data_1QRP
# 
_entry.id   1QRP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QRP         
RCSB  RCSB009187   
WWPDB D_1000009187 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QRP 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fujinaga, M.'   1 
'Cherney, M.M.'  2 
'Tarasova, N.I.' 3 
'Bartlett, P.A.' 4 
'Hanson, J.E.'   5 
'James, M.N.G.'  6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural study of the complex between human pepsin and a phosphorus-containing peptidic -transition-state analog.' 
'Acta Crystallogr.,Sect.D' 56 272 279 2000 ABCRE6 DK 0907-4449 0766 ? 10713513 10.1107/S0907444999016376 
1       'Crystal structure of human pepsin and its complex with pepstatin'                                                    
'Protein Sci.'             4  960 972 1995 PRCIEI US 0961-8368 0795 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fujinaga, M.'   1  
primary 'Cherney, M.M.'  2  
primary 'Tarasova, N.I.' 3  
primary 'Bartlett, P.A.' 4  
primary 'Hanson, J.E.'   5  
primary 'James, M.N.'    6  
1       'Fujinaga, M.'   7  
1       'Chernaia, M.M.' 8  
1       'Tarasova, N.I.' 9  
1       'Mosimann, S.C.' 10 
1       'James, M.N.G.'  11 
# 
_cell.entry_id           1QRP 
_cell.length_a           71.900 
_cell.length_b           151.270 
_cell.length_c           40.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1QRP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PEPSIN 3A' 34631.887 1   ? ? ? ? 
2 non-polymer syn 
;methyl N-[(2S)-2-({(S)-hydroxy[(1R)-3-methyl-1-{[N-(3-methylbutanoyl)-L-valyl-L-valyl]amino}butyl]phosphoryl}oxy)-3-phenylpropanoyl]-L-alanyl-L-alaninate
;
753.863   1   ? ? ? ? 
3 water       nat water 18.015    135 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSM
TGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQ
SGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASEN
SDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQV
GLAPVA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSM
TGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQ
SGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASEN
SDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQV
GLAPVA
;
_entity_poly.pdbx_strand_id                 E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ASP n 
1 3   GLU n 
1 4   GLN n 
1 5   PRO n 
1 6   LEU n 
1 7   GLU n 
1 8   ASN n 
1 9   TYR n 
1 10  LEU n 
1 11  ASP n 
1 12  MET n 
1 13  GLU n 
1 14  TYR n 
1 15  PHE n 
1 16  GLY n 
1 17  THR n 
1 18  ILE n 
1 19  GLY n 
1 20  ILE n 
1 21  GLY n 
1 22  THR n 
1 23  PRO n 
1 24  ALA n 
1 25  GLN n 
1 26  ASP n 
1 27  PHE n 
1 28  THR n 
1 29  VAL n 
1 30  VAL n 
1 31  PHE n 
1 32  ASP n 
1 33  THR n 
1 34  GLY n 
1 35  SER n 
1 36  SER n 
1 37  ASN n 
1 38  LEU n 
1 39  TRP n 
1 40  VAL n 
1 41  PRO n 
1 42  SER n 
1 43  VAL n 
1 44  TYR n 
1 45  CYS n 
1 46  SER n 
1 47  SER n 
1 48  LEU n 
1 49  ALA n 
1 50  CYS n 
1 51  THR n 
1 52  ASN n 
1 53  HIS n 
1 54  ASN n 
1 55  ARG n 
1 56  PHE n 
1 57  ASN n 
1 58  PRO n 
1 59  GLU n 
1 60  ASP n 
1 61  SER n 
1 62  SER n 
1 63  THR n 
1 64  TYR n 
1 65  GLN n 
1 66  SER n 
1 67  THR n 
1 68  SER n 
1 69  GLU n 
1 70  THR n 
1 71  VAL n 
1 72  SER n 
1 73  ILE n 
1 74  THR n 
1 75  TYR n 
1 76  GLY n 
1 77  THR n 
1 78  GLY n 
1 79  SER n 
1 80  MET n 
1 81  THR n 
1 82  GLY n 
1 83  ILE n 
1 84  LEU n 
1 85  GLY n 
1 86  TYR n 
1 87  ASP n 
1 88  THR n 
1 89  VAL n 
1 90  GLN n 
1 91  VAL n 
1 92  GLY n 
1 93  GLY n 
1 94  ILE n 
1 95  SER n 
1 96  ASP n 
1 97  THR n 
1 98  ASN n 
1 99  GLN n 
1 100 ILE n 
1 101 PHE n 
1 102 GLY n 
1 103 LEU n 
1 104 SER n 
1 105 GLU n 
1 106 THR n 
1 107 GLU n 
1 108 PRO n 
1 109 GLY n 
1 110 SER n 
1 111 PHE n 
1 112 LEU n 
1 113 TYR n 
1 114 TYR n 
1 115 ALA n 
1 116 PRO n 
1 117 PHE n 
1 118 ASP n 
1 119 GLY n 
1 120 ILE n 
1 121 LEU n 
1 122 GLY n 
1 123 LEU n 
1 124 ALA n 
1 125 TYR n 
1 126 PRO n 
1 127 SER n 
1 128 ILE n 
1 129 SER n 
1 130 SER n 
1 131 SER n 
1 132 GLY n 
1 133 ALA n 
1 134 THR n 
1 135 PRO n 
1 136 VAL n 
1 137 PHE n 
1 138 ASP n 
1 139 ASN n 
1 140 ILE n 
1 141 TRP n 
1 142 ASN n 
1 143 GLN n 
1 144 GLY n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 GLN n 
1 149 ASP n 
1 150 LEU n 
1 151 PHE n 
1 152 SER n 
1 153 VAL n 
1 154 TYR n 
1 155 LEU n 
1 156 SER n 
1 157 ALA n 
1 158 ASP n 
1 159 ASP n 
1 160 GLN n 
1 161 SER n 
1 162 GLY n 
1 163 SER n 
1 164 VAL n 
1 165 VAL n 
1 166 ILE n 
1 167 PHE n 
1 168 GLY n 
1 169 GLY n 
1 170 ILE n 
1 171 ASP n 
1 172 SER n 
1 173 SER n 
1 174 TYR n 
1 175 TYR n 
1 176 THR n 
1 177 GLY n 
1 178 SER n 
1 179 LEU n 
1 180 ASN n 
1 181 TRP n 
1 182 VAL n 
1 183 PRO n 
1 184 VAL n 
1 185 THR n 
1 186 VAL n 
1 187 GLU n 
1 188 GLY n 
1 189 TYR n 
1 190 TRP n 
1 191 GLN n 
1 192 ILE n 
1 193 THR n 
1 194 VAL n 
1 195 ASP n 
1 196 SER n 
1 197 ILE n 
1 198 THR n 
1 199 MET n 
1 200 ASN n 
1 201 GLY n 
1 202 GLU n 
1 203 ALA n 
1 204 ILE n 
1 205 ALA n 
1 206 CYS n 
1 207 ALA n 
1 208 GLU n 
1 209 GLY n 
1 210 CYS n 
1 211 GLN n 
1 212 ALA n 
1 213 ILE n 
1 214 VAL n 
1 215 ASP n 
1 216 THR n 
1 217 GLY n 
1 218 THR n 
1 219 SER n 
1 220 LEU n 
1 221 LEU n 
1 222 THR n 
1 223 GLY n 
1 224 PRO n 
1 225 THR n 
1 226 SER n 
1 227 PRO n 
1 228 ILE n 
1 229 ALA n 
1 230 ASN n 
1 231 ILE n 
1 232 GLN n 
1 233 SER n 
1 234 ASP n 
1 235 ILE n 
1 236 GLY n 
1 237 ALA n 
1 238 SER n 
1 239 GLU n 
1 240 ASN n 
1 241 SER n 
1 242 ASP n 
1 243 GLY n 
1 244 ASP n 
1 245 MET n 
1 246 VAL n 
1 247 VAL n 
1 248 SER n 
1 249 CYS n 
1 250 SER n 
1 251 ALA n 
1 252 ILE n 
1 253 SER n 
1 254 SER n 
1 255 LEU n 
1 256 PRO n 
1 257 ASP n 
1 258 ILE n 
1 259 VAL n 
1 260 PHE n 
1 261 THR n 
1 262 ILE n 
1 263 ASN n 
1 264 GLY n 
1 265 VAL n 
1 266 GLN n 
1 267 TYR n 
1 268 PRO n 
1 269 VAL n 
1 270 PRO n 
1 271 PRO n 
1 272 SER n 
1 273 ALA n 
1 274 TYR n 
1 275 ILE n 
1 276 LEU n 
1 277 GLN n 
1 278 SER n 
1 279 GLU n 
1 280 GLY n 
1 281 SER n 
1 282 CYS n 
1 283 ILE n 
1 284 SER n 
1 285 GLY n 
1 286 PHE n 
1 287 GLN n 
1 288 GLY n 
1 289 MET n 
1 290 ASN n 
1 291 LEU n 
1 292 PRO n 
1 293 THR n 
1 294 GLU n 
1 295 SER n 
1 296 GLY n 
1 297 GLU n 
1 298 LEU n 
1 299 TRP n 
1 300 ILE n 
1 301 LEU n 
1 302 GLY n 
1 303 ASP n 
1 304 VAL n 
1 305 PHE n 
1 306 ILE n 
1 307 ARG n 
1 308 GLN n 
1 309 TYR n 
1 310 PHE n 
1 311 THR n 
1 312 VAL n 
1 313 PHE n 
1 314 ASP n 
1 315 ARG n 
1 316 ALA n 
1 317 ASN n 
1 318 ASN n 
1 319 GLN n 
1 320 VAL n 
1 321 GLY n 
1 322 LEU n 
1 323 ALA n 
1 324 PRO n 
1 325 VAL n 
1 326 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PEPA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00790 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QRP 
_struct_ref_seq.pdbx_strand_id                E 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 326 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00790 
_struct_ref_seq.db_align_beg                  63 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  388 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       326 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                       'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?                                       'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                       'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                       'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ?                                       'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                                       'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                       'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?                                       'C2 H5 N O2'       75.067  
HH0 peptide-like        . 
;methyl N-[(2S)-2-({(S)-hydroxy[(1R)-3-methyl-1-{[N-(3-methylbutanoyl)-L-valyl-L-valyl]amino}butyl]phosphoryl}oxy)-3-phenylpropanoyl]-L-alanyl-L-alaninate
;
'IVA-VAL-VAL-LEU(P)-(O)PHE-ALA-ALA-OME' 'C36 H60 N5 O10 P' 753.863 
HIS 'L-peptide linking' y HISTIDINE ?                                       'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?                                       'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                       'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ?                                       'C6 H13 N O2'      131.173 
MET 'L-peptide linking' y METHIONINE ?                                       'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                                       'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?                                       'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?                                       'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ?                                       'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                       'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?                                       'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?                                       'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1QRP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.14 
_exptl_crystal.density_percent_sol   60.77 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'40% AMMONIUM SULFATE, 100MM SODIUM ACETATE, 5% MPD, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'UCSD MARK III' 
_diffrn_detector.pdbx_collection_date   1994-08-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QRP 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   3.0 
_reflns.d_resolution_low             65 
_reflns.d_resolution_high            1.96 
_reflns.number_obs                   ? 
_reflns.number_all                   31990 
_reflns.percent_possible_obs         89.3 
_reflns.pdbx_Rmerge_I_obs            0.108 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.96 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   64.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1QRP 
_refine.ls_number_reflns_obs                     31976 
_refine.ls_number_reflns_all                     31976 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            1.96 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          0.2 
_refine.ls_R_factor_all                          0.2 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'GROMOS87 FORCE FIELD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2438 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               2625 
_refine_hist.d_res_high                       1.96 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QRP 
_struct.title                     'Human pepsin 3A in complex with a phosphonate inhibitor IVA-VAL-VAL-LEU(P)-(O)PHE-ALA-ALA-OME' 
_struct.pdbx_descriptor           'PEPSIN 3A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QRP 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'ASPARTIC PROTEINASE, PHOSPHONATE INHIBITOR, TRANSITION STATE ANALOGUE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 47  ? ASN A 52  ? SER E 47  ASN E 52  1 ? 6  
HELX_P HELX_P2  2  ASN A 57  ? SER A 61  ? ASN E 57  SER E 61  5 ? 5  
HELX_P HELX_P3  3  GLY A 109 ? ALA A 115 ? GLY E 109 ALA E 115 1 ? 7  
HELX_P HELX_P4  4  TYR A 125 ? SER A 129 ? TYR E 125 SER E 129 5 ? 5  
HELX_P HELX_P5  5  SER A 129 ? ALA A 133 ? SER E 129 ALA E 133 5 ? 5  
HELX_P HELX_P6  6  PRO A 135 ? GLN A 143 ? PRO E 135 GLN E 143 1 ? 9  
HELX_P HELX_P7  7  ASP A 171 ? TYR A 174 ? ASP E 171 TYR E 174 5 ? 4  
HELX_P HELX_P8  8  PRO A 224 ? ILE A 235 ? PRO E 224 ILE E 235 1 ? 12 
HELX_P HELX_P9  9  SER A 248 ? LEU A 255 ? SER E 248 LEU E 255 5 ? 8  
HELX_P HELX_P10 10 PRO A 270 ? TYR A 274 ? PRO E 270 TYR E 274 1 ? 5  
HELX_P HELX_P11 11 GLY A 302 ? GLN A 308 ? GLY E 302 GLN E 308 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 45  SG ? ? ? 1_555 A CYS 50  SG ? ? E CYS 45  E CYS 50  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf2 disulf ? ? A CYS 206 SG ? ? ? 1_555 A CYS 210 SG ? ? E CYS 206 E CYS 210 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf3 disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 282 SG ? ? E CYS 249 E CYS 282 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          THR 
_struct_mon_prot_cis.label_seq_id           22 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           THR 
_struct_mon_prot_cis.auth_seq_id            22 
_struct_mon_prot_cis.auth_asym_id           E 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    23 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     23 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    E 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
C ? 3 ? 
D ? 4 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 3   ? PRO A 5   ? GLU E 3   PRO E 5   
A 2 VAL A 164 ? PHE A 167 ? VAL E 164 PHE E 167 
A 3 LEU A 150 ? TYR A 154 ? LEU E 150 TYR E 154 
A 4 TYR A 309 ? ASP A 314 ? TYR E 309 ASP E 314 
A 5 GLN A 319 ? PRO A 324 ? GLN E 319 PRO E 324 
A 6 ASN A 180 ? PRO A 183 ? ASN E 180 PRO E 183 
C 1 GLN A 191 ? VAL A 194 ? GLN E 191 VAL E 194 
C 2 CYS A 210 ? VAL A 214 ? CYS E 210 VAL E 214 
C 3 TRP A 299 ? LEU A 301 ? TRP E 299 LEU E 301 
D 1 GLU A 202 ? ALA A 205 ? GLU E 202 ALA E 205 
D 2 SER A 196 ? MET A 199 ? SER E 196 MET E 199 
D 3 ILE A 258 ? ILE A 262 ? ILE E 258 ILE E 262 
D 4 VAL A 265 ? VAL A 269 ? VAL E 265 VAL E 269 
E 1 LEU A 221 ? GLY A 223 ? LEU E 221 GLY E 223 
E 2 PHE A 286 ? GLY A 288 ? PHE E 286 GLY E 288 
F 1 SER A 238 ? GLU A 239 ? SER E 238 GLU E 239 
F 2 MET A 245 ? VAL A 247 ? MET E 245 VAL E 247 
F 3 SER A 281 ? SER A 284 ? SER E 281 SER E 284 
F 4 ILE A 275 ? SER A 278 ? ILE E 275 SER E 278 
G 1 PRO A 292 ? THR A 293 ? PRO E 292 THR E 293 
G 2 GLY A 296 ? GLU A 297 ? GLY E 296 GLU E 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 4   ? O GLN E 4   N VAL A 165 ? N VAL E 165 
A 2 3 N ILE A 166 ? N ILE E 166 O SER A 152 ? O SER E 152 
A 3 4 N VAL A 153 ? N VAL E 153 O THR A 311 ? O THR E 311 
A 4 5 N ASP A 314 ? N ASP E 314 O GLN A 319 ? O GLN E 319 
A 5 6 N LEU A 322 ? N LEU E 322 O ASN A 180 ? O ASN E 180 
C 1 2 N VAL A 194 ? N VAL E 194 O CYS A 210 ? O CYS E 210 
C 2 3 N ILE A 213 ? N ILE E 213 O TRP A 299 ? O TRP E 299 
D 1 2 N ILE A 204 ? N ILE E 204 O ILE A 197 ? O ILE E 197 
D 2 3 O THR A 198 ? O THR E 198 N VAL A 259 ? N VAL E 259 
D 3 4 N ILE A 262 ? N ILE E 262 O VAL A 265 ? O VAL E 265 
E 1 2 O LEU A 221 ? O LEU E 221 N GLN A 287 ? N GLN E 287 
F 1 2 O SER A 238 ? O SER E 238 N VAL A 246 ? N VAL E 246 
F 2 3 N VAL A 247 ? N VAL E 247 O CYS A 282 ? O CYS E 282 
F 3 4 N ILE A 283 ? N ILE E 283 O LEU A 276 ? O LEU E 276 
G 1 2 N THR A 293 ? N THR E 293 O GLY A 296 ? O GLY E 296 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    17 
_struct_site.details              'BINDING SITE FOR RESIDUE HH0 E 327' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 MET A 12  ? MET E 12  . ? 1_555 ? 
2  AC1 17 GLU A 13  ? GLU E 13  . ? 1_555 ? 
3  AC1 17 ASP A 32  ? ASP E 32  . ? 1_555 ? 
4  AC1 17 GLY A 34  ? GLY E 34  . ? 1_555 ? 
5  AC1 17 SER A 35  ? SER E 35  . ? 1_555 ? 
6  AC1 17 THR A 74  ? THR E 74  . ? 1_555 ? 
7  AC1 17 TYR A 75  ? TYR E 75  . ? 1_555 ? 
8  AC1 17 GLY A 76  ? GLY E 76  . ? 1_555 ? 
9  AC1 17 THR A 77  ? THR E 77  . ? 1_555 ? 
10 AC1 17 PHE A 111 ? PHE E 111 . ? 1_555 ? 
11 AC1 17 TYR A 189 ? TYR E 189 . ? 1_555 ? 
12 AC1 17 ILE A 213 ? ILE E 213 . ? 1_555 ? 
13 AC1 17 ASP A 215 ? ASP E 215 . ? 1_555 ? 
14 AC1 17 GLY A 217 ? GLY E 217 . ? 1_555 ? 
15 AC1 17 THR A 218 ? THR E 218 . ? 1_555 ? 
16 AC1 17 SER A 219 ? SER E 219 . ? 1_555 ? 
17 AC1 17 HOH C .   ? HOH E 461 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QRP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QRP 
_atom_sites.fract_transf_matrix[1][1]   0.013908 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006611 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024516 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 1   ? 30.360  35.912 12.953  1.00 92.71 ? 1   VAL E N   1 
ATOM   2    C CA  . VAL A 1 1   ? 31.267  35.369 11.894  1.00 99.99 ? 1   VAL E CA  1 
ATOM   3    C C   . VAL A 1 1   ? 30.807  34.002 11.329  1.00 91.56 ? 1   VAL E C   1 
ATOM   4    O O   . VAL A 1 1   ? 30.788  33.787 10.120  1.00 99.99 ? 1   VAL E O   1 
ATOM   5    C CB  . VAL A 1 1   ? 32.730  35.373 12.397  1.00 99.99 ? 1   VAL E CB  1 
ATOM   6    C CG1 . VAL A 1 1   ? 32.996  34.449 13.601  1.00 99.99 ? 1   VAL E CG1 1 
ATOM   7    C CG2 . VAL A 1 1   ? 33.738  35.069 11.271  1.00 94.69 ? 1   VAL E CG2 1 
ATOM   8    N N   . ASP A 1 2   ? 30.366  33.137 12.249  1.00 38.88 ? 2   ASP E N   1 
ATOM   9    C CA  . ASP A 1 2   ? 30.012  31.721 11.922  1.00 99.99 ? 2   ASP E CA  1 
ATOM   10   C C   . ASP A 1 2   ? 28.688  31.483 11.139  1.00 99.99 ? 2   ASP E C   1 
ATOM   11   O O   . ASP A 1 2   ? 27.735  30.859 11.601  1.00 33.90 ? 2   ASP E O   1 
ATOM   12   C CB  . ASP A 1 2   ? 30.057  30.823 13.180  1.00 25.59 ? 2   ASP E CB  1 
ATOM   13   C CG  . ASP A 1 2   ? 31.422  30.579 13.847  1.00 99.99 ? 2   ASP E CG  1 
ATOM   14   O OD1 . ASP A 1 2   ? 31.382  30.407 15.097  1.00 53.97 ? 2   ASP E OD1 1 
ATOM   15   O OD2 . ASP A 1 2   ? 32.460  30.572 13.154  1.00 54.67 ? 2   ASP E OD2 1 
ATOM   16   N N   . GLU A 1 3   ? 28.666  31.921 9.876   1.00 35.96 ? 3   GLU E N   1 
ATOM   17   C CA  . GLU A 1 3   ? 27.485  31.724 8.993   1.00 34.82 ? 3   GLU E CA  1 
ATOM   18   C C   . GLU A 1 3   ? 27.541  30.434 8.156   1.00 85.36 ? 3   GLU E C   1 
ATOM   19   O O   . GLU A 1 3   ? 28.581  29.864 7.840   1.00 53.98 ? 3   GLU E O   1 
ATOM   20   C CB  . GLU A 1 3   ? 27.222  32.941 8.099   1.00 29.13 ? 3   GLU E CB  1 
ATOM   21   C CG  . GLU A 1 3   ? 26.858  34.179 8.930   1.00 51.31 ? 3   GLU E CG  1 
ATOM   22   C CD  . GLU A 1 3   ? 26.351  35.407 8.154   1.00 25.17 ? 3   GLU E CD  1 
ATOM   23   O OE1 . GLU A 1 3   ? 26.290  36.491 8.797   1.00 59.09 ? 3   GLU E OE1 1 
ATOM   24   O OE2 . GLU A 1 3   ? 25.950  35.255 6.986   1.00 99.99 ? 3   GLU E OE2 1 
ATOM   25   N N   . GLN A 1 4   ? 26.331  29.908 7.958   1.00 27.18 ? 4   GLN E N   1 
ATOM   26   C CA  . GLN A 1 4   ? 26.074  28.696 7.151   1.00 21.65 ? 4   GLN E CA  1 
ATOM   27   C C   . GLN A 1 4   ? 25.032  29.047 6.081   1.00 18.51 ? 4   GLN E C   1 
ATOM   28   O O   . GLN A 1 4   ? 23.880  29.329 6.431   1.00 25.96 ? 4   GLN E O   1 
ATOM   29   C CB  . GLN A 1 4   ? 25.576  27.622 8.118   1.00 20.15 ? 4   GLN E CB  1 
ATOM   30   C CG  . GLN A 1 4   ? 25.058  26.342 7.447   1.00 17.61 ? 4   GLN E CG  1 
ATOM   31   C CD  . GLN A 1 4   ? 26.135  25.460 6.826   1.00 17.91 ? 4   GLN E CD  1 
ATOM   32   O OE1 . GLN A 1 4   ? 27.183  25.175 7.397   1.00 55.27 ? 4   GLN E OE1 1 
ATOM   33   N NE2 . GLN A 1 4   ? 25.883  24.975 5.641   1.00 21.72 ? 4   GLN E NE2 1 
ATOM   34   N N   . PRO A 1 5   ? 25.419  29.192 4.794   1.00 25.10 ? 5   PRO E N   1 
ATOM   35   C CA  . PRO A 1 5   ? 24.469  29.517 3.729   1.00 12.33 ? 5   PRO E CA  1 
ATOM   36   C C   . PRO A 1 5   ? 23.600  28.320 3.411   1.00 8.36  ? 5   PRO E C   1 
ATOM   37   O O   . PRO A 1 5   ? 23.995  27.162 3.597   1.00 15.73 ? 5   PRO E O   1 
ATOM   38   C CB  . PRO A 1 5   ? 25.322  29.958 2.541   1.00 13.70 ? 5   PRO E CB  1 
ATOM   39   C CG  . PRO A 1 5   ? 26.632  29.219 2.772   1.00 23.95 ? 5   PRO E CG  1 
ATOM   40   C CD  . PRO A 1 5   ? 26.803  29.209 4.293   1.00 14.27 ? 5   PRO E CD  1 
ATOM   41   N N   . LEU A 1 6   ? 22.336  28.654 3.232   1.00 9.74  ? 6   LEU E N   1 
ATOM   42   C CA  . LEU A 1 6   ? 21.282  27.681 2.919   1.00 10.91 ? 6   LEU E CA  1 
ATOM   43   C C   . LEU A 1 6   ? 20.782  27.904 1.503   1.00 11.75 ? 6   LEU E C   1 
ATOM   44   O O   . LEU A 1 6   ? 20.628  29.028 0.992   1.00 18.38 ? 6   LEU E O   1 
ATOM   45   C CB  . LEU A 1 6   ? 20.057  27.744 3.862   1.00 12.61 ? 6   LEU E CB  1 
ATOM   46   C CG  . LEU A 1 6   ? 20.351  27.660 5.360   1.00 10.01 ? 6   LEU E CG  1 
ATOM   47   C CD1 . LEU A 1 6   ? 19.033  27.843 6.121   1.00 6.46  ? 6   LEU E CD1 1 
ATOM   48   C CD2 . LEU A 1 6   ? 21.062  26.361 5.742   1.00 12.74 ? 6   LEU E CD2 1 
ATOM   49   N N   . GLU A 1 7   ? 20.595  26.781 0.821   1.00 12.58 ? 7   GLU E N   1 
ATOM   50   C CA  . GLU A 1 7   ? 19.927  26.769 -0.505  1.00 15.74 ? 7   GLU E CA  1 
ATOM   51   C C   . GLU A 1 7   ? 18.405  26.702 -0.306  1.00 20.59 ? 7   GLU E C   1 
ATOM   52   O O   . GLU A 1 7   ? 17.898  25.989 0.556   1.00 18.52 ? 7   GLU E O   1 
ATOM   53   C CB  . GLU A 1 7   ? 20.439  25.563 -1.301  1.00 11.62 ? 7   GLU E CB  1 
ATOM   54   C CG  . GLU A 1 7   ? 20.276  25.747 -2.812  1.00 99.99 ? 7   GLU E CG  1 
ATOM   55   C CD  . GLU A 1 7   ? 20.580  24.462 -3.587  1.00 99.99 ? 7   GLU E CD  1 
ATOM   56   O OE1 . GLU A 1 7   ? 21.663  23.869 -3.316  1.00 99.99 ? 7   GLU E OE1 1 
ATOM   57   O OE2 . GLU A 1 7   ? 19.731  24.096 -4.417  1.00 99.99 ? 7   GLU E OE2 1 
ATOM   58   N N   . ASN A 1 8   ? 17.709  27.602 -1.016  1.00 14.03 ? 8   ASN E N   1 
ATOM   59   C CA  . ASN A 1 8   ? 16.247  27.721 -1.077  1.00 18.47 ? 8   ASN E CA  1 
ATOM   60   C C   . ASN A 1 8   ? 15.708  26.924 -2.267  1.00 34.67 ? 8   ASN E C   1 
ATOM   61   O O   . ASN A 1 8   ? 15.996  27.238 -3.424  1.00 21.53 ? 8   ASN E O   1 
ATOM   62   C CB  . ASN A 1 8   ? 15.837  29.207 -1.198  1.00 6.74  ? 8   ASN E CB  1 
ATOM   63   C CG  . ASN A 1 8   ? 14.318  29.433 -1.320  1.00 14.38 ? 8   ASN E CG  1 
ATOM   64   O OD1 . ASN A 1 8   ? 13.524  28.537 -1.563  1.00 18.76 ? 8   ASN E OD1 1 
ATOM   65   N ND2 . ASN A 1 8   ? 13.874  30.659 -1.101  1.00 10.29 ? 8   ASN E ND2 1 
ATOM   66   N N   . TYR A 1 9   ? 14.965  25.873 -1.957  1.00 13.01 ? 9   TYR E N   1 
ATOM   67   C CA  . TYR A 1 9   ? 14.324  25.014 -2.962  1.00 12.80 ? 9   TYR E CA  1 
ATOM   68   C C   . TYR A 1 9   ? 12.814  25.279 -3.046  1.00 14.37 ? 9   TYR E C   1 
ATOM   69   O O   . TYR A 1 9   ? 12.001  24.795 -2.253  1.00 13.70 ? 9   TYR E O   1 
ATOM   70   C CB  . TYR A 1 9   ? 14.649  23.538 -2.678  1.00 14.51 ? 9   TYR E CB  1 
ATOM   71   C CG  . TYR A 1 9   ? 14.099  22.567 -3.730  1.00 19.42 ? 9   TYR E CG  1 
ATOM   72   C CD1 . TYR A 1 9   ? 12.828  21.952 -3.524  1.00 18.82 ? 9   TYR E CD1 1 
ATOM   73   C CD2 . TYR A 1 9   ? 14.850  22.300 -4.902  1.00 36.15 ? 9   TYR E CD2 1 
ATOM   74   C CE1 . TYR A 1 9   ? 12.332  21.072 -4.496  1.00 19.54 ? 9   TYR E CE1 1 
ATOM   75   C CE2 . TYR A 1 9   ? 14.351  21.416 -5.862  1.00 51.74 ? 9   TYR E CE2 1 
ATOM   76   C CZ  . TYR A 1 9   ? 13.092  20.791 -5.651  1.00 99.99 ? 9   TYR E CZ  1 
ATOM   77   O OH  . TYR A 1 9   ? 12.687  19.828 -6.514  1.00 58.39 ? 9   TYR E OH  1 
ATOM   78   N N   . LEU A 1 10  ? 12.484  26.157 -3.997  1.00 21.17 ? 10  LEU E N   1 
ATOM   79   C CA  . LEU A 1 10  ? 11.089  26.461 -4.436  1.00 23.18 ? 10  LEU E CA  1 
ATOM   80   C C   . LEU A 1 10  ? 10.190  27.042 -3.324  1.00 16.91 ? 10  LEU E C   1 
ATOM   81   O O   . LEU A 1 10  ? 8.960   26.888 -3.300  1.00 19.10 ? 10  LEU E O   1 
ATOM   82   C CB  . LEU A 1 10  ? 10.400  25.238 -5.080  1.00 63.58 ? 10  LEU E CB  1 
ATOM   83   C CG  . LEU A 1 10  ? 11.137  24.540 -6.242  1.00 46.92 ? 10  LEU E CG  1 
ATOM   84   C CD1 . LEU A 1 10  ? 10.306  23.359 -6.743  1.00 36.64 ? 10  LEU E CD1 1 
ATOM   85   C CD2 . LEU A 1 10  ? 11.429  25.473 -7.419  1.00 32.72 ? 10  LEU E CD2 1 
ATOM   86   N N   . ASP A 1 11  ? 10.828  27.750 -2.373  1.00 23.79 ? 11  ASP E N   1 
ATOM   87   C CA  . ASP A 1 11  ? 10.182  28.289 -1.157  1.00 29.13 ? 11  ASP E CA  1 
ATOM   88   C C   . ASP A 1 11  ? 9.544   27.198 -0.265  1.00 15.53 ? 11  ASP E C   1 
ATOM   89   O O   . ASP A 1 11  ? 8.812   27.492 0.681   1.00 19.94 ? 11  ASP E O   1 
ATOM   90   C CB  . ASP A 1 11  ? 9.152   29.389 -1.513  1.00 17.89 ? 11  ASP E CB  1 
ATOM   91   C CG  . ASP A 1 11  ? 9.764   30.759 -1.874  1.00 14.87 ? 11  ASP E CG  1 
ATOM   92   O OD1 . ASP A 1 11  ? 11.008  30.874 -1.922  1.00 16.31 ? 11  ASP E OD1 1 
ATOM   93   O OD2 . ASP A 1 11  ? 8.973   31.700 -2.134  1.00 30.77 ? 11  ASP E OD2 1 
ATOM   94   N N   . MET A 1 12  ? 9.971   25.945 -0.445  1.00 17.76 ? 12  MET E N   1 
ATOM   95   C CA  . MET A 1 12  ? 9.391   24.783 0.263   1.00 18.77 ? 12  MET E CA  1 
ATOM   96   C C   . MET A 1 12  ? 10.357  24.162 1.270   1.00 12.93 ? 12  MET E C   1 
ATOM   97   O O   . MET A 1 12  ? 9.933   23.559 2.251   1.00 15.81 ? 12  MET E O   1 
ATOM   98   C CB  . MET A 1 12  ? 8.871   23.643 -0.653  1.00 19.81 ? 12  MET E CB  1 
ATOM   99   C CG  . MET A 1 12  ? 7.721   23.999 -1.619  1.00 33.93 ? 12  MET E CG  1 
ATOM   100  S SD  . MET A 1 12  ? 6.442   25.148 -0.978  1.00 50.51 ? 12  MET E SD  1 
ATOM   101  C CE  . MET A 1 12  ? 5.248   24.084 -0.212  1.00 52.59 ? 12  MET E CE  1 
ATOM   102  N N   . GLU A 1 13  ? 11.652  24.205 0.962   1.00 8.69  ? 13  GLU E N   1 
ATOM   103  C CA  . GLU A 1 13  ? 12.687  23.513 1.734   1.00 15.41 ? 13  GLU E CA  1 
ATOM   104  C C   . GLU A 1 13  ? 13.965  24.297 1.674   1.00 10.88 ? 13  GLU E C   1 
ATOM   105  O O   . GLU A 1 13  ? 14.318  24.827 0.619   1.00 17.17 ? 13  GLU E O   1 
ATOM   106  C CB  . GLU A 1 13  ? 13.061  22.160 1.118   1.00 16.23 ? 13  GLU E CB  1 
ATOM   107  C CG  . GLU A 1 13  ? 11.873  21.217 1.076   1.00 23.65 ? 13  GLU E CG  1 
ATOM   108  C CD  . GLU A 1 13  ? 12.124  20.089 0.100   1.00 23.14 ? 13  GLU E CD  1 
ATOM   109  O OE1 . GLU A 1 13  ? 11.121  19.689 -0.538  1.00 45.58 ? 13  GLU E OE1 1 
ATOM   110  O OE2 . GLU A 1 13  ? 13.285  19.642 0.015   1.00 37.79 ? 13  GLU E OE2 1 
ATOM   111  N N   . TYR A 1 14  ? 14.695  24.288 2.772   1.00 11.57 ? 14  TYR E N   1 
ATOM   112  C CA  . TYR A 1 14  ? 15.965  25.018 2.901   1.00 12.24 ? 14  TYR E CA  1 
ATOM   113  C C   . TYR A 1 14  ? 16.975  24.051 3.501   1.00 11.29 ? 14  TYR E C   1 
ATOM   114  O O   . TYR A 1 14  ? 16.722  23.405 4.519   1.00 18.99 ? 14  TYR E O   1 
ATOM   115  C CB  . TYR A 1 14  ? 15.809  26.254 3.808   1.00 8.80  ? 14  TYR E CB  1 
ATOM   116  C CG  . TYR A 1 14  ? 14.835  27.282 3.249   1.00 7.32  ? 14  TYR E CG  1 
ATOM   117  C CD1 . TYR A 1 14  ? 13.426  27.092 3.404   1.00 6.37  ? 14  TYR E CD1 1 
ATOM   118  C CD2 . TYR A 1 14  ? 15.345  28.453 2.644   1.00 12.92 ? 14  TYR E CD2 1 
ATOM   119  C CE1 . TYR A 1 14  ? 12.540  28.065 2.940   1.00 11.18 ? 14  TYR E CE1 1 
ATOM   120  C CE2 . TYR A 1 14  ? 14.447  29.446 2.188   1.00 5.45  ? 14  TYR E CE2 1 
ATOM   121  C CZ  . TYR A 1 14  ? 13.066  29.238 2.342   1.00 9.43  ? 14  TYR E CZ  1 
ATOM   122  O OH  . TYR A 1 14  ? 12.192  30.207 1.950   1.00 12.36 ? 14  TYR E OH  1 
ATOM   123  N N   . PHE A 1 15  ? 18.098  23.952 2.811   1.00 10.90 ? 15  PHE E N   1 
ATOM   124  C CA  . PHE A 1 15  ? 19.146  23.014 3.226   1.00 5.43  ? 15  PHE E CA  1 
ATOM   125  C C   . PHE A 1 15  ? 20.554  23.522 2.938   1.00 14.28 ? 15  PHE E C   1 
ATOM   126  O O   . PHE A 1 15  ? 20.740  24.405 2.105   1.00 12.01 ? 15  PHE E O   1 
ATOM   127  C CB  . PHE A 1 15  ? 18.900  21.621 2.619   1.00 6.92  ? 15  PHE E CB  1 
ATOM   128  C CG  . PHE A 1 15  ? 18.660  21.659 1.112   1.00 8.75  ? 15  PHE E CG  1 
ATOM   129  C CD1 . PHE A 1 15  ? 19.759  21.681 0.217   1.00 37.65 ? 15  PHE E CD1 1 
ATOM   130  C CD2 . PHE A 1 15  ? 17.325  21.661 0.629   1.00 10.68 ? 15  PHE E CD2 1 
ATOM   131  C CE1 . PHE A 1 15  ? 19.530  21.701 -1.166  1.00 20.93 ? 15  PHE E CE1 1 
ATOM   132  C CE2 . PHE A 1 15  ? 17.103  21.681 -0.758  1.00 16.25 ? 15  PHE E CE2 1 
ATOM   133  C CZ  . PHE A 1 15  ? 18.200  21.703 -1.649  1.00 11.88 ? 15  PHE E CZ  1 
ATOM   134  N N   . GLY A 1 16  ? 21.491  22.996 3.689   1.00 9.55  ? 16  GLY E N   1 
ATOM   135  C CA  . GLY A 1 16  ? 22.896  23.424 3.604   1.00 5.68  ? 16  GLY E CA  1 
ATOM   136  C C   . GLY A 1 16  ? 23.760  22.199 3.655   1.00 9.75  ? 16  GLY E C   1 
ATOM   137  O O   . GLY A 1 16  ? 23.311  21.120 4.031   1.00 16.06 ? 16  GLY E O   1 
ATOM   138  N N   . THR A 1 17  ? 25.006  22.409 3.239   1.00 11.33 ? 17  THR E N   1 
ATOM   139  C CA  . THR A 1 17  ? 26.065  21.386 3.253   1.00 14.38 ? 17  THR E CA  1 
ATOM   140  C C   . THR A 1 17  ? 26.780  21.335 4.596   1.00 23.12 ? 17  THR E C   1 
ATOM   141  O O   . THR A 1 17  ? 27.192  22.351 5.180   1.00 18.95 ? 17  THR E O   1 
ATOM   142  C CB  . THR A 1 17  ? 27.062  21.684 2.102   1.00 15.00 ? 17  THR E CB  1 
ATOM   143  O OG1 . THR A 1 17  ? 26.316  21.696 0.886   1.00 22.20 ? 17  THR E OG1 1 
ATOM   144  C CG2 . THR A 1 17  ? 28.171  20.635 1.970   1.00 19.81 ? 17  THR E CG2 1 
ATOM   145  N N   . ILE A 1 18  ? 26.930  20.097 5.103   1.00 17.10 ? 18  ILE E N   1 
ATOM   146  C CA  . ILE A 1 18  ? 27.767  19.791 6.275   1.00 8.00  ? 18  ILE E CA  1 
ATOM   147  C C   . ILE A 1 18  ? 28.790  18.732 5.893   1.00 10.18 ? 18  ILE E C   1 
ATOM   148  O O   . ILE A 1 18  ? 28.566  17.973 4.949   1.00 20.31 ? 18  ILE E O   1 
ATOM   149  C CB  . ILE A 1 18  ? 26.948  19.357 7.519   1.00 12.88 ? 18  ILE E CB  1 
ATOM   150  C CG1 . ILE A 1 18  ? 26.180  18.040 7.282   1.00 11.88 ? 18  ILE E CG1 1 
ATOM   151  C CG2 . ILE A 1 18  ? 26.063  20.527 7.972   1.00 12.35 ? 18  ILE E CG2 1 
ATOM   152  C CD1 . ILE A 1 18  ? 25.669  17.408 8.584   1.00 8.69  ? 18  ILE E CD1 1 
ATOM   153  N N   . GLY A 1 19  ? 29.909  18.721 6.606   1.00 10.36 ? 19  GLY E N   1 
ATOM   154  C CA  . GLY A 1 19  ? 30.920  17.669 6.483   1.00 8.43  ? 19  GLY E CA  1 
ATOM   155  C C   . GLY A 1 19  ? 30.920  16.728 7.690   1.00 15.79 ? 19  GLY E C   1 
ATOM   156  O O   . GLY A 1 19  ? 30.820  17.185 8.826   1.00 16.51 ? 19  GLY E O   1 
ATOM   157  N N   . ILE A 1 20  ? 30.946  15.426 7.457   1.00 16.26 ? 20  ILE E N   1 
ATOM   158  C CA  . ILE A 1 20  ? 31.047  14.400 8.524   1.00 10.09 ? 20  ILE E CA  1 
ATOM   159  C C   . ILE A 1 20  ? 32.247  13.505 8.255   1.00 12.14 ? 20  ILE E C   1 
ATOM   160  O O   . ILE A 1 20  ? 32.400  12.933 7.164   1.00 17.12 ? 20  ILE E O   1 
ATOM   161  C CB  . ILE A 1 20  ? 29.761  13.553 8.682   1.00 7.90  ? 20  ILE E CB  1 
ATOM   162  C CG1 . ILE A 1 20  ? 28.501  14.431 8.841   1.00 8.08  ? 20  ILE E CG1 1 
ATOM   163  C CG2 . ILE A 1 20  ? 29.933  12.629 9.904   1.00 11.84 ? 20  ILE E CG2 1 
ATOM   164  C CD1 . ILE A 1 20  ? 27.199  13.629 8.899   1.00 7.94  ? 20  ILE E CD1 1 
ATOM   165  N N   . GLY A 1 21  ? 33.066  13.318 9.283   1.00 14.47 ? 21  GLY E N   1 
ATOM   166  C CA  . GLY A 1 21  ? 34.198  12.381 9.243   1.00 18.99 ? 21  GLY E CA  1 
ATOM   167  C C   . GLY A 1 21  ? 35.552  13.020 8.946   1.00 29.19 ? 21  GLY E C   1 
ATOM   168  O O   . GLY A 1 21  ? 35.661  14.234 8.765   1.00 20.21 ? 21  GLY E O   1 
ATOM   169  N N   . THR A 1 22  ? 36.584  12.202 9.013   1.00 14.43 ? 22  THR E N   1 
ATOM   170  C CA  . THR A 1 22  ? 37.966  12.591 8.635   1.00 20.32 ? 22  THR E CA  1 
ATOM   171  C C   . THR A 1 22  ? 38.517  11.623 7.539   1.00 29.21 ? 22  THR E C   1 
ATOM   172  O O   . THR A 1 22  ? 38.766  10.471 7.847   1.00 29.06 ? 22  THR E O   1 
ATOM   173  C CB  . THR A 1 22  ? 38.899  12.587 9.841   1.00 26.77 ? 22  THR E CB  1 
ATOM   174  O OG1 . THR A 1 22  ? 38.308  13.362 10.881  1.00 25.56 ? 22  THR E OG1 1 
ATOM   175  C CG2 . THR A 1 22  ? 40.289  13.141 9.498   1.00 22.80 ? 22  THR E CG2 1 
ATOM   176  N N   . PRO A 1 23  ? 38.689  12.111 6.305   1.00 27.09 ? 23  PRO E N   1 
ATOM   177  C CA  . PRO A 1 23  ? 38.339  13.471 5.831   1.00 25.11 ? 23  PRO E CA  1 
ATOM   178  C C   . PRO A 1 23  ? 36.835  13.617 5.659   1.00 73.50 ? 23  PRO E C   1 
ATOM   179  O O   . PRO A 1 23  ? 36.102  12.622 5.600   1.00 23.23 ? 23  PRO E O   1 
ATOM   180  C CB  . PRO A 1 23  ? 39.068  13.590 4.493   1.00 27.35 ? 23  PRO E CB  1 
ATOM   181  C CG  . PRO A 1 23  ? 39.072  12.160 3.969   1.00 31.95 ? 23  PRO E CG  1 
ATOM   182  C CD  . PRO A 1 23  ? 39.319  11.327 5.221   1.00 41.57 ? 23  PRO E CD  1 
ATOM   183  N N   . ALA A 1 24  ? 36.369  14.836 5.490   1.00 20.89 ? 24  ALA E N   1 
ATOM   184  C CA  . ALA A 1 24  ? 34.929  15.122 5.419   1.00 17.16 ? 24  ALA E CA  1 
ATOM   185  C C   . ALA A 1 24  ? 34.237  14.523 4.180   1.00 29.07 ? 24  ALA E C   1 
ATOM   186  O O   . ALA A 1 24  ? 34.698  14.642 3.050   1.00 45.65 ? 24  ALA E O   1 
ATOM   187  C CB  . ALA A 1 24  ? 34.641  16.624 5.509   1.00 14.83 ? 24  ALA E CB  1 
ATOM   188  N N   . GLN A 1 25  ? 33.166  13.796 4.485   1.00 18.48 ? 25  GLN E N   1 
ATOM   189  C CA  . GLN A 1 25  ? 32.154  13.382 3.486   1.00 10.12 ? 25  GLN E CA  1 
ATOM   190  C C   . GLN A 1 25  ? 31.025  14.415 3.588   1.00 15.75 ? 25  GLN E C   1 
ATOM   191  O O   . GLN A 1 25  ? 30.593  14.756 4.687   1.00 18.41 ? 25  GLN E O   1 
ATOM   192  C CB  . GLN A 1 25  ? 31.613  11.967 3.782   1.00 9.04  ? 25  GLN E CB  1 
ATOM   193  C CG  . GLN A 1 25  ? 32.726  10.921 3.909   1.00 22.78 ? 25  GLN E CG  1 
ATOM   194  C CD  . GLN A 1 25  ? 32.218  9.519  4.285   1.00 26.23 ? 25  GLN E CD  1 
ATOM   195  O OE1 . GLN A 1 25  ? 31.200  9.039  3.806   1.00 23.14 ? 25  GLN E OE1 1 
ATOM   196  N NE2 . GLN A 1 25  ? 32.997  8.831  5.088   1.00 15.07 ? 25  GLN E NE2 1 
ATOM   197  N N   . ASP A 1 26  ? 30.670  15.017 2.455   1.00 18.61 ? 26  ASP E N   1 
ATOM   198  C CA  . ASP A 1 26  ? 29.680  16.097 2.366   1.00 12.75 ? 26  ASP E CA  1 
ATOM   199  C C   . ASP A 1 26  ? 28.259  15.568 2.177   1.00 12.79 ? 26  ASP E C   1 
ATOM   200  O O   . ASP A 1 26  ? 28.031  14.638 1.406   1.00 19.71 ? 26  ASP E O   1 
ATOM   201  C CB  . ASP A 1 26  ? 30.011  17.022 1.186   1.00 28.21 ? 26  ASP E CB  1 
ATOM   202  C CG  . ASP A 1 26  ? 31.246  17.903 1.364   1.00 24.41 ? 26  ASP E CG  1 
ATOM   203  O OD1 . ASP A 1 26  ? 31.453  18.747 0.461   1.00 99.99 ? 26  ASP E OD1 1 
ATOM   204  O OD2 . ASP A 1 26  ? 31.911  17.780 2.408   1.00 31.21 ? 26  ASP E OD2 1 
ATOM   205  N N   . PHE A 1 27  ? 27.327  16.196 2.901   1.00 14.12 ? 27  PHE E N   1 
ATOM   206  C CA  . PHE A 1 27  ? 25.879  15.909 2.860   1.00 10.47 ? 27  PHE E CA  1 
ATOM   207  C C   . PHE A 1 27  ? 25.127  17.216 2.883   1.00 7.95  ? 27  PHE E C   1 
ATOM   208  O O   . PHE A 1 27  ? 25.559  18.204 3.495   1.00 12.91 ? 27  PHE E O   1 
ATOM   209  C CB  . PHE A 1 27  ? 25.380  15.101 4.079   1.00 14.40 ? 27  PHE E CB  1 
ATOM   210  C CG  . PHE A 1 27  ? 26.118  13.774 4.270   1.00 10.27 ? 27  PHE E CG  1 
ATOM   211  C CD1 . PHE A 1 27  ? 27.343  13.770 4.980   1.00 17.93 ? 27  PHE E CD1 1 
ATOM   212  C CD2 . PHE A 1 27  ? 25.657  12.623 3.605   1.00 12.86 ? 27  PHE E CD2 1 
ATOM   213  C CE1 . PHE A 1 27  ? 28.130  12.594 5.006   1.00 12.05 ? 27  PHE E CE1 1 
ATOM   214  C CE2 . PHE A 1 27  ? 26.443  11.457 3.613   1.00 9.34  ? 27  PHE E CE2 1 
ATOM   215  C CZ  . PHE A 1 27  ? 27.679  11.463 4.321   1.00 11.07 ? 27  PHE E CZ  1 
ATOM   216  N N   . THR A 1 28  ? 23.961  17.221 2.253   1.00 11.04 ? 28  THR E N   1 
ATOM   217  C CA  . THR A 1 28  ? 23.002  18.320 2.411   1.00 20.90 ? 28  THR E CA  1 
ATOM   218  C C   . THR A 1 28  ? 21.941  17.962 3.445   1.00 19.57 ? 28  THR E C   1 
ATOM   219  O O   . THR A 1 28  ? 21.447  16.821 3.519   1.00 18.31 ? 28  THR E O   1 
ATOM   220  C CB  . THR A 1 28  ? 22.337  18.740 1.080   1.00 13.23 ? 28  THR E CB  1 
ATOM   221  O OG1 . THR A 1 28  ? 21.640  17.627 0.533   1.00 23.73 ? 28  THR E OG1 1 
ATOM   222  C CG2 . THR A 1 28  ? 23.370  19.278 0.103   1.00 15.33 ? 28  THR E CG2 1 
ATOM   223  N N   . VAL A 1 29  ? 21.697  18.881 4.386   1.00 13.58 ? 29  VAL E N   1 
ATOM   224  C CA  . VAL A 1 29  ? 20.742  18.634 5.486   1.00 6.54  ? 29  VAL E CA  1 
ATOM   225  C C   . VAL A 1 29  ? 19.784  19.810 5.642   1.00 5.92  ? 29  VAL E C   1 
ATOM   226  O O   . VAL A 1 29  ? 20.233  20.937 5.446   1.00 12.55 ? 29  VAL E O   1 
ATOM   227  C CB  . VAL A 1 29  ? 21.470  18.337 6.810   1.00 2.83  ? 29  VAL E CB  1 
ATOM   228  C CG1 . VAL A 1 29  ? 22.249  17.009 6.697   1.00 6.28  ? 29  VAL E CG1 1 
ATOM   229  C CG2 . VAL A 1 29  ? 22.438  19.441 7.248   1.00 5.18  ? 29  VAL E CG2 1 
ATOM   230  N N   . VAL A 1 30  ? 18.501  19.500 5.845   1.00 8.03  ? 30  VAL E N   1 
ATOM   231  C CA  . VAL A 1 30  ? 17.519  20.514 6.304   1.00 7.27  ? 30  VAL E CA  1 
ATOM   232  C C   . VAL A 1 30  ? 17.892  20.914 7.736   1.00 15.31 ? 30  VAL E C   1 
ATOM   233  O O   . VAL A 1 30  ? 18.018  20.039 8.600   1.00 9.09  ? 30  VAL E O   1 
ATOM   234  C CB  . VAL A 1 30  ? 16.056  19.996 6.288   1.00 11.27 ? 30  VAL E CB  1 
ATOM   235  C CG1 . VAL A 1 30  ? 15.062  20.981 6.924   1.00 8.35  ? 30  VAL E CG1 1 
ATOM   236  C CG2 . VAL A 1 30  ? 15.559  19.849 4.860   1.00 15.36 ? 30  VAL E CG2 1 
ATOM   237  N N   . PHE A 1 31  ? 18.029  22.217 7.948   1.00 8.78  ? 31  PHE E N   1 
ATOM   238  C CA  . PHE A 1 31  ? 18.269  22.799 9.290   1.00 4.94  ? 31  PHE E CA  1 
ATOM   239  C C   . PHE A 1 31  ? 16.918  23.078 9.898   1.00 2.75  ? 31  PHE E C   1 
ATOM   240  O O   . PHE A 1 31  ? 16.180  23.982 9.478   1.00 9.99  ? 31  PHE E O   1 
ATOM   241  C CB  . PHE A 1 31  ? 19.084  24.088 9.197   1.00 6.14  ? 31  PHE E CB  1 
ATOM   242  C CG  . PHE A 1 31  ? 20.551  23.768 8.967   1.00 12.96 ? 31  PHE E CG  1 
ATOM   243  C CD1 . PHE A 1 31  ? 21.001  23.289 7.720   1.00 10.53 ? 31  PHE E CD1 1 
ATOM   244  C CD2 . PHE A 1 31  ? 21.471  23.991 10.025  1.00 6.89  ? 31  PHE E CD2 1 
ATOM   245  C CE1 . PHE A 1 31  ? 22.367  23.011 7.531   1.00 10.16 ? 31  PHE E CE1 1 
ATOM   246  C CE2 . PHE A 1 31  ? 22.840  23.720 9.827   1.00 16.86 ? 31  PHE E CE2 1 
ATOM   247  C CZ  . PHE A 1 31  ? 23.293  23.229 8.596   1.00 8.21  ? 31  PHE E CZ  1 
ATOM   248  N N   . ASP A 1 32  ? 16.542  22.113 10.731  1.00 8.85  ? 32  ASP E N   1 
ATOM   249  C CA  . ASP A 1 32  ? 15.158  21.914 11.162  1.00 12.03 ? 32  ASP E CA  1 
ATOM   250  C C   . ASP A 1 32  ? 14.946  22.252 12.656  1.00 11.27 ? 32  ASP E C   1 
ATOM   251  O O   . ASP A 1 32  ? 15.241  21.444 13.503  1.00 10.91 ? 32  ASP E O   1 
ATOM   252  C CB  . ASP A 1 32  ? 14.773  20.454 10.870  1.00 3.76  ? 32  ASP E CB  1 
ATOM   253  C CG  . ASP A 1 32  ? 13.332  20.101 11.264  1.00 8.21  ? 32  ASP E CG  1 
ATOM   254  O OD1 . ASP A 1 32  ? 12.531  21.034 11.443  1.00 7.39  ? 32  ASP E OD1 1 
ATOM   255  O OD2 . ASP A 1 32  ? 13.055  18.891 11.379  1.00 11.83 ? 32  ASP E OD2 1 
ATOM   256  N N   . THR A 1 33  ? 14.208  23.337 12.916  1.00 10.41 ? 33  THR E N   1 
ATOM   257  C CA  . THR A 1 33  ? 13.872  23.713 14.308  1.00 7.40  ? 33  THR E CA  1 
ATOM   258  C C   . THR A 1 33  ? 12.661  22.956 14.894  1.00 6.64  ? 33  THR E C   1 
ATOM   259  O O   . THR A 1 33  ? 12.421  23.016 16.082  1.00 13.39 ? 33  THR E O   1 
ATOM   260  C CB  . THR A 1 33  ? 13.668  25.212 14.527  1.00 5.87  ? 33  THR E CB  1 
ATOM   261  O OG1 . THR A 1 33  ? 12.577  25.682 13.747  1.00 7.36  ? 33  THR E OG1 1 
ATOM   262  C CG2 . THR A 1 33  ? 14.931  26.025 14.196  1.00 5.41  ? 33  THR E CG2 1 
ATOM   263  N N   . GLY A 1 34  ? 12.115  22.022 14.114  1.00 8.76  ? 34  GLY E N   1 
ATOM   264  C CA  . GLY A 1 34  ? 10.959  21.182 14.516  1.00 4.38  ? 34  GLY E CA  1 
ATOM   265  C C   . GLY A 1 34  ? 11.335  19.794 15.056  1.00 8.00  ? 34  GLY E C   1 
ATOM   266  O O   . GLY A 1 34  ? 10.477  18.938 15.280  1.00 7.16  ? 34  GLY E O   1 
ATOM   267  N N   . SER A 1 35  ? 12.629  19.513 15.047  1.00 5.33  ? 35  SER E N   1 
ATOM   268  C CA  . SER A 1 35  ? 13.207  18.226 15.486  1.00 3.98  ? 35  SER E CA  1 
ATOM   269  C C   . SER A 1 35  ? 14.605  18.456 16.062  1.00 10.29 ? 35  SER E C   1 
ATOM   270  O O   . SER A 1 35  ? 15.142  19.563 15.989  1.00 8.99  ? 35  SER E O   1 
ATOM   271  C CB  . SER A 1 35  ? 13.266  17.210 14.342  1.00 7.43  ? 35  SER E CB  1 
ATOM   272  O OG  . SER A 1 35  ? 14.314  17.508 13.404  1.00 6.10  ? 35  SER E OG  1 
ATOM   273  N N   . SER A 1 36  ? 15.174  17.399 16.644  1.00 5.63  ? 36  SER E N   1 
ATOM   274  C CA  . SER A 1 36  ? 16.447  17.521 17.404  1.00 6.91  ? 36  SER E CA  1 
ATOM   275  C C   . SER A 1 36  ? 17.559  16.548 17.022  1.00 8.26  ? 36  SER E C   1 
ATOM   276  O O   . SER A 1 36  ? 18.690  16.715 17.454  1.00 14.63 ? 36  SER E O   1 
ATOM   277  C CB  . SER A 1 36  ? 16.189  17.371 18.899  1.00 10.65 ? 36  SER E CB  1 
ATOM   278  O OG  . SER A 1 36  ? 15.242  18.358 19.299  1.00 13.71 ? 36  SER E OG  1 
ATOM   279  N N   . ASN A 1 37  ? 17.269  15.601 16.121  1.00 9.53  ? 37  ASN E N   1 
ATOM   280  C CA  . ASN A 1 37  ? 18.295  14.634 15.710  1.00 2.80  ? 37  ASN E CA  1 
ATOM   281  C C   . ASN A 1 37  ? 19.021  15.019 14.445  1.00 6.72  ? 37  ASN E C   1 
ATOM   282  O O   . ASN A 1 37  ? 18.464  15.643 13.551  1.00 13.00 ? 37  ASN E O   1 
ATOM   283  C CB  . ASN A 1 37  ? 17.723  13.229 15.467  1.00 8.22  ? 37  ASN E CB  1 
ATOM   284  C CG  . ASN A 1 37  ? 17.199  12.582 16.738  1.00 18.16 ? 37  ASN E CG  1 
ATOM   285  O OD1 . ASN A 1 37  ? 16.078  12.836 17.162  1.00 15.71 ? 37  ASN E OD1 1 
ATOM   286  N ND2 . ASN A 1 37  ? 18.008  11.731 17.348  1.00 3.42  ? 37  ASN E ND2 1 
ATOM   287  N N   . LEU A 1 38  ? 20.310  14.659 14.428  1.00 9.69  ? 38  LEU E N   1 
ATOM   288  C CA  . LEU A 1 38  ? 21.118  14.690 13.215  1.00 4.03  ? 38  LEU E CA  1 
ATOM   289  C C   . LEU A 1 38  ? 21.189  13.282 12.677  1.00 3.20  ? 38  LEU E C   1 
ATOM   290  O O   . LEU A 1 38  ? 21.477  12.346 13.425  1.00 10.89 ? 38  LEU E O   1 
ATOM   291  C CB  . LEU A 1 38  ? 22.555  15.202 13.443  1.00 5.43  ? 38  LEU E CB  1 
ATOM   292  C CG  . LEU A 1 38  ? 23.469  15.028 12.211  1.00 7.85  ? 38  LEU E CG  1 
ATOM   293  C CD1 . LEU A 1 38  ? 23.013  15.827 10.989  1.00 11.98 ? 38  LEU E CD1 1 
ATOM   294  C CD2 . LEU A 1 38  ? 24.898  15.428 12.560  1.00 8.20  ? 38  LEU E CD2 1 
ATOM   295  N N   . TRP A 1 39  ? 20.726  13.140 11.448  1.00 11.25 ? 39  TRP E N   1 
ATOM   296  C CA  . TRP A 1 39  ? 21.015  11.899 10.702  1.00 6.94  ? 39  TRP E CA  1 
ATOM   297  C C   . TRP A 1 39  ? 21.275  12.147 9.214   1.00 23.33 ? 39  TRP E C   1 
ATOM   298  O O   . TRP A 1 39  ? 20.889  13.167 8.650   1.00 12.75 ? 39  TRP E O   1 
ATOM   299  C CB  . TRP A 1 39  ? 19.916  10.854 10.916  1.00 2.60  ? 39  TRP E CB  1 
ATOM   300  C CG  . TRP A 1 39  ? 18.579  11.328 10.323  1.00 3.60  ? 39  TRP E CG  1 
ATOM   301  C CD1 . TRP A 1 39  ? 17.684  12.068 10.941  1.00 3.53  ? 39  TRP E CD1 1 
ATOM   302  C CD2 . TRP A 1 39  ? 18.147  11.121 9.012   1.00 12.00 ? 39  TRP E CD2 1 
ATOM   303  N NE1 . TRP A 1 39  ? 16.687  12.351 10.095  1.00 11.23 ? 39  TRP E NE1 1 
ATOM   304  C CE2 . TRP A 1 39  ? 16.919  11.808 8.902   1.00 8.47  ? 39  TRP E CE2 1 
ATOM   305  C CE3 . TRP A 1 39  ? 18.700  10.472 7.889   1.00 7.98  ? 39  TRP E CE3 1 
ATOM   306  C CZ2 . TRP A 1 39  ? 16.233  11.882 7.679   1.00 13.52 ? 39  TRP E CZ2 1 
ATOM   307  C CZ3 . TRP A 1 39  ? 18.018  10.549 6.657   1.00 10.36 ? 39  TRP E CZ3 1 
ATOM   308  C CH2 . TRP A 1 39  ? 16.794  11.249 6.551   1.00 12.91 ? 39  TRP E CH2 1 
ATOM   309  N N   . VAL A 1 40  ? 22.066  11.230 8.639   1.00 14.83 ? 40  VAL E N   1 
ATOM   310  C CA  . VAL A 1 40  ? 22.386  11.166 7.201   1.00 4.65  ? 40  VAL E CA  1 
ATOM   311  C C   . VAL A 1 40  ? 22.191  9.728  6.662   1.00 6.67  ? 40  VAL E C   1 
ATOM   312  O O   . VAL A 1 40  ? 22.186  8.789  7.481   1.00 15.63 ? 40  VAL E O   1 
ATOM   313  C CB  . VAL A 1 40  ? 23.829  11.661 6.948   1.00 7.80  ? 40  VAL E CB  1 
ATOM   314  C CG1 . VAL A 1 40  ? 23.909  13.164 7.219   1.00 9.70  ? 40  VAL E CG1 1 
ATOM   315  C CG2 . VAL A 1 40  ? 24.911  10.864 7.680   1.00 9.86  ? 40  VAL E CG2 1 
ATOM   316  N N   . PRO A 1 41  ? 22.041  9.501  5.342   1.00 13.68 ? 41  PRO E N   1 
ATOM   317  C CA  . PRO A 1 41  ? 22.019  8.127  4.793   1.00 3.94  ? 41  PRO E CA  1 
ATOM   318  C C   . PRO A 1 41  ? 23.388  7.504  4.984   1.00 7.31  ? 41  PRO E C   1 
ATOM   319  O O   . PRO A 1 41  ? 24.404  8.195  5.161   1.00 16.49 ? 41  PRO E O   1 
ATOM   320  C CB  . PRO A 1 41  ? 21.712  8.266  3.300   1.00 3.33  ? 41  PRO E CB  1 
ATOM   321  C CG  . PRO A 1 41  ? 21.060  9.646  3.201   1.00 8.88  ? 41  PRO E CG  1 
ATOM   322  C CD  . PRO A 1 41  ? 21.788  10.480 4.263   1.00 11.91 ? 41  PRO E CD  1 
ATOM   323  N N   . SER A 1 42  ? 23.409  6.192  5.097   1.00 12.69 ? 42  SER E N   1 
ATOM   324  C CA  . SER A 1 42  ? 24.661  5.426  5.201   1.00 15.04 ? 42  SER E CA  1 
ATOM   325  C C   . SER A 1 42  ? 24.655  4.177  4.306   1.00 7.68  ? 42  SER E C   1 
ATOM   326  O O   . SER A 1 42  ? 23.603  3.720  3.857   1.00 17.64 ? 42  SER E O   1 
ATOM   327  C CB  . SER A 1 42  ? 24.968  4.987  6.636   1.00 9.47  ? 42  SER E CB  1 
ATOM   328  O OG  . SER A 1 42  ? 24.138  3.868  6.952   1.00 13.74 ? 42  SER E OG  1 
ATOM   329  N N   . VAL A 1 43  ? 25.831  3.561  4.193   1.00 19.94 ? 43  VAL E N   1 
ATOM   330  C CA  . VAL A 1 43  ? 26.030  2.285  3.463   1.00 27.49 ? 43  VAL E CA  1 
ATOM   331  C C   . VAL A 1 43  ? 25.188  1.108  3.985   1.00 19.98 ? 43  VAL E C   1 
ATOM   332  O O   . VAL A 1 43  ? 24.989  0.081  3.328   1.00 25.06 ? 43  VAL E O   1 
ATOM   333  C CB  . VAL A 1 43  ? 27.531  1.898  3.366   1.00 25.58 ? 43  VAL E CB  1 
ATOM   334  C CG1 . VAL A 1 43  ? 28.313  2.925  2.558   1.00 13.81 ? 43  VAL E CG1 1 
ATOM   335  C CG2 . VAL A 1 43  ? 28.208  1.702  4.719   1.00 15.66 ? 43  VAL E CG2 1 
ATOM   336  N N   . TYR A 1 44  ? 24.683  1.204  5.209   1.00 15.10 ? 44  TYR E N   1 
ATOM   337  C CA  . TYR A 1 44  ? 23.823  0.175  5.798   1.00 17.70 ? 44  TYR E CA  1 
ATOM   338  C C   . TYR A 1 44  ? 22.386  0.206  5.262   1.00 21.95 ? 44  TYR E C   1 
ATOM   339  O O   . TYR A 1 44  ? 21.603  -0.711 5.480   1.00 28.87 ? 44  TYR E O   1 
ATOM   340  C CB  . TYR A 1 44  ? 23.824  0.292  7.334   1.00 22.40 ? 44  TYR E CB  1 
ATOM   341  C CG  . TYR A 1 44  ? 25.221  0.214  7.944   1.00 23.90 ? 44  TYR E CG  1 
ATOM   342  C CD1 . TYR A 1 44  ? 26.145  -0.799 7.552   1.00 79.78 ? 44  TYR E CD1 1 
ATOM   343  C CD2 . TYR A 1 44  ? 25.581  1.191  8.892   1.00 22.28 ? 44  TYR E CD2 1 
ATOM   344  C CE1 . TYR A 1 44  ? 27.429  -0.817 8.119   1.00 63.51 ? 44  TYR E CE1 1 
ATOM   345  C CE2 . TYR A 1 44  ? 26.874  1.165  9.471   1.00 19.17 ? 44  TYR E CE2 1 
ATOM   346  C CZ  . TYR A 1 44  ? 27.770  0.160  9.081   1.00 83.68 ? 44  TYR E CZ  1 
ATOM   347  O OH  . TYR A 1 44  ? 28.973  0.069  9.720   1.00 46.95 ? 44  TYR E OH  1 
ATOM   348  N N   . CYS A 1 45  ? 22.088  1.270  4.513   1.00 17.50 ? 45  CYS E N   1 
ATOM   349  C CA  . CYS A 1 45  ? 20.757  1.517  3.957   1.00 17.56 ? 45  CYS E CA  1 
ATOM   350  C C   . CYS A 1 45  ? 20.638  1.092  2.497   1.00 25.78 ? 45  CYS E C   1 
ATOM   351  O O   . CYS A 1 45  ? 21.329  1.624  1.612   1.00 23.24 ? 45  CYS E O   1 
ATOM   352  C CB  . CYS A 1 45  ? 20.429  3.010  4.092   1.00 10.63 ? 45  CYS E CB  1 
ATOM   353  S SG  . CYS A 1 45  ? 18.681  3.309  3.673   1.00 13.85 ? 45  CYS E SG  1 
ATOM   354  N N   . SER A 1 46  ? 19.582  0.333  2.237   1.00 15.47 ? 46  SER E N   1 
ATOM   355  C CA  . SER A 1 46  ? 19.275  -0.264 0.923   1.00 31.20 ? 46  SER E CA  1 
ATOM   356  C C   . SER A 1 46  ? 17.885  0.156  0.396   1.00 28.33 ? 46  SER E C   1 
ATOM   357  O O   . SER A 1 46  ? 17.384  -0.351 -0.614  1.00 33.63 ? 46  SER E O   1 
ATOM   358  C CB  . SER A 1 46  ? 19.376  -1.810 0.960   1.00 21.85 ? 46  SER E CB  1 
ATOM   359  O OG  . SER A 1 46  ? 20.738  -2.252 0.998   1.00 48.15 ? 46  SER E OG  1 
ATOM   360  N N   . SER A 1 47  ? 17.239  1.059  1.118   1.00 12.58 ? 47  SER E N   1 
ATOM   361  C CA  . SER A 1 47  ? 15.959  1.677  0.724   1.00 8.35  ? 47  SER E CA  1 
ATOM   362  C C   . SER A 1 47  ? 16.168  2.472  -0.554  1.00 14.79 ? 47  SER E C   1 
ATOM   363  O O   . SER A 1 47  ? 17.234  3.049  -0.730  1.00 14.57 ? 47  SER E O   1 
ATOM   364  C CB  . SER A 1 47  ? 15.465  2.691  1.758   1.00 29.46 ? 47  SER E CB  1 
ATOM   365  O OG  . SER A 1 47  ? 15.233  2.011  2.971   1.00 14.61 ? 47  SER E OG  1 
ATOM   366  N N   . LEU A 1 48  ? 15.069  2.672  -1.299  1.00 12.26 ? 48  LEU E N   1 
ATOM   367  C CA  . LEU A 1 48  ? 15.100  3.463  -2.538  1.00 21.20 ? 48  LEU E CA  1 
ATOM   368  C C   . LEU A 1 48  ? 15.706  4.857  -2.387  1.00 70.69 ? 48  LEU E C   1 
ATOM   369  O O   . LEU A 1 48  ? 16.645  5.213  -3.089  1.00 10.98 ? 48  LEU E O   1 
ATOM   370  C CB  . LEU A 1 48  ? 13.676  3.638  -3.108  1.00 28.33 ? 48  LEU E CB  1 
ATOM   371  C CG  . LEU A 1 48  ? 13.320  2.576  -4.138  1.00 29.26 ? 48  LEU E CG  1 
ATOM   372  C CD1 . LEU A 1 48  ? 11.825  2.693  -4.429  1.00 42.40 ? 48  LEU E CD1 1 
ATOM   373  C CD2 . LEU A 1 48  ? 14.151  2.724  -5.423  1.00 35.81 ? 48  LEU E CD2 1 
ATOM   374  N N   . ALA A 1 49  ? 15.363  5.548  -1.323  1.00 11.14 ? 49  ALA E N   1 
ATOM   375  C CA  . ALA A 1 49  ? 15.860  6.908  -1.025  1.00 11.35 ? 49  ALA E CA  1 
ATOM   376  C C   . ALA A 1 49  ? 17.353  6.937  -0.717  1.00 14.22 ? 49  ALA E C   1 
ATOM   377  O O   . ALA A 1 49  ? 18.057  7.906  -0.974  1.00 26.45 ? 49  ALA E O   1 
ATOM   378  C CB  . ALA A 1 49  ? 15.051  7.530  0.120   1.00 12.24 ? 49  ALA E CB  1 
ATOM   379  N N   . CYS A 1 50  ? 17.872  5.835  -0.144  1.00 18.04 ? 50  CYS E N   1 
ATOM   380  C CA  . CYS A 1 50  ? 19.314  5.690  0.077   1.00 17.69 ? 50  CYS E CA  1 
ATOM   381  C C   . CYS A 1 50  ? 20.143  5.483  -1.187  1.00 99.99 ? 50  CYS E C   1 
ATOM   382  O O   . CYS A 1 50  ? 21.292  5.882  -1.218  1.00 23.50 ? 50  CYS E O   1 
ATOM   383  C CB  . CYS A 1 50  ? 19.591  4.562  1.071   1.00 11.95 ? 50  CYS E CB  1 
ATOM   384  S SG  . CYS A 1 50  ? 18.856  5.057  2.638   1.00 14.98 ? 50  CYS E SG  1 
ATOM   385  N N   . THR A 1 51  ? 19.508  5.032  -2.273  1.00 18.13 ? 51  THR E N   1 
ATOM   386  C CA  . THR A 1 51  ? 20.239  4.706  -3.511  1.00 18.77 ? 51  THR E CA  1 
ATOM   387  C C   . THR A 1 51  ? 20.567  5.909  -4.375  1.00 27.36 ? 51  THR E C   1 
ATOM   388  O O   . THR A 1 51  ? 21.604  5.914  -5.062  1.00 25.95 ? 51  THR E O   1 
ATOM   389  C CB  . THR A 1 51  ? 19.531  3.635  -4.361  1.00 21.57 ? 51  THR E CB  1 
ATOM   390  O OG1 . THR A 1 51  ? 18.370  4.194  -4.961  1.00 28.47 ? 51  THR E OG1 1 
ATOM   391  C CG2 . THR A 1 51  ? 19.209  2.381  -3.535  1.00 15.96 ? 51  THR E CG2 1 
ATOM   392  N N   . ASN A 1 52  ? 19.807  7.005  -4.216  1.00 23.65 ? 52  ASN E N   1 
ATOM   393  C CA  . ASN A 1 52  ? 19.980  8.247  -4.974  1.00 25.07 ? 52  ASN E CA  1 
ATOM   394  C C   . ASN A 1 52  ? 20.403  9.489  -4.144  1.00 21.08 ? 52  ASN E C   1 
ATOM   395  O O   . ASN A 1 52  ? 20.260  10.630 -4.571  1.00 29.67 ? 52  ASN E O   1 
ATOM   396  C CB  . ASN A 1 52  ? 18.710  8.561  -5.787  1.00 20.89 ? 52  ASN E CB  1 
ATOM   397  C CG  . ASN A 1 52  ? 17.515  9.012  -4.942  1.00 21.57 ? 52  ASN E CG  1 
ATOM   398  O OD1 . ASN A 1 52  ? 17.266  8.514  -3.848  1.00 18.88 ? 52  ASN E OD1 1 
ATOM   399  N ND2 . ASN A 1 52  ? 16.727  9.884  -5.501  1.00 22.97 ? 52  ASN E ND2 1 
ATOM   400  N N   . HIS A 1 53  ? 20.858  9.221  -2.920  1.00 17.61 ? 53  HIS E N   1 
ATOM   401  C CA  . HIS A 1 53  ? 21.407  10.241 -2.015  1.00 12.82 ? 53  HIS E CA  1 
ATOM   402  C C   . HIS A 1 53  ? 22.816  9.874  -1.549  1.00 11.42 ? 53  HIS E C   1 
ATOM   403  O O   . HIS A 1 53  ? 23.234  8.731  -1.707  1.00 17.02 ? 53  HIS E O   1 
ATOM   404  C CB  . HIS A 1 53  ? 20.471  10.479 -0.818  1.00 9.25  ? 53  HIS E CB  1 
ATOM   405  C CG  . HIS A 1 53  ? 19.196  11.181 -1.240  1.00 8.87  ? 53  HIS E CG  1 
ATOM   406  N ND1 . HIS A 1 53  ? 18.034  10.575 -1.556  1.00 13.51 ? 53  HIS E ND1 1 
ATOM   407  C CD2 . HIS A 1 53  ? 19.039  12.482 -1.441  1.00 10.48 ? 53  HIS E CD2 1 
ATOM   408  C CE1 . HIS A 1 53  ? 17.175  11.511 -1.951  1.00 9.45  ? 53  HIS E CE1 1 
ATOM   409  N NE2 . HIS A 1 53  ? 17.777  12.661 -1.877  1.00 8.96  ? 53  HIS E NE2 1 
ATOM   410  N N   . ASN A 1 54  ? 23.551  10.858 -1.039  1.00 13.31 ? 54  ASN E N   1 
ATOM   411  C CA  . ASN A 1 54  ? 24.915  10.571 -0.500  1.00 15.37 ? 54  ASN E CA  1 
ATOM   412  C C   . ASN A 1 54  ? 24.816  9.714  0.765   1.00 36.75 ? 54  ASN E C   1 
ATOM   413  O O   . ASN A 1 54  ? 24.005  9.966  1.653   1.00 21.14 ? 54  ASN E O   1 
ATOM   414  C CB  . ASN A 1 54  ? 25.741  11.835 -0.218  1.00 17.45 ? 54  ASN E CB  1 
ATOM   415  C CG  . ASN A 1 54  ? 25.915  12.703 -1.473  1.00 99.99 ? 54  ASN E CG  1 
ATOM   416  O OD1 . ASN A 1 54  ? 26.427  12.283 -2.493  1.00 40.57 ? 54  ASN E OD1 1 
ATOM   417  N ND2 . ASN A 1 54  ? 25.379  13.906 -1.443  1.00 33.31 ? 54  ASN E ND2 1 
ATOM   418  N N   . ARG A 1 55  ? 25.677  8.696  0.837   1.00 17.27 ? 55  ARG E N   1 
ATOM   419  C CA  . ARG A 1 55  ? 25.698  7.686  1.891   1.00 10.73 ? 55  ARG E CA  1 
ATOM   420  C C   . ARG A 1 55  ? 27.010  7.738  2.657   1.00 13.72 ? 55  ARG E C   1 
ATOM   421  O O   . ARG A 1 55  ? 28.098  7.871  2.099   1.00 27.20 ? 55  ARG E O   1 
ATOM   422  C CB  . ARG A 1 55  ? 25.485  6.277  1.273   1.00 10.54 ? 55  ARG E CB  1 
ATOM   423  C CG  . ARG A 1 55  ? 24.157  6.180  0.553   1.00 13.46 ? 55  ARG E CG  1 
ATOM   424  C CD  . ARG A 1 55  ? 23.720  4.725  0.232   1.00 15.19 ? 55  ARG E CD  1 
ATOM   425  N NE  . ARG A 1 55  ? 24.618  3.970  -0.634  1.00 50.42 ? 55  ARG E NE  1 
ATOM   426  C CZ  . ARG A 1 55  ? 24.685  2.628  -0.673  1.00 99.99 ? 55  ARG E CZ  1 
ATOM   427  N NH1 . ARG A 1 55  ? 23.882  1.841  0.065   1.00 90.86 ? 55  ARG E NH1 1 
ATOM   428  N NH2 . ARG A 1 55  ? 25.626  2.006  -1.414  1.00 99.99 ? 55  ARG E NH2 1 
ATOM   429  N N   . PHE A 1 56  ? 26.867  7.912  3.978   1.00 17.57 ? 56  PHE E N   1 
ATOM   430  C CA  . PHE A 1 56  ? 28.014  7.899  4.896   1.00 9.38  ? 56  PHE E CA  1 
ATOM   431  C C   . PHE A 1 56  ? 28.634  6.501  4.892   1.00 7.86  ? 56  PHE E C   1 
ATOM   432  O O   . PHE A 1 56  ? 27.961  5.486  5.071   1.00 13.58 ? 56  PHE E O   1 
ATOM   433  C CB  . PHE A 1 56  ? 27.587  8.288  6.327   1.00 16.63 ? 56  PHE E CB  1 
ATOM   434  C CG  . PHE A 1 56  ? 28.804  8.503  7.249   1.00 16.29 ? 56  PHE E CG  1 
ATOM   435  C CD1 . PHE A 1 56  ? 29.046  7.563  8.281   1.00 15.31 ? 56  PHE E CD1 1 
ATOM   436  C CD2 . PHE A 1 56  ? 29.696  9.548  7.001   1.00 18.40 ? 56  PHE E CD2 1 
ATOM   437  C CE1 . PHE A 1 56  ? 30.224  7.688  9.051   1.00 13.79 ? 56  PHE E CE1 1 
ATOM   438  C CE2 . PHE A 1 56  ? 30.882  9.674  7.772   1.00 27.49 ? 56  PHE E CE2 1 
ATOM   439  C CZ  . PHE A 1 56  ? 31.129  8.728  8.794   1.00 13.50 ? 56  PHE E CZ  1 
ATOM   440  N N   . ASN A 1 57  ? 29.934  6.518  4.701   1.00 12.49 ? 57  ASN E N   1 
ATOM   441  C CA  . ASN A 1 57  ? 30.749  5.282  4.771   1.00 20.47 ? 57  ASN E CA  1 
ATOM   442  C C   . ASN A 1 57  ? 31.664  5.347  6.014   1.00 13.33 ? 57  ASN E C   1 
ATOM   443  O O   . ASN A 1 57  ? 32.704  6.001  5.939   1.00 15.96 ? 57  ASN E O   1 
ATOM   444  C CB  . ASN A 1 57  ? 31.551  5.127  3.479   1.00 20.98 ? 57  ASN E CB  1 
ATOM   445  C CG  . ASN A 1 57  ? 32.128  3.715  3.304   1.00 45.64 ? 57  ASN E CG  1 
ATOM   446  O OD1 . ASN A 1 57  ? 32.254  2.935  4.250   1.00 26.84 ? 57  ASN E OD1 1 
ATOM   447  N ND2 . ASN A 1 57  ? 32.494  3.378  2.099   1.00 87.47 ? 57  ASN E ND2 1 
ATOM   448  N N   . PRO A 1 58  ? 31.308  4.674  7.123   1.00 23.72 ? 58  PRO E N   1 
ATOM   449  C CA  . PRO A 1 58  ? 32.090  4.658  8.379   1.00 23.26 ? 58  PRO E CA  1 
ATOM   450  C C   . PRO A 1 58  ? 33.540  4.244  8.218   1.00 22.85 ? 58  PRO E C   1 
ATOM   451  O O   . PRO A 1 58  ? 34.430  4.816  8.833   1.00 22.50 ? 58  PRO E O   1 
ATOM   452  C CB  . PRO A 1 58  ? 31.408  3.631  9.290   1.00 19.69 ? 58  PRO E CB  1 
ATOM   453  C CG  . PRO A 1 58  ? 29.989  3.511  8.767   1.00 12.91 ? 58  PRO E CG  1 
ATOM   454  C CD  . PRO A 1 58  ? 30.100  3.825  7.273   1.00 24.40 ? 58  PRO E CD  1 
ATOM   455  N N   . GLU A 1 59  ? 33.804  3.311  7.273   1.00 18.72 ? 59  GLU E N   1 
ATOM   456  C CA  . GLU A 1 59  ? 35.127  2.698  7.109   1.00 28.18 ? 59  GLU E CA  1 
ATOM   457  C C   . GLU A 1 59  ? 36.180  3.701  6.589   1.00 23.32 ? 59  GLU E C   1 
ATOM   458  O O   . GLU A 1 59  ? 37.375  3.617  6.895   1.00 34.80 ? 59  GLU E O   1 
ATOM   459  C CB  . GLU A 1 59  ? 35.032  1.402  6.266   1.00 26.02 ? 59  GLU E CB  1 
ATOM   460  C CG  . GLU A 1 59  ? 35.122  1.575  4.740   1.00 99.99 ? 59  GLU E CG  1 
ATOM   461  C CD  . GLU A 1 59  ? 34.872  0.301  3.890   1.00 99.99 ? 59  GLU E CD  1 
ATOM   462  O OE1 . GLU A 1 59  ? 34.884  -0.806 4.458   1.00 99.99 ? 59  GLU E OE1 1 
ATOM   463  O OE2 . GLU A 1 59  ? 34.568  0.504  2.688   1.00 99.99 ? 59  GLU E OE2 1 
ATOM   464  N N   . ASP A 1 60  ? 35.670  4.713  5.925   1.00 24.61 ? 60  ASP E N   1 
ATOM   465  C CA  . ASP A 1 60  ? 36.494  5.791  5.329   1.00 19.21 ? 60  ASP E CA  1 
ATOM   466  C C   . ASP A 1 60  ? 36.842  6.946  6.271   1.00 24.29 ? 60  ASP E C   1 
ATOM   467  O O   . ASP A 1 60  ? 37.592  7.837  5.879   1.00 33.81 ? 60  ASP E O   1 
ATOM   468  C CB  . ASP A 1 60  ? 35.859  6.285  4.029   1.00 34.48 ? 60  ASP E CB  1 
ATOM   469  C CG  . ASP A 1 60  ? 35.876  5.254  2.887   1.00 33.94 ? 60  ASP E CG  1 
ATOM   470  O OD1 . ASP A 1 60  ? 36.789  4.391  2.881   1.00 99.99 ? 60  ASP E OD1 1 
ATOM   471  O OD2 . ASP A 1 60  ? 34.946  5.334  2.057   1.00 99.99 ? 60  ASP E OD2 1 
ATOM   472  N N   . SER A 1 61  ? 36.311  6.936  7.492   1.00 26.24 ? 61  SER E N   1 
ATOM   473  C CA  . SER A 1 61  ? 36.616  7.962  8.506   1.00 32.01 ? 61  SER E CA  1 
ATOM   474  C C   . SER A 1 61  ? 37.548  7.455  9.616   1.00 23.83 ? 61  SER E C   1 
ATOM   475  O O   . SER A 1 61  ? 37.229  6.543  10.367  1.00 29.85 ? 61  SER E O   1 
ATOM   476  C CB  . SER A 1 61  ? 35.336  8.512  9.149   1.00 17.93 ? 61  SER E CB  1 
ATOM   477  O OG  . SER A 1 61  ? 35.696  9.502  10.122  1.00 18.15 ? 61  SER E OG  1 
ATOM   478  N N   . SER A 1 62  ? 38.648  8.194  9.810   1.00 21.01 ? 62  SER E N   1 
ATOM   479  C CA  . SER A 1 62  ? 39.625  7.840  10.864  1.00 18.49 ? 62  SER E CA  1 
ATOM   480  C C   . SER A 1 62  ? 39.165  8.157  12.298  1.00 26.68 ? 62  SER E C   1 
ATOM   481  O O   . SER A 1 62  ? 39.672  7.654  13.278  1.00 38.64 ? 62  SER E O   1 
ATOM   482  C CB  . SER A 1 62  ? 40.987  8.490  10.577  1.00 21.18 ? 62  SER E CB  1 
ATOM   483  O OG  . SER A 1 62  ? 40.900  9.910  10.653  1.00 46.01 ? 62  SER E OG  1 
ATOM   484  N N   . THR A 1 63  ? 38.077  8.949  12.372  1.00 22.82 ? 63  THR E N   1 
ATOM   485  C CA  . THR A 1 63  ? 37.524  9.476  13.615  1.00 13.45 ? 63  THR E CA  1 
ATOM   486  C C   . THR A 1 63  ? 36.130  8.949  13.985  1.00 14.87 ? 63  THR E C   1 
ATOM   487  O O   . THR A 1 63  ? 35.512  9.388  14.967  1.00 32.13 ? 63  THR E O   1 
ATOM   488  C CB  . THR A 1 63  ? 37.491  11.011 13.561  1.00 15.45 ? 63  THR E CB  1 
ATOM   489  O OG1 . THR A 1 63  ? 36.870  11.385 12.336  1.00 22.58 ? 63  THR E OG1 1 
ATOM   490  C CG2 . THR A 1 63  ? 38.889  11.618 13.701  1.00 13.17 ? 63  THR E CG2 1 
ATOM   491  N N   . TYR A 1 64  ? 35.638  7.966  13.240  1.00 18.77 ? 64  TYR E N   1 
ATOM   492  C CA  . TYR A 1 64  ? 34.353  7.317  13.526  1.00 20.05 ? 64  TYR E CA  1 
ATOM   493  C C   . TYR A 1 64  ? 34.465  6.347  14.716  1.00 16.65 ? 64  TYR E C   1 
ATOM   494  O O   . TYR A 1 64  ? 35.422  5.605  14.858  1.00 28.63 ? 64  TYR E O   1 
ATOM   495  C CB  . TYR A 1 64  ? 33.824  6.570  12.297  1.00 16.04 ? 64  TYR E CB  1 
ATOM   496  C CG  . TYR A 1 64  ? 32.430  5.981  12.510  1.00 12.03 ? 64  TYR E CG  1 
ATOM   497  C CD1 . TYR A 1 64  ? 31.331  6.849  12.390  1.00 23.61 ? 64  TYR E CD1 1 
ATOM   498  C CD2 . TYR A 1 64  ? 32.273  4.613  12.817  1.00 13.29 ? 64  TYR E CD2 1 
ATOM   499  C CE1 . TYR A 1 64  ? 30.030  6.351  12.595  1.00 10.03 ? 64  TYR E CE1 1 
ATOM   500  C CE2 . TYR A 1 64  ? 30.959  4.113  13.018  1.00 14.05 ? 64  TYR E CE2 1 
ATOM   501  C CZ  . TYR A 1 64  ? 29.877  4.992  12.909  1.00 11.86 ? 64  TYR E CZ  1 
ATOM   502  O OH  . TYR A 1 64  ? 28.607  4.548  13.036  1.00 23.75 ? 64  TYR E OH  1 
ATOM   503  N N   . GLN A 1 65  ? 33.461  6.459  15.576  1.00 24.68 ? 65  GLN E N   1 
ATOM   504  C CA  . GLN A 1 65  ? 33.278  5.576  16.745  1.00 13.69 ? 65  GLN E CA  1 
ATOM   505  C C   . GLN A 1 65  ? 31.869  4.971  16.710  1.00 26.57 ? 65  GLN E C   1 
ATOM   506  O O   . GLN A 1 65  ? 30.883  5.702  16.597  1.00 22.46 ? 65  GLN E O   1 
ATOM   507  C CB  . GLN A 1 65  ? 33.450  6.307  18.081  1.00 50.85 ? 65  GLN E CB  1 
ATOM   508  C CG  . GLN A 1 65  ? 34.880  6.796  18.370  1.00 99.99 ? 65  GLN E CG  1 
ATOM   509  C CD  . GLN A 1 65  ? 34.934  7.716  19.597  1.00 99.99 ? 65  GLN E CD  1 
ATOM   510  O OE1 . GLN A 1 65  ? 35.481  8.824  19.568  1.00 99.99 ? 65  GLN E OE1 1 
ATOM   511  N NE2 . GLN A 1 65  ? 34.308  7.337  20.694  1.00 99.99 ? 65  GLN E NE2 1 
ATOM   512  N N   . SER A 1 66  ? 31.820  3.646  16.679  1.00 20.53 ? 66  SER E N   1 
ATOM   513  C CA  . SER A 1 66  ? 30.524  2.913  16.657  1.00 18.52 ? 66  SER E CA  1 
ATOM   514  C C   . SER A 1 66  ? 29.855  2.780  18.013  1.00 14.69 ? 66  SER E C   1 
ATOM   515  O O   . SER A 1 66  ? 30.434  3.049  19.075  1.00 20.00 ? 66  SER E O   1 
ATOM   516  C CB  . SER A 1 66  ? 30.670  1.540  15.979  1.00 22.74 ? 66  SER E CB  1 
ATOM   517  O OG  . SER A 1 66  ? 31.568  0.728  16.721  1.00 51.58 ? 66  SER E OG  1 
ATOM   518  N N   . THR A 1 67  ? 28.523  2.687  17.982  1.00 18.06 ? 67  THR E N   1 
ATOM   519  C CA  . THR A 1 67  ? 27.755  2.292  19.147  1.00 9.89  ? 67  THR E CA  1 
ATOM   520  C C   . THR A 1 67  ? 26.945  1.033  18.805  1.00 25.50 ? 67  THR E C   1 
ATOM   521  O O   . THR A 1 67  ? 26.881  0.633  17.637  1.00 23.83 ? 67  THR E O   1 
ATOM   522  C CB  . THR A 1 67  ? 26.782  3.385  19.690  1.00 12.05 ? 67  THR E CB  1 
ATOM   523  O OG1 . THR A 1 67  ? 25.501  3.323  19.071  1.00 21.72 ? 67  THR E OG1 1 
ATOM   524  C CG2 . THR A 1 67  ? 27.369  4.791  19.676  1.00 22.25 ? 67  THR E CG2 1 
ATOM   525  N N   . SER A 1 68  ? 26.313  0.450  19.815  1.00 14.74 ? 68  SER E N   1 
ATOM   526  C CA  . SER A 1 68  ? 25.322  -0.640 19.657  1.00 18.73 ? 68  SER E CA  1 
ATOM   527  C C   . SER A 1 68  ? 23.849  -0.155 19.765  1.00 13.71 ? 68  SER E C   1 
ATOM   528  O O   . SER A 1 68  ? 22.908  -0.932 19.839  1.00 17.73 ? 68  SER E O   1 
ATOM   529  C CB  . SER A 1 68  ? 25.629  -1.751 20.676  1.00 10.38 ? 68  SER E CB  1 
ATOM   530  O OG  . SER A 1 68  ? 26.388  -2.793 20.059  1.00 99.18 ? 68  SER E OG  1 
ATOM   531  N N   . GLU A 1 69  ? 23.644  1.172  19.717  1.00 12.05 ? 69  GLU E N   1 
ATOM   532  C CA  . GLU A 1 69  ? 22.299  1.783  19.857  1.00 13.66 ? 69  GLU E CA  1 
ATOM   533  C C   . GLU A 1 69  ? 21.677  2.230  18.555  1.00 15.56 ? 69  GLU E C   1 
ATOM   534  O O   . GLU A 1 69  ? 22.363  2.611  17.599  1.00 17.68 ? 69  GLU E O   1 
ATOM   535  C CB  . GLU A 1 69  ? 22.312  2.974  20.830  1.00 33.50 ? 69  GLU E CB  1 
ATOM   536  C CG  . GLU A 1 69  ? 22.639  2.566  22.275  1.00 72.56 ? 69  GLU E CG  1 
ATOM   537  C CD  . GLU A 1 69  ? 21.685  1.516  22.848  1.00 79.59 ? 69  GLU E CD  1 
ATOM   538  O OE1 . GLU A 1 69  ? 20.465  1.779  22.864  1.00 24.82 ? 69  GLU E OE1 1 
ATOM   539  O OE2 . GLU A 1 69  ? 22.207  0.466  23.281  1.00 30.51 ? 69  GLU E OE2 1 
ATOM   540  N N   . THR A 1 70  ? 20.337  2.154  18.499  1.00 12.51 ? 70  THR E N   1 
ATOM   541  C CA  . THR A 1 70  ? 19.579  2.531  17.333  1.00 14.56 ? 70  THR E CA  1 
ATOM   542  C C   . THR A 1 70  ? 18.676  3.740  17.607  1.00 9.58  ? 70  THR E C   1 
ATOM   543  O O   . THR A 1 70  ? 18.607  4.253  18.712  1.00 23.29 ? 70  THR E O   1 
ATOM   544  C CB  . THR A 1 70  ? 18.669  1.420  16.743  1.00 17.62 ? 70  THR E CB  1 
ATOM   545  O OG1 . THR A 1 70  ? 17.608  1.141  17.644  1.00 21.39 ? 70  THR E OG1 1 
ATOM   546  C CG2 . THR A 1 70  ? 19.468  0.196  16.312  1.00 13.32 ? 70  THR E CG2 1 
ATOM   547  N N   . VAL A 1 71  ? 18.220  4.294  16.490  1.00 13.51 ? 71  VAL E N   1 
ATOM   548  C CA  . VAL A 1 71  ? 17.313  5.454  16.468  1.00 10.51 ? 71  VAL E CA  1 
ATOM   549  C C   . VAL A 1 71  ? 16.221  5.219  15.440  1.00 11.03 ? 71  VAL E C   1 
ATOM   550  O O   . VAL A 1 71  ? 16.385  4.506  14.455  1.00 17.16 ? 71  VAL E O   1 
ATOM   551  C CB  . VAL A 1 71  ? 18.164  6.728  16.229  1.00 16.83 ? 71  VAL E CB  1 
ATOM   552  C CG1 . VAL A 1 71  ? 18.782  6.806  14.831  1.00 16.22 ? 71  VAL E CG1 1 
ATOM   553  C CG2 . VAL A 1 71  ? 17.384  7.995  16.561  1.00 10.66 ? 71  VAL E CG2 1 
ATOM   554  N N   . SER A 1 72  ? 15.018  5.644  15.801  1.00 10.15 ? 72  SER E N   1 
ATOM   555  C CA  . SER A 1 72  ? 13.851  5.621  14.936  1.00 10.59 ? 72  SER E CA  1 
ATOM   556  C C   . SER A 1 72  ? 13.136  6.976  15.074  1.00 23.94 ? 72  SER E C   1 
ATOM   557  O O   . SER A 1 72  ? 13.054  7.518  16.151  1.00 19.34 ? 72  SER E O   1 
ATOM   558  C CB  . SER A 1 72  ? 12.929  4.471  15.353  1.00 17.33 ? 72  SER E CB  1 
ATOM   559  O OG  . SER A 1 72  ? 11.682  4.594  14.671  1.00 75.60 ? 72  SER E OG  1 
ATOM   560  N N   . ILE A 1 73  ? 13.033  7.668  13.929  1.00 13.68 ? 73  ILE E N   1 
ATOM   561  C CA  . ILE A 1 73  ? 12.437  9.025  13.903  1.00 12.12 ? 73  ILE E CA  1 
ATOM   562  C C   . ILE A 1 73  ? 11.325  9.022  12.858  1.00 11.54 ? 73  ILE E C   1 
ATOM   563  O O   . ILE A 1 73  ? 11.545  8.599  11.735  1.00 17.88 ? 73  ILE E O   1 
ATOM   564  C CB  . ILE A 1 73  ? 13.430  10.160 13.564  1.00 7.50  ? 73  ILE E CB  1 
ATOM   565  C CG1 . ILE A 1 73  ? 14.731  10.082 14.372  1.00 11.37 ? 73  ILE E CG1 1 
ATOM   566  C CG2 . ILE A 1 73  ? 12.749  11.499 13.895  1.00 12.04 ? 73  ILE E CG2 1 
ATOM   567  C CD1 . ILE A 1 73  ? 15.896  10.789 13.678  1.00 11.95 ? 73  ILE E CD1 1 
ATOM   568  N N   . THR A 1 74  ? 10.173  9.557  13.288  1.00 18.23 ? 74  THR E N   1 
ATOM   569  C CA  . THR A 1 74  ? 8.988   9.802  12.463  1.00 10.87 ? 74  THR E CA  1 
ATOM   570  C C   . THR A 1 74  ? 8.662   11.291 12.426  1.00 16.05 ? 74  THR E C   1 
ATOM   571  O O   . THR A 1 74  ? 8.595   11.972 13.466  1.00 26.01 ? 74  THR E O   1 
ATOM   572  C CB  . THR A 1 74  ? 7.792   8.987  12.996  1.00 21.60 ? 74  THR E CB  1 
ATOM   573  O OG1 . THR A 1 74  ? 8.173   7.610  12.956  1.00 30.09 ? 74  THR E OG1 1 
ATOM   574  C CG2 . THR A 1 74  ? 6.493   9.187  12.203  1.00 27.57 ? 74  THR E CG2 1 
ATOM   575  N N   . TYR A 1 75  ? 8.574   11.792 11.195  1.00 21.61 ? 75  TYR E N   1 
ATOM   576  C CA  . TYR A 1 75  ? 8.191   13.174 10.886  1.00 12.98 ? 75  TYR E CA  1 
ATOM   577  C C   . TYR A 1 75  ? 6.758   13.241 10.311  1.00 18.65 ? 75  TYR E C   1 
ATOM   578  O O   . TYR A 1 75  ? 6.109   12.204 10.059  1.00 16.44 ? 75  TYR E O   1 
ATOM   579  C CB  . TYR A 1 75  ? 9.195   13.830 9.917   1.00 6.38  ? 75  TYR E CB  1 
ATOM   580  C CG  . TYR A 1 75  ? 10.660  13.759 10.367  1.00 7.75  ? 75  TYR E CG  1 
ATOM   581  C CD1 . TYR A 1 75  ? 11.210  14.807 11.140  1.00 9.15  ? 75  TYR E CD1 1 
ATOM   582  C CD2 . TYR A 1 75  ? 11.449  12.660 9.959   1.00 8.05  ? 75  TYR E CD2 1 
ATOM   583  C CE1 . TYR A 1 75  ? 12.558  14.759 11.509  1.00 6.75  ? 75  TYR E CE1 1 
ATOM   584  C CE2 . TYR A 1 75  ? 12.798  12.602 10.321  1.00 3.08  ? 75  TYR E CE2 1 
ATOM   585  C CZ  . TYR A 1 75  ? 13.338  13.661 11.090  1.00 6.16  ? 75  TYR E CZ  1 
ATOM   586  O OH  . TYR A 1 75  ? 14.647  13.666 11.314  1.00 9.40  ? 75  TYR E OH  1 
ATOM   587  N N   . GLY A 1 76  ? 6.228   14.437 10.206  1.00 17.11 ? 76  GLY E N   1 
ATOM   588  C CA  . GLY A 1 76  ? 4.938   14.685 9.511   1.00 12.49 ? 76  GLY E CA  1 
ATOM   589  C C   . GLY A 1 76  ? 4.983   14.062 8.094   1.00 12.83 ? 76  GLY E C   1 
ATOM   590  O O   . GLY A 1 76  ? 4.097   13.330 7.672   1.00 34.02 ? 76  GLY E O   1 
ATOM   591  N N   . THR A 1 77  ? 6.120   14.289 7.433   1.00 19.27 ? 77  THR E N   1 
ATOM   592  C CA  . THR A 1 77  ? 6.448   13.749 6.097   1.00 22.21 ? 77  THR E CA  1 
ATOM   593  C C   . THR A 1 77  ? 7.823   13.087 6.153   1.00 12.73 ? 77  THR E C   1 
ATOM   594  O O   . THR A 1 77  ? 8.877   13.712 6.273   1.00 20.96 ? 77  THR E O   1 
ATOM   595  C CB  . THR A 1 77  ? 6.411   14.817 4.964   1.00 16.41 ? 77  THR E CB  1 
ATOM   596  O OG1 . THR A 1 77  ? 7.331   15.878 5.217   1.00 16.63 ? 77  THR E OG1 1 
ATOM   597  C CG2 . THR A 1 77  ? 5.018   15.385 4.714   1.00 20.84 ? 77  THR E CG2 1 
ATOM   598  N N   . GLY A 1 78  ? 7.800   11.749 6.091   1.00 20.02 ? 78  GLY E N   1 
ATOM   599  C CA  . GLY A 1 78  ? 9.036   10.951 6.096   1.00 19.21 ? 78  GLY E CA  1 
ATOM   600  C C   . GLY A 1 78  ? 9.361   10.337 7.469   1.00 21.76 ? 78  GLY E C   1 
ATOM   601  O O   . GLY A 1 78  ? 8.796   10.673 8.499   1.00 19.67 ? 78  GLY E O   1 
ATOM   602  N N   . SER A 1 79  ? 10.198  9.302  7.390   1.00 22.93 ? 79  SER E N   1 
ATOM   603  C CA  . SER A 1 79  ? 10.628  8.493  8.551   1.00 16.50 ? 79  SER E CA  1 
ATOM   604  C C   . SER A 1 79  ? 11.932  7.767  8.252   1.00 18.39 ? 79  SER E C   1 
ATOM   605  O O   . SER A 1 79  ? 12.355  7.669  7.094   1.00 20.28 ? 79  SER E O   1 
ATOM   606  C CB  . SER A 1 79  ? 9.602   7.434  9.006   1.00 11.37 ? 79  SER E CB  1 
ATOM   607  O OG  . SER A 1 79  ? 9.361   6.447  8.001   1.00 31.61 ? 79  SER E OG  1 
ATOM   608  N N   . MET A 1 80  ? 12.685  7.530  9.319   1.00 14.88 ? 80  MET E N   1 
ATOM   609  C CA  . MET A 1 80  ? 13.935  6.762  9.201   1.00 15.66 ? 80  MET E CA  1 
ATOM   610  C C   . MET A 1 80  ? 14.154  5.846  10.412  1.00 14.14 ? 80  MET E C   1 
ATOM   611  O O   . MET A 1 80  ? 13.592  6.051  11.483  1.00 15.52 ? 80  MET E O   1 
ATOM   612  C CB  . MET A 1 80  ? 15.115  7.710  8.922   1.00 10.65 ? 80  MET E CB  1 
ATOM   613  C CG  . MET A 1 80  ? 15.518  8.601  10.090  1.00 7.79  ? 80  MET E CG  1 
ATOM   614  S SD  . MET A 1 80  ? 16.397  7.688  11.400  1.00 16.67 ? 80  MET E SD  1 
ATOM   615  C CE  . MET A 1 80  ? 18.029  7.577  10.726  1.00 8.16  ? 80  MET E CE  1 
ATOM   616  N N   . THR A 1 81  ? 14.885  4.770  10.177  1.00 8.72  ? 81  THR E N   1 
ATOM   617  C CA  . THR A 1 81  ? 15.556  4.056  11.273  1.00 10.60 ? 81  THR E CA  1 
ATOM   618  C C   . THR A 1 81  ? 17.049  4.003  10.973  1.00 9.76  ? 81  THR E C   1 
ATOM   619  O O   . THR A 1 81  ? 17.480  4.084  9.832   1.00 16.10 ? 81  THR E O   1 
ATOM   620  C CB  . THR A 1 81  ? 15.044  2.633  11.541  1.00 11.92 ? 81  THR E CB  1 
ATOM   621  O OG1 . THR A 1 81  ? 15.432  1.857  10.429  1.00 15.08 ? 81  THR E OG1 1 
ATOM   622  C CG2 . THR A 1 81  ? 13.524  2.560  11.753  1.00 7.54  ? 81  THR E CG2 1 
ATOM   623  N N   . GLY A 1 82  ? 17.825  4.007  12.029  1.00 9.32  ? 82  GLY E N   1 
ATOM   624  C CA  . GLY A 1 82  ? 19.276  3.924  11.848  1.00 9.70  ? 82  GLY E CA  1 
ATOM   625  C C   . GLY A 1 82  ? 20.002  3.515  13.105  1.00 11.18 ? 82  GLY E C   1 
ATOM   626  O O   . GLY A 1 82  ? 19.414  3.332  14.156  1.00 19.80 ? 82  GLY E O   1 
ATOM   627  N N   . ILE A 1 83  ? 21.318  3.489  12.930  1.00 10.80 ? 83  ILE E N   1 
ATOM   628  C CA  . ILE A 1 83  ? 22.232  3.243  14.033  1.00 12.67 ? 83  ILE E CA  1 
ATOM   629  C C   . ILE A 1 83  ? 22.976  4.526  14.390  1.00 21.02 ? 83  ILE E C   1 
ATOM   630  O O   . ILE A 1 83  ? 23.143  5.427  13.573  1.00 18.45 ? 83  ILE E O   1 
ATOM   631  C CB  . ILE A 1 83  ? 23.191  2.048  13.780  1.00 17.67 ? 83  ILE E CB  1 
ATOM   632  C CG1 . ILE A 1 83  ? 24.306  2.387  12.809  1.00 21.52 ? 83  ILE E CG1 1 
ATOM   633  C CG2 . ILE A 1 83  ? 22.441  0.794  13.312  1.00 30.15 ? 83  ILE E CG2 1 
ATOM   634  C CD1 . ILE A 1 83  ? 25.582  1.675  13.261  1.00 92.89 ? 83  ILE E CD1 1 
ATOM   635  N N   . LEU A 1 84  ? 23.226  4.707  15.691  1.00 13.90 ? 84  LEU E N   1 
ATOM   636  C CA  . LEU A 1 84  ? 23.959  5.858  16.200  1.00 11.99 ? 84  LEU E CA  1 
ATOM   637  C C   . LEU A 1 84  ? 25.461  5.586  16.182  1.00 16.25 ? 84  LEU E C   1 
ATOM   638  O O   . LEU A 1 84  ? 25.941  4.507  16.485  1.00 13.13 ? 84  LEU E O   1 
ATOM   639  C CB  . LEU A 1 84  ? 23.497  6.190  17.625  1.00 12.77 ? 84  LEU E CB  1 
ATOM   640  C CG  . LEU A 1 84  ? 22.018  6.589  17.648  1.00 16.98 ? 84  LEU E CG  1 
ATOM   641  C CD1 . LEU A 1 84  ? 21.536  6.661  19.098  1.00 17.27 ? 84  LEU E CD1 1 
ATOM   642  C CD2 . LEU A 1 84  ? 21.793  7.930  16.949  1.00 9.96  ? 84  LEU E CD2 1 
ATOM   643  N N   . GLY A 1 85  ? 26.163  6.605  15.741  1.00 10.38 ? 85  GLY E N   1 
ATOM   644  C CA  . GLY A 1 85  ? 27.644  6.627  15.765  1.00 5.77  ? 85  GLY E CA  1 
ATOM   645  C C   . GLY A 1 85  ? 28.102  8.019  16.169  1.00 14.34 ? 85  GLY E C   1 
ATOM   646  O O   . GLY A 1 85  ? 27.306  8.939  16.253  1.00 18.49 ? 85  GLY E O   1 
ATOM   647  N N   . TYR A 1 86  ? 29.411  8.134  16.441  1.00 11.68 ? 86  TYR E N   1 
ATOM   648  C CA  . TYR A 1 86  ? 30.062  9.410  16.789  1.00 10.79 ? 86  TYR E CA  1 
ATOM   649  C C   . TYR A 1 86  ? 31.094  9.733  15.720  1.00 22.30 ? 86  TYR E C   1 
ATOM   650  O O   . TYR A 1 86  ? 31.806  8.858  15.236  1.00 21.18 ? 86  TYR E O   1 
ATOM   651  C CB  . TYR A 1 86  ? 30.858  9.358  18.110  1.00 13.11 ? 86  TYR E CB  1 
ATOM   652  C CG  . TYR A 1 86  ? 30.030  9.254  19.403  1.00 15.53 ? 86  TYR E CG  1 
ATOM   653  C CD1 . TYR A 1 86  ? 29.612  7.970  19.839  1.00 21.76 ? 86  TYR E CD1 1 
ATOM   654  C CD2 . TYR A 1 86  ? 29.687  10.417 20.085  1.00 13.49 ? 86  TYR E CD2 1 
ATOM   655  C CE1 . TYR A 1 86  ? 28.787  7.882  20.982  1.00 36.78 ? 86  TYR E CE1 1 
ATOM   656  C CE2 . TYR A 1 86  ? 28.849  10.331 21.229  1.00 19.36 ? 86  TYR E CE2 1 
ATOM   657  C CZ  . TYR A 1 86  ? 28.409  9.055  21.646  1.00 23.71 ? 86  TYR E CZ  1 
ATOM   658  O OH  . TYR A 1 86  ? 27.491  8.969  22.637  1.00 39.95 ? 86  TYR E OH  1 
ATOM   659  N N   . ASP A 1 87  ? 31.174  11.023 15.374  1.00 15.46 ? 87  ASP E N   1 
ATOM   660  C CA  . ASP A 1 87  ? 32.225  11.559 14.514  1.00 11.36 ? 87  ASP E CA  1 
ATOM   661  C C   . ASP A 1 87  ? 32.225  13.082 14.573  1.00 13.33 ? 87  ASP E C   1 
ATOM   662  O O   . ASP A 1 87  ? 31.439  13.675 15.312  1.00 17.96 ? 87  ASP E O   1 
ATOM   663  C CB  . ASP A 1 87  ? 31.993  11.066 13.071  1.00 9.63  ? 87  ASP E CB  1 
ATOM   664  C CG  . ASP A 1 87  ? 33.296  10.786 12.338  1.00 43.14 ? 87  ASP E CG  1 
ATOM   665  O OD1 . ASP A 1 87  ? 34.251  11.580 12.495  1.00 18.83 ? 87  ASP E OD1 1 
ATOM   666  O OD2 . ASP A 1 87  ? 33.329  9.880  11.495  1.00 18.06 ? 87  ASP E OD2 1 
ATOM   667  N N   . THR A 1 88  ? 33.182  13.698 13.878  1.00 16.56 ? 88  THR E N   1 
ATOM   668  C CA  . THR A 1 88  ? 33.288  15.153 13.718  1.00 14.04 ? 88  THR E CA  1 
ATOM   669  C C   . THR A 1 88  ? 32.342  15.651 12.638  1.00 16.86 ? 88  THR E C   1 
ATOM   670  O O   . THR A 1 88  ? 32.369  15.191 11.506  1.00 18.46 ? 88  THR E O   1 
ATOM   671  C CB  . THR A 1 88  ? 34.708  15.549 13.351  1.00 14.59 ? 88  THR E CB  1 
ATOM   672  O OG1 . THR A 1 88  ? 35.515  14.998 14.376  1.00 13.24 ? 88  THR E OG1 1 
ATOM   673  C CG2 . THR A 1 88  ? 34.911  17.064 13.315  1.00 9.13  ? 88  THR E CG2 1 
ATOM   674  N N   . VAL A 1 89  ? 31.519  16.622 13.041  1.00 15.85 ? 89  VAL E N   1 
ATOM   675  C CA  . VAL A 1 89  ? 30.591  17.283 12.124  1.00 14.45 ? 89  VAL E CA  1 
ATOM   676  C C   . VAL A 1 89  ? 31.022  18.751 11.908  1.00 15.65 ? 89  VAL E C   1 
ATOM   677  O O   . VAL A 1 89  ? 31.246  19.493 12.844  1.00 18.63 ? 89  VAL E O   1 
ATOM   678  C CB  . VAL A 1 89  ? 29.148  17.160 12.639  1.00 10.03 ? 89  VAL E CB  1 
ATOM   679  C CG1 . VAL A 1 89  ? 28.170  17.905 11.731  1.00 11.17 ? 89  VAL E CG1 1 
ATOM   680  C CG2 . VAL A 1 89  ? 28.759  15.674 12.727  1.00 11.05 ? 89  VAL E CG2 1 
ATOM   681  N N   . GLN A 1 90  ? 31.344  19.067 10.653  1.00 14.09 ? 90  GLN E N   1 
ATOM   682  C CA  . GLN A 1 90  ? 31.673  20.438 10.205  1.00 30.52 ? 90  GLN E CA  1 
ATOM   683  C C   . GLN A 1 90  ? 30.409  21.175 9.748   1.00 9.54  ? 90  GLN E C   1 
ATOM   684  O O   . GLN A 1 90  ? 29.779  20.793 8.768   1.00 27.09 ? 90  GLN E O   1 
ATOM   685  C CB  . GLN A 1 90  ? 32.680  20.460 9.059   1.00 17.57 ? 90  GLN E CB  1 
ATOM   686  C CG  . GLN A 1 90  ? 34.123  20.360 9.542   1.00 58.04 ? 90  GLN E CG  1 
ATOM   687  C CD  . GLN A 1 90  ? 35.021  20.880 8.419   1.00 99.99 ? 90  GLN E CD  1 
ATOM   688  O OE1 . GLN A 1 90  ? 35.526  20.130 7.593   1.00 99.99 ? 90  GLN E OE1 1 
ATOM   689  N NE2 . GLN A 1 90  ? 35.108  22.194 8.341   1.00 99.99 ? 90  GLN E NE2 1 
ATOM   690  N N   . VAL A 1 91  ? 30.109  22.221 10.484  1.00 13.41 ? 91  VAL E N   1 
ATOM   691  C CA  . VAL A 1 91  ? 28.852  22.988 10.297  1.00 9.27  ? 91  VAL E CA  1 
ATOM   692  C C   . VAL A 1 91  ? 29.061  24.420 10.732  1.00 14.86 ? 91  VAL E C   1 
ATOM   693  O O   . VAL A 1 91  ? 29.704  24.661 11.740  1.00 32.12 ? 91  VAL E O   1 
ATOM   694  C CB  . VAL A 1 91  ? 27.671  22.328 11.041  1.00 17.65 ? 91  VAL E CB  1 
ATOM   695  C CG1 . VAL A 1 91  ? 27.944  22.094 12.531  1.00 21.93 ? 91  VAL E CG1 1 
ATOM   696  C CG2 . VAL A 1 91  ? 26.362  23.100 10.801  1.00 16.21 ? 91  VAL E CG2 1 
ATOM   697  N N   . GLY A 1 92  ? 28.815  25.343 9.774   1.00 30.46 ? 92  GLY E N   1 
ATOM   698  C CA  . GLY A 1 92  ? 28.849  26.795 9.996   1.00 23.34 ? 92  GLY E CA  1 
ATOM   699  C C   . GLY A 1 92  ? 30.230  27.338 10.428  1.00 35.86 ? 92  GLY E C   1 
ATOM   700  O O   . GLY A 1 92  ? 30.332  28.289 11.202  1.00 65.54 ? 92  GLY E O   1 
ATOM   701  N N   . GLY A 1 93  ? 31.250  26.695 9.882   1.00 23.41 ? 93  GLY E N   1 
ATOM   702  C CA  . GLY A 1 93  ? 32.698  26.884 10.135  1.00 15.26 ? 93  GLY E CA  1 
ATOM   703  C C   . GLY A 1 93  ? 33.198  26.400 11.503  1.00 46.76 ? 93  GLY E C   1 
ATOM   704  O O   . GLY A 1 93  ? 34.325  26.625 11.911  1.00 30.01 ? 93  GLY E O   1 
ATOM   705  N N   . ILE A 1 94  ? 32.361  25.552 12.150  1.00 19.79 ? 94  ILE E N   1 
ATOM   706  C CA  . ILE A 1 94  ? 32.640  24.964 13.447  1.00 19.30 ? 94  ILE E CA  1 
ATOM   707  C C   . ILE A 1 94  ? 32.920  23.450 13.266  1.00 22.14 ? 94  ILE E C   1 
ATOM   708  O O   . ILE A 1 94  ? 32.155  22.731 12.653  1.00 17.77 ? 94  ILE E O   1 
ATOM   709  C CB  . ILE A 1 94  ? 31.427  25.190 14.376  1.00 15.91 ? 94  ILE E CB  1 
ATOM   710  C CG1 . ILE A 1 94  ? 31.099  26.686 14.525  1.00 14.08 ? 94  ILE E CG1 1 
ATOM   711  C CG2 . ILE A 1 94  ? 31.689  24.581 15.760  1.00 18.07 ? 94  ILE E CG2 1 
ATOM   712  C CD1 . ILE A 1 94  ? 29.665  26.881 15.039  1.00 22.18 ? 94  ILE E CD1 1 
ATOM   713  N N   . SER A 1 95  ? 34.070  23.036 13.812  1.00 9.85  ? 95  SER E N   1 
ATOM   714  C CA  . SER A 1 95  ? 34.409  21.597 13.950  1.00 16.25 ? 95  SER E CA  1 
ATOM   715  C C   . SER A 1 95  ? 33.816  20.979 15.209  1.00 17.77 ? 95  SER E C   1 
ATOM   716  O O   . SER A 1 95  ? 34.397  20.986 16.288  1.00 19.51 ? 95  SER E O   1 
ATOM   717  C CB  . SER A 1 95  ? 35.932  21.353 13.928  1.00 17.52 ? 95  SER E CB  1 
ATOM   718  O OG  . SER A 1 95  ? 36.453  21.738 12.651  1.00 56.93 ? 95  SER E OG  1 
ATOM   719  N N   . ASP A 1 96  ? 32.575  20.473 15.082  1.00 14.23 ? 96  ASP E N   1 
ATOM   720  C CA  . ASP A 1 96  ? 31.803  19.869 16.166  1.00 12.98 ? 96  ASP E CA  1 
ATOM   721  C C   . ASP A 1 96  ? 32.215  18.422 16.397  1.00 16.52 ? 96  ASP E C   1 
ATOM   722  O O   . ASP A 1 96  ? 31.696  17.497 15.757  1.00 18.34 ? 96  ASP E O   1 
ATOM   723  C CB  . ASP A 1 96  ? 30.302  20.009 15.806  1.00 16.49 ? 96  ASP E CB  1 
ATOM   724  C CG  . ASP A 1 96  ? 29.353  19.221 16.692  1.00 25.32 ? 96  ASP E CG  1 
ATOM   725  O OD1 . ASP A 1 96  ? 29.666  19.068 17.878  1.00 17.57 ? 96  ASP E OD1 1 
ATOM   726  O OD2 . ASP A 1 96  ? 28.339  18.739 16.115  1.00 19.93 ? 96  ASP E OD2 1 
ATOM   727  N N   . THR A 1 97  ? 33.310  18.294 17.150  1.00 16.42 ? 97  THR E N   1 
ATOM   728  C CA  . THR A 1 97  ? 33.914  17.000 17.547  1.00 18.39 ? 97  THR E CA  1 
ATOM   729  C C   . THR A 1 97  ? 33.007  16.186 18.505  1.00 15.86 ? 97  THR E C   1 
ATOM   730  O O   . THR A 1 97  ? 32.088  16.692 19.113  1.00 19.25 ? 97  THR E O   1 
ATOM   731  C CB  . THR A 1 97  ? 35.305  17.171 18.177  1.00 18.52 ? 97  THR E CB  1 
ATOM   732  O OG1 . THR A 1 97  ? 35.179  18.075 19.265  1.00 29.11 ? 97  THR E OG1 1 
ATOM   733  C CG2 . THR A 1 97  ? 36.350  17.708 17.201  1.00 21.08 ? 97  THR E CG2 1 
ATOM   734  N N   . ASN A 1 98  ? 33.088  14.863 18.350  1.00 12.06 ? 98  ASN E N   1 
ATOM   735  C CA  . ASN A 1 98  ? 32.397  13.852 19.165  1.00 14.99 ? 98  ASN E CA  1 
ATOM   736  C C   . ASN A 1 98  ? 30.876  14.044 19.179  1.00 11.71 ? 98  ASN E C   1 
ATOM   737  O O   . ASN A 1 98  ? 30.199  13.883 20.188  1.00 16.95 ? 98  ASN E O   1 
ATOM   738  C CB  . ASN A 1 98  ? 32.934  13.835 20.613  1.00 28.26 ? 98  ASN E CB  1 
ATOM   739  C CG  . ASN A 1 98  ? 34.432  13.504 20.660  1.00 99.99 ? 98  ASN E CG  1 
ATOM   740  O OD1 . ASN A 1 98  ? 35.271  14.355 20.908  1.00 99.99 ? 98  ASN E OD1 1 
ATOM   741  N ND2 . ASN A 1 98  ? 34.764  12.268 20.367  1.00 99.99 ? 98  ASN E ND2 1 
ATOM   742  N N   . GLN A 1 99  ? 30.368  14.186 17.961  1.00 11.15 ? 99  GLN E N   1 
ATOM   743  C CA  . GLN A 1 99  ? 28.950  14.380 17.698  1.00 10.92 ? 99  GLN E CA  1 
ATOM   744  C C   . GLN A 1 99  ? 28.321  13.021 17.379  1.00 12.61 ? 99  GLN E C   1 
ATOM   745  O O   . GLN A 1 99  ? 28.766  12.312 16.483  1.00 13.58 ? 99  GLN E O   1 
ATOM   746  C CB  . GLN A 1 99  ? 28.747  15.354 16.520  1.00 7.16  ? 99  GLN E CB  1 
ATOM   747  C CG  . GLN A 1 99  ? 27.271  15.580 16.172  1.00 7.78  ? 99  GLN E CG  1 
ATOM   748  C CD  . GLN A 1 99  ? 26.542  16.228 17.343  1.00 9.98  ? 99  GLN E CD  1 
ATOM   749  O OE1 . GLN A 1 99  ? 26.848  17.339 17.748  1.00 12.66 ? 99  GLN E OE1 1 
ATOM   750  N NE2 . GLN A 1 99  ? 25.499  15.588 17.838  1.00 7.54  ? 99  GLN E NE2 1 
ATOM   751  N N   . ILE A 1 100 ? 27.330  12.710 18.182  1.00 13.06 ? 100 ILE E N   1 
ATOM   752  C CA  . ILE A 1 100 ? 26.409  11.572 17.950  1.00 9.13  ? 100 ILE E CA  1 
ATOM   753  C C   . ILE A 1 100 ? 25.433  11.955 16.834  1.00 15.95 ? 100 ILE E C   1 
ATOM   754  O O   . ILE A 1 100 ? 24.929  13.078 16.745  1.00 12.82 ? 100 ILE E O   1 
ATOM   755  C CB  . ILE A 1 100 ? 25.717  11.122 19.260  1.00 13.13 ? 100 ILE E CB  1 
ATOM   756  C CG1 . ILE A 1 100 ? 25.201  9.681  19.133  1.00 13.04 ? 100 ILE E CG1 1 
ATOM   757  C CG2 . ILE A 1 100 ? 24.580  12.059 19.685  1.00 15.90 ? 100 ILE E CG2 1 
ATOM   758  C CD1 . ILE A 1 100 ? 24.730  9.041  20.445  1.00 19.33 ? 100 ILE E CD1 1 
ATOM   759  N N   . PHE A 1 101 ? 25.268  11.007 15.911  1.00 7.35  ? 101 PHE E N   1 
ATOM   760  C CA  . PHE A 1 101 ? 24.324  11.131 14.797  1.00 12.24 ? 101 PHE E CA  1 
ATOM   761  C C   . PHE A 1 101 ? 23.860  9.748  14.323  1.00 12.48 ? 101 PHE E C   1 
ATOM   762  O O   . PHE A 1 101 ? 24.452  8.735  14.643  1.00 9.28  ? 101 PHE E O   1 
ATOM   763  C CB  . PHE A 1 101 ? 24.959  11.920 13.643  1.00 13.04 ? 101 PHE E CB  1 
ATOM   764  C CG  . PHE A 1 101 ? 26.074  11.197 12.883  1.00 15.70 ? 101 PHE E CG  1 
ATOM   765  C CD1 . PHE A 1 101 ? 25.771  10.671 11.598  1.00 16.12 ? 101 PHE E CD1 1 
ATOM   766  C CD2 . PHE A 1 101 ? 27.337  11.056 13.456  1.00 12.53 ? 101 PHE E CD2 1 
ATOM   767  C CE1 . PHE A 1 101 ? 26.782  10.001 10.889  1.00 16.73 ? 101 PHE E CE1 1 
ATOM   768  C CE2 . PHE A 1 101 ? 28.354  10.361 12.745  1.00 16.50 ? 101 PHE E CE2 1 
ATOM   769  C CZ  . PHE A 1 101 ? 28.062  9.851  11.470  1.00 27.94 ? 101 PHE E CZ  1 
ATOM   770  N N   . GLY A 1 102 ? 22.723  9.782  13.647  1.00 5.95  ? 102 GLY E N   1 
ATOM   771  C CA  . GLY A 1 102 ? 22.139  8.596  13.015  1.00 3.46  ? 102 GLY E CA  1 
ATOM   772  C C   . GLY A 1 102 ? 22.721  8.338  11.621  1.00 15.30 ? 102 GLY E C   1 
ATOM   773  O O   . GLY A 1 102 ? 22.895  9.231  10.791  1.00 10.63 ? 102 GLY E O   1 
ATOM   774  N N   . LEU A 1 103 ? 23.034  7.086  11.426  1.00 13.84 ? 103 LEU E N   1 
ATOM   775  C CA  . LEU A 1 103 ? 23.419  6.519  10.113  1.00 10.25 ? 103 LEU E CA  1 
ATOM   776  C C   . LEU A 1 103 ? 22.214  5.700  9.660   1.00 13.46 ? 103 LEU E C   1 
ATOM   777  O O   . LEU A 1 103 ? 21.874  4.699  10.280  1.00 17.25 ? 103 LEU E O   1 
ATOM   778  C CB  . LEU A 1 103 ? 24.621  5.572  10.281  1.00 8.25  ? 103 LEU E CB  1 
ATOM   779  C CG  . LEU A 1 103 ? 25.980  6.230  10.498  1.00 9.84  ? 103 LEU E CG  1 
ATOM   780  C CD1 . LEU A 1 103 ? 26.172  6.672  11.942  1.00 13.27 ? 103 LEU E CD1 1 
ATOM   781  C CD2 . LEU A 1 103 ? 27.011  5.130  10.247  1.00 10.56 ? 103 LEU E CD2 1 
ATOM   782  N N   . SER A 1 104 ? 21.475  6.158  8.616   1.00 12.20 ? 104 SER E N   1 
ATOM   783  C CA  . SER A 1 104 ? 20.224  5.472  8.268   1.00 8.32  ? 104 SER E CA  1 
ATOM   784  C C   . SER A 1 104 ? 20.413  4.010  7.796   1.00 18.52 ? 104 SER E C   1 
ATOM   785  O O   . SER A 1 104 ? 21.479  3.607  7.335   1.00 12.58 ? 104 SER E O   1 
ATOM   786  C CB  . SER A 1 104 ? 19.355  6.203  7.251   1.00 11.12 ? 104 SER E CB  1 
ATOM   787  O OG  . SER A 1 104 ? 19.859  5.976  5.930   1.00 16.14 ? 104 SER E OG  1 
ATOM   788  N N   . GLU A 1 105 ? 19.441  3.219  8.176   1.00 10.06 ? 105 GLU E N   1 
ATOM   789  C CA  . GLU A 1 105 ? 19.290  1.792  7.775   1.00 14.49 ? 105 GLU E CA  1 
ATOM   790  C C   . GLU A 1 105 ? 18.080  1.621  6.881   1.00 14.29 ? 105 GLU E C   1 
ATOM   791  O O   . GLU A 1 105 ? 18.103  0.850  5.929   1.00 20.76 ? 105 GLU E O   1 
ATOM   792  C CB  . GLU A 1 105 ? 19.103  0.838  8.957   1.00 15.08 ? 105 GLU E CB  1 
ATOM   793  C CG  . GLU A 1 105 ? 20.412  0.496  9.661   1.00 45.64 ? 105 GLU E CG  1 
ATOM   794  C CD  . GLU A 1 105 ? 20.138  -0.620 10.673  1.00 54.22 ? 105 GLU E CD  1 
ATOM   795  O OE1 . GLU A 1 105 ? 20.511  -1.771 10.338  1.00 63.33 ? 105 GLU E OE1 1 
ATOM   796  O OE2 . GLU A 1 105 ? 19.558  -0.294 11.726  1.00 52.03 ? 105 GLU E OE2 1 
ATOM   797  N N   . THR A 1 106 ? 16.971  2.269  7.232   1.00 18.64 ? 106 THR E N   1 
ATOM   798  C CA  . THR A 1 106 ? 15.775  2.294  6.393   1.00 13.51 ? 106 THR E CA  1 
ATOM   799  C C   . THR A 1 106 ? 15.235  3.738  6.326   1.00 28.23 ? 106 THR E C   1 
ATOM   800  O O   . THR A 1 106 ? 15.397  4.518  7.249   1.00 11.36 ? 106 THR E O   1 
ATOM   801  C CB  . THR A 1 106 ? 14.632  1.360  6.837   1.00 18.91 ? 106 THR E CB  1 
ATOM   802  O OG1 . THR A 1 106 ? 13.929  1.876  7.968   1.00 23.73 ? 106 THR E OG1 1 
ATOM   803  C CG2 . THR A 1 106 ? 15.115  -0.071 7.088   1.00 19.30 ? 106 THR E CG2 1 
ATOM   804  N N   . GLU A 1 107 ? 14.850  4.106  5.139   1.00 16.12 ? 107 GLU E N   1 
ATOM   805  C CA  . GLU A 1 107 ? 14.176  5.368  4.813   1.00 14.37 ? 107 GLU E CA  1 
ATOM   806  C C   . GLU A 1 107 ? 13.006  5.058  3.898   1.00 7.63  ? 107 GLU E C   1 
ATOM   807  O O   . GLU A 1 107 ? 13.162  5.102  2.661   1.00 22.55 ? 107 GLU E O   1 
ATOM   808  C CB  . GLU A 1 107 ? 15.152  6.321  4.100   1.00 5.05  ? 107 GLU E CB  1 
ATOM   809  C CG  . GLU A 1 107 ? 16.406  6.643  4.911   1.00 9.46  ? 107 GLU E CG  1 
ATOM   810  C CD  . GLU A 1 107 ? 17.251  7.717  4.254   1.00 9.10  ? 107 GLU E CD  1 
ATOM   811  O OE1 . GLU A 1 107 ? 16.654  8.542  3.545   1.00 18.23 ? 107 GLU E OE1 1 
ATOM   812  O OE2 . GLU A 1 107 ? 18.493  7.667  4.457   1.00 12.39 ? 107 GLU E OE2 1 
ATOM   813  N N   . PRO A 1 108 ? 11.890  4.556  4.435   1.00 12.06 ? 108 PRO E N   1 
ATOM   814  C CA  . PRO A 1 108 ? 10.772  4.063  3.621   1.00 14.29 ? 108 PRO E CA  1 
ATOM   815  C C   . PRO A 1 108 ? 9.963   5.197  3.018   1.00 32.18 ? 108 PRO E C   1 
ATOM   816  O O   . PRO A 1 108 ? 9.945   6.308  3.531   1.00 21.48 ? 108 PRO E O   1 
ATOM   817  C CB  . PRO A 1 108 ? 9.955   3.202  4.587   1.00 20.47 ? 108 PRO E CB  1 
ATOM   818  C CG  . PRO A 1 108 ? 10.189  3.858  5.939   1.00 28.40 ? 108 PRO E CG  1 
ATOM   819  C CD  . PRO A 1 108 ? 11.638  4.344  5.871   1.00 16.26 ? 108 PRO E CD  1 
ATOM   820  N N   . GLY A 1 109 ? 9.398   4.889  1.842   1.00 35.88 ? 109 GLY E N   1 
ATOM   821  C CA  . GLY A 1 109 ? 8.445   5.764  1.142   1.00 32.44 ? 109 GLY E CA  1 
ATOM   822  C C   . GLY A 1 109 ? 9.007   6.667  0.038   1.00 27.00 ? 109 GLY E C   1 
ATOM   823  O O   . GLY A 1 109 ? 10.195  6.864  -0.194  1.00 30.51 ? 109 GLY E O   1 
ATOM   824  N N   . SER A 1 110 ? 8.032   7.213  -0.706  1.00 49.93 ? 110 SER E N   1 
ATOM   825  C CA  . SER A 1 110 ? 8.254   8.089  -1.844  1.00 39.27 ? 110 SER E CA  1 
ATOM   826  C C   . SER A 1 110 ? 8.869   9.466  -1.494  1.00 99.99 ? 110 SER E C   1 
ATOM   827  O O   . SER A 1 110 ? 9.801   9.893  -2.165  1.00 22.30 ? 110 SER E O   1 
ATOM   828  C CB  . SER A 1 110 ? 6.925   8.266  -2.606  1.00 23.34 ? 110 SER E CB  1 
ATOM   829  O OG  . SER A 1 110 ? 5.861   8.515  -1.676  1.00 99.99 ? 110 SER E OG  1 
ATOM   830  N N   . PHE A 1 111 ? 8.478   10.056 -0.379  1.00 20.52 ? 111 PHE E N   1 
ATOM   831  C CA  . PHE A 1 111 ? 8.888   11.428 0.027   1.00 22.74 ? 111 PHE E CA  1 
ATOM   832  C C   . PHE A 1 111 ? 10.415  11.637 0.051   1.00 17.69 ? 111 PHE E C   1 
ATOM   833  O O   . PHE A 1 111 ? 10.930  12.564 -0.572  1.00 26.71 ? 111 PHE E O   1 
ATOM   834  C CB  . PHE A 1 111 ? 8.251   11.843 1.367   1.00 30.95 ? 111 PHE E CB  1 
ATOM   835  C CG  . PHE A 1 111 ? 8.767   13.196 1.913   1.00 25.91 ? 111 PHE E CG  1 
ATOM   836  C CD1 . PHE A 1 111 ? 8.383   14.398 1.306   1.00 31.37 ? 111 PHE E CD1 1 
ATOM   837  C CD2 . PHE A 1 111 ? 9.782   13.180 2.919   1.00 99.99 ? 111 PHE E CD2 1 
ATOM   838  C CE1 . PHE A 1 111 ? 9.038   15.601 1.639   1.00 33.07 ? 111 PHE E CE1 1 
ATOM   839  C CE2 . PHE A 1 111 ? 10.432  14.384 3.263   1.00 30.97 ? 111 PHE E CE2 1 
ATOM   840  C CZ  . PHE A 1 111 ? 10.073  15.578 2.625   1.00 33.66 ? 111 PHE E CZ  1 
ATOM   841  N N   . LEU A 1 112 ? 11.115  10.787 0.808   1.00 16.52 ? 112 LEU E N   1 
ATOM   842  C CA  . LEU A 1 112 ? 12.599  10.927 0.935   1.00 15.91 ? 112 LEU E CA  1 
ATOM   843  C C   . LEU A 1 112 ? 13.362  10.644 -0.385  1.00 17.10 ? 112 LEU E C   1 
ATOM   844  O O   . LEU A 1 112 ? 14.367  11.284 -0.662  1.00 20.89 ? 112 LEU E O   1 
ATOM   845  C CB  . LEU A 1 112 ? 13.148  10.133 2.139   1.00 23.76 ? 112 LEU E CB  1 
ATOM   846  C CG  . LEU A 1 112 ? 12.745  10.702 3.513   1.00 20.47 ? 112 LEU E CG  1 
ATOM   847  C CD1 . LEU A 1 112 ? 13.079  9.680  4.601   1.00 23.02 ? 112 LEU E CD1 1 
ATOM   848  C CD2 . LEU A 1 112 ? 13.437  12.041 3.801   1.00 21.05 ? 112 LEU E CD2 1 
ATOM   849  N N   . TYR A 1 113 ? 12.769  9.823  -1.266  1.00 25.52 ? 113 TYR E N   1 
ATOM   850  C CA  . TYR A 1 113 ? 13.326  9.501  -2.605  1.00 25.24 ? 113 TYR E CA  1 
ATOM   851  C C   . TYR A 1 113 ? 13.429  10.735 -3.529  1.00 7.69  ? 113 TYR E C   1 
ATOM   852  O O   . TYR A 1 113 ? 14.458  10.962 -4.159  1.00 19.81 ? 113 TYR E O   1 
ATOM   853  C CB  . TYR A 1 113 ? 12.556  8.315  -3.252  1.00 26.45 ? 113 TYR E CB  1 
ATOM   854  C CG  . TYR A 1 113 ? 13.070  7.852  -4.631  1.00 31.98 ? 113 TYR E CG  1 
ATOM   855  C CD1 . TYR A 1 113 ? 14.307  7.194  -4.748  1.00 26.33 ? 113 TYR E CD1 1 
ATOM   856  C CD2 . TYR A 1 113 ? 12.315  8.181  -5.793  1.00 57.20 ? 113 TYR E CD2 1 
ATOM   857  C CE1 . TYR A 1 113 ? 14.833  6.880  -6.018  1.00 33.10 ? 113 TYR E CE1 1 
ATOM   858  C CE2 . TYR A 1 113 ? 12.834  7.872  -7.064  1.00 99.99 ? 113 TYR E CE2 1 
ATOM   859  C CZ  . TYR A 1 113 ? 14.088  7.238  -7.170  1.00 48.62 ? 113 TYR E CZ  1 
ATOM   860  O OH  . TYR A 1 113 ? 14.638  7.028  -8.400  1.00 78.34 ? 113 TYR E OH  1 
ATOM   861  N N   . TYR A 1 114 ? 12.361  11.542 -3.522  1.00 14.40 ? 114 TYR E N   1 
ATOM   862  C CA  . TYR A 1 114 ? 12.189  12.748 -4.354  1.00 28.88 ? 114 TYR E CA  1 
ATOM   863  C C   . TYR A 1 114 ? 12.757  14.052 -3.769  1.00 24.84 ? 114 TYR E C   1 
ATOM   864  O O   . TYR A 1 114 ? 13.052  15.020 -4.468  1.00 38.65 ? 114 TYR E O   1 
ATOM   865  C CB  . TYR A 1 114 ? 10.688  12.891 -4.726  1.00 25.84 ? 114 TYR E CB  1 
ATOM   866  C CG  . TYR A 1 114 ? 10.172  11.833 -5.714  1.00 99.99 ? 114 TYR E CG  1 
ATOM   867  C CD1 . TYR A 1 114 ? 10.688  11.732 -7.024  1.00 28.82 ? 114 TYR E CD1 1 
ATOM   868  C CD2 . TYR A 1 114 ? 9.158   10.934 -5.271  1.00 32.59 ? 114 TYR E CD2 1 
ATOM   869  C CE1 . TYR A 1 114 ? 10.228  10.719 -7.890  1.00 99.99 ? 114 TYR E CE1 1 
ATOM   870  C CE2 . TYR A 1 114 ? 8.699   9.924  -6.129  1.00 99.99 ? 114 TYR E CE2 1 
ATOM   871  C CZ  . TYR A 1 114 ? 9.251   9.818  -7.430  1.00 99.99 ? 114 TYR E CZ  1 
ATOM   872  O OH  . TYR A 1 114 ? 8.898   8.759  -8.213  1.00 76.24 ? 114 TYR E OH  1 
ATOM   873  N N   . ALA A 1 115 ? 12.955  14.065 -2.439  1.00 26.83 ? 115 ALA E N   1 
ATOM   874  C CA  . ALA A 1 115 ? 13.573  15.178 -1.710  1.00 12.67 ? 115 ALA E CA  1 
ATOM   875  C C   . ALA A 1 115 ? 15.022  15.462 -2.180  1.00 14.98 ? 115 ALA E C   1 
ATOM   876  O O   . ALA A 1 115 ? 15.798  14.540 -2.362  1.00 20.34 ? 115 ALA E O   1 
ATOM   877  C CB  . ALA A 1 115 ? 13.588  14.845 -0.216  1.00 12.46 ? 115 ALA E CB  1 
ATOM   878  N N   . PRO A 1 116 ? 15.396  16.729 -2.330  1.00 15.49 ? 116 PRO E N   1 
ATOM   879  C CA  . PRO A 1 116 ? 16.760  17.129 -2.779  1.00 22.15 ? 116 PRO E CA  1 
ATOM   880  C C   . PRO A 1 116 ? 17.867  17.093 -1.709  1.00 16.61 ? 116 PRO E C   1 
ATOM   881  O O   . PRO A 1 116 ? 19.057  17.309 -1.997  1.00 36.94 ? 116 PRO E O   1 
ATOM   882  C CB  . PRO A 1 116 ? 16.532  18.529 -3.349  1.00 24.98 ? 116 PRO E CB  1 
ATOM   883  C CG  . PRO A 1 116 ? 15.398  19.086 -2.489  1.00 20.07 ? 116 PRO E CG  1 
ATOM   884  C CD  . PRO A 1 116 ? 14.484  17.891 -2.262  1.00 17.31 ? 116 PRO E CD  1 
ATOM   885  N N   . PHE A 1 117 ? 17.482  16.958 -0.443  1.00 23.53 ? 117 PHE E N   1 
ATOM   886  C CA  . PHE A 1 117 ? 18.403  16.880 0.705   1.00 15.03 ? 117 PHE E CA  1 
ATOM   887  C C   . PHE A 1 117 ? 18.707  15.410 1.090   1.00 8.52  ? 117 PHE E C   1 
ATOM   888  O O   . PHE A 1 117 ? 17.849  14.547 0.945   1.00 14.51 ? 117 PHE E O   1 
ATOM   889  C CB  . PHE A 1 117 ? 17.848  17.706 1.898   1.00 10.04 ? 117 PHE E CB  1 
ATOM   890  C CG  . PHE A 1 117 ? 16.475  17.273 2.435   1.00 7.97  ? 117 PHE E CG  1 
ATOM   891  C CD1 . PHE A 1 117 ? 16.352  16.235 3.360   1.00 15.16 ? 117 PHE E CD1 1 
ATOM   892  C CD2 . PHE A 1 117 ? 15.306  17.925 1.936   1.00 17.97 ? 117 PHE E CD2 1 
ATOM   893  C CE1 . PHE A 1 117 ? 15.079  15.783 3.778   1.00 18.17 ? 117 PHE E CE1 1 
ATOM   894  C CE2 . PHE A 1 117 ? 14.044  17.494 2.370   1.00 10.83 ? 117 PHE E CE2 1 
ATOM   895  C CZ  . PHE A 1 117 ? 13.927  16.420 3.276   1.00 14.94 ? 117 PHE E CZ  1 
ATOM   896  N N   . ASP A 1 118 ? 19.912  15.148 1.595   1.00 9.65  ? 118 ASP E N   1 
ATOM   897  C CA  . ASP A 1 118 ? 20.302  13.845 2.151   1.00 6.63  ? 118 ASP E CA  1 
ATOM   898  C C   . ASP A 1 118 ? 19.741  13.547 3.541   1.00 10.96 ? 118 ASP E C   1 
ATOM   899  O O   . ASP A 1 118 ? 19.397  12.412 3.809   1.00 10.70 ? 118 ASP E O   1 
ATOM   900  C CB  . ASP A 1 118 ? 21.822  13.687 2.261   1.00 2.95  ? 118 ASP E CB  1 
ATOM   901  C CG  . ASP A 1 118 ? 22.508  13.886 0.898   1.00 14.25 ? 118 ASP E CG  1 
ATOM   902  O OD1 . ASP A 1 118 ? 22.003  13.316 -0.074  1.00 13.88 ? 118 ASP E OD1 1 
ATOM   903  O OD2 . ASP A 1 118 ? 23.488  14.649 0.844   1.00 12.45 ? 118 ASP E OD2 1 
ATOM   904  N N   . GLY A 1 119 ? 19.889  14.482 4.502   1.00 11.97 ? 119 GLY E N   1 
ATOM   905  C CA  . GLY A 1 119 ? 19.409  14.266 5.877   1.00 10.27 ? 119 GLY E CA  1 
ATOM   906  C C   . GLY A 1 119 ? 18.805  15.502 6.555   1.00 9.55  ? 119 GLY E C   1 
ATOM   907  O O   . GLY A 1 119 ? 18.390  16.462 5.909   1.00 10.28 ? 119 GLY E O   1 
ATOM   908  N N   . ILE A 1 120 ? 18.729  15.428 7.886   1.00 9.32  ? 120 ILE E N   1 
ATOM   909  C CA  . ILE A 1 120 ? 18.130  16.469 8.742   1.00 11.03 ? 120 ILE E CA  1 
ATOM   910  C C   . ILE A 1 120 ? 19.083  16.723 9.920   1.00 7.74  ? 120 ILE E C   1 
ATOM   911  O O   . ILE A 1 120 ? 19.673  15.794 10.441  1.00 12.95 ? 120 ILE E O   1 
ATOM   912  C CB  . ILE A 1 120 ? 16.738  16.049 9.212   1.00 8.83  ? 120 ILE E CB  1 
ATOM   913  C CG1 . ILE A 1 120 ? 15.893  15.854 7.950   1.00 9.53  ? 120 ILE E CG1 1 
ATOM   914  C CG2 . ILE A 1 120 ? 16.113  17.122 10.130  1.00 7.20  ? 120 ILE E CG2 1 
ATOM   915  C CD1 . ILE A 1 120 ? 14.518  15.222 8.129   1.00 10.98 ? 120 ILE E CD1 1 
ATOM   916  N N   . LEU A 1 121 ? 19.283  18.016 10.155  1.00 12.34 ? 121 LEU E N   1 
ATOM   917  C CA  . LEU A 1 121 ? 20.039  18.533 11.315  1.00 5.77  ? 121 LEU E CA  1 
ATOM   918  C C   . LEU A 1 121 ? 19.043  19.284 12.181  1.00 17.80 ? 121 LEU E C   1 
ATOM   919  O O   . LEU A 1 121 ? 18.498  20.316 11.798  1.00 11.23 ? 121 LEU E O   1 
ATOM   920  C CB  . LEU A 1 121 ? 21.151  19.464 10.824  1.00 7.36  ? 121 LEU E CB  1 
ATOM   921  C CG  . LEU A 1 121 ? 22.206  19.755 11.897  1.00 8.98  ? 121 LEU E CG  1 
ATOM   922  C CD1 . LEU A 1 121 ? 23.568  20.040 11.254  1.00 5.75  ? 121 LEU E CD1 1 
ATOM   923  C CD2 . LEU A 1 121 ? 21.776  20.924 12.774  1.00 10.62 ? 121 LEU E CD2 1 
ATOM   924  N N   . GLY A 1 122 ? 18.598  18.571 13.218  1.00 5.66  ? 122 GLY E N   1 
ATOM   925  C CA  . GLY A 1 122 ? 17.605  19.104 14.148  1.00 4.11  ? 122 GLY E CA  1 
ATOM   926  C C   . GLY A 1 122 ? 18.230  20.169 15.060  1.00 3.90  ? 122 GLY E C   1 
ATOM   927  O O   . GLY A 1 122 ? 19.384  20.070 15.440  1.00 11.38 ? 122 GLY E O   1 
ATOM   928  N N   . LEU A 1 123 ? 17.437  21.209 15.316  1.00 10.54 ? 123 LEU E N   1 
ATOM   929  C CA  . LEU A 1 123 ? 17.849  22.403 16.091  1.00 6.66  ? 123 LEU E CA  1 
ATOM   930  C C   . LEU A 1 123 ? 16.975  22.723 17.340  1.00 5.60  ? 123 LEU E C   1 
ATOM   931  O O   . LEU A 1 123 ? 17.001  23.828 17.863  1.00 12.51 ? 123 LEU E O   1 
ATOM   932  C CB  . LEU A 1 123 ? 17.875  23.637 15.180  1.00 4.64  ? 123 LEU E CB  1 
ATOM   933  C CG  . LEU A 1 123 ? 19.047  23.648 14.197  1.00 5.91  ? 123 LEU E CG  1 
ATOM   934  C CD1 . LEU A 1 123 ? 18.820  24.769 13.186  1.00 7.13  ? 123 LEU E CD1 1 
ATOM   935  C CD2 . LEU A 1 123 ? 20.391  23.839 14.896  1.00 8.53  ? 123 LEU E CD2 1 
ATOM   936  N N   . ALA A 1 124 ? 16.054  21.818 17.675  1.00 7.58  ? 124 ALA E N   1 
ATOM   937  C CA  . ALA A 1 124 ? 15.203  21.942 18.867  1.00 9.24  ? 124 ALA E CA  1 
ATOM   938  C C   . ALA A 1 124 ? 15.874  21.378 20.136  1.00 10.79 ? 124 ALA E C   1 
ATOM   939  O O   . ALA A 1 124 ? 17.076  21.084 20.162  1.00 13.36 ? 124 ALA E O   1 
ATOM   940  C CB  . ALA A 1 124 ? 13.808  21.330 18.586  1.00 3.46  ? 124 ALA E CB  1 
ATOM   941  N N   . TYR A 1 125 ? 15.107  21.270 21.231  1.00 12.05 ? 125 TYR E N   1 
ATOM   942  C CA  . TYR A 1 125 ? 15.625  20.900 22.567  1.00 10.11 ? 125 TYR E CA  1 
ATOM   943  C C   . TYR A 1 125 ? 15.928  19.397 22.697  1.00 13.27 ? 125 TYR E C   1 
ATOM   944  O O   . TYR A 1 125 ? 15.237  18.610 22.049  1.00 11.28 ? 125 TYR E O   1 
ATOM   945  C CB  . TYR A 1 125 ? 14.607  21.320 23.640  1.00 8.07  ? 125 TYR E CB  1 
ATOM   946  C CG  . TYR A 1 125 ? 14.619  22.819 23.904  1.00 11.67 ? 125 TYR E CG  1 
ATOM   947  C CD1 . TYR A 1 125 ? 15.430  23.306 24.969  1.00 10.80 ? 125 TYR E CD1 1 
ATOM   948  C CD2 . TYR A 1 125 ? 13.806  23.678 23.150  1.00 6.14  ? 125 TYR E CD2 1 
ATOM   949  C CE1 . TYR A 1 125 ? 15.412  24.678 25.261  1.00 14.93 ? 125 TYR E CE1 1 
ATOM   950  C CE2 . TYR A 1 125 ? 13.778  25.058 23.450  1.00 8.76  ? 125 TYR E CE2 1 
ATOM   951  C CZ  . TYR A 1 125 ? 14.584  25.538 24.508  1.00 19.80 ? 125 TYR E CZ  1 
ATOM   952  O OH  . TYR A 1 125 ? 14.457  26.824 24.899  1.00 13.66 ? 125 TYR E OH  1 
ATOM   953  N N   . PRO A 1 126 ? 16.890  18.991 23.548  1.00 15.56 ? 126 PRO E N   1 
ATOM   954  C CA  . PRO A 1 126 ? 17.261  17.570 23.771  1.00 12.35 ? 126 PRO E CA  1 
ATOM   955  C C   . PRO A 1 126 ? 16.098  16.688 24.224  1.00 12.35 ? 126 PRO E C   1 
ATOM   956  O O   . PRO A 1 126 ? 16.044  15.502 23.919  1.00 20.29 ? 126 PRO E O   1 
ATOM   957  C CB  . PRO A 1 126 ? 18.309  17.583 24.879  1.00 9.72  ? 126 PRO E CB  1 
ATOM   958  C CG  . PRO A 1 126 ? 18.947  18.953 24.779  1.00 13.42 ? 126 PRO E CG  1 
ATOM   959  C CD  . PRO A 1 126 ? 17.817  19.862 24.312  1.00 10.53 ? 126 PRO E CD  1 
ATOM   960  N N   . SER A 1 127 ? 15.121  17.273 24.886  1.00 12.52 ? 127 SER E N   1 
ATOM   961  C CA  . SER A 1 127 ? 13.997  16.525 25.462  1.00 20.00 ? 127 SER E CA  1 
ATOM   962  C C   . SER A 1 127 ? 13.139  15.778 24.422  1.00 17.91 ? 127 SER E C   1 
ATOM   963  O O   . SER A 1 127 ? 12.501  14.781 24.748  1.00 30.56 ? 127 SER E O   1 
ATOM   964  C CB  . SER A 1 127 ? 13.083  17.386 26.328  1.00 14.91 ? 127 SER E CB  1 
ATOM   965  O OG  . SER A 1 127 ? 12.539  18.424 25.522  1.00 20.40 ? 127 SER E OG  1 
ATOM   966  N N   . ILE A 1 128 ? 13.128  16.267 23.195  1.00 15.47 ? 128 ILE E N   1 
ATOM   967  C CA  . ILE A 1 128 ? 12.373  15.592 22.123  1.00 8.04  ? 128 ILE E CA  1 
ATOM   968  C C   . ILE A 1 128 ? 13.243  14.716 21.189  1.00 19.31 ? 128 ILE E C   1 
ATOM   969  O O   . ILE A 1 128 ? 12.815  14.260 20.140  1.00 20.71 ? 128 ILE E O   1 
ATOM   970  C CB  . ILE A 1 128 ? 11.500  16.551 21.292  1.00 12.31 ? 128 ILE E CB  1 
ATOM   971  C CG1 . ILE A 1 128 ? 12.316  17.582 20.508  1.00 13.74 ? 128 ILE E CG1 1 
ATOM   972  C CG2 . ILE A 1 128 ? 10.427  17.169 22.185  1.00 17.13 ? 128 ILE E CG2 1 
ATOM   973  C CD1 . ILE A 1 128 ? 11.568  18.172 19.301  1.00 8.27  ? 128 ILE E CD1 1 
ATOM   974  N N   . SER A 1 129 ? 14.536  14.660 21.510  1.00 10.58 ? 129 SER E N   1 
ATOM   975  C CA  . SER A 1 129 ? 15.525  13.934 20.699  1.00 4.46  ? 129 SER E CA  1 
ATOM   976  C C   . SER A 1 129 ? 15.319  12.422 20.878  1.00 15.35 ? 129 SER E C   1 
ATOM   977  O O   . SER A 1 129 ? 15.172  11.927 21.980  1.00 20.07 ? 129 SER E O   1 
ATOM   978  C CB  . SER A 1 129 ? 16.935  14.303 21.110  1.00 9.83  ? 129 SER E CB  1 
ATOM   979  O OG  . SER A 1 129 ? 17.817  13.660 20.190  1.00 15.09 ? 129 SER E OG  1 
ATOM   980  N N   . SER A 1 130 ? 15.115  11.768 19.733  1.00 12.95 ? 130 SER E N   1 
ATOM   981  C CA  . SER A 1 130 ? 15.013  10.294 19.673  1.00 13.18 ? 130 SER E CA  1 
ATOM   982  C C   . SER A 1 130 ? 16.298  9.636  20.135  1.00 24.08 ? 130 SER E C   1 
ATOM   983  O O   . SER A 1 130 ? 17.412  10.068 19.822  1.00 13.56 ? 130 SER E O   1 
ATOM   984  C CB  . SER A 1 130 ? 14.675  9.768  18.272  1.00 22.72 ? 130 SER E CB  1 
ATOM   985  O OG  . SER A 1 130 ? 13.299  9.999  17.987  1.00 29.39 ? 130 SER E OG  1 
ATOM   986  N N   . SER A 1 131 ? 16.093  8.627  20.984  1.00 18.68 ? 131 SER E N   1 
ATOM   987  C CA  . SER A 1 131 ? 17.107  7.852  21.729  1.00 22.29 ? 131 SER E CA  1 
ATOM   988  C C   . SER A 1 131 ? 17.997  8.711  22.657  1.00 17.26 ? 131 SER E C   1 
ATOM   989  O O   . SER A 1 131 ? 19.097  8.322  23.022  1.00 19.69 ? 131 SER E O   1 
ATOM   990  C CB  . SER A 1 131 ? 17.953  6.989  20.781  1.00 13.23 ? 131 SER E CB  1 
ATOM   991  O OG  . SER A 1 131 ? 17.082  6.125  20.026  1.00 20.15 ? 131 SER E OG  1 
ATOM   992  N N   . GLY A 1 132 ? 17.473  9.899  23.023  1.00 15.63 ? 132 GLY E N   1 
ATOM   993  C CA  . GLY A 1 132 ? 18.189  10.933 23.807  1.00 12.91 ? 132 GLY E CA  1 
ATOM   994  C C   . GLY A 1 132 ? 19.558  11.322 23.233  1.00 17.85 ? 132 GLY E C   1 
ATOM   995  O O   . GLY A 1 132 ? 20.477  11.732 23.956  1.00 19.93 ? 132 GLY E O   1 
ATOM   996  N N   . ALA A 1 133 ? 19.678  11.297 21.912  1.00 14.77 ? 133 ALA E N   1 
ATOM   997  C CA  . ALA A 1 133 ? 20.925  11.668 21.221  1.00 16.10 ? 133 ALA E CA  1 
ATOM   998  C C   . ALA A 1 133 ? 21.135  13.185 21.346  1.00 18.05 ? 133 ALA E C   1 
ATOM   999  O O   . ALA A 1 133 ? 20.204  13.962 21.099  1.00 17.48 ? 133 ALA E O   1 
ATOM   1000 C CB  . ALA A 1 133 ? 20.884  11.227 19.748  1.00 13.73 ? 133 ALA E CB  1 
ATOM   1001 N N   . THR A 1 134 ? 22.341  13.577 21.767  1.00 10.53 ? 134 THR E N   1 
ATOM   1002 C CA  . THR A 1 134 ? 22.717  14.993 21.940  1.00 9.34  ? 134 THR E CA  1 
ATOM   1003 C C   . THR A 1 134 ? 22.555  15.717 20.592  1.00 11.92 ? 134 THR E C   1 
ATOM   1004 O O   . THR A 1 134 ? 23.195  15.309 19.623  1.00 17.56 ? 134 THR E O   1 
ATOM   1005 C CB  . THR A 1 134 ? 24.177  15.138 22.412  1.00 22.60 ? 134 THR E CB  1 
ATOM   1006 O OG1 . THR A 1 134 ? 24.364  14.305 23.553  1.00 19.98 ? 134 THR E OG1 1 
ATOM   1007 C CG2 . THR A 1 134 ? 24.556  16.571 22.810  1.00 7.24  ? 134 THR E CG2 1 
ATOM   1008 N N   . PRO A 1 135 ? 21.696  16.753 20.523  1.00 14.42 ? 135 PRO E N   1 
ATOM   1009 C CA  . PRO A 1 135 ? 21.568  17.589 19.313  1.00 16.22 ? 135 PRO E CA  1 
ATOM   1010 C C   . PRO A 1 135 ? 22.925  18.264 19.015  1.00 12.77 ? 135 PRO E C   1 
ATOM   1011 O O   . PRO A 1 135 ? 23.648  18.641 19.914  1.00 16.91 ? 135 PRO E O   1 
ATOM   1012 C CB  . PRO A 1 135 ? 20.509  18.620 19.689  1.00 9.35  ? 135 PRO E CB  1 
ATOM   1013 C CG  . PRO A 1 135 ? 19.655  17.929 20.740  1.00 9.76  ? 135 PRO E CG  1 
ATOM   1014 C CD  . PRO A 1 135 ? 20.700  17.151 21.524  1.00 8.82  ? 135 PRO E CD  1 
ATOM   1015 N N   . VAL A 1 136 ? 23.075  18.623 17.751  1.00 9.85  ? 136 VAL E N   1 
ATOM   1016 C CA  . VAL A 1 136 ? 24.296  19.357 17.282  1.00 7.25  ? 136 VAL E CA  1 
ATOM   1017 C C   . VAL A 1 136 ? 24.594  20.621 18.092  1.00 13.44 ? 136 VAL E C   1 
ATOM   1018 O O   . VAL A 1 136 ? 25.689  20.795 18.608  1.00 12.07 ? 136 VAL E O   1 
ATOM   1019 C CB  . VAL A 1 136 ? 24.111  19.665 15.781  1.00 8.99  ? 136 VAL E CB  1 
ATOM   1020 C CG1 . VAL A 1 136 ? 25.143  20.660 15.242  1.00 7.99  ? 136 VAL E CG1 1 
ATOM   1021 C CG2 . VAL A 1 136 ? 24.191  18.366 14.982  1.00 6.68  ? 136 VAL E CG2 1 
ATOM   1022 N N   . PHE A 1 137 ? 23.607  21.528 18.176  1.00 11.58 ? 137 PHE E N   1 
ATOM   1023 C CA  . PHE A 1 137 ? 23.792  22.826 18.871  1.00 12.20 ? 137 PHE E CA  1 
ATOM   1024 C C   . PHE A 1 137 ? 24.110  22.684 20.355  1.00 15.81 ? 137 PHE E C   1 
ATOM   1025 O O   . PHE A 1 137 ? 24.920  23.430 20.923  1.00 15.51 ? 137 PHE E O   1 
ATOM   1026 C CB  . PHE A 1 137 ? 22.608  23.785 18.659  1.00 9.95  ? 137 PHE E CB  1 
ATOM   1027 C CG  . PHE A 1 137 ? 23.030  25.226 18.997  1.00 14.33 ? 137 PHE E CG  1 
ATOM   1028 C CD1 . PHE A 1 137 ? 22.461  25.876 20.121  1.00 25.27 ? 137 PHE E CD1 1 
ATOM   1029 C CD2 . PHE A 1 137 ? 24.045  25.846 18.242  1.00 11.29 ? 137 PHE E CD2 1 
ATOM   1030 C CE1 . PHE A 1 137 ? 22.927  27.145 20.492  1.00 14.37 ? 137 PHE E CE1 1 
ATOM   1031 C CE2 . PHE A 1 137 ? 24.505  27.142 18.601  1.00 11.13 ? 137 PHE E CE2 1 
ATOM   1032 C CZ  . PHE A 1 137 ? 23.954  27.766 19.719  1.00 8.28  ? 137 PHE E CZ  1 
ATOM   1033 N N   . ASP A 1 138 ? 23.476  21.724 21.034  1.00 10.32 ? 138 ASP E N   1 
ATOM   1034 C CA  . ASP A 1 138 ? 23.822  21.400 22.432  1.00 11.06 ? 138 ASP E CA  1 
ATOM   1035 C C   . ASP A 1 138 ? 25.274  20.946 22.585  1.00 17.24 ? 138 ASP E C   1 
ATOM   1036 O O   . ASP A 1 138 ? 26.002  21.468 23.420  1.00 14.43 ? 138 ASP E O   1 
ATOM   1037 C CB  . ASP A 1 138 ? 22.928  20.319 23.034  1.00 3.38  ? 138 ASP E CB  1 
ATOM   1038 C CG  . ASP A 1 138 ? 21.515  20.829 23.258  1.00 15.82 ? 138 ASP E CG  1 
ATOM   1039 O OD1 . ASP A 1 138 ? 20.801  20.991 22.256  1.00 18.92 ? 138 ASP E OD1 1 
ATOM   1040 O OD2 . ASP A 1 138 ? 21.224  21.154 24.421  1.00 29.57 ? 138 ASP E OD2 1 
ATOM   1041 N N   . ASN A 1 139 ? 25.751  20.140 21.623  1.00 11.18 ? 139 ASN E N   1 
ATOM   1042 C CA  . ASN A 1 139 ? 27.122  19.625 21.661  1.00 10.26 ? 139 ASN E CA  1 
ATOM   1043 C C   . ASN A 1 139 ? 28.185  20.718 21.371  1.00 9.32  ? 139 ASN E C   1 
ATOM   1044 O O   . ASN A 1 139 ? 29.201  20.810 22.048  1.00 24.17 ? 139 ASN E O   1 
ATOM   1045 C CB  . ASN A 1 139 ? 27.251  18.427 20.713  1.00 14.24 ? 139 ASN E CB  1 
ATOM   1046 C CG  . ASN A 1 139 ? 28.402  17.505 21.113  1.00 18.79 ? 139 ASN E CG  1 
ATOM   1047 O OD1 . ASN A 1 139 ? 28.430  16.967 22.204  1.00 24.91 ? 139 ASN E OD1 1 
ATOM   1048 N ND2 . ASN A 1 139 ? 29.329  17.269 20.204  1.00 17.31 ? 139 ASN E ND2 1 
ATOM   1049 N N   . ILE A 1 140 ? 27.844  21.618 20.447  1.00 23.66 ? 140 ILE E N   1 
ATOM   1050 C CA  . ILE A 1 140 ? 28.672  22.820 20.102  1.00 15.46 ? 140 ILE E CA  1 
ATOM   1051 C C   . ILE A 1 140 ? 28.834  23.701 21.339  1.00 28.08 ? 140 ILE E C   1 
ATOM   1052 O O   . ILE A 1 140 ? 29.955  24.050 21.733  1.00 13.61 ? 140 ILE E O   1 
ATOM   1053 C CB  . ILE A 1 140 ? 28.077  23.559 18.871  1.00 11.11 ? 140 ILE E CB  1 
ATOM   1054 C CG1 . ILE A 1 140 ? 28.242  22.690 17.613  1.00 9.80  ? 140 ILE E CG1 1 
ATOM   1055 C CG2 . ILE A 1 140 ? 28.659  24.978 18.690  1.00 16.42 ? 140 ILE E CG2 1 
ATOM   1056 C CD1 . ILE A 1 140 ? 27.579  23.229 16.339  1.00 20.92 ? 140 ILE E CD1 1 
ATOM   1057 N N   . TRP A 1 141 ? 27.720  23.979 22.047  1.00 12.12 ? 141 TRP E N   1 
ATOM   1058 C CA  . TRP A 1 141 ? 27.682  24.816 23.246  1.00 19.96 ? 141 TRP E CA  1 
ATOM   1059 C C   . TRP A 1 141 ? 28.418  24.201 24.429  1.00 15.83 ? 141 TRP E C   1 
ATOM   1060 O O   . TRP A 1 141 ? 29.407  24.765 24.870  1.00 20.26 ? 141 TRP E O   1 
ATOM   1061 C CB  . TRP A 1 141 ? 26.235  25.196 23.638  1.00 11.96 ? 141 TRP E CB  1 
ATOM   1062 C CG  . TRP A 1 141 ? 26.170  25.972 24.965  1.00 18.94 ? 141 TRP E CG  1 
ATOM   1063 C CD1 . TRP A 1 141 ? 25.633  25.489 26.099  1.00 22.56 ? 141 TRP E CD1 1 
ATOM   1064 C CD2 . TRP A 1 141 ? 26.715  27.215 25.249  1.00 15.86 ? 141 TRP E CD2 1 
ATOM   1065 N NE1 . TRP A 1 141 ? 25.834  26.373 27.083  1.00 20.22 ? 141 TRP E NE1 1 
ATOM   1066 C CE2 . TRP A 1 141 ? 26.469  27.436 26.620  1.00 66.53 ? 141 TRP E CE2 1 
ATOM   1067 C CE3 . TRP A 1 141 ? 27.322  28.220 24.462  1.00 18.64 ? 141 TRP E CE3 1 
ATOM   1068 C CZ2 . TRP A 1 141 ? 26.830  28.668 27.216  1.00 27.30 ? 141 TRP E CZ2 1 
ATOM   1069 C CZ3 . TRP A 1 141 ? 27.679  29.450 25.060  1.00 17.84 ? 141 TRP E CZ3 1 
ATOM   1070 C CH2 . TRP A 1 141 ? 27.436  29.663 26.427  1.00 16.58 ? 141 TRP E CH2 1 
ATOM   1071 N N   . ASN A 1 142 ? 28.124  22.907 24.690  1.00 18.99 ? 142 ASN E N   1 
ATOM   1072 C CA  . ASN A 1 142 ? 28.768  22.103 25.735  1.00 16.14 ? 142 ASN E CA  1 
ATOM   1073 C C   . ASN A 1 142 ? 30.301  21.984 25.616  1.00 12.35 ? 142 ASN E C   1 
ATOM   1074 O O   . ASN A 1 142 ? 30.989  21.856 26.612  1.00 29.78 ? 142 ASN E O   1 
ATOM   1075 C CB  . ASN A 1 142 ? 28.189  20.679 25.848  1.00 12.66 ? 142 ASN E CB  1 
ATOM   1076 C CG  . ASN A 1 142 ? 26.747  20.619 26.387  1.00 20.56 ? 142 ASN E CG  1 
ATOM   1077 O OD1 . ASN A 1 142 ? 26.056  19.619 26.269  1.00 34.21 ? 142 ASN E OD1 1 
ATOM   1078 N ND2 . ASN A 1 142 ? 26.282  21.689 26.991  1.00 23.43 ? 142 ASN E ND2 1 
ATOM   1079 N N   . GLN A 1 143 ? 30.774  22.150 24.386  1.00 15.04 ? 143 GLN E N   1 
ATOM   1080 C CA  . GLN A 1 143 ? 32.228  22.126 24.092  1.00 18.53 ? 143 GLN E CA  1 
ATOM   1081 C C   . GLN A 1 143 ? 32.913  23.515 24.054  1.00 23.66 ? 143 GLN E C   1 
ATOM   1082 O O   . GLN A 1 143 ? 34.083  23.619 23.699  1.00 26.75 ? 143 GLN E O   1 
ATOM   1083 C CB  . GLN A 1 143 ? 32.475  21.363 22.797  1.00 18.03 ? 143 GLN E CB  1 
ATOM   1084 C CG  . GLN A 1 143 ? 32.120  19.883 22.959  1.00 45.63 ? 143 GLN E CG  1 
ATOM   1085 C CD  . GLN A 1 143 ? 32.440  19.141 21.671  1.00 51.15 ? 143 GLN E CD  1 
ATOM   1086 O OE1 . GLN A 1 143 ? 31.804  19.278 20.644  1.00 29.17 ? 143 GLN E OE1 1 
ATOM   1087 N NE2 . GLN A 1 143 ? 33.520  18.402 21.701  1.00 20.20 ? 143 GLN E NE2 1 
ATOM   1088 N N   . GLY A 1 144 ? 32.131  24.546 24.359  1.00 18.74 ? 144 GLY E N   1 
ATOM   1089 C CA  . GLY A 1 144 ? 32.560  25.963 24.359  1.00 12.71 ? 144 GLY E CA  1 
ATOM   1090 C C   . GLY A 1 144 ? 33.021  26.475 22.985  1.00 10.91 ? 144 GLY E C   1 
ATOM   1091 O O   . GLY A 1 144 ? 33.910  27.299 22.875  1.00 28.43 ? 144 GLY E O   1 
ATOM   1092 N N   . LEU A 1 145 ? 32.286  26.066 21.930  1.00 20.45 ? 145 LEU E N   1 
ATOM   1093 C CA  . LEU A 1 145 ? 32.678  26.374 20.537  1.00 14.50 ? 145 LEU E CA  1 
ATOM   1094 C C   . LEU A 1 145 ? 32.083  27.702 19.971  1.00 11.56 ? 145 LEU E C   1 
ATOM   1095 O O   . LEU A 1 145 ? 32.504  28.197 18.932  1.00 28.49 ? 145 LEU E O   1 
ATOM   1096 C CB  . LEU A 1 145 ? 32.446  25.189 19.585  1.00 28.44 ? 145 LEU E CB  1 
ATOM   1097 C CG  . LEU A 1 145 ? 33.266  23.927 19.955  1.00 22.41 ? 145 LEU E CG  1 
ATOM   1098 C CD1 . LEU A 1 145 ? 32.805  22.728 19.131  1.00 13.91 ? 145 LEU E CD1 1 
ATOM   1099 C CD2 . LEU A 1 145 ? 34.778  24.118 19.809  1.00 24.67 ? 145 LEU E CD2 1 
ATOM   1100 N N   . VAL A 1 146 ? 31.015  28.122 20.603  1.00 17.81 ? 146 VAL E N   1 
ATOM   1101 C CA  . VAL A 1 146 ? 30.447  29.482 20.448  1.00 6.73  ? 146 VAL E CA  1 
ATOM   1102 C C   . VAL A 1 146 ? 30.443  30.171 21.826  1.00 13.69 ? 146 VAL E C   1 
ATOM   1103 O O   . VAL A 1 146 ? 30.310  29.507 22.848  1.00 12.81 ? 146 VAL E O   1 
ATOM   1104 C CB  . VAL A 1 146 ? 29.042  29.481 19.828  1.00 22.00 ? 146 VAL E CB  1 
ATOM   1105 C CG1 . VAL A 1 146 ? 29.121  29.073 18.358  1.00 13.56 ? 146 VAL E CG1 1 
ATOM   1106 C CG2 . VAL A 1 146 ? 28.019  28.622 20.583  1.00 15.51 ? 146 VAL E CG2 1 
ATOM   1107 N N   . SER A 1 147 ? 30.337  31.472 21.769  1.00 9.25  ? 147 SER E N   1 
ATOM   1108 C CA  . SER A 1 147 ? 30.267  32.362 22.971  1.00 17.06 ? 147 SER E CA  1 
ATOM   1109 C C   . SER A 1 147 ? 28.843  32.673 23.386  1.00 24.71 ? 147 SER E C   1 
ATOM   1110 O O   . SER A 1 147 ? 28.511  32.920 24.547  1.00 15.90 ? 147 SER E O   1 
ATOM   1111 C CB  . SER A 1 147 ? 30.945  33.708 22.702  1.00 21.39 ? 147 SER E CB  1 
ATOM   1112 O OG  . SER A 1 147 ? 32.289  33.439 22.337  1.00 33.50 ? 147 SER E OG  1 
ATOM   1113 N N   . GLN A 1 148 ? 28.000  32.839 22.374  1.00 8.39  ? 148 GLN E N   1 
ATOM   1114 C CA  . GLN A 1 148 ? 26.579  33.123 22.572  1.00 5.36  ? 148 GLN E CA  1 
ATOM   1115 C C   . GLN A 1 148 ? 25.790  31.858 22.276  1.00 12.84 ? 148 GLN E C   1 
ATOM   1116 O O   . GLN A 1 148 ? 26.019  31.178 21.289  1.00 15.41 ? 148 GLN E O   1 
ATOM   1117 C CB  . GLN A 1 148 ? 26.079  34.277 21.698  1.00 10.47 ? 148 GLN E CB  1 
ATOM   1118 C CG  . GLN A 1 148 ? 26.874  35.561 21.912  1.00 13.15 ? 148 GLN E CG  1 
ATOM   1119 C CD  . GLN A 1 148 ? 26.240  36.684 21.085  1.00 8.58  ? 148 GLN E CD  1 
ATOM   1120 O OE1 . GLN A 1 148 ? 25.058  36.953 21.158  1.00 20.68 ? 148 GLN E OE1 1 
ATOM   1121 N NE2 . GLN A 1 148 ? 27.054  37.414 20.385  1.00 25.40 ? 148 GLN E NE2 1 
ATOM   1122 N N   . ASP A 1 149 ? 24.968  31.494 23.267  1.00 9.96  ? 149 ASP E N   1 
ATOM   1123 C CA  . ASP A 1 149 ? 24.180  30.257 23.229  1.00 9.66  ? 149 ASP E CA  1 
ATOM   1124 C C   . ASP A 1 149 ? 22.838  30.480 22.496  1.00 10.76 ? 149 ASP E C   1 
ATOM   1125 O O   . ASP A 1 149 ? 21.739  30.358 23.028  1.00 14.59 ? 149 ASP E O   1 
ATOM   1126 C CB  . ASP A 1 149 ? 23.984  29.808 24.669  1.00 6.19  ? 149 ASP E CB  1 
ATOM   1127 C CG  . ASP A 1 149 ? 23.398  28.400 24.831  1.00 17.01 ? 149 ASP E CG  1 
ATOM   1128 O OD1 . ASP A 1 149 ? 23.451  27.624 23.865  1.00 14.62 ? 149 ASP E OD1 1 
ATOM   1129 O OD2 . ASP A 1 149 ? 22.867  28.187 25.932  1.00 17.88 ? 149 ASP E OD2 1 
ATOM   1130 N N   . LEU A 1 150 ? 23.004  30.979 21.286  1.00 11.23 ? 150 LEU E N   1 
ATOM   1131 C CA  . LEU A 1 150 ? 21.895  31.252 20.363  1.00 12.99 ? 150 LEU E CA  1 
ATOM   1132 C C   . LEU A 1 150 ? 22.326  31.044 18.909  1.00 9.42  ? 150 LEU E C   1 
ATOM   1133 O O   . LEU A 1 150 ? 23.504  30.923 18.593  1.00 12.60 ? 150 LEU E O   1 
ATOM   1134 C CB  . LEU A 1 150 ? 21.265  32.637 20.606  1.00 16.28 ? 150 LEU E CB  1 
ATOM   1135 C CG  . LEU A 1 150 ? 22.128  33.890 20.366  1.00 16.63 ? 150 LEU E CG  1 
ATOM   1136 C CD1 . LEU A 1 150 ? 22.422  34.169 18.895  1.00 27.67 ? 150 LEU E CD1 1 
ATOM   1137 C CD2 . LEU A 1 150 ? 21.363  35.101 20.907  1.00 12.00 ? 150 LEU E CD2 1 
ATOM   1138 N N   . PHE A 1 151 ? 21.312  30.921 18.067  1.00 12.87 ? 151 PHE E N   1 
ATOM   1139 C CA  . PHE A 1 151 ? 21.469  30.891 16.604  1.00 2.00  ? 151 PHE E CA  1 
ATOM   1140 C C   . PHE A 1 151 ? 20.295  31.637 15.990  1.00 10.64 ? 151 PHE E C   1 
ATOM   1141 O O   . PHE A 1 151 ? 19.220  31.813 16.574  1.00 11.13 ? 151 PHE E O   1 
ATOM   1142 C CB  . PHE A 1 151 ? 21.622  29.431 16.110  1.00 4.14  ? 151 PHE E CB  1 
ATOM   1143 C CG  . PHE A 1 151 ? 20.377  28.534 16.307  1.00 7.67  ? 151 PHE E CG  1 
ATOM   1144 C CD1 . PHE A 1 151 ? 20.296  27.703 17.439  1.00 7.67  ? 151 PHE E CD1 1 
ATOM   1145 C CD2 . PHE A 1 151 ? 19.343  28.572 15.360  1.00 3.48  ? 151 PHE E CD2 1 
ATOM   1146 C CE1 . PHE A 1 151 ? 19.137  26.921 17.646  1.00 6.66  ? 151 PHE E CE1 1 
ATOM   1147 C CE2 . PHE A 1 151 ? 18.188  27.768 15.553  1.00 10.04 ? 151 PHE E CE2 1 
ATOM   1148 C CZ  . PHE A 1 151 ? 18.091  26.966 16.701  1.00 7.92  ? 151 PHE E CZ  1 
ATOM   1149 N N   . SER A 1 152 ? 20.529  32.210 14.806  1.00 11.98 ? 152 SER E N   1 
ATOM   1150 C CA  . SER A 1 152 ? 19.498  32.963 14.112  1.00 7.14  ? 152 SER E CA  1 
ATOM   1151 C C   . SER A 1 152 ? 19.385  32.566 12.642  1.00 6.92  ? 152 SER E C   1 
ATOM   1152 O O   . SER A 1 152 ? 20.247  31.898 12.086  1.00 8.46  ? 152 SER E O   1 
ATOM   1153 C CB  . SER A 1 152 ? 19.712  34.466 14.320  1.00 2.00  ? 152 SER E CB  1 
ATOM   1154 O OG  . SER A 1 152 ? 20.946  34.835 13.748  1.00 17.28 ? 152 SER E OG  1 
ATOM   1155 N N   . VAL A 1 153 ? 18.163  32.702 12.152  1.00 8.86  ? 153 VAL E N   1 
ATOM   1156 C CA  . VAL A 1 153 ? 17.793  32.153 10.846  1.00 9.06  ? 153 VAL E CA  1 
ATOM   1157 C C   . VAL A 1 153 ? 17.182  33.270 10.006  1.00 11.42 ? 153 VAL E C   1 
ATOM   1158 O O   . VAL A 1 153 ? 16.254  33.942 10.428  1.00 11.19 ? 153 VAL E O   1 
ATOM   1159 C CB  . VAL A 1 153 ? 16.815  30.983 11.003  1.00 8.76  ? 153 VAL E CB  1 
ATOM   1160 C CG1 . VAL A 1 153 ? 16.371  30.429 9.653   1.00 16.17 ? 153 VAL E CG1 1 
ATOM   1161 C CG2 . VAL A 1 153 ? 17.504  29.837 11.730  1.00 7.11  ? 153 VAL E CG2 1 
ATOM   1162 N N   . TYR A 1 154 ? 17.771  33.400 8.827   1.00 10.45 ? 154 TYR E N   1 
ATOM   1163 C CA  . TYR A 1 154 ? 17.194  34.227 7.742   1.00 14.34 ? 154 TYR E CA  1 
ATOM   1164 C C   . TYR A 1 154 ? 16.881  33.351 6.533   1.00 8.18  ? 154 TYR E C   1 
ATOM   1165 O O   . TYR A 1 154 ? 17.738  32.628 6.058   1.00 10.33 ? 154 TYR E O   1 
ATOM   1166 C CB  . TYR A 1 154 ? 18.155  35.361 7.359   1.00 9.47  ? 154 TYR E CB  1 
ATOM   1167 C CG  . TYR A 1 154 ? 17.713  36.089 6.104   1.00 16.71 ? 154 TYR E CG  1 
ATOM   1168 C CD1 . TYR A 1 154 ? 16.471  36.801 6.098   1.00 13.73 ? 154 TYR E CD1 1 
ATOM   1169 C CD2 . TYR A 1 154 ? 18.438  35.906 4.911   1.00 12.30 ? 154 TYR E CD2 1 
ATOM   1170 C CE1 . TYR A 1 154 ? 15.968  37.299 4.901   1.00 20.94 ? 154 TYR E CE1 1 
ATOM   1171 C CE2 . TYR A 1 154 ? 17.932  36.432 3.706   1.00 21.87 ? 154 TYR E CE2 1 
ATOM   1172 C CZ  . TYR A 1 154 ? 16.704  37.110 3.719   1.00 37.32 ? 154 TYR E CZ  1 
ATOM   1173 O OH  . TYR A 1 154 ? 16.200  37.629 2.554   1.00 29.08 ? 154 TYR E OH  1 
ATOM   1174 N N   . LEU A 1 155 ? 15.598  33.298 6.196   1.00 8.96  ? 155 LEU E N   1 
ATOM   1175 C CA  . LEU A 1 155 ? 15.136  32.502 5.062   1.00 9.85  ? 155 LEU E CA  1 
ATOM   1176 C C   . LEU A 1 155 ? 14.686  33.486 3.965   1.00 12.09 ? 155 LEU E C   1 
ATOM   1177 O O   . LEU A 1 155 ? 13.851  34.338 4.183   1.00 15.15 ? 155 LEU E O   1 
ATOM   1178 C CB  . LEU A 1 155 ? 13.948  31.589 5.399   1.00 7.89  ? 155 LEU E CB  1 
ATOM   1179 C CG  . LEU A 1 155 ? 14.208  30.539 6.480   1.00 3.24  ? 155 LEU E CG  1 
ATOM   1180 C CD1 . LEU A 1 155 ? 12.943  29.697 6.536   1.00 10.86 ? 155 LEU E CD1 1 
ATOM   1181 C CD2 . LEU A 1 155 ? 15.409  29.613 6.219   1.00 4.91  ? 155 LEU E CD2 1 
ATOM   1182 N N   . SER A 1 156 ? 15.301  33.312 2.814   1.00 16.54 ? 156 SER E N   1 
ATOM   1183 C CA  . SER A 1 156 ? 15.002  34.155 1.611   1.00 9.52  ? 156 SER E CA  1 
ATOM   1184 C C   . SER A 1 156 ? 13.649  33.797 0.993   1.00 14.57 ? 156 SER E C   1 
ATOM   1185 O O   . SER A 1 156 ? 13.069  32.733 1.185   1.00 15.30 ? 156 SER E O   1 
ATOM   1186 C CB  . SER A 1 156 ? 16.113  33.988 0.573   1.00 14.91 ? 156 SER E CB  1 
ATOM   1187 O OG  . SER A 1 156 ? 16.035  32.668 0.006   1.00 18.71 ? 156 SER E OG  1 
ATOM   1188 N N   . ALA A 1 157 ? 13.167  34.724 0.156   1.00 15.45 ? 157 ALA E N   1 
ATOM   1189 C CA  . ALA A 1 157 ? 11.910  34.562 -0.593  1.00 25.00 ? 157 ALA E CA  1 
ATOM   1190 C C   . ALA A 1 157 ? 12.131  34.357 -2.084  1.00 32.78 ? 157 ALA E C   1 
ATOM   1191 O O   . ALA A 1 157 ? 13.267  34.493 -2.571  1.00 23.43 ? 157 ALA E O   1 
ATOM   1192 C CB  . ALA A 1 157 ? 11.004  35.781 -0.352  1.00 17.41 ? 157 ALA E CB  1 
ATOM   1193 N N   . ASP A 1 158 ? 11.100  33.875 -2.790  1.00 27.34 ? 158 ASP E N   1 
ATOM   1194 C CA  . ASP A 1 158 ? 11.056  33.730 -4.265  1.00 99.99 ? 158 ASP E CA  1 
ATOM   1195 C C   . ASP A 1 158 ? 12.325  33.114 -4.892  1.00 37.20 ? 158 ASP E C   1 
ATOM   1196 O O   . ASP A 1 158 ? 13.011  33.724 -5.711  1.00 53.21 ? 158 ASP E O   1 
ATOM   1197 C CB  . ASP A 1 158 ? 10.771  35.082 -4.947  1.00 99.99 ? 158 ASP E CB  1 
ATOM   1198 C CG  . ASP A 1 158 ? 9.436   35.727 -4.567  1.00 99.99 ? 158 ASP E CG  1 
ATOM   1199 O OD1 . ASP A 1 158 ? 9.499   36.942 -4.247  1.00 99.99 ? 158 ASP E OD1 1 
ATOM   1200 O OD2 . ASP A 1 158 ? 8.419   35.007 -4.581  1.00 99.99 ? 158 ASP E OD2 1 
ATOM   1201 N N   . ASP A 1 159 ? 12.730  31.970 -4.333  1.00 38.05 ? 159 ASP E N   1 
ATOM   1202 C CA  . ASP A 1 159 ? 13.902  31.186 -4.762  1.00 26.91 ? 159 ASP E CA  1 
ATOM   1203 C C   . ASP A 1 159 ? 15.274  31.894 -4.770  1.00 23.49 ? 159 ASP E C   1 
ATOM   1204 O O   . ASP A 1 159 ? 16.268  31.330 -5.248  1.00 74.80 ? 159 ASP E O   1 
ATOM   1205 C CB  . ASP A 1 159 ? 13.680  30.573 -6.151  1.00 99.99 ? 159 ASP E CB  1 
ATOM   1206 C CG  . ASP A 1 159 ? 12.766  29.373 -6.053  1.00 99.99 ? 159 ASP E CG  1 
ATOM   1207 O OD1 . ASP A 1 159 ? 11.557  29.590 -5.838  1.00 99.99 ? 159 ASP E OD1 1 
ATOM   1208 O OD2 . ASP A 1 159 ? 13.331  28.244 -6.100  1.00 99.99 ? 159 ASP E OD2 1 
ATOM   1209 N N   . GLN A 1 160 ? 15.345  33.042 -4.112  1.00 24.84 ? 160 GLN E N   1 
ATOM   1210 C CA  . GLN A 1 160 ? 16.603  33.828 -4.050  1.00 22.46 ? 160 GLN E CA  1 
ATOM   1211 C C   . GLN A 1 160 ? 17.663  33.161 -3.181  1.00 21.53 ? 160 GLN E C   1 
ATOM   1212 O O   . GLN A 1 160 ? 17.347  32.327 -2.332  1.00 28.53 ? 160 GLN E O   1 
ATOM   1213 C CB  . GLN A 1 160 ? 16.346  35.260 -3.567  1.00 18.76 ? 160 GLN E CB  1 
ATOM   1214 C CG  . GLN A 1 160 ? 15.552  36.103 -4.570  1.00 70.29 ? 160 GLN E CG  1 
ATOM   1215 C CD  . GLN A 1 160 ? 15.384  37.539 -4.068  1.00 99.99 ? 160 GLN E CD  1 
ATOM   1216 O OE1 . GLN A 1 160 ? 16.343  38.303 -3.899  1.00 99.99 ? 160 GLN E OE1 1 
ATOM   1217 N NE2 . GLN A 1 160 ? 14.166  37.957 -3.809  1.00 99.99 ? 160 GLN E NE2 1 
ATOM   1218 N N   . SER A 1 161 ? 18.937  33.322 -3.565  1.00 26.21 ? 161 SER E N   1 
ATOM   1219 C CA  . SER A 1 161 ? 20.084  33.062 -2.693  1.00 29.09 ? 161 SER E CA  1 
ATOM   1220 C C   . SER A 1 161 ? 20.045  34.018 -1.472  1.00 30.34 ? 161 SER E C   1 
ATOM   1221 O O   . SER A 1 161 ? 19.272  34.960 -1.412  1.00 25.26 ? 161 SER E O   1 
ATOM   1222 C CB  . SER A 1 161 ? 21.410  33.304 -3.432  1.00 23.20 ? 161 SER E CB  1 
ATOM   1223 O OG  . SER A 1 161 ? 21.605  32.303 -4.430  1.00 77.74 ? 161 SER E OG  1 
ATOM   1224 N N   . GLY A 1 162 ? 20.821  33.682 -0.462  1.00 22.11 ? 162 GLY E N   1 
ATOM   1225 C CA  . GLY A 1 162 ? 21.025  34.573 0.706   1.00 20.36 ? 162 GLY E CA  1 
ATOM   1226 C C   . GLY A 1 162 ? 20.522  34.042 2.044   1.00 19.17 ? 162 GLY E C   1 
ATOM   1227 O O   . GLY A 1 162 ? 20.849  34.592 3.095   1.00 17.06 ? 162 GLY E O   1 
ATOM   1228 N N   . SER A 1 163 ? 19.687  32.985 2.026   1.00 16.18 ? 163 SER E N   1 
ATOM   1229 C CA  . SER A 1 163 ? 19.275  32.317 3.271   1.00 14.94 ? 163 SER E CA  1 
ATOM   1230 C C   . SER A 1 163 ? 20.501  31.880 4.044   1.00 11.24 ? 163 SER E C   1 
ATOM   1231 O O   . SER A 1 163 ? 21.480  31.366 3.447   1.00 12.07 ? 163 SER E O   1 
ATOM   1232 C CB  . SER A 1 163 ? 18.431  31.061 3.018   1.00 7.76  ? 163 SER E CB  1 
ATOM   1233 O OG  . SER A 1 163 ? 17.210  31.421 2.370   1.00 10.27 ? 163 SER E OG  1 
ATOM   1234 N N   . VAL A 1 164 ? 20.480  32.105 5.346   1.00 12.14 ? 164 VAL E N   1 
ATOM   1235 C CA  . VAL A 1 164 ? 21.582  31.755 6.271   1.00 9.51  ? 164 VAL E CA  1 
ATOM   1236 C C   . VAL A 1 164 ? 21.047  31.296 7.616   1.00 9.15  ? 164 VAL E C   1 
ATOM   1237 O O   . VAL A 1 164 ? 20.019  31.780 8.079   1.00 14.93 ? 164 VAL E O   1 
ATOM   1238 C CB  . VAL A 1 164 ? 22.586  32.903 6.536   1.00 9.45  ? 164 VAL E CB  1 
ATOM   1239 C CG1 . VAL A 1 164 ? 23.412  33.249 5.297   1.00 15.66 ? 164 VAL E CG1 1 
ATOM   1240 C CG2 . VAL A 1 164 ? 21.929  34.180 7.076   1.00 7.26  ? 164 VAL E CG2 1 
ATOM   1241 N N   . VAL A 1 165 ? 21.847  30.419 8.239   1.00 12.64 ? 165 VAL E N   1 
ATOM   1242 C CA  . VAL A 1 165 ? 21.756  30.100 9.673   1.00 12.70 ? 165 VAL E CA  1 
ATOM   1243 C C   . VAL A 1 165 ? 23.034  30.639 10.297  1.00 11.83 ? 165 VAL E C   1 
ATOM   1244 O O   . VAL A 1 165 ? 24.123  30.373 9.795   1.00 19.42 ? 165 VAL E O   1 
ATOM   1245 C CB  . VAL A 1 165 ? 21.669  28.588 9.985   1.00 13.82 ? 165 VAL E CB  1 
ATOM   1246 C CG1 . VAL A 1 165 ? 21.494  28.359 11.493  1.00 10.41 ? 165 VAL E CG1 1 
ATOM   1247 C CG2 . VAL A 1 165 ? 20.429  27.987 9.349   1.00 22.82 ? 165 VAL E CG2 1 
ATOM   1248 N N   . ILE A 1 166 ? 22.855  31.476 11.309  1.00 11.76 ? 166 ILE E N   1 
ATOM   1249 C CA  . ILE A 1 166 ? 24.024  32.077 12.021  1.00 6.51  ? 166 ILE E CA  1 
ATOM   1250 C C   . ILE A 1 166 ? 24.136  31.440 13.408  1.00 11.08 ? 166 ILE E C   1 
ATOM   1251 O O   . ILE A 1 166 ? 23.240  31.587 14.229  1.00 14.94 ? 166 ILE E O   1 
ATOM   1252 C CB  . ILE A 1 166 ? 23.929  33.606 12.187  1.00 9.26  ? 166 ILE E CB  1 
ATOM   1253 C CG1 . ILE A 1 166 ? 23.511  34.300 10.880  1.00 15.01 ? 166 ILE E CG1 1 
ATOM   1254 C CG2 . ILE A 1 166 ? 25.298  34.126 12.669  1.00 13.52 ? 166 ILE E CG2 1 
ATOM   1255 C CD1 . ILE A 1 166 ? 23.092  35.763 11.049  1.00 15.90 ? 166 ILE E CD1 1 
ATOM   1256 N N   . PHE A 1 167 ? 25.214  30.691 13.583  1.00 13.98 ? 167 PHE E N   1 
ATOM   1257 C CA  . PHE A 1 167 ? 25.522  30.024 14.877  1.00 11.63 ? 167 PHE E CA  1 
ATOM   1258 C C   . PHE A 1 167 ? 26.311  30.931 15.806  1.00 19.19 ? 167 PHE E C   1 
ATOM   1259 O O   . PHE A 1 167 ? 27.389  31.429 15.502  1.00 17.24 ? 167 PHE E O   1 
ATOM   1260 C CB  . PHE A 1 167 ? 26.299  28.721 14.669  1.00 7.33  ? 167 PHE E CB  1 
ATOM   1261 C CG  . PHE A 1 167 ? 25.426  27.644 14.041  1.00 13.18 ? 167 PHE E CG  1 
ATOM   1262 C CD1 . PHE A 1 167 ? 25.507  27.407 12.654  1.00 29.07 ? 167 PHE E CD1 1 
ATOM   1263 C CD2 . PHE A 1 167 ? 24.578  26.872 14.860  1.00 18.05 ? 167 PHE E CD2 1 
ATOM   1264 C CE1 . PHE A 1 167 ? 24.738  26.367 12.094  1.00 19.89 ? 167 PHE E CE1 1 
ATOM   1265 C CE2 . PHE A 1 167 ? 23.818  25.832 14.300  1.00 27.78 ? 167 PHE E CE2 1 
ATOM   1266 C CZ  . PHE A 1 167 ? 23.903  25.587 12.917  1.00 18.31 ? 167 PHE E CZ  1 
ATOM   1267 N N   . GLY A 1 168 ? 25.729  31.122 17.008  1.00 11.07 ? 168 GLY E N   1 
ATOM   1268 C CA  . GLY A 1 168 ? 26.345  31.916 18.074  1.00 9.39  ? 168 GLY E CA  1 
ATOM   1269 C C   . GLY A 1 168 ? 26.429  33.415 17.768  1.00 14.81 ? 168 GLY E C   1 
ATOM   1270 O O   . GLY A 1 168 ? 27.300  34.113 18.296  1.00 16.18 ? 168 GLY E O   1 
ATOM   1271 N N   . GLY A 1 169 ? 25.399  33.919 17.103  1.00 13.05 ? 169 GLY E N   1 
ATOM   1272 C CA  . GLY A 1 169 ? 25.356  35.337 16.734  1.00 13.27 ? 169 GLY E CA  1 
ATOM   1273 C C   . GLY A 1 169 ? 24.114  35.753 15.929  1.00 13.71 ? 169 GLY E C   1 
ATOM   1274 O O   . GLY A 1 169 ? 23.275  34.948 15.591  1.00 16.43 ? 169 GLY E O   1 
ATOM   1275 N N   . ILE A 1 170 ? 23.991  37.066 15.904  1.00 20.11 ? 170 ILE E N   1 
ATOM   1276 C CA  . ILE A 1 170 ? 22.925  37.841 15.218  1.00 18.42 ? 170 ILE E CA  1 
ATOM   1277 C C   . ILE A 1 170 ? 23.618  38.708 14.181  1.00 19.73 ? 170 ILE E C   1 
ATOM   1278 O O   . ILE A 1 170 ? 24.825  38.993 14.264  1.00 18.31 ? 170 ILE E O   1 
ATOM   1279 C CB  . ILE A 1 170 ? 22.186  38.639 16.312  1.00 24.61 ? 170 ILE E CB  1 
ATOM   1280 C CG1 . ILE A 1 170 ? 21.206  37.693 17.013  1.00 26.50 ? 170 ILE E CG1 1 
ATOM   1281 C CG2 . ILE A 1 170 ? 21.521  39.956 15.869  1.00 31.66 ? 170 ILE E CG2 1 
ATOM   1282 C CD1 . ILE A 1 170 ? 20.669  38.219 18.357  1.00 75.17 ? 170 ILE E CD1 1 
ATOM   1283 N N   . ASP A 1 171 ? 22.888  38.988 13.136  1.00 19.30 ? 171 ASP E N   1 
ATOM   1284 C CA  . ASP A 1 171 ? 23.291  40.006 12.137  1.00 16.40 ? 171 ASP E CA  1 
ATOM   1285 C C   . ASP A 1 171 ? 22.107  40.946 11.898  1.00 15.14 ? 171 ASP E C   1 
ATOM   1286 O O   . ASP A 1 171 ? 21.103  40.592 11.282  1.00 13.76 ? 171 ASP E O   1 
ATOM   1287 C CB  . ASP A 1 171 ? 23.787  39.324 10.858  1.00 17.32 ? 171 ASP E CB  1 
ATOM   1288 C CG  . ASP A 1 171 ? 24.441  40.291 9.841   1.00 33.63 ? 171 ASP E CG  1 
ATOM   1289 O OD1 . ASP A 1 171 ? 25.086  39.777 8.898   1.00 31.10 ? 171 ASP E OD1 1 
ATOM   1290 O OD2 . ASP A 1 171 ? 24.291  41.503 10.038  1.00 17.15 ? 171 ASP E OD2 1 
ATOM   1291 N N   . SER A 1 172 ? 22.249  42.159 12.429  1.00 15.08 ? 172 SER E N   1 
ATOM   1292 C CA  . SER A 1 172 ? 21.205  43.195 12.399  1.00 15.65 ? 172 SER E CA  1 
ATOM   1293 C C   . SER A 1 172 ? 20.908  43.829 11.030  1.00 24.01 ? 172 SER E C   1 
ATOM   1294 O O   . SER A 1 172 ? 19.885  44.487 10.853  1.00 31.89 ? 172 SER E O   1 
ATOM   1295 C CB  . SER A 1 172 ? 21.423  44.299 13.444  1.00 19.16 ? 172 SER E CB  1 
ATOM   1296 O OG  . SER A 1 172 ? 22.575  45.049 13.057  1.00 36.45 ? 172 SER E OG  1 
ATOM   1297 N N   . SER A 1 173 ? 21.729  43.485 10.034  1.00 16.67 ? 173 SER E N   1 
ATOM   1298 C CA  . SER A 1 173 ? 21.519  43.821 8.620   1.00 25.65 ? 173 SER E CA  1 
ATOM   1299 C C   . SER A 1 173 ? 20.256  43.174 8.032   1.00 20.81 ? 173 SER E C   1 
ATOM   1300 O O   . SER A 1 173 ? 19.653  43.734 7.108   1.00 25.50 ? 173 SER E O   1 
ATOM   1301 C CB  . SER A 1 173 ? 22.721  43.413 7.743   1.00 18.22 ? 173 SER E CB  1 
ATOM   1302 O OG  . SER A 1 173 ? 22.889  41.992 7.722   1.00 87.71 ? 173 SER E OG  1 
ATOM   1303 N N   . TYR A 1 174 ? 19.826  42.057 8.619   1.00 20.07 ? 174 TYR E N   1 
ATOM   1304 C CA  . TYR A 1 174 ? 18.724  41.218 8.118   1.00 15.13 ? 174 TYR E CA  1 
ATOM   1305 C C   . TYR A 1 174 ? 17.308  41.644 8.515   1.00 15.01 ? 174 TYR E C   1 
ATOM   1306 O O   . TYR A 1 174 ? 16.329  41.147 7.989   1.00 23.32 ? 174 TYR E O   1 
ATOM   1307 C CB  . TYR A 1 174 ? 18.884  39.756 8.521   1.00 10.07 ? 174 TYR E CB  1 
ATOM   1308 C CG  . TYR A 1 174 ? 20.006  39.078 7.740   1.00 15.70 ? 174 TYR E CG  1 
ATOM   1309 C CD1 . TYR A 1 174 ? 21.108  38.674 8.487   1.00 40.67 ? 174 TYR E CD1 1 
ATOM   1310 C CD2 . TYR A 1 174 ? 19.940  38.952 6.333   1.00 16.92 ? 174 TYR E CD2 1 
ATOM   1311 C CE1 . TYR A 1 174 ? 22.222  38.132 7.820   1.00 19.03 ? 174 TYR E CE1 1 
ATOM   1312 C CE2 . TYR A 1 174 ? 21.063  38.400 5.666   1.00 19.87 ? 174 TYR E CE2 1 
ATOM   1313 C CZ  . TYR A 1 174 ? 22.177  38.010 6.418   1.00 28.60 ? 174 TYR E CZ  1 
ATOM   1314 O OH  . TYR A 1 174 ? 23.285  37.511 5.821   1.00 22.94 ? 174 TYR E OH  1 
ATOM   1315 N N   . TYR A 1 175 ? 17.258  42.521 9.513   1.00 16.60 ? 175 TYR E N   1 
ATOM   1316 C CA  . TYR A 1 175 ? 15.981  42.960 10.096  1.00 24.39 ? 175 TYR E CA  1 
ATOM   1317 C C   . TYR A 1 175 ? 15.897  44.468 10.261  1.00 15.62 ? 175 TYR E C   1 
ATOM   1318 O O   . TYR A 1 175 ? 16.880  45.212 10.189  1.00 16.52 ? 175 TYR E O   1 
ATOM   1319 C CB  . TYR A 1 175 ? 15.688  42.228 11.428  1.00 18.29 ? 175 TYR E CB  1 
ATOM   1320 C CG  . TYR A 1 175 ? 16.650  42.484 12.598  1.00 21.86 ? 175 TYR E CG  1 
ATOM   1321 C CD1 . TYR A 1 175 ? 17.744  41.641 12.787  1.00 13.62 ? 175 TYR E CD1 1 
ATOM   1322 C CD2 . TYR A 1 175 ? 16.329  43.498 13.555  1.00 20.91 ? 175 TYR E CD2 1 
ATOM   1323 C CE1 . TYR A 1 175 ? 18.554  41.771 13.934  1.00 16.63 ? 175 TYR E CE1 1 
ATOM   1324 C CE2 . TYR A 1 175 ? 17.156  43.646 14.689  1.00 17.75 ? 175 TYR E CE2 1 
ATOM   1325 C CZ  . TYR A 1 175 ? 18.262  42.796 14.867  1.00 17.68 ? 175 TYR E CZ  1 
ATOM   1326 O OH  . TYR A 1 175 ? 19.184  43.060 15.831  1.00 81.56 ? 175 TYR E OH  1 
ATOM   1327 N N   . THR A 1 176 ? 14.649  44.893 10.396  1.00 23.23 ? 176 THR E N   1 
ATOM   1328 C CA  . THR A 1 176 ? 14.343  46.314 10.687  1.00 45.06 ? 176 THR E CA  1 
ATOM   1329 C C   . THR A 1 176 ? 13.738  46.427 12.082  1.00 24.92 ? 176 THR E C   1 
ATOM   1330 O O   . THR A 1 176 ? 13.017  45.564 12.531  1.00 39.43 ? 176 THR E O   1 
ATOM   1331 C CB  . THR A 1 176 ? 13.470  46.946 9.589   1.00 25.85 ? 176 THR E CB  1 
ATOM   1332 O OG1 . THR A 1 176 ? 13.392  48.351 9.838   1.00 99.99 ? 176 THR E OG1 1 
ATOM   1333 C CG2 . THR A 1 176 ? 12.059  46.354 9.457   1.00 34.03 ? 176 THR E CG2 1 
ATOM   1334 N N   . GLY A 1 177 ? 14.121  47.546 12.759  1.00 20.64 ? 177 GLY E N   1 
ATOM   1335 C CA  . GLY A 1 177 ? 13.766  47.823 14.150  1.00 17.91 ? 177 GLY E CA  1 
ATOM   1336 C C   . GLY A 1 177 ? 14.654  47.031 15.133  1.00 29.22 ? 177 GLY E C   1 
ATOM   1337 O O   . GLY A 1 177 ? 15.838  46.818 14.940  1.00 49.27 ? 177 GLY E O   1 
ATOM   1338 N N   . SER A 1 178 ? 14.031  46.743 16.279  1.00 62.57 ? 178 SER E N   1 
ATOM   1339 C CA  . SER A 1 178 ? 14.647  45.894 17.315  1.00 56.32 ? 178 SER E CA  1 
ATOM   1340 C C   . SER A 1 178 ? 13.873  44.589 17.498  1.00 17.74 ? 178 SER E C   1 
ATOM   1341 O O   . SER A 1 178 ? 12.690  44.442 17.179  1.00 21.57 ? 178 SER E O   1 
ATOM   1342 C CB  . SER A 1 178 ? 14.746  46.647 18.645  1.00 51.18 ? 178 SER E CB  1 
ATOM   1343 O OG  . SER A 1 178 ? 13.432  47.000 19.077  1.00 99.99 ? 178 SER E OG  1 
ATOM   1344 N N   . LEU A 1 179 ? 14.613  43.568 17.933  1.00 19.35 ? 179 LEU E N   1 
ATOM   1345 C CA  . LEU A 1 179 ? 14.074  42.271 18.268  1.00 12.77 ? 179 LEU E CA  1 
ATOM   1346 C C   . LEU A 1 179 ? 13.033  42.369 19.384  1.00 14.51 ? 179 LEU E C   1 
ATOM   1347 O O   . LEU A 1 179 ? 13.235  43.076 20.384  1.00 31.70 ? 179 LEU E O   1 
ATOM   1348 C CB  . LEU A 1 179 ? 15.212  41.331 18.713  1.00 17.27 ? 179 LEU E CB  1 
ATOM   1349 C CG  . LEU A 1 179 ? 16.070  40.942 17.503  1.00 17.86 ? 179 LEU E CG  1 
ATOM   1350 C CD1 . LEU A 1 179 ? 17.462  40.501 17.961  1.00 21.91 ? 179 LEU E CD1 1 
ATOM   1351 C CD2 . LEU A 1 179 ? 15.376  39.879 16.653  1.00 21.25 ? 179 LEU E CD2 1 
ATOM   1352 N N   . ASN A 1 180 ? 11.911  41.713 19.162  1.00 14.90 ? 180 ASN E N   1 
ATOM   1353 C CA  . ASN A 1 180 ? 10.887  41.451 20.173  1.00 8.61  ? 180 ASN E CA  1 
ATOM   1354 C C   . ASN A 1 180 ? 11.133  40.026 20.688  1.00 12.78 ? 180 ASN E C   1 
ATOM   1355 O O   . ASN A 1 180 ? 11.269  39.087 19.925  1.00 17.07 ? 180 ASN E O   1 
ATOM   1356 C CB  . ASN A 1 180 ? 9.462   41.472 19.610  1.00 14.95 ? 180 ASN E CB  1 
ATOM   1357 C CG  . ASN A 1 180 ? 9.139   42.768 18.873  1.00 99.99 ? 180 ASN E CG  1 
ATOM   1358 O OD1 . ASN A 1 180 ? 9.010   43.813 19.495  1.00 21.26 ? 180 ASN E OD1 1 
ATOM   1359 N ND2 . ASN A 1 180 ? 9.006   42.740 17.568  1.00 28.75 ? 180 ASN E ND2 1 
ATOM   1360 N N   . TRP A 1 181 ? 11.249  39.912 21.989  1.00 14.90 ? 181 TRP E N   1 
ATOM   1361 C CA  . TRP A 1 181 ? 11.551  38.683 22.709  1.00 18.39 ? 181 TRP E CA  1 
ATOM   1362 C C   . TRP A 1 181 ? 10.304  38.008 23.264  1.00 14.87 ? 181 TRP E C   1 
ATOM   1363 O O   . TRP A 1 181 ? 9.401   38.627 23.813  1.00 17.83 ? 181 TRP E O   1 
ATOM   1364 C CB  . TRP A 1 181 ? 12.597  38.974 23.800  1.00 20.36 ? 181 TRP E CB  1 
ATOM   1365 C CG  . TRP A 1 181 ? 13.926  39.391 23.189  1.00 15.38 ? 181 TRP E CG  1 
ATOM   1366 C CD1 . TRP A 1 181 ? 14.433  40.626 23.257  1.00 16.88 ? 181 TRP E CD1 1 
ATOM   1367 C CD2 . TRP A 1 181 ? 14.855  38.580 22.537  1.00 25.38 ? 181 TRP E CD2 1 
ATOM   1368 N NE1 . TRP A 1 181 ? 15.625  40.639 22.676  1.00 44.55 ? 181 TRP E NE1 1 
ATOM   1369 C CE2 . TRP A 1 181 ? 15.942  39.433 22.206  1.00 33.00 ? 181 TRP E CE2 1 
ATOM   1370 C CE3 . TRP A 1 181 ? 14.912  37.205 22.218  1.00 16.93 ? 181 TRP E CE3 1 
ATOM   1371 C CZ2 . TRP A 1 181 ? 17.068  38.932 21.539  1.00 21.55 ? 181 TRP E CZ2 1 
ATOM   1372 C CZ3 . TRP A 1 181 ? 16.057  36.695 21.551  1.00 11.93 ? 181 TRP E CZ3 1 
ATOM   1373 C CH2 . TRP A 1 181 ? 17.120  37.549 21.219  1.00 24.76 ? 181 TRP E CH2 1 
ATOM   1374 N N   . VAL A 1 182 ? 10.184  36.709 22.950  1.00 12.79 ? 182 VAL E N   1 
ATOM   1375 C CA  . VAL A 1 182 ? 9.002   35.899 23.272  1.00 10.39 ? 182 VAL E CA  1 
ATOM   1376 C C   . VAL A 1 182 ? 9.470   34.676 24.066  1.00 12.74 ? 182 VAL E C   1 
ATOM   1377 O O   . VAL A 1 182 ? 10.315  33.927 23.571  1.00 18.25 ? 182 VAL E O   1 
ATOM   1378 C CB  . VAL A 1 182 ? 8.274   35.428 21.995  1.00 10.03 ? 182 VAL E CB  1 
ATOM   1379 C CG1 . VAL A 1 182 ? 6.956   34.733 22.351  1.00 11.04 ? 182 VAL E CG1 1 
ATOM   1380 C CG2 . VAL A 1 182 ? 7.963   36.601 21.056  1.00 17.90 ? 182 VAL E CG2 1 
ATOM   1381 N N   . PRO A 1 183 ? 8.932   34.421 25.274  1.00 24.08 ? 183 PRO E N   1 
ATOM   1382 C CA  . PRO A 1 183 ? 9.328   33.228 26.037  1.00 19.70 ? 183 PRO E CA  1 
ATOM   1383 C C   . PRO A 1 183 ? 8.817   31.938 25.414  1.00 13.27 ? 183 PRO E C   1 
ATOM   1384 O O   . PRO A 1 183 ? 7.673   31.814 25.008  1.00 12.27 ? 183 PRO E O   1 
ATOM   1385 C CB  . PRO A 1 183 ? 8.731   33.462 27.428  1.00 22.17 ? 183 PRO E CB  1 
ATOM   1386 C CG  . PRO A 1 183 ? 7.592   34.451 27.205  1.00 28.08 ? 183 PRO E CG  1 
ATOM   1387 C CD  . PRO A 1 183 ? 8.104   35.335 26.070  1.00 21.67 ? 183 PRO E CD  1 
ATOM   1388 N N   . VAL A 1 184 ? 9.707   30.935 25.438  1.00 9.17  ? 184 VAL E N   1 
ATOM   1389 C CA  . VAL A 1 184 ? 9.320   29.538 25.176  1.00 10.42 ? 184 VAL E CA  1 
ATOM   1390 C C   . VAL A 1 184 ? 8.464   29.025 26.327  1.00 16.33 ? 184 VAL E C   1 
ATOM   1391 O O   . VAL A 1 184 ? 8.882   29.046 27.495  1.00 19.32 ? 184 VAL E O   1 
ATOM   1392 C CB  . VAL A 1 184 ? 10.576  28.671 24.953  1.00 11.71 ? 184 VAL E CB  1 
ATOM   1393 C CG1 . VAL A 1 184 ? 10.263  27.171 24.850  1.00 8.27  ? 184 VAL E CG1 1 
ATOM   1394 C CG2 . VAL A 1 184 ? 11.275  29.129 23.679  1.00 10.02 ? 184 VAL E CG2 1 
ATOM   1395 N N   . THR A 1 185 ? 7.282   28.532 25.989  1.00 12.67 ? 185 THR E N   1 
ATOM   1396 C CA  . THR A 1 185 ? 6.326   28.039 26.998  1.00 8.21  ? 185 THR E CA  1 
ATOM   1397 C C   . THR A 1 185 ? 6.679   26.661 27.529  1.00 13.76 ? 185 THR E C   1 
ATOM   1398 O O   . THR A 1 185 ? 6.609   26.385 28.742  1.00 29.53 ? 185 THR E O   1 
ATOM   1399 C CB  . THR A 1 185 ? 4.875   28.085 26.511  1.00 9.77  ? 185 THR E CB  1 
ATOM   1400 O OG1 . THR A 1 185 ? 4.743   27.318 25.325  1.00 15.98 ? 185 THR E OG1 1 
ATOM   1401 C CG2 . THR A 1 185 ? 4.412   29.522 26.286  1.00 13.82 ? 185 THR E CG2 1 
ATOM   1402 N N   . VAL A 1 186 ? 6.975   25.760 26.594  1.00 15.53 ? 186 VAL E N   1 
ATOM   1403 C CA  . VAL A 1 186 ? 7.415   24.393 26.853  1.00 10.90 ? 186 VAL E CA  1 
ATOM   1404 C C   . VAL A 1 186 ? 8.712   24.156 26.066  1.00 15.79 ? 186 VAL E C   1 
ATOM   1405 O O   . VAL A 1 186 ? 8.760   24.387 24.858  1.00 17.59 ? 186 VAL E O   1 
ATOM   1406 C CB  . VAL A 1 186 ? 6.328   23.359 26.482  1.00 15.42 ? 186 VAL E CB  1 
ATOM   1407 C CG1 . VAL A 1 186 ? 6.768   21.923 26.770  1.00 15.21 ? 186 VAL E CG1 1 
ATOM   1408 C CG2 . VAL A 1 186 ? 5.009   23.621 27.224  1.00 13.20 ? 186 VAL E CG2 1 
ATOM   1409 N N   . GLU A 1 187 ? 9.722   23.673 26.777  1.00 14.61 ? 187 GLU E N   1 
ATOM   1410 C CA  . GLU A 1 187 ? 11.048  23.360 26.222  1.00 17.55 ? 187 GLU E CA  1 
ATOM   1411 C C   . GLU A 1 187 ? 11.116  21.933 25.615  1.00 25.85 ? 187 GLU E C   1 
ATOM   1412 O O   . GLU A 1 187 ? 11.444  20.950 26.272  1.00 39.09 ? 187 GLU E O   1 
ATOM   1413 C CB  . GLU A 1 187 ? 12.135  23.581 27.296  1.00 9.05  ? 187 GLU E CB  1 
ATOM   1414 C CG  . GLU A 1 187 ? 12.157  25.021 27.817  1.00 11.09 ? 187 GLU E CG  1 
ATOM   1415 C CD  . GLU A 1 187 ? 13.149  25.237 28.970  1.00 33.21 ? 187 GLU E CD  1 
ATOM   1416 O OE1 . GLU A 1 187 ? 13.141  26.373 29.508  1.00 43.64 ? 187 GLU E OE1 1 
ATOM   1417 O OE2 . GLU A 1 187 ? 13.832  24.275 29.349  1.00 35.60 ? 187 GLU E OE2 1 
ATOM   1418 N N   . GLY A 1 188 ? 10.889  21.916 24.318  1.00 20.30 ? 188 GLY E N   1 
ATOM   1419 C CA  . GLY A 1 188 ? 10.826  20.668 23.483  1.00 9.62  ? 188 GLY E CA  1 
ATOM   1420 C C   . GLY A 1 188 ? 11.103  21.090 22.044  1.00 10.99 ? 188 GLY E C   1 
ATOM   1421 O O   . GLY A 1 188 ? 12.244  21.195 21.605  1.00 11.27 ? 188 GLY E O   1 
ATOM   1422 N N   . TYR A 1 189 ? 10.023  21.499 21.432  1.00 10.29 ? 189 TYR E N   1 
ATOM   1423 C CA  . TYR A 1 189 ? 10.047  22.349 20.213  1.00 14.14 ? 189 TYR E CA  1 
ATOM   1424 C C   . TYR A 1 189 ? 10.317  23.803 20.656  1.00 15.58 ? 189 TYR E C   1 
ATOM   1425 O O   . TYR A 1 189 ? 10.237  24.155 21.833  1.00 12.44 ? 189 TYR E O   1 
ATOM   1426 C CB  . TYR A 1 189 ? 8.667   22.294 19.561  1.00 8.18  ? 189 TYR E CB  1 
ATOM   1427 C CG  . TYR A 1 189 ? 8.179   20.869 19.302  1.00 7.44  ? 189 TYR E CG  1 
ATOM   1428 C CD1 . TYR A 1 189 ? 8.751   20.108 18.261  1.00 9.13  ? 189 TYR E CD1 1 
ATOM   1429 C CD2 . TYR A 1 189 ? 7.201   20.343 20.155  1.00 23.38 ? 189 TYR E CD2 1 
ATOM   1430 C CE1 . TYR A 1 189 ? 8.350   18.769 18.089  1.00 9.14  ? 189 TYR E CE1 1 
ATOM   1431 C CE2 . TYR A 1 189 ? 6.797   19.008 19.995  1.00 17.69 ? 189 TYR E CE2 1 
ATOM   1432 C CZ  . TYR A 1 189 ? 7.390   18.248 18.968  1.00 25.15 ? 189 TYR E CZ  1 
ATOM   1433 O OH  . TYR A 1 189 ? 6.994   16.965 18.829  1.00 23.25 ? 189 TYR E OH  1 
ATOM   1434 N N   . TRP A 1 190 ? 10.477  24.692 19.691  1.00 11.07 ? 190 TRP E N   1 
ATOM   1435 C CA  . TRP A 1 190 ? 10.538  26.139 20.006  1.00 3.17  ? 190 TRP E CA  1 
ATOM   1436 C C   . TRP A 1 190 ? 9.105   26.659 20.086  1.00 12.74 ? 190 TRP E C   1 
ATOM   1437 O O   . TRP A 1 190 ? 8.519   27.083 19.101  1.00 11.28 ? 190 TRP E O   1 
ATOM   1438 C CB  . TRP A 1 190 ? 11.381  26.858 18.967  1.00 10.82 ? 190 TRP E CB  1 
ATOM   1439 C CG  . TRP A 1 190 ? 12.840  26.442 19.183  1.00 2.00  ? 190 TRP E CG  1 
ATOM   1440 C CD1 . TRP A 1 190 ? 13.518  25.497 18.541  1.00 2.00  ? 190 TRP E CD1 1 
ATOM   1441 C CD2 . TRP A 1 190 ? 13.728  27.096 20.028  1.00 6.69  ? 190 TRP E CD2 1 
ATOM   1442 N NE1 . TRP A 1 190 ? 14.816  25.536 18.910  1.00 3.28  ? 190 TRP E NE1 1 
ATOM   1443 C CE2 . TRP A 1 190 ? 14.975  26.500 19.815  1.00 9.47  ? 190 TRP E CE2 1 
ATOM   1444 C CE3 . TRP A 1 190 ? 13.582  28.176 20.928  1.00 7.82  ? 190 TRP E CE3 1 
ATOM   1445 C CZ2 . TRP A 1 190 ? 16.119  26.974 20.491  1.00 5.32  ? 190 TRP E CZ2 1 
ATOM   1446 C CZ3 . TRP A 1 190 ? 14.726  28.653 21.599  1.00 7.73  ? 190 TRP E CZ3 1 
ATOM   1447 C CH2 . TRP A 1 190 ? 15.975  28.059 21.384  1.00 5.91  ? 190 TRP E CH2 1 
ATOM   1448 N N   . GLN A 1 191 ? 8.492   26.383 21.239  1.00 10.09 ? 191 GLN E N   1 
ATOM   1449 C CA  . GLN A 1 191 ? 7.048   26.552 21.464  1.00 6.71  ? 191 GLN E CA  1 
ATOM   1450 C C   . GLN A 1 191 ? 6.701   27.835 22.171  1.00 11.44 ? 191 GLN E C   1 
ATOM   1451 O O   . GLN A 1 191 ? 7.346   28.200 23.153  1.00 8.90  ? 191 GLN E O   1 
ATOM   1452 C CB  . GLN A 1 191 ? 6.502   25.346 22.242  1.00 7.65  ? 191 GLN E CB  1 
ATOM   1453 C CG  . GLN A 1 191 ? 4.971   25.335 22.297  1.00 8.74  ? 191 GLN E CG  1 
ATOM   1454 C CD  . GLN A 1 191 ? 4.463   24.042 22.926  1.00 14.15 ? 191 GLN E CD  1 
ATOM   1455 O OE1 . GLN A 1 191 ? 5.051   22.971 22.851  1.00 15.81 ? 191 GLN E OE1 1 
ATOM   1456 N NE2 . GLN A 1 191 ? 3.341   24.145 23.582  1.00 11.05 ? 191 GLN E NE2 1 
ATOM   1457 N N   . ILE A 1 192 ? 5.730   28.552 21.628  1.00 5.73  ? 192 ILE E N   1 
ATOM   1458 C CA  . ILE A 1 192 ? 5.310   29.875 22.082  1.00 7.05  ? 192 ILE E CA  1 
ATOM   1459 C C   . ILE A 1 192 ? 3.785   29.954 22.154  1.00 8.56  ? 192 ILE E C   1 
ATOM   1460 O O   . ILE A 1 192 ? 3.062   29.117 21.637  1.00 8.76  ? 192 ILE E O   1 
ATOM   1461 C CB  . ILE A 1 192 ? 5.882   30.989 21.166  1.00 10.31 ? 192 ILE E CB  1 
ATOM   1462 C CG1 . ILE A 1 192 ? 5.395   30.858 19.720  1.00 11.28 ? 192 ILE E CG1 1 
ATOM   1463 C CG2 . ILE A 1 192 ? 7.421   31.037 21.299  1.00 11.24 ? 192 ILE E CG2 1 
ATOM   1464 C CD1 . ILE A 1 192 ? 5.757   32.081 18.871  1.00 15.38 ? 192 ILE E CD1 1 
ATOM   1465 N N   . THR A 1 193 ? 3.279   31.018 22.782  1.00 11.36 ? 193 THR E N   1 
ATOM   1466 C CA  . THR A 1 193 ? 1.844   31.336 22.795  1.00 13.67 ? 193 THR E CA  1 
ATOM   1467 C C   . THR A 1 193 ? 1.578   32.339 21.685  1.00 12.16 ? 193 THR E C   1 
ATOM   1468 O O   . THR A 1 193 ? 2.206   33.395 21.640  1.00 13.63 ? 193 THR E O   1 
ATOM   1469 C CB  . THR A 1 193 ? 1.396   31.955 24.145  1.00 13.06 ? 193 THR E CB  1 
ATOM   1470 O OG1 . THR A 1 193 ? 1.670   31.012 25.189  1.00 15.00 ? 193 THR E OG1 1 
ATOM   1471 C CG2 . THR A 1 193 ? -0.098  32.315 24.184  1.00 13.80 ? 193 THR E CG2 1 
ATOM   1472 N N   . VAL A 1 194 ? 0.521   32.047 20.910  1.00 10.76 ? 194 VAL E N   1 
ATOM   1473 C CA  . VAL A 1 194 ? -0.106  32.997 19.982  1.00 11.95 ? 194 VAL E CA  1 
ATOM   1474 C C   . VAL A 1 194 ? -1.394  33.497 20.685  1.00 8.54  ? 194 VAL E C   1 
ATOM   1475 O O   . VAL A 1 194 ? -2.220  32.719 21.141  1.00 12.90 ? 194 VAL E O   1 
ATOM   1476 C CB  . VAL A 1 194 ? -0.343  32.324 18.609  1.00 12.38 ? 194 VAL E CB  1 
ATOM   1477 C CG1 . VAL A 1 194 ? -1.159  33.193 17.649  1.00 13.01 ? 194 VAL E CG1 1 
ATOM   1478 C CG2 . VAL A 1 194 ? 0.993   32.010 17.920  1.00 7.11  ? 194 VAL E CG2 1 
ATOM   1479 N N   . ASP A 1 195 ? -1.410  34.796 20.954  1.00 12.90 ? 195 ASP E N   1 
ATOM   1480 C CA  . ASP A 1 195 ? -2.540  35.451 21.650  1.00 14.73 ? 195 ASP E CA  1 
ATOM   1481 C C   . ASP A 1 195 ? -3.856  35.387 20.877  1.00 12.51 ? 195 ASP E C   1 
ATOM   1482 O O   . ASP A 1 195 ? -4.900  35.091 21.467  1.00 15.37 ? 195 ASP E O   1 
ATOM   1483 C CB  . ASP A 1 195 ? -2.247  36.916 22.020  1.00 18.27 ? 195 ASP E CB  1 
ATOM   1484 C CG  . ASP A 1 195 ? -1.001  37.113 22.868  1.00 6.85  ? 195 ASP E CG  1 
ATOM   1485 O OD1 . ASP A 1 195 ? -0.400  38.195 22.755  1.00 19.72 ? 195 ASP E OD1 1 
ATOM   1486 O OD2 . ASP A 1 195 ? -0.597  36.138 23.549  1.00 21.33 ? 195 ASP E OD2 1 
ATOM   1487 N N   . SER A 1 196 ? -3.756  35.615 19.567  1.00 12.68 ? 196 SER E N   1 
ATOM   1488 C CA  . SER A 1 196 ? -4.890  35.519 18.619  1.00 11.81 ? 196 SER E CA  1 
ATOM   1489 C C   . SER A 1 196 ? -4.401  35.551 17.149  1.00 17.29 ? 196 SER E C   1 
ATOM   1490 O O   . SER A 1 196 ? -3.261  35.894 16.868  1.00 10.63 ? 196 SER E O   1 
ATOM   1491 C CB  . SER A 1 196 ? -5.889  36.657 18.787  1.00 11.17 ? 196 SER E CB  1 
ATOM   1492 O OG  . SER A 1 196 ? -5.181  37.872 18.549  1.00 14.71 ? 196 SER E OG  1 
ATOM   1493 N N   . ILE A 1 197 ? -5.296  35.041 16.312  1.00 14.04 ? 197 ILE E N   1 
ATOM   1494 C CA  . ILE A 1 197 ? -5.198  35.158 14.826  1.00 9.00  ? 197 ILE E CA  1 
ATOM   1495 C C   . ILE A 1 197 ? -6.411  35.945 14.339  1.00 12.05 ? 197 ILE E C   1 
ATOM   1496 O O   . ILE A 1 197 ? -7.575  35.551 14.477  1.00 16.65 ? 197 ILE E O   1 
ATOM   1497 C CB  . ILE A 1 197 ? -5.047  33.777 14.170  1.00 11.34 ? 197 ILE E CB  1 
ATOM   1498 C CG1 . ILE A 1 197 ? -3.798  33.078 14.740  1.00 15.01 ? 197 ILE E CG1 1 
ATOM   1499 C CG2 . ILE A 1 197 ? -4.839  33.961 12.656  1.00 13.15 ? 197 ILE E CG2 1 
ATOM   1500 C CD1 . ILE A 1 197 ? -3.751  31.556 14.574  1.00 13.88 ? 197 ILE E CD1 1 
ATOM   1501 N N   . THR A 1 198 ? -6.110  37.123 13.784  1.00 12.55 ? 198 THR E N   1 
ATOM   1502 C CA  . THR A 1 198 ? -7.145  38.052 13.349  1.00 7.65  ? 198 THR E CA  1 
ATOM   1503 C C   . THR A 1 198 ? -7.056  38.421 11.850  1.00 7.79  ? 198 THR E C   1 
ATOM   1504 O O   . THR A 1 198 ? -6.000  38.471 11.236  1.00 10.71 ? 198 THR E O   1 
ATOM   1505 C CB  . THR A 1 198 ? -7.119  39.366 14.151  1.00 8.51  ? 198 THR E CB  1 
ATOM   1506 O OG1 . THR A 1 198 ? -5.801  39.891 13.982  1.00 21.65 ? 198 THR E OG1 1 
ATOM   1507 C CG2 . THR A 1 198 ? -7.491  39.213 15.626  1.00 9.05  ? 198 THR E CG2 1 
ATOM   1508 N N   . MET A 1 199 ? -8.218  38.807 11.343  1.00 10.55 ? 199 MET E N   1 
ATOM   1509 C CA  . MET A 1 199 ? -8.409  39.338 9.983   1.00 16.95 ? 199 MET E CA  1 
ATOM   1510 C C   . MET A 1 199 ? -9.499  40.417 10.051  1.00 14.64 ? 199 MET E C   1 
ATOM   1511 O O   . MET A 1 199 ? -10.618 40.157 10.484  1.00 26.42 ? 199 MET E O   1 
ATOM   1512 C CB  . MET A 1 199 ? -8.887  38.181 9.129   1.00 25.21 ? 199 MET E CB  1 
ATOM   1513 C CG  . MET A 1 199 ? -8.600  38.427 7.652   1.00 56.39 ? 199 MET E CG  1 
ATOM   1514 S SD  . MET A 1 199 ? -9.139  37.027 6.628   1.00 29.56 ? 199 MET E SD  1 
ATOM   1515 C CE  . MET A 1 199 ? -10.900 37.241 6.738   1.00 30.92 ? 199 MET E CE  1 
ATOM   1516 N N   . ASN A 1 200 ? -9.140  41.629 9.657   1.00 14.78 ? 200 ASN E N   1 
ATOM   1517 C CA  . ASN A 1 200 ? -9.978  42.845 9.747   1.00 45.67 ? 200 ASN E CA  1 
ATOM   1518 C C   . ASN A 1 200 ? -10.574 43.148 11.155  1.00 28.95 ? 200 ASN E C   1 
ATOM   1519 O O   . ASN A 1 200 ? -11.718 43.515 11.333  1.00 32.49 ? 200 ASN E O   1 
ATOM   1520 C CB  . ASN A 1 200 ? -11.107 42.806 8.704   1.00 25.83 ? 200 ASN E CB  1 
ATOM   1521 C CG  . ASN A 1 200 ? -10.613 42.963 7.271   1.00 99.99 ? 200 ASN E CG  1 
ATOM   1522 O OD1 . ASN A 1 200 ? -9.719  43.752 6.980   1.00 36.18 ? 200 ASN E OD1 1 
ATOM   1523 N ND2 . ASN A 1 200 ? -11.242 42.228 6.374   1.00 44.22 ? 200 ASN E ND2 1 
ATOM   1524 N N   . GLY A 1 201 ? -9.705  42.950 12.142  1.00 13.18 ? 201 GLY E N   1 
ATOM   1525 C CA  . GLY A 1 201 ? -9.975  43.120 13.595  1.00 16.37 ? 201 GLY E CA  1 
ATOM   1526 C C   . GLY A 1 201 ? -10.902 42.078 14.228  1.00 12.76 ? 201 GLY E C   1 
ATOM   1527 O O   . GLY A 1 201 ? -11.284 42.244 15.384  1.00 19.60 ? 201 GLY E O   1 
ATOM   1528 N N   . GLU A 1 202 ? -11.149 40.983 13.531  1.00 13.26 ? 202 GLU E N   1 
ATOM   1529 C CA  . GLU A 1 202 ? -11.958 39.844 13.988  1.00 10.47 ? 202 GLU E CA  1 
ATOM   1530 C C   . GLU A 1 202 ? -11.065 38.598 14.081  1.00 17.51 ? 202 GLU E C   1 
ATOM   1531 O O   . GLU A 1 202 ? -10.277 38.299 13.196  1.00 18.47 ? 202 GLU E O   1 
ATOM   1532 C CB  . GLU A 1 202 ? -13.098 39.646 12.968  1.00 12.48 ? 202 GLU E CB  1 
ATOM   1533 C CG  . GLU A 1 202 ? -14.014 38.443 13.214  1.00 17.73 ? 202 GLU E CG  1 
ATOM   1534 C CD  . GLU A 1 202 ? -15.072 38.595 14.330  1.00 99.99 ? 202 GLU E CD  1 
ATOM   1535 O OE1 . GLU A 1 202 ? -15.665 37.549 14.696  1.00 50.11 ? 202 GLU E OE1 1 
ATOM   1536 O OE2 . GLU A 1 202 ? -15.298 39.720 14.808  1.00 18.05 ? 202 GLU E OE2 1 
ATOM   1537 N N   . ALA A 1 203 ? -11.133 37.929 15.232  1.00 10.21 ? 203 ALA E N   1 
ATOM   1538 C CA  . ALA A 1 203 ? -10.523 36.605 15.473  1.00 7.20  ? 203 ALA E CA  1 
ATOM   1539 C C   . ALA A 1 203 ? -11.160 35.509 14.619  1.00 10.40 ? 203 ALA E C   1 
ATOM   1540 O O   . ALA A 1 203 ? -12.371 35.269 14.646  1.00 21.32 ? 203 ALA E O   1 
ATOM   1541 C CB  . ALA A 1 203 ? -10.629 36.218 16.945  1.00 11.12 ? 203 ALA E CB  1 
ATOM   1542 N N   . ILE A 1 204 ? -10.300 34.992 13.755  1.00 19.80 ? 204 ILE E N   1 
ATOM   1543 C CA  . ILE A 1 204 ? -10.640 33.876 12.809  1.00 12.30 ? 204 ILE E CA  1 
ATOM   1544 C C   . ILE A 1 204 ? -10.257 32.505 13.340  1.00 28.44 ? 204 ILE E C   1 
ATOM   1545 O O   . ILE A 1 204 ? -10.762 31.447 12.936  1.00 18.32 ? 204 ILE E O   1 
ATOM   1546 C CB  . ILE A 1 204 ? -10.077 34.123 11.399  1.00 43.29 ? 204 ILE E CB  1 
ATOM   1547 C CG1 . ILE A 1 204 ? -8.527  34.169 11.351  1.00 12.95 ? 204 ILE E CG1 1 
ATOM   1548 C CG2 . ILE A 1 204 ? -10.781 35.354 10.809  1.00 24.49 ? 204 ILE E CG2 1 
ATOM   1549 C CD1 . ILE A 1 204 ? -7.922  34.350 9.953   1.00 12.78 ? 204 ILE E CD1 1 
ATOM   1550 N N   . ALA A 1 205 ? -9.296  32.520 14.270  1.00 15.14 ? 205 ALA E N   1 
ATOM   1551 C CA  . ALA A 1 205 ? -8.873  31.337 15.014  1.00 17.53 ? 205 ALA E CA  1 
ATOM   1552 C C   . ALA A 1 205 ? -8.208  31.819 16.307  1.00 31.04 ? 205 ALA E C   1 
ATOM   1553 O O   . ALA A 1 205 ? -7.940  32.997 16.497  1.00 17.86 ? 205 ALA E O   1 
ATOM   1554 C CB  . ALA A 1 205 ? -7.910  30.466 14.186  1.00 14.17 ? 205 ALA E CB  1 
ATOM   1555 N N   . CYS A 1 206 ? -8.114  30.903 17.257  1.00 19.98 ? 206 CYS E N   1 
ATOM   1556 C CA  . CYS A 1 206 ? -7.274  31.086 18.461  1.00 17.40 ? 206 CYS E CA  1 
ATOM   1557 C C   . CYS A 1 206 ? -7.611  32.406 19.176  1.00 16.89 ? 206 CYS E C   1 
ATOM   1558 O O   . CYS A 1 206 ? -6.773  33.152 19.681  1.00 16.54 ? 206 CYS E O   1 
ATOM   1559 C CB  . CYS A 1 206 ? -5.861  30.926 17.859  1.00 16.72 ? 206 CYS E CB  1 
ATOM   1560 S SG  . CYS A 1 206 ? -4.493  31.301 18.963  1.00 36.24 ? 206 CYS E SG  1 
ATOM   1561 N N   . ALA A 1 207 ? -8.934  32.570 19.442  1.00 18.56 ? 207 ALA E N   1 
ATOM   1562 C CA  . ALA A 1 207 ? -9.556  33.785 19.978  1.00 17.11 ? 207 ALA E CA  1 
ATOM   1563 C C   . ALA A 1 207 ? -9.115  34.147 21.403  1.00 25.30 ? 207 ALA E C   1 
ATOM   1564 O O   . ALA A 1 207 ? -9.058  35.310 21.788  1.00 21.31 ? 207 ALA E O   1 
ATOM   1565 C CB  . ALA A 1 207 ? -11.090 33.631 19.948  1.00 21.25 ? 207 ALA E CB  1 
ATOM   1566 N N   . GLU A 1 208 ? -8.839  33.094 22.181  1.00 17.40 ? 208 GLU E N   1 
ATOM   1567 C CA  . GLU A 1 208 ? -8.323  33.129 23.554  1.00 15.86 ? 208 GLU E CA  1 
ATOM   1568 C C   . GLU A 1 208 ? -6.935  32.500 23.704  1.00 14.12 ? 208 GLU E C   1 
ATOM   1569 O O   . GLU A 1 208 ? -6.541  32.046 24.775  1.00 20.48 ? 208 GLU E O   1 
ATOM   1570 C CB  . GLU A 1 208 ? -9.294  32.403 24.484  1.00 15.87 ? 208 GLU E CB  1 
ATOM   1571 C CG  . GLU A 1 208 ? -10.573 33.201 24.705  1.00 37.94 ? 208 GLU E CG  1 
ATOM   1572 C CD  . GLU A 1 208 ? -11.369 32.517 25.809  1.00 43.00 ? 208 GLU E CD  1 
ATOM   1573 O OE1 . GLU A 1 208 ? -10.990 32.753 26.991  1.00 32.21 ? 208 GLU E OE1 1 
ATOM   1574 O OE2 . GLU A 1 208 ? -12.264 31.738 25.452  1.00 54.86 ? 208 GLU E OE2 1 
ATOM   1575 N N   . GLY A 1 209 ? -6.159  32.570 22.629  1.00 16.05 ? 209 GLY E N   1 
ATOM   1576 C CA  . GLY A 1 209 ? -4.782  32.076 22.641  1.00 15.23 ? 209 GLY E CA  1 
ATOM   1577 C C   . GLY A 1 209 ? -4.706  30.584 22.270  1.00 8.00  ? 209 GLY E C   1 
ATOM   1578 O O   . GLY A 1 209 ? -5.695  29.855 22.237  1.00 21.92 ? 209 GLY E O   1 
ATOM   1579 N N   . CYS A 1 210 ? -3.483  30.245 21.876  1.00 15.60 ? 210 CYS E N   1 
ATOM   1580 C CA  . CYS A 1 210 ? -3.100  28.892 21.403  1.00 9.97  ? 210 CYS E CA  1 
ATOM   1581 C C   . CYS A 1 210 ? -1.588  28.728 21.397  1.00 6.36  ? 210 CYS E C   1 
ATOM   1582 O O   . CYS A 1 210 ? -0.820  29.694 21.485  1.00 10.65 ? 210 CYS E O   1 
ATOM   1583 C CB  . CYS A 1 210 ? -3.728  28.532 20.041  1.00 17.14 ? 210 CYS E CB  1 
ATOM   1584 S SG  . CYS A 1 210 ? -3.316  29.660 18.656  1.00 27.04 ? 210 CYS E SG  1 
ATOM   1585 N N   . GLN A 1 211 ? -1.184  27.463 21.320  1.00 9.91  ? 211 GLN E N   1 
ATOM   1586 C CA  . GLN A 1 211 ? 0.226   27.053 21.340  1.00 12.26 ? 211 GLN E CA  1 
ATOM   1587 C C   . GLN A 1 211 ? 0.757   26.815 19.919  1.00 8.03  ? 211 GLN E C   1 
ATOM   1588 O O   . GLN A 1 211 ? 0.079   26.211 19.109  1.00 10.00 ? 211 GLN E O   1 
ATOM   1589 C CB  . GLN A 1 211 ? 0.397   25.786 22.196  1.00 21.03 ? 211 GLN E CB  1 
ATOM   1590 C CG  . GLN A 1 211 ? 0.130   26.046 23.691  1.00 11.79 ? 211 GLN E CG  1 
ATOM   1591 C CD  . GLN A 1 211 ? 1.092   27.076 24.278  1.00 5.63  ? 211 GLN E CD  1 
ATOM   1592 O OE1 . GLN A 1 211 ? 2.292   26.859 24.413  1.00 10.16 ? 211 GLN E OE1 1 
ATOM   1593 N NE2 . GLN A 1 211 ? 0.576   28.264 24.582  1.00 10.50 ? 211 GLN E NE2 1 
ATOM   1594 N N   . ALA A 1 212 ? 1.886   27.463 19.628  1.00 7.08  ? 212 ALA E N   1 
ATOM   1595 C CA  . ALA A 1 212 ? 2.506   27.354 18.305  1.00 9.01  ? 212 ALA E CA  1 
ATOM   1596 C C   . ALA A 1 212 ? 4.001   27.055 18.414  1.00 11.64 ? 212 ALA E C   1 
ATOM   1597 O O   . ALA A 1 212 ? 4.631   27.357 19.415  1.00 13.73 ? 212 ALA E O   1 
ATOM   1598 C CB  . ALA A 1 212 ? 2.287   28.631 17.469  1.00 7.83  ? 212 ALA E CB  1 
ATOM   1599 N N   . ILE A 1 213 ? 4.507   26.386 17.388  1.00 11.74 ? 213 ILE E N   1 
ATOM   1600 C CA  . ILE A 1 213 ? 5.969   26.138 17.273  1.00 4.69  ? 213 ILE E CA  1 
ATOM   1601 C C   . ILE A 1 213 ? 6.576   26.879 16.081  1.00 9.63  ? 213 ILE E C   1 
ATOM   1602 O O   . ILE A 1 213 ? 5.928   27.040 15.047  1.00 13.14 ? 213 ILE E O   1 
ATOM   1603 C CB  . ILE A 1 213 ? 6.322   24.642 17.268  1.00 5.20  ? 213 ILE E CB  1 
ATOM   1604 C CG1 . ILE A 1 213 ? 5.782   23.903 16.032  1.00 7.76  ? 213 ILE E CG1 1 
ATOM   1605 C CG2 . ILE A 1 213 ? 5.813   23.953 18.538  1.00 7.87  ? 213 ILE E CG2 1 
ATOM   1606 C CD1 . ILE A 1 213 ? 6.563   22.608 15.784  1.00 7.85  ? 213 ILE E CD1 1 
ATOM   1607 N N   . VAL A 1 214 ? 7.820   27.306 16.219  1.00 5.04  ? 214 VAL E N   1 
ATOM   1608 C CA  . VAL A 1 214 ? 8.529   28.059 15.176  1.00 11.93 ? 214 VAL E CA  1 
ATOM   1609 C C   . VAL A 1 214 ? 9.434   27.030 14.504  1.00 10.50 ? 214 VAL E C   1 
ATOM   1610 O O   . VAL A 1 214 ? 10.371  26.553 15.142  1.00 11.22 ? 214 VAL E O   1 
ATOM   1611 C CB  . VAL A 1 214 ? 9.371   29.223 15.731  1.00 8.62  ? 214 VAL E CB  1 
ATOM   1612 C CG1 . VAL A 1 214 ? 10.042  29.981 14.592  1.00 13.46 ? 214 VAL E CG1 1 
ATOM   1613 C CG2 . VAL A 1 214 ? 8.494   30.234 16.477  1.00 13.64 ? 214 VAL E CG2 1 
ATOM   1614 N N   . ASP A 1 215 ? 8.999   26.628 13.326  1.00 11.71 ? 215 ASP E N   1 
ATOM   1615 C CA  . ASP A 1 215 ? 9.535   25.400 12.655  1.00 9.06  ? 215 ASP E CA  1 
ATOM   1616 C C   . ASP A 1 215 ? 10.042  25.692 11.237  1.00 12.67 ? 215 ASP E C   1 
ATOM   1617 O O   . ASP A 1 215 ? 9.307   25.598 10.266  1.00 14.27 ? 215 ASP E O   1 
ATOM   1618 C CB  . ASP A 1 215 ? 8.461   24.312 12.659  1.00 5.03  ? 215 ASP E CB  1 
ATOM   1619 C CG  . ASP A 1 215 ? 8.903   22.917 12.160  1.00 7.52  ? 215 ASP E CG  1 
ATOM   1620 O OD1 . ASP A 1 215 ? 8.058   22.008 12.296  1.00 11.62 ? 215 ASP E OD1 1 
ATOM   1621 O OD2 . ASP A 1 215 ? 10.067  22.786 11.738  1.00 16.44 ? 215 ASP E OD2 1 
ATOM   1622 N N   . THR A 1 216 ? 11.364  25.748 11.159  1.00 8.33  ? 216 THR E N   1 
ATOM   1623 C CA  . THR A 1 216 ? 12.034  25.992 9.848   1.00 12.35 ? 216 THR E CA  1 
ATOM   1624 C C   . THR A 1 216 ? 11.865  24.845 8.872   1.00 11.93 ? 216 THR E C   1 
ATOM   1625 O O   . THR A 1 216 ? 12.055  25.016 7.675   1.00 11.79 ? 216 THR E O   1 
ATOM   1626 C CB  . THR A 1 216 ? 13.526  26.261 9.985   1.00 9.45  ? 216 THR E CB  1 
ATOM   1627 O OG1 . THR A 1 216 ? 14.107  25.156 10.661  1.00 7.99  ? 216 THR E OG1 1 
ATOM   1628 C CG2 . THR A 1 216 ? 13.807  27.593 10.691  1.00 7.01  ? 216 THR E CG2 1 
ATOM   1629 N N   . GLY A 1 217 ? 11.489  23.670 9.362   1.00 5.75  ? 217 GLY E N   1 
ATOM   1630 C CA  . GLY A 1 217 ? 11.404  22.454 8.545   1.00 6.93  ? 217 GLY E CA  1 
ATOM   1631 C C   . GLY A 1 217 ? 10.022  22.233 7.944   1.00 9.73  ? 217 GLY E C   1 
ATOM   1632 O O   . GLY A 1 217 ? 9.803   21.184 7.344   1.00 14.75 ? 217 GLY E O   1 
ATOM   1633 N N   . THR A 1 218 ? 9.056   23.052 8.344   1.00 7.95  ? 218 THR E N   1 
ATOM   1634 C CA  . THR A 1 218 ? 7.681   22.948 7.823   1.00 10.33 ? 218 THR E CA  1 
ATOM   1635 C C   . THR A 1 218 ? 7.441   24.069 6.821   1.00 11.19 ? 218 THR E C   1 
ATOM   1636 O O   . THR A 1 218 ? 7.648   25.233 7.157   1.00 9.38  ? 218 THR E O   1 
ATOM   1637 C CB  . THR A 1 218 ? 6.650   22.902 8.952   1.00 2.42  ? 218 THR E CB  1 
ATOM   1638 O OG1 . THR A 1 218 ? 6.798   21.642 9.628   1.00 8.13  ? 218 THR E OG1 1 
ATOM   1639 C CG2 . THR A 1 218 ? 5.193   22.995 8.469   1.00 7.02  ? 218 THR E CG2 1 
ATOM   1640 N N   . SER A 1 219 ? 6.904   23.738 5.644   1.00 13.67 ? 219 SER E N   1 
ATOM   1641 C CA  . SER A 1 219 ? 6.767   24.709 4.525   1.00 7.34  ? 219 SER E CA  1 
ATOM   1642 C C   . SER A 1 219 ? 5.708   25.775 4.798   1.00 3.55  ? 219 SER E C   1 
ATOM   1643 O O   . SER A 1 219 ? 5.984   26.977 4.754   1.00 17.08 ? 219 SER E O   1 
ATOM   1644 C CB  . SER A 1 219 ? 6.361   24.033 3.210   1.00 12.03 ? 219 SER E CB  1 
ATOM   1645 O OG  . SER A 1 219 ? 7.252   22.974 2.879   1.00 14.81 ? 219 SER E OG  1 
ATOM   1646 N N   . LEU A 1 220 ? 4.555   25.286 5.241   1.00 11.29 ? 220 LEU E N   1 
ATOM   1647 C CA  . LEU A 1 220 ? 3.304   26.049 5.367   1.00 11.44 ? 220 LEU E CA  1 
ATOM   1648 C C   . LEU A 1 220 ? 2.983   26.402 6.833   1.00 12.44 ? 220 LEU E C   1 
ATOM   1649 O O   . LEU A 1 220 ? 3.717   26.095 7.762   1.00 20.17 ? 220 LEU E O   1 
ATOM   1650 C CB  . LEU A 1 220 ? 2.127   25.256 4.758   1.00 14.88 ? 220 LEU E CB  1 
ATOM   1651 C CG  . LEU A 1 220 ? 2.313   24.819 3.286   1.00 19.94 ? 220 LEU E CG  1 
ATOM   1652 C CD1 . LEU A 1 220 ? 0.997   24.290 2.719   1.00 16.17 ? 220 LEU E CD1 1 
ATOM   1653 C CD2 . LEU A 1 220 ? 2.794   25.958 2.388   1.00 16.73 ? 220 LEU E CD2 1 
ATOM   1654 N N   . LEU A 1 221 ? 1.927   27.182 6.954   1.00 10.22 ? 221 LEU E N   1 
ATOM   1655 C CA  . LEU A 1 221 ? 1.299   27.543 8.236   1.00 9.36  ? 221 LEU E CA  1 
ATOM   1656 C C   . LEU A 1 221 ? 0.297   26.428 8.513   1.00 19.13 ? 221 LEU E C   1 
ATOM   1657 O O   . LEU A 1 221 ? -0.608  26.151 7.731   1.00 13.10 ? 221 LEU E O   1 
ATOM   1658 C CB  . LEU A 1 221 ? 0.590   28.873 7.979   1.00 8.39  ? 221 LEU E CB  1 
ATOM   1659 C CG  . LEU A 1 221 ? 1.169   30.109 8.675   1.00 23.73 ? 221 LEU E CG  1 
ATOM   1660 C CD1 . LEU A 1 221 ? 2.685   30.140 8.838   1.00 17.55 ? 221 LEU E CD1 1 
ATOM   1661 C CD2 . LEU A 1 221 ? 0.662   31.312 7.887   1.00 18.63 ? 221 LEU E CD2 1 
ATOM   1662 N N   . THR A 1 222 ? 0.614   25.615 9.520   1.00 13.03 ? 222 THR E N   1 
ATOM   1663 C CA  . THR A 1 222 ? -0.301  24.505 9.851   1.00 11.06 ? 222 THR E CA  1 
ATOM   1664 C C   . THR A 1 222 ? -1.003  24.716 11.202  1.00 19.09 ? 222 THR E C   1 
ATOM   1665 O O   . THR A 1 222 ? -0.559  25.413 12.094  1.00 16.49 ? 222 THR E O   1 
ATOM   1666 C CB  . THR A 1 222 ? 0.334   23.100 9.799   1.00 13.50 ? 222 THR E CB  1 
ATOM   1667 O OG1 . THR A 1 222 ? 0.958   22.898 11.053  1.00 25.27 ? 222 THR E OG1 1 
ATOM   1668 C CG2 . THR A 1 222 ? 1.363   22.932 8.677   1.00 9.91  ? 222 THR E CG2 1 
ATOM   1669 N N   . GLY A 1 223 ? -2.219  24.185 11.257  1.00 18.46 ? 223 GLY E N   1 
ATOM   1670 C CA  . GLY A 1 223 ? -3.017  24.235 12.493  1.00 8.25  ? 223 GLY E CA  1 
ATOM   1671 C C   . GLY A 1 223 ? -3.980  23.043 12.556  1.00 11.07 ? 223 GLY E C   1 
ATOM   1672 O O   . GLY A 1 223 ? -4.103  22.318 11.562  1.00 13.94 ? 223 GLY E O   1 
ATOM   1673 N N   . PRO A 1 224 ? -4.748  22.902 13.647  1.00 15.79 ? 224 PRO E N   1 
ATOM   1674 C CA  . PRO A 1 224 ? -5.787  21.860 13.769  1.00 17.39 ? 224 PRO E CA  1 
ATOM   1675 C C   . PRO A 1 224 ? -6.776  22.023 12.616  1.00 21.96 ? 224 PRO E C   1 
ATOM   1676 O O   . PRO A 1 224 ? -7.098  23.141 12.187  1.00 17.44 ? 224 PRO E O   1 
ATOM   1677 C CB  . PRO A 1 224 ? -6.518  22.168 15.073  1.00 27.49 ? 224 PRO E CB  1 
ATOM   1678 C CG  . PRO A 1 224 ? -5.537  23.018 15.872  1.00 44.81 ? 224 PRO E CG  1 
ATOM   1679 C CD  . PRO A 1 224 ? -4.787  23.809 14.810  1.00 21.68 ? 224 PRO E CD  1 
ATOM   1680 N N   . THR A 1 225 ? -7.290  20.881 12.169  1.00 22.95 ? 225 THR E N   1 
ATOM   1681 C CA  . THR A 1 225 ? -8.133  20.788 10.952  1.00 25.38 ? 225 THR E CA  1 
ATOM   1682 C C   . THR A 1 225 ? -9.386  21.662 10.934  1.00 20.84 ? 225 THR E C   1 
ATOM   1683 O O   . THR A 1 225 ? -9.606  22.382 9.959   1.00 33.30 ? 225 THR E O   1 
ATOM   1684 C CB  . THR A 1 225 ? -8.533  19.345 10.562  1.00 18.69 ? 225 THR E CB  1 
ATOM   1685 O OG1 . THR A 1 225 ? -9.284  18.729 11.605  1.00 35.72 ? 225 THR E OG1 1 
ATOM   1686 C CG2 . THR A 1 225 ? -7.322  18.481 10.210  1.00 29.41 ? 225 THR E CG2 1 
ATOM   1687 N N   . SER A 1 226 ? -10.066 21.801 12.083  1.00 17.70 ? 226 SER E N   1 
ATOM   1688 C CA  . SER A 1 226 ? -11.293 22.622 12.168  1.00 18.70 ? 226 SER E CA  1 
ATOM   1689 C C   . SER A 1 226 ? -11.078 24.138 12.088  1.00 18.63 ? 226 SER E C   1 
ATOM   1690 O O   . SER A 1 226 ? -11.726 24.741 11.227  1.00 24.62 ? 226 SER E O   1 
ATOM   1691 C CB  . SER A 1 226 ? -12.206 22.267 13.354  1.00 25.16 ? 226 SER E CB  1 
ATOM   1692 O OG  . SER A 1 226 ? -12.629 20.905 13.264  1.00 99.99 ? 226 SER E OG  1 
ATOM   1693 N N   . PRO A 1 227 ? -10.150 24.777 12.840  1.00 24.62 ? 227 PRO E N   1 
ATOM   1694 C CA  . PRO A 1 227 ? -9.838  26.216 12.677  1.00 32.37 ? 227 PRO E CA  1 
ATOM   1695 C C   . PRO A 1 227 ? -9.311  26.546 11.271  1.00 26.39 ? 227 PRO E C   1 
ATOM   1696 O O   . PRO A 1 227 ? -9.675  27.562 10.701  1.00 17.75 ? 227 PRO E O   1 
ATOM   1697 C CB  . PRO A 1 227 ? -8.757  26.523 13.702  1.00 33.88 ? 227 PRO E CB  1 
ATOM   1698 C CG  . PRO A 1 227 ? -8.970  25.480 14.787  1.00 28.14 ? 227 PRO E CG  1 
ATOM   1699 C CD  . PRO A 1 227 ? -9.441  24.249 14.019  1.00 26.28 ? 227 PRO E CD  1 
ATOM   1700 N N   . ILE A 1 228 ? -8.492  25.647 10.716  1.00 19.00 ? 228 ILE E N   1 
ATOM   1701 C CA  . ILE A 1 228 ? -7.953  25.818 9.344   1.00 26.65 ? 228 ILE E CA  1 
ATOM   1702 C C   . ILE A 1 228 ? -9.060  25.804 8.291   1.00 18.60 ? 228 ILE E C   1 
ATOM   1703 O O   . ILE A 1 228 ? -9.056  26.639 7.390   1.00 23.31 ? 228 ILE E O   1 
ATOM   1704 C CB  . ILE A 1 228 ? -6.806  24.817 9.072   1.00 14.70 ? 228 ILE E CB  1 
ATOM   1705 C CG1 . ILE A 1 228 ? -5.550  25.169 9.882   1.00 7.32  ? 228 ILE E CG1 1 
ATOM   1706 C CG2 . ILE A 1 228 ? -6.478  24.648 7.580   1.00 12.14 ? 228 ILE E CG2 1 
ATOM   1707 C CD1 . ILE A 1 228 ? -4.843  26.476 9.509   1.00 11.78 ? 228 ILE E CD1 1 
ATOM   1708 N N   . ALA A 1 229 ? -10.051 24.915 8.436   1.00 22.19 ? 229 ALA E N   1 
ATOM   1709 C CA  . ALA A 1 229 ? -11.225 24.900 7.525   1.00 23.28 ? 229 ALA E CA  1 
ATOM   1710 C C   . ALA A 1 229 ? -11.949 26.251 7.474   1.00 18.56 ? 229 ALA E C   1 
ATOM   1711 O O   . ALA A 1 229 ? -12.175 26.793 6.394   1.00 31.39 ? 229 ALA E O   1 
ATOM   1712 C CB  . ALA A 1 229 ? -12.209 23.809 7.939   1.00 21.97 ? 229 ALA E CB  1 
ATOM   1713 N N   . ASN A 1 230 ? -12.007 26.931 8.629   1.00 25.31 ? 230 ASN E N   1 
ATOM   1714 C CA  . ASN A 1 230 ? -12.535 28.305 8.731   1.00 23.68 ? 230 ASN E CA  1 
ATOM   1715 C C   . ASN A 1 230 ? -11.648 29.352 8.033   1.00 22.84 ? 230 ASN E C   1 
ATOM   1716 O O   . ASN A 1 230 ? -12.123 30.160 7.236   1.00 25.84 ? 230 ASN E O   1 
ATOM   1717 C CB  . ASN A 1 230 ? -12.758 28.757 10.185  1.00 49.57 ? 230 ASN E CB  1 
ATOM   1718 C CG  . ASN A 1 230 ? -13.624 27.833 11.053  1.00 46.47 ? 230 ASN E CG  1 
ATOM   1719 O OD1 . ASN A 1 230 ? -14.653 27.276 10.655  1.00 44.62 ? 230 ASN E OD1 1 
ATOM   1720 N ND2 . ASN A 1 230 ? -13.172 27.655 12.256  1.00 99.99 ? 230 ASN E ND2 1 
ATOM   1721 N N   . ILE A 1 231 ? -10.319 29.255 8.234   1.00 17.26 ? 231 ILE E N   1 
ATOM   1722 C CA  . ILE A 1 231 ? -9.355  30.136 7.562   1.00 18.67 ? 231 ILE E CA  1 
ATOM   1723 C C   . ILE A 1 231 ? -9.418  29.975 6.031   1.00 21.76 ? 231 ILE E C   1 
ATOM   1724 O O   . ILE A 1 231 ? -9.530  30.974 5.340   1.00 20.60 ? 231 ILE E O   1 
ATOM   1725 C CB  . ILE A 1 231 ? -7.919  30.012 8.120   1.00 20.18 ? 231 ILE E CB  1 
ATOM   1726 C CG1 . ILE A 1 231 ? -7.893  30.458 9.591   1.00 13.58 ? 231 ILE E CG1 1 
ATOM   1727 C CG2 . ILE A 1 231 ? -6.933  30.868 7.297   1.00 20.58 ? 231 ILE E CG2 1 
ATOM   1728 C CD1 . ILE A 1 231 ? -6.571  30.120 10.303  1.00 8.49  ? 231 ILE E CD1 1 
ATOM   1729 N N   . GLN A 1 232 ? -9.572  28.730 5.557   1.00 23.49 ? 232 GLN E N   1 
ATOM   1730 C CA  . GLN A 1 232 ? -9.719  28.414 4.125   1.00 15.92 ? 232 GLN E CA  1 
ATOM   1731 C C   . GLN A 1 232 ? -10.944 29.097 3.474   1.00 18.86 ? 232 GLN E C   1 
ATOM   1732 O O   . GLN A 1 232 ? -10.788 29.828 2.506   1.00 23.23 ? 232 GLN E O   1 
ATOM   1733 C CB  . GLN A 1 232 ? -9.770  26.903 3.821   1.00 17.38 ? 232 GLN E CB  1 
ATOM   1734 C CG  . GLN A 1 232 ? -8.579  26.072 4.319   1.00 18.89 ? 232 GLN E CG  1 
ATOM   1735 C CD  . GLN A 1 232 ? -7.203  26.401 3.735   1.00 16.51 ? 232 GLN E CD  1 
ATOM   1736 O OE1 . GLN A 1 232 ? -6.888  27.480 3.250   1.00 24.37 ? 232 GLN E OE1 1 
ATOM   1737 N NE2 . GLN A 1 232 ? -6.313  25.424 3.847   1.00 22.16 ? 232 GLN E NE2 1 
ATOM   1738 N N   . SER A 1 233 ? -12.106 29.044 4.145   1.00 13.95 ? 233 SER E N   1 
ATOM   1739 C CA  . SER A 1 233 ? -13.332 29.731 3.674   1.00 31.11 ? 233 SER E CA  1 
ATOM   1740 C C   . SER A 1 233 ? -13.214 31.249 3.676   1.00 25.18 ? 233 SER E C   1 
ATOM   1741 O O   . SER A 1 233 ? -13.581 31.920 2.707   1.00 36.58 ? 233 SER E O   1 
ATOM   1742 C CB  . SER A 1 233 ? -14.593 29.386 4.499   1.00 17.37 ? 233 SER E CB  1 
ATOM   1743 O OG  . SER A 1 233 ? -14.728 27.976 4.649   1.00 69.42 ? 233 SER E OG  1 
ATOM   1744 N N   . ASP A 1 234 ? -12.497 31.803 4.680   1.00 23.73 ? 234 ASP E N   1 
ATOM   1745 C CA  . ASP A 1 234 ? -12.293 33.242 4.850   1.00 13.31 ? 234 ASP E CA  1 
ATOM   1746 C C   . ASP A 1 234 ? -11.451 33.902 3.754   1.00 24.50 ? 234 ASP E C   1 
ATOM   1747 O O   . ASP A 1 234 ? -11.630 35.086 3.472   1.00 35.94 ? 234 ASP E O   1 
ATOM   1748 C CB  . ASP A 1 234 ? -11.661 33.588 6.213   1.00 24.63 ? 234 ASP E CB  1 
ATOM   1749 C CG  . ASP A 1 234 ? -12.534 33.209 7.413   1.00 41.25 ? 234 ASP E CG  1 
ATOM   1750 O OD1 . ASP A 1 234 ? -13.791 33.246 7.261   1.00 30.32 ? 234 ASP E OD1 1 
ATOM   1751 O OD2 . ASP A 1 234 ? -11.948 32.932 8.464   1.00 37.96 ? 234 ASP E OD2 1 
ATOM   1752 N N   . ILE A 1 235 ? -10.523 33.119 3.206   1.00 16.56 ? 235 ILE E N   1 
ATOM   1753 C CA  . ILE A 1 235 ? -9.590  33.577 2.139   1.00 19.25 ? 235 ILE E CA  1 
ATOM   1754 C C   . ILE A 1 235 ? -9.989  33.135 0.711   1.00 23.08 ? 235 ILE E C   1 
ATOM   1755 O O   . ILE A 1 235 ? -9.297  33.381 -0.283  1.00 29.73 ? 235 ILE E O   1 
ATOM   1756 C CB  . ILE A 1 235 ? -8.108  33.248 2.460   1.00 22.38 ? 235 ILE E CB  1 
ATOM   1757 C CG1 . ILE A 1 235 ? -7.830  31.740 2.498   1.00 27.92 ? 235 ILE E CG1 1 
ATOM   1758 C CG2 . ILE A 1 235 ? -7.691  33.940 3.767   1.00 27.40 ? 235 ILE E CG2 1 
ATOM   1759 C CD1 . ILE A 1 235 ? -6.341  31.379 2.521   1.00 17.67 ? 235 ILE E CD1 1 
ATOM   1760 N N   . GLY A 1 236 ? -11.125 32.445 0.631   1.00 22.50 ? 236 GLY E N   1 
ATOM   1761 C CA  . GLY A 1 236 ? -11.760 31.994 -0.617  1.00 54.16 ? 236 GLY E CA  1 
ATOM   1762 C C   . GLY A 1 236 ? -11.076 30.804 -1.307  1.00 84.53 ? 236 GLY E C   1 
ATOM   1763 O O   . GLY A 1 236 ? -11.217 30.606 -2.508  1.00 38.60 ? 236 GLY E O   1 
ATOM   1764 N N   . ALA A 1 237 ? -10.451 29.958 -0.510  1.00 37.48 ? 237 ALA E N   1 
ATOM   1765 C CA  . ALA A 1 237 ? -9.822  28.715 -1.005  1.00 40.32 ? 237 ALA E CA  1 
ATOM   1766 C C   . ALA A 1 237 ? -10.878 27.642 -1.262  1.00 49.63 ? 237 ALA E C   1 
ATOM   1767 O O   . ALA A 1 237 ? -11.757 27.380 -0.439  1.00 33.86 ? 237 ALA E O   1 
ATOM   1768 C CB  . ALA A 1 237 ? -8.762  28.169 -0.047  1.00 23.70 ? 237 ALA E CB  1 
ATOM   1769 N N   . SER A 1 238 ? -10.846 27.124 -2.478  1.00 99.99 ? 238 SER E N   1 
ATOM   1770 C CA  . SER A 1 238 ? -11.676 25.963 -2.837  1.00 99.99 ? 238 SER E CA  1 
ATOM   1771 C C   . SER A 1 238 ? -10.782 24.757 -3.125  1.00 38.97 ? 238 SER E C   1 
ATOM   1772 O O   . SER A 1 238 ? -9.627  24.849 -3.500  1.00 99.99 ? 238 SER E O   1 
ATOM   1773 C CB  . SER A 1 238 ? -12.645 26.225 -4.004  1.00 80.09 ? 238 SER E CB  1 
ATOM   1774 O OG  . SER A 1 238 ? -11.974 26.259 -5.269  1.00 99.99 ? 238 SER E OG  1 
ATOM   1775 N N   . GLU A 1 239 ? -11.356 23.610 -2.736  1.00 99.97 ? 239 GLU E N   1 
ATOM   1776 C CA  . GLU A 1 239 ? -10.726 22.295 -2.940  1.00 99.99 ? 239 GLU E CA  1 
ATOM   1777 C C   . GLU A 1 239 ? -10.895 21.814 -4.391  1.00 99.99 ? 239 GLU E C   1 
ATOM   1778 O O   . GLU A 1 239 ? -11.999 21.572 -4.873  1.00 99.99 ? 239 GLU E O   1 
ATOM   1779 C CB  . GLU A 1 239 ? -11.339 21.339 -1.909  1.00 99.99 ? 239 GLU E CB  1 
ATOM   1780 C CG  . GLU A 1 239 ? -10.579 20.011 -1.782  1.00 99.99 ? 239 GLU E CG  1 
ATOM   1781 C CD  . GLU A 1 239 ? -11.036 19.159 -0.591  1.00 99.99 ? 239 GLU E CD  1 
ATOM   1782 O OE1 . GLU A 1 239 ? -12.155 19.407 -0.050  1.00 99.99 ? 239 GLU E OE1 1 
ATOM   1783 O OE2 . GLU A 1 239 ? -10.248 18.269 -0.220  1.00 99.99 ? 239 GLU E OE2 1 
ATOM   1784 N N   . ASN A 1 240 ? -9.769  21.877 -5.120  1.00 96.15 ? 240 ASN E N   1 
ATOM   1785 C CA  . ASN A 1 240 ? -9.719  21.484 -6.536  1.00 99.99 ? 240 ASN E CA  1 
ATOM   1786 C C   . ASN A 1 240 ? -9.629  19.951 -6.726  1.00 99.99 ? 240 ASN E C   1 
ATOM   1787 O O   . ASN A 1 240 ? -9.131  19.211 -5.899  1.00 99.99 ? 240 ASN E O   1 
ATOM   1788 C CB  . ASN A 1 240 ? -8.656  22.278 -7.332  1.00 71.29 ? 240 ASN E CB  1 
ATOM   1789 C CG  . ASN A 1 240 ? -7.231  21.742 -7.470  1.00 99.99 ? 240 ASN E CG  1 
ATOM   1790 O OD1 . ASN A 1 240 ? -6.821  20.697 -6.938  1.00 34.15 ? 240 ASN E OD1 1 
ATOM   1791 N ND2 . ASN A 1 240 ? -6.459  22.333 -8.336  1.00 99.99 ? 240 ASN E ND2 1 
ATOM   1792 N N   . SER A 1 241 ? -9.904  19.595 -7.989  1.00 99.99 ? 241 SER E N   1 
ATOM   1793 C CA  . SER A 1 241 ? -10.076 18.211 -8.494  1.00 99.99 ? 241 SER E CA  1 
ATOM   1794 C C   . SER A 1 241 ? -8.884  17.250 -8.257  1.00 99.99 ? 241 SER E C   1 
ATOM   1795 O O   . SER A 1 241 ? -9.059  16.036 -8.165  1.00 99.99 ? 241 SER E O   1 
ATOM   1796 C CB  . SER A 1 241 ? -10.378 18.292 -9.998  1.00 99.99 ? 241 SER E CB  1 
ATOM   1797 O OG  . SER A 1 241 ? -11.309 19.360 -10.260 1.00 99.99 ? 241 SER E OG  1 
ATOM   1798 N N   . ASP A 1 242 ? -7.705  17.829 -8.075  1.00 99.99 ? 242 ASP E N   1 
ATOM   1799 C CA  . ASP A 1 242 ? -6.411  17.111 -7.916  1.00 99.99 ? 242 ASP E CA  1 
ATOM   1800 C C   . ASP A 1 242 ? -5.890  16.946 -6.475  1.00 99.99 ? 242 ASP E C   1 
ATOM   1801 O O   . ASP A 1 242 ? -4.802  16.408 -6.269  1.00 99.99 ? 242 ASP E O   1 
ATOM   1802 C CB  . ASP A 1 242 ? -5.337  17.812 -8.768  1.00 99.99 ? 242 ASP E CB  1 
ATOM   1803 C CG  . ASP A 1 242 ? -5.659  17.831 -10.268 1.00 99.99 ? 242 ASP E CG  1 
ATOM   1804 O OD1 . ASP A 1 242 ? -6.388  18.768 -10.679 1.00 99.99 ? 242 ASP E OD1 1 
ATOM   1805 O OD2 . ASP A 1 242 ? -5.132  16.940 -10.980 1.00 99.99 ? 242 ASP E OD2 1 
ATOM   1806 N N   . GLY A 1 243 ? -6.588  17.570 -5.500  1.00 99.99 ? 243 GLY E N   1 
ATOM   1807 C CA  . GLY A 1 243 ? -6.238  17.524 -4.066  1.00 99.99 ? 243 GLY E CA  1 
ATOM   1808 C C   . GLY A 1 243 ? -5.851  18.877 -3.402  1.00 99.99 ? 243 GLY E C   1 
ATOM   1809 O O   . GLY A 1 243 ? -5.930  19.051 -2.203  1.00 91.55 ? 243 GLY E O   1 
ATOM   1810 N N   . ASP A 1 244 ? -5.453  19.833 -4.258  1.00 99.99 ? 244 ASP E N   1 
ATOM   1811 C CA  . ASP A 1 244 ? -4.969  21.164 -3.830  1.00 77.82 ? 244 ASP E CA  1 
ATOM   1812 C C   . ASP A 1 244 ? -6.092  22.075 -3.296  1.00 55.53 ? 244 ASP E C   1 
ATOM   1813 O O   . ASP A 1 244 ? -7.220  22.065 -3.768  1.00 99.99 ? 244 ASP E O   1 
ATOM   1814 C CB  . ASP A 1 244 ? -4.290  21.890 -5.001  1.00 99.99 ? 244 ASP E CB  1 
ATOM   1815 C CG  . ASP A 1 244 ? -3.244  21.050 -5.757  1.00 99.99 ? 244 ASP E CG  1 
ATOM   1816 O OD1 . ASP A 1 244 ? -2.203  20.745 -5.168  1.00 99.99 ? 244 ASP E OD1 1 
ATOM   1817 O OD2 . ASP A 1 244 ? -3.549  20.776 -6.953  1.00 99.99 ? 244 ASP E OD2 1 
ATOM   1818 N N   . MET A 1 245 ? -5.668  22.988 -2.410  1.00 44.78 ? 245 MET E N   1 
ATOM   1819 C CA  . MET A 1 245 ? -6.511  24.085 -1.890  1.00 99.99 ? 245 MET E CA  1 
ATOM   1820 C C   . MET A 1 245 ? -6.120  25.395 -2.590  1.00 55.26 ? 245 MET E C   1 
ATOM   1821 O O   . MET A 1 245 ? -5.106  26.031 -2.331  1.00 32.22 ? 245 MET E O   1 
ATOM   1822 C CB  . MET A 1 245 ? -6.345  24.221 -0.367  1.00 99.99 ? 245 MET E CB  1 
ATOM   1823 C CG  . MET A 1 245 ? -6.990  23.085 0.432   1.00 55.31 ? 245 MET E CG  1 
ATOM   1824 S SD  . MET A 1 245 ? -8.785  23.291 0.710   1.00 62.30 ? 245 MET E SD  1 
ATOM   1825 C CE  . MET A 1 245 ? -9.088  21.967 1.859   1.00 95.16 ? 245 MET E CE  1 
ATOM   1826 N N   . VAL A 1 246 ? -6.921  25.703 -3.622  1.00 32.35 ? 246 VAL E N   1 
ATOM   1827 C CA  . VAL A 1 246 ? -6.583  26.773 -4.575  1.00 21.74 ? 246 VAL E CA  1 
ATOM   1828 C C   . VAL A 1 246 ? -7.354  28.069 -4.348  1.00 26.07 ? 246 VAL E C   1 
ATOM   1829 O O   . VAL A 1 246 ? -8.510  28.069 -3.952  1.00 43.56 ? 246 VAL E O   1 
ATOM   1830 C CB  . VAL A 1 246 ? -6.684  26.360 -6.060  1.00 53.34 ? 246 VAL E CB  1 
ATOM   1831 C CG1 . VAL A 1 246 ? -5.576  25.372 -6.441  1.00 99.99 ? 246 VAL E CG1 1 
ATOM   1832 C CG2 . VAL A 1 246 ? -8.073  25.848 -6.439  1.00 33.58 ? 246 VAL E CG2 1 
ATOM   1833 N N   . VAL A 1 247 ? -6.630  29.147 -4.642  1.00 33.12 ? 247 VAL E N   1 
ATOM   1834 C CA  . VAL A 1 247 ? -7.158  30.516 -4.667  1.00 35.92 ? 247 VAL E CA  1 
ATOM   1835 C C   . VAL A 1 247 ? -6.813  31.125 -6.033  1.00 40.34 ? 247 VAL E C   1 
ATOM   1836 O O   . VAL A 1 247 ? -5.770  30.806 -6.637  1.00 40.39 ? 247 VAL E O   1 
ATOM   1837 C CB  . VAL A 1 247 ? -6.544  31.351 -3.499  1.00 43.28 ? 247 VAL E CB  1 
ATOM   1838 C CG1 . VAL A 1 247 ? -7.098  32.777 -3.430  1.00 99.99 ? 247 VAL E CG1 1 
ATOM   1839 C CG2 . VAL A 1 247 ? -6.801  30.710 -2.139  1.00 37.54 ? 247 VAL E CG2 1 
ATOM   1840 N N   . SER A 1 248 ? -7.699  31.958 -6.558  1.00 28.30 ? 248 SER E N   1 
ATOM   1841 C CA  . SER A 1 248 ? -7.432  32.760 -7.761  1.00 67.10 ? 248 SER E CA  1 
ATOM   1842 C C   . SER A 1 248 ? -6.265  33.727 -7.498  1.00 36.46 ? 248 SER E C   1 
ATOM   1843 O O   . SER A 1 248 ? -6.371  34.614 -6.667  1.00 42.27 ? 248 SER E O   1 
ATOM   1844 C CB  . SER A 1 248 ? -8.653  33.606 -8.163  1.00 57.18 ? 248 SER E CB  1 
ATOM   1845 O OG  . SER A 1 248 ? -8.312  34.345 -9.344  1.00 60.69 ? 248 SER E OG  1 
ATOM   1846 N N   . CYS A 1 249 ? -5.220  33.609 -8.315  1.00 21.24 ? 249 CYS E N   1 
ATOM   1847 C CA  . CYS A 1 249 ? -4.057  34.528 -8.232  1.00 21.04 ? 249 CYS E CA  1 
ATOM   1848 C C   . CYS A 1 249 ? -4.447  36.014 -8.281  1.00 48.66 ? 249 CYS E C   1 
ATOM   1849 O O   . CYS A 1 249 ? -3.840  36.857 -7.616  1.00 35.23 ? 249 CYS E O   1 
ATOM   1850 C CB  . CYS A 1 249 ? -3.085  34.223 -9.361  1.00 64.17 ? 249 CYS E CB  1 
ATOM   1851 S SG  . CYS A 1 249 ? -2.444  32.512 -9.289  1.00 43.86 ? 249 CYS E SG  1 
ATOM   1852 N N   . SER A 1 250 ? -5.550  36.302 -8.977  1.00 99.99 ? 250 SER E N   1 
ATOM   1853 C CA  . SER A 1 250 ? -6.128  37.653 -9.118  1.00 78.75 ? 250 SER E CA  1 
ATOM   1854 C C   . SER A 1 250 ? -6.507  38.275 -7.775  1.00 49.89 ? 250 SER E C   1 
ATOM   1855 O O   . SER A 1 250 ? -6.193  39.438 -7.501  1.00 51.32 ? 250 SER E O   1 
ATOM   1856 C CB  . SER A 1 250 ? -7.378  37.624 -10.021 1.00 64.65 ? 250 SER E CB  1 
ATOM   1857 O OG  . SER A 1 250 ? -7.075  37.043 -11.295 1.00 89.25 ? 250 SER E OG  1 
ATOM   1858 N N   . ALA A 1 251 ? -7.006  37.440 -6.860  1.00 30.45 ? 251 ALA E N   1 
ATOM   1859 C CA  . ALA A 1 251 ? -7.492  37.789 -5.528  1.00 24.95 ? 251 ALA E CA  1 
ATOM   1860 C C   . ALA A 1 251 ? -6.453  38.283 -4.475  1.00 54.63 ? 251 ALA E C   1 
ATOM   1861 O O   . ALA A 1 251 ? -6.821  38.917 -3.508  1.00 42.29 ? 251 ALA E O   1 
ATOM   1862 C CB  . ALA A 1 251 ? -8.283  36.618 -4.928  1.00 22.07 ? 251 ALA E CB  1 
ATOM   1863 N N   . ILE A 1 252 ? -5.164  38.048 -4.710  1.00 27.41 ? 252 ILE E N   1 
ATOM   1864 C CA  . ILE A 1 252 ? -4.092  38.505 -3.786  1.00 22.01 ? 252 ILE E CA  1 
ATOM   1865 C C   . ILE A 1 252 ? -4.202  40.022 -3.492  1.00 28.13 ? 252 ILE E C   1 
ATOM   1866 O O   . ILE A 1 252 ? -4.071  40.467 -2.364  1.00 51.62 ? 252 ILE E O   1 
ATOM   1867 C CB  . ILE A 1 252 ? -2.700  38.142 -4.353  1.00 21.82 ? 252 ILE E CB  1 
ATOM   1868 C CG1 . ILE A 1 252 ? -2.569  36.612 -4.432  1.00 32.08 ? 252 ILE E CG1 1 
ATOM   1869 C CG2 . ILE A 1 252 ? -1.542  38.782 -3.565  1.00 23.35 ? 252 ILE E CG2 1 
ATOM   1870 C CD1 . ILE A 1 252 ? -1.398  36.120 -5.293  1.00 64.38 ? 252 ILE E CD1 1 
ATOM   1871 N N   . SER A 1 253 ? -4.538  40.775 -4.528  1.00 33.45 ? 253 SER E N   1 
ATOM   1872 C CA  . SER A 1 253 ? -4.689  42.245 -4.479  1.00 24.06 ? 253 SER E CA  1 
ATOM   1873 C C   . SER A 1 253 ? -5.842  42.783 -3.612  1.00 24.08 ? 253 SER E C   1 
ATOM   1874 O O   . SER A 1 253 ? -5.867  43.971 -3.297  1.00 70.87 ? 253 SER E O   1 
ATOM   1875 C CB  . SER A 1 253 ? -4.856  42.770 -5.909  1.00 23.30 ? 253 SER E CB  1 
ATOM   1876 O OG  . SER A 1 253 ? -6.006  42.143 -6.470  1.00 71.83 ? 253 SER E OG  1 
ATOM   1877 N N   . SER A 1 254 ? -6.833  41.927 -3.316  1.00 23.08 ? 254 SER E N   1 
ATOM   1878 C CA  . SER A 1 254 ? -8.053  42.322 -2.572  1.00 22.75 ? 254 SER E CA  1 
ATOM   1879 C C   . SER A 1 254 ? -8.225  41.702 -1.173  1.00 53.08 ? 254 SER E C   1 
ATOM   1880 O O   . SER A 1 254 ? -9.151  42.044 -0.441  1.00 26.60 ? 254 SER E O   1 
ATOM   1881 C CB  . SER A 1 254 ? -9.317  42.009 -3.391  1.00 34.10 ? 254 SER E CB  1 
ATOM   1882 O OG  . SER A 1 254 ? -9.428  40.600 -3.582  1.00 34.05 ? 254 SER E OG  1 
ATOM   1883 N N   . LEU A 1 255 ? -7.367  40.725 -0.852  1.00 17.82 ? 255 LEU E N   1 
ATOM   1884 C CA  . LEU A 1 255 ? -7.372  40.061 0.474   1.00 20.03 ? 255 LEU E CA  1 
ATOM   1885 C C   . LEU A 1 255 ? -6.646  40.914 1.548   1.00 41.31 ? 255 LEU E C   1 
ATOM   1886 O O   . LEU A 1 255 ? -5.741  41.668 1.227   1.00 18.27 ? 255 LEU E O   1 
ATOM   1887 C CB  . LEU A 1 255 ? -6.755  38.663 0.396   1.00 18.71 ? 255 LEU E CB  1 
ATOM   1888 C CG  . LEU A 1 255 ? -7.718  37.614 -0.181  1.00 25.38 ? 255 LEU E CG  1 
ATOM   1889 C CD1 . LEU A 1 255 ? -6.959  36.313 -0.441  1.00 29.40 ? 255 LEU E CD1 1 
ATOM   1890 C CD2 . LEU A 1 255 ? -8.926  37.371 0.738   1.00 39.95 ? 255 LEU E CD2 1 
ATOM   1891 N N   . PRO A 1 256 ? -7.122  40.842 2.807   1.00 18.12 ? 256 PRO E N   1 
ATOM   1892 C CA  . PRO A 1 256 ? -6.436  41.535 3.922   1.00 16.43 ? 256 PRO E CA  1 
ATOM   1893 C C   . PRO A 1 256 ? -5.321  40.676 4.507   1.00 22.13 ? 256 PRO E C   1 
ATOM   1894 O O   . PRO A 1 256 ? -5.208  39.459 4.259   1.00 18.71 ? 256 PRO E O   1 
ATOM   1895 C CB  . PRO A 1 256 ? -7.570  41.770 4.928   1.00 19.75 ? 256 PRO E CB  1 
ATOM   1896 C CG  . PRO A 1 256 ? -8.470  40.551 4.733   1.00 27.50 ? 256 PRO E CG  1 
ATOM   1897 C CD  . PRO A 1 256 ? -8.426  40.300 3.231   1.00 30.37 ? 256 PRO E CD  1 
ATOM   1898 N N   . ASP A 1 257 ? -4.412  41.294 5.251   1.00 16.59 ? 257 ASP E N   1 
ATOM   1899 C CA  . ASP A 1 257 ? -3.404  40.613 6.054   1.00 15.48 ? 257 ASP E CA  1 
ATOM   1900 C C   . ASP A 1 257 ? -4.083  39.789 7.154   1.00 12.12 ? 257 ASP E C   1 
ATOM   1901 O O   . ASP A 1 257 ? -5.173  40.137 7.621   1.00 19.86 ? 257 ASP E O   1 
ATOM   1902 C CB  . ASP A 1 257 ? -2.490  41.626 6.762   1.00 12.04 ? 257 ASP E CB  1 
ATOM   1903 C CG  . ASP A 1 257 ? -1.628  42.519 5.869   1.00 30.41 ? 257 ASP E CG  1 
ATOM   1904 O OD1 . ASP A 1 257 ? -1.099  43.515 6.389   1.00 31.78 ? 257 ASP E OD1 1 
ATOM   1905 O OD2 . ASP A 1 257 ? -1.528  42.230 4.658   1.00 22.29 ? 257 ASP E OD2 1 
ATOM   1906 N N   . ILE A 1 258 ? -3.493  38.632 7.413   1.00 16.35 ? 258 ILE E N   1 
ATOM   1907 C CA  . ILE A 1 258 ? -3.823  37.809 8.606   1.00 15.47 ? 258 ILE E CA  1 
ATOM   1908 C C   . ILE A 1 258 ? -2.759  38.128 9.652   1.00 22.47 ? 258 ILE E C   1 
ATOM   1909 O O   . ILE A 1 258 ? -1.556  38.156 9.373   1.00 15.31 ? 258 ILE E O   1 
ATOM   1910 C CB  . ILE A 1 258 ? -3.890  36.318 8.287   1.00 14.35 ? 258 ILE E CB  1 
ATOM   1911 C CG1 . ILE A 1 258 ? -5.096  36.107 7.346   1.00 18.37 ? 258 ILE E CG1 1 
ATOM   1912 C CG2 . ILE A 1 258 ? -4.029  35.466 9.564   1.00 9.64  ? 258 ILE E CG2 1 
ATOM   1913 C CD1 . ILE A 1 258 ? -5.148  34.713 6.732   1.00 16.10 ? 258 ILE E CD1 1 
ATOM   1914 N N   . VAL A 1 259 ? -3.240  38.523 10.821  1.00 17.62 ? 259 VAL E N   1 
ATOM   1915 C CA  . VAL A 1 259 ? -2.356  39.020 11.892  1.00 8.59  ? 259 VAL E CA  1 
ATOM   1916 C C   . VAL A 1 259 ? -2.236  37.981 13.009  1.00 12.68 ? 259 VAL E C   1 
ATOM   1917 O O   . VAL A 1 259 ? -3.213  37.503 13.578  1.00 14.45 ? 259 VAL E O   1 
ATOM   1918 C CB  . VAL A 1 259 ? -2.899  40.380 12.398  1.00 10.91 ? 259 VAL E CB  1 
ATOM   1919 C CG1 . VAL A 1 259 ? -2.028  40.958 13.509  1.00 14.90 ? 259 VAL E CG1 1 
ATOM   1920 C CG2 . VAL A 1 259 ? -2.994  41.422 11.280  1.00 16.35 ? 259 VAL E CG2 1 
ATOM   1921 N N   . PHE A 1 260 ? -0.991  37.579 13.249  1.00 9.87  ? 260 PHE E N   1 
ATOM   1922 C CA  . PHE A 1 260 ? -0.640  36.747 14.396  1.00 10.36 ? 260 PHE E CA  1 
ATOM   1923 C C   . PHE A 1 260 ? -0.154  37.694 15.500  1.00 11.76 ? 260 PHE E C   1 
ATOM   1924 O O   . PHE A 1 260 ? 0.791   38.432 15.288  1.00 20.03 ? 260 PHE E O   1 
ATOM   1925 C CB  . PHE A 1 260 ? 0.502   35.788 14.050  1.00 12.32 ? 260 PHE E CB  1 
ATOM   1926 C CG  . PHE A 1 260 ? 0.032   34.719 13.069  1.00 12.92 ? 260 PHE E CG  1 
ATOM   1927 C CD1 . PHE A 1 260 ? 0.016   34.982 11.677  1.00 14.34 ? 260 PHE E CD1 1 
ATOM   1928 C CD2 . PHE A 1 260 ? -0.381  33.466 13.572  1.00 5.09  ? 260 PHE E CD2 1 
ATOM   1929 C CE1 . PHE A 1 260 ? -0.418  33.981 10.792  1.00 12.94 ? 260 PHE E CE1 1 
ATOM   1930 C CE2 . PHE A 1 260 ? -0.800  32.463 12.682  1.00 16.11 ? 260 PHE E CE2 1 
ATOM   1931 C CZ  . PHE A 1 260 ? -0.819  32.722 11.294  1.00 13.69 ? 260 PHE E CZ  1 
ATOM   1932 N N   . THR A 1 261 ? -0.921  37.773 16.574  1.00 13.30 ? 261 THR E N   1 
ATOM   1933 C CA  . THR A 1 261 ? -0.499  38.560 17.767  1.00 8.98  ? 261 THR E CA  1 
ATOM   1934 C C   . THR A 1 261 ? 0.259   37.639 18.727  1.00 7.15  ? 261 THR E C   1 
ATOM   1935 O O   . THR A 1 261 ? -0.211  36.569 19.081  1.00 13.10 ? 261 THR E O   1 
ATOM   1936 C CB  . THR A 1 261 ? -1.700  39.207 18.461  1.00 14.18 ? 261 THR E CB  1 
ATOM   1937 O OG1 . THR A 1 261 ? -2.246  40.070 17.493  1.00 13.00 ? 261 THR E OG1 1 
ATOM   1938 C CG2 . THR A 1 261 ? -1.354  40.109 19.649  1.00 9.23  ? 261 THR E CG2 1 
ATOM   1939 N N   . ILE A 1 262 ? 1.496   38.018 19.010  1.00 5.06  ? 262 ILE E N   1 
ATOM   1940 C CA  . ILE A 1 262 ? 2.419   37.193 19.835  1.00 13.85 ? 262 ILE E CA  1 
ATOM   1941 C C   . ILE A 1 262 ? 3.058   38.109 20.875  1.00 17.29 ? 262 ILE E C   1 
ATOM   1942 O O   . ILE A 1 262 ? 3.619   39.147 20.518  1.00 19.59 ? 262 ILE E O   1 
ATOM   1943 C CB  . ILE A 1 262 ? 3.507   36.509 18.981  1.00 12.56 ? 262 ILE E CB  1 
ATOM   1944 C CG1 . ILE A 1 262 ? 2.910   35.606 17.880  1.00 14.97 ? 262 ILE E CG1 1 
ATOM   1945 C CG2 . ILE A 1 262 ? 4.408   35.671 19.891  1.00 16.68 ? 262 ILE E CG2 1 
ATOM   1946 C CD1 . ILE A 1 262 ? 3.910   35.292 16.760  1.00 13.53 ? 262 ILE E CD1 1 
ATOM   1947 N N   . ASN A 1 263 ? 2.697   37.848 22.140  1.00 17.94 ? 263 ASN E N   1 
ATOM   1948 C CA  . ASN A 1 263 ? 3.128   38.614 23.344  1.00 18.06 ? 263 ASN E CA  1 
ATOM   1949 C C   . ASN A 1 263 ? 2.713   40.100 23.265  1.00 19.33 ? 263 ASN E C   1 
ATOM   1950 O O   . ASN A 1 263 ? 3.513   41.019 23.352  1.00 17.83 ? 263 ASN E O   1 
ATOM   1951 C CB  . ASN A 1 263 ? 4.636   38.439 23.559  1.00 25.09 ? 263 ASN E CB  1 
ATOM   1952 C CG  . ASN A 1 263 ? 5.105   38.757 24.991  1.00 18.75 ? 263 ASN E CG  1 
ATOM   1953 O OD1 . ASN A 1 263 ? 4.386   38.580 25.969  1.00 48.72 ? 263 ASN E OD1 1 
ATOM   1954 N ND2 . ASN A 1 263 ? 6.339   39.127 25.094  1.00 16.93 ? 263 ASN E ND2 1 
ATOM   1955 N N   . GLY A 1 264 ? 1.483   40.255 22.781  1.00 10.21 ? 264 GLY E N   1 
ATOM   1956 C CA  . GLY A 1 264 ? 0.832   41.573 22.602  1.00 12.05 ? 264 GLY E CA  1 
ATOM   1957 C C   . GLY A 1 264 ? 1.444   42.442 21.512  1.00 19.39 ? 264 GLY E C   1 
ATOM   1958 O O   . GLY A 1 264 ? 1.122   43.630 21.465  1.00 22.03 ? 264 GLY E O   1 
ATOM   1959 N N   . VAL A 1 265 ? 2.227   41.838 20.606  1.00 20.88 ? 265 VAL E N   1 
ATOM   1960 C CA  . VAL A 1 265 ? 2.769   42.485 19.394  1.00 13.72 ? 265 VAL E CA  1 
ATOM   1961 C C   . VAL A 1 265 ? 2.150   41.810 18.141  1.00 15.29 ? 265 VAL E C   1 
ATOM   1962 O O   . VAL A 1 265 ? 2.034   40.592 18.055  1.00 21.92 ? 265 VAL E O   1 
ATOM   1963 C CB  . VAL A 1 265 ? 4.311   42.423 19.332  1.00 5.59  ? 265 VAL E CB  1 
ATOM   1964 C CG1 . VAL A 1 265 ? 4.867   43.084 18.054  1.00 7.07  ? 265 VAL E CG1 1 
ATOM   1965 C CG2 . VAL A 1 265 ? 4.946   43.078 20.552  1.00 15.52 ? 265 VAL E CG2 1 
ATOM   1966 N N   . GLN A 1 266 ? 1.723   42.644 17.200  1.00 19.20 ? 266 GLN E N   1 
ATOM   1967 C CA  . GLN A 1 266 ? 1.136   42.260 15.901  1.00 12.17 ? 266 GLN E CA  1 
ATOM   1968 C C   . GLN A 1 266 ? 2.193   41.896 14.853  1.00 9.71  ? 266 GLN E C   1 
ATOM   1969 O O   . GLN A 1 266 ? 3.148   42.635 14.631  1.00 10.80 ? 266 GLN E O   1 
ATOM   1970 C CB  . GLN A 1 266 ? 0.270   43.373 15.342  1.00 10.32 ? 266 GLN E CB  1 
ATOM   1971 C CG  . GLN A 1 266 ? -0.982  43.521 16.200  1.00 6.30  ? 266 GLN E CG  1 
ATOM   1972 C CD  . GLN A 1 266 ? -1.936  44.533 15.603  1.00 22.37 ? 266 GLN E CD  1 
ATOM   1973 O OE1 . GLN A 1 266 ? -2.364  44.448 14.438  1.00 35.73 ? 266 GLN E OE1 1 
ATOM   1974 N NE2 . GLN A 1 266 ? -2.355  45.484 16.379  1.00 18.44 ? 266 GLN E NE2 1 
ATOM   1975 N N   . TYR A 1 267 ? 2.021   40.695 14.278  1.00 10.04 ? 267 TYR E N   1 
ATOM   1976 C CA  . TYR A 1 267 ? 2.872   40.158 13.198  1.00 16.96 ? 267 TYR E CA  1 
ATOM   1977 C C   . TYR A 1 267 ? 1.996   39.850 11.972  1.00 13.53 ? 267 TYR E C   1 
ATOM   1978 O O   . TYR A 1 267 ? 1.413   38.765 11.915  1.00 12.66 ? 267 TYR E O   1 
ATOM   1979 C CB  . TYR A 1 267 ? 3.580   38.857 13.613  1.00 6.67  ? 267 TYR E CB  1 
ATOM   1980 C CG  . TYR A 1 267 ? 4.588   39.112 14.718  1.00 6.15  ? 267 TYR E CG  1 
ATOM   1981 C CD1 . TYR A 1 267 ? 4.166   39.011 16.062  1.00 12.55 ? 267 TYR E CD1 1 
ATOM   1982 C CD2 . TYR A 1 267 ? 5.888   39.539 14.380  1.00 10.73 ? 267 TYR E CD2 1 
ATOM   1983 C CE1 . TYR A 1 267 ? 5.076   39.360 17.081  1.00 7.72  ? 267 TYR E CE1 1 
ATOM   1984 C CE2 . TYR A 1 267 ? 6.794   39.884 15.390  1.00 21.70 ? 267 TYR E CE2 1 
ATOM   1985 C CZ  . TYR A 1 267 ? 6.373   39.790 16.736  1.00 8.88  ? 267 TYR E CZ  1 
ATOM   1986 O OH  . TYR A 1 267 ? 7.233   40.172 17.710  1.00 16.53 ? 267 TYR E OH  1 
ATOM   1987 N N   . PRO A 1 268 ? 1.738   40.853 11.122  1.00 15.88 ? 268 PRO E N   1 
ATOM   1988 C CA  . PRO A 1 268 ? 0.928   40.651 9.905   1.00 19.06 ? 268 PRO E CA  1 
ATOM   1989 C C   . PRO A 1 268 ? 1.636   39.756 8.883   1.00 24.89 ? 268 PRO E C   1 
ATOM   1990 O O   . PRO A 1 268 ? 2.835   39.829 8.671   1.00 20.45 ? 268 PRO E O   1 
ATOM   1991 C CB  . PRO A 1 268 ? 0.707   42.063 9.363   1.00 9.69  ? 268 PRO E CB  1 
ATOM   1992 C CG  . PRO A 1 268 ? 1.922   42.837 9.840   1.00 16.39 ? 268 PRO E CG  1 
ATOM   1993 C CD  . PRO A 1 268 ? 2.173   42.252 11.230  1.00 18.32 ? 268 PRO E CD  1 
ATOM   1994 N N   . VAL A 1 269 ? 0.837   38.863 8.290   1.00 12.08 ? 269 VAL E N   1 
ATOM   1995 C CA  . VAL A 1 269 ? 1.275   38.044 7.144   1.00 11.77 ? 269 VAL E CA  1 
ATOM   1996 C C   . VAL A 1 269 ? 0.407   38.500 5.949   1.00 14.81 ? 269 VAL E C   1 
ATOM   1997 O O   . VAL A 1 269 ? -0.811  38.342 5.988   1.00 15.57 ? 269 VAL E O   1 
ATOM   1998 C CB  . VAL A 1 269 ? 1.191   36.533 7.410   1.00 8.11  ? 269 VAL E CB  1 
ATOM   1999 C CG1 . VAL A 1 269 ? 1.733   35.731 6.222   1.00 14.57 ? 269 VAL E CG1 1 
ATOM   2000 C CG2 . VAL A 1 269 ? 2.075   36.171 8.607   1.00 19.05 ? 269 VAL E CG2 1 
ATOM   2001 N N   . PRO A 1 270 ? 1.041   39.170 4.977   1.00 15.43 ? 270 PRO E N   1 
ATOM   2002 C CA  . PRO A 1 270 ? 0.332   39.684 3.777   1.00 17.34 ? 270 PRO E CA  1 
ATOM   2003 C C   . PRO A 1 270 ? -0.148  38.564 2.839   1.00 22.14 ? 270 PRO E C   1 
ATOM   2004 O O   . PRO A 1 270 ? 0.446   37.472 2.858   1.00 19.28 ? 270 PRO E O   1 
ATOM   2005 C CB  . PRO A 1 270 ? 1.370   40.617 3.150   1.00 15.38 ? 270 PRO E CB  1 
ATOM   2006 C CG  . PRO A 1 270 ? 2.702   39.955 3.474   1.00 29.92 ? 270 PRO E CG  1 
ATOM   2007 C CD  . PRO A 1 270 ? 2.488   39.435 4.895   1.00 8.44  ? 270 PRO E CD  1 
ATOM   2008 N N   . PRO A 1 271 ? -1.189  38.773 2.013   1.00 22.31 ? 271 PRO E N   1 
ATOM   2009 C CA  . PRO A 1 271 ? -1.647  37.749 1.038   1.00 14.94 ? 271 PRO E CA  1 
ATOM   2010 C C   . PRO A 1 271 ? -0.623  37.337 -0.008  1.00 12.97 ? 271 PRO E C   1 
ATOM   2011 O O   . PRO A 1 271 ? -0.585  36.162 -0.370  1.00 18.73 ? 271 PRO E O   1 
ATOM   2012 C CB  . PRO A 1 271 ? -2.972  38.257 0.473   1.00 11.68 ? 271 PRO E CB  1 
ATOM   2013 C CG  . PRO A 1 271 ? -2.862  39.763 0.662   1.00 12.37 ? 271 PRO E CG  1 
ATOM   2014 C CD  . PRO A 1 271 ? -2.060  39.960 1.957   1.00 11.69 ? 271 PRO E CD  1 
ATOM   2015 N N   . SER A 1 272 ? 0.383   38.186 -0.271  1.00 11.45 ? 272 SER E N   1 
ATOM   2016 C CA  . SER A 1 272 ? 1.523   37.823 -1.124  1.00 18.76 ? 272 SER E CA  1 
ATOM   2017 C C   . SER A 1 272 ? 2.475   36.800 -0.493  1.00 30.18 ? 272 SER E C   1 
ATOM   2018 O O   . SER A 1 272 ? 3.374   36.270 -1.171  1.00 29.90 ? 272 SER E O   1 
ATOM   2019 C CB  . SER A 1 272 ? 2.291   39.097 -1.512  1.00 20.69 ? 272 SER E CB  1 
ATOM   2020 O OG  . SER A 1 272 ? 2.781   39.719 -0.327  1.00 34.04 ? 272 SER E OG  1 
ATOM   2021 N N   . ALA A 1 273 ? 2.339   36.575 0.814   1.00 18.19 ? 273 ALA E N   1 
ATOM   2022 C CA  . ALA A 1 273 ? 3.069   35.541 1.579   1.00 9.64  ? 273 ALA E CA  1 
ATOM   2023 C C   . ALA A 1 273 ? 2.216   34.312 1.895   1.00 11.11 ? 273 ALA E C   1 
ATOM   2024 O O   . ALA A 1 273 ? 2.630   33.182 1.699   1.00 19.17 ? 273 ALA E O   1 
ATOM   2025 C CB  . ALA A 1 273 ? 3.621   36.139 2.871   1.00 15.42 ? 273 ALA E CB  1 
ATOM   2026 N N   . TYR A 1 274 ? 0.948   34.515 2.288   1.00 9.76  ? 274 TYR E N   1 
ATOM   2027 C CA  . TYR A 1 274 ? 0.121   33.376 2.661   1.00 13.66 ? 274 TYR E CA  1 
ATOM   2028 C C   . TYR A 1 274 ? -0.594  32.666 1.497   1.00 30.24 ? 274 TYR E C   1 
ATOM   2029 O O   . TYR A 1 274 ? -1.274  31.659 1.692   1.00 20.21 ? 274 TYR E O   1 
ATOM   2030 C CB  . TYR A 1 274 ? -0.801  33.669 3.874   1.00 12.29 ? 274 TYR E CB  1 
ATOM   2031 C CG  . TYR A 1 274 ? -1.971  34.638 3.642   1.00 9.05  ? 274 TYR E CG  1 
ATOM   2032 C CD1 . TYR A 1 274 ? -3.105  34.164 2.963   1.00 12.86 ? 274 TYR E CD1 1 
ATOM   2033 C CD2 . TYR A 1 274 ? -1.940  35.895 4.261   1.00 12.92 ? 274 TYR E CD2 1 
ATOM   2034 C CE1 . TYR A 1 274 ? -4.260  34.977 2.891   1.00 9.97  ? 274 TYR E CE1 1 
ATOM   2035 C CE2 . TYR A 1 274 ? -3.084  36.718 4.195   1.00 9.31  ? 274 TYR E CE2 1 
ATOM   2036 C CZ  . TYR A 1 274 ? -4.211  36.228 3.505   1.00 8.70  ? 274 TYR E CZ  1 
ATOM   2037 O OH  . TYR A 1 274 ? -5.314  37.021 3.384   1.00 15.54 ? 274 TYR E OH  1 
ATOM   2038 N N   . ILE A 1 275 ? -0.588  33.311 0.319   1.00 27.84 ? 275 ILE E N   1 
ATOM   2039 C CA  . ILE A 1 275 ? -0.998  32.705 -0.968  1.00 21.98 ? 275 ILE E CA  1 
ATOM   2040 C C   . ILE A 1 275 ? 0.292   32.485 -1.788  1.00 15.76 ? 275 ILE E C   1 
ATOM   2041 O O   . ILE A 1 275 ? 1.034   33.411 -2.110  1.00 23.16 ? 275 ILE E O   1 
ATOM   2042 C CB  . ILE A 1 275 ? -2.005  33.536 -1.791  1.00 20.10 ? 275 ILE E CB  1 
ATOM   2043 C CG1 . ILE A 1 275 ? -3.287  33.911 -1.027  1.00 15.63 ? 275 ILE E CG1 1 
ATOM   2044 C CG2 . ILE A 1 275 ? -2.344  32.870 -3.134  1.00 25.95 ? 275 ILE E CG2 1 
ATOM   2045 C CD1 . ILE A 1 275 ? -4.123  32.739 -0.511  1.00 22.11 ? 275 ILE E CD1 1 
ATOM   2046 N N   . LEU A 1 276 ? 0.509   31.203 -2.047  1.00 17.49 ? 276 LEU E N   1 
ATOM   2047 C CA  . LEU A 1 276 ? 1.713   30.712 -2.732  1.00 18.97 ? 276 LEU E CA  1 
ATOM   2048 C C   . LEU A 1 276 ? 1.420   30.477 -4.230  1.00 42.46 ? 276 LEU E C   1 
ATOM   2049 O O   . LEU A 1 276 ? 0.365   30.000 -4.620  1.00 20.78 ? 276 LEU E O   1 
ATOM   2050 C CB  . LEU A 1 276 ? 2.158   29.371 -2.141  1.00 36.03 ? 276 LEU E CB  1 
ATOM   2051 C CG  . LEU A 1 276 ? 2.498   29.361 -0.658  1.00 25.78 ? 276 LEU E CG  1 
ATOM   2052 C CD1 . LEU A 1 276 ? 2.884   27.920 -0.359  1.00 38.04 ? 276 LEU E CD1 1 
ATOM   2053 C CD2 . LEU A 1 276 ? 3.679   30.271 -0.319  1.00 45.18 ? 276 LEU E CD2 1 
ATOM   2054 N N   . GLN A 1 277 ? 2.418   30.833 -5.038  1.00 37.24 ? 277 GLN E N   1 
ATOM   2055 C CA  . GLN A 1 277 ? 2.479   30.546 -6.490  1.00 36.29 ? 277 GLN E CA  1 
ATOM   2056 C C   . GLN A 1 277 ? 3.317   29.311 -6.713  1.00 24.70 ? 277 GLN E C   1 
ATOM   2057 O O   . GLN A 1 277 ? 4.515   29.252 -6.364  1.00 51.06 ? 277 GLN E O   1 
ATOM   2058 C CB  . GLN A 1 277 ? 3.074   31.731 -7.280  1.00 40.48 ? 277 GLN E CB  1 
ATOM   2059 C CG  . GLN A 1 277 ? 2.126   32.932 -7.312  1.00 99.99 ? 277 GLN E CG  1 
ATOM   2060 C CD  . GLN A 1 277 ? 2.819   34.256 -7.667  1.00 99.99 ? 277 GLN E CD  1 
ATOM   2061 O OE1 . GLN A 1 277 ? 4.015   34.466 -7.461  1.00 99.99 ? 277 GLN E OE1 1 
ATOM   2062 N NE2 . GLN A 1 277 ? 2.042   35.205 -8.135  1.00 99.99 ? 277 GLN E NE2 1 
ATOM   2063 N N   . SER A 1 278 ? 2.591   28.226 -6.974  1.00 29.74 ? 278 SER E N   1 
ATOM   2064 C CA  . SER A 1 278 ? 3.184   26.927 -7.261  1.00 73.81 ? 278 SER E CA  1 
ATOM   2065 C C   . SER A 1 278 ? 2.548   26.318 -8.506  1.00 99.99 ? 278 SER E C   1 
ATOM   2066 O O   . SER A 1 278 ? 1.329   26.290 -8.641  1.00 36.23 ? 278 SER E O   1 
ATOM   2067 C CB  . SER A 1 278 ? 3.068   25.942 -6.090  1.00 48.12 ? 278 SER E CB  1 
ATOM   2068 O OG  . SER A 1 278 ? 3.871   24.783 -6.352  1.00 74.42 ? 278 SER E OG  1 
ATOM   2069 N N   . GLU A 1 279 ? 3.399   26.292 -9.532  1.00 66.10 ? 279 GLU E N   1 
ATOM   2070 C CA  . GLU A 1 279 ? 3.195   25.553 -10.790 1.00 99.99 ? 279 GLU E CA  1 
ATOM   2071 C C   . GLU A 1 279 ? 1.955   25.963 -11.615 1.00 74.26 ? 279 GLU E C   1 
ATOM   2072 O O   . GLU A 1 279 ? 1.171   25.164 -12.149 1.00 40.87 ? 279 GLU E O   1 
ATOM   2073 C CB  . GLU A 1 279 ? 3.324   24.038 -10.518 1.00 78.63 ? 279 GLU E CB  1 
ATOM   2074 C CG  . GLU A 1 279 ? 4.734   23.752 -9.977  1.00 99.99 ? 279 GLU E CG  1 
ATOM   2075 C CD  . GLU A 1 279 ? 5.076   22.310 -9.574  1.00 99.99 ? 279 GLU E CD  1 
ATOM   2076 O OE1 . GLU A 1 279 ? 4.126   21.478 -9.473  1.00 99.99 ? 279 GLU E OE1 1 
ATOM   2077 O OE2 . GLU A 1 279 ? 6.277   22.070 -9.366  1.00 99.99 ? 279 GLU E OE2 1 
ATOM   2078 N N   . GLY A 1 280 ? 1.800   27.283 -11.696 1.00 43.61 ? 280 GLY E N   1 
ATOM   2079 C CA  . GLY A 1 280 ? 0.852   27.977 -12.578 1.00 26.73 ? 280 GLY E CA  1 
ATOM   2080 C C   . GLY A 1 280 ? -0.422  28.528 -11.917 1.00 80.37 ? 280 GLY E C   1 
ATOM   2081 O O   . GLY A 1 280 ? -1.032  29.490 -12.372 1.00 86.81 ? 280 GLY E O   1 
ATOM   2082 N N   . SER A 1 281 ? -0.834  27.781 -10.904 1.00 99.99 ? 281 SER E N   1 
ATOM   2083 C CA  . SER A 1 281 ? -1.931  28.164 -10.009 1.00 69.03 ? 281 SER E CA  1 
ATOM   2084 C C   . SER A 1 281 ? -1.390  28.714 -8.681  1.00 95.65 ? 281 SER E C   1 
ATOM   2085 O O   . SER A 1 281 ? -0.197  28.808 -8.416  1.00 25.05 ? 281 SER E O   1 
ATOM   2086 C CB  . SER A 1 281 ? -2.854  26.956 -9.795  1.00 43.30 ? 281 SER E CB  1 
ATOM   2087 O OG  . SER A 1 281 ? -2.076  25.821 -9.399  1.00 62.30 ? 281 SER E OG  1 
ATOM   2088 N N   . CYS A 1 282 ? -2.347  29.361 -8.004  1.00 28.00 ? 282 CYS E N   1 
ATOM   2089 C CA  . CYS A 1 282 ? -2.152  29.858 -6.627  1.00 57.70 ? 282 CYS E CA  1 
ATOM   2090 C C   . CYS A 1 282 ? -2.861  28.991 -5.557  1.00 37.73 ? 282 CYS E C   1 
ATOM   2091 O O   . CYS A 1 282 ? -3.981  28.543 -5.690  1.00 32.27 ? 282 CYS E O   1 
ATOM   2092 C CB  . CYS A 1 282 ? -2.587  31.318 -6.517  1.00 16.22 ? 282 CYS E CB  1 
ATOM   2093 S SG  . CYS A 1 282 ? -1.504  32.425 -7.491  1.00 34.66 ? 282 CYS E SG  1 
ATOM   2094 N N   . ILE A 1 283 ? -2.045  28.652 -4.546  1.00 21.88 ? 283 ILE E N   1 
ATOM   2095 C CA  . ILE A 1 283 ? -2.466  27.759 -3.433  1.00 19.44 ? 283 ILE E CA  1 
ATOM   2096 C C   . ILE A 1 283 ? -2.437  28.467 -2.078  1.00 15.29 ? 283 ILE E C   1 
ATOM   2097 O O   . ILE A 1 283 ? -1.658  29.413 -1.851  1.00 19.90 ? 283 ILE E O   1 
ATOM   2098 C CB  . ILE A 1 283 ? -1.639  26.441 -3.353  1.00 14.36 ? 283 ILE E CB  1 
ATOM   2099 C CG1 . ILE A 1 283 ? -0.131  26.689 -3.229  1.00 24.14 ? 283 ILE E CG1 1 
ATOM   2100 C CG2 . ILE A 1 283 ? -1.994  25.530 -4.540  1.00 35.48 ? 283 ILE E CG2 1 
ATOM   2101 C CD1 . ILE A 1 283 ? 0.659   25.524 -2.601  1.00 43.97 ? 283 ILE E CD1 1 
ATOM   2102 N N   . SER A 1 284 ? -3.333  28.033 -1.190  1.00 20.26 ? 284 SER E N   1 
ATOM   2103 C CA  . SER A 1 284 ? -3.321  28.439 0.225   1.00 13.20 ? 284 SER E CA  1 
ATOM   2104 C C   . SER A 1 284 ? -2.044  27.975 0.951   1.00 14.48 ? 284 SER E C   1 
ATOM   2105 O O   . SER A 1 284 ? -1.554  26.867 0.744   1.00 17.43 ? 284 SER E O   1 
ATOM   2106 C CB  . SER A 1 284 ? -4.539  27.836 0.930   1.00 20.50 ? 284 SER E CB  1 
ATOM   2107 O OG  . SER A 1 284 ? -4.522  28.221 2.302   1.00 17.16 ? 284 SER E OG  1 
ATOM   2108 N N   . GLY A 1 285 ? -1.436  28.910 1.701   1.00 14.27 ? 285 GLY E N   1 
ATOM   2109 C CA  . GLY A 1 285 ? -0.298  28.653 2.619   1.00 21.66 ? 285 GLY E CA  1 
ATOM   2110 C C   . GLY A 1 285 ? -0.676  28.063 3.983   1.00 12.73 ? 285 GLY E C   1 
ATOM   2111 O O   . GLY A 1 285 ? 0.166   27.893 4.865   1.00 22.04 ? 285 GLY E O   1 
ATOM   2112 N N   . PHE A 1 286 ? -1.970  27.747 4.138   1.00 12.45 ? 286 PHE E N   1 
ATOM   2113 C CA  . PHE A 1 286 ? -2.556  27.103 5.318   1.00 11.98 ? 286 PHE E CA  1 
ATOM   2114 C C   . PHE A 1 286 ? -2.842  25.646 5.035   1.00 15.70 ? 286 PHE E C   1 
ATOM   2115 O O   . PHE A 1 286 ? -3.459  25.274 4.024   1.00 18.99 ? 286 PHE E O   1 
ATOM   2116 C CB  . PHE A 1 286 ? -3.862  27.798 5.737   1.00 10.54 ? 286 PHE E CB  1 
ATOM   2117 C CG  . PHE A 1 286 ? -3.569  29.181 6.339   1.00 13.62 ? 286 PHE E CG  1 
ATOM   2118 C CD1 . PHE A 1 286 ? -3.512  30.305 5.514   1.00 13.22 ? 286 PHE E CD1 1 
ATOM   2119 C CD2 . PHE A 1 286 ? -3.363  29.290 7.742   1.00 14.09 ? 286 PHE E CD2 1 
ATOM   2120 C CE1 . PHE A 1 286 ? -3.239  31.573 6.076   1.00 13.62 ? 286 PHE E CE1 1 
ATOM   2121 C CE2 . PHE A 1 286 ? -3.114  30.562 8.309   1.00 22.60 ? 286 PHE E CE2 1 
ATOM   2122 C CZ  . PHE A 1 286 ? -3.048  31.681 7.469   1.00 21.16 ? 286 PHE E CZ  1 
ATOM   2123 N N   . GLN A 1 287 ? -2.423  24.829 5.971   1.00 15.39 ? 287 GLN E N   1 
ATOM   2124 C CA  . GLN A 1 287 ? -2.580  23.352 5.905   1.00 19.32 ? 287 GLN E CA  1 
ATOM   2125 C C   . GLN A 1 287 ? -3.188  22.843 7.209   1.00 24.00 ? 287 GLN E C   1 
ATOM   2126 O O   . GLN A 1 287 ? -2.837  23.257 8.315   1.00 14.62 ? 287 GLN E O   1 
ATOM   2127 C CB  . GLN A 1 287 ? -1.180  22.801 5.652   1.00 18.09 ? 287 GLN E CB  1 
ATOM   2128 C CG  . GLN A 1 287 ? -1.048  21.282 5.537   1.00 24.74 ? 287 GLN E CG  1 
ATOM   2129 C CD  . GLN A 1 287 ? 0.444   20.911 5.362   1.00 49.79 ? 287 GLN E CD  1 
ATOM   2130 O OE1 . GLN A 1 287 ? 1.378   21.625 5.691   1.00 35.82 ? 287 GLN E OE1 1 
ATOM   2131 N NE2 . GLN A 1 287 ? 0.656   19.753 4.812   1.00 55.00 ? 287 GLN E NE2 1 
ATOM   2132 N N   . GLY A 1 288 ? -4.188  21.972 7.055   1.00 14.31 ? 288 GLY E N   1 
ATOM   2133 C CA  . GLY A 1 288 ? -4.885  21.350 8.172   1.00 15.85 ? 288 GLY E CA  1 
ATOM   2134 C C   . GLY A 1 288 ? -4.166  20.082 8.620   1.00 33.42 ? 288 GLY E C   1 
ATOM   2135 O O   . GLY A 1 288 ? -3.932  19.184 7.794   1.00 35.22 ? 288 GLY E O   1 
ATOM   2136 N N   . MET A 1 289 ? -3.662  20.124 9.833   1.00 28.14 ? 289 MET E N   1 
ATOM   2137 C CA  . MET A 1 289 ? -3.071  18.945 10.521  1.00 35.96 ? 289 MET E CA  1 
ATOM   2138 C C   . MET A 1 289 ? -3.262  18.981 12.037  1.00 33.74 ? 289 MET E C   1 
ATOM   2139 O O   . MET A 1 289 ? -2.960  19.953 12.714  1.00 44.21 ? 289 MET E O   1 
ATOM   2140 C CB  . MET A 1 289 ? -1.572  18.792 10.249  1.00 28.53 ? 289 MET E CB  1 
ATOM   2141 C CG  . MET A 1 289 ? -1.209  18.118 8.930   1.00 99.99 ? 289 MET E CG  1 
ATOM   2142 S SD  . MET A 1 289 ? 0.523   17.537 8.973   1.00 55.50 ? 289 MET E SD  1 
ATOM   2143 C CE  . MET A 1 289 ? 0.357   16.003 9.860   1.00 42.86 ? 289 MET E CE  1 
ATOM   2144 N N   . ASN A 1 290 ? -3.748  17.849 12.570  1.00 25.97 ? 290 ASN E N   1 
ATOM   2145 C CA  . ASN A 1 290 ? -3.872  17.616 14.010  1.00 99.99 ? 290 ASN E CA  1 
ATOM   2146 C C   . ASN A 1 290 ? -2.605  16.955 14.561  1.00 40.08 ? 290 ASN E C   1 
ATOM   2147 O O   . ASN A 1 290 ? -2.158  15.909 14.115  1.00 99.99 ? 290 ASN E O   1 
ATOM   2148 C CB  . ASN A 1 290 ? -5.098  16.750 14.348  1.00 28.85 ? 290 ASN E CB  1 
ATOM   2149 C CG  . ASN A 1 290 ? -6.464  17.359 13.999  1.00 99.99 ? 290 ASN E CG  1 
ATOM   2150 O OD1 . ASN A 1 290 ? -6.659  18.570 13.913  1.00 34.21 ? 290 ASN E OD1 1 
ATOM   2151 N ND2 . ASN A 1 290 ? -7.439  16.527 13.765  1.00 99.99 ? 290 ASN E ND2 1 
ATOM   2152 N N   . LEU A 1 291 ? -1.923  17.749 15.410  1.00 99.99 ? 291 LEU E N   1 
ATOM   2153 C CA  . LEU A 1 291 ? -0.700  17.429 16.132  1.00 95.06 ? 291 LEU E CA  1 
ATOM   2154 C C   . LEU A 1 291 ? -1.024  17.556 17.642  1.00 99.99 ? 291 LEU E C   1 
ATOM   2155 O O   . LEU A 1 291 ? -1.020  18.678 18.172  1.00 38.05 ? 291 LEU E O   1 
ATOM   2156 C CB  . LEU A 1 291 ? 0.400   18.446 15.803  1.00 46.00 ? 291 LEU E CB  1 
ATOM   2157 C CG  . LEU A 1 291 ? 1.078   18.305 14.440  1.00 60.75 ? 291 LEU E CG  1 
ATOM   2158 C CD1 . LEU A 1 291 ? 0.172   18.601 13.249  1.00 99.99 ? 291 LEU E CD1 1 
ATOM   2159 C CD2 . LEU A 1 291 ? 2.170   19.361 14.402  1.00 99.99 ? 291 LEU E CD2 1 
ATOM   2160 N N   . PRO A 1 292 ? -1.512  16.482 18.246  1.00 99.99 ? 292 PRO E N   1 
ATOM   2161 C CA  . PRO A 1 292 ? -1.941  16.517 19.668  1.00 99.99 ? 292 PRO E CA  1 
ATOM   2162 C C   . PRO A 1 292 ? -0.754  16.395 20.619  1.00 99.99 ? 292 PRO E C   1 
ATOM   2163 O O   . PRO A 1 292 ? 0.241   15.707 20.349  1.00 99.99 ? 292 PRO E O   1 
ATOM   2164 C CB  . PRO A 1 292 ? -2.941  15.370 19.801  1.00 99.99 ? 292 PRO E CB  1 
ATOM   2165 C CG  . PRO A 1 292 ? -2.478  14.342 18.764  1.00 99.99 ? 292 PRO E CG  1 
ATOM   2166 C CD  . PRO A 1 292 ? -1.863  15.177 17.638  1.00 99.99 ? 292 PRO E CD  1 
ATOM   2167 N N   . THR A 1 293 ? -0.767  17.351 21.538  1.00 99.99 ? 293 THR E N   1 
ATOM   2168 C CA  . THR A 1 293 ? 0.093   17.338 22.746  1.00 99.99 ? 293 THR E CA  1 
ATOM   2169 C C   . THR A 1 293 ? -0.728  17.738 23.977  1.00 99.99 ? 293 THR E C   1 
ATOM   2170 O O   . THR A 1 293 ? -1.893  18.163 23.892  1.00 99.99 ? 293 THR E O   1 
ATOM   2171 C CB  . THR A 1 293 ? 1.357   18.233 22.671  1.00 99.99 ? 293 THR E CB  1 
ATOM   2172 O OG1 . THR A 1 293 ? 1.030   19.603 22.963  1.00 94.62 ? 293 THR E OG1 1 
ATOM   2173 C CG2 . THR A 1 293 ? 2.171   18.063 21.382  1.00 69.26 ? 293 THR E CG2 1 
ATOM   2174 N N   . GLU A 1 294 ? -0.039  17.699 25.106  1.00 99.99 ? 294 GLU E N   1 
ATOM   2175 C CA  . GLU A 1 294 ? -0.536  18.059 26.462  1.00 99.99 ? 294 GLU E CA  1 
ATOM   2176 C C   . GLU A 1 294 ? -0.713  19.546 26.790  1.00 99.99 ? 294 GLU E C   1 
ATOM   2177 O O   . GLU A 1 294 ? -1.125  19.911 27.899  1.00 99.99 ? 294 GLU E O   1 
ATOM   2178 C CB  . GLU A 1 294 ? 0.327   17.327 27.513  1.00 99.99 ? 294 GLU E CB  1 
ATOM   2179 C CG  . GLU A 1 294 ? 1.840   17.521 27.323  1.00 99.99 ? 294 GLU E CG  1 
ATOM   2180 C CD  . GLU A 1 294 ? 2.711   16.662 28.253  1.00 99.99 ? 294 GLU E CD  1 
ATOM   2181 O OE1 . GLU A 1 294 ? 2.245   15.580 28.680  1.00 99.99 ? 294 GLU E OE1 1 
ATOM   2182 O OE2 . GLU A 1 294 ? 3.881   17.072 28.430  1.00 99.99 ? 294 GLU E OE2 1 
ATOM   2183 N N   . SER A 1 295 ? -0.372  20.437 25.832  1.00 99.99 ? 295 SER E N   1 
ATOM   2184 C CA  . SER A 1 295 ? -0.639  21.894 25.948  1.00 99.99 ? 295 SER E CA  1 
ATOM   2185 C C   . SER A 1 295 ? -1.813  22.345 25.079  1.00 99.99 ? 295 SER E C   1 
ATOM   2186 O O   . SER A 1 295 ? -2.374  23.452 25.240  1.00 99.99 ? 295 SER E O   1 
ATOM   2187 C CB  . SER A 1 295 ? 0.588   22.764 25.628  1.00 99.99 ? 295 SER E CB  1 
ATOM   2188 O OG  . SER A 1 295 ? 1.765   21.995 25.361  1.00 58.22 ? 295 SER E OG  1 
ATOM   2189 N N   . GLY A 1 296 ? -2.120  21.501 24.110  1.00 99.99 ? 296 GLY E N   1 
ATOM   2190 C CA  . GLY A 1 296 ? -3.258  21.580 23.175  1.00 99.99 ? 296 GLY E CA  1 
ATOM   2191 C C   . GLY A 1 296 ? -2.852  20.958 21.850  1.00 99.99 ? 296 GLY E C   1 
ATOM   2192 O O   . GLY A 1 296 ? -1.904  20.177 21.739  1.00 99.99 ? 296 GLY E O   1 
ATOM   2193 N N   . GLU A 1 297 ? -3.668  21.245 20.818  1.00 99.99 ? 297 GLU E N   1 
ATOM   2194 C CA  . GLU A 1 297 ? -3.265  20.988 19.442  1.00 99.99 ? 297 GLU E CA  1 
ATOM   2195 C C   . GLU A 1 297 ? -2.448  22.169 18.913  1.00 49.68 ? 297 GLU E C   1 
ATOM   2196 O O   . GLU A 1 297 ? -2.796  23.332 19.162  1.00 30.94 ? 297 GLU E O   1 
ATOM   2197 C CB  . GLU A 1 297 ? -4.485  20.729 18.562  1.00 42.30 ? 297 GLU E CB  1 
ATOM   2198 C CG  . GLU A 1 297 ? -5.089  19.340 18.773  1.00 95.09 ? 297 GLU E CG  1 
ATOM   2199 C CD  . GLU A 1 297 ? -6.436  19.225 18.066  1.00 99.99 ? 297 GLU E CD  1 
ATOM   2200 O OE1 . GLU A 1 297 ? -6.645  18.186 17.416  1.00 99.99 ? 297 GLU E OE1 1 
ATOM   2201 O OE2 . GLU A 1 297 ? -7.266  20.170 18.226  1.00 99.99 ? 297 GLU E OE2 1 
ATOM   2202 N N   . LEU A 1 298 ? -1.242  21.815 18.462  1.00 24.80 ? 298 LEU E N   1 
ATOM   2203 C CA  . LEU A 1 298 ? -0.226  22.766 17.998  1.00 12.60 ? 298 LEU E CA  1 
ATOM   2204 C C   . LEU A 1 298 ? -0.554  23.337 16.633  1.00 14.98 ? 298 LEU E C   1 
ATOM   2205 O O   . LEU A 1 298 ? -1.059  22.684 15.726  1.00 20.41 ? 298 LEU E O   1 
ATOM   2206 C CB  . LEU A 1 298 ? 1.173   22.125 17.917  1.00 14.90 ? 298 LEU E CB  1 
ATOM   2207 C CG  . LEU A 1 298 ? 1.732   21.649 19.249  1.00 27.62 ? 298 LEU E CG  1 
ATOM   2208 C CD1 . LEU A 1 298 ? 3.079   20.972 18.984  1.00 28.91 ? 298 LEU E CD1 1 
ATOM   2209 C CD2 . LEU A 1 298 ? 1.923   22.799 20.239  1.00 19.40 ? 298 LEU E CD2 1 
ATOM   2210 N N   . TRP A 1 299 ? -0.242  24.643 16.561  1.00 13.67 ? 299 TRP E N   1 
ATOM   2211 C CA  . TRP A 1 299 ? -0.047  25.346 15.309  1.00 11.35 ? 299 TRP E CA  1 
ATOM   2212 C C   . TRP A 1 299 ? 1.442   25.290 14.954  1.00 8.21  ? 299 TRP E C   1 
ATOM   2213 O O   . TRP A 1 299 ? 2.300   25.283 15.834  1.00 10.59 ? 299 TRP E O   1 
ATOM   2214 C CB  . TRP A 1 299 ? -0.466  26.821 15.444  1.00 14.98 ? 299 TRP E CB  1 
ATOM   2215 C CG  . TRP A 1 299 ? -1.968  26.882 15.625  1.00 14.15 ? 299 TRP E CG  1 
ATOM   2216 C CD1 . TRP A 1 299 ? -2.665  26.467 16.693  1.00 15.66 ? 299 TRP E CD1 1 
ATOM   2217 C CD2 . TRP A 1 299 ? -2.881  27.348 14.692  1.00 8.90  ? 299 TRP E CD2 1 
ATOM   2218 N NE1 . TRP A 1 299 ? -3.955  26.649 16.481  1.00 13.01 ? 299 TRP E NE1 1 
ATOM   2219 C CE2 . TRP A 1 299 ? -4.147  27.180 15.273  1.00 14.88 ? 299 TRP E CE2 1 
ATOM   2220 C CE3 . TRP A 1 299 ? -2.727  27.929 13.413  1.00 12.77 ? 299 TRP E CE3 1 
ATOM   2221 C CZ2 . TRP A 1 299 ? -5.312  27.557 14.583  1.00 13.24 ? 299 TRP E CZ2 1 
ATOM   2222 C CZ3 . TRP A 1 299 ? -3.903  28.300 12.717  1.00 15.14 ? 299 TRP E CZ3 1 
ATOM   2223 C CH2 . TRP A 1 299 ? -5.168  28.116 13.289  1.00 11.81 ? 299 TRP E CH2 1 
ATOM   2224 N N   . ILE A 1 300 ? 1.717   25.235 13.652  1.00 10.55 ? 300 ILE E N   1 
ATOM   2225 C CA  . ILE A 1 300 ? 3.106   25.391 13.159  1.00 3.90  ? 300 ILE E CA  1 
ATOM   2226 C C   . ILE A 1 300 ? 3.212   26.677 12.384  1.00 10.95 ? 300 ILE E C   1 
ATOM   2227 O O   . ILE A 1 300 ? 2.593   26.871 11.324  1.00 14.37 ? 300 ILE E O   1 
ATOM   2228 C CB  . ILE A 1 300 ? 3.598   24.178 12.342  1.00 9.61  ? 300 ILE E CB  1 
ATOM   2229 C CG1 . ILE A 1 300 ? 3.437   22.879 13.142  1.00 11.29 ? 300 ILE E CG1 1 
ATOM   2230 C CG2 . ILE A 1 300 ? 5.058   24.412 11.950  1.00 8.93  ? 300 ILE E CG2 1 
ATOM   2231 C CD1 . ILE A 1 300 ? 3.823   21.576 12.421  1.00 9.04  ? 300 ILE E CD1 1 
ATOM   2232 N N   . LEU A 1 301 ? 4.065   27.553 12.911  1.00 10.36 ? 301 LEU E N   1 
ATOM   2233 C CA  . LEU A 1 301 ? 4.552   28.710 12.181  1.00 4.89  ? 301 LEU E CA  1 
ATOM   2234 C C   . LEU A 1 301 ? 5.768   28.271 11.367  1.00 5.27  ? 301 LEU E C   1 
ATOM   2235 O O   . LEU A 1 301 ? 6.884   28.130 11.879  1.00 11.43 ? 301 LEU E O   1 
ATOM   2236 C CB  . LEU A 1 301 ? 4.929   29.877 13.122  1.00 10.11 ? 301 LEU E CB  1 
ATOM   2237 C CG  . LEU A 1 301 ? 3.828   30.279 14.115  1.00 8.89  ? 301 LEU E CG  1 
ATOM   2238 C CD1 . LEU A 1 301 ? 4.377   31.448 14.940  1.00 14.65 ? 301 LEU E CD1 1 
ATOM   2239 C CD2 . LEU A 1 301 ? 2.487   30.651 13.479  1.00 9.61  ? 301 LEU E CD2 1 
ATOM   2240 N N   . GLY A 1 302 ? 5.460   27.792 10.162  1.00 12.10 ? 302 GLY E N   1 
ATOM   2241 C CA  . GLY A 1 302 ? 6.453   27.274 9.212   1.00 11.32 ? 302 GLY E CA  1 
ATOM   2242 C C   . GLY A 1 302 ? 7.150   28.368 8.403   1.00 9.22  ? 302 GLY E C   1 
ATOM   2243 O O   . GLY A 1 302 ? 7.022   29.564 8.692   1.00 10.42 ? 302 GLY E O   1 
ATOM   2244 N N   . ASP A 1 303 ? 7.614   27.992 7.211   1.00 5.57  ? 303 ASP E N   1 
ATOM   2245 C CA  . ASP A 1 303 ? 8.467   28.880 6.393   1.00 3.29  ? 303 ASP E CA  1 
ATOM   2246 C C   . ASP A 1 303 ? 7.759   30.110 5.827   1.00 5.71  ? 303 ASP E C   1 
ATOM   2247 O O   . ASP A 1 303 ? 8.354   31.193 5.791   1.00 12.14 ? 303 ASP E O   1 
ATOM   2248 C CB  . ASP A 1 303 ? 9.128   28.146 5.218   1.00 7.72  ? 303 ASP E CB  1 
ATOM   2249 C CG  . ASP A 1 303 ? 10.122  27.087 5.638   1.00 10.83 ? 303 ASP E CG  1 
ATOM   2250 O OD1 . ASP A 1 303 ? 10.749  27.272 6.708   1.00 16.03 ? 303 ASP E OD1 1 
ATOM   2251 O OD2 . ASP A 1 303 ? 10.277  26.150 4.837   1.00 15.70 ? 303 ASP E OD2 1 
ATOM   2252 N N   . VAL A 1 304 ? 6.442   29.993 5.634   1.00 10.18 ? 304 VAL E N   1 
ATOM   2253 C CA  . VAL A 1 304 ? 5.554   31.117 5.269   1.00 4.73  ? 304 VAL E CA  1 
ATOM   2254 C C   . VAL A 1 304 ? 5.735   32.305 6.257   1.00 12.54 ? 304 VAL E C   1 
ATOM   2255 O O   . VAL A 1 304 ? 5.852   33.445 5.831   1.00 9.86  ? 304 VAL E O   1 
ATOM   2256 C CB  . VAL A 1 304 ? 4.082   30.669 5.171   1.00 15.11 ? 304 VAL E CB  1 
ATOM   2257 C CG1 . VAL A 1 304 ? 3.099   31.838 5.050   1.00 7.15  ? 304 VAL E CG1 1 
ATOM   2258 C CG2 . VAL A 1 304 ? 3.863   29.720 3.989   1.00 9.30  ? 304 VAL E CG2 1 
ATOM   2259 N N   . PHE A 1 305 ? 5.708   31.989 7.557   1.00 16.36 ? 305 PHE E N   1 
ATOM   2260 C CA  . PHE A 1 305 ? 5.897   32.977 8.636   1.00 8.93  ? 305 PHE E CA  1 
ATOM   2261 C C   . PHE A 1 305 ? 7.358   33.472 8.764   1.00 8.88  ? 305 PHE E C   1 
ATOM   2262 O O   . PHE A 1 305 ? 7.627   34.662 8.766   1.00 10.70 ? 305 PHE E O   1 
ATOM   2263 C CB  . PHE A 1 305 ? 5.368   32.412 9.968   1.00 12.72 ? 305 PHE E CB  1 
ATOM   2264 C CG  . PHE A 1 305 ? 5.391   33.436 11.107  1.00 17.90 ? 305 PHE E CG  1 
ATOM   2265 C CD1 . PHE A 1 305 ? 6.554   33.577 11.909  1.00 8.99  ? 305 PHE E CD1 1 
ATOM   2266 C CD2 . PHE A 1 305 ? 4.243   34.241 11.357  1.00 12.35 ? 305 PHE E CD2 1 
ATOM   2267 C CE1 . PHE A 1 305 ? 6.578   34.521 12.948  1.00 7.32  ? 305 PHE E CE1 1 
ATOM   2268 C CE2 . PHE A 1 305 ? 4.268   35.188 12.386  1.00 8.80  ? 305 PHE E CE2 1 
ATOM   2269 C CZ  . PHE A 1 305 ? 5.439   35.330 13.170  1.00 4.25  ? 305 PHE E CZ  1 
ATOM   2270 N N   . ILE A 1 306 ? 8.285   32.522 8.785   1.00 4.94  ? 306 ILE E N   1 
ATOM   2271 C CA  . ILE A 1 306 ? 9.724   32.813 9.031   1.00 2.42  ? 306 ILE E CA  1 
ATOM   2272 C C   . ILE A 1 306 ? 10.330  33.697 7.939   1.00 15.18 ? 306 ILE E C   1 
ATOM   2273 O O   . ILE A 1 306 ? 11.198  34.518 8.218   1.00 15.16 ? 306 ILE E O   1 
ATOM   2274 C CB  . ILE A 1 306 ? 10.518  31.496 9.244   1.00 8.27  ? 306 ILE E CB  1 
ATOM   2275 C CG1 . ILE A 1 306 ? 9.931   30.783 10.479  1.00 8.76  ? 306 ILE E CG1 1 
ATOM   2276 C CG2 . ILE A 1 306 ? 12.025  31.754 9.433   1.00 4.73  ? 306 ILE E CG2 1 
ATOM   2277 C CD1 . ILE A 1 306 ? 10.343  29.317 10.620  1.00 6.68  ? 306 ILE E CD1 1 
ATOM   2278 N N   . ARG A 1 307 ? 9.918   33.517 6.681   1.00 10.28 ? 307 ARG E N   1 
ATOM   2279 C CA  . ARG A 1 307 ? 10.342  34.422 5.587   1.00 6.49  ? 307 ARG E CA  1 
ATOM   2280 C C   . ARG A 1 307 ? 10.034  35.905 5.855   1.00 11.21 ? 307 ARG E C   1 
ATOM   2281 O O   . ARG A 1 307 ? 10.826  36.798 5.570   1.00 17.43 ? 307 ARG E O   1 
ATOM   2282 C CB  . ARG A 1 307 ? 9.698   34.066 4.244   1.00 9.72  ? 307 ARG E CB  1 
ATOM   2283 C CG  . ARG A 1 307 ? 10.469  32.958 3.539   1.00 10.01 ? 307 ARG E CG  1 
ATOM   2284 C CD  . ARG A 1 307 ? 9.953   32.807 2.110   1.00 12.15 ? 307 ARG E CD  1 
ATOM   2285 N NE  . ARG A 1 307 ? 8.590   32.266 2.063   1.00 7.57  ? 307 ARG E NE  1 
ATOM   2286 C CZ  . ARG A 1 307 ? 8.281   30.967 1.972   1.00 9.32  ? 307 ARG E CZ  1 
ATOM   2287 N NH1 . ARG A 1 307 ? 7.002   30.606 1.874   1.00 7.03  ? 307 ARG E NH1 1 
ATOM   2288 N NH2 . ARG A 1 307 ? 9.224   30.021 2.123   1.00 8.13  ? 307 ARG E NH2 1 
ATOM   2289 N N   . GLN A 1 308 ? 8.930   36.139 6.566   1.00 10.39 ? 308 GLN E N   1 
ATOM   2290 C CA  . GLN A 1 308 ? 8.517   37.507 6.920   1.00 8.50  ? 308 GLN E CA  1 
ATOM   2291 C C   . GLN A 1 308 ? 9.255   38.100 8.113   1.00 7.73  ? 308 GLN E C   1 
ATOM   2292 O O   . GLN A 1 308 ? 9.373   39.311 8.241   1.00 7.01  ? 308 GLN E O   1 
ATOM   2293 C CB  . GLN A 1 308 ? 6.994   37.555 7.161   1.00 10.16 ? 308 GLN E CB  1 
ATOM   2294 C CG  . GLN A 1 308 ? 6.182   37.057 5.955   1.00 8.27  ? 308 GLN E CG  1 
ATOM   2295 C CD  . GLN A 1 308 ? 6.404   37.907 4.703   1.00 29.88 ? 308 GLN E CD  1 
ATOM   2296 O OE1 . GLN A 1 308 ? 5.995   39.065 4.609   1.00 30.87 ? 308 GLN E OE1 1 
ATOM   2297 N NE2 . GLN A 1 308 ? 7.060   37.345 3.716   1.00 30.82 ? 308 GLN E NE2 1 
ATOM   2298 N N   . TYR A 1 309 ? 9.717   37.221 9.022   1.00 14.34 ? 309 TYR E N   1 
ATOM   2299 C CA  . TYR A 1 309 ? 10.316  37.609 10.308  1.00 13.16 ? 309 TYR E CA  1 
ATOM   2300 C C   . TYR A 1 309 ? 11.639  36.877 10.592  1.00 8.00  ? 309 TYR E C   1 
ATOM   2301 O O   . TYR A 1 309 ? 11.653  35.658 10.692  1.00 18.79 ? 309 TYR E O   1 
ATOM   2302 C CB  . TYR A 1 309 ? 9.343   37.319 11.455  1.00 5.97  ? 309 TYR E CB  1 
ATOM   2303 C CG  . TYR A 1 309 ? 8.088   38.195 11.314  1.00 7.24  ? 309 TYR E CG  1 
ATOM   2304 C CD1 . TYR A 1 309 ? 6.899   37.617 10.816  1.00 10.94 ? 309 TYR E CD1 1 
ATOM   2305 C CD2 . TYR A 1 309 ? 8.209   39.572 11.498  1.00 11.15 ? 309 TYR E CD2 1 
ATOM   2306 C CE1 . TYR A 1 309 ? 5.809   38.443 10.482  1.00 7.18  ? 309 TYR E CE1 1 
ATOM   2307 C CE2 . TYR A 1 309 ? 7.128   40.417 11.155  1.00 2.82  ? 309 TYR E CE2 1 
ATOM   2308 C CZ  . TYR A 1 309 ? 5.953   39.833 10.658  1.00 5.97  ? 309 TYR E CZ  1 
ATOM   2309 O OH  . TYR A 1 309 ? 4.918   40.657 10.376  1.00 9.92  ? 309 TYR E OH  1 
ATOM   2310 N N   . PHE A 1 310 ? 12.724  37.627 10.563  1.00 9.93  ? 310 PHE E N   1 
ATOM   2311 C CA  . PHE A 1 310 ? 14.045  37.143 11.048  1.00 14.04 ? 310 PHE E CA  1 
ATOM   2312 C C   . PHE A 1 310 ? 13.887  36.597 12.470  1.00 14.19 ? 310 PHE E C   1 
ATOM   2313 O O   . PHE A 1 310 ? 13.249  37.232 13.324  1.00 15.47 ? 310 PHE E O   1 
ATOM   2314 C CB  . PHE A 1 310 ? 15.064  38.293 11.035  1.00 10.43 ? 310 PHE E CB  1 
ATOM   2315 C CG  . PHE A 1 310 ? 16.451  37.860 11.532  1.00 7.66  ? 310 PHE E CG  1 
ATOM   2316 C CD1 . PHE A 1 310 ? 16.853  38.202 12.829  1.00 14.22 ? 310 PHE E CD1 1 
ATOM   2317 C CD2 . PHE A 1 310 ? 17.321  37.211 10.643  1.00 9.37  ? 310 PHE E CD2 1 
ATOM   2318 C CE1 . PHE A 1 310 ? 18.195  37.916 13.235  1.00 6.99  ? 310 PHE E CE1 1 
ATOM   2319 C CE2 . PHE A 1 310 ? 18.650  36.927 11.042  1.00 13.21 ? 310 PHE E CE2 1 
ATOM   2320 C CZ  . PHE A 1 310 ? 19.067  37.303 12.342  1.00 10.54 ? 310 PHE E CZ  1 
ATOM   2321 N N   . THR A 1 311 ? 14.365  35.382 12.676  1.00 11.31 ? 311 THR E N   1 
ATOM   2322 C CA  . THR A 1 311 ? 14.112  34.603 13.876  1.00 4.81  ? 311 THR E CA  1 
ATOM   2323 C C   . THR A 1 311 ? 15.411  34.221 14.555  1.00 10.94 ? 311 THR E C   1 
ATOM   2324 O O   . THR A 1 311 ? 16.364  33.812 13.908  1.00 8.68  ? 311 THR E O   1 
ATOM   2325 C CB  . THR A 1 311 ? 13.261  33.334 13.621  1.00 13.35 ? 311 THR E CB  1 
ATOM   2326 O OG1 . THR A 1 311 ? 12.103  33.714 12.902  1.00 13.17 ? 311 THR E OG1 1 
ATOM   2327 C CG2 . THR A 1 311 ? 12.682  32.790 14.924  1.00 14.68 ? 311 THR E CG2 1 
ATOM   2328 N N   . VAL A 1 312 ? 15.429  34.571 15.853  1.00 11.32 ? 312 VAL E N   1 
ATOM   2329 C CA  . VAL A 1 312 ? 16.535  34.308 16.780  1.00 11.79 ? 312 VAL E CA  1 
ATOM   2330 C C   . VAL A 1 312 ? 16.055  33.276 17.797  1.00 8.22  ? 312 VAL E C   1 
ATOM   2331 O O   . VAL A 1 312 ? 15.035  33.474 18.438  1.00 13.11 ? 312 VAL E O   1 
ATOM   2332 C CB  . VAL A 1 312 ? 17.022  35.579 17.518  1.00 14.74 ? 312 VAL E CB  1 
ATOM   2333 C CG1 . VAL A 1 312 ? 18.271  35.288 18.349  1.00 12.26 ? 312 VAL E CG1 1 
ATOM   2334 C CG2 . VAL A 1 312 ? 17.418  36.699 16.559  1.00 12.41 ? 312 VAL E CG2 1 
ATOM   2335 N N   . PHE A 1 313 ? 16.852  32.229 17.979  1.00 9.56  ? 313 PHE E N   1 
ATOM   2336 C CA  . PHE A 1 313 ? 16.521  31.102 18.888  1.00 5.69  ? 313 PHE E CA  1 
ATOM   2337 C C   . PHE A 1 313 ? 17.542  31.077 20.035  1.00 9.94  ? 313 PHE E C   1 
ATOM   2338 O O   . PHE A 1 313 ? 18.712  30.764 19.847  1.00 11.00 ? 313 PHE E O   1 
ATOM   2339 C CB  . PHE A 1 313 ? 16.540  29.788 18.110  1.00 7.15  ? 313 PHE E CB  1 
ATOM   2340 C CG  . PHE A 1 313 ? 15.492  29.717 16.993  1.00 9.29  ? 313 PHE E CG  1 
ATOM   2341 C CD1 . PHE A 1 313 ? 15.800  30.229 15.720  1.00 8.31  ? 313 PHE E CD1 1 
ATOM   2342 C CD2 . PHE A 1 313 ? 14.263  29.078 17.252  1.00 8.07  ? 313 PHE E CD2 1 
ATOM   2343 C CE1 . PHE A 1 313 ? 14.861  30.073 14.681  1.00 5.18  ? 313 PHE E CE1 1 
ATOM   2344 C CE2 . PHE A 1 313 ? 13.317  28.931 16.217  1.00 9.81  ? 313 PHE E CE2 1 
ATOM   2345 C CZ  . PHE A 1 313 ? 13.628  29.431 14.946  1.00 7.25  ? 313 PHE E CZ  1 
ATOM   2346 N N   . ASP A 1 314 ? 17.109  31.657 21.154  1.00 10.99 ? 314 ASP E N   1 
ATOM   2347 C CA  . ASP A 1 314 ? 17.977  31.893 22.326  1.00 11.39 ? 314 ASP E CA  1 
ATOM   2348 C C   . ASP A 1 314 ? 17.853  30.797 23.386  1.00 7.24  ? 314 ASP E C   1 
ATOM   2349 O O   . ASP A 1 314 ? 16.916  30.776 24.182  1.00 10.62 ? 314 ASP E O   1 
ATOM   2350 C CB  . ASP A 1 314 ? 17.655  33.275 22.919  1.00 13.92 ? 314 ASP E CB  1 
ATOM   2351 C CG  . ASP A 1 314 ? 18.687  33.790 23.937  1.00 15.26 ? 314 ASP E CG  1 
ATOM   2352 O OD1 . ASP A 1 314 ? 18.629  34.978 24.273  1.00 26.33 ? 314 ASP E OD1 1 
ATOM   2353 O OD2 . ASP A 1 314 ? 19.535  32.974 24.360  1.00 20.64 ? 314 ASP E OD2 1 
ATOM   2354 N N   . ARG A 1 315 ? 18.889  29.952 23.450  1.00 8.19  ? 315 ARG E N   1 
ATOM   2355 C CA  . ARG A 1 315 ? 18.978  28.857 24.417  1.00 18.50 ? 315 ARG E CA  1 
ATOM   2356 C C   . ARG A 1 315 ? 19.422  29.279 25.827  1.00 21.88 ? 315 ARG E C   1 
ATOM   2357 O O   . ARG A 1 315 ? 18.985  28.696 26.807  1.00 24.08 ? 315 ARG E O   1 
ATOM   2358 C CB  . ARG A 1 315 ? 19.905  27.739 23.910  1.00 16.31 ? 315 ARG E CB  1 
ATOM   2359 C CG  . ARG A 1 315 ? 19.262  26.879 22.818  1.00 11.38 ? 315 ARG E CG  1 
ATOM   2360 C CD  . ARG A 1 315 ? 18.090  26.008 23.302  1.00 11.59 ? 315 ARG E CD  1 
ATOM   2361 N NE  . ARG A 1 315 ? 18.492  25.060 24.347  1.00 16.10 ? 315 ARG E NE  1 
ATOM   2362 C CZ  . ARG A 1 315 ? 19.002  23.814 24.187  1.00 9.87  ? 315 ARG E CZ  1 
ATOM   2363 N NH1 . ARG A 1 315 ? 19.147  23.270 22.977  1.00 18.19 ? 315 ARG E NH1 1 
ATOM   2364 N NH2 . ARG A 1 315 ? 19.443  23.170 25.265  1.00 11.20 ? 315 ARG E NH2 1 
ATOM   2365 N N   . ALA A 1 316 ? 20.183  30.393 25.927  1.00 14.95 ? 316 ALA E N   1 
ATOM   2366 C CA  . ALA A 1 316 ? 20.624  30.958 27.226  1.00 14.98 ? 316 ALA E CA  1 
ATOM   2367 C C   . ALA A 1 316 ? 19.458  31.392 28.113  1.00 15.47 ? 316 ALA E C   1 
ATOM   2368 O O   . ALA A 1 316 ? 19.382  31.090 29.294  1.00 22.69 ? 316 ALA E O   1 
ATOM   2369 C CB  . ALA A 1 316 ? 21.552  32.163 27.005  1.00 11.17 ? 316 ALA E CB  1 
ATOM   2370 N N   . ASN A 1 317 ? 18.467  32.042 27.491  1.00 12.56 ? 317 ASN E N   1 
ATOM   2371 C CA  . ASN A 1 317 ? 17.290  32.586 28.167  1.00 8.82  ? 317 ASN E CA  1 
ATOM   2372 C C   . ASN A 1 317 ? 15.968  31.903 27.798  1.00 17.92 ? 317 ASN E C   1 
ATOM   2373 O O   . ASN A 1 317 ? 14.909  32.317 28.258  1.00 14.79 ? 317 ASN E O   1 
ATOM   2374 C CB  . ASN A 1 317 ? 17.165  34.103 27.910  1.00 16.09 ? 317 ASN E CB  1 
ATOM   2375 C CG  . ASN A 1 317 ? 18.147  34.998 28.694  1.00 31.92 ? 317 ASN E CG  1 
ATOM   2376 O OD1 . ASN A 1 317 ? 18.111  36.219 28.617  1.00 99.99 ? 317 ASN E OD1 1 
ATOM   2377 N ND2 . ASN A 1 317 ? 19.077  34.426 29.432  1.00 99.99 ? 317 ASN E ND2 1 
ATOM   2378 N N   . ASN A 1 318 ? 16.018  30.855 26.958  1.00 10.71 ? 318 ASN E N   1 
ATOM   2379 C CA  . ASN A 1 318 ? 14.804  30.151 26.494  1.00 9.38  ? 318 ASN E CA  1 
ATOM   2380 C C   . ASN A 1 318 ? 13.731  31.125 25.962  1.00 5.28  ? 318 ASN E C   1 
ATOM   2381 O O   . ASN A 1 318 ? 12.557  31.140 26.316  1.00 18.76 ? 318 ASN E O   1 
ATOM   2382 C CB  . ASN A 1 318 ? 14.238  29.234 27.597  1.00 14.59 ? 318 ASN E CB  1 
ATOM   2383 C CG  . ASN A 1 318 ? 15.285  28.215 28.046  1.00 18.39 ? 318 ASN E CG  1 
ATOM   2384 O OD1 . ASN A 1 318 ? 15.823  27.416 27.290  1.00 24.15 ? 318 ASN E OD1 1 
ATOM   2385 N ND2 . ASN A 1 318 ? 15.785  28.404 29.242  1.00 17.94 ? 318 ASN E ND2 1 
ATOM   2386 N N   . GLN A 1 319 ? 14.150  31.865 24.930  1.00 11.52 ? 319 GLN E N   1 
ATOM   2387 C CA  . GLN A 1 319 ? 13.290  32.827 24.222  1.00 10.03 ? 319 GLN E CA  1 
ATOM   2388 C C   . GLN A 1 319 ? 13.503  32.777 22.703  1.00 9.23  ? 319 GLN E C   1 
ATOM   2389 O O   . GLN A 1 319 ? 14.589  32.428 22.246  1.00 10.71 ? 319 GLN E O   1 
ATOM   2390 C CB  . GLN A 1 319 ? 13.618  34.269 24.642  1.00 17.12 ? 319 GLN E CB  1 
ATOM   2391 C CG  . GLN A 1 319 ? 13.231  34.673 26.061  1.00 99.99 ? 319 GLN E CG  1 
ATOM   2392 C CD  . GLN A 1 319 ? 13.657  36.125 26.295  1.00 53.02 ? 319 GLN E CD  1 
ATOM   2393 O OE1 . GLN A 1 319 ? 14.745  36.563 25.953  1.00 32.82 ? 319 GLN E OE1 1 
ATOM   2394 N NE2 . GLN A 1 319 ? 12.740  36.893 26.858  1.00 99.99 ? 319 GLN E NE2 1 
ATOM   2395 N N   . VAL A 1 320 ? 12.459  33.169 21.974  1.00 10.21 ? 320 VAL E N   1 
ATOM   2396 C CA  . VAL A 1 320 ? 12.511  33.411 20.514  1.00 12.59 ? 320 VAL E CA  1 
ATOM   2397 C C   . VAL A 1 320 ? 12.503  34.927 20.284  1.00 17.42 ? 320 VAL E C   1 
ATOM   2398 O O   . VAL A 1 320 ? 11.724  35.642 20.904  1.00 13.05 ? 320 VAL E O   1 
ATOM   2399 C CB  . VAL A 1 320 ? 11.319  32.718 19.804  1.00 7.00  ? 320 VAL E CB  1 
ATOM   2400 C CG1 . VAL A 1 320 ? 11.233  33.047 18.315  1.00 14.18 ? 320 VAL E CG1 1 
ATOM   2401 C CG2 . VAL A 1 320 ? 11.389  31.193 19.974  1.00 5.76  ? 320 VAL E CG2 1 
ATOM   2402 N N   . GLY A 1 321 ? 13.403  35.417 19.432  1.00 8.03  ? 321 GLY E N   1 
ATOM   2403 C CA  . GLY A 1 321 ? 13.452  36.821 18.981  1.00 8.82  ? 321 GLY E CA  1 
ATOM   2404 C C   . GLY A 1 321 ? 12.893  36.954 17.561  1.00 8.95  ? 321 GLY E C   1 
ATOM   2405 O O   . GLY A 1 321 ? 13.202  36.135 16.699  1.00 17.39 ? 321 GLY E O   1 
ATOM   2406 N N   . LEU A 1 322 ? 12.028  37.940 17.373  1.00 12.17 ? 322 LEU E N   1 
ATOM   2407 C CA  . LEU A 1 322 ? 11.351  38.195 16.070  1.00 11.19 ? 322 LEU E CA  1 
ATOM   2408 C C   . LEU A 1 322 ? 11.484  39.657 15.697  1.00 14.42 ? 322 LEU E C   1 
ATOM   2409 O O   . LEU A 1 322 ? 11.233  40.557 16.495  1.00 15.12 ? 322 LEU E O   1 
ATOM   2410 C CB  . LEU A 1 322 ? 9.840   37.866 16.110  1.00 6.32  ? 322 LEU E CB  1 
ATOM   2411 C CG  . LEU A 1 322 ? 9.462   36.409 16.382  1.00 11.34 ? 322 LEU E CG  1 
ATOM   2412 C CD1 . LEU A 1 322 ? 7.963   36.365 16.669  1.00 13.80 ? 322 LEU E CD1 1 
ATOM   2413 C CD2 . LEU A 1 322 ? 9.812   35.471 15.222  1.00 13.01 ? 322 LEU E CD2 1 
ATOM   2414 N N   . ALA A 1 323 ? 11.709  39.900 14.392  1.00 14.58 ? 323 ALA E N   1 
ATOM   2415 C CA  . ALA A 1 323 ? 11.731  41.241 13.789  1.00 16.13 ? 323 ALA E CA  1 
ATOM   2416 C C   . ALA A 1 323 ? 11.501  41.171 12.267  1.00 12.14 ? 323 ALA E C   1 
ATOM   2417 O O   . ALA A 1 323 ? 11.920  40.186 11.654  1.00 14.82 ? 323 ALA E O   1 
ATOM   2418 C CB  . ALA A 1 323 ? 13.071  41.958 14.029  1.00 8.52  ? 323 ALA E CB  1 
ATOM   2419 N N   . PRO A 1 324 ? 10.789  42.122 11.663  1.00 13.57 ? 324 PRO E N   1 
ATOM   2420 C CA  . PRO A 1 324 ? 10.496  42.057 10.219  1.00 13.23 ? 324 PRO E CA  1 
ATOM   2421 C C   . PRO A 1 324 ? 11.780  42.132 9.405   1.00 14.15 ? 324 PRO E C   1 
ATOM   2422 O O   . PRO A 1 324 ? 12.752  42.783 9.803   1.00 12.78 ? 324 PRO E O   1 
ATOM   2423 C CB  . PRO A 1 324 ? 9.500   43.190 9.965   1.00 17.10 ? 324 PRO E CB  1 
ATOM   2424 C CG  . PRO A 1 324 ? 9.699   44.157 11.122  1.00 18.77 ? 324 PRO E CG  1 
ATOM   2425 C CD  . PRO A 1 324 ? 10.121  43.272 12.290  1.00 10.90 ? 324 PRO E CD  1 
ATOM   2426 N N   . VAL A 1 325 ? 11.846  41.247 8.414   1.00 20.84 ? 325 VAL E N   1 
ATOM   2427 C CA  . VAL A 1 325 ? 13.017  41.168 7.493   1.00 15.74 ? 325 VAL E CA  1 
ATOM   2428 C C   . VAL A 1 325 ? 13.240  42.515 6.793   1.00 16.91 ? 325 VAL E C   1 
ATOM   2429 O O   . VAL A 1 325 ? 12.283  43.233 6.500   1.00 22.82 ? 325 VAL E O   1 
ATOM   2430 C CB  . VAL A 1 325 ? 12.947  40.029 6.441   1.00 14.12 ? 325 VAL E CB  1 
ATOM   2431 C CG1 . VAL A 1 325 ? 13.037  38.669 7.125   1.00 18.33 ? 325 VAL E CG1 1 
ATOM   2432 C CG2 . VAL A 1 325 ? 11.730  40.079 5.509   1.00 15.42 ? 325 VAL E CG2 1 
ATOM   2433 N N   . ALA A 1 326 ? 14.497  42.852 6.591   1.00 22.95 ? 326 ALA E N   1 
ATOM   2434 C CA  . ALA A 1 326 ? 14.901  44.087 5.859   1.00 95.90 ? 326 ALA E CA  1 
ATOM   2435 C C   . ALA A 1 326 ? 14.654  43.979 4.353   1.00 36.51 ? 326 ALA E C   1 
ATOM   2436 O O   . ALA A 1 326 ? 14.263  45.021 3.761   1.00 99.99 ? 326 ALA E O   1 
ATOM   2437 C CB  . ALA A 1 326 ? 16.376  44.388 6.122   1.00 99.58 ? 326 ALA E CB  1 
ATOM   2438 O OXT . ALA A 1 326 ? 14.906  42.882 3.802   1.00 79.06 ? 326 ALA E OXT 1 
HETATM 2439 C CA1 . HH0 B 2 .   ? 4.349   20.856 1.956   1.00 37.78 ? 327 HH0 E CA1 1 
HETATM 2440 C CB1 . HH0 B 2 .   ? 3.839   20.507 0.558   1.00 47.05 ? 327 HH0 E CB1 1 
HETATM 2441 C CZ2 . HH0 B 2 .   ? 4.946   20.697 -0.489  1.00 43.55 ? 327 HH0 E CZ2 1 
HETATM 2442 C CW1 . HH0 B 2 .   ? 2.620   21.369 0.228   1.00 49.47 ? 327 HH0 E CW1 1 
HETATM 2443 C C1  . HH0 B 2 .   ? 5.167   19.747 2.620   1.00 43.45 ? 327 HH0 E C1  1 
HETATM 2444 O O1  . HH0 B 2 .   ? 4.659   18.652 2.865   1.00 52.23 ? 327 HH0 E O1  1 
HETATM 2445 N N1  . HH0 B 2 .   ? 6.459   20.024 2.819   1.00 30.83 ? 327 HH0 E N1  1 
HETATM 2446 C CA2 . HH0 B 2 .   ? 7.254   19.349 3.861   1.00 21.38 ? 327 HH0 E CA2 1 
HETATM 2447 C C2  . HH0 B 2 .   ? 6.738   19.710 5.276   1.00 20.00 ? 327 HH0 E C2  1 
HETATM 2448 O O2  . HH0 B 2 .   ? 6.348   20.835 5.582   1.00 9.06  ? 327 HH0 E O2  1 
HETATM 2449 C CB2 . HH0 B 2 .   ? 8.789   19.563 3.811   1.00 16.96 ? 327 HH0 E CB2 1 
HETATM 2450 C CG1 . HH0 B 2 .   ? 9.343   19.048 2.494   1.00 81.19 ? 327 HH0 E CG1 1 
HETATM 2451 C CG2 . HH0 B 2 .   ? 9.270   21.001 4.045   1.00 34.89 ? 327 HH0 E CG2 1 
HETATM 2452 N N3  . HH0 B 2 .   ? 6.581   18.656 6.069   1.00 12.52 ? 327 HH0 E N3  1 
HETATM 2453 C CA3 . HH0 B 2 .   ? 6.301   18.787 7.505   1.00 12.70 ? 327 HH0 E CA3 1 
HETATM 2454 C C3  . HH0 B 2 .   ? 7.367   17.989 8.281   1.00 14.32 ? 327 HH0 E C3  1 
HETATM 2455 O O3  . HH0 B 2 .   ? 7.233   16.790 8.479   1.00 12.54 ? 327 HH0 E O3  1 
HETATM 2456 C CB3 . HH0 B 2 .   ? 4.878   18.322 7.841   1.00 13.71 ? 327 HH0 E CB3 1 
HETATM 2457 C CO2 . HH0 B 2 .   ? 3.823   19.045 6.982   1.00 13.77 ? 327 HH0 E CO2 1 
HETATM 2458 C CP1 . HH0 B 2 .   ? 4.584   18.604 9.320   1.00 9.91  ? 327 HH0 E CP1 1 
HETATM 2459 C C5  . HH0 B 2 .   ? 8.216   16.649 13.220  1.00 17.83 ? 327 HH0 E C5  1 
HETATM 2460 N N5  . HH0 B 2 .   ? 8.516   18.645 8.475   1.00 8.88  ? 327 HH0 E N5  1 
HETATM 2461 O O5  . HH0 B 2 .   ? 7.661   15.768 12.584  1.00 28.96 ? 327 HH0 E O5  1 
HETATM 2462 P P5  . HH0 B 2 .   ? 9.519   18.832 10.886  1.00 12.08 ? 327 HH0 E P5  1 
HETATM 2463 C CZ  . HH0 B 2 .   ? 4.458   17.651 16.821  1.00 99.99 ? 327 HH0 E CZ  1 
HETATM 2464 O O11 . HH0 B 2 .   ? 9.529   20.287 10.687  1.00 13.97 ? 327 HH0 E O11 1 
HETATM 2465 O O21 . HH0 B 2 .   ? 10.688  18.277 11.598  1.00 7.98  ? 327 HH0 E O21 1 
HETATM 2466 C CA4 . HH0 B 2 .   ? 9.642   18.076 9.225   1.00 10.22 ? 327 HH0 E CA4 1 
HETATM 2467 C CA5 . HH0 B 2 .   ? 7.816   18.151 12.923  1.00 20.27 ? 327 HH0 E CA5 1 
HETATM 2468 O OA5 . HH0 B 2 .   ? 8.089   18.425 11.540  1.00 21.85 ? 327 HH0 E OA5 1 
HETATM 2469 C CB4 . HH0 B 2 .   ? 11.006  18.293 8.549   1.00 10.32 ? 327 HH0 E CB4 1 
HETATM 2470 C CB5 . HH0 B 2 .   ? 6.339   18.684 13.073  1.00 17.28 ? 327 HH0 E CB5 1 
HETATM 2471 C CE2 . HH0 B 2 .   ? 4.432   16.727 15.735  1.00 29.43 ? 327 HH0 E CE2 1 
HETATM 2472 C CG4 . HH0 B 2 .   ? 11.016  17.719 7.118   1.00 11.54 ? 327 HH0 E CG4 1 
HETATM 2473 C CG5 . HH0 B 2 .   ? 5.769   18.282 14.426  1.00 37.44 ? 327 HH0 E CG5 1 
HETATM 2474 C CJ2 . HH0 B 2 .   ? 5.080   17.045 14.541  1.00 36.66 ? 327 HH0 E CJ2 1 
HETATM 2475 C CN1 . HH0 B 2 .   ? 12.246  18.238 6.386   1.00 16.65 ? 327 HH0 E CN1 1 
HETATM 2476 C CM2 . HH0 B 2 .   ? 11.010  16.187 7.100   1.00 7.25  ? 327 HH0 E CM2 1 
HETATM 2477 C CU1 . HH0 B 2 .   ? 5.817   19.193 15.508  1.00 14.33 ? 327 HH0 E CU1 1 
HETATM 2478 C CV1 . HH0 B 2 .   ? 5.139   18.878 16.699  1.00 48.79 ? 327 HH0 E CV1 1 
HETATM 2479 N N6  . HH0 B 2 .   ? 9.028   16.455 14.249  1.00 17.82 ? 327 HH0 E N6  1 
HETATM 2480 C CA6 . HH0 B 2 .   ? 9.249   15.087 14.786  1.00 13.19 ? 327 HH0 E CA6 1 
HETATM 2481 C C6  . HH0 B 2 .   ? 8.304   14.750 15.911  1.00 18.71 ? 327 HH0 E C6  1 
HETATM 2482 O O6  . HH0 B 2 .   ? 8.208   15.499 16.861  1.00 26.73 ? 327 HH0 E O6  1 
HETATM 2483 C CB6 . HH0 B 2 .   ? 10.670  14.918 15.304  1.00 15.25 ? 327 HH0 E CB6 1 
HETATM 2484 N N7  . HH0 B 2 .   ? 7.601   13.623 15.747  1.00 31.49 ? 327 HH0 E N7  1 
HETATM 2485 C CA7 . HH0 B 2 .   ? 6.692   13.028 16.747  1.00 76.61 ? 327 HH0 E CA7 1 
HETATM 2486 C C7  . HH0 B 2 .   ? 7.352   12.943 18.139  1.00 99.99 ? 327 HH0 E C7  1 
HETATM 2487 O O7  . HH0 B 2 .   ? 8.303   12.182 18.342  1.00 99.99 ? 327 HH0 E O7  1 
HETATM 2488 C CB7 . HH0 B 2 .   ? 6.304   11.621 16.275  1.00 35.81 ? 327 HH0 E CB7 1 
HETATM 2489 O O77 . HH0 B 2 .   ? 7.298   13.459 19.496  1.00 99.99 ? 327 HH0 E O77 1 
HETATM 2490 C C99 . HH0 B 2 .   ? 8.428   13.257 20.389  1.00 75.46 ? 327 HH0 E C99 1 
HETATM 2491 O O   . HOH C 3 .   ? 20.480  11.485 16.187  1.00 16.27 ? 328 HOH E O   1 
HETATM 2492 O O   . HOH C 3 .   ? 23.969  11.237 23.016  1.00 35.07 ? 329 HOH E O   1 
HETATM 2493 O O   . HOH C 3 .   ? 9.710   10.260 15.995  1.00 39.61 ? 330 HOH E O   1 
HETATM 2494 O O   . HOH C 3 .   ? 33.953  10.914 17.520  1.00 33.31 ? 331 HOH E O   1 
HETATM 2495 O O   . HOH C 3 .   ? 35.563  9.927  5.675   1.00 35.36 ? 332 HOH E O   1 
HETATM 2496 O O   . HOH C 3 .   ? 9.628   9.249  2.507   1.00 29.32 ? 333 HOH E O   1 
HETATM 2497 O O   . HOH C 3 .   ? 14.532  6.010  18.626  1.00 22.84 ? 334 HOH E O   1 
HETATM 2498 O O   . HOH C 3 .   ? 12.880  4.898  -0.178  1.00 22.48 ? 335 HOH E O   1 
HETATM 2499 O O   . HOH C 3 .   ? 35.173  13.653 16.923  1.00 29.28 ? 336 HOH E O   1 
HETATM 2500 O O   . HOH C 3 .   ? 27.379  13.971 20.816  1.00 17.23 ? 337 HOH E O   1 
HETATM 2501 O O   . HOH C 3 .   ? 21.989  13.770 16.764  1.00 22.01 ? 338 HOH E O   1 
HETATM 2502 O O   . HOH C 3 .   ? 14.021  14.963 16.869  1.00 13.72 ? 339 HOH E O   1 
HETATM 2503 O O   . HOH C 3 .   ? 15.761  15.329 13.177  1.00 10.06 ? 340 HOH E O   1 
HETATM 2504 O O   . HOH C 3 .   ? 37.967  15.987 14.300  1.00 32.44 ? 341 HOH E O   1 
HETATM 2505 O O   . HOH C 3 .   ? 34.139  16.762 9.278   1.00 23.12 ? 342 HOH E O   1 
HETATM 2506 O O   . HOH C 3 .   ? 20.970  17.761 15.891  1.00 8.52  ? 343 HOH E O   1 
HETATM 2507 O O   . HOH C 3 .   ? -2.920  20.294 15.883  1.00 35.79 ? 344 HOH E O   1 
HETATM 2508 O O   . HOH C 3 .   ? 20.959  21.247 17.463  1.00 9.85  ? 345 HOH E O   1 
HETATM 2509 O O   . HOH C 3 .   ? 36.843  21.538 18.162  1.00 34.21 ? 346 HOH E O   1 
HETATM 2510 O O   . HOH C 3 .   ? 19.810  21.876 19.851  1.00 13.92 ? 347 HOH E O   1 
HETATM 2511 O O   . HOH C 3 .   ? 7.687   21.984 23.078  1.00 11.40 ? 348 HOH E O   1 
HETATM 2512 O O   . HOH C 3 .   ? 23.399  22.378 26.127  1.00 42.01 ? 349 HOH E O   1 
HETATM 2513 O O   . HOH C 3 .   ? 9.644   23.381 29.606  1.00 31.17 ? 350 HOH E O   1 
HETATM 2514 O O   . HOH C 3 .   ? 13.255  23.719 5.076   1.00 20.39 ? 351 HOH E O   1 
HETATM 2515 O O   . HOH C 3 .   ? 18.707  24.588 20.215  1.00 11.60 ? 352 HOH E O   1 
HETATM 2516 O O   . HOH C 3 .   ? 9.998   24.201 16.945  1.00 10.18 ? 353 HOH E O   1 
HETATM 2517 O O   . HOH C 3 .   ? -3.165  25.387 21.398  1.00 23.89 ? 354 HOH E O   1 
HETATM 2518 O O   . HOH C 3 .   ? 22.701  24.571 23.502  1.00 28.73 ? 355 HOH E O   1 
HETATM 2519 O O   . HOH C 3 .   ? 25.734  24.986 2.540   1.00 40.09 ? 356 HOH E O   1 
HETATM 2520 O O   . HOH C 3 .   ? 35.808  24.886 15.271  1.00 34.13 ? 357 HOH E O   1 
HETATM 2521 O O   . HOH C 3 .   ? 6.276   27.781 1.900   1.00 15.42 ? 358 HOH E O   1 
HETATM 2522 O O   . HOH C 3 .   ? -2.106  28.908 24.814  1.00 29.71 ? 359 HOH E O   1 
HETATM 2523 O O   . HOH C 3 .   ? -5.063  29.273 -9.026  1.00 30.54 ? 360 HOH E O   1 
HETATM 2524 O O   . HOH C 3 .   ? 1.978   45.635 17.589  1.00 20.92 ? 361 HOH E O   1 
HETATM 2525 O O   . HOH C 3 .   ? 19.225  29.479 -2.484  1.00 25.16 ? 362 HOH E O   1 
HETATM 2526 O O   . HOH C 3 .   ? -8.738  30.304 21.472  1.00 34.22 ? 363 HOH E O   1 
HETATM 2527 O O   . HOH C 3 .   ? 18.817  31.059 -0.063  1.00 18.25 ? 364 HOH E O   1 
HETATM 2528 O O   . HOH C 3 .   ? -13.420 31.817 11.208  1.00 35.93 ? 365 HOH E O   1 
HETATM 2529 O O   . HOH C 3 .   ? 4.882   32.554 24.543  1.00 15.12 ? 366 HOH E O   1 
HETATM 2530 O O   . HOH C 3 .   ? 5.397   32.833 1.268   1.00 20.29 ? 367 HOH E O   1 
HETATM 2531 O O   . HOH C 3 .   ? 29.556  33.198 19.697  1.00 21.52 ? 368 HOH E O   1 
HETATM 2532 O O   . HOH C 3 .   ? -7.246  42.011 11.709  1.00 44.87 ? 369 HOH E O   1 
HETATM 2533 O O   . HOH C 3 .   ? -6.552  42.287 8.905   1.00 17.27 ? 370 HOH E O   1 
HETATM 2534 O O   . HOH C 3 .   ? 7.461   41.669 7.614   1.00 32.03 ? 371 HOH E O   1 
HETATM 2535 O O   . HOH C 3 .   ? 6.680   34.468 3.190   1.00 20.76 ? 372 HOH E O   1 
HETATM 2536 O O   . HOH C 3 .   ? 7.674   40.562 22.806  1.00 21.62 ? 373 HOH E O   1 
HETATM 2537 O O   . HOH C 3 .   ? 13.968  34.858 7.786   1.00 17.55 ? 374 HOH E O   1 
HETATM 2538 O O   . HOH C 3 .   ? 6.516   39.678 20.502  1.00 19.86 ? 375 HOH E O   1 
HETATM 2539 O O   . HOH C 3 .   ? -5.152  35.909 24.460  1.00 40.11 ? 376 HOH E O   1 
HETATM 2540 O O   . HOH C 3 .   ? -5.207  39.725 20.673  1.00 28.45 ? 377 HOH E O   1 
HETATM 2541 O O   . HOH C 3 .   ? -12.664 39.057 17.371  1.00 23.42 ? 378 HOH E O   1 
HETATM 2542 O O   . HOH C 3 .   ? 12.546  36.805 3.012   1.00 21.69 ? 379 HOH E O   1 
HETATM 2543 O O   . HOH C 3 .   ? 22.660  36.962 3.282   1.00 38.67 ? 380 HOH E O   1 
HETATM 2544 O O   . HOH C 3 .   ? 26.456  38.403 16.951  1.00 41.64 ? 381 HOH E O   1 
HETATM 2545 O O   . HOH C 3 .   ? -4.141  38.897 16.020  1.00 14.10 ? 382 HOH E O   1 
HETATM 2546 O O   . HOH C 3 .   ? 14.699  37.127 -0.454  1.00 38.81 ? 383 HOH E O   1 
HETATM 2547 O O   . HOH C 3 .   ? 26.721  11.397 23.591  1.00 40.43 ? 384 HOH E O   1 
HETATM 2548 O O   . HOH C 3 .   ? 18.011  10.485 2.296   1.00 19.34 ? 385 HOH E O   1 
HETATM 2549 O O   . HOH C 3 .   ? 29.978  10.142 1.154   1.00 44.06 ? 386 HOH E O   1 
HETATM 2550 O O   . HOH C 3 .   ? 13.629  7.674  21.595  1.00 42.18 ? 387 HOH E O   1 
HETATM 2551 O O   . HOH C 3 .   ? 27.824  2.761  14.907  1.00 37.72 ? 388 HOH E O   1 
HETATM 2552 O O   . HOH C 3 .   ? 26.708  1.263  22.585  1.00 48.82 ? 389 HOH E O   1 
HETATM 2553 O O   . HOH C 3 .   ? 17.592  -1.073 3.761   1.00 33.69 ? 390 HOH E O   1 
HETATM 2554 O O   . HOH C 3 .   ? 15.199  19.688 26.750  1.00 39.34 ? 391 HOH E O   1 
HETATM 2555 O O   . HOH C 3 .   ? -9.744  20.375 14.653  1.00 41.79 ? 392 HOH E O   1 
HETATM 2556 O O   . HOH C 3 .   ? -8.233  21.189 7.165   1.00 51.18 ? 393 HOH E O   1 
HETATM 2557 O O   . HOH C 3 .   ? 29.712  23.575 6.455   1.00 39.64 ? 394 HOH E O   1 
HETATM 2558 O O   . HOH C 3 .   ? 31.797  24.535 8.136   1.00 35.62 ? 395 HOH E O   1 
HETATM 2559 O O   . HOH C 3 .   ? 22.142  25.259 26.294  1.00 41.03 ? 396 HOH E O   1 
HETATM 2560 O O   . HOH C 3 .   ? -6.461  26.431 18.420  1.00 42.09 ? 397 HOH E O   1 
HETATM 2561 O O   . HOH C 3 .   ? -8.605  28.229 17.185  1.00 35.93 ? 398 HOH E O   1 
HETATM 2562 O O   . HOH C 3 .   ? 36.290  27.834 24.971  1.00 44.61 ? 399 HOH E O   1 
HETATM 2563 O O   . HOH C 3 .   ? 18.116  46.945 12.592  1.00 41.82 ? 400 HOH E O   1 
HETATM 2564 O O   . HOH C 3 .   ? 17.838  44.264 18.425  1.00 39.33 ? 401 HOH E O   1 
HETATM 2565 O O   . HOH C 3 .   ? 9.370   43.226 5.819   1.00 44.68 ? 402 HOH E O   1 
HETATM 2566 O O   . HOH C 3 .   ? 4.724   32.030 -3.886  1.00 44.73 ? 403 HOH E O   1 
HETATM 2567 O O   . HOH C 3 .   ? -5.818  42.799 13.863  1.00 35.03 ? 404 HOH E O   1 
HETATM 2568 O O   . HOH C 3 .   ? -8.876  34.948 -13.152 1.00 38.24 ? 405 HOH E O   1 
HETATM 2569 O O   . HOH C 3 .   ? 0.138   34.402 28.109  1.00 42.85 ? 406 HOH E O   1 
HETATM 2570 O O   . HOH C 3 .   ? 0.169   41.269 -0.499  1.00 46.57 ? 407 HOH E O   1 
HETATM 2571 O O   . HOH C 3 .   ? 2.125   35.528 23.633  1.00 30.88 ? 408 HOH E O   1 
HETATM 2572 O O   . HOH C 3 .   ? -2.296  34.947 25.905  1.00 43.28 ? 409 HOH E O   1 
HETATM 2573 O O   . HOH C 3 .   ? 23.521  38.631 19.568  1.00 45.01 ? 410 HOH E O   1 
HETATM 2574 O O   . HOH C 3 .   ? 29.073  37.630 18.184  1.00 38.60 ? 411 HOH E O   1 
HETATM 2575 O O   . HOH C 3 .   ? 21.333  6.124  22.938  1.00 46.18 ? 412 HOH E O   1 
HETATM 2576 O O   . HOH C 3 .   ? 15.586  -0.808 10.980  1.00 37.37 ? 413 HOH E O   1 
HETATM 2577 O O   . HOH C 3 .   ? 10.858  -0.064 6.576   1.00 43.75 ? 414 HOH E O   1 
HETATM 2578 O O   . HOH C 3 .   ? 18.610  14.418 24.189  1.00 58.50 ? 415 HOH E O   1 
HETATM 2579 O O   . HOH C 3 .   ? 21.322  15.578 25.482  1.00 47.87 ? 416 HOH E O   1 
HETATM 2580 O O   . HOH C 3 .   ? 22.729  19.292 26.130  1.00 52.89 ? 417 HOH E O   1 
HETATM 2581 O O   . HOH C 3 .   ? -6.523  22.576 4.822   1.00 47.53 ? 418 HOH E O   1 
HETATM 2582 O O   . HOH C 3 .   ? -4.630  44.583 9.785   1.00 46.04 ? 419 HOH E O   1 
HETATM 2583 O O   . HOH C 3 .   ? 6.202   43.181 13.872  1.00 55.16 ? 420 HOH E O   1 
HETATM 2584 O O   . HOH C 3 .   ? 11.068  42.335 23.655  1.00 40.41 ? 421 HOH E O   1 
HETATM 2585 O O   . HOH C 3 .   ? 3.454   32.802 27.242  1.00 51.99 ? 422 HOH E O   1 
HETATM 2586 O O   . HOH C 3 .   ? -15.333 34.090 20.141  1.00 47.05 ? 423 HOH E O   1 
HETATM 2587 O O   . HOH C 3 .   ? 11.739  12.422 17.914  1.00 45.77 ? 424 HOH E O   1 
HETATM 2588 O O   . HOH C 3 .   ? 23.810  11.372 -5.006  1.00 55.81 ? 425 HOH E O   1 
HETATM 2589 O O   . HOH C 3 .   ? 24.322  23.757 -0.227  1.00 53.73 ? 426 HOH E O   1 
HETATM 2590 O O   . HOH C 3 .   ? 24.644  25.494 29.788  1.00 47.78 ? 427 HOH E O   1 
HETATM 2591 O O   . HOH C 3 .   ? 29.547  26.052 27.943  1.00 45.24 ? 428 HOH E O   1 
HETATM 2592 O O   . HOH C 3 .   ? 19.496  27.355 30.210  1.00 55.78 ? 429 HOH E O   1 
HETATM 2593 O O   . HOH C 3 .   ? -11.758 29.121 -5.245  1.00 53.25 ? 430 HOH E O   1 
HETATM 2594 O O   . HOH C 3 .   ? 6.397   8.866  2.538   1.00 48.29 ? 431 HOH E O   1 
HETATM 2595 O O   . HOH C 3 .   ? 10.307  17.260 -1.856  1.00 44.98 ? 432 HOH E O   1 
HETATM 2596 O O   . HOH C 3 .   ? 9.209   18.354 26.132  1.00 48.12 ? 433 HOH E O   1 
HETATM 2597 O O   . HOH C 3 .   ? 30.580  28.539 25.809  1.00 55.53 ? 434 HOH E O   1 
HETATM 2598 O O   . HOH C 3 .   ? -13.279 47.162 8.074   1.00 50.17 ? 435 HOH E O   1 
HETATM 2599 O O   . HOH C 3 .   ? 35.160  28.364 14.339  1.00 48.27 ? 436 HOH E O   1 
HETATM 2600 O O   . HOH C 3 .   ? -1.990  44.697 8.951   1.00 47.10 ? 437 HOH E O   1 
HETATM 2601 O O   . HOH C 3 .   ? 22.904  31.980 0.637   1.00 51.92 ? 438 HOH E O   1 
HETATM 2602 O O   . HOH C 3 .   ? -15.139 37.665 17.798  1.00 40.77 ? 439 HOH E O   1 
HETATM 2603 O O   . HOH C 3 .   ? 18.859  13.141 -6.107  1.00 59.81 ? 440 HOH E O   1 
HETATM 2604 O O   . HOH C 3 .   ? 27.588  8.492  -1.211  1.00 53.40 ? 441 HOH E O   1 
HETATM 2605 O O   . HOH C 3 .   ? 34.182  2.012  16.120  1.00 54.53 ? 442 HOH E O   1 
HETATM 2606 O O   . HOH C 3 .   ? 1.636   17.117 3.544   1.00 52.50 ? 443 HOH E O   1 
HETATM 2607 O O   . HOH C 3 .   ? 18.301  25.892 27.128  1.00 26.78 ? 444 HOH E O   1 
HETATM 2608 O O   . HOH C 3 .   ? -4.680  44.080 5.508   1.00 53.93 ? 445 HOH E O   1 
HETATM 2609 O O   . HOH C 3 .   ? 27.057  -2.283 3.313   1.00 53.56 ? 446 HOH E O   1 
HETATM 2610 O O   . HOH C 3 .   ? -7.500  46.207 10.318  1.00 49.32 ? 447 HOH E O   1 
HETATM 2611 O O   . HOH C 3 .   ? 22.591  33.812 23.645  1.00 41.24 ? 448 HOH E O   1 
HETATM 2612 O O   . HOH C 3 .   ? 22.179  14.332 -2.720  1.00 56.97 ? 449 HOH E O   1 
HETATM 2613 O O   . HOH C 3 .   ? 24.173  5.715  22.915  1.00 48.57 ? 450 HOH E O   1 
HETATM 2614 O O   . HOH C 3 .   ? -9.992  29.718 -8.233  1.00 52.13 ? 451 HOH E O   1 
HETATM 2615 O O   . HOH C 3 .   ? 32.556  33.148 18.963  1.00 44.49 ? 452 HOH E O   1 
HETATM 2616 O O   . HOH C 3 .   ? -9.570  31.889 -10.609 1.00 46.98 ? 453 HOH E O   1 
HETATM 2617 O O   . HOH C 3 .   ? 30.731  15.118 23.878  1.00 50.35 ? 454 HOH E O   1 
HETATM 2618 O O   . HOH C 3 .   ? -11.070 43.200 3.328   1.00 53.06 ? 455 HOH E O   1 
HETATM 2619 O O   . HOH C 3 .   ? -11.228 38.947 -1.625  1.00 59.24 ? 456 HOH E O   1 
HETATM 2620 O O   . HOH C 3 .   ? 8.185   39.302 27.454  1.00 60.09 ? 457 HOH E O   1 
HETATM 2621 O O   . HOH C 3 .   ? 38.001  14.148 18.008  1.00 55.00 ? 458 HOH E O   1 
HETATM 2622 O O   . HOH C 3 .   ? 31.796  -0.284 4.889   1.00 57.06 ? 459 HOH E O   1 
HETATM 2623 O O   . HOH C 3 .   ? -10.807 30.392 18.496  1.00 39.27 ? 460 HOH E O   1 
HETATM 2624 O O   . HOH C 3 .   ? 4.079   22.364 5.000   1.00 17.45 ? 461 HOH E O   1 
HETATM 2625 O O   . HOH C 3 .   ? 16.150  12.323 1.359   1.00 16.07 ? 462 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL E . n 
A 1 2   ASP 2   2   2   ASP ASP E . n 
A 1 3   GLU 3   3   3   GLU GLU E . n 
A 1 4   GLN 4   4   4   GLN GLN E . n 
A 1 5   PRO 5   5   5   PRO PRO E . n 
A 1 6   LEU 6   6   6   LEU LEU E . n 
A 1 7   GLU 7   7   7   GLU GLU E . n 
A 1 8   ASN 8   8   8   ASN ASN E . n 
A 1 9   TYR 9   9   9   TYR TYR E . n 
A 1 10  LEU 10  10  10  LEU LEU E . n 
A 1 11  ASP 11  11  11  ASP ASP E . n 
A 1 12  MET 12  12  12  MET MET E . n 
A 1 13  GLU 13  13  13  GLU GLU E . n 
A 1 14  TYR 14  14  14  TYR TYR E . n 
A 1 15  PHE 15  15  15  PHE PHE E . n 
A 1 16  GLY 16  16  16  GLY GLY E . n 
A 1 17  THR 17  17  17  THR THR E . n 
A 1 18  ILE 18  18  18  ILE ILE E . n 
A 1 19  GLY 19  19  19  GLY GLY E . n 
A 1 20  ILE 20  20  20  ILE ILE E . n 
A 1 21  GLY 21  21  21  GLY GLY E . n 
A 1 22  THR 22  22  22  THR THR E . n 
A 1 23  PRO 23  23  23  PRO PRO E . n 
A 1 24  ALA 24  24  24  ALA ALA E . n 
A 1 25  GLN 25  25  25  GLN GLN E . n 
A 1 26  ASP 26  26  26  ASP ASP E . n 
A 1 27  PHE 27  27  27  PHE PHE E . n 
A 1 28  THR 28  28  28  THR THR E . n 
A 1 29  VAL 29  29  29  VAL VAL E . n 
A 1 30  VAL 30  30  30  VAL VAL E . n 
A 1 31  PHE 31  31  31  PHE PHE E . n 
A 1 32  ASP 32  32  32  ASP ASP E . n 
A 1 33  THR 33  33  33  THR THR E . n 
A 1 34  GLY 34  34  34  GLY GLY E . n 
A 1 35  SER 35  35  35  SER SER E . n 
A 1 36  SER 36  36  36  SER SER E . n 
A 1 37  ASN 37  37  37  ASN ASN E . n 
A 1 38  LEU 38  38  38  LEU LEU E . n 
A 1 39  TRP 39  39  39  TRP TRP E . n 
A 1 40  VAL 40  40  40  VAL VAL E . n 
A 1 41  PRO 41  41  41  PRO PRO E . n 
A 1 42  SER 42  42  42  SER SER E . n 
A 1 43  VAL 43  43  43  VAL VAL E . n 
A 1 44  TYR 44  44  44  TYR TYR E . n 
A 1 45  CYS 45  45  45  CYS CYS E . n 
A 1 46  SER 46  46  46  SER SER E . n 
A 1 47  SER 47  47  47  SER SER E . n 
A 1 48  LEU 48  48  48  LEU LEU E . n 
A 1 49  ALA 49  49  49  ALA ALA E . n 
A 1 50  CYS 50  50  50  CYS CYS E . n 
A 1 51  THR 51  51  51  THR THR E . n 
A 1 52  ASN 52  52  52  ASN ASN E . n 
A 1 53  HIS 53  53  53  HIS HIS E . n 
A 1 54  ASN 54  54  54  ASN ASN E . n 
A 1 55  ARG 55  55  55  ARG ARG E . n 
A 1 56  PHE 56  56  56  PHE PHE E . n 
A 1 57  ASN 57  57  57  ASN ASN E . n 
A 1 58  PRO 58  58  58  PRO PRO E . n 
A 1 59  GLU 59  59  59  GLU GLU E . n 
A 1 60  ASP 60  60  60  ASP ASP E . n 
A 1 61  SER 61  61  61  SER SER E . n 
A 1 62  SER 62  62  62  SER SER E . n 
A 1 63  THR 63  63  63  THR THR E . n 
A 1 64  TYR 64  64  64  TYR TYR E . n 
A 1 65  GLN 65  65  65  GLN GLN E . n 
A 1 66  SER 66  66  66  SER SER E . n 
A 1 67  THR 67  67  67  THR THR E . n 
A 1 68  SER 68  68  68  SER SER E . n 
A 1 69  GLU 69  69  69  GLU GLU E . n 
A 1 70  THR 70  70  70  THR THR E . n 
A 1 71  VAL 71  71  71  VAL VAL E . n 
A 1 72  SER 72  72  72  SER SER E . n 
A 1 73  ILE 73  73  73  ILE ILE E . n 
A 1 74  THR 74  74  74  THR THR E . n 
A 1 75  TYR 75  75  75  TYR TYR E . n 
A 1 76  GLY 76  76  76  GLY GLY E . n 
A 1 77  THR 77  77  77  THR THR E . n 
A 1 78  GLY 78  78  78  GLY GLY E . n 
A 1 79  SER 79  79  79  SER SER E . n 
A 1 80  MET 80  80  80  MET MET E . n 
A 1 81  THR 81  81  81  THR THR E . n 
A 1 82  GLY 82  82  82  GLY GLY E . n 
A 1 83  ILE 83  83  83  ILE ILE E . n 
A 1 84  LEU 84  84  84  LEU LEU E . n 
A 1 85  GLY 85  85  85  GLY GLY E . n 
A 1 86  TYR 86  86  86  TYR TYR E . n 
A 1 87  ASP 87  87  87  ASP ASP E . n 
A 1 88  THR 88  88  88  THR THR E . n 
A 1 89  VAL 89  89  89  VAL VAL E . n 
A 1 90  GLN 90  90  90  GLN GLN E . n 
A 1 91  VAL 91  91  91  VAL VAL E . n 
A 1 92  GLY 92  92  92  GLY GLY E . n 
A 1 93  GLY 93  93  93  GLY GLY E . n 
A 1 94  ILE 94  94  94  ILE ILE E . n 
A 1 95  SER 95  95  95  SER SER E . n 
A 1 96  ASP 96  96  96  ASP ASP E . n 
A 1 97  THR 97  97  97  THR THR E . n 
A 1 98  ASN 98  98  98  ASN ASN E . n 
A 1 99  GLN 99  99  99  GLN GLN E . n 
A 1 100 ILE 100 100 100 ILE ILE E . n 
A 1 101 PHE 101 101 101 PHE PHE E . n 
A 1 102 GLY 102 102 102 GLY GLY E . n 
A 1 103 LEU 103 103 103 LEU LEU E . n 
A 1 104 SER 104 104 104 SER SER E . n 
A 1 105 GLU 105 105 105 GLU GLU E . n 
A 1 106 THR 106 106 106 THR THR E . n 
A 1 107 GLU 107 107 107 GLU GLU E . n 
A 1 108 PRO 108 108 108 PRO PRO E . n 
A 1 109 GLY 109 109 109 GLY GLY E . n 
A 1 110 SER 110 110 110 SER SER E . n 
A 1 111 PHE 111 111 111 PHE PHE E . n 
A 1 112 LEU 112 112 112 LEU LEU E . n 
A 1 113 TYR 113 113 113 TYR TYR E . n 
A 1 114 TYR 114 114 114 TYR TYR E . n 
A 1 115 ALA 115 115 115 ALA ALA E . n 
A 1 116 PRO 116 116 116 PRO PRO E . n 
A 1 117 PHE 117 117 117 PHE PHE E . n 
A 1 118 ASP 118 118 118 ASP ASP E . n 
A 1 119 GLY 119 119 119 GLY GLY E . n 
A 1 120 ILE 120 120 120 ILE ILE E . n 
A 1 121 LEU 121 121 121 LEU LEU E . n 
A 1 122 GLY 122 122 122 GLY GLY E . n 
A 1 123 LEU 123 123 123 LEU LEU E . n 
A 1 124 ALA 124 124 124 ALA ALA E . n 
A 1 125 TYR 125 125 125 TYR TYR E . n 
A 1 126 PRO 126 126 126 PRO PRO E . n 
A 1 127 SER 127 127 127 SER SER E . n 
A 1 128 ILE 128 128 128 ILE ILE E . n 
A 1 129 SER 129 129 129 SER SER E . n 
A 1 130 SER 130 130 130 SER SER E . n 
A 1 131 SER 131 131 131 SER SER E . n 
A 1 132 GLY 132 132 132 GLY GLY E . n 
A 1 133 ALA 133 133 133 ALA ALA E . n 
A 1 134 THR 134 134 134 THR THR E . n 
A 1 135 PRO 135 135 135 PRO PRO E . n 
A 1 136 VAL 136 136 136 VAL VAL E . n 
A 1 137 PHE 137 137 137 PHE PHE E . n 
A 1 138 ASP 138 138 138 ASP ASP E . n 
A 1 139 ASN 139 139 139 ASN ASN E . n 
A 1 140 ILE 140 140 140 ILE ILE E . n 
A 1 141 TRP 141 141 141 TRP TRP E . n 
A 1 142 ASN 142 142 142 ASN ASN E . n 
A 1 143 GLN 143 143 143 GLN GLN E . n 
A 1 144 GLY 144 144 144 GLY GLY E . n 
A 1 145 LEU 145 145 145 LEU LEU E . n 
A 1 146 VAL 146 146 146 VAL VAL E . n 
A 1 147 SER 147 147 147 SER SER E . n 
A 1 148 GLN 148 148 148 GLN GLN E . n 
A 1 149 ASP 149 149 149 ASP ASP E . n 
A 1 150 LEU 150 150 150 LEU LEU E . n 
A 1 151 PHE 151 151 151 PHE PHE E . n 
A 1 152 SER 152 152 152 SER SER E . n 
A 1 153 VAL 153 153 153 VAL VAL E . n 
A 1 154 TYR 154 154 154 TYR TYR E . n 
A 1 155 LEU 155 155 155 LEU LEU E . n 
A 1 156 SER 156 156 156 SER SER E . n 
A 1 157 ALA 157 157 157 ALA ALA E . n 
A 1 158 ASP 158 158 158 ASP ASP E . n 
A 1 159 ASP 159 159 159 ASP ASP E . n 
A 1 160 GLN 160 160 160 GLN GLN E . n 
A 1 161 SER 161 161 161 SER SER E . n 
A 1 162 GLY 162 162 162 GLY GLY E . n 
A 1 163 SER 163 163 163 SER SER E . n 
A 1 164 VAL 164 164 164 VAL VAL E . n 
A 1 165 VAL 165 165 165 VAL VAL E . n 
A 1 166 ILE 166 166 166 ILE ILE E . n 
A 1 167 PHE 167 167 167 PHE PHE E . n 
A 1 168 GLY 168 168 168 GLY GLY E . n 
A 1 169 GLY 169 169 169 GLY GLY E . n 
A 1 170 ILE 170 170 170 ILE ILE E . n 
A 1 171 ASP 171 171 171 ASP ASP E . n 
A 1 172 SER 172 172 172 SER SER E . n 
A 1 173 SER 173 173 173 SER SER E . n 
A 1 174 TYR 174 174 174 TYR TYR E . n 
A 1 175 TYR 175 175 175 TYR TYR E . n 
A 1 176 THR 176 176 176 THR THR E . n 
A 1 177 GLY 177 177 177 GLY GLY E . n 
A 1 178 SER 178 178 178 SER SER E . n 
A 1 179 LEU 179 179 179 LEU LEU E . n 
A 1 180 ASN 180 180 180 ASN ASN E . n 
A 1 181 TRP 181 181 181 TRP TRP E . n 
A 1 182 VAL 182 182 182 VAL VAL E . n 
A 1 183 PRO 183 183 183 PRO PRO E . n 
A 1 184 VAL 184 184 184 VAL VAL E . n 
A 1 185 THR 185 185 185 THR THR E . n 
A 1 186 VAL 186 186 186 VAL VAL E . n 
A 1 187 GLU 187 187 187 GLU GLU E . n 
A 1 188 GLY 188 188 188 GLY GLY E . n 
A 1 189 TYR 189 189 189 TYR TYR E . n 
A 1 190 TRP 190 190 190 TRP TRP E . n 
A 1 191 GLN 191 191 191 GLN GLN E . n 
A 1 192 ILE 192 192 192 ILE ILE E . n 
A 1 193 THR 193 193 193 THR THR E . n 
A 1 194 VAL 194 194 194 VAL VAL E . n 
A 1 195 ASP 195 195 195 ASP ASP E . n 
A 1 196 SER 196 196 196 SER SER E . n 
A 1 197 ILE 197 197 197 ILE ILE E . n 
A 1 198 THR 198 198 198 THR THR E . n 
A 1 199 MET 199 199 199 MET MET E . n 
A 1 200 ASN 200 200 200 ASN ASN E . n 
A 1 201 GLY 201 201 201 GLY GLY E . n 
A 1 202 GLU 202 202 202 GLU GLU E . n 
A 1 203 ALA 203 203 203 ALA ALA E . n 
A 1 204 ILE 204 204 204 ILE ILE E . n 
A 1 205 ALA 205 205 205 ALA ALA E . n 
A 1 206 CYS 206 206 206 CYS CYS E . n 
A 1 207 ALA 207 207 207 ALA ALA E . n 
A 1 208 GLU 208 208 208 GLU GLU E . n 
A 1 209 GLY 209 209 209 GLY GLY E . n 
A 1 210 CYS 210 210 210 CYS CYS E . n 
A 1 211 GLN 211 211 211 GLN GLN E . n 
A 1 212 ALA 212 212 212 ALA ALA E . n 
A 1 213 ILE 213 213 213 ILE ILE E . n 
A 1 214 VAL 214 214 214 VAL VAL E . n 
A 1 215 ASP 215 215 215 ASP ASP E . n 
A 1 216 THR 216 216 216 THR THR E . n 
A 1 217 GLY 217 217 217 GLY GLY E . n 
A 1 218 THR 218 218 218 THR THR E . n 
A 1 219 SER 219 219 219 SER SER E . n 
A 1 220 LEU 220 220 220 LEU LEU E . n 
A 1 221 LEU 221 221 221 LEU LEU E . n 
A 1 222 THR 222 222 222 THR THR E . n 
A 1 223 GLY 223 223 223 GLY GLY E . n 
A 1 224 PRO 224 224 224 PRO PRO E . n 
A 1 225 THR 225 225 225 THR THR E . n 
A 1 226 SER 226 226 226 SER SER E . n 
A 1 227 PRO 227 227 227 PRO PRO E . n 
A 1 228 ILE 228 228 228 ILE ILE E . n 
A 1 229 ALA 229 229 229 ALA ALA E . n 
A 1 230 ASN 230 230 230 ASN ASN E . n 
A 1 231 ILE 231 231 231 ILE ILE E . n 
A 1 232 GLN 232 232 232 GLN GLN E . n 
A 1 233 SER 233 233 233 SER SER E . n 
A 1 234 ASP 234 234 234 ASP ASP E . n 
A 1 235 ILE 235 235 235 ILE ILE E . n 
A 1 236 GLY 236 236 236 GLY GLY E . n 
A 1 237 ALA 237 237 237 ALA ALA E . n 
A 1 238 SER 238 238 238 SER SER E . n 
A 1 239 GLU 239 239 239 GLU GLU E . n 
A 1 240 ASN 240 240 240 ASN ASN E . n 
A 1 241 SER 241 241 241 SER SER E . n 
A 1 242 ASP 242 242 242 ASP ASP E . n 
A 1 243 GLY 243 243 243 GLY GLY E . n 
A 1 244 ASP 244 244 244 ASP ASP E . n 
A 1 245 MET 245 245 245 MET MET E . n 
A 1 246 VAL 246 246 246 VAL VAL E . n 
A 1 247 VAL 247 247 247 VAL VAL E . n 
A 1 248 SER 248 248 248 SER SER E . n 
A 1 249 CYS 249 249 249 CYS CYS E . n 
A 1 250 SER 250 250 250 SER SER E . n 
A 1 251 ALA 251 251 251 ALA ALA E . n 
A 1 252 ILE 252 252 252 ILE ILE E . n 
A 1 253 SER 253 253 253 SER SER E . n 
A 1 254 SER 254 254 254 SER SER E . n 
A 1 255 LEU 255 255 255 LEU LEU E . n 
A 1 256 PRO 256 256 256 PRO PRO E . n 
A 1 257 ASP 257 257 257 ASP ASP E . n 
A 1 258 ILE 258 258 258 ILE ILE E . n 
A 1 259 VAL 259 259 259 VAL VAL E . n 
A 1 260 PHE 260 260 260 PHE PHE E . n 
A 1 261 THR 261 261 261 THR THR E . n 
A 1 262 ILE 262 262 262 ILE ILE E . n 
A 1 263 ASN 263 263 263 ASN ASN E . n 
A 1 264 GLY 264 264 264 GLY GLY E . n 
A 1 265 VAL 265 265 265 VAL VAL E . n 
A 1 266 GLN 266 266 266 GLN GLN E . n 
A 1 267 TYR 267 267 267 TYR TYR E . n 
A 1 268 PRO 268 268 268 PRO PRO E . n 
A 1 269 VAL 269 269 269 VAL VAL E . n 
A 1 270 PRO 270 270 270 PRO PRO E . n 
A 1 271 PRO 271 271 271 PRO PRO E . n 
A 1 272 SER 272 272 272 SER SER E . n 
A 1 273 ALA 273 273 273 ALA ALA E . n 
A 1 274 TYR 274 274 274 TYR TYR E . n 
A 1 275 ILE 275 275 275 ILE ILE E . n 
A 1 276 LEU 276 276 276 LEU LEU E . n 
A 1 277 GLN 277 277 277 GLN GLN E . n 
A 1 278 SER 278 278 278 SER SER E . n 
A 1 279 GLU 279 279 279 GLU GLU E . n 
A 1 280 GLY 280 280 280 GLY GLY E . n 
A 1 281 SER 281 281 281 SER SER E . n 
A 1 282 CYS 282 282 282 CYS CYS E . n 
A 1 283 ILE 283 283 283 ILE ILE E . n 
A 1 284 SER 284 284 284 SER SER E . n 
A 1 285 GLY 285 285 285 GLY GLY E . n 
A 1 286 PHE 286 286 286 PHE PHE E . n 
A 1 287 GLN 287 287 287 GLN GLN E . n 
A 1 288 GLY 288 288 288 GLY GLY E . n 
A 1 289 MET 289 289 289 MET MET E . n 
A 1 290 ASN 290 290 290 ASN ASN E . n 
A 1 291 LEU 291 291 291 LEU LEU E . n 
A 1 292 PRO 292 292 292 PRO PRO E . n 
A 1 293 THR 293 293 293 THR THR E . n 
A 1 294 GLU 294 294 294 GLU GLU E . n 
A 1 295 SER 295 295 295 SER SER E . n 
A 1 296 GLY 296 296 296 GLY GLY E . n 
A 1 297 GLU 297 297 297 GLU GLU E . n 
A 1 298 LEU 298 298 298 LEU LEU E . n 
A 1 299 TRP 299 299 299 TRP TRP E . n 
A 1 300 ILE 300 300 300 ILE ILE E . n 
A 1 301 LEU 301 301 301 LEU LEU E . n 
A 1 302 GLY 302 302 302 GLY GLY E . n 
A 1 303 ASP 303 303 303 ASP ASP E . n 
A 1 304 VAL 304 304 304 VAL VAL E . n 
A 1 305 PHE 305 305 305 PHE PHE E . n 
A 1 306 ILE 306 306 306 ILE ILE E . n 
A 1 307 ARG 307 307 307 ARG ARG E . n 
A 1 308 GLN 308 308 308 GLN GLN E . n 
A 1 309 TYR 309 309 309 TYR TYR E . n 
A 1 310 PHE 310 310 310 PHE PHE E . n 
A 1 311 THR 311 311 311 THR THR E . n 
A 1 312 VAL 312 312 312 VAL VAL E . n 
A 1 313 PHE 313 313 313 PHE PHE E . n 
A 1 314 ASP 314 314 314 ASP ASP E . n 
A 1 315 ARG 315 315 315 ARG ARG E . n 
A 1 316 ALA 316 316 316 ALA ALA E . n 
A 1 317 ASN 317 317 317 ASN ASN E . n 
A 1 318 ASN 318 318 318 ASN ASN E . n 
A 1 319 GLN 319 319 319 GLN GLN E . n 
A 1 320 VAL 320 320 320 VAL VAL E . n 
A 1 321 GLY 321 321 321 GLY GLY E . n 
A 1 322 LEU 322 322 322 LEU LEU E . n 
A 1 323 ALA 323 323 323 ALA ALA E . n 
A 1 324 PRO 324 324 324 PRO PRO E . n 
A 1 325 VAL 325 325 325 VAL VAL E . n 
A 1 326 ALA 326 326 326 ALA ALA E . n 
# 
_pdbx_molecule_features.prd_id    PRD_000657 
_pdbx_molecule_features.name      'IVA VAL VAL P0L ALA MA' 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000657 
_pdbx_molecule.asym_id       B 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-12-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' Other                       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SDMS     'data collection' . ? 1 
SDMS     'data reduction'  . ? 2 
XTALVIEW refinement        . ? 3 
GROMOS87 refinement        . ? 4 
SDMS     'data scaling'    . ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             E 
_pdbx_validate_rmsd_angle.auth_comp_id_1             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              174 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             E 
_pdbx_validate_rmsd_angle.auth_comp_id_2             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_2              174 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             E 
_pdbx_validate_rmsd_angle.auth_comp_id_3             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_3              174 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                115.89 
_pdbx_validate_rmsd_angle.angle_target_value         121.00 
_pdbx_validate_rmsd_angle.angle_deviation            -5.11 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP E 11  ? ? 59.54 19.45 
2 1 ASP E 159 ? ? 57.24 14.77 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 SER E 72  ? ? 10.94 
2 1 SER E 278 ? ? 11.41 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;methyl N-[(2S)-2-({(S)-hydroxy[(1R)-3-methyl-1-{[N-(3-methylbutanoyl)-L-valyl-L-valyl]amino}butyl]phosphoryl}oxy)-3-phenylpropanoyl]-L-alanyl-L-alaninate
;
HH0 
3 water HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HH0 1   327 327 HH0 HH0 E . 
C 3 HOH 1   328 328 HOH HOH E . 
C 3 HOH 2   329 329 HOH HOH E . 
C 3 HOH 3   330 330 HOH HOH E . 
C 3 HOH 4   331 331 HOH HOH E . 
C 3 HOH 5   332 332 HOH HOH E . 
C 3 HOH 6   333 333 HOH HOH E . 
C 3 HOH 7   334 334 HOH HOH E . 
C 3 HOH 8   335 335 HOH HOH E . 
C 3 HOH 9   336 336 HOH HOH E . 
C 3 HOH 10  337 337 HOH HOH E . 
C 3 HOH 11  338 338 HOH HOH E . 
C 3 HOH 12  339 339 HOH HOH E . 
C 3 HOH 13  340 340 HOH HOH E . 
C 3 HOH 14  341 341 HOH HOH E . 
C 3 HOH 15  342 342 HOH HOH E . 
C 3 HOH 16  343 343 HOH HOH E . 
C 3 HOH 17  344 344 HOH HOH E . 
C 3 HOH 18  345 345 HOH HOH E . 
C 3 HOH 19  346 346 HOH HOH E . 
C 3 HOH 20  347 347 HOH HOH E . 
C 3 HOH 21  348 348 HOH HOH E . 
C 3 HOH 22  349 349 HOH HOH E . 
C 3 HOH 23  350 350 HOH HOH E . 
C 3 HOH 24  351 351 HOH HOH E . 
C 3 HOH 25  352 352 HOH HOH E . 
C 3 HOH 26  353 353 HOH HOH E . 
C 3 HOH 27  354 354 HOH HOH E . 
C 3 HOH 28  355 355 HOH HOH E . 
C 3 HOH 29  356 356 HOH HOH E . 
C 3 HOH 30  357 357 HOH HOH E . 
C 3 HOH 31  358 358 HOH HOH E . 
C 3 HOH 32  359 359 HOH HOH E . 
C 3 HOH 33  360 360 HOH HOH E . 
C 3 HOH 34  361 361 HOH HOH E . 
C 3 HOH 35  362 362 HOH HOH E . 
C 3 HOH 36  363 363 HOH HOH E . 
C 3 HOH 37  364 364 HOH HOH E . 
C 3 HOH 38  365 365 HOH HOH E . 
C 3 HOH 39  366 366 HOH HOH E . 
C 3 HOH 40  367 367 HOH HOH E . 
C 3 HOH 41  368 368 HOH HOH E . 
C 3 HOH 42  369 369 HOH HOH E . 
C 3 HOH 43  370 370 HOH HOH E . 
C 3 HOH 44  371 371 HOH HOH E . 
C 3 HOH 45  372 372 HOH HOH E . 
C 3 HOH 46  373 373 HOH HOH E . 
C 3 HOH 47  374 374 HOH HOH E . 
C 3 HOH 48  375 375 HOH HOH E . 
C 3 HOH 49  376 376 HOH HOH E . 
C 3 HOH 50  377 377 HOH HOH E . 
C 3 HOH 51  378 378 HOH HOH E . 
C 3 HOH 52  379 379 HOH HOH E . 
C 3 HOH 53  380 380 HOH HOH E . 
C 3 HOH 54  381 381 HOH HOH E . 
C 3 HOH 55  382 382 HOH HOH E . 
C 3 HOH 56  383 383 HOH HOH E . 
C 3 HOH 57  384 384 HOH HOH E . 
C 3 HOH 58  385 385 HOH HOH E . 
C 3 HOH 59  386 386 HOH HOH E . 
C 3 HOH 60  387 387 HOH HOH E . 
C 3 HOH 61  388 388 HOH HOH E . 
C 3 HOH 62  389 389 HOH HOH E . 
C 3 HOH 63  390 390 HOH HOH E . 
C 3 HOH 64  391 391 HOH HOH E . 
C 3 HOH 65  392 392 HOH HOH E . 
C 3 HOH 66  393 393 HOH HOH E . 
C 3 HOH 67  394 394 HOH HOH E . 
C 3 HOH 68  395 395 HOH HOH E . 
C 3 HOH 69  396 396 HOH HOH E . 
C 3 HOH 70  397 397 HOH HOH E . 
C 3 HOH 71  398 398 HOH HOH E . 
C 3 HOH 72  399 399 HOH HOH E . 
C 3 HOH 73  400 400 HOH HOH E . 
C 3 HOH 74  401 401 HOH HOH E . 
C 3 HOH 75  402 402 HOH HOH E . 
C 3 HOH 76  403 403 HOH HOH E . 
C 3 HOH 77  404 404 HOH HOH E . 
C 3 HOH 78  405 405 HOH HOH E . 
C 3 HOH 79  406 406 HOH HOH E . 
C 3 HOH 80  407 407 HOH HOH E . 
C 3 HOH 81  408 408 HOH HOH E . 
C 3 HOH 82  409 409 HOH HOH E . 
C 3 HOH 83  410 410 HOH HOH E . 
C 3 HOH 84  411 411 HOH HOH E . 
C 3 HOH 85  412 412 HOH HOH E . 
C 3 HOH 86  413 413 HOH HOH E . 
C 3 HOH 87  414 414 HOH HOH E . 
C 3 HOH 88  415 415 HOH HOH E . 
C 3 HOH 89  416 416 HOH HOH E . 
C 3 HOH 90  417 417 HOH HOH E . 
C 3 HOH 91  418 418 HOH HOH E . 
C 3 HOH 92  419 419 HOH HOH E . 
C 3 HOH 93  420 420 HOH HOH E . 
C 3 HOH 94  421 421 HOH HOH E . 
C 3 HOH 95  422 422 HOH HOH E . 
C 3 HOH 96  423 423 HOH HOH E . 
C 3 HOH 97  424 424 HOH HOH E . 
C 3 HOH 98  425 425 HOH HOH E . 
C 3 HOH 99  426 426 HOH HOH E . 
C 3 HOH 100 427 427 HOH HOH E . 
C 3 HOH 101 428 428 HOH HOH E . 
C 3 HOH 102 429 429 HOH HOH E . 
C 3 HOH 103 430 430 HOH HOH E . 
C 3 HOH 104 431 431 HOH HOH E . 
C 3 HOH 105 432 432 HOH HOH E . 
C 3 HOH 106 433 433 HOH HOH E . 
C 3 HOH 107 434 434 HOH HOH E . 
C 3 HOH 108 435 435 HOH HOH E . 
C 3 HOH 109 436 436 HOH HOH E . 
C 3 HOH 110 437 437 HOH HOH E . 
C 3 HOH 111 438 438 HOH HOH E . 
C 3 HOH 112 439 439 HOH HOH E . 
C 3 HOH 113 440 440 HOH HOH E . 
C 3 HOH 114 441 441 HOH HOH E . 
C 3 HOH 115 442 442 HOH HOH E . 
C 3 HOH 116 443 443 HOH HOH E . 
C 3 HOH 117 444 444 HOH HOH E . 
C 3 HOH 118 445 445 HOH HOH E . 
C 3 HOH 119 446 446 HOH HOH E . 
C 3 HOH 120 447 447 HOH HOH E . 
C 3 HOH 121 448 448 HOH HOH E . 
C 3 HOH 122 449 449 HOH HOH E . 
C 3 HOH 123 450 450 HOH HOH E . 
C 3 HOH 124 451 451 HOH HOH E . 
C 3 HOH 125 452 452 HOH HOH E . 
C 3 HOH 126 453 453 HOH HOH E . 
C 3 HOH 127 454 454 HOH HOH E . 
C 3 HOH 128 455 455 HOH HOH E . 
C 3 HOH 129 456 456 HOH HOH E . 
C 3 HOH 130 457 457 HOH HOH E . 
C 3 HOH 131 458 458 HOH HOH E . 
C 3 HOH 132 459 459 HOH HOH E . 
C 3 HOH 133 460 460 HOH HOH E . 
C 3 HOH 134 461 23  HOH HOH E . 
C 3 HOH 135 462 327 HOH HOH E . 
#