 GLY B CA  1 
ATOM   7197  C  C   . GLY B 1 400 ? 33.604  47.877  87.767  1.00 12.95 ? 400 GLY B C   1 
ATOM   7198  O  O   . GLY B 1 400 ? 33.952  48.616  88.685  1.00 12.77 ? 400 GLY B O   1 
ATOM   7199  N  N   . ALA B 1 401 ? 32.852  48.295  86.755  1.00 12.66 ? 401 ALA B N   1 
ATOM   7200  C  CA  . ALA B 1 401 ? 32.387  49.672  86.688  1.00 12.55 ? 401 ALA B CA  1 
ATOM   7201  C  C   . ALA B 1 401 ? 30.928  49.731  87.111  1.00 12.40 ? 401 ALA B C   1 
ATOM   7202  O  O   . ALA B 1 401 ? 30.231  48.718  87.094  1.00 12.82 ? 401 ALA B O   1 
ATOM   7203  C  CB  . ALA B 1 401 ? 32.537  50.201  85.275  1.00 12.57 ? 401 ALA B CB  1 
ATOM   7204  N  N   . PRO B 1 402 ? 30.453  50.912  87.532  1.00 12.08 ? 402 PRO B N   1 
ATOM   7205  C  CA  . PRO B 1 402 ? 29.046  51.003  87.935  1.00 11.81 ? 402 PRO B CA  1 
ATOM   7206  C  C   . PRO B 1 402 ? 28.161  50.475  86.806  1.00 11.59 ? 402 PRO B C   1 
ATOM   7207  O  O   . PRO B 1 402 ? 28.422  50.736  85.628  1.00 11.37 ? 402 PRO B O   1 
ATOM   7208  C  CB  . PRO B 1 402 ? 28.846  52.492  88.196  1.00 11.67 ? 402 PRO B CB  1 
ATOM   7209  C  CG  . PRO B 1 402 ? 30.212  52.985  88.565  1.00 11.61 ? 402 PRO B CG  1 
ATOM   7210  C  CD  . PRO B 1 402 ? 31.159  52.194  87.702  1.00 11.92 ? 402 PRO B CD  1 
ATOM   7211  N  N   . ASN B 1 403 ? 27.129  49.719  87.173  1.00 11.72 ? 403 ASN B N   1 
ATOM   7212  C  CA  . ASN B 1 403 ? 26.216  49.125  86.198  1.00 11.51 ? 403 ASN B CA  1 
ATOM   7213  C  C   . ASN B 1 403 ? 24.787  49.662  86.256  1.00 11.59 ? 403 ASN B C   1 
ATOM   7214  O  O   . ASN B 1 403 ? 23.834  48.955  85.941  1.00 11.60 ? 403 ASN B O   1 
ATOM   7215  C  CB  . ASN B 1 403 ? 26.200  47.605  86.371  1.00 11.58 ? 403 ASN B CB  1 
ATOM   7216  C  CG  . ASN B 1 403 ? 25.877  47.180  87.791  1.00 11.61 ? 403 ASN B CG  1 
ATOM   7217  O  OD1 . ASN B 1 403 ? 25.260  46.134  88.010  1.00 11.29 ? 403 ASN B OD1 1 
ATOM   7218  N  ND2 . ASN B 1 403 ? 26.293  47.987  88.764  1.00 11.68 ? 403 ASN B ND2 1 
ATOM   7219  N  N   . TYR B 1 404 ? 24.640  50.919  86.655  1.00 11.94 ? 404 TYR B N   1 
ATOM   7220  C  CA  . TYR B 1 404 ? 23.324  51.533  86.728  1.00 12.13 ? 404 TYR B CA  1 
ATOM   7221  C  C   . TYR B 1 404 ? 23.421  53.018  86.398  1.00 12.08 ? 404 TYR B C   1 
ATOM   7222  O  O   . TYR B 1 404 ? 24.311  53.710  86.886  1.00 12.09 ? 404 TYR B O   1 
ATOM   7223  C  CB  . TYR B 1 404 ? 22.728  51.336  88.121  1.00 12.43 ? 404 TYR B CB  1 
ATOM   7224  C  CG  . TYR B 1 404 ? 23.467  52.073  89.219  1.00 12.82 ? 404 TYR B CG  1 
ATOM   7225  C  CD1 . TYR B 1 404 ? 24.617  51.537  89.796  1.00 12.91 ? 404 TYR B CD1 1 
ATOM   7226  C  CD2 . TYR B 1 404 ? 23.011  53.306  89.682  1.00 13.03 ? 404 TYR B CD2 1 
ATOM   7227  C  CE1 . TYR B 1 404 ? 25.294  52.209  90.804  1.00 13.22 ? 404 TYR B CE1 1 
ATOM   7228  C  CE2 . TYR B 1 404 ? 23.677  53.987  90.688  1.00 13.35 ? 404 TYR B CE2 1 
ATOM   7229  C  CZ  . TYR B 1 404 ? 24.817  53.435  91.245  1.00 13.43 ? 404 TYR B CZ  1 
ATOM   7230  O  OH  . TYR B 1 404 ? 25.479  54.118  92.237  1.00 13.99 ? 404 TYR B OH  1 
ATOM   7231  N  N   . TYR B 1 405 ? 22.499  53.492  85.562  1.00 12.08 ? 405 TYR B N   1 
ATOM   7232  C  CA  . TYR B 1 405 ? 22.453  54.888  85.133  1.00 11.81 ? 405 TYR B CA  1 
ATOM   7233  C  C   . TYR B 1 405 ? 21.157  55.523  85.627  1.00 11.86 ? 405 TYR B C   1 
ATOM   7234  O  O   . TYR B 1 405 ? 20.071  54.972  85.423  1.00 11.81 ? 405 TYR B O   1 
ATOM   7235  C  CB  . TYR B 1 405 ? 22.513  54.951  83.602  1.00 11.95 ? 405 TYR B CB  1 
ATOM   7236  C  CG  . TYR B 1 405 ? 22.837  56.311  83.010  1.00 11.75 ? 405 TYR B CG  1 
ATOM   7237  C  CD1 . TYR B 1 405 ? 24.049  56.947  83.280  1.00 11.62 ? 405 TYR B CD1 1 
ATOM   7238  C  CD2 . TYR B 1 405 ? 21.943  56.944  82.150  1.00 11.71 ? 405 TYR B CD2 1 
ATOM   7239  C  CE1 . TYR B 1 405 ? 24.362  58.179  82.707  1.00 11.43 ? 405 TYR B CE1 1 
ATOM   7240  C  CE2 . TYR B 1 405 ? 22.246  58.175  81.573  1.00 11.55 ? 405 TYR B CE2 1 
ATOM   7241  C  CZ  . TYR B 1 405 ? 23.452  58.784  81.856  1.00 11.47 ? 405 TYR B CZ  1 
ATOM   7242  O  OH  . TYR B 1 405 ? 23.737  60.003  81.295  1.00 11.52 ? 405 TYR B OH  1 
ATOM   7243  N  N   . PRO B 1 406 ? 21.248  56.703  86.263  1.00 11.90 ? 406 PRO B N   1 
ATOM   7244  C  CA  . PRO B 1 406 ? 22.486  57.441  86.526  1.00 12.04 ? 406 PRO B CA  1 
ATOM   7245  C  C   . PRO B 1 406 ? 23.255  56.983  87.762  1.00 12.29 ? 406 PRO B C   1 
ATOM   7246  O  O   . PRO B 1 406 ? 22.804  56.115  88.512  1.00 12.36 ? 406 PRO B O   1 
ATOM   7247  C  CB  . PRO B 1 406 ? 22.013  58.881  86.661  1.00 11.96 ? 406 PRO B CB  1 
ATOM   7248  C  CG  . PRO B 1 406 ? 20.625  58.759  87.214  1.00 11.83 ? 406 PRO B CG  1 
ATOM   7249  C  CD  . PRO B 1 406 ? 20.068  57.424  86.776  1.00 11.87 ? 406 PRO B CD  1 
ATOM   7250  N  N   . ASN B 1 407 ? 24.421  57.585  87.965  1.00 12.30 ? 407 ASN B N   1 
ATOM   7251  C  CA  . ASN B 1 407 ? 25.266  57.257  89.102  1.00 12.61 ? 407 ASN B CA  1 
ATOM   7252  C  C   . ASN B 1 407 ? 26.312  58.341  89.301  1.00 12.76 ? 407 ASN B C   1 
ATOM   7253  O  O   . ASN B 1 407 ? 26.699  59.020  88.357  1.00 12.60 ? 407 ASN B O   1 
ATOM   7254  C  CB  . ASN B 1 407 ? 25.961  55.917  88.875  1.00 12.57 ? 407 ASN B CB  1 
ATOM   7255  C  CG  . ASN B 1 407 ? 27.124  56.022  87.909  1.00 12.58 ? 407 ASN B CG  1 
ATOM   7256  O  OD1 . ASN B 1 407 ? 28.176  56.580  88.234  1.00 12.57 ? 407 ASN B OD1 1 
ATOM   7257  N  ND2 . ASN B 1 407 ? 26.941  55.482  86.711  1.00 12.70 ? 407 ASN B ND2 1 
ATOM   7258  N  N   . SER B 1 408 ? 26.778  58.491  90.531  1.00 12.92 ? 408 SER B N   1 
ATOM   7259  C  CA  . SER B 1 408 ? 27.775  59.505  90.838  1.00 13.48 ? 408 SER B CA  1 
ATOM   7260  C  C   . SER B 1 408 ? 29.174  58.905  90.931  1.00 13.38 ? 408 SER B C   1 
ATOM   7261  O  O   . SER B 1 408 ? 29.894  59.144  91.903  1.00 13.37 ? 408 SER B O   1 
ATOM   7262  C  CB  . SER B 1 408 ? 27.419  60.192  92.162  1.00 13.89 ? 408 SER B CB  1 
ATOM   7263  O  OG  . SER B 1 408 ? 26.140  59.782  92.630  1.00 14.53 ? 408 SER B OG  1 
ATOM   7264  N  N   . PHE B 1 409 ? 29.564  58.129  89.923  1.00 13.25 ? 409 PHE B N   1 
ATOM   7265  C  CA  . PHE B 1 409 ? 30.882  57.505  89.937  1.00 13.01 ? 409 PHE B CA  1 
ATOM   7266  C  C   . PHE B 1 409 ? 31.604  57.459  88.591  1.00 12.88 ? 409 PHE B C   1 
ATOM   7267  O  O   . PHE B 1 409 ? 32.332  56.512  88.301  1.00 12.79 ? 409 PHE B O   1 
ATOM   7268  C  CB  . PHE B 1 409 ? 30.781  56.093  90.520  1.00 13.11 ? 409 PHE B CB  1 
ATOM   7269  C  CG  . PHE B 1 409 ? 30.353  56.066  91.960  1.00 13.13 ? 409 PHE B CG  1 
ATOM   7270  C  CD1 . PHE B 1 409 ? 31.293  56.154  92.977  1.00 13.20 ? 409 PHE B CD1 1 
ATOM   7271  C  CD2 . PHE B 1 409 ? 29.007  55.971  92.297  1.00 13.18 ? 409 PHE B CD2 1 
ATOM   7272  C  CE1 . PHE B 1 409 ? 30.902  56.150  94.312  1.00 13.17 ? 409 PHE B CE1 1 
ATOM   7273  C  CE2 . PHE B 1 409 ? 28.602  55.965  93.628  1.00 13.11 ? 409 PHE B CE2 1 
ATOM   7274  C  CZ  . PHE B 1 409 ? 29.551  56.055  94.637  1.00 13.22 ? 409 PHE B CZ  1 
ATOM   7275  N  N   . GLY B 1 410 ? 31.398  58.484  87.773  1.00 12.96 ? 410 GLY B N   1 
ATOM   7276  C  CA  . GLY B 1 410 ? 32.075  58.564  86.487  1.00 13.19 ? 410 GLY B CA  1 
ATOM   7277  C  C   . GLY B 1 410 ? 31.792  57.537  85.400  1.00 13.25 ? 410 GLY B C   1 
ATOM   7278  O  O   . GLY B 1 410 ? 32.557  57.436  84.433  1.00 13.21 ? 410 GLY B O   1 
ATOM   7279  N  N   . ALA B 1 411 ? 30.712  56.773  85.533  1.00 13.39 ? 411 ALA B N   1 
ATOM   7280  C  CA  . ALA B 1 411 ? 30.386  55.784  84.516  1.00 13.42 ? 411 ALA B CA  1 
ATOM   7281  C  C   . ALA B 1 411 ? 29.916  56.530  83.271  1.00 13.42 ? 411 ALA B C   1 
ATOM   7282  O  O   . ALA B 1 411 ? 29.412  57.648  83.373  1.00 13.45 ? 411 ALA B O   1 
ATOM   7283  C  CB  . ALA B 1 411 ? 29.295  54.849  85.017  1.00 13.67 ? 411 ALA B CB  1 
ATOM   7284  N  N   . PRO B 1 412 ? 30.092  55.928  82.079  1.00 13.35 ? 412 PRO B N   1 
ATOM   7285  C  CA  . PRO B 1 412 ? 29.688  56.526  80.796  1.00 13.39 ? 412 PRO B CA  1 
ATOM   7286  C  C   . PRO B 1 412 ? 28.373  57.317  80.834  1.00 13.42 ? 412 PRO B C   1 
ATOM   7287  O  O   . PRO B 1 412 ? 27.409  56.911  81.477  1.00 13.38 ? 412 PRO B O   1 
ATOM   7288  C  CB  . PRO B 1 412 ? 29.600  55.327  79.841  1.00 13.28 ? 412 PRO B CB  1 
ATOM   7289  C  CG  . PRO B 1 412 ? 30.083  54.110  80.636  1.00 13.26 ? 412 PRO B CG  1 
ATOM   7290  C  CD  . PRO B 1 412 ? 30.724  54.611  81.890  1.00 13.28 ? 412 PRO B CD  1 
ATOM   7291  N  N   . GLU B 1 413 ? 28.342  58.446  80.133  1.00 13.55 ? 413 GLU B N   1 
ATOM   7292  C  CA  . GLU B 1 413 ? 27.153  59.293  80.089  1.00 13.46 ? 413 GLU B CA  1 
ATOM   7293  C  C   . GLU B 1 413 ? 26.640  59.470  78.664  1.00 13.51 ? 413 GLU B C   1 
ATOM   7294  O  O   . GLU B 1 413 ? 27.377  59.293  77.694  1.00 13.51 ? 413 GLU B O   1 
ATOM   7295  C  CB  . GLU B 1 413 ? 27.453  60.668  80.692  1.00 13.64 ? 413 GLU B CB  1 
ATOM   7296  C  CG  . GLU B 1 413 ? 28.531  60.655  81.772  1.00 13.59 ? 413 GLU B CG  1 
ATOM   7297  C  CD  . GLU B 1 413 ? 27.954  60.595  83.180  1.00 13.49 ? 413 GLU B CD  1 
ATOM   7298  O  OE1 . GLU B 1 413 ? 26.732  60.816  83.330  1.00 13.45 ? 413 GLU B OE1 1 
ATOM   7299  O  OE2 . GLU B 1 413 ? 28.722  60.324  84.133  1.00 13.11 ? 413 GLU B OE2 1 
ATOM   7300  N  N   . GLN B 1 414 ? 25.366  59.822  78.549  1.00 13.49 ? 414 GLN B N   1 
ATOM   7301  C  CA  . GLN B 1 414 ? 24.748  60.026  77.249  1.00 13.60 ? 414 GLN B CA  1 
ATOM   7302  C  C   . GLN B 1 414 ? 25.259  61.311  76.610  1.00 13.70 ? 414 GLN B C   1 
ATOM   7303  O  O   . GLN B 1 414 ? 25.679  62.235  77.300  1.00 13.85 ? 414 GLN B O   1 
ATOM   7304  C  CB  . GLN B 1 414 ? 23.229  60.107  77.403  1.00 13.32 ? 414 GLN B CB  1 
ATOM   7305  C  CG  . GLN B 1 414 ? 22.770  61.254  78.282  1.00 13.00 ? 414 GLN B CG  1 
ATOM   7306  C  CD  . GLN B 1 414 ? 21.405  61.018  78.898  1.00 12.84 ? 414 GLN B CD  1 
ATOM   7307  O  OE1 . GLN B 1 414 ? 21.012  59.881  79.156  1.00 12.55 ? 414 GLN B OE1 1 
ATOM   7308  N  NE2 . GLN B 1 414 ? 20.673  62.099  79.139  1.00 12.88 ? 414 GLN B NE2 1 
ATOM   7309  N  N   . GLN B 1 415 ? 25.221  61.365  75.285  1.00 13.84 ? 415 GLN B N   1 
ATOM   7310  C  CA  . GLN B 1 415 ? 25.666  62.552  74.567  1.00 13.86 ? 415 GLN B CA  1 
ATOM   7311  C  C   . GLN B 1 415 ? 24.467  63.222  73.902  1.00 13.74 ? 415 GLN B C   1 
ATOM   7312  O  O   . GLN B 1 415 ? 23.936  62.729  72.909  1.00 13.91 ? 415 GLN B O   1 
ATOM   7313  C  CB  . GLN B 1 415 ? 26.699  62.179  73.511  1.00 14.04 ? 415 GLN B CB  1 
ATOM   7314  C  CG  . GLN B 1 415 ? 27.619  63.322  73.142  1.00 14.50 ? 415 GLN B CG  1 
ATOM   7315  C  CD  . GLN B 1 415 ? 28.644  62.914  72.105  1.00 14.83 ? 415 GLN B CD  1 
ATOM   7316  O  OE1 . GLN B 1 415 ? 28.734  61.741  71.727  1.00 15.23 ? 415 GLN B OE1 1 
ATOM   7317  N  NE2 . GLN B 1 415 ? 29.426  63.879  71.638  1.00 15.11 ? 415 GLN B NE2 1 
ATOM   7318  N  N   . PRO B 1 416 ? 24.021  64.356  74.452  1.00 13.59 ? 416 PRO B N   1 
ATOM   7319  C  CA  . PRO B 1 416 ? 22.877  65.109  73.924  1.00 13.34 ? 416 PRO B CA  1 
ATOM   7320  C  C   . PRO B 1 416 ? 22.972  65.529  72.453  1.00 13.08 ? 416 PRO B C   1 
ATOM   7321  O  O   . PRO B 1 416 ? 22.048  66.149  71.925  1.00 13.10 ? 416 PRO B O   1 
ATOM   7322  C  CB  . PRO B 1 416 ? 22.778  66.319  74.856  1.00 13.47 ? 416 PRO B CB  1 
ATOM   7323  C  CG  . PRO B 1 416 ? 23.501  65.911  76.099  1.00 13.50 ? 416 PRO B CG  1 
ATOM   7324  C  CD  . PRO B 1 416 ? 24.593  64.988  75.653  1.00 13.57 ? 416 PRO B CD  1 
ATOM   7325  N  N   . SER B 1 417 ? 24.078  65.203  71.795  1.00 12.69 ? 417 SER B N   1 
ATOM   7326  C  CA  . SER B 1 417 ? 24.246  65.554  70.390  1.00 12.12 ? 417 SER B CA  1 
ATOM   7327  C  C   . SER B 1 417 ? 23.882  64.359  69.524  1.00 12.32 ? 417 SER B C   1 
ATOM   7328  O  O   . SER B 1 417 ? 23.792  64.464  68.299  1.00 12.26 ? 417 SER B O   1 
ATOM   7329  C  CB  . SER B 1 417 ? 25.691  65.968  70.109  1.00 11.90 ? 417 SER B CB  1 
ATOM   7330  O  OG  . SER B 1 417 ? 26.601  64.958  70.510  1.00 11.19 ? 417 SER B OG  1 
ATOM   7331  N  N   . ALA B 1 418 ? 23.673  63.216  70.171  1.00 12.49 ? 418 ALA B N   1 
ATOM   7332  C  CA  . ALA B 1 418 ? 23.313  61.998  69.458  1.00 12.60 ? 418 ALA B CA  1 
ATOM   7333  C  C   . ALA B 1 418 ? 21.797  61.830  69.407  1.00 12.65 ? 418 ALA B C   1 
ATOM   7334  O  O   . ALA B 1 418 ? 21.291  60.814  68.925  1.00 12.93 ? 418 ALA B O   1 
ATOM   7335  C  CB  . ALA B 1 418 ? 23.950  60.793  70.130  1.00 12.49 ? 418 ALA B CB  1 
ATOM   7336  N  N   . LEU B 1 419 ? 21.076  62.833  69.900  1.00 12.59 ? 419 LEU B N   1 
ATOM   7337  C  CA  . LEU B 1 419 ? 19.620  62.789  69.914  1.00 12.43 ? 419 LEU B CA  1 
ATOM   7338  C  C   . LEU B 1 419 ? 19.033  62.618  68.520  1.00 12.39 ? 419 LEU B C   1 
ATOM   7339  O  O   . LEU B 1 419 ? 19.475  63.247  67.557  1.00 12.16 ? 419 LEU B O   1 
ATOM   7340  C  CB  . LEU B 1 419 ? 19.052  64.056  70.557  1.00 12.38 ? 419 LEU B CB  1 
ATOM   7341  C  CG  . LEU B 1 419 ? 18.769  63.975  72.060  1.00 12.42 ? 419 LEU B CG  1 
ATOM   7342  C  CD1 . LEU B 1 419 ? 17.724  65.011  72.445  1.00 12.12 ? 419 LEU B CD1 1 
ATOM   7343  C  CD2 . LEU B 1 419 ? 18.294  62.567  72.423  1.00 12.73 ? 419 LEU B CD2 1 
ATOM   7344  N  N   . GLU B 1 420 ? 18.024  61.761  68.427  1.00 12.37 ? 420 GLU B N   1 
ATOM   7345  C  CA  . GLU B 1 420 ? 17.363  61.488  67.161  1.00 12.42 ? 420 GLU B CA  1 
ATOM   7346  C  C   . GLU B 1 420 ? 16.628  62.725  66.659  1.00 12.59 ? 420 GLU B C   1 
ATOM   7347  O  O   . GLU B 1 420 ? 16.466  63.701  67.394  1.00 12.69 ? 420 GLU B O   1 
ATOM   7348  C  CB  . GLU B 1 420 ? 16.378  60.331  67.330  1.00 12.44 ? 420 GLU B CB  1 
ATOM   7349  C  CG  . GLU B 1 420 ? 17.021  59.036  67.803  1.00 12.56 ? 420 GLU B CG  1 
ATOM   7350  C  CD  . GLU B 1 420 ? 17.062  58.905  69.318  1.00 12.64 ? 420 GLU B CD  1 
ATOM   7351  O  OE1 . GLU B 1 420 ? 17.876  58.104  69.818  1.00 12.62 ? 420 GLU B OE1 1 
ATOM   7352  O  OE2 . GLU B 1 420 ? 16.286  59.595  70.012  1.00 12.91 ? 420 GLU B OE2 1 
ATOM   7353  N  N   . HIS B 1 421 ? 16.198  62.680  65.400  1.00 12.62 ? 421 HIS B N   1 
ATOM   7354  C  CA  . HIS B 1 421 ? 15.468  63.787  64.792  1.00 12.67 ? 421 HIS B CA  1 
ATOM   7355  C  C   . HIS B 1 421 ? 14.012  63.639  65.189  1.00 12.82 ? 421 HIS B C   1 
ATOM   7356  O  O   . HIS B 1 421 ? 13.486  62.529  65.218  1.00 12.86 ? 421 HIS B O   1 
ATOM   7357  C  CB  . HIS B 1 421 ? 15.598  63.738  63.267  1.00 12.30 ? 421 HIS B CB  1 
ATOM   7358  C  CG  . HIS B 1 421 ? 14.772  64.765  62.554  1.00 11.84 ? 421 HIS B CG  1 
ATOM   7359  N  ND1 . HIS B 1 421 ? 15.231  66.037  62.286  1.00 11.66 ? 421 HIS B ND1 1 
ATOM   7360  C  CD2 . HIS B 1 421 ? 13.513  64.708  62.057  1.00 11.68 ? 421 HIS B CD2 1 
ATOM   7361  C  CE1 . HIS B 1 421 ? 14.292  66.719  61.657  1.00 11.61 ? 421 HIS B CE1 1 
ATOM   7362  N  NE2 . HIS B 1 421 ? 13.238  65.935  61.506  1.00 11.57 ? 421 HIS B NE2 1 
ATOM   7363  N  N   . SER B 1 422 ? 13.352  64.746  65.495  1.00 13.34 ? 422 SER B N   1 
ATOM   7364  C  CA  . SER B 1 422 ? 11.958  64.661  65.904  1.00 14.00 ? 422 SER B CA  1 
ATOM   7365  C  C   . SER B 1 422 ? 10.989  65.110  64.827  1.00 14.22 ? 422 SER B C   1 
ATOM   7366  O  O   . SER B 1 422 ? 11.160  66.171  64.221  1.00 14.34 ? 422 SER B O   1 
ATOM   7367  C  CB  . SER B 1 422 ? 11.722  65.478  67.181  1.00 14.17 ? 422 SER B CB  1 
ATOM   7368  O  OG  . SER B 1 422 ? 10.899  64.764  68.093  1.00 14.64 ? 422 SER B OG  1 
ATOM   7369  N  N   . ILE B 1 423 ? 9.964   64.292  64.603  1.00 14.24 ? 423 ILE B N   1 
ATOM   7370  C  CA  . ILE B 1 423 ? 8.937   64.582  63.608  1.00 14.17 ? 423 ILE B CA  1 
ATOM   7371  C  C   . ILE B 1 423 ? 7.556   64.646  64.267  1.00 14.35 ? 423 ILE B C   1 
ATOM   7372  O  O   . ILE B 1 423 ? 7.318   64.023  65.304  1.00 14.73 ? 423 ILE B O   1 
ATOM   7373  C  CB  . ILE B 1 423 ? 8.928   63.509  62.494  1.00 13.69 ? 423 ILE B CB  1 
ATOM   7374  C  CG1 . ILE B 1 423 ? 10.314  63.441  61.838  1.00 13.16 ? 423 ILE B CG1 1 
ATOM   7375  C  CG2 . ILE B 1 423 ? 7.838   63.823  61.473  1.00 13.48 ? 423 ILE B CG2 1 
ATOM   7376  C  CD1 . ILE B 1 423 ? 10.357  62.665  60.540  1.00 12.73 ? 423 ILE B CD1 1 
ATOM   7377  N  N   . GLN B 1 424 ? 6.657   65.414  63.661  1.00 14.21 ? 424 GLN B N   1 
ATOM   7378  C  CA  . GLN B 1 424 ? 5.301   65.583  64.171  1.00 13.73 ? 424 GLN B CA  1 
ATOM   7379  C  C   . GLN B 1 424 ? 4.339   64.691  63.402  1.00 13.18 ? 424 GLN B C   1 
ATOM   7380  O  O   . GLN B 1 424 ? 4.226   64.803  62.184  1.00 13.01 ? 424 GLN B O   1 
ATOM   7381  C  CB  . GLN B 1 424 ? 4.856   67.047  64.009  1.00 14.37 ? 424 GLN B CB  1 
ATOM   7382  C  CG  . GLN B 1 424 ? 4.153   67.658  65.220  1.00 14.93 ? 424 GLN B CG  1 
ATOM   7383  C  CD  . GLN B 1 424 ? 2.643   67.441  65.206  1.00 15.27 ? 424 GLN B CD  1 
ATOM   7384  O  OE1 . GLN B 1 424 ? 2.097   66.836  64.276  1.00 15.59 ? 424 GLN B OE1 1 
ATOM   7385  N  NE2 . GLN B 1 424 ? 1.962   67.935  66.242  1.00 15.24 ? 424 GLN B NE2 1 
ATOM   7386  N  N   . TYR B 1 425 ? 3.652   63.802  64.114  1.00 12.99 ? 425 TYR B N   1 
ATOM   7387  C  CA  . TYR B 1 425 ? 2.674   62.913  63.489  1.00 12.60 ? 425 TYR B CA  1 
ATOM   7388  C  C   . TYR B 1 425 ? 1.320   63.148  64.147  1.00 12.32 ? 425 TYR B C   1 
ATOM   7389  O  O   . TYR B 1 425 ? 1.232   63.807  65.181  1.00 12.03 ? 425 TYR B O   1 
ATOM   7390  C  CB  . TYR B 1 425 ? 3.070   61.447  63.658  1.00 12.58 ? 425 TYR B CB  1 
ATOM   7391  C  CG  . TYR B 1 425 ? 4.386   61.067  63.018  1.00 12.93 ? 425 TYR B CG  1 
ATOM   7392  C  CD1 . TYR B 1 425 ? 5.595   61.483  63.575  1.00 13.13 ? 425 TYR B CD1 1 
ATOM   7393  C  CD2 . TYR B 1 425 ? 4.427   60.236  61.896  1.00 13.06 ? 425 TYR B CD2 1 
ATOM   7394  C  CE1 . TYR B 1 425 ? 6.813   61.080  63.042  1.00 13.32 ? 425 TYR B CE1 1 
ATOM   7395  C  CE2 . TYR B 1 425 ? 5.640   59.823  61.351  1.00 13.26 ? 425 TYR B CE2 1 
ATOM   7396  C  CZ  . TYR B 1 425 ? 6.836   60.247  61.934  1.00 13.35 ? 425 TYR B CZ  1 
ATOM   7397  O  OH  . TYR B 1 425 ? 8.057   59.833  61.430  1.00 13.31 ? 425 TYR B OH  1 
ATOM   7398  N  N   . SER B 1 426 ? 0.271   62.609  63.539  1.00 12.57 ? 426 SER B N   1 
ATOM   7399  C  CA  . SER B 1 426 ? -1.083  62.761  64.059  1.00 12.86 ? 426 SER B CA  1 
ATOM   7400  C  C   . SER B 1 426 ? -2.035  61.778  63.396  1.00 12.88 ? 426 SER B C   1 
ATOM   7401  O  O   . SER B 1 426 ? -1.886  61.453  62.221  1.00 13.07 ? 426 SER B O   1 
ATOM   7402  C  CB  . SER B 1 426 ? -1.587  64.183  63.817  1.00 13.21 ? 426 SER B CB  1 
ATOM   7403  O  OG  . SER B 1 426 ? -2.881  64.363  64.370  1.00 13.88 ? 426 SER B OG  1 
ATOM   7404  N  N   . GLY B 1 427 ? -3.018  61.309  64.152  1.00 12.65 ? 427 GLY B N   1 
ATOM   7405  C  CA  . GLY B 1 427 ? -3.974  60.367  63.605  1.00 12.53 ? 427 GLY B CA  1 
ATOM   7406  C  C   . GLY B 1 427 ? -4.279  59.230  64.557  1.00 12.38 ? 427 GLY B C   1 
ATOM   7407  O  O   . GLY B 1 427 ? -3.677  59.123  65.627  1.00 12.24 ? 427 GLY B O   1 
ATOM   7408  N  N   . GLU B 1 428 ? -5.218  58.374  64.173  1.00 12.14 ? 428 GLU B N   1 
ATOM   7409  C  CA  . GLU B 1 428 ? -5.584  57.244  65.011  1.00 12.25 ? 428 GLU B CA  1 
ATOM   7410  C  C   . GLU B 1 428 ? -4.491  56.190  64.995  1.00 12.14 ? 428 GLU B C   1 
ATOM   7411  O  O   . GLU B 1 428 ? -3.653  56.160  64.095  1.00 12.07 ? 428 GLU B O   1 
ATOM   7412  C  CB  . GLU B 1 428 ? -6.886  56.614  64.526  1.00 12.34 ? 428 GLU B CB  1 
ATOM   7413  C  CG  . GLU B 1 428 ? -8.097  57.492  64.699  1.00 12.84 ? 428 GLU B CG  1 
ATOM   7414  C  CD  . GLU B 1 428 ? -9.330  56.873  64.090  1.00 13.22 ? 428 GLU B CD  1 
ATOM   7415  O  OE1 . GLU B 1 428 ? -9.600  55.692  64.394  1.00 13.55 ? 428 GLU B OE1 1 
ATOM   7416  O  OE2 . GLU B 1 428 ? -10.026 57.558  63.308  1.00 13.68 ? 428 GLU B OE2 1 
ATOM   7417  N  N   . VAL B 1 429 ? -4.506  55.328  66.004  1.00 12.26 ? 429 VAL B N   1 
ATOM   7418  C  CA  . VAL B 1 429 ? -3.535  54.250  66.111  1.00 12.48 ? 429 VAL B CA  1 
ATOM   7419  C  C   . VAL B 1 429 ? -4.251  52.957  65.755  1.00 12.47 ? 429 VAL B C   1 
ATOM   7420  O  O   . VAL B 1 429 ? -4.845  52.312  66.619  1.00 12.31 ? 429 VAL B O   1 
ATOM   7421  C  CB  . VAL B 1 429 ? -2.980  54.143  67.541  1.00 12.61 ? 429 VAL B CB  1 
ATOM   7422  C  CG1 . VAL B 1 429 ? -1.881  53.097  67.600  1.00 12.66 ? 429 VAL B CG1 1 
ATOM   7423  C  CG2 . VAL B 1 429 ? -2.452  55.488  67.984  1.00 13.06 ? 429 VAL B CG2 1 
ATOM   7424  N  N   . ARG B 1 430 ? -4.194  52.586  64.480  1.00 12.20 ? 430 ARG B N   1 
ATOM   7425  C  CA  . ARG B 1 430 ? -4.866  51.381  64.016  1.00 12.17 ? 430 ARG B CA  1 
ATOM   7426  C  C   . ARG B 1 430 ? -4.137  50.718  62.860  1.00 12.15 ? 430 ARG B C   1 
ATOM   7427  O  O   . ARG B 1 430 ? -3.083  51.173  62.423  1.00 12.31 ? 430 ARG B O   1 
ATOM   7428  C  CB  . ARG B 1 430 ? -6.286  51.726  63.572  1.00 12.32 ? 430 ARG B CB  1 
ATOM   7429  C  CG  . ARG B 1 430 ? -6.339  52.922  62.631  1.00 12.36 ? 430 ARG B CG  1 
ATOM   7430  C  CD  . ARG B 1 430 ? -7.742  53.473  62.483  1.00 12.55 ? 430 ARG B CD  1 
ATOM   7431  N  NE  . ARG B 1 430 ? -8.733  52.405  62.425  1.00 12.95 ? 430 ARG B NE  1 
ATOM   7432  C  CZ  . ARG B 1 430 ? -10.046 52.601  62.414  1.00 13.15 ? 430 ARG B CZ  1 
ATOM   7433  N  NH1 . ARG B 1 430 ? -10.538 53.834  62.457  1.00 13.41 ? 430 ARG B NH1 1 
ATOM   7434  N  NH2 . ARG B 1 430 ? -10.864 51.558  62.358  1.00 13.21 ? 430 ARG B NH2 1 
ATOM   7435  N  N   . ARG B 1 431 ? -4.723  49.637  62.364  1.00 12.19 ? 431 ARG B N   1 
ATOM   7436  C  CA  . ARG B 1 431 ? -4.148  48.894  61.253  1.00 11.92 ? 431 ARG B CA  1 
ATOM   7437  C  C   . ARG B 1 431 ? -4.697  49.421  59.930  1.00 11.87 ? 431 ARG B C   1 
ATOM   7438  O  O   . ARG B 1 431 ? -5.730  48.959  59.443  1.00 12.02 ? 431 ARG B O   1 
ATOM   7439  C  CB  . ARG B 1 431 ? -4.457  47.400  61.405  1.00 11.38 ? 431 ARG B CB  1 
ATOM   7440  C  CG  . ARG B 1 431 ? -3.924  46.793  62.697  1.00 10.71 ? 431 ARG B CG  1 
ATOM   7441  C  CD  . ARG B 1 431 ? -4.314  45.331  62.825  1.00 10.25 ? 431 ARG B CD  1 
ATOM   7442  N  NE  . ARG B 1 431 ? -3.881  44.730  64.087  1.00 10.04 ? 431 ARG B NE  1 
ATOM   7443  C  CZ  . ARG B 1 431 ? -2.613  44.609  64.473  1.00 9.99  ? 431 ARG B CZ  1 
ATOM   7444  N  NH1 . ARG B 1 431 ? -1.636  45.050  63.696  1.00 10.00 ? 431 ARG B NH1 1 
ATOM   7445  N  NH2 . ARG B 1 431 ? -2.318  44.028  65.630  1.00 10.06 ? 431 ARG B NH2 1 
ATOM   7446  N  N   . PHE B 1 432 ? -3.991  50.393  59.360  1.00 11.99 ? 432 PHE B N   1 
ATOM   7447  C  CA  . PHE B 1 432 ? -4.386  51.003  58.098  1.00 11.94 ? 432 PHE B CA  1 
ATOM   7448  C  C   . PHE B 1 432 ? -4.102  50.103  56.906  1.00 11.84 ? 432 PHE B C   1 
ATOM   7449  O  O   . PHE B 1 432 ? -2.947  49.835  56.576  1.00 11.65 ? 432 PHE B O   1 
ATOM   7450  C  CB  . PHE B 1 432 ? -3.665  52.338  57.921  1.00 12.19 ? 432 PHE B CB  1 
ATOM   7451  C  CG  . PHE B 1 432 ? -4.029  53.355  58.960  1.00 12.50 ? 432 PHE B CG  1 
ATOM   7452  C  CD1 . PHE B 1 432 ? -5.228  54.055  58.874  1.00 12.74 ? 432 PHE B CD1 1 
ATOM   7453  C  CD2 . PHE B 1 432 ? -3.185  53.597  60.038  1.00 12.57 ? 432 PHE B CD2 1 
ATOM   7454  C  CE1 . PHE B 1 432 ? -5.583  54.981  59.847  1.00 12.83 ? 432 PHE B CE1 1 
ATOM   7455  C  CE2 . PHE B 1 432 ? -3.528  54.520  61.018  1.00 12.59 ? 432 PHE B CE2 1 
ATOM   7456  C  CZ  . PHE B 1 432 ? -4.731  55.214  60.923  1.00 12.83 ? 432 PHE B CZ  1 
ATOM   7457  N  N   . ASN B 1 433 ? -5.172  49.649  56.262  1.00 11.67 ? 433 ASN B N   1 
ATOM   7458  C  CA  . ASN B 1 433 ? -5.073  48.777  55.102  1.00 11.79 ? 433 ASN B CA  1 
ATOM   7459  C  C   . ASN B 1 433 ? -4.370  49.443  53.925  1.00 11.73 ? 433 ASN B C   1 
ATOM   7460  O  O   . ASN B 1 433 ? -4.810  50.481  53.427  1.00 11.62 ? 433 ASN B O   1 
ATOM   7461  C  CB  . ASN B 1 433 ? -6.468  48.327  54.671  1.00 12.21 ? 433 ASN B CB  1 
ATOM   7462  C  CG  . ASN B 1 433 ? -6.427  47.264  53.601  1.00 12.56 ? 433 ASN B CG  1 
ATOM   7463  O  OD1 . ASN B 1 433 ? -7.367  47.122  52.828  1.00 13.15 ? 433 ASN B OD1 1 
ATOM   7464  N  ND2 . ASN B 1 433 ? -5.331  46.511  53.547  1.00 12.74 ? 433 ASN B ND2 1 
ATOM   7465  N  N   . THR B 1 434 ? -3.282  48.829  53.478  1.00 11.58 ? 434 THR B N   1 
ATOM   7466  C  CA  . THR B 1 434 ? -2.510  49.361  52.365  1.00 11.57 ? 434 THR B CA  1 
ATOM   7467  C  C   . THR B 1 434 ? -2.497  48.371  51.208  1.00 11.38 ? 434 THR B C   1 
ATOM   7468  O  O   . THR B 1 434 ? -1.573  48.359  50.395  1.00 11.16 ? 434 THR B O   1 
ATOM   7469  C  CB  . THR B 1 434 ? -1.057  49.643  52.797  1.00 11.75 ? 434 THR B CB  1 
ATOM   7470  O  OG1 . THR B 1 434 ? -0.543  48.505  53.495  1.00 12.00 ? 434 THR B OG1 1 
ATOM   7471  C  CG2 . THR B 1 434 ? -0.997  50.856  53.719  1.00 11.92 ? 434 THR B CG2 1 
ATOM   7472  N  N   . ALA B 1 435 ? -3.543  47.554  51.133  1.00 11.56 ? 435 ALA B N   1 
ATOM   7473  C  CA  . ALA B 1 435 ? -3.651  46.535  50.093  1.00 11.71 ? 435 ALA B CA  1 
ATOM   7474  C  C   . ALA B 1 435 ? -3.892  47.098  48.698  1.00 11.68 ? 435 ALA B C   1 
ATOM   7475  O  O   . ALA B 1 435 ? -3.465  46.507  47.703  1.00 11.59 ? 435 ALA B O   1 
ATOM   7476  C  CB  . ALA B 1 435 ? -4.758  45.537  50.454  1.00 11.91 ? 435 ALA B CB  1 
ATOM   7477  N  N   . ASN B 1 436 ? -4.565  48.242  48.620  1.00 11.56 ? 436 ASN B N   1 
ATOM   7478  C  CA  . ASN B 1 436 ? -4.856  48.845  47.325  1.00 11.79 ? 436 ASN B CA  1 
ATOM   7479  C  C   . ASN B 1 436 ? -4.161  50.181  47.082  1.00 11.98 ? 436 ASN B C   1 
ATOM   7480  O  O   . ASN B 1 436 ? -4.784  51.141  46.633  1.00 11.82 ? 436 ASN B O   1 
ATOM   7481  C  CB  . ASN B 1 436 ? -6.366  49.006  47.170  1.00 11.74 ? 436 ASN B CB  1 
ATOM   7482  C  CG  . ASN B 1 436 ? -7.131  47.798  47.679  1.00 11.76 ? 436 ASN B CG  1 
ATOM   7483  O  OD1 . ASN B 1 436 ? -7.172  46.751  47.028  1.00 11.55 ? 436 ASN B OD1 1 
ATOM   7484  N  ND2 . ASN B 1 436 ? -7.741  47.939  48.850  1.00 12.01 ? 436 ASN B ND2 1 
ATOM   7485  N  N   . ASP B 1 437 ? -2.864  50.233  47.368  1.00 12.22 ? 437 ASP B N   1 
ATOM   7486  C  CA  . ASP B 1 437 ? -2.090  51.451  47.171  1.00 12.40 ? 437 ASP B CA  1 
ATOM   7487  C  C   . ASP B 1 437 ? -1.573  51.550  45.731  1.00 12.62 ? 437 ASP B C   1 
ATOM   7488  O  O   . ASP B 1 437 ? -0.449  52.008  45.498  1.00 12.89 ? 437 ASP B O   1 
ATOM   7489  C  CB  . ASP B 1 437 ? -0.910  51.489  48.147  1.00 12.65 ? 437 ASP B CB  1 
ATOM   7490  C  CG  . ASP B 1 437 ? -1.299  52.020  49.519  1.00 12.83 ? 437 ASP B CG  1 
ATOM   7491  O  OD1 . ASP B 1 437 ? -2.393  51.665  50.014  1.00 13.16 ? 437 ASP B OD1 1 
ATOM   7492  O  OD2 . ASP B 1 437 ? -0.509  52.793  50.108  1.00 12.69 ? 437 ASP B OD2 1 
ATOM   7493  N  N   . ASP B 1 438 ? -2.391  51.122  44.769  1.00 12.52 ? 438 ASP B N   1 
ATOM   7494  C  CA  . ASP B 1 438 ? -2.009  51.170  43.355  1.00 12.20 ? 438 ASP B CA  1 
ATOM   7495  C  C   . ASP B 1 438 ? -0.870  50.188  43.094  1.00 12.02 ? 438 ASP B C   1 
ATOM   7496  O  O   . ASP B 1 438 ? 0.290   50.481  43.381  1.00 11.96 ? 438 ASP B O   1 
ATOM   7497  C  CB  . ASP B 1 438 ? -1.584  52.599  42.980  1.00 12.03 ? 438 ASP B CB  1 
ATOM   7498  C  CG  . ASP B 1 438 ? -1.022  52.703  41.569  1.00 11.95 ? 438 ASP B CG  1 
ATOM   7499  O  OD1 . ASP B 1 438 ? -0.462  53.769  41.244  1.00 11.78 ? 438 ASP B OD1 1 
ATOM   7500  O  OD2 . ASP B 1 438 ? -1.134  51.734  40.787  1.00 12.03 ? 438 ASP B OD2 1 
ATOM   7501  N  N   . ASN B 1 439 ? -1.206  49.023  42.550  1.00 11.83 ? 439 ASN B N   1 
ATOM   7502  C  CA  . ASN B 1 439 ? -0.207  47.996  42.272  1.00 12.08 ? 439 ASN B CA  1 
ATOM   7503  C  C   . ASN B 1 439 ? -0.060  47.710  40.782  1.00 12.22 ? 439 ASN B C   1 
ATOM   7504  O  O   . ASN B 1 439 ? 0.237   46.577  40.393  1.00 12.17 ? 439 ASN B O   1 
ATOM   7505  C  CB  . ASN B 1 439 ? -0.573  46.690  42.990  1.00 11.82 ? 439 ASN B CB  1 
ATOM   7506  C  CG  . ASN B 1 439 ? -1.458  46.912  44.208  1.00 11.73 ? 439 ASN B CG  1 
ATOM   7507  O  OD1 . ASN B 1 439 ? -2.563  46.368  44.299  1.00 11.26 ? 439 ASN B OD1 1 
ATOM   7508  N  ND2 . ASN B 1 439 ? -0.973  47.711  45.154  1.00 11.98 ? 439 ASN B ND2 1 
ATOM   7509  N  N   . VAL B 1 440 ? -0.251  48.725  39.947  1.00 12.08 ? 440 VAL B N   1 
ATOM   7510  C  CA  . VAL B 1 440 ? -0.160  48.511  38.508  1.00 12.18 ? 440 VAL B CA  1 
ATOM   7511  C  C   . VAL B 1 440 ? 0.589   49.597  37.745  1.00 12.06 ? 440 VAL B C   1 
ATOM   7512  O  O   . VAL B 1 440 ? 1.481   49.306  36.946  1.00 12.12 ? 440 VAL B O   1 
ATOM   7513  C  CB  . VAL B 1 440 ? -1.574  48.357  37.890  1.00 12.21 ? 440 VAL B CB  1 
ATOM   7514  C  CG1 . VAL B 1 440 ? -2.115  46.960  38.175  1.00 12.51 ? 440 VAL B CG1 1 
ATOM   7515  C  CG2 . VAL B 1 440 ? -2.515  49.411  38.458  1.00 11.91 ? 440 VAL B CG2 1 
ATOM   7516  N  N   . THR B 1 441 ? 0.217   50.845  37.998  1.00 11.85 ? 441 THR B N   1 
ATOM   7517  C  CA  . THR B 1 441 ? 0.825   51.984  37.333  1.00 11.53 ? 441 THR B CA  1 
ATOM   7518  C  C   . THR B 1 441 ? 2.325   51.833  37.095  1.00 11.32 ? 441 THR B C   1 
ATOM   7519  O  O   . THR B 1 441 ? 2.766   51.689  35.956  1.00 11.26 ? 441 THR B O   1 
ATOM   7520  C  CB  . THR B 1 441 ? 0.564   53.266  38.130  1.00 11.59 ? 441 THR B CB  1 
ATOM   7521  O  OG1 . THR B 1 441 ? -0.848  53.480  38.217  1.00 11.71 ? 441 THR B OG1 1 
ATOM   7522  C  CG2 . THR B 1 441 ? 1.209   54.464  37.452  1.00 11.54 ? 441 THR B CG2 1 
ATOM   7523  N  N   . GLN B 1 442 ? 3.104   51.856  38.171  1.00 11.38 ? 442 GLN B N   1 
ATOM   7524  C  CA  . GLN B 1 442 ? 4.556   51.745  38.069  1.00 11.36 ? 442 GLN B CA  1 
ATOM   7525  C  C   . GLN B 1 442 ? 4.980   50.472  37.350  1.00 11.60 ? 442 GLN B C   1 
ATOM   7526  O  O   . GLN B 1 442 ? 6.038   50.420  36.717  1.00 11.24 ? 442 GLN B O   1 
ATOM   7527  C  CB  . GLN B 1 442 ? 5.187   51.798  39.464  1.00 11.19 ? 442 GLN B CB  1 
ATOM   7528  C  CG  . GLN B 1 442 ? 5.225   53.199  40.059  1.00 11.13 ? 442 GLN B CG  1 
ATOM   7529  C  CD  . GLN B 1 442 ? 6.570   53.558  40.667  1.00 11.06 ? 442 GLN B CD  1 
ATOM   7530  O  OE1 . GLN B 1 442 ? 6.805   54.706  41.046  1.00 11.06 ? 442 GLN B OE1 1 
ATOM   7531  N  NE2 . GLN B 1 442 ? 7.456   52.578  40.767  1.00 10.89 ? 442 GLN B NE2 1 
ATOM   7532  N  N   . VAL B 1 443 ? 4.147   49.443  37.447  1.00 11.99 ? 443 VAL B N   1 
ATOM   7533  C  CA  . VAL B 1 443 ? 4.453   48.181  36.793  1.00 12.57 ? 443 VAL B CA  1 
ATOM   7534  C  C   . VAL B 1 443 ? 4.245   48.312  35.289  1.00 12.68 ? 443 VAL B C   1 
ATOM   7535  O  O   . VAL B 1 443 ? 5.057   47.834  34.499  1.00 12.85 ? 443 VAL B O   1 
ATOM   7536  C  CB  . VAL B 1 443 ? 3.564   47.029  37.317  1.00 12.75 ? 443 VAL B CB  1 
ATOM   7537  C  CG1 . VAL B 1 443 ? 3.950   45.724  36.622  1.00 12.71 ? 443 VAL B CG1 1 
ATOM   7538  C  CG2 . VAL B 1 443 ? 3.714   46.895  38.834  1.00 13.15 ? 443 VAL B CG2 1 
ATOM   7539  N  N   . ARG B 1 444 ? 3.158   48.965  34.898  1.00 12.69 ? 444 ARG B N   1 
ATOM   7540  C  CA  . ARG B 1 444 ? 2.856   49.146  33.486  1.00 12.84 ? 444 ARG B CA  1 
ATOM   7541  C  C   . ARG B 1 444 ? 3.975   49.933  32.802  1.00 12.95 ? 444 ARG B C   1 
ATOM   7542  O  O   . ARG B 1 444 ? 4.387   49.606  31.684  1.00 12.95 ? 444 ARG B O   1 
ATOM   7543  C  CB  . ARG B 1 444 ? 1.520   49.881  33.321  1.00 12.78 ? 444 ARG B CB  1 
ATOM   7544  C  CG  . ARG B 1 444 ? 1.268   50.413  31.918  1.00 12.71 ? 444 ARG B CG  1 
ATOM   7545  C  CD  . ARG B 1 444 ? -0.215  50.528  31.645  1.00 12.93 ? 444 ARG B CD  1 
ATOM   7546  N  NE  . ARG B 1 444 ? -0.896  51.246  32.718  1.00 13.55 ? 444 ARG B NE  1 
ATOM   7547  C  CZ  . ARG B 1 444 ? -2.027  50.846  33.292  1.00 13.91 ? 444 ARG B CZ  1 
ATOM   7548  N  NH1 . ARG B 1 444 ? -2.614  49.723  32.896  1.00 14.19 ? 444 ARG B NH1 1 
ATOM   7549  N  NH2 . ARG B 1 444 ? -2.576  51.573  34.258  1.00 14.17 ? 444 ARG B NH2 1 
ATOM   7550  N  N   . ALA B 1 445 ? 4.461   50.969  33.483  1.00 12.50 ? 445 ALA B N   1 
ATOM   7551  C  CA  . ALA B 1 445 ? 5.527   51.806  32.945  1.00 12.20 ? 445 ALA B CA  1 
ATOM   7552  C  C   . ALA B 1 445 ? 6.807   50.989  32.745  1.00 12.16 ? 445 ALA B C   1 
ATOM   7553  O  O   . ALA B 1 445 ? 7.638   51.293  31.885  1.00 12.03 ? 445 ALA B O   1 
ATOM   7554  C  CB  . ALA B 1 445 ? 5.791   52.979  33.889  1.00 11.82 ? 445 ALA B CB  1 
ATOM   7555  N  N   . PHE B 1 446 ? 6.950   49.945  33.551  1.00 12.45 ? 446 PHE B N   1 
ATOM   7556  C  CA  . PHE B 1 446 ? 8.113   49.075  33.501  1.00 12.58 ? 446 PHE B CA  1 
ATOM   7557  C  C   . PHE B 1 446 ? 7.997   48.099  32.334  1.00 12.90 ? 446 PHE B C   1 
ATOM   7558  O  O   . PHE B 1 446 ? 8.914   47.971  31.515  1.00 12.78 ? 446 PHE B O   1 
ATOM   7559  C  CB  . PHE B 1 446 ? 8.224   48.314  34.824  1.00 12.73 ? 446 PHE B CB  1 
ATOM   7560  C  CG  . PHE B 1 446 ? 9.196   47.171  34.794  1.00 12.86 ? 446 PHE B CG  1 
ATOM   7561  C  CD1 . PHE B 1 446 ? 10.567  47.404  34.874  1.00 12.88 ? 446 PHE B CD1 1 
ATOM   7562  C  CD2 . PHE B 1 446 ? 8.740   45.857  34.709  1.00 12.78 ? 446 PHE B CD2 1 
ATOM   7563  C  CE1 . PHE B 1 446 ? 11.470  46.347  34.873  1.00 12.71 ? 446 PHE B CE1 1 
ATOM   7564  C  CE2 . PHE B 1 446 ? 9.635   44.792  34.706  1.00 12.59 ? 446 PHE B CE2 1 
ATOM   7565  C  CZ  . PHE B 1 446 ? 11.004  45.038  34.789  1.00 12.65 ? 446 PHE B CZ  1 
ATOM   7566  N  N   . TYR B 1 447 ? 6.859   47.414  32.264  1.00 13.03 ? 447 TYR B N   1 
ATOM   7567  C  CA  . TYR B 1 447 ? 6.603   46.445  31.205  1.00 13.19 ? 447 TYR B CA  1 
ATOM   7568  C  C   . TYR B 1 447 ? 6.753   47.091  29.840  1.00 13.08 ? 447 TYR B C   1 
ATOM   7569  O  O   . TYR B 1 447 ? 7.185   46.452  28.882  1.00 13.24 ? 447 TYR B O   1 
ATOM   7570  C  CB  . TYR B 1 447 ? 5.190   45.874  31.340  1.00 13.48 ? 447 TYR B CB  1 
ATOM   7571  C  CG  . TYR B 1 447 ? 4.817   44.892  30.251  1.00 13.81 ? 447 TYR B CG  1 
ATOM   7572  C  CD1 . TYR B 1 447 ? 3.936   45.255  29.230  1.00 13.88 ? 447 TYR B CD1 1 
ATOM   7573  C  CD2 . TYR B 1 447 ? 5.348   43.603  30.239  1.00 14.01 ? 447 TYR B CD2 1 
ATOM   7574  C  CE1 . TYR B 1 447 ? 3.595   44.359  28.220  1.00 14.25 ? 447 TYR B CE1 1 
ATOM   7575  C  CE2 . TYR B 1 447 ? 5.015   42.700  29.234  1.00 14.41 ? 447 TYR B CE2 1 
ATOM   7576  C  CZ  . TYR B 1 447 ? 4.138   43.084  28.226  1.00 14.48 ? 447 TYR B CZ  1 
ATOM   7577  O  OH  . TYR B 1 447 ? 3.822   42.201  27.212  1.00 15.06 ? 447 TYR B OH  1 
ATOM   7578  N  N   . VAL B 1 448 ? 6.388   48.366  29.763  1.00 13.15 ? 448 VAL B N   1 
ATOM   7579  C  CA  . VAL B 1 448 ? 6.473   49.112  28.520  1.00 13.02 ? 448 VAL B CA  1 
ATOM   7580  C  C   . VAL B 1 448 ? 7.853   49.743  28.321  1.00 13.03 ? 448 VAL B C   1 
ATOM   7581  O  O   . VAL B 1 448 ? 8.796   49.069  27.905  1.00 12.94 ? 448 VAL B O   1 
ATOM   7582  C  CB  . VAL B 1 448 ? 5.391   50.210  28.471  1.00 12.97 ? 448 VAL B CB  1 
ATOM   7583  C  CG1 . VAL B 1 448 ? 5.366   50.864  27.093  1.00 12.93 ? 448 VAL B CG1 1 
ATOM   7584  C  CG2 . VAL B 1 448 ? 4.031   49.604  28.802  1.00 12.88 ? 448 VAL B CG2 1 
ATOM   7585  N  N   . ASN B 1 449 ? 7.967   51.029  28.638  1.00 12.95 ? 449 ASN B N   1 
ATOM   7586  C  CA  . ASN B 1 449 ? 9.213   51.773  28.474  1.00 13.09 ? 449 ASN B CA  1 
ATOM   7587  C  C   . ASN B 1 449 ? 10.511  51.094  28.935  1.00 13.39 ? 449 ASN B C   1 
ATOM   7588  O  O   . ASN B 1 449 ? 11.490  51.039  28.182  1.00 13.18 ? 449 ASN B O   1 
ATOM   7589  C  CB  . ASN B 1 449 ? 9.080   53.129  29.161  1.00 12.94 ? 449 ASN B CB  1 
ATOM   7590  C  CG  . ASN B 1 449 ? 7.747   53.788  28.878  1.00 12.92 ? 449 ASN B CG  1 
ATOM   7591  O  OD1 . ASN B 1 449 ? 6.794   53.642  29.646  1.00 12.50 ? 449 ASN B OD1 1 
ATOM   7592  N  ND2 . ASN B 1 449 ? 7.671   54.516  27.768  1.00 13.32 ? 449 ASN B ND2 1 
ATOM   7593  N  N   . VAL B 1 450 ? 10.531  50.584  30.163  1.00 13.37 ? 450 VAL B N   1 
ATOM   7594  C  CA  . VAL B 1 450 ? 11.740  49.948  30.682  1.00 13.66 ? 450 VAL B CA  1 
ATOM   7595  C  C   . VAL B 1 450 ? 12.240  48.774  29.834  1.00 13.68 ? 450 VAL B C   1 
ATOM   7596  O  O   . VAL B 1 450 ? 13.421  48.702  29.496  1.00 13.73 ? 450 VAL B O   1 
ATOM   7597  C  CB  . VAL B 1 450 ? 11.538  49.460  32.127  1.00 13.79 ? 450 VAL B CB  1 
ATOM   7598  C  CG1 . VAL B 1 450 ? 12.780  48.714  32.603  1.00 13.89 ? 450 VAL B CG1 1 
ATOM   7599  C  CG2 . VAL B 1 450 ? 11.245  50.642  33.035  1.00 13.74 ? 450 VAL B CG2 1 
ATOM   7600  N  N   . LEU B 1 451 ? 11.349  47.851  29.496  1.00 13.89 ? 451 LEU B N   1 
ATOM   7601  C  CA  . LEU B 1 451 ? 11.741  46.701  28.688  1.00 14.09 ? 451 LEU B CA  1 
ATOM   7602  C  C   . LEU B 1 451 ? 11.338  46.885  27.222  1.00 14.12 ? 451 LEU B C   1 
ATOM   7603  O  O   . LEU B 1 451 ? 10.595  47.807  26.883  1.00 14.12 ? 451 LEU B O   1 
ATOM   7604  C  CB  . LEU B 1 451 ? 11.107  45.419  29.244  1.00 13.93 ? 451 LEU B CB  1 
ATOM   7605  C  CG  . LEU B 1 451 ? 11.176  45.202  30.760  1.00 13.94 ? 451 LEU B CG  1 
ATOM   7606  C  CD1 . LEU B 1 451 ? 9.765   45.081  31.314  1.00 14.00 ? 451 LEU B CD1 1 
ATOM   7607  C  CD2 . LEU B 1 451 ? 11.979  43.944  31.079  1.00 13.70 ? 451 LEU B CD2 1 
ATOM   7608  N  N   . ASN B 1 452 ? 11.840  46.011  26.356  1.00 14.03 ? 452 ASN B N   1 
ATOM   7609  C  CA  . ASN B 1 452 ? 11.504  46.084  24.943  1.00 14.03 ? 452 ASN B CA  1 
ATOM   7610  C  C   . ASN B 1 452 ? 10.885  44.770  24.482  1.00 14.18 ? 452 ASN B C   1 
ATOM   7611  O  O   . ASN B 1 452 ? 10.561  43.902  25.299  1.00 14.30 ? 452 ASN B O   1 
ATOM   7612  C  CB  . ASN B 1 452 ? 12.749  46.400  24.112  1.00 13.90 ? 452 ASN B CB  1 
ATOM   7613  C  CG  . ASN B 1 452 ? 13.880  45.430  24.361  1.00 13.69 ? 452 ASN B CG  1 
ATOM   7614  O  OD1 . ASN B 1 452 ? 13.718  44.213  24.222  1.00 13.77 ? 452 ASN B OD1 1 
ATOM   7615  N  ND2 . ASN B 1 452 ? 15.040  45.965  24.727  1.00 13.46 ? 452 ASN B ND2 1 
ATOM   7616  N  N   . GLU B 1 453 ? 10.721  44.633  23.170  1.00 14.30 ? 453 GLU B N   1 
ATOM   7617  C  CA  . GLU B 1 453 ? 10.140  43.436  22.589  1.00 14.25 ? 453 GLU B CA  1 
ATOM   7618  C  C   . GLU B 1 453 ? 10.749  42.177  23.189  1.00 14.01 ? 453 GLU B C   1 
ATOM   7619  O  O   . GLU B 1 453 ? 10.075  41.419  23.887  1.00 13.80 ? 453 GLU B O   1 
ATOM   7620  C  CB  . GLU B 1 453 ? 10.356  43.440  21.077  1.00 14.90 ? 453 GLU B CB  1 
ATOM   7621  C  CG  . GLU B 1 453 ? 9.082   43.280  20.270  1.00 16.18 ? 453 GLU B CG  1 
ATOM   7622  C  CD  . GLU B 1 453 ? 7.847   43.690  21.055  1.00 16.97 ? 453 GLU B CD  1 
ATOM   7623  O  OE1 . GLU B 1 453 ? 7.212   42.797  21.676  1.00 17.86 ? 453 GLU B OE1 1 
ATOM   7624  O  OE2 . GLU B 1 453 ? 7.520   44.903  21.052  1.00 17.12 ? 453 GLU B OE2 1 
ATOM   7625  N  N   . GLU B 1 454 ? 12.031  41.965  22.915  1.00 13.72 ? 454 GLU B N   1 
ATOM   7626  C  CA  . GLU B 1 454 ? 12.743  40.797  23.413  1.00 13.93 ? 454 GLU B CA  1 
ATOM   7627  C  C   . GLU B 1 454 ? 12.437  40.514  24.884  1.00 13.86 ? 454 GLU B C   1 
ATOM   7628  O  O   . GLU B 1 454 ? 11.897  39.456  25.233  1.00 13.63 ? 454 GLU B O   1 
ATOM   7629  C  CB  . GLU B 1 454 ? 14.247  40.999  23.232  1.00 14.07 ? 454 GLU B CB  1 
ATOM   7630  C  CG  . GLU B 1 454 ? 14.816  40.308  22.011  1.00 14.44 ? 454 GLU B CG  1 
ATOM   7631  C  CD  . GLU B 1 454 ? 14.782  38.791  22.136  1.00 14.69 ? 454 GLU B CD  1 
ATOM   7632  O  OE1 . GLU B 1 454 ? 13.666  38.213  22.120  1.00 14.41 ? 454 GLU B OE1 1 
ATOM   7633  O  OE2 . GLU B 1 454 ? 15.873  38.180  22.255  1.00 15.10 ? 454 GLU B OE2 1 
ATOM   7634  N  N   . GLN B 1 455 ? 12.784  41.469  25.741  1.00 13.64 ? 455 GLN B N   1 
ATOM   7635  C  CA  . GLN B 1 455 ? 12.558  41.329  27.174  1.00 13.74 ? 455 GLN B CA  1 
ATOM   7636  C  C   . GLN B 1 455 ? 11.114  40.955  27.521  1.00 13.57 ? 455 GLN B C   1 
ATOM   7637  O  O   . GLN B 1 455 ? 10.876  39.990  28.249  1.00 13.52 ? 455 GLN B O   1 
ATOM   7638  C  CB  . GLN B 1 455 ? 12.965  42.619  27.883  1.00 13.80 ? 455 GLN B CB  1 
ATOM   7639  C  CG  . GLN B 1 455 ? 14.476  42.804  27.948  1.00 13.67 ? 455 GLN B CG  1 
ATOM   7640  C  CD  . GLN B 1 455 ? 14.910  44.188  27.520  1.00 13.56 ? 455 GLN B CD  1 
ATOM   7641  O  OE1 . GLN B 1 455 ? 14.079  45.075  27.303  1.00 13.39 ? 455 GLN B OE1 1 
ATOM   7642  N  NE2 . GLN B 1 455 ? 16.219  44.383  27.391  1.00 13.32 ? 455 GLN B NE2 1 
ATOM   7643  N  N   . ARG B 1 456 ? 10.155  41.714  27.000  1.00 13.49 ? 456 ARG B N   1 
ATOM   7644  C  CA  . ARG B 1 456 ? 8.746   41.434  27.258  1.00 13.16 ? 456 ARG B CA  1 
ATOM   7645  C  C   . ARG B 1 456 ? 8.431   39.979  26.906  1.00 13.19 ? 456 ARG B C   1 
ATOM   7646  O  O   . ARG B 1 456 ? 7.721   39.288  27.641  1.00 12.98 ? 456 ARG B O   1 
ATOM   7647  C  CB  . ARG B 1 456 ? 7.862   42.365  26.429  1.00 13.18 ? 456 ARG B CB  1 
ATOM   7648  C  CG  . ARG B 1 456 ? 7.627   43.726  27.054  1.00 13.18 ? 456 ARG B CG  1 
ATOM   7649  C  CD  . ARG B 1 456 ? 6.954   44.676  26.069  1.00 13.33 ? 456 ARG B CD  1 
ATOM   7650  N  NE  . ARG B 1 456 ? 7.899   45.642  25.514  1.00 13.53 ? 456 ARG B NE  1 
ATOM   7651  C  CZ  . ARG B 1 456 ? 7.691   46.957  25.478  1.00 13.70 ? 456 ARG B CZ  1 
ATOM   7652  N  NH1 . ARG B 1 456 ? 6.565   47.465  25.968  1.00 13.81 ? 456 ARG B NH1 1 
ATOM   7653  N  NH2 . ARG B 1 456 ? 8.606   47.767  24.956  1.00 13.68 ? 456 ARG B NH2 1 
ATOM   7654  N  N   . LYS B 1 457 ? 8.965   39.522  25.778  1.00 13.34 ? 457 LYS B N   1 
ATOM   7655  C  CA  . LYS B 1 457 ? 8.745   38.150  25.331  1.00 13.92 ? 457 LYS B CA  1 
ATOM   7656  C  C   . LYS B 1 457 ? 9.360   37.161  26.325  1.00 13.73 ? 457 LYS B C   1 
ATOM   7657  O  O   . LYS B 1 457 ? 8.674   36.281  26.853  1.00 13.66 ? 457 LYS B O   1 
ATOM   7658  C  CB  . LYS B 1 457 ? 9.364   37.940  23.945  1.00 14.15 ? 457 LYS B CB  1 
ATOM   7659  C  CG  . LYS B 1 457 ? 9.293   36.498  23.442  1.00 14.62 ? 457 LYS B CG  1 
ATOM   7660  C  CD  . LYS B 1 457 ? 10.639  36.027  22.908  1.00 14.72 ? 457 LYS B CD  1 
ATOM   7661  C  CE  . LYS B 1 457 ? 11.663  35.888  24.032  1.00 14.76 ? 457 LYS B CE  1 
ATOM   7662  N  NZ  . LYS B 1 457 ? 12.936  35.249  23.579  1.00 14.44 ? 457 LYS B NZ  1 
ATOM   7663  N  N   . ARG B 1 458 ? 10.658  37.318  26.570  1.00 13.60 ? 458 ARG B N   1 
ATOM   7664  C  CA  . ARG B 1 458 ? 11.384  36.460  27.496  1.00 13.39 ? 458 ARG B CA  1 
ATOM   7665  C  C   . ARG B 1 458 ? 10.702  36.439  28.862  1.00 13.48 ? 458 ARG B C   1 
ATOM   7666  O  O   . ARG B 1 458 ? 10.535  35.380  29.467  1.00 13.60 ? 458 ARG B O   1 
ATOM   7667  C  CB  . ARG B 1 458 ? 12.820  36.962  27.643  1.00 13.38 ? 458 ARG B CB  1 
ATOM   7668  C  CG  . ARG B 1 458 ? 13.850  35.862  27.797  1.00 13.22 ? 458 ARG B CG  1 
ATOM   7669  C  CD  . ARG B 1 458 ? 15.056  36.089  26.898  1.00 13.13 ? 458 ARG B CD  1 
ATOM   7670  N  NE  . ARG B 1 458 ? 15.182  37.476  26.455  1.00 13.11 ? 458 ARG B NE  1 
ATOM   7671  C  CZ  . ARG B 1 458 ? 16.207  38.264  26.765  1.00 13.11 ? 458 ARG B CZ  1 
ATOM   7672  N  NH1 . ARG B 1 458 ? 17.194  37.800  27.524  1.00 13.05 ? 458 ARG B NH1 1 
ATOM   7673  N  NH2 . ARG B 1 458 ? 16.259  39.508  26.303  1.00 13.11 ? 458 ARG B NH2 1 
ATOM   7674  N  N   . LEU B 1 459 ? 10.313  37.618  29.339  1.00 13.37 ? 459 LEU B N   1 
ATOM   7675  C  CA  . LEU B 1 459 ? 9.648   37.750  30.628  1.00 12.97 ? 459 LEU B CA  1 
ATOM   7676  C  C   . LEU B 1 459 ? 8.419   36.858  30.689  1.00 13.06 ? 459 LEU B C   1 
ATOM   7677  O  O   . LEU B 1 459 ? 8.351   35.939  31.504  1.00 13.19 ? 459 LEU B O   1 
ATOM   7678  C  CB  . LEU B 1 459 ? 9.235   39.203  30.865  1.00 12.69 ? 459 LEU B CB  1 
ATOM   7679  C  CG  . LEU B 1 459 ? 8.164   39.451  31.926  1.00 12.40 ? 459 LEU B CG  1 
ATOM   7680  C  CD1 . LEU B 1 459 ? 8.617   38.868  33.260  1.00 12.37 ? 459 LEU B CD1 1 
ATOM   7681  C  CD2 . LEU B 1 459 ? 7.914   40.944  32.050  1.00 12.35 ? 459 LEU B CD2 1 
ATOM   7682  N  N   . CYS B 1 460 ? 7.444   37.133  29.829  1.00 12.94 ? 460 CYS B N   1 
ATOM   7683  C  CA  . CYS B 1 460 ? 6.224   36.339  29.810  1.00 13.02 ? 460 CYS B CA  1 
ATOM   7684  C  C   . CYS B 1 460 ? 6.579   34.858  29.790  1.00 13.01 ? 460 CYS B C   1 
ATOM   7685  O  O   . CYS B 1 460 ? 5.994   34.058  30.526  1.00 13.00 ? 460 CYS B O   1 
ATOM   7686  C  CB  . CYS B 1 460 ? 5.373   36.701  28.594  1.00 12.88 ? 460 CYS B CB  1 
ATOM   7687  S  SG  . CYS B 1 460 ? 4.568   38.322  28.737  1.00 12.78 ? 460 CYS B SG  1 
ATOM   7688  N  N   . GLU B 1 461 ? 7.548   34.501  28.955  1.00 12.96 ? 461 GLU B N   1 
ATOM   7689  C  CA  . GLU B 1 461 ? 7.990   33.119  28.852  1.00 12.94 ? 461 GLU B CA  1 
ATOM   7690  C  C   . GLU B 1 461 ? 8.390   32.616  30.235  1.00 12.86 ? 461 GLU B C   1 
ATOM   7691  O  O   . GLU B 1 461 ? 7.807   31.663  30.756  1.00 12.72 ? 461 GLU B O   1 
ATOM   7692  C  CB  . GLU B 1 461 ? 9.184   33.021  27.902  1.00 13.22 ? 461 GLU B CB  1 
ATOM   7693  C  CG  . GLU B 1 461 ? 8.947   32.122  26.703  1.00 13.69 ? 461 GLU B CG  1 
ATOM   7694  C  CD  . GLU B 1 461 ? 9.357   32.775  25.390  1.00 13.97 ? 461 GLU B CD  1 
ATOM   7695  O  OE1 . GLU B 1 461 ? 10.565  33.071  25.232  1.00 14.12 ? 461 GLU B OE1 1 
ATOM   7696  O  OE2 . GLU B 1 461 ? 8.476   32.986  24.522  1.00 13.96 ? 461 GLU B OE2 1 
ATOM   7697  N  N   . ASN B 1 462 ? 9.385   33.276  30.821  1.00 12.83 ? 462 ASN B N   1 
ATOM   7698  C  CA  . ASN B 1 462 ? 9.891   32.931  32.146  1.00 12.88 ? 462 ASN B CA  1 
ATOM   7699  C  C   . ASN B 1 462 ? 8.768   32.710  33.149  1.00 12.73 ? 462 ASN B C   1 
ATOM   7700  O  O   . ASN B 1 462 ? 8.795   31.747  33.915  1.00 12.80 ? 462 ASN B O   1 
ATOM   7701  C  CB  . ASN B 1 462 ? 10.811  34.037  32.656  1.00 13.00 ? 462 ASN B CB  1 
ATOM   7702  C  CG  . ASN B 1 462 ? 12.226  33.888  32.150  1.00 13.20 ? 462 ASN B CG  1 
ATOM   7703  O  OD1 . ASN B 1 462 ? 12.684  32.778  31.866  1.00 13.01 ? 462 ASN B OD1 1 
ATOM   7704  N  ND2 . ASN B 1 462 ? 12.931  35.007  32.030  1.00 13.72 ? 462 ASN B ND2 1 
ATOM   7705  N  N   . ILE B 1 463 ? 7.788   33.609  33.137  1.00 12.58 ? 463 ILE B N   1 
ATOM   7706  C  CA  . ILE B 1 463 ? 6.653   33.520  34.044  1.00 12.22 ? 463 ILE B CA  1 
ATOM   7707  C  C   . ILE B 1 463 ? 5.811   32.288  33.775  1.00 12.08 ? 463 ILE B C   1 
ATOM   7708  O  O   . ILE B 1 463 ? 5.633   31.450  34.654  1.00 12.26 ? 463 ILE B O   1 
ATOM   7709  C  CB  . ILE B 1 463 ? 5.730   34.740  33.916  1.00 12.15 ? 463 ILE B CB  1 
ATOM   7710  C  CG1 . ILE B 1 463 ? 6.494   36.014  34.281  1.00 12.19 ? 463 ILE B CG1 1 
ATOM   7711  C  CG2 . ILE B 1 463 ? 4.514   34.555  34.814  1.00 11.65 ? 463 ILE B CG2 1 
ATOM   7712  C  CD1 . ILE B 1 463 ? 5.682   37.294  34.133  1.00 12.27 ? 463 ILE B CD1 1 
ATOM   7713  N  N   . ALA B 1 464 ? 5.291   32.192  32.556  1.00 12.13 ? 464 ALA B N   1 
ATOM   7714  C  CA  . ALA B 1 464 ? 4.437   31.078  32.160  1.00 12.03 ? 464 ALA B CA  1 
ATOM   7715  C  C   . ALA B 1 464 ? 5.096   29.723  32.365  1.00 12.07 ? 464 ALA B C   1 
ATOM   7716  O  O   . ALA B 1 464 ? 4.418   28.729  32.627  1.00 11.90 ? 464 ALA B O   1 
ATOM   7717  C  CB  . ALA B 1 464 ? 4.016   31.240  30.712  1.00 11.76 ? 464 ALA B CB  1 
ATOM   7718  N  N   . GLY B 1 465 ? 6.417   29.685  32.245  1.00 12.25 ? 465 GLY B N   1 
ATOM   7719  C  CA  . GLY B 1 465 ? 7.127   28.435  32.425  1.00 12.49 ? 465 GLY B CA  1 
ATOM   7720  C  C   . GLY B 1 465 ? 6.955   27.917  33.839  1.00 12.88 ? 465 GLY B C   1 
ATOM   7721  O  O   . GLY B 1 465 ? 6.921   26.705  34.074  1.00 12.90 ? 465 GLY B O   1 
ATOM   7722  N  N   . HIS B 1 466 ? 6.842   28.844  34.786  1.00 12.83 ? 466 HIS B N   1 
ATOM   7723  C  CA  . HIS B 1 466 ? 6.673   28.501  36.192  1.00 12.79 ? 466 HIS B CA  1 
ATOM   7724  C  C   . HIS B 1 466 ? 5.196   28.417  36.560  1.00 12.67 ? 466 HIS B C   1 
ATOM   7725  O  O   . HIS B 1 466 ? 4.730   27.406  37.088  1.00 12.68 ? 466 HIS B O   1 
ATOM   7726  C  CB  . HIS B 1 466 ? 7.364   29.552  37.073  1.00 13.07 ? 466 HIS B CB  1 
ATOM   7727  C  CG  . HIS B 1 466 ? 7.357   29.226  38.538  1.00 13.40 ? 466 HIS B CG  1 
ATOM   7728  N  ND1 . HIS B 1 466 ? 7.546   30.182  39.514  1.00 13.50 ? 466 HIS B ND1 1 
ATOM   7729  C  CD2 . HIS B 1 466 ? 7.198   28.050  39.191  1.00 13.57 ? 466 HIS B CD2 1 
ATOM   7730  C  CE1 . HIS B 1 466 ? 7.505   29.609  40.704  1.00 13.63 ? 466 HIS B CE1 1 
ATOM   7731  N  NE2 . HIS B 1 466 ? 7.294   28.316  40.536  1.00 13.74 ? 466 HIS B NE2 1 
ATOM   7732  N  N   . LEU B 1 467 ? 4.469   29.490  36.266  1.00 12.54 ? 467 LEU B N   1 
ATOM   7733  C  CA  . LEU B 1 467 ? 3.047   29.595  36.570  1.00 12.48 ? 467 LEU B CA  1 
ATOM   7734  C  C   . LEU B 1 467 ? 2.179   28.494  35.970  1.00 12.48 ? 467 LEU B C   1 
ATOM   7735  O  O   . LEU B 1 467 ? 1.033   28.305  36.381  1.00 12.52 ? 467 LEU B O   1 
ATOM   7736  C  CB  . LEU B 1 467 ? 2.531   30.958  36.111  1.00 12.30 ? 467 LEU B CB  1 
ATOM   7737  C  CG  . LEU B 1 467 ? 1.024   31.175  36.189  1.00 12.24 ? 467 LEU B CG  1 
ATOM   7738  C  CD1 . LEU B 1 467 ? 0.555   31.028  37.635  1.00 12.61 ? 467 LEU B CD1 1 
ATOM   7739  C  CD2 . LEU B 1 467 ? 0.681   32.553  35.637  1.00 12.13 ? 467 LEU B CD2 1 
ATOM   7740  N  N   . LYS B 1 468 ? 2.724   27.771  34.998  1.00 12.59 ? 468 LYS B N   1 
ATOM   7741  C  CA  . LYS B 1 468 ? 1.991   26.693  34.340  1.00 12.44 ? 468 LYS B CA  1 
ATOM   7742  C  C   . LYS B 1 468 ? 1.807   25.480  35.247  1.00 12.49 ? 468 LYS B C   1 
ATOM   7743  O  O   . LYS B 1 468 ? 0.864   24.707  35.077  1.00 12.47 ? 468 LYS B O   1 
ATOM   7744  C  CB  . LYS B 1 468 ? 2.724   26.267  33.064  1.00 12.60 ? 468 LYS B CB  1 
ATOM   7745  C  CG  . LYS B 1 468 ? 4.082   25.606  33.298  1.00 12.54 ? 468 LYS B CG  1 
ATOM   7746  C  CD  . LYS B 1 468 ? 4.324   24.481  32.300  1.00 12.48 ? 468 LYS B CD  1 
ATOM   7747  C  CE  . LYS B 1 468 ? 5.429   23.544  32.758  1.00 12.49 ? 468 LYS B CE  1 
ATOM   7748  N  NZ  . LYS B 1 468 ? 6.433   24.227  33.621  1.00 12.54 ? 468 LYS B NZ  1 
ATOM   7749  N  N   . ASP B 1 469 ? 2.708   25.326  36.213  1.00 12.46 ? 469 ASP B N   1 
ATOM   7750  C  CA  . ASP B 1 469 ? 2.667   24.199  37.140  1.00 12.43 ? 469 ASP B CA  1 
ATOM   7751  C  C   . ASP B 1 469 ? 1.693   24.368  38.301  1.00 12.31 ? 469 ASP B C   1 
ATOM   7752  O  O   . ASP B 1 469 ? 1.697   23.574  39.238  1.00 12.50 ? 469 ASP B O   1 
ATOM   7753  C  CB  . ASP B 1 469 ? 4.071   23.932  37.687  1.00 12.24 ? 469 ASP B CB  1 
ATOM   7754  C  CG  . ASP B 1 469 ? 4.902   23.079  36.752  1.00 12.10 ? 469 ASP B CG  1 
ATOM   7755  O  OD1 . ASP B 1 469 ? 4.325   22.197  36.082  1.00 11.91 ? 469 ASP B OD1 1 
ATOM   7756  O  OD2 . ASP B 1 469 ? 6.130   23.292  36.682  1.00 12.10 ? 469 ASP B OD2 1 
ATOM   7757  N  N   . ALA B 1 470 ? 0.861   25.399  38.251  1.00 12.12 ? 470 ALA B N   1 
ATOM   7758  C  CA  . ALA B 1 470 ? -0.104  25.618  39.319  1.00 12.00 ? 470 ALA B CA  1 
ATOM   7759  C  C   . ALA B 1 470 ? -1.499  25.230  38.842  1.00 11.95 ? 470 ALA B C   1 
ATOM   7760  O  O   . ALA B 1 470 ? -1.718  25.024  37.651  1.00 11.98 ? 470 ALA B O   1 
ATOM   7761  C  CB  . ALA B 1 470 ? -0.082  27.078  39.759  1.00 11.75 ? 470 ALA B CB  1 
ATOM   7762  N  N   . GLN B 1 471 ? -2.439  25.121  39.776  1.00 12.13 ? 471 GLN B N   1 
ATOM   7763  C  CA  . GLN B 1 471 ? -3.810  24.769  39.429  1.00 11.93 ? 471 GLN B CA  1 
ATOM   7764  C  C   . GLN B 1 471 ? -4.339  25.819  38.465  1.00 11.95 ? 471 GLN B C   1 
ATOM   7765  O  O   . GLN B 1 471 ? -3.819  26.935  38.412  1.00 11.97 ? 471 GLN B O   1 
ATOM   7766  C  CB  . GLN B 1 471 ? -4.685  24.734  40.679  1.00 12.00 ? 471 GLN B CB  1 
ATOM   7767  C  CG  . GLN B 1 471 ? -4.656  23.412  41.422  1.00 12.24 ? 471 GLN B CG  1 
ATOM   7768  C  CD  . GLN B 1 471 ? -5.425  23.470  42.733  1.00 12.41 ? 471 GLN B CD  1 
ATOM   7769  O  OE1 . GLN B 1 471 ? -4.960  24.056  43.711  1.00 12.52 ? 471 GLN B OE1 1 
ATOM   7770  N  NE2 . GLN B 1 471 ? -6.608  22.864  42.757  1.00 12.30 ? 471 GLN B NE2 1 
ATOM   7771  N  N   . ILE B 1 472 ? -5.372  25.470  37.705  1.00 11.90 ? 472 ILE B N   1 
ATOM   7772  C  CA  . ILE B 1 472 ? -5.939  26.404  36.742  1.00 11.99 ? 472 ILE B CA  1 
ATOM   7773  C  C   . ILE B 1 472 ? -6.638  27.570  37.430  1.00 12.06 ? 472 ILE B C   1 
ATOM   7774  O  O   . ILE B 1 472 ? -6.530  28.718  36.985  1.00 11.95 ? 472 ILE B O   1 
ATOM   7775  C  CB  . ILE B 1 472 ? -6.940  25.696  35.791  1.00 11.99 ? 472 ILE B CB  1 
ATOM   7776  C  CG1 . ILE B 1 472 ? -6.257  25.403  34.452  1.00 11.75 ? 472 ILE B CG1 1 
ATOM   7777  C  CG2 . ILE B 1 472 ? -8.166  26.584  35.546  1.00 12.41 ? 472 ILE B CG2 1 
ATOM   7778  C  CD1 . ILE B 1 472 ? -5.387  24.167  34.455  1.00 11.25 ? 472 ILE B CD1 1 
ATOM   7779  N  N   . PHE B 1 473 ? -7.351  27.279  38.514  1.00 11.89 ? 473 PHE B N   1 
ATOM   7780  C  CA  . PHE B 1 473 ? -8.062  28.318  39.242  1.00 12.17 ? 473 PHE B CA  1 
ATOM   7781  C  C   . PHE B 1 473 ? -7.102  29.360  39.815  1.00 12.21 ? 473 PHE B C   1 
ATOM   7782  O  O   . PHE B 1 473 ? -7.498  30.494  40.091  1.00 12.07 ? 473 PHE B O   1 
ATOM   7783  C  CB  . PHE B 1 473 ? -8.929  27.699  40.348  1.00 12.18 ? 473 PHE B CB  1 
ATOM   7784  C  CG  . PHE B 1 473 ? -8.282  27.683  41.706  1.00 12.24 ? 473 PHE B CG  1 
ATOM   7785  C  CD1 . PHE B 1 473 ? -8.405  28.772  42.565  1.00 12.08 ? 473 PHE B CD1 1 
ATOM   7786  C  CD2 . PHE B 1 473 ? -7.571  26.568  42.138  1.00 12.48 ? 473 PHE B CD2 1 
ATOM   7787  C  CE1 . PHE B 1 473 ? -7.831  28.749  43.831  1.00 11.99 ? 473 PHE B CE1 1 
ATOM   7788  C  CE2 . PHE B 1 473 ? -6.993  26.536  43.406  1.00 12.55 ? 473 PHE B CE2 1 
ATOM   7789  C  CZ  . PHE B 1 473 ? -7.125  27.629  44.253  1.00 12.21 ? 473 PHE B CZ  1 
ATOM   7790  N  N   . ILE B 1 474 ? -5.844  28.979  39.999  1.00 12.16 ? 474 ILE B N   1 
ATOM   7791  C  CA  . ILE B 1 474 ? -4.860  29.921  40.515  1.00 12.29 ? 474 ILE B CA  1 
ATOM   7792  C  C   . ILE B 1 474 ? -4.305  30.661  39.312  1.00 12.40 ? 474 ILE B C   1 
ATOM   7793  O  O   . ILE B 1 474 ? -4.078  31.873  39.351  1.00 12.60 ? 474 ILE B O   1 
ATOM   7794  C  CB  . ILE B 1 474 ? -3.697  29.211  41.239  1.00 12.20 ? 474 ILE B CB  1 
ATOM   7795  C  CG1 . ILE B 1 474 ? -4.150  28.711  42.613  1.00 11.77 ? 474 ILE B CG1 1 
ATOM   7796  C  CG2 . ILE B 1 474 ? -2.538  30.177  41.417  1.00 12.53 ? 474 ILE B CG2 1 
ATOM   7797  C  CD1 . ILE B 1 474 ? -3.246  27.658  43.199  1.00 11.29 ? 474 ILE B CD1 1 
ATOM   7798  N  N   . GLN B 1 475 ? -4.096  29.908  38.238  1.00 12.66 ? 475 GLN B N   1 
ATOM   7799  C  CA  . GLN B 1 475 ? -3.578  30.465  36.997  1.00 12.62 ? 475 GLN B CA  1 
ATOM   7800  C  C   . GLN B 1 475 ? -4.451  31.638  36.552  1.00 12.60 ? 475 GLN B C   1 
ATOM   7801  O  O   . GLN B 1 475 ? -3.943  32.674  36.125  1.00 12.53 ? 475 GLN B O   1 
ATOM   7802  C  CB  . GLN B 1 475 ? -3.559  29.385  35.911  1.00 12.40 ? 475 GLN B CB  1 
ATOM   7803  C  CG  . GLN B 1 475 ? -2.219  28.685  35.754  1.00 12.18 ? 475 GLN B CG  1 
ATOM   7804  C  CD  . GLN B 1 475 ? -2.270  27.517  34.770  1.00 12.06 ? 475 GLN B CD  1 
ATOM   7805  O  OE1 . GLN B 1 475 ? -2.040  26.363  35.143  1.00 11.67 ? 475 GLN B OE1 1 
ATOM   7806  N  NE2 . GLN B 1 475 ? -2.567  27.817  33.506  1.00 12.01 ? 475 GLN B NE2 1 
ATOM   7807  N  N   . LYS B 1 476 ? -5.764  31.472  36.668  1.00 12.62 ? 476 LYS B N   1 
ATOM   7808  C  CA  . LYS B 1 476 ? -6.699  32.514  36.267  1.00 12.89 ? 476 LYS B CA  1 
ATOM   7809  C  C   . LYS B 1 476 ? -6.480  33.813  37.034  1.00 12.93 ? 476 LYS B C   1 
ATOM   7810  O  O   . LYS B 1 476 ? -6.282  34.879  36.442  1.00 12.78 ? 476 LYS B O   1 
ATOM   7811  C  CB  . LYS B 1 476 ? -8.134  32.033  36.474  1.00 13.18 ? 476 LYS B CB  1 
ATOM   7812  C  CG  . LYS B 1 476 ? -8.432  30.707  35.797  1.00 13.57 ? 476 LYS B CG  1 
ATOM   7813  C  CD  . LYS B 1 476 ? -8.863  30.903  34.344  1.00 13.48 ? 476 LYS B CD  1 
ATOM   7814  C  CE  . LYS B 1 476 ? -10.384 30.879  34.209  1.00 13.44 ? 476 LYS B CE  1 
ATOM   7815  N  NZ  . LYS B 1 476 ? -10.843 29.983  33.114  1.00 12.85 ? 476 LYS B NZ  1 
ATOM   7816  N  N   . LYS B 1 477 ? -6.516  33.715  38.359  1.00 12.92 ? 477 LYS B N   1 
ATOM   7817  C  CA  . LYS B 1 477 ? -6.335  34.879  39.219  1.00 12.83 ? 477 LYS B CA  1 
ATOM   7818  C  C   . LYS B 1 477 ? -5.096  35.669  38.830  1.00 12.64 ? 477 LYS B C   1 
ATOM   7819  O  O   . LYS B 1 477 ? -5.148  36.885  38.671  1.00 12.57 ? 477 LYS B O   1 
ATOM   7820  C  CB  . LYS B 1 477 ? -6.225  34.440  40.680  1.00 13.01 ? 477 LYS B CB  1 
ATOM   7821  C  CG  . LYS B 1 477 ? -7.254  35.084  41.602  1.00 13.35 ? 477 LYS B CG  1 
ATOM   7822  C  CD  . LYS B 1 477 ? -7.061  34.649  43.048  1.00 13.48 ? 477 LYS B CD  1 
ATOM   7823  C  CE  . LYS B 1 477 ? -7.245  33.137  43.216  1.00 13.58 ? 477 LYS B CE  1 
ATOM   7824  N  NZ  . LYS B 1 477 ? -6.065  32.499  43.879  1.00 13.20 ? 477 LYS B NZ  1 
ATOM   7825  N  N   . ALA B 1 478 ? -3.983  34.960  38.677  1.00 12.73 ? 478 ALA B N   1 
ATOM   7826  C  CA  . ALA B 1 478 ? -2.712  35.575  38.316  1.00 12.68 ? 478 ALA B CA  1 
ATOM   7827  C  C   . ALA B 1 478 ? -2.809  36.343  37.009  1.00 12.93 ? 478 ALA B C   1 
ATOM   7828  O  O   . ALA B 1 478 ? -2.375  37.496  36.925  1.00 12.83 ? 478 ALA B O   1 
ATOM   7829  C  CB  . ALA B 1 478 ? -1.626  34.508  38.209  1.00 12.60 ? 478 ALA B CB  1 
ATOM   7830  N  N   . VAL B 1 479 ? -3.379  35.703  35.992  1.00 13.09 ? 479 VAL B N   1 
ATOM   7831  C  CA  . VAL B 1 479 ? -3.510  36.339  34.691  1.00 13.54 ? 479 VAL B CA  1 
ATOM   7832  C  C   . VAL B 1 479 ? -4.357  37.613  34.771  1.00 13.73 ? 479 VAL B C   1 
ATOM   7833  O  O   . VAL B 1 479 ? -3.990  38.647  34.204  1.00 13.74 ? 479 VAL B O   1 
ATOM   7834  C  CB  . VAL B 1 479 ? -4.123  35.370  33.665  1.00 13.45 ? 479 VAL B CB  1 
ATOM   7835  C  CG1 . VAL B 1 479 ? -4.169  36.031  32.299  1.00 13.75 ? 479 VAL B CG1 1 
ATOM   7836  C  CG2 . VAL B 1 479 ? -3.303  34.097  33.605  1.00 13.22 ? 479 VAL B CG2 1 
ATOM   7837  N  N   . LYS B 1 480 ? -5.484  37.537  35.476  1.00 13.86 ? 480 LYS B N   1 
ATOM   7838  C  CA  . LYS B 1 480 ? -6.366  38.690  35.632  1.00 13.94 ? 480 LYS B CA  1 
ATOM   7839  C  C   . LYS B 1 480 ? -5.582  39.865  36.222  1.00 14.10 ? 480 LYS B C   1 
ATOM   7840  O  O   . LYS B 1 480 ? -5.810  41.026  35.863  1.00 14.23 ? 480 LYS B O   1 
ATOM   7841  C  CB  . LYS B 1 480 ? -7.538  38.339  36.551  1.00 14.13 ? 480 LYS B CB  1 
ATOM   7842  C  CG  . LYS B 1 480 ? -8.854  39.008  36.169  1.00 14.34 ? 480 LYS B CG  1 
ATOM   7843  C  CD  . LYS B 1 480 ? -9.919  38.789  37.241  1.00 14.60 ? 480 LYS B CD  1 
ATOM   7844  C  CE  . LYS B 1 480 ? -10.025 39.990  38.182  1.00 15.05 ? 480 LYS B CE  1 
ATOM   7845  N  NZ  . LYS B 1 480 ? -8.891  40.967  38.015  1.00 15.02 ? 480 LYS B NZ  1 
ATOM   7846  N  N   . ASN B 1 481 ? -4.656  39.558  37.126  1.00 13.89 ? 481 ASN B N   1 
ATOM   7847  C  CA  . ASN B 1 481 ? -3.837  40.586  37.751  1.00 13.62 ? 481 ASN B CA  1 
ATOM   7848  C  C   . ASN B 1 481 ? -2.874  41.157  36.726  1.00 13.36 ? 481 ASN B C   1 
ATOM   7849  O  O   . ASN B 1 481 ? -2.641  42.363  36.683  1.00 13.22 ? 481 ASN B O   1 
ATOM   7850  C  CB  . ASN B 1 481 ? -3.057  40.000  38.925  1.00 13.81 ? 481 ASN B CB  1 
ATOM   7851  C  CG  . ASN B 1 481 ? -3.904  39.878  40.180  1.00 13.93 ? 481 ASN B CG  1 
ATOM   7852  O  OD1 . ASN B 1 481 ? -4.650  40.795  40.532  1.00 13.70 ? 481 ASN B OD1 1 
ATOM   7853  N  ND2 . ASN B 1 481 ? -3.792  38.739  40.863  1.00 14.19 ? 481 ASN B ND2 1 
ATOM   7854  N  N   . PHE B 1 482 ? -2.324  40.279  35.893  1.00 13.33 ? 482 PHE B N   1 
ATOM   7855  C  CA  . PHE B 1 482 ? -1.380  40.689  34.858  1.00 13.41 ? 482 PHE B CA  1 
ATOM   7856  C  C   . PHE B 1 482 ? -2.073  41.543  33.801  1.00 13.43 ? 482 PHE B C   1 
ATOM   7857  O  O   . PHE B 1 482 ? -1.499  42.515  33.293  1.00 13.15 ? 482 PHE B O   1 
ATOM   7858  C  CB  . PHE B 1 482 ? -0.751  39.458  34.204  1.00 13.23 ? 482 PHE B CB  1 
ATOM   7859  C  CG  . PHE B 1 482 ? 0.355   38.846  35.013  1.00 13.36 ? 482 PHE B CG  1 
ATOM   7860  C  CD1 . PHE B 1 482 ? 1.381   39.639  35.522  1.00 13.33 ? 482 PHE B CD1 1 
ATOM   7861  C  CD2 . PHE B 1 482 ? 0.370   37.477  35.272  1.00 13.43 ? 482 PHE B CD2 1 
ATOM   7862  C  CE1 . PHE B 1 482 ? 2.406   39.079  36.279  1.00 13.29 ? 482 PHE B CE1 1 
ATOM   7863  C  CE2 . PHE B 1 482 ? 1.393   36.902  36.029  1.00 13.40 ? 482 PHE B CE2 1 
ATOM   7864  C  CZ  . PHE B 1 482 ? 2.415   37.707  36.534  1.00 13.40 ? 482 PHE B CZ  1 
ATOM   7865  N  N   . THR B 1 483 ? -3.307  41.171  33.475  1.00 13.23 ? 483 THR B N   1 
ATOM   7866  C  CA  . THR B 1 483 ? -4.087  41.903  32.490  1.00 13.52 ? 483 THR B CA  1 
ATOM   7867  C  C   . THR B 1 483 ? -4.257  43.336  32.978  1.00 13.67 ? 483 THR B C   1 
ATOM   7868  O  O   . THR B 1 483 ? -4.218  44.286  32.192  1.00 13.65 ? 483 THR B O   1 
ATOM   7869  C  CB  . THR B 1 483 ? -5.481  41.268  32.299  1.00 13.51 ? 483 THR B CB  1 
ATOM   7870  O  OG1 . THR B 1 483 ? -5.356  40.041  31.565  1.00 13.39 ? 483 THR B OG1 1 
ATOM   7871  C  CG2 . THR B 1 483 ? -6.400  42.222  31.540  1.00 13.49 ? 483 THR B CG2 1 
ATOM   7872  N  N   . GLU B 1 484 ? -4.439  43.478  34.288  1.00 14.00 ? 484 GLU B N   1 
ATOM   7873  C  CA  . GLU B 1 484 ? -4.614  44.786  34.915  1.00 14.02 ? 484 GLU B CA  1 
ATOM   7874  C  C   . GLU B 1 484 ? -3.416  45.678  34.643  1.00 14.15 ? 484 GLU B C   1 
ATOM   7875  O  O   . GLU B 1 484 ? -3.561  46.888  34.457  1.00 14.50 ? 484 GLU B O   1 
ATOM   7876  C  CB  . GLU B 1 484 ? -4.796  44.626  36.419  1.00 13.96 ? 484 GLU B CB  1 
ATOM   7877  C  CG  . GLU B 1 484 ? -6.038  43.848  36.798  1.00 13.52 ? 484 GLU B CG  1 
ATOM   7878  C  CD  . GLU B 1 484 ? -7.083  44.729  37.427  1.00 13.22 ? 484 GLU B CD  1 
ATOM   7879  O  OE1 . GLU B 1 484 ? -7.758  44.266  38.370  1.00 13.26 ? 484 GLU B OE1 1 
ATOM   7880  O  OE2 . GLU B 1 484 ? -7.225  45.886  36.979  1.00 12.75 ? 484 GLU B OE2 1 
ATOM   7881  N  N   . VAL B 1 485 ? -2.229  45.080  34.635  1.00 14.07 ? 485 VAL B N   1 
ATOM   7882  C  CA  . VAL B 1 485 ? -1.015  45.832  34.353  1.00 13.86 ? 485 VAL B CA  1 
ATOM   7883  C  C   . VAL B 1 485 ? -1.124  46.336  32.921  1.00 13.63 ? 485 VAL B C   1 
ATOM   7884  O  O   . VAL B 1 485 ? -1.064  47.537  32.665  1.00 13.29 ? 485 VAL B O   1 
ATOM   7885  C  CB  . VAL B 1 485 ? 0.233   44.940  34.456  1.00 13.96 ? 485 VAL B CB  1 
ATOM   7886  C  CG1 . VAL B 1 485 ? 1.482   45.753  34.161  1.00 13.86 ? 485 VAL B CG1 1 
ATOM   7887  C  CG2 . VAL B 1 485 ? 0.309   44.318  35.834  1.00 14.34 ? 485 VAL B CG2 1 
ATOM   7888  N  N   . HIS B 1 486 ? -1.302  45.389  32.002  1.00 13.71 ? 486 HIS B N   1 
ATOM   7889  C  CA  . HIS B 1 486 ? -1.419  45.673  30.577  1.00 13.76 ? 486 HIS B CA  1 
ATOM   7890  C  C   . HIS B 1 486 ? -2.119  44.498  29.890  1.00 13.84 ? 486 HIS B C   1 
ATOM   7891  O  O   . HIS B 1 486 ? -1.881  43.340  30.231  1.00 13.80 ? 486 HIS B O   1 
ATOM   7892  C  CB  . HIS B 1 486 ? -0.024  45.875  29.972  1.00 13.88 ? 486 HIS B CB  1 
ATOM   7893  C  CG  . HIS B 1 486 ? -0.038  46.483  28.603  1.00 14.11 ? 486 HIS B CG  1 
ATOM   7894  N  ND1 . HIS B 1 486 ? 0.304   47.799  28.369  1.00 14.13 ? 486 HIS B ND1 1 
ATOM   7895  C  CD2 . HIS B 1 486 ? -0.360  45.958  27.396  1.00 14.18 ? 486 HIS B CD2 1 
ATOM   7896  C  CE1 . HIS B 1 486 ? 0.192   48.058  27.078  1.00 14.15 ? 486 HIS B CE1 1 
ATOM   7897  N  NE2 . HIS B 1 486 ? -0.209  46.957  26.467  1.00 14.23 ? 486 HIS B NE2 1 
ATOM   7898  N  N   . PRO B 1 487 ? -2.999  44.786  28.918  1.00 14.05 ? 487 PRO B N   1 
ATOM   7899  C  CA  . PRO B 1 487 ? -3.738  43.751  28.178  1.00 14.06 ? 487 PRO B CA  1 
ATOM   7900  C  C   . PRO B 1 487 ? -2.844  42.737  27.451  1.00 14.06 ? 487 PRO B C   1 
ATOM   7901  O  O   . PRO B 1 487 ? -3.188  41.560  27.342  1.00 13.79 ? 487 PRO B O   1 
ATOM   7902  C  CB  . PRO B 1 487 ? -4.601  44.550  27.195  1.00 14.29 ? 487 PRO B CB  1 
ATOM   7903  C  CG  . PRO B 1 487 ? -3.913  45.879  27.076  1.00 14.47 ? 487 PRO B CG  1 
ATOM   7904  C  CD  . PRO B 1 487 ? -3.357  46.138  28.458  1.00 14.29 ? 487 PRO B CD  1 
ATOM   7905  N  N   . ASP B 1 488 ? -1.704  43.196  26.947  1.00 14.09 ? 488 ASP B N   1 
ATOM   7906  C  CA  . ASP B 1 488 ? -0.790  42.305  26.242  1.00 14.36 ? 488 ASP B CA  1 
ATOM   7907  C  C   . ASP B 1 488 ? -0.024  41.454  27.247  1.00 14.41 ? 488 ASP B C   1 
ATOM   7908  O  O   . ASP B 1 488 ? 0.232   40.272  27.012  1.00 14.55 ? 488 ASP B O   1 
ATOM   7909  C  CB  . ASP B 1 488 ? 0.190   43.113  25.379  1.00 14.24 ? 488 ASP B CB  1 
ATOM   7910  C  CG  . ASP B 1 488 ? -0.466  43.686  24.124  1.00 14.16 ? 488 ASP B CG  1 
ATOM   7911  O  OD1 . ASP B 1 488 ? -1.536  43.180  23.721  1.00 13.76 ? 488 ASP B OD1 1 
ATOM   7912  O  OD2 . ASP B 1 488 ? 0.088   44.643  23.543  1.00 14.21 ? 488 ASP B OD2 1 
ATOM   7913  N  N   . TYR B 1 489 ? 0.335   42.067  28.370  1.00 14.47 ? 489 TYR B N   1 
ATOM   7914  C  CA  . TYR B 1 489 ? 1.066   41.375  29.424  1.00 14.22 ? 489 TYR B CA  1 
ATOM   7915  C  C   . TYR B 1 489 ? 0.297   40.133  29.866  1.00 14.29 ? 489 TYR B C   1 
ATOM   7916  O  O   . TYR B 1 489 ? 0.888   39.065  30.051  1.00 14.24 ? 489 TYR B O   1 
ATOM   7917  C  CB  . TYR B 1 489 ? 1.272   42.319  30.616  1.00 14.22 ? 489 TYR B CB  1 
ATOM   7918  C  CG  . TYR B 1 489 ? 2.278   41.846  31.648  1.00 14.07 ? 489 TYR B CG  1 
ATOM   7919  C  CD1 . TYR B 1 489 ? 3.052   40.700  31.433  1.00 13.97 ? 489 TYR B CD1 1 
ATOM   7920  C  CD2 . TYR B 1 489 ? 2.454   42.544  32.846  1.00 13.95 ? 489 TYR B CD2 1 
ATOM   7921  C  CE1 . TYR B 1 489 ? 3.974   40.264  32.385  1.00 13.72 ? 489 TYR B CE1 1 
ATOM   7922  C  CE2 . TYR B 1 489 ? 3.373   42.114  33.802  1.00 13.73 ? 489 TYR B CE2 1 
ATOM   7923  C  CZ  . TYR B 1 489 ? 4.128   40.975  33.563  1.00 13.67 ? 489 TYR B CZ  1 
ATOM   7924  O  OH  . TYR B 1 489 ? 5.040   40.550  34.497  1.00 13.55 ? 489 TYR B OH  1 
ATOM   7925  N  N   . GLY B 1 490 ? -1.018  40.280  30.033  1.00 14.11 ? 490 GLY B N   1 
ATOM   7926  C  CA  . GLY B 1 490 ? -1.848  39.162  30.448  1.00 13.73 ? 490 GLY B CA  1 
ATOM   7927  C  C   . GLY B 1 490 ? -2.027  38.123  29.352  1.00 13.83 ? 490 GLY B C   1 
ATOM   7928  O  O   . GLY B 1 490 ? -1.612  36.972  29.505  1.00 13.69 ? 490 GLY B O   1 
ATOM   7929  N  N   . SER B 1 491 ? -2.640  38.529  28.241  1.00 13.74 ? 491 SER B N   1 
ATOM   7930  C  CA  . SER B 1 491 ? -2.883  37.641  27.107  1.00 13.71 ? 491 SER B CA  1 
ATOM   7931  C  C   . SER B 1 491 ? -1.669  36.789  26.735  1.00 13.53 ? 491 SER B C   1 
ATOM   7932  O  O   . SER B 1 491 ? -1.744  35.562  26.706  1.00 13.41 ? 491 SER B O   1 
ATOM   7933  C  CB  . SER B 1 491 ? -3.318  38.461  25.891  1.00 14.01 ? 491 SER B CB  1 
ATOM   7934  O  OG  . SER B 1 491 ? -2.370  39.476  25.591  1.00 14.71 ? 491 SER B OG  1 
ATOM   7935  N  N   . HIS B 1 492 ? -0.554  37.448  26.445  1.00 13.67 ? 492 HIS B N   1 
ATOM   7936  C  CA  . HIS B 1 492 ? 0.676   36.754  26.071  1.00 13.79 ? 492 HIS B CA  1 
ATOM   7937  C  C   . HIS B 1 492 ? 0.961   35.573  27.002  1.00 13.57 ? 492 HIS B C   1 
ATOM   7938  O  O   . HIS B 1 492 ? 1.322   34.485  26.549  1.00 13.39 ? 492 HIS B O   1 
ATOM   7939  C  CB  . HIS B 1 492 ? 1.851   37.736  26.095  1.00 14.30 ? 492 HIS B CB  1 
ATOM   7940  C  CG  . HIS B 1 492 ? 3.049   37.263  25.334  1.00 15.16 ? 492 HIS B CG  1 
ATOM   7941  N  ND1 . HIS B 1 492 ? 4.105   38.093  25.016  1.00 15.53 ? 492 HIS B ND1 1 
ATOM   7942  C  CD2 . HIS B 1 492 ? 3.368   36.041  24.841  1.00 15.49 ? 492 HIS B CD2 1 
ATOM   7943  C  CE1 . HIS B 1 492 ? 5.023   37.402  24.362  1.00 15.82 ? 492 HIS B CE1 1 
ATOM   7944  N  NE2 . HIS B 1 492 ? 4.601   36.155  24.243  1.00 15.84 ? 492 HIS B NE2 1 
ATOM   7945  N  N   . ILE B 1 493 ? 0.798   35.796  28.303  1.00 13.44 ? 493 ILE B N   1 
ATOM   7946  C  CA  . ILE B 1 493 ? 1.026   34.744  29.284  1.00 13.42 ? 493 ILE B CA  1 
ATOM   7947  C  C   . ILE B 1 493 ? -0.042  33.674  29.081  1.00 13.40 ? 493 ILE B C   1 
ATOM   7948  O  O   . ILE B 1 493 ? 0.261   32.477  29.021  1.00 13.55 ? 493 ILE B O   1 
ATOM   7949  C  CB  . ILE B 1 493 ? 0.940   35.298  30.738  1.00 13.41 ? 493 ILE B CB  1 
ATOM   7950  C  CG1 . ILE B 1 493 ? 2.274   35.943  31.129  1.00 13.42 ? 493 ILE B CG1 1 
ATOM   7951  C  CG2 . ILE B 1 493 ? 0.600   34.176  31.721  1.00 13.25 ? 493 ILE B CG2 1 
ATOM   7952  C  CD1 . ILE B 1 493 ? 2.149   37.012  32.201  1.00 13.19 ? 493 ILE B CD1 1 
ATOM   7953  N  N   . GLN B 1 494 ? -1.292  34.119  28.969  1.00 13.16 ? 494 GLN B N   1 
ATOM   7954  C  CA  . GLN B 1 494 ? -2.417  33.215  28.773  1.00 13.05 ? 494 GLN B CA  1 
ATOM   7955  C  C   . GLN B 1 494 ? -2.127  32.277  27.605  1.00 13.01 ? 494 GLN B C   1 
ATOM   7956  O  O   . GLN B 1 494 ? -2.292  31.060  27.707  1.00 12.68 ? 494 GLN B O   1 
ATOM   7957  C  CB  . GLN B 1 494 ? -3.689  34.022  28.496  1.00 12.95 ? 494 GLN B CB  1 
ATOM   7958  C  CG  . GLN B 1 494 ? -4.827  33.756  29.469  1.00 13.12 ? 494 GLN B CG  1 
ATOM   7959  C  CD  . GLN B 1 494 ? -5.036  32.278  29.736  1.00 13.27 ? 494 GLN B CD  1 
ATOM   7960  O  OE1 . GLN B 1 494 ? -5.234  31.863  30.878  1.00 13.45 ? 494 GLN B OE1 1 
ATOM   7961  N  NE2 . GLN B 1 494 ? -4.993  31.474  28.680  1.00 13.53 ? 494 GLN B NE2 1 
ATOM   7962  N  N   . ALA B 1 495 ? -1.682  32.868  26.499  1.00 13.24 ? 495 ALA B N   1 
ATOM   7963  C  CA  . ALA B 1 495 ? -1.358  32.130  25.289  1.00 13.33 ? 495 ALA B CA  1 
ATOM   7964  C  C   . ALA B 1 495 ? -0.338  31.042  25.582  1.00 13.62 ? 495 ALA B C   1 
ATOM   7965  O  O   . ALA B 1 495 ? -0.479  29.905  25.120  1.00 13.82 ? 495 ALA B O   1 
ATOM   7966  C  CB  . ALA B 1 495 ? -0.814  33.086  24.233  1.00 13.53 ? 495 ALA B CB  1 
ATOM   7967  N  N   . LEU B 1 496 ? 0.690   31.398  26.350  1.00 13.41 ? 496 LEU B N   1 
ATOM   7968  C  CA  . LEU B 1 496 ? 1.745   30.454  26.699  1.00 13.32 ? 496 LEU B CA  1 
ATOM   7969  C  C   . LEU B 1 496 ? 1.215   29.328  27.575  1.00 13.50 ? 496 LEU B C   1 
ATOM   7970  O  O   . LEU B 1 496 ? 1.573   28.159  27.389  1.00 13.59 ? 496 LEU B O   1 
ATOM   7971  C  CB  . LEU B 1 496 ? 2.886   31.178  27.415  1.00 12.86 ? 496 LEU B CB  1 
ATOM   7972  C  CG  . LEU B 1 496 ? 3.974   31.789  26.528  1.00 12.35 ? 496 LEU B CG  1 
ATOM   7973  C  CD1 . LEU B 1 496 ? 4.971   32.536  27.383  1.00 12.03 ? 496 LEU B CD1 1 
ATOM   7974  C  CD2 . LEU B 1 496 ? 4.674   30.692  25.747  1.00 12.45 ? 496 LEU B CD2 1 
ATOM   7975  N  N   . LEU B 1 497 ? 0.355   29.679  28.529  1.00 13.64 ? 497 LEU B N   1 
ATOM   7976  C  CA  . LEU B 1 497 ? -0.224  28.686  29.434  1.00 13.68 ? 497 LEU B CA  1 
ATOM   7977  C  C   . LEU B 1 497 ? -1.039  27.663  28.654  1.00 13.81 ? 497 LEU B C   1 
ATOM   7978  O  O   . LEU B 1 497 ? -0.896  26.459  28.864  1.00 13.97 ? 497 LEU B O   1 
ATOM   7979  C  CB  . LEU B 1 497 ? -1.118  29.359  30.478  1.00 13.43 ? 497 LEU B CB  1 
ATOM   7980  C  CG  . LEU B 1 497 ? -0.439  30.322  31.452  1.00 13.17 ? 497 LEU B CG  1 
ATOM   7981  C  CD1 . LEU B 1 497 ? -1.496  31.022  32.286  1.00 13.20 ? 497 LEU B CD1 1 
ATOM   7982  C  CD2 . LEU B 1 497 ? 0.528   29.559  32.337  1.00 12.78 ? 497 LEU B CD2 1 
ATOM   7983  N  N   . ASP B 1 498 ? -1.890  28.147  27.751  1.00 14.17 ? 498 ASP B N   1 
ATOM   7984  C  CA  . ASP B 1 498 ? -2.727  27.271  26.934  1.00 14.33 ? 498 ASP B CA  1 
ATOM   7985  C  C   . ASP B 1 498 ? -1.891  26.176  26.278  1.00 14.43 ? 498 ASP B C   1 
ATOM   7986  O  O   . ASP B 1 498 ? -2.340  25.037  26.138  1.00 14.45 ? 498 ASP B O   1 
ATOM   7987  C  CB  . ASP B 1 498 ? -3.449  28.083  25.860  1.00 14.45 ? 498 ASP B CB  1 
ATOM   7988  C  CG  . ASP B 1 498 ? -4.407  29.102  26.450  1.00 14.68 ? 498 ASP B CG  1 
ATOM   7989  O  OD1 . ASP B 1 498 ? -4.752  28.972  27.644  1.00 14.81 ? 498 ASP B OD1 1 
ATOM   7990  O  OD2 . ASP B 1 498 ? -4.818  30.034  25.724  1.00 14.98 ? 498 ASP B OD2 1 
ATOM   7991  N  N   . LYS B 1 499 ? -0.669  26.523  25.885  1.00 14.23 ? 499 LYS B N   1 
ATOM   7992  C  CA  . LYS B 1 499 ? 0.224   25.560  25.254  1.00 14.17 ? 499 LYS B CA  1 
ATOM   7993  C  C   . LYS B 1 499 ? 0.583   24.452  26.237  1.00 14.06 ? 499 LYS B C   1 
ATOM   7994  O  O   . LYS B 1 499 ? 0.345   23.272  25.965  1.00 13.98 ? 499 LYS B O   1 
ATOM   7995  C  CB  . LYS B 1 499 ? 1.502   26.255  24.772  1.00 14.24 ? 499 LYS B CB  1 
ATOM   7996  C  CG  . LYS B 1 499 ? 2.316   25.447  23.760  1.00 14.11 ? 499 LYS B CG  1 
ATOM   7997  C  CD  . LYS B 1 499 ? 2.153   25.997  22.341  1.00 13.81 ? 499 LYS B CD  1 
ATOM   7998  C  CE  . LYS B 1 499 ? 3.402   25.752  21.498  1.00 13.56 ? 499 LYS B CE  1 
ATOM   7999  N  NZ  . LYS B 1 499 ? 4.652   26.132  22.222  1.00 13.20 ? 499 LYS B NZ  1 
ATOM   8000  N  N   . TYR B 1 500 ? 1.154   24.842  27.375  1.00 14.08 ? 500 TYR B N   1 
ATOM   8001  C  CA  . TYR B 1 500 ? 1.550   23.891  28.415  1.00 14.10 ? 500 TYR B CA  1 
ATOM   8002  C  C   . TYR B 1 500 ? 0.354   23.129  28.980  1.00 14.26 ? 500 TYR B C   1 
ATOM   8003  O  O   . TYR B 1 500 ? 0.399   21.904  29.133  1.00 13.92 ? 500 TYR B O   1 
ATOM   8004  C  CB  . TYR B 1 500 ? 2.248   24.624  29.554  1.00 14.13 ? 500 TYR B CB  1 
ATOM   8005  C  CG  . TYR B 1 500 ? 3.381   25.515  29.111  1.00 14.29 ? 500 TYR B CG  1 
ATOM   8006  C  CD1 . TYR B 1 500 ? 4.196   25.157  28.040  1.00 14.43 ? 500 TYR B CD1 1 
ATOM   8007  C  CD2 . TYR B 1 500 ? 3.664   26.701  29.787  1.00 14.24 ? 500 TYR B CD2 1 
ATOM   8008  C  CE1 . TYR B 1 500 ? 5.270   25.954  27.654  1.00 14.39 ? 500 TYR B CE1 1 
ATOM   8009  C  CE2 . TYR B 1 500 ? 4.733   27.503  29.411  1.00 14.22 ? 500 TYR B CE2 1 
ATOM   8010  C  CZ  . TYR B 1 500 ? 5.533   27.122  28.345  1.00 14.29 ? 500 TYR B CZ  1 
ATOM   8011  O  OH  . TYR B 1 500 ? 6.604   27.899  27.978  1.00 14.23 ? 500 TYR B OH  1 
ATOM   8012  N  N   . ASN B 1 501 ? -0.710  23.862  29.298  1.00 14.40 ? 501 ASN B N   1 
ATOM   8013  C  CA  . ASN B 1 501 ? -1.916  23.254  29.840  1.00 14.89 ? 501 ASN B CA  1 
ATOM   8014  C  C   . ASN B 1 501 ? -2.428  22.184  28.888  1.00 15.18 ? 501 ASN B C   1 
ATOM   8015  O  O   . ASN B 1 501 ? -2.942  21.144  29.318  1.00 15.55 ? 501 ASN B O   1 
ATOM   8016  C  CB  . ASN B 1 501 ? -2.993  24.318  30.060  1.00 14.83 ? 501 ASN B CB  1 
ATOM   8017  C  CG  . ASN B 1 501 ? -2.789  25.082  31.352  1.00 14.75 ? 501 ASN B CG  1 
ATOM   8018  O  OD1 . ASN B 1 501 ? -1.864  24.794  32.116  1.00 14.72 ? 501 ASN B OD1 1 
ATOM   8019  N  ND2 . ASN B 1 501 ? -3.649  26.063  31.604  1.00 14.56 ? 501 ASN B ND2 1 
ATOM   8020  N  N   . ALA B 1 502 ? -2.276  22.447  27.592  1.00 15.17 ? 502 ALA B N   1 
ATOM   8021  C  CA  . ALA B 1 502 ? -2.706  21.515  26.559  1.00 14.84 ? 502 ALA B CA  1 
ATOM   8022  C  C   . ALA B 1 502 ? -2.056  20.150  26.788  1.00 14.47 ? 502 ALA B C   1 
ATOM   8023  O  O   . ALA B 1 502 ? -2.726  19.196  27.179  1.00 14.24 ? 502 ALA B O   1 
ATOM   8024  C  CB  . ALA B 1 502 ? -2.331  22.060  25.180  1.00 15.07 ? 502 ALA B CB  1 
ATOM   8025  N  N   . GLU B 1 503 ? -0.749  20.069  26.552  1.00 14.42 ? 503 GLU B N   1 
ATOM   8026  C  CA  . GLU B 1 503 ? -0.015  18.824  26.735  1.00 14.36 ? 503 GLU B CA  1 
ATOM   8027  C  C   . GLU B 1 503 ? 1.467   18.993  26.418  1.00 14.43 ? 503 GLU B C   1 
ATOM   8028  O  O   . GLU B 1 503 ? 2.209   17.995  26.577  1.00 14.47 ? 503 GLU B O   1 
ATOM   8029  C  CB  . GLU B 1 503 ? -0.611  17.734  25.854  1.00 14.39 ? 503 GLU B CB  1 
ATOM   8030  N  N   . SER C 1 4   ? -5.780  14.367  38.195  1.00 14.17 ? 4   SER C N   1 
ATOM   8031  C  CA  . SER C 1 4   ? -5.038  15.626  37.881  1.00 14.13 ? 4   SER C CA  1 
ATOM   8032  C  C   . SER C 1 4   ? -3.518  15.432  37.978  1.00 14.19 ? 4   SER C C   1 
ATOM   8033  O  O   . SER C 1 4   ? -2.893  14.977  37.015  1.00 14.35 ? 4   SER C O   1 
ATOM   8034  C  CB  . SER C 1 4   ? -5.494  16.755  38.818  1.00 13.93 ? 4   SER C CB  1 
ATOM   8035  O  OG  . SER C 1 4   ? -6.835  17.142  38.544  1.00 13.48 ? 4   SER C OG  1 
ATOM   8036  N  N   . ARG C 1 5   ? -2.923  15.768  39.125  1.00 14.01 ? 5   ARG C N   1 
ATOM   8037  C  CA  . ARG C 1 5   ? -1.473  15.617  39.296  1.00 14.00 ? 5   ARG C CA  1 
ATOM   8038  C  C   . ARG C 1 5   ? -1.101  14.627  40.395  1.00 13.87 ? 5   ARG C C   1 
ATOM   8039  O  O   . ARG C 1 5   ? -1.973  14.079  41.073  1.00 13.89 ? 5   ARG C O   1 
ATOM   8040  C  CB  . ARG C 1 5   ? -0.817  16.967  39.604  1.00 13.91 ? 5   ARG C CB  1 
ATOM   8041  C  CG  . ARG C 1 5   ? -1.707  18.173  39.349  1.00 13.86 ? 5   ARG C CG  1 
ATOM   8042  C  CD  . ARG C 1 5   ? -1.806  19.044  40.585  1.00 13.82 ? 5   ARG C CD  1 
ATOM   8043  N  NE  . ARG C 1 5   ? -1.068  20.296  40.437  1.00 13.56 ? 5   ARG C NE  1 
ATOM   8044  C  CZ  . ARG C 1 5   ? -0.971  21.221  41.385  1.00 13.34 ? 5   ARG C CZ  1 
ATOM   8045  N  NH1 . ARG C 1 5   ? -1.567  21.039  42.560  1.00 13.00 ? 5   ARG C NH1 1 
ATOM   8046  N  NH2 . ARG C 1 5   ? -0.280  22.329  41.153  1.00 13.16 ? 5   ARG C NH2 1 
ATOM   8047  N  N   . ASP C 1 6   ? 0.201   14.406  40.568  1.00 13.64 ? 6   ASP C N   1 
ATOM   8048  C  CA  . ASP C 1 6   ? 0.688   13.486  41.587  1.00 13.35 ? 6   ASP C CA  1 
ATOM   8049  C  C   . ASP C 1 6   ? 0.187   13.945  42.951  1.00 13.23 ? 6   ASP C C   1 
ATOM   8050  O  O   . ASP C 1 6   ? 0.082   15.145  43.217  1.00 13.09 ? 6   ASP C O   1 
ATOM   8051  C  CB  . ASP C 1 6   ? 2.220   13.422  41.574  1.00 13.57 ? 6   ASP C CB  1 
ATOM   8052  C  CG  . ASP C 1 6   ? 2.862   14.748  41.913  1.00 13.76 ? 6   ASP C CG  1 
ATOM   8053  O  OD1 . ASP C 1 6   ? 3.937   14.743  42.549  1.00 13.92 ? 6   ASP C OD1 1 
ATOM   8054  O  OD2 . ASP C 1 6   ? 2.289   15.796  41.543  1.00 14.04 ? 6   ASP C OD2 1 
ATOM   8055  N  N   . PRO C 1 7   ? -0.129  12.987  43.835  1.00 13.03 ? 7   PRO C N   1 
ATOM   8056  C  CA  . PRO C 1 7   ? -0.627  13.309  45.175  1.00 12.91 ? 7   PRO C CA  1 
ATOM   8057  C  C   . PRO C 1 7   ? 0.242   14.315  45.913  1.00 12.66 ? 7   PRO C C   1 
ATOM   8058  O  O   . PRO C 1 7   ? -0.266  15.133  46.672  1.00 12.71 ? 7   PRO C O   1 
ATOM   8059  C  CB  . PRO C 1 7   ? -0.678  11.948  45.887  1.00 12.82 ? 7   PRO C CB  1 
ATOM   8060  C  CG  . PRO C 1 7   ? 0.104   11.017  45.025  1.00 12.88 ? 7   PRO C CG  1 
ATOM   8061  C  CD  . PRO C 1 7   ? -0.017  11.535  43.629  1.00 12.92 ? 7   PRO C CD  1 
ATOM   8062  N  N   . ALA C 1 8   ? 1.548   14.256  45.677  1.00 12.47 ? 8   ALA C N   1 
ATOM   8063  C  CA  . ALA C 1 8   ? 2.494   15.150  46.336  1.00 12.52 ? 8   ALA C CA  1 
ATOM   8064  C  C   . ALA C 1 8   ? 2.260   16.623  46.014  1.00 12.50 ? 8   ALA C C   1 
ATOM   8065  O  O   . ALA C 1 8   ? 2.488   17.493  46.851  1.00 12.31 ? 8   ALA C O   1 
ATOM   8066  C  CB  . ALA C 1 8   ? 3.928   14.754  45.965  1.00 12.26 ? 8   ALA C CB  1 
ATOM   8067  N  N   . SER C 1 9   ? 1.799   16.901  44.802  1.00 12.93 ? 9   SER C N   1 
ATOM   8068  C  CA  . SER C 1 9   ? 1.555   18.276  44.391  1.00 13.36 ? 9   SER C CA  1 
ATOM   8069  C  C   . SER C 1 9   ? 0.219   18.804  44.894  1.00 13.39 ? 9   SER C C   1 
ATOM   8070  O  O   . SER C 1 9   ? 0.080   19.997  45.170  1.00 13.45 ? 9   SER C O   1 
ATOM   8071  C  CB  . SER C 1 9   ? 1.617   18.386  42.864  1.00 13.77 ? 9   SER C CB  1 
ATOM   8072  O  OG  . SER C 1 9   ? 2.963   18.438  42.412  1.00 14.64 ? 9   SER C OG  1 
ATOM   8073  N  N   . ASP C 1 10  ? -0.758  17.912  45.018  1.00 13.37 ? 10  ASP C N   1 
ATOM   8074  C  CA  . ASP C 1 10  ? -2.084  18.302  45.472  1.00 13.33 ? 10  ASP C CA  1 
ATOM   8075  C  C   . ASP C 1 10  ? -2.284  18.179  46.978  1.00 13.13 ? 10  ASP C C   1 
ATOM   8076  O  O   . ASP C 1 10  ? -3.372  17.843  47.432  1.00 12.99 ? 10  ASP C O   1 
ATOM   8077  C  CB  . ASP C 1 10  ? -3.152  17.480  44.747  1.00 13.74 ? 10  ASP C CB  1 
ATOM   8078  C  CG  . ASP C 1 10  ? -3.035  17.574  43.230  1.00 14.14 ? 10  ASP C CG  1 
ATOM   8079  O  OD1 . ASP C 1 10  ? -2.387  16.690  42.628  1.00 14.49 ? 10  ASP C OD1 1 
ATOM   8080  O  OD2 . ASP C 1 10  ? -3.591  18.527  42.637  1.00 14.65 ? 10  ASP C OD2 1 
ATOM   8081  N  N   . GLN C 1 11  ? -1.237  18.452  47.751  1.00 13.27 ? 11  GLN C N   1 
ATOM   8082  C  CA  . GLN C 1 11  ? -1.335  18.395  49.209  1.00 13.39 ? 11  GLN C CA  1 
ATOM   8083  C  C   . GLN C 1 11  ? -2.393  19.397  49.671  1.00 13.46 ? 11  GLN C C   1 
ATOM   8084  O  O   . GLN C 1 11  ? -3.476  19.016  50.115  1.00 13.16 ? 11  GLN C O   1 
ATOM   8085  C  CB  . GLN C 1 11  ? 0.008   18.756  49.844  1.00 13.73 ? 11  GLN C CB  1 
ATOM   8086  C  CG  . GLN C 1 11  ? 0.050   18.586  51.356  1.00 14.13 ? 11  GLN C CG  1 
ATOM   8087  C  CD  . GLN C 1 11  ? -0.464  19.805  52.106  1.00 14.26 ? 11  GLN C CD  1 
ATOM   8088  O  OE1 . GLN C 1 11  ? -0.150  20.949  51.757  1.00 14.17 ? 11  GLN C OE1 1 
ATOM   8089  N  NE2 . GLN C 1 11  ? -1.261  19.564  53.147  1.00 14.20 ? 11  GLN C NE2 1 
ATOM   8090  N  N   . MET C 1 12  ? -2.066  20.682  49.553  1.00 13.65 ? 12  MET C N   1 
ATOM   8091  C  CA  . MET C 1 12  ? -2.973  21.754  49.946  1.00 13.94 ? 12  MET C CA  1 
ATOM   8092  C  C   . MET C 1 12  ? -4.390  21.516  49.427  1.00 14.14 ? 12  MET C C   1 
ATOM   8093  O  O   . MET C 1 12  ? -5.379  21.781  50.124  1.00 14.31 ? 12  MET C O   1 
ATOM   8094  C  CB  . MET C 1 12  ? -2.467  23.090  49.409  1.00 14.27 ? 12  MET C CB  1 
ATOM   8095  C  CG  . MET C 1 12  ? -1.429  23.768  50.287  1.00 14.69 ? 12  MET C CG  1 
ATOM   8096  S  SD  . MET C 1 12  ? -1.274  25.545  49.927  1.00 15.26 ? 12  MET C SD  1 
ATOM   8097  C  CE  . MET C 1 12  ? -0.858  25.509  48.170  1.00 15.19 ? 12  MET C CE  1 
ATOM   8098  N  N   . GLN C 1 13  ? -4.489  21.021  48.198  1.00 13.94 ? 13  GLN C N   1 
ATOM   8099  C  CA  . GLN C 1 13  ? -5.790  20.762  47.599  1.00 13.68 ? 13  GLN C CA  1 
ATOM   8100  C  C   . GLN C 1 13  ? -6.550  19.688  48.370  1.00 13.34 ? 13  GLN C C   1 
ATOM   8101  O  O   . GLN C 1 13  ? -7.715  19.880  48.704  1.00 13.16 ? 13  GLN C O   1 
ATOM   8102  C  CB  . GLN C 1 13  ? -5.617  20.349  46.133  1.00 13.84 ? 13  GLN C CB  1 
ATOM   8103  C  CG  . GLN C 1 13  ? -6.914  20.039  45.393  1.00 13.86 ? 13  GLN C CG  1 
ATOM   8104  C  CD  . GLN C 1 13  ? -8.026  21.030  45.699  1.00 13.85 ? 13  GLN C CD  1 
ATOM   8105  O  OE1 . GLN C 1 13  ? -9.166  20.640  45.968  1.00 13.13 ? 13  GLN C OE1 1 
ATOM   8106  N  NE2 . GLN C 1 13  ? -7.698  22.321  45.656  1.00 14.24 ? 13  GLN C NE2 1 
ATOM   8107  N  N   . HIS C 1 14  ? -5.889  18.571  48.666  1.00 13.42 ? 14  HIS C N   1 
ATOM   8108  C  CA  . HIS C 1 14  ? -6.532  17.471  49.394  1.00 13.54 ? 14  HIS C CA  1 
ATOM   8109  C  C   . HIS C 1 14  ? -6.873  17.842  50.830  1.00 13.56 ? 14  HIS C C   1 
ATOM   8110  O  O   . HIS C 1 14  ? -7.868  17.359  51.382  1.00 13.37 ? 14  HIS C O   1 
ATOM   8111  C  CB  . HIS C 1 14  ? -5.642  16.226  49.396  1.00 13.78 ? 14  HIS C CB  1 
ATOM   8112  C  CG  . HIS C 1 14  ? -5.475  15.601  48.046  1.00 14.32 ? 14  HIS C CG  1 
ATOM   8113  N  ND1 . HIS C 1 14  ? -4.506  14.657  47.777  1.00 14.49 ? 14  HIS C ND1 1 
ATOM   8114  C  CD2 . HIS C 1 14  ? -6.142  15.796  46.882  1.00 14.57 ? 14  HIS C CD2 1 
ATOM   8115  C  CE1 . HIS C 1 14  ? -4.583  14.298  46.507  1.00 14.66 ? 14  HIS C CE1 1 
ATOM   8116  N  NE2 . HIS C 1 14  ? -5.567  14.974  45.942  1.00 14.77 ? 14  HIS C NE2 1 
ATOM   8117  N  N   . TRP C 1 15  ? -6.045  18.691  51.435  1.00 13.56 ? 15  TRP C N   1 
ATOM   8118  C  CA  . TRP C 1 15  ? -6.290  19.120  52.807  1.00 13.64 ? 15  TRP C CA  1 
ATOM   8119  C  C   . TRP C 1 15  ? -7.571  19.940  52.815  1.00 13.72 ? 15  TRP C C   1 
ATOM   8120  O  O   . TRP C 1 15  ? -8.401  19.814  53.717  1.00 13.75 ? 15  TRP C O   1 
ATOM   8121  C  CB  . TRP C 1 15  ? -5.127  19.965  53.326  1.00 13.63 ? 15  TRP C CB  1 
ATOM   8122  C  CG  . TRP C 1 15  ? -5.293  20.389  54.756  1.00 13.57 ? 15  TRP C CG  1 
ATOM   8123  C  CD1 . TRP C 1 15  ? -4.928  19.685  55.871  1.00 13.61 ? 15  TRP C CD1 1 
ATOM   8124  C  CD2 . TRP C 1 15  ? -5.841  21.629  55.228  1.00 13.38 ? 15  TRP C CD2 1 
ATOM   8125  N  NE1 . TRP C 1 15  ? -5.214  20.409  57.006  1.00 13.46 ? 15  TRP C NE1 1 
ATOM   8126  C  CE2 . TRP C 1 15  ? -5.774  21.606  56.640  1.00 13.29 ? 15  TRP C CE2 1 
ATOM   8127  C  CE3 . TRP C 1 15  ? -6.382  22.757  54.594  1.00 13.18 ? 15  TRP C CE3 1 
ATOM   8128  C  CZ2 . TRP C 1 15  ? -6.229  22.669  57.430  1.00 12.98 ? 15  TRP C CZ2 1 
ATOM   8129  C  CZ3 . TRP C 1 15  ? -6.834  23.815  55.382  1.00 12.92 ? 15  TRP C CZ3 1 
ATOM   8130  C  CH2 . TRP C 1 15  ? -6.753  23.761  56.784  1.00 12.77 ? 15  TRP C CH2 1 
ATOM   8131  N  N   . LYS C 1 16  ? -7.728  20.772  51.792  1.00 13.84 ? 16  LYS C N   1 
ATOM   8132  C  CA  . LYS C 1 16  ? -8.914  21.608  51.664  1.00 14.07 ? 16  LYS C CA  1 
ATOM   8133  C  C   . LYS C 1 16  ? -10.137 20.720  51.471  1.00 14.15 ? 16  LYS C C   1 
ATOM   8134  O  O   . LYS C 1 16  ? -11.210 21.000  52.015  1.00 14.14 ? 16  LYS C O   1 
ATOM   8135  C  CB  . LYS C 1 16  ? -8.766  22.567  50.470  1.00 13.99 ? 16  LYS C CB  1 
ATOM   8136  C  CG  . LYS C 1 16  ? -10.085 23.002  49.837  1.00 13.88 ? 16  LYS C CG  1 
ATOM   8137  C  CD  . LYS C 1 16  ? -10.189 24.512  49.714  1.00 13.77 ? 16  LYS C CD  1 
ATOM   8138  C  CE  . LYS C 1 16  ? -11.635 24.969  49.854  1.00 13.57 ? 16  LYS C CE  1 
ATOM   8139  N  NZ  . LYS C 1 16  ? -12.177 25.536  48.583  1.00 13.76 ? 16  LYS C NZ  1 
ATOM   8140  N  N   . GLU C 1 17  ? -9.967  19.650  50.698  1.00 14.05 ? 17  GLU C N   1 
ATOM   8141  C  CA  . GLU C 1 17  ? -11.053 18.717  50.429  1.00 14.16 ? 17  GLU C CA  1 
ATOM   8142  C  C   . GLU C 1 17  ? -11.535 18.046  51.711  1.00 14.28 ? 17  GLU C C   1 
ATOM   8143  O  O   . GLU C 1 17  ? -12.721 17.751  51.856  1.00 14.16 ? 17  GLU C O   1 
ATOM   8144  C  CB  . GLU C 1 17  ? -10.596 17.647  49.435  1.00 14.27 ? 17  GLU C CB  1 
ATOM   8145  C  CG  . GLU C 1 17  ? -11.467 17.544  48.187  1.00 14.47 ? 17  GLU C CG  1 
ATOM   8146  C  CD  . GLU C 1 17  ? -10.658 17.649  46.904  1.00 14.65 ? 17  GLU C CD  1 
ATOM   8147  O  OE1 . GLU C 1 17  ? -9.443  17.349  46.940  1.00 14.79 ? 17  GLU C OE1 1 
ATOM   8148  O  OE2 . GLU C 1 17  ? -11.237 18.029  45.862  1.00 14.64 ? 17  GLU C OE2 1 
ATOM   8149  N  N   . GLN C 1 18  ? -10.614 17.800  52.638  1.00 14.48 ? 18  GLN C N   1 
ATOM   8150  C  CA  . GLN C 1 18  ? -10.964 17.162  53.902  1.00 14.78 ? 18  GLN C CA  1 
ATOM   8151  C  C   . GLN C 1 18  ? -11.943 18.033  54.680  1.00 14.77 ? 18  GLN C C   1 
ATOM   8152  O  O   . GLN C 1 18  ? -12.823 17.527  55.375  1.00 14.82 ? 18  GLN C O   1 
ATOM   8153  C  CB  . GLN C 1 18  ? -9.709  16.919  54.744  1.00 14.98 ? 18  GLN C CB  1 
ATOM   8154  C  CG  . GLN C 1 18  ? -8.951  15.642  54.383  1.00 15.18 ? 18  GLN C CG  1 
ATOM   8155  C  CD  . GLN C 1 18  ? -7.614  15.537  55.102  1.00 15.26 ? 18  GLN C CD  1 
ATOM   8156  O  OE1 . GLN C 1 18  ? -6.962  14.490  55.069  1.00 15.28 ? 18  GLN C OE1 1 
ATOM   8157  N  NE2 . GLN C 1 18  ? -7.198  16.625  55.759  1.00 15.13 ? 18  GLN C NE2 1 
ATOM   8158  N  N   . ARG C 1 19  ? -11.783 19.346  54.564  1.00 14.96 ? 19  ARG C N   1 
ATOM   8159  C  CA  . ARG C 1 19  ? -12.665 20.278  55.254  1.00 15.15 ? 19  ARG C CA  1 
ATOM   8160  C  C   . ARG C 1 19  ? -13.921 20.507  54.416  1.00 15.43 ? 19  ARG C C   1 
ATOM   8161  O  O   . ARG C 1 19  ? -14.032 21.506  53.695  1.00 15.43 ? 19  ARG C O   1 
ATOM   8162  C  CB  . ARG C 1 19  ? -11.944 21.606  55.496  1.00 15.03 ? 19  ARG C CB  1 
ATOM   8163  C  CG  . ARG C 1 19  ? -10.547 21.455  56.081  1.00 15.20 ? 19  ARG C CG  1 
ATOM   8164  C  CD  . ARG C 1 19  ? -10.544 20.508  57.276  1.00 15.64 ? 19  ARG C CD  1 
ATOM   8165  N  NE  . ARG C 1 19  ? -9.335  19.684  57.321  1.00 16.31 ? 19  ARG C NE  1 
ATOM   8166  C  CZ  . ARG C 1 19  ? -9.259  18.481  57.893  1.00 16.70 ? 19  ARG C CZ  1 
ATOM   8167  N  NH1 . ARG C 1 19  ? -10.330 17.949  58.477  1.00 17.07 ? 19  ARG C NH1 1 
ATOM   8168  N  NH2 . ARG C 1 19  ? -8.108  17.808  57.886  1.00 16.65 ? 19  ARG C NH2 1 
ATOM   8169  N  N   . ALA C 1 20  ? -14.861 19.570  54.523  1.00 15.22 ? 20  ALA C N   1 
ATOM   8170  C  CA  . ALA C 1 20  ? -16.116 19.632  53.788  1.00 15.33 ? 20  ALA C CA  1 
ATOM   8171  C  C   . ALA C 1 20  ? -16.928 20.895  54.069  1.00 15.44 ? 20  ALA C C   1 
ATOM   8172  O  O   . ALA C 1 20  ? -16.716 21.940  53.439  1.00 15.44 ? 20  ALA C O   1 
ATOM   8173  C  CB  . ALA C 1 20  ? -16.953 18.403  54.102  1.00 15.29 ? 20  ALA C CB  1 
ATOM   8174  N  N   . ALA C 1 21  ? -17.863 20.793  55.012  1.00 15.35 ? 21  ALA C N   1 
ATOM   8175  C  CA  . ALA C 1 21  ? -18.727 21.918  55.368  1.00 15.22 ? 21  ALA C CA  1 
ATOM   8176  C  C   . ALA C 1 21  ? -18.196 22.701  56.565  1.00 15.23 ? 21  ALA C C   1 
ATOM   8177  O  O   . ALA C 1 21  ? -18.766 23.730  56.951  1.00 15.16 ? 21  ALA C O   1 
ATOM   8178  C  CB  . ALA C 1 21  ? -20.138 21.418  55.660  1.00 15.32 ? 21  ALA C CB  1 
ATOM   8179  N  N   . GLN C 1 22  ? -17.109 22.210  57.156  1.00 15.21 ? 22  GLN C N   1 
ATOM   8180  C  CA  . GLN C 1 22  ? -16.511 22.881  58.304  1.00 14.94 ? 22  GLN C CA  1 
ATOM   8181  C  C   . GLN C 1 22  ? -16.022 24.259  57.887  1.00 14.66 ? 22  GLN C C   1 
ATOM   8182  O  O   . GLN C 1 22  ? -15.436 24.420  56.809  1.00 14.82 ? 22  GLN C O   1 
ATOM   8183  C  CB  . GLN C 1 22  ? -15.331 22.074  58.850  1.00 15.14 ? 22  GLN C CB  1 
ATOM   8184  C  CG  . GLN C 1 22  ? -14.712 21.120  57.849  1.00 15.45 ? 22  GLN C CG  1 
ATOM   8185  C  CD  . GLN C 1 22  ? -15.003 19.673  58.187  1.00 15.63 ? 22  GLN C CD  1 
ATOM   8186  O  OE1 . GLN C 1 22  ? -16.163 19.270  58.292  1.00 15.77 ? 22  GLN C OE1 1 
ATOM   8187  N  NE2 . GLN C 1 22  ? -13.949 18.880  58.362  1.00 15.86 ? 22  GLN C NE2 1 
ATOM   8188  N  N   . LYS C 1 23  ? -16.277 25.254  58.730  1.00 14.42 ? 23  LYS C N   1 
ATOM   8189  C  CA  . LYS C 1 23  ? -15.830 26.608  58.441  1.00 13.94 ? 23  LYS C CA  1 
ATOM   8190  C  C   . LYS C 1 23  ? -14.371 26.719  58.869  1.00 13.60 ? 23  LYS C C   1 
ATOM   8191  O  O   . LYS C 1 23  ? -13.826 25.805  59.503  1.00 13.33 ? 23  LYS C O   1 
ATOM   8192  C  CB  . LYS C 1 23  ? -16.676 27.627  59.198  1.00 14.16 ? 23  LYS C CB  1 
ATOM   8193  C  CG  . LYS C 1 23  ? -17.013 28.864  58.387  1.00 14.41 ? 23  LYS C CG  1 
ATOM   8194  C  CD  . LYS C 1 23  ? -16.201 30.066  58.848  1.00 14.71 ? 23  LYS C CD  1 
ATOM   8195  C  CE  . LYS C 1 23  ? -15.109 30.427  57.837  1.00 14.83 ? 23  LYS C CE  1 
ATOM   8196  N  NZ  . LYS C 1 23  ? -14.848 31.897  57.787  1.00 14.97 ? 23  LYS C NZ  1 
ATOM   8197  N  N   . ALA C 1 24  ? -13.740 27.833  58.514  1.00 13.38 ? 24  ALA C N   1 
ATOM   8198  C  CA  . ALA C 1 24  ? -12.338 28.055  58.852  1.00 13.28 ? 24  ALA C CA  1 
ATOM   8199  C  C   . ALA C 1 24  ? -12.144 28.357  60.343  1.00 13.35 ? 24  ALA C C   1 
ATOM   8200  O  O   . ALA C 1 24  ? -12.937 29.079  60.961  1.00 13.18 ? 24  ALA C O   1 
ATOM   8201  C  CB  . ALA C 1 24  ? -11.780 29.190  58.008  1.00 13.32 ? 24  ALA C CB  1 
ATOM   8202  N  N   . ASP C 1 25  ? -11.085 27.791  60.915  1.00 13.22 ? 25  ASP C N   1 
ATOM   8203  C  CA  . ASP C 1 25  ? -10.776 27.997  62.321  1.00 13.06 ? 25  ASP C CA  1 
ATOM   8204  C  C   . ASP C 1 25  ? -10.545 29.483  62.539  1.00 13.03 ? 25  ASP C C   1 
ATOM   8205  O  O   . ASP C 1 25  ? -10.348 30.238  61.577  1.00 12.89 ? 25  ASP C O   1 
ATOM   8206  C  CB  . ASP C 1 25  ? -9.512  27.221  62.707  1.00 13.47 ? 25  ASP C CB  1 
ATOM   8207  C  CG  . ASP C 1 25  ? -9.819  25.903  63.406  1.00 13.76 ? 25  ASP C CG  1 
ATOM   8208  O  OD1 . ASP C 1 25  ? -10.293 25.941  64.565  1.00 14.53 ? 25  ASP C OD1 1 
ATOM   8209  O  OD2 . ASP C 1 25  ? -9.584  24.832  62.802  1.00 13.33 ? 25  ASP C OD2 1 
ATOM   8210  N  N   . VAL C 1 26  ? -10.577 29.906  63.798  1.00 12.78 ? 26  VAL C N   1 
ATOM   8211  C  CA  . VAL C 1 26  ? -10.353 31.308  64.118  1.00 12.69 ? 26  VAL C CA  1 
ATOM   8212  C  C   . VAL C 1 26  ? -8.857  31.543  64.270  1.00 12.56 ? 26  VAL C C   1 
ATOM   8213  O  O   . VAL C 1 26  ? -8.193  30.870  65.057  1.00 12.64 ? 26  VAL C O   1 
ATOM   8214  C  CB  . VAL C 1 26  ? -11.050 31.718  65.437  1.00 12.67 ? 26  VAL C CB  1 
ATOM   8215  C  CG1 . VAL C 1 26  ? -11.002 33.232  65.598  1.00 12.47 ? 26  VAL C CG1 1 
ATOM   8216  C  CG2 . VAL C 1 26  ? -12.488 31.227  65.443  1.00 12.80 ? 26  VAL C CG2 1 
ATOM   8217  N  N   . LEU C 1 27  ? -8.327  32.491  63.506  1.00 12.26 ? 27  LEU C N   1 
ATOM   8218  C  CA  . LEU C 1 27  ? -6.912  32.810  63.575  1.00 12.23 ? 27  LEU C CA  1 
ATOM   8219  C  C   . LEU C 1 27  ? -6.594  33.466  64.924  1.00 12.15 ? 27  LEU C C   1 
ATOM   8220  O  O   . LEU C 1 27  ? -7.165  34.496  65.281  1.00 11.86 ? 27  LEU C O   1 
ATOM   8221  C  CB  . LEU C 1 27  ? -6.539  33.748  62.427  1.00 12.11 ? 27  LEU C CB  1 
ATOM   8222  C  CG  . LEU C 1 27  ? -5.083  34.196  62.354  1.00 12.14 ? 27  LEU C CG  1 
ATOM   8223  C  CD1 . LEU C 1 27  ? -4.181  33.034  62.698  1.00 12.29 ? 27  LEU C CD1 1 
ATOM   8224  C  CD2 . LEU C 1 27  ? -4.775  34.724  60.971  1.00 12.10 ? 27  LEU C CD2 1 
ATOM   8225  N  N   . THR C 1 28  ? -5.682  32.857  65.672  1.00 12.04 ? 28  THR C N   1 
ATOM   8226  C  CA  . THR C 1 28  ? -5.309  33.379  66.980  1.00 12.16 ? 28  THR C CA  1 
ATOM   8227  C  C   . THR C 1 28  ? -3.811  33.567  67.097  1.00 12.51 ? 28  THR C C   1 
ATOM   8228  O  O   . THR C 1 28  ? -3.044  33.100  66.254  1.00 12.96 ? 28  THR C O   1 
ATOM   8229  C  CB  . THR C 1 28  ? -5.712  32.429  68.115  1.00 11.82 ? 28  THR C CB  1 
ATOM   8230  O  OG1 . THR C 1 28  ? -4.632  31.524  68.367  1.00 11.05 ? 28  THR C OG1 1 
ATOM   8231  C  CG2 . THR C 1 28  ? -6.955  31.640  67.747  1.00 11.70 ? 28  THR C CG2 1 
ATOM   8232  N  N   . THR C 1 29  ? -3.406  34.251  68.163  1.00 12.43 ? 29  THR C N   1 
ATOM   8233  C  CA  . THR C 1 29  ? -1.998  34.492  68.430  1.00 12.16 ? 29  THR C CA  1 
ATOM   8234  C  C   . THR C 1 29  ? -1.448  33.221  69.067  1.00 12.14 ? 29  THR C C   1 
ATOM   8235  O  O   . THR C 1 29  ? -2.036  32.145  68.940  1.00 12.01 ? 29  THR C O   1 
ATOM   8236  C  CB  . THR C 1 29  ? -1.799  35.666  69.410  1.00 11.95 ? 29  THR C CB  1 
ATOM   8237  O  OG1 . THR C 1 29  ? -2.464  35.375  70.643  1.00 11.69 ? 29  THR C OG1 1 
ATOM   8238  C  CG2 . THR C 1 29  ? -2.367  36.948  68.831  1.00 11.70 ? 29  THR C CG2 1 
ATOM   8239  N  N   . GLY C 1 30  ? -0.323  33.346  69.757  1.00 12.05 ? 30  GLY C N   1 
ATOM   8240  C  CA  . GLY C 1 30  ? 0.261   32.184  70.391  1.00 11.96 ? 30  GLY C CA  1 
ATOM   8241  C  C   . GLY C 1 30  ? -0.511  31.807  71.634  1.00 12.02 ? 30  GLY C C   1 
ATOM   8242  O  O   . GLY C 1 30  ? -0.785  30.633  71.871  1.00 11.90 ? 30  GLY C O   1 
ATOM   8243  N  N   . ALA C 1 31  ? -0.869  32.819  72.421  1.00 12.15 ? 31  ALA C N   1 
ATOM   8244  C  CA  . ALA C 1 31  ? -1.602  32.633  73.672  1.00 12.09 ? 31  ALA C CA  1 
ATOM   8245  C  C   . ALA C 1 31  ? -3.056  32.203  73.484  1.00 12.07 ? 31  ALA C C   1 
ATOM   8246  O  O   . ALA C 1 31  ? -3.769  31.946  74.460  1.00 12.07 ? 31  ALA C O   1 
ATOM   8247  C  CB  . ALA C 1 31  ? -1.546  33.913  74.492  1.00 12.42 ? 31  ALA C CB  1 
ATOM   8248  N  N   . GLY C 1 32  ? -3.497  32.129  72.233  1.00 11.92 ? 32  GLY C N   1 
ATOM   8249  C  CA  . GLY C 1 32  ? -4.860  31.712  71.965  1.00 11.62 ? 32  GLY C CA  1 
ATOM   8250  C  C   . GLY C 1 32  ? -5.811  32.870  71.787  1.00 11.57 ? 32  GLY C C   1 
ATOM   8251  O  O   . GLY C 1 32  ? -7.013  32.674  71.629  1.00 11.32 ? 32  GLY C O   1 
ATOM   8252  N  N   . ASN C 1 33  ? -5.277  34.084  71.820  1.00 11.89 ? 33  ASN C N   1 
ATOM   8253  C  CA  . ASN C 1 33  ? -6.104  35.269  71.643  1.00 12.42 ? 33  ASN C CA  1 
ATOM   8254  C  C   . ASN C 1 33  ? -6.425  35.437  70.159  1.00 12.62 ? 33  ASN C C   1 
ATOM   8255  O  O   . ASN C 1 33  ? -5.556  35.268  69.303  1.00 12.80 ? 33  ASN C O   1 
ATOM   8256  C  CB  . ASN C 1 33  ? -5.373  36.509  72.169  1.00 12.77 ? 33  ASN C CB  1 
ATOM   8257  C  CG  . ASN C 1 33  ? -4.992  36.384  73.639  1.00 13.04 ? 33  ASN C CG  1 
ATOM   8258  O  OD1 . ASN C 1 33  ? -3.847  36.626  74.021  1.00 13.15 ? 33  ASN C OD1 1 
ATOM   8259  N  ND2 . ASN C 1 33  ? -5.955  36.002  74.469  1.00 13.27 ? 33  ASN C ND2 1 
ATOM   8260  N  N   . PRO C 1 34  ? -7.685  35.761  69.834  1.00 12.60 ? 34  PRO C N   1 
ATOM   8261  C  CA  . PRO C 1 34  ? -8.067  35.939  68.428  1.00 12.45 ? 34  PRO C CA  1 
ATOM   8262  C  C   . PRO C 1 34  ? -7.402  37.160  67.788  1.00 12.24 ? 34  PRO C C   1 
ATOM   8263  O  O   . PRO C 1 34  ? -6.988  38.089  68.482  1.00 12.44 ? 34  PRO C O   1 
ATOM   8264  C  CB  . PRO C 1 34  ? -9.588  36.074  68.485  1.00 12.52 ? 34  PRO C CB  1 
ATOM   8265  C  CG  . PRO C 1 34  ? -9.861  36.597  69.861  1.00 12.52 ? 34  PRO C CG  1 
ATOM   8266  C  CD  . PRO C 1 34  ? -8.818  35.978  70.748  1.00 12.55 ? 34  PRO C CD  1 
ATOM   8267  N  N   . VAL C 1 35  ? -7.298  37.148  66.463  1.00 11.92 ? 35  VAL C N   1 
ATOM   8268  C  CA  . VAL C 1 35  ? -6.694  38.255  65.725  1.00 11.43 ? 35  VAL C CA  1 
ATOM   8269  C  C   . VAL C 1 35  ? -7.743  38.919  64.835  1.00 11.17 ? 35  VAL C C   1 
ATOM   8270  O  O   . VAL C 1 35  ? -8.474  38.237  64.117  1.00 10.97 ? 35  VAL C O   1 
ATOM   8271  C  CB  . VAL C 1 35  ? -5.529  37.765  64.843  1.00 11.45 ? 35  VAL C CB  1 
ATOM   8272  C  CG1 . VAL C 1 35  ? -4.770  38.945  64.288  1.00 11.69 ? 35  VAL C CG1 1 
ATOM   8273  C  CG2 . VAL C 1 35  ? -4.604  36.878  65.649  1.00 11.32 ? 35  VAL C CG2 1 
ATOM   8274  N  N   . GLY C 1 36  ? -7.817  40.246  64.890  1.00 10.89 ? 36  GLY C N   1 
ATOM   8275  C  CA  . GLY C 1 36  ? -8.788  40.971  64.086  1.00 10.85 ? 36  GLY C CA  1 
ATOM   8276  C  C   . GLY C 1 36  ? -8.329  41.267  62.668  1.00 10.99 ? 36  GLY C C   1 
ATOM   8277  O  O   . GLY C 1 36  ? -9.129  41.306  61.734  1.00 10.63 ? 36  GLY C O   1 
ATOM   8278  N  N   . ASP C 1 37  ? -7.030  41.484  62.508  1.00 11.46 ? 37  ASP C N   1 
ATOM   8279  C  CA  . ASP C 1 37  ? -6.449  41.773  61.205  1.00 11.97 ? 37  ASP C CA  1 
ATOM   8280  C  C   . ASP C 1 37  ? -4.968  41.433  61.250  1.00 12.19 ? 37  ASP C C   1 
ATOM   8281  O  O   . ASP C 1 37  ? -4.195  42.101  61.929  1.00 12.37 ? 37  ASP C O   1 
ATOM   8282  C  CB  . ASP C 1 37  ? -6.631  43.257  60.859  1.00 12.44 ? 37  ASP C CB  1 
ATOM   8283  C  CG  . ASP C 1 37  ? -5.973  43.645  59.531  1.00 12.74 ? 37  ASP C CG  1 
ATOM   8284  O  OD1 . ASP C 1 37  ? -6.172  44.800  59.079  1.00 12.52 ? 37  ASP C OD1 1 
ATOM   8285  O  OD2 . ASP C 1 37  ? -5.259  42.800  58.940  1.00 12.92 ? 37  ASP C OD2 1 
ATOM   8286  N  N   . LYS C 1 38  ? -4.582  40.388  60.525  1.00 12.48 ? 38  LYS C N   1 
ATOM   8287  C  CA  . LYS C 1 38  ? -3.190  39.956  60.468  1.00 12.48 ? 38  LYS C CA  1 
ATOM   8288  C  C   . LYS C 1 38  ? -2.562  40.354  59.132  1.00 12.61 ? 38  LYS C C   1 
ATOM   8289  O  O   . LYS C 1 38  ? -1.544  39.796  58.719  1.00 12.57 ? 38  LYS C O   1 
ATOM   8290  C  CB  . LYS C 1 38  ? -3.106  38.439  60.641  1.00 12.42 ? 38  LYS C CB  1 
ATOM   8291  C  CG  . LYS C 1 38  ? -1.742  37.944  61.099  1.00 12.24 ? 38  LYS C CG  1 
ATOM   8292  C  CD  . LYS C 1 38  ? -1.213  36.857  60.179  1.00 12.00 ? 38  LYS C CD  1 
ATOM   8293  C  CE  . LYS C 1 38  ? 0.023   37.329  59.442  1.00 11.92 ? 38  LYS C CE  1 
ATOM   8294  N  NZ  . LYS C 1 38  ? 0.132   36.716  58.084  1.00 12.39 ? 38  LYS C NZ  1 
ATOM   8295  N  N   . LEU C 1 39  ? -3.172  41.323  58.459  1.00 12.73 ? 39  LEU C N   1 
ATOM   8296  C  CA  . LEU C 1 39  ? -2.676  41.770  57.165  1.00 12.94 ? 39  LEU C CA  1 
ATOM   8297  C  C   . LEU C 1 39  ? -2.204  43.212  57.218  1.00 13.00 ? 39  LEU C C   1 
ATOM   8298  O  O   . LEU C 1 39  ? -1.819  43.788  56.195  1.00 12.96 ? 39  LEU C O   1 
ATOM   8299  C  CB  . LEU C 1 39  ? -3.772  41.637  56.104  1.00 12.90 ? 39  LEU C CB  1 
ATOM   8300  C  CG  . LEU C 1 39  ? -4.387  40.249  55.920  1.00 13.05 ? 39  LEU C CG  1 
ATOM   8301  C  CD1 . LEU C 1 39  ? -5.597  40.350  55.008  1.00 13.23 ? 39  LEU C CD1 1 
ATOM   8302  C  CD2 . LEU C 1 39  ? -3.359  39.296  55.334  1.00 13.14 ? 39  LEU C CD2 1 
ATOM   8303  N  N   . ASN C 1 40  ? -2.229  43.795  58.410  1.00 12.73 ? 40  ASN C N   1 
ATOM   8304  C  CA  . ASN C 1 40  ? -1.810  45.179  58.563  1.00 12.93 ? 40  ASN C CA  1 
ATOM   8305  C  C   . ASN C 1 40  ? -1.184  45.448  59.917  1.00 12.89 ? 40  ASN C C   1 
ATOM   8306  O  O   . ASN C 1 40  ? -1.717  45.055  60.945  1.00 12.89 ? 40  ASN C O   1 
ATOM   8307  C  CB  . ASN C 1 40  ? -3.005  46.118  58.364  1.00 12.87 ? 40  ASN C CB  1 
ATOM   8308  C  CG  . ASN C 1 40  ? -3.275  46.412  56.904  1.00 12.83 ? 40  ASN C CG  1 
ATOM   8309  O  OD1 . ASN C 1 40  ? -2.416  46.931  56.193  1.00 13.02 ? 40  ASN C OD1 1 
ATOM   8310  N  ND2 . ASN C 1 40  ? -4.471  46.074  56.447  1.00 12.89 ? 40  ASN C ND2 1 
ATOM   8311  N  N   . VAL C 1 41  ? -0.045  46.122  59.911  1.00 13.10 ? 41  VAL C N   1 
ATOM   8312  C  CA  . VAL C 1 41  ? 0.634   46.455  61.151  1.00 13.37 ? 41  VAL C CA  1 
ATOM   8313  C  C   . VAL C 1 41  ? 0.007   47.737  61.721  1.00 13.64 ? 41  VAL C C   1 
ATOM   8314  O  O   . VAL C 1 41  ? -0.562  48.537  60.974  1.00 13.90 ? 41  VAL C O   1 
ATOM   8315  C  CB  . VAL C 1 41  ? 2.154   46.651  60.897  1.00 13.25 ? 41  VAL C CB  1 
ATOM   8316  C  CG1 . VAL C 1 41  ? 2.548   48.120  61.056  1.00 13.15 ? 41  VAL C CG1 1 
ATOM   8317  C  CG2 . VAL C 1 41  ? 2.943   45.771  61.837  1.00 12.95 ? 41  VAL C CG2 1 
ATOM   8318  N  N   . ILE C 1 42  ? 0.107   47.926  63.036  1.00 13.40 ? 42  ILE C N   1 
ATOM   8319  C  CA  . ILE C 1 42  ? -0.460  49.107  63.682  1.00 12.98 ? 42  ILE C CA  1 
ATOM   8320  C  C   . ILE C 1 42  ? 0.504   50.291  63.673  1.00 13.05 ? 42  ILE C C   1 
ATOM   8321  O  O   . ILE C 1 42  ? 1.651   50.175  64.109  1.00 13.35 ? 42  ILE C O   1 
ATOM   8322  C  CB  . ILE C 1 42  ? -0.840  48.813  65.150  1.00 12.78 ? 42  ILE C CB  1 
ATOM   8323  C  CG1 . ILE C 1 42  ? -1.875  47.695  65.198  1.00 12.55 ? 42  ILE C CG1 1 
ATOM   8324  C  CG2 . ILE C 1 42  ? -1.386  50.072  65.819  1.00 11.88 ? 42  ILE C CG2 1 
ATOM   8325  C  CD1 . ILE C 1 42  ? -2.254  47.269  66.598  1.00 12.74 ? 42  ILE C CD1 1 
ATOM   8326  N  N   . THR C 1 43  ? 0.035   51.433  63.183  1.00 12.65 ? 43  THR C N   1 
ATOM   8327  C  CA  . THR C 1 43  ? 0.864   52.629  63.150  1.00 12.21 ? 43  THR C CA  1 
ATOM   8328  C  C   . THR C 1 43  ? 0.034   53.866  63.469  1.00 12.23 ? 43  THR C C   1 
ATOM   8329  O  O   . THR C 1 43  ? -1.186  53.872  63.287  1.00 12.14 ? 43  THR C O   1 
ATOM   8330  C  CB  . THR C 1 43  ? 1.534   52.810  61.777  1.00 11.73 ? 43  THR C CB  1 
ATOM   8331  O  OG1 . THR C 1 43  ? 0.542   53.095  60.787  1.00 11.20 ? 43  THR C OG1 1 
ATOM   8332  C  CG2 . THR C 1 43  ? 2.281   51.552  61.392  1.00 11.24 ? 43  THR C CG2 1 
ATOM   8333  N  N   . VAL C 1 44  ? 0.700   54.903  63.965  1.00 12.18 ? 44  VAL C N   1 
ATOM   8334  C  CA  . VAL C 1 44  ? 0.031   56.153  64.304  1.00 12.19 ? 44  VAL C CA  1 
ATOM   8335  C  C   . VAL C 1 44  ? -0.189  56.925  63.009  1.00 12.29 ? 44  VAL C C   1 
ATOM   8336  O  O   . VAL C 1 44  ? 0.713   57.605  62.511  1.00 12.42 ? 44  VAL C O   1 
ATOM   8337  C  CB  . VAL C 1 44  ? 0.886   57.002  65.285  1.00 12.16 ? 44  VAL C CB  1 
ATOM   8338  C  CG1 . VAL C 1 44  ? 2.335   57.006  64.846  1.00 12.26 ? 44  VAL C CG1 1 
ATOM   8339  C  CG2 . VAL C 1 44  ? 0.352   58.425  65.360  1.00 12.06 ? 44  VAL C CG2 1 
ATOM   8340  N  N   . GLY C 1 45  ? -1.394  56.815  62.462  1.00 12.10 ? 45  GLY C N   1 
ATOM   8341  C  CA  . GLY C 1 45  ? -1.688  57.490  61.216  1.00 12.18 ? 45  GLY C CA  1 
ATOM   8342  C  C   . GLY C 1 45  ? -1.297  56.580  60.068  1.00 12.24 ? 45  GLY C C   1 
ATOM   8343  O  O   . GLY C 1 45  ? -0.428  55.726  60.228  1.00 11.98 ? 45  GLY C O   1 
ATOM   8344  N  N   . PRO C 1 46  ? -1.931  56.725  58.896  1.00 12.53 ? 46  PRO C N   1 
ATOM   8345  C  CA  . PRO C 1 46  ? -1.607  55.882  57.744  1.00 12.67 ? 46  PRO C CA  1 
ATOM   8346  C  C   . PRO C 1 46  ? -0.118  55.821  57.412  1.00 12.72 ? 46  PRO C C   1 
ATOM   8347  O  O   . PRO C 1 46  ? 0.383   54.776  56.989  1.00 12.90 ? 46  PRO C O   1 
ATOM   8348  C  CB  . PRO C 1 46  ? -2.432  56.492  56.612  1.00 12.72 ? 46  PRO C CB  1 
ATOM   8349  C  CG  . PRO C 1 46  ? -3.588  57.128  57.308  1.00 12.76 ? 46  PRO C CG  1 
ATOM   8350  C  CD  . PRO C 1 46  ? -3.011  57.678  58.588  1.00 12.58 ? 46  PRO C CD  1 
ATOM   8351  N  N   . ARG C 1 47  ? 0.590   56.931  57.602  1.00 12.56 ? 47  ARG C N   1 
ATOM   8352  C  CA  . ARG C 1 47  ? 2.019   56.956  57.303  1.00 12.48 ? 47  ARG C CA  1 
ATOM   8353  C  C   . ARG C 1 47  ? 2.900   57.101  58.537  1.00 12.57 ? 47  ARG C C   1 
ATOM   8354  O  O   . ARG C 1 47  ? 4.082   57.416  58.424  1.00 12.61 ? 47  ARG C O   1 
ATOM   8355  C  CB  . ARG C 1 47  ? 2.329   58.090  56.333  1.00 12.16 ? 47  ARG C CB  1 
ATOM   8356  C  CG  . ARG C 1 47  ? 1.363   58.186  55.180  1.00 11.88 ? 47  ARG C CG  1 
ATOM   8357  C  CD  . ARG C 1 47  ? 2.098   58.234  53.853  1.00 11.69 ? 47  ARG C CD  1 
ATOM   8358  N  NE  . ARG C 1 47  ? 1.166   58.128  52.739  1.00 11.95 ? 47  ARG C NE  1 
ATOM   8359  C  CZ  . ARG C 1 47  ? 1.296   58.786  51.598  1.00 12.12 ? 47  ARG C CZ  1 
ATOM   8360  N  NH1 . ARG C 1 47  ? 2.327   59.602  51.421  1.00 12.47 ? 47  ARG C NH1 1 
ATOM   8361  N  NH2 . ARG C 1 47  ? 0.390   58.631  50.641  1.00 12.33 ? 47  ARG C NH2 1 
ATOM   8362  N  N   . GLY C 1 48  ? 2.332   56.869  59.714  1.00 12.38 ? 48  GLY C N   1 
ATOM   8363  C  CA  . GLY C 1 48  ? 3.108   57.001  60.931  1.00 12.22 ? 48  GLY C CA  1 
ATOM   8364  C  C   . GLY C 1 48  ? 3.955   55.779  61.222  1.00 12.04 ? 48  GLY C C   1 
ATOM   8365  O  O   . GLY C 1 48  ? 3.856   54.779  60.513  1.00 12.17 ? 48  GLY C O   1 
ATOM   8366  N  N   . PRO C 1 49  ? 4.825   55.843  62.243  1.00 11.83 ? 49  PRO C N   1 
ATOM   8367  C  CA  . PRO C 1 49  ? 5.697   54.728  62.631  1.00 11.50 ? 49  PRO C CA  1 
ATOM   8368  C  C   . PRO C 1 49  ? 4.936   53.593  63.311  1.00 11.26 ? 49  PRO C C   1 
ATOM   8369  O  O   . PRO C 1 49  ? 3.780   53.746  63.701  1.00 11.22 ? 49  PRO C O   1 
ATOM   8370  C  CB  . PRO C 1 49  ? 6.720   55.372  63.573  1.00 11.43 ? 49  PRO C CB  1 
ATOM   8371  C  CG  . PRO C 1 49  ? 6.522   56.865  63.416  1.00 11.51 ? 49  PRO C CG  1 
ATOM   8372  C  CD  . PRO C 1 49  ? 5.084   57.033  63.064  1.00 11.57 ? 49  PRO C CD  1 
ATOM   8373  N  N   . LEU C 1 50  ? 5.600   52.455  63.450  1.00 11.09 ? 50  LEU C N   1 
ATOM   8374  C  CA  . LEU C 1 50  ? 5.000   51.287  64.070  1.00 11.06 ? 50  LEU C CA  1 
ATOM   8375  C  C   . LEU C 1 50  ? 5.307   51.280  65.557  1.00 11.22 ? 50  LEU C C   1 
ATOM   8376  O  O   . LEU C 1 50  ? 6.435   51.554  65.962  1.00 11.30 ? 50  LEU C O   1 
ATOM   8377  C  CB  . LEU C 1 50  ? 5.551   50.020  63.417  1.00 10.83 ? 50  LEU C CB  1 
ATOM   8378  C  CG  . LEU C 1 50  ? 5.429   48.724  64.210  1.00 10.56 ? 50  LEU C CG  1 
ATOM   8379  C  CD1 . LEU C 1 50  ? 4.069   48.107  63.966  1.00 10.30 ? 50  LEU C CD1 1 
ATOM   8380  C  CD2 . LEU C 1 50  ? 6.538   47.778  63.789  1.00 10.91 ? 50  LEU C CD2 1 
ATOM   8381  N  N   . LEU C 1 51  ? 4.302   50.954  66.365  1.00 11.30 ? 51  LEU C N   1 
ATOM   8382  C  CA  . LEU C 1 51  ? 4.467   50.923  67.812  1.00 11.54 ? 51  LEU C CA  1 
ATOM   8383  C  C   . LEU C 1 51  ? 4.504   49.504  68.372  1.00 11.62 ? 51  LEU C C   1 
ATOM   8384  O  O   . LEU C 1 51  ? 4.004   48.565  67.752  1.00 11.44 ? 51  LEU C O   1 
ATOM   8385  C  CB  . LEU C 1 51  ? 3.349   51.722  68.493  1.00 11.56 ? 51  LEU C CB  1 
ATOM   8386  C  CG  . LEU C 1 51  ? 1.966   51.726  67.842  1.00 11.59 ? 51  LEU C CG  1 
ATOM   8387  C  CD1 . LEU C 1 51  ? 0.960   52.215  68.853  1.00 11.46 ? 51  LEU C CD1 1 
ATOM   8388  C  CD2 . LEU C 1 51  ? 1.954   52.618  66.608  1.00 11.84 ? 51  LEU C CD2 1 
ATOM   8389  N  N   . VAL C 1 52  ? 5.095   49.368  69.557  1.00 11.87 ? 52  VAL C N   1 
ATOM   8390  C  CA  . VAL C 1 52  ? 5.243   48.078  70.220  1.00 12.27 ? 52  VAL C CA  1 
ATOM   8391  C  C   . VAL C 1 52  ? 3.929   47.407  70.592  1.00 12.40 ? 52  VAL C C   1 
ATOM   8392  O  O   . VAL C 1 52  ? 3.873   46.184  70.744  1.00 12.52 ? 52  VAL C O   1 
ATOM   8393  C  CB  . VAL C 1 52  ? 6.094   48.204  71.496  1.00 12.43 ? 52  VAL C CB  1 
ATOM   8394  C  CG1 . VAL C 1 52  ? 6.596   46.830  71.918  1.00 12.59 ? 52  VAL C CG1 1 
ATOM   8395  C  CG2 . VAL C 1 52  ? 7.262   49.143  71.253  1.00 12.56 ? 52  VAL C CG2 1 
ATOM   8396  N  N   . GLN C 1 53  ? 2.876   48.204  70.742  1.00 12.58 ? 53  GLN C N   1 
ATOM   8397  C  CA  . GLN C 1 53  ? 1.559   47.676  71.101  1.00 12.66 ? 53  GLN C CA  1 
ATOM   8398  C  C   . GLN C 1 53  ? 1.151   46.486  70.227  1.00 12.73 ? 53  GLN C C   1 
ATOM   8399  O  O   . GLN C 1 53  ? 0.406   45.606  70.664  1.00 12.71 ? 53  GLN C O   1 
ATOM   8400  C  CB  . GLN C 1 53  ? 0.502   48.777  70.980  1.00 12.53 ? 53  GLN C CB  1 
ATOM   8401  C  CG  . GLN C 1 53  ? 0.147   49.447  72.292  1.00 12.47 ? 53  GLN C CG  1 
ATOM   8402  C  CD  . GLN C 1 53  ? -0.600  50.750  72.089  1.00 12.41 ? 53  GLN C CD  1 
ATOM   8403  O  OE1 . GLN C 1 53  ? -1.592  50.802  71.365  1.00 12.36 ? 53  GLN C OE1 1 
ATOM   8404  N  NE2 . GLN C 1 53  ? -0.124  51.812  72.727  1.00 12.40 ? 53  GLN C NE2 1 
ATOM   8405  N  N   . ASP C 1 54  ? 1.643   46.464  68.992  1.00 12.77 ? 54  ASP C N   1 
ATOM   8406  C  CA  . ASP C 1 54  ? 1.308   45.393  68.070  1.00 12.54 ? 54  ASP C CA  1 
ATOM   8407  C  C   . ASP C 1 54  ? 1.935   44.070  68.484  1.00 12.35 ? 54  ASP C C   1 
ATOM   8408  O  O   . ASP C 1 54  ? 2.904   43.612  67.873  1.00 12.32 ? 54  ASP C O   1 
ATOM   8409  C  CB  . ASP C 1 54  ? 1.757   45.755  66.653  1.00 13.02 ? 54  ASP C CB  1 
ATOM   8410  C  CG  . ASP C 1 54  ? 0.987   44.990  65.582  1.00 13.38 ? 54  ASP C CG  1 
ATOM   8411  O  OD1 . ASP C 1 54  ? 0.505   43.866  65.862  1.00 13.49 ? 54  ASP C OD1 1 
ATOM   8412  O  OD2 . ASP C 1 54  ? 0.864   45.519  64.454  1.00 13.71 ? 54  ASP C OD2 1 
ATOM   8413  N  N   . VAL C 1 55  ? 1.377   43.457  69.525  1.00 12.16 ? 55  VAL C N   1 
ATOM   8414  C  CA  . VAL C 1 55  ? 1.867   42.170  70.011  1.00 11.96 ? 55  VAL C CA  1 
ATOM   8415  C  C   . VAL C 1 55  ? 1.537   41.072  68.998  1.00 12.04 ? 55  VAL C C   1 
ATOM   8416  O  O   . VAL C 1 55  ? 2.187   40.025  68.957  1.00 11.79 ? 55  VAL C O   1 
ATOM   8417  C  CB  . VAL C 1 55  ? 1.228   41.805  71.357  1.00 11.76 ? 55  VAL C CB  1 
ATOM   8418  C  CG1 . VAL C 1 55  ? 1.473   42.911  72.362  1.00 11.86 ? 55  VAL C CG1 1 
ATOM   8419  C  CG2 . VAL C 1 55  ? -0.255  41.578  71.179  1.00 11.67 ? 55  VAL C CG2 1 
ATOM   8420  N  N   . VAL C 1 56  ? 0.514   41.320  68.186  1.00 11.95 ? 56  VAL C N   1 
ATOM   8421  C  CA  . VAL C 1 56  ? 0.095   40.375  67.157  1.00 12.32 ? 56  VAL C CA  1 
ATOM   8422  C  C   . VAL C 1 56  ? 1.252   40.235  66.176  1.00 12.22 ? 56  VAL C C   1 
ATOM   8423  O  O   . VAL C 1 56  ? 1.617   39.129  65.766  1.00 12.15 ? 56  VAL C O   1 
ATOM   8424  C  CB  . VAL C 1 56  ? -1.162  40.892  66.411  1.00 12.51 ? 56  VAL C CB  1 
ATOM   8425  C  CG1 . VAL C 1 56  ? -1.479  39.992  65.221  1.00 12.71 ? 56  VAL C CG1 1 
ATOM   8426  C  CG2 . VAL C 1 56  ? -2.340  40.955  67.372  1.00 12.65 ? 56  VAL C CG2 1 
ATOM   8427  N  N   . PHE C 1 57  ? 1.832   41.375  65.814  1.00 12.02 ? 57  PHE C N   1 
ATOM   8428  C  CA  . PHE C 1 57  ? 2.963   41.404  64.902  1.00 12.02 ? 57  PHE C CA  1 
ATOM   8429  C  C   . PHE C 1 57  ? 4.156   40.687  65.536  1.00 12.02 ? 57  PHE C C   1 
ATOM   8430  O  O   . PHE C 1 57  ? 4.609   39.656  65.041  1.00 12.14 ? 57  PHE C O   1 
ATOM   8431  C  CB  . PHE C 1 57  ? 3.339   42.853  64.600  1.00 11.82 ? 57  PHE C CB  1 
ATOM   8432  C  CG  . PHE C 1 57  ? 4.621   43.002  63.834  1.00 11.57 ? 57  PHE C CG  1 
ATOM   8433  C  CD1 . PHE C 1 57  ? 4.789   42.378  62.599  1.00 11.51 ? 57  PHE C CD1 1 
ATOM   8434  C  CD2 . PHE C 1 57  ? 5.652   43.784  64.336  1.00 11.43 ? 57  PHE C CD2 1 
ATOM   8435  C  CE1 . PHE C 1 57  ? 5.967   42.535  61.875  1.00 11.55 ? 57  PHE C CE1 1 
ATOM   8436  C  CE2 . PHE C 1 57  ? 6.835   43.946  63.620  1.00 11.50 ? 57  PHE C CE2 1 
ATOM   8437  C  CZ  . PHE C 1 57  ? 6.992   43.320  62.386  1.00 11.50 ? 57  PHE C CZ  1 
ATOM   8438  N  N   . THR C 1 58  ? 4.648   41.241  66.642  1.00 11.88 ? 58  THR C N   1 
ATOM   8439  C  CA  . THR C 1 58  ? 5.791   40.685  67.369  1.00 11.57 ? 58  THR C CA  1 
ATOM   8440  C  C   . THR C 1 58  ? 5.683   39.181  67.635  1.00 11.39 ? 58  THR C C   1 
ATOM   8441  O  O   . THR C 1 58  ? 6.646   38.434  67.462  1.00 11.40 ? 58  THR C O   1 
ATOM   8442  C  CB  . THR C 1 58  ? 5.976   41.397  68.719  1.00 11.57 ? 58  THR C CB  1 
ATOM   8443  O  OG1 . THR C 1 58  ? 5.758   42.804  68.554  1.00 11.23 ? 58  THR C OG1 1 
ATOM   8444  C  CG2 . THR C 1 58  ? 7.378   41.159  69.251  1.00 11.70 ? 58  THR C CG2 1 
ATOM   8445  N  N   . ASP C 1 59  ? 4.506   38.752  68.068  1.00 11.09 ? 59  ASP C N   1 
ATOM   8446  C  CA  . ASP C 1 59  ? 4.252   37.349  68.355  1.00 10.77 ? 59  ASP C CA  1 
ATOM   8447  C  C   . ASP C 1 59  ? 4.640   36.487  67.160  1.00 10.67 ? 59  ASP C C   1 
ATOM   8448  O  O   . ASP C 1 59  ? 5.541   35.658  67.239  1.00 10.46 ? 59  ASP C O   1 
ATOM   8449  C  CB  . ASP C 1 59  ? 2.770   37.161  68.673  1.00 10.36 ? 59  ASP C CB  1 
ATOM   8450  C  CG  . ASP C 1 59  ? 2.505   35.926  69.483  1.00 10.08 ? 59  ASP C CG  1 
ATOM   8451  O  OD1 . ASP C 1 59  ? 3.061   35.809  70.595  1.00 9.80  ? 59  ASP C OD1 1 
ATOM   8452  O  OD2 . ASP C 1 59  ? 1.738   35.070  69.005  1.00 10.22 ? 59  ASP C OD2 1 
ATOM   8453  N  N   . GLU C 1 60  ? 3.949   36.700  66.048  1.00 11.27 ? 60  GLU C N   1 
ATOM   8454  C  CA  . GLU C 1 60  ? 4.202   35.953  64.823  1.00 11.70 ? 60  GLU C CA  1 
ATOM   8455  C  C   . GLU C 1 60  ? 5.646   36.136  64.379  1.00 12.15 ? 60  GLU C C   1 
ATOM   8456  O  O   . GLU C 1 60  ? 6.341   35.166  64.079  1.00 12.42 ? 60  GLU C O   1 
ATOM   8457  C  CB  . GLU C 1 60  ? 3.256   36.430  63.718  1.00 11.62 ? 60  GLU C CB  1 
ATOM   8458  C  CG  . GLU C 1 60  ? 3.667   36.034  62.318  1.00 11.66 ? 60  GLU C CG  1 
ATOM   8459  C  CD  . GLU C 1 60  ? 2.632   36.414  61.274  1.00 11.70 ? 60  GLU C CD  1 
ATOM   8460  O  OE1 . GLU C 1 60  ? 2.544   37.611  60.935  1.00 11.83 ? 60  GLU C OE1 1 
ATOM   8461  O  OE2 . GLU C 1 60  ? 1.906   35.518  60.789  1.00 11.72 ? 60  GLU C OE2 1 
ATOM   8462  N  N   . MET C 1 61  ? 6.092   37.387  64.346  1.00 12.23 ? 61  MET C N   1 
ATOM   8463  C  CA  . MET C 1 61  ? 7.453   37.711  63.933  1.00 12.27 ? 61  MET C CA  1 
ATOM   8464  C  C   . MET C 1 61  ? 8.518   36.972  64.732  1.00 12.08 ? 61  MET C C   1 
ATOM   8465  O  O   . MET C 1 61  ? 9.301   36.206  64.171  1.00 12.31 ? 61  MET C O   1 
ATOM   8466  C  CB  . MET C 1 61  ? 7.700   39.216  64.048  1.00 12.17 ? 61  MET C CB  1 
ATOM   8467  C  CG  . MET C 1 61  ? 8.939   39.667  63.303  1.00 11.74 ? 61  MET C CG  1 
ATOM   8468  S  SD  . MET C 1 61  ? 9.150   38.762  61.760  1.00 11.43 ? 61  MET C SD  1 
ATOM   8469  C  CE  . MET C 1 61  ? 8.277   39.842  60.621  1.00 10.87 ? 61  MET C CE  1 
ATOM   8470  N  N   . ALA C 1 62  ? 8.544   37.220  66.041  1.00 11.93 ? 62  ALA C N   1 
ATOM   8471  C  CA  . ALA C 1 62  ? 9.506   36.599  66.950  1.00 11.30 ? 62  ALA C CA  1 
ATOM   8472  C  C   . ALA C 1 62  ? 9.646   35.101  66.727  1.00 11.16 ? 62  ALA C C   1 
ATOM   8473  O  O   . ALA C 1 62  ? 10.758  34.587  66.652  1.00 11.15 ? 62  ALA C O   1 
ATOM   8474  C  CB  . ALA C 1 62  ? 9.107   36.867  68.388  1.00 11.17 ? 62  ALA C CB  1 
ATOM   8475  N  N   . HIS C 1 63  ? 8.517   34.403  66.628  1.00 10.95 ? 63  HIS C N   1 
ATOM   8476  C  CA  . HIS C 1 63  ? 8.534   32.965  66.410  1.00 10.95 ? 63  HIS C CA  1 
ATOM   8477  C  C   . HIS C 1 63  ? 9.171   32.628  65.067  1.00 10.98 ? 63  HIS C C   1 
ATOM   8478  O  O   . HIS C 1 63  ? 10.008  31.732  64.973  1.00 10.81 ? 63  HIS C O   1 
ATOM   8479  C  CB  . HIS C 1 63  ? 7.115   32.396  66.453  1.00 10.82 ? 63  HIS C CB  1 
ATOM   8480  C  CG  . HIS C 1 63  ? 7.071   30.902  66.549  1.00 10.79 ? 63  HIS C CG  1 
ATOM   8481  N  ND1 . HIS C 1 63  ? 7.789   30.081  65.706  1.00 10.84 ? 63  HIS C ND1 1 
ATOM   8482  C  CD2 . HIS C 1 63  ? 6.405   30.080  67.394  1.00 10.84 ? 63  HIS C CD2 1 
ATOM   8483  C  CE1 . HIS C 1 63  ? 7.567   28.819  66.027  1.00 10.87 ? 63  HIS C CE1 1 
ATOM   8484  N  NE2 . HIS C 1 63  ? 6.730   28.791  67.048  1.00 10.92 ? 63  HIS C NE2 1 
ATOM   8485  N  N   . PHE C 1 64  ? 8.762   33.344  64.026  1.00 11.06 ? 64  PHE C N   1 
ATOM   8486  C  CA  . PHE C 1 64  ? 9.300   33.123  62.693  1.00 11.21 ? 64  PHE C CA  1 
ATOM   8487  C  C   . PHE C 1 64  ? 10.812  33.236  62.755  1.00 11.23 ? 64  PHE C C   1 
ATOM   8488  O  O   . PHE C 1 64  ? 11.523  32.552  62.024  1.00 11.13 ? 64  PHE C O   1 
ATOM   8489  C  CB  . PHE C 1 64  ? 8.734   34.165  61.721  1.00 11.74 ? 64  PHE C CB  1 
ATOM   8490  C  CG  . PHE C 1 64  ? 9.509   34.293  60.434  1.00 12.05 ? 64  PHE C CG  1 
ATOM   8491  C  CD1 . PHE C 1 64  ? 9.382   33.337  59.430  1.00 12.20 ? 64  PHE C CD1 1 
ATOM   8492  C  CD2 . PHE C 1 64  ? 10.341  35.386  60.213  1.00 12.22 ? 64  PHE C CD2 1 
ATOM   8493  C  CE1 . PHE C 1 64  ? 10.070  33.469  58.222  1.00 12.11 ? 64  PHE C CE1 1 
ATOM   8494  C  CE2 . PHE C 1 64  ? 11.030  35.525  59.010  1.00 12.19 ? 64  PHE C CE2 1 
ATOM   8495  C  CZ  . PHE C 1 64  ? 10.893  34.565  58.015  1.00 12.20 ? 64  PHE C CZ  1 
ATOM   8496  N  N   . ASP C 1 65  ? 11.298  34.100  63.643  1.00 11.29 ? 65  ASP C N   1 
ATOM   8497  C  CA  . ASP C 1 65  ? 12.733  34.314  63.810  1.00 11.41 ? 65  ASP C CA  1 
ATOM   8498  C  C   . ASP C 1 65  ? 13.433  33.112  64.455  1.00 11.30 ? 65  ASP C C   1 
ATOM   8499  O  O   . ASP C 1 65  ? 14.659  33.014  64.431  1.00 11.45 ? 65  ASP C O   1 
ATOM   8500  C  CB  . ASP C 1 65  ? 12.985  35.565  64.662  1.00 11.30 ? 65  ASP C CB  1 
ATOM   8501  C  CG  . ASP C 1 65  ? 12.479  36.834  64.006  1.00 11.34 ? 65  ASP C CG  1 
ATOM   8502  O  OD1 . ASP C 1 65  ? 12.155  36.793  62.804  1.00 11.30 ? 65  ASP C OD1 1 
ATOM   8503  O  OD2 . ASP C 1 65  ? 12.402  37.875  64.695  1.00 11.19 ? 65  ASP C OD2 1 
ATOM   8504  N  N   . ARG C 1 66  ? 12.650  32.202  65.024  1.00 11.12 ? 66  ARG C N   1 
ATOM   8505  C  CA  . ARG C 1 66  ? 13.199  31.023  65.683  1.00 11.04 ? 66  ARG C CA  1 
ATOM   8506  C  C   . ARG C 1 66  ? 12.686  29.720  65.064  1.00 10.93 ? 66  ARG C C   1 
ATOM   8507  O  O   . ARG C 1 66  ? 12.482  28.716  65.755  1.00 10.66 ? 66  ARG C O   1 
ATOM   8508  C  CB  . ARG C 1 66  ? 12.854  31.071  67.172  1.00 11.27 ? 66  ARG C CB  1 
ATOM   8509  C  CG  . ARG C 1 66  ? 13.542  32.200  67.923  1.00 11.63 ? 66  ARG C CG  1 
ATOM   8510  C  CD  . ARG C 1 66  ? 12.672  32.748  69.055  1.00 11.93 ? 66  ARG C CD  1 
ATOM   8511  N  NE  . ARG C 1 66  ? 13.385  33.770  69.818  1.00 11.98 ? 66  ARG C NE  1 
ATOM   8512  C  CZ  . ARG C 1 66  ? 13.412  35.059  69.498  1.00 11.93 ? 66  ARG C CZ  1 
ATOM   8513  N  NH1 . ARG C 1 66  ? 12.761  35.489  68.427  1.00 11.73 ? 66  ARG C NH1 1 
ATOM   8514  N  NH2 . ARG C 1 66  ? 14.112  35.914  70.230  1.00 11.90 ? 66  ARG C NH2 1 
ATOM   8515  N  N   . GLU C 1 67  ? 12.491  29.747  63.750  1.00 11.09 ? 67  GLU C N   1 
ATOM   8516  C  CA  . GLU C 1 67  ? 12.001  28.594  63.009  1.00 11.13 ? 67  GLU C CA  1 
ATOM   8517  C  C   . GLU C 1 67  ? 13.095  27.558  62.761  1.00 11.31 ? 67  GLU C C   1 
ATOM   8518  O  O   . GLU C 1 67  ? 12.849  26.348  62.812  1.00 11.30 ? 67  GLU C O   1 
ATOM   8519  C  CB  . GLU C 1 67  ? 11.431  29.052  61.670  1.00 11.10 ? 67  GLU C CB  1 
ATOM   8520  C  CG  . GLU C 1 67  ? 9.957   28.777  61.505  1.00 11.68 ? 67  GLU C CG  1 
ATOM   8521  C  CD  . GLU C 1 67  ? 9.334   29.630  60.424  1.00 11.99 ? 67  GLU C CD  1 
ATOM   8522  O  OE1 . GLU C 1 67  ? 9.376   29.228  59.241  1.00 12.48 ? 67  GLU C OE1 1 
ATOM   8523  O  OE2 . GLU C 1 67  ? 8.801   30.706  60.759  1.00 12.36 ? 67  GLU C OE2 1 
ATOM   8524  N  N   . ARG C 1 68  ? 14.304  28.040  62.496  1.00 11.53 ? 68  ARG C N   1 
ATOM   8525  C  CA  . ARG C 1 68  ? 15.429  27.160  62.214  1.00 11.88 ? 68  ARG C CA  1 
ATOM   8526  C  C   . ARG C 1 68  ? 16.097  26.554  63.446  1.00 12.14 ? 68  ARG C C   1 
ATOM   8527  O  O   . ARG C 1 68  ? 16.018  27.092  64.555  1.00 12.25 ? 68  ARG C O   1 
ATOM   8528  C  CB  . ARG C 1 68  ? 16.474  27.912  61.390  1.00 11.72 ? 68  ARG C CB  1 
ATOM   8529  C  CG  . ARG C 1 68  ? 15.888  28.702  60.229  1.00 11.45 ? 68  ARG C CG  1 
ATOM   8530  C  CD  . ARG C 1 68  ? 15.612  27.811  59.025  1.00 11.07 ? 68  ARG C CD  1 
ATOM   8531  N  NE  . ARG C 1 68  ? 14.261  27.265  59.041  1.00 10.94 ? 68  ARG C NE  1 
ATOM   8532  C  CZ  . ARG C 1 68  ? 13.243  27.750  58.337  1.00 10.93 ? 68  ARG C CZ  1 
ATOM   8533  N  NH1 . ARG C 1 68  ? 13.412  28.804  57.548  1.00 11.16 ? 68  ARG C NH1 1 
ATOM   8534  N  NH2 . ARG C 1 68  ? 12.052  27.175  58.425  1.00 10.90 ? 68  ARG C NH2 1 
ATOM   8535  N  N   . ILE C 1 69  ? 16.753  25.418  63.231  1.00 12.33 ? 69  ILE C N   1 
ATOM   8536  C  CA  . ILE C 1 69  ? 17.470  24.709  64.281  1.00 12.29 ? 69  ILE C CA  1 
ATOM   8537  C  C   . ILE C 1 69  ? 18.683  24.057  63.622  1.00 12.38 ? 69  ILE C C   1 
ATOM   8538  O  O   . ILE C 1 69  ? 18.655  23.754  62.430  1.00 12.52 ? 69  ILE C O   1 
ATOM   8539  C  CB  . ILE C 1 69  ? 16.583  23.629  64.937  1.00 12.12 ? 69  ILE C CB  1 
ATOM   8540  C  CG1 . ILE C 1 69  ? 16.044  22.671  63.878  1.00 12.03 ? 69  ILE C CG1 1 
ATOM   8541  C  CG2 . ILE C 1 69  ? 15.432  24.284  65.675  1.00 11.93 ? 69  ILE C CG2 1 
ATOM   8542  C  CD1 . ILE C 1 69  ? 16.094  21.213  64.300  1.00 11.96 ? 69  ILE C CD1 1 
ATOM   8543  N  N   . PRO C 1 70  ? 19.771  23.843  64.381  1.00 12.46 ? 70  PRO C N   1 
ATOM   8544  C  CA  . PRO C 1 70  ? 20.944  23.223  63.756  1.00 12.50 ? 70  PRO C CA  1 
ATOM   8545  C  C   . PRO C 1 70  ? 20.606  21.945  63.008  1.00 12.28 ? 70  PRO C C   1 
ATOM   8546  O  O   . PRO C 1 70  ? 19.869  21.093  63.502  1.00 12.05 ? 70  PRO C O   1 
ATOM   8547  C  CB  . PRO C 1 70  ? 21.894  22.973  64.925  1.00 12.65 ? 70  PRO C CB  1 
ATOM   8548  C  CG  . PRO C 1 70  ? 21.480  23.974  65.967  1.00 12.82 ? 70  PRO C CG  1 
ATOM   8549  C  CD  . PRO C 1 70  ? 19.991  24.137  65.809  1.00 12.72 ? 70  PRO C CD  1 
ATOM   8550  N  N   . GLU C 1 71  ? 21.142  21.831  61.799  1.00 12.32 ? 71  GLU C N   1 
ATOM   8551  C  CA  . GLU C 1 71  ? 20.914  20.655  60.978  1.00 12.38 ? 71  GLU C CA  1 
ATOM   8552  C  C   . GLU C 1 71  ? 21.892  19.569  61.411  1.00 12.56 ? 71  GLU C C   1 
ATOM   8553  O  O   . GLU C 1 71  ? 22.934  19.863  62.000  1.00 12.68 ? 71  GLU C O   1 
ATOM   8554  C  CB  . GLU C 1 71  ? 21.128  20.999  59.503  1.00 12.14 ? 71  GLU C CB  1 
ATOM   8555  C  CG  . GLU C 1 71  ? 22.540  20.761  59.006  1.00 11.50 ? 71  GLU C CG  1 
ATOM   8556  C  CD  . GLU C 1 71  ? 22.692  21.067  57.533  1.00 11.02 ? 71  GLU C CD  1 
ATOM   8557  O  OE1 . GLU C 1 71  ? 21.671  21.048  56.818  1.00 10.18 ? 71  GLU C OE1 1 
ATOM   8558  O  OE2 . GLU C 1 71  ? 23.832  21.325  57.096  1.00 11.01 ? 71  GLU C OE2 1 
ATOM   8559  N  N   . ARG C 1 72  ? 21.554  18.317  61.130  1.00 12.36 ? 72  ARG C N   1 
ATOM   8560  C  CA  . ARG C 1 72  ? 22.431  17.216  61.496  1.00 12.23 ? 72  ARG C CA  1 
ATOM   8561  C  C   . ARG C 1 72  ? 23.820  17.504  60.957  1.00 12.14 ? 72  ARG C C   1 
ATOM   8562  O  O   . ARG C 1 72  ? 23.967  17.973  59.826  1.00 12.04 ? 72  ARG C O   1 
ATOM   8563  C  CB  . ARG C 1 72  ? 21.921  15.901  60.903  1.00 12.12 ? 72  ARG C CB  1 
ATOM   8564  C  CG  . ARG C 1 72  ? 20.641  15.390  61.529  1.00 11.79 ? 72  ARG C CG  1 
ATOM   8565  C  CD  . ARG C 1 72  ? 19.767  14.724  60.496  1.00 11.36 ? 72  ARG C CD  1 
ATOM   8566  N  NE  . ARG C 1 72  ? 18.597  14.105  61.103  1.00 11.33 ? 72  ARG C NE  1 
ATOM   8567  C  CZ  . ARG C 1 72  ? 17.351  14.517  60.910  1.00 11.23 ? 72  ARG C CZ  1 
ATOM   8568  N  NH1 . ARG C 1 72  ? 17.117  15.553  60.124  1.00 11.67 ? 72  ARG C NH1 1 
ATOM   8569  N  NH2 . ARG C 1 72  ? 16.341  13.884  61.487  1.00 11.05 ? 72  ARG C NH2 1 
ATOM   8570  N  N   . VAL C 1 73  ? 24.837  17.236  61.769  1.00 12.08 ? 73  VAL C N   1 
ATOM   8571  C  CA  . VAL C 1 73  ? 26.213  17.458  61.345  1.00 11.90 ? 73  VAL C CA  1 
ATOM   8572  C  C   . VAL C 1 73  ? 26.502  16.585  60.118  1.00 11.85 ? 73  VAL C C   1 
ATOM   8573  O  O   . VAL C 1 73  ? 27.350  16.914  59.287  1.00 11.91 ? 73  VAL C O   1 
ATOM   8574  C  CB  . VAL C 1 73  ? 27.205  17.127  62.482  1.00 11.85 ? 73  VAL C CB  1 
ATOM   8575  C  CG1 . VAL C 1 73  ? 26.854  15.793  63.112  1.00 11.79 ? 73  VAL C CG1 1 
ATOM   8576  C  CG2 . VAL C 1 73  ? 28.621  17.125  61.949  1.00 11.91 ? 73  VAL C CG2 1 
ATOM   8577  N  N   . VAL C 1 74  ? 25.778  15.473  60.018  1.00 11.79 ? 74  VAL C N   1 
ATOM   8578  C  CA  . VAL C 1 74  ? 25.899  14.539  58.899  1.00 11.68 ? 74  VAL C CA  1 
ATOM   8579  C  C   . VAL C 1 74  ? 24.508  13.998  58.562  1.00 11.68 ? 74  VAL C C   1 
ATOM   8580  O  O   . VAL C 1 74  ? 23.626  13.967  59.421  1.00 11.50 ? 74  VAL C O   1 
ATOM   8581  C  CB  . VAL C 1 74  ? 26.817  13.359  59.244  1.00 11.61 ? 74  VAL C CB  1 
ATOM   8582  C  CG1 . VAL C 1 74  ? 28.131  13.497  58.509  1.00 11.47 ? 74  VAL C CG1 1 
ATOM   8583  C  CG2 . VAL C 1 74  ? 27.047  13.305  60.737  1.00 11.93 ? 74  VAL C CG2 1 
ATOM   8584  N  N   . HIS C 1 75  ? 24.315  13.574  57.318  1.00 11.49 ? 75  HIS C N   1 
ATOM   8585  C  CA  . HIS C 1 75  ? 23.022  13.050  56.887  1.00 11.69 ? 75  HIS C CA  1 
ATOM   8586  C  C   . HIS C 1 75  ? 21.935  14.125  57.028  1.00 11.75 ? 75  HIS C C   1 
ATOM   8587  O  O   . HIS C 1 75  ? 20.836  13.843  57.505  1.00 11.94 ? 75  HIS C O   1 
ATOM   8588  C  CB  . HIS C 1 75  ? 22.629  11.824  57.728  1.00 11.53 ? 75  HIS C CB  1 
ATOM   8589  C  CG  . HIS C 1 75  ? 23.513  10.631  57.526  1.00 11.35 ? 75  HIS C CG  1 
ATOM   8590  N  ND1 . HIS C 1 75  ? 23.119  9.528   56.802  1.00 11.26 ? 75  HIS C ND1 1 
ATOM   8591  C  CD2 . HIS C 1 75  ? 24.760  10.357  57.980  1.00 11.24 ? 75  HIS C CD2 1 
ATOM   8592  C  CE1 . HIS C 1 75  ? 24.084  8.626   56.818  1.00 11.27 ? 75  HIS C CE1 1 
ATOM   8593  N  NE2 . HIS C 1 75  ? 25.091  9.105   57.526  1.00 11.17 ? 75  HIS C NE2 1 
ATOM   8594  N  N   . ALA C 1 76  ? 22.233  15.352  56.609  1.00 11.60 ? 76  ALA C N   1 
ATOM   8595  C  CA  . ALA C 1 76  ? 21.260  16.437  56.728  1.00 11.25 ? 76  ALA C CA  1 
ATOM   8596  C  C   . ALA C 1 76  ? 20.066  16.310  55.795  1.00 11.04 ? 76  ALA C C   1 
ATOM   8597  O  O   . ALA C 1 76  ? 18.924  16.446  56.227  1.00 11.01 ? 76  ALA C O   1 
ATOM   8598  C  CB  . ALA C 1 76  ? 21.931  17.778  56.505  1.00 11.21 ? 76  ALA C CB  1 
ATOM   8599  N  N   . LYS C 1 77  ? 20.330  16.055  54.517  1.00 11.37 ? 77  LYS C N   1 
ATOM   8600  C  CA  . LYS C 1 77  ? 19.268  15.935  53.520  1.00 11.30 ? 77  LYS C CA  1 
ATOM   8601  C  C   . LYS C 1 77  ? 18.664  14.546  53.474  1.00 11.33 ? 77  LYS C C   1 
ATOM   8602  O  O   . LYS C 1 77  ? 19.273  13.625  52.938  1.00 11.59 ? 77  LYS C O   1 
ATOM   8603  C  CB  . LYS C 1 77  ? 19.804  16.289  52.136  1.00 11.26 ? 77  LYS C CB  1 
ATOM   8604  C  CG  . LYS C 1 77  ? 18.845  17.112  51.293  1.00 11.13 ? 77  LYS C CG  1 
ATOM   8605  C  CD  . LYS C 1 77  ? 17.526  16.386  51.074  1.00 10.70 ? 77  LYS C CD  1 
ATOM   8606  C  CE  . LYS C 1 77  ? 16.579  17.216  50.239  1.00 10.12 ? 77  LYS C CE  1 
ATOM   8607  N  NZ  . LYS C 1 77  ? 16.801  17.029  48.788  1.00 9.62  ? 77  LYS C NZ  1 
ATOM   8608  N  N   . GLY C 1 78  ? 17.461  14.400  54.019  1.00 11.39 ? 78  GLY C N   1 
ATOM   8609  C  CA  . GLY C 1 78  ? 16.817  13.101  54.030  1.00 11.37 ? 78  GLY C CA  1 
ATOM   8610  C  C   . GLY C 1 78  ? 15.303  13.137  53.929  1.00 11.66 ? 78  GLY C C   1 
ATOM   8611  O  O   . GLY C 1 78  ? 14.697  14.207  53.850  1.00 11.29 ? 78  GLY C O   1 
ATOM   8612  N  N   . ALA C 1 79  ? 14.695  11.956  53.930  1.00 11.70 ? 79  ALA C N   1 
ATOM   8613  C  CA  . ALA C 1 79  ? 13.246  11.827  53.842  1.00 12.26 ? 79  ALA C CA  1 
ATOM   8614  C  C   . ALA C 1 79  ? 12.789  10.855  54.914  1.00 12.62 ? 79  ALA C C   1 
ATOM   8615  O  O   . ALA C 1 79  ? 13.585  10.055  55.397  1.00 12.79 ? 79  ALA C O   1 
ATOM   8616  C  CB  . ALA C 1 79  ? 12.848  11.314  52.463  1.00 12.21 ? 79  ALA C CB  1 
ATOM   8617  N  N   . GLY C 1 80  ? 11.512  10.919  55.283  1.00 12.96 ? 80  GLY C N   1 
ATOM   8618  C  CA  . GLY C 1 80  ? 11.001  10.025  56.307  1.00 13.03 ? 80  GLY C CA  1 
ATOM   8619  C  C   . GLY C 1 80  ? 9.653   9.411   55.984  1.00 12.92 ? 80  GLY C C   1 
ATOM   8620  O  O   . GLY C 1 80  ? 8.921   9.915   55.135  1.00 13.36 ? 80  GLY C O   1 
ATOM   8621  N  N   . ALA C 1 81  ? 9.321   8.322   56.670  1.00 12.64 ? 81  ALA C N   1 
ATOM   8622  C  CA  . ALA C 1 81  ? 8.053   7.627   56.467  1.00 11.96 ? 81  ALA C CA  1 
ATOM   8623  C  C   . ALA C 1 81  ? 7.800   6.677   57.636  1.00 11.78 ? 81  ALA C C   1 
ATOM   8624  O  O   . ALA C 1 81  ? 8.712   6.358   58.394  1.00 11.73 ? 81  ALA C O   1 
ATOM   8625  C  CB  . ALA C 1 81  ? 8.087   6.847   55.148  1.00 11.62 ? 81  ALA C CB  1 
ATOM   8626  N  N   . PHE C 1 82  ? 6.561   6.223   57.780  1.00 11.78 ? 82  PHE C N   1 
ATOM   8627  C  CA  . PHE C 1 82  ? 6.206   5.314   58.865  1.00 11.79 ? 82  PHE C CA  1 
ATOM   8628  C  C   . PHE C 1 82  ? 5.552   4.043   58.357  1.00 11.89 ? 82  PHE C C   1 
ATOM   8629  O  O   . PHE C 1 82  ? 4.968   4.020   57.273  1.00 11.60 ? 82  PHE C O   1 
ATOM   8630  C  CB  . PHE C 1 82  ? 5.264   6.007   59.846  1.00 11.71 ? 82  PHE C CB  1 
ATOM   8631  C  CG  . PHE C 1 82  ? 5.811   7.290   60.395  1.00 11.80 ? 82  PHE C CG  1 
ATOM   8632  C  CD1 . PHE C 1 82  ? 5.382   8.517   59.895  1.00 11.64 ? 82  PHE C CD1 1 
ATOM   8633  C  CD2 . PHE C 1 82  ? 6.776   7.278   61.394  1.00 11.86 ? 82  PHE C CD2 1 
ATOM   8634  C  CE1 . PHE C 1 82  ? 5.906   9.706   60.379  1.00 11.34 ? 82  PHE C CE1 1 
ATOM   8635  C  CE2 . PHE C 1 82  ? 7.303   8.464   61.881  1.00 11.71 ? 82  PHE C CE2 1 
ATOM   8636  C  CZ  . PHE C 1 82  ? 6.866   9.682   61.370  1.00 11.47 ? 82  PHE C CZ  1 
ATOM   8637  N  N   . GLY C 1 83  ? 5.655   2.985   59.153  1.00 11.80 ? 83  GLY C N   1 
ATOM   8638  C  CA  . GLY C 1 83  ? 5.071   1.718   58.771  1.00 12.10 ? 83  GLY C CA  1 
ATOM   8639  C  C   . GLY C 1 83  ? 5.069   0.765   59.943  1.00 12.36 ? 83  GLY C C   1 
ATOM   8640  O  O   . GLY C 1 83  ? 4.522   1.072   61.001  1.00 12.44 ? 83  GLY C O   1 
ATOM   8641  N  N   . TYR C 1 84  ? 5.694   -0.391  59.766  1.00 12.39 ? 84  TYR C N   1 
ATOM   8642  C  CA  . TYR C 1 84  ? 5.743   -1.372  60.832  1.00 12.15 ? 84  TYR C CA  1 
ATOM   8643  C  C   . TYR C 1 84  ? 6.661   -2.533  60.479  1.00 12.35 ? 84  TYR C C   1 
ATOM   8644  O  O   . TYR C 1 84  ? 7.065   -2.703  59.326  1.00 12.37 ? 84  TYR C O   1 
ATOM   8645  C  CB  . TYR C 1 84  ? 4.337   -1.896  61.109  1.00 11.97 ? 84  TYR C CB  1 
ATOM   8646  C  CG  . TYR C 1 84  ? 3.791   -2.771  60.004  1.00 11.70 ? 84  TYR C CG  1 
ATOM   8647  C  CD1 . TYR C 1 84  ? 4.126   -4.125  59.936  1.00 11.53 ? 84  TYR C CD1 1 
ATOM   8648  C  CD2 . TYR C 1 84  ? 2.934   -2.252  59.030  1.00 11.52 ? 84  TYR C CD2 1 
ATOM   8649  C  CE1 . TYR C 1 84  ? 3.626   -4.939  58.931  1.00 11.31 ? 84  TYR C CE1 1 
ATOM   8650  C  CE2 . TYR C 1 84  ? 2.424   -3.063  58.013  1.00 11.27 ? 84  TYR C CE2 1 
ATOM   8651  C  CZ  . TYR C 1 84  ? 2.778   -4.406  57.974  1.00 11.21 ? 84  TYR C CZ  1 
ATOM   8652  O  OH  . TYR C 1 84  ? 2.294   -5.228  56.987  1.00 10.85 ? 84  TYR C OH  1 
ATOM   8653  N  N   . PHE C 1 85  ? 6.992   -3.324  61.493  1.00 12.26 ? 85  PHE C N   1 
ATOM   8654  C  CA  . PHE C 1 85  ? 7.829   -4.497  61.320  1.00 12.35 ? 85  PHE C CA  1 
ATOM   8655  C  C   . PHE C 1 85  ? 6.964   -5.697  61.691  1.00 12.14 ? 85  PHE C C   1 
ATOM   8656  O  O   . PHE C 1 85  ? 6.141   -5.621  62.603  1.00 11.87 ? 85  PHE C O   1 
ATOM   8657  C  CB  . PHE C 1 85  ? 9.052   -4.428  62.238  1.00 12.56 ? 85  PHE C CB  1 
ATOM   8658  C  CG  . PHE C 1 85  ? 9.831   -5.714  62.304  1.00 12.88 ? 85  PHE C CG  1 
ATOM   8659  C  CD1 . PHE C 1 85  ? 10.394  -6.263  61.155  1.00 12.94 ? 85  PHE C CD1 1 
ATOM   8660  C  CD2 . PHE C 1 85  ? 10.004  -6.378  63.516  1.00 13.05 ? 85  PHE C CD2 1 
ATOM   8661  C  CE1 . PHE C 1 85  ? 11.118  -7.456  61.211  1.00 13.00 ? 85  PHE C CE1 1 
ATOM   8662  C  CE2 . PHE C 1 85  ? 10.730  -7.577  63.584  1.00 13.12 ? 85  PHE C CE2 1 
ATOM   8663  C  CZ  . PHE C 1 85  ? 11.287  -8.115  62.430  1.00 12.91 ? 85  PHE C CZ  1 
ATOM   8664  N  N   . GLU C 1 86  ? 7.145   -6.802  60.983  1.00 12.03 ? 86  GLU C N   1 
ATOM   8665  C  CA  . GLU C 1 86  ? 6.358   -7.994  61.250  1.00 12.17 ? 86  GLU C CA  1 
ATOM   8666  C  C   . GLU C 1 86  ? 7.233   -9.234  61.245  1.00 12.23 ? 86  GLU C C   1 
ATOM   8667  O  O   . GLU C 1 86  ? 7.889   -9.534  60.249  1.00 12.35 ? 86  GLU C O   1 
ATOM   8668  C  CB  . GLU C 1 86  ? 5.256   -8.134  60.197  1.00 12.07 ? 86  GLU C CB  1 
ATOM   8669  C  CG  . GLU C 1 86  ? 4.261   -9.250  60.465  1.00 11.67 ? 86  GLU C CG  1 
ATOM   8670  C  CD  . GLU C 1 86  ? 3.407   -9.573  59.255  1.00 11.40 ? 86  GLU C CD  1 
ATOM   8671  O  OE1 . GLU C 1 86  ? 3.201   -8.674  58.408  1.00 11.19 ? 86  GLU C OE1 1 
ATOM   8672  O  OE2 . GLU C 1 86  ? 2.942   -10.727 59.154  1.00 11.10 ? 86  GLU C OE2 1 
ATOM   8673  N  N   . VAL C 1 87  ? 7.237   -9.953  62.362  1.00 12.41 ? 87  VAL C N   1 
ATOM   8674  C  CA  . VAL C 1 87  ? 8.033   -11.167 62.480  1.00 12.49 ? 87  VAL C CA  1 
ATOM   8675  C  C   . VAL C 1 87  ? 7.402   -12.264 61.633  1.00 12.27 ? 87  VAL C C   1 
ATOM   8676  O  O   . VAL C 1 87  ? 6.199   -12.520 61.721  1.00 12.19 ? 87  VAL C O   1 
ATOM   8677  C  CB  . VAL C 1 87  ? 8.120   -11.624 63.951  1.00 12.79 ? 87  VAL C CB  1 
ATOM   8678  C  CG1 . VAL C 1 87  ? 8.936   -12.909 64.060  1.00 13.06 ? 87  VAL C CG1 1 
ATOM   8679  C  CG2 . VAL C 1 87  ? 8.760   -10.515 64.790  1.00 13.17 ? 87  VAL C CG2 1 
ATOM   8680  N  N   . THR C 1 88  ? 8.222   -12.904 60.808  1.00 12.15 ? 88  THR C N   1 
ATOM   8681  C  CA  . THR C 1 88  ? 7.750   -13.956 59.921  1.00 12.03 ? 88  THR C CA  1 
ATOM   8682  C  C   . THR C 1 88  ? 8.380   -15.285 60.293  1.00 12.11 ? 88  THR C C   1 
ATOM   8683  O  O   . THR C 1 88  ? 7.814   -16.351 60.043  1.00 12.07 ? 88  THR C O   1 
ATOM   8684  C  CB  . THR C 1 88  ? 8.106   -13.634 58.468  1.00 11.82 ? 88  THR C CB  1 
ATOM   8685  O  OG1 . THR C 1 88  ? 9.520   -13.756 58.283  1.00 11.61 ? 88  THR C OG1 1 
ATOM   8686  C  CG2 . THR C 1 88  ? 7.698   -12.219 58.134  1.00 11.71 ? 88  THR C CG2 1 
ATOM   8687  N  N   . HIS C 1 89  ? 9.556   -15.213 60.901  1.00 12.32 ? 89  HIS C N   1 
ATOM   8688  C  CA  . HIS C 1 89  ? 10.269  -16.411 61.300  1.00 12.56 ? 89  HIS C CA  1 
ATOM   8689  C  C   . HIS C 1 89  ? 10.679  -16.378 62.763  1.00 12.45 ? 89  HIS C C   1 
ATOM   8690  O  O   . HIS C 1 89  ? 10.889  -15.317 63.340  1.00 12.43 ? 89  HIS C O   1 
ATOM   8691  C  CB  . HIS C 1 89  ? 11.497  -16.595 60.412  1.00 12.86 ? 89  HIS C CB  1 
ATOM   8692  C  CG  . HIS C 1 89  ? 11.163  -17.017 59.018  1.00 13.09 ? 89  HIS C CG  1 
ATOM   8693  N  ND1 . HIS C 1 89  ? 10.350  -16.271 58.193  1.00 13.14 ? 89  HIS C ND1 1 
ATOM   8694  C  CD2 . HIS C 1 89  ? 11.508  -18.121 58.311  1.00 13.17 ? 89  HIS C CD2 1 
ATOM   8695  C  CE1 . HIS C 1 89  ? 10.207  -16.896 57.039  1.00 13.16 ? 89  HIS C CE1 1 
ATOM   8696  N  NE2 . HIS C 1 89  ? 10.899  -18.021 57.085  1.00 13.20 ? 89  HIS C NE2 1 
ATOM   8697  N  N   . ASP C 1 90  ? 10.788  -17.559 63.357  1.00 12.57 ? 90  ASP C N   1 
ATOM   8698  C  CA  . ASP C 1 90  ? 11.164  -17.682 64.752  1.00 12.39 ? 90  ASP C CA  1 
ATOM   8699  C  C   . ASP C 1 90  ? 12.676  -17.753 64.899  1.00 12.24 ? 90  ASP C C   1 
ATOM   8700  O  O   . ASP C 1 90  ? 13.326  -18.621 64.320  1.00 12.16 ? 90  ASP C O   1 
ATOM   8701  C  CB  . ASP C 1 90  ? 10.524  -18.935 65.354  1.00 12.58 ? 90  ASP C CB  1 
ATOM   8702  C  CG  . ASP C 1 90  ? 10.768  -19.052 66.843  1.00 12.76 ? 90  ASP C CG  1 
ATOM   8703  O  OD1 . ASP C 1 90  ? 11.800  -19.645 67.223  1.00 12.73 ? 90  ASP C OD1 1 
ATOM   8704  O  OD2 . ASP C 1 90  ? 9.932   -18.551 67.630  1.00 12.87 ? 90  ASP C OD2 1 
ATOM   8705  N  N   . ILE C 1 91  ? 13.228  -16.825 65.671  1.00 12.43 ? 91  ILE C N   1 
ATOM   8706  C  CA  . ILE C 1 91  ? 14.665  -16.780 65.918  1.00 12.41 ? 91  ILE C CA  1 
ATOM   8707  C  C   . ILE C 1 91  ? 14.895  -16.582 67.410  1.00 12.36 ? 91  ILE C C   1 
ATOM   8708  O  O   . ILE C 1 91  ? 15.997  -16.256 67.845  1.00 12.22 ? 91  ILE C O   1 
ATOM   8709  C  CB  . ILE C 1 91  ? 15.343  -15.622 65.144  1.00 12.46 ? 91  ILE C CB  1 
ATOM   8710  C  CG1 . ILE C 1 91  ? 14.983  -14.273 65.777  1.00 12.52 ? 91  ILE C CG1 1 
ATOM   8711  C  CG2 . ILE C 1 91  ? 14.905  -15.649 63.687  1.00 12.88 ? 91  ILE C CG2 1 
ATOM   8712  C  CD1 . ILE C 1 91  ? 15.837  -13.127 65.285  1.00 11.89 ? 91  ILE C CD1 1 
ATOM   8713  N  N   . THR C 1 92  ? 13.836  -16.792 68.184  1.00 12.53 ? 92  THR C N   1 
ATOM   8714  C  CA  . THR C 1 92  ? 13.878  -16.641 69.630  1.00 12.89 ? 92  THR C CA  1 
ATOM   8715  C  C   . THR C 1 92  ? 15.020  -17.441 70.254  1.00 13.11 ? 92  THR C C   1 
ATOM   8716  O  O   . THR C 1 92  ? 15.500  -17.121 71.348  1.00 13.14 ? 92  THR C O   1 
ATOM   8717  C  CB  . THR C 1 92  ? 12.555  -17.104 70.244  1.00 13.00 ? 92  THR C CB  1 
ATOM   8718  O  OG1 . THR C 1 92  ? 12.530  -18.536 70.299  1.00 13.12 ? 92  THR C OG1 1 
ATOM   8719  C  CG2 . THR C 1 92  ? 11.389  -16.620 69.394  1.00 13.08 ? 92  THR C CG2 1 
ATOM   8720  N  N   . LYS C 1 93  ? 15.450  -18.486 69.555  1.00 13.19 ? 93  LYS C N   1 
ATOM   8721  C  CA  . LYS C 1 93  ? 16.533  -19.324 70.045  1.00 13.43 ? 93  LYS C CA  1 
ATOM   8722  C  C   . LYS C 1 93  ? 17.849  -18.560 69.981  1.00 13.42 ? 93  LYS C C   1 
ATOM   8723  O  O   . LYS C 1 93  ? 18.896  -19.075 70.391  1.00 13.44 ? 93  LYS C O   1 
ATOM   8724  C  CB  . LYS C 1 93  ? 16.631  -20.608 69.213  1.00 13.51 ? 93  LYS C CB  1 
ATOM   8725  C  CG  . LYS C 1 93  ? 17.589  -20.523 68.029  1.00 13.74 ? 93  LYS C CG  1 
ATOM   8726  C  CD  . LYS C 1 93  ? 16.998  -21.177 66.786  1.00 13.69 ? 93  LYS C CD  1 
ATOM   8727  C  CE  . LYS C 1 93  ? 16.315  -20.154 65.877  1.00 13.58 ? 93  LYS C CE  1 
ATOM   8728  N  NZ  . LYS C 1 93  ? 14.841  -20.071 66.110  1.00 12.70 ? 93  LYS C NZ  1 
ATOM   8729  N  N   . TYR C 1 94  ? 17.789  -17.332 69.466  1.00 13.07 ? 94  TYR C N   1 
ATOM   8730  C  CA  . TYR C 1 94  ? 18.974  -16.491 69.344  1.00 12.80 ? 94  TYR C CA  1 
ATOM   8731  C  C   . TYR C 1 94  ? 18.897  -15.250 70.223  1.00 12.68 ? 94  TYR C C   1 
ATOM   8732  O  O   . TYR C 1 94  ? 19.872  -14.889 70.885  1.00 12.79 ? 94  TYR C O   1 
ATOM   8733  C  CB  . TYR C 1 94  ? 19.173  -16.080 67.889  1.00 12.78 ? 94  TYR C CB  1 
ATOM   8734  C  CG  . TYR C 1 94  ? 19.796  -17.161 67.043  1.00 12.90 ? 94  TYR C CG  1 
ATOM   8735  C  CD1 . TYR C 1 94  ? 20.730  -18.042 67.588  1.00 13.04 ? 94  TYR C CD1 1 
ATOM   8736  C  CD2 . TYR C 1 94  ? 19.457  -17.304 65.695  1.00 12.81 ? 94  TYR C CD2 1 
ATOM   8737  C  CE1 . TYR C 1 94  ? 21.314  -19.042 66.816  1.00 13.56 ? 94  TYR C CE1 1 
ATOM   8738  C  CE2 . TYR C 1 94  ? 20.035  -18.300 64.911  1.00 13.33 ? 94  TYR C CE2 1 
ATOM   8739  C  CZ  . TYR C 1 94  ? 20.966  -19.166 65.480  1.00 13.66 ? 94  TYR C CZ  1 
ATOM   8740  O  OH  . TYR C 1 94  ? 21.555  -20.154 64.721  1.00 14.45 ? 94  TYR C OH  1 
ATOM   8741  N  N   . SER C 1 95  ? 17.739  -14.594 70.217  1.00 12.26 ? 95  SER C N   1 
ATOM   8742  C  CA  . SER C 1 95  ? 17.529  -13.396 71.020  1.00 12.05 ? 95  SER C CA  1 
ATOM   8743  C  C   . SER C 1 95  ? 16.222  -13.515 71.788  1.00 12.00 ? 95  SER C C   1 
ATOM   8744  O  O   . SER C 1 95  ? 15.337  -14.278 71.400  1.00 11.86 ? 95  SER C O   1 
ATOM   8745  C  CB  . SER C 1 95  ? 17.483  -12.151 70.137  1.00 11.75 ? 95  SER C CB  1 
ATOM   8746  O  OG  . SER C 1 95  ? 16.541  -11.215 70.634  1.00 11.22 ? 95  SER C OG  1 
ATOM   8747  N  N   . LYS C 1 96  ? 16.110  -12.759 72.876  1.00 11.94 ? 96  LYS C N   1 
ATOM   8748  C  CA  . LYS C 1 96  ? 14.916  -12.777 73.709  1.00 12.14 ? 96  LYS C CA  1 
ATOM   8749  C  C   . LYS C 1 96  ? 14.162  -11.466 73.601  1.00 12.16 ? 96  LYS C C   1 
ATOM   8750  O  O   . LYS C 1 96  ? 13.145  -11.274 74.260  1.00 12.05 ? 96  LYS C O   1 
ATOM   8751  C  CB  . LYS C 1 96  ? 15.292  -13.024 75.173  1.00 12.32 ? 96  LYS C CB  1 
ATOM   8752  C  CG  . LYS C 1 96  ? 15.916  -11.827 75.875  1.00 12.66 ? 96  LYS C CG  1 
ATOM   8753  C  CD  . LYS C 1 96  ? 17.101  -12.246 76.742  1.00 12.89 ? 96  LYS C CD  1 
ATOM   8754  C  CE  . LYS C 1 96  ? 17.596  -11.095 77.612  1.00 12.96 ? 96  LYS C CE  1 
ATOM   8755  N  NZ  . LYS C 1 96  ? 16.799  -10.941 78.866  1.00 12.81 ? 96  LYS C NZ  1 
ATOM   8756  N  N   . ALA C 1 97  ? 14.672  -10.563 72.770  1.00 12.42 ? 97  ALA C N   1 
ATOM   8757  C  CA  . ALA C 1 97  ? 14.053  -9.256  72.577  1.00 12.38 ? 97  ALA C CA  1 
ATOM   8758  C  C   . ALA C 1 97  ? 12.566  -9.388  72.269  1.00 12.39 ? 97  ALA C C   1 
ATOM   8759  O  O   . ALA C 1 97  ? 12.157  -10.142 71.384  1.00 12.44 ? 97  ALA C O   1 
ATOM   8760  C  CB  . ALA C 1 97  ? 14.758  -8.502  71.456  1.00 12.70 ? 97  ALA C CB  1 
ATOM   8761  N  N   . LYS C 1 98  ? 11.767  -8.634  73.009  1.00 12.47 ? 98  LYS C N   1 
ATOM   8762  C  CA  . LYS C 1 98  ? 10.320  -8.655  72.860  1.00 12.57 ? 98  LYS C CA  1 
ATOM   8763  C  C   . LYS C 1 98  ? 9.810   -8.372  71.446  1.00 12.68 ? 98  LYS C C   1 
ATOM   8764  O  O   . LYS C 1 98  ? 8.671   -8.701  71.113  1.00 12.71 ? 98  LYS C O   1 
ATOM   8765  C  CB  . LYS C 1 98  ? 9.698   -7.658  73.841  1.00 12.29 ? 98  LYS C CB  1 
ATOM   8766  C  CG  . LYS C 1 98  ? 8.857   -8.312  74.920  1.00 12.09 ? 98  LYS C CG  1 
ATOM   8767  C  CD  . LYS C 1 98  ? 9.280   -7.850  76.299  1.00 12.10 ? 98  LYS C CD  1 
ATOM   8768  C  CE  . LYS C 1 98  ? 9.035   -8.927  77.337  1.00 12.11 ? 98  LYS C CE  1 
ATOM   8769  N  NZ  . LYS C 1 98  ? 7.906   -8.567  78.231  1.00 12.18 ? 98  LYS C NZ  1 
ATOM   8770  N  N   . VAL C 1 99  ? 10.645  -7.762  70.614  1.00 12.95 ? 99  VAL C N   1 
ATOM   8771  C  CA  . VAL C 1 99  ? 10.239  -7.441  69.249  1.00 13.13 ? 99  VAL C CA  1 
ATOM   8772  C  C   . VAL C 1 99  ? 10.170  -8.673  68.350  1.00 13.09 ? 99  VAL C C   1 
ATOM   8773  O  O   . VAL C 1 99  ? 9.465   -8.673  67.339  1.00 13.14 ? 99  VAL C O   1 
ATOM   8774  C  CB  . VAL C 1 99  ? 11.198  -6.408  68.613  1.00 13.36 ? 99  VAL C CB  1 
ATOM   8775  C  CG1 . VAL C 1 99  ? 12.553  -7.052  68.319  1.00 13.48 ? 99  VAL C CG1 1 
ATOM   8776  C  CG2 . VAL C 1 99  ? 10.574  -5.842  67.339  1.00 13.64 ? 99  VAL C CG2 1 
ATOM   8777  N  N   . PHE C 1 100 ? 10.903  -9.719  68.724  1.00 13.04 ? 100 PHE C N   1 
ATOM   8778  C  CA  . PHE C 1 100 ? 10.933  -10.962 67.956  1.00 12.93 ? 100 PHE C CA  1 
ATOM   8779  C  C   . PHE C 1 100 ? 10.079  -12.007 68.657  1.00 12.97 ? 100 PHE C C   1 
ATOM   8780  O  O   . PHE C 1 100 ? 9.969   -13.145 68.206  1.00 13.09 ? 100 PHE C O   1 
ATOM   8781  C  CB  . PHE C 1 100 ? 12.371  -11.474 67.833  1.00 12.73 ? 100 PHE C CB  1 
ATOM   8782  C  CG  . PHE C 1 100 ? 13.339  -10.454 67.298  1.00 12.42 ? 100 PHE C CG  1 
ATOM   8783  C  CD1 . PHE C 1 100 ? 13.102  -9.816  66.086  1.00 12.30 ? 100 PHE C CD1 1 
ATOM   8784  C  CD2 . PHE C 1 100 ? 14.496  -10.141 68.001  1.00 12.25 ? 100 PHE C CD2 1 
ATOM   8785  C  CE1 . PHE C 1 100 ? 14.008  -8.881  65.584  1.00 12.24 ? 100 PHE C CE1 1 
ATOM   8786  C  CE2 . PHE C 1 100 ? 15.406  -9.207  67.506  1.00 12.14 ? 100 PHE C CE2 1 
ATOM   8787  C  CZ  . PHE C 1 100 ? 15.161  -8.578  66.296  1.00 12.05 ? 100 PHE C CZ  1 
ATOM   8788  N  N   . GLU C 1 101 ? 9.484   -11.591 69.768  1.00 13.14 ? 101 GLU C N   1 
ATOM   8789  C  CA  . GLU C 1 101 ? 8.623   -12.431 70.598  1.00 13.07 ? 101 GLU C CA  1 
ATOM   8790  C  C   . GLU C 1 101 ? 8.024   -13.647 69.892  1.00 12.88 ? 101 GLU C C   1 
ATOM   8791  O  O   . GLU C 1 101 ? 8.442   -14.778 70.119  1.00 12.83 ? 101 GLU C O   1 
ATOM   8792  C  CB  . GLU C 1 101 ? 7.495   -11.574 71.170  1.00 13.38 ? 101 GLU C CB  1 
ATOM   8793  C  CG  . GLU C 1 101 ? 7.591   -11.328 72.654  1.00 14.16 ? 101 GLU C CG  1 
ATOM   8794  C  CD  . GLU C 1 101 ? 6.419   -11.920 73.385  1.00 14.69 ? 101 GLU C CD  1 
ATOM   8795  O  OE1 . GLU C 1 101 ? 5.608   -11.143 73.933  1.00 15.12 ? 101 GLU C OE1 1 
ATOM   8796  O  OE2 . GLU C 1 101 ? 6.305   -13.166 73.399  1.00 15.33 ? 101 GLU C OE2 1 
ATOM   8797  N  N   . HIS C 1 102 ? 7.037   -13.406 69.040  1.00 13.21 ? 102 HIS C N   1 
ATOM   8798  C  CA  . HIS C 1 102 ? 6.383   -14.483 68.316  1.00 13.55 ? 102 HIS C CA  1 
ATOM   8799  C  C   . HIS C 1 102 ? 6.015   -14.070 66.888  1.00 13.34 ? 102 HIS C C   1 
ATOM   8800  O  O   . HIS C 1 102 ? 5.849   -12.881 66.591  1.00 12.84 ? 102 HIS C O   1 
ATOM   8801  C  CB  . HIS C 1 102 ? 5.129   -14.926 69.076  1.00 14.32 ? 102 HIS C CB  1 
ATOM   8802  C  CG  . HIS C 1 102 ? 4.060   -13.879 69.144  1.00 15.54 ? 102 HIS C CG  1 
ATOM   8803  N  ND1 . HIS C 1 102 ? 2.845   -14.010 68.502  1.00 16.12 ? 102 HIS C ND1 1 
ATOM   8804  C  CD2 . HIS C 1 102 ? 4.017   -12.686 69.787  1.00 16.03 ? 102 HIS C CD2 1 
ATOM   8805  C  CE1 . HIS C 1 102 ? 2.101   -12.945 68.749  1.00 16.46 ? 102 HIS C CE1 1 
ATOM   8806  N  NE2 . HIS C 1 102 ? 2.788   -12.127 69.525  1.00 16.36 ? 102 HIS C NE2 1 
ATOM   8807  N  N   . ILE C 1 103 ? 5.897   -15.063 66.008  1.00 13.11 ? 103 ILE C N   1 
ATOM   8808  C  CA  . ILE C 1 103 ? 5.550   -14.826 64.612  1.00 13.32 ? 103 ILE C CA  1 
ATOM   8809  C  C   . ILE C 1 103 ? 4.207   -14.098 64.503  1.00 13.72 ? 103 ILE C C   1 
ATOM   8810  O  O   . ILE C 1 103 ? 3.233   -14.474 65.162  1.00 14.02 ? 103 ILE C O   1 
ATOM   8811  C  CB  . ILE C 1 103 ? 5.471   -16.160 63.838  1.00 13.06 ? 103 ILE C CB  1 
ATOM   8812  C  CG1 . ILE C 1 103 ? 6.874   -16.587 63.406  1.00 12.97 ? 103 ILE C CG1 1 
ATOM   8813  C  CG2 . ILE C 1 103 ? 4.564   -16.021 62.626  1.00 12.48 ? 103 ILE C CG2 1 
ATOM   8814  C  CD1 . ILE C 1 103 ? 7.065   -18.102 63.345  1.00 13.10 ? 103 ILE C CD1 1 
ATOM   8815  N  N   . GLY C 1 104 ? 4.160   -13.058 63.670  1.00 13.83 ? 104 GLY C N   1 
ATOM   8816  C  CA  . GLY C 1 104 ? 2.931   -12.303 63.491  1.00 13.67 ? 104 GLY C CA  1 
ATOM   8817  C  C   . GLY C 1 104 ? 2.883   -11.021 64.309  1.00 13.76 ? 104 GLY C C   1 
ATOM   8818  O  O   . GLY C 1 104 ? 2.044   -10.147 64.068  1.00 13.66 ? 104 GLY C O   1 
ATOM   8819  N  N   . LYS C 1 105 ? 3.788   -10.907 65.278  1.00 13.60 ? 105 LYS C N   1 
ATOM   8820  C  CA  . LYS C 1 105 ? 3.864   -9.731  66.140  1.00 13.22 ? 105 LYS C CA  1 
ATOM   8821  C  C   . LYS C 1 105 ? 4.255   -8.478  65.360  1.00 13.36 ? 105 LYS C C   1 
ATOM   8822  O  O   . LYS C 1 105 ? 5.378   -8.363  64.859  1.00 13.48 ? 105 LYS C O   1 
ATOM   8823  C  CB  . LYS C 1 105 ? 4.884   -9.972  67.255  1.00 13.24 ? 105 LYS C CB  1 
ATOM   8824  C  CG  . LYS C 1 105 ? 4.463   -9.443  68.615  1.00 13.08 ? 105 LYS C CG  1 
ATOM   8825  C  CD  . LYS C 1 105 ? 5.586   -8.655  69.279  1.00 13.05 ? 105 LYS C CD  1 
ATOM   8826  C  CE  . LYS C 1 105 ? 5.163   -8.130  70.654  1.00 13.08 ? 105 LYS C CE  1 
ATOM   8827  N  NZ  . LYS C 1 105 ? 5.940   -8.747  71.776  1.00 12.98 ? 105 LYS C NZ  1 
ATOM   8828  N  N   . LYS C 1 106 ? 3.323   -7.536  65.268  1.00 13.21 ? 106 LYS C N   1 
ATOM   8829  C  CA  . LYS C 1 106 ? 3.563   -6.290  64.554  1.00 13.14 ? 106 LYS C CA  1 
ATOM   8830  C  C   . LYS C 1 106 ? 4.049   -5.198  65.510  1.00 13.03 ? 106 LYS C C   1 
ATOM   8831  O  O   . LYS C 1 106 ? 3.490   -5.020  66.597  1.00 13.00 ? 106 LYS C O   1 
ATOM   8832  C  CB  . LYS C 1 106 ? 2.277   -5.829  63.861  1.00 13.13 ? 106 LYS C CB  1 
ATOM   8833  C  CG  . LYS C 1 106 ? 1.961   -6.574  62.578  1.00 13.28 ? 106 LYS C CG  1 
ATOM   8834  C  CD  . LYS C 1 106 ? 1.086   -5.734  61.653  1.00 13.45 ? 106 LYS C CD  1 
ATOM   8835  C  CE  . LYS C 1 106 ? -0.189  -6.466  61.261  1.00 13.40 ? 106 LYS C CE  1 
ATOM   8836  N  NZ  . LYS C 1 106 ? 0.118   -7.651  60.410  1.00 13.74 ? 106 LYS C NZ  1 
ATOM   8837  N  N   . THR C 1 107 ? 5.086   -4.467  65.100  1.00 12.54 ? 107 THR C N   1 
ATOM   8838  C  CA  . THR C 1 107 ? 5.633   -3.390  65.919  1.00 12.24 ? 107 THR C CA  1 
ATOM   8839  C  C   . THR C 1 107 ? 5.771   -2.133  65.070  1.00 11.77 ? 107 THR C C   1 
ATOM   8840  O  O   . THR C 1 107 ? 6.364   -2.168  64.001  1.00 11.89 ? 107 THR C O   1 
ATOM   8841  C  CB  . THR C 1 107 ? 7.014   -3.767  66.493  1.00 12.10 ? 107 THR C CB  1 
ATOM   8842  O  OG1 . THR C 1 107 ? 6.917   -5.023  67.173  1.00 11.96 ? 107 THR C OG1 1 
ATOM   8843  C  CG2 . THR C 1 107 ? 7.495   -2.711  67.475  1.00 12.01 ? 107 THR C CG2 1 
ATOM   8844  N  N   . PRO C 1 108 ? 5.231   -0.999  65.549  1.00 11.60 ? 108 PRO C N   1 
ATOM   8845  C  CA  . PRO C 1 108 ? 5.309   0.258   64.799  1.00 11.74 ? 108 PRO C CA  1 
ATOM   8846  C  C   . PRO C 1 108 ? 6.742   0.735   64.644  1.00 11.81 ? 108 PRO C C   1 
ATOM   8847  O  O   . PRO C 1 108 ? 7.514   0.698   65.599  1.00 12.02 ? 108 PRO C O   1 
ATOM   8848  C  CB  . PRO C 1 108 ? 4.468   1.226   65.626  1.00 11.61 ? 108 PRO C CB  1 
ATOM   8849  C  CG  . PRO C 1 108 ? 4.477   0.660   66.997  1.00 11.46 ? 108 PRO C CG  1 
ATOM   8850  C  CD  . PRO C 1 108 ? 4.540   -0.828  66.839  1.00 11.63 ? 108 PRO C CD  1 
ATOM   8851  N  N   . ILE C 1 109 ? 7.090   1.190   63.444  1.00 11.77 ? 109 ILE C N   1 
ATOM   8852  C  CA  . ILE C 1 109 ? 8.439   1.664   63.171  1.00 11.68 ? 109 ILE C CA  1 
ATOM   8853  C  C   . ILE C 1 109 ? 8.468   3.011   62.458  1.00 11.42 ? 109 ILE C C   1 
ATOM   8854  O  O   . ILE C 1 109 ? 7.458   3.468   61.934  1.00 11.53 ? 109 ILE C O   1 
ATOM   8855  C  CB  . ILE C 1 109 ? 9.209   0.656   62.309  1.00 11.61 ? 109 ILE C CB  1 
ATOM   8856  C  CG1 . ILE C 1 109 ? 8.475   0.436   60.985  1.00 11.41 ? 109 ILE C CG1 1 
ATOM   8857  C  CG2 . ILE C 1 109 ? 9.355   -0.647  63.058  1.00 12.04 ? 109 ILE C CG2 1 
ATOM   8858  C  CD1 . ILE C 1 109 ? 9.355   -0.076  59.869  1.00 10.62 ? 109 ILE C CD1 1 
ATOM   8859  N  N   . ALA C 1 110 ? 9.643   3.632   62.445  1.00 11.13 ? 110 ALA C N   1 
ATOM   8860  C  CA  . ALA C 1 110 ? 9.852   4.921   61.798  1.00 10.62 ? 110 ALA C CA  1 
ATOM   8861  C  C   . ALA C 1 110 ? 11.139  4.834   60.996  1.00 10.48 ? 110 ALA C C   1 
ATOM   8862  O  O   . ALA C 1 110 ? 12.098  4.192   61.419  1.00 10.34 ? 110 ALA C O   1 
ATOM   8863  C  CB  . ALA C 1 110 ? 9.962   6.022   62.841  1.00 10.66 ? 110 ALA C CB  1 
ATOM   8864  N  N   . VAL C 1 111 ? 11.158  5.472   59.832  1.00 10.42 ? 111 VAL C N   1 
ATOM   8865  C  CA  . VAL C 1 111 ? 12.341  5.441   58.984  1.00 10.50 ? 111 VAL C CA  1 
ATOM   8866  C  C   . VAL C 1 111 ? 12.685  6.794   58.363  1.00 10.58 ? 111 VAL C C   1 
ATOM   8867  O  O   . VAL C 1 111 ? 11.801  7.591   58.041  1.00 10.37 ? 111 VAL C O   1 
ATOM   8868  C  CB  . VAL C 1 111 ? 12.190  4.410   57.831  1.00 10.33 ? 111 VAL C CB  1 
ATOM   8869  C  CG1 . VAL C 1 111 ? 13.523  4.220   57.136  1.00 10.45 ? 111 VAL C CG1 1 
ATOM   8870  C  CG2 . VAL C 1 111 ? 11.690  3.083   58.363  1.00 10.17 ? 111 VAL C CG2 1 
ATOM   8871  N  N   . ARG C 1 112 ? 13.985  7.041   58.215  1.00 10.80 ? 112 ARG C N   1 
ATOM   8872  C  CA  . ARG C 1 112 ? 14.491  8.267   57.614  1.00 11.05 ? 112 ARG C CA  1 
ATOM   8873  C  C   . ARG C 1 112 ? 15.707  7.940   56.767  1.00 11.34 ? 112 ARG C C   1 
ATOM   8874  O  O   . ARG C 1 112 ? 16.721  7.451   57.266  1.00 11.29 ? 112 ARG C O   1 
ATOM   8875  C  CB  . ARG C 1 112 ? 14.884  9.300   58.673  1.00 11.24 ? 112 ARG C CB  1 
ATOM   8876  C  CG  . ARG C 1 112 ? 15.061  10.708  58.101  1.00 11.40 ? 112 ARG C CG  1 
ATOM   8877  C  CD  . ARG C 1 112 ? 15.807  11.628  59.059  1.00 11.69 ? 112 ARG C CD  1 
ATOM   8878  N  NE  . ARG C 1 112 ? 17.001  12.233  58.462  1.00 11.35 ? 112 ARG C NE  1 
ATOM   8879  C  CZ  . ARG C 1 112 ? 17.020  13.418  57.857  1.00 11.19 ? 112 ARG C CZ  1 
ATOM   8880  N  NH1 . ARG C 1 112 ? 15.909  14.139  57.761  1.00 10.92 ? 112 ARG C NH1 1 
ATOM   8881  N  NH2 . ARG C 1 112 ? 18.154  13.889  57.351  1.00 10.82 ? 112 ARG C NH2 1 
ATOM   8882  N  N   . PHE C 1 113 ? 15.585  8.208   55.476  1.00 11.71 ? 113 PHE C N   1 
ATOM   8883  C  CA  . PHE C 1 113 ? 16.655  7.956   54.528  1.00 12.08 ? 113 PHE C CA  1 
ATOM   8884  C  C   . PHE C 1 113 ? 17.433  9.241   54.321  1.00 12.25 ? 113 PHE C C   1 
ATOM   8885  O  O   . PHE C 1 113 ? 16.891  10.333  54.504  1.00 12.46 ? 113 PHE C O   1 
ATOM   8886  C  CB  . PHE C 1 113 ? 16.055  7.466   53.219  1.00 12.13 ? 113 PHE C CB  1 
ATOM   8887  C  CG  . PHE C 1 113 ? 15.100  6.325   53.399  1.00 12.03 ? 113 PHE C CG  1 
ATOM   8888  C  CD1 . PHE C 1 113 ? 15.577  5.033   53.614  1.00 11.97 ? 113 PHE C CD1 1 
ATOM   8889  C  CD2 . PHE C 1 113 ? 13.729  6.539   53.377  1.00 11.91 ? 113 PHE C CD2 1 
ATOM   8890  C  CE1 . PHE C 1 113 ? 14.699  3.974   53.805  1.00 11.83 ? 113 PHE C CE1 1 
ATOM   8891  C  CE2 . PHE C 1 113 ? 12.843  5.482   53.567  1.00 11.79 ? 113 PHE C CE2 1 
ATOM   8892  C  CZ  . PHE C 1 113 ? 13.331  4.197   53.781  1.00 11.72 ? 113 PHE C CZ  1 
ATOM   8893  N  N   . SER C 1 114 ? 18.698  9.124   53.940  1.00 12.06 ? 114 SER C N   1 
ATOM   8894  C  CA  . SER C 1 114 ? 19.495  10.324  53.759  1.00 12.17 ? 114 SER C CA  1 
ATOM   8895  C  C   . SER C 1 114 ? 20.805  10.131  53.008  1.00 12.07 ? 114 SER C C   1 
ATOM   8896  O  O   . SER C 1 114 ? 21.196  9.013   52.667  1.00 11.72 ? 114 SER C O   1 
ATOM   8897  C  CB  . SER C 1 114 ? 19.793  10.947  55.130  1.00 12.11 ? 114 SER C CB  1 
ATOM   8898  O  OG  . SER C 1 114 ? 20.307  9.977   56.032  1.00 12.28 ? 114 SER C OG  1 
ATOM   8899  N  N   . THR C 1 115 ? 21.461  11.258  52.752  1.00 12.03 ? 115 THR C N   1 
ATOM   8900  C  CA  . THR C 1 115 ? 22.747  11.302  52.077  1.00 12.28 ? 115 THR C CA  1 
ATOM   8901  C  C   . THR C 1 115 ? 23.742  11.480  53.215  1.00 12.25 ? 115 THR C C   1 
ATOM   8902  O  O   . THR C 1 115 ? 23.415  11.181  54.365  1.00 12.33 ? 115 THR C O   1 
ATOM   8903  C  CB  . THR C 1 115 ? 22.836  12.511  51.138  1.00 12.48 ? 115 THR C CB  1 
ATOM   8904  O  OG1 . THR C 1 115 ? 22.504  13.702  51.863  1.00 13.03 ? 115 THR C OG1 1 
ATOM   8905  C  CG2 . THR C 1 115 ? 21.876  12.348  49.974  1.00 12.40 ? 115 THR C CG2 1 
ATOM   8906  N  N   . VAL C 1 116 ? 24.937  11.983  52.920  1.00 12.16 ? 116 VAL C N   1 
ATOM   8907  C  CA  . VAL C 1 116 ? 25.926  12.160  53.975  1.00 12.01 ? 116 VAL C CA  1 
ATOM   8908  C  C   . VAL C 1 116 ? 26.540  13.552  54.075  1.00 11.87 ? 116 VAL C C   1 
ATOM   8909  O  O   . VAL C 1 116 ? 26.288  14.272  55.038  1.00 12.02 ? 116 VAL C O   1 
ATOM   8910  C  CB  . VAL C 1 116 ? 27.061  11.131  53.842  1.00 12.12 ? 116 VAL C CB  1 
ATOM   8911  C  CG1 . VAL C 1 116 ? 27.914  11.134  55.103  1.00 12.44 ? 116 VAL C CG1 1 
ATOM   8912  C  CG2 . VAL C 1 116 ? 26.479  9.743   53.605  1.00 11.84 ? 116 VAL C CG2 1 
ATOM   8913  N  N   . ALA C 1 117 ? 27.338  13.939  53.086  1.00 11.69 ? 117 ALA C N   1 
ATOM   8914  C  CA  . ALA C 1 117 ? 27.994  15.245  53.117  1.00 11.58 ? 117 ALA C CA  1 
ATOM   8915  C  C   . ALA C 1 117 ? 27.105  16.428  52.746  1.00 11.36 ? 117 ALA C C   1 
ATOM   8916  O  O   . ALA C 1 117 ? 27.256  17.518  53.299  1.00 11.33 ? 117 ALA C O   1 
ATOM   8917  C  CB  . ALA C 1 117 ? 29.227  15.225  52.225  1.00 11.43 ? 117 ALA C CB  1 
ATOM   8918  N  N   . GLY C 1 118 ? 26.181  16.216  51.817  1.00 11.30 ? 118 GLY C N   1 
ATOM   8919  C  CA  . GLY C 1 118 ? 25.299  17.290  51.387  1.00 11.33 ? 118 GLY C CA  1 
ATOM   8920  C  C   . GLY C 1 118 ? 24.478  17.961  52.475  1.00 11.31 ? 118 GLY C C   1 
ATOM   8921  O  O   . GLY C 1 118 ? 23.852  17.294  53.297  1.00 11.21 ? 118 GLY C O   1 
ATOM   8922  N  N   . GLU C 1 119 ? 24.472  19.291  52.464  1.00 11.66 ? 119 GLU C N   1 
ATOM   8923  C  CA  . GLU C 1 119 ? 23.728  20.075  53.448  1.00 12.02 ? 119 GLU C CA  1 
ATOM   8924  C  C   . GLU C 1 119 ? 22.218  20.028  53.216  1.00 12.13 ? 119 GLU C C   1 
ATOM   8925  O  O   . GLU C 1 119 ? 21.733  19.375  52.293  1.00 11.94 ? 119 GLU C O   1 
ATOM   8926  C  CB  . GLU C 1 119 ? 24.197  21.530  53.423  1.00 12.17 ? 119 GLU C CB  1 
ATOM   8927  C  CG  . GLU C 1 119 ? 25.398  21.772  52.531  1.00 12.58 ? 119 GLU C CG  1 
ATOM   8928  C  CD  . GLU C 1 119 ? 26.699  21.797  53.309  1.00 12.78 ? 119 GLU C CD  1 
ATOM   8929  O  OE1 . GLU C 1 119 ? 26.644  21.908  54.552  1.00 12.60 ? 119 GLU C OE1 1 
ATOM   8930  O  OE2 . GLU C 1 119 ? 27.775  21.706  52.679  1.00 13.05 ? 119 GLU C OE2 1 
ATOM   8931  N  N   . SER C 1 120 ? 21.481  20.746  54.057  1.00 12.46 ? 120 SER C N   1 
ATOM   8932  C  CA  . SER C 1 120 ? 20.023  20.788  53.978  1.00 12.85 ? 120 SER C CA  1 
ATOM   8933  C  C   . SER C 1 120 ? 19.451  21.042  52.585  1.00 13.16 ? 120 SER C C   1 
ATOM   8934  O  O   . SER C 1 120 ? 18.492  20.383  52.177  1.00 13.31 ? 120 SER C O   1 
ATOM   8935  C  CB  . SER C 1 120 ? 19.481  21.842  54.945  1.00 12.90 ? 120 SER C CB  1 
ATOM   8936  O  OG  . SER C 1 120 ? 19.270  21.272  56.225  1.00 13.35 ? 120 SER C OG  1 
ATOM   8937  N  N   . GLY C 1 121 ? 20.028  21.992  51.857  1.00 12.99 ? 121 GLY C N   1 
ATOM   8938  C  CA  . GLY C 1 121 ? 19.521  22.290  50.530  1.00 12.90 ? 121 GLY C CA  1 
ATOM   8939  C  C   . GLY C 1 121 ? 20.151  21.521  49.380  1.00 12.86 ? 121 GLY C C   1 
ATOM   8940  O  O   . GLY C 1 121 ? 19.900  21.838  48.214  1.00 12.76 ? 121 GLY C O   1 
ATOM   8941  N  N   . SER C 1 122 ? 20.959  20.512  49.690  1.00 12.54 ? 122 SER C N   1 
ATOM   8942  C  CA  . SER C 1 122 ? 21.618  19.732  48.649  1.00 12.42 ? 122 SER C CA  1 
ATOM   8943  C  C   . SER C 1 122 ? 20.645  18.863  47.855  1.00 12.09 ? 122 SER C C   1 
ATOM   8944  O  O   . SER C 1 122 ? 19.463  18.766  48.187  1.00 11.94 ? 122 SER C O   1 
ATOM   8945  C  CB  . SER C 1 122 ? 22.712  18.858  49.262  1.00 12.62 ? 122 SER C CB  1 
ATOM   8946  O  OG  . SER C 1 122 ? 22.231  18.188  50.408  1.00 13.13 ? 122 SER C OG  1 
ATOM   8947  N  N   . ALA C 1 123 ? 21.158  18.229  46.805  1.00 12.20 ? 123 ALA C N   1 
ATOM   8948  C  CA  . ALA C 1 123 ? 20.348  17.375  45.942  1.00 12.06 ? 123 ALA C CA  1 
ATOM   8949  C  C   . ALA C 1 123 ? 20.451  15.912  46.350  1.00 12.05 ? 123 ALA C C   1 
ATOM   8950  O  O   . ALA C 1 123 ? 21.500  15.458  46.802  1.00 12.12 ? 123 ALA C O   1 
ATOM   8951  C  CB  . ALA C 1 123 ? 20.780  17.546  44.487  1.00 12.04 ? 123 ALA C CB  1 
ATOM   8952  N  N   . ASP C 1 124 ? 19.354  15.182  46.167  1.00 12.03 ? 124 ASP C N   1 
ATOM   8953  C  CA  . ASP C 1 124 ? 19.279  13.769  46.523  1.00 12.05 ? 124 ASP C CA  1 
ATOM   8954  C  C   . ASP C 1 124 ? 20.113  12.844  45.647  1.00 12.14 ? 124 ASP C C   1 
ATOM   8955  O  O   . ASP C 1 124 ? 20.950  12.096  46.147  1.00 12.12 ? 124 ASP C O   1 
ATOM   8956  C  CB  . ASP C 1 124 ? 17.824  13.309  46.479  1.00 11.95 ? 124 ASP C CB  1 
ATOM   8957  C  CG  . ASP C 1 124 ? 16.994  13.903  47.592  1.00 11.80 ? 124 ASP C CG  1 
ATOM   8958  O  OD1 . ASP C 1 124 ? 17.582  14.564  48.475  1.00 11.74 ? 124 ASP C OD1 1 
ATOM   8959  O  OD2 . ASP C 1 124 ? 15.759  13.706  47.582  1.00 11.57 ? 124 ASP C OD2 1 
ATOM   8960  N  N   . THR C 1 125 ? 19.868  12.892  44.342  1.00 12.39 ? 125 THR C N   1 
ATOM   8961  C  CA  . THR C 1 125 ? 20.569  12.045  43.376  1.00 12.54 ? 125 THR C CA  1 
ATOM   8962  C  C   . THR C 1 125 ? 22.046  12.395  43.213  1.00 12.52 ? 125 THR C C   1 
ATOM   8963  O  O   . THR C 1 125 ? 22.461  12.908  42.172  1.00 12.63 ? 125 THR C O   1 
ATOM   8964  C  CB  . THR C 1 125 ? 19.893  12.130  41.997  1.00 12.67 ? 125 THR C CB  1 
ATOM   8965  O  OG1 . THR C 1 125 ? 20.038  13.458  41.477  1.00 12.98 ? 125 THR C OG1 1 
ATOM   8966  C  CG2 . THR C 1 125 ? 18.409  11.796  42.111  1.00 12.62 ? 125 THR C CG2 1 
ATOM   8967  N  N   . VAL C 1 126 ? 22.838  12.096  44.239  1.00 12.60 ? 126 VAL C N   1 
ATOM   8968  C  CA  . VAL C 1 126 ? 24.271  12.383  44.232  1.00 12.45 ? 126 VAL C CA  1 
ATOM   8969  C  C   . VAL C 1 126 ? 25.043  11.165  44.730  1.00 12.45 ? 126 VAL C C   1 
ATOM   8970  O  O   . VAL C 1 126 ? 24.526  10.390  45.532  1.00 12.53 ? 126 VAL C O   1 
ATOM   8971  C  CB  . VAL C 1 126 ? 24.596  13.581  45.158  1.00 12.33 ? 126 VAL C CB  1 
ATOM   8972  C  CG1 . VAL C 1 126 ? 25.977  14.119  44.858  1.00 12.55 ? 126 VAL C CG1 1 
ATOM   8973  C  CG2 . VAL C 1 126 ? 23.571  14.668  44.969  1.00 12.05 ? 126 VAL C CG2 1 
ATOM   8974  N  N   . ARG C 1 127 ? 26.271  10.986  44.253  1.00 12.49 ? 127 ARG C N   1 
ATOM   8975  C  CA  . ARG C 1 127 ? 27.074  9.852   44.701  1.00 12.77 ? 127 ARG C CA  1 
ATOM   8976  C  C   . ARG C 1 127 ? 27.449  10.091  46.160  1.00 12.86 ? 127 ARG C C   1 
ATOM   8977  O  O   . ARG C 1 127 ? 28.201  11.015  46.480  1.00 12.97 ? 127 ARG C O   1 
ATOM   8978  C  CB  . ARG C 1 127 ? 28.348  9.704   43.861  1.00 12.57 ? 127 ARG C CB  1 
ATOM   8979  C  CG  . ARG C 1 127 ? 29.456  8.929   44.562  1.00 12.40 ? 127 ARG C CG  1 
ATOM   8980  C  CD  . ARG C 1 127 ? 29.904  7.732   43.750  1.00 12.51 ? 127 ARG C CD  1 
ATOM   8981  N  NE  . ARG C 1 127 ? 29.907  8.014   42.318  1.00 12.75 ? 127 ARG C NE  1 
ATOM   8982  C  CZ  . ARG C 1 127 ? 29.413  7.195   41.395  1.00 12.91 ? 127 ARG C CZ  1 
ATOM   8983  N  NH1 . ARG C 1 127 ? 28.874  6.037   41.754  1.00 12.81 ? 127 ARG C NH1 1 
ATOM   8984  N  NH2 . ARG C 1 127 ? 29.453  7.539   40.115  1.00 13.17 ? 127 ARG C NH2 1 
ATOM   8985  N  N   . ASP C 1 128 ? 26.920  9.244   47.036  1.00 12.69 ? 128 ASP C N   1 
ATOM   8986  C  CA  . ASP C 1 128 ? 27.162  9.349   48.463  1.00 12.25 ? 128 ASP C CA  1 
ATOM   8987  C  C   . ASP C 1 128 ? 26.500  8.138   49.098  1.00 12.53 ? 128 ASP C C   1 
ATOM   8988  O  O   . ASP C 1 128 ? 25.558  7.574   48.533  1.00 12.88 ? 128 ASP C O   1 
ATOM   8989  C  CB  . ASP C 1 128 ? 26.508  10.627  49.000  1.00 11.82 ? 128 ASP C CB  1 
ATOM   8990  C  CG  . ASP C 1 128 ? 27.420  11.422  49.917  1.00 11.16 ? 128 ASP C CG  1 
ATOM   8991  O  OD1 . ASP C 1 128 ? 28.649  11.199  49.895  1.00 11.23 ? 128 ASP C OD1 1 
ATOM   8992  O  OD2 . ASP C 1 128 ? 26.903  12.280  50.662  1.00 10.38 ? 128 ASP C OD2 1 
ATOM   8993  N  N   . PRO C 1 129 ? 26.993  7.702   50.266  1.00 12.52 ? 129 PRO C N   1 
ATOM   8994  C  CA  . PRO C 1 129 ? 26.362  6.542   50.905  1.00 12.47 ? 129 PRO C CA  1 
ATOM   8995  C  C   . PRO C 1 129 ? 24.944  6.956   51.308  1.00 12.35 ? 129 PRO C C   1 
ATOM   8996  O  O   . PRO C 1 129 ? 24.648  8.147   51.370  1.00 12.34 ? 129 PRO C O   1 
ATOM   8997  C  CB  . PRO C 1 129 ? 27.255  6.261   52.119  1.00 12.42 ? 129 PRO C CB  1 
ATOM   8998  C  CG  . PRO C 1 129 ? 28.536  7.016   51.852  1.00 12.42 ? 129 PRO C CG  1 
ATOM   8999  C  CD  . PRO C 1 129 ? 28.135  8.210   51.040  1.00 12.45 ? 129 PRO C CD  1 
ATOM   9000  N  N   . ARG C 1 130 ? 24.071  5.996   51.579  1.00 12.25 ? 130 ARG C N   1 
ATOM   9001  C  CA  . ARG C 1 130 ? 22.705  6.340   51.957  1.00 12.44 ? 130 ARG C CA  1 
ATOM   9002  C  C   . ARG C 1 130 ? 22.354  5.992   53.402  1.00 12.59 ? 130 ARG C C   1 
ATOM   9003  O  O   . ARG C 1 130 ? 22.694  4.914   53.899  1.00 12.42 ? 130 ARG C O   1 
ATOM   9004  C  CB  . ARG C 1 130 ? 21.711  5.655   51.015  1.00 12.36 ? 130 ARG C CB  1 
ATOM   9005  C  CG  . ARG C 1 130 ? 20.964  6.603   50.093  1.00 12.47 ? 130 ARG C CG  1 
ATOM   9006  C  CD  . ARG C 1 130 ? 21.925  7.465   49.302  1.00 12.78 ? 130 ARG C CD  1 
ATOM   9007  N  NE  . ARG C 1 130 ? 21.388  7.855   48.000  1.00 12.92 ? 130 ARG C NE  1 
ATOM   9008  C  CZ  . ARG C 1 130 ? 22.028  8.648   47.147  1.00 12.99 ? 130 ARG C CZ  1 
ATOM   9009  N  NH1 . ARG C 1 130 ? 23.224  9.130   47.461  1.00 13.05 ? 130 ARG C NH1 1 
ATOM   9010  N  NH2 . ARG C 1 130 ? 21.480  8.959   45.982  1.00 12.94 ? 130 ARG C NH2 1 
ATOM   9011  N  N   . GLY C 1 131 ? 21.663  6.915   54.067  1.00 12.61 ? 131 GLY C N   1 
ATOM   9012  C  CA  . GLY C 1 131 ? 21.254  6.689   55.440  1.00 12.93 ? 131 GLY C CA  1 
ATOM   9013  C  C   . GLY C 1 131 ? 19.968  5.884   55.495  1.00 13.03 ? 131 GLY C C   1 
ATOM   9014  O  O   . GLY C 1 131 ? 19.036  6.131   54.729  1.00 13.32 ? 131 GLY C O   1 
ATOM   9015  N  N   . PHE C 1 132 ? 19.912  4.916   56.400  1.00 12.59 ? 132 PHE C N   1 
ATOM   9016  C  CA  . PHE C 1 132 ? 18.730  4.077   56.546  1.00 12.16 ? 132 PHE C CA  1 
ATOM   9017  C  C   . PHE C 1 132 ? 18.564  3.681   58.015  1.00 11.63 ? 132 PHE C C   1 
ATOM   9018  O  O   . PHE C 1 132 ? 19.023  2.622   58.440  1.00 11.26 ? 132 PHE C O   1 
ATOM   9019  C  CB  . PHE C 1 132 ? 18.868  2.825   55.668  1.00 12.41 ? 132 PHE C CB  1 
ATOM   9020  C  CG  . PHE C 1 132 ? 17.563  2.140   55.370  1.00 12.56 ? 132 PHE C CG  1 
ATOM   9021  C  CD1 . PHE C 1 132 ? 16.540  2.103   56.318  1.00 12.53 ? 132 PHE C CD1 1 
ATOM   9022  C  CD2 . PHE C 1 132 ? 17.356  1.525   54.141  1.00 12.69 ? 132 PHE C CD2 1 
ATOM   9023  C  CE1 . PHE C 1 132 ? 15.335  1.465   56.047  1.00 12.45 ? 132 PHE C CE1 1 
ATOM   9024  C  CE2 . PHE C 1 132 ? 16.151  0.883   53.859  1.00 12.72 ? 132 PHE C CE2 1 
ATOM   9025  C  CZ  . PHE C 1 132 ? 15.138  0.853   54.816  1.00 12.55 ? 132 PHE C CZ  1 
ATOM   9026  N  N   . ALA C 1 133 ? 17.905  4.546   58.780  1.00 11.48 ? 133 ALA C N   1 
ATOM   9027  C  CA  . ALA C 1 133 ? 17.679  4.303   60.200  1.00 11.42 ? 133 ALA C CA  1 
ATOM   9028  C  C   . ALA C 1 133 ? 16.237  3.881   60.481  1.00 11.42 ? 133 ALA C C   1 
ATOM   9029  O  O   . ALA C 1 133 ? 15.294  4.388   59.877  1.00 11.39 ? 133 ALA C O   1 
ATOM   9030  C  CB  . ALA C 1 133 ? 18.032  5.552   61.000  1.00 11.21 ? 133 ALA C CB  1 
ATOM   9031  N  N   . VAL C 1 134 ? 16.078  2.948   61.409  1.00 11.60 ? 134 VAL C N   1 
ATOM   9032  C  CA  . VAL C 1 134 ? 14.764  2.437   61.770  1.00 11.76 ? 134 VAL C CA  1 
ATOM   9033  C  C   . VAL C 1 134 ? 14.562  2.502   63.275  1.00 11.51 ? 134 VAL C C   1 
ATOM   9034  O  O   . VAL C 1 134 ? 15.430  2.091   64.037  1.00 11.72 ? 134 VAL C O   1 
ATOM   9035  C  CB  . VAL C 1 134 ? 14.602  0.963   61.333  1.00 12.07 ? 134 VAL C CB  1 
ATOM   9036  C  CG1 . VAL C 1 134 ? 13.179  0.713   60.847  1.00 12.47 ? 134 VAL C CG1 1 
ATOM   9037  C  CG2 . VAL C 1 134 ? 15.611  0.625   60.246  1.00 12.11 ? 134 VAL C CG2 1 
ATOM   9038  N  N   . LYS C 1 135 ? 13.416  3.020   63.697  1.00 11.25 ? 135 LYS C N   1 
ATOM   9039  C  CA  . LYS C 1 135 ? 13.103  3.117   65.113  1.00 10.72 ? 135 LYS C CA  1 
ATOM   9040  C  C   . LYS C 1 135 ? 11.931  2.206   65.444  1.00 10.82 ? 135 LYS C C   1 
ATOM   9041  O  O   . LYS C 1 135 ? 10.822  2.400   64.946  1.00 10.65 ? 135 LYS C O   1 
ATOM   9042  C  CB  . LYS C 1 135 ? 12.743  4.551   65.487  1.00 10.34 ? 135 LYS C CB  1 
ATOM   9043  C  CG  . LYS C 1 135 ? 12.428  4.730   66.958  1.00 9.70  ? 135 LYS C CG  1 
ATOM   9044  C  CD  . LYS C 1 135 ? 11.858  6.102   67.243  1.00 9.35  ? 135 LYS C CD  1 
ATOM   9045  C  CE  . LYS C 1 135 ? 12.824  7.213   66.855  1.00 9.07  ? 135 LYS C CE  1 
ATOM   9046  N  NZ  . LYS C 1 135 ? 14.236  6.862   67.130  1.00 8.62  ? 135 LYS C NZ  1 
ATOM   9047  N  N   . PHE C 1 136 ? 12.179  1.207   66.282  1.00 10.87 ? 136 PHE C N   1 
ATOM   9048  C  CA  . PHE C 1 136 ? 11.128  0.283   66.678  1.00 11.01 ? 136 PHE C CA  1 
ATOM   9049  C  C   . PHE C 1 136 ? 10.556  0.703   68.025  1.00 11.11 ? 136 PHE C C   1 
ATOM   9050  O  O   . PHE C 1 136 ? 11.288  0.853   68.997  1.00 11.00 ? 136 PHE C O   1 
ATOM   9051  C  CB  . PHE C 1 136 ? 11.673  -1.138  66.798  1.00 11.32 ? 136 PHE C CB  1 
ATOM   9052  C  CG  . PHE C 1 136 ? 12.308  -1.660  65.543  1.00 11.59 ? 136 PHE C CG  1 
ATOM   9053  C  CD1 . PHE C 1 136 ? 13.499  -1.111  65.065  1.00 11.55 ? 136 PHE C CD1 1 
ATOM   9054  C  CD2 . PHE C 1 136 ? 11.747  -2.738  64.867  1.00 11.84 ? 136 PHE C CD2 1 
ATOM   9055  C  CE1 . PHE C 1 136 ? 14.123  -1.630  63.935  1.00 11.64 ? 136 PHE C CE1 1 
ATOM   9056  C  CE2 . PHE C 1 136 ? 12.366  -3.266  63.734  1.00 12.04 ? 136 PHE C CE2 1 
ATOM   9057  C  CZ  . PHE C 1 136 ? 13.558  -2.709  63.269  1.00 11.88 ? 136 PHE C CZ  1 
ATOM   9058  N  N   . TYR C 1 137 ? 9.245   0.896   68.076  1.00 11.41 ? 137 TYR C N   1 
ATOM   9059  C  CA  . TYR C 1 137 ? 8.585   1.287   69.311  1.00 11.97 ? 137 TYR C CA  1 
ATOM   9060  C  C   . TYR C 1 137 ? 8.123   0.023   70.038  1.00 12.32 ? 137 TYR C C   1 
ATOM   9061  O  O   . TYR C 1 137 ? 6.935   -0.316  70.024  1.00 12.41 ? 137 TYR C O   1 
ATOM   9062  C  CB  . TYR C 1 137 ? 7.384   2.183   68.996  1.00 11.77 ? 137 TYR C CB  1 
ATOM   9063  C  CG  . TYR C 1 137 ? 7.754   3.486   68.327  1.00 11.51 ? 137 TYR C CG  1 
ATOM   9064  C  CD1 . TYR C 1 137 ? 7.831   3.584   66.938  1.00 11.35 ? 137 TYR C CD1 1 
ATOM   9065  C  CD2 . TYR C 1 137 ? 8.029   4.626   69.085  1.00 11.43 ? 137 TYR C CD2 1 
ATOM   9066  C  CE1 . TYR C 1 137 ? 8.174   4.786   66.322  1.00 10.80 ? 137 TYR C CE1 1 
ATOM   9067  C  CE2 . TYR C 1 137 ? 8.372   5.830   68.478  1.00 10.82 ? 137 TYR C CE2 1 
ATOM   9068  C  CZ  . TYR C 1 137 ? 8.443   5.901   67.104  1.00 10.67 ? 137 TYR C CZ  1 
ATOM   9069  O  OH  . TYR C 1 137 ? 8.789   7.091   66.518  1.00 10.15 ? 137 TYR C OH  1 
ATOM   9070  N  N   . THR C 1 138 ? 9.066   -0.677  70.665  1.00 12.16 ? 138 THR C N   1 
ATOM   9071  C  CA  . THR C 1 138 ? 8.747   -1.909  71.379  1.00 12.14 ? 138 THR C CA  1 
ATOM   9072  C  C   . THR C 1 138 ? 8.314   -1.684  72.824  1.00 12.20 ? 138 THR C C   1 
ATOM   9073  O  O   . THR C 1 138 ? 8.423   -0.580  73.359  1.00 12.27 ? 138 THR C O   1 
ATOM   9074  C  CB  . THR C 1 138 ? 9.941   -2.876  71.393  1.00 12.18 ? 138 THR C CB  1 
ATOM   9075  O  OG1 . THR C 1 138 ? 10.814  -2.540  72.481  1.00 11.79 ? 138 THR C OG1 1 
ATOM   9076  C  CG2 . THR C 1 138 ? 10.698  -2.807  70.073  1.00 12.24 ? 138 THR C CG2 1 
ATOM   9077  N  N   . GLU C 1 139 ? 7.822   -2.751  73.445  1.00 12.02 ? 139 GLU C N   1 
ATOM   9078  C  CA  . GLU C 1 139 ? 7.362   -2.705  74.827  1.00 12.01 ? 139 GLU C CA  1 
ATOM   9079  C  C   . GLU C 1 139 ? 8.536   -2.486  75.770  1.00 11.59 ? 139 GLU C C   1 
ATOM   9080  O  O   . GLU C 1 139 ? 8.401   -1.824  76.799  1.00 11.22 ? 139 GLU C O   1 
ATOM   9081  C  CB  . GLU C 1 139 ? 6.656   -4.014  75.192  1.00 12.31 ? 139 GLU C CB  1 
ATOM   9082  C  CG  . GLU C 1 139 ? 5.535   -4.393  74.247  1.00 12.81 ? 139 GLU C CG  1 
ATOM   9083  C  CD  . GLU C 1 139 ? 6.016   -5.232  73.078  1.00 13.07 ? 139 GLU C CD  1 
ATOM   9084  O  OE1 . GLU C 1 139 ? 6.746   -4.696  72.213  1.00 12.79 ? 139 GLU C OE1 1 
ATOM   9085  O  OE2 . GLU C 1 139 ? 5.661   -6.430  73.026  1.00 13.55 ? 139 GLU C OE2 1 
ATOM   9086  N  N   . ASP C 1 140 ? 9.684   -3.053  75.406  1.00 11.59 ? 140 ASP C N   1 
ATOM   9087  C  CA  . ASP C 1 140 ? 10.900  -2.944  76.208  1.00 11.67 ? 140 ASP C CA  1 
ATOM   9088  C  C   . ASP C 1 140 ? 11.679  -1.695  75.837  1.00 11.55 ? 140 ASP C C   1 
ATOM   9089  O  O   . ASP C 1 140 ? 12.903  -1.661  75.929  1.00 11.39 ? 140 ASP C O   1 
ATOM   9090  C  CB  . ASP C 1 140 ? 11.785  -4.174  75.999  1.00 11.86 ? 140 ASP C CB  1 
ATOM   9091  C  CG  . ASP C 1 140 ? 11.390  -5.338  76.888  1.00 12.27 ? 140 ASP C CG  1 
ATOM   9092  O  OD1 . ASP C 1 140 ? 10.351  -5.242  77.585  1.00 12.24 ? 140 ASP C OD1 1 
ATOM   9093  O  OD2 . ASP C 1 140 ? 12.127  -6.353  76.886  1.00 12.86 ? 140 ASP C OD2 1 
ATOM   9094  N  N   . GLY C 1 141 ? 10.956  -0.668  75.412  1.00 11.85 ? 141 GLY C N   1 
ATOM   9095  C  CA  . GLY C 1 141 ? 11.594  0.573   75.026  1.00 12.24 ? 141 GLY C CA  1 
ATOM   9096  C  C   . GLY C 1 141 ? 11.845  0.655   73.531  1.00 12.40 ? 141 GLY C C   1 
ATOM   9097  O  O   . GLY C 1 141 ? 11.602  -0.299  72.787  1.00 12.67 ? 141 GLY C O   1 
ATOM   9098  N  N   . ASN C 1 142 ? 12.341  1.805   73.089  1.00 12.05 ? 142 ASN C N   1 
ATOM   9099  C  CA  . ASN C 1 142 ? 12.622  2.012   71.683  1.00 11.70 ? 142 ASN C CA  1 
ATOM   9100  C  C   . ASN C 1 142 ? 13.942  1.371   71.279  1.00 11.59 ? 142 ASN C C   1 
ATOM   9101  O  O   . ASN C 1 142 ? 14.892  1.324   72.065  1.00 11.44 ? 142 ASN C O   1 
ATOM   9102  C  CB  . ASN C 1 142 ? 12.651  3.509   71.374  1.00 11.51 ? 142 ASN C CB  1 
ATOM   9103  C  CG  . ASN C 1 142 ? 11.265  4.126   71.346  1.00 11.28 ? 142 ASN C CG  1 
ATOM   9104  O  OD1 . ASN C 1 142 ? 10.275  3.489   71.715  1.00 11.35 ? 142 ASN C OD1 1 
ATOM   9105  N  ND2 . ASN C 1 142 ? 11.187  5.373   70.903  1.00 10.93 ? 142 ASN C ND2 1 
ATOM   9106  N  N   . TRP C 1 143 ? 13.981  0.865   70.049  1.00 11.60 ? 143 TRP C N   1 
ATOM   9107  C  CA  . TRP C 1 143 ? 15.171  0.229   69.498  1.00 11.55 ? 143 TRP C CA  1 
ATOM   9108  C  C   . TRP C 1 143 ? 15.522  0.920   68.188  1.00 11.58 ? 143 TRP C C   1 
ATOM   9109  O  O   . TRP C 1 143 ? 14.753  0.871   67.230  1.00 11.67 ? 143 TRP C O   1 
ATOM   9110  C  CB  . TRP C 1 143 ? 14.920  -1.251  69.237  1.00 11.46 ? 143 TRP C CB  1 
ATOM   9111  C  CG  . TRP C 1 143 ? 16.009  -1.895  68.445  1.00 11.49 ? 143 TRP C CG  1 
ATOM   9112  C  CD1 . TRP C 1 143 ? 17.342  -1.615  68.509  1.00 11.65 ? 143 TRP C CD1 1 
ATOM   9113  C  CD2 . TRP C 1 143 ? 15.866  -2.936  67.472  1.00 11.39 ? 143 TRP C CD2 1 
ATOM   9114  N  NE1 . TRP C 1 143 ? 18.039  -2.418  67.639  1.00 11.67 ? 143 TRP C NE1 1 
ATOM   9115  C  CE2 . TRP C 1 143 ? 17.156  -3.238  66.990  1.00 11.46 ? 143 TRP C CE2 1 
ATOM   9116  C  CE3 . TRP C 1 143 ? 14.771  -3.645  66.963  1.00 11.15 ? 143 TRP C CE3 1 
ATOM   9117  C  CZ2 . TRP C 1 143 ? 17.383  -4.218  66.021  1.00 11.41 ? 143 TRP C CZ2 1 
ATOM   9118  C  CZ3 . TRP C 1 143 ? 14.998  -4.621  65.999  1.00 11.08 ? 143 TRP C CZ3 1 
ATOM   9119  C  CH2 . TRP C 1 143 ? 16.294  -4.898  65.541  1.00 11.22 ? 143 TRP C CH2 1 
ATOM   9120  N  N   . ASP C 1 144 ? 16.684  1.559   68.150  1.00 11.52 ? 144 ASP C N   1 
ATOM   9121  C  CA  . ASP C 1 144 ? 17.120  2.271   66.961  1.00 11.28 ? 144 ASP C CA  1 
ATOM   9122  C  C   . ASP C 1 144 ? 18.203  1.524   66.203  1.00 11.65 ? 144 ASP C C   1 
ATOM   9123  O  O   . ASP C 1 144 ? 19.335  1.372   66.681  1.00 11.91 ? 144 ASP C O   1 
ATOM   9124  C  CB  . ASP C 1 144 ? 17.632  3.661   67.340  1.00 10.78 ? 144 ASP C CB  1 
ATOM   9125  C  CG  . ASP C 1 144 ? 16.515  4.620   67.655  1.00 10.12 ? 144 ASP C CG  1 
ATOM   9126  O  OD1 . ASP C 1 144 ? 16.808  5.789   67.967  1.00 9.76  ? 144 ASP C OD1 1 
ATOM   9127  O  OD2 . ASP C 1 144 ? 15.342  4.205   67.589  1.00 9.66  ? 144 ASP C OD2 1 
ATOM   9128  N  N   . LEU C 1 145 ? 17.847  1.060   65.012  1.00 11.97 ? 145 LEU C N   1 
ATOM   9129  C  CA  . LEU C 1 145 ? 18.781  0.344   64.167  1.00 12.04 ? 145 LEU C CA  1 
ATOM   9130  C  C   . LEU C 1 145 ? 19.193  1.315   63.072  1.00 12.10 ? 145 LEU C C   1 
ATOM   9131  O  O   . LEU C 1 145 ? 18.557  1.400   62.024  1.00 12.17 ? 145 LEU C O   1 
ATOM   9132  C  CB  . LEU C 1 145 ? 18.113  -0.897  63.574  1.00 11.86 ? 145 LEU C CB  1 
ATOM   9133  C  CG  . LEU C 1 145 ? 18.905  -1.696  62.535  1.00 11.80 ? 145 LEU C CG  1 
ATOM   9134  C  CD1 . LEU C 1 145 ? 20.315  -1.949  63.028  1.00 11.64 ? 145 LEU C CD1 1 
ATOM   9135  C  CD2 . LEU C 1 145 ? 18.187  -3.010  62.265  1.00 11.93 ? 145 LEU C CD2 1 
ATOM   9136  N  N   . VAL C 1 146 ? 20.256  2.063   63.344  1.00 12.21 ? 146 VAL C N   1 
ATOM   9137  C  CA  . VAL C 1 146 ? 20.774  3.054   62.412  1.00 12.16 ? 146 VAL C CA  1 
ATOM   9138  C  C   . VAL C 1 146 ? 21.750  2.411   61.430  1.00 12.47 ? 146 VAL C C   1 
ATOM   9139  O  O   . VAL C 1 146 ? 22.837  1.987   61.818  1.00 12.82 ? 146 VAL C O   1 
ATOM   9140  C  CB  . VAL C 1 146 ? 21.490  4.186   63.177  1.00 11.87 ? 146 VAL C CB  1 
ATOM   9141  C  CG1 . VAL C 1 146 ? 21.413  5.465   62.386  1.00 11.80 ? 146 VAL C CG1 1 
ATOM   9142  C  CG2 . VAL C 1 146 ? 20.857  4.376   64.555  1.00 10.89 ? 146 VAL C CG2 1 
ATOM   9143  N  N   . GLY C 1 147 ? 21.368  2.340   60.158  1.00 12.66 ? 147 GLY C N   1 
ATOM   9144  C  CA  . GLY C 1 147 ? 22.245  1.731   59.172  1.00 12.86 ? 147 GLY C CA  1 
ATOM   9145  C  C   . GLY C 1 147 ? 22.397  2.474   57.855  1.00 12.87 ? 147 GLY C C   1 
ATOM   9146  O  O   . GLY C 1 147 ? 21.639  3.392   57.553  1.00 12.75 ? 147 GLY C O   1 
ATOM   9147  N  N   . ASN C 1 148 ? 23.397  2.070   57.073  1.00 13.02 ? 148 ASN C N   1 
ATOM   9148  C  CA  . ASN C 1 148 ? 23.673  2.664   55.767  1.00 13.08 ? 148 ASN C CA  1 
ATOM   9149  C  C   . ASN C 1 148 ? 23.180  1.698   54.689  1.00 13.51 ? 148 ASN C C   1 
ATOM   9150  O  O   . ASN C 1 148 ? 22.641  0.623   54.998  1.00 13.54 ? 148 ASN C O   1 
ATOM   9151  C  CB  . ASN C 1 148 ? 25.182  2.877   55.569  1.00 13.02 ? 148 ASN C CB  1 
ATOM   9152  C  CG  . ASN C 1 148 ? 25.761  3.963   56.474  1.00 12.92 ? 148 ASN C CG  1 
ATOM   9153  O  OD1 . ASN C 1 148 ? 25.106  4.966   56.783  1.00 12.81 ? 148 ASN C OD1 1 
ATOM   9154  N  ND2 . ASN C 1 148 ? 27.009  3.765   56.898  1.00 12.59 ? 148 ASN C ND2 1 
ATOM   9155  N  N   . ASN C 1 149 ? 23.378  2.082   53.427  1.00 13.52 ? 149 ASN C N   1 
ATOM   9156  C  CA  . ASN C 1 149 ? 22.981  1.255   52.291  1.00 13.43 ? 149 ASN C CA  1 
ATOM   9157  C  C   . ASN C 1 149 ? 24.157  0.379   51.855  1.00 13.48 ? 149 ASN C C   1 
ATOM   9158  O  O   . ASN C 1 149 ? 24.090  -0.304  50.833  1.00 13.79 ? 149 ASN C O   1 
ATOM   9159  C  CB  . ASN C 1 149 ? 22.530  2.137   51.126  1.00 13.22 ? 149 ASN C CB  1 
ATOM   9160  C  CG  . ASN C 1 149 ? 23.646  3.035   50.605  1.00 12.91 ? 149 ASN C CG  1 
ATOM   9161  O  OD1 . ASN C 1 149 ? 24.660  3.241   51.277  1.00 12.66 ? 149 ASN C OD1 1 
ATOM   9162  N  ND2 . ASN C 1 149 ? 23.460  3.574   49.400  1.00 12.46 ? 149 ASN C ND2 1 
ATOM   9163  N  N   . THR C 1 150 ? 25.233  0.419   52.641  1.00 13.51 ? 150 THR C N   1 
ATOM   9164  C  CA  . THR C 1 150 ? 26.443  -0.368  52.395  1.00 13.17 ? 150 THR C CA  1 
ATOM   9165  C  C   . THR C 1 150 ? 26.785  -1.135  53.687  1.00 13.23 ? 150 THR C C   1 
ATOM   9166  O  O   . THR C 1 150 ? 26.639  -0.602  54.791  1.00 13.48 ? 150 THR C O   1 
ATOM   9167  C  CB  . THR C 1 150 ? 27.632  0.547   51.995  1.00 12.86 ? 150 THR C CB  1 
ATOM   9168  O  OG1 . THR C 1 150 ? 28.867  -0.150  52.200  1.00 12.17 ? 150 THR C OG1 1 
ATOM   9169  C  CG2 . THR C 1 150 ? 27.624  1.830   52.822  1.00 12.64 ? 150 THR C CG2 1 
ATOM   9170  N  N   . PRO C 1 151 ? 27.254  -2.390  53.564  1.00 12.95 ? 151 PRO C N   1 
ATOM   9171  C  CA  . PRO C 1 151 ? 27.607  -3.230  54.715  1.00 12.73 ? 151 PRO C CA  1 
ATOM   9172  C  C   . PRO C 1 151 ? 28.945  -2.925  55.387  1.00 12.76 ? 151 PRO C C   1 
ATOM   9173  O  O   . PRO C 1 151 ? 29.275  -3.516  56.421  1.00 12.75 ? 151 PRO C O   1 
ATOM   9174  C  CB  . PRO C 1 151 ? 27.587  -4.635  54.135  1.00 12.72 ? 151 PRO C CB  1 
ATOM   9175  C  CG  . PRO C 1 151 ? 28.052  -4.434  52.738  1.00 12.63 ? 151 PRO C CG  1 
ATOM   9176  C  CD  . PRO C 1 151 ? 27.497  -3.095  52.294  1.00 12.86 ? 151 PRO C CD  1 
ATOM   9177  N  N   . ILE C 1 152 ? 29.719  -2.019  54.801  1.00 12.73 ? 152 ILE C N   1 
ATOM   9178  C  CA  . ILE C 1 152 ? 31.020  -1.669  55.360  1.00 12.55 ? 152 ILE C CA  1 
ATOM   9179  C  C   . ILE C 1 152 ? 31.193  -0.165  55.448  1.00 12.28 ? 152 ILE C C   1 
ATOM   9180  O  O   . ILE C 1 152 ? 30.234  0.584   55.260  1.00 12.18 ? 152 ILE C O   1 
ATOM   9181  C  CB  . ILE C 1 152 ? 32.166  -2.245  54.511  1.00 12.75 ? 152 ILE C CB  1 
ATOM   9182  C  CG1 . ILE C 1 152 ? 31.725  -2.363  53.051  1.00 12.87 ? 152 ILE C CG1 1 
ATOM   9183  C  CG2 . ILE C 1 152 ? 32.577  -3.603  55.058  1.00 13.06 ? 152 ILE C CG2 1 
ATOM   9184  C  CD1 . ILE C 1 152 ? 32.686  -1.743  52.067  1.00 12.92 ? 152 ILE C CD1 1 
ATOM   9185  N  N   . PHE C 1 153 ? 32.414  0.273   55.741  1.00 11.93 ? 153 PHE C N   1 
ATOM   9186  C  CA  . PHE C 1 153 ? 32.697  1.698   55.851  1.00 11.88 ? 153 PHE C CA  1 
ATOM   9187  C  C   . PHE C 1 153 ? 34.146  2.041   55.503  1.00 11.65 ? 153 PHE C C   1 
ATOM   9188  O  O   . PHE C 1 153 ? 35.008  1.168   55.437  1.00 11.42 ? 153 PHE C O   1 
ATOM   9189  C  CB  . PHE C 1 153 ? 32.360  2.195   57.264  1.00 11.96 ? 153 PHE C CB  1 
ATOM   9190  C  CG  . PHE C 1 153 ? 31.990  3.646   57.318  1.00 12.08 ? 153 PHE C CG  1 
ATOM   9191  C  CD1 . PHE C 1 153 ? 30.798  4.093   56.754  1.00 12.23 ? 153 PHE C CD1 1 
ATOM   9192  C  CD2 . PHE C 1 153 ? 32.847  4.574   57.911  1.00 12.02 ? 153 PHE C CD2 1 
ATOM   9193  C  CE1 . PHE C 1 153 ? 30.462  5.449   56.778  1.00 12.34 ? 153 PHE C CE1 1 
ATOM   9194  C  CE2 . PHE C 1 153 ? 32.526  5.927   57.942  1.00 12.00 ? 153 PHE C CE2 1 
ATOM   9195  C  CZ  . PHE C 1 153 ? 31.330  6.371   57.374  1.00 12.18 ? 153 PHE C CZ  1 
ATOM   9196  N  N   . PHE C 1 154 ? 34.401  3.325   55.283  1.00 11.67 ? 154 PHE C N   1 
ATOM   9197  C  CA  . PHE C 1 154 ? 35.727  3.804   54.924  1.00 11.66 ? 154 PHE C CA  1 
ATOM   9198  C  C   . PHE C 1 154 ? 36.768  3.564   56.006  1.00 11.75 ? 154 PHE C C   1 
ATOM   9199  O  O   . PHE C 1 154 ? 37.862  3.085   55.713  1.00 11.74 ? 154 PHE C O   1 
ATOM   9200  C  CB  . PHE C 1 154 ? 35.667  5.295   54.584  1.00 11.76 ? 154 PHE C CB  1 
ATOM   9201  C  CG  . PHE C 1 154 ? 34.639  5.636   53.541  1.00 11.84 ? 154 PHE C CG  1 
ATOM   9202  C  CD1 . PHE C 1 154 ? 34.974  5.638   52.191  1.00 11.88 ? 154 PHE C CD1 1 
ATOM   9203  C  CD2 . PHE C 1 154 ? 33.334  5.942   53.904  1.00 11.84 ? 154 PHE C CD2 1 
ATOM   9204  C  CE1 . PHE C 1 154 ? 34.019  5.941   51.211  1.00 11.76 ? 154 PHE C CE1 1 
ATOM   9205  C  CE2 . PHE C 1 154 ? 32.378  6.244   52.937  1.00 11.74 ? 154 PHE C CE2 1 
ATOM   9206  C  CZ  . PHE C 1 154 ? 32.723  6.243   51.587  1.00 11.69 ? 154 PHE C CZ  1 
ATOM   9207  N  N   . ILE C 1 155 ? 36.437  3.901   57.251  1.00 11.93 ? 155 ILE C N   1 
ATOM   9208  C  CA  . ILE C 1 155 ? 37.370  3.709   58.360  1.00 12.23 ? 155 ILE C CA  1 
ATOM   9209  C  C   . ILE C 1 155 ? 36.857  2.707   59.386  1.00 12.42 ? 155 ILE C C   1 
ATOM   9210  O  O   . ILE C 1 155 ? 35.683  2.336   59.367  1.00 12.58 ? 155 ILE C O   1 
ATOM   9211  C  CB  . ILE C 1 155 ? 37.678  5.039   59.092  1.00 12.07 ? 155 ILE C CB  1 
ATOM   9212  C  CG1 . ILE C 1 155 ? 36.489  5.995   58.992  1.00 11.73 ? 155 ILE C CG1 1 
ATOM   9213  C  CG2 . ILE C 1 155 ? 38.918  5.676   58.492  1.00 12.45 ? 155 ILE C CG2 1 
ATOM   9214  C  CD1 . ILE C 1 155 ? 36.565  7.157   59.957  1.00 10.95 ? 155 ILE C CD1 1 
ATOM   9215  N  N   . ARG C 1 156 ? 37.744  2.281   60.283  1.00 12.57 ? 156 ARG C N   1 
ATOM   9216  C  CA  . ARG C 1 156 ? 37.383  1.312   61.312  1.00 12.57 ? 156 ARG C CA  1 
ATOM   9217  C  C   . ARG C 1 156 ? 37.642  1.802   62.735  1.00 12.74 ? 156 ARG C C   1 
ATOM   9218  O  O   . ARG C 1 156 ? 37.562  1.021   63.683  1.00 13.05 ? 156 ARG C O   1 
ATOM   9219  C  CB  . ARG C 1 156 ? 38.134  0.001   61.085  1.00 12.33 ? 156 ARG C CB  1 
ATOM   9220  C  CG  . ARG C 1 156 ? 39.576  0.178   60.661  1.00 11.76 ? 156 ARG C CG  1 
ATOM   9221  C  CD  . ARG C 1 156 ? 40.150  -1.132  60.160  1.00 11.45 ? 156 ARG C CD  1 
ATOM   9222  N  NE  . ARG C 1 156 ? 41.525  -0.975  59.702  1.00 11.07 ? 156 ARG C NE  1 
ATOM   9223  C  CZ  . ARG C 1 156 ? 42.111  -1.762  58.808  1.00 10.90 ? 156 ARG C CZ  1 
ATOM   9224  N  NH1 . ARG C 1 156 ? 41.444  -2.773  58.266  1.00 10.75 ? 156 ARG C NH1 1 
ATOM   9225  N  NH2 . ARG C 1 156 ? 43.370  -1.539  58.463  1.00 10.72 ? 156 ARG C NH2 1 
ATOM   9226  N  N   . ASP C 1 157 ? 37.963  3.086   62.881  1.00 12.54 ? 157 ASP C N   1 
ATOM   9227  C  CA  . ASP C 1 157 ? 38.213  3.670   64.195  1.00 11.95 ? 157 ASP C CA  1 
ATOM   9228  C  C   . ASP C 1 157 ? 37.564  5.042   64.220  1.00 11.61 ? 157 ASP C C   1 
ATOM   9229  O  O   . ASP C 1 157 ? 37.916  5.911   63.430  1.00 11.58 ? 157 ASP C O   1 
ATOM   9230  C  CB  . ASP C 1 157 ? 39.715  3.797   64.461  1.00 12.16 ? 157 ASP C CB  1 
ATOM   9231  C  CG  . ASP C 1 157 ? 40.036  3.998   65.934  1.00 12.20 ? 157 ASP C CG  1 
ATOM   9232  O  OD1 . ASP C 1 157 ? 39.527  4.967   66.532  1.00 12.37 ? 157 ASP C OD1 1 
ATOM   9233  O  OD2 . ASP C 1 157 ? 40.799  3.187   66.497  1.00 12.46 ? 157 ASP C OD2 1 
ATOM   9234  N  N   . PRO C 1 158 ? 36.616  5.254   65.145  1.00 11.44 ? 158 PRO C N   1 
ATOM   9235  C  CA  . PRO C 1 158 ? 35.844  6.490   65.356  1.00 11.38 ? 158 PRO C CA  1 
ATOM   9236  C  C   . PRO C 1 158 ? 36.634  7.789   65.514  1.00 11.29 ? 158 PRO C C   1 
ATOM   9237  O  O   . PRO C 1 158 ? 36.151  8.860   65.153  1.00 10.93 ? 158 PRO C O   1 
ATOM   9238  C  CB  . PRO C 1 158 ? 35.015  6.189   66.604  1.00 11.39 ? 158 PRO C CB  1 
ATOM   9239  C  CG  . PRO C 1 158 ? 35.715  5.025   67.259  1.00 11.52 ? 158 PRO C CG  1 
ATOM   9240  C  CD  . PRO C 1 158 ? 36.254  4.221   66.128  1.00 11.52 ? 158 PRO C CD  1 
ATOM   9241  N  N   . ILE C 1 159 ? 37.840  7.694   66.063  1.00 11.36 ? 159 ILE C N   1 
ATOM   9242  C  CA  . ILE C 1 159 ? 38.672  8.868   66.277  1.00 11.49 ? 159 ILE C CA  1 
ATOM   9243  C  C   . ILE C 1 159 ? 39.048  9.536   64.956  1.00 11.48 ? 159 ILE C C   1 
ATOM   9244  O  O   . ILE C 1 159 ? 39.539  10.660  64.941  1.00 11.43 ? 159 ILE C O   1 
ATOM   9245  C  CB  . ILE C 1 159 ? 39.951  8.487   67.073  1.00 11.71 ? 159 ILE C CB  1 
ATOM   9246  C  CG1 . ILE C 1 159 ? 40.614  9.742   67.649  1.00 11.80 ? 159 ILE C CG1 1 
ATOM   9247  C  CG2 . ILE C 1 159 ? 40.907  7.718   66.183  1.00 12.28 ? 159 ILE C CG2 1 
ATOM   9248  C  CD1 . ILE C 1 159 ? 40.441  9.897   69.147  1.00 11.16 ? 159 ILE C CD1 1 
ATOM   9249  N  N   . LEU C 1 160 ? 38.801  8.840   63.850  1.00 11.57 ? 160 LEU C N   1 
ATOM   9250  C  CA  . LEU C 1 160 ? 39.107  9.358   62.517  1.00 11.82 ? 160 LEU C CA  1 
ATOM   9251  C  C   . LEU C 1 160 ? 37.869  9.942   61.830  1.00 11.84 ? 160 LEU C C   1 
ATOM   9252  O  O   . LEU C 1 160 ? 37.983  10.681  60.852  1.00 11.86 ? 160 LEU C O   1 
ATOM   9253  C  CB  . LEU C 1 160 ? 39.687  8.244   61.635  1.00 11.65 ? 160 LEU C CB  1 
ATOM   9254  C  CG  . LEU C 1 160 ? 41.127  7.785   61.889  1.00 11.62 ? 160 LEU C CG  1 
ATOM   9255  C  CD1 . LEU C 1 160 ? 41.170  6.271   62.032  1.00 11.40 ? 160 LEU C CD1 1 
ATOM   9256  C  CD2 . LEU C 1 160 ? 42.012  8.235   60.743  1.00 11.35 ? 160 LEU C CD2 1 
ATOM   9257  N  N   . PHE C 1 161 ? 36.693  9.606   62.346  1.00 11.87 ? 161 PHE C N   1 
ATOM   9258  C  CA  . PHE C 1 161 ? 35.440  10.074  61.769  1.00 11.71 ? 161 PHE C CA  1 
ATOM   9259  C  C   . PHE C 1 161 ? 35.336  11.587  61.606  1.00 11.77 ? 161 PHE C C   1 
ATOM   9260  O  O   . PHE C 1 161 ? 35.076  12.077  60.503  1.00 12.01 ? 161 PHE C O   1 
ATOM   9261  C  CB  . PHE C 1 161 ? 34.257  9.568   62.597  1.00 11.71 ? 161 PHE C CB  1 
ATOM   9262  C  CG  . PHE C 1 161 ? 32.923  9.862   61.983  1.00 11.57 ? 161 PHE C CG  1 
ATOM   9263  C  CD1 . PHE C 1 161 ? 32.444  9.093   60.930  1.00 11.50 ? 161 PHE C CD1 1 
ATOM   9264  C  CD2 . PHE C 1 161 ? 32.141  10.915  62.454  1.00 11.54 ? 161 PHE C CD2 1 
ATOM   9265  C  CE1 . PHE C 1 161 ? 31.206  9.365   60.354  1.00 11.37 ? 161 PHE C CE1 1 
ATOM   9266  C  CE2 . PHE C 1 161 ? 30.902  11.195  61.883  1.00 11.38 ? 161 PHE C CE2 1 
ATOM   9267  C  CZ  . PHE C 1 161 ? 30.436  10.420  60.834  1.00 11.36 ? 161 PHE C CZ  1 
ATOM   9268  N  N   . PRO C 1 162 ? 35.528  12.351  62.695  1.00 11.71 ? 162 PRO C N   1 
ATOM   9269  C  CA  . PRO C 1 162 ? 35.434  13.810  62.587  1.00 11.65 ? 162 PRO C CA  1 
ATOM   9270  C  C   . PRO C 1 162 ? 36.254  14.370  61.431  1.00 11.39 ? 162 PRO C C   1 
ATOM   9271  O  O   . PRO C 1 162 ? 35.797  15.245  60.699  1.00 11.18 ? 162 PRO C O   1 
ATOM   9272  C  CB  . PRO C 1 162 ? 35.939  14.302  63.940  1.00 11.73 ? 162 PRO C CB  1 
ATOM   9273  C  CG  . PRO C 1 162 ? 35.639  13.182  64.870  1.00 11.87 ? 162 PRO C CG  1 
ATOM   9274  C  CD  . PRO C 1 162 ? 35.842  11.927  64.070  1.00 11.86 ? 162 PRO C CD  1 
ATOM   9275  N  N   . SER C 1 163 ? 37.470  13.857  61.273  1.00 11.44 ? 163 SER C N   1 
ATOM   9276  C  CA  . SER C 1 163 ? 38.353  14.300  60.207  1.00 11.28 ? 163 SER C CA  1 
ATOM   9277  C  C   . SER C 1 163 ? 37.759  13.896  58.872  1.00 11.30 ? 163 SER C C   1 
ATOM   9278  O  O   . SER C 1 163 ? 37.575  14.731  57.987  1.00 11.18 ? 163 SER C O   1 
ATOM   9279  C  CB  . SER C 1 163 ? 39.736  13.661  60.354  1.00 11.70 ? 163 SER C CB  1 
ATOM   9280  O  OG  . SER C 1 163 ? 40.448  14.190  61.457  1.00 12.37 ? 163 SER C OG  1 
ATOM   9281  N  N   . PHE C 1 164 ? 37.463  12.607  58.736  1.00 11.51 ? 164 PHE C N   1 
ATOM   9282  C  CA  . PHE C 1 164 ? 36.902  12.081  57.504  1.00 11.65 ? 164 PHE C CA  1 
ATOM   9283  C  C   . PHE C 1 164 ? 35.792  12.973  56.971  1.00 11.67 ? 164 PHE C C   1 
ATOM   9284  O  O   . PHE C 1 164 ? 35.898  13.516  55.870  1.00 11.80 ? 164 PHE C O   1 
ATOM   9285  C  CB  . PHE C 1 164 ? 36.364  10.667  57.720  1.00 11.83 ? 164 PHE C CB  1 
ATOM   9286  C  CG  . PHE C 1 164 ? 35.697  10.086  56.505  1.00 12.30 ? 164 PHE C CG  1 
ATOM   9287  C  CD1 . PHE C 1 164 ? 36.295  10.193  55.250  1.00 12.48 ? 164 PHE C CD1 1 
ATOM   9288  C  CD2 . PHE C 1 164 ? 34.463  9.455   56.608  1.00 12.49 ? 164 PHE C CD2 1 
ATOM   9289  C  CE1 . PHE C 1 164 ? 35.671  9.680   54.113  1.00 12.88 ? 164 PHE C CE1 1 
ATOM   9290  C  CE2 . PHE C 1 164 ? 33.828  8.937   55.476  1.00 12.91 ? 164 PHE C CE2 1 
ATOM   9291  C  CZ  . PHE C 1 164 ? 34.432  9.050   54.226  1.00 12.95 ? 164 PHE C CZ  1 
ATOM   9292  N  N   . ILE C 1 165 ? 34.729  13.123  57.755  1.00 11.62 ? 165 ILE C N   1 
ATOM   9293  C  CA  . ILE C 1 165 ? 33.593  13.950  57.358  1.00 11.57 ? 165 ILE C CA  1 
ATOM   9294  C  C   . ILE C 1 165 ? 34.054  15.361  56.996  1.00 11.48 ? 165 ILE C C   1 
ATOM   9295  O  O   . ILE C 1 165 ? 33.520  15.992  56.082  1.00 11.28 ? 165 ILE C O   1 
ATOM   9296  C  CB  . ILE C 1 165 ? 32.550  14.029  58.496  1.00 11.65 ? 165 ILE C CB  1 
ATOM   9297  C  CG1 . ILE C 1 165 ? 32.083  12.620  58.864  1.00 11.65 ? 165 ILE C CG1 1 
ATOM   9298  C  CG2 . ILE C 1 165 ? 31.365  14.883  58.070  1.00 11.90 ? 165 ILE C CG2 1 
ATOM   9299  C  CD1 . ILE C 1 165 ? 31.523  11.832  57.699  1.00 11.52 ? 165 ILE C CD1 1 
ATOM   9300  N  N   . HIS C 1 166 ? 35.053  15.851  57.719  1.00 11.44 ? 166 HIS C N   1 
ATOM   9301  C  CA  . HIS C 1 166 ? 35.594  17.176  57.468  1.00 11.53 ? 166 HIS C CA  1 
ATOM   9302  C  C   . HIS C 1 166 ? 36.129  17.234  56.040  1.00 11.75 ? 166 HIS C C   1 
ATOM   9303  O  O   . HIS C 1 166 ? 35.869  18.189  55.302  1.00 11.82 ? 166 HIS C O   1 
ATOM   9304  C  CB  . HIS C 1 166 ? 36.712  17.484  58.470  1.00 11.20 ? 166 HIS C CB  1 
ATOM   9305  C  CG  . HIS C 1 166 ? 36.259  18.290  59.648  1.00 10.83 ? 166 HIS C CG  1 
ATOM   9306  N  ND1 . HIS C 1 166 ? 37.137  18.817  60.570  1.00 10.72 ? 166 HIS C ND1 1 
ATOM   9307  C  CD2 . HIS C 1 166 ? 35.023  18.671  60.047  1.00 10.63 ? 166 HIS C CD2 1 
ATOM   9308  C  CE1 . HIS C 1 166 ? 36.460  19.489  61.485  1.00 10.61 ? 166 HIS C CE1 1 
ATOM   9309  N  NE2 . HIS C 1 166 ? 35.175  19.415  61.191  1.00 10.32 ? 166 HIS C NE2 1 
ATOM   9310  N  N   . SER C 1 167 ? 36.868  16.195  55.660  1.00 11.82 ? 167 SER C N   1 
ATOM   9311  C  CA  . SER C 1 167 ? 37.447  16.093  54.324  1.00 12.04 ? 167 SER C CA  1 
ATOM   9312  C  C   . SER C 1 167 ? 36.369  15.980  53.244  1.00 12.15 ? 167 SER C C   1 
ATOM   9313  O  O   . SER C 1 167 ? 36.550  16.446  52.118  1.00 12.13 ? 167 SER C O   1 
ATOM   9314  C  CB  . SER C 1 167 ? 38.365  14.870  54.246  1.00 12.00 ? 167 SER C CB  1 
ATOM   9315  O  OG  . SER C 1 167 ? 37.620  13.694  53.964  1.00 11.79 ? 167 SER C OG  1 
ATOM   9316  N  N   . GLN C 1 168 ? 35.250  15.355  53.599  1.00 12.34 ? 168 GLN C N   1 
ATOM   9317  C  CA  . GLN C 1 168 ? 34.140  15.157  52.675  1.00 12.42 ? 168 GLN C CA  1 
ATOM   9318  C  C   . GLN C 1 168 ? 33.332  16.422  52.433  1.00 12.48 ? 168 GLN C C   1 
ATOM   9319  O  O   . GLN C 1 168 ? 32.687  16.554  51.398  1.00 12.64 ? 168 GLN C O   1 
ATOM   9320  C  CB  . GLN C 1 168 ? 33.203  14.070  53.207  1.00 12.32 ? 168 GLN C CB  1 
ATOM   9321  C  CG  . GLN C 1 168 ? 33.686  12.656  52.965  1.00 12.32 ? 168 GLN C CG  1 
ATOM   9322  C  CD  . GLN C 1 168 ? 33.655  12.284  51.503  1.00 12.33 ? 168 GLN C CD  1 
ATOM   9323  O  OE1 . GLN C 1 168 ? 34.680  11.939  50.918  1.00 12.76 ? 168 GLN C OE1 1 
ATOM   9324  N  NE2 . GLN C 1 168 ? 32.475  12.355  50.900  1.00 12.33 ? 168 GLN C NE2 1 
ATOM   9325  N  N   . LYS C 1 169 ? 33.366  17.347  53.388  1.00 12.77 ? 169 LYS C N   1 
ATOM   9326  C  CA  . LYS C 1 169 ? 32.610  18.593  53.272  1.00 12.81 ? 169 LYS C CA  1 
ATOM   9327  C  C   . LYS C 1 169 ? 33.397  19.719  52.593  1.00 12.95 ? 169 LYS C C   1 
ATOM   9328  O  O   . LYS C 1 169 ? 34.348  19.461  51.848  1.00 13.05 ? 169 LYS C O   1 
ATOM   9329  C  CB  . LYS C 1 169 ? 32.134  19.043  54.658  1.00 12.76 ? 169 LYS C CB  1 
ATOM   9330  C  CG  . LYS C 1 169 ? 31.349  17.984  55.434  1.00 12.52 ? 169 LYS C CG  1 
ATOM   9331  C  CD  . LYS C 1 169 ? 29.882  18.377  55.587  1.00 12.20 ? 169 LYS C CD  1 
ATOM   9332  C  CE  . LYS C 1 169 ? 29.255  17.760  56.838  1.00 11.91 ? 169 LYS C CE  1 
ATOM   9333  N  NZ  . LYS C 1 169 ? 27.951  17.079  56.551  1.00 11.07 ? 169 LYS C NZ  1 
ATOM   9334  N  N   . ARG C 1 170 ? 32.999  20.966  52.857  1.00 12.96 ? 170 ARG C N   1 
ATOM   9335  C  CA  . ARG C 1 170 ? 33.650  22.132  52.252  1.00 12.83 ? 170 ARG C CA  1 
ATOM   9336  C  C   . ARG C 1 170 ? 34.930  22.578  52.936  1.00 12.79 ? 170 ARG C C   1 
ATOM   9337  O  O   . ARG C 1 170 ? 35.158  22.303  54.116  1.00 12.71 ? 170 ARG C O   1 
ATOM   9338  C  CB  . ARG C 1 170 ? 32.697  23.326  52.205  1.00 12.73 ? 170 ARG C CB  1 
ATOM   9339  C  CG  . ARG C 1 170 ? 31.234  22.971  52.329  1.00 12.64 ? 170 ARG C CG  1 
ATOM   9340  C  CD  . ARG C 1 170 ? 30.364  24.061  51.728  1.00 12.32 ? 170 ARG C CD  1 
ATOM   9341  N  NE  . ARG C 1 170 ? 29.048  23.550  51.362  1.00 11.73 ? 170 ARG C NE  1 
ATOM   9342  C  CZ  . ARG C 1 170 ? 28.404  23.874  50.247  1.00 11.36 ? 170 ARG C CZ  1 
ATOM   9343  N  NH1 . ARG C 1 170 ? 28.957  24.714  49.383  1.00 10.81 ? 170 ARG C NH1 1 
ATOM   9344  N  NH2 . ARG C 1 170 ? 27.208  23.350  49.997  1.00 11.16 ? 170 ARG C NH2 1 
ATOM   9345  N  N   . ASN C 1 171 ? 35.751  23.286  52.169  1.00 12.46 ? 171 ASN C N   1 
ATOM   9346  C  CA  . ASN C 1 171 ? 37.023  23.808  52.643  1.00 12.48 ? 171 ASN C CA  1 
ATOM   9347  C  C   . ASN C 1 171 ? 36.774  24.889  53.695  1.00 12.48 ? 171 ASN C C   1 
ATOM   9348  O  O   . ASN C 1 171 ? 35.811  25.649  53.596  1.00 12.52 ? 171 ASN C O   1 
ATOM   9349  C  CB  . ASN C 1 171 ? 37.806  24.394  51.467  1.00 12.00 ? 171 ASN C CB  1 
ATOM   9350  C  CG  . ASN C 1 171 ? 39.231  24.750  51.834  1.00 11.57 ? 171 ASN C CG  1 
ATOM   9351  O  OD1 . ASN C 1 171 ? 39.517  25.879  52.231  1.00 10.99 ? 171 ASN C OD1 1 
ATOM   9352  N  ND2 . ASN C 1 171 ? 40.134  23.786  51.699  1.00 11.38 ? 171 ASN C ND2 1 
ATOM   9353  N  N   . PRO C 1 172 ? 37.642  24.968  54.718  1.00 12.36 ? 172 PRO C N   1 
ATOM   9354  C  CA  . PRO C 1 172 ? 37.508  25.960  55.789  1.00 12.29 ? 172 PRO C CA  1 
ATOM   9355  C  C   . PRO C 1 172 ? 37.610  27.406  55.333  1.00 12.18 ? 172 PRO C C   1 
ATOM   9356  O  O   . PRO C 1 172 ? 37.028  28.296  55.950  1.00 12.40 ? 172 PRO C O   1 
ATOM   9357  C  CB  . PRO C 1 172 ? 38.622  25.591  56.763  1.00 12.26 ? 172 PRO C CB  1 
ATOM   9358  C  CG  . PRO C 1 172 ? 39.614  24.858  55.941  1.00 12.20 ? 172 PRO C CG  1 
ATOM   9359  C  CD  . PRO C 1 172 ? 38.812  24.099  54.929  1.00 12.30 ? 172 PRO C CD  1 
ATOM   9360  N  N   . GLN C 1 173 ? 38.341  27.639  54.249  1.00 12.25 ? 173 GLN C N   1 
ATOM   9361  C  CA  . GLN C 1 173 ? 38.521  28.994  53.732  1.00 12.21 ? 173 GLN C CA  1 
ATOM   9362  C  C   . GLN C 1 173 ? 37.591  29.336  52.572  1.00 11.99 ? 173 GLN C C   1 
ATOM   9363  O  O   . GLN C 1 173 ? 36.844  30.316  52.629  1.00 12.00 ? 173 GLN C O   1 
ATOM   9364  C  CB  . GLN C 1 173 ? 39.977  29.192  53.290  1.00 12.21 ? 173 GLN C CB  1 
ATOM   9365  C  CG  . GLN C 1 173 ? 40.172  30.265  52.220  1.00 12.38 ? 173 GLN C CG  1 
ATOM   9366  C  CD  . GLN C 1 173 ? 41.388  31.140  52.472  1.00 12.52 ? 173 GLN C CD  1 
ATOM   9367  O  OE1 . GLN C 1 173 ? 42.498  30.823  52.036  1.00 12.72 ? 173 GLN C OE1 1 
ATOM   9368  N  NE2 . GLN C 1 173 ? 41.184  32.250  53.178  1.00 12.32 ? 173 GLN C NE2 1 
ATOM   9369  N  N   . THR C 1 174 ? 37.639  28.515  51.528  1.00 11.67 ? 174 THR C N   1 
ATOM   9370  C  CA  . THR C 1 174 ? 36.842  28.725  50.323  1.00 11.56 ? 174 THR C CA  1 
ATOM   9371  C  C   . THR C 1 174 ? 35.368  28.318  50.434  1.00 11.83 ? 174 THR C C   1 
ATOM   9372  O  O   . THR C 1 174 ? 34.508  28.881  49.750  1.00 11.69 ? 174 THR C O   1 
ATOM   9373  C  CB  . THR C 1 174 ? 37.481  27.983  49.125  1.00 11.35 ? 174 THR C CB  1 
ATOM   9374  O  OG1 . THR C 1 174 ? 37.575  26.582  49.415  1.00 10.91 ? 174 THR C OG1 1 
ATOM   9375  C  CG2 . THR C 1 174 ? 38.877  28.517  48.857  1.00 11.19 ? 174 THR C CG2 1 
ATOM   9376  N  N   . HIS C 1 175 ? 35.082  27.343  51.293  1.00 11.80 ? 175 HIS C N   1 
ATOM   9377  C  CA  . HIS C 1 175 ? 33.719  26.850  51.501  1.00 11.88 ? 175 HIS C CA  1 
ATOM   9378  C  C   . HIS C 1 175 ? 33.224  26.047  50.300  1.00 11.86 ? 175 HIS C C   1 
ATOM   9379  O  O   . HIS C 1 175 ? 32.021  25.856  50.120  1.00 12.02 ? 175 HIS C O   1 
ATOM   9380  C  CB  . HIS C 1 175 ? 32.754  28.014  51.788  1.00 11.76 ? 175 HIS C CB  1 
ATOM   9381  C  CG  . HIS C 1 175 ? 31.460  27.589  52.413  1.00 11.56 ? 175 HIS C CG  1 
ATOM   9382  N  ND1 . HIS C 1 175 ? 31.396  26.829  53.560  1.00 11.48 ? 175 HIS C ND1 1 
ATOM   9383  C  CD2 . HIS C 1 175 ? 30.176  27.823  52.049  1.00 11.50 ? 175 HIS C CD2 1 
ATOM   9384  C  CE1 . HIS C 1 175 ? 30.133  26.613  53.879  1.00 11.36 ? 175 HIS C CE1 1 
ATOM   9385  N  NE2 . HIS C 1 175 ? 29.370  27.205  52.977  1.00 11.37 ? 175 HIS C NE2 1 
ATOM   9386  N  N   . LEU C 1 176 ? 34.161  25.579  49.481  1.00 11.92 ? 176 LEU C N   1 
ATOM   9387  C  CA  . LEU C 1 176 ? 33.829  24.779  48.303  1.00 11.71 ? 176 LEU C CA  1 
ATOM   9388  C  C   . LEU C 1 176 ? 34.414  23.382  48.445  1.00 11.81 ? 176 LEU C C   1 
ATOM   9389  O  O   . LEU C 1 176 ? 35.469  23.201  49.046  1.00 11.81 ? 176 LEU C O   1 
ATOM   9390  C  CB  . LEU C 1 176 ? 34.402  25.412  47.036  1.00 11.58 ? 176 LEU C CB  1 
ATOM   9391  C  CG  . LEU C 1 176 ? 34.349  26.923  46.844  1.00 11.38 ? 176 LEU C CG  1 
ATOM   9392  C  CD1 . LEU C 1 176 ? 35.502  27.356  45.962  1.00 11.25 ? 176 LEU C CD1 1 
ATOM   9393  C  CD2 . LEU C 1 176 ? 33.037  27.304  46.205  1.00 11.43 ? 176 LEU C CD2 1 
ATOM   9394  N  N   . LYS C 1 177 ? 33.729  22.392  47.890  1.00 12.17 ? 177 LYS C N   1 
ATOM   9395  C  CA  . LYS C 1 177 ? 34.221  21.028  47.953  1.00 12.47 ? 177 LYS C CA  1 
ATOM   9396  C  C   . LYS C 1 177 ? 35.671  21.039  47.485  1.00 12.81 ? 177 LYS C C   1 
ATOM   9397  O  O   . LYS C 1 177 ? 36.014  21.711  46.511  1.00 12.96 ? 177 LYS C O   1 
ATOM   9398  C  CB  . LYS C 1 177 ? 33.383  20.122  47.050  1.00 12.51 ? 177 LYS C CB  1 
ATOM   9399  C  CG  . LYS C 1 177 ? 32.241  19.417  47.766  1.00 12.76 ? 177 LYS C CG  1 
ATOM   9400  C  CD  . LYS C 1 177 ? 31.151  20.403  48.168  1.00 13.21 ? 177 LYS C CD  1 
ATOM   9401  C  CE  . LYS C 1 177 ? 29.775  19.746  48.188  1.00 13.55 ? 177 LYS C CE  1 
ATOM   9402  N  NZ  . LYS C 1 177 ? 29.835  18.334  48.675  1.00 13.98 ? 177 LYS C NZ  1 
ATOM   9403  N  N   . ASP C 1 178 ? 36.530  20.309  48.182  1.00 12.97 ? 178 ASP C N   1 
ATOM   9404  C  CA  . ASP C 1 178 ? 37.930  20.274  47.801  1.00 13.18 ? 178 ASP C CA  1 
ATOM   9405  C  C   . ASP C 1 178 ? 38.430  18.859  47.534  1.00 13.26 ? 178 ASP C C   1 
ATOM   9406  O  O   . ASP C 1 178 ? 38.764  18.123  48.463  1.00 13.28 ? 178 ASP C O   1 
ATOM   9407  C  CB  . ASP C 1 178 ? 38.785  20.931  48.884  1.00 13.33 ? 178 ASP C CB  1 
ATOM   9408  C  CG  . ASP C 1 178 ? 40.180  21.246  48.401  1.00 13.44 ? 178 ASP C CG  1 
ATOM   9409  O  OD1 . ASP C 1 178 ? 40.945  21.875  49.158  1.00 13.39 ? 178 ASP C OD1 1 
ATOM   9410  O  OD2 . ASP C 1 178 ? 40.509  20.863  47.258  1.00 13.80 ? 178 ASP C OD2 1 
ATOM   9411  N  N   . PRO C 1 179 ? 38.481  18.461  46.250  1.00 13.24 ? 179 PRO C N   1 
ATOM   9412  C  CA  . PRO C 1 179 ? 38.945  17.128  45.838  1.00 13.02 ? 179 PRO C CA  1 
ATOM   9413  C  C   . PRO C 1 179 ? 40.321  16.798  46.394  1.00 12.65 ? 179 PRO C C   1 
ATOM   9414  O  O   . PRO C 1 179 ? 40.708  15.634  46.460  1.00 12.52 ? 179 PRO C O   1 
ATOM   9415  C  CB  . PRO C 1 179 ? 38.955  17.193  44.308  1.00 13.19 ? 179 PRO C CB  1 
ATOM   9416  C  CG  . PRO C 1 179 ? 38.783  18.642  43.958  1.00 13.37 ? 179 PRO C CG  1 
ATOM   9417  C  CD  . PRO C 1 179 ? 38.064  19.278  45.098  1.00 13.29 ? 179 PRO C CD  1 
ATOM   9418  N  N   . ASP C 1 180 ? 41.061  17.833  46.778  1.00 12.39 ? 180 ASP C N   1 
ATOM   9419  C  CA  . ASP C 1 180 ? 42.389  17.661  47.345  1.00 12.45 ? 180 ASP C CA  1 
ATOM   9420  C  C   . ASP C 1 180 ? 42.243  17.036  48.738  1.00 12.72 ? 180 ASP C C   1 
ATOM   9421  O  O   . ASP C 1 180 ? 42.955  16.087  49.087  1.00 12.54 ? 180 ASP C O   1 
ATOM   9422  C  CB  . ASP C 1 180 ? 43.091  19.019  47.446  1.00 12.26 ? 180 ASP C CB  1 
ATOM   9423  C  CG  . ASP C 1 180 ? 44.303  19.120  46.540  1.00 12.17 ? 180 ASP C CG  1 
ATOM   9424  O  OD1 . ASP C 1 180 ? 44.444  18.270  45.633  1.00 12.41 ? 180 ASP C OD1 1 
ATOM   9425  O  OD2 . ASP C 1 180 ? 45.116  20.049  46.734  1.00 12.00 ? 180 ASP C OD2 1 
ATOM   9426  N  N   . MET C 1 181 ? 41.306  17.574  49.518  1.00 12.71 ? 181 MET C N   1 
ATOM   9427  C  CA  . MET C 1 181 ? 41.033  17.092  50.870  1.00 12.86 ? 181 MET C CA  1 
ATOM   9428  C  C   . MET C 1 181 ? 40.491  15.673  50.851  1.00 12.54 ? 181 MET C C   1 
ATOM   9429  O  O   . MET C 1 181 ? 40.955  14.807  51.590  1.00 12.59 ? 181 MET C O   1 
ATOM   9430  C  CB  . MET C 1 181 ? 40.000  17.982  51.554  1.00 13.56 ? 181 MET C CB  1 
ATOM   9431  C  CG  . MET C 1 181 ? 40.292  19.466  51.498  1.00 14.26 ? 181 MET C CG  1 
ATOM   9432  S  SD  . MET C 1 181 ? 39.003  20.406  52.350  1.00 15.02 ? 181 MET C SD  1 
ATOM   9433  C  CE  . MET C 1 181 ? 38.716  19.349  53.778  1.00 14.44 ? 181 MET C CE  1 
ATOM   9434  N  N   . VAL C 1 182 ? 39.487  15.460  50.011  1.00 12.34 ? 182 VAL C N   1 
ATOM   9435  C  CA  . VAL C 1 182 ? 38.844  14.165  49.863  1.00 12.16 ? 182 VAL C CA  1 
ATOM   9436  C  C   . VAL C 1 182 ? 39.830  13.027  49.605  1.00 12.22 ? 182 VAL C C   1 
ATOM   9437  O  O   . VAL C 1 182 ? 39.791  11.993  50.278  1.00 12.15 ? 182 VAL C O   1 
ATOM   9438  C  CB  . VAL C 1 182 ? 37.836  14.193  48.697  1.00 11.93 ? 182 VAL C CB  1 
ATOM   9439  C  CG1 . VAL C 1 182 ? 37.243  12.807  48.483  1.00 11.80 ? 182 VAL C CG1 1 
ATOM   9440  C  CG2 . VAL C 1 182 ? 36.749  15.209  48.976  1.00 11.74 ? 182 VAL C CG2 1 
ATOM   9441  N  N   . TRP C 1 183 ? 40.715  13.226  48.632  1.00 12.19 ? 183 TRP C N   1 
ATOM   9442  C  CA  . TRP C 1 183 ? 41.688  12.209  48.255  1.00 12.22 ? 183 TRP C CA  1 
ATOM   9443  C  C   . TRP C 1 183 ? 42.942  12.141  49.115  1.00 12.37 ? 183 TRP C C   1 
ATOM   9444  O  O   . TRP C 1 183 ? 43.541  11.073  49.259  1.00 12.43 ? 183 TRP C O   1 
ATOM   9445  C  CB  . TRP C 1 183 ? 42.053  12.388  46.778  1.00 12.12 ? 183 TRP C CB  1 
ATOM   9446  C  CG  . TRP C 1 183 ? 40.920  11.976  45.889  1.00 11.83 ? 183 TRP C CG  1 
ATOM   9447  C  CD1 . TRP C 1 183 ? 40.053  12.797  45.228  1.00 11.64 ? 183 TRP C CD1 1 
ATOM   9448  C  CD2 . TRP C 1 183 ? 40.463  10.639  45.657  1.00 11.74 ? 183 TRP C CD2 1 
ATOM   9449  N  NE1 . TRP C 1 183 ? 39.078  12.054  44.603  1.00 11.53 ? 183 TRP C NE1 1 
ATOM   9450  C  CE2 . TRP C 1 183 ? 39.306  10.726  44.850  1.00 11.61 ? 183 TRP C CE2 1 
ATOM   9451  C  CE3 . TRP C 1 183 ? 40.918  9.374   46.056  1.00 11.68 ? 183 TRP C CE3 1 
ATOM   9452  C  CZ2 . TRP C 1 183 ? 38.597  9.595   44.434  1.00 11.59 ? 183 TRP C CZ2 1 
ATOM   9453  C  CZ3 . TRP C 1 183 ? 40.213  8.251   45.644  1.00 11.68 ? 183 TRP C CZ3 1 
ATOM   9454  C  CH2 . TRP C 1 183 ? 39.065  8.370   44.841  1.00 11.64 ? 183 TRP C CH2 1 
ATOM   9455  N  N   . ASP C 1 184 ? 43.347  13.271  49.684  1.00 12.44 ? 184 ASP C N   1 
ATOM   9456  C  CA  . ASP C 1 184 ? 44.526  13.284  50.540  1.00 12.31 ? 184 ASP C CA  1 
ATOM   9457  C  C   . ASP C 1 184 ? 44.273  12.343  51.721  1.00 12.19 ? 184 ASP C C   1 
ATOM   9458  O  O   . ASP C 1 184 ? 45.135  11.551  52.094  1.00 12.11 ? 184 ASP C O   1 
ATOM   9459  C  CB  . ASP C 1 184 ? 44.804  14.703  51.045  1.00 12.46 ? 184 ASP C CB  1 
ATOM   9460  C  CG  . ASP C 1 184 ? 46.022  14.774  51.952  1.00 12.62 ? 184 ASP C CG  1 
ATOM   9461  O  OD1 . ASP C 1 184 ? 46.632  13.717  52.222  1.00 12.82 ? 184 ASP C OD1 1 
ATOM   9462  O  OD2 . ASP C 1 184 ? 46.371  15.890  52.398  1.00 12.45 ? 184 ASP C OD2 1 
ATOM   9463  N  N   . PHE C 1 185 ? 43.080  12.423  52.301  1.00 12.05 ? 185 PHE C N   1 
ATOM   9464  C  CA  . PHE C 1 185 ? 42.745  11.568  53.426  1.00 12.21 ? 185 PHE C CA  1 
ATOM   9465  C  C   . PHE C 1 185 ? 42.630  10.124  52.960  1.00 12.17 ? 185 PHE C C   1 
ATOM   9466  O  O   . PHE C 1 185 ? 43.277  9.228   53.507  1.00 12.15 ? 185 PHE C O   1 
ATOM   9467  C  CB  . PHE C 1 185 ? 41.423  12.003  54.059  1.00 12.05 ? 185 PHE C CB  1 
ATOM   9468  C  CG  . PHE C 1 185 ? 40.956  11.097  55.162  1.00 11.95 ? 185 PHE C CG  1 
ATOM   9469  C  CD1 . PHE C 1 185 ? 41.313  11.344  56.484  1.00 11.79 ? 185 PHE C CD1 1 
ATOM   9470  C  CD2 . PHE C 1 185 ? 40.169  9.982   54.880  1.00 12.00 ? 185 PHE C CD2 1 
ATOM   9471  C  CE1 . PHE C 1 185 ? 40.896  10.494  57.510  1.00 11.54 ? 185 PHE C CE1 1 
ATOM   9472  C  CE2 . PHE C 1 185 ? 39.746  9.124   55.905  1.00 11.84 ? 185 PHE C CE2 1 
ATOM   9473  C  CZ  . PHE C 1 185 ? 40.112  9.383   57.219  1.00 11.54 ? 185 PHE C CZ  1 
ATOM   9474  N  N   . TRP C 1 186 ? 41.800  9.914   51.944  1.00 12.13 ? 186 TRP C N   1 
ATOM   9475  C  CA  . TRP C 1 186 ? 41.563  8.588   51.382  1.00 12.08 ? 186 TRP C CA  1 
ATOM   9476  C  C   . TRP C 1 186 ? 42.854  7.900   50.973  1.00 12.23 ? 186 TRP C C   1 
ATOM   9477  O  O   . TRP C 1 186 ? 43.022  6.700   51.184  1.00 12.20 ? 186 TRP C O   1 
ATOM   9478  C  CB  . TRP C 1 186 ? 40.646  8.697   50.166  1.00 12.15 ? 186 TRP C CB  1 
ATOM   9479  C  CG  . TRP C 1 186 ? 39.208  8.471   50.471  1.00 12.04 ? 186 TRP C CG  1 
ATOM   9480  C  CD1 . TRP C 1 186 ? 38.686  7.954   51.615  1.00 12.09 ? 186 TRP C CD1 1 
ATOM   9481  C  CD2 . TRP C 1 186 ? 38.098  8.746   49.611  1.00 12.10 ? 186 TRP C CD2 1 
ATOM   9482  N  NE1 . TRP C 1 186 ? 37.320  7.888   51.526  1.00 12.21 ? 186 TRP C NE1 1 
ATOM   9483  C  CE2 . TRP C 1 186 ? 36.931  8.368   50.303  1.00 12.18 ? 186 TRP C CE2 1 
ATOM   9484  C  CE3 . TRP C 1 186 ? 37.978  9.276   48.318  1.00 12.18 ? 186 TRP C CE3 1 
ATOM   9485  C  CZ2 . TRP C 1 186 ? 35.650  8.502   49.751  1.00 12.18 ? 186 TRP C CZ2 1 
ATOM   9486  C  CZ3 . TRP C 1 186 ? 36.702  9.409   47.767  1.00 12.26 ? 186 TRP C CZ3 1 
ATOM   9487  C  CH2 . TRP C 1 186 ? 35.557  9.021   48.486  1.00 12.13 ? 186 TRP C CH2 1 
ATOM   9488  N  N   . SER C 1 187 ? 43.760  8.670   50.377  1.00 12.70 ? 187 SER C N   1 
ATOM   9489  C  CA  . SER C 1 187 ? 45.041  8.143   49.928  1.00 12.80 ? 187 SER C CA  1 
ATOM   9490  C  C   . SER C 1 187 ? 45.951  7.834   51.110  1.00 12.75 ? 187 SER C C   1 
ATOM   9491  O  O   . SER C 1 187 ? 46.934  7.115   50.967  1.00 13.11 ? 187 SER C O   1 
ATOM   9492  C  CB  . SER C 1 187 ? 45.725  9.148   48.996  1.00 12.98 ? 187 SER C CB  1 
ATOM   9493  O  OG  . SER C 1 187 ? 46.709  9.894   49.695  1.00 13.29 ? 187 SER C OG  1 
ATOM   9494  N  N   . LEU C 1 188 ? 45.616  8.377   52.277  1.00 12.60 ? 188 LEU C N   1 
ATOM   9495  C  CA  . LEU C 1 188 ? 46.415  8.156   53.477  1.00 12.34 ? 188 LEU C CA  1 
ATOM   9496  C  C   . LEU C 1 188 ? 45.860  7.036   54.354  1.00 12.00 ? 188 LEU C C   1 
ATOM   9497  O  O   . LEU C 1 188 ? 46.536  6.560   55.265  1.00 11.65 ? 188 LEU C O   1 
ATOM   9498  C  CB  . LEU C 1 188 ? 46.505  9.452   54.288  1.00 12.45 ? 188 LEU C CB  1 
ATOM   9499  C  CG  . LEU C 1 188 ? 47.332  10.571  53.651  1.00 12.52 ? 188 LEU C CG  1 
ATOM   9500  C  CD1 . LEU C 1 188 ? 47.309  11.806  54.551  1.00 12.57 ? 188 LEU C CD1 1 
ATOM   9501  C  CD2 . LEU C 1 188 ? 48.757  10.083  53.413  1.00 12.32 ? 188 LEU C CD2 1 
ATOM   9502  N  N   . ARG C 1 189 ? 44.629  6.622   54.072  1.00 12.03 ? 189 ARG C N   1 
ATOM   9503  C  CA  . ARG C 1 189 ? 43.975  5.557   54.833  1.00 12.19 ? 189 ARG C CA  1 
ATOM   9504  C  C   . ARG C 1 189 ? 43.482  4.455   53.896  1.00 12.37 ? 189 ARG C C   1 
ATOM   9505  O  O   . ARG C 1 189 ? 42.285  4.314   53.647  1.00 12.17 ? 189 ARG C O   1 
ATOM   9506  C  CB  . ARG C 1 189 ? 42.806  6.136   55.638  1.00 12.25 ? 189 ARG C CB  1 
ATOM   9507  C  CG  . ARG C 1 189 ? 43.079  7.528   56.227  1.00 12.25 ? 189 ARG C CG  1 
ATOM   9508  C  CD  . ARG C 1 189 ? 44.039  7.461   57.407  1.00 11.78 ? 189 ARG C CD  1 
ATOM   9509  N  NE  . ARG C 1 189 ? 43.916  6.198   58.129  1.00 11.33 ? 189 ARG C NE  1 
ATOM   9510  C  CZ  . ARG C 1 189 ? 44.591  5.894   59.230  1.00 11.01 ? 189 ARG C CZ  1 
ATOM   9511  N  NH1 . ARG C 1 189 ? 45.448  6.761   59.748  1.00 10.99 ? 189 ARG C NH1 1 
ATOM   9512  N  NH2 . ARG C 1 189 ? 44.402  4.724   59.819  1.00 10.81 ? 189 ARG C NH2 1 
ATOM   9513  N  N   . PRO C 1 190 ? 44.415  3.645   53.378  1.00 12.63 ? 190 PRO C N   1 
ATOM   9514  C  CA  . PRO C 1 190 ? 44.150  2.534   52.455  1.00 12.73 ? 190 PRO C CA  1 
ATOM   9515  C  C   . PRO C 1 190 ? 43.029  1.598   52.891  1.00 12.76 ? 190 PRO C C   1 
ATOM   9516  O  O   . PRO C 1 190 ? 42.546  0.785   52.101  1.00 12.64 ? 190 PRO C O   1 
ATOM   9517  C  CB  . PRO C 1 190 ? 45.497  1.807   52.364  1.00 13.03 ? 190 PRO C CB  1 
ATOM   9518  C  CG  . PRO C 1 190 ? 46.315  2.343   53.515  1.00 13.15 ? 190 PRO C CG  1 
ATOM   9519  C  CD  . PRO C 1 190 ? 45.845  3.746   53.704  1.00 12.90 ? 190 PRO C CD  1 
ATOM   9520  N  N   . GLU C 1 191 ? 42.624  1.706   54.151  1.00 12.74 ? 191 GLU C N   1 
ATOM   9521  C  CA  . GLU C 1 191 ? 41.559  0.861   54.669  1.00 12.76 ? 191 GLU C CA  1 
ATOM   9522  C  C   . GLU C 1 191 ? 40.235  1.266   54.033  1.00 12.87 ? 191 GLU C C   1 
ATOM   9523  O  O   . GLU C 1 191 ? 39.325  0.449   53.892  1.00 13.04 ? 191 GLU C O   1 
ATOM   9524  C  CB  . GLU C 1 191 ? 41.474  0.984   56.195  1.00 12.51 ? 191 GLU C CB  1 
ATOM   9525  C  CG  . GLU C 1 191 ? 40.894  2.298   56.694  1.00 12.41 ? 191 GLU C CG  1 
ATOM   9526  C  CD  . GLU C 1 191 ? 41.870  3.079   57.546  1.00 12.38 ? 191 GLU C CD  1 
ATOM   9527  O  OE1 . GLU C 1 191 ? 43.015  3.284   57.093  1.00 12.62 ? 191 GLU C OE1 1 
ATOM   9528  O  OE2 . GLU C 1 191 ? 41.495  3.489   58.665  1.00 12.45 ? 191 GLU C OE2 1 
ATOM   9529  N  N   . SER C 1 192 ? 40.145  2.531   53.632  1.00 12.83 ? 192 SER C N   1 
ATOM   9530  C  CA  . SER C 1 192 ? 38.929  3.056   53.018  1.00 12.85 ? 192 SER C CA  1 
ATOM   9531  C  C   . SER C 1 192 ? 38.656  2.433   51.657  1.00 12.95 ? 192 SER C C   1 
ATOM   9532  O  O   . SER C 1 192 ? 37.521  2.447   51.176  1.00 13.09 ? 192 SER C O   1 
ATOM   9533  C  CB  . SER C 1 192 ? 39.027  4.575   52.868  1.00 12.58 ? 192 SER C CB  1 
ATOM   9534  O  OG  . SER C 1 192 ? 39.984  4.925   51.888  1.00 11.89 ? 192 SER C OG  1 
ATOM   9535  N  N   . LEU C 1 193 ? 39.700  1.882   51.048  1.00 12.85 ? 193 LEU C N   1 
ATOM   9536  C  CA  . LEU C 1 193 ? 39.591  1.261   49.734  1.00 12.70 ? 193 LEU C CA  1 
ATOM   9537  C  C   . LEU C 1 193 ? 38.309  0.454   49.523  1.00 12.60 ? 193 LEU C C   1 
ATOM   9538  O  O   . LEU C 1 193 ? 37.548  0.740   48.604  1.00 12.53 ? 193 LEU C O   1 
ATOM   9539  C  CB  . LEU C 1 193 ? 40.815  0.381   49.471  1.00 12.58 ? 193 LEU C CB  1 
ATOM   9540  C  CG  . LEU C 1 193 ? 42.002  1.137   48.866  1.00 12.51 ? 193 LEU C CG  1 
ATOM   9541  C  CD1 . LEU C 1 193 ? 43.171  0.184   48.653  1.00 12.63 ? 193 LEU C CD1 1 
ATOM   9542  C  CD2 . LEU C 1 193 ? 41.579  1.780   47.549  1.00 12.36 ? 193 LEU C CD2 1 
ATOM   9543  N  N   . HIS C 1 194 ? 38.069  -0.544  50.369  1.00 12.60 ? 194 HIS C N   1 
ATOM   9544  C  CA  . HIS C 1 194 ? 36.871  -1.377  50.245  1.00 12.72 ? 194 HIS C CA  1 
ATOM   9545  C  C   . HIS C 1 194 ? 35.609  -0.566  49.966  1.00 12.74 ? 194 HIS C C   1 
ATOM   9546  O  O   . HIS C 1 194 ? 34.973  -0.723  48.923  1.00 12.88 ? 194 HIS C O   1 
ATOM   9547  C  CB  . HIS C 1 194 ? 36.651  -2.204  51.516  1.00 12.57 ? 194 HIS C CB  1 
ATOM   9548  C  CG  . HIS C 1 194 ? 35.899  -3.479  51.283  1.00 12.17 ? 194 HIS C CG  1 
ATOM   9549  N  ND1 . HIS C 1 194 ? 36.076  -4.601  52.064  1.00 12.15 ? 194 HIS C ND1 1 
ATOM   9550  C  CD2 . HIS C 1 194 ? 34.994  -3.819  50.338  1.00 11.94 ? 194 HIS C CD2 1 
ATOM   9551  C  CE1 . HIS C 1 194 ? 35.313  -5.579  51.608  1.00 11.96 ? 194 HIS C CE1 1 
ATOM   9552  N  NE2 . HIS C 1 194 ? 34.646  -5.130  50.560  1.00 11.80 ? 194 HIS C NE2 1 
ATOM   9553  N  N   . GLN C 1 195 ? 35.254  0.297   50.913  1.00 12.79 ? 195 GLN C N   1 
ATOM   9554  C  CA  . GLN C 1 195 ? 34.072  1.141   50.799  1.00 12.63 ? 195 GLN C CA  1 
ATOM   9555  C  C   . GLN C 1 195 ? 34.121  2.045   49.571  1.00 12.54 ? 195 GLN C C   1 
ATOM   9556  O  O   . GLN C 1 195 ? 33.115  2.224   48.881  1.00 12.45 ? 195 GLN C O   1 
ATOM   9557  C  CB  . GLN C 1 195 ? 33.928  1.997   52.060  1.00 12.73 ? 195 GLN C CB  1 
ATOM   9558  C  CG  . GLN C 1 195 ? 32.739  2.951   52.036  1.00 12.63 ? 195 GLN C CG  1 
ATOM   9559  C  CD  . GLN C 1 195 ? 31.424  2.235   51.819  1.00 12.52 ? 195 GLN C CD  1 
ATOM   9560  O  OE1 . GLN C 1 195 ? 31.339  1.009   51.933  1.00 12.36 ? 195 GLN C OE1 1 
ATOM   9561  N  NE2 . GLN C 1 195 ? 30.385  2.999   51.510  1.00 12.43 ? 195 GLN C NE2 1 
ATOM   9562  N  N   . VAL C 1 196 ? 35.291  2.623   49.313  1.00 12.27 ? 196 VAL C N   1 
ATOM   9563  C  CA  . VAL C 1 196 ? 35.472  3.507   48.169  1.00 12.09 ? 196 VAL C CA  1 
ATOM   9564  C  C   . VAL C 1 196 ? 35.024  2.783   46.906  1.00 12.22 ? 196 VAL C C   1 
ATOM   9565  O  O   . VAL C 1 196 ? 34.194  3.288   46.155  1.00 12.15 ? 196 VAL C O   1 
ATOM   9566  C  CB  . VAL C 1 196 ? 36.955  3.927   48.022  1.00 11.91 ? 196 VAL C CB  1 
ATOM   9567  C  CG1 . VAL C 1 196 ? 37.204  4.515   46.642  1.00 11.64 ? 196 VAL C CG1 1 
ATOM   9568  C  CG2 . VAL C 1 196 ? 37.316  4.931   49.111  1.00 11.76 ? 196 VAL C CG2 1 
ATOM   9569  N  N   . SER C 1 197 ? 35.572  1.589   46.699  1.00 12.23 ? 197 SER C N   1 
ATOM   9570  C  CA  . SER C 1 197 ? 35.251  0.762   45.538  1.00 12.47 ? 197 SER C CA  1 
ATOM   9571  C  C   . SER C 1 197 ? 33.747  0.576   45.377  1.00 12.49 ? 197 SER C C   1 
ATOM   9572  O  O   . SER C 1 197 ? 33.223  0.577   44.259  1.00 12.75 ? 197 SER C O   1 
ATOM   9573  C  CB  . SER C 1 197 ? 35.923  -0.609  45.667  1.00 12.42 ? 197 SER C CB  1 
ATOM   9574  O  OG  . SER C 1 197 ? 37.103  -0.537  46.449  1.00 12.11 ? 197 SER C OG  1 
ATOM   9575  N  N   . PHE C 1 198 ? 33.064  0.416   46.504  1.00 12.13 ? 198 PHE C N   1 
ATOM   9576  C  CA  . PHE C 1 198 ? 31.620  0.229   46.522  1.00 11.76 ? 198 PHE C CA  1 
ATOM   9577  C  C   . PHE C 1 198 ? 30.907  1.523   46.172  1.00 11.34 ? 198 PHE C C   1 
ATOM   9578  O  O   . PHE C 1 198 ? 29.963  1.534   45.382  1.00 10.82 ? 198 PHE C O   1 
ATOM   9579  C  CB  . PHE C 1 198 ? 31.169  -0.231  47.913  1.00 12.21 ? 198 PHE C CB  1 
ATOM   9580  C  CG  . PHE C 1 198 ? 29.728  -0.652  47.976  1.00 12.69 ? 198 PHE C CG  1 
ATOM   9581  C  CD1 . PHE C 1 198 ? 28.706  0.289   47.872  1.00 12.85 ? 198 PHE C CD1 1 
ATOM   9582  C  CD2 . PHE C 1 198 ? 29.391  -1.991  48.134  1.00 13.05 ? 198 PHE C CD2 1 
ATOM   9583  C  CE1 . PHE C 1 198 ? 27.371  -0.095  47.923  1.00 13.07 ? 198 PHE C CE1 1 
ATOM   9584  C  CE2 . PHE C 1 198 ? 28.058  -2.385  48.187  1.00 13.39 ? 198 PHE C CE2 1 
ATOM   9585  C  CZ  . PHE C 1 198 ? 27.044  -1.431  48.080  1.00 13.36 ? 198 PHE C CZ  1 
ATOM   9586  N  N   . LEU C 1 199 ? 31.364  2.609   46.781  1.00 11.49 ? 199 LEU C N   1 
ATOM   9587  C  CA  . LEU C 1 199 ? 30.773  3.920   46.564  1.00 11.70 ? 199 LEU C CA  1 
ATOM   9588  C  C   . LEU C 1 199 ? 30.843  4.346   45.105  1.00 11.75 ? 199 LEU C C   1 
ATOM   9589  O  O   . LEU C 1 199 ? 29.886  4.898   44.571  1.00 11.91 ? 199 LEU C O   1 
ATOM   9590  C  CB  . LEU C 1 199 ? 31.477  4.957   47.441  1.00 11.95 ? 199 LEU C CB  1 
ATOM   9591  C  CG  . LEU C 1 199 ? 31.094  6.428   47.261  1.00 12.23 ? 199 LEU C CG  1 
ATOM   9592  C  CD1 . LEU C 1 199 ? 29.585  6.600   47.293  1.00 12.48 ? 199 LEU C CD1 1 
ATOM   9593  C  CD2 . LEU C 1 199 ? 31.737  7.247   48.361  1.00 12.37 ? 199 LEU C CD2 1 
ATOM   9594  N  N   . PHE C 1 200 ? 31.973  4.076   44.461  1.00 12.05 ? 200 PHE C N   1 
ATOM   9595  C  CA  . PHE C 1 200 ? 32.162  4.453   43.065  1.00 11.96 ? 200 PHE C CA  1 
ATOM   9596  C  C   . PHE C 1 200 ? 31.654  3.418   42.068  1.00 12.04 ? 200 PHE C C   1 
ATOM   9597  O  O   . PHE C 1 200 ? 31.858  3.546   40.859  1.00 12.11 ? 200 PHE C O   1 
ATOM   9598  C  CB  . PHE C 1 200 ? 33.635  4.764   42.809  1.00 12.00 ? 200 PHE C CB  1 
ATOM   9599  C  CG  . PHE C 1 200 ? 34.055  6.117   43.310  1.00 12.12 ? 200 PHE C CG  1 
ATOM   9600  C  CD1 . PHE C 1 200 ? 34.691  6.250   44.541  1.00 12.10 ? 200 PHE C CD1 1 
ATOM   9601  C  CD2 . PHE C 1 200 ? 33.797  7.258   42.561  1.00 12.20 ? 200 PHE C CD2 1 
ATOM   9602  C  CE1 . PHE C 1 200 ? 35.063  7.500   45.022  1.00 12.26 ? 200 PHE C CE1 1 
ATOM   9603  C  CE2 . PHE C 1 200 ? 34.164  8.516   43.031  1.00 12.43 ? 200 PHE C CE2 1 
ATOM   9604  C  CZ  . PHE C 1 200 ? 34.799  8.638   44.267  1.00 12.46 ? 200 PHE C CZ  1 
ATOM   9605  N  N   . SER C 1 201 ? 30.992  2.389   42.578  1.00 11.92 ? 201 SER C N   1 
ATOM   9606  C  CA  . SER C 1 201 ? 30.423  1.366   41.718  1.00 11.95 ? 201 SER C CA  1 
ATOM   9607  C  C   . SER C 1 201 ? 29.033  1.874   41.329  1.00 12.02 ? 201 SER C C   1 
ATOM   9608  O  O   . SER C 1 201 ? 28.680  3.011   41.634  1.00 11.68 ? 201 SER C O   1 
ATOM   9609  C  CB  . SER C 1 201 ? 30.321  0.028   42.466  1.00 11.79 ? 201 SER C CB  1 
ATOM   9610  O  OG  . SER C 1 201 ? 29.000  -0.219  42.925  1.00 11.45 ? 201 SER C OG  1 
ATOM   9611  N  N   . ASP C 1 202 ? 28.248  1.033   40.667  1.00 12.46 ? 202 ASP C N   1 
ATOM   9612  C  CA  . ASP C 1 202 ? 26.910  1.419   40.237  1.00 12.78 ? 202 ASP C CA  1 
ATOM   9613  C  C   . ASP C 1 202 ? 25.953  1.649   41.397  1.00 13.15 ? 202 ASP C C   1 
ATOM   9614  O  O   . ASP C 1 202 ? 25.021  2.439   41.287  1.00 13.61 ? 202 ASP C O   1 
ATOM   9615  C  CB  . ASP C 1 202 ? 26.318  0.348   39.322  1.00 12.83 ? 202 ASP C CB  1 
ATOM   9616  C  CG  . ASP C 1 202 ? 26.977  0.314   37.966  1.00 12.87 ? 202 ASP C CG  1 
ATOM   9617  O  OD1 . ASP C 1 202 ? 27.730  1.257   37.638  1.00 12.86 ? 202 ASP C OD1 1 
ATOM   9618  O  OD2 . ASP C 1 202 ? 26.743  -0.661  37.227  1.00 13.23 ? 202 ASP C OD2 1 
ATOM   9619  N  N   . ARG C 1 203 ? 26.170  0.955   42.507  1.00 13.22 ? 203 ARG C N   1 
ATOM   9620  C  CA  . ARG C 1 203 ? 25.293  1.103   43.661  1.00 13.11 ? 203 ARG C CA  1 
ATOM   9621  C  C   . ARG C 1 203 ? 25.523  2.447   44.352  1.00 13.01 ? 203 ARG C C   1 
ATOM   9622  O  O   . ARG C 1 203 ? 24.823  2.800   45.304  1.00 13.07 ? 203 ARG C O   1 
ATOM   9623  C  CB  . ARG C 1 203 ? 25.526  -0.051  44.644  1.00 13.05 ? 203 ARG C CB  1 
ATOM   9624  C  CG  . ARG C 1 203 ? 25.402  -1.436  44.016  1.00 12.85 ? 203 ARG C CG  1 
ATOM   9625  C  CD  . ARG C 1 203 ? 24.187  -2.184  44.543  1.00 12.78 ? 203 ARG C CD  1 
ATOM   9626  N  NE  . ARG C 1 203 ? 24.281  -2.448  45.977  1.00 13.08 ? 203 ARG C NE  1 
ATOM   9627  C  CZ  . ARG C 1 203 ? 24.457  -3.655  46.509  1.00 13.24 ? 203 ARG C CZ  1 
ATOM   9628  N  NH1 . ARG C 1 203 ? 24.558  -4.723  45.726  1.00 13.78 ? 203 ARG C NH1 1 
ATOM   9629  N  NH2 . ARG C 1 203 ? 24.536  -3.796  47.827  1.00 13.08 ? 203 ARG C NH2 1 
ATOM   9630  N  N   . GLY C 1 204 ? 26.500  3.195   43.850  1.00 12.65 ? 204 GLY C N   1 
ATOM   9631  C  CA  . GLY C 1 204 ? 26.825  4.492   44.421  1.00 12.42 ? 204 GLY C CA  1 
ATOM   9632  C  C   . GLY C 1 204 ? 25.717  5.530   44.390  1.00 12.05 ? 204 GLY C C   1 
ATOM   9633  O  O   . GLY C 1 204 ? 25.670  6.407   45.249  1.00 11.95 ? 204 GLY C O   1 
ATOM   9634  N  N   . ILE C 1 205 ? 24.837  5.450   43.397  1.00 12.06 ? 205 ILE C N   1 
ATOM   9635  C  CA  . ILE C 1 205 ? 23.727  6.395   43.281  1.00 12.22 ? 205 ILE C CA  1 
ATOM   9636  C  C   . ILE C 1 205 ? 22.421  5.657   43.014  1.00 12.45 ? 205 ILE C C   1 
ATOM   9637  O  O   . ILE C 1 205 ? 22.005  5.512   41.862  1.00 12.33 ? 205 ILE C O   1 
ATOM   9638  C  CB  . ILE C 1 205 ? 23.949  7.400   42.142  1.00 11.99 ? 205 ILE C CB  1 
ATOM   9639  C  CG1 . ILE C 1 205 ? 25.389  7.899   42.156  1.00 11.90 ? 205 ILE C CG1 1 
ATOM   9640  C  CG2 . ILE C 1 205 ? 23.009  8.573   42.308  1.00 12.00 ? 205 ILE C CG2 1 
ATOM   9641  C  CD1 . ILE C 1 205 ? 25.729  8.786   40.987  1.00 11.98 ? 205 ILE C CD1 1 
ATOM   9642  N  N   . PRO C 1 206 ? 21.753  5.191   44.085  1.00 12.70 ? 206 PRO C N   1 
ATOM   9643  C  CA  . PRO C 1 206 ? 20.485  4.457   43.984  1.00 12.82 ? 206 PRO C CA  1 
ATOM   9644  C  C   . PRO C 1 206 ? 19.340  5.263   43.383  1.00 12.91 ? 206 PRO C C   1 
ATOM   9645  O  O   . PRO C 1 206 ? 19.235  6.471   43.606  1.00 13.04 ? 206 PRO C O   1 
ATOM   9646  C  CB  . PRO C 1 206 ? 20.193  4.039   45.426  1.00 12.92 ? 206 PRO C CB  1 
ATOM   9647  C  CG  . PRO C 1 206 ? 20.929  5.029   46.259  1.00 12.95 ? 206 PRO C CG  1 
ATOM   9648  C  CD  . PRO C 1 206 ? 22.178  5.353   45.487  1.00 12.81 ? 206 PRO C CD  1 
ATOM   9649  N  N   . ASP C 1 207 ? 18.488  4.588   42.618  1.00 12.84 ? 207 ASP C N   1 
ATOM   9650  C  CA  . ASP C 1 207 ? 17.340  5.235   42.000  1.00 12.78 ? 207 ASP C CA  1 
ATOM   9651  C  C   . ASP C 1 207 ? 16.200  5.296   43.014  1.00 12.70 ? 207 ASP C C   1 
ATOM   9652  O  O   . ASP C 1 207 ? 15.192  4.600   42.872  1.00 12.52 ? 207 ASP C O   1 
ATOM   9653  C  CB  . ASP C 1 207 ? 16.895  4.454   40.762  1.00 12.84 ? 207 ASP C CB  1 
ATOM   9654  C  CG  . ASP C 1 207 ? 15.722  5.105   40.047  1.00 12.90 ? 207 ASP C CG  1 
ATOM   9655  O  OD1 . ASP C 1 207 ? 15.390  4.654   38.929  1.00 13.17 ? 207 ASP C OD1 1 
ATOM   9656  O  OD2 . ASP C 1 207 ? 15.130  6.060   40.598  1.00 12.63 ? 207 ASP C OD2 1 
ATOM   9657  N  N   . GLY C 1 208 ? 16.374  6.133   44.033  1.00 12.60 ? 208 GLY C N   1 
ATOM   9658  C  CA  . GLY C 1 208 ? 15.366  6.274   45.069  1.00 12.79 ? 208 GLY C CA  1 
ATOM   9659  C  C   . GLY C 1 208 ? 15.765  5.559   46.347  1.00 12.72 ? 208 GLY C C   1 
ATOM   9660  O  O   . GLY C 1 208 ? 16.804  4.903   46.397  1.00 12.81 ? 208 GLY C O   1 
ATOM   9661  N  N   . HIS C 1 209 ? 14.944  5.681   47.385  1.00 12.71 ? 209 HIS C N   1 
ATOM   9662  C  CA  . HIS C 1 209 ? 15.238  5.032   48.662  1.00 12.90 ? 209 HIS C CA  1 
ATOM   9663  C  C   . HIS C 1 209 ? 14.660  3.621   48.711  1.00 12.86 ? 209 HIS C C   1 
ATOM   9664  O  O   . HIS C 1 209 ? 15.102  2.784   49.504  1.00 12.71 ? 209 HIS C O   1 
ATOM   9665  C  CB  . HIS C 1 209 ? 14.662  5.843   49.827  1.00 12.71 ? 209 HIS C CB  1 
ATOM   9666  C  CG  . HIS C 1 209 ? 15.237  7.217   49.952  1.00 12.74 ? 209 HIS C CG  1 
ATOM   9667  N  ND1 . HIS C 1 209 ? 16.594  7.459   49.957  1.00 12.77 ? 209 HIS C ND1 1 
ATOM   9668  C  CD2 . HIS C 1 209 ? 14.639  8.424   50.092  1.00 12.71 ? 209 HIS C CD2 1 
ATOM   9669  C  CE1 . HIS C 1 209 ? 16.806  8.756   50.094  1.00 12.78 ? 209 HIS C CE1 1 
ATOM   9670  N  NE2 . HIS C 1 209 ? 15.636  9.364   50.178  1.00 12.63 ? 209 HIS C NE2 1 
ATOM   9671  N  N   . ARG C 1 210 ? 13.675  3.364   47.855  1.00 12.79 ? 210 ARG C N   1 
ATOM   9672  C  CA  . ARG C 1 210 ? 13.025  2.063   47.811  1.00 12.73 ? 210 ARG C CA  1 
ATOM   9673  C  C   . ARG C 1 210 ? 13.750  1.017   46.983  1.00 12.53 ? 210 ARG C C   1 
ATOM   9674  O  O   . ARG C 1 210 ? 13.354  -0.143  46.988  1.00 12.57 ? 210 ARG C O   1 
ATOM   9675  C  CB  . ARG C 1 210 ? 11.600  2.207   47.279  1.00 13.21 ? 210 ARG C CB  1 
ATOM   9676  C  CG  . ARG C 1 210 ? 10.797  3.305   47.944  1.00 13.51 ? 210 ARG C CG  1 
ATOM   9677  C  CD  . ARG C 1 210 ? 9.444   3.457   47.279  1.00 13.55 ? 210 ARG C CD  1 
ATOM   9678  N  NE  . ARG C 1 210 ? 9.527   4.170   46.006  1.00 13.08 ? 210 ARG C NE  1 
ATOM   9679  C  CZ  . ARG C 1 210 ? 9.525   3.581   44.814  1.00 12.72 ? 210 ARG C CZ  1 
ATOM   9680  N  NH1 . ARG C 1 210 ? 9.445   2.258   44.722  1.00 12.34 ? 210 ARG C NH1 1 
ATOM   9681  N  NH2 . ARG C 1 210 ? 9.590   4.316   43.714  1.00 12.28 ? 210 ARG C NH2 1 
ATOM   9682  N  N   . HIS C 1 211 ? 14.804  1.408   46.274  1.00 12.44 ? 211 HIS C N   1 
ATOM   9683  C  CA  . HIS C 1 211 ? 15.524  0.446   45.447  1.00 12.47 ? 211 HIS C CA  1 
ATOM   9684  C  C   . HIS C 1 211 ? 16.936  0.156   45.919  1.00 12.53 ? 211 HIS C C   1 
ATOM   9685  O  O   . HIS C 1 211 ? 17.819  -0.182  45.129  1.00 12.44 ? 211 HIS C O   1 
ATOM   9686  C  CB  . HIS C 1 211 ? 15.525  0.911   43.990  1.00 12.06 ? 211 HIS C CB  1 
ATOM   9687  C  CG  . HIS C 1 211 ? 14.176  0.833   43.349  1.00 11.98 ? 211 HIS C CG  1 
ATOM   9688  N  ND1 . HIS C 1 211 ? 13.513  -0.360  43.161  1.00 11.85 ? 211 HIS C ND1 1 
ATOM   9689  C  CD2 . HIS C 1 211 ? 13.336  1.804   42.916  1.00 12.05 ? 211 HIS C CD2 1 
ATOM   9690  C  CE1 . HIS C 1 211 ? 12.321  -0.121  42.642  1.00 11.97 ? 211 HIS C CE1 1 
ATOM   9691  N  NE2 . HIS C 1 211 ? 12.188  1.185   42.485  1.00 12.06 ? 211 HIS C NE2 1 
ATOM   9692  N  N   . MET C 1 212 ? 17.136  0.271   47.222  1.00 12.61 ? 212 MET C N   1 
ATOM   9693  C  CA  . MET C 1 212 ? 18.438  0.013   47.811  1.00 12.88 ? 212 MET C CA  1 
ATOM   9694  C  C   . MET C 1 212 ? 18.256  -0.848  49.043  1.00 12.98 ? 212 MET C C   1 
ATOM   9695  O  O   . MET C 1 212 ? 17.178  -0.864  49.637  1.00 13.00 ? 212 MET C O   1 
ATOM   9696  C  CB  . MET C 1 212 ? 19.101  1.323   48.213  1.00 13.28 ? 212 MET C CB  1 
ATOM   9697  C  CG  . MET C 1 212 ? 18.494  1.943   49.452  1.00 13.73 ? 212 MET C CG  1 
ATOM   9698  S  SD  . MET C 1 212 ? 19.037  3.623   49.649  1.00 14.25 ? 212 MET C SD  1 
ATOM   9699  C  CE  . MET C 1 212 ? 18.126  4.112   51.117  1.00 14.55 ? 212 MET C CE  1 
ATOM   9700  N  N   . ASN C 1 213 ? 19.310  -1.558  49.430  1.00 13.13 ? 213 ASN C N   1 
ATOM   9701  C  CA  . ASN C 1 213 ? 19.251  -2.417  50.606  1.00 13.50 ? 213 ASN C CA  1 
ATOM   9702  C  C   . ASN C 1 213 ? 19.736  -1.695  51.854  1.00 13.27 ? 213 ASN C C   1 
ATOM   9703  O  O   . ASN C 1 213 ? 20.280  -0.593  51.780  1.00 13.13 ? 213 ASN C O   1 
ATOM   9704  C  CB  . ASN C 1 213 ? 20.086  -3.677  50.380  1.00 13.71 ? 213 ASN C CB  1 
ATOM   9705  C  CG  . ASN C 1 213 ? 19.530  -4.540  49.273  1.00 14.18 ? 213 ASN C CG  1 
ATOM   9706  O  OD1 . ASN C 1 213 ? 18.312  -4.725  49.165  1.00 14.26 ? 213 ASN C OD1 1 
ATOM   9707  N  ND2 . ASN C 1 213 ? 20.418  -5.076  48.436  1.00 14.66 ? 213 ASN C ND2 1 
ATOM   9708  N  N   . GLY C 1 214 ? 19.533  -2.323  53.003  1.00 13.28 ? 214 GLY C N   1 
ATOM   9709  C  CA  . GLY C 1 214 ? 19.964  -1.720  54.246  1.00 13.70 ? 214 GLY C CA  1 
ATOM   9710  C  C   . GLY C 1 214 ? 20.706  -2.718  55.108  1.00 13.81 ? 214 GLY C C   1 
ATOM   9711  O  O   . GLY C 1 214 ? 20.369  -3.903  55.131  1.00 13.97 ? 214 GLY C O   1 
ATOM   9712  N  N   . TYR C 1 215 ? 21.726  -2.243  55.812  1.00 13.83 ? 215 TYR C N   1 
ATOM   9713  C  CA  . TYR C 1 215 ? 22.513  -3.101  56.687  1.00 13.80 ? 215 TYR C CA  1 
ATOM   9714  C  C   . TYR C 1 215 ? 22.756  -2.397  58.019  1.00 13.87 ? 215 TYR C C   1 
ATOM   9715  O  O   . TYR C 1 215 ? 22.780  -1.167  58.085  1.00 13.89 ? 215 TYR C O   1 
ATOM   9716  C  CB  . TYR C 1 215 ? 23.860  -3.434  56.034  1.00 13.69 ? 215 TYR C CB  1 
ATOM   9717  C  CG  . TYR C 1 215 ? 23.761  -3.823  54.577  1.00 13.71 ? 215 TYR C CG  1 
ATOM   9718  C  CD1 . TYR C 1 215 ? 23.706  -5.168  54.194  1.00 13.69 ? 215 TYR C CD1 1 
ATOM   9719  C  CD2 . TYR C 1 215 ? 23.708  -2.848  53.575  1.00 13.64 ? 215 TYR C CD2 1 
ATOM   9720  C  CE1 . TYR C 1 215 ? 23.599  -5.532  52.854  1.00 13.71 ? 215 TYR C CE1 1 
ATOM   9721  C  CE2 . TYR C 1 215 ? 23.602  -3.201  52.229  1.00 13.63 ? 215 TYR C CE2 1 
ATOM   9722  C  CZ  . TYR C 1 215 ? 23.547  -4.544  51.876  1.00 13.70 ? 215 TYR C CZ  1 
ATOM   9723  O  OH  . TYR C 1 215 ? 23.438  -4.904  50.548  1.00 13.71 ? 215 TYR C OH  1 
ATOM   9724  N  N   . GLY C 1 216 ? 22.914  -3.178  59.081  1.00 13.70 ? 216 GLY C N   1 
ATOM   9725  C  CA  . GLY C 1 216 ? 23.188  -2.588  60.375  1.00 13.51 ? 216 GLY C CA  1 
ATOM   9726  C  C   . GLY C 1 216 ? 24.650  -2.198  60.343  1.00 13.57 ? 216 GLY C C   1 
ATOM   9727  O  O   . GLY C 1 216 ? 25.097  -1.316  61.083  1.00 13.49 ? 216 GLY C O   1 
ATOM   9728  N  N   . SER C 1 217 ? 25.383  -2.877  59.461  1.00 13.23 ? 217 SER C N   1 
ATOM   9729  C  CA  . SER C 1 217 ? 26.807  -2.663  59.244  1.00 13.30 ? 217 SER C CA  1 
ATOM   9730  C  C   . SER C 1 217 ? 27.705  -3.198  60.349  1.00 13.18 ? 217 SER C C   1 
ATOM   9731  O  O   . SER C 1 217 ? 28.603  -4.001  60.089  1.00 12.79 ? 217 SER C O   1 
ATOM   9732  C  CB  . SER C 1 217 ? 27.094  -1.177  59.032  1.00 13.44 ? 217 SER C CB  1 
ATOM   9733  O  OG  . SER C 1 217 ? 27.211  -0.889  57.654  1.00 14.30 ? 217 SER C OG  1 
ATOM   9734  N  N   . HIS C 1 218 ? 27.473  -2.751  61.578  1.00 13.13 ? 218 HIS C N   1 
ATOM   9735  C  CA  . HIS C 1 218 ? 28.288  -3.187  62.708  1.00 13.33 ? 218 HIS C CA  1 
ATOM   9736  C  C   . HIS C 1 218 ? 27.981  -4.611  63.159  1.00 13.35 ? 218 HIS C C   1 
ATOM   9737  O  O   . HIS C 1 218 ? 26.945  -5.178  62.823  1.00 13.50 ? 218 HIS C O   1 
ATOM   9738  C  CB  . HIS C 1 218 ? 28.085  -2.258  63.908  1.00 13.47 ? 218 HIS C CB  1 
ATOM   9739  C  CG  . HIS C 1 218 ? 28.436  -0.827  63.646  1.00 13.42 ? 218 HIS C CG  1 
ATOM   9740  N  ND1 . HIS C 1 218 ? 29.716  -0.337  63.794  1.00 13.39 ? 218 HIS C ND1 1 
ATOM   9741  C  CD2 . HIS C 1 218 ? 27.663  0.231   63.308  1.00 13.45 ? 218 HIS C CD2 1 
ATOM   9742  C  CE1 . HIS C 1 218 ? 29.715  0.964   63.561  1.00 13.27 ? 218 HIS C CE1 1 
ATOM   9743  N  NE2 . HIS C 1 218 ? 28.482  1.334   63.265  1.00 13.38 ? 218 HIS C NE2 1 
ATOM   9744  N  N   . THR C 1 219 ? 28.899  -5.181  63.929  1.00 13.61 ? 219 THR C N   1 
ATOM   9745  C  CA  . THR C 1 219 ? 28.716  -6.521  64.471  1.00 13.90 ? 219 THR C CA  1 
ATOM   9746  C  C   . THR C 1 219 ? 28.037  -6.360  65.832  1.00 13.99 ? 219 THR C C   1 
ATOM   9747  O  O   . THR C 1 219 ? 28.620  -5.790  66.761  1.00 13.99 ? 219 THR C O   1 
ATOM   9748  C  CB  . THR C 1 219 ? 30.068  -7.253  64.670  1.00 13.81 ? 219 THR C CB  1 
ATOM   9749  O  OG1 . THR C 1 219 ? 30.514  -7.786  63.416  1.00 14.10 ? 219 THR C OG1 1 
ATOM   9750  C  CG2 . THR C 1 219 ? 29.915  -8.392  65.672  1.00 13.38 ? 219 THR C CG2 1 
ATOM   9751  N  N   . PHE C 1 220 ? 26.805  -6.851  65.937  1.00 13.78 ? 220 PHE C N   1 
ATOM   9752  C  CA  . PHE C 1 220 ? 26.038  -6.759  67.172  1.00 13.30 ? 220 PHE C CA  1 
ATOM   9753  C  C   . PHE C 1 220 ? 26.013  -8.094  67.896  1.00 13.37 ? 220 PHE C C   1 
ATOM   9754  O  O   . PHE C 1 220 ? 26.345  -9.131  67.323  1.00 13.74 ? 220 PHE C O   1 
ATOM   9755  C  CB  . PHE C 1 220 ? 24.606  -6.324  66.867  1.00 13.09 ? 220 PHE C CB  1 
ATOM   9756  C  CG  . PHE C 1 220 ? 24.496  -4.912  66.383  1.00 12.63 ? 220 PHE C CG  1 
ATOM   9757  C  CD1 . PHE C 1 220 ? 24.204  -4.643  65.053  1.00 12.49 ? 220 PHE C CD1 1 
ATOM   9758  C  CD2 . PHE C 1 220 ? 24.701  -3.850  67.254  1.00 12.40 ? 220 PHE C CD2 1 
ATOM   9759  C  CE1 . PHE C 1 220 ? 24.120  -3.336  64.593  1.00 12.57 ? 220 PHE C CE1 1 
ATOM   9760  C  CE2 . PHE C 1 220 ? 24.620  -2.542  66.810  1.00 12.47 ? 220 PHE C CE2 1 
ATOM   9761  C  CZ  . PHE C 1 220 ? 24.329  -2.282  65.471  1.00 12.64 ? 220 PHE C CZ  1 
ATOM   9762  N  N   . LYS C 1 221 ? 25.614  -8.061  69.162  1.00 13.27 ? 221 LYS C N   1 
ATOM   9763  C  CA  . LYS C 1 221 ? 25.538  -9.270  69.968  1.00 12.82 ? 221 LYS C CA  1 
ATOM   9764  C  C   . LYS C 1 221 ? 24.092  -9.594  70.310  1.00 12.36 ? 221 LYS C C   1 
ATOM   9765  O  O   . LYS C 1 221 ? 23.314  -8.710  70.656  1.00 12.23 ? 221 LYS C O   1 
ATOM   9766  C  CB  . LYS C 1 221 ? 26.339  -9.098  71.261  1.00 12.88 ? 221 LYS C CB  1 
ATOM   9767  C  CG  . LYS C 1 221 ? 26.217  -10.276 72.216  1.00 13.00 ? 221 LYS C CG  1 
ATOM   9768  C  CD  . LYS C 1 221 ? 27.316  -10.260 73.258  1.00 12.93 ? 221 LYS C CD  1 
ATOM   9769  C  CE  . LYS C 1 221 ? 26.877  -9.525  74.512  1.00 12.88 ? 221 LYS C CE  1 
ATOM   9770  N  NZ  . LYS C 1 221 ? 28.031  -8.820  75.133  1.00 12.62 ? 221 LYS C NZ  1 
ATOM   9771  N  N   . LEU C 1 222 ? 23.737  -10.868 70.213  1.00 12.10 ? 222 LEU C N   1 
ATOM   9772  C  CA  . LEU C 1 222 ? 22.387  -11.296 70.525  1.00 12.03 ? 222 LEU C CA  1 
ATOM   9773  C  C   . LEU C 1 222 ? 22.394  -12.185 71.760  1.00 12.19 ? 222 LEU C C   1 
ATOM   9774  O  O   . LEU C 1 222 ? 23.306  -12.991 71.948  1.00 12.33 ? 222 LEU C O   1 
ATOM   9775  C  CB  . LEU C 1 222 ? 21.789  -12.057 69.347  1.00 11.71 ? 222 LEU C CB  1 
ATOM   9776  C  CG  . LEU C 1 222 ? 21.137  -11.216 68.254  1.00 11.42 ? 222 LEU C CG  1 
ATOM   9777  C  CD1 . LEU C 1 222 ? 20.083  -12.056 67.545  1.00 11.19 ? 222 LEU C CD1 1 
ATOM   9778  C  CD2 . LEU C 1 222 ? 20.518  -9.964  68.854  1.00 11.42 ? 222 LEU C CD2 1 
ATOM   9779  N  N   . VAL C 1 223 ? 21.376  -12.036 72.601  1.00 12.01 ? 223 VAL C N   1 
ATOM   9780  C  CA  . VAL C 1 223 ? 21.281  -12.829 73.815  1.00 12.03 ? 223 VAL C CA  1 
ATOM   9781  C  C   . VAL C 1 223 ? 19.896  -13.445 73.934  1.00 12.10 ? 223 VAL C C   1 
ATOM   9782  O  O   . VAL C 1 223 ? 18.888  -12.739 73.858  1.00 12.09 ? 223 VAL C O   1 
ATOM   9783  C  CB  . VAL C 1 223 ? 21.566  -11.968 75.072  1.00 11.83 ? 223 VAL C CB  1 
ATOM   9784  C  CG1 . VAL C 1 223 ? 21.575  -12.844 76.314  1.00 11.62 ? 223 VAL C CG1 1 
ATOM   9785  C  CG2 . VAL C 1 223 ? 22.899  -11.260 74.922  1.00 11.61 ? 223 VAL C CG2 1 
ATOM   9786  N  N   . ASN C 1 224 ? 19.859  -14.764 74.109  1.00 12.04 ? 224 ASN C N   1 
ATOM   9787  C  CA  . ASN C 1 224 ? 18.601  -15.488 74.244  1.00 11.83 ? 224 ASN C CA  1 
ATOM   9788  C  C   . ASN C 1 224 ? 18.169  -15.494 75.703  1.00 11.91 ? 224 ASN C C   1 
ATOM   9789  O  O   . ASN C 1 224 ? 18.855  -14.939 76.565  1.00 11.75 ? 224 ASN C O   1 
ATOM   9790  C  CB  . ASN C 1 224 ? 18.745  -16.926 73.722  1.00 11.87 ? 224 ASN C CB  1 
ATOM   9791  C  CG  . ASN C 1 224 ? 19.395  -17.863 74.730  1.00 11.78 ? 224 ASN C CG  1 
ATOM   9792  O  OD1 . ASN C 1 224 ? 20.010  -17.425 75.700  1.00 11.94 ? 224 ASN C OD1 1 
ATOM   9793  N  ND2 . ASN C 1 224 ? 19.262  -19.162 74.498  1.00 11.40 ? 224 ASN C ND2 1 
ATOM   9794  N  N   . ALA C 1 225 ? 17.031  -16.123 75.970  1.00 12.29 ? 225 ALA C N   1 
ATOM   9795  C  CA  . ALA C 1 225 ? 16.493  -16.190 77.323  1.00 12.41 ? 225 ALA C CA  1 
ATOM   9796  C  C   . ALA C 1 225 ? 17.448  -16.864 78.298  1.00 12.43 ? 225 ALA C C   1 
ATOM   9797  O  O   . ALA C 1 225 ? 17.446  -16.551 79.486  1.00 12.50 ? 225 ALA C O   1 
ATOM   9798  C  CB  . ALA C 1 225 ? 15.157  -16.925 77.315  1.00 12.68 ? 225 ALA C CB  1 
ATOM   9799  N  N   . ASN C 1 226 ? 18.272  -17.777 77.797  1.00 12.36 ? 226 ASN C N   1 
ATOM   9800  C  CA  . ASN C 1 226 ? 19.202  -18.492 78.660  1.00 12.30 ? 226 ASN C CA  1 
ATOM   9801  C  C   . ASN C 1 226 ? 20.614  -17.935 78.666  1.00 12.37 ? 226 ASN C C   1 
ATOM   9802  O  O   . ASN C 1 226 ? 21.589  -18.690 78.688  1.00 12.45 ? 226 ASN C O   1 
ATOM   9803  C  CB  . ASN C 1 226 ? 19.234  -19.967 78.274  1.00 12.23 ? 226 ASN C CB  1 
ATOM   9804  C  CG  . ASN C 1 226 ? 17.848  -20.545 78.109  1.00 12.05 ? 226 ASN C CG  1 
ATOM   9805  O  OD1 . ASN C 1 226 ? 17.342  -20.654 76.993  1.00 12.39 ? 226 ASN C OD1 1 
ATOM   9806  N  ND2 . ASN C 1 226 ? 17.222  -20.914 79.222  1.00 11.52 ? 226 ASN C ND2 1 
ATOM   9807  N  N   . GLY C 1 227 ? 20.717  -16.611 78.652  1.00 12.35 ? 227 GLY C N   1 
ATOM   9808  C  CA  . GLY C 1 227 ? 22.015  -15.964 78.683  1.00 12.26 ? 227 GLY C CA  1 
ATOM   9809  C  C   . GLY C 1 227 ? 23.007  -16.420 77.631  1.00 12.16 ? 227 GLY C C   1 
ATOM   9810  O  O   . GLY C 1 227 ? 24.211  -16.198 77.782  1.00 12.11 ? 227 GLY C O   1 
ATOM   9811  N  N   . GLU C 1 228 ? 22.514  -17.049 76.569  1.00 12.18 ? 228 GLU C N   1 
ATOM   9812  C  CA  . GLU C 1 228 ? 23.376  -17.523 75.489  1.00 12.29 ? 228 GLU C CA  1 
ATOM   9813  C  C   . GLU C 1 228 ? 23.579  -16.407 74.469  1.00 12.39 ? 228 GLU C C   1 
ATOM   9814  O  O   . GLU C 1 228 ? 22.616  -15.878 73.906  1.00 12.14 ? 228 GLU C O   1 
ATOM   9815  C  CB  . GLU C 1 228 ? 22.753  -18.741 74.814  1.00 12.51 ? 228 GLU C CB  1 
ATOM   9816  C  CG  . GLU C 1 228 ? 22.136  -19.729 75.785  1.00 13.04 ? 228 GLU C CG  1 
ATOM   9817  C  CD  . GLU C 1 228 ? 22.411  -21.167 75.400  1.00 13.33 ? 228 GLU C CD  1 
ATOM   9818  O  OE1 . GLU C 1 228 ? 23.599  -21.558 75.382  1.00 13.36 ? 228 GLU C OE1 1 
ATOM   9819  O  OE2 . GLU C 1 228 ? 21.439  -21.903 75.112  1.00 13.70 ? 228 GLU C OE2 1 
ATOM   9820  N  N   . ALA C 1 229 ? 24.836  -16.059 74.224  1.00 12.39 ? 229 ALA C N   1 
ATOM   9821  C  CA  . ALA C 1 229 ? 25.145  -14.985 73.297  1.00 12.73 ? 229 ALA C CA  1 
ATOM   9822  C  C   . ALA C 1 229 ? 25.809  -15.429 72.004  1.00 12.91 ? 229 ALA C C   1 
ATOM   9823  O  O   . ALA C 1 229 ? 26.663  -16.316 71.993  1.00 13.11 ? 229 ALA C O   1 
ATOM   9824  C  CB  . ALA C 1 229 ? 26.015  -13.944 73.989  1.00 12.50 ? 229 ALA C CB  1 
ATOM   9825  N  N   . VAL C 1 230 ? 25.399  -14.788 70.916  1.00 13.22 ? 230 VAL C N   1 
ATOM   9826  C  CA  . VAL C 1 230 ? 25.933  -15.051 69.586  1.00 13.44 ? 230 VAL C CA  1 
ATOM   9827  C  C   . VAL C 1 230 ? 26.045  -13.685 68.916  1.00 13.57 ? 230 VAL C C   1 
ATOM   9828  O  O   . VAL C 1 230 ? 25.310  -12.763 69.271  1.00 13.64 ? 230 VAL C O   1 
ATOM   9829  C  CB  . VAL C 1 230 ? 24.975  -15.941 68.750  1.00 13.43 ? 230 VAL C CB  1 
ATOM   9830  C  CG1 . VAL C 1 230 ? 24.849  -17.318 69.380  1.00 13.13 ? 230 VAL C CG1 1 
ATOM   9831  C  CG2 . VAL C 1 230 ? 23.602  -15.280 68.648  1.00 13.56 ? 230 VAL C CG2 1 
ATOM   9832  N  N   . TYR C 1 231 ? 26.969  -13.539 67.970  1.00 13.69 ? 231 TYR C N   1 
ATOM   9833  C  CA  . TYR C 1 231 ? 27.125  -12.264 67.276  1.00 13.78 ? 231 TYR C CA  1 
ATOM   9834  C  C   . TYR C 1 231 ? 26.247  -12.291 66.029  1.00 14.07 ? 231 TYR C C   1 
ATOM   9835  O  O   . TYR C 1 231 ? 25.708  -13.337 65.669  1.00 14.23 ? 231 TYR C O   1 
ATOM   9836  C  CB  . TYR C 1 231 ? 28.588  -12.040 66.895  1.00 13.62 ? 231 TYR C CB  1 
ATOM   9837  C  CG  . TYR C 1 231 ? 29.496  -11.836 68.087  1.00 13.69 ? 231 TYR C CG  1 
ATOM   9838  C  CD1 . TYR C 1 231 ? 29.248  -10.821 69.012  1.00 13.81 ? 231 TYR C CD1 1 
ATOM   9839  C  CD2 . TYR C 1 231 ? 30.594  -12.669 68.302  1.00 13.72 ? 231 TYR C CD2 1 
ATOM   9840  C  CE1 . TYR C 1 231 ? 30.072  -10.642 70.127  1.00 14.47 ? 231 TYR C CE1 1 
ATOM   9841  C  CE2 . TYR C 1 231 ? 31.425  -12.501 69.410  1.00 14.40 ? 231 TYR C CE2 1 
ATOM   9842  C  CZ  . TYR C 1 231 ? 31.158  -11.488 70.319  1.00 14.67 ? 231 TYR C CZ  1 
ATOM   9843  O  OH  . TYR C 1 231 ? 31.966  -11.337 71.425  1.00 15.57 ? 231 TYR C OH  1 
ATOM   9844  N  N   . CYS C 1 232 ? 26.085  -11.147 65.373  1.00 14.25 ? 232 CYS C N   1 
ATOM   9845  C  CA  . CYS C 1 232 ? 25.249  -11.102 64.183  1.00 14.51 ? 232 CYS C CA  1 
ATOM   9846  C  C   . CYS C 1 232 ? 25.332  -9.784  63.419  1.00 14.55 ? 232 CYS C C   1 
ATOM   9847  O  O   . CYS C 1 232 ? 25.916  -8.802  63.892  1.00 14.34 ? 232 CYS C O   1 
ATOM   9848  C  CB  . CYS C 1 232 ? 23.789  -11.380 64.558  1.00 14.81 ? 232 CYS C CB  1 
ATOM   9849  S  SG  . CYS C 1 232 ? 23.046  -10.153 65.666  1.00 15.74 ? 232 CYS C SG  1 
ATOM   9850  N  N   . LYS C 1 233 ? 24.740  -9.780  62.229  1.00 14.02 ? 233 LYS C N   1 
ATOM   9851  C  CA  . LYS C 1 233 ? 24.720  -8.605  61.376  1.00 13.91 ? 233 LYS C CA  1 
ATOM   9852  C  C   . LYS C 1 233 ? 23.306  -8.456  60.830  1.00 13.58 ? 233 LYS C C   1 
ATOM   9853  O  O   . LYS C 1 233 ? 22.650  -9.445  60.522  1.00 13.66 ? 233 LYS C O   1 
ATOM   9854  C  CB  . LYS C 1 233 ? 25.718  -8.776  60.226  1.00 14.08 ? 233 LYS C CB  1 
ATOM   9855  C  CG  . LYS C 1 233 ? 27.176  -8.868  60.667  1.00 14.25 ? 233 LYS C CG  1 
ATOM   9856  C  CD  . LYS C 1 233 ? 27.929  -7.563  60.389  1.00 14.21 ? 233 LYS C CD  1 
ATOM   9857  C  CE  . LYS C 1 233 ? 29.399  -7.662  60.798  1.00 14.07 ? 233 LYS C CE  1 
ATOM   9858  N  NZ  . LYS C 1 233 ? 30.305  -6.911  59.880  1.00 13.66 ? 233 LYS C NZ  1 
ATOM   9859  N  N   . PHE C 1 234 ? 22.836  -7.223  60.708  1.00 13.38 ? 234 PHE C N   1 
ATOM   9860  C  CA  . PHE C 1 234 ? 21.493  -6.982  60.209  1.00 13.25 ? 234 PHE C CA  1 
ATOM   9861  C  C   . PHE C 1 234 ? 21.459  -6.618  58.723  1.00 13.17 ? 234 PHE C C   1 
ATOM   9862  O  O   . PHE C 1 234 ? 22.268  -5.818  58.248  1.00 13.07 ? 234 PHE C O   1 
ATOM   9863  C  CB  . PHE C 1 234 ? 20.841  -5.869  61.024  1.00 13.36 ? 234 PHE C CB  1 
ATOM   9864  C  CG  . PHE C 1 234 ? 20.603  -6.228  62.465  1.00 13.57 ? 234 PHE C CG  1 
ATOM   9865  C  CD1 . PHE C 1 234 ? 19.797  -7.314  62.804  1.00 13.80 ? 234 PHE C CD1 1 
ATOM   9866  C  CD2 . PHE C 1 234 ? 21.156  -5.462  63.484  1.00 13.49 ? 234 PHE C CD2 1 
ATOM   9867  C  CE1 . PHE C 1 234 ? 19.542  -7.629  64.143  1.00 14.07 ? 234 PHE C CE1 1 
ATOM   9868  C  CE2 . PHE C 1 234 ? 20.909  -5.766  64.822  1.00 13.68 ? 234 PHE C CE2 1 
ATOM   9869  C  CZ  . PHE C 1 234 ? 20.098  -6.853  65.153  1.00 13.89 ? 234 PHE C CZ  1 
ATOM   9870  N  N   . HIS C 1 235 ? 20.522  -7.215  57.992  1.00 12.85 ? 235 HIS C N   1 
ATOM   9871  C  CA  . HIS C 1 235 ? 20.369  -6.942  56.567  1.00 12.68 ? 235 HIS C CA  1 
ATOM   9872  C  C   . HIS C 1 235 ? 18.896  -6.878  56.188  1.00 12.73 ? 235 HIS C C   1 
ATOM   9873  O  O   . HIS C 1 235 ? 18.115  -7.763  56.554  1.00 12.45 ? 235 HIS C O   1 
ATOM   9874  C  CB  . HIS C 1 235 ? 21.019  -8.037  55.715  1.00 12.41 ? 235 HIS C CB  1 
ATOM   9875  C  CG  . HIS C 1 235 ? 22.372  -8.466  56.185  1.00 12.18 ? 235 HIS C CG  1 
ATOM   9876  N  ND1 . HIS C 1 235 ? 23.534  -8.074  55.557  1.00 12.18 ? 235 HIS C ND1 1 
ATOM   9877  C  CD2 . HIS C 1 235 ? 22.747  -9.308  57.175  1.00 12.05 ? 235 HIS C CD2 1 
ATOM   9878  C  CE1 . HIS C 1 235 ? 24.566  -8.658  56.137  1.00 12.07 ? 235 HIS C CE1 1 
ATOM   9879  N  NE2 . HIS C 1 235 ? 24.116  -9.413  57.123  1.00 11.89 ? 235 HIS C NE2 1 
ATOM   9880  N  N   . TYR C 1 236 ? 18.515  -5.830  55.463  1.00 12.78 ? 236 TYR C N   1 
ATOM   9881  C  CA  . TYR C 1 236 ? 17.138  -5.705  54.999  1.00 13.07 ? 236 TYR C CA  1 
ATOM   9882  C  C   . TYR C 1 236 ? 17.133  -5.413  53.508  1.00 13.07 ? 236 TYR C C   1 
ATOM   9883  O  O   . TYR C 1 236 ? 17.374  -4.289  53.079  1.00 13.45 ? 236 TYR C O   1 
ATOM   9884  C  CB  . TYR C 1 236 ? 16.367  -4.609  55.740  1.00 13.09 ? 236 TYR C CB  1 
ATOM   9885  C  CG  . TYR C 1 236 ? 17.193  -3.628  56.530  1.00 13.00 ? 236 TYR C CG  1 
ATOM   9886  C  CD1 . TYR C 1 236 ? 17.930  -4.040  57.637  1.00 13.00 ? 236 TYR C CD1 1 
ATOM   9887  C  CD2 . TYR C 1 236 ? 17.171  -2.269  56.220  1.00 12.88 ? 236 TYR C CD2 1 
ATOM   9888  C  CE1 . TYR C 1 236 ? 18.616  -3.126  58.421  1.00 12.90 ? 236 TYR C CE1 1 
ATOM   9889  C  CE2 . TYR C 1 236 ? 17.853  -1.346  56.995  1.00 12.78 ? 236 TYR C CE2 1 
ATOM   9890  C  CZ  . TYR C 1 236 ? 18.572  -1.780  58.099  1.00 12.83 ? 236 TYR C CZ  1 
ATOM   9891  O  OH  . TYR C 1 236 ? 19.235  -0.873  58.894  1.00 12.63 ? 236 TYR C OH  1 
ATOM   9892  N  N   . LYS C 1 237 ? 16.864  -6.445  52.719  1.00 13.16 ? 237 LYS C N   1 
ATOM   9893  C  CA  . LYS C 1 237 ? 16.836  -6.317  51.273  1.00 13.11 ? 237 LYS C CA  1 
ATOM   9894  C  C   . LYS C 1 237 ? 15.538  -5.670  50.802  1.00 12.94 ? 237 LYS C C   1 
ATOM   9895  O  O   . LYS C 1 237 ? 14.482  -5.860  51.407  1.00 12.63 ? 237 LYS C O   1 
ATOM   9896  C  CB  . LYS C 1 237 ? 17.002  -7.697  50.630  1.00 13.15 ? 237 LYS C CB  1 
ATOM   9897  C  CG  . LYS C 1 237 ? 17.664  -8.728  51.535  1.00 13.28 ? 237 LYS C CG  1 
ATOM   9898  C  CD  . LYS C 1 237 ? 19.183  -8.600  51.528  1.00 13.21 ? 237 LYS C CD  1 
ATOM   9899  C  CE  . LYS C 1 237 ? 19.801  -9.331  50.339  1.00 13.21 ? 237 LYS C CE  1 
ATOM   9900  N  NZ  . LYS C 1 237 ? 21.063  -10.056 50.682  1.00 12.66 ? 237 LYS C NZ  1 
ATOM   9901  N  N   . THR C 1 238 ? 15.628  -4.900  49.721  1.00 12.92 ? 238 THR C N   1 
ATOM   9902  C  CA  . THR C 1 238 ? 14.458  -4.232  49.167  1.00 12.95 ? 238 THR C CA  1 
ATOM   9903  C  C   . THR C 1 238 ? 13.637  -5.207  48.339  1.00 13.15 ? 238 THR C C   1 
ATOM   9904  O  O   . THR C 1 238 ? 14.171  -5.904  47.473  1.00 13.23 ? 238 THR C O   1 
ATOM   9905  C  CB  . THR C 1 238 ? 14.848  -3.059  48.265  1.00 12.77 ? 238 THR C CB  1 
ATOM   9906  O  OG1 . THR C 1 238 ? 13.824  -2.861  47.285  1.00 12.62 ? 238 THR C OG1 1 
ATOM   9907  C  CG2 . THR C 1 238 ? 16.163  -3.339  47.565  1.00 12.73 ? 238 THR C CG2 1 
ATOM   9908  N  N   . ASP C 1 239 ? 12.338  -5.253  48.610  1.00 13.24 ? 239 ASP C N   1 
ATOM   9909  C  CA  . ASP C 1 239 ? 11.443  -6.139  47.884  1.00 13.23 ? 239 ASP C CA  1 
ATOM   9910  C  C   . ASP C 1 239 ? 11.056  -5.506  46.554  1.00 13.23 ? 239 ASP C C   1 
ATOM   9911  O  O   . ASP C 1 239 ? 10.270  -6.073  45.788  1.00 13.34 ? 239 ASP C O   1 
ATOM   9912  C  CB  . ASP C 1 239 ? 10.193  -6.417  48.719  1.00 13.31 ? 239 ASP C CB  1 
ATOM   9913  C  CG  . ASP C 1 239 ? 10.508  -7.160  50.004  1.00 13.27 ? 239 ASP C CG  1 
ATOM   9914  O  OD1 . ASP C 1 239 ? 11.703  -7.445  50.241  1.00 13.61 ? 239 ASP C OD1 1 
ATOM   9915  O  OD2 . ASP C 1 239 ? 9.570   -7.461  50.773  1.00 12.71 ? 239 ASP C OD2 1 
ATOM   9916  N  N   . GLN C 1 240 ? 11.618  -4.328  46.291  1.00 13.06 ? 240 GLN C N   1 
ATOM   9917  C  CA  . GLN C 1 240 ? 11.354  -3.597  45.058  1.00 13.02 ? 240 GLN C CA  1 
ATOM   9918  C  C   . GLN C 1 240 ? 12.524  -3.767  44.096  1.00 13.09 ? 240 GLN C C   1 
ATOM   9919  O  O   . GLN C 1 240 ? 12.543  -3.181  43.017  1.00 12.86 ? 240 GLN C O   1 
ATOM   9920  C  CB  . GLN C 1 240 ? 11.156  -2.111  45.358  1.00 12.85 ? 240 GLN C CB  1 
ATOM   9921  C  CG  . GLN C 1 240 ? 9.834   -1.782  46.023  1.00 12.93 ? 240 GLN C CG  1 
ATOM   9922  C  CD  . GLN C 1 240 ? 9.852   -2.028  47.518  1.00 13.02 ? 240 GLN C CD  1 
ATOM   9923  O  OE1 . GLN C 1 240 ? 9.279   -3.005  48.005  1.00 13.17 ? 240 GLN C OE1 1 
ATOM   9924  N  NE2 . GLN C 1 240 ? 10.505  -1.138  48.257  1.00 13.11 ? 240 GLN C NE2 1 
ATOM   9925  N  N   . GLY C 1 241 ? 13.499  -4.573  44.501  1.00 13.17 ? 241 GLY C N   1 
ATOM   9926  C  CA  . GLY C 1 241 ? 14.663  -4.810  43.668  1.00 13.62 ? 241 GLY C CA  1 
ATOM   9927  C  C   . GLY C 1 241 ? 15.648  -3.660  43.711  1.00 14.01 ? 241 GLY C C   1 
ATOM   9928  O  O   . GLY C 1 241 ? 15.272  -2.523  44.012  1.00 14.06 ? 241 GLY C O   1 
ATOM   9929  N  N   . ILE C 1 242 ? 16.912  -3.952  43.412  1.00 13.95 ? 242 ILE C N   1 
ATOM   9930  C  CA  . ILE C 1 242 ? 17.956  -2.934  43.418  1.00 14.04 ? 242 ILE C CA  1 
ATOM   9931  C  C   . ILE C 1 242 ? 18.020  -2.232  42.069  1.00 13.99 ? 242 ILE C C   1 
ATOM   9932  O  O   . ILE C 1 242 ? 18.156  -2.881  41.031  1.00 14.08 ? 242 ILE C O   1 
ATOM   9933  C  CB  . ILE C 1 242 ? 19.353  -3.541  43.700  1.00 14.06 ? 242 ILE C CB  1 
ATOM   9934  C  CG1 . ILE C 1 242 ? 19.220  -4.993  44.161  1.00 14.18 ? 242 ILE C CG1 1 
ATOM   9935  C  CG2 . ILE C 1 242 ? 20.078  -2.710  44.740  1.00 13.80 ? 242 ILE C CG2 1 
ATOM   9936  C  CD1 . ILE C 1 242 ? 19.253  -6.007  43.018  1.00 14.29 ? 242 ILE C CD1 1 
ATOM   9937  N  N   . LYS C 1 243 ? 17.926  -0.906  42.092  1.00 13.86 ? 243 LYS C N   1 
ATOM   9938  C  CA  . LYS C 1 243 ? 17.986  -0.110  40.872  1.00 13.59 ? 243 LYS C CA  1 
ATOM   9939  C  C   . LYS C 1 243 ? 18.814  1.146   41.096  1.00 13.47 ? 243 LYS C C   1 
ATOM   9940  O  O   . LYS C 1 243 ? 18.587  1.881   42.059  1.00 13.51 ? 243 LYS C O   1 
ATOM   9941  C  CB  . LYS C 1 243 ? 16.583  0.286   40.436  1.00 13.69 ? 243 LYS C CB  1 
ATOM   9942  C  CG  . LYS C 1 243 ? 15.801  -0.831  39.769  1.00 13.91 ? 243 LYS C CG  1 
ATOM   9943  C  CD  . LYS C 1 243 ? 14.489  -0.303  39.205  1.00 14.61 ? 243 LYS C CD  1 
ATOM   9944  C  CE  . LYS C 1 243 ? 14.708  0.947   38.350  1.00 15.16 ? 243 LYS C CE  1 
ATOM   9945  N  NZ  . LYS C 1 243 ? 13.511  1.261   37.526  1.00 16.08 ? 243 LYS C NZ  1 
ATOM   9946  N  N   . ASN C 1 244 ? 19.771  1.389   40.206  1.00 13.48 ? 244 ASN C N   1 
ATOM   9947  C  CA  . ASN C 1 244 ? 20.631  2.563   40.314  1.00 13.57 ? 244 ASN C CA  1 
ATOM   9948  C  C   . ASN C 1 244 ? 20.528  3.461   39.084  1.00 13.43 ? 244 ASN C C   1 
ATOM   9949  O  O   . ASN C 1 244 ? 20.326  2.984   37.964  1.00 13.24 ? 244 ASN C O   1 
ATOM   9950  C  CB  . ASN C 1 244 ? 22.089  2.138   40.504  1.00 13.89 ? 244 ASN C CB  1 
ATOM   9951  C  CG  . ASN C 1 244 ? 22.251  1.039   41.544  1.00 14.29 ? 244 ASN C CG  1 
ATOM   9952  O  OD1 . ASN C 1 244 ? 21.616  1.071   42.610  1.00 14.67 ? 244 ASN C OD1 1 
ATOM   9953  N  ND2 . ASN C 1 244 ? 23.106  0.058   41.241  1.00 14.34 ? 244 ASN C ND2 1 
ATOM   9954  N  N   . LEU C 1 245 ? 20.665  4.765   39.299  1.00 13.33 ? 245 LEU C N   1 
ATOM   9955  C  CA  . LEU C 1 245 ? 20.604  5.722   38.206  1.00 13.24 ? 245 LEU C CA  1 
ATOM   9956  C  C   . LEU C 1 245 ? 21.992  5.854   37.597  1.00 13.40 ? 245 LEU C C   1 
ATOM   9957  O  O   . LEU C 1 245 ? 23.005  5.643   38.275  1.00 13.53 ? 245 LEU C O   1 
ATOM   9958  C  CB  . LEU C 1 245 ? 20.146  7.088   38.717  1.00 13.19 ? 245 LEU C CB  1 
ATOM   9959  C  CG  . LEU C 1 245 ? 18.765  7.153   39.365  1.00 13.08 ? 245 LEU C CG  1 
ATOM   9960  C  CD1 . LEU C 1 245 ? 18.809  8.092   40.561  1.00 13.15 ? 245 LEU C CD1 1 
ATOM   9961  C  CD2 . LEU C 1 245 ? 17.748  7.630   38.348  1.00 12.91 ? 245 LEU C CD2 1 
ATOM   9962  N  N   . SER C 1 246 ? 22.036  6.195   36.313  1.00 13.28 ? 246 SER C N   1 
ATOM   9963  C  CA  . SER C 1 246 ? 23.303  6.374   35.617  1.00 13.13 ? 246 SER C CA  1 
ATOM   9964  C  C   . SER C 1 246 ? 23.880  7.719   36.028  1.00 13.04 ? 246 SER C C   1 
ATOM   9965  O  O   . SER C 1 246 ? 23.169  8.570   36.564  1.00 12.76 ? 246 SER C O   1 
ATOM   9966  C  CB  . SER C 1 246 ? 23.088  6.363   34.107  1.00 13.03 ? 246 SER C CB  1 
ATOM   9967  O  OG  . SER C 1 246 ? 22.951  7.686   33.615  1.00 12.64 ? 246 SER C OG  1 
ATOM   9968  N  N   . VAL C 1 247 ? 25.168  7.908   35.774  1.00 13.15 ? 247 VAL C N   1 
ATOM   9969  C  CA  . VAL C 1 247 ? 25.827  9.160   36.122  1.00 13.60 ? 247 VAL C CA  1 
ATOM   9970  C  C   . VAL C 1 247 ? 25.157  10.324  35.395  1.00 13.92 ? 247 VAL C C   1 
ATOM   9971  O  O   . VAL C 1 247 ? 24.940  11.393  35.974  1.00 14.08 ? 247 VAL C O   1 
ATOM   9972  C  CB  . VAL C 1 247 ? 27.321  9.125   35.754  1.00 13.53 ? 247 VAL C CB  1 
ATOM   9973  C  CG1 . VAL C 1 247 ? 27.986  10.410  36.193  1.00 13.36 ? 247 VAL C CG1 1 
ATOM   9974  C  CG2 . VAL C 1 247 ? 27.990  7.926   36.417  1.00 13.57 ? 247 VAL C CG2 1 
ATOM   9975  N  N   . GLU C 1 248 ? 24.825  10.106  34.127  1.00 13.90 ? 248 GLU C N   1 
ATOM   9976  C  CA  . GLU C 1 248 ? 24.163  11.122  33.315  1.00 13.86 ? 248 GLU C CA  1 
ATOM   9977  C  C   . GLU C 1 248 ? 22.789  11.467  33.901  1.00 13.74 ? 248 GLU C C   1 
ATOM   9978  O  O   . GLU C 1 248 ? 22.438  12.639  34.046  1.00 13.75 ? 248 GLU C O   1 
ATOM   9979  C  CB  . GLU C 1 248 ? 23.990  10.611  31.878  1.00 14.00 ? 248 GLU C CB  1 
ATOM   9980  C  CG  . GLU C 1 248 ? 25.259  10.629  31.038  1.00 14.07 ? 248 GLU C CG  1 
ATOM   9981  C  CD  . GLU C 1 248 ? 25.983  9.291   31.033  1.00 14.14 ? 248 GLU C CD  1 
ATOM   9982  O  OE1 . GLU C 1 248 ? 25.380  8.280   31.462  1.00 14.28 ? 248 GLU C OE1 1 
ATOM   9983  O  OE2 . GLU C 1 248 ? 27.157  9.251   30.598  1.00 14.14 ? 248 GLU C OE2 1 
ATOM   9984  N  N   . ASP C 1 249 ? 22.021  10.430  34.228  1.00 13.73 ? 249 ASP C N   1 
ATOM   9985  C  CA  . ASP C 1 249 ? 20.680  10.586  34.788  1.00 13.59 ? 249 ASP C CA  1 
ATOM   9986  C  C   . ASP C 1 249 ? 20.683  11.306  36.126  1.00 13.41 ? 249 ASP C C   1 
ATOM   9987  O  O   . ASP C 1 249 ? 19.929  12.256  36.326  1.00 13.18 ? 249 ASP C O   1 
ATOM   9988  C  CB  . ASP C 1 249 ? 20.021  9.215   34.960  1.00 13.77 ? 249 ASP C CB  1 
ATOM   9989  C  CG  . ASP C 1 249 ? 19.549  8.628   33.645  1.00 14.01 ? 249 ASP C CG  1 
ATOM   9990  O  OD1 . ASP C 1 249 ? 19.245  9.422   32.725  1.00 14.23 ? 249 ASP C OD1 1 
ATOM   9991  O  OD2 . ASP C 1 249 ? 19.485  7.381   33.535  1.00 13.80 ? 249 ASP C OD2 1 
ATOM   9992  N  N   . ALA C 1 250 ? 21.530  10.842  37.041  1.00 13.45 ? 250 ALA C N   1 
ATOM   9993  C  CA  . ALA C 1 250 ? 21.630  11.439  38.367  1.00 13.30 ? 250 ALA C CA  1 
ATOM   9994  C  C   . ALA C 1 250 ? 22.038  12.890  38.234  1.00 13.20 ? 250 ALA C C   1 
ATOM   9995  O  O   . ALA C 1 250 ? 21.544  13.745  38.962  1.00 13.31 ? 250 ALA C O   1 
ATOM   9996  C  CB  . ALA C 1 250 ? 22.653  10.683  39.215  1.00 13.64 ? 250 ALA C CB  1 
ATOM   9997  N  N   . ALA C 1 251 ? 22.939  13.159  37.294  1.00 12.92 ? 251 ALA C N   1 
ATOM   9998  C  CA  . ALA C 1 251 ? 23.424  14.517  37.051  1.00 13.04 ? 251 ALA C CA  1 
ATOM   9999  C  C   . ALA C 1 251 ? 22.297  15.467  36.657  1.00 12.75 ? 251 ALA C C   1 
ATOM   10000 O  O   . ALA C 1 251 ? 22.250  16.611  37.108  1.00 12.49 ? 251 ALA C O   1 
ATOM   10001 C  CB  . ALA C 1 251 ? 24.486  14.501  35.960  1.00 12.90 ? 251 ALA C CB  1 
ATOM   10002 N  N   . ARG C 1 252 ? 21.396  14.985  35.808  1.00 12.59 ? 252 ARG C N   1 
ATOM   10003 C  CA  . ARG C 1 252 ? 20.267  15.781  35.345  1.00 12.68 ? 252 ARG C CA  1 
ATOM   10004 C  C   . ARG C 1 252 ? 19.227  15.950  36.444  1.00 12.68 ? 252 ARG C C   1 
ATOM   10005 O  O   . ARG C 1 252 ? 18.748  17.055  36.692  1.00 12.86 ? 252 ARG C O   1 
ATOM   10006 C  CB  . ARG C 1 252 ? 19.625  15.118  34.121  1.00 12.75 ? 252 ARG C CB  1 
ATOM   10007 C  CG  . ARG C 1 252 ? 18.129  15.370  33.978  1.00 12.59 ? 252 ARG C CG  1 
ATOM   10008 C  CD  . ARG C 1 252 ? 17.554  14.520  32.869  1.00 12.59 ? 252 ARG C CD  1 
ATOM   10009 N  NE  . ARG C 1 252 ? 16.811  13.367  33.378  1.00 12.73 ? 252 ARG C NE  1 
ATOM   10010 C  CZ  . ARG C 1 252 ? 17.292  12.126  33.431  1.00 12.80 ? 252 ARG C CZ  1 
ATOM   10011 N  NH1 . ARG C 1 252 ? 18.522  11.867  33.006  1.00 13.03 ? 252 ARG C NH1 1 
ATOM   10012 N  NH2 . ARG C 1 252 ? 16.539  11.136  33.895  1.00 12.74 ? 252 ARG C NH2 1 
ATOM   10013 N  N   . LEU C 1 253 ? 18.871  14.848  37.095  1.00 12.59 ? 253 LEU C N   1 
ATOM   10014 C  CA  . LEU C 1 253 ? 17.891  14.897  38.171  1.00 12.49 ? 253 LEU C CA  1 
ATOM   10015 C  C   . LEU C 1 253 ? 18.460  15.728  39.304  1.00 12.45 ? 253 LEU C C   1 
ATOM   10016 O  O   . LEU C 1 253 ? 17.717  16.361  40.053  1.00 12.57 ? 253 LEU C O   1 
ATOM   10017 C  CB  . LEU C 1 253 ? 17.577  13.490  38.678  1.00 12.31 ? 253 LEU C CB  1 
ATOM   10018 C  CG  . LEU C 1 253 ? 16.752  12.601  37.748  1.00 12.13 ? 253 LEU C CG  1 
ATOM   10019 C  CD1 . LEU C 1 253 ? 16.784  11.166  38.248  1.00 12.31 ? 253 LEU C CD1 1 
ATOM   10020 C  CD2 . LEU C 1 253 ? 15.328  13.108  37.686  1.00 12.18 ? 253 LEU C CD2 1 
ATOM   10021 N  N   . SER C 1 254 ? 19.787  15.718  39.415  1.00 12.41 ? 254 SER C N   1 
ATOM   10022 C  CA  . SER C 1 254 ? 20.498  16.463  40.450  1.00 12.46 ? 254 SER C CA  1 
ATOM   10023 C  C   . SER C 1 254 ? 20.110  17.937  40.430  1.00 12.86 ? 254 SER C C   1 
ATOM   10024 O  O   . SER C 1 254 ? 20.222  18.634  41.440  1.00 12.85 ? 254 SER C O   1 
ATOM   10025 C  CB  . SER C 1 254 ? 22.009  16.331  40.252  1.00 11.97 ? 254 SER C CB  1 
ATOM   10026 O  OG  . SER C 1 254 ? 22.700  17.382  40.897  1.00 11.38 ? 254 SER C OG  1 
ATOM   10027 N  N   . GLN C 1 255 ? 19.652  18.411  39.277  1.00 13.17 ? 255 GLN C N   1 
ATOM   10028 C  CA  . GLN C 1 255 ? 19.248  19.800  39.159  1.00 13.75 ? 255 GLN C CA  1 
ATOM   10029 C  C   . GLN C 1 255 ? 17.768  19.923  38.823  1.00 13.75 ? 255 GLN C C   1 
ATOM   10030 O  O   . GLN C 1 255 ? 17.109  20.876  39.241  1.00 13.83 ? 255 GLN C O   1 
ATOM   10031 C  CB  . GLN C 1 255 ? 20.089  20.504  38.094  1.00 14.30 ? 255 GLN C CB  1 
ATOM   10032 C  CG  . GLN C 1 255 ? 20.060  19.841  36.729  1.00 15.22 ? 255 GLN C CG  1 
ATOM   10033 C  CD  . GLN C 1 255 ? 19.159  20.580  35.749  1.00 15.77 ? 255 GLN C CD  1 
ATOM   10034 O  OE1 . GLN C 1 255 ? 17.949  20.338  35.694  1.00 16.21 ? 255 GLN C OE1 1 
ATOM   10035 N  NE2 . GLN C 1 255 ? 19.746  21.490  34.972  1.00 15.96 ? 255 GLN C NE2 1 
ATOM   10036 N  N   . GLU C 1 256 ? 17.246  18.957  38.073  1.00 13.39 ? 256 GLU C N   1 
ATOM   10037 C  CA  . GLU C 1 256 ? 15.839  18.977  37.686  1.00 13.15 ? 256 GLU C CA  1 
ATOM   10038 C  C   . GLU C 1 256 ? 14.944  18.858  38.912  1.00 12.89 ? 256 GLU C C   1 
ATOM   10039 O  O   . GLU C 1 256 ? 14.000  19.623  39.088  1.00 12.77 ? 256 GLU C O   1 
ATOM   10040 C  CB  . GLU C 1 256 ? 15.543  17.832  36.722  1.00 13.32 ? 256 GLU C CB  1 
ATOM   10041 C  CG  . GLU C 1 256 ? 15.787  18.176  35.264  1.00 13.32 ? 256 GLU C CG  1 
ATOM   10042 C  CD  . GLU C 1 256 ? 14.787  17.510  34.337  1.00 13.33 ? 256 GLU C CD  1 
ATOM   10043 O  OE1 . GLU C 1 256 ? 14.156  18.240  33.546  1.00 13.62 ? 256 GLU C OE1 1 
ATOM   10044 O  OE2 . GLU C 1 256 ? 14.632  16.267  34.399  1.00 12.85 ? 256 GLU C OE2 1 
ATOM   10045 N  N   . ASP C 1 257 ? 15.248  17.887  39.761  1.00 12.72 ? 257 ASP C N   1 
ATOM   10046 C  CA  . ASP C 1 257 ? 14.479  17.675  40.978  1.00 12.54 ? 257 ASP C CA  1 
ATOM   10047 C  C   . ASP C 1 257 ? 15.420  17.221  42.090  1.00 12.30 ? 257 ASP C C   1 
ATOM   10048 O  O   . ASP C 1 257 ? 15.634  16.027  42.287  1.00 12.28 ? 257 ASP C O   1 
ATOM   10049 C  CB  . ASP C 1 257 ? 13.391  16.625  40.742  1.00 12.48 ? 257 ASP C CB  1 
ATOM   10050 C  CG  . ASP C 1 257 ? 12.311  16.659  41.805  1.00 12.53 ? 257 ASP C CG  1 
ATOM   10051 O  OD1 . ASP C 1 257 ? 12.489  17.368  42.822  1.00 12.46 ? 257 ASP C OD1 1 
ATOM   10052 O  OD2 . ASP C 1 257 ? 11.284  15.975  41.619  1.00 12.42 ? 257 ASP C OD2 1 
ATOM   10053 N  N   . PRO C 1 258 ? 15.994  18.178  42.834  1.00 12.12 ? 258 PRO C N   1 
ATOM   10054 C  CA  . PRO C 1 258 ? 16.917  17.866  43.929  1.00 11.95 ? 258 PRO C CA  1 
ATOM   10055 C  C   . PRO C 1 258 ? 16.260  17.058  45.043  1.00 11.82 ? 258 PRO C C   1 
ATOM   10056 O  O   . PRO C 1 258 ? 16.944  16.395  45.824  1.00 11.83 ? 258 PRO C O   1 
ATOM   10057 C  CB  . PRO C 1 258 ? 17.385  19.240  44.411  1.00 11.99 ? 258 PRO C CB  1 
ATOM   10058 C  CG  . PRO C 1 258 ? 17.033  20.184  43.300  1.00 11.98 ? 258 PRO C CG  1 
ATOM   10059 C  CD  . PRO C 1 258 ? 15.794  19.629  42.692  1.00 12.05 ? 258 PRO C CD  1 
ATOM   10060 N  N   . ASP C 1 259 ? 14.933  17.121  45.108  1.00 11.75 ? 259 ASP C N   1 
ATOM   10061 C  CA  . ASP C 1 259 ? 14.173  16.392  46.118  1.00 11.58 ? 259 ASP C CA  1 
ATOM   10062 C  C   . ASP C 1 259 ? 13.569  15.139  45.509  1.00 11.45 ? 259 ASP C C   1 
ATOM   10063 O  O   . ASP C 1 259 ? 12.562  14.620  45.994  1.00 11.03 ? 259 ASP C O   1 
ATOM   10064 C  CB  . ASP C 1 259 ? 13.058  17.266  46.690  1.00 11.98 ? 259 ASP C CB  1 
ATOM   10065 C  CG  . ASP C 1 259 ? 13.566  18.581  47.238  1.00 12.40 ? 259 ASP C CG  1 
ATOM   10066 O  OD1 . ASP C 1 259 ? 14.716  18.629  47.725  1.00 12.26 ? 259 ASP C OD1 1 
ATOM   10067 O  OD2 . ASP C 1 259 ? 12.805  19.569  47.178  1.00 13.11 ? 259 ASP C OD2 1 
ATOM   10068 N  N   . TYR C 1 260 ? 14.192  14.664  44.437  1.00 11.41 ? 260 TYR C N   1 
ATOM   10069 C  CA  . TYR C 1 260 ? 13.744  13.464  43.750  1.00 11.87 ? 260 TYR C CA  1 
ATOM   10070 C  C   . TYR C 1 260 ? 13.395  12.380  44.772  1.00 12.08 ? 260 TYR C C   1 
ATOM   10071 O  O   . TYR C 1 260 ? 12.263  11.896  44.815  1.00 11.98 ? 260 TYR C O   1 
ATOM   10072 C  CB  . TYR C 1 260 ? 14.848  12.967  42.806  1.00 12.01 ? 260 TYR C CB  1 
ATOM   10073 C  CG  . TYR C 1 260 ? 14.532  11.664  42.110  1.00 12.22 ? 260 TYR C CG  1 
ATOM   10074 C  CD1 . TYR C 1 260 ? 15.176  10.485  42.476  1.00 12.46 ? 260 TYR C CD1 1 
ATOM   10075 C  CD2 . TYR C 1 260 ? 13.560  11.600  41.113  1.00 12.24 ? 260 TYR C CD2 1 
ATOM   10076 C  CE1 . TYR C 1 260 ? 14.855  9.265   41.870  1.00 12.61 ? 260 TYR C CE1 1 
ATOM   10077 C  CE2 . TYR C 1 260 ? 13.232  10.389  40.502  1.00 12.37 ? 260 TYR C CE2 1 
ATOM   10078 C  CZ  . TYR C 1 260 ? 13.881  9.228   40.888  1.00 12.52 ? 260 TYR C CZ  1 
ATOM   10079 O  OH  . TYR C 1 260 ? 13.542  8.026   40.314  1.00 12.78 ? 260 TYR C OH  1 
ATOM   10080 N  N   . GLY C 1 261 ? 14.367  12.021  45.604  1.00 12.20 ? 261 GLY C N   1 
ATOM   10081 C  CA  . GLY C 1 261 ? 14.147  10.999  46.615  1.00 12.56 ? 261 GLY C CA  1 
ATOM   10082 C  C   . GLY C 1 261 ? 12.945  11.220  47.519  1.00 12.58 ? 261 GLY C C   1 
ATOM   10083 O  O   . GLY C 1 261 ? 12.177  10.295  47.781  1.00 12.80 ? 261 GLY C O   1 
ATOM   10084 N  N   . ILE C 1 262 ? 12.786  12.443  48.010  1.00 12.64 ? 262 ILE C N   1 
ATOM   10085 C  CA  . ILE C 1 262 ? 11.665  12.776  48.883  1.00 12.44 ? 262 ILE C CA  1 
ATOM   10086 C  C   . ILE C 1 262 ? 10.355  12.535  48.142  1.00 12.33 ? 262 ILE C C   1 
ATOM   10087 O  O   . ILE C 1 262 ? 9.516   11.741  48.585  1.00 12.62 ? 262 ILE C O   1 
ATOM   10088 C  CB  . ILE C 1 262 ? 11.715  14.264  49.323  1.00 12.37 ? 262 ILE C CB  1 
ATOM   10089 C  CG1 . ILE C 1 262 ? 12.935  14.510  50.209  1.00 12.01 ? 262 ILE C CG1 1 
ATOM   10090 C  CG2 . ILE C 1 262 ? 10.443  14.638  50.071  1.00 12.42 ? 262 ILE C CG2 1 
ATOM   10091 C  CD1 . ILE C 1 262 ? 13.373  15.946  50.223  1.00 11.48 ? 262 ILE C CD1 1 
ATOM   10092 N  N   . ARG C 1 263 ? 10.197  13.224  47.012  1.00 11.82 ? 263 ARG C N   1 
ATOM   10093 C  CA  . ARG C 1 263 ? 9.002   13.112  46.177  1.00 11.31 ? 263 ARG C CA  1 
ATOM   10094 C  C   . ARG C 1 263 ? 8.667   11.670  45.798  1.00 11.07 ? 263 ARG C C   1 
ATOM   10095 O  O   . ARG C 1 263 ? 7.543   11.220  46.001  1.00 10.44 ? 263 ARG C O   1 
ATOM   10096 C  CB  . ARG C 1 263 ? 9.181   13.939  44.902  1.00 11.22 ? 263 ARG C CB  1 
ATOM   10097 C  CG  . ARG C 1 263 ? 7.980   13.919  43.963  1.00 11.03 ? 263 ARG C CG  1 
ATOM   10098 C  CD  . ARG C 1 263 ? 8.302   14.568  42.619  1.00 10.82 ? 263 ARG C CD  1 
ATOM   10099 N  NE  . ARG C 1 263 ? 8.982   15.855  42.751  1.00 10.37 ? 263 ARG C NE  1 
ATOM   10100 C  CZ  . ARG C 1 263 ? 8.367   17.017  42.962  1.00 10.14 ? 263 ARG C CZ  1 
ATOM   10101 N  NH1 . ARG C 1 263 ? 7.048   17.065  43.069  1.00 9.74  ? 263 ARG C NH1 1 
ATOM   10102 N  NH2 . ARG C 1 263 ? 9.073   18.136  43.060  1.00 10.04 ? 263 ARG C NH2 1 
ATOM   10103 N  N   . ASP C 1 264 ? 9.651   10.956  45.255  1.00 11.37 ? 264 ASP C N   1 
ATOM   10104 C  CA  . ASP C 1 264 ? 9.463   9.570   44.828  1.00 12.00 ? 264 ASP C CA  1 
ATOM   10105 C  C   . ASP C 1 264 ? 8.862   8.674   45.899  1.00 12.34 ? 264 ASP C C   1 
ATOM   10106 O  O   . ASP C 1 264 ? 7.934   7.902   45.630  1.00 12.44 ? 264 ASP C O   1 
ATOM   10107 C  CB  . ASP C 1 264 ? 10.786  8.959   44.369  1.00 12.18 ? 264 ASP C CB  1 
ATOM   10108 C  CG  . ASP C 1 264 ? 10.697  7.455   44.207  1.00 12.52 ? 264 ASP C CG  1 
ATOM   10109 O  OD1 . ASP C 1 264 ? 11.047  6.730   45.160  1.00 12.86 ? 264 ASP C OD1 1 
ATOM   10110 O  OD2 . ASP C 1 264 ? 10.270  6.995   43.129  1.00 12.69 ? 264 ASP C OD2 1 
ATOM   10111 N  N   . LEU C 1 265 ? 9.405   8.770   47.108  1.00 12.40 ? 265 LEU C N   1 
ATOM   10112 C  CA  . LEU C 1 265 ? 8.924   7.969   48.222  1.00 12.65 ? 265 LEU C CA  1 
ATOM   10113 C  C   . LEU C 1 265 ? 7.508   8.373   48.607  1.00 12.46 ? 265 LEU C C   1 
ATOM   10114 O  O   . LEU C 1 265 ? 6.620   7.532   48.702  1.00 12.33 ? 265 LEU C O   1 
ATOM   10115 C  CB  . LEU C 1 265 ? 9.852   8.135   49.430  1.00 13.05 ? 265 LEU C CB  1 
ATOM   10116 C  CG  . LEU C 1 265 ? 9.380   7.480   50.733  1.00 13.29 ? 265 LEU C CG  1 
ATOM   10117 C  CD1 . LEU C 1 265 ? 9.478   5.972   50.611  1.00 13.29 ? 265 LEU C CD1 1 
ATOM   10118 C  CD2 . LEU C 1 265 ? 10.220  7.975   51.893  1.00 13.62 ? 265 LEU C CD2 1 
ATOM   10119 N  N   . PHE C 1 266 ? 7.303   9.664   48.823  1.00 12.42 ? 266 PHE C N   1 
ATOM   10120 C  CA  . PHE C 1 266 ? 5.996   10.169  49.210  1.00 12.51 ? 266 PHE C CA  1 
ATOM   10121 C  C   . PHE C 1 266 ? 4.884   9.653   48.309  1.00 12.58 ? 266 PHE C C   1 
ATOM   10122 O  O   . PHE C 1 266 ? 3.888   9.099   48.780  1.00 12.45 ? 266 PHE C O   1 
ATOM   10123 C  CB  . PHE C 1 266 ? 6.000   11.697  49.185  1.00 12.68 ? 266 PHE C CB  1 
ATOM   10124 C  CG  . PHE C 1 266 ? 4.815   12.318  49.867  1.00 12.84 ? 266 PHE C CG  1 
ATOM   10125 C  CD1 . PHE C 1 266 ? 3.588   12.410  49.211  1.00 12.94 ? 266 PHE C CD1 1 
ATOM   10126 C  CD2 . PHE C 1 266 ? 4.927   12.826  51.162  1.00 12.96 ? 266 PHE C CD2 1 
ATOM   10127 C  CE1 . PHE C 1 266 ? 2.488   13.001  49.835  1.00 13.00 ? 266 PHE C CE1 1 
ATOM   10128 C  CE2 . PHE C 1 266 ? 3.833   13.420  51.798  1.00 13.03 ? 266 PHE C CE2 1 
ATOM   10129 C  CZ  . PHE C 1 266 ? 2.612   13.508  51.133  1.00 13.02 ? 266 PHE C CZ  1 
ATOM   10130 N  N   . ASN C 1 267 ? 5.055   9.843   47.006  1.00 12.85 ? 267 ASN C N   1 
ATOM   10131 C  CA  . ASN C 1 267 ? 4.053   9.411   46.041  1.00 13.17 ? 267 ASN C CA  1 
ATOM   10132 C  C   . ASN C 1 267 ? 3.789   7.913   46.107  1.00 13.52 ? 267 ASN C C   1 
ATOM   10133 O  O   . ASN C 1 267 ? 2.634   7.480   46.092  1.00 13.82 ? 267 ASN C O   1 
ATOM   10134 C  CB  . ASN C 1 267 ? 4.485   9.811   44.632  1.00 12.59 ? 267 ASN C CB  1 
ATOM   10135 C  CG  . ASN C 1 267 ? 4.410   11.299  44.417  1.00 12.19 ? 267 ASN C CG  1 
ATOM   10136 O  OD1 . ASN C 1 267 ? 3.436   11.940  44.804  1.00 11.86 ? 267 ASN C OD1 1 
ATOM   10137 N  ND2 . ASN C 1 267 ? 5.442   11.863  43.804  1.00 12.01 ? 267 ASN C ND2 1 
ATOM   10138 N  N   . ALA C 1 268 ? 4.855   7.124   46.178  1.00 13.57 ? 268 ALA C N   1 
ATOM   10139 C  CA  . ALA C 1 268 ? 4.701   5.679   46.253  1.00 13.78 ? 268 ALA C CA  1 
ATOM   10140 C  C   . ALA C 1 268 ? 3.682   5.366   47.341  1.00 13.84 ? 268 ALA C C   1 
ATOM   10141 O  O   . ALA C 1 268 ? 2.639   4.763   47.080  1.00 13.92 ? 268 ALA C O   1 
ATOM   10142 C  CB  . ALA C 1 268 ? 6.039   5.020   46.577  1.00 13.60 ? 268 ALA C CB  1 
ATOM   10143 N  N   . ILE C 1 269 ? 3.980   5.806   48.557  1.00 13.57 ? 269 ILE C N   1 
ATOM   10144 C  CA  . ILE C 1 269 ? 3.101   5.571   49.692  1.00 13.40 ? 269 ILE C CA  1 
ATOM   10145 C  C   . ILE C 1 269 ? 1.702   6.126   49.441  1.00 13.38 ? 269 ILE C C   1 
ATOM   10146 O  O   . ILE C 1 269 ? 0.700   5.462   49.710  1.00 13.24 ? 269 ILE C O   1 
ATOM   10147 C  CB  . ILE C 1 269 ? 3.686   6.205   50.985  1.00 13.23 ? 269 ILE C CB  1 
ATOM   10148 C  CG1 . ILE C 1 269 ? 4.932   5.423   51.424  1.00 13.17 ? 269 ILE C CG1 1 
ATOM   10149 C  CG2 . ILE C 1 269 ? 2.643   6.207   52.094  1.00 12.95 ? 269 ILE C CG2 1 
ATOM   10150 C  CD1 . ILE C 1 269 ? 5.664   6.017   52.617  1.00 13.21 ? 269 ILE C CD1 1 
ATOM   10151 N  N   . ALA C 1 270 ? 1.640   7.341   48.910  1.00 13.56 ? 270 ALA C N   1 
ATOM   10152 C  CA  . ALA C 1 270 ? 0.361   7.996   48.640  1.00 13.67 ? 270 ALA C CA  1 
ATOM   10153 C  C   . ALA C 1 270 ? -0.523  7.230   47.656  1.00 13.40 ? 270 ALA C C   1 
ATOM   10154 O  O   . ALA C 1 270 ? -1.743  7.413   47.631  1.00 13.58 ? 270 ALA C O   1 
ATOM   10155 C  CB  . ALA C 1 270 ? 0.607   9.411   48.125  1.00 14.01 ? 270 ALA C CB  1 
ATOM   10156 N  N   . THR C 1 271 ? 0.096   6.371   46.853  1.00 13.17 ? 271 THR C N   1 
ATOM   10157 C  CA  . THR C 1 271 ? -0.630  5.588   45.860  1.00 12.54 ? 271 THR C CA  1 
ATOM   10158 C  C   . THR C 1 271 ? -0.682  4.101   46.201  1.00 12.60 ? 271 THR C C   1 
ATOM   10159 O  O   . THR C 1 271 ? -0.687  3.258   45.300  1.00 12.70 ? 271 THR C O   1 
ATOM   10160 C  CB  . THR C 1 271 ? 0.016   5.736   44.479  1.00 12.14 ? 271 THR C CB  1 
ATOM   10161 O  OG1 . THR C 1 271 ? 1.404   5.391   44.569  1.00 11.57 ? 271 THR C OG1 1 
ATOM   10162 C  CG2 . THR C 1 271 ? -0.124  7.164   43.978  1.00 11.77 ? 271 THR C CG2 1 
ATOM   10163 N  N   . GLY C 1 272 ? -0.708  3.782   47.494  1.00 12.12 ? 272 GLY C N   1 
ATOM   10164 C  CA  . GLY C 1 272 ? -0.766  2.393   47.918  1.00 11.66 ? 272 GLY C CA  1 
ATOM   10165 C  C   . GLY C 1 272 ? 0.309   1.498   47.327  1.00 11.44 ? 272 GLY C C   1 
ATOM   10166 O  O   . GLY C 1 272 ? 0.062   0.327   47.053  1.00 11.13 ? 272 GLY C O   1 
ATOM   10167 N  N   . LYS C 1 273 ? 1.498   2.052   47.116  1.00 11.43 ? 273 LYS C N   1 
ATOM   10168 C  CA  . LYS C 1 273 ? 2.623   1.299   46.571  1.00 11.37 ? 273 LYS C CA  1 
ATOM   10169 C  C   . LYS C 1 273 ? 3.640   1.143   47.689  1.00 11.44 ? 273 LYS C C   1 
ATOM   10170 O  O   . LYS C 1 273 ? 4.839   1.316   47.491  1.00 11.62 ? 273 LYS C O   1 
ATOM   10171 C  CB  . LYS C 1 273 ? 3.255   2.047   45.395  1.00 11.63 ? 273 LYS C CB  1 
ATOM   10172 C  CG  . LYS C 1 273 ? 3.637   1.159   44.213  1.00 11.99 ? 273 LYS C CG  1 
ATOM   10173 C  CD  . LYS C 1 273 ? 2.435   0.870   43.311  1.00 12.23 ? 273 LYS C CD  1 
ATOM   10174 C  CE  . LYS C 1 273 ? 1.833   2.149   42.729  1.00 12.38 ? 273 LYS C CE  1 
ATOM   10175 N  NZ  . LYS C 1 273 ? 2.871   3.087   42.202  1.00 11.89 ? 273 LYS C NZ  1 
ATOM   10176 N  N   . TYR C 1 274 ? 3.131   0.825   48.871  1.00 11.50 ? 274 TYR C N   1 
ATOM   10177 C  CA  . TYR C 1 274 ? 3.937   0.638   50.071  1.00 11.59 ? 274 TYR C CA  1 
ATOM   10178 C  C   . TYR C 1 274 ? 5.176   -0.216  49.862  1.00 11.48 ? 274 TYR C C   1 
ATOM   10179 O  O   . TYR C 1 274 ? 5.083   -1.411  49.600  1.00 11.35 ? 274 TYR C O   1 
ATOM   10180 C  CB  . TYR C 1 274 ? 3.056   0.040   51.170  1.00 11.83 ? 274 TYR C CB  1 
ATOM   10181 C  CG  . TYR C 1 274 ? 1.751   0.790   51.315  1.00 12.33 ? 274 TYR C CG  1 
ATOM   10182 C  CD1 . TYR C 1 274 ? 1.741   2.186   51.407  1.00 12.49 ? 274 TYR C CD1 1 
ATOM   10183 C  CD2 . TYR C 1 274 ? 0.527   0.120   51.311  1.00 12.64 ? 274 TYR C CD2 1 
ATOM   10184 C  CE1 . TYR C 1 274 ? 0.550   2.900   51.487  1.00 12.99 ? 274 TYR C CE1 1 
ATOM   10185 C  CE2 . TYR C 1 274 ? -0.682  0.828   51.391  1.00 13.17 ? 274 TYR C CE2 1 
ATOM   10186 C  CZ  . TYR C 1 274 ? -0.659  2.220   51.477  1.00 13.25 ? 274 TYR C CZ  1 
ATOM   10187 O  OH  . TYR C 1 274 ? -1.834  2.939   51.541  1.00 13.70 ? 274 TYR C OH  1 
ATOM   10188 N  N   . PRO C 1 275 ? 6.363   0.393   49.999  1.00 11.53 ? 275 PRO C N   1 
ATOM   10189 C  CA  . PRO C 1 275 ? 7.632   -0.318  49.820  1.00 11.59 ? 275 PRO C CA  1 
ATOM   10190 C  C   . PRO C 1 275 ? 7.829   -1.420  50.850  1.00 11.63 ? 275 PRO C C   1 
ATOM   10191 O  O   . PRO C 1 275 ? 7.345   -1.327  51.975  1.00 11.80 ? 275 PRO C O   1 
ATOM   10192 C  CB  . PRO C 1 275 ? 8.692   0.778   49.942  1.00 11.68 ? 275 PRO C CB  1 
ATOM   10193 C  CG  . PRO C 1 275 ? 7.955   2.066   49.871  1.00 11.65 ? 275 PRO C CG  1 
ATOM   10194 C  CD  . PRO C 1 275 ? 6.574   1.803   50.359  1.00 11.60 ? 275 PRO C CD  1 
ATOM   10195 N  N   . SER C 1 276 ? 8.549   -2.463  50.457  1.00 11.65 ? 276 SER C N   1 
ATOM   10196 C  CA  . SER C 1 276 ? 8.810   -3.578  51.351  1.00 11.32 ? 276 SER C CA  1 
ATOM   10197 C  C   . SER C 1 276 ? 10.267  -4.016  51.366  1.00 11.18 ? 276 SER C C   1 
ATOM   10198 O  O   . SER C 1 276 ? 10.941  -4.021  50.337  1.00 10.93 ? 276 SER C O   1 
ATOM   10199 C  CB  . SER C 1 276 ? 7.933   -4.765  50.978  1.00 11.39 ? 276 SER C CB  1 
ATOM   10200 O  OG  . SER C 1 276 ? 7.451   -5.396  52.149  1.00 11.53 ? 276 SER C OG  1 
ATOM   10201 N  N   . TRP C 1 277 ? 10.732  -4.383  52.557  1.00 11.26 ? 277 TRP C N   1 
ATOM   10202 C  CA  . TRP C 1 277 ? 12.094  -4.843  52.778  1.00 11.27 ? 277 TRP C CA  1 
ATOM   10203 C  C   . TRP C 1 277 ? 12.030  -6.106  53.630  1.00 11.48 ? 277 TRP C C   1 
ATOM   10204 O  O   . TRP C 1 277 ? 11.252  -6.166  54.579  1.00 11.80 ? 277 TRP C O   1 
ATOM   10205 C  CB  . TRP C 1 277 ? 12.884  -3.783  53.536  1.00 10.98 ? 277 TRP C CB  1 
ATOM   10206 C  CG  . TRP C 1 277 ? 13.499  -2.732  52.681  1.00 10.59 ? 277 TRP C CG  1 
ATOM   10207 C  CD1 . TRP C 1 277 ? 14.779  -2.704  52.213  1.00 10.49 ? 277 TRP C CD1 1 
ATOM   10208 C  CD2 . TRP C 1 277 ? 12.879  -1.527  52.227  1.00 10.45 ? 277 TRP C CD2 1 
ATOM   10209 N  NE1 . TRP C 1 277 ? 14.997  -1.555  51.496  1.00 10.33 ? 277 TRP C NE1 1 
ATOM   10210 C  CE2 . TRP C 1 277 ? 13.847  -0.813  51.488  1.00 10.34 ? 277 TRP C CE2 1 
ATOM   10211 C  CE3 . TRP C 1 277 ? 11.599  -0.978  52.373  1.00 10.40 ? 277 TRP C CE3 1 
ATOM   10212 C  CZ2 . TRP C 1 277 ? 13.576  0.421   50.896  1.00 10.28 ? 277 TRP C CZ2 1 
ATOM   10213 C  CZ3 . TRP C 1 277 ? 11.330  0.249   51.785  1.00 10.34 ? 277 TRP C CZ3 1 
ATOM   10214 C  CH2 . TRP C 1 277 ? 12.316  0.934   51.055  1.00 10.42 ? 277 TRP C CH2 1 
ATOM   10215 N  N   . THR C 1 278 ? 12.834  -7.114  53.299  1.00 11.45 ? 278 THR C N   1 
ATOM   10216 C  CA  . THR C 1 278 ? 12.843  -8.347  54.079  1.00 11.36 ? 278 THR C CA  1 
ATOM   10217 C  C   . THR C 1 278 ? 14.012  -8.293  55.051  1.00 11.41 ? 278 THR C C   1 
ATOM   10218 O  O   . THR C 1 278 ? 15.103  -7.853  54.693  1.00 11.03 ? 278 THR C O   1 
ATOM   10219 C  CB  . THR C 1 278 ? 12.976  -9.589  53.185  1.00 11.41 ? 278 THR C CB  1 
ATOM   10220 O  OG1 . THR C 1 278 ? 11.945  -9.573  52.191  1.00 11.52 ? 278 THR C OG1 1 
ATOM   10221 C  CG2 . THR C 1 278 ? 12.838  -10.858 54.016  1.00 11.49 ? 278 THR C CG2 1 
ATOM   10222 N  N   . PHE C 1 279 ? 13.778  -8.749  56.278  1.00 11.63 ? 279 PHE C N   1 
ATOM   10223 C  CA  . PHE C 1 279 ? 14.794  -8.719  57.329  1.00 12.23 ? 279 PHE C CA  1 
ATOM   10224 C  C   . PHE C 1 279 ? 15.540  -10.035 57.532  1.00 12.32 ? 279 PHE C C   1 
ATOM   10225 O  O   . PHE C 1 279 ? 14.922  -11.076 57.754  1.00 12.43 ? 279 PHE C O   1 
ATOM   10226 C  CB  . PHE C 1 279 ? 14.131  -8.314  58.644  1.00 12.67 ? 279 PHE C CB  1 
ATOM   10227 C  CG  . PHE C 1 279 ? 15.036  -7.581  59.589  1.00 13.24 ? 279 PHE C CG  1 
ATOM   10228 C  CD1 . PHE C 1 279 ? 15.680  -8.258  60.619  1.00 13.56 ? 279 PHE C CD1 1 
ATOM   10229 C  CD2 . PHE C 1 279 ? 15.203  -6.207  59.483  1.00 13.59 ? 279 PHE C CD2 1 
ATOM   10230 C  CE1 . PHE C 1 279 ? 16.476  -7.576  61.535  1.00 13.84 ? 279 PHE C CE1 1 
ATOM   10231 C  CE2 . PHE C 1 279 ? 15.995  -5.514  60.392  1.00 13.86 ? 279 PHE C CE2 1 
ATOM   10232 C  CZ  . PHE C 1 279 ? 16.633  -6.200  61.421  1.00 13.94 ? 279 PHE C CZ  1 
ATOM   10233 N  N   . TYR C 1 280 ? 16.869  -9.976  57.471  1.00 12.36 ? 280 TYR C N   1 
ATOM   10234 C  CA  . TYR C 1 280 ? 17.703  -11.158 57.668  1.00 12.63 ? 280 TYR C CA  1 
ATOM   10235 C  C   . TYR C 1 280 ? 18.819  -10.884 58.668  1.00 12.85 ? 280 TYR C C   1 
ATOM   10236 O  O   . TYR C 1 280 ? 19.173  -9.728  58.920  1.00 12.70 ? 280 TYR C O   1 
ATOM   10237 C  CB  . TYR C 1 280 ? 18.340  -11.600 56.352  1.00 12.85 ? 280 TYR C CB  1 
ATOM   10238 C  CG  . TYR C 1 280 ? 17.363  -11.825 55.231  1.00 13.06 ? 280 TYR C CG  1 
ATOM   10239 C  CD1 . TYR C 1 280 ? 16.928  -10.765 54.439  1.00 13.16 ? 280 TYR C CD1 1 
ATOM   10240 C  CD2 . TYR C 1 280 ? 16.894  -13.106 54.939  1.00 13.17 ? 280 TYR C CD2 1 
ATOM   10241 C  CE1 . TYR C 1 280 ? 16.056  -10.973 53.385  1.00 13.33 ? 280 TYR C CE1 1 
ATOM   10242 C  CE2 . TYR C 1 280 ? 16.019  -13.326 53.884  1.00 13.34 ? 280 TYR C CE2 1 
ATOM   10243 C  CZ  . TYR C 1 280 ? 15.605  -12.253 53.110  1.00 13.42 ? 280 TYR C CZ  1 
ATOM   10244 O  OH  . TYR C 1 280 ? 14.746  -12.451 52.052  1.00 13.60 ? 280 TYR C OH  1 
ATOM   10245 N  N   . ILE C 1 281 ? 19.379  -11.949 59.234  1.00 12.82 ? 281 ILE C N   1 
ATOM   10246 C  CA  . ILE C 1 281 ? 20.476  -11.802 60.183  1.00 13.14 ? 281 ILE C CA  1 
ATOM   10247 C  C   . ILE C 1 281 ? 21.569  -12.824 59.903  1.00 13.27 ? 281 ILE C C   1 
ATOM   10248 O  O   . ILE C 1 281 ? 21.290  -13.955 59.500  1.00 13.36 ? 281 ILE C O   1 
ATOM   10249 C  CB  . ILE C 1 281 ? 20.014  -11.994 61.644  1.00 13.25 ? 281 ILE C CB  1 
ATOM   10250 C  CG1 . ILE C 1 281 ? 19.029  -13.158 61.729  1.00 13.40 ? 281 ILE C CG1 1 
ATOM   10251 C  CG2 . ILE C 1 281 ? 19.404  -10.713 62.173  1.00 13.09 ? 281 ILE C CG2 1 
ATOM   10252 C  CD1 . ILE C 1 281 ? 19.231  -14.023 62.954  1.00 13.71 ? 281 ILE C CD1 1 
ATOM   10253 N  N   . GLN C 1 282 ? 22.816  -12.414 60.107  1.00 13.09 ? 282 GLN C N   1 
ATOM   10254 C  CA  . GLN C 1 282 ? 23.958  -13.296 59.903  1.00 13.32 ? 282 GLN C CA  1 
ATOM   10255 C  C   . GLN C 1 282 ? 24.509  -13.634 61.281  1.00 13.12 ? 282 GLN C C   1 
ATOM   10256 O  O   . GLN C 1 282 ? 24.983  -12.756 62.000  1.00 13.19 ? 282 GLN C O   1 
ATOM   10257 C  CB  . GLN C 1 282 ? 25.036  -12.599 59.070  1.00 13.30 ? 282 GLN C CB  1 
ATOM   10258 C  CG  . GLN C 1 282 ? 25.378  -13.319 57.783  1.00 13.68 ? 282 GLN C CG  1 
ATOM   10259 C  CD  . GLN C 1 282 ? 26.115  -12.431 56.803  1.00 14.03 ? 282 GLN C CD  1 
ATOM   10260 O  OE1 . GLN C 1 282 ? 26.728  -11.434 57.192  1.00 14.60 ? 282 GLN C OE1 1 
ATOM   10261 N  NE2 . GLN C 1 282 ? 26.060  -12.786 55.523  1.00 14.15 ? 282 GLN C NE2 1 
ATOM   10262 N  N   . VAL C 1 283 ? 24.449  -14.907 61.647  1.00 13.00 ? 283 VAL C N   1 
ATOM   10263 C  CA  . VAL C 1 283 ? 24.917  -15.335 62.954  1.00 12.76 ? 283 VAL C CA  1 
ATOM   10264 C  C   . VAL C 1 283 ? 26.326  -15.917 62.958  1.00 12.79 ? 283 VAL C C   1 
ATOM   10265 O  O   . VAL C 1 283 ? 26.737  -16.605 62.026  1.00 12.85 ? 283 VAL C O   1 
ATOM   10266 C  CB  . VAL C 1 283 ? 23.952  -16.375 63.557  1.00 12.66 ? 283 VAL C CB  1 
ATOM   10267 C  CG1 . VAL C 1 283 ? 24.369  -16.710 64.973  1.00 12.87 ? 283 VAL C CG1 1 
ATOM   10268 C  CG2 . VAL C 1 283 ? 22.529  -15.837 63.532  1.00 12.23 ? 283 VAL C CG2 1 
ATOM   10269 N  N   . MET C 1 284 ? 27.067  -15.614 64.018  1.00 13.02 ? 284 MET C N   1 
ATOM   10270 C  CA  . MET C 1 284 ? 28.422  -16.117 64.201  1.00 13.28 ? 284 MET C CA  1 
ATOM   10271 C  C   . MET C 1 284 ? 28.601  -16.423 65.680  1.00 13.43 ? 284 MET C C   1 
ATOM   10272 O  O   . MET C 1 284 ? 28.494  -15.530 66.527  1.00 13.51 ? 284 MET C O   1 
ATOM   10273 C  CB  . MET C 1 284 ? 29.465  -15.087 63.773  1.00 13.50 ? 284 MET C CB  1 
ATOM   10274 C  CG  . MET C 1 284 ? 30.898  -15.545 64.038  1.00 13.98 ? 284 MET C CG  1 
ATOM   10275 S  SD  . MET C 1 284 ? 32.169  -14.269 63.833  1.00 14.81 ? 284 MET C SD  1 
ATOM   10276 C  CE  . MET C 1 284 ? 32.393  -14.327 62.062  1.00 14.63 ? 284 MET C CE  1 
ATOM   10277 N  N   . THR C 1 285 ? 28.856  -17.689 65.991  1.00 13.22 ? 285 THR C N   1 
ATOM   10278 C  CA  . THR C 1 285 ? 29.046  -18.094 67.374  1.00 13.10 ? 285 THR C CA  1 
ATOM   10279 C  C   . THR C 1 285 ? 30.376  -17.551 67.863  1.00 12.99 ? 285 THR C C   1 
ATOM   10280 O  O   . THR C 1 285 ? 31.185  -17.066 67.074  1.00 13.12 ? 285 THR C O   1 
ATOM   10281 C  CB  . THR C 1 285 ? 29.065  -19.627 67.518  1.00 13.07 ? 285 THR C CB  1 
ATOM   10282 O  OG1 . THR C 1 285 ? 30.356  -20.127 67.145  1.00 12.90 ? 285 THR C OG1 1 
ATOM   10283 C  CG2 . THR C 1 285 ? 28.001  -20.257 66.637  1.00 12.84 ? 285 THR C CG2 1 
ATOM   10284 N  N   . PHE C 1 286 ? 30.599  -17.640 69.167  1.00 13.06 ? 286 PHE C N   1 
ATOM   10285 C  CA  . PHE C 1 286 ? 31.836  -17.164 69.761  1.00 12.87 ? 286 PHE C CA  1 
ATOM   10286 C  C   . PHE C 1 286 ? 33.029  -17.926 69.204  1.00 12.84 ? 286 PHE C C   1 
ATOM   10287 O  O   . PHE C 1 286 ? 34.097  -17.356 69.006  1.00 12.57 ? 286 PHE C O   1 
ATOM   10288 C  CB  . PHE C 1 286 ? 31.770  -17.316 71.284  1.00 12.74 ? 286 PHE C CB  1 
ATOM   10289 C  CG  . PHE C 1 286 ? 30.980  -16.230 71.967  1.00 12.70 ? 286 PHE C CG  1 
ATOM   10290 C  CD1 . PHE C 1 286 ? 30.429  -15.178 71.234  1.00 12.63 ? 286 PHE C CD1 1 
ATOM   10291 C  CD2 . PHE C 1 286 ? 30.800  -16.248 73.342  1.00 12.77 ? 286 PHE C CD2 1 
ATOM   10292 C  CE1 . PHE C 1 286 ? 29.716  -14.161 71.859  1.00 12.47 ? 286 PHE C CE1 1 
ATOM   10293 C  CE2 . PHE C 1 286 ? 30.085  -15.233 73.978  1.00 12.75 ? 286 PHE C CE2 1 
ATOM   10294 C  CZ  . PHE C 1 286 ? 29.544  -14.188 73.233  1.00 12.62 ? 286 PHE C CZ  1 
ATOM   10295 N  N   . ASN C 1 287 ? 32.839  -19.214 68.939  1.00 13.18 ? 287 ASN C N   1 
ATOM   10296 C  CA  . ASN C 1 287 ? 33.915  -20.043 68.402  1.00 13.84 ? 287 ASN C CA  1 
ATOM   10297 C  C   . ASN C 1 287 ? 34.385  -19.543 67.043  1.00 13.81 ? 287 ASN C C   1 
ATOM   10298 O  O   . ASN C 1 287 ? 35.553  -19.192 66.868  1.00 13.85 ? 287 ASN C O   1 
ATOM   10299 C  CB  . ASN C 1 287 ? 33.457  -21.497 68.273  1.00 14.51 ? 287 ASN C CB  1 
ATOM   10300 C  CG  . ASN C 1 287 ? 32.884  -22.044 69.567  1.00 15.16 ? 287 ASN C CG  1 
ATOM   10301 O  OD1 . ASN C 1 287 ? 33.584  -22.710 70.337  1.00 15.89 ? 287 ASN C OD1 1 
ATOM   10302 N  ND2 . ASN C 1 287 ? 31.603  -21.764 69.816  1.00 15.17 ? 287 ASN C ND2 1 
ATOM   10303 N  N   . GLN C 1 288 ? 33.475  -19.515 66.079  1.00 13.60 ? 288 GLN C N   1 
ATOM   10304 C  CA  . GLN C 1 288 ? 33.823  -19.054 64.745  1.00 13.43 ? 288 GLN C CA  1 
ATOM   10305 C  C   . GLN C 1 288 ? 34.359  -17.631 64.814  1.00 13.34 ? 288 GLN C C   1 
ATOM   10306 O  O   . GLN C 1 288 ? 35.094  -17.194 63.928  1.00 13.41 ? 288 GLN C O   1 
ATOM   10307 C  CB  . GLN C 1 288 ? 32.602  -19.106 63.822  1.00 13.38 ? 288 GLN C CB  1 
ATOM   10308 C  CG  . GLN C 1 288 ? 31.271  -18.901 64.524  1.00 13.41 ? 288 GLN C CG  1 
ATOM   10309 C  CD  . GLN C 1 288 ? 30.132  -19.619 63.826  1.00 13.48 ? 288 GLN C CD  1 
ATOM   10310 O  OE1 . GLN C 1 288 ? 29.011  -19.106 63.743  1.00 12.80 ? 288 GLN C OE1 1 
ATOM   10311 N  NE2 . GLN C 1 288 ? 30.413  -20.819 63.320  1.00 14.19 ? 288 GLN C NE2 1 
ATOM   10312 N  N   . ALA C 1 289 ? 33.995  -16.911 65.869  1.00 13.11 ? 289 ALA C N   1 
ATOM   10313 C  CA  . ALA C 1 289 ? 34.451  -15.540 66.037  1.00 13.13 ? 289 ALA C CA  1 
ATOM   10314 C  C   . ALA C 1 289 ? 35.973  -15.493 66.051  1.00 13.18 ? 289 ALA C C   1 
ATOM   10315 O  O   . ALA C 1 289 ? 36.576  -14.557 65.525  1.00 13.06 ? 289 ALA C O   1 
ATOM   10316 C  CB  . ALA C 1 289 ? 33.899  -14.957 67.323  1.00 12.88 ? 289 ALA C CB  1 
ATOM   10317 N  N   . GLU C 1 290 ? 36.591  -16.513 66.642  1.00 13.44 ? 290 GLU C N   1 
ATOM   10318 C  CA  . GLU C 1 290 ? 38.048  -16.588 66.723  1.00 13.68 ? 290 GLU C CA  1 
ATOM   10319 C  C   . GLU C 1 290 ? 38.660  -17.100 65.427  1.00 13.75 ? 290 GLU C C   1 
ATOM   10320 O  O   . GLU C 1 290 ? 39.546  -16.462 64.863  1.00 14.04 ? 290 GLU C O   1 
ATOM   10321 C  CB  . GLU C 1 290 ? 38.473  -17.503 67.866  1.00 14.04 ? 290 GLU C CB  1 
ATOM   10322 C  CG  . GLU C 1 290 ? 38.588  -16.802 69.209  1.00 14.79 ? 290 GLU C CG  1 
ATOM   10323 C  CD  . GLU C 1 290 ? 37.614  -17.361 70.234  1.00 15.30 ? 290 GLU C CD  1 
ATOM   10324 O  OE1 . GLU C 1 290 ? 36.955  -16.562 70.940  1.00 16.00 ? 290 GLU C OE1 1 
ATOM   10325 O  OE2 . GLU C 1 290 ? 37.506  -18.602 70.328  1.00 15.47 ? 290 GLU C OE2 1 
ATOM   10326 N  N   . THR C 1 291 ? 38.186  -18.249 64.956  1.00 13.82 ? 291 THR C N   1 
ATOM   10327 C  CA  . THR C 1 291 ? 38.701  -18.844 63.724  1.00 13.56 ? 291 THR C CA  1 
ATOM   10328 C  C   . THR C 1 291 ? 38.612  -17.876 62.552  1.00 13.68 ? 291 THR C C   1 
ATOM   10329 O  O   . THR C 1 291 ? 39.317  -18.036 61.551  1.00 13.93 ? 291 THR C O   1 
ATOM   10330 C  CB  . THR C 1 291 ? 37.934  -20.139 63.338  1.00 13.35 ? 291 THR C CB  1 
ATOM   10331 O  OG1 . THR C 1 291 ? 36.783  -19.803 62.550  1.00 12.94 ? 291 THR C OG1 1 
ATOM   10332 C  CG2 . THR C 1 291 ? 37.495  -20.897 64.585  1.00 12.99 ? 291 THR C CG2 1 
ATOM   10333 N  N   . PHE C 1 292 ? 37.744  -16.874 62.672  1.00 13.69 ? 292 PHE C N   1 
ATOM   10334 C  CA  . PHE C 1 292 ? 37.577  -15.887 61.608  1.00 13.63 ? 292 PHE C CA  1 
ATOM   10335 C  C   . PHE C 1 292 ? 38.928  -15.332 61.175  1.00 13.55 ? 292 PHE C C   1 
ATOM   10336 O  O   . PHE C 1 292 ? 39.680  -14.796 61.991  1.00 13.50 ? 292 PHE C O   1 
ATOM   10337 C  CB  . PHE C 1 292 ? 36.680  -14.739 62.078  1.00 13.46 ? 292 PHE C CB  1 
ATOM   10338 C  CG  . PHE C 1 292 ? 36.103  -13.921 60.955  1.00 13.33 ? 292 PHE C CG  1 
ATOM   10339 C  CD1 . PHE C 1 292 ? 35.232  -14.495 60.032  1.00 13.24 ? 292 PHE C CD1 1 
ATOM   10340 C  CD2 . PHE C 1 292 ? 36.427  -12.573 60.820  1.00 13.27 ? 292 PHE C CD2 1 
ATOM   10341 C  CE1 . PHE C 1 292 ? 34.688  -13.736 58.982  1.00 13.25 ? 292 PHE C CE1 1 
ATOM   10342 C  CE2 . PHE C 1 292 ? 35.893  -11.805 59.778  1.00 13.31 ? 292 PHE C CE2 1 
ATOM   10343 C  CZ  . PHE C 1 292 ? 35.021  -12.388 58.857  1.00 13.15 ? 292 PHE C CZ  1 
ATOM   10344 N  N   . PRO C 1 293 ? 39.252  -15.459 59.879  1.00 13.51 ? 293 PRO C N   1 
ATOM   10345 C  CA  . PRO C 1 293 ? 40.517  -14.976 59.312  1.00 13.52 ? 293 PRO C CA  1 
ATOM   10346 C  C   . PRO C 1 293 ? 40.785  -13.498 59.566  1.00 13.63 ? 293 PRO C C   1 
ATOM   10347 O  O   . PRO C 1 293 ? 41.936  -13.061 59.551  1.00 13.67 ? 293 PRO C O   1 
ATOM   10348 C  CB  . PRO C 1 293 ? 40.392  -15.286 57.818  1.00 13.40 ? 293 PRO C CB  1 
ATOM   10349 C  CG  . PRO C 1 293 ? 38.928  -15.498 57.583  1.00 13.36 ? 293 PRO C CG  1 
ATOM   10350 C  CD  . PRO C 1 293 ? 38.402  -16.089 58.858  1.00 13.39 ? 293 PRO C CD  1 
ATOM   10351 N  N   . PHE C 1 294 ? 39.726  -12.730 59.800  1.00 13.65 ? 294 PHE C N   1 
ATOM   10352 C  CA  . PHE C 1 294 ? 39.877  -11.301 60.055  1.00 13.96 ? 294 PHE C CA  1 
ATOM   10353 C  C   . PHE C 1 294 ? 39.317  -10.944 61.423  1.00 14.02 ? 294 PHE C C   1 
ATOM   10354 O  O   . PHE C 1 294 ? 39.013  -11.829 62.221  1.00 14.04 ? 294 PHE C O   1 
ATOM   10355 C  CB  . PHE C 1 294 ? 39.150  -10.495 58.978  1.00 13.85 ? 294 PHE C CB  1 
ATOM   10356 C  CG  . PHE C 1 294 ? 39.535  -10.876 57.580  1.00 13.78 ? 294 PHE C CG  1 
ATOM   10357 C  CD1 . PHE C 1 294 ? 40.742  -10.442 57.035  1.00 13.92 ? 294 PHE C CD1 1 
ATOM   10358 C  CD2 . PHE C 1 294 ? 38.710  -11.697 56.816  1.00 13.53 ? 294 PHE C CD2 1 
ATOM   10359 C  CE1 . PHE C 1 294 ? 41.121  -10.826 55.748  1.00 13.79 ? 294 PHE C CE1 1 
ATOM   10360 C  CE2 . PHE C 1 294 ? 39.077  -12.086 55.533  1.00 13.26 ? 294 PHE C CE2 1 
ATOM   10361 C  CZ  . PHE C 1 294 ? 40.286  -11.651 54.998  1.00 13.47 ? 294 PHE C CZ  1 
ATOM   10362 N  N   . ASN C 1 295 ? 39.199  -9.647  61.694  1.00 13.80 ? 295 ASN C N   1 
ATOM   10363 C  CA  . ASN C 1 295 ? 38.647  -9.205  62.961  1.00 13.38 ? 295 ASN C CA  1 
ATOM   10364 C  C   . ASN C 1 295 ? 37.145  -9.078  62.771  1.00 13.19 ? 295 ASN C C   1 
ATOM   10365 O  O   . ASN C 1 295 ? 36.669  -8.146  62.126  1.00 12.99 ? 295 ASN C O   1 
ATOM   10366 C  CB  . ASN C 1 295 ? 39.225  -7.855  63.374  1.00 13.93 ? 295 ASN C CB  1 
ATOM   10367 C  CG  . ASN C 1 295 ? 38.403  -7.183  64.469  1.00 14.28 ? 295 ASN C CG  1 
ATOM   10368 O  OD1 . ASN C 1 295 ? 37.744  -7.853  65.272  1.00 14.09 ? 295 ASN C OD1 1 
ATOM   10369 N  ND2 . ASN C 1 295 ? 38.435  -5.849  64.502  1.00 14.85 ? 295 ASN C ND2 1 
ATOM   10370 N  N   . PRO C 1 296 ? 36.379  -10.027 63.325  1.00 12.97 ? 296 PRO C N   1 
ATOM   10371 C  CA  . PRO C 1 296 ? 34.916  -10.027 63.216  1.00 12.93 ? 296 PRO C CA  1 
ATOM   10372 C  C   . PRO C 1 296 ? 34.262  -8.692  63.548  1.00 12.89 ? 296 PRO C C   1 
ATOM   10373 O  O   . PRO C 1 296 ? 33.098  -8.475  63.221  1.00 12.99 ? 296 PRO C O   1 
ATOM   10374 C  CB  . PRO C 1 296 ? 34.469  -11.140 64.174  1.00 12.71 ? 296 PRO C CB  1 
ATOM   10375 C  CG  . PRO C 1 296 ? 35.699  -11.546 64.925  1.00 12.67 ? 296 PRO C CG  1 
ATOM   10376 C  CD  . PRO C 1 296 ? 36.872  -11.179 64.093  1.00 12.71 ? 296 PRO C CD  1 
ATOM   10377 N  N   . PHE C 1 297 ? 35.008  -7.803  64.194  1.00 12.81 ? 297 PHE C N   1 
ATOM   10378 C  CA  . PHE C 1 297 ? 34.476  -6.494  64.556  1.00 12.80 ? 297 PHE C CA  1 
ATOM   10379 C  C   . PHE C 1 297 ? 35.097  -5.372  63.728  1.00 12.67 ? 297 PHE C C   1 
ATOM   10380 O  O   . PHE C 1 297 ? 35.018  -4.204  64.098  1.00 12.67 ? 297 PHE C O   1 
ATOM   10381 C  CB  . PHE C 1 297 ? 34.699  -6.230  66.047  1.00 12.70 ? 297 PHE C CB  1 
ATOM   10382 C  CG  . PHE C 1 297 ? 34.519  -7.448  66.910  1.00 12.52 ? 297 PHE C CG  1 
ATOM   10383 C  CD1 . PHE C 1 297 ? 33.262  -8.029  67.061  1.00 12.47 ? 297 PHE C CD1 1 
ATOM   10384 C  CD2 . PHE C 1 297 ? 35.608  -8.015  67.572  1.00 12.43 ? 297 PHE C CD2 1 
ATOM   10385 C  CE1 . PHE C 1 297 ? 33.093  -9.158  67.857  1.00 12.33 ? 297 PHE C CE1 1 
ATOM   10386 C  CE2 . PHE C 1 297 ? 35.454  -9.143  68.371  1.00 12.26 ? 297 PHE C CE2 1 
ATOM   10387 C  CZ  . PHE C 1 297 ? 34.195  -9.717  68.516  1.00 12.40 ? 297 PHE C CZ  1 
ATOM   10388 N  N   . ASP C 1 298 ? 35.720  -5.741  62.612  1.00 12.70 ? 298 ASP C N   1 
ATOM   10389 C  CA  . ASP C 1 298 ? 36.338  -4.776  61.708  1.00 12.60 ? 298 ASP C CA  1 
ATOM   10390 C  C   . ASP C 1 298 ? 35.249  -4.274  60.768  1.00 12.56 ? 298 ASP C C   1 
ATOM   10391 O  O   . ASP C 1 298 ? 34.742  -5.036  59.942  1.00 12.66 ? 298 ASP C O   1 
ATOM   10392 C  CB  . ASP C 1 298 ? 37.455  -5.441  60.892  1.00 12.42 ? 298 ASP C CB  1 
ATOM   10393 C  CG  . ASP C 1 298 ? 38.413  -4.430  60.271  1.00 12.34 ? 298 ASP C CG  1 
ATOM   10394 O  OD1 . ASP C 1 298 ? 37.973  -3.311  59.935  1.00 12.47 ? 298 ASP C OD1 1 
ATOM   10395 O  OD2 . ASP C 1 298 ? 39.610  -4.750  60.120  1.00 12.15 ? 298 ASP C OD2 1 
ATOM   10396 N  N   . LEU C 1 299 ? 34.886  -3.001  60.898  1.00 12.32 ? 299 LEU C N   1 
ATOM   10397 C  CA  . LEU C 1 299 ? 33.846  -2.423  60.058  1.00 12.20 ? 299 LEU C CA  1 
ATOM   10398 C  C   . LEU C 1 299 ? 34.227  -2.383  58.578  1.00 12.17 ? 299 LEU C C   1 
ATOM   10399 O  O   . LEU C 1 299 ? 33.367  -2.206  57.718  1.00 12.22 ? 299 LEU C O   1 
ATOM   10400 C  CB  . LEU C 1 299 ? 33.504  -1.013  60.544  1.00 12.20 ? 299 LEU C CB  1 
ATOM   10401 C  CG  . LEU C 1 299 ? 32.327  -0.295  59.875  1.00 12.05 ? 299 LEU C CG  1 
ATOM   10402 C  CD1 . LEU C 1 299 ? 31.076  -1.163  59.946  1.00 12.02 ? 299 LEU C CD1 1 
ATOM   10403 C  CD2 . LEU C 1 299 ? 32.093  1.047   60.561  1.00 11.90 ? 299 LEU C CD2 1 
ATOM   10404 N  N   . THR C 1 300 ? 35.511  -2.547  58.277  1.00 11.92 ? 300 THR C N   1 
ATOM   10405 C  CA  . THR C 1 300 ? 35.956  -2.526  56.892  1.00 11.92 ? 300 THR C CA  1 
ATOM   10406 C  C   . THR C 1 300 ? 35.995  -3.928  56.303  1.00 11.78 ? 300 THR C C   1 
ATOM   10407 O  O   . THR C 1 300 ? 36.694  -4.183  55.324  1.00 11.75 ? 300 THR C O   1 
ATOM   10408 C  CB  . THR C 1 300 ? 37.352  -1.897  56.756  1.00 11.99 ? 300 THR C CB  1 
ATOM   10409 O  OG1 . THR C 1 300 ? 38.314  -2.711  57.435  1.00 12.01 ? 300 THR C OG1 1 
ATOM   10410 C  CG2 . THR C 1 300 ? 37.364  -0.500  57.347  1.00 12.24 ? 300 THR C CG2 1 
ATOM   10411 N  N   . LYS C 1 301 ? 35.233  -4.834  56.901  1.00 11.66 ? 301 LYS C N   1 
ATOM   10412 C  CA  . LYS C 1 301 ? 35.178  -6.205  56.433  1.00 11.59 ? 301 LYS C CA  1 
ATOM   10413 C  C   . LYS C 1 301 ? 33.736  -6.673  56.430  1.00 11.82 ? 301 LYS C C   1 
ATOM   10414 O  O   . LYS C 1 301 ? 32.886  -6.088  57.102  1.00 11.78 ? 301 LYS C O   1 
ATOM   10415 C  CB  . LYS C 1 301 ? 36.012  -7.102  57.343  1.00 11.50 ? 301 LYS C CB  1 
ATOM   10416 C  CG  . LYS C 1 301 ? 37.370  -6.526  57.684  1.00 11.42 ? 301 LYS C CG  1 
ATOM   10417 C  CD  . LYS C 1 301 ? 38.495  -7.281  56.992  1.00 11.28 ? 301 LYS C CD  1 
ATOM   10418 C  CE  . LYS C 1 301 ? 39.837  -6.608  57.238  1.00 11.03 ? 301 LYS C CE  1 
ATOM   10419 N  NZ  . LYS C 1 301 ? 39.767  -5.137  57.022  1.00 11.19 ? 301 LYS C NZ  1 
ATOM   10420 N  N   . VAL C 1 302 ? 33.463  -7.729  55.669  1.00 11.87 ? 302 VAL C N   1 
ATOM   10421 C  CA  . VAL C 1 302 ? 32.117  -8.278  55.579  1.00 11.99 ? 302 VAL C CA  1 
ATOM   10422 C  C   . VAL C 1 302 ? 32.100  -9.779  55.864  1.00 12.04 ? 302 VAL C C   1 
ATOM   10423 O  O   . VAL C 1 302 ? 33.118  -10.463 55.724  1.00 11.96 ? 302 VAL C O   1 
ATOM   10424 C  CB  . VAL C 1 302 ? 31.488  -8.007  54.174  1.00 11.88 ? 302 VAL C CB  1 
ATOM   10425 C  CG1 . VAL C 1 302 ? 31.676  -6.542  53.798  1.00 11.73 ? 302 VAL C CG1 1 
ATOM   10426 C  CG2 . VAL C 1 302 ? 32.114  -8.913  53.117  1.00 11.77 ? 302 VAL C CG2 1 
ATOM   10427 N  N   . TRP C 1 303 ? 30.934  -10.281 56.259  1.00 12.47 ? 303 TRP C N   1 
ATOM   10428 C  CA  . TRP C 1 303 ? 30.764  -11.696 56.581  1.00 12.85 ? 303 TRP C CA  1 
ATOM   10429 C  C   . TRP C 1 303 ? 30.236  -12.498 55.390  1.00 13.01 ? 303 TRP C C   1 
ATOM   10430 O  O   . TRP C 1 303 ? 29.045  -12.452 55.066  1.00 12.90 ? 303 TRP C O   1 
ATOM   10431 C  CB  . TRP C 1 303 ? 29.805  -11.846 57.768  1.00 13.16 ? 303 TRP C CB  1 
ATOM   10432 C  CG  . TRP C 1 303 ? 30.409  -11.484 59.104  1.00 13.35 ? 303 TRP C CG  1 
ATOM   10433 C  CD1 . TRP C 1 303 ? 31.652  -10.964 59.334  1.00 13.35 ? 303 TRP C CD1 1 
ATOM   10434 C  CD2 . TRP C 1 303 ? 29.802  -11.653 60.394  1.00 13.38 ? 303 TRP C CD2 1 
ATOM   10435 N  NE1 . TRP C 1 303 ? 31.858  -10.803 60.683  1.00 13.28 ? 303 TRP C NE1 1 
ATOM   10436 C  CE2 . TRP C 1 303 ? 30.739  -11.218 61.357  1.00 13.36 ? 303 TRP C CE2 1 
ATOM   10437 C  CE3 . TRP C 1 303 ? 28.558  -12.130 60.828  1.00 13.48 ? 303 TRP C CE3 1 
ATOM   10438 C  CZ2 . TRP C 1 303 ? 30.470  -11.246 62.732  1.00 13.27 ? 303 TRP C CZ2 1 
ATOM   10439 C  CZ3 . TRP C 1 303 ? 28.291  -12.158 62.196  1.00 13.49 ? 303 TRP C CZ3 1 
ATOM   10440 C  CH2 . TRP C 1 303 ? 29.246  -11.718 63.131  1.00 13.24 ? 303 TRP C CH2 1 
ATOM   10441 N  N   . PRO C 1 304 ? 31.124  -13.250 54.724  1.00 13.08 ? 304 PRO C N   1 
ATOM   10442 C  CA  . PRO C 1 304 ? 30.762  -14.072 53.562  1.00 13.26 ? 304 PRO C CA  1 
ATOM   10443 C  C   . PRO C 1 304 ? 29.481  -14.906 53.739  1.00 13.51 ? 304 PRO C C   1 
ATOM   10444 O  O   . PRO C 1 304 ? 29.359  -15.703 54.676  1.00 13.76 ? 304 PRO C O   1 
ATOM   10445 C  CB  . PRO C 1 304 ? 31.996  -14.942 53.347  1.00 13.11 ? 304 PRO C CB  1 
ATOM   10446 C  CG  . PRO C 1 304 ? 33.118  -14.115 53.880  1.00 12.95 ? 304 PRO C CG  1 
ATOM   10447 C  CD  . PRO C 1 304 ? 32.558  -13.352 55.047  1.00 12.95 ? 304 PRO C CD  1 
ATOM   10448 N  N   . HIS C 1 305 ? 28.535  -14.720 52.822  1.00 13.68 ? 305 HIS C N   1 
ATOM   10449 C  CA  . HIS C 1 305 ? 27.259  -15.438 52.857  1.00 13.87 ? 305 HIS C CA  1 
ATOM   10450 C  C   . HIS C 1 305 ? 27.417  -16.963 52.793  1.00 13.76 ? 305 HIS C C   1 
ATOM   10451 O  O   . HIS C 1 305 ? 26.537  -17.703 53.232  1.00 13.64 ? 305 HIS C O   1 
ATOM   10452 C  CB  . HIS C 1 305 ? 26.364  -14.974 51.702  1.00 13.93 ? 305 HIS C CB  1 
ATOM   10453 C  CG  . HIS C 1 305 ? 26.094  -13.503 51.701  1.00 14.28 ? 305 HIS C CG  1 
ATOM   10454 N  ND1 . HIS C 1 305 ? 27.082  -12.564 51.485  1.00 14.44 ? 305 HIS C ND1 1 
ATOM   10455 C  CD2 . HIS C 1 305 ? 24.948  -12.807 51.889  1.00 14.44 ? 305 HIS C CD2 1 
ATOM   10456 C  CE1 . HIS C 1 305 ? 26.556  -11.352 51.539  1.00 14.57 ? 305 HIS C CE1 1 
ATOM   10457 N  NE2 . HIS C 1 305 ? 25.262  -11.472 51.784  1.00 14.70 ? 305 HIS C NE2 1 
ATOM   10458 N  N   . LYS C 1 306 ? 28.528  -17.432 52.237  1.00 13.37 ? 306 LYS C N   1 
ATOM   10459 C  CA  . LYS C 1 306 ? 28.762  -18.864 52.142  1.00 13.29 ? 306 LYS C CA  1 
ATOM   10460 C  C   . LYS C 1 306 ? 29.033  -19.462 53.525  1.00 13.17 ? 306 LYS C C   1 
ATOM   10461 O  O   . LYS C 1 306 ? 28.464  -20.488 53.885  1.00 12.99 ? 306 LYS C O   1 
ATOM   10462 C  CB  . LYS C 1 306 ? 29.945  -19.154 51.204  1.00 13.52 ? 306 LYS C CB  1 
ATOM   10463 C  CG  . LYS C 1 306 ? 30.976  -18.030 51.110  1.00 13.70 ? 306 LYS C CG  1 
ATOM   10464 C  CD  . LYS C 1 306 ? 30.705  -17.125 49.912  1.00 13.85 ? 306 LYS C CD  1 
ATOM   10465 C  CE  . LYS C 1 306 ? 30.509  -15.673 50.343  1.00 13.89 ? 306 LYS C CE  1 
ATOM   10466 N  NZ  . LYS C 1 306 ? 29.113  -15.188 50.101  1.00 13.92 ? 306 LYS C NZ  1 
ATOM   10467 N  N   . ASP C 1 307 ? 29.899  -18.816 54.300  1.00 13.12 ? 307 ASP C N   1 
ATOM   10468 C  CA  . ASP C 1 307 ? 30.230  -19.305 55.637  1.00 13.13 ? 307 ASP C CA  1 
ATOM   10469 C  C   . ASP C 1 307 ? 29.187  -18.847 56.648  1.00 13.04 ? 307 ASP C C   1 
ATOM   10470 O  O   . ASP C 1 307 ? 28.954  -19.513 57.662  1.00 13.01 ? 307 ASP C O   1 
ATOM   10471 C  CB  . ASP C 1 307 ? 31.605  -18.794 56.074  1.00 13.33 ? 307 ASP C CB  1 
ATOM   10472 C  CG  . ASP C 1 307 ? 32.705  -19.162 55.097  1.00 13.56 ? 307 ASP C CG  1 
ATOM   10473 O  OD1 . ASP C 1 307 ? 33.496  -20.080 55.409  1.00 13.51 ? 307 ASP C OD1 1 
ATOM   10474 O  OD2 . ASP C 1 307 ? 32.777  -18.531 54.017  1.00 13.72 ? 307 ASP C OD2 1 
ATOM   10475 N  N   . TYR C 1 308 ? 28.566  -17.704 56.370  1.00 12.80 ? 308 TYR C N   1 
ATOM   10476 C  CA  . TYR C 1 308 ? 27.547  -17.153 57.253  1.00 12.62 ? 308 TYR C CA  1 
ATOM   10477 C  C   . TYR C 1 308 ? 26.345  -16.685 56.439  1.00 12.79 ? 308 TYR C C   1 
ATOM   10478 O  O   . TYR C 1 308 ? 26.243  -15.515 56.068  1.00 12.84 ? 308 TYR C O   1 
ATOM   10479 C  CB  . TYR C 1 308 ? 28.145  -16.007 58.064  1.00 12.02 ? 308 TYR C CB  1 
ATOM   10480 C  CG  . TYR C 1 308 ? 29.470  -16.393 58.666  1.00 11.58 ? 308 TYR C CG  1 
ATOM   10481 C  CD1 . TYR C 1 308 ? 29.533  -17.299 59.727  1.00 11.35 ? 308 TYR C CD1 1 
ATOM   10482 C  CD2 . TYR C 1 308 ? 30.668  -15.908 58.140  1.00 11.33 ? 308 TYR C CD2 1 
ATOM   10483 C  CE1 . TYR C 1 308 ? 30.756  -17.717 60.247  1.00 11.25 ? 308 TYR C CE1 1 
ATOM   10484 C  CE2 . TYR C 1 308 ? 31.900  -16.321 58.654  1.00 11.24 ? 308 TYR C CE2 1 
ATOM   10485 C  CZ  . TYR C 1 308 ? 31.935  -17.227 59.707  1.00 11.27 ? 308 TYR C CZ  1 
ATOM   10486 O  OH  . TYR C 1 308 ? 33.145  -17.649 60.218  1.00 11.39 ? 308 TYR C OH  1 
ATOM   10487 N  N   . PRO C 1 309 ? 25.420  -17.614 56.145  1.00 12.90 ? 309 PRO C N   1 
ATOM   10488 C  CA  . PRO C 1 309 ? 24.198  -17.362 55.370  1.00 12.98 ? 309 PRO C CA  1 
ATOM   10489 C  C   . PRO C 1 309 ? 23.142  -16.499 56.053  1.00 13.10 ? 309 PRO C C   1 
ATOM   10490 O  O   . PRO C 1 309 ? 22.981  -16.532 57.271  1.00 13.40 ? 309 PRO C O   1 
ATOM   10491 C  CB  . PRO C 1 309 ? 23.666  -18.762 55.074  1.00 12.94 ? 309 PRO C CB  1 
ATOM   10492 C  CG  . PRO C 1 309 ? 24.184  -19.595 56.187  1.00 12.82 ? 309 PRO C CG  1 
ATOM   10493 C  CD  . PRO C 1 309 ? 25.526  -19.024 56.558  1.00 12.76 ? 309 PRO C CD  1 
ATOM   10494 N  N   . LEU C 1 310 ? 22.411  -15.735 55.249  1.00 13.13 ? 310 LEU C N   1 
ATOM   10495 C  CA  . LEU C 1 310 ? 21.358  -14.881 55.769  1.00 13.26 ? 310 LEU C CA  1 
ATOM   10496 C  C   . LEU C 1 310 ? 20.225  -15.728 56.345  1.00 13.17 ? 310 LEU C C   1 
ATOM   10497 O  O   . LEU C 1 310 ? 19.854  -16.757 55.781  1.00 13.09 ? 310 LEU C O   1 
ATOM   10498 C  CB  . LEU C 1 310 ? 20.810  -13.986 54.657  1.00 13.06 ? 310 LEU C CB  1 
ATOM   10499 C  CG  . LEU C 1 310 ? 21.817  -13.069 53.960  1.00 12.98 ? 310 LEU C CG  1 
ATOM   10500 C  CD1 . LEU C 1 310 ? 21.321  -12.773 52.561  1.00 12.83 ? 310 LEU C CD1 1 
ATOM   10501 C  CD2 . LEU C 1 310 ? 22.003  -11.775 54.756  1.00 12.95 ? 310 LEU C CD2 1 
ATOM   10502 N  N   . ILE C 1 311 ? 19.679  -15.284 57.471  1.00 13.03 ? 311 ILE C N   1 
ATOM   10503 C  CA  . ILE C 1 311 ? 18.587  -15.988 58.117  1.00 12.71 ? 311 ILE C CA  1 
ATOM   10504 C  C   . ILE C 1 311 ? 17.365  -15.082 58.138  1.00 12.62 ? 311 ILE C C   1 
ATOM   10505 O  O   . ILE C 1 311 ? 17.414  -13.973 58.668  1.00 12.96 ? 311 ILE C O   1 
ATOM   10506 C  CB  . ILE C 1 311 ? 18.965  -16.372 59.550  1.00 12.52 ? 311 ILE C CB  1 
ATOM   10507 C  CG1 . ILE C 1 311 ? 20.223  -17.236 59.522  1.00 12.33 ? 311 ILE C CG1 1 
ATOM   10508 C  CG2 . ILE C 1 311 ? 17.820  -17.114 60.216  1.00 12.44 ? 311 ILE C CG2 1 
ATOM   10509 C  CD1 . ILE C 1 311 ? 20.882  -17.383 60.863  1.00 12.30 ? 311 ILE C CD1 1 
ATOM   10510 N  N   . PRO C 1 312 ? 16.253  -15.538 57.545  1.00 12.52 ? 312 PRO C N   1 
ATOM   10511 C  CA  . PRO C 1 312 ? 15.037  -14.719 57.526  1.00 12.47 ? 312 PRO C CA  1 
ATOM   10512 C  C   . PRO C 1 312 ? 14.496  -14.445 58.930  1.00 12.37 ? 312 PRO C C   1 
ATOM   10513 O  O   . PRO C 1 312 ? 14.469  -15.338 59.787  1.00 12.03 ? 312 PRO C O   1 
ATOM   10514 C  CB  . PRO C 1 312 ? 14.064  -15.537 56.680  1.00 12.35 ? 312 PRO C CB  1 
ATOM   10515 C  CG  . PRO C 1 312 ? 14.589  -16.939 56.737  1.00 12.38 ? 312 PRO C CG  1 
ATOM   10516 C  CD  . PRO C 1 312 ? 16.070  -16.829 56.858  1.00 12.46 ? 312 PRO C CD  1 
ATOM   10517 N  N   . VAL C 1 313 ? 14.071  -13.203 59.154  1.00 12.17 ? 313 VAL C N   1 
ATOM   10518 C  CA  . VAL C 1 313 ? 13.524  -12.799 60.444  1.00 12.49 ? 313 VAL C CA  1 
ATOM   10519 C  C   . VAL C 1 313 ? 12.131  -12.193 60.306  1.00 12.52 ? 313 VAL C C   1 
ATOM   10520 O  O   . VAL C 1 313 ? 11.233  -12.504 61.088  1.00 12.48 ? 313 VAL C O   1 
ATOM   10521 C  CB  . VAL C 1 313 ? 14.433  -11.771 61.145  1.00 12.54 ? 313 VAL C CB  1 
ATOM   10522 C  CG1 . VAL C 1 313 ? 13.952  -11.550 62.577  1.00 12.70 ? 313 VAL C CG1 1 
ATOM   10523 C  CG2 . VAL C 1 313 ? 15.874  -12.256 61.132  1.00 12.57 ? 313 VAL C CG2 1 
ATOM   10524 N  N   . GLY C 1 314 ? 11.953  -11.324 59.319  1.00 12.45 ? 314 GLY C N   1 
ATOM   10525 C  CA  . GLY C 1 314 ? 10.653  -10.713 59.128  1.00 12.61 ? 314 GLY C CA  1 
ATOM   10526 C  C   . GLY C 1 314 ? 10.544  -9.802  57.923  1.00 12.66 ? 314 GLY C C   1 
ATOM   10527 O  O   . GLY C 1 314 ? 11.322  -9.902  56.973  1.00 12.62 ? 314 GLY C O   1 
ATOM   10528 N  N   . LYS C 1 315 ? 9.567   -8.901  57.972  1.00 12.82 ? 315 LYS C N   1 
ATOM   10529 C  CA  . LYS C 1 315 ? 9.327   -7.952  56.891  1.00 12.77 ? 315 LYS C CA  1 
ATOM   10530 C  C   . LYS C 1 315 ? 9.225   -6.502  57.378  1.00 12.63 ? 315 LYS C C   1 
ATOM   10531 O  O   . LYS C 1 315 ? 8.677   -6.226  58.439  1.00 12.72 ? 315 LYS C O   1 
ATOM   10532 C  CB  . LYS C 1 315 ? 8.045   -8.333  56.149  1.00 12.79 ? 315 LYS C CB  1 
ATOM   10533 C  CG  . LYS C 1 315 ? 7.999   -7.847  54.711  1.00 12.72 ? 315 LYS C CG  1 
ATOM   10534 C  CD  . LYS C 1 315 ? 8.886   -8.688  53.820  1.00 12.58 ? 315 LYS C CD  1 
ATOM   10535 C  CE  . LYS C 1 315 ? 8.074   -9.725  53.069  1.00 12.44 ? 315 LYS C CE  1 
ATOM   10536 N  NZ  . LYS C 1 315 ? 8.943   -10.546 52.180  1.00 12.86 ? 315 LYS C NZ  1 
ATOM   10537 N  N   . LEU C 1 316 ? 9.762   -5.585  56.582  1.00 12.72 ? 316 LEU C N   1 
ATOM   10538 C  CA  . LEU C 1 316 ? 9.746   -4.161  56.890  1.00 12.70 ? 316 LEU C CA  1 
ATOM   10539 C  C   . LEU C 1 316 ? 8.788   -3.494  55.914  1.00 12.77 ? 316 LEU C C   1 
ATOM   10540 O  O   . LEU C 1 316 ? 8.954   -3.628  54.701  1.00 12.76 ? 316 LEU C O   1 
ATOM   10541 C  CB  . LEU C 1 316 ? 11.148  -3.574  56.707  1.00 12.73 ? 316 LEU C CB  1 
ATOM   10542 C  CG  . LEU C 1 316 ? 11.725  -2.622  57.763  1.00 12.74 ? 316 LEU C CG  1 
ATOM   10543 C  CD1 . LEU C 1 316 ? 11.614  -3.230  59.161  1.00 12.92 ? 316 LEU C CD1 1 
ATOM   10544 C  CD2 . LEU C 1 316 ? 13.181  -2.331  57.416  1.00 12.58 ? 316 LEU C CD2 1 
ATOM   10545 N  N   . VAL C 1 317 ? 7.790   -2.782  56.429  1.00 12.65 ? 317 VAL C N   1 
ATOM   10546 C  CA  . VAL C 1 317 ? 6.824   -2.122  55.556  1.00 12.64 ? 317 VAL C CA  1 
ATOM   10547 C  C   . VAL C 1 317 ? 6.604   -0.648  55.878  1.00 12.80 ? 317 VAL C C   1 
ATOM   10548 O  O   . VAL C 1 317 ? 6.507   -0.261  57.042  1.00 13.14 ? 317 VAL C O   1 
ATOM   10549 C  CB  . VAL C 1 317 ? 5.464   -2.821  55.607  1.00 12.39 ? 317 VAL C CB  1 
ATOM   10550 C  CG1 . VAL C 1 317 ? 4.573   -2.278  54.510  1.00 12.26 ? 317 VAL C CG1 1 
ATOM   10551 C  CG2 . VAL C 1 317 ? 5.641   -4.319  55.467  1.00 11.96 ? 317 VAL C CG2 1 
ATOM   10552 N  N   . LEU C 1 318 ? 6.515   0.170   54.835  1.00 12.57 ? 318 LEU C N   1 
ATOM   10553 C  CA  . LEU C 1 318 ? 6.298   1.601   54.995  1.00 12.28 ? 318 LEU C CA  1 
ATOM   10554 C  C   . LEU C 1 318 ? 4.982   1.977   54.336  1.00 12.24 ? 318 LEU C C   1 
ATOM   10555 O  O   . LEU C 1 318 ? 4.910   2.120   53.119  1.00 12.29 ? 318 LEU C O   1 
ATOM   10556 C  CB  . LEU C 1 318 ? 7.443   2.375   54.354  1.00 11.92 ? 318 LEU C CB  1 
ATOM   10557 C  CG  . LEU C 1 318 ? 8.800   2.170   55.024  1.00 11.58 ? 318 LEU C CG  1 
ATOM   10558 C  CD1 . LEU C 1 318 ? 9.850   3.018   54.325  1.00 11.32 ? 318 LEU C CD1 1 
ATOM   10559 C  CD2 . LEU C 1 318 ? 8.699   2.537   56.496  1.00 11.41 ? 318 LEU C CD2 1 
ATOM   10560 N  N   . ASN C 1 319 ? 3.946   2.154   55.146  1.00 12.11 ? 319 ASN C N   1 
ATOM   10561 C  CA  . ASN C 1 319 ? 2.624   2.477   54.632  1.00 11.99 ? 319 ASN C CA  1 
ATOM   10562 C  C   . ASN C 1 319 ? 2.038   3.781   55.139  1.00 12.01 ? 319 ASN C C   1 
ATOM   10563 O  O   . ASN C 1 319 ? 0.819   3.889   55.264  1.00 11.80 ? 319 ASN C O   1 
ATOM   10564 C  CB  . ASN C 1 319 ? 1.658   1.353   54.992  1.00 12.27 ? 319 ASN C CB  1 
ATOM   10565 C  CG  . ASN C 1 319 ? 1.527   1.165   56.495  1.00 12.44 ? 319 ASN C CG  1 
ATOM   10566 O  OD1 . ASN C 1 319 ? 0.911   0.209   56.961  1.00 12.58 ? 319 ASN C OD1 1 
ATOM   10567 N  ND2 . ASN C 1 319 ? 2.114   2.080   57.260  1.00 12.78 ? 319 ASN C ND2 1 
ATOM   10568 N  N   . ARG C 1 320 ? 2.873   4.770   55.438  1.00 12.09 ? 320 ARG C N   1 
ATOM   10569 C  CA  . ARG C 1 320 ? 2.338   6.032   55.939  1.00 12.38 ? 320 ARG C CA  1 
ATOM   10570 C  C   . ARG C 1 320 ? 3.290   7.211   55.882  1.00 12.35 ? 320 ARG C C   1 
ATOM   10571 O  O   . ARG C 1 320 ? 4.339   7.207   56.518  1.00 12.51 ? 320 ARG C O   1 
ATOM   10572 C  CB  . ARG C 1 320 ? 1.845   5.863   57.377  1.00 12.28 ? 320 ARG C CB  1 
ATOM   10573 C  CG  . ARG C 1 320 ? 0.859   6.939   57.795  1.00 12.34 ? 320 ARG C CG  1 
ATOM   10574 C  CD  . ARG C 1 320 ? 0.556   6.884   59.276  1.00 12.43 ? 320 ARG C CD  1 
ATOM   10575 N  NE  . ARG C 1 320 ? 1.430   7.768   60.039  1.00 12.62 ? 320 ARG C NE  1 
ATOM   10576 C  CZ  . ARG C 1 320 ? 2.170   7.369   61.066  1.00 12.79 ? 320 ARG C CZ  1 
ATOM   10577 N  NH1 . ARG C 1 320 ? 2.139   6.097   61.452  1.00 12.89 ? 320 ARG C NH1 1 
ATOM   10578 N  NH2 . ARG C 1 320 ? 2.944   8.239   61.707  1.00 12.82 ? 320 ARG C NH2 1 
ATOM   10579 N  N   . ASN C 1 321 ? 2.896   8.232   55.131  1.00 12.45 ? 321 ASN C N   1 
ATOM   10580 C  CA  . ASN C 1 321 ? 3.703   9.433   54.975  1.00 12.46 ? 321 ASN C CA  1 
ATOM   10581 C  C   . ASN C 1 321 ? 3.584   10.326  56.198  1.00 12.40 ? 321 ASN C C   1 
ATOM   10582 O  O   . ASN C 1 321 ? 2.646   10.200  56.985  1.00 12.31 ? 321 ASN C O   1 
ATOM   10583 C  CB  . ASN C 1 321 ? 3.258   10.210  53.734  1.00 12.71 ? 321 ASN C CB  1 
ATOM   10584 C  CG  . ASN C 1 321 ? 3.605   9.497   52.448  1.00 12.83 ? 321 ASN C CG  1 
ATOM   10585 O  OD1 . ASN C 1 321 ? 2.879   9.588   51.457  1.00 12.91 ? 321 ASN C OD1 1 
ATOM   10586 N  ND2 . ASN C 1 321 ? 4.723   8.781   52.454  1.00 12.85 ? 321 ASN C ND2 1 
ATOM   10587 N  N   . PRO C 1 322 ? 4.539   11.247  56.373  1.00 12.31 ? 322 PRO C N   1 
ATOM   10588 C  CA  . PRO C 1 322 ? 4.476   12.136  57.529  1.00 12.36 ? 322 PRO C CA  1 
ATOM   10589 C  C   . PRO C 1 322 ? 3.431   13.212  57.279  1.00 12.58 ? 322 PRO C C   1 
ATOM   10590 O  O   . PRO C 1 322 ? 3.093   13.488  56.131  1.00 12.86 ? 322 PRO C O   1 
ATOM   10591 C  CB  . PRO C 1 322 ? 5.893   12.719  57.624  1.00 12.22 ? 322 PRO C CB  1 
ATOM   10592 C  CG  . PRO C 1 322 ? 6.690   12.071  56.516  1.00 11.99 ? 322 PRO C CG  1 
ATOM   10593 C  CD  . PRO C 1 322 ? 5.715   11.525  55.534  1.00 12.11 ? 322 PRO C CD  1 
ATOM   10594 N  N   . VAL C 1 323 ? 2.911   13.805  58.349  1.00 12.65 ? 323 VAL C N   1 
ATOM   10595 C  CA  . VAL C 1 323 ? 1.918   14.864  58.214  1.00 12.56 ? 323 VAL C CA  1 
ATOM   10596 C  C   . VAL C 1 323 ? 2.654   16.200  58.184  1.00 12.57 ? 323 VAL C C   1 
ATOM   10597 O  O   . VAL C 1 323 ? 2.344   17.082  57.382  1.00 12.37 ? 323 VAL C O   1 
ATOM   10598 C  CB  . VAL C 1 323 ? 0.927   14.876  59.403  1.00 12.61 ? 323 VAL C CB  1 
ATOM   10599 C  CG1 . VAL C 1 323 ? -0.031  16.046  59.261  1.00 12.69 ? 323 VAL C CG1 1 
ATOM   10600 C  CG2 . VAL C 1 323 ? 0.159   13.570  59.460  1.00 12.59 ? 323 VAL C CG2 1 
ATOM   10601 N  N   . ASN C 1 324 ? 3.640   16.331  59.062  1.00 12.45 ? 324 ASN C N   1 
ATOM   10602 C  CA  . ASN C 1 324 ? 4.429   17.547  59.165  1.00 12.52 ? 324 ASN C CA  1 
ATOM   10603 C  C   . ASN C 1 324 ? 5.907   17.188  59.152  1.00 12.49 ? 324 ASN C C   1 
ATOM   10604 O  O   . ASN C 1 324 ? 6.447   16.702  60.146  1.00 12.78 ? 324 ASN C O   1 
ATOM   10605 C  CB  . ASN C 1 324 ? 4.079   18.281  60.458  1.00 12.55 ? 324 ASN C CB  1 
ATOM   10606 C  CG  . ASN C 1 324 ? 4.509   19.728  60.436  1.00 12.57 ? 324 ASN C CG  1 
ATOM   10607 O  OD1 . ASN C 1 324 ? 5.533   20.092  61.014  1.00 13.06 ? 324 ASN C OD1 1 
ATOM   10608 N  ND2 . ASN C 1 324 ? 3.729   20.565  59.763  1.00 12.39 ? 324 ASN C ND2 1 
ATOM   10609 N  N   . TYR C 1 325 ? 6.561   17.437  58.026  1.00 12.30 ? 325 TYR C N   1 
ATOM   10610 C  CA  . TYR C 1 325 ? 7.974   17.107  57.870  1.00 12.26 ? 325 TYR C CA  1 
ATOM   10611 C  C   . TYR C 1 325 ? 8.876   17.501  59.036  1.00 12.14 ? 325 TYR C C   1 
ATOM   10612 O  O   . TYR C 1 325 ? 9.683   16.692  59.497  1.00 12.12 ? 325 TYR C O   1 
ATOM   10613 C  CB  . TYR C 1 325 ? 8.522   17.722  56.586  1.00 11.83 ? 325 TYR C CB  1 
ATOM   10614 C  CG  . TYR C 1 325 ? 9.934   17.298  56.286  1.00 11.73 ? 325 TYR C CG  1 
ATOM   10615 C  CD1 . TYR C 1 325 ? 10.198  16.079  55.671  1.00 11.75 ? 325 TYR C CD1 1 
ATOM   10616 C  CD2 . TYR C 1 325 ? 11.010  18.119  56.609  1.00 11.79 ? 325 TYR C CD2 1 
ATOM   10617 C  CE1 . TYR C 1 325 ? 11.506  15.689  55.381  1.00 12.21 ? 325 TYR C CE1 1 
ATOM   10618 C  CE2 . TYR C 1 325 ? 12.317  17.742  56.325  1.00 12.24 ? 325 TYR C CE2 1 
ATOM   10619 C  CZ  . TYR C 1 325 ? 12.559  16.528  55.713  1.00 12.37 ? 325 TYR C CZ  1 
ATOM   10620 O  OH  . TYR C 1 325 ? 13.858  16.154  55.445  1.00 13.19 ? 325 TYR C OH  1 
ATOM   10621 N  N   . PHE C 1 326 ? 8.745   18.738  59.503  1.00 11.81 ? 326 PHE C N   1 
ATOM   10622 C  CA  . PHE C 1 326 ? 9.566   19.221  60.602  1.00 11.54 ? 326 PHE C CA  1 
ATOM   10623 C  C   . PHE C 1 326 ? 9.353   18.422  61.883  1.00 11.71 ? 326 PHE C C   1 
ATOM   10624 O  O   . PHE C 1 326 ? 10.305  17.925  62.485  1.00 11.75 ? 326 PHE C O   1 
ATOM   10625 C  CB  . PHE C 1 326 ? 9.263   20.694  60.878  1.00 11.60 ? 326 PHE C CB  1 
ATOM   10626 C  CG  . PHE C 1 326 ? 10.197  21.322  61.867  1.00 11.50 ? 326 PHE C CG  1 
ATOM   10627 C  CD1 . PHE C 1 326 ? 11.454  21.764  61.470  1.00 11.53 ? 326 PHE C CD1 1 
ATOM   10628 C  CD2 . PHE C 1 326 ? 9.835   21.442  63.207  1.00 11.42 ? 326 PHE C CD2 1 
ATOM   10629 C  CE1 . PHE C 1 326 ? 12.342  22.315  62.392  1.00 11.68 ? 326 PHE C CE1 1 
ATOM   10630 C  CE2 . PHE C 1 326 ? 10.715  21.993  64.141  1.00 11.48 ? 326 PHE C CE2 1 
ATOM   10631 C  CZ  . PHE C 1 326 ? 11.971  22.429  63.733  1.00 11.68 ? 326 PHE C CZ  1 
ATOM   10632 N  N   . ALA C 1 327 ? 8.092   18.301  62.287  1.00 11.78 ? 327 ALA C N   1 
ATOM   10633 C  CA  . ALA C 1 327 ? 7.726   17.596  63.512  1.00 11.68 ? 327 ALA C CA  1 
ATOM   10634 C  C   . ALA C 1 327 ? 8.001   16.096  63.522  1.00 11.39 ? 327 ALA C C   1 
ATOM   10635 O  O   . ALA C 1 327 ? 8.506   15.565  64.511  1.00 11.45 ? 327 ALA C O   1 
ATOM   10636 C  CB  . ALA C 1 327 ? 6.251   17.847  63.828  1.00 11.73 ? 327 ALA C CB  1 
ATOM   10637 N  N   . GLU C 1 328 ? 7.670   15.413  62.430  1.00 11.34 ? 328 GLU C N   1 
ATOM   10638 C  CA  . GLU C 1 328 ? 7.862   13.967  62.362  1.00 11.33 ? 328 GLU C CA  1 
ATOM   10639 C  C   . GLU C 1 328 ? 9.191   13.497  61.772  1.00 11.36 ? 328 GLU C C   1 
ATOM   10640 O  O   . GLU C 1 328 ? 9.688   12.428  62.138  1.00 11.00 ? 328 GLU C O   1 
ATOM   10641 C  CB  . GLU C 1 328 ? 6.707   13.332  61.579  1.00 11.53 ? 328 GLU C CB  1 
ATOM   10642 C  CG  . GLU C 1 328 ? 5.342   13.473  62.251  1.00 12.08 ? 328 GLU C CG  1 
ATOM   10643 C  CD  . GLU C 1 328 ? 4.181   13.364  61.273  1.00 12.38 ? 328 GLU C CD  1 
ATOM   10644 O  OE1 . GLU C 1 328 ? 3.381   14.318  61.184  1.00 12.57 ? 328 GLU C OE1 1 
ATOM   10645 O  OE2 . GLU C 1 328 ? 4.061   12.325  60.593  1.00 12.73 ? 328 GLU C OE2 1 
ATOM   10646 N  N   . VAL C 1 329 ? 9.771   14.290  60.874  1.00 11.33 ? 329 VAL C N   1 
ATOM   10647 C  CA  . VAL C 1 329 ? 11.020  13.901  60.230  1.00 11.50 ? 329 VAL C CA  1 
ATOM   10648 C  C   . VAL C 1 329 ? 12.275  14.654  60.667  1.00 11.65 ? 329 VAL C C   1 
ATOM   10649 O  O   . VAL C 1 329 ? 13.213  14.059  61.192  1.00 11.74 ? 329 VAL C O   1 
ATOM   10650 C  CB  . VAL C 1 329 ? 10.885  14.004  58.696  1.00 11.40 ? 329 VAL C CB  1 
ATOM   10651 C  CG1 . VAL C 1 329 ? 12.248  13.886  58.034  1.00 11.52 ? 329 VAL C CG1 1 
ATOM   10652 C  CG2 . VAL C 1 329 ? 9.955   12.909  58.191  1.00 11.23 ? 329 VAL C CG2 1 
ATOM   10653 N  N   . GLU C 1 330 ? 12.310  15.959  60.446  1.00 12.05 ? 330 GLU C N   1 
ATOM   10654 C  CA  . GLU C 1 330 ? 13.489  16.721  60.827  1.00 12.23 ? 330 GLU C CA  1 
ATOM   10655 C  C   . GLU C 1 330 ? 13.808  16.624  62.326  1.00 12.48 ? 330 GLU C C   1 
ATOM   10656 O  O   . GLU C 1 330 ? 14.959  16.794  62.730  1.00 12.89 ? 330 GLU C O   1 
ATOM   10657 C  CB  . GLU C 1 330 ? 13.324  18.184  60.415  1.00 11.91 ? 330 GLU C CB  1 
ATOM   10658 C  CG  . GLU C 1 330 ? 14.490  19.070  60.814  1.00 11.47 ? 330 GLU C CG  1 
ATOM   10659 C  CD  . GLU C 1 330 ? 15.799  18.645  60.184  1.00 11.19 ? 330 GLU C CD  1 
ATOM   10660 O  OE1 . GLU C 1 330 ? 15.798  18.281  58.992  1.00 11.31 ? 330 GLU C OE1 1 
ATOM   10661 O  OE2 . GLU C 1 330 ? 16.833  18.679  60.882  1.00 10.94 ? 330 GLU C OE2 1 
ATOM   10662 N  N   . GLN C 1 331 ? 12.809  16.332  63.152  1.00 12.41 ? 331 GLN C N   1 
ATOM   10663 C  CA  . GLN C 1 331 ? 13.046  16.247  64.591  1.00 12.27 ? 331 GLN C CA  1 
ATOM   10664 C  C   . GLN C 1 331 ? 13.318  14.843  65.117  1.00 12.19 ? 331 GLN C C   1 
ATOM   10665 O  O   . GLN C 1 331 ? 13.815  14.688  66.235  1.00 12.07 ? 331 GLN C O   1 
ATOM   10666 C  CB  . GLN C 1 331 ? 11.877  16.869  65.363  1.00 12.30 ? 331 GLN C CB  1 
ATOM   10667 C  CG  . GLN C 1 331 ? 12.053  18.361  65.632  1.00 12.36 ? 331 GLN C CG  1 
ATOM   10668 C  CD  . GLN C 1 331 ? 10.967  18.950  66.516  1.00 12.45 ? 331 GLN C CD  1 
ATOM   10669 O  OE1 . GLN C 1 331 ? 11.226  19.852  67.318  1.00 12.47 ? 331 GLN C OE1 1 
ATOM   10670 N  NE2 . GLN C 1 331 ? 9.745   18.448  66.371  1.00 12.53 ? 331 GLN C NE2 1 
ATOM   10671 N  N   . ILE C 1 332 ? 13.000  13.822  64.326  1.00 12.08 ? 332 ILE C N   1 
ATOM   10672 C  CA  . ILE C 1 332 ? 13.239  12.450  64.759  1.00 11.97 ? 332 ILE C CA  1 
ATOM   10673 C  C   . ILE C 1 332 ? 14.719  12.265  65.052  1.00 12.09 ? 332 ILE C C   1 
ATOM   10674 O  O   . ILE C 1 332 ? 15.571  12.774  64.323  1.00 12.20 ? 332 ILE C O   1 
ATOM   10675 C  CB  . ILE C 1 332 ? 12.843  11.420  63.684  1.00 11.97 ? 332 ILE C CB  1 
ATOM   10676 C  CG1 . ILE C 1 332 ? 13.038  10.003  64.230  1.00 12.07 ? 332 ILE C CG1 1 
ATOM   10677 C  CG2 . ILE C 1 332 ? 13.710  11.586  62.454  1.00 11.33 ? 332 ILE C CG2 1 
ATOM   10678 C  CD1 . ILE C 1 332 ? 11.884  9.073   63.943  1.00 12.97 ? 332 ILE C CD1 1 
ATOM   10679 N  N   . ALA C 1 333 ? 15.019  11.534  66.118  1.00 12.24 ? 333 ALA C N   1 
ATOM   10680 C  CA  . ALA C 1 333 ? 16.401  11.285  66.501  1.00 12.47 ? 333 ALA C CA  1 
ATOM   10681 C  C   . ALA C 1 333 ? 16.627  9.799   66.726  1.00 12.34 ? 333 ALA C C   1 
ATOM   10682 O  O   . ALA C 1 333 ? 15.863  9.157   67.445  1.00 12.54 ? 333 ALA C O   1 
ATOM   10683 C  CB  . ALA C 1 333 ? 16.733  12.057  67.764  1.00 12.44 ? 333 ALA C CB  1 
ATOM   10684 N  N   . PHE C 1 334 ? 17.677  9.258   66.112  1.00 11.79 ? 334 PHE C N   1 
ATOM   10685 C  CA  . PHE C 1 334 ? 17.999  7.842   66.253  1.00 11.38 ? 334 PHE C CA  1 
ATOM   10686 C  C   . PHE C 1 334 ? 19.259  7.651   67.089  1.00 11.09 ? 334 PHE C C   1 
ATOM   10687 O  O   . PHE C 1 334 ? 20.307  8.197   66.771  1.00 10.81 ? 334 PHE C O   1 
ATOM   10688 C  CB  . PHE C 1 334 ? 18.214  7.199   64.878  1.00 11.55 ? 334 PHE C CB  1 
ATOM   10689 C  CG  . PHE C 1 334 ? 17.007  7.248   63.976  1.00 11.39 ? 334 PHE C CG  1 
ATOM   10690 C  CD1 . PHE C 1 334 ? 16.777  8.351   63.161  1.00 11.40 ? 334 PHE C CD1 1 
ATOM   10691 C  CD2 . PHE C 1 334 ? 16.109  6.185   63.933  1.00 11.36 ? 334 PHE C CD2 1 
ATOM   10692 C  CE1 . PHE C 1 334 ? 15.673  8.395   62.316  1.00 11.29 ? 334 PHE C CE1 1 
ATOM   10693 C  CE2 . PHE C 1 334 ? 15.001  6.219   63.090  1.00 11.24 ? 334 PHE C CE2 1 
ATOM   10694 C  CZ  . PHE C 1 334 ? 14.783  7.327   62.280  1.00 11.28 ? 334 PHE C CZ  1 
ATOM   10695 N  N   . ASP C 1 335 ? 19.151  6.871   68.158  1.00 11.14 ? 335 ASP C N   1 
ATOM   10696 C  CA  . ASP C 1 335 ? 20.289  6.600   69.031  1.00 10.80 ? 335 ASP C CA  1 
ATOM   10697 C  C   . ASP C 1 335 ? 20.624  5.122   68.950  1.00 10.88 ? 335 ASP C C   1 
ATOM   10698 O  O   . ASP C 1 335 ? 19.814  4.278   69.322  1.00 11.05 ? 335 ASP C O   1 
ATOM   10699 C  CB  . ASP C 1 335 ? 19.953  6.968   70.478  1.00 10.54 ? 335 ASP C CB  1 
ATOM   10700 C  CG  . ASP C 1 335 ? 19.698  8.447   70.655  1.00 10.34 ? 335 ASP C CG  1 
ATOM   10701 O  OD1 . ASP C 1 335 ? 20.643  9.230   70.458  1.00 9.85  ? 335 ASP C OD1 1 
ATOM   10702 O  OD2 . ASP C 1 335 ? 18.557  8.829   70.989  1.00 10.24 ? 335 ASP C OD2 1 
ATOM   10703 N  N   . PRO C 1 336 ? 21.819  4.788   68.443  1.00 10.91 ? 336 PRO C N   1 
ATOM   10704 C  CA  . PRO C 1 336 ? 22.245  3.390   68.320  1.00 11.03 ? 336 PRO C CA  1 
ATOM   10705 C  C   . PRO C 1 336 ? 22.336  2.709   69.679  1.00 10.92 ? 336 PRO C C   1 
ATOM   10706 O  O   . PRO C 1 336 ? 22.313  1.485   69.771  1.00 10.75 ? 336 PRO C O   1 
ATOM   10707 C  CB  . PRO C 1 336 ? 23.610  3.485   67.635  1.00 11.04 ? 336 PRO C CB  1 
ATOM   10708 C  CG  . PRO C 1 336 ? 23.641  4.843   67.017  1.00 11.07 ? 336 PRO C CG  1 
ATOM   10709 C  CD  . PRO C 1 336 ? 22.842  5.714   67.938  1.00 11.04 ? 336 PRO C CD  1 
ATOM   10710 N  N   . SER C 1 337 ? 22.437  3.524   70.727  1.00 11.03 ? 337 SER C N   1 
ATOM   10711 C  CA  . SER C 1 337 ? 22.527  3.042   72.096  1.00 11.01 ? 337 SER C CA  1 
ATOM   10712 C  C   . SER C 1 337 ? 21.208  2.427   72.526  1.00 11.02 ? 337 SER C C   1 
ATOM   10713 O  O   . SER C 1 337 ? 21.183  1.505   73.337  1.00 10.92 ? 337 SER C O   1 
ATOM   10714 C  CB  . SER C 1 337 ? 22.876  4.194   73.021  1.00 11.44 ? 337 SER C CB  1 
ATOM   10715 O  OG  . SER C 1 337 ? 22.979  5.396   72.280  1.00 12.67 ? 337 SER C OG  1 
ATOM   10716 N  N   . ASN C 1 338 ? 20.113  2.947   71.980  1.00 11.32 ? 338 ASN C N   1 
ATOM   10717 C  CA  . ASN C 1 338 ? 18.780  2.445   72.295  1.00 11.48 ? 338 ASN C CA  1 
ATOM   10718 C  C   . ASN C 1 338 ? 18.629  0.996   71.836  1.00 11.56 ? 338 ASN C C   1 
ATOM   10719 O  O   . ASN C 1 338 ? 18.252  0.735   70.697  1.00 11.69 ? 338 ASN C O   1 
ATOM   10720 C  CB  . ASN C 1 338 ? 17.719  3.318   71.616  1.00 11.41 ? 338 ASN C CB  1 
ATOM   10721 C  CG  . ASN C 1 338 ? 17.638  4.714   72.222  1.00 11.58 ? 338 ASN C CG  1 
ATOM   10722 O  OD1 . ASN C 1 338 ? 17.303  5.687   71.538  1.00 11.25 ? 338 ASN C OD1 1 
ATOM   10723 N  ND2 . ASN C 1 338 ? 17.947  4.818   73.512  1.00 11.93 ? 338 ASN C ND2 1 
ATOM   10724 N  N   . MET C 1 339 ? 18.930  0.058   72.728  1.00 11.68 ? 339 MET C N   1 
ATOM   10725 C  CA  . MET C 1 339 ? 18.830  -1.365  72.422  1.00 11.74 ? 339 MET C CA  1 
ATOM   10726 C  C   . MET C 1 339 ? 18.237  -2.121  73.604  1.00 11.96 ? 339 MET C C   1 
ATOM   10727 O  O   . MET C 1 339 ? 18.888  -2.280  74.638  1.00 12.23 ? 339 MET C O   1 
ATOM   10728 C  CB  . MET C 1 339 ? 20.208  -1.949  72.114  1.00 11.52 ? 339 MET C CB  1 
ATOM   10729 C  CG  . MET C 1 339 ? 21.146  -1.021  71.363  1.00 11.23 ? 339 MET C CG  1 
ATOM   10730 S  SD  . MET C 1 339 ? 22.503  -1.936  70.601  1.00 10.89 ? 339 MET C SD  1 
ATOM   10731 C  CE  . MET C 1 339 ? 23.683  -1.967  71.937  1.00 10.97 ? 339 MET C CE  1 
ATOM   10732 N  N   . PRO C 1 340 ? 16.994  -2.611  73.466  1.00 11.92 ? 340 PRO C N   1 
ATOM   10733 C  CA  . PRO C 1 340 ? 16.327  -3.353  74.540  1.00 11.86 ? 340 PRO C CA  1 
ATOM   10734 C  C   . PRO C 1 340 ? 16.933  -4.731  74.809  1.00 11.67 ? 340 PRO C C   1 
ATOM   10735 O  O   . PRO C 1 340 ? 17.725  -5.236  74.018  1.00 11.51 ? 340 PRO C O   1 
ATOM   10736 C  CB  . PRO C 1 340 ? 14.880  -3.452  74.061  1.00 12.00 ? 340 PRO C CB  1 
ATOM   10737 C  CG  . PRO C 1 340 ? 14.987  -3.414  72.586  1.00 12.14 ? 340 PRO C CG  1 
ATOM   10738 C  CD  . PRO C 1 340 ? 16.138  -2.488  72.276  1.00 12.11 ? 340 PRO C CD  1 
ATOM   10739 N  N   . PRO C 1 341 ? 16.570  -5.348  75.948  1.00 11.78 ? 341 PRO C N   1 
ATOM   10740 C  CA  . PRO C 1 341 ? 17.069  -6.671  76.336  1.00 11.80 ? 341 PRO C CA  1 
ATOM   10741 C  C   . PRO C 1 341 ? 17.044  -7.676  75.192  1.00 11.73 ? 341 PRO C C   1 
ATOM   10742 O  O   . PRO C 1 341 ? 16.012  -7.875  74.552  1.00 11.63 ? 341 PRO C O   1 
ATOM   10743 C  CB  . PRO C 1 341 ? 16.138  -7.079  77.472  1.00 11.83 ? 341 PRO C CB  1 
ATOM   10744 C  CG  . PRO C 1 341 ? 15.715  -5.785  78.081  1.00 11.87 ? 341 PRO C CG  1 
ATOM   10745 C  CD  . PRO C 1 341 ? 15.655  -4.789  76.962  1.00 11.78 ? 341 PRO C CD  1 
ATOM   10746 N  N   . GLY C 1 342 ? 18.184  -8.310  74.945  1.00 11.74 ? 342 GLY C N   1 
ATOM   10747 C  CA  . GLY C 1 342 ? 18.270  -9.286  73.877  1.00 11.87 ? 342 GLY C CA  1 
ATOM   10748 C  C   . GLY C 1 342 ? 19.234  -8.827  72.803  1.00 11.91 ? 342 GLY C C   1 
ATOM   10749 O  O   . GLY C 1 342 ? 19.832  -9.639  72.092  1.00 12.09 ? 342 GLY C O   1 
ATOM   10750 N  N   . ILE C 1 343 ? 19.387  -7.512  72.687  1.00 11.81 ? 343 ILE C N   1 
ATOM   10751 C  CA  . ILE C 1 343 ? 20.285  -6.918  71.699  1.00 11.52 ? 343 ILE C CA  1 
ATOM   10752 C  C   . ILE C 1 343 ? 21.299  -6.021  72.397  1.00 11.17 ? 343 ILE C C   1 
ATOM   10753 O  O   . ILE C 1 343 ? 20.925  -5.090  73.104  1.00 11.07 ? 343 ILE C O   1 
ATOM   10754 C  CB  . ILE C 1 343 ? 19.512  -6.065  70.676  1.00 11.56 ? 343 ILE C CB  1 
ATOM   10755 C  CG1 . ILE C 1 343 ? 18.415  -6.899  70.018  1.00 11.61 ? 343 ILE C CG1 1 
ATOM   10756 C  CG2 . ILE C 1 343 ? 20.465  -5.530  69.630  1.00 11.77 ? 343 ILE C CG2 1 
ATOM   10757 C  CD1 . ILE C 1 343 ? 17.486  -6.085  69.137  1.00 11.62 ? 343 ILE C CD1 1 
ATOM   10758 N  N   . GLU C 1 344 ? 22.579  -6.307  72.194  1.00 10.98 ? 344 GLU C N   1 
ATOM   10759 C  CA  . GLU C 1 344 ? 23.645  -5.531  72.813  1.00 10.84 ? 344 GLU C CA  1 
ATOM   10760 C  C   . GLU C 1 344 ? 24.698  -5.145  71.783  1.00 11.06 ? 344 GLU C C   1 
ATOM   10761 O  O   . GLU C 1 344 ? 24.664  -5.607  70.643  1.00 10.73 ? 344 GLU C O   1 
ATOM   10762 C  CB  . GLU C 1 344 ? 24.302  -6.337  73.939  1.00 10.76 ? 344 GLU C CB  1 
ATOM   10763 C  CG  . GLU C 1 344 ? 23.323  -7.107  74.813  1.00 10.58 ? 344 GLU C CG  1 
ATOM   10764 C  CD  . GLU C 1 344 ? 23.840  -7.337  76.221  1.00 10.57 ? 344 GLU C CD  1 
ATOM   10765 O  OE1 . GLU C 1 344 ? 25.047  -7.111  76.478  1.00 10.57 ? 344 GLU C OE1 1 
ATOM   10766 O  OE2 . GLU C 1 344 ? 23.029  -7.751  77.075  1.00 10.33 ? 344 GLU C OE2 1 
ATOM   10767 N  N   . ALA C 1 345 ? 25.632  -4.295  72.198  1.00 11.60 ? 345 ALA C N   1 
ATOM   10768 C  CA  . ALA C 1 345 ? 26.706  -3.829  71.326  1.00 12.02 ? 345 ALA C CA  1 
ATOM   10769 C  C   . ALA C 1 345 ? 27.844  -4.836  71.300  1.00 12.17 ? 345 ALA C C   1 
ATOM   10770 O  O   . ALA C 1 345 ? 27.740  -5.902  71.903  1.00 12.64 ? 345 ALA C O   1 
ATOM   10771 C  CB  . ALA C 1 345 ? 27.219  -2.478  71.807  1.00 12.32 ? 345 ALA C CB  1 
ATOM   10772 N  N   . SER C 1 346 ? 28.925  -4.496  70.601  1.00 12.03 ? 346 SER C N   1 
ATOM   10773 C  CA  . SER C 1 346 ? 30.085  -5.382  70.500  1.00 11.87 ? 346 SER C CA  1 
ATOM   10774 C  C   . SER C 1 346 ? 31.383  -4.587  70.574  1.00 11.86 ? 346 SER C C   1 
ATOM   10775 O  O   . SER C 1 346 ? 31.372  -3.361  70.499  1.00 11.80 ? 346 SER C O   1 
ATOM   10776 C  CB  . SER C 1 346 ? 30.042  -6.164  69.189  1.00 11.62 ? 346 SER C CB  1 
ATOM   10777 O  OG  . SER C 1 346 ? 31.022  -5.680  68.292  1.00 11.64 ? 346 SER C OG  1 
ATOM   10778 N  N   . PRO C 1 347 ? 32.523  -5.279  70.727  1.00 11.96 ? 347 PRO C N   1 
ATOM   10779 C  CA  . PRO C 1 347 ? 33.817  -4.591  70.809  1.00 12.06 ? 347 PRO C CA  1 
ATOM   10780 C  C   . PRO C 1 347 ? 34.177  -3.720  69.601  1.00 12.35 ? 347 PRO C C   1 
ATOM   10781 O  O   . PRO C 1 347 ? 35.239  -3.091  69.589  1.00 12.41 ? 347 PRO C O   1 
ATOM   10782 C  CB  . PRO C 1 347 ? 34.821  -5.727  71.012  1.00 11.92 ? 347 PRO C CB  1 
ATOM   10783 C  CG  . PRO C 1 347 ? 34.012  -6.874  71.507  1.00 11.83 ? 347 PRO C CG  1 
ATOM   10784 C  CD  . PRO C 1 347 ? 32.673  -6.738  70.858  1.00 11.88 ? 347 PRO C CD  1 
ATOM   10785 N  N   . ASP C 1 348 ? 33.309  -3.677  68.589  1.00 12.50 ? 348 ASP C N   1 
ATOM   10786 C  CA  . ASP C 1 348 ? 33.596  -2.860  67.412  1.00 12.51 ? 348 ASP C CA  1 
ATOM   10787 C  C   . ASP C 1 348 ? 33.847  -1.416  67.831  1.00 12.35 ? 348 ASP C C   1 
ATOM   10788 O  O   . ASP C 1 348 ? 32.964  -0.751  68.368  1.00 12.38 ? 348 ASP C O   1 
ATOM   10789 C  CB  . ASP C 1 348 ? 32.444  -2.901  66.407  1.00 12.74 ? 348 ASP C CB  1 
ATOM   10790 C  CG  . ASP C 1 348 ? 32.743  -2.082  65.152  1.00 12.95 ? 348 ASP C CG  1 
ATOM   10791 O  OD1 . ASP C 1 348 ? 33.874  -1.568  65.029  1.00 12.89 ? 348 ASP C OD1 1 
ATOM   10792 O  OD2 . ASP C 1 348 ? 31.854  -1.948  64.287  1.00 13.20 ? 348 ASP C OD2 1 
ATOM   10793 N  N   . LYS C 1 349 ? 35.058  -0.936  67.577  1.00 12.09 ? 349 LYS C N   1 
ATOM   10794 C  CA  . LYS C 1 349 ? 35.427  0.425   67.947  1.00 12.08 ? 349 LYS C CA  1 
ATOM   10795 C  C   . LYS C 1 349 ? 34.518  1.493   67.334  1.00 12.06 ? 349 LYS C C   1 
ATOM   10796 O  O   . LYS C 1 349 ? 34.130  2.446   68.008  1.00 11.74 ? 349 LYS C O   1 
ATOM   10797 C  CB  . LYS C 1 349 ? 36.881  0.692   67.553  1.00 11.97 ? 349 LYS C CB  1 
ATOM   10798 C  CG  . LYS C 1 349 ? 37.894  -0.138  68.328  1.00 12.06 ? 349 LYS C CG  1 
ATOM   10799 C  CD  . LYS C 1 349 ? 39.284  -0.017  67.722  1.00 12.42 ? 349 LYS C CD  1 
ATOM   10800 C  CE  . LYS C 1 349 ? 40.238  -1.033  68.323  1.00 12.73 ? 349 LYS C CE  1 
ATOM   10801 N  NZ  . LYS C 1 349 ? 41.471  -0.383  68.850  1.00 13.38 ? 349 LYS C NZ  1 
ATOM   10802 N  N   . MET C 1 350 ? 34.187  1.339   66.058  1.00 12.29 ? 350 MET C N   1 
ATOM   10803 C  CA  . MET C 1 350 ? 33.333  2.302   65.375  1.00 12.55 ? 350 MET C CA  1 
ATOM   10804 C  C   . MET C 1 350 ? 31.961  2.386   66.031  1.00 12.78 ? 350 MET C C   1 
ATOM   10805 O  O   . MET C 1 350 ? 31.358  3.459   66.098  1.00 13.01 ? 350 MET C O   1 
ATOM   10806 C  CB  . MET C 1 350 ? 33.177  1.914   63.906  1.00 12.64 ? 350 MET C CB  1 
ATOM   10807 C  CG  . MET C 1 350 ? 34.294  2.419   63.026  1.00 12.60 ? 350 MET C CG  1 
ATOM   10808 S  SD  . MET C 1 350 ? 34.369  4.214   63.011  1.00 12.39 ? 350 MET C SD  1 
ATOM   10809 C  CE  . MET C 1 350 ? 33.806  4.553   61.358  1.00 12.06 ? 350 MET C CE  1 
ATOM   10810 N  N   . LEU C 1 351 ? 31.469  1.244   66.502  1.00 12.66 ? 351 LEU C N   1 
ATOM   10811 C  CA  . LEU C 1 351 ? 30.171  1.182   67.158  1.00 12.39 ? 351 LEU C CA  1 
ATOM   10812 C  C   . LEU C 1 351 ? 30.285  1.787   68.551  1.00 12.22 ? 351 LEU C C   1 
ATOM   10813 O  O   . LEU C 1 351 ? 29.447  2.592   68.957  1.00 12.20 ? 351 LEU C O   1 
ATOM   10814 C  CB  . LEU C 1 351 ? 29.699  -0.273  67.251  1.00 12.41 ? 351 LEU C CB  1 
ATOM   10815 C  CG  . LEU C 1 351 ? 28.461  -0.565  68.104  1.00 12.37 ? 351 LEU C CG  1 
ATOM   10816 C  CD1 . LEU C 1 351 ? 27.319  0.351   67.704  1.00 12.20 ? 351 LEU C CD1 1 
ATOM   10817 C  CD2 . LEU C 1 351 ? 28.058  -2.014  67.922  1.00 12.62 ? 351 LEU C CD2 1 
ATOM   10818 N  N   . GLN C 1 352 ? 31.333  1.395   69.270  1.00 12.06 ? 352 GLN C N   1 
ATOM   10819 C  CA  . GLN C 1 352 ? 31.588  1.887   70.618  1.00 12.01 ? 352 GLN C CA  1 
ATOM   10820 C  C   . GLN C 1 352 ? 31.482  3.408   70.678  1.00 12.23 ? 352 GLN C C   1 
ATOM   10821 O  O   . GLN C 1 352 ? 30.805  3.962   71.545  1.00 12.35 ? 352 GLN C O   1 
ATOM   10822 C  CB  . GLN C 1 352 ? 32.987  1.464   71.077  1.00 11.54 ? 352 GLN C CB  1 
ATOM   10823 C  CG  . GLN C 1 352 ? 33.121  -0.008  71.402  1.00 11.19 ? 352 GLN C CG  1 
ATOM   10824 C  CD  . GLN C 1 352 ? 32.436  -0.380  72.702  1.00 11.08 ? 352 GLN C CD  1 
ATOM   10825 O  OE1 . GLN C 1 352 ? 32.938  -0.093  73.786  1.00 11.13 ? 352 GLN C OE1 1 
ATOM   10826 N  NE2 . GLN C 1 352 ? 31.281  -1.021  72.599  1.00 11.05 ? 352 GLN C NE2 1 
ATOM   10827 N  N   . GLY C 1 353 ? 32.158  4.072   69.744  1.00 12.27 ? 353 GLY C N   1 
ATOM   10828 C  CA  . GLY C 1 353 ? 32.158  5.523   69.704  1.00 12.35 ? 353 GLY C CA  1 
ATOM   10829 C  C   . GLY C 1 353 ? 30.817  6.117   69.323  1.00 12.54 ? 353 GLY C C   1 
ATOM   10830 O  O   . GLY C 1 353 ? 30.526  7.278   69.638  1.00 12.33 ? 353 GLY C O   1 
ATOM   10831 N  N   . ARG C 1 354 ? 29.995  5.326   68.644  1.00 12.38 ? 354 ARG C N   1 
ATOM   10832 C  CA  . ARG C 1 354 ? 28.685  5.803   68.226  1.00 12.51 ? 354 ARG C CA  1 
ATOM   10833 C  C   . ARG C 1 354 ? 27.703  5.774   69.389  1.00 12.46 ? 354 ARG C C   1 
ATOM   10834 O  O   . ARG C 1 354 ? 26.708  6.501   69.393  1.00 12.68 ? 354 ARG C O   1 
ATOM   10835 C  CB  . ARG C 1 354 ? 28.161  4.965   67.057  1.00 12.62 ? 354 ARG C CB  1 
ATOM   10836 C  CG  . ARG C 1 354 ? 28.637  5.472   65.696  1.00 12.56 ? 354 ARG C CG  1 
ATOM   10837 C  CD  . ARG C 1 354 ? 28.381  4.473   64.588  1.00 12.49 ? 354 ARG C CD  1 
ATOM   10838 N  NE  . ARG C 1 354 ? 27.137  4.754   63.876  1.00 12.51 ? 354 ARG C NE  1 
ATOM   10839 C  CZ  . ARG C 1 354 ? 26.159  3.867   63.713  1.00 12.55 ? 354 ARG C CZ  1 
ATOM   10840 N  NH1 . ARG C 1 354 ? 26.287  2.646   64.214  1.00 12.54 ? 354 ARG C NH1 1 
ATOM   10841 N  NH2 . ARG C 1 354 ? 25.051  4.199   63.056  1.00 12.54 ? 354 ARG C NH2 1 
ATOM   10842 N  N   . LEU C 1 355 ? 28.000  4.949   70.387  1.00 12.24 ? 355 LEU C N   1 
ATOM   10843 C  CA  . LEU C 1 355 ? 27.141  4.830   71.558  1.00 11.82 ? 355 LEU C CA  1 
ATOM   10844 C  C   . LEU C 1 355 ? 27.069  6.137   72.340  1.00 11.65 ? 355 LEU C C   1 
ATOM   10845 O  O   . LEU C 1 355 ? 26.191  6.318   73.179  1.00 11.66 ? 355 LEU C O   1 
ATOM   10846 C  CB  . LEU C 1 355 ? 27.662  3.728   72.475  1.00 11.54 ? 355 LEU C CB  1 
ATOM   10847 C  CG  . LEU C 1 355 ? 27.767  2.330   71.882  1.00 11.29 ? 355 LEU C CG  1 
ATOM   10848 C  CD1 . LEU C 1 355 ? 28.354  1.390   72.918  1.00 11.42 ? 355 LEU C CD1 1 
ATOM   10849 C  CD2 . LEU C 1 355 ? 26.394  1.861   71.449  1.00 11.21 ? 355 LEU C CD2 1 
ATOM   10850 N  N   . PHE C 1 356 ? 27.996  7.044   72.060  1.00 11.55 ? 356 PHE C N   1 
ATOM   10851 C  CA  . PHE C 1 356 ? 28.042  8.324   72.758  1.00 11.62 ? 356 PHE C CA  1 
ATOM   10852 C  C   . PHE C 1 356 ? 27.671  9.491   71.858  1.00 11.74 ? 356 PHE C C   1 
ATOM   10853 O  O   . PHE C 1 356 ? 26.881  10.362  72.239  1.00 11.73 ? 356 PHE C O   1 
ATOM   10854 C  CB  . PHE C 1 356 ? 29.451  8.545   73.329  1.00 11.37 ? 356 PHE C CB  1 
ATOM   10855 C  CG  . PHE C 1 356 ? 29.784  9.987   73.608  1.00 11.15 ? 356 PHE C CG  1 
ATOM   10856 C  CD1 . PHE C 1 356 ? 29.483  10.560  74.838  1.00 10.97 ? 356 PHE C CD1 1 
ATOM   10857 C  CD2 . PHE C 1 356 ? 30.428  10.766  72.650  1.00 11.22 ? 356 PHE C CD2 1 
ATOM   10858 C  CE1 . PHE C 1 356 ? 29.821  11.889  75.112  1.00 10.94 ? 356 PHE C CE1 1 
ATOM   10859 C  CE2 . PHE C 1 356 ? 30.770  12.098  72.915  1.00 11.27 ? 356 PHE C CE2 1 
ATOM   10860 C  CZ  . PHE C 1 356 ? 30.465  12.658  74.151  1.00 11.06 ? 356 PHE C CZ  1 
ATOM   10861 N  N   . ALA C 1 357 ? 28.251  9.489   70.662  1.00 12.00 ? 357 ALA C N   1 
ATOM   10862 C  CA  . ALA C 1 357 ? 28.053  10.546  69.677  1.00 11.88 ? 357 ALA C CA  1 
ATOM   10863 C  C   . ALA C 1 357 ? 26.615  10.976  69.404  1.00 11.85 ? 357 ALA C C   1 
ATOM   10864 O  O   . ALA C 1 357 ? 26.312  12.170  69.409  1.00 11.97 ? 357 ALA C O   1 
ATOM   10865 C  CB  . ALA C 1 357 ? 28.728  10.149  68.376  1.00 12.14 ? 357 ALA C CB  1 
ATOM   10866 N  N   . TYR C 1 358 ? 25.728  10.017  69.171  1.00 11.85 ? 358 TYR C N   1 
ATOM   10867 C  CA  . TYR C 1 358 ? 24.339  10.347  68.871  1.00 11.89 ? 358 TYR C CA  1 
ATOM   10868 C  C   . TYR C 1 358 ? 23.553  10.999  70.004  1.00 11.98 ? 358 TYR C C   1 
ATOM   10869 O  O   . TYR C 1 358 ? 23.085  12.130  69.865  1.00 11.87 ? 358 TYR C O   1 
ATOM   10870 C  CB  . TYR C 1 358 ? 23.602  9.105   68.386  1.00 11.68 ? 358 TYR C CB  1 
ATOM   10871 C  CG  . TYR C 1 358 ? 24.104  8.591   67.066  1.00 11.61 ? 358 TYR C CG  1 
ATOM   10872 C  CD1 . TYR C 1 358 ? 25.323  7.924   66.981  1.00 11.71 ? 358 TYR C CD1 1 
ATOM   10873 C  CD2 . TYR C 1 358 ? 23.341  8.721   65.907  1.00 11.50 ? 358 TYR C CD2 1 
ATOM   10874 C  CE1 . TYR C 1 358 ? 25.765  7.388   65.781  1.00 11.52 ? 358 TYR C CE1 1 
ATOM   10875 C  CE2 . TYR C 1 358 ? 23.773  8.189   64.701  1.00 11.31 ? 358 TYR C CE2 1 
ATOM   10876 C  CZ  . TYR C 1 358 ? 24.982  7.519   64.650  1.00 11.31 ? 358 TYR C CZ  1 
ATOM   10877 O  OH  . TYR C 1 358 ? 25.385  6.914   63.492  1.00 10.71 ? 358 TYR C OH  1 
ATOM   10878 N  N   . PRO C 1 359 ? 23.389  10.299  71.139  1.00 12.06 ? 359 PRO C N   1 
ATOM   10879 C  CA  . PRO C 1 359 ? 22.636  10.909  72.243  1.00 12.18 ? 359 PRO C CA  1 
ATOM   10880 C  C   . PRO C 1 359 ? 23.211  12.269  72.632  1.00 12.24 ? 359 PRO C C   1 
ATOM   10881 O  O   . PRO C 1 359 ? 22.483  13.172  73.052  1.00 12.26 ? 359 PRO C O   1 
ATOM   10882 C  CB  . PRO C 1 359 ? 22.758  9.888   73.376  1.00 12.31 ? 359 PRO C CB  1 
ATOM   10883 C  CG  . PRO C 1 359 ? 23.063  8.587   72.689  1.00 12.35 ? 359 PRO C CG  1 
ATOM   10884 C  CD  . PRO C 1 359 ? 23.873  8.948   71.475  1.00 12.21 ? 359 PRO C CD  1 
ATOM   10885 N  N   . ASP C 1 360 ? 24.524  12.403  72.481  1.00 12.20 ? 360 ASP C N   1 
ATOM   10886 C  CA  . ASP C 1 360 ? 25.217  13.641  72.803  1.00 12.16 ? 360 ASP C CA  1 
ATOM   10887 C  C   . ASP C 1 360 ? 24.880  14.757  71.821  1.00 11.76 ? 360 ASP C C   1 
ATOM   10888 O  O   . ASP C 1 360 ? 24.567  15.872  72.227  1.00 11.72 ? 360 ASP C O   1 
ATOM   10889 C  CB  . ASP C 1 360 ? 26.730  13.409  72.808  1.00 12.55 ? 360 ASP C CB  1 
ATOM   10890 C  CG  . ASP C 1 360 ? 27.513  14.700  72.954  1.00 12.88 ? 360 ASP C CG  1 
ATOM   10891 O  OD1 . ASP C 1 360 ? 27.164  15.510  73.838  1.00 13.11 ? 360 ASP C OD1 1 
ATOM   10892 O  OD2 . ASP C 1 360 ? 28.475  14.903  72.182  1.00 13.10 ? 360 ASP C OD2 1 
ATOM   10893 N  N   . THR C 1 361 ? 24.948  14.456  70.528  1.00 11.70 ? 361 THR C N   1 
ATOM   10894 C  CA  . THR C 1 361 ? 24.655  15.452  69.499  1.00 11.41 ? 361 THR C CA  1 
ATOM   10895 C  C   . THR C 1 361 ? 23.178  15.832  69.477  1.00 11.32 ? 361 THR C C   1 
ATOM   10896 O  O   . THR C 1 361 ? 22.812  16.942  69.087  1.00 10.89 ? 361 THR C O   1 
ATOM   10897 C  CB  . THR C 1 361 ? 25.057  14.947  68.098  1.00 11.43 ? 361 THR C CB  1 
ATOM   10898 O  OG1 . THR C 1 361 ? 25.126  16.055  67.197  1.00 11.40 ? 361 THR C OG1 1 
ATOM   10899 C  CG2 . THR C 1 361 ? 24.042  13.939  67.570  1.00 11.89 ? 361 THR C CG2 1 
ATOM   10900 N  N   . HIS C 1 362 ? 22.331  14.902  69.901  1.00 11.27 ? 362 HIS C N   1 
ATOM   10901 C  CA  . HIS C 1 362 ? 20.900  15.150  69.927  1.00 11.71 ? 362 HIS C CA  1 
ATOM   10902 C  C   . HIS C 1 362 ? 20.557  16.175  71.001  1.00 11.84 ? 362 HIS C C   1 
ATOM   10903 O  O   . HIS C 1 362 ? 19.703  17.043  70.792  1.00 11.62 ? 362 HIS C O   1 
ATOM   10904 C  CB  . HIS C 1 362 ? 20.144  13.842  70.179  1.00 11.92 ? 362 HIS C CB  1 
ATOM   10905 C  CG  . HIS C 1 362 ? 20.170  12.902  69.016  1.00 12.27 ? 362 HIS C CG  1 
ATOM   10906 N  ND1 . HIS C 1 362 ? 20.215  11.532  69.163  1.00 12.39 ? 362 HIS C ND1 1 
ATOM   10907 C  CD2 . HIS C 1 362 ? 20.172  13.136  67.681  1.00 12.44 ? 362 HIS C CD2 1 
ATOM   10908 C  CE1 . HIS C 1 362 ? 20.244  10.962  67.972  1.00 12.47 ? 362 HIS C CE1 1 
ATOM   10909 N  NE2 . HIS C 1 362 ? 20.219  11.913  67.055  1.00 12.55 ? 362 HIS C NE2 1 
ATOM   10910 N  N   . ARG C 1 363 ? 21.238  16.076  72.142  1.00 12.09 ? 363 ARG C N   1 
ATOM   10911 C  CA  . ARG C 1 363 ? 21.012  16.989  73.260  1.00 12.36 ? 363 ARG C CA  1 
ATOM   10912 C  C   . ARG C 1 363 ? 21.326  18.426  72.869  1.00 12.35 ? 363 ARG C C   1 
ATOM   10913 O  O   . ARG C 1 363 ? 20.875  19.368  73.525  1.00 12.48 ? 363 ARG C O   1 
ATOM   10914 C  CB  . ARG C 1 363 ? 21.871  16.584  74.465  1.00 12.53 ? 363 ARG C CB  1 
ATOM   10915 C  CG  . ARG C 1 363 ? 21.290  15.431  75.288  1.00 12.82 ? 363 ARG C CG  1 
ATOM   10916 C  CD  . ARG C 1 363 ? 22.376  14.461  75.737  1.00 12.93 ? 363 ARG C CD  1 
ATOM   10917 N  NE  . ARG C 1 363 ? 21.842  13.341  76.509  1.00 13.13 ? 363 ARG C NE  1 
ATOM   10918 C  CZ  . ARG C 1 363 ? 22.469  12.176  76.675  1.00 13.28 ? 363 ARG C CZ  1 
ATOM   10919 N  NH1 . ARG C 1 363 ? 23.661  11.966  76.124  1.00 13.41 ? 363 ARG C NH1 1 
ATOM   10920 N  NH2 . ARG C 1 363 ? 21.912  11.219  77.406  1.00 13.21 ? 363 ARG C NH2 1 
ATOM   10921 N  N   . HIS C 1 364 ? 22.093  18.580  71.792  1.00 12.33 ? 364 HIS C N   1 
ATOM   10922 C  CA  . HIS C 1 364 ? 22.488  19.893  71.291  1.00 12.25 ? 364 HIS C CA  1 
ATOM   10923 C  C   . HIS C 1 364 ? 21.588  20.367  70.153  1.00 12.24 ? 364 HIS C C   1 
ATOM   10924 O  O   . HIS C 1 364 ? 21.073  21.486  70.184  1.00 12.14 ? 364 HIS C O   1 
ATOM   10925 C  CB  . HIS C 1 364 ? 23.942  19.851  70.813  1.00 12.33 ? 364 HIS C CB  1 
ATOM   10926 C  CG  . HIS C 1 364 ? 24.302  20.950  69.862  1.00 12.47 ? 364 HIS C CG  1 
ATOM   10927 N  ND1 . HIS C 1 364 ? 24.693  22.203  70.286  1.00 12.49 ? 364 HIS C ND1 1 
ATOM   10928 C  CD2 . HIS C 1 364 ? 24.335  20.982  68.509  1.00 12.54 ? 364 HIS C CD2 1 
ATOM   10929 C  CE1 . HIS C 1 364 ? 24.953  22.958  69.233  1.00 12.59 ? 364 HIS C CE1 1 
ATOM   10930 N  NE2 . HIS C 1 364 ? 24.743  22.241  68.143  1.00 12.67 ? 364 HIS C NE2 1 
ATOM   10931 N  N   . ARG C 1 365 ? 21.399  19.510  69.153  1.00 12.19 ? 365 ARG C N   1 
ATOM   10932 C  CA  . ARG C 1 365 ? 20.572  19.849  68.003  1.00 11.88 ? 365 ARG C CA  1 
ATOM   10933 C  C   . ARG C 1 365 ? 19.099  20.050  68.342  1.00 11.78 ? 365 ARG C C   1 
ATOM   10934 O  O   . ARG C 1 365 ? 18.464  20.958  67.812  1.00 11.95 ? 365 ARG C O   1 
ATOM   10935 C  CB  . ARG C 1 365 ? 20.693  18.774  66.922  1.00 12.06 ? 365 ARG C CB  1 
ATOM   10936 C  CG  . ARG C 1 365 ? 19.781  19.017  65.726  1.00 12.25 ? 365 ARG C CG  1 
ATOM   10937 C  CD  . ARG C 1 365 ? 20.156  18.157  64.536  1.00 12.53 ? 365 ARG C CD  1 
ATOM   10938 N  NE  . ARG C 1 365 ? 19.601  16.812  64.646  1.00 12.69 ? 365 ARG C NE  1 
ATOM   10939 C  CZ  . ARG C 1 365 ? 18.424  16.442  64.152  1.00 12.77 ? 365 ARG C CZ  1 
ATOM   10940 N  NH1 . ARG C 1 365 ? 17.669  17.324  63.506  1.00 12.59 ? 365 ARG C NH1 1 
ATOM   10941 N  NH2 . ARG C 1 365 ? 18.003  15.189  64.306  1.00 12.85 ? 365 ARG C NH2 1 
ATOM   10942 N  N   . LEU C 1 366 ? 18.551  19.207  69.214  1.00 11.62 ? 366 LEU C N   1 
ATOM   10943 C  CA  . LEU C 1 366 ? 17.143  19.319  69.594  1.00 11.36 ? 366 LEU C CA  1 
ATOM   10944 C  C   . LEU C 1 366 ? 16.944  19.820  71.023  1.00 11.30 ? 366 LEU C C   1 
ATOM   10945 O  O   . LEU C 1 366 ? 16.206  20.777  71.261  1.00 11.26 ? 366 LEU C O   1 
ATOM   10946 C  CB  . LEU C 1 366 ? 16.443  17.969  69.423  1.00 11.21 ? 366 LEU C CB  1 
ATOM   10947 C  CG  . LEU C 1 366 ? 16.536  17.354  68.025  1.00 11.09 ? 366 LEU C CG  1 
ATOM   10948 C  CD1 . LEU C 1 366 ? 16.350  15.851  68.117  1.00 11.24 ? 366 LEU C CD1 1 
ATOM   10949 C  CD2 . LEU C 1 366 ? 15.490  17.973  67.121  1.00 10.72 ? 366 LEU C CD2 1 
ATOM   10950 N  N   . GLY C 1 367 ? 17.603  19.173  71.975  1.00 11.21 ? 367 GLY C N   1 
ATOM   10951 C  CA  . GLY C 1 367 ? 17.466  19.587  73.357  1.00 11.17 ? 367 GLY C CA  1 
ATOM   10952 C  C   . GLY C 1 367 ? 17.717  18.443  74.309  1.00 10.92 ? 367 GLY C C   1 
ATOM   10953 O  O   . GLY C 1 367 ? 17.694  17.289  73.897  1.00 11.04 ? 367 GLY C O   1 
ATOM   10954 N  N   . PRO C 1 368 ? 17.954  18.733  75.597  1.00 11.15 ? 368 PRO C N   1 
ATOM   10955 C  CA  . PRO C 1 368 ? 18.213  17.693  76.598  1.00 11.06 ? 368 PRO C CA  1 
ATOM   10956 C  C   . PRO C 1 368 ? 17.023  16.760  76.795  1.00 11.09 ? 368 PRO C C   1 
ATOM   10957 O  O   . PRO C 1 368 ? 17.184  15.610  77.213  1.00 10.78 ? 368 PRO C O   1 
ATOM   10958 C  CB  . PRO C 1 368 ? 18.540  18.483  77.869  1.00 11.04 ? 368 PRO C CB  1 
ATOM   10959 C  CG  . PRO C 1 368 ? 18.839  19.874  77.406  1.00 11.18 ? 368 PRO C CG  1 
ATOM   10960 C  CD  . PRO C 1 368 ? 17.990  20.080  76.191  1.00 11.19 ? 368 PRO C CD  1 
ATOM   10961 N  N   . ASN C 1 369 ? 15.832  17.264  76.482  1.00 10.93 ? 369 ASN C N   1 
ATOM   10962 C  CA  . ASN C 1 369 ? 14.600  16.497  76.632  1.00 11.17 ? 369 ASN C CA  1 
ATOM   10963 C  C   . ASN C 1 369 ? 13.978  16.174  75.277  1.00 11.07 ? 369 ASN C C   1 
ATOM   10964 O  O   . ASN C 1 369 ? 12.757  16.172  75.117  1.00 11.05 ? 369 ASN C O   1 
ATOM   10965 C  CB  . ASN C 1 369 ? 13.605  17.282  77.491  1.00 11.33 ? 369 ASN C CB  1 
ATOM   10966 C  CG  . ASN C 1 369 ? 13.996  17.304  78.957  1.00 11.53 ? 369 ASN C CG  1 
ATOM   10967 O  OD1 . ASN C 1 369 ? 14.582  16.349  79.469  1.00 11.33 ? 369 ASN C OD1 1 
ATOM   10968 N  ND2 . ASN C 1 369 ? 13.672  18.397  79.640  1.00 11.86 ? 369 ASN C ND2 1 
ATOM   10969 N  N   . TYR C 1 370 ? 14.834  15.893  74.304  1.00 10.90 ? 370 TYR C N   1 
ATOM   10970 C  CA  . TYR C 1 370 ? 14.383  15.577  72.964  1.00 10.64 ? 370 TYR C CA  1 
ATOM   10971 C  C   . TYR C 1 370 ? 13.562  14.295  72.920  1.00 10.59 ? 370 TYR C C   1 
ATOM   10972 O  O   . TYR C 1 370 ? 12.785  14.076  71.992  1.00 10.57 ? 370 TYR C O   1 
ATOM   10973 C  CB  . TYR C 1 370 ? 15.588  15.468  72.031  1.00 10.73 ? 370 TYR C CB  1 
ATOM   10974 C  CG  . TYR C 1 370 ? 16.482  14.277  72.283  1.00 10.69 ? 370 TYR C CG  1 
ATOM   10975 C  CD1 . TYR C 1 370 ? 16.266  13.068  71.615  1.00 10.76 ? 370 TYR C CD1 1 
ATOM   10976 C  CD2 . TYR C 1 370 ? 17.573  14.367  73.147  1.00 10.62 ? 370 TYR C CD2 1 
ATOM   10977 C  CE1 . TYR C 1 370 ? 17.113  11.981  71.794  1.00 10.76 ? 370 TYR C CE1 1 
ATOM   10978 C  CE2 . TYR C 1 370 ? 18.430  13.283  73.334  1.00 10.67 ? 370 TYR C CE2 1 
ATOM   10979 C  CZ  . TYR C 1 370 ? 18.192  12.094  72.650  1.00 10.71 ? 370 TYR C CZ  1 
ATOM   10980 O  OH  . TYR C 1 370 ? 19.033  11.019  72.812  1.00 10.59 ? 370 TYR C OH  1 
ATOM   10981 N  N   . LEU C 1 371 ? 13.731  13.450  73.930  1.00 10.62 ? 371 LEU C N   1 
ATOM   10982 C  CA  . LEU C 1 371 ? 13.000  12.194  73.994  1.00 10.61 ? 371 LEU C CA  1 
ATOM   10983 C  C   . LEU C 1 371 ? 11.553  12.442  74.392  1.00 10.59 ? 371 LEU C C   1 
ATOM   10984 O  O   . LEU C 1 371 ? 10.803  11.506  74.652  1.00 10.43 ? 371 LEU C O   1 
ATOM   10985 C  CB  . LEU C 1 371 ? 13.666  11.243  74.986  1.00 10.71 ? 371 LEU C CB  1 
ATOM   10986 C  CG  . LEU C 1 371 ? 14.974  10.617  74.499  1.00 10.83 ? 371 LEU C CG  1 
ATOM   10987 C  CD1 . LEU C 1 371 ? 15.804  10.181  75.680  1.00 11.11 ? 371 LEU C CD1 1 
ATOM   10988 C  CD2 . LEU C 1 371 ? 14.672  9.428   73.609  1.00 11.03 ? 371 LEU C CD2 1 
ATOM   10989 N  N   . HIS C 1 372 ? 11.173  13.716  74.433  1.00 10.97 ? 372 HIS C N   1 
ATOM   10990 C  CA  . HIS C 1 372 ? 9.815   14.107  74.780  1.00 11.27 ? 372 HIS C CA  1 
ATOM   10991 C  C   . HIS C 1 372 ? 9.045   14.401  73.504  1.00 11.64 ? 372 HIS C C   1 
ATOM   10992 O  O   . HIS C 1 372 ? 7.826   14.252  73.457  1.00 11.76 ? 372 HIS C O   1 
ATOM   10993 C  CB  . HIS C 1 372 ? 9.824   15.349  75.672  1.00 11.51 ? 372 HIS C CB  1 
ATOM   10994 C  CG  . HIS C 1 372 ? 10.281  15.083  77.071  1.00 11.77 ? 372 HIS C CG  1 
ATOM   10995 N  ND1 . HIS C 1 372 ? 10.470  16.090  77.992  1.00 11.87 ? 372 HIS C ND1 1 
ATOM   10996 C  CD2 . HIS C 1 372 ? 10.595  13.929  77.703  1.00 11.91 ? 372 HIS C CD2 1 
ATOM   10997 C  CE1 . HIS C 1 372 ? 10.883  15.567  79.133  1.00 12.04 ? 372 HIS C CE1 1 
ATOM   10998 N  NE2 . HIS C 1 372 ? 10.967  14.257  78.983  1.00 12.15 ? 372 HIS C NE2 1 
ATOM   10999 N  N   . ILE C 1 373 ? 9.760   14.839  72.471  1.00 11.83 ? 373 ILE C N   1 
ATOM   11000 C  CA  . ILE C 1 373 ? 9.132   15.116  71.186  1.00 11.97 ? 373 ILE C CA  1 
ATOM   11001 C  C   . ILE C 1 373 ? 8.467   13.800  70.776  1.00 12.06 ? 373 ILE C C   1 
ATOM   11002 O  O   . ILE C 1 373 ? 9.109   12.750  70.772  1.00 12.37 ? 373 ILE C O   1 
ATOM   11003 C  CB  . ILE C 1 373 ? 10.181  15.542  70.129  1.00 11.75 ? 373 ILE C CB  1 
ATOM   11004 C  CG1 . ILE C 1 373 ? 10.846  16.848  70.559  1.00 11.30 ? 373 ILE C CG1 1 
ATOM   11005 C  CG2 . ILE C 1 373 ? 9.522   15.741  68.773  1.00 12.10 ? 373 ILE C CG2 1 
ATOM   11006 C  CD1 . ILE C 1 373 ? 12.276  16.989  70.097  1.00 10.48 ? 373 ILE C CD1 1 
ATOM   11007 N  N   . PRO C 1 374 ? 7.168   13.843  70.437  1.00 12.03 ? 374 PRO C N   1 
ATOM   11008 C  CA  . PRO C 1 374 ? 6.387   12.669  70.034  1.00 12.00 ? 374 PRO C CA  1 
ATOM   11009 C  C   . PRO C 1 374 ? 7.148   11.598  69.263  1.00 12.01 ? 374 PRO C C   1 
ATOM   11010 O  O   . PRO C 1 374 ? 7.424   10.522  69.788  1.00 11.91 ? 374 PRO C O   1 
ATOM   11011 C  CB  . PRO C 1 374 ? 5.249   13.270  69.226  1.00 11.98 ? 374 PRO C CB  1 
ATOM   11012 C  CG  . PRO C 1 374 ? 5.015   14.590  69.873  1.00 11.97 ? 374 PRO C CG  1 
ATOM   11013 C  CD  . PRO C 1 374 ? 6.352   15.071  70.395  1.00 12.09 ? 374 PRO C CD  1 
ATOM   11014 N  N   . VAL C 1 375 ? 7.487   11.899  68.015  1.00 12.27 ? 375 VAL C N   1 
ATOM   11015 C  CA  . VAL C 1 375 ? 8.208   10.963  67.161  1.00 12.30 ? 375 VAL C CA  1 
ATOM   11016 C  C   . VAL C 1 375 ? 9.345   10.258  67.876  1.00 12.58 ? 375 VAL C C   1 
ATOM   11017 O  O   . VAL C 1 375 ? 9.731   9.157   67.495  1.00 12.86 ? 375 VAL C O   1 
ATOM   11018 C  CB  . VAL C 1 375 ? 8.804   11.670  65.940  1.00 12.11 ? 375 VAL C CB  1 
ATOM   11019 C  CG1 . VAL C 1 375 ? 8.028   11.280  64.691  1.00 11.94 ? 375 VAL C CG1 1 
ATOM   11020 C  CG2 . VAL C 1 375 ? 8.781   13.171  66.150  1.00 11.89 ? 375 VAL C CG2 1 
ATOM   11021 N  N   . ASN C 1 376 ? 9.886   10.895  68.907  1.00 12.81 ? 376 ASN C N   1 
ATOM   11022 C  CA  . ASN C 1 376 ? 10.994  10.317  69.655  1.00 12.94 ? 376 ASN C CA  1 
ATOM   11023 C  C   . ASN C 1 376 ? 10.557  9.620   70.942  1.00 13.04 ? 376 ASN C C   1 
ATOM   11024 O  O   . ASN C 1 376 ? 11.196  8.660   71.372  1.00 13.26 ? 376 ASN C O   1 
ATOM   11025 C  CB  . ASN C 1 376 ? 12.022  11.404  69.966  1.00 12.69 ? 376 ASN C CB  1 
ATOM   11026 C  CG  . ASN C 1 376 ? 12.623  12.015  68.707  1.00 12.40 ? 376 ASN C CG  1 
ATOM   11027 O  OD1 . ASN C 1 376 ? 12.941  11.310  67.749  1.00 11.91 ? 376 ASN C OD1 1 
ATOM   11028 N  ND2 . ASN C 1 376 ? 12.778  13.331  68.705  1.00 12.33 ? 376 ASN C ND2 1 
ATOM   11029 N  N   . CYS C 1 377 ? 9.473   10.095  71.549  1.00 12.59 ? 377 CYS C N   1 
ATOM   11030 C  CA  . CYS C 1 377 ? 8.963   9.500   72.785  1.00 12.46 ? 377 CYS C CA  1 
ATOM   11031 C  C   . CYS C 1 377 ? 8.617   8.027   72.554  1.00 12.36 ? 377 CYS C C   1 
ATOM   11032 O  O   . CYS C 1 377 ? 8.024   7.678   71.538  1.00 12.26 ? 377 CYS C O   1 
ATOM   11033 C  CB  . CYS C 1 377 ? 7.721   10.271  73.269  1.00 11.99 ? 377 CYS C CB  1 
ATOM   11034 S  SG  . CYS C 1 377 ? 6.811   9.521   74.655  1.00 10.94 ? 377 CYS C SG  1 
ATOM   11035 N  N   . PRO C 1 378 ? 8.996   7.143   73.496  1.00 12.31 ? 378 PRO C N   1 
ATOM   11036 C  CA  . PRO C 1 378 ? 8.724   5.699   73.395  1.00 12.32 ? 378 PRO C CA  1 
ATOM   11037 C  C   . PRO C 1 378 ? 7.336   5.340   73.920  1.00 12.30 ? 378 PRO C C   1 
ATOM   11038 O  O   . PRO C 1 378 ? 7.208   4.642   74.919  1.00 12.60 ? 378 PRO C O   1 
ATOM   11039 C  CB  . PRO C 1 378 ? 9.829   5.074   74.236  1.00 12.36 ? 378 PRO C CB  1 
ATOM   11040 C  CG  . PRO C 1 378 ? 10.159  6.137   75.274  1.00 12.29 ? 378 PRO C CG  1 
ATOM   11041 C  CD  . PRO C 1 378 ? 9.726   7.483   74.732  1.00 12.27 ? 378 PRO C CD  1 
ATOM   11042 N  N   . TYR C 1 379 ? 6.305   5.806   73.222  1.00 12.30 ? 379 TYR C N   1 
ATOM   11043 C  CA  . TYR C 1 379 ? 4.911   5.594   73.619  1.00 12.11 ? 379 TYR C CA  1 
ATOM   11044 C  C   . TYR C 1 379 ? 4.425   4.166   73.865  1.00 11.70 ? 379 TYR C C   1 
ATOM   11045 O  O   . TYR C 1 379 ? 3.409   3.970   74.527  1.00 11.51 ? 379 TYR C O   1 
ATOM   11046 C  CB  . TYR C 1 379 ? 3.976   6.277   72.608  1.00 12.24 ? 379 TYR C CB  1 
ATOM   11047 C  CG  . TYR C 1 379 ? 3.903   5.583   71.266  1.00 12.40 ? 379 TYR C CG  1 
ATOM   11048 C  CD1 . TYR C 1 379 ? 2.860   4.707   70.968  1.00 12.42 ? 379 TYR C CD1 1 
ATOM   11049 C  CD2 . TYR C 1 379 ? 4.878   5.803   70.293  1.00 12.51 ? 379 TYR C CD2 1 
ATOM   11050 C  CE1 . TYR C 1 379 ? 2.788   4.067   69.735  1.00 12.51 ? 379 TYR C CE1 1 
ATOM   11051 C  CE2 . TYR C 1 379 ? 4.814   5.167   69.055  1.00 12.61 ? 379 TYR C CE2 1 
ATOM   11052 C  CZ  . TYR C 1 379 ? 3.768   4.301   68.783  1.00 12.61 ? 379 TYR C CZ  1 
ATOM   11053 O  OH  . TYR C 1 379 ? 3.710   3.658   67.565  1.00 12.86 ? 379 TYR C OH  1 
ATOM   11054 N  N   . ARG C 1 380 ? 5.127   3.170   73.343  1.00 11.63 ? 380 ARG C N   1 
ATOM   11055 C  CA  . ARG C 1 380 ? 4.701   1.790   73.555  1.00 11.80 ? 380 ARG C CA  1 
ATOM   11056 C  C   . ARG C 1 380 ? 5.358   1.211   74.811  1.00 11.99 ? 380 ARG C C   1 
ATOM   11057 O  O   . ARG C 1 380 ? 5.262   0.016   75.095  1.00 12.04 ? 380 ARG C O   1 
ATOM   11058 C  CB  . ARG C 1 380 ? 5.041   0.942   72.328  1.00 11.68 ? 380 ARG C CB  1 
ATOM   11059 C  CG  . ARG C 1 380 ? 4.183   1.261   71.120  1.00 11.64 ? 380 ARG C CG  1 
ATOM   11060 C  CD  . ARG C 1 380 ? 3.045   0.275   70.981  1.00 11.85 ? 380 ARG C CD  1 
ATOM   11061 N  NE  . ARG C 1 380 ? 3.483   -0.966  70.344  1.00 12.27 ? 380 ARG C NE  1 
ATOM   11062 C  CZ  . ARG C 1 380 ? 3.500   -2.152  70.947  1.00 12.56 ? 380 ARG C CZ  1 
ATOM   11063 N  NH1 . ARG C 1 380 ? 3.099   -2.262  72.211  1.00 13.33 ? 380 ARG C NH1 1 
ATOM   11064 N  NH2 . ARG C 1 380 ? 3.920   -3.231  70.292  1.00 12.36 ? 380 ARG C NH2 1 
ATOM   11065 N  N   . ALA C 1 381 ? 6.028   2.079   75.557  1.00 11.99 ? 381 ALA C N   1 
ATOM   11066 C  CA  . ALA C 1 381 ? 6.701   1.694   76.786  1.00 11.99 ? 381 ALA C CA  1 
ATOM   11067 C  C   . ALA C 1 381 ? 6.312   2.691   77.867  1.00 12.39 ? 381 ALA C C   1 
ATOM   11068 O  O   . ALA C 1 381 ? 5.685   3.714   77.581  1.00 12.24 ? 381 ALA C O   1 
ATOM   11069 C  CB  . ALA C 1 381 ? 8.207   1.705   76.583  1.00 11.76 ? 381 ALA C CB  1 
ATOM   11070 N  N   . ARG C 1 382 ? 6.675   2.388   79.108  1.00 12.59 ? 382 ARG C N   1 
ATOM   11071 C  CA  . ARG C 1 382 ? 6.370   3.273   80.221  1.00 12.75 ? 382 ARG C CA  1 
ATOM   11072 C  C   . ARG C 1 382 ? 7.665   3.789   80.832  1.00 12.72 ? 382 ARG C C   1 
ATOM   11073 O  O   . ARG C 1 382 ? 8.396   3.043   81.479  1.00 13.05 ? 382 ARG C O   1 
ATOM   11074 C  CB  . ARG C 1 382 ? 5.560   2.536   81.289  1.00 13.03 ? 382 ARG C CB  1 
ATOM   11075 C  CG  . ARG C 1 382 ? 5.728   3.106   82.701  1.00 13.05 ? 382 ARG C CG  1 
ATOM   11076 C  CD  . ARG C 1 382 ? 4.738   4.234   82.972  1.00 12.83 ? 382 ARG C CD  1 
ATOM   11077 N  NE  . ARG C 1 382 ? 3.923   3.974   84.159  1.00 12.65 ? 382 ARG C NE  1 
ATOM   11078 C  CZ  . ARG C 1 382 ? 3.000   3.019   84.248  1.00 12.57 ? 382 ARG C CZ  1 
ATOM   11079 N  NH1 . ARG C 1 382 ? 2.762   2.216   83.218  1.00 12.57 ? 382 ARG C NH1 1 
ATOM   11080 N  NH2 . ARG C 1 382 ? 2.306   2.867   85.369  1.00 12.51 ? 382 ARG C NH2 1 
ATOM   11081 N  N   . VAL C 1 383 ? 7.955   5.067   80.623  1.00 12.56 ? 383 VAL C N   1 
ATOM   11082 C  CA  . VAL C 1 383 ? 9.167   5.645   81.180  1.00 12.28 ? 383 VAL C CA  1 
ATOM   11083 C  C   . VAL C 1 383 ? 8.956   5.956   82.658  1.00 12.19 ? 383 VAL C C   1 
ATOM   11084 O  O   . VAL C 1 383 ? 8.039   6.690   83.021  1.00 12.04 ? 383 VAL C O   1 
ATOM   11085 C  CB  . VAL C 1 383 ? 9.570   6.931   80.429  1.00 12.04 ? 383 VAL C CB  1 
ATOM   11086 C  CG1 . VAL C 1 383 ? 10.930  7.403   80.908  1.00 11.84 ? 383 VAL C CG1 1 
ATOM   11087 C  CG2 . VAL C 1 383 ? 9.610   6.665   78.935  1.00 11.82 ? 383 VAL C CG2 1 
ATOM   11088 N  N   . ALA C 1 384 ? 9.799   5.372   83.504  1.00 12.15 ? 384 ALA C N   1 
ATOM   11089 C  CA  . ALA C 1 384 ? 9.719   5.570   84.951  1.00 12.18 ? 384 ALA C CA  1 
ATOM   11090 C  C   . ALA C 1 384 ? 11.104  5.409   85.549  1.00 12.36 ? 384 ALA C C   1 
ATOM   11091 O  O   . ALA C 1 384 ? 11.570  4.288   85.758  1.00 12.26 ? 384 ALA C O   1 
ATOM   11092 C  CB  . ALA C 1 384 ? 8.774   4.554   85.570  1.00 12.24 ? 384 ALA C CB  1 
ATOM   11093 N  N   . ASN C 1 385 ? 11.761  6.531   85.823  1.00 12.55 ? 385 ASN C N   1 
ATOM   11094 C  CA  . ASN C 1 385 ? 13.101  6.503   86.385  1.00 12.67 ? 385 ASN C CA  1 
ATOM   11095 C  C   . ASN C 1 385 ? 13.287  7.556   87.469  1.00 12.72 ? 385 ASN C C   1 
ATOM   11096 O  O   . ASN C 1 385 ? 12.367  7.839   88.231  1.00 12.87 ? 385 ASN C O   1 
ATOM   11097 C  CB  . ASN C 1 385 ? 14.127  6.713   85.274  1.00 12.92 ? 385 ASN C CB  1 
ATOM   11098 C  CG  . ASN C 1 385 ? 13.830  7.937   84.437  1.00 13.13 ? 385 ASN C CG  1 
ATOM   11099 O  OD1 . ASN C 1 385 ? 13.318  8.942   84.944  1.00 13.14 ? 385 ASN C OD1 1 
ATOM   11100 N  ND2 . ASN C 1 385 ? 14.144  7.864   83.144  1.00 13.39 ? 385 ASN C ND2 1 
ATOM   11101 N  N   . TYR C 1 386 ? 14.485  8.131   87.534  1.00 12.91 ? 386 TYR C N   1 
ATOM   11102 C  CA  . TYR C 1 386 ? 14.793  9.152   88.530  1.00 12.82 ? 386 TYR C CA  1 
ATOM   11103 C  C   . TYR C 1 386 ? 15.398  10.407  87.923  1.00 12.71 ? 386 TYR C C   1 
ATOM   11104 O  O   . TYR C 1 386 ? 16.171  11.111  88.566  1.00 12.98 ? 386 TYR C O   1 
ATOM   11105 C  CB  . TYR C 1 386 ? 15.725  8.572   89.593  1.00 12.61 ? 386 TYR C CB  1 
ATOM   11106 C  CG  . TYR C 1 386 ? 15.050  7.499   90.401  1.00 12.45 ? 386 TYR C CG  1 
ATOM   11107 C  CD1 . TYR C 1 386 ? 15.302  6.151   90.154  1.00 12.44 ? 386 TYR C CD1 1 
ATOM   11108 C  CD2 . TYR C 1 386 ? 14.102  7.831   91.371  1.00 12.29 ? 386 TYR C CD2 1 
ATOM   11109 C  CE1 . TYR C 1 386 ? 14.622  5.156   90.849  1.00 12.52 ? 386 TYR C CE1 1 
ATOM   11110 C  CE2 . TYR C 1 386 ? 13.417  6.851   92.073  1.00 12.37 ? 386 TYR C CE2 1 
ATOM   11111 C  CZ  . TYR C 1 386 ? 13.677  5.514   91.809  1.00 12.47 ? 386 TYR C CZ  1 
ATOM   11112 O  OH  . TYR C 1 386 ? 12.984  4.541   92.498  1.00 12.60 ? 386 TYR C OH  1 
ATOM   11113 N  N   . GLN C 1 387 ? 15.041  10.677  86.675  1.00 12.69 ? 387 GLN C N   1 
ATOM   11114 C  CA  . GLN C 1 387 ? 15.520  11.861  85.978  1.00 12.63 ? 387 GLN C CA  1 
ATOM   11115 C  C   . GLN C 1 387 ? 14.413  12.905  86.080  1.00 12.51 ? 387 GLN C C   1 
ATOM   11116 O  O   . GLN C 1 387 ? 13.229  12.575  85.997  1.00 12.24 ? 387 GLN C O   1 
ATOM   11117 C  CB  . GLN C 1 387 ? 15.799  11.544  84.503  1.00 12.78 ? 387 GLN C CB  1 
ATOM   11118 C  CG  . GLN C 1 387 ? 16.572  10.251  84.259  1.00 13.04 ? 387 GLN C CG  1 
ATOM   11119 C  CD  . GLN C 1 387 ? 17.106  10.157  82.839  1.00 13.15 ? 387 GLN C CD  1 
ATOM   11120 O  OE1 . GLN C 1 387 ? 16.927  11.072  82.036  1.00 13.45 ? 387 GLN C OE1 1 
ATOM   11121 N  NE2 . GLN C 1 387 ? 17.763  9.048   82.523  1.00 12.98 ? 387 GLN C NE2 1 
ATOM   11122 N  N   . ARG C 1 388 ? 14.793  14.162  86.270  1.00 12.39 ? 388 ARG C N   1 
ATOM   11123 C  CA  . ARG C 1 388 ? 13.812  15.231  86.386  1.00 12.34 ? 388 ARG C CA  1 
ATOM   11124 C  C   . ARG C 1 388 ? 14.317  16.505  85.745  1.00 12.45 ? 388 ARG C C   1 
ATOM   11125 O  O   . ARG C 1 388 ? 15.460  16.579  85.307  1.00 12.89 ? 388 ARG C O   1 
ATOM   11126 C  CB  . ARG C 1 388 ? 13.504  15.527  87.854  1.00 12.14 ? 388 ARG C CB  1 
ATOM   11127 C  CG  . ARG C 1 388 ? 12.994  14.353  88.645  1.00 11.96 ? 388 ARG C CG  1 
ATOM   11128 C  CD  . ARG C 1 388 ? 11.667  13.872  88.108  1.00 12.11 ? 388 ARG C CD  1 
ATOM   11129 N  NE  . ARG C 1 388 ? 11.537  12.432  88.286  1.00 12.14 ? 388 ARG C NE  1 
ATOM   11130 C  CZ  . ARG C 1 388 ? 11.062  11.860  89.384  1.00 12.11 ? 388 ARG C CZ  1 
ATOM   11131 N  NH1 . ARG C 1 388 ? 10.666  12.611  90.405  1.00 12.04 ? 388 ARG C NH1 1 
ATOM   11132 N  NH2 . ARG C 1 388 ? 11.001  10.536  89.463  1.00 11.87 ? 388 ARG C NH2 1 
ATOM   11133 N  N   . ASP C 1 389 ? 13.445  17.505  85.703  1.00 12.57 ? 389 ASP C N   1 
ATOM   11134 C  CA  . ASP C 1 389 ? 13.766  18.813  85.152  1.00 12.30 ? 389 ASP C CA  1 
ATOM   11135 C  C   . ASP C 1 389 ? 14.313  18.798  83.731  1.00 12.38 ? 389 ASP C C   1 
ATOM