data_1QRV
# 
_entry.id   1QRV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QRV         
NDB   PD0110       
RCSB  RCSB009190   
WWPDB D_1000009190 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2LEF 'RELATED PROTEIN LEF-1 COMPLEXED TO DNA SEQUENCE SPECIFIC NMR'  unspecified 
PDB 1HRZ 'RELATED PROTEIN SRY COMPLEXED TO DNA SEQUENCE SPECIFIC NMR'    unspecified 
PDB 1HMA 'RELATED PROTEIN HMG1 DOMAIN A FREE NMR'                        unspecified 
PDB 1HMF 'RELATED PROTEIN HMG1 DOMAIN B FREE NMR'                        unspecified 
PDB 1CG7 'RELATED PROTEIN NHP6A'                                         unspecified 
PDB 1CKT 'RELATED PROTEIN HMG1 DOMAIN A BOUND TO CISPLATIN MODIFIED DNA' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QRV 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Murphy IV, F.V.'   1 
'Sweet, R.M.'       2 
'Churchill, M.E.A.' 3 
# 
_citation.id                        primary 
_citation.title                     
;The structure of a chromosomal high mobility group protein-DNA complex reveals sequence-neutral mechanisms important for non-sequence-specific DNA recognition.
;
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            18 
_citation.page_first                6610 
_citation.page_last                 6618 
_citation.year                      1999 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10581235 
_citation.pdbx_database_id_DOI      10.1093/emboj/18.23.6610 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Murphy IV, F.V.' 1 
primary 'Sweet, R.M.'     2 
primary 'Churchill, M.E.' 3 
# 
_cell.entry_id           1QRV 
_cell.length_a           43.740 
_cell.length_b           53.797 
_cell.length_c           86.843 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1QRV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3')
;
3045.005 2   ? ? ?               ? 
2 polymer     man 'HIGH MOBILITY GROUP PROTEIN D'                8370.515 2   ? ? 'RESIDUES 2-74' ? 
3 non-polymer syn 'SODIUM ION'                                   22.990   1   ? ? ?               ? 
4 water       nat water                                          18.015   116 ? ? ?               ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        HMG-D 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DT)(DA)(DT)(DC)(DG)(DC)'                                GCGATATCGC C,D ? 
2 'polypeptide(L)'        no no SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANG 
SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANG A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DG  n 
1 2  DC  n 
1 3  DG  n 
1 4  DA  n 
1 5  DT  n 
1 6  DA  n 
1 7  DT  n 
1 8  DC  n 
1 9  DG  n 
1 10 DC  n 
2 1  SER n 
2 2  ASP n 
2 3  LYS n 
2 4  PRO n 
2 5  LYS n 
2 6  ARG n 
2 7  PRO n 
2 8  LEU n 
2 9  SER n 
2 10 ALA n 
2 11 TYR n 
2 12 MET n 
2 13 LEU n 
2 14 TRP n 
2 15 LEU n 
2 16 ASN n 
2 17 SER n 
2 18 ALA n 
2 19 ARG n 
2 20 GLU n 
2 21 SER n 
2 22 ILE n 
2 23 LYS n 
2 24 ARG n 
2 25 GLU n 
2 26 ASN n 
2 27 PRO n 
2 28 GLY n 
2 29 ILE n 
2 30 LYS n 
2 31 VAL n 
2 32 THR n 
2 33 GLU n 
2 34 VAL n 
2 35 ALA n 
2 36 LYS n 
2 37 ARG n 
2 38 GLY n 
2 39 GLY n 
2 40 GLU n 
2 41 LEU n 
2 42 TRP n 
2 43 ARG n 
2 44 ALA n 
2 45 MET n 
2 46 LYS n 
2 47 ASP n 
2 48 LYS n 
2 49 SER n 
2 50 GLU n 
2 51 TRP n 
2 52 GLU n 
2 53 ALA n 
2 54 LYS n 
2 55 ALA n 
2 56 ALA n 
2 57 LYS n 
2 58 ALA n 
2 59 LYS n 
2 60 ASP n 
2 61 ASP n 
2 62 TYR n 
2 63 ASP n 
2 64 ARG n 
2 65 ALA n 
2 66 VAL n 
2 67 LYS n 
2 68 GLU n 
2 69 PHE n 
2 70 GLU n 
2 71 ALA n 
2 72 ASN n 
2 73 GLY n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'fruit fly' 
_entity_src_gen.gene_src_genus                     Drosophila 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET13A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP HMGD_DROME 2 Q05783 ? ? ? 
2 PDB 1QRV       1 1QRV   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QRV A 1 ? 73 ? Q05783 2  ? 74 ? 2  74 
2 1 1QRV B 1 ? 73 ? Q05783 2  ? 74 ? 2  74 
3 2 1QRV C 1 ? 10 ? 1QRV   1  ? 10 ? 1  10 
4 2 1QRV D 1 ? 10 ? 1QRV   11 ? 20 ? 11 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1QRV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.85 
_exptl_crystal_grow.pdbx_details    'PEG 3350, TRIZMA-CL, NACL, pH 7.85, VAPOR DIFFUSION, SITTING DROP, temperature 296K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 3350,' ? ? ? 
1 2 1 TRIZMA-CL   ? ? ? 
1 3 1 NACL        ? ? ? 
1 4 2 'PEG 3350,' ? ? ? 
1 5 2 TRIZMA-CL   ? ? ? 
1 6 2 NACL        ? ? ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100.0 ? 1 
2 100.0 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD           'BRANDEIS - B4'    1998-08-15 ? 
2 'IMAGE PLATE' 'RIGAKU RAXIS IIC' 1996-07-02 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9000  1.0 
2 0.9211  1.0 
3 0.92157 1.0 
4 1.05    1.0 
5 1.5418  1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON      'NSLS BEAMLINE X12C' NSLS X12C ?      0.9000,0.9211,0.92157,1.05 
2 'ROTATING ANODE' 'RIGAKU RU300'       ?    ?    1.5418 1.5418                     
# 
_reflns.entry_id                     1QRV 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   10672 
_reflns.number_all                   10672 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.0520000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.2 
_reflns.B_iso_Wilson_estimate        24.2 
_reflns.pdbx_redundancy              8.8 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           0.1980000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QRV 
_refine.ls_number_reflns_obs                     10672 
_refine.ls_number_reflns_all                     10672 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               931772.80 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    97.9 
_refine.ls_R_factor_obs                          0.2380000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2380000 
_refine.ls_R_factor_R_free                       0.2880000 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  560 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               34.2 
_refine.aniso_B[1][1]                            8.56 
_refine.aniso_B[2][2]                            -4.17 
_refine.aniso_B[3][3]                            -4.38 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.294 
_refine.solvent_model_param_bsol                 32.39 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'USED CROSS VALIDATED MAXIMUM LIKELIHOOD PROCEDURE INSTITUTED IN CNS 0.5.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'PROTEIN: ENGH & HUBER, DNA: PARKINSON ET AL.' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QRV 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1160 
_refine_hist.pdbx_number_atoms_nucleic_acid   423 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             116 
_refine_hist.number_atoms_total               1700 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      18.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.11  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.18  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.32  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.34  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.64  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             1648 
_refine_ls_shell.R_factor_R_work                  0.2660000 
_refine_ls_shell.percent_reflns_obs               97.6 
_refine_ls_shell.R_factor_R_free                  0.3320000 
_refine_ls_shell.R_factor_R_free_error            0.036 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             87 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PA PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PA DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER.PARAM    WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM      ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QRV 
_struct.title                     'CRYSTAL STRUCTURE OF THE COMPLEX OF HMG-D AND DNA' 
_struct.pdbx_descriptor           'HIGH MOBILITY GROUP PROTEIN D/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QRV 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, HMG DOMAIN, NON-SEQUENCE SPECIFIC CHROMOSOMAL PROTEIN HMG-D, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER C 9  ? GLU C 25 ? SER A 10 GLU A 26 1 ? 17 
HELX_P HELX_P2 2 LYS C 30 ? MET C 45 ? LYS A 31 MET A 46 1 ? 16 
HELX_P HELX_P3 3 LYS C 48 ? GLU C 70 ? LYS A 49 GLU A 71 1 ? 23 
HELX_P HELX_P4 4 SER D 9  ? ASN D 26 ? SER B 10 ASN B 27 1 ? 18 
HELX_P HELX_P5 5 LYS D 30 ? MET D 45 ? LYS B 31 MET B 46 1 ? 16 
HELX_P HELX_P6 6 LYS D 48 ? ALA D 71 ? LYS B 49 ALA B 72 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A DA 6 OP1 ? ? ? 1_555 E NA .  NA ? ? C DA 6 C NA 501 1_555 ? ? ? ? ? ? ?            2.784 ? 
hydrog1  hydrog ? ? A DG 1 N1  ? ? ? 1_555 B DC 10 N3 ? ? C DG 1 D DC 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1 N2  ? ? ? 1_555 B DC 10 O2 ? ? C DG 1 D DC 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1 O6  ? ? ? 1_555 B DC 10 N4 ? ? C DG 1 D DC 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2 N3  ? ? ? 1_555 B DG 9  N1 ? ? C DC 2 D DG 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2 N4  ? ? ? 1_555 B DG 9  O6 ? ? C DC 2 D DG 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 2 O2  ? ? ? 1_555 B DG 9  N2 ? ? C DC 2 D DG 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 3 N1  ? ? ? 1_555 B DC 8  N3 ? ? C DG 3 D DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 3 N2  ? ? ? 1_555 B DC 8  O2 ? ? C DG 3 D DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 3 O6  ? ? ? 1_555 B DC 8  N4 ? ? C DG 3 D DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA 4 N1  ? ? ? 1_555 B DT 7  N3 ? ? C DA 4 D DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA 4 N6  ? ? ? 1_555 B DT 7  O4 ? ? C DA 4 D DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT 5 N3  ? ? ? 1_555 B DA 6  N1 ? ? C DT 5 D DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT 5 O4  ? ? ? 1_555 B DA 6  N6 ? ? C DT 5 D DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA 6 N1  ? ? ? 1_555 B DT 5  N3 ? ? C DA 6 D DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DA 6 N6  ? ? ? 1_555 B DT 5  O4 ? ? C DA 6 D DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 7 N3  ? ? ? 1_555 B DA 4  N1 ? ? C DT 7 D DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT 7 O4  ? ? ? 1_555 B DA 4  N6 ? ? C DT 7 D DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC 8 N3  ? ? ? 1_555 B DG 3  N1 ? ? C DC 8 D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC 8 N4  ? ? ? 1_555 B DG 3  O6 ? ? C DC 8 D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC 8 O2  ? ? ? 1_555 B DG 3  N2 ? ? C DC 8 D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 9 N1  ? ? ? 1_555 B DC 2  N3 ? ? C DG 9 D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 9 N2  ? ? ? 1_555 B DC 2  O2 ? ? C DG 9 D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG 9 O6  ? ? ? 1_555 B DC 2  N4 ? ? C DG 9 D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE NA C 501' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        DA 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         6 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         DA 
_struct_site_gen.auth_asym_id         C 
_struct_site_gen.auth_seq_id          6 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          1QRV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QRV 
_atom_sites.fract_transf_matrix[1][1]   0.022862 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018588 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011515 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1  ? 0.540   -13.511 -0.122  1.00 50.06 ? 1   DG  C "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1  ? 0.114   -14.872 -0.095  1.00 48.11 ? 1   DG  C "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1  ? 0.256   -15.445 1.295   1.00 46.20 ? 1   DG  C "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1  ? 1.617   -15.893 1.487   1.00 42.56 ? 1   DG  C "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1  ? -0.031  -14.427 2.397   1.00 48.94 ? 1   DG  C "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1  ? -0.905  -14.942 3.408   1.00 55.41 ? 1   DG  C "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1  ? 1.336   -14.092 2.958   1.00 42.09 ? 1   DG  C "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1  ? 2.176   -15.319 2.652   1.00 41.46 ? 1   DG  C "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1  ? 3.552   -14.942 2.355   1.00 36.01 ? 1   DG  C N9    1 
ATOM   10   C  C8    . DG  A 1 1  ? 4.036   -14.439 1.168   1.00 33.95 ? 1   DG  C C8    1 
ATOM   11   N  N7    . DG  A 1 1  ? 5.293   -14.080 1.236   1.00 34.17 ? 1   DG  C N7    1 
ATOM   12   C  C5    . DG  A 1 1  ? 5.672   -14.389 2.537   1.00 31.67 ? 1   DG  C C5    1 
ATOM   13   C  C6    . DG  A 1 1  ? 6.901   -14.190 3.196   1.00 30.48 ? 1   DG  C C6    1 
ATOM   14   O  O6    . DG  A 1 1  ? 7.929   -13.661 2.756   1.00 34.54 ? 1   DG  C O6    1 
ATOM   15   N  N1    . DG  A 1 1  ? 6.864   -14.659 4.512   1.00 34.65 ? 1   DG  C N1    1 
ATOM   16   C  C2    . DG  A 1 1  ? 5.758   -15.228 5.125   1.00 33.39 ? 1   DG  C C2    1 
ATOM   17   N  N2    . DG  A 1 1  ? 5.912   -15.633 6.401   1.00 23.37 ? 1   DG  C N2    1 
ATOM   18   N  N3    . DG  A 1 1  ? 4.589   -15.387 4.521   1.00 31.69 ? 1   DG  C N3    1 
ATOM   19   C  C4    . DG  A 1 1  ? 4.619   -14.951 3.235   1.00 34.86 ? 1   DG  C C4    1 
ATOM   20   P  P     . DC  A 1 2  ? -1.653  -13.915 4.406   1.00 62.81 ? 2   DC  C P     1 
ATOM   21   O  OP1   . DC  A 1 2  ? -3.116  -14.198 4.407   1.00 63.01 ? 2   DC  C OP1   1 
ATOM   22   O  OP2   . DC  A 1 2  ? -1.170  -12.544 4.078   1.00 58.21 ? 2   DC  C OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2  ? -1.057  -14.308 5.830   1.00 55.89 ? 2   DC  C "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2  ? 0.308   -14.696 5.939   1.00 51.92 ? 2   DC  C "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2  ? 0.923   -14.082 7.170   1.00 44.46 ? 2   DC  C "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2  ? 2.312   -13.824 6.859   1.00 44.36 ? 2   DC  C "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2  ? 0.311   -12.726 7.530   1.00 46.89 ? 2   DC  C "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2  ? 0.234   -12.564 8.954   1.00 47.38 ? 2   DC  C "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2  ? 1.272   -11.725 6.917   1.00 43.54 ? 2   DC  C "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2  ? 2.598   -12.446 7.037   1.00 41.64 ? 2   DC  C "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2  ? 3.608   -12.048 6.043   1.00 35.83 ? 2   DC  C N1    1 
ATOM   32   C  C2    . DC  A 1 2  ? 4.931   -11.890 6.471   1.00 33.42 ? 2   DC  C C2    1 
ATOM   33   O  O2    . DC  A 1 2  ? 5.198   -12.103 7.659   1.00 37.90 ? 2   DC  C O2    1 
ATOM   34   N  N3    . DC  A 1 2  ? 5.881   -11.506 5.591   1.00 31.28 ? 2   DC  C N3    1 
ATOM   35   C  C4    . DC  A 1 2  ? 5.555   -11.276 4.320   1.00 35.13 ? 2   DC  C C4    1 
ATOM   36   N  N4    . DC  A 1 2  ? 6.535   -10.882 3.491   1.00 31.12 ? 2   DC  C N4    1 
ATOM   37   C  C5    . DC  A 1 2  ? 4.209   -11.434 3.842   1.00 32.43 ? 2   DC  C C5    1 
ATOM   38   C  C6    . DC  A 1 2  ? 3.274   -11.823 4.735   1.00 30.91 ? 2   DC  C C6    1 
ATOM   39   P  P     . DG  A 1 3  ? -0.891  -11.602 9.588   1.00 50.61 ? 3   DG  C P     1 
ATOM   40   O  OP1   . DG  A 1 3  ? -1.789  -12.434 10.439  1.00 48.51 ? 3   DG  C OP1   1 
ATOM   41   O  OP2   . DG  A 1 3  ? -1.464  -10.759 8.500   1.00 47.05 ? 3   DG  C OP2   1 
ATOM   42   O  "O5'" . DG  A 1 3  ? -0.070  -10.662 10.565  1.00 45.39 ? 3   DG  C "O5'" 1 
ATOM   43   C  "C5'" . DG  A 1 3  ? 0.958   -11.196 11.381  1.00 43.32 ? 3   DG  C "C5'" 1 
ATOM   44   C  "C4'" . DG  A 1 3  ? 2.072   -10.188 11.499  1.00 41.53 ? 3   DG  C "C4'" 1 
ATOM   45   O  "O4'" . DG  A 1 3  ? 2.792   -10.090 10.247  1.00 38.48 ? 3   DG  C "O4'" 1 
ATOM   46   C  "C3'" . DG  A 1 3  ? 1.569   -8.772  11.795  1.00 39.60 ? 3   DG  C "C3'" 1 
ATOM   47   O  "O3'" . DG  A 1 3  ? 2.518   -8.133  12.632  1.00 40.70 ? 3   DG  C "O3'" 1 
ATOM   48   C  "C2'" . DG  A 1 3  ? 1.618   -8.102  10.436  1.00 36.36 ? 3   DG  C "C2'" 1 
ATOM   49   C  "C1'" . DG  A 1 3  ? 2.891   -8.717  9.923   1.00 35.57 ? 3   DG  C "C1'" 1 
ATOM   50   N  N9    . DG  A 1 3  ? 3.143   -8.598  8.500   1.00 27.92 ? 3   DG  C N9    1 
ATOM   51   C  C8    . DG  A 1 3  ? 2.245   -8.669  7.473   1.00 24.94 ? 3   DG  C C8    1 
ATOM   52   N  N7    . DG  A 1 3  ? 2.797   -8.512  6.305   1.00 24.75 ? 3   DG  C N7    1 
ATOM   53   C  C5    . DG  A 1 3  ? 4.139   -8.322  6.585   1.00 24.43 ? 3   DG  C C5    1 
ATOM   54   C  C6    . DG  A 1 3  ? 5.215   -8.086  5.728   1.00 25.01 ? 3   DG  C C6    1 
ATOM   55   O  O6    . DG  A 1 3  ? 5.204   -7.991  4.501   1.00 25.96 ? 3   DG  C O6    1 
ATOM   56   N  N1    . DG  A 1 3  ? 6.410   -7.952  6.428   1.00 25.76 ? 3   DG  C N1    1 
ATOM   57   C  C2    . DG  A 1 3  ? 6.547   -8.044  7.790   1.00 29.97 ? 3   DG  C C2    1 
ATOM   58   N  N2    . DG  A 1 3  ? 7.807   -7.913  8.277   1.00 24.25 ? 3   DG  C N2    1 
ATOM   59   N  N3    . DG  A 1 3  ? 5.531   -8.255  8.611   1.00 24.56 ? 3   DG  C N3    1 
ATOM   60   C  C4    . DG  A 1 3  ? 4.367   -8.381  7.938   1.00 26.18 ? 3   DG  C C4    1 
ATOM   61   P  P     . DA  A 1 4  ? 2.039   -7.456  13.995  1.00 41.42 ? 4   DA  C P     1 
ATOM   62   O  OP1   . DA  A 1 4  ? 3.213   -7.498  14.912  1.00 44.85 ? 4   DA  C OP1   1 
ATOM   63   O  OP2   . DA  A 1 4  ? 0.727   -8.019  14.409  1.00 39.95 ? 4   DA  C OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4  ? 1.782   -5.952  13.597  1.00 42.49 ? 4   DA  C "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4  ? 0.815   -5.621  12.627  1.00 35.17 ? 4   DA  C "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4  ? 1.134   -4.251  12.096  1.00 31.29 ? 4   DA  C "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4  ? 1.963   -4.426  10.932  1.00 26.90 ? 4   DA  C "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4  ? -0.087  -3.477  11.648  1.00 27.39 ? 4   DA  C "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4  ? -0.298  -2.350  12.473  1.00 30.64 ? 4   DA  C "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4  ? 0.192   -3.079  10.214  1.00 27.61 ? 4   DA  C "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4  ? 1.628   -3.488  9.946   1.00 24.71 ? 4   DA  C "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4  ? 1.724   -4.164  8.659   1.00 23.98 ? 4   DA  C N9    1 
ATOM   73   C  C8    . DA  A 1 4  ? 0.735   -4.913  8.066   1.00 24.19 ? 4   DA  C C8    1 
ATOM   74   N  N7    . DA  A 1 4  ? 1.038   -5.327  6.860   1.00 28.03 ? 4   DA  C N7    1 
ATOM   75   C  C5    . DA  A 1 4  ? 2.322   -4.846  6.658   1.00 24.66 ? 4   DA  C C5    1 
ATOM   76   C  C6    . DA  A 1 4  ? 3.190   -4.930  5.571   1.00 21.48 ? 4   DA  C C6    1 
ATOM   77   N  N6    . DA  A 1 4  ? 2.868   -5.503  4.422   1.00 19.54 ? 4   DA  C N6    1 
ATOM   78   N  N1    . DA  A 1 4  ? 4.415   -4.371  5.699   1.00 21.57 ? 4   DA  C N1    1 
ATOM   79   C  C2    . DA  A 1 4  ? 4.716   -3.742  6.842   1.00 21.80 ? 4   DA  C C2    1 
ATOM   80   N  N3    . DA  A 1 4  ? 3.971   -3.564  7.923   1.00 26.18 ? 4   DA  C N3    1 
ATOM   81   C  C4    . DA  A 1 4  ? 2.769   -4.150  7.769   1.00 24.54 ? 4   DA  C C4    1 
ATOM   82   P  P     . DT  A 1 5  ? -1.749  -1.688  12.501  1.00 27.74 ? 5   DT  C P     1 
ATOM   83   O  OP1   . DT  A 1 5  ? -2.044  -1.327  13.900  1.00 31.55 ? 5   DT  C OP1   1 
ATOM   84   O  OP2   . DT  A 1 5  ? -2.700  -2.547  11.740  1.00 23.99 ? 5   DT  C OP2   1 
ATOM   85   O  "O5'" . DT  A 1 5  ? -1.547  -0.384  11.621  1.00 31.32 ? 5   DT  C "O5'" 1 
ATOM   86   C  "C5'" . DT  A 1 5  ? -2.134  -0.301  10.344  1.00 25.09 ? 5   DT  C "C5'" 1 
ATOM   87   C  "C4'" . DT  A 1 5  ? -1.570  0.873   9.588   1.00 25.02 ? 5   DT  C "C4'" 1 
ATOM   88   O  "O4'" . DT  A 1 5  ? -0.348  0.436   8.941   1.00 21.16 ? 5   DT  C "O4'" 1 
ATOM   89   C  "C3'" . DT  A 1 5  ? -2.502  1.258   8.459   1.00 21.61 ? 5   DT  C "C3'" 1 
ATOM   90   O  "O3'" . DT  A 1 5  ? -3.216  2.436   8.716   1.00 24.16 ? 5   DT  C "O3'" 1 
ATOM   91   C  "C2'" . DT  A 1 5  ? -1.624  1.419   7.238   1.00 22.46 ? 5   DT  C "C2'" 1 
ATOM   92   C  "C1'" . DT  A 1 5  ? -0.255  0.928   7.625   1.00 20.07 ? 5   DT  C "C1'" 1 
ATOM   93   N  N1    . DT  A 1 5  ? 0.046   -0.206  6.750   1.00 21.47 ? 5   DT  C N1    1 
ATOM   94   C  C2    . DT  A 1 5  ? 1.111   -0.146  5.869   1.00 21.70 ? 5   DT  C C2    1 
ATOM   95   O  O2    . DT  A 1 5  ? 1.829   0.829   5.756   1.00 18.28 ? 5   DT  C O2    1 
ATOM   96   N  N3    . DT  A 1 5  ? 1.276   -1.274  5.090   1.00 22.44 ? 5   DT  C N3    1 
ATOM   97   C  C4    . DT  A 1 5  ? 0.474   -2.403  5.075   1.00 21.01 ? 5   DT  C C4    1 
ATOM   98   O  O4    . DT  A 1 5  ? 0.737   -3.320  4.308   1.00 18.29 ? 5   DT  C O4    1 
ATOM   99   C  C5    . DT  A 1 5  ? -0.650  -2.381  6.011   1.00 21.83 ? 5   DT  C C5    1 
ATOM   100  C  C7    . DT  A 1 5  ? -1.617  -3.526  6.035   1.00 21.45 ? 5   DT  C C7    1 
ATOM   101  C  C6    . DT  A 1 5  ? -0.781  -1.314  6.802   1.00 23.11 ? 5   DT  C C6    1 
ATOM   102  P  P     . DA  A 1 6  ? -4.657  2.609   8.043   1.00 21.39 ? 6   DA  C P     1 
ATOM   103  O  OP1   . DA  A 1 6  ? -5.346  3.740   8.746   1.00 23.07 ? 6   DA  C OP1   1 
ATOM   104  O  OP2   . DA  A 1 6  ? -5.324  1.302   7.918   1.00 25.18 ? 6   DA  C OP2   1 
ATOM   105  O  "O5'" . DA  A 1 6  ? -4.285  3.062   6.581   1.00 19.56 ? 6   DA  C "O5'" 1 
ATOM   106  C  "C5'" . DA  A 1 6  ? -3.449  4.182   6.377   1.00 22.53 ? 6   DA  C "C5'" 1 
ATOM   107  C  "C4'" . DA  A 1 6  ? -3.208  4.350   4.903   1.00 20.31 ? 6   DA  C "C4'" 1 
ATOM   108  O  "O4'" . DA  A 1 6  ? -2.476  3.189   4.428   1.00 18.78 ? 6   DA  C "O4'" 1 
ATOM   109  C  "C3'" . DA  A 1 6  ? -4.514  4.393   4.102   1.00 22.38 ? 6   DA  C "C3'" 1 
ATOM   110  O  "O3'" . DA  A 1 6  ? -4.387  5.424   3.121   1.00 25.64 ? 6   DA  C "O3'" 1 
ATOM   111  C  "C2'" . DA  A 1 6  ? -4.589  3.012   3.460   1.00 20.17 ? 6   DA  C "C2'" 1 
ATOM   112  C  "C1'" . DA  A 1 6  ? -3.116  2.680   3.267   1.00 17.59 ? 6   DA  C "C1'" 1 
ATOM   113  N  N9    . DA  A 1 6  ? -2.761  1.265   3.145   1.00 20.52 ? 6   DA  C N9    1 
ATOM   114  C  C8    . DA  A 1 6  ? -2.992  0.256   4.048   1.00 18.85 ? 6   DA  C C8    1 
ATOM   115  N  N7    . DA  A 1 6  ? -2.499  -0.903  3.678   1.00 19.85 ? 6   DA  C N7    1 
ATOM   116  C  C5    . DA  A 1 6  ? -1.920  -0.648  2.443   1.00 20.76 ? 6   DA  C C5    1 
ATOM   117  C  C6    . DA  A 1 6  ? -1.221  -1.478  1.524   1.00 23.04 ? 6   DA  C C6    1 
ATOM   118  N  N6    . DA  A 1 6  ? -0.984  -2.780  1.720   1.00 21.59 ? 6   DA  C N6    1 
ATOM   119  N  N1    . DA  A 1 6  ? -0.775  -0.913  0.386   1.00 20.90 ? 6   DA  C N1    1 
ATOM   120  C  C2    . DA  A 1 6  ? -1.013  0.399   0.184   1.00 26.79 ? 6   DA  C C2    1 
ATOM   121  N  N3    . DA  A 1 6  ? -1.643  1.277   0.968   1.00 22.52 ? 6   DA  C N3    1 
ATOM   122  C  C4    . DA  A 1 6  ? -2.081  0.683   2.096   1.00 19.16 ? 6   DA  C C4    1 
ATOM   123  P  P     . DT  A 1 7  ? -5.675  5.946   2.333   1.00 26.75 ? 7   DT  C P     1 
ATOM   124  O  OP1   . DT  A 1 7  ? -5.379  7.339   1.886   1.00 28.04 ? 7   DT  C OP1   1 
ATOM   125  O  OP2   . DT  A 1 7  ? -6.925  5.670   3.068   1.00 32.29 ? 7   DT  C OP2   1 
ATOM   126  O  "O5'" . DT  A 1 7  ? -5.696  4.958   1.097   1.00 28.61 ? 7   DT  C "O5'" 1 
ATOM   127  C  "C5'" . DT  A 1 7  ? -6.482  5.236   -0.019  1.00 20.19 ? 7   DT  C "C5'" 1 
ATOM   128  C  "C4'" . DT  A 1 7  ? -5.642  5.075   -1.257  1.00 25.36 ? 7   DT  C "C4'" 1 
ATOM   129  O  "O4'" . DT  A 1 7  ? -4.793  3.910   -1.128  1.00 22.58 ? 7   DT  C "O4'" 1 
ATOM   130  C  "C3'" . DT  A 1 7  ? -6.463  4.855   -2.514  1.00 29.30 ? 7   DT  C "C3'" 1 
ATOM   131  O  "O3'" . DT  A 1 7  ? -5.714  5.431   -3.576  1.00 34.69 ? 7   DT  C "O3'" 1 
ATOM   132  C  "C2'" . DT  A 1 7  ? -6.519  3.341   -2.615  1.00 23.66 ? 7   DT  C "C2'" 1 
ATOM   133  C  "C1'" . DT  A 1 7  ? -5.123  2.961   -2.118  1.00 22.47 ? 7   DT  C "C1'" 1 
ATOM   134  N  N1    . DT  A 1 7  ? -4.977  1.624   -1.513  1.00 20.65 ? 7   DT  C N1    1 
ATOM   135  C  C2    . DT  A 1 7  ? -4.215  0.691   -2.185  1.00 17.71 ? 7   DT  C C2    1 
ATOM   136  O  O2    . DT  A 1 7  ? -3.723  0.900   -3.277  1.00 18.90 ? 7   DT  C O2    1 
ATOM   137  N  N3    . DT  A 1 7  ? -4.056  -0.503  -1.529  1.00 19.36 ? 7   DT  C N3    1 
ATOM   138  C  C4    . DT  A 1 7  ? -4.577  -0.853  -0.309  1.00 20.17 ? 7   DT  C C4    1 
ATOM   139  O  O4    . DT  A 1 7  ? -4.311  -1.958  0.163   1.00 22.84 ? 7   DT  C O4    1 
ATOM   140  C  C5    . DT  A 1 7  ? -5.413  0.171   0.327   1.00 18.47 ? 7   DT  C C5    1 
ATOM   141  C  C7    . DT  A 1 7  ? -6.058  -0.114  1.645   1.00 14.65 ? 7   DT  C C7    1 
ATOM   142  C  C6    . DT  A 1 7  ? -5.562  1.334   -0.304  1.00 13.07 ? 7   DT  C C6    1 
ATOM   143  P  P     . DC  A 1 8  ? -6.466  5.954   -4.878  1.00 36.26 ? 8   DC  C P     1 
ATOM   144  O  OP1   . DC  A 1 8  ? -5.667  7.080   -5.419  1.00 39.00 ? 8   DC  C OP1   1 
ATOM   145  O  OP2   . DC  A 1 8  ? -7.911  6.136   -4.549  1.00 38.82 ? 8   DC  C OP2   1 
ATOM   146  O  "O5'" . DC  A 1 8  ? -6.376  4.724   -5.881  1.00 42.32 ? 8   DC  C "O5'" 1 
ATOM   147  C  "C5'" . DC  A 1 8  ? -5.145  4.377   -6.495  1.00 39.44 ? 8   DC  C "C5'" 1 
ATOM   148  C  "C4'" . DC  A 1 8  ? -5.354  3.172   -7.372  1.00 39.22 ? 8   DC  C "C4'" 1 
ATOM   149  O  "O4'" . DC  A 1 8  ? -5.126  1.948   -6.634  1.00 34.59 ? 8   DC  C "O4'" 1 
ATOM   150  C  "C3'" . DC  A 1 8  ? -6.781  3.097   -7.907  1.00 40.87 ? 8   DC  C "C3'" 1 
ATOM   151  O  "O3'" . DC  A 1 8  ? -6.759  2.702   -9.268  1.00 41.39 ? 8   DC  C "O3'" 1 
ATOM   152  C  "C2'" . DC  A 1 8  ? -7.417  2.010   -7.060  1.00 41.74 ? 8   DC  C "C2'" 1 
ATOM   153  C  "C1'" . DC  A 1 8  ? -6.236  1.093   -6.786  1.00 38.31 ? 8   DC  C "C1'" 1 
ATOM   154  N  N1    . DC  A 1 8  ? -6.353  0.291   -5.564  1.00 36.47 ? 8   DC  C N1    1 
ATOM   155  C  C2    . DC  A 1 8  ? -5.511  -0.806  -5.400  1.00 36.50 ? 8   DC  C C2    1 
ATOM   156  O  O2    . DC  A 1 8  ? -4.654  -1.034  -6.258  1.00 38.18 ? 8   DC  C O2    1 
ATOM   157  N  N3    . DC  A 1 8  ? -5.648  -1.589  -4.311  1.00 33.98 ? 8   DC  C N3    1 
ATOM   158  C  C4    . DC  A 1 8  ? -6.571  -1.301  -3.397  1.00 30.33 ? 8   DC  C C4    1 
ATOM   159  N  N4    . DC  A 1 8  ? -6.686  -2.120  -2.345  1.00 29.86 ? 8   DC  C N4    1 
ATOM   160  C  C5    . DC  A 1 8  ? -7.421  -0.164  -3.519  1.00 34.40 ? 8   DC  C C5    1 
ATOM   161  C  C6    . DC  A 1 8  ? -7.281  0.598   -4.608  1.00 33.74 ? 8   DC  C C6    1 
ATOM   162  P  P     . DG  A 1 9  ? -8.080  2.856   -10.171 1.00 34.89 ? 9   DG  C P     1 
ATOM   163  O  OP1   . DG  A 1 9  ? -7.766  3.952   -11.118 1.00 35.73 ? 9   DG  C OP1   1 
ATOM   164  O  OP2   . DG  A 1 9  ? -9.280  2.954   -9.303  1.00 35.41 ? 9   DG  C OP2   1 
ATOM   165  O  "O5'" . DG  A 1 9  ? -8.099  1.456   -10.925 1.00 36.69 ? 9   DG  C "O5'" 1 
ATOM   166  C  "C5'" . DG  A 1 9  ? -6.914  0.978   -11.570 1.00 39.35 ? 9   DG  C "C5'" 1 
ATOM   167  C  "C4'" . DG  A 1 9  ? -7.008  -0.511  -11.800 1.00 41.14 ? 9   DG  C "C4'" 1 
ATOM   168  O  "O4'" . DG  A 1 9  ? -6.986  -1.203  -10.532 1.00 39.29 ? 9   DG  C "O4'" 1 
ATOM   169  C  "C3'" . DG  A 1 9  ? -8.287  -0.955  -12.507 1.00 38.77 ? 9   DG  C "C3'" 1 
ATOM   170  O  "O3'" . DG  A 1 9  ? -7.997  -2.104  -13.298 1.00 42.27 ? 9   DG  C "O3'" 1 
ATOM   171  C  "C2'" . DG  A 1 9  ? -9.188  -1.371  -11.353 1.00 41.32 ? 9   DG  C "C2'" 1 
ATOM   172  C  "C1'" . DG  A 1 9  ? -8.181  -1.950  -10.366 1.00 42.23 ? 9   DG  C "C1'" 1 
ATOM   173  N  N9    . DG  A 1 9  ? -8.559  -1.854  -8.961  1.00 40.78 ? 9   DG  C N9    1 
ATOM   174  C  C8    . DG  A 1 9  ? -9.320  -0.881  -8.358  1.00 41.93 ? 9   DG  C C8    1 
ATOM   175  N  N7    . DG  A 1 9  ? -9.482  -1.079  -7.077  1.00 39.91 ? 9   DG  C N7    1 
ATOM   176  C  C5    . DG  A 1 9  ? -8.777  -2.249  -6.821  1.00 39.38 ? 9   DG  C C5    1 
ATOM   177  C  C6    . DG  A 1 9  ? -8.572  -2.956  -5.610  1.00 34.53 ? 9   DG  C C6    1 
ATOM   178  O  O6    . DG  A 1 9  ? -8.979  -2.678  -4.480  1.00 38.47 ? 9   DG  C O6    1 
ATOM   179  N  N1    . DG  A 1 9  ? -7.804  -4.099  -5.807  1.00 35.72 ? 9   DG  C N1    1 
ATOM   180  C  C2    . DG  A 1 9  ? -7.294  -4.506  -7.010  1.00 35.28 ? 9   DG  C C2    1 
ATOM   181  N  N2    . DG  A 1 9  ? -6.616  -5.663  -7.015  1.00 36.99 ? 9   DG  C N2    1 
ATOM   182  N  N3    . DG  A 1 9  ? -7.449  -3.839  -8.135  1.00 36.64 ? 9   DG  C N3    1 
ATOM   183  C  C4    . DG  A 1 9  ? -8.203  -2.739  -7.973  1.00 39.88 ? 9   DG  C C4    1 
ATOM   184  P  P     A DC  A 1 10 ? -7.192  -1.955  -14.689 0.75 34.22 ? 10  DC  C P     1 
ATOM   185  P  P     B DC  A 1 10 ? -7.737  -1.945  -14.880 0.25 40.80 ? 10  DC  C P     1 
ATOM   186  O  OP1   A DC  A 1 10 ? -6.598  -0.597  -14.766 0.75 39.27 ? 10  DC  C OP1   1 
ATOM   187  O  OP1   B DC  A 1 10 ? -6.308  -1.603  -15.098 0.25 42.13 ? 10  DC  C OP1   1 
ATOM   188  O  OP2   A DC  A 1 10 ? -8.066  -2.435  -15.794 0.75 40.65 ? 10  DC  C OP2   1 
ATOM   189  O  OP2   B DC  A 1 10 ? -8.793  -1.049  -15.409 0.25 43.48 ? 10  DC  C OP2   1 
ATOM   190  O  "O5'" A DC  A 1 10 ? -6.023  -3.018  -14.508 0.75 40.17 ? 10  DC  C "O5'" 1 
ATOM   191  O  "O5'" B DC  A 1 10 ? -7.999  -3.426  -15.401 0.25 42.47 ? 10  DC  C "O5'" 1 
ATOM   192  C  "C5'" A DC  A 1 10 ? -4.740  -2.624  -14.048 0.75 37.65 ? 10  DC  C "C5'" 1 
ATOM   193  C  "C5'" B DC  A 1 10 ? -8.220  -4.477  -14.462 0.25 42.53 ? 10  DC  C "C5'" 1 
ATOM   194  C  "C4'" A DC  A 1 10 ? -3.739  -3.718  -14.328 0.75 39.60 ? 10  DC  C "C4'" 1 
ATOM   195  C  "C4'" B DC  A 1 10 ? -7.216  -5.586  -14.674 0.25 43.78 ? 10  DC  C "C4'" 1 
ATOM   196  O  "O4'" A DC  A 1 10 ? -3.846  -4.088  -15.725 0.75 37.57 ? 10  DC  C "O4'" 1 
ATOM   197  O  "O4'" B DC  A 1 10 ? -6.638  -5.949  -13.403 0.25 44.68 ? 10  DC  C "O4'" 1 
ATOM   198  C  "C3'" A DC  A 1 10 ? -2.284  -3.309  -14.112 0.75 38.44 ? 10  DC  C "C3'" 1 
ATOM   199  C  "C3'" B DC  A 1 10 ? -7.819  -6.871  -15.219 0.25 43.80 ? 10  DC  C "C3'" 1 
ATOM   200  O  "O3'" A DC  A 1 10 ? -1.459  -4.452  -13.839 0.75 45.13 ? 10  DC  C "O3'" 1 
ATOM   201  O  "O3'" B DC  A 1 10 ? -6.793  -7.668  -15.809 0.25 43.58 ? 10  DC  C "O3'" 1 
ATOM   202  C  "C2'" A DC  A 1 10 ? -1.891  -2.785  -15.476 0.75 36.32 ? 10  DC  C "C2'" 1 
ATOM   203  C  "C2'" B DC  A 1 10 ? -8.271  -7.569  -13.950 0.25 44.28 ? 10  DC  C "C2'" 1 
ATOM   204  C  "C1'" A DC  A 1 10 ? -2.714  -3.635  -16.445 0.75 39.33 ? 10  DC  C "C1'" 1 
ATOM   205  C  "C1'" B DC  A 1 10 ? -7.218  -7.158  -12.927 0.25 43.34 ? 10  DC  C "C1'" 1 
ATOM   206  N  N1    A DC  A 1 10 ? -3.193  -2.863  -17.608 0.75 38.69 ? 10  DC  C N1    1 
ATOM   207  N  N1    B DC  A 1 10 ? -7.800  -6.861  -11.616 0.25 42.65 ? 10  DC  C N1    1 
ATOM   208  C  C2    A DC  A 1 10 ? -2.312  -2.653  -18.671 0.75 36.53 ? 10  DC  C C2    1 
ATOM   209  C  C2    B DC  A 1 10 ? -8.236  -7.911  -10.786 0.25 41.53 ? 10  DC  C C2    1 
ATOM   210  O  O2    A DC  A 1 10 ? -1.206  -3.208  -18.643 0.75 35.99 ? 10  DC  C O2    1 
ATOM   211  O  O2    B DC  A 1 10 ? -8.074  -9.084  -11.160 0.25 40.46 ? 10  DC  C O2    1 
ATOM   212  N  N3    A DC  A 1 10 ? -2.691  -1.859  -19.701 0.75 31.62 ? 10  DC  C N3    1 
ATOM   213  N  N3    B DC  A 1 10 ? -8.819  -7.610  -9.604  0.25 38.33 ? 10  DC  C N3    1 
ATOM   214  C  C4    A DC  A 1 10 ? -3.898  -1.294  -19.700 0.75 33.68 ? 10  DC  C C4    1 
ATOM   215  C  C4    B DC  A 1 10 ? -8.969  -6.333  -9.245  0.25 39.11 ? 10  DC  C C4    1 
ATOM   216  N  N4    A DC  A 1 10 ? -4.201  -0.466  -20.714 0.75 30.92 ? 10  DC  C N4    1 
ATOM   217  N  N4    B DC  A 1 10 ? -9.587  -6.077  -8.105  0.25 38.45 ? 10  DC  C N4    1 
ATOM   218  C  C5    A DC  A 1 10 ? -4.841  -1.538  -18.658 0.75 34.69 ? 10  DC  C C5    1 
ATOM   219  C  C5    B DC  A 1 10 ? -8.503  -5.259  -10.057 0.25 39.52 ? 10  DC  C C5    1 
ATOM   220  C  C6    A DC  A 1 10 ? -4.451  -2.325  -17.641 0.75 37.22 ? 10  DC  C C6    1 
ATOM   221  C  C6    B DC  A 1 10 ? -7.933  -5.564  -11.217 0.25 40.87 ? 10  DC  C C6    1 
ATOM   222  O  "O5'" . DG  B 1 1  ? -14.079 -10.472 1.004   1.00 44.68 ? 11  DG  D "O5'" 1 
ATOM   223  C  "C5'" . DG  B 1 1  ? -13.742 -10.289 -0.369  1.00 35.86 ? 11  DG  D "C5'" 1 
ATOM   224  C  "C4'" . DG  B 1 1  ? -12.549 -11.096 -0.828  1.00 34.96 ? 11  DG  D "C4'" 1 
ATOM   225  O  "O4'" . DG  B 1 1  ? -12.206 -10.664 -2.164  1.00 29.36 ? 11  DG  D "O4'" 1 
ATOM   226  C  "C3'" . DG  B 1 1  ? -11.278 -10.902 0.003   1.00 36.39 ? 11  DG  D "C3'" 1 
ATOM   227  O  "O3'" . DG  B 1 1  ? -10.494 -12.098 -0.007  1.00 38.66 ? 11  DG  D "O3'" 1 
ATOM   228  C  "C2'" . DG  B 1 1  ? -10.545 -9.793  -0.725  1.00 33.57 ? 11  DG  D "C2'" 1 
ATOM   229  C  "C1'" . DG  B 1 1  ? -10.935 -10.025 -2.178  1.00 31.87 ? 11  DG  D "C1'" 1 
ATOM   230  N  N9    . DG  B 1 1  ? -11.077 -8.778  -2.914  1.00 28.42 ? 11  DG  D N9    1 
ATOM   231  C  C8    . DG  B 1 1  ? -11.751 -7.647  -2.513  1.00 28.80 ? 11  DG  D C8    1 
ATOM   232  N  N7    . DG  B 1 1  ? -11.681 -6.674  -3.383  1.00 25.63 ? 11  DG  D N7    1 
ATOM   233  C  C5    . DG  B 1 1  ? -10.918 -7.191  -4.416  1.00 23.33 ? 11  DG  D C5    1 
ATOM   234  C  C6    . DG  B 1 1  ? -10.492 -6.596  -5.628  1.00 25.75 ? 11  DG  D C6    1 
ATOM   235  O  O6    . DG  B 1 1  ? -10.667 -5.425  -6.030  1.00 21.83 ? 11  DG  D O6    1 
ATOM   236  N  N1    . DG  B 1 1  ? -9.765  -7.493  -6.402  1.00 20.22 ? 11  DG  D N1    1 
ATOM   237  C  C2    . DG  B 1 1  ? -9.443  -8.784  -6.041  1.00 27.05 ? 11  DG  D C2    1 
ATOM   238  N  N2    . DG  B 1 1  ? -8.708  -9.497  -6.923  1.00 26.13 ? 11  DG  D N2    1 
ATOM   239  N  N3    . DG  B 1 1  ? -9.812  -9.339  -4.901  1.00 31.74 ? 11  DG  D N3    1 
ATOM   240  C  C4    . DG  B 1 1  ? -10.546 -8.494  -4.145  1.00 30.06 ? 11  DG  D C4    1 
ATOM   241  P  P     . DC  B 1 2  ? -9.024  -12.100 0.653   1.00 38.37 ? 12  DC  D P     1 
ATOM   242  O  OP1   . DC  B 1 2  ? -8.695  -13.529 0.909   1.00 45.59 ? 12  DC  D OP1   1 
ATOM   243  O  OP2   . DC  B 1 2  ? -8.958  -11.122 1.774   1.00 39.61 ? 12  DC  D OP2   1 
ATOM   244  O  "O5'" . DC  B 1 2  ? -8.084  -11.597 -0.533  1.00 43.12 ? 12  DC  D "O5'" 1 
ATOM   245  C  "C5'" . DC  B 1 2  ? -8.090  -12.281 -1.781  1.00 42.28 ? 12  DC  D "C5'" 1 
ATOM   246  C  "C4'" . DC  B 1 2  ? -7.013  -11.741 -2.690  1.00 43.00 ? 12  DC  D "C4'" 1 
ATOM   247  O  "O4'" . DC  B 1 2  ? -7.432  -10.504 -3.307  1.00 39.51 ? 12  DC  D "O4'" 1 
ATOM   248  C  "C3'" . DC  B 1 2  ? -5.674  -11.458 -2.012  1.00 43.45 ? 12  DC  D "C3'" 1 
ATOM   249  O  "O3'" . DC  B 1 2  ? -4.594  -11.915 -2.824  1.00 47.31 ? 12  DC  D "O3'" 1 
ATOM   250  C  "C2'" . DC  B 1 2  ? -5.627  -9.945  -1.939  1.00 42.52 ? 12  DC  D "C2'" 1 
ATOM   251  C  "C1'" . DC  B 1 2  ? -6.411  -9.536  -3.173  1.00 40.36 ? 12  DC  D "C1'" 1 
ATOM   252  N  N1    . DC  B 1 2  ? -7.063  -8.230  -3.034  1.00 37.93 ? 12  DC  D N1    1 
ATOM   253  C  C2    . DC  B 1 2  ? -7.039  -7.339  -4.116  1.00 35.72 ? 12  DC  D C2    1 
ATOM   254  O  O2    . DC  B 1 2  ? -6.443  -7.667  -5.158  1.00 37.19 ? 12  DC  D O2    1 
ATOM   255  N  N3    . DC  B 1 2  ? -7.661  -6.140  -3.994  1.00 33.18 ? 12  DC  D N3    1 
ATOM   256  C  C4    . DC  B 1 2  ? -8.271  -5.818  -2.843  1.00 32.35 ? 12  DC  D C4    1 
ATOM   257  N  N4    . DC  B 1 2  ? -8.863  -4.624  -2.759  1.00 32.60 ? 12  DC  D N4    1 
ATOM   258  C  C5    . DC  B 1 2  ? -8.297  -6.706  -1.726  1.00 33.35 ? 12  DC  D C5    1 
ATOM   259  C  C6    . DC  B 1 2  ? -7.688  -7.887  -1.862  1.00 31.89 ? 12  DC  D C6    1 
ATOM   260  P  P     . DG  B 1 3  ? -3.136  -12.075 -2.173  1.00 45.32 ? 13  DG  D P     1 
ATOM   261  O  OP1   . DG  B 1 3  ? -2.917  -13.506 -1.858  1.00 49.95 ? 13  DG  D OP1   1 
ATOM   262  O  OP2   . DG  B 1 3  ? -3.023  -11.064 -1.097  1.00 48.65 ? 13  DG  D OP2   1 
ATOM   263  O  "O5'" . DG  B 1 3  ? -2.161  -11.642 -3.353  1.00 43.46 ? 13  DG  D "O5'" 1 
ATOM   264  C  "C5'" . DG  B 1 3  ? -2.475  -11.913 -4.713  1.00 38.05 ? 13  DG  D "C5'" 1 
ATOM   265  C  "C4'" . DG  B 1 3  ? -1.838  -10.869 -5.601  1.00 39.43 ? 13  DG  D "C4'" 1 
ATOM   266  O  "O4'" . DG  B 1 3  ? -2.585  -9.637  -5.483  1.00 39.22 ? 13  DG  D "O4'" 1 
ATOM   267  C  "C3'" . DG  B 1 3  ? -0.392  -10.525 -5.240  1.00 40.59 ? 13  DG  D "C3'" 1 
ATOM   268  O  "O3'" . DG  B 1 3  ? 0.374   -10.278 -6.418  1.00 45.86 ? 13  DG  D "O3'" 1 
ATOM   269  C  "C2'" . DG  B 1 3  ? -0.526  -9.258  -4.412  1.00 39.35 ? 13  DG  D "C2'" 1 
ATOM   270  C  "C1'" . DG  B 1 3  ? -1.743  -8.592  -5.028  1.00 36.86 ? 13  DG  D "C1'" 1 
ATOM   271  N  N9    . DG  B 1 3  ? -2.517  -7.780  -4.095  1.00 36.39 ? 13  DG  D N9    1 
ATOM   272  C  C8    . DG  B 1 3  ? -2.791  -8.040  -2.769  1.00 32.93 ? 13  DG  D C8    1 
ATOM   273  N  N7    . DG  B 1 3  ? -3.512  -7.106  -2.206  1.00 29.85 ? 13  DG  D N7    1 
ATOM   274  C  C5    . DG  B 1 3  ? -3.729  -6.180  -3.223  1.00 30.37 ? 13  DG  D C5    1 
ATOM   275  C  C6    . DG  B 1 3  ? -4.439  -4.954  -3.220  1.00 28.97 ? 13  DG  D C6    1 
ATOM   276  O  O6    . DG  B 1 3  ? -5.074  -4.445  -2.300  1.00 30.18 ? 13  DG  D O6    1 
ATOM   277  N  N1    . DG  B 1 3  ? -4.371  -4.314  -4.458  1.00 27.02 ? 13  DG  D N1    1 
ATOM   278  C  C2    . DG  B 1 3  ? -3.724  -4.812  -5.562  1.00 26.96 ? 13  DG  D C2    1 
ATOM   279  N  N2    . DG  B 1 3  ? -3.764  -4.069  -6.687  1.00 23.50 ? 13  DG  D N2    1 
ATOM   280  N  N3    . DG  B 1 3  ? -3.079  -5.961  -5.575  1.00 28.72 ? 13  DG  D N3    1 
ATOM   281  C  C4    . DG  B 1 3  ? -3.117  -6.581  -4.388  1.00 30.30 ? 13  DG  D C4    1 
ATOM   282  P  P     . DA  B 1 4  ? 1.820   -9.580  -6.302  1.00 52.82 ? 14  DA  D P     1 
ATOM   283  O  OP1   . DA  B 1 4  ? 2.621   -10.021 -7.472  1.00 54.88 ? 14  DA  D OP1   1 
ATOM   284  O  OP2   . DA  B 1 4  ? 2.358   -9.777  -4.929  1.00 51.97 ? 14  DA  D OP2   1 
ATOM   285  O  "O5'" . DA  B 1 4  ? 1.502   -8.036  -6.528  1.00 53.34 ? 14  DA  D "O5'" 1 
ATOM   286  C  "C5'" . DA  B 1 4  ? 0.957   -7.590  -7.772  1.00 51.79 ? 14  DA  D "C5'" 1 
ATOM   287  C  "C4'" . DA  B 1 4  ? 1.115   -6.094  -7.908  1.00 52.19 ? 14  DA  D "C4'" 1 
ATOM   288  O  "O4'" . DA  B 1 4  ? 0.227   -5.413  -6.988  1.00 49.84 ? 14  DA  D "O4'" 1 
ATOM   289  C  "C3'" . DA  B 1 4  ? 2.517   -5.568  -7.606  1.00 52.52 ? 14  DA  D "C3'" 1 
ATOM   290  O  "O3'" . DA  B 1 4  ? 2.818   -4.490  -8.504  1.00 56.62 ? 14  DA  D "O3'" 1 
ATOM   291  C  "C2'" . DA  B 1 4  ? 2.405   -5.101  -6.164  1.00 48.84 ? 14  DA  D "C2'" 1 
ATOM   292  C  "C1'" . DA  B 1 4  ? 0.976   -4.578  -6.108  1.00 45.63 ? 14  DA  D "C1'" 1 
ATOM   293  N  N9    . DA  B 1 4  ? 0.333   -4.640  -4.793  1.00 37.55 ? 14  DA  D N9    1 
ATOM   294  C  C8    . DA  B 1 4  ? 0.389   -5.675  -3.891  1.00 38.76 ? 14  DA  D C8    1 
ATOM   295  N  N7    . DA  B 1 4  ? -0.349  -5.491  -2.824  1.00 33.28 ? 14  DA  D N7    1 
ATOM   296  C  C5    . DA  B 1 4  ? -0.908  -4.234  -3.021  1.00 32.24 ? 14  DA  D C5    1 
ATOM   297  C  C6    . DA  B 1 4  ? -1.783  -3.466  -2.241  1.00 22.97 ? 14  DA  D C6    1 
ATOM   298  N  N6    . DA  B 1 4  ? -2.236  -3.864  -1.051  1.00 21.03 ? 14  DA  D N6    1 
ATOM   299  N  N1    . DA  B 1 4  ? -2.170  -2.265  -2.722  1.00 26.08 ? 14  DA  D N1    1 
ATOM   300  C  C2    . DA  B 1 4  ? -1.682  -1.861  -3.911  1.00 26.20 ? 14  DA  D C2    1 
ATOM   301  N  N3    . DA  B 1 4  ? -0.841  -2.490  -4.732  1.00 29.78 ? 14  DA  D N3    1 
ATOM   302  C  C4    . DA  B 1 4  ? -0.490  -3.691  -4.225  1.00 33.18 ? 14  DA  D C4    1 
ATOM   303  P  P     . DT  B 1 5  ? 4.245   -3.748  -8.423  1.00 62.61 ? 15  DT  D P     1 
ATOM   304  O  OP1   . DT  B 1 5  ? 4.392   -2.977  -9.690  1.00 59.09 ? 15  DT  D OP1   1 
ATOM   305  O  OP2   . DT  B 1 5  ? 5.314   -4.691  -7.994  1.00 59.60 ? 15  DT  D OP2   1 
ATOM   306  O  "O5'" . DT  B 1 5  ? 4.061   -2.710  -7.234  1.00 58.64 ? 15  DT  D "O5'" 1 
ATOM   307  C  "C5'" . DT  B 1 5  ? 3.406   -1.471  -7.449  1.00 52.52 ? 15  DT  D "C5'" 1 
ATOM   308  C  "C4'" . DT  B 1 5  ? 3.615   -0.571  -6.257  1.00 49.35 ? 15  DT  D "C4'" 1 
ATOM   309  O  "O4'" . DT  B 1 5  ? 2.655   -0.908  -5.219  1.00 46.03 ? 15  DT  D "O4'" 1 
ATOM   310  C  "C3'" . DT  B 1 5  ? 5.005   -0.722  -5.633  1.00 46.83 ? 15  DT  D "C3'" 1 
ATOM   311  O  "O3'" . DT  B 1 5  ? 5.710   0.515   -5.556  1.00 52.63 ? 15  DT  D "O3'" 1 
ATOM   312  C  "C2'" . DT  B 1 5  ? 4.727   -1.253  -4.238  1.00 44.15 ? 15  DT  D "C2'" 1 
ATOM   313  C  "C1'" . DT  B 1 5  ? 3.296   -0.811  -3.971  1.00 40.73 ? 15  DT  D "C1'" 1 
ATOM   314  N  N1    . DT  B 1 5  ? 2.586   -1.674  -3.001  1.00 36.75 ? 15  DT  D N1    1 
ATOM   315  C  C2    . DT  B 1 5  ? 1.547   -1.151  -2.257  1.00 31.13 ? 15  DT  D C2    1 
ATOM   316  O  O2    . DT  B 1 5  ? 1.085   -0.041  -2.438  1.00 29.34 ? 15  DT  D O2    1 
ATOM   317  N  N3    . DT  B 1 5  ? 1.052   -1.997  -1.296  1.00 27.99 ? 15  DT  D N3    1 
ATOM   318  C  C4    . DT  B 1 5  ? 1.455   -3.297  -1.035  1.00 30.52 ? 15  DT  D C4    1 
ATOM   319  O  O4    . DT  B 1 5  ? 0.933   -3.928  -0.122  1.00 29.96 ? 15  DT  D O4    1 
ATOM   320  C  C5    . DT  B 1 5  ? 2.498   -3.801  -1.899  1.00 33.89 ? 15  DT  D C5    1 
ATOM   321  C  C7    . DT  B 1 5  ? 2.971   -5.215  -1.730  1.00 31.65 ? 15  DT  D C7    1 
ATOM   322  C  C6    . DT  B 1 5  ? 3.001   -2.975  -2.824  1.00 33.57 ? 15  DT  D C6    1 
ATOM   323  P  P     . DA  B 1 6  ? 7.316   0.518   -5.703  1.00 53.18 ? 16  DA  D P     1 
ATOM   324  O  OP1   . DA  B 1 6  ? 7.721   1.866   -6.186  1.00 57.70 ? 16  DA  D OP1   1 
ATOM   325  O  OP2   . DA  B 1 6  ? 7.697   -0.688  -6.477  1.00 57.43 ? 16  DA  D OP2   1 
ATOM   326  O  "O5'" . DA  B 1 6  ? 7.869   0.315   -4.222  1.00 49.88 ? 16  DA  D "O5'" 1 
ATOM   327  C  "C5'" . DA  B 1 6  ? 7.013   0.455   -3.091  1.00 46.43 ? 16  DA  D "C5'" 1 
ATOM   328  C  "C4'" . DA  B 1 6  ? 7.779   0.998   -1.906  1.00 42.65 ? 16  DA  D "C4'" 1 
ATOM   329  O  "O4'" . DA  B 1 6  ? 6.841   1.087   -0.810  1.00 36.03 ? 16  DA  D "O4'" 1 
ATOM   330  C  "C3'" . DA  B 1 6  ? 8.910   0.096   -1.420  1.00 38.74 ? 16  DA  D "C3'" 1 
ATOM   331  O  "O3'" . DA  B 1 6  ? 10.020  0.840   -0.925  1.00 43.84 ? 16  DA  D "O3'" 1 
ATOM   332  C  "C2'" . DA  B 1 6  ? 8.281   -0.706  -0.304  1.00 38.73 ? 16  DA  D "C2'" 1 
ATOM   333  C  "C1'" . DA  B 1 6  ? 7.154   0.168   0.213   1.00 33.69 ? 16  DA  D "C1'" 1 
ATOM   334  N  N9    . DA  B 1 6  ? 5.961   -0.646  0.436   1.00 33.23 ? 16  DA  D N9    1 
ATOM   335  C  C8    . DA  B 1 6  ? 5.402   -1.515  -0.469  1.00 31.45 ? 16  DA  D C8    1 
ATOM   336  N  N7    . DA  B 1 6  ? 4.380   -2.184  0.001   1.00 35.25 ? 16  DA  D N7    1 
ATOM   337  C  C5    . DA  B 1 6  ? 4.243   -1.712  1.300   1.00 29.53 ? 16  DA  D C5    1 
ATOM   338  C  C6    . DA  B 1 6  ? 3.349   -2.041  2.329   1.00 24.67 ? 16  DA  D C6    1 
ATOM   339  N  N6    . DA  B 1 6  ? 2.385   -2.947  2.203   1.00 25.55 ? 16  DA  D N6    1 
ATOM   340  N  N1    . DA  B 1 6  ? 3.481   -1.392  3.508   1.00 27.93 ? 16  DA  D N1    1 
ATOM   341  C  C2    . DA  B 1 6  ? 4.450   -0.476  3.628   1.00 27.40 ? 16  DA  D C2    1 
ATOM   342  N  N3    . DA  B 1 6  ? 5.359   -0.083  2.728   1.00 26.64 ? 16  DA  D N3    1 
ATOM   343  C  C4    . DA  B 1 6  ? 5.199   -0.748  1.574   1.00 29.35 ? 16  DA  D C4    1 
ATOM   344  P  P     . DT  B 1 7  ? 11.419  0.079   -0.632  1.00 49.81 ? 17  DT  D P     1 
ATOM   345  O  OP1   . DT  B 1 7  ? 12.520  1.087   -0.662  1.00 43.47 ? 17  DT  D OP1   1 
ATOM   346  O  OP2   . DT  B 1 7  ? 11.507  -1.167  -1.447  1.00 36.86 ? 17  DT  D OP2   1 
ATOM   347  O  "O5'" . DT  B 1 7  ? 11.287  -0.418  0.866   1.00 42.07 ? 17  DT  D "O5'" 1 
ATOM   348  C  "C5'" . DT  B 1 7  ? 11.130  0.509   1.906   1.00 37.75 ? 17  DT  D "C5'" 1 
ATOM   349  C  "C4'" . DT  B 1 7  ? 10.801  -0.224  3.176   1.00 33.99 ? 17  DT  D "C4'" 1 
ATOM   350  O  "O4'" . DT  B 1 7  ? 9.495   -0.820  3.032   1.00 28.50 ? 17  DT  D "O4'" 1 
ATOM   351  C  "C3'" . DT  B 1 7  ? 11.754  -1.379  3.487   1.00 32.04 ? 17  DT  D "C3'" 1 
ATOM   352  O  "O3'" . DT  B 1 7  ? 12.242  -1.239  4.802   1.00 39.42 ? 17  DT  D "O3'" 1 
ATOM   353  C  "C2'" . DT  B 1 7  ? 10.881  -2.620  3.394   1.00 32.38 ? 17  DT  D "C2'" 1 
ATOM   354  C  "C1'" . DT  B 1 7  ? 9.519   -2.050  3.709   1.00 26.43 ? 17  DT  D "C1'" 1 
ATOM   355  N  N1    . DT  B 1 7  ? 8.367   -2.841  3.264   1.00 28.58 ? 17  DT  D N1    1 
ATOM   356  C  C2    . DT  B 1 7  ? 7.378   -3.077  4.200   1.00 26.82 ? 17  DT  D C2    1 
ATOM   357  O  O2    . DT  B 1 7  ? 7.426   -2.647  5.339   1.00 26.26 ? 17  DT  D O2    1 
ATOM   358  N  N3    . DT  B 1 7  ? 6.326   -3.829  3.750   1.00 25.01 ? 17  DT  D N3    1 
ATOM   359  C  C4    . DT  B 1 7  ? 6.152   -4.351  2.478   1.00 27.15 ? 17  DT  D C4    1 
ATOM   360  O  O4    . DT  B 1 7  ? 5.142   -5.006  2.228   1.00 21.50 ? 17  DT  D O4    1 
ATOM   361  C  C5    . DT  B 1 7  ? 7.227   -4.054  1.531   1.00 31.65 ? 17  DT  D C5    1 
ATOM   362  C  C7    . DT  B 1 7  ? 7.120   -4.556  0.118   1.00 31.43 ? 17  DT  D C7    1 
ATOM   363  C  C6    . DT  B 1 7  ? 8.271   -3.328  1.973   1.00 28.33 ? 17  DT  D C6    1 
ATOM   364  P  P     . DC  B 1 8  ? 13.801  -1.454  5.082   1.00 46.92 ? 18  DC  D P     1 
ATOM   365  O  OP1   . DC  B 1 8  ? 14.079  -0.716  6.346   1.00 48.18 ? 18  DC  D OP1   1 
ATOM   366  O  OP2   . DC  B 1 8  ? 14.558  -1.117  3.851   1.00 47.72 ? 18  DC  D OP2   1 
ATOM   367  O  "O5'" . DC  B 1 8  ? 13.914  -3.026  5.321   1.00 44.72 ? 18  DC  D "O5'" 1 
ATOM   368  C  "C5'" . DC  B 1 8  ? 13.685  -3.559  6.621   1.00 43.21 ? 18  DC  D "C5'" 1 
ATOM   369  C  "C4'" . DC  B 1 8  ? 13.477  -5.053  6.565   1.00 40.10 ? 18  DC  D "C4'" 1 
ATOM   370  O  "O4'" . DC  B 1 8  ? 12.133  -5.394  6.167   1.00 39.25 ? 18  DC  D "O4'" 1 
ATOM   371  C  "C3'" . DC  B 1 8  ? 14.403  -5.847  5.644   1.00 43.04 ? 18  DC  D "C3'" 1 
ATOM   372  O  "O3'" . DC  B 1 8  ? 14.791  -7.022  6.342   1.00 48.19 ? 18  DC  D "O3'" 1 
ATOM   373  C  "C2'" . DC  B 1 8  ? 13.481  -6.275  4.514   1.00 40.42 ? 18  DC  D "C2'" 1 
ATOM   374  C  "C1'" . DC  B 1 8  ? 12.219  -6.510  5.309   1.00 38.58 ? 18  DC  D "C1'" 1 
ATOM   375  N  N1    . DC  B 1 8  ? 10.929  -6.680  4.611   1.00 35.43 ? 18  DC  D N1    1 
ATOM   376  C  C2    . DC  B 1 8  ? 9.807   -6.995  5.391   1.00 33.43 ? 18  DC  D C2    1 
ATOM   377  O  O2    . DC  B 1 8  ? 9.942   -7.103  6.618   1.00 30.04 ? 18  DC  D O2    1 
ATOM   378  N  N3    . DC  B 1 8  ? 8.613   -7.183  4.795   1.00 33.11 ? 18  DC  D N3    1 
ATOM   379  C  C4    . DC  B 1 8  ? 8.506   -7.074  3.470   1.00 32.74 ? 18  DC  D C4    1 
ATOM   380  N  N4    . DC  B 1 8  ? 7.298   -7.264  2.934   1.00 30.61 ? 18  DC  D N4    1 
ATOM   381  C  C5    . DC  B 1 8  ? 9.630   -6.761  2.642   1.00 28.32 ? 18  DC  D C5    1 
ATOM   382  C  C6    . DC  B 1 8  ? 10.813  -6.562  3.253   1.00 31.11 ? 18  DC  D C6    1 
ATOM   383  P  P     . DG  B 1 9  ? 16.330  -7.249  6.735   1.00 50.41 ? 19  DG  D P     1 
ATOM   384  O  OP1   . DG  B 1 9  ? 17.070  -5.958  6.715   1.00 51.71 ? 19  DG  D OP1   1 
ATOM   385  O  OP2   . DG  B 1 9  ? 16.799  -8.381  5.900   1.00 49.91 ? 19  DG  D OP2   1 
ATOM   386  O  "O5'" . DG  B 1 9  ? 16.226  -7.734  8.236   1.00 47.99 ? 19  DG  D "O5'" 1 
ATOM   387  C  "C5'" . DG  B 1 9  ? 16.169  -9.105  8.517   1.00 44.75 ? 19  DG  D "C5'" 1 
ATOM   388  C  "C4'" . DG  B 1 9  ? 15.050  -9.406  9.481   1.00 45.62 ? 19  DG  D "C4'" 1 
ATOM   389  O  "O4'" . DG  B 1 9  ? 13.751  -9.107  8.899   1.00 46.24 ? 19  DG  D "O4'" 1 
ATOM   390  C  "C3'" . DG  B 1 9  ? 15.045  -10.902 9.742   1.00 45.63 ? 19  DG  D "C3'" 1 
ATOM   391  O  "O3'" . DG  B 1 9  ? 14.688  -11.179 11.085  1.00 51.99 ? 19  DG  D "O3'" 1 
ATOM   392  C  "C2'" . DG  B 1 9  ? 14.016  -11.434 8.765   1.00 44.26 ? 19  DG  D "C2'" 1 
ATOM   393  C  "C1'" . DG  B 1 9  ? 13.001  -10.313 8.736   1.00 41.03 ? 19  DG  D "C1'" 1 
ATOM   394  N  N9    . DG  B 1 9  ? 12.301  -10.244 7.459   1.00 35.76 ? 19  DG  D N9    1 
ATOM   395  C  C8    . DG  B 1 9  ? 12.832  -9.878  6.247   1.00 34.14 ? 19  DG  D C8    1 
ATOM   396  N  N7    . DG  B 1 9  ? 11.961  -9.901  5.276   1.00 31.96 ? 19  DG  D N7    1 
ATOM   397  C  C5    . DG  B 1 9  ? 10.782  -10.308 5.882   1.00 31.71 ? 19  DG  D C5    1 
ATOM   398  C  C6    . DG  B 1 9  ? 9.490   -10.499 5.334   1.00 33.79 ? 19  DG  D C6    1 
ATOM   399  O  O6    . DG  B 1 9  ? 9.114   -10.345 4.153   1.00 37.69 ? 19  DG  D O6    1 
ATOM   400  N  N1    . DG  B 1 9  ? 8.582   -10.912 6.306   1.00 31.71 ? 19  DG  D N1    1 
ATOM   401  C  C2    . DG  B 1 9  ? 8.876   -11.116 7.634   1.00 31.14 ? 19  DG  D C2    1 
ATOM   402  N  N2    . DG  B 1 9  ? 7.851   -11.525 8.415   1.00 29.03 ? 19  DG  D N2    1 
ATOM   403  N  N3    . DG  B 1 9  ? 10.079  -10.935 8.158   1.00 29.35 ? 19  DG  D N3    1 
ATOM   404  C  C4    . DG  B 1 9  ? 10.977  -10.533 7.231   1.00 31.72 ? 19  DG  D C4    1 
ATOM   405  P  P     . DC  B 1 10 ? 14.957  -12.641 11.669  1.00 53.12 ? 20  DC  D P     1 
ATOM   406  O  OP1   . DC  B 1 10 ? 14.950  -12.478 13.144  1.00 56.15 ? 20  DC  D OP1   1 
ATOM   407  O  OP2   . DC  B 1 10 ? 16.158  -13.187 10.980  1.00 52.54 ? 20  DC  D OP2   1 
ATOM   408  O  "O5'" . DC  B 1 10 ? 13.682  -13.476 11.219  1.00 50.93 ? 20  DC  D "O5'" 1 
ATOM   409  C  "C5'" . DC  B 1 10 ? 12.424  -13.234 11.828  1.00 48.51 ? 20  DC  D "C5'" 1 
ATOM   410  C  "C4'" . DC  B 1 10 ? 11.378  -14.160 11.257  1.00 47.22 ? 20  DC  D "C4'" 1 
ATOM   411  O  "O4'" . DC  B 1 10 ? 10.922  -13.718 9.954   1.00 44.51 ? 20  DC  D "O4'" 1 
ATOM   412  C  "C3'" . DC  B 1 10 ? 11.814  -15.616 11.081  1.00 46.81 ? 20  DC  D "C3'" 1 
ATOM   413  O  "O3'" . DC  B 1 10 ? 10.733  -16.435 11.588  1.00 48.09 ? 20  DC  D "O3'" 1 
ATOM   414  C  "C2'" . DC  B 1 10 ? 11.919  -15.763 9.570   1.00 43.92 ? 20  DC  D "C2'" 1 
ATOM   415  C  "C1'" . DC  B 1 10 ? 10.771  -14.869 9.152   1.00 42.38 ? 20  DC  D "C1'" 1 
ATOM   416  N  N1    . DC  B 1 10 ? 10.667  -14.458 7.740   1.00 37.82 ? 20  DC  D N1    1 
ATOM   417  C  C2    . DC  B 1 10 ? 9.391   -14.476 7.135   1.00 39.05 ? 20  DC  D C2    1 
ATOM   418  O  O2    . DC  B 1 10 ? 8.399   -14.828 7.809   1.00 39.21 ? 20  DC  D O2    1 
ATOM   419  N  N3    . DC  B 1 10 ? 9.267   -14.106 5.846   1.00 35.32 ? 20  DC  D N3    1 
ATOM   420  C  C4    . DC  B 1 10 ? 10.343  -13.728 5.155   1.00 35.94 ? 20  DC  D C4    1 
ATOM   421  N  N4    . DC  B 1 10 ? 10.162  -13.369 3.877   1.00 32.45 ? 20  DC  D N4    1 
ATOM   422  C  C5    . DC  B 1 10 ? 11.652  -13.697 5.744   1.00 34.53 ? 20  DC  D C5    1 
ATOM   423  C  C6    . DC  B 1 10 ? 11.765  -14.066 7.025   1.00 30.78 ? 20  DC  D C6    1 
ATOM   424  N  N     . SER C 2 1  ? 7.473   -9.123  -16.543 1.00 72.94 ? 2   SER A N     1 
ATOM   425  C  CA    . SER C 2 1  ? 8.287   -8.285  -15.615 1.00 73.13 ? 2   SER A CA    1 
ATOM   426  C  C     . SER C 2 1  ? 8.864   -7.047  -16.327 1.00 72.54 ? 2   SER A C     1 
ATOM   427  O  O     . SER C 2 1  ? 9.998   -6.643  -16.054 1.00 73.09 ? 2   SER A O     1 
ATOM   428  C  CB    . SER C 2 1  ? 9.423   -9.139  -15.012 1.00 71.88 ? 2   SER A CB    1 
ATOM   429  N  N     . ASP C 2 2  ? 8.080   -6.435  -17.220 1.00 71.24 ? 3   ASP A N     1 
ATOM   430  C  CA    . ASP C 2 2  ? 8.556   -5.260  -17.955 1.00 68.11 ? 3   ASP A CA    1 
ATOM   431  C  C     . ASP C 2 2  ? 7.595   -4.058  -18.091 1.00 63.80 ? 3   ASP A C     1 
ATOM   432  O  O     . ASP C 2 2  ? 8.039   -2.926  -18.334 1.00 62.33 ? 3   ASP A O     1 
ATOM   433  C  CB    . ASP C 2 2  ? 9.024   -5.688  -19.350 1.00 70.26 ? 3   ASP A CB    1 
ATOM   434  C  CG    . ASP C 2 2  ? 9.966   -4.677  -19.980 1.00 72.63 ? 3   ASP A CG    1 
ATOM   435  O  OD1   . ASP C 2 2  ? 10.272  -4.827  -21.187 1.00 72.63 ? 3   ASP A OD1   1 
ATOM   436  O  OD2   . ASP C 2 2  ? 10.405  -3.739  -19.262 1.00 71.95 ? 3   ASP A OD2   1 
ATOM   437  N  N     . LYS C 2 3  ? 6.292   -4.285  -17.947 1.00 59.11 ? 4   LYS A N     1 
ATOM   438  C  CA    . LYS C 2 3  ? 5.331   -3.185  -18.058 1.00 54.87 ? 4   LYS A CA    1 
ATOM   439  C  C     . LYS C 2 3  ? 5.567   -2.158  -16.944 1.00 50.23 ? 4   LYS A C     1 
ATOM   440  O  O     . LYS C 2 3  ? 6.210   -2.460  -15.932 1.00 47.67 ? 4   LYS A O     1 
ATOM   441  C  CB    . LYS C 2 3  ? 3.890   -3.717  -18.001 1.00 55.28 ? 4   LYS A CB    1 
ATOM   442  C  CG    . LYS C 2 3  ? 3.288   -3.843  -16.617 1.00 57.18 ? 4   LYS A CG    1 
ATOM   443  C  CD    . LYS C 2 3  ? 2.139   -4.852  -16.606 1.00 58.09 ? 4   LYS A CD    1 
ATOM   444  C  CE    . LYS C 2 3  ? 1.167   -4.623  -17.754 1.00 57.97 ? 4   LYS A CE    1 
ATOM   445  N  NZ    . LYS C 2 3  ? 0.195   -5.747  -17.881 1.00 56.14 ? 4   LYS A NZ    1 
ATOM   446  N  N     . PRO C 2 4  ? 5.060   -0.923  -17.121 1.00 46.22 ? 5   PRO A N     1 
ATOM   447  C  CA    . PRO C 2 4  ? 5.248   0.118   -16.099 1.00 42.20 ? 5   PRO A CA    1 
ATOM   448  C  C     . PRO C 2 4  ? 4.787   -0.318  -14.703 1.00 37.36 ? 5   PRO A C     1 
ATOM   449  O  O     . PRO C 2 4  ? 3.776   -1.005  -14.566 1.00 30.10 ? 5   PRO A O     1 
ATOM   450  C  CB    . PRO C 2 4  ? 4.416   1.285   -16.631 1.00 42.04 ? 5   PRO A CB    1 
ATOM   451  C  CG    . PRO C 2 4  ? 4.461   1.082   -18.138 1.00 45.81 ? 5   PRO A CG    1 
ATOM   452  C  CD    . PRO C 2 4  ? 4.274   -0.412  -18.262 1.00 44.15 ? 5   PRO A CD    1 
ATOM   453  N  N     . LYS C 2 5  ? 5.532   0.076   -13.674 1.00 35.99 ? 6   LYS A N     1 
ATOM   454  C  CA    . LYS C 2 5  ? 5.148   -0.281  -12.311 1.00 35.86 ? 6   LYS A CA    1 
ATOM   455  C  C     . LYS C 2 5  ? 3.956   0.596   -11.981 1.00 31.78 ? 6   LYS A C     1 
ATOM   456  O  O     . LYS C 2 5  ? 3.915   1.754   -12.381 1.00 26.16 ? 6   LYS A O     1 
ATOM   457  C  CB    . LYS C 2 5  ? 6.300   -0.005  -11.326 1.00 35.27 ? 6   LYS A CB    1 
ATOM   458  N  N     . ARG C 2 6  ? 2.977   0.046   -11.273 1.00 31.80 ? 7   ARG A N     1 
ATOM   459  C  CA    . ARG C 2 6  ? 1.812   0.839   -10.907 1.00 31.30 ? 7   ARG A CA    1 
ATOM   460  C  C     . ARG C 2 6  ? 2.245   2.072   -10.086 1.00 32.12 ? 7   ARG A C     1 
ATOM   461  O  O     . ARG C 2 6  ? 3.141   1.984   -9.241  1.00 33.49 ? 7   ARG A O     1 
ATOM   462  C  CB    . ARG C 2 6  ? 0.832   -0.011  -10.107 1.00 34.80 ? 7   ARG A CB    1 
ATOM   463  C  CG    . ARG C 2 6  ? -0.123  -0.863  -10.948 1.00 37.86 ? 7   ARG A CG    1 
ATOM   464  C  CD    . ARG C 2 6  ? -1.387  -1.149  -10.124 1.00 42.53 ? 7   ARG A CD    1 
ATOM   465  N  NE    . ARG C 2 6  ? -2.370  -1.962  -10.833 1.00 47.83 ? 7   ARG A NE    1 
ATOM   466  C  CZ    . ARG C 2 6  ? -3.622  -2.165  -10.422 1.00 49.59 ? 7   ARG A CZ    1 
ATOM   467  N  NH1   . ARG C 2 6  ? -4.070  -1.613  -9.297  1.00 45.42 ? 7   ARG A NH1   1 
ATOM   468  N  NH2   . ARG C 2 6  ? -4.431  -2.935  -11.138 1.00 54.17 ? 7   ARG A NH2   1 
ATOM   469  N  N     . PRO C 2 7  ? 1.617   3.237   -10.332 1.00 28.11 ? 8   PRO A N     1 
ATOM   470  C  CA    . PRO C 2 7  ? 1.956   4.466   -9.607  1.00 25.78 ? 8   PRO A CA    1 
ATOM   471  C  C     . PRO C 2 7  ? 1.590   4.348   -8.121  1.00 24.37 ? 8   PRO A C     1 
ATOM   472  O  O     . PRO C 2 7  ? 0.659   3.626   -7.755  1.00 21.65 ? 8   PRO A O     1 
ATOM   473  C  CB    . PRO C 2 7  ? 1.140   5.534   -10.346 1.00 27.54 ? 8   PRO A CB    1 
ATOM   474  C  CG    . PRO C 2 7  ? -0.085  4.787   -10.728 1.00 29.77 ? 8   PRO A CG    1 
ATOM   475  C  CD    . PRO C 2 7  ? 0.440   3.441   -11.198 1.00 27.55 ? 8   PRO A CD    1 
ATOM   476  N  N     . LEU C 2 8  ? 2.344   5.036   -7.268  1.00 23.90 ? 9   LEU A N     1 
ATOM   477  C  CA    . LEU C 2 8  ? 2.097   4.995   -5.827  1.00 24.74 ? 9   LEU A CA    1 
ATOM   478  C  C     . LEU C 2 8  ? 1.017   5.957   -5.353  1.00 23.45 ? 9   LEU A C     1 
ATOM   479  O  O     . LEU C 2 8  ? 0.908   7.073   -5.827  1.00 23.20 ? 9   LEU A O     1 
ATOM   480  C  CB    . LEU C 2 8  ? 3.370   5.309   -5.055  1.00 22.96 ? 9   LEU A CB    1 
ATOM   481  C  CG    . LEU C 2 8  ? 4.476   4.262   -5.183  1.00 24.57 ? 9   LEU A CG    1 
ATOM   482  C  CD1   . LEU C 2 8  ? 5.701   4.794   -4.469  1.00 25.83 ? 9   LEU A CD1   1 
ATOM   483  C  CD2   . LEU C 2 8  ? 4.043   2.935   -4.587  1.00 24.74 ? 9   LEU A CD2   1 
ATOM   484  N  N     . SER C 2 9  ? 0.233   5.504   -4.395  1.00 25.05 ? 10  SER A N     1 
ATOM   485  C  CA    . SER C 2 9  ? -0.824  6.319   -3.818  1.00 21.19 ? 10  SER A CA    1 
ATOM   486  C  C     . SER C 2 9  ? -0.208  7.484   -3.035  1.00 19.33 ? 10  SER A C     1 
ATOM   487  O  O     . SER C 2 9  ? 1.008   7.539   -2.802  1.00 17.67 ? 10  SER A O     1 
ATOM   488  C  CB    . SER C 2 9  ? -1.641  5.452   -2.876  1.00 20.83 ? 10  SER A CB    1 
ATOM   489  O  OG    . SER C 2 9  ? -0.845  5.076   -1.773  1.00 15.81 ? 10  SER A OG    1 
ATOM   490  N  N     . ALA C 2 10 ? -1.055  8.405   -2.607  1.00 18.87 ? 11  ALA A N     1 
ATOM   491  C  CA    . ALA C 2 10 ? -0.595  9.562   -1.843  1.00 14.18 ? 11  ALA A CA    1 
ATOM   492  C  C     . ALA C 2 10 ? 0.054   9.105   -0.544  1.00 15.58 ? 11  ALA A C     1 
ATOM   493  O  O     . ALA C 2 10 ? 1.113   9.615   -0.140  1.00 13.77 ? 11  ALA A O     1 
ATOM   494  C  CB    . ALA C 2 10 ? -1.783  10.496  -1.553  1.00 15.12 ? 11  ALA A CB    1 
ATOM   495  N  N     . TYR C 2 11 ? -0.567  8.107   0.083   1.00 12.86 ? 12  TYR A N     1 
ATOM   496  C  CA    . TYR C 2 11 ? -0.078  7.572   1.332   1.00 17.05 ? 12  TYR A CA    1 
ATOM   497  C  C     . TYR C 2 11 ? 1.288   6.890   1.200   1.00 19.20 ? 12  TYR A C     1 
ATOM   498  O  O     . TYR C 2 11 ? 2.166   7.082   2.038   1.00 19.92 ? 12  TYR A O     1 
ATOM   499  C  CB    . TYR C 2 11 ? -1.104  6.599   1.921   1.00 13.81 ? 12  TYR A CB    1 
ATOM   500  C  CG    . TYR C 2 11 ? -0.536  5.778   3.072   1.00 15.23 ? 12  TYR A CG    1 
ATOM   501  C  CD1   . TYR C 2 11 ? -0.332  6.341   4.340   1.00 11.64 ? 12  TYR A CD1   1 
ATOM   502  C  CD2   . TYR C 2 11 ? -0.140  4.452   2.867   1.00 18.48 ? 12  TYR A CD2   1 
ATOM   503  C  CE1   . TYR C 2 11 ? 0.273   5.595   5.376   1.00 18.56 ? 12  TYR A CE1   1 
ATOM   504  C  CE2   . TYR C 2 11 ? 0.450   3.702   3.878   1.00 16.74 ? 12  TYR A CE2   1 
ATOM   505  C  CZ    . TYR C 2 11 ? 0.661   4.272   5.130   1.00 17.61 ? 12  TYR A CZ    1 
ATOM   506  O  OH    . TYR C 2 11 ? 1.266   3.519   6.102   1.00 15.30 ? 12  TYR A OH    1 
ATOM   507  N  N     . MET C 2 12 ? 1.463   6.090   0.154   1.00 19.69 ? 13  MET A N     1 
ATOM   508  C  CA    . MET C 2 12 ? 2.728   5.403   -0.061  1.00 21.00 ? 13  MET A CA    1 
ATOM   509  C  C     . MET C 2 12 ? 3.836   6.380   -0.416  1.00 21.43 ? 13  MET A C     1 
ATOM   510  O  O     . MET C 2 12 ? 4.980   6.186   -0.024  1.00 21.55 ? 13  MET A O     1 
ATOM   511  C  CB    . MET C 2 12 ? 2.586   4.350   -1.159  1.00 20.73 ? 13  MET A CB    1 
ATOM   512  C  CG    . MET C 2 12 ? 1.936   3.072   -0.672  1.00 26.57 ? 13  MET A CG    1 
ATOM   513  S  SD    . MET C 2 12 ? 3.021   2.306   0.554   1.00 26.40 ? 13  MET A SD    1 
ATOM   514  C  CE    . MET C 2 12 ? 1.879   1.491   1.630   1.00 31.32 ? 13  MET A CE    1 
ATOM   515  N  N     . LEU C 2 13 ? 3.516   7.425   -1.165  1.00 20.97 ? 14  LEU A N     1 
ATOM   516  C  CA    . LEU C 2 13 ? 4.545   8.409   -1.503  1.00 23.41 ? 14  LEU A CA    1 
ATOM   517  C  C     . LEU C 2 13 ? 4.965   9.094   -0.204  1.00 22.86 ? 14  LEU A C     1 
ATOM   518  O  O     . LEU C 2 13 ? 6.148   9.308   0.065   1.00 21.50 ? 14  LEU A O     1 
ATOM   519  C  CB    . LEU C 2 13 ? 4.000   9.441   -2.491  1.00 22.23 ? 14  LEU A CB    1 
ATOM   520  C  CG    . LEU C 2 13 ? 3.836   8.928   -3.931  1.00 31.05 ? 14  LEU A CG    1 
ATOM   521  C  CD1   . LEU C 2 13 ? 3.095   9.993   -4.770  1.00 28.12 ? 14  LEU A CD1   1 
ATOM   522  C  CD2   . LEU C 2 13 ? 5.240   8.607   -4.547  1.00 26.80 ? 14  LEU A CD2   1 
ATOM   523  N  N     . TRP C 2 14 ? 3.985   9.435   0.618   1.00 19.96 ? 15  TRP A N     1 
ATOM   524  C  CA    . TRP C 2 14 ? 4.327   10.068  1.866   1.00 21.21 ? 15  TRP A CA    1 
ATOM   525  C  C     . TRP C 2 14 ? 5.156   9.158   2.789   1.00 23.68 ? 15  TRP A C     1 
ATOM   526  O  O     . TRP C 2 14 ? 6.157   9.595   3.362   1.00 27.21 ? 15  TRP A O     1 
ATOM   527  C  CB    . TRP C 2 14 ? 3.081   10.532  2.603   1.00 20.82 ? 15  TRP A CB    1 
ATOM   528  C  CG    . TRP C 2 14 ? 3.453   10.911  3.971   1.00 23.00 ? 15  TRP A CG    1 
ATOM   529  C  CD1   . TRP C 2 14 ? 4.094   12.049  4.363   1.00 19.52 ? 15  TRP A CD1   1 
ATOM   530  C  CD2   . TRP C 2 14 ? 3.341   10.091  5.131   1.00 20.56 ? 15  TRP A CD2   1 
ATOM   531  N  NE1   . TRP C 2 14 ? 4.390   11.985  5.699   1.00 17.51 ? 15  TRP A NE1   1 
ATOM   532  C  CE2   . TRP C 2 14 ? 3.937   10.792  6.196   1.00 22.25 ? 15  TRP A CE2   1 
ATOM   533  C  CE3   . TRP C 2 14 ? 2.795   8.825   5.373   1.00 18.98 ? 15  TRP A CE3   1 
ATOM   534  C  CZ2   . TRP C 2 14 ? 3.999   10.271  7.489   1.00 20.36 ? 15  TRP A CZ2   1 
ATOM   535  C  CZ3   . TRP C 2 14 ? 2.860   8.306   6.659   1.00 18.40 ? 15  TRP A CZ3   1 
ATOM   536  C  CH2   . TRP C 2 14 ? 3.455   9.029   7.699   1.00 22.56 ? 15  TRP A CH2   1 
ATOM   537  N  N     . LEU C 2 15 ? 4.756   7.897   2.909   1.00 22.32 ? 16  LEU A N     1 
ATOM   538  C  CA    . LEU C 2 15 ? 5.449   6.973   3.786   1.00 23.90 ? 16  LEU A CA    1 
ATOM   539  C  C     . LEU C 2 15 ? 6.870   6.726   3.321   1.00 25.63 ? 16  LEU A C     1 
ATOM   540  O  O     . LEU C 2 15 ? 7.806   6.740   4.123   1.00 26.91 ? 16  LEU A O     1 
ATOM   541  C  CB    . LEU C 2 15 ? 4.713   5.634   3.857   1.00 22.02 ? 16  LEU A CB    1 
ATOM   542  C  CG    . LEU C 2 15 ? 4.700   4.826   5.158   1.00 25.51 ? 16  LEU A CG    1 
ATOM   543  C  CD1   . LEU C 2 15 ? 4.677   3.345   4.792   1.00 22.59 ? 16  LEU A CD1   1 
ATOM   544  C  CD2   . LEU C 2 15 ? 5.893   5.145   6.054   1.00 24.62 ? 16  LEU A CD2   1 
ATOM   545  N  N     . ASN C 2 16 ? 7.034   6.472   2.034   1.00 25.09 ? 17  ASN A N     1 
ATOM   546  C  CA    . ASN C 2 16 ? 8.362   6.235   1.513   1.00 28.76 ? 17  ASN A CA    1 
ATOM   547  C  C     . ASN C 2 16 ? 9.254   7.433   1.864   1.00 28.95 ? 17  ASN A C     1 
ATOM   548  O  O     . ASN C 2 16 ? 10.411  7.258   2.255   1.00 32.93 ? 17  ASN A O     1 
ATOM   549  C  CB    . ASN C 2 16 ? 8.324   6.048   -0.009  1.00 27.63 ? 17  ASN A CB    1 
ATOM   550  C  CG    . ASN C 2 16 ? 7.660   4.748   -0.440  1.00 35.15 ? 17  ASN A CG    1 
ATOM   551  O  OD1   . ASN C 2 16 ? 7.209   4.628   -1.586  1.00 37.83 ? 17  ASN A OD1   1 
ATOM   552  N  ND2   . ASN C 2 16 ? 7.612   3.762   0.459   1.00 38.18 ? 17  ASN A ND2   1 
ATOM   553  N  N     . SER C 2 17 ? 8.717   8.644   1.747   1.00 26.29 ? 18  SER A N     1 
ATOM   554  C  CA    . SER C 2 17 ? 9.516   9.830   2.028   1.00 26.45 ? 18  SER A CA    1 
ATOM   555  C  C     . SER C 2 17 ? 9.763   10.056  3.502   1.00 25.56 ? 18  SER A C     1 
ATOM   556  O  O     . SER C 2 17 ? 10.744  10.701  3.876   1.00 21.51 ? 18  SER A O     1 
ATOM   557  C  CB    . SER C 2 17 ? 8.839   11.095  1.497   1.00 23.26 ? 18  SER A CB    1 
ATOM   558  O  OG    . SER C 2 17 ? 7.775   11.483  2.357   1.00 26.07 ? 18  SER A OG    1 
ATOM   559  N  N     . ALA C 2 18 ? 8.849   9.563   4.329   1.00 22.69 ? 19  ALA A N     1 
ATOM   560  C  CA    . ALA C 2 18 ? 8.945   9.768   5.768   1.00 23.12 ? 19  ALA A CA    1 
ATOM   561  C  C     . ALA C 2 18 ? 9.554   8.620   6.585   1.00 22.61 ? 19  ALA A C     1 
ATOM   562  O  O     . ALA C 2 18 ? 9.947   8.831   7.725   1.00 22.07 ? 19  ALA A O     1 
ATOM   563  C  CB    . ALA C 2 18 ? 7.571   10.120  6.316   1.00 22.08 ? 19  ALA A CB    1 
ATOM   564  N  N     . ARG C 2 19 ? 9.616   7.427   5.996   1.00 23.22 ? 20  ARG A N     1 
ATOM   565  C  CA    . ARG C 2 19 ? 10.158  6.230   6.625   1.00 22.57 ? 20  ARG A CA    1 
ATOM   566  C  C     . ARG C 2 19 ? 11.451  6.443   7.415   1.00 26.93 ? 20  ARG A C     1 
ATOM   567  O  O     . ARG C 2 19 ? 11.491  6.193   8.622   1.00 25.42 ? 20  ARG A O     1 
ATOM   568  C  CB    . ARG C 2 19 ? 10.420  5.163   5.567   1.00 26.20 ? 20  ARG A CB    1 
ATOM   569  C  CG    . ARG C 2 19 ? 10.962  3.864   6.135   1.00 27.74 ? 20  ARG A CG    1 
ATOM   570  C  CD    . ARG C 2 19 ? 11.053  2.816   5.063   1.00 26.21 ? 20  ARG A CD    1 
ATOM   571  N  NE    . ARG C 2 19 ? 9.743   2.457   4.541   1.00 27.35 ? 20  ARG A NE    1 
ATOM   572  C  CZ    . ARG C 2 19 ? 8.868   1.682   5.166   1.00 25.87 ? 20  ARG A CZ    1 
ATOM   573  N  NH1   . ARG C 2 19 ? 9.160   1.161   6.349   1.00 27.84 ? 20  ARG A NH1   1 
ATOM   574  N  NH2   . ARG C 2 19 ? 7.688   1.434   4.606   1.00 31.23 ? 20  ARG A NH2   1 
ATOM   575  N  N     . GLU C 2 20 ? 12.513  6.876   6.733   1.00 29.54 ? 21  GLU A N     1 
ATOM   576  C  CA    . GLU C 2 20 ? 13.798  7.108   7.400   1.00 31.88 ? 21  GLU A CA    1 
ATOM   577  C  C     . GLU C 2 20 ? 13.686  8.120   8.536   1.00 30.38 ? 21  GLU A C     1 
ATOM   578  O  O     . GLU C 2 20 ? 14.422  8.044   9.525   1.00 33.10 ? 21  GLU A O     1 
ATOM   579  C  CB    . GLU C 2 20 ? 14.873  7.571   6.398   1.00 36.79 ? 21  GLU A CB    1 
ATOM   580  C  CG    . GLU C 2 20 ? 15.260  6.524   5.337   1.00 40.05 ? 21  GLU A CG    1 
ATOM   581  C  CD    . GLU C 2 20 ? 15.469  5.119   5.919   1.00 43.59 ? 21  GLU A CD    1 
ATOM   582  O  OE1   . GLU C 2 20 ? 16.199  4.995   6.921   1.00 46.80 ? 21  GLU A OE1   1 
ATOM   583  O  OE2   . GLU C 2 20 ? 14.912  4.136   5.370   1.00 45.07 ? 21  GLU A OE2   1 
ATOM   584  N  N     . SER C 2 21 ? 12.763  9.063   8.408   1.00 28.21 ? 22  SER A N     1 
ATOM   585  C  CA    . SER C 2 21 ? 12.577  10.060  9.455   1.00 30.54 ? 22  SER A CA    1 
ATOM   586  C  C     . SER C 2 21 ? 11.979  9.378   10.685  1.00 28.71 ? 22  SER A C     1 
ATOM   587  O  O     . SER C 2 21 ? 12.494  9.499   11.797  1.00 29.70 ? 22  SER A O     1 
ATOM   588  C  CB    . SER C 2 21 ? 11.651  11.180  8.963   1.00 34.08 ? 22  SER A CB    1 
ATOM   589  O  OG    . SER C 2 21 ? 11.164  11.953  10.048  1.00 40.98 ? 22  SER A OG    1 
ATOM   590  N  N     . ILE C 2 22 ? 10.885  8.664   10.457  1.00 28.70 ? 23  ILE A N     1 
ATOM   591  C  CA    . ILE C 2 22 ? 10.173  7.898   11.489  1.00 25.49 ? 23  ILE A CA    1 
ATOM   592  C  C     . ILE C 2 22 ? 11.159  6.933   12.146  1.00 22.67 ? 23  ILE A C     1 
ATOM   593  O  O     . ILE C 2 22 ? 11.139  6.751   13.349  1.00 25.38 ? 23  ILE A O     1 
ATOM   594  C  CB    . ILE C 2 22 ? 8.990   7.077   10.842  1.00 23.75 ? 23  ILE A CB    1 
ATOM   595  C  CG1   . ILE C 2 22 ? 7.885   8.028   10.386  1.00 19.70 ? 23  ILE A CG1   1 
ATOM   596  C  CG2   . ILE C 2 22 ? 8.455   6.026   11.820  1.00 25.35 ? 23  ILE A CG2   1 
ATOM   597  C  CD1   . ILE C 2 22 ? 6.854   7.384   9.413   1.00 17.79 ? 23  ILE A CD1   1 
ATOM   598  N  N     . LYS C 2 23 ? 12.037  6.326   11.351  1.00 25.74 ? 24  LYS A N     1 
ATOM   599  C  CA    . LYS C 2 23 ? 13.004  5.384   11.899  1.00 31.44 ? 24  LYS A CA    1 
ATOM   600  C  C     . LYS C 2 23 ? 14.040  6.013   12.827  1.00 33.46 ? 24  LYS A C     1 
ATOM   601  O  O     . LYS C 2 23 ? 14.422  5.402   13.830  1.00 35.84 ? 24  LYS A O     1 
ATOM   602  C  CB    . LYS C 2 23 ? 13.712  4.617   10.781  1.00 30.43 ? 24  LYS A CB    1 
ATOM   603  C  CG    . LYS C 2 23 ? 12.891  3.495   10.189  1.00 24.77 ? 24  LYS A CG    1 
ATOM   604  C  CD    . LYS C 2 23 ? 13.599  2.869   9.014   1.00 28.33 ? 24  LYS A CD    1 
ATOM   605  C  CE    . LYS C 2 23 ? 14.917  2.211   9.419   1.00 27.12 ? 24  LYS A CE    1 
ATOM   606  N  NZ    . LYS C 2 23 ? 15.578  1.688   8.188   1.00 29.88 ? 24  LYS A NZ    1 
ATOM   607  N  N     . ARG C 2 24 ? 14.501  7.220   12.514  1.00 36.90 ? 25  ARG A N     1 
ATOM   608  C  CA    . ARG C 2 24 ? 15.490  7.835   13.392  1.00 39.68 ? 25  ARG A CA    1 
ATOM   609  C  C     . ARG C 2 24 ? 14.826  8.463   14.608  1.00 38.15 ? 25  ARG A C     1 
ATOM   610  O  O     . ARG C 2 24 ? 15.485  8.692   15.618  1.00 38.24 ? 25  ARG A O     1 
ATOM   611  C  CB    . ARG C 2 24 ? 16.376  8.845   12.638  1.00 42.11 ? 25  ARG A CB    1 
ATOM   612  C  CG    . ARG C 2 24 ? 15.687  10.008  11.965  1.00 48.76 ? 25  ARG A CG    1 
ATOM   613  C  CD    . ARG C 2 24 ? 16.726  10.959  11.351  1.00 53.46 ? 25  ARG A CD    1 
ATOM   614  N  NE    . ARG C 2 24 ? 17.317  10.461  10.105  1.00 58.87 ? 25  ARG A NE    1 
ATOM   615  C  CZ    . ARG C 2 24 ? 16.788  10.652  8.894   1.00 62.46 ? 25  ARG A CZ    1 
ATOM   616  N  NH1   . ARG C 2 24 ? 15.653  11.330  8.764   1.00 64.66 ? 25  ARG A NH1   1 
ATOM   617  N  NH2   . ARG C 2 24 ? 17.394  10.177  7.806   1.00 62.60 ? 25  ARG A NH2   1 
ATOM   618  N  N     . GLU C 2 25 ? 13.516  8.698   14.524  1.00 38.21 ? 26  GLU A N     1 
ATOM   619  C  CA    . GLU C 2 25 ? 12.758  9.260   15.649  1.00 38.13 ? 26  GLU A CA    1 
ATOM   620  C  C     . GLU C 2 25 ? 12.352  8.165   16.641  1.00 36.60 ? 26  GLU A C     1 
ATOM   621  O  O     . GLU C 2 25 ? 11.836  8.455   17.716  1.00 39.71 ? 26  GLU A O     1 
ATOM   622  C  CB    . GLU C 2 25 ? 11.480  9.943   15.170  1.00 39.71 ? 26  GLU A CB    1 
ATOM   623  C  CG    . GLU C 2 25 ? 11.679  11.160  14.295  1.00 47.53 ? 26  GLU A CG    1 
ATOM   624  C  CD    . GLU C 2 25 ? 10.569  12.173  14.505  1.00 50.92 ? 26  GLU A CD    1 
ATOM   625  O  OE1   . GLU C 2 25 ? 10.115  12.793  13.519  1.00 54.24 ? 26  GLU A OE1   1 
ATOM   626  O  OE2   . GLU C 2 25 ? 10.153  12.347  15.672  1.00 50.92 ? 26  GLU A OE2   1 
ATOM   627  N  N     . ASN C 2 26 ? 12.567  6.911   16.253  1.00 34.14 ? 27  ASN A N     1 
ATOM   628  C  CA    . ASN C 2 26 ? 12.235  5.739   17.078  1.00 30.77 ? 27  ASN A CA    1 
ATOM   629  C  C     . ASN C 2 26 ? 13.324  4.736   16.779  1.00 28.83 ? 27  ASN A C     1 
ATOM   630  O  O     . ASN C 2 26 ? 13.110  3.822   15.992  1.00 24.79 ? 27  ASN A O     1 
ATOM   631  C  CB    . ASN C 2 26 ? 10.916  5.126   16.632  1.00 28.60 ? 27  ASN A CB    1 
ATOM   632  C  CG    . ASN C 2 26 ? 9.818   6.133   16.543  1.00 33.85 ? 27  ASN A CG    1 
ATOM   633  O  OD1   . ASN C 2 26 ? 9.086   6.346   17.505  1.00 34.02 ? 27  ASN A OD1   1 
ATOM   634  N  ND2   . ASN C 2 26 ? 9.693   6.781   15.381  1.00 34.16 ? 27  ASN A ND2   1 
ATOM   635  N  N     . PRO C 2 27 ? 14.510  4.892   17.389  1.00 29.69 ? 28  PRO A N     1 
ATOM   636  C  CA    . PRO C 2 27 ? 15.587  3.938   17.105  1.00 30.46 ? 28  PRO A CA    1 
ATOM   637  C  C     . PRO C 2 27 ? 15.104  2.496   17.213  1.00 31.70 ? 28  PRO A C     1 
ATOM   638  O  O     . PRO C 2 27 ? 14.341  2.157   18.111  1.00 28.55 ? 28  PRO A O     1 
ATOM   639  C  CB    . PRO C 2 27 ? 16.652  4.272   18.153  1.00 31.81 ? 28  PRO A CB    1 
ATOM   640  C  CG    . PRO C 2 27 ? 16.381  5.711   18.489  1.00 35.20 ? 28  PRO A CG    1 
ATOM   641  C  CD    . PRO C 2 27 ? 14.869  5.791   18.497  1.00 31.15 ? 28  PRO A CD    1 
ATOM   642  N  N     . GLY C 2 28 ? 15.535  1.661   16.278  1.00 31.86 ? 29  GLY A N     1 
ATOM   643  C  CA    . GLY C 2 28 ? 15.149  0.264   16.306  1.00 33.85 ? 29  GLY A CA    1 
ATOM   644  C  C     . GLY C 2 28 ? 13.731  -0.098  15.905  1.00 32.97 ? 29  GLY A C     1 
ATOM   645  O  O     . GLY C 2 28 ? 13.401  -1.278  15.879  1.00 32.70 ? 29  GLY A O     1 
ATOM   646  N  N     . ILE C 2 29 ? 12.888  0.889   15.603  1.00 32.57 ? 30  ILE A N     1 
ATOM   647  C  CA    . ILE C 2 29 ? 11.505  0.613   15.211  1.00 30.14 ? 30  ILE A CA    1 
ATOM   648  C  C     . ILE C 2 29 ? 11.475  -0.423  14.071  1.00 31.03 ? 30  ILE A C     1 
ATOM   649  O  O     . ILE C 2 29 ? 12.233  -0.314  13.111  1.00 30.93 ? 30  ILE A O     1 
ATOM   650  C  CB    . ILE C 2 29 ? 10.789  1.938   14.792  1.00 29.84 ? 30  ILE A CB    1 
ATOM   651  C  CG1   . ILE C 2 29 ? 9.303   1.680   14.548  1.00 29.51 ? 30  ILE A CG1   1 
ATOM   652  C  CG2   . ILE C 2 29 ? 11.450  2.527   13.547  1.00 28.09 ? 30  ILE A CG2   1 
ATOM   653  C  CD1   . ILE C 2 29 ? 8.457   2.942   14.472  1.00 20.51 ? 30  ILE A CD1   1 
ATOM   654  N  N     . LYS C 2 30 ? 10.628  -1.448  14.198  1.00 30.87 ? 31  LYS A N     1 
ATOM   655  C  CA    . LYS C 2 30 ? 10.511  -2.494  13.176  1.00 28.67 ? 31  LYS A CA    1 
ATOM   656  C  C     . LYS C 2 30 ? 9.588   -2.029  12.046  1.00 26.90 ? 31  LYS A C     1 
ATOM   657  O  O     . LYS C 2 30 ? 8.807   -1.097  12.222  1.00 31.78 ? 31  LYS A O     1 
ATOM   658  C  CB    . LYS C 2 30 ? 9.962   -3.786  13.792  1.00 36.62 ? 31  LYS A CB    1 
ATOM   659  C  CG    . LYS C 2 30 ? 10.614  -4.194  15.131  1.00 43.29 ? 31  LYS A CG    1 
ATOM   660  C  CD    . LYS C 2 30 ? 12.127  -4.416  15.003  1.00 48.87 ? 31  LYS A CD    1 
ATOM   661  C  CE    . LYS C 2 30 ? 12.745  -4.883  16.326  1.00 50.84 ? 31  LYS A CE    1 
ATOM   662  N  NZ    . LYS C 2 30 ? 12.569  -3.901  17.451  1.00 52.19 ? 31  LYS A NZ    1 
ATOM   663  N  N     . VAL C 2 31 ? 9.668   -2.675  10.887  1.00 24.53 ? 32  VAL A N     1 
ATOM   664  C  CA    . VAL C 2 31 ? 8.860   -2.251  9.754   1.00 24.61 ? 32  VAL A CA    1 
ATOM   665  C  C     . VAL C 2 31 ? 7.365   -2.275  10.023  1.00 26.27 ? 32  VAL A C     1 
ATOM   666  O  O     . VAL C 2 31 ? 6.622   -1.415  9.530   1.00 26.25 ? 32  VAL A O     1 
ATOM   667  C  CB    . VAL C 2 31 ? 9.144   -3.092  8.507   1.00 24.77 ? 32  VAL A CB    1 
ATOM   668  C  CG1   . VAL C 2 31 ? 10.555  -2.866  8.055   1.00 27.79 ? 32  VAL A CG1   1 
ATOM   669  C  CG2   . VAL C 2 31 ? 8.905   -4.563  8.800   1.00 31.76 ? 32  VAL A CG2   1 
ATOM   670  N  N     . THR C 2 32 ? 6.914   -3.246  10.806  1.00 22.55 ? 33  THR A N     1 
ATOM   671  C  CA    . THR C 2 32 ? 5.500   -3.334  11.104  1.00 24.00 ? 33  THR A CA    1 
ATOM   672  C  C     . THR C 2 32 ? 5.103   -2.173  12.008  1.00 22.88 ? 33  THR A C     1 
ATOM   673  O  O     . THR C 2 32 ? 3.960   -1.744  12.001  1.00 20.93 ? 33  THR A O     1 
ATOM   674  C  CB    . THR C 2 32 ? 5.156   -4.683  11.775  1.00 27.22 ? 33  THR A CB    1 
ATOM   675  O  OG1   . THR C 2 32 ? 6.030   -4.901  12.891  1.00 26.59 ? 33  THR A OG1   1 
ATOM   676  C  CG2   . THR C 2 32 ? 5.307   -5.816  10.774  1.00 20.97 ? 33  THR A CG2   1 
ATOM   677  N  N     . GLU C 2 33 ? 6.050   -1.683  12.796  1.00 21.51 ? 34  GLU A N     1 
ATOM   678  C  CA    . GLU C 2 33 ? 5.794   -0.542  13.670  1.00 23.45 ? 34  GLU A CA    1 
ATOM   679  C  C     . GLU C 2 33 ? 5.917   0.763   12.876  1.00 20.23 ? 34  GLU A C     1 
ATOM   680  O  O     . GLU C 2 33 ? 5.309   1.763   13.224  1.00 21.21 ? 34  GLU A O     1 
ATOM   681  C  CB    . GLU C 2 33 ? 6.794   -0.525  14.813  1.00 25.24 ? 34  GLU A CB    1 
ATOM   682  C  CG    . GLU C 2 33 ? 6.715   -1.729  15.719  1.00 35.00 ? 34  GLU A CG    1 
ATOM   683  C  CD    . GLU C 2 33 ? 7.825   -1.707  16.748  1.00 42.08 ? 34  GLU A CD    1 
ATOM   684  O  OE1   . GLU C 2 33 ? 7.841   -0.770  17.573  1.00 47.41 ? 34  GLU A OE1   1 
ATOM   685  O  OE2   . GLU C 2 33 ? 8.686   -2.609  16.720  1.00 44.08 ? 34  GLU A OE2   1 
ATOM   686  N  N     . VAL C 2 34 ? 6.731   0.751   11.824  1.00 19.34 ? 35  VAL A N     1 
ATOM   687  C  CA    . VAL C 2 34 ? 6.873   1.935   10.978  1.00 19.98 ? 35  VAL A CA    1 
ATOM   688  C  C     . VAL C 2 34 ? 5.530   2.083   10.257  1.00 17.93 ? 35  VAL A C     1 
ATOM   689  O  O     . VAL C 2 34 ? 4.997   3.180   10.140  1.00 20.27 ? 35  VAL A O     1 
ATOM   690  C  CB    . VAL C 2 34 ? 8.040   1.755   9.965   1.00 18.31 ? 35  VAL A CB    1 
ATOM   691  C  CG1   . VAL C 2 34 ? 8.095   2.919   8.980   1.00 16.53 ? 35  VAL A CG1   1 
ATOM   692  C  CG2   . VAL C 2 34 ? 9.340   1.678   10.720  1.00 16.12 ? 35  VAL A CG2   1 
ATOM   693  N  N     . ALA C 2 35 ? 4.963   0.957   9.827   1.00 15.50 ? 36  ALA A N     1 
ATOM   694  C  CA    . ALA C 2 35 ? 3.676   0.962   9.145   1.00 19.00 ? 36  ALA A CA    1 
ATOM   695  C  C     . ALA C 2 35 ? 2.588   1.416   10.120  1.00 22.29 ? 36  ALA A C     1 
ATOM   696  O  O     . ALA C 2 35 ? 1.754   2.257   9.798   1.00 22.12 ? 36  ALA A O     1 
ATOM   697  C  CB    . ALA C 2 35 ? 3.354   -0.440  8.629   1.00 15.38 ? 36  ALA A CB    1 
ATOM   698  N  N     . LYS C 2 36 ? 2.586   0.839   11.314  1.00 24.13 ? 37  LYS A N     1 
ATOM   699  C  CA    . LYS C 2 36 ? 1.597   1.209   12.314  1.00 22.42 ? 37  LYS A CA    1 
ATOM   700  C  C     . LYS C 2 36 ? 1.682   2.727   12.513  1.00 23.95 ? 37  LYS A C     1 
ATOM   701  O  O     . LYS C 2 36 ? 0.665   3.437   12.486  1.00 18.66 ? 37  LYS A O     1 
ATOM   702  C  CB    . LYS C 2 36 ? 1.904   0.483   13.629  1.00 23.31 ? 37  LYS A CB    1 
ATOM   703  C  CG    . LYS C 2 36 ? 1.040   0.909   14.820  1.00 30.10 ? 37  LYS A CG    1 
ATOM   704  C  CD    . LYS C 2 36 ? 1.151   -0.098  15.963  1.00 34.24 ? 37  LYS A CD    1 
ATOM   705  C  CE    . LYS C 2 36 ? 0.586   0.456   17.265  1.00 38.23 ? 37  LYS A CE    1 
ATOM   706  N  NZ    . LYS C 2 36 ? -0.862  0.783   17.149  1.00 37.41 ? 37  LYS A NZ    1 
ATOM   707  N  N     . ARG C 2 37 ? 2.911   3.210   12.703  1.00 23.86 ? 38  ARG A N     1 
ATOM   708  C  CA    . ARG C 2 37 ? 3.175   4.628   12.918  1.00 23.60 ? 38  ARG A CA    1 
ATOM   709  C  C     . ARG C 2 37 ? 2.768   5.450   11.695  1.00 24.55 ? 38  ARG A C     1 
ATOM   710  O  O     . ARG C 2 37 ? 2.264   6.571   11.829  1.00 21.98 ? 38  ARG A O     1 
ATOM   711  C  CB    . ARG C 2 37 ? 4.667   4.836   13.252  1.00 22.33 ? 38  ARG A CB    1 
ATOM   712  C  CG    . ARG C 2 37 ? 5.047   6.241   13.705  1.00 20.32 ? 38  ARG A CG    1 
ATOM   713  C  CD    . ARG C 2 37 ? 4.084   6.786   14.781  1.00 26.31 ? 38  ARG A CD    1 
ATOM   714  N  NE    . ARG C 2 37 ? 4.480   8.112   15.250  1.00 22.99 ? 38  ARG A NE    1 
ATOM   715  C  CZ    . ARG C 2 37 ? 3.667   8.978   15.855  1.00 26.80 ? 38  ARG A CZ    1 
ATOM   716  N  NH1   . ARG C 2 37 ? 2.393   8.676   16.073  1.00 19.70 ? 38  ARG A NH1   1 
ATOM   717  N  NH2   . ARG C 2 37 ? 4.134   10.154  16.253  1.00 19.56 ? 38  ARG A NH2   1 
ATOM   718  N  N     . GLY C 2 38 ? 2.966   4.889   10.503  1.00 25.05 ? 39  GLY A N     1 
ATOM   719  C  CA    . GLY C 2 38 ? 2.589   5.603   9.300   1.00 21.70 ? 39  GLY A CA    1 
ATOM   720  C  C     . GLY C 2 38 ? 1.090   5.846   9.259   1.00 17.70 ? 39  GLY A C     1 
ATOM   721  O  O     . GLY C 2 38 ? 0.630   6.917   8.889   1.00 18.69 ? 39  GLY A O     1 
ATOM   722  N  N     . GLY C 2 39 ? 0.324   4.833   9.633   1.00 17.85 ? 40  GLY A N     1 
ATOM   723  C  CA    . GLY C 2 39 ? -1.116  4.971   9.645   1.00 18.91 ? 40  GLY A CA    1 
ATOM   724  C  C     . GLY C 2 39 ? -1.530  6.083   10.593  1.00 21.24 ? 40  GLY A C     1 
ATOM   725  O  O     . GLY C 2 39 ? -2.455  6.846   10.308  1.00 21.81 ? 40  GLY A O     1 
ATOM   726  N  N     . GLU C 2 40 ? -0.835  6.180   11.722  1.00 21.98 ? 41  GLU A N     1 
ATOM   727  C  CA    . GLU C 2 40 ? -1.141  7.198   12.712  1.00 23.16 ? 41  GLU A CA    1 
ATOM   728  C  C     . GLU C 2 40 ? -0.920  8.602   12.157  1.00 23.12 ? 41  GLU A C     1 
ATOM   729  O  O     . GLU C 2 40 ? -1.806  9.463   12.229  1.00 21.61 ? 41  GLU A O     1 
ATOM   730  C  CB    . GLU C 2 40 ? -0.286  6.957   13.966  1.00 21.53 ? 41  GLU A CB    1 
ATOM   731  C  CG    . GLU C 2 40 ? -0.798  5.790   14.801  1.00 24.90 ? 41  GLU A CG    1 
ATOM   732  C  CD    . GLU C 2 40 ? 0.154   5.341   15.895  1.00 25.23 ? 41  GLU A CD    1 
ATOM   733  O  OE1   . GLU C 2 40 ? 1.277   5.858   15.964  1.00 27.26 ? 41  GLU A OE1   1 
ATOM   734  O  OE2   . GLU C 2 40 ? -0.221  4.448   16.682  1.00 31.83 ? 41  GLU A OE2   1 
ATOM   735  N  N     . LEU C 2 41 ? 0.261   8.836   11.597  1.00 23.69 ? 42  LEU A N     1 
ATOM   736  C  CA    . LEU C 2 41 ? 0.553   10.152  11.047  1.00 24.41 ? 42  LEU A CA    1 
ATOM   737  C  C     . LEU C 2 41 ? -0.409  10.474  9.912   1.00 20.84 ? 42  LEU A C     1 
ATOM   738  O  O     . LEU C 2 41 ? -0.969  11.559  9.849   1.00 22.31 ? 42  LEU A O     1 
ATOM   739  C  CB    . LEU C 2 41 ? 2.003   10.220  10.552  1.00 27.08 ? 42  LEU A CB    1 
ATOM   740  C  CG    . LEU C 2 41 ? 3.127   10.379  11.594  1.00 29.19 ? 42  LEU A CG    1 
ATOM   741  C  CD1   . LEU C 2 41 ? 2.576   11.042  12.847  1.00 29.24 ? 42  LEU A CD1   1 
ATOM   742  C  CD2   . LEU C 2 41 ? 3.733   9.060   11.933  1.00 29.76 ? 42  LEU A CD2   1 
ATOM   743  N  N     . TRP C 2 42 ? -0.597  9.521   9.010   1.00 20.99 ? 43  TRP A N     1 
ATOM   744  C  CA    . TRP C 2 42 ? -1.513  9.717   7.904   1.00 21.80 ? 43  TRP A CA    1 
ATOM   745  C  C     . TRP C 2 42 ? -2.986  10.019  8.343   1.00 20.72 ? 43  TRP A C     1 
ATOM   746  O  O     . TRP C 2 42 ? -3.613  10.947  7.831   1.00 20.97 ? 43  TRP A O     1 
ATOM   747  C  CB    . TRP C 2 42 ? -1.461  8.501   6.992   1.00 17.88 ? 43  TRP A CB    1 
ATOM   748  C  CG    . TRP C 2 42 ? -2.103  8.756   5.674   1.00 21.07 ? 43  TRP A CG    1 
ATOM   749  C  CD1   . TRP C 2 42 ? -3.257  8.205   5.209   1.00 17.24 ? 43  TRP A CD1   1 
ATOM   750  C  CD2   . TRP C 2 42 ? -1.628  9.631   4.636   1.00 24.67 ? 43  TRP A CD2   1 
ATOM   751  N  NE1   . TRP C 2 42 ? -3.534  8.675   3.955   1.00 21.96 ? 43  TRP A NE1   1 
ATOM   752  C  CE2   . TRP C 2 42 ? -2.553  9.550   3.573   1.00 22.26 ? 43  TRP A CE2   1 
ATOM   753  C  CE3   . TRP C 2 42 ? -0.506  10.475  4.502   1.00 22.66 ? 43  TRP A CE3   1 
ATOM   754  C  CZ2   . TRP C 2 42 ? -2.399  10.276  2.380   1.00 21.48 ? 43  TRP A CZ2   1 
ATOM   755  C  CZ3   . TRP C 2 42 ? -0.350  11.202  3.312   1.00 20.51 ? 43  TRP A CZ3   1 
ATOM   756  C  CH2   . TRP C 2 42 ? -1.297  11.092  2.267   1.00 22.36 ? 43  TRP A CH2   1 
ATOM   757  N  N     . ARG C 2 43 ? -3.543  9.257   9.277   1.00 20.39 ? 44  ARG A N     1 
ATOM   758  C  CA    . ARG C 2 43 ? -4.924  9.532   9.710   1.00 23.75 ? 44  ARG A CA    1 
ATOM   759  C  C     . ARG C 2 43 ? -5.074  10.927  10.326  1.00 23.04 ? 44  ARG A C     1 
ATOM   760  O  O     . ARG C 2 43 ? -6.141  11.543  10.233  1.00 24.07 ? 44  ARG A O     1 
ATOM   761  C  CB    . ARG C 2 43 ? -5.420  8.464   10.704  1.00 21.26 ? 44  ARG A CB    1 
ATOM   762  C  CG    . ARG C 2 43 ? -5.670  7.111   10.052  1.00 23.87 ? 44  ARG A CG    1 
ATOM   763  C  CD    . ARG C 2 43 ? -6.309  6.138   11.021  1.00 21.60 ? 44  ARG A CD    1 
ATOM   764  N  NE    . ARG C 2 43 ? -5.481  5.933   12.209  1.00 21.22 ? 44  ARG A NE    1 
ATOM   765  C  CZ    . ARG C 2 43 ? -4.458  5.093   12.275  1.00 21.48 ? 44  ARG A CZ    1 
ATOM   766  N  NH1   . ARG C 2 43 ? -4.115  4.366   11.216  1.00 19.91 ? 44  ARG A NH1   1 
ATOM   767  N  NH2   . ARG C 2 43 ? -3.797  4.949   13.414  1.00 21.27 ? 44  ARG A NH2   1 
ATOM   768  N  N     . ALA C 2 44 ? -3.991  11.423  10.923  1.00 25.09 ? 45  ALA A N     1 
ATOM   769  C  CA    . ALA C 2 44 ? -3.963  12.742  11.573  1.00 27.48 ? 45  ALA A CA    1 
ATOM   770  C  C     . ALA C 2 44 ? -3.506  13.956  10.718  1.00 25.68 ? 45  ALA A C     1 
ATOM   771  O  O     . ALA C 2 44 ? -3.741  15.112  11.077  1.00 25.53 ? 45  ALA A O     1 
ATOM   772  C  CB    . ALA C 2 44 ? -3.092  12.662  12.800  1.00 24.60 ? 45  ALA A CB    1 
ATOM   773  N  N     . MET C 2 45 ? -2.859  13.697  9.598   1.00 23.48 ? 46  MET A N     1 
ATOM   774  C  CA    . MET C 2 45 ? -2.338  14.774  8.777   1.00 24.64 ? 46  MET A CA    1 
ATOM   775  C  C     . MET C 2 45 ? -3.374  15.827  8.378   1.00 26.32 ? 46  MET A C     1 
ATOM   776  O  O     . MET C 2 45 ? -4.423  15.517  7.816   1.00 29.12 ? 46  MET A O     1 
ATOM   777  C  CB    . MET C 2 45 ? -1.657  14.188  7.540   1.00 18.10 ? 46  MET A CB    1 
ATOM   778  C  CG    . MET C 2 45 ? -0.803  15.198  6.826   1.00 21.82 ? 46  MET A CG    1 
ATOM   779  S  SD    . MET C 2 45 ? 0.103   14.452  5.519   1.00 21.88 ? 46  MET A SD    1 
ATOM   780  C  CE    . MET C 2 45 ? 1.313   13.452  6.459   1.00 26.25 ? 46  MET A CE    1 
ATOM   781  N  N     . LYS C 2 46 ? -3.061  17.080  8.686   1.00 31.22 ? 47  LYS A N     1 
ATOM   782  C  CA    . LYS C 2 46 ? -3.934  18.207  8.388   1.00 31.69 ? 47  LYS A CA    1 
ATOM   783  C  C     . LYS C 2 46 ? -4.181  18.372  6.893   1.00 29.38 ? 47  LYS A C     1 
ATOM   784  O  O     . LYS C 2 46 ? -5.317  18.491  6.438   1.00 26.79 ? 47  LYS A O     1 
ATOM   785  C  CB    . LYS C 2 46 ? -3.307  19.490  8.940   1.00 36.55 ? 47  LYS A CB    1 
ATOM   786  C  CG    . LYS C 2 46 ? -3.973  20.783  8.497   1.00 37.71 ? 47  LYS A CG    1 
ATOM   787  C  CD    . LYS C 2 46 ? -5.339  20.970  9.138   1.00 45.08 ? 47  LYS A CD    1 
ATOM   788  C  CE    . LYS C 2 46 ? -5.929  22.333  8.778   1.00 46.80 ? 47  LYS A CE    1 
ATOM   789  N  NZ    . LYS C 2 46 ? -7.218  22.592  9.483   1.00 46.91 ? 47  LYS A NZ    1 
ATOM   790  N  N     . ASP C 2 47 ? -3.106  18.385  6.122   1.00 28.97 ? 48  ASP A N     1 
ATOM   791  C  CA    . ASP C 2 47 ? -3.266  18.591  4.712   1.00 29.50 ? 48  ASP A CA    1 
ATOM   792  C  C     . ASP C 2 47 ? -2.564  17.571  3.831   1.00 25.73 ? 48  ASP A C     1 
ATOM   793  O  O     . ASP C 2 47 ? -1.343  17.534  3.747   1.00 25.05 ? 48  ASP A O     1 
ATOM   794  C  CB    . ASP C 2 47 ? -2.792  19.999  4.365   1.00 31.45 ? 48  ASP A CB    1 
ATOM   795  C  CG    . ASP C 2 47 ? -3.333  20.472  3.048   1.00 33.95 ? 48  ASP A CG    1 
ATOM   796  O  OD1   . ASP C 2 47 ? -3.559  19.613  2.164   1.00 36.39 ? 48  ASP A OD1   1 
ATOM   797  O  OD2   . ASP C 2 47 ? -3.524  21.696  2.891   1.00 38.63 ? 48  ASP A OD2   1 
ATOM   798  N  N     . LYS C 2 48 ? -3.352  16.767  3.135   1.00 24.66 ? 49  LYS A N     1 
ATOM   799  C  CA    . LYS C 2 48 ? -2.784  15.756  2.258   1.00 22.16 ? 49  LYS A CA    1 
ATOM   800  C  C     . LYS C 2 48 ? -2.632  16.242  0.816   1.00 21.70 ? 49  LYS A C     1 
ATOM   801  O  O     . LYS C 2 48 ? -1.983  15.594  0.017   1.00 22.52 ? 49  LYS A O     1 
ATOM   802  C  CB    . LYS C 2 48 ? -3.668  14.512  2.295   1.00 23.41 ? 49  LYS A CB    1 
ATOM   803  C  CG    . LYS C 2 48 ? -3.789  13.901  3.669   1.00 23.94 ? 49  LYS A CG    1 
ATOM   804  C  CD    . LYS C 2 48 ? -4.817  12.778  3.691   1.00 19.81 ? 49  LYS A CD    1 
ATOM   805  C  CE    . LYS C 2 48 ? -4.711  11.997  4.989   1.00 21.57 ? 49  LYS A CE    1 
ATOM   806  N  NZ    . LYS C 2 48 ? -5.796  10.995  5.125   1.00 22.84 ? 49  LYS A NZ    1 
ATOM   807  N  N     . SER C 2 49 ? -3.208  17.398  0.505   1.00 21.80 ? 50  SER A N     1 
ATOM   808  C  CA    . SER C 2 49 ? -3.199  17.932  -0.844  1.00 22.56 ? 50  SER A CA    1 
ATOM   809  C  C     . SER C 2 49 ? -1.875  17.918  -1.591  1.00 23.95 ? 50  SER A C     1 
ATOM   810  O  O     . SER C 2 49 ? -1.848  17.668  -2.795  1.00 25.59 ? 50  SER A O     1 
ATOM   811  C  CB    . SER C 2 49 ? -3.795  19.348  -0.851  1.00 22.89 ? 50  SER A CB    1 
ATOM   812  O  OG    . SER C 2 49 ? -3.015  20.251  -0.079  1.00 24.71 ? 50  SER A OG    1 
ATOM   813  N  N     . GLU C 2 50 ? -0.770  18.178  -0.914  1.00 24.40 ? 51  GLU A N     1 
ATOM   814  C  CA    . GLU C 2 50 ? 0.489   18.160  -1.626  1.00 24.31 ? 51  GLU A CA    1 
ATOM   815  C  C     . GLU C 2 50 ? 0.800   16.727  -2.034  1.00 24.21 ? 51  GLU A C     1 
ATOM   816  O  O     . GLU C 2 50 ? 1.279   16.468  -3.143  1.00 26.91 ? 51  GLU A O     1 
ATOM   817  C  CB    . GLU C 2 50 ? 1.625   18.693  -0.765  1.00 27.27 ? 51  GLU A CB    1 
ATOM   818  C  CG    . GLU C 2 50 ? 2.864   19.026  -1.593  1.00 25.92 ? 51  GLU A CG    1 
ATOM   819  C  CD    . GLU C 2 50 ? 4.057   19.401  -0.739  1.00 33.71 ? 51  GLU A CD    1 
ATOM   820  O  OE1   . GLU C 2 50 ? 3.881   19.791  0.443   1.00 32.75 ? 51  GLU A OE1   1 
ATOM   821  O  OE2   . GLU C 2 50 ? 5.182   19.312  -1.263  1.00 31.94 ? 51  GLU A OE2   1 
ATOM   822  N  N     . TRP C 2 51 ? 0.523   15.799  -1.124  1.00 23.06 ? 52  TRP A N     1 
ATOM   823  C  CA    . TRP C 2 51 ? 0.772   14.387  -1.369  1.00 22.68 ? 52  TRP A CA    1 
ATOM   824  C  C     . TRP C 2 51 ? -0.173  13.857  -2.441  1.00 24.52 ? 52  TRP A C     1 
ATOM   825  O  O     . TRP C 2 51 ? 0.208   12.999  -3.237  1.00 24.00 ? 52  TRP A O     1 
ATOM   826  C  CB    . TRP C 2 51 ? 0.657   13.594  -0.052  1.00 20.28 ? 52  TRP A CB    1 
ATOM   827  C  CG    . TRP C 2 51 ? 1.834   13.890  0.893   1.00 15.77 ? 52  TRP A CG    1 
ATOM   828  C  CD1   . TRP C 2 51 ? 1.780   14.541  2.101   1.00 12.52 ? 52  TRP A CD1   1 
ATOM   829  C  CD2   . TRP C 2 51 ? 3.220   13.689  0.612   1.00 14.09 ? 52  TRP A CD2   1 
ATOM   830  N  NE1   . TRP C 2 51 ? 3.047   14.777  2.569   1.00 16.15 ? 52  TRP A NE1   1 
ATOM   831  C  CE2   . TRP C 2 51 ? 3.952   14.259  1.676   1.00 17.51 ? 52  TRP A CE2   1 
ATOM   832  C  CE3   . TRP C 2 51 ? 3.920   13.084  -0.443  1.00 17.29 ? 52  TRP A CE3   1 
ATOM   833  C  CZ2   . TRP C 2 51 ? 5.363   14.246  1.715   1.00 18.21 ? 52  TRP A CZ2   1 
ATOM   834  C  CZ3   . TRP C 2 51 ? 5.317   13.071  -0.408  1.00 17.26 ? 52  TRP A CZ3   1 
ATOM   835  C  CH2   . TRP C 2 51 ? 6.024   13.645  0.655   1.00 12.46 ? 52  TRP A CH2   1 
ATOM   836  N  N     . GLU C 2 52 ? -1.394  14.385  -2.485  1.00 22.60 ? 53  GLU A N     1 
ATOM   837  C  CA    . GLU C 2 52 ? -2.350  13.959  -3.503  1.00 24.35 ? 53  GLU A CA    1 
ATOM   838  C  C     . GLU C 2 52 ? -1.943  14.434  -4.901  1.00 20.95 ? 53  GLU A C     1 
ATOM   839  O  O     . GLU C 2 52 ? -2.120  13.716  -5.883  1.00 19.37 ? 53  GLU A O     1 
ATOM   840  C  CB    . GLU C 2 52 ? -3.750  14.446  -3.126  1.00 22.41 ? 53  GLU A CB    1 
ATOM   841  C  CG    . GLU C 2 52 ? -4.235  13.694  -1.920  1.00 23.37 ? 53  GLU A CG    1 
ATOM   842  C  CD    . GLU C 2 52 ? -5.324  14.410  -1.163  1.00 29.34 ? 53  GLU A CD    1 
ATOM   843  O  OE1   . GLU C 2 52 ? -5.971  13.755  -0.326  1.00 24.75 ? 53  GLU A OE1   1 
ATOM   844  O  OE2   . GLU C 2 52 ? -5.526  15.625  -1.382  1.00 32.62 ? 53  GLU A OE2   1 
ATOM   845  N  N     . ALA C 2 53 ? -1.380  15.633  -4.989  1.00 21.25 ? 54  ALA A N     1 
ATOM   846  C  CA    . ALA C 2 53 ? -0.928  16.161  -6.278  1.00 20.35 ? 54  ALA A CA    1 
ATOM   847  C  C     . ALA C 2 53 ? 0.202   15.275  -6.793  1.00 21.10 ? 54  ALA A C     1 
ATOM   848  O  O     . ALA C 2 53 ? 0.258   14.920  -7.971  1.00 22.67 ? 54  ALA A O     1 
ATOM   849  C  CB    . ALA C 2 53 ? -0.433  17.600  -6.122  1.00 13.37 ? 54  ALA A CB    1 
ATOM   850  N  N     . LYS C 2 54 ? 1.099   14.893  -5.894  1.00 25.12 ? 55  LYS A N     1 
ATOM   851  C  CA    . LYS C 2 54 ? 2.208   14.043  -6.294  1.00 23.12 ? 55  LYS A CA    1 
ATOM   852  C  C     . LYS C 2 54 ? 1.697   12.697  -6.758  1.00 22.63 ? 55  LYS A C     1 
ATOM   853  O  O     . LYS C 2 54 ? 2.251   12.100  -7.679  1.00 20.54 ? 55  LYS A O     1 
ATOM   854  C  CB    . LYS C 2 54 ? 3.188   13.885  -5.135  1.00 27.37 ? 55  LYS A CB    1 
ATOM   855  C  CG    . LYS C 2 54 ? 3.774   15.229  -4.683  1.00 31.90 ? 55  LYS A CG    1 
ATOM   856  C  CD    . LYS C 2 54 ? 4.863   15.066  -3.623  1.00 34.57 ? 55  LYS A CD    1 
ATOM   857  C  CE    . LYS C 2 54 ? 5.548   16.412  -3.323  1.00 33.52 ? 55  LYS A CE    1 
ATOM   858  N  NZ    . LYS C 2 54 ? 6.670   16.214  -2.372  1.00 34.04 ? 55  LYS A NZ    1 
ATOM   859  N  N     . ALA C 2 55 ? 0.635   12.218  -6.118  1.00 22.74 ? 56  ALA A N     1 
ATOM   860  C  CA    . ALA C 2 55 ? 0.052   10.933  -6.479  1.00 21.73 ? 56  ALA A CA    1 
ATOM   861  C  C     . ALA C 2 55 ? -0.605  11.064  -7.851  1.00 21.95 ? 56  ALA A C     1 
ATOM   862  O  O     . ALA C 2 55 ? -0.468  10.168  -8.697  1.00 22.36 ? 56  ALA A O     1 
ATOM   863  C  CB    . ALA C 2 55 ? -0.978  10.499  -5.424  1.00 20.73 ? 56  ALA A CB    1 
ATOM   864  N  N     . ALA C 2 56 ? -1.311  12.178  -8.062  1.00 18.76 ? 57  ALA A N     1 
ATOM   865  C  CA    . ALA C 2 56 ? -1.966  12.448  -9.339  1.00 19.25 ? 57  ALA A CA    1 
ATOM   866  C  C     . ALA C 2 56 ? -0.929  12.572  -10.438 1.00 20.83 ? 57  ALA A C     1 
ATOM   867  O  O     . ALA C 2 56 ? -1.147  12.097  -11.551 1.00 21.79 ? 57  ALA A O     1 
ATOM   868  C  CB    . ALA C 2 56 ? -2.761  13.715  -9.267  1.00 12.45 ? 57  ALA A CB    1 
ATOM   869  N  N     . LYS C 2 57 ? 0.195   13.228  -10.144 1.00 24.75 ? 58  LYS A N     1 
ATOM   870  C  CA    . LYS C 2 57 ? 1.237   13.344  -11.156 1.00 28.25 ? 58  LYS A CA    1 
ATOM   871  C  C     . LYS C 2 57 ? 1.879   11.989  -11.448 1.00 31.14 ? 58  LYS A C     1 
ATOM   872  O  O     . LYS C 2 57 ? 2.264   11.712  -12.588 1.00 31.51 ? 58  LYS A O     1 
ATOM   873  C  CB    . LYS C 2 57 ? 2.335   14.301  -10.741 1.00 32.32 ? 58  LYS A CB    1 
ATOM   874  C  CG    . LYS C 2 57 ? 3.386   14.455  -11.842 1.00 35.86 ? 58  LYS A CG    1 
ATOM   875  C  CD    . LYS C 2 57 ? 4.622   15.192  -11.366 1.00 44.59 ? 58  LYS A CD    1 
ATOM   876  C  CE    . LYS C 2 57 ? 5.454   15.685  -12.548 1.00 49.91 ? 58  LYS A CE    1 
ATOM   877  N  NZ    . LYS C 2 57 ? 5.805   14.582  -13.491 1.00 54.07 ? 58  LYS A NZ    1 
ATOM   878  N  N     . ALA C 2 58 ? 2.010   11.146  -10.425 1.00 30.12 ? 59  ALA A N     1 
ATOM   879  C  CA    . ALA C 2 58 ? 2.612   9.832   -10.631 1.00 28.55 ? 59  ALA A CA    1 
ATOM   880  C  C     . ALA C 2 58 ? 1.678   9.021   -11.526 1.00 29.33 ? 59  ALA A C     1 
ATOM   881  O  O     . ALA C 2 58 ? 2.122   8.258   -12.368 1.00 28.52 ? 59  ALA A O     1 
ATOM   882  C  CB    . ALA C 2 58 ? 2.811   9.125   -9.311  1.00 26.94 ? 59  ALA A CB    1 
ATOM   883  N  N     . LYS C 2 59 ? 0.378   9.190   -11.320 1.00 28.69 ? 60  LYS A N     1 
ATOM   884  C  CA    . LYS C 2 59 ? -0.612  8.485   -12.117 1.00 30.11 ? 60  LYS A CA    1 
ATOM   885  C  C     . LYS C 2 59 ? -0.484  8.898   -13.591 1.00 30.32 ? 60  LYS A C     1 
ATOM   886  O  O     . LYS C 2 59 ? -0.522  8.053   -14.479 1.00 28.73 ? 60  LYS A O     1 
ATOM   887  C  CB    . LYS C 2 59 ? -2.011  8.812   -11.616 1.00 27.96 ? 60  LYS A CB    1 
ATOM   888  C  CG    . LYS C 2 59 ? -3.114  8.138   -12.408 1.00 32.88 ? 60  LYS A CG    1 
ATOM   889  C  CD    . LYS C 2 59 ? -4.496  8.513   -11.875 1.00 36.88 ? 60  LYS A CD    1 
ATOM   890  C  CE    . LYS C 2 59 ? -5.599  7.797   -12.646 1.00 39.50 ? 60  LYS A CE    1 
ATOM   891  N  NZ    . LYS C 2 59 ? -6.959  8.308   -12.287 1.00 43.47 ? 60  LYS A NZ    1 
ATOM   892  N  N     . ASP C 2 60 ? -0.339  10.200  -13.831 1.00 30.76 ? 61  ASP A N     1 
ATOM   893  C  CA    . ASP C 2 60 ? -0.185  10.731  -15.176 1.00 33.51 ? 61  ASP A CA    1 
ATOM   894  C  C     . ASP C 2 60 ? 1.034   10.182  -15.885 1.00 32.26 ? 61  ASP A C     1 
ATOM   895  O  O     . ASP C 2 60 ? 0.944   9.779   -17.038 1.00 31.32 ? 61  ASP A O     1 
ATOM   896  C  CB    . ASP C 2 60 ? -0.105  12.254  -15.148 1.00 35.22 ? 61  ASP A CB    1 
ATOM   897  C  CG    . ASP C 2 60 ? -1.459  12.891  -14.952 1.00 40.03 ? 61  ASP A CG    1 
ATOM   898  O  OD1   . ASP C 2 60 ? -1.544  14.131  -15.030 1.00 45.88 ? 61  ASP A OD1   1 
ATOM   899  O  OD2   . ASP C 2 60 ? -2.441  12.144  -14.724 1.00 41.38 ? 61  ASP A OD2   1 
ATOM   900  N  N     . ASP C 2 61 ? 2.171   10.166  -15.198 1.00 30.01 ? 62  ASP A N     1 
ATOM   901  C  CA    . ASP C 2 61 ? 3.387   9.643   -15.799 1.00 29.42 ? 62  ASP A CA    1 
ATOM   902  C  C     . ASP C 2 61 ? 3.133   8.183   -16.110 1.00 26.55 ? 62  ASP A C     1 
ATOM   903  O  O     . ASP C 2 61 ? 3.564   7.670   -17.132 1.00 24.94 ? 62  ASP A O     1 
ATOM   904  C  CB    . ASP C 2 61 ? 4.575   9.752   -14.834 1.00 31.12 ? 62  ASP A CB    1 
ATOM   905  C  CG    . ASP C 2 61 ? 4.828   11.174  -14.377 1.00 34.13 ? 62  ASP A CG    1 
ATOM   906  O  OD1   . ASP C 2 61 ? 4.430   12.098  -15.110 1.00 35.22 ? 62  ASP A OD1   1 
ATOM   907  O  OD2   . ASP C 2 61 ? 5.426   11.374  -13.290 1.00 36.84 ? 62  ASP A OD2   1 
ATOM   908  N  N     . TYR C 2 62 ? 2.417   7.511   -15.215 1.00 24.83 ? 63  TYR A N     1 
ATOM   909  C  CA    . TYR C 2 62 ? 2.137   6.098   -15.401 1.00 25.51 ? 63  TYR A CA    1 
ATOM   910  C  C     . TYR C 2 62 ? 1.231   5.832   -16.596 1.00 29.13 ? 63  TYR A C     1 
ATOM   911  O  O     . TYR C 2 62 ? 1.531   4.958   -17.422 1.00 30.08 ? 63  TYR A O     1 
ATOM   912  C  CB    . TYR C 2 62 ? 1.502   5.507   -14.157 1.00 23.96 ? 63  TYR A CB    1 
ATOM   913  C  CG    . TYR C 2 62 ? 0.973   4.114   -14.387 1.00 23.15 ? 63  TYR A CG    1 
ATOM   914  C  CD1   . TYR C 2 62 ? 1.840   3.046   -14.569 1.00 20.20 ? 63  TYR A CD1   1 
ATOM   915  C  CD2   . TYR C 2 62 ? -0.399  3.866   -14.416 1.00 26.34 ? 63  TYR A CD2   1 
ATOM   916  C  CE1   . TYR C 2 62 ? 1.361   1.768   -14.758 1.00 22.96 ? 63  TYR A CE1   1 
ATOM   917  C  CE2   . TYR C 2 62 ? -0.900  2.575   -14.617 1.00 26.71 ? 63  TYR A CE2   1 
ATOM   918  C  CZ    . TYR C 2 62 ? -0.013  1.533   -14.780 1.00 25.68 ? 63  TYR A CZ    1 
ATOM   919  O  OH    . TYR C 2 62 ? -0.483  0.248   -14.925 1.00 19.86 ? 63  TYR A OH    1 
ATOM   920  N  N     . ASP C 2 63 ? 0.120   6.566   -16.680 1.00 28.77 ? 64  ASP A N     1 
ATOM   921  C  CA    . ASP C 2 63 ? -0.816  6.391   -17.790 1.00 26.23 ? 64  ASP A CA    1 
ATOM   922  C  C     . ASP C 2 63 ? -0.046  6.667   -19.071 1.00 27.44 ? 64  ASP A C     1 
ATOM   923  O  O     . ASP C 2 63 ? -0.177  5.943   -20.039 1.00 26.79 ? 64  ASP A O     1 
ATOM   924  C  CB    . ASP C 2 63 ? -2.002  7.340   -17.656 1.00 27.11 ? 64  ASP A CB    1 
ATOM   925  C  CG    . ASP C 2 63 ? -2.970  6.920   -16.553 1.00 27.96 ? 64  ASP A CG    1 
ATOM   926  O  OD1   . ASP C 2 63 ? -2.770  5.828   -15.976 1.00 26.33 ? 64  ASP A OD1   1 
ATOM   927  O  OD2   . ASP C 2 63 ? -3.936  7.677   -16.272 1.00 26.65 ? 64  ASP A OD2   1 
ATOM   928  N  N     . ARG C 2 64 ? 0.781   7.705   -19.059 1.00 29.74 ? 65  ARG A N     1 
ATOM   929  C  CA    . ARG C 2 64 ? 1.602   8.039   -20.219 1.00 33.06 ? 65  ARG A CA    1 
ATOM   930  C  C     . ARG C 2 64 ? 2.548   6.882   -20.545 1.00 32.82 ? 65  ARG A C     1 
ATOM   931  O  O     . ARG C 2 64 ? 2.689   6.478   -21.696 1.00 32.09 ? 65  ARG A O     1 
ATOM   932  C  CB    . ARG C 2 64 ? 2.437   9.292   -19.943 1.00 36.08 ? 65  ARG A CB    1 
ATOM   933  C  CG    . ARG C 2 64 ? 1.921   10.556  -20.599 1.00 46.00 ? 65  ARG A CG    1 
ATOM   934  C  CD    . ARG C 2 64 ? 3.047   11.558  -20.716 1.00 54.23 ? 65  ARG A CD    1 
ATOM   935  N  NE    . ARG C 2 64 ? 4.162   11.016  -21.494 1.00 60.99 ? 65  ARG A NE    1 
ATOM   936  C  CZ    . ARG C 2 64 ? 4.142   10.831  -22.814 1.00 65.37 ? 65  ARG A CZ    1 
ATOM   937  N  NH1   . ARG C 2 64 ? 3.061   11.145  -23.520 1.00 67.63 ? 65  ARG A NH1   1 
ATOM   938  N  NH2   . ARG C 2 64 ? 5.205   10.330  -23.431 1.00 66.05 ? 65  ARG A NH2   1 
ATOM   939  N  N     . ALA C 2 65 ? 3.198   6.360   -19.512 1.00 33.07 ? 66  ALA A N     1 
ATOM   940  C  CA    . ALA C 2 65 ? 4.136   5.262   -19.672 1.00 33.60 ? 66  ALA A CA    1 
ATOM   941  C  C     . ALA C 2 65 ? 3.448   4.058   -20.265 1.00 33.11 ? 66  ALA A C     1 
ATOM   942  O  O     . ALA C 2 65 ? 4.056   3.298   -21.013 1.00 35.29 ? 66  ALA A O     1 
ATOM   943  C  CB    . ALA C 2 65 ? 4.750   4.884   -18.322 1.00 35.91 ? 66  ALA A CB    1 
ATOM   944  N  N     . VAL C 2 66 ? 2.178   3.881   -19.926 1.00 30.85 ? 67  VAL A N     1 
ATOM   945  C  CA    . VAL C 2 66 ? 1.434   2.744   -20.416 1.00 32.19 ? 67  VAL A CA    1 
ATOM   946  C  C     . VAL C 2 66 ? 1.054   2.886   -21.890 1.00 34.50 ? 67  VAL A C     1 
ATOM   947  O  O     . VAL C 2 66 ? 1.019   1.895   -22.622 1.00 34.22 ? 67  VAL A O     1 
ATOM   948  C  CB    . VAL C 2 66 ? 0.199   2.504   -19.532 1.00 33.01 ? 67  VAL A CB    1 
ATOM   949  C  CG1   . VAL C 2 66 ? -0.718  1.458   -20.141 1.00 32.10 ? 67  VAL A CG1   1 
ATOM   950  C  CG2   . VAL C 2 66 ? 0.667   2.017   -18.172 1.00 34.41 ? 67  VAL A CG2   1 
ATOM   951  N  N     . LYS C 2 67 ? 0.785   4.117   -22.317 1.00 34.42 ? 68  LYS A N     1 
ATOM   952  C  CA    . LYS C 2 67 ? 0.441   4.383   -23.707 1.00 36.53 ? 68  LYS A CA    1 
ATOM   953  C  C     . LYS C 2 67 ? 1.668   4.099   -24.579 1.00 36.17 ? 68  LYS A C     1 
ATOM   954  O  O     . LYS C 2 67 ? 1.553   3.479   -25.637 1.00 35.38 ? 68  LYS A O     1 
ATOM   955  C  CB    . LYS C 2 67 ? -0.037  5.828   -23.855 1.00 32.57 ? 68  LYS A CB    1 
ATOM   956  C  CG    . LYS C 2 67 ? -1.433  6.033   -23.247 1.00 33.13 ? 68  LYS A CG    1 
ATOM   957  C  CD    . LYS C 2 67 ? -1.770  7.508   -23.036 1.00 35.25 ? 68  LYS A CD    1 
ATOM   958  C  CE    . LYS C 2 67 ? -1.548  8.334   -24.301 1.00 31.76 ? 68  LYS A CE    1 
ATOM   959  N  NZ    . LYS C 2 67 ? -1.669  9.800   -24.068 1.00 34.79 ? 68  LYS A NZ    1 
ATOM   960  N  N     . GLU C 2 68 ? 2.842   4.531   -24.126 1.00 35.25 ? 69  GLU A N     1 
ATOM   961  C  CA    . GLU C 2 68 ? 4.070   4.263   -24.866 1.00 36.95 ? 69  GLU A CA    1 
ATOM   962  C  C     . GLU C 2 68 ? 4.270   2.757   -25.037 1.00 34.26 ? 69  GLU A C     1 
ATOM   963  O  O     . GLU C 2 68 ? 4.537   2.279   -26.134 1.00 29.93 ? 69  GLU A O     1 
ATOM   964  C  CB    . GLU C 2 68 ? 5.273   4.842   -24.135 1.00 38.07 ? 69  GLU A CB    1 
ATOM   965  C  CG    . GLU C 2 68 ? 5.335   6.347   -24.168 1.00 47.87 ? 69  GLU A CG    1 
ATOM   966  C  CD    . GLU C 2 68 ? 6.710   6.866   -23.799 1.00 51.19 ? 69  GLU A CD    1 
ATOM   967  O  OE1   . GLU C 2 68 ? 7.702   6.456   -24.442 1.00 53.39 ? 69  GLU A OE1   1 
ATOM   968  O  OE2   . GLU C 2 68 ? 6.799   7.689   -22.867 1.00 56.14 ? 69  GLU A OE2   1 
ATOM   969  N  N     . PHE C 2 69 ? 4.120   2.028   -23.932 1.00 34.76 ? 70  PHE A N     1 
ATOM   970  C  CA    . PHE C 2 69 ? 4.279   0.572   -23.861 1.00 32.43 ? 70  PHE A CA    1 
ATOM   971  C  C     . PHE C 2 69 ? 3.290   -0.197  -24.745 1.00 31.35 ? 70  PHE A C     1 
ATOM   972  O  O     . PHE C 2 69 ? 3.562   -1.317  -25.204 1.00 30.71 ? 70  PHE A O     1 
ATOM   973  C  CB    . PHE C 2 69 ? 4.102   0.128   -22.407 1.00 32.43 ? 70  PHE A CB    1 
ATOM   974  C  CG    . PHE C 2 69 ? 4.503   -1.280  -22.149 1.00 32.49 ? 70  PHE A CG    1 
ATOM   975  C  CD1   . PHE C 2 69 ? 5.841   -1.660  -22.223 1.00 33.92 ? 70  PHE A CD1   1 
ATOM   976  C  CD2   . PHE C 2 69 ? 3.552   -2.236  -21.815 1.00 35.69 ? 70  PHE A CD2   1 
ATOM   977  C  CE1   . PHE C 2 69 ? 6.224   -2.972  -21.966 1.00 30.55 ? 70  PHE A CE1   1 
ATOM   978  C  CE2   . PHE C 2 69 ? 3.928   -3.553  -21.557 1.00 32.92 ? 70  PHE A CE2   1 
ATOM   979  C  CZ    . PHE C 2 69 ? 5.266   -3.916  -21.633 1.00 31.75 ? 70  PHE A CZ    1 
ATOM   980  N  N     . GLU C 2 70 ? 2.131   0.398   -24.963 1.00 30.07 ? 71  GLU A N     1 
ATOM   981  C  CA    . GLU C 2 70 ? 1.111   -0.231  -25.789 1.00 35.34 ? 71  GLU A CA    1 
ATOM   982  C  C     . GLU C 2 70 ? 0.998   0.500   -27.122 1.00 33.34 ? 71  GLU A C     1 
ATOM   983  O  O     . GLU C 2 70 ? 0.106   0.217   -27.916 1.00 30.47 ? 71  GLU A O     1 
ATOM   984  C  CB    . GLU C 2 70 ? -0.234  -0.222  -25.050 1.00 30.56 ? 71  GLU A CB    1 
ATOM   985  C  CG    . GLU C 2 70 ? -0.252  -1.221  -23.914 1.00 34.22 ? 71  GLU A CG    1 
ATOM   986  C  CD    . GLU C 2 70 ? -1.346  -0.965  -22.902 1.00 32.58 ? 71  GLU A CD    1 
ATOM   987  O  OE1   . GLU C 2 70 ? -2.454  -0.558  -23.304 1.00 29.66 ? 71  GLU A OE1   1 
ATOM   988  O  OE2   . GLU C 2 70 ? -1.091  -1.187  -21.699 1.00 34.33 ? 71  GLU A OE2   1 
ATOM   989  N  N     . ALA C 2 71 ? 1.927   1.424   -27.352 1.00 33.52 ? 72  ALA A N     1 
ATOM   990  C  CA    . ALA C 2 71 ? 1.943   2.233   -28.560 1.00 37.42 ? 72  ALA A CA    1 
ATOM   991  C  C     . ALA C 2 71 ? 2.107   1.435   -29.863 1.00 40.44 ? 72  ALA A C     1 
ATOM   992  O  O     . ALA C 2 71 ? 1.570   1.834   -30.898 1.00 38.48 ? 72  ALA A O     1 
ATOM   993  C  CB    . ALA C 2 71 ? 3.030   3.302   -28.445 1.00 34.52 ? 72  ALA A CB    1 
ATOM   994  N  N     . ASN C 2 72 ? 2.849   0.326   -29.820 1.00 44.00 ? 73  ASN A N     1 
ATOM   995  C  CA    . ASN C 2 72 ? 3.037   -0.508  -31.013 1.00 47.10 ? 73  ASN A CA    1 
ATOM   996  C  C     . ASN C 2 72 ? 1.983   -1.605  -31.000 1.00 50.11 ? 73  ASN A C     1 
ATOM   997  O  O     . ASN C 2 72 ? 1.939   -2.450  -31.896 1.00 52.61 ? 73  ASN A O     1 
ATOM   998  C  CB    . ASN C 2 72 ? 4.422   -1.179  -31.035 1.00 42.14 ? 73  ASN A CB    1 
ATOM   999  C  CG    . ASN C 2 72 ? 5.572   -0.181  -31.093 1.00 40.64 ? 73  ASN A CG    1 
ATOM   1000 O  OD1   . ASN C 2 72 ? 5.430   0.930   -31.599 1.00 38.89 ? 73  ASN A OD1   1 
ATOM   1001 N  ND2   . ASN C 2 72 ? 6.730   -0.594  -30.588 1.00 35.07 ? 73  ASN A ND2   1 
ATOM   1002 N  N     . GLY C 2 73 ? 1.144   -1.588  -29.969 1.00 53.21 ? 74  GLY A N     1 
ATOM   1003 C  CA    . GLY C 2 73 ? 0.108   -2.591  -29.823 1.00 57.20 ? 74  GLY A CA    1 
ATOM   1004 C  C     . GLY C 2 73 ? 0.732   -3.908  -29.392 1.00 60.59 ? 74  GLY A C     1 
ATOM   1005 O  O     . GLY C 2 73 ? 0.647   -4.245  -28.186 1.00 60.84 ? 74  GLY A O     1 
ATOM   1006 O  OXT   . GLY C 2 73 ? 1.332   -4.590  -30.257 1.00 62.23 ? 74  GLY A OXT   1 
ATOM   1007 N  N     . ASP D 2 2  ? 10.982  -9.204  -12.598 1.00 61.54 ? 3   ASP B N     1 
ATOM   1008 C  CA    . ASP D 2 2  ? 10.959  -9.722  -11.190 1.00 62.70 ? 3   ASP B CA    1 
ATOM   1009 C  C     . ASP D 2 2  ? 11.060  -11.246 -11.101 1.00 60.46 ? 3   ASP B C     1 
ATOM   1010 O  O     . ASP D 2 2  ? 10.114  -11.965 -11.450 1.00 58.35 ? 3   ASP B O     1 
ATOM   1011 C  CB    . ASP D 2 2  ? 9.676   -9.285  -10.467 1.00 67.56 ? 3   ASP B CB    1 
ATOM   1012 C  CG    . ASP D 2 2  ? 9.693   -7.822  -10.053 1.00 69.64 ? 3   ASP B CG    1 
ATOM   1013 O  OD1   . ASP D 2 2  ? 10.600  -7.421  -9.290  1.00 72.18 ? 3   ASP B OD1   1 
ATOM   1014 O  OD2   . ASP D 2 2  ? 8.786   -7.077  -10.486 1.00 72.75 ? 3   ASP B OD2   1 
ATOM   1015 N  N     . LYS D 2 3  ? 12.213  -11.720 -10.627 1.00 57.22 ? 4   LYS B N     1 
ATOM   1016 C  CA    . LYS D 2 3  ? 12.486  -13.149 -10.447 1.00 53.98 ? 4   LYS B CA    1 
ATOM   1017 C  C     . LYS D 2 3  ? 11.558  -13.634 -9.322  1.00 49.14 ? 4   LYS B C     1 
ATOM   1018 O  O     . LYS D 2 3  ? 11.451  -12.975 -8.288  1.00 50.70 ? 4   LYS B O     1 
ATOM   1019 C  CB    . LYS D 2 3  ? 13.961  -13.321 -10.061 1.00 55.83 ? 4   LYS B CB    1 
ATOM   1020 C  CG    . LYS D 2 3  ? 14.398  -14.719 -9.669  1.00 58.44 ? 4   LYS B CG    1 
ATOM   1021 C  CD    . LYS D 2 3  ? 15.793  -14.661 -9.048  1.00 59.85 ? 4   LYS B CD    1 
ATOM   1022 C  CE    . LYS D 2 3  ? 16.286  -16.033 -8.621  1.00 61.58 ? 4   LYS B CE    1 
ATOM   1023 N  NZ    . LYS D 2 3  ? 17.652  -15.954 -8.038  1.00 63.21 ? 4   LYS B NZ    1 
ATOM   1024 N  N     . PRO D 2 4  ? 10.880  -14.789 -9.506  1.00 44.32 ? 5   PRO B N     1 
ATOM   1025 C  CA    . PRO D 2 4  ? 9.966   -15.294 -8.466  1.00 40.37 ? 5   PRO B CA    1 
ATOM   1026 C  C     . PRO D 2 4  ? 10.633  -15.462 -7.103  1.00 37.94 ? 5   PRO B C     1 
ATOM   1027 O  O     . PRO D 2 4  ? 11.782  -15.913 -7.019  1.00 34.28 ? 5   PRO B O     1 
ATOM   1028 C  CB    . PRO D 2 4  ? 9.490   -16.649 -9.020  1.00 38.10 ? 5   PRO B CB    1 
ATOM   1029 C  CG    . PRO D 2 4  ? 9.759   -16.568 -10.493 1.00 41.22 ? 5   PRO B CG    1 
ATOM   1030 C  CD    . PRO D 2 4  ? 11.053  -15.787 -10.575 1.00 41.96 ? 5   PRO B CD    1 
ATOM   1031 N  N     . LYS D 2 5  ? 9.917   -15.091 -6.042  1.00 33.71 ? 6   LYS B N     1 
ATOM   1032 C  CA    . LYS D 2 5  ? 10.455  -15.266 -4.702  1.00 35.26 ? 6   LYS B CA    1 
ATOM   1033 C  C     . LYS D 2 5  ? 10.450  -16.775 -4.490  1.00 32.55 ? 6   LYS B C     1 
ATOM   1034 O  O     . LYS D 2 5  ? 9.652   -17.486 -5.099  1.00 33.22 ? 6   LYS B O     1 
ATOM   1035 C  CB    . LYS D 2 5  ? 9.544   -14.608 -3.652  1.00 36.94 ? 6   LYS B CB    1 
ATOM   1036 C  CG    . LYS D 2 5  ? 10.050  -13.278 -3.084  1.00 42.73 ? 6   LYS B CG    1 
ATOM   1037 C  CD    . LYS D 2 5  ? 9.226   -12.849 -1.869  1.00 44.92 ? 6   LYS B CD    1 
ATOM   1038 C  CE    . LYS D 2 5  ? 9.760   -11.575 -1.217  1.00 49.49 ? 6   LYS B CE    1 
ATOM   1039 N  NZ    . LYS D 2 5  ? 10.993  -11.773 -0.377  1.00 52.33 ? 6   LYS B NZ    1 
ATOM   1040 N  N     . ARG D 2 6  ? 11.350  -17.274 -3.659  1.00 31.09 ? 7   ARG B N     1 
ATOM   1041 C  CA    . ARG D 2 6  ? 11.354  -18.700 -3.367  1.00 32.01 ? 7   ARG B CA    1 
ATOM   1042 C  C     . ARG D 2 6  ? 10.019  -19.072 -2.695  1.00 27.81 ? 7   ARG B C     1 
ATOM   1043 O  O     . ARG D 2 6  ? 9.377   -18.250 -2.041  1.00 26.41 ? 7   ARG B O     1 
ATOM   1044 C  CB    . ARG D 2 6  ? 12.551  -19.043 -2.472  1.00 33.13 ? 7   ARG B CB    1 
ATOM   1045 C  CG    . ARG D 2 6  ? 13.867  -18.913 -3.225  1.00 36.34 ? 7   ARG B CG    1 
ATOM   1046 C  CD    . ARG D 2 6  ? 15.054  -18.976 -2.306  1.00 36.29 ? 7   ARG B CD    1 
ATOM   1047 N  NE    . ARG D 2 6  ? 15.197  -20.293 -1.713  1.00 34.72 ? 7   ARG B NE    1 
ATOM   1048 C  CZ    . ARG D 2 6  ? 16.034  -20.564 -0.723  1.00 32.43 ? 7   ARG B CZ    1 
ATOM   1049 N  NH1   . ARG D 2 6  ? 16.792  -19.604 -0.222  1.00 33.28 ? 7   ARG B NH1   1 
ATOM   1050 N  NH2   . ARG D 2 6  ? 16.122  -21.794 -0.245  1.00 32.81 ? 7   ARG B NH2   1 
ATOM   1051 N  N     . PRO D 2 7  ? 9.595   -20.324 -2.842  1.00 24.57 ? 8   PRO B N     1 
ATOM   1052 C  CA    . PRO D 2 7  ? 8.330   -20.764 -2.249  1.00 27.14 ? 8   PRO B CA    1 
ATOM   1053 C  C     . PRO D 2 7  ? 8.356   -20.898 -0.728  1.00 25.08 ? 8   PRO B C     1 
ATOM   1054 O  O     . PRO D 2 7  ? 9.408   -21.088 -0.130  1.00 26.71 ? 8   PRO B O     1 
ATOM   1055 C  CB    . PRO D 2 7  ? 8.084   -22.103 -2.945  1.00 22.73 ? 8   PRO B CB    1 
ATOM   1056 C  CG    . PRO D 2 7  ? 9.465   -22.666 -3.010  1.00 26.92 ? 8   PRO B CG    1 
ATOM   1057 C  CD    . PRO D 2 7  ? 10.351  -21.470 -3.377  1.00 23.16 ? 8   PRO B CD    1 
ATOM   1058 N  N     . LEU D 2 8  ? 7.188   -20.800 -0.109  1.00 23.25 ? 9   LEU B N     1 
ATOM   1059 C  CA    . LEU D 2 8  ? 7.100   -20.936 1.330   1.00 22.76 ? 9   LEU B CA    1 
ATOM   1060 C  C     . LEU D 2 8  ? 7.389   -22.370 1.694   1.00 22.60 ? 9   LEU B C     1 
ATOM   1061 O  O     . LEU D 2 8  ? 6.850   -23.290 1.078   1.00 20.48 ? 9   LEU B O     1 
ATOM   1062 C  CB    . LEU D 2 8  ? 5.700   -20.553 1.832   1.00 20.59 ? 9   LEU B CB    1 
ATOM   1063 C  CG    . LEU D 2 8  ? 5.451   -19.051 1.943   1.00 24.95 ? 9   LEU B CG    1 
ATOM   1064 C  CD1   . LEU D 2 8  ? 3.973   -18.754 2.142   1.00 20.40 ? 9   LEU B CD1   1 
ATOM   1065 C  CD2   . LEU D 2 8  ? 6.290   -18.521 3.102   1.00 23.67 ? 9   LEU B CD2   1 
ATOM   1066 N  N     . SER D 2 9  ? 8.271   -22.556 2.669   1.00 21.47 ? 10  SER B N     1 
ATOM   1067 C  CA    . SER D 2 9  ? 8.590   -23.892 3.145   1.00 23.66 ? 10  SER B CA    1 
ATOM   1068 C  C     . SER D 2 9  ? 7.381   -24.451 3.916   1.00 22.24 ? 10  SER B C     1 
ATOM   1069 O  O     . SER D 2 9  ? 6.468   -23.710 4.311   1.00 21.70 ? 10  SER B O     1 
ATOM   1070 C  CB    . SER D 2 9  ? 9.782   -23.842 4.094   1.00 23.69 ? 10  SER B CB    1 
ATOM   1071 O  OG    . SER D 2 9  ? 9.396   -23.235 5.322   1.00 22.67 ? 10  SER B OG    1 
ATOM   1072 N  N     . ALA D 2 10 ? 7.382   -25.764 4.113   1.00 24.01 ? 11  ALA B N     1 
ATOM   1073 C  CA    . ALA D 2 10 ? 6.328   -26.442 4.869   1.00 25.06 ? 11  ALA B CA    1 
ATOM   1074 C  C     . ALA D 2 10 ? 6.395   -25.897 6.306   1.00 25.83 ? 11  ALA B C     1 
ATOM   1075 O  O     . ALA D 2 10 ? 5.375   -25.710 6.974   1.00 22.23 ? 11  ALA B O     1 
ATOM   1076 C  CB    . ALA D 2 10 ? 6.580   -27.964 4.860   1.00 25.55 ? 11  ALA B CB    1 
ATOM   1077 N  N     . TYR D 2 11 ? 7.614   -25.647 6.779   1.00 26.23 ? 12  TYR B N     1 
ATOM   1078 C  CA    . TYR D 2 11 ? 7.789   -25.084 8.115   1.00 25.06 ? 12  TYR B CA    1 
ATOM   1079 C  C     . TYR D 2 11 ? 7.122   -23.701 8.215   1.00 25.34 ? 12  TYR B C     1 
ATOM   1080 O  O     . TYR D 2 11 ? 6.311   -23.452 9.113   1.00 22.33 ? 12  TYR B O     1 
ATOM   1081 C  CB    . TYR D 2 11 ? 9.278   -24.963 8.452   1.00 24.03 ? 12  TYR B CB    1 
ATOM   1082 C  CG    . TYR D 2 11 ? 9.564   -24.067 9.641   1.00 26.31 ? 12  TYR B CG    1 
ATOM   1083 C  CD1   . TYR D 2 11 ? 9.152   -24.419 10.929  1.00 26.58 ? 12  TYR B CD1   1 
ATOM   1084 C  CD2   . TYR D 2 11 ? 10.255  -22.863 9.479   1.00 28.85 ? 12  TYR B CD2   1 
ATOM   1085 C  CE1   . TYR D 2 11 ? 9.432   -23.595 12.023  1.00 34.77 ? 12  TYR B CE1   1 
ATOM   1086 C  CE2   . TYR D 2 11 ? 10.528  -22.039 10.568  1.00 33.26 ? 12  TYR B CE2   1 
ATOM   1087 C  CZ    . TYR D 2 11 ? 10.124  -22.405 11.831  1.00 35.78 ? 12  TYR B CZ    1 
ATOM   1088 O  OH    . TYR D 2 11 ? 10.450  -21.594 12.889  1.00 44.70 ? 12  TYR B OH    1 
ATOM   1089 N  N     . MET D 2 12 ? 7.463   -22.806 7.287   1.00 24.04 ? 13  MET B N     1 
ATOM   1090 C  CA    . MET D 2 12 ? 6.899   -21.458 7.293   1.00 23.89 ? 13  MET B CA    1 
ATOM   1091 C  C     . MET D 2 12 ? 5.398   -21.409 7.013   1.00 22.61 ? 13  MET B C     1 
ATOM   1092 O  O     . MET D 2 12 ? 4.685   -20.531 7.499   1.00 19.21 ? 13  MET B O     1 
ATOM   1093 C  CB    . MET D 2 12 ? 7.628   -20.566 6.294   1.00 23.19 ? 13  MET B CB    1 
ATOM   1094 C  CG    . MET D 2 12 ? 7.296   -19.103 6.461   1.00 23.92 ? 13  MET B CG    1 
ATOM   1095 S  SD    . MET D 2 12 ? 7.632   -18.483 8.161   1.00 27.67 ? 13  MET B SD    1 
ATOM   1096 C  CE    . MET D 2 12 ? 9.466   -18.690 8.251   1.00 27.50 ? 13  MET B CE    1 
ATOM   1097 N  N     . LEU D 2 13 ? 4.923   -22.334 6.201   1.00 20.96 ? 14  LEU B N     1 
ATOM   1098 C  CA    . LEU D 2 13 ? 3.509   -22.387 5.911   1.00 23.44 ? 14  LEU B CA    1 
ATOM   1099 C  C     . LEU D 2 13 ? 2.828   -22.654 7.253   1.00 25.64 ? 14  LEU B C     1 
ATOM   1100 O  O     . LEU D 2 13 ? 1.879   -21.974 7.618   1.00 27.35 ? 14  LEU B O     1 
ATOM   1101 C  CB    . LEU D 2 13 ? 3.210   -23.527 4.925   1.00 24.33 ? 14  LEU B CB    1 
ATOM   1102 C  CG    . LEU D 2 13 ? 3.535   -23.244 3.449   1.00 27.22 ? 14  LEU B CG    1 
ATOM   1103 C  CD1   . LEU D 2 13 ? 3.417   -24.503 2.594   1.00 28.18 ? 14  LEU B CD1   1 
ATOM   1104 C  CD2   . LEU D 2 13 ? 2.566   -22.198 2.955   1.00 27.82 ? 14  LEU B CD2   1 
ATOM   1105 N  N     . TRP D 2 14 ? 3.312   -23.652 7.987   1.00 26.13 ? 15  TRP B N     1 
ATOM   1106 C  CA    . TRP D 2 14 ? 2.718   -23.962 9.282   1.00 28.16 ? 15  TRP B CA    1 
ATOM   1107 C  C     . TRP D 2 14 ? 2.826   -22.783 10.241  1.00 27.81 ? 15  TRP B C     1 
ATOM   1108 O  O     . TRP D 2 14 ? 1.825   -22.333 10.803  1.00 25.96 ? 15  TRP B O     1 
ATOM   1109 C  CB    . TRP D 2 14 ? 3.402   -25.178 9.904   1.00 28.85 ? 15  TRP B CB    1 
ATOM   1110 C  CG    . TRP D 2 14 ? 3.161   -25.284 11.378  1.00 33.61 ? 15  TRP B CG    1 
ATOM   1111 C  CD1   . TRP D 2 14 ? 2.035   -25.754 12.008  1.00 30.66 ? 15  TRP B CD1   1 
ATOM   1112 C  CD2   . TRP D 2 14 ? 4.063   -24.870 12.419  1.00 30.11 ? 15  TRP B CD2   1 
ATOM   1113 N  NE1   . TRP D 2 14 ? 2.191   -25.659 13.370  1.00 32.71 ? 15  TRP B NE1   1 
ATOM   1114 C  CE2   . TRP D 2 14 ? 3.421   -25.121 13.650  1.00 32.76 ? 15  TRP B CE2   1 
ATOM   1115 C  CE3   . TRP D 2 14 ? 5.350   -24.311 12.426  1.00 31.39 ? 15  TRP B CE3   1 
ATOM   1116 C  CZ2   . TRP D 2 14 ? 4.024   -24.831 14.883  1.00 30.36 ? 15  TRP B CZ2   1 
ATOM   1117 C  CZ3   . TRP D 2 14 ? 5.952   -24.021 13.657  1.00 31.40 ? 15  TRP B CZ3   1 
ATOM   1118 C  CH2   . TRP D 2 14 ? 5.288   -24.283 14.864  1.00 30.43 ? 15  TRP B CH2   1 
ATOM   1119 N  N     . LEU D 2 15 ? 4.048   -22.293 10.430  1.00 27.42 ? 16  LEU B N     1 
ATOM   1120 C  CA    . LEU D 2 15 ? 4.286   -21.166 11.337  1.00 28.59 ? 16  LEU B CA    1 
ATOM   1121 C  C     . LEU D 2 15 ? 3.330   -20.003 11.107  1.00 27.17 ? 16  LEU B C     1 
ATOM   1122 O  O     . LEU D 2 15 ? 2.802   -19.449 12.063  1.00 26.96 ? 16  LEU B O     1 
ATOM   1123 C  CB    . LEU D 2 15 ? 5.733   -20.683 11.219  1.00 26.65 ? 16  LEU B CB    1 
ATOM   1124 C  CG    . LEU D 2 15 ? 6.162   -19.508 12.107  1.00 26.34 ? 16  LEU B CG    1 
ATOM   1125 C  CD1   . LEU D 2 15 ? 5.850   -19.794 13.576  1.00 25.06 ? 16  LEU B CD1   1 
ATOM   1126 C  CD2   . LEU D 2 15 ? 7.650   -19.284 11.908  1.00 23.63 ? 16  LEU B CD2   1 
ATOM   1127 N  N     . ASN D 2 16 ? 3.104   -19.624 9.849   1.00 28.68 ? 17  ASN B N     1 
ATOM   1128 C  CA    . ASN D 2 16 ? 2.168   -18.532 9.563   1.00 28.35 ? 17  ASN B CA    1 
ATOM   1129 C  C     . ASN D 2 16 ? 0.819   -18.879 10.196  1.00 29.22 ? 17  ASN B C     1 
ATOM   1130 O  O     . ASN D 2 16 ? 0.172   -18.051 10.844  1.00 31.04 ? 17  ASN B O     1 
ATOM   1131 C  CB    . ASN D 2 16 ? 1.941   -18.347 8.050   1.00 28.96 ? 17  ASN B CB    1 
ATOM   1132 C  CG    . ASN D 2 16 ? 3.107   -17.673 7.337   1.00 30.95 ? 17  ASN B CG    1 
ATOM   1133 O  OD1   . ASN D 2 16 ? 3.951   -16.998 7.947   1.00 26.83 ? 17  ASN B OD1   1 
ATOM   1134 N  ND2   . ASN D 2 16 ? 3.146   -17.840 6.019   1.00 25.71 ? 17  ASN B ND2   1 
ATOM   1135 N  N     . SER D 2 17 ? 0.397   -20.121 10.000  1.00 30.00 ? 18  SER B N     1 
ATOM   1136 C  CA    . SER D 2 17 ? -0.879  -20.564 10.533  1.00 32.50 ? 18  SER B CA    1 
ATOM   1137 C  C     . SER D 2 17 ? -0.861  -20.735 12.042  1.00 30.12 ? 18  SER B C     1 
ATOM   1138 O  O     . SER D 2 17 ? -1.904  -20.659 12.674  1.00 30.65 ? 18  SER B O     1 
ATOM   1139 C  CB    . SER D 2 17 ? -1.313  -21.880 9.878   1.00 31.83 ? 18  SER B CB    1 
ATOM   1140 O  OG    . SER D 2 17 ? -0.643  -22.985 10.455  1.00 31.92 ? 18  SER B OG    1 
ATOM   1141 N  N     . ALA D 2 18 ? 0.315   -20.956 12.618  1.00 27.67 ? 19  ALA B N     1 
ATOM   1142 C  CA    . ALA D 2 18 ? 0.407   -21.158 14.064  1.00 27.52 ? 19  ALA B CA    1 
ATOM   1143 C  C     . ALA D 2 18 ? 0.894   -19.967 14.892  1.00 28.19 ? 19  ALA B C     1 
ATOM   1144 O  O     . ALA D 2 18 ? 0.945   -20.061 16.112  1.00 26.77 ? 19  ALA B O     1 
ATOM   1145 C  CB    . ALA D 2 18 ? 1.280   -22.374 14.362  1.00 23.04 ? 19  ALA B CB    1 
ATOM   1146 N  N     . ARG D 2 19 ? 1.234   -18.859 14.236  1.00 32.43 ? 20  ARG B N     1 
ATOM   1147 C  CA    . ARG D 2 19 ? 1.743   -17.666 14.914  1.00 32.80 ? 20  ARG B CA    1 
ATOM   1148 C  C     . ARG D 2 19 ? 0.820   -17.043 15.968  1.00 33.46 ? 20  ARG B C     1 
ATOM   1149 O  O     . ARG D 2 19 ? 1.292   -16.647 17.024  1.00 34.03 ? 20  ARG B O     1 
ATOM   1150 C  CB    . ARG D 2 19 ? 2.145   -16.601 13.890  1.00 33.17 ? 20  ARG B CB    1 
ATOM   1151 C  CG    . ARG D 2 19 ? 3.125   -15.586 14.462  1.00 37.97 ? 20  ARG B CG    1 
ATOM   1152 C  CD    . ARG D 2 19 ? 3.727   -14.680 13.388  1.00 44.82 ? 20  ARG B CD    1 
ATOM   1153 N  NE    . ARG D 2 19 ? 4.481   -15.442 12.394  1.00 46.31 ? 20  ARG B NE    1 
ATOM   1154 C  CZ    . ARG D 2 19 ? 4.021   -15.767 11.184  1.00 48.41 ? 20  ARG B CZ    1 
ATOM   1155 N  NH1   . ARG D 2 19 ? 2.797   -15.391 10.789  1.00 44.06 ? 20  ARG B NH1   1 
ATOM   1156 N  NH2   . ARG D 2 19 ? 4.785   -16.482 10.371  1.00 45.54 ? 20  ARG B NH2   1 
ATOM   1157 N  N     . GLU D 2 20 ? -0.477  -16.926 15.700  1.00 34.96 ? 21  GLU B N     1 
ATOM   1158 C  CA    . GLU D 2 20 ? -1.362  -16.377 16.729  1.00 37.81 ? 21  GLU B CA    1 
ATOM   1159 C  C     . GLU D 2 20 ? -1.414  -17.339 17.918  1.00 36.34 ? 21  GLU B C     1 
ATOM   1160 O  O     . GLU D 2 20 ? -1.338  -16.929 19.078  1.00 35.61 ? 21  GLU B O     1 
ATOM   1161 C  CB    . GLU D 2 20 ? -2.780  -16.188 16.210  1.00 41.37 ? 21  GLU B CB    1 
ATOM   1162 C  CG    . GLU D 2 20 ? -3.010  -14.920 15.425  1.00 47.52 ? 21  GLU B CG    1 
ATOM   1163 C  CD    . GLU D 2 20 ? -4.495  -14.607 15.304  1.00 53.70 ? 21  GLU B CD    1 
ATOM   1164 O  OE1   . GLU D 2 20 ? -5.291  -15.564 15.114  1.00 53.28 ? 21  GLU B OE1   1 
ATOM   1165 O  OE2   . GLU D 2 20 ? -4.863  -13.410 15.397  1.00 52.54 ? 21  GLU B OE2   1 
ATOM   1166 N  N     . SER D 2 21 ? -1.558  -18.627 17.622  1.00 36.09 ? 22  SER B N     1 
ATOM   1167 C  CA    . SER D 2 21 ? -1.609  -19.628 18.671  1.00 35.49 ? 22  SER B CA    1 
ATOM   1168 C  C     . SER D 2 21 ? -0.403  -19.526 19.591  1.00 35.35 ? 22  SER B C     1 
ATOM   1169 O  O     . SER D 2 21 ? -0.558  -19.479 20.809  1.00 33.50 ? 22  SER B O     1 
ATOM   1170 C  CB    . SER D 2 21 ? -1.667  -21.034 18.084  1.00 34.45 ? 22  SER B CB    1 
ATOM   1171 O  OG    . SER D 2 21 ? -1.699  -21.989 19.132  1.00 33.59 ? 22  SER B OG    1 
ATOM   1172 N  N     . ILE D 2 22 ? 0.796   -19.486 19.006  1.00 36.31 ? 23  ILE B N     1 
ATOM   1173 C  CA    . ILE D 2 22 ? 2.012   -19.393 19.802  1.00 36.60 ? 23  ILE B CA    1 
ATOM   1174 C  C     . ILE D 2 22 ? 1.977   -18.134 20.652  1.00 37.68 ? 23  ILE B C     1 
ATOM   1175 O  O     . ILE D 2 22 ? 2.391   -18.145 21.817  1.00 38.89 ? 23  ILE B O     1 
ATOM   1176 C  CB    . ILE D 2 22 ? 3.291   -19.361 18.920  1.00 36.70 ? 23  ILE B CB    1 
ATOM   1177 C  CG1   . ILE D 2 22 ? 3.551   -20.746 18.319  1.00 36.58 ? 23  ILE B CG1   1 
ATOM   1178 C  CG2   . ILE D 2 22 ? 4.496   -18.945 19.763  1.00 36.07 ? 23  ILE B CG2   1 
ATOM   1179 C  CD1   . ILE D 2 22 ? 4.762   -20.801 17.404  1.00 36.64 ? 23  ILE B CD1   1 
ATOM   1180 N  N     . LYS D 2 23 ? 1.468   -17.049 20.080  1.00 36.45 ? 24  LYS B N     1 
ATOM   1181 C  CA    . LYS D 2 23 ? 1.420   -15.805 20.816  1.00 38.92 ? 24  LYS B CA    1 
ATOM   1182 C  C     . LYS D 2 23 ? 0.364   -15.819 21.915  1.00 37.29 ? 24  LYS B C     1 
ATOM   1183 O  O     . LYS D 2 23 ? 0.533   -15.178 22.943  1.00 36.39 ? 24  LYS B O     1 
ATOM   1184 C  CB    . LYS D 2 23 ? 1.227   -14.643 19.850  1.00 39.25 ? 24  LYS B CB    1 
ATOM   1185 C  CG    . LYS D 2 23 ? 2.421   -14.501 18.914  1.00 42.37 ? 24  LYS B CG    1 
ATOM   1186 C  CD    . LYS D 2 23 ? 2.411   -13.216 18.105  1.00 46.66 ? 24  LYS B CD    1 
ATOM   1187 C  CE    . LYS D 2 23 ? 1.297   -13.200 17.080  1.00 49.08 ? 24  LYS B CE    1 
ATOM   1188 N  NZ    . LYS D 2 23 ? 1.536   -12.108 16.093  1.00 53.61 ? 24  LYS B NZ    1 
ATOM   1189 N  N     . ARG D 2 24 ? -0.723  -16.550 21.707  1.00 35.79 ? 25  ARG B N     1 
ATOM   1190 C  CA    . ARG D 2 24 ? -1.737  -16.632 22.748  1.00 35.72 ? 25  ARG B CA    1 
ATOM   1191 C  C     . ARG D 2 24 ? -1.127  -17.358 23.952  1.00 32.76 ? 25  ARG B C     1 
ATOM   1192 O  O     . ARG D 2 24 ? -1.228  -16.875 25.066  1.00 31.34 ? 25  ARG B O     1 
ATOM   1193 C  CB    . ARG D 2 24 ? -2.971  -17.390 22.260  1.00 39.24 ? 25  ARG B CB    1 
ATOM   1194 C  CG    . ARG D 2 24 ? -3.936  -17.723 23.386  1.00 46.28 ? 25  ARG B CG    1 
ATOM   1195 C  CD    . ARG D 2 24 ? -5.165  -18.479 22.914  1.00 48.45 ? 25  ARG B CD    1 
ATOM   1196 N  NE    . ARG D 2 24 ? -5.871  -19.060 24.053  1.00 53.71 ? 25  ARG B NE    1 
ATOM   1197 C  CZ    . ARG D 2 24 ? -5.419  -20.086 24.769  1.00 54.73 ? 25  ARG B CZ    1 
ATOM   1198 N  NH1   . ARG D 2 24 ? -4.261  -20.660 24.462  1.00 54.48 ? 25  ARG B NH1   1 
ATOM   1199 N  NH2   . ARG D 2 24 ? -6.112  -20.520 25.812  1.00 55.23 ? 25  ARG B NH2   1 
ATOM   1200 N  N     . GLU D 2 25 ? -0.457  -18.488 23.706  1.00 32.25 ? 26  GLU B N     1 
ATOM   1201 C  CA    . GLU D 2 25 ? 0.182   -19.303 24.755  1.00 30.78 ? 26  GLU B CA    1 
ATOM   1202 C  C     . GLU D 2 25 ? 1.468   -18.717 25.352  1.00 32.73 ? 26  GLU B C     1 
ATOM   1203 O  O     . GLU D 2 25 ? 2.021   -19.265 26.309  1.00 30.56 ? 26  GLU B O     1 
ATOM   1204 C  CB    . GLU D 2 25 ? 0.535   -20.691 24.216  1.00 35.47 ? 26  GLU B CB    1 
ATOM   1205 C  CG    . GLU D 2 25 ? -0.625  -21.580 23.859  1.00 37.82 ? 26  GLU B CG    1 
ATOM   1206 C  CD    . GLU D 2 25 ? -0.167  -22.759 23.024  1.00 42.67 ? 26  GLU B CD    1 
ATOM   1207 O  OE1   . GLU D 2 25 ? 1.066   -22.910 22.841  1.00 42.00 ? 26  GLU B OE1   1 
ATOM   1208 O  OE2   . GLU D 2 25 ? -1.036  -23.528 22.551  1.00 43.62 ? 26  GLU B OE2   1 
ATOM   1209 N  N     . ASN D 2 26 ? 1.965   -17.635 24.774  1.00 30.52 ? 27  ASN B N     1 
ATOM   1210 C  CA    . ASN D 2 26 ? 3.177   -17.001 25.276  1.00 34.46 ? 27  ASN B CA    1 
ATOM   1211 C  C     . ASN D 2 26 ? 2.954   -15.490 25.265  1.00 36.87 ? 27  ASN B C     1 
ATOM   1212 O  O     . ASN D 2 26 ? 3.501   -14.789 24.431  1.00 37.66 ? 27  ASN B O     1 
ATOM   1213 C  CB    . ASN D 2 26 ? 4.372   -17.347 24.380  1.00 37.11 ? 27  ASN B CB    1 
ATOM   1214 C  CG    . ASN D 2 26 ? 4.652   -18.841 24.315  1.00 38.26 ? 27  ASN B CG    1 
ATOM   1215 O  OD1   . ASN D 2 26 ? 5.156   -19.430 25.268  1.00 42.89 ? 27  ASN B OD1   1 
ATOM   1216 N  ND2   . ASN D 2 26 ? 4.320   -19.460 23.187  1.00 38.20 ? 27  ASN B ND2   1 
ATOM   1217 N  N     . PRO D 2 27 ? 2.134   -14.974 26.193  1.00 37.60 ? 28  PRO B N     1 
ATOM   1218 C  CA    . PRO D 2 27 ? 1.867   -13.530 26.244  1.00 37.94 ? 28  PRO B CA    1 
ATOM   1219 C  C     . PRO D 2 27 ? 3.148   -12.668 26.255  1.00 40.23 ? 28  PRO B C     1 
ATOM   1220 O  O     . PRO D 2 27 ? 4.120   -12.968 26.972  1.00 37.14 ? 28  PRO B O     1 
ATOM   1221 C  CB    . PRO D 2 27 ? 1.040   -13.369 27.535  1.00 37.88 ? 28  PRO B CB    1 
ATOM   1222 C  CG    . PRO D 2 27 ? 0.341   -14.717 27.677  1.00 37.11 ? 28  PRO B CG    1 
ATOM   1223 C  CD    . PRO D 2 27 ? 1.464   -15.685 27.303  1.00 38.25 ? 28  PRO B CD    1 
ATOM   1224 N  N     . GLY D 2 28 ? 3.130   -11.608 25.447  1.00 41.29 ? 29  GLY B N     1 
ATOM   1225 C  CA    . GLY D 2 28 ? 4.252   -10.692 25.345  1.00 44.16 ? 29  GLY B CA    1 
ATOM   1226 C  C     . GLY D 2 28 ? 5.473   -11.264 24.652  1.00 47.21 ? 29  GLY B C     1 
ATOM   1227 O  O     . GLY D 2 28 ? 6.504   -10.590 24.551  1.00 46.87 ? 29  GLY B O     1 
ATOM   1228 N  N     . ILE D 2 29 ? 5.363   -12.494 24.155  1.00 46.47 ? 30  ILE B N     1 
ATOM   1229 C  CA    . ILE D 2 29 ? 6.501   -13.143 23.506  1.00 48.14 ? 30  ILE B CA    1 
ATOM   1230 C  C     . ILE D 2 29 ? 7.130   -12.372 22.337  1.00 51.55 ? 30  ILE B C     1 
ATOM   1231 O  O     . ILE D 2 29 ? 6.426   -11.796 21.494  1.00 52.81 ? 30  ILE B O     1 
ATOM   1232 C  CB    . ILE D 2 29 ? 6.141   -14.568 23.020  1.00 45.62 ? 30  ILE B CB    1 
ATOM   1233 C  CG1   . ILE D 2 29 ? 7.391   -15.233 22.440  1.00 42.39 ? 30  ILE B CG1   1 
ATOM   1234 C  CG2   . ILE D 2 29 ? 4.981   -14.506 22.008  1.00 39.10 ? 30  ILE B CG2   1 
ATOM   1235 C  CD1   . ILE D 2 29 ? 7.232   -16.712 22.102  1.00 44.59 ? 30  ILE B CD1   1 
ATOM   1236 N  N     . LYS D 2 30 ? 8.464   -12.384 22.301  1.00 51.49 ? 31  LYS B N     1 
ATOM   1237 C  CA    . LYS D 2 30 ? 9.243   -11.716 21.263  1.00 52.02 ? 31  LYS B CA    1 
ATOM   1238 C  C     . LYS D 2 30 ? 9.317   -12.491 19.949  1.00 52.63 ? 31  LYS B C     1 
ATOM   1239 O  O     . LYS D 2 30 ? 9.355   -13.724 19.941  1.00 51.44 ? 31  LYS B O     1 
ATOM   1240 C  CB    . LYS D 2 30 ? 10.665  -11.469 21.770  1.00 52.48 ? 31  LYS B CB    1 
ATOM   1241 C  CG    . LYS D 2 30 ? 10.737  -10.479 22.917  1.00 54.68 ? 31  LYS B CG    1 
ATOM   1242 C  CD    . LYS D 2 30 ? 10.141  -9.157  22.471  1.00 55.15 ? 31  LYS B CD    1 
ATOM   1243 C  CE    . LYS D 2 30 ? 10.351  -8.068  23.492  1.00 56.98 ? 31  LYS B CE    1 
ATOM   1244 N  NZ    . LYS D 2 30 ? 9.907   -6.771  22.920  1.00 58.02 ? 31  LYS B NZ    1 
ATOM   1245 N  N     . VAL D 2 31 ? 9.351   -11.757 18.838  1.00 51.85 ? 32  VAL B N     1 
ATOM   1246 C  CA    . VAL D 2 31 ? 9.448   -12.361 17.511  1.00 51.20 ? 32  VAL B CA    1 
ATOM   1247 C  C     . VAL D 2 31 ? 10.512  -13.461 17.508  1.00 51.55 ? 32  VAL B C     1 
ATOM   1248 O  O     . VAL D 2 31 ? 10.305  -14.543 16.949  1.00 51.14 ? 32  VAL B O     1 
ATOM   1249 C  CB    . VAL D 2 31 ? 9.832   -11.306 16.453  1.00 50.37 ? 32  VAL B CB    1 
ATOM   1250 C  CG1   . VAL D 2 31 ? 9.949   -11.951 15.081  1.00 51.72 ? 32  VAL B CG1   1 
ATOM   1251 C  CG2   . VAL D 2 31 ? 8.799   -10.204 16.431  1.00 51.11 ? 32  VAL B CG2   1 
ATOM   1252 N  N     . THR D 2 32 ? 11.642  -13.171 18.151  1.00 49.08 ? 33  THR B N     1 
ATOM   1253 C  CA    . THR D 2 32 ? 12.765  -14.097 18.244  1.00 45.58 ? 33  THR B CA    1 
ATOM   1254 C  C     . THR D 2 32 ? 12.389  -15.353 19.024  1.00 43.10 ? 33  THR B C     1 
ATOM   1255 O  O     . THR D 2 32 ? 12.774  -16.463 18.645  1.00 39.38 ? 33  THR B O     1 
ATOM   1256 C  CB    . THR D 2 32 ? 13.965  -13.432 18.952  1.00 46.07 ? 33  THR B CB    1 
ATOM   1257 O  OG1   . THR D 2 32 ? 13.826  -12.007 18.884  1.00 49.70 ? 33  THR B OG1   1 
ATOM   1258 C  CG2   . THR D 2 32 ? 15.276  -13.845 18.283  1.00 47.34 ? 33  THR B CG2   1 
ATOM   1259 N  N     . GLU D 2 33 ? 11.653  -15.162 20.121  1.00 43.03 ? 34  GLU B N     1 
ATOM   1260 C  CA    . GLU D 2 33 ? 11.210  -16.265 20.976  1.00 42.90 ? 34  GLU B CA    1 
ATOM   1261 C  C     . GLU D 2 33 ? 10.087  -17.067 20.317  1.00 41.91 ? 34  GLU B C     1 
ATOM   1262 O  O     . GLU D 2 33 ? 9.938   -18.255 20.568  1.00 44.90 ? 34  GLU B O     1 
ATOM   1263 C  CB    . GLU D 2 33 ? 10.738  -15.730 22.330  1.00 46.80 ? 34  GLU B CB    1 
ATOM   1264 C  CG    . GLU D 2 33 ? 11.847  -15.430 23.334  1.00 51.38 ? 34  GLU B CG    1 
ATOM   1265 C  CD    . GLU D 2 33 ? 12.890  -14.456 22.811  1.00 56.47 ? 34  GLU B CD    1 
ATOM   1266 O  OE1   . GLU D 2 33 ? 13.890  -14.908 22.201  1.00 56.56 ? 34  GLU B OE1   1 
ATOM   1267 O  OE2   . GLU D 2 33 ? 12.707  -13.234 23.006  1.00 60.61 ? 34  GLU B OE2   1 
ATOM   1268 N  N     . VAL D 2 34 ? 9.288   -16.411 19.485  1.00 42.20 ? 35  VAL B N     1 
ATOM   1269 C  CA    . VAL D 2 34 ? 8.215   -17.094 18.769  1.00 40.78 ? 35  VAL B CA    1 
ATOM   1270 C  C     . VAL D 2 34 ? 8.876   -18.113 17.844  1.00 40.65 ? 35  VAL B C     1 
ATOM   1271 O  O     . VAL D 2 34 ? 8.440   -19.262 17.731  1.00 41.99 ? 35  VAL B O     1 
ATOM   1272 C  CB    . VAL D 2 34 ? 7.393   -16.103 17.906  1.00 40.07 ? 35  VAL B CB    1 
ATOM   1273 C  CG1   . VAL D 2 34 ? 6.697   -16.839 16.764  1.00 40.42 ? 35  VAL B CG1   1 
ATOM   1274 C  CG2   . VAL D 2 34 ? 6.357   -15.394 18.775  1.00 39.78 ? 35  VAL B CG2   1 
ATOM   1275 N  N     . ALA D 2 35 ? 9.950   -17.674 17.201  1.00 37.50 ? 36  ALA B N     1 
ATOM   1276 C  CA    . ALA D 2 35 ? 10.689  -18.501 16.276  1.00 35.86 ? 36  ALA B CA    1 
ATOM   1277 C  C     . ALA D 2 35 ? 11.258  -19.721 16.977  1.00 37.43 ? 36  ALA B C     1 
ATOM   1278 O  O     . ALA D 2 35 ? 11.234  -20.826 16.431  1.00 36.21 ? 36  ALA B O     1 
ATOM   1279 C  CB    . ALA D 2 35 ? 11.802  -17.687 15.648  1.00 35.80 ? 36  ALA B CB    1 
ATOM   1280 N  N     . LYS D 2 36 ? 11.793  -19.517 18.177  1.00 36.38 ? 37  LYS B N     1 
ATOM   1281 C  CA    . LYS D 2 36 ? 12.356  -20.617 18.938  1.00 36.56 ? 37  LYS B CA    1 
ATOM   1282 C  C     . LYS D 2 36 ? 11.248  -21.561 19.362  1.00 34.69 ? 37  LYS B C     1 
ATOM   1283 O  O     . LYS D 2 36 ? 11.416  -22.784 19.329  1.00 32.80 ? 37  LYS B O     1 
ATOM   1284 C  CB    . LYS D 2 36 ? 13.095  -20.107 20.181  1.00 43.24 ? 37  LYS B CB    1 
ATOM   1285 C  CG    . LYS D 2 36 ? 13.495  -21.222 21.173  1.00 48.01 ? 37  LYS B CG    1 
ATOM   1286 C  CD    . LYS D 2 36 ? 14.263  -22.366 20.488  1.00 51.91 ? 37  LYS B CD    1 
ATOM   1287 C  CE    . LYS D 2 36 ? 14.803  -23.412 21.487  1.00 54.42 ? 37  LYS B CE    1 
ATOM   1288 N  NZ    . LYS D 2 36 ? 13.766  -24.270 22.143  1.00 51.22 ? 37  LYS B NZ    1 
ATOM   1289 N  N     . ARG D 2 37 ? 10.122  -20.989 19.768  1.00 36.77 ? 38  ARG B N     1 
ATOM   1290 C  CA    . ARG D 2 37 ? 8.970   -21.775 20.192  1.00 39.17 ? 38  ARG B CA    1 
ATOM   1291 C  C     . ARG D 2 37 ? 8.407   -22.508 18.969  1.00 37.61 ? 38  ARG B C     1 
ATOM   1292 O  O     . ARG D 2 37 ? 8.133   -23.712 19.007  1.00 34.21 ? 38  ARG B O     1 
ATOM   1293 C  CB    . ARG D 2 37 ? 7.904   -20.853 20.782  1.00 43.89 ? 38  ARG B CB    1 
ATOM   1294 C  CG    . ARG D 2 37 ? 6.922   -21.571 21.662  1.00 46.94 ? 38  ARG B CG    1 
ATOM   1295 C  CD    . ARG D 2 37 ? 7.657   -22.224 22.816  1.00 51.56 ? 38  ARG B CD    1 
ATOM   1296 N  NE    . ARG D 2 37 ? 6.815   -23.193 23.505  1.00 56.69 ? 38  ARG B NE    1 
ATOM   1297 C  CZ    . ARG D 2 37 ? 6.399   -24.330 22.961  1.00 58.97 ? 38  ARG B CZ    1 
ATOM   1298 N  NH1   . ARG D 2 37 ? 6.753   -24.634 21.723  1.00 63.14 ? 38  ARG B NH1   1 
ATOM   1299 N  NH2   . ARG D 2 37 ? 5.631   -25.165 23.651  1.00 60.06 ? 38  ARG B NH2   1 
ATOM   1300 N  N     . GLY D 2 38 ? 8.255   -21.767 17.877  1.00 39.96 ? 39  GLY B N     1 
ATOM   1301 C  CA    . GLY D 2 38 ? 7.749   -22.351 16.649  1.00 39.71 ? 39  GLY B CA    1 
ATOM   1302 C  C     . GLY D 2 38 ? 8.575   -23.562 16.281  1.00 39.30 ? 39  GLY B C     1 
ATOM   1303 O  O     . GLY D 2 38 ? 8.058   -24.549 15.779  1.00 43.25 ? 39  GLY B O     1 
ATOM   1304 N  N     . GLY D 2 39 ? 9.871   -23.492 16.539  1.00 37.49 ? 40  GLY B N     1 
ATOM   1305 C  CA    . GLY D 2 39 ? 10.730  -24.621 16.239  1.00 37.80 ? 40  GLY B CA    1 
ATOM   1306 C  C     . GLY D 2 39 ? 10.505  -25.815 17.149  1.00 36.54 ? 40  GLY B C     1 
ATOM   1307 O  O     . GLY D 2 39 ? 10.659  -26.962 16.716  1.00 36.27 ? 40  GLY B O     1 
ATOM   1308 N  N     . GLU D 2 40 ? 10.147  -25.557 18.409  1.00 35.28 ? 41  GLU B N     1 
ATOM   1309 C  CA    . GLU D 2 40 ? 9.899   -26.635 19.374  1.00 34.57 ? 41  GLU B CA    1 
ATOM   1310 C  C     . GLU D 2 40 ? 8.661   -27.403 18.929  1.00 32.01 ? 41  GLU B C     1 
ATOM   1311 O  O     . GLU D 2 40 ? 8.649   -28.641 18.930  1.00 27.57 ? 41  GLU B O     1 
ATOM   1312 C  CB    . GLU D 2 40 ? 9.662   -26.073 20.791  1.00 35.61 ? 41  GLU B CB    1 
ATOM   1313 C  CG    . GLU D 2 40 ? 10.926  -25.528 21.479  1.00 45.80 ? 41  GLU B CG    1 
ATOM   1314 C  CD    . GLU D 2 40 ? 10.653  -24.882 22.846  1.00 48.68 ? 41  GLU B CD    1 
ATOM   1315 O  OE1   . GLU D 2 40 ? 10.033  -25.536 23.716  1.00 49.55 ? 41  GLU B OE1   1 
ATOM   1316 O  OE2   . GLU D 2 40 ? 11.069  -23.720 23.052  1.00 51.91 ? 41  GLU B OE2   1 
ATOM   1317 N  N     . LEU D 2 41 ? 7.622   -26.653 18.556  1.00 27.62 ? 42  LEU B N     1 
ATOM   1318 C  CA    . LEU D 2 41 ? 6.376   -27.241 18.103  1.00 26.55 ? 42  LEU B CA    1 
ATOM   1319 C  C     . LEU D 2 41 ? 6.615   -27.972 16.775  1.00 28.81 ? 42  LEU B C     1 
ATOM   1320 O  O     . LEU D 2 41 ? 6.132   -29.088 16.558  1.00 25.04 ? 42  LEU B O     1 
ATOM   1321 C  CB    . LEU D 2 41 ? 5.325   -26.140 17.968  1.00 24.19 ? 42  LEU B CB    1 
ATOM   1322 C  CG    . LEU D 2 41 ? 5.061   -25.566 19.378  1.00 29.81 ? 42  LEU B CG    1 
ATOM   1323 C  CD1   . LEU D 2 41 ? 4.078   -24.392 19.385  1.00 28.05 ? 42  LEU B CD1   1 
ATOM   1324 C  CD2   . LEU D 2 41 ? 4.507   -26.696 20.236  1.00 26.00 ? 42  LEU B CD2   1 
ATOM   1325 N  N     . TRP D 2 42 ? 7.395   -27.360 15.895  1.00 25.16 ? 43  TRP B N     1 
ATOM   1326 C  CA    . TRP D 2 42 ? 7.662   -28.000 14.632  1.00 28.55 ? 43  TRP B CA    1 
ATOM   1327 C  C     . TRP D 2 42 ? 8.420   -29.315 14.810  1.00 29.98 ? 43  TRP B C     1 
ATOM   1328 O  O     . TRP D 2 42 ? 8.055   -30.331 14.196  1.00 30.65 ? 43  TRP B O     1 
ATOM   1329 C  CB    . TRP D 2 42 ? 8.448   -27.073 13.724  1.00 28.22 ? 43  TRP B CB    1 
ATOM   1330 C  CG    . TRP D 2 42 ? 8.695   -27.670 12.383  1.00 28.89 ? 43  TRP B CG    1 
ATOM   1331 C  CD1   . TRP D 2 42 ? 9.888   -28.108 11.891  1.00 29.43 ? 43  TRP B CD1   1 
ATOM   1332 C  CD2   . TRP D 2 42 ? 7.740   -27.823 11.324  1.00 28.35 ? 43  TRP B CD2   1 
ATOM   1333 N  NE1   . TRP D 2 42 ? 9.738   -28.511 10.584  1.00 30.75 ? 43  TRP B NE1   1 
ATOM   1334 C  CE2   . TRP D 2 42 ? 8.430   -28.344 10.213  1.00 30.00 ? 43  TRP B CE2   1 
ATOM   1335 C  CE3   . TRP D 2 42 ? 6.370   -27.565 11.207  1.00 23.75 ? 43  TRP B CE3   1 
ATOM   1336 C  CZ2   . TRP D 2 42 ? 7.798   -28.610 8.993   1.00 29.72 ? 43  TRP B CZ2   1 
ATOM   1337 C  CZ3   . TRP D 2 42 ? 5.744   -27.828 10.000  1.00 25.18 ? 43  TRP B CZ3   1 
ATOM   1338 C  CH2   . TRP D 2 42 ? 6.459   -28.345 8.907   1.00 27.20 ? 43  TRP B CH2   1 
ATOM   1339 N  N     . ARG D 2 43 ? 9.463   -29.318 15.642  1.00 29.31 ? 44  ARG B N     1 
ATOM   1340 C  CA    . ARG D 2 43 ? 10.236  -30.548 15.834  1.00 33.88 ? 44  ARG B CA    1 
ATOM   1341 C  C     . ARG D 2 43 ? 9.407   -31.630 16.514  1.00 34.50 ? 44  ARG B C     1 
ATOM   1342 O  O     . ARG D 2 43 ? 9.636   -32.828 16.294  1.00 33.94 ? 44  ARG B O     1 
ATOM   1343 C  CB    . ARG D 2 43 ? 11.526  -30.283 16.623  1.00 39.56 ? 44  ARG B CB    1 
ATOM   1344 C  CG    . ARG D 2 43 ? 11.365  -29.897 18.093  1.00 50.49 ? 44  ARG B CG    1 
ATOM   1345 C  CD    . ARG D 2 43 ? 12.749  -29.634 18.717  1.00 56.77 ? 44  ARG B CD    1 
ATOM   1346 N  NE    . ARG D 2 43 ? 12.849  -29.963 20.143  1.00 60.04 ? 44  ARG B NE    1 
ATOM   1347 C  CZ    . ARG D 2 43 ? 12.429  -31.104 20.693  1.00 63.09 ? 44  ARG B CZ    1 
ATOM   1348 N  NH1   . ARG D 2 43 ? 11.855  -32.040 19.941  1.00 65.39 ? 44  ARG B NH1   1 
ATOM   1349 N  NH2   . ARG D 2 43 ? 12.623  -31.332 21.994  1.00 63.26 ? 44  ARG B NH2   1 
ATOM   1350 N  N     . ALA D 2 44 ? 8.427   -31.199 17.310  1.00 34.34 ? 45  ALA B N     1 
ATOM   1351 C  CA    . ALA D 2 44 ? 7.536   -32.112 18.025  1.00 37.96 ? 45  ALA B CA    1 
ATOM   1352 C  C     . ALA D 2 44 ? 6.453   -32.684 17.114  1.00 38.41 ? 45  ALA B C     1 
ATOM   1353 O  O     . ALA D 2 44 ? 6.076   -33.849 17.234  1.00 41.88 ? 45  ALA B O     1 
ATOM   1354 C  CB    . ALA D 2 44 ? 6.888   -31.394 19.201  1.00 38.79 ? 45  ALA B CB    1 
ATOM   1355 N  N     . MET D 2 45 ? 5.947   -31.863 16.205  1.00 38.77 ? 46  MET B N     1 
ATOM   1356 C  CA    . MET D 2 45 ? 4.904   -32.310 15.286  1.00 37.97 ? 46  MET B CA    1 
ATOM   1357 C  C     . MET D 2 45 ? 5.379   -33.485 14.411  1.00 38.39 ? 46  MET B C     1 
ATOM   1358 O  O     . MET D 2 45 ? 6.137   -33.297 13.443  1.00 35.32 ? 46  MET B O     1 
ATOM   1359 C  CB    . MET D 2 45 ? 4.484   -31.160 14.397  1.00 35.60 ? 46  MET B CB    1 
ATOM   1360 C  CG    . MET D 2 45 ? 3.103   -31.331 13.826  1.00 36.47 ? 46  MET B CG    1 
ATOM   1361 S  SD    . MET D 2 45 ? 2.932   -30.371 12.331  1.00 33.31 ? 46  MET B SD    1 
ATOM   1362 C  CE    . MET D 2 45 ? 3.790   -28.852 12.773  1.00 37.66 ? 46  MET B CE    1 
ATOM   1363 N  N     . LYS D 2 46 ? 4.907   -34.685 14.749  1.00 34.98 ? 47  LYS B N     1 
ATOM   1364 C  CA    . LYS D 2 46 ? 5.279   -35.903 14.040  1.00 36.05 ? 47  LYS B CA    1 
ATOM   1365 C  C     . LYS D 2 46 ? 4.631   -36.038 12.673  1.00 33.10 ? 47  LYS B C     1 
ATOM   1366 O  O     . LYS D 2 46 ? 5.272   -36.494 11.732  1.00 34.52 ? 47  LYS B O     1 
ATOM   1367 C  CB    . LYS D 2 46 ? 4.958   -37.136 14.905  1.00 39.20 ? 47  LYS B CB    1 
ATOM   1368 C  CG    . LYS D 2 46 ? 5.897   -37.302 16.116  1.00 42.36 ? 47  LYS B CG    1 
ATOM   1369 C  CD    . LYS D 2 46 ? 7.305   -37.700 15.662  1.00 47.94 ? 47  LYS B CD    1 
ATOM   1370 C  CE    . LYS D 2 46 ? 8.353   -37.573 16.771  1.00 49.56 ? 47  LYS B CE    1 
ATOM   1371 N  NZ    . LYS D 2 46 ? 8.728   -36.150 17.025  1.00 48.69 ? 47  LYS B NZ    1 
ATOM   1372 N  N     . ASP D 2 47 ? 3.362   -35.658 12.567  1.00 30.91 ? 48  ASP B N     1 
ATOM   1373 C  CA    . ASP D 2 47 ? 2.672   -35.728 11.284  1.00 29.11 ? 48  ASP B CA    1 
ATOM   1374 C  C     . ASP D 2 47 ? 2.656   -34.333 10.658  1.00 24.79 ? 48  ASP B C     1 
ATOM   1375 O  O     . ASP D 2 47 ? 1.821   -33.506 11.003  1.00 23.89 ? 48  ASP B O     1 
ATOM   1376 C  CB    . ASP D 2 47 ? 1.225   -36.216 11.464  1.00 29.40 ? 48  ASP B CB    1 
ATOM   1377 C  CG    . ASP D 2 47 ? 0.449   -36.195 10.150  1.00 31.77 ? 48  ASP B CG    1 
ATOM   1378 O  OD1   . ASP D 2 47 ? 1.118   -36.234 9.089   1.00 25.38 ? 48  ASP B OD1   1 
ATOM   1379 O  OD2   . ASP D 2 47 ? -0.802  -36.143 10.176  1.00 26.14 ? 48  ASP B OD2   1 
ATOM   1380 N  N     . LYS D 2 48 ? 3.589   -34.080 9.752   1.00 25.09 ? 49  LYS B N     1 
ATOM   1381 C  CA    . LYS D 2 48 ? 3.666   -32.781 9.089   1.00 27.32 ? 49  LYS B CA    1 
ATOM   1382 C  C     . LYS D 2 48 ? 3.085   -32.893 7.672   1.00 28.22 ? 49  LYS B C     1 
ATOM   1383 O  O     . LYS D 2 48 ? 3.347   -32.037 6.813   1.00 28.80 ? 49  LYS B O     1 
ATOM   1384 C  CB    . LYS D 2 48 ? 5.133   -32.325 9.000   1.00 26.10 ? 49  LYS B CB    1 
ATOM   1385 C  CG    . LYS D 2 48 ? 5.891   -32.099 10.344  1.00 19.45 ? 49  LYS B CG    1 
ATOM   1386 C  CD    . LYS D 2 48 ? 7.360   -31.789 10.020  1.00 26.29 ? 49  LYS B CD    1 
ATOM   1387 C  CE    . LYS D 2 48 ? 8.174   -31.315 11.237  1.00 24.92 ? 49  LYS B CE    1 
ATOM   1388 N  NZ    . LYS D 2 48 ? 8.531   -32.437 12.161  1.00 20.10 ? 49  LYS B NZ    1 
ATOM   1389 N  N     . SER D 2 49 ? 2.304   -33.948 7.433   1.00 25.66 ? 50  SER B N     1 
ATOM   1390 C  CA    . SER D 2 49 ? 1.717   -34.193 6.112   1.00 25.24 ? 50  SER B CA    1 
ATOM   1391 C  C     . SER D 2 49 ? 0.966   -33.009 5.508   1.00 24.57 ? 50  SER B C     1 
ATOM   1392 O  O     . SER D 2 49 ? 1.160   -32.688 4.345   1.00 27.27 ? 50  SER B O     1 
ATOM   1393 C  CB    . SER D 2 49 ? 0.793   -35.419 6.147   1.00 23.68 ? 50  SER B CB    1 
ATOM   1394 O  OG    . SER D 2 49 ? -0.400  -35.175 6.879   1.00 23.47 ? 50  SER B OG    1 
ATOM   1395 N  N     . GLU D 2 50 ? 0.116   -32.352 6.288   1.00 29.25 ? 51  GLU B N     1 
ATOM   1396 C  CA    . GLU D 2 50 ? -0.632  -31.218 5.769   1.00 28.58 ? 51  GLU B CA    1 
ATOM   1397 C  C     . GLU D 2 50 ? 0.274   -30.109 5.234   1.00 31.63 ? 51  GLU B C     1 
ATOM   1398 O  O     . GLU D 2 50 ? 0.032   -29.561 4.164   1.00 29.20 ? 51  GLU B O     1 
ATOM   1399 C  CB    . GLU D 2 50 ? -1.548  -30.621 6.834   1.00 25.89 ? 51  GLU B CB    1 
ATOM   1400 C  CG    . GLU D 2 50 ? -2.303  -29.420 6.321   1.00 27.33 ? 51  GLU B CG    1 
ATOM   1401 C  CD    . GLU D 2 50 ? -3.014  -28.634 7.402   1.00 31.40 ? 51  GLU B CD    1 
ATOM   1402 O  OE1   . GLU D 2 50 ? -3.165  -29.149 8.531   1.00 31.12 ? 51  GLU B OE1   1 
ATOM   1403 O  OE2   . GLU D 2 50 ? -3.435  -27.493 7.111   1.00 23.87 ? 51  GLU B OE2   1 
ATOM   1404 N  N     . TRP D 2 51 ? 1.317   -29.775 5.983   1.00 30.88 ? 52  TRP B N     1 
ATOM   1405 C  CA    . TRP D 2 51 ? 2.224   -28.708 5.574   1.00 27.17 ? 52  TRP B CA    1 
ATOM   1406 C  C     . TRP D 2 51 ? 3.167   -29.134 4.457   1.00 24.30 ? 52  TRP B C     1 
ATOM   1407 O  O     . TRP D 2 51 ? 3.554   -28.332 3.608   1.00 22.95 ? 52  TRP B O     1 
ATOM   1408 C  CB    . TRP D 2 51 ? 2.998   -28.224 6.805   1.00 25.70 ? 52  TRP B CB    1 
ATOM   1409 C  CG    . TRP D 2 51 ? 2.037   -27.948 7.917   1.00 26.01 ? 52  TRP B CG    1 
ATOM   1410 C  CD1   . TRP D 2 51 ? 1.837   -28.711 9.043   1.00 22.66 ? 52  TRP B CD1   1 
ATOM   1411 C  CD2   . TRP D 2 51 ? 1.034   -26.931 7.941   1.00 24.95 ? 52  TRP B CD2   1 
ATOM   1412 N  NE1   . TRP D 2 51 ? 0.769   -28.234 9.748   1.00 25.16 ? 52  TRP B NE1   1 
ATOM   1413 C  CE2   . TRP D 2 51 ? 0.253   -27.143 9.102   1.00 26.16 ? 52  TRP B CE2   1 
ATOM   1414 C  CE3   . TRP D 2 51 ? 0.708   -25.865 7.092   1.00 26.11 ? 52  TRP B CE3   1 
ATOM   1415 C  CZ2   . TRP D 2 51 ? -0.836  -26.327 9.434   1.00 24.53 ? 52  TRP B CZ2   1 
ATOM   1416 C  CZ3   . TRP D 2 51 ? -0.382  -25.053 7.422   1.00 24.66 ? 52  TRP B CZ3   1 
ATOM   1417 C  CH2   . TRP D 2 51 ? -1.138  -25.293 8.582   1.00 24.74 ? 52  TRP B CH2   1 
ATOM   1418 N  N     . GLU D 2 52 ? 3.542   -30.404 4.464   1.00 25.64 ? 53  GLU B N     1 
ATOM   1419 C  CA    . GLU D 2 52 ? 4.419   -30.931 3.439   1.00 23.76 ? 53  GLU B CA    1 
ATOM   1420 C  C     . GLU D 2 52 ? 3.631   -30.982 2.117   1.00 20.59 ? 53  GLU B C     1 
ATOM   1421 O  O     . GLU D 2 52 ? 4.188   -30.749 1.045   1.00 21.47 ? 53  GLU B O     1 
ATOM   1422 C  CB    . GLU D 2 52 ? 4.916   -32.323 3.857   1.00 27.09 ? 53  GLU B CB    1 
ATOM   1423 C  CG    . GLU D 2 52 ? 5.908   -32.274 5.037   1.00 30.81 ? 53  GLU B CG    1 
ATOM   1424 C  CD    . GLU D 2 52 ? 6.167   -33.631 5.708   1.00 35.49 ? 53  GLU B CD    1 
ATOM   1425 O  OE1   . GLU D 2 52 ? 7.284   -33.825 6.252   1.00 37.74 ? 53  GLU B OE1   1 
ATOM   1426 O  OE2   . GLU D 2 52 ? 5.260   -34.491 5.724   1.00 28.45 ? 53  GLU B OE2   1 
ATOM   1427 N  N     . ALA D 2 53 ? 2.332   -31.251 2.214   1.00 19.79 ? 54  ALA B N     1 
ATOM   1428 C  CA    . ALA D 2 53 ? 1.460   -31.339 1.036   1.00 22.59 ? 54  ALA B CA    1 
ATOM   1429 C  C     . ALA D 2 53 ? 1.348   -29.943 0.452   1.00 22.54 ? 54  ALA B C     1 
ATOM   1430 O  O     . ALA D 2 53 ? 1.522   -29.752 -0.738  1.00 23.83 ? 54  ALA B O     1 
ATOM   1431 C  CB    . ALA D 2 53 ? 0.064   -31.892 1.417   1.00 19.72 ? 54  ALA B CB    1 
ATOM   1432 N  N     . LYS D 2 54 ? 1.107   -28.954 1.302   1.00 25.40 ? 55  LYS B N     1 
ATOM   1433 C  CA    . LYS D 2 54 ? 1.001   -27.589 0.813   1.00 25.50 ? 55  LYS B CA    1 
ATOM   1434 C  C     . LYS D 2 54 ? 2.302   -27.044 0.246   1.00 24.62 ? 55  LYS B C     1 
ATOM   1435 O  O     . LYS D 2 54 ? 2.294   -26.417 -0.796  1.00 27.89 ? 55  LYS B O     1 
ATOM   1436 C  CB    . LYS D 2 54 ? 0.501   -26.685 1.913   1.00 24.75 ? 55  LYS B CB    1 
ATOM   1437 C  CG    . LYS D 2 54 ? -0.933  -26.894 2.217   1.00 28.28 ? 55  LYS B CG    1 
ATOM   1438 C  CD    . LYS D 2 54 ? -1.243  -26.237 3.536   1.00 25.31 ? 55  LYS B CD    1 
ATOM   1439 C  CE    . LYS D 2 54 ? -2.729  -26.174 3.743   1.00 25.42 ? 55  LYS B CE    1 
ATOM   1440 N  NZ    . LYS D 2 54 ? -2.966  -25.364 4.959   1.00 23.82 ? 55  LYS B NZ    1 
ATOM   1441 N  N     . ALA D 2 55 ? 3.419   -27.284 0.927   1.00 25.89 ? 56  ALA B N     1 
ATOM   1442 C  CA    . ALA D 2 55 ? 4.711   -26.807 0.448   1.00 25.90 ? 56  ALA B CA    1 
ATOM   1443 C  C     . ALA D 2 55 ? 4.995   -27.443 -0.919  1.00 26.96 ? 56  ALA B C     1 
ATOM   1444 O  O     . ALA D 2 55 ? 5.654   -26.833 -1.772  1.00 24.37 ? 56  ALA B O     1 
ATOM   1445 C  CB    . ALA D 2 55 ? 5.837   -27.172 1.458   1.00 23.65 ? 56  ALA B CB    1 
ATOM   1446 N  N     . ALA D 2 56 ? 4.490   -28.666 -1.117  1.00 30.01 ? 57  ALA B N     1 
ATOM   1447 C  CA    . ALA D 2 56 ? 4.667   -29.394 -2.386  1.00 29.98 ? 57  ALA B CA    1 
ATOM   1448 C  C     . ALA D 2 56 ? 3.993   -28.647 -3.533  1.00 26.93 ? 57  ALA B C     1 
ATOM   1449 O  O     . ALA D 2 56 ? 4.593   -28.443 -4.587  1.00 27.77 ? 57  ALA B O     1 
ATOM   1450 C  CB    . ALA D 2 56 ? 4.085   -30.815 -2.271  1.00 30.59 ? 57  ALA B CB    1 
ATOM   1451 N  N     . LYS D 2 57 ? 2.749   -28.230 -3.334  1.00 29.16 ? 58  LYS B N     1 
ATOM   1452 C  CA    . LYS D 2 57 ? 2.036   -27.480 -4.374  1.00 30.80 ? 58  LYS B CA    1 
ATOM   1453 C  C     . LYS D 2 57 ? 2.687   -26.102 -4.545  1.00 29.99 ? 58  LYS B C     1 
ATOM   1454 O  O     . LYS D 2 57 ? 2.877   -25.629 -5.664  1.00 30.09 ? 58  LYS B O     1 
ATOM   1455 C  CB    . LYS D 2 57 ? 0.555   -27.325 -4.005  1.00 32.64 ? 58  LYS B CB    1 
ATOM   1456 C  CG    . LYS D 2 57 ? -0.179  -28.657 -3.858  1.00 41.85 ? 58  LYS B CG    1 
ATOM   1457 C  CD    . LYS D 2 57 ? -1.630  -28.453 -3.408  1.00 46.31 ? 58  LYS B CD    1 
ATOM   1458 C  CE    . LYS D 2 57 ? -2.405  -29.767 -3.264  1.00 47.47 ? 58  LYS B CE    1 
ATOM   1459 N  NZ    . LYS D 2 57 ? -1.940  -30.657 -2.143  1.00 49.11 ? 58  LYS B NZ    1 
ATOM   1460 N  N     . ALA D 2 58 ? 3.024   -25.452 -3.432  1.00 27.98 ? 59  ALA B N     1 
ATOM   1461 C  CA    . ALA D 2 58 ? 3.668   -24.147 -3.499  1.00 28.68 ? 59  ALA B CA    1 
ATOM   1462 C  C     . ALA D 2 58 ? 4.940   -24.280 -4.313  1.00 27.19 ? 59  ALA B C     1 
ATOM   1463 O  O     . ALA D 2 58 ? 5.358   -23.331 -4.969  1.00 29.51 ? 59  ALA B O     1 
ATOM   1464 C  CB    . ALA D 2 58 ? 4.013   -23.633 -2.101  1.00 27.53 ? 59  ALA B CB    1 
ATOM   1465 N  N     . LYS D 2 59 ? 5.556   -25.456 -4.266  1.00 25.51 ? 60  LYS B N     1 
ATOM   1466 C  CA    . LYS D 2 59 ? 6.788   -25.685 -5.023  1.00 26.49 ? 60  LYS B CA    1 
ATOM   1467 C  C     . LYS D 2 59 ? 6.427   -25.719 -6.503  1.00 26.28 ? 60  LYS B C     1 
ATOM   1468 O  O     . LYS D 2 59 ? 7.062   -25.069 -7.335  1.00 26.04 ? 60  LYS B O     1 
ATOM   1469 C  CB    . LYS D 2 59 ? 7.437   -27.008 -4.626  1.00 25.62 ? 60  LYS B CB    1 
ATOM   1470 C  CG    . LYS D 2 59 ? 8.935   -26.959 -4.776  1.00 31.22 ? 60  LYS B CG    1 
ATOM   1471 C  CD    . LYS D 2 59 ? 9.488   -28.141 -5.527  1.00 34.37 ? 60  LYS B CD    1 
ATOM   1472 C  CE    . LYS D 2 59 ? 10.939  -27.885 -5.903  1.00 36.46 ? 60  LYS B CE    1 
ATOM   1473 N  NZ    . LYS D 2 59 ? 11.068  -26.555 -6.597  1.00 35.97 ? 60  LYS B NZ    1 
ATOM   1474 N  N     . ASP D 2 60 ? 5.393   -26.484 -6.822  1.00 27.82 ? 61  ASP B N     1 
ATOM   1475 C  CA    . ASP D 2 60 ? 4.924   -26.565 -8.183  1.00 30.00 ? 61  ASP B CA    1 
ATOM   1476 C  C     . ASP D 2 60 ? 4.608   -25.166 -8.710  1.00 31.08 ? 61  ASP B C     1 
ATOM   1477 O  O     . ASP D 2 60 ? 5.033   -24.809 -9.817  1.00 32.97 ? 61  ASP B O     1 
ATOM   1478 C  CB    . ASP D 2 60 ? 3.669   -27.436 -8.275  1.00 32.70 ? 61  ASP B CB    1 
ATOM   1479 C  CG    . ASP D 2 60 ? 3.912   -28.876 -7.823  1.00 36.23 ? 61  ASP B CG    1 
ATOM   1480 O  OD1   . ASP D 2 60 ? 5.082   -29.338 -7.816  1.00 34.73 ? 61  ASP B OD1   1 
ATOM   1481 O  OD2   . ASP D 2 60 ? 2.916   -29.555 -7.487  1.00 37.50 ? 61  ASP B OD2   1 
ATOM   1482 N  N     . ASP D 2 61 ? 3.869   -24.375 -7.930  1.00 30.62 ? 62  ASP B N     1 
ATOM   1483 C  CA    . ASP D 2 61 ? 3.508   -23.016 -8.355  1.00 32.17 ? 62  ASP B CA    1 
ATOM   1484 C  C     . ASP D 2 61 ? 4.783   -22.222 -8.635  1.00 31.95 ? 62  ASP B C     1 
ATOM   1485 O  O     . ASP D 2 61 ? 4.889   -21.548 -9.660  1.00 29.62 ? 62  ASP B O     1 
ATOM   1486 C  CB    . ASP D 2 61 ? 2.691   -22.279 -7.281  1.00 38.35 ? 62  ASP B CB    1 
ATOM   1487 C  CG    . ASP D 2 61 ? 1.438   -23.040 -6.856  1.00 44.10 ? 62  ASP B CG    1 
ATOM   1488 O  OD1   . ASP D 2 61 ? 0.740   -23.598 -7.731  1.00 44.85 ? 62  ASP B OD1   1 
ATOM   1489 O  OD2   . ASP D 2 61 ? 1.138   -23.066 -5.639  1.00 48.30 ? 62  ASP B OD2   1 
ATOM   1490 N  N     . TYR D 2 62 ? 5.744   -22.308 -7.716  1.00 27.06 ? 63  TYR B N     1 
ATOM   1491 C  CA    . TYR D 2 62 ? 7.020   -21.612 -7.866  1.00 26.08 ? 63  TYR B CA    1 
ATOM   1492 C  C     . TYR D 2 62 ? 7.688   -22.061 -9.170  1.00 26.56 ? 63  TYR B C     1 
ATOM   1493 O  O     . TYR D 2 62 ? 8.171   -21.247 -9.940  1.00 25.33 ? 63  TYR B O     1 
ATOM   1494 C  CB    . TYR D 2 62 ? 7.941   -21.934 -6.683  1.00 25.69 ? 63  TYR B CB    1 
ATOM   1495 C  CG    . TYR D 2 62 ? 9.351   -21.449 -6.867  1.00 23.98 ? 63  TYR B CG    1 
ATOM   1496 C  CD1   . TYR D 2 62 ? 9.645   -20.082 -6.836  1.00 21.20 ? 63  TYR B CD1   1 
ATOM   1497 C  CD2   . TYR D 2 62 ? 10.390  -22.348 -7.111  1.00 24.73 ? 63  TYR B CD2   1 
ATOM   1498 C  CE1   . TYR D 2 62 ? 10.935  -19.624 -7.050  1.00 18.80 ? 63  TYR B CE1   1 
ATOM   1499 C  CE2   . TYR D 2 62 ? 11.693  -21.898 -7.325  1.00 23.53 ? 63  TYR B CE2   1 
ATOM   1500 C  CZ    . TYR D 2 62 ? 11.954  -20.536 -7.291  1.00 20.12 ? 63  TYR B CZ    1 
ATOM   1501 O  OH    . TYR D 2 62 ? 13.235  -20.072 -7.500  1.00 22.78 ? 63  TYR B OH    1 
ATOM   1502 N  N     . ASP D 2 63 ? 7.715   -23.367 -9.411  1.00 30.57 ? 64  ASP B N     1 
ATOM   1503 C  CA    . ASP D 2 63 ? 8.308   -23.881 -10.633 1.00 30.84 ? 64  ASP B CA    1 
ATOM   1504 C  C     . ASP D 2 63 ? 7.651   -23.275 -11.871 1.00 33.61 ? 64  ASP B C     1 
ATOM   1505 O  O     . ASP D 2 63 ? 8.349   -22.908 -12.826 1.00 32.84 ? 64  ASP B O     1 
ATOM   1506 C  CB    . ASP D 2 63 ? 8.216   -25.404 -10.663 1.00 30.91 ? 64  ASP B CB    1 
ATOM   1507 C  CG    . ASP D 2 63 ? 9.282   -26.063 -9.783  1.00 38.06 ? 64  ASP B CG    1 
ATOM   1508 O  OD1   . ASP D 2 63 ? 10.266  -25.362 -9.431  1.00 31.33 ? 64  ASP B OD1   1 
ATOM   1509 O  OD2   . ASP D 2 63 ? 9.146   -27.271 -9.453  1.00 35.02 ? 64  ASP B OD2   1 
ATOM   1510 N  N     . ARG D 2 64 ? 6.320   -23.162 -11.866 1.00 30.29 ? 65  ARG B N     1 
ATOM   1511 C  CA    . ARG D 2 64 ? 5.627   -22.565 -13.009 1.00 31.63 ? 65  ARG B CA    1 
ATOM   1512 C  C     . ARG D 2 64 ? 5.964   -21.078 -13.149 1.00 30.29 ? 65  ARG B C     1 
ATOM   1513 O  O     . ARG D 2 64 ? 6.064   -20.560 -14.269 1.00 33.10 ? 65  ARG B O     1 
ATOM   1514 C  CB    . ARG D 2 64 ? 4.100   -22.737 -12.900 1.00 30.60 ? 65  ARG B CB    1 
ATOM   1515 C  CG    . ARG D 2 64 ? 3.584   -24.132 -13.263 1.00 30.98 ? 65  ARG B CG    1 
ATOM   1516 C  CD    . ARG D 2 64 ? 2.037   -24.194 -13.245 1.00 34.71 ? 65  ARG B CD    1 
ATOM   1517 N  NE    . ARG D 2 64 ? 1.467   -24.243 -11.897 1.00 37.03 ? 65  ARG B NE    1 
ATOM   1518 C  CZ    . ARG D 2 64 ? 1.399   -25.348 -11.150 1.00 40.70 ? 65  ARG B CZ    1 
ATOM   1519 N  NH1   . ARG D 2 64 ? 1.860   -26.506 -11.614 1.00 41.31 ? 65  ARG B NH1   1 
ATOM   1520 N  NH2   . ARG D 2 64 ? 0.874   -25.299 -9.934  1.00 38.49 ? 65  ARG B NH2   1 
ATOM   1521 N  N     . ALA D 2 65 ? 6.146   -20.385 -12.026 1.00 28.57 ? 66  ALA B N     1 
ATOM   1522 C  CA    . ALA D 2 65 ? 6.468   -18.960 -12.092 1.00 28.68 ? 66  ALA B CA    1 
ATOM   1523 C  C     . ALA D 2 65 ? 7.889   -18.803 -12.608 1.00 30.51 ? 66  ALA B C     1 
ATOM   1524 O  O     . ALA D 2 65 ? 8.218   -17.805 -13.236 1.00 29.31 ? 66  ALA B O     1 
ATOM   1525 C  CB    . ALA D 2 65 ? 6.329   -18.305 -10.732 1.00 27.39 ? 66  ALA B CB    1 
ATOM   1526 N  N     . VAL D 2 66 ? 8.718   -19.807 -12.338 1.00 31.74 ? 67  VAL B N     1 
ATOM   1527 C  CA    . VAL D 2 66 ? 10.100  -19.829 -12.783 1.00 32.63 ? 67  VAL B CA    1 
ATOM   1528 C  C     . VAL D 2 66 ? 10.102  -20.038 -14.288 1.00 34.30 ? 67  VAL B C     1 
ATOM   1529 O  O     . VAL D 2 66 ? 10.831  -19.361 -15.027 1.00 33.83 ? 67  VAL B O     1 
ATOM   1530 C  CB    . VAL D 2 66 ? 10.874  -20.978 -12.129 1.00 29.49 ? 67  VAL B CB    1 
ATOM   1531 C  CG1   . VAL D 2 66 ? 12.230  -21.114 -12.764 1.00 30.96 ? 67  VAL B CG1   1 
ATOM   1532 C  CG2   . VAL D 2 66 ? 11.028  -20.709 -10.652 1.00 29.48 ? 67  VAL B CG2   1 
ATOM   1533 N  N     . LYS D 2 67 ? 9.265   -20.970 -14.737 1.00 37.13 ? 68  LYS B N     1 
ATOM   1534 C  CA    . LYS D 2 67 ? 9.146   -21.288 -16.160 1.00 35.91 ? 68  LYS B CA    1 
ATOM   1535 C  C     . LYS D 2 67 ? 8.765   -20.039 -16.952 1.00 35.30 ? 68  LYS B C     1 
ATOM   1536 O  O     . LYS D 2 67 ? 9.382   -19.725 -17.974 1.00 32.93 ? 68  LYS B O     1 
ATOM   1537 C  CB    . LYS D 2 67 ? 8.092   -22.380 -16.364 1.00 38.12 ? 68  LYS B CB    1 
ATOM   1538 C  CG    . LYS D 2 67 ? 7.931   -22.822 -17.810 1.00 41.15 ? 68  LYS B CG    1 
ATOM   1539 C  CD    . LYS D 2 67 ? 7.093   -24.089 -17.934 1.00 45.27 ? 68  LYS B CD    1 
ATOM   1540 C  CE    . LYS D 2 67 ? 5.594   -23.833 -17.801 1.00 48.63 ? 68  LYS B CE    1 
ATOM   1541 N  NZ    . LYS D 2 67 ? 5.136   -23.383 -16.445 1.00 54.65 ? 68  LYS B NZ    1 
ATOM   1542 N  N     . GLU D 2 68 ? 7.753   -19.330 -16.453 1.00 35.22 ? 69  GLU B N     1 
ATOM   1543 C  CA    . GLU D 2 68 ? 7.236   -18.106 -17.062 1.00 34.92 ? 69  GLU B CA    1 
ATOM   1544 C  C     . GLU D 2 68 ? 8.215   -16.938 -17.013 1.00 40.46 ? 69  GLU B C     1 
ATOM   1545 O  O     . GLU D 2 68 ? 8.193   -16.059 -17.882 1.00 40.80 ? 69  GLU B O     1 
ATOM   1546 C  CB    . GLU D 2 68 ? 5.943   -17.693 -16.361 1.00 33.34 ? 69  GLU B CB    1 
ATOM   1547 C  CG    . GLU D 2 68 ? 5.313   -16.374 -16.824 1.00 30.38 ? 69  GLU B CG    1 
ATOM   1548 C  CD    . GLU D 2 68 ? 4.790   -16.406 -18.268 1.00 33.25 ? 69  GLU B CD    1 
ATOM   1549 O  OE1   . GLU D 2 68 ? 4.319   -17.468 -18.724 1.00 32.12 ? 69  GLU B OE1   1 
ATOM   1550 O  OE2   . GLU D 2 68 ? 4.836   -15.354 -18.946 1.00 35.16 ? 69  GLU B OE2   1 
ATOM   1551 N  N     . PHE D 2 69 ? 9.067   -16.912 -15.992 1.00 42.69 ? 70  PHE B N     1 
ATOM   1552 C  CA    . PHE D 2 69 ? 10.026  -15.829 -15.856 1.00 43.03 ? 70  PHE B CA    1 
ATOM   1553 C  C     . PHE D 2 69 ? 11.216  -15.985 -16.808 1.00 46.14 ? 70  PHE B C     1 
ATOM   1554 O  O     . PHE D 2 69 ? 11.758  -14.999 -17.323 1.00 44.69 ? 70  PHE B O     1 
ATOM   1555 C  CB    . PHE D 2 69 ? 10.546  -15.777 -14.429 1.00 43.07 ? 70  PHE B CB    1 
ATOM   1556 C  CG    . PHE D 2 69 ? 11.651  -14.788 -14.236 1.00 45.12 ? 70  PHE B CG    1 
ATOM   1557 C  CD1   . PHE D 2 69 ? 11.385  -13.417 -14.217 1.00 46.24 ? 70  PHE B CD1   1 
ATOM   1558 C  CD2   . PHE D 2 69 ? 12.966  -15.219 -14.104 1.00 45.34 ? 70  PHE B CD2   1 
ATOM   1559 C  CE1   . PHE D 2 69 ? 12.420  -12.483 -14.072 1.00 43.50 ? 70  PHE B CE1   1 
ATOM   1560 C  CE2   . PHE D 2 69 ? 14.005  -14.301 -13.959 1.00 47.34 ? 70  PHE B CE2   1 
ATOM   1561 C  CZ    . PHE D 2 69 ? 13.730  -12.926 -13.944 1.00 45.62 ? 70  PHE B CZ    1 
ATOM   1562 N  N     . GLU D 2 70 ? 11.609  -17.229 -17.041 1.00 47.47 ? 71  GLU B N     1 
ATOM   1563 C  CA    . GLU D 2 70 ? 12.752  -17.521 -17.885 1.00 54.44 ? 71  GLU B CA    1 
ATOM   1564 C  C     . GLU D 2 70 ? 12.507  -17.394 -19.374 1.00 58.41 ? 71  GLU B C     1 
ATOM   1565 O  O     . GLU D 2 70 ? 13.345  -16.859 -20.101 1.00 59.41 ? 71  GLU B O     1 
ATOM   1566 C  CB    . GLU D 2 70 ? 13.274  -18.910 -17.551 1.00 54.73 ? 71  GLU B CB    1 
ATOM   1567 C  CG    . GLU D 2 70 ? 13.536  -19.039 -16.071 1.00 57.86 ? 71  GLU B CG    1 
ATOM   1568 C  CD    . GLU D 2 70 ? 14.531  -20.112 -15.748 1.00 57.49 ? 71  GLU B CD    1 
ATOM   1569 O  OE1   . GLU D 2 70 ? 14.244  -21.290 -16.038 1.00 57.25 ? 71  GLU B OE1   1 
ATOM   1570 O  OE2   . GLU D 2 70 ? 15.603  -19.767 -15.207 1.00 60.37 ? 71  GLU B OE2   1 
ATOM   1571 N  N     . ALA D 2 71 ? 11.371  -17.889 -19.839 1.00 62.02 ? 72  ALA B N     1 
ATOM   1572 C  CA    . ALA D 2 71 ? 11.060  -17.782 -21.252 1.00 66.48 ? 72  ALA B CA    1 
ATOM   1573 C  C     . ALA D 2 71 ? 9.944   -16.761 -21.362 1.00 69.59 ? 72  ALA B C     1 
ATOM   1574 O  O     . ALA D 2 71 ? 8.770   -17.096 -21.226 1.00 71.09 ? 72  ALA B O     1 
ATOM   1575 C  CB    . ALA D 2 71 ? 10.619  -19.140 -21.810 1.00 67.54 ? 72  ALA B CB    1 
ATOM   1576 N  N     . ASN D 2 72 ? 10.341  -15.511 -21.582 1.00 72.38 ? 73  ASN B N     1 
ATOM   1577 C  CA    . ASN D 2 72 ? 9.451   -14.359 -21.715 1.00 74.74 ? 73  ASN B CA    1 
ATOM   1578 C  C     . ASN D 2 72 ? 8.827   -13.919 -20.386 1.00 74.97 ? 73  ASN B C     1 
ATOM   1579 O  O     . ASN D 2 72 ? 7.696   -13.370 -20.384 1.00 73.48 ? 73  ASN B O     1 
ATOM   1580 C  CB    . ASN D 2 72 ? 8.381   -14.613 -22.808 1.00 78.00 ? 73  ASN B CB    1 
ATOM   1581 C  CG    . ASN D 2 72 ? 7.032   -15.119 -22.264 1.00 80.63 ? 73  ASN B CG    1 
ATOM   1582 O  OD1   . ASN D 2 72 ? 6.026   -15.085 -22.982 1.00 81.61 ? 73  ASN B OD1   1 
ATOM   1583 N  ND2   . ASN D 2 72 ? 7.006   -15.595 -21.021 1.00 80.90 ? 73  ASN B ND2   1 
HETATM 1584 NA NA    . NA  E 3 .  ? -7.230  5.129   7.239   1.00 21.25 ? 501 NA  C NA    1 
HETATM 1585 O  O     . HOH F 4 .  ? -3.562  7.455   -0.295  1.00 18.59 ? 502 HOH C O     1 
HETATM 1586 O  O     . HOH F 4 .  ? -11.670 -0.222  -5.935  1.00 17.44 ? 503 HOH C O     1 
HETATM 1587 O  O     . HOH F 4 .  ? -1.949  -2.634  16.401  1.00 33.36 ? 504 HOH C O     1 
HETATM 1588 O  O     . HOH F 4 .  ? 6.113   -9.514  11.331  1.00 33.99 ? 505 HOH C O     1 
HETATM 1589 O  O     . HOH F 4 .  ? -9.503  -1.406  -0.866  1.00 41.03 ? 506 HOH C O     1 
HETATM 1590 O  O     . HOH F 4 .  ? -4.334  2.775   -21.819 1.00 33.48 ? 507 HOH C O     1 
HETATM 1591 O  O     . HOH F 4 .  ? 2.671   -8.480  3.201   1.00 41.38 ? 508 HOH C O     1 
HETATM 1592 O  O     . HOH F 4 .  ? -3.425  -16.987 3.671   1.00 49.28 ? 509 HOH C O     1 
HETATM 1593 O  O     . HOH F 4 .  ? -7.972  -0.657  -17.960 1.00 25.92 ? 510 HOH C O     1 
HETATM 1594 O  O     . HOH F 4 .  ? -2.910  0.915   14.301  0.96 22.36 ? 511 HOH C O     1 
HETATM 1595 O  O     . HOH F 4 .  ? -0.938  -14.245 12.772  1.00 34.22 ? 512 HOH C O     1 
HETATM 1596 O  O     . HOH F 4 .  ? -9.376  3.020   -4.377  1.00 38.30 ? 513 HOH C O     1 
HETATM 1597 O  O     . HOH F 4 .  ? -2.027  -6.991  9.664   1.00 41.26 ? 514 HOH C O     1 
HETATM 1598 O  O     . HOH F 4 .  ? -2.525  -3.806  9.405   1.00 32.48 ? 515 HOH C O     1 
HETATM 1599 O  O     . HOH F 4 .  ? -4.781  -13.369 2.345   1.00 44.75 ? 516 HOH C O     1 
HETATM 1600 O  O     . HOH F 4 .  ? -6.431  9.976   2.212   0.99 38.98 ? 517 HOH C O     1 
HETATM 1601 O  O     . HOH F 4 .  ? -4.785  0.866   -15.519 0.86 39.36 ? 518 HOH C O     1 
HETATM 1602 O  O     . HOH F 4 .  ? -2.616  2.675   -4.902  1.00 45.68 ? 519 HOH C O     1 
HETATM 1603 O  O     . HOH G 4 .  ? 6.815   -0.387  6.852   0.93 20.55 ? 21  HOH D O     1 
HETATM 1604 O  O     . HOH G 4 .  ? 11.206  -6.989  8.870   0.82 26.75 ? 22  HOH D O     1 
HETATM 1605 O  O     . HOH G 4 .  ? -6.208  -10.828 2.817   1.00 42.79 ? 23  HOH D O     1 
HETATM 1606 O  O     . HOH G 4 .  ? 9.517   -3.000  -5.324  1.00 51.78 ? 24  HOH D O     1 
HETATM 1607 O  O     . HOH G 4 .  ? 0.394   -6.747  0.160   1.00 31.39 ? 25  HOH D O     1 
HETATM 1608 O  O     . HOH G 4 .  ? 16.588  -8.949  12.494  1.00 45.84 ? 26  HOH D O     1 
HETATM 1609 O  O     . HOH G 4 .  ? 0.644   -10.779 -9.499  0.83 41.57 ? 27  HOH D O     1 
HETATM 1610 O  O     . HOH G 4 .  ? 0.295   2.225   -3.862  1.00 26.80 ? 28  HOH D O     1 
HETATM 1611 O  O     . HOH H 4 .  ? 0.089   17.633  1.592   1.00 15.57 ? 75  HOH A O     1 
HETATM 1612 O  O     . HOH H 4 .  ? 7.500   9.065   15.166  1.00 34.46 ? 76  HOH A O     1 
HETATM 1613 O  O     . HOH H 4 .  ? -0.269  7.675   -8.112  1.00 16.64 ? 77  HOH A O     1 
HETATM 1614 O  O     . HOH H 4 .  ? 8.043   9.520   -1.910  1.00 29.33 ? 78  HOH A O     1 
HETATM 1615 O  O     . HOH H 4 .  ? 8.275   13.758  -2.553  0.95 27.74 ? 79  HOH A O     1 
HETATM 1616 O  O     . HOH H 4 .  ? 8.270   13.433  4.160   1.00 31.62 ? 80  HOH A O     1 
HETATM 1617 O  O     . HOH H 4 .  ? -3.484  8.883   -3.660  1.00 31.46 ? 81  HOH A O     1 
HETATM 1618 O  O     . HOH H 4 .  ? 12.512  3.248   19.581  1.00 27.85 ? 82  HOH A O     1 
HETATM 1619 O  O     . HOH H 4 .  ? -6.430  16.793  3.140   1.00 27.06 ? 83  HOH A O     1 
HETATM 1620 O  O     . HOH H 4 .  ? -3.969  9.565   14.065  1.00 25.59 ? 84  HOH A O     1 
HETATM 1621 O  O     . HOH H 4 .  ? -2.270  3.997   -0.084  1.00 19.03 ? 85  HOH A O     1 
HETATM 1622 O  O     . HOH H 4 .  ? 4.706   16.713  -0.262  1.00 22.26 ? 86  HOH A O     1 
HETATM 1623 O  O     . HOH H 4 .  ? 17.065  6.100   9.026   1.00 27.93 ? 87  HOH A O     1 
HETATM 1624 O  O     . HOH H 4 .  ? -4.049  18.145  -4.391  1.00 27.93 ? 88  HOH A O     1 
HETATM 1625 O  O     . HOH H 4 .  ? -3.393  15.206  -13.749 0.93 27.49 ? 89  HOH A O     1 
HETATM 1626 O  O     . HOH H 4 .  ? 15.776  3.159   13.769  1.00 30.59 ? 90  HOH A O     1 
HETATM 1627 O  O     . HOH H 4 .  ? -6.111  13.451  8.117   1.00 35.99 ? 91  HOH A O     1 
HETATM 1628 O  O     . HOH H 4 .  ? 8.255   6.941   -3.285  0.87 35.23 ? 92  HOH A O     1 
HETATM 1629 O  O     . HOH H 4 .  ? 2.456   19.046  2.349   1.00 20.91 ? 93  HOH A O     1 
HETATM 1630 O  O     . HOH H 4 .  ? -2.962  3.201   -17.569 1.00 37.31 ? 94  HOH A O     1 
HETATM 1631 O  O     . HOH H 4 .  ? 3.985   15.641  5.143   1.00 30.61 ? 95  HOH A O     1 
HETATM 1632 O  O     . HOH H 4 .  ? 0.732   13.710  10.618  1.00 24.78 ? 96  HOH A O     1 
HETATM 1633 O  O     . HOH H 4 .  ? 8.007   10.994  12.401  1.00 38.14 ? 97  HOH A O     1 
HETATM 1634 O  O     . HOH H 4 .  ? -3.021  6.111   -8.356  1.00 28.41 ? 98  HOH A O     1 
HETATM 1635 O  O     . HOH H 4 .  ? 5.798   8.546   -18.069 1.00 35.60 ? 99  HOH A O     1 
HETATM 1636 O  O     . HOH H 4 .  ? -4.418  6.930   15.420  0.97 33.44 ? 100 HOH A O     1 
HETATM 1637 O  O     . HOH H 4 .  ? 6.649   3.213   -21.208 0.97 26.98 ? 101 HOH A O     1 
HETATM 1638 O  O     . HOH H 4 .  ? -5.790  16.080  12.031  0.85 33.14 ? 102 HOH A O     1 
HETATM 1639 O  O     . HOH H 4 .  ? -6.849  20.524  5.079   1.00 42.77 ? 103 HOH A O     1 
HETATM 1640 O  O     . HOH H 4 .  ? -2.403  2.473   -24.024 1.00 38.69 ? 104 HOH A O     1 
HETATM 1641 O  O     . HOH H 4 .  ? -2.321  -0.003  -17.152 0.99 34.12 ? 105 HOH A O     1 
HETATM 1642 O  O     . HOH H 4 .  ? 11.621  0.421   7.828   0.90 20.46 ? 106 HOH A O     1 
HETATM 1643 O  O     . HOH H 4 .  ? -6.769  20.572  1.450   1.00 39.70 ? 107 HOH A O     1 
HETATM 1644 O  O     . HOH H 4 .  ? 3.402   -2.433  15.746  1.00 33.85 ? 108 HOH A O     1 
HETATM 1645 O  O     . HOH H 4 .  ? 12.752  7.905   3.701   0.98 28.28 ? 109 HOH A O     1 
HETATM 1646 O  O     . HOH H 4 .  ? 3.015   16.143  7.902   0.98 19.91 ? 110 HOH A O     1 
HETATM 1647 O  O     . HOH H 4 .  ? -1.454  10.923  -18.546 1.00 34.88 ? 111 HOH A O     1 
HETATM 1648 O  O     . HOH H 4 .  ? 4.518   2.092   15.691  1.00 35.41 ? 112 HOH A O     1 
HETATM 1649 O  O     . HOH H 4 .  ? -2.917  4.875   -20.166 1.00 29.13 ? 113 HOH A O     1 
HETATM 1650 O  O     . HOH H 4 .  ? 6.072   0.986   18.141  1.00 58.48 ? 114 HOH A O     1 
HETATM 1651 O  O     . HOH H 4 .  ? 6.310   14.365  6.162   1.00 43.93 ? 115 HOH A O     1 
HETATM 1652 O  O     . HOH H 4 .  ? 1.390   -1.381  -15.573 1.00 30.24 ? 116 HOH A O     1 
HETATM 1653 O  O     . HOH H 4 .  ? 3.086   13.903  -23.299 0.98 30.46 ? 117 HOH A O     1 
HETATM 1654 O  O     . HOH H 4 .  ? 17.734  4.683   11.539  1.00 36.05 ? 118 HOH A O     1 
HETATM 1655 O  O     . HOH H 4 .  ? -0.704  3.546   -27.196 0.89 31.05 ? 119 HOH A O     1 
HETATM 1656 O  O     . HOH H 4 .  ? 6.282   17.567  2.111   1.00 29.47 ? 120 HOH A O     1 
HETATM 1657 O  O     . HOH H 4 .  ? 3.132   4.096   17.429  1.00 35.20 ? 121 HOH A O     1 
HETATM 1658 O  O     . HOH H 4 .  ? -4.263  11.993  -5.983  1.00 45.74 ? 122 HOH A O     1 
HETATM 1659 O  O     . HOH H 4 .  ? 4.917   6.722   -11.473 1.00 39.81 ? 123 HOH A O     1 
HETATM 1660 O  O     . HOH H 4 .  ? 7.825   17.115  5.772   0.98 38.74 ? 124 HOH A O     1 
HETATM 1661 O  O     . HOH H 4 .  ? 5.353   3.288   -8.902  1.00 27.16 ? 125 HOH A O     1 
HETATM 1662 O  O     . HOH H 4 .  ? 5.089   6.254   -8.218  1.00 39.48 ? 126 HOH A O     1 
HETATM 1663 O  O     . HOH H 4 .  ? 12.132  -0.436  10.489  1.00 42.47 ? 127 HOH A O     1 
HETATM 1664 O  O     . HOH H 4 .  ? 0.762   1.232   -6.444  1.00 23.89 ? 128 HOH A O     1 
HETATM 1665 O  O     . HOH H 4 .  ? 12.010  10.378  6.057   1.00 30.27 ? 129 HOH A O     1 
HETATM 1666 O  O     . HOH H 4 .  ? -2.027  2.968   12.314  1.00 13.53 ? 130 HOH A O     1 
HETATM 1667 O  O     . HOH H 4 .  ? 3.189   -1.576  -27.850 1.00 38.06 ? 131 HOH A O     1 
HETATM 1668 O  O     . HOH H 4 .  ? 7.675   -0.116  -18.622 1.00 54.16 ? 132 HOH A O     1 
HETATM 1669 O  O     . HOH H 4 .  ? -1.862  1.492   -8.551  1.00 39.06 ? 133 HOH A O     1 
HETATM 1670 O  O     . HOH H 4 .  ? 4.996   12.346  -8.356  0.78 28.41 ? 134 HOH A O     1 
HETATM 1671 O  O     . HOH I 4 .  ? -1.861  -30.939 10.156  1.00 25.46 ? 75  HOH B O     1 
HETATM 1672 O  O     . HOH I 4 .  ? 1.804   -12.290 23.085  1.00 26.52 ? 76  HOH B O     1 
HETATM 1673 O  O     . HOH I 4 .  ? 0.558   -32.129 9.121   1.00 33.20 ? 77  HOH B O     1 
HETATM 1674 O  O     . HOH I 4 .  ? 3.996   -22.412 23.596  1.00 39.25 ? 78  HOH B O     1 
HETATM 1675 O  O     . HOH I 4 .  ? 4.934   -19.883 -1.623  1.00 28.31 ? 79  HOH B O     1 
HETATM 1676 O  O     . HOH I 4 .  ? -3.611  -21.542 21.574  1.00 33.31 ? 80  HOH B O     1 
HETATM 1677 O  O     . HOH I 4 .  ? 11.279  -32.512 11.951  1.00 40.65 ? 81  HOH B O     1 
HETATM 1678 O  O     . HOH I 4 .  ? 0.104   -30.846 14.395  1.00 43.63 ? 82  HOH B O     1 
HETATM 1679 O  O     . HOH I 4 .  ? -4.060  -19.529 11.840  0.96 37.90 ? 83  HOH B O     1 
HETATM 1680 O  O     . HOH I 4 .  ? -1.574  -24.831 12.653  0.93 32.79 ? 84  HOH B O     1 
HETATM 1681 O  O     . HOH I 4 .  ? 4.088   -20.911 -4.319  1.00 46.43 ? 85  HOH B O     1 
HETATM 1682 O  O     . HOH I 4 .  ? 7.860   -25.024 -1.266  1.00 24.58 ? 86  HOH B O     1 
HETATM 1683 O  O     . HOH I 4 .  ? 5.024   -20.144 -18.785 1.00 40.72 ? 87  HOH B O     1 
HETATM 1684 O  O     . HOH I 4 .  ? 2.534   -25.363 23.601  1.00 46.28 ? 88  HOH B O     1 
HETATM 1685 O  O     . HOH I 4 .  ? 8.489   -29.154 -8.001  1.00 56.16 ? 89  HOH B O     1 
HETATM 1686 O  O     . HOH I 4 .  ? 2.739   -20.076 -10.309 0.84 21.27 ? 90  HOH B O     1 
HETATM 1687 O  O     . HOH I 4 .  ? -1.747  -37.239 12.508  1.00 34.39 ? 91  HOH B O     1 
HETATM 1688 O  O     . HOH I 4 .  ? 3.785   -20.948 -16.169 1.00 37.02 ? 92  HOH B O     1 
HETATM 1689 O  O     . HOH I 4 .  ? 0.670   -32.246 -2.396  0.98 29.77 ? 93  HOH B O     1 
HETATM 1690 O  O     . HOH I 4 .  ? 0.083   -21.115 6.165   0.97 26.64 ? 94  HOH B O     1 
HETATM 1691 O  O     . HOH I 4 .  ? 9.363   -26.461 -17.986 1.00 48.96 ? 95  HOH B O     1 
HETATM 1692 O  O     . HOH I 4 .  ? 3.824   -29.430 17.931  1.00 36.93 ? 96  HOH B O     1 
HETATM 1693 O  O     . HOH I 4 .  ? 15.872  -15.960 -19.502 0.65 31.14 ? 97  HOH B O     1 
HETATM 1694 O  O     . HOH I 4 .  ? 11.738  -22.442 0.344   1.00 35.72 ? 98  HOH B O     1 
HETATM 1695 O  O     . HOH I 4 .  ? 8.292   -13.817 -11.961 1.00 47.96 ? 99  HOH B O     1 
HETATM 1696 O  O     . HOH I 4 .  ? 3.104   -33.054 17.957  1.00 50.40 ? 100 HOH B O     1 
HETATM 1697 O  O     . HOH I 4 .  ? 4.324   -35.759 4.022   1.00 21.79 ? 101 HOH B O     1 
HETATM 1698 O  O     . HOH I 4 .  ? 5.314   -36.149 7.742   0.85 27.06 ? 102 HOH B O     1 
HETATM 1699 O  O     . HOH I 4 .  ? -1.308  -17.726 13.170  1.00 53.40 ? 103 HOH B O     1 
HETATM 1700 O  O     . HOH I 4 .  ? 6.097   -11.159 18.735  1.00 52.82 ? 104 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DG  1  1  1  DG  G   C . n 
A 1 2  DC  2  2  2  DC  C   C . n 
A 1 3  DG  3  3  3  DG  G   C . n 
A 1 4  DA  4  4  4  DA  A   C . n 
A 1 5  DT  5  5  5  DT  T   C . n 
A 1 6  DA  6  6  6  DA  A   C . n 
A 1 7  DT  7  7  7  DT  T   C . n 
A 1 8  DC  8  8  8  DC  C   C . n 
A 1 9  DG  9  9  9  DG  G   C . n 
A 1 10 DC  10 10 10 DC  C   C . n 
B 1 1  DG  1  11 11 DG  G   D . n 
B 1 2  DC  2  12 12 DC  C   D . n 
B 1 3  DG  3  13 13 DG  G   D . n 
B 1 4  DA  4  14 14 DA  A   D . n 
B 1 5  DT  5  15 15 DT  T   D . n 
B 1 6  DA  6  16 16 DA  A   D . n 
B 1 7  DT  7  17 17 DT  T   D . n 
B 1 8  DC  8  18 18 DC  C   D . n 
B 1 9  DG  9  19 19 DG  G   D . n 
B 1 10 DC  10 20 20 DC  C   D . n 
C 2 1  SER 1  2  2  SER ALA A . n 
C 2 2  ASP 2  3  3  ASP ASP A . n 
C 2 3  LYS 3  4  4  LYS LYS A . n 
C 2 4  PRO 4  5  5  PRO PRO A . n 
C 2 5  LYS 5  6  6  LYS ALA A . n 
C 2 6  ARG 6  7  7  ARG ARG A . n 
C 2 7  PRO 7  8  8  PRO PRO A . n 
C 2 8  LEU 8  9  9  LEU LEU A . n 
C 2 9  SER 9  10 10 SER SER A . n 
C 2 10 ALA 10 11 11 ALA ALA A . n 
C 2 11 TYR 11 12 12 TYR TYR A . n 
C 2 12 MET 12 13 13 MET MET A . n 
C 2 13 LEU 13 14 14 LEU LEU A . n 
C 2 14 TRP 14 15 15 TRP TRP A . n 
C 2 15 LEU 15 16 16 LEU LEU A . n 
C 2 16 ASN 16 17 17 ASN ASN A . n 
C 2 17 SER 17 18 18 SER SER A . n 
C 2 18 ALA 18 19 19 ALA ALA A . n 
C 2 19 ARG 19 20 20 ARG ARG A . n 
C 2 20 GLU 20 21 21 GLU GLU A . n 
C 2 21 SER 21 22 22 SER SER A . n 
C 2 22 ILE 22 23 23 ILE ILE A . n 
C 2 23 LYS 23 24 24 LYS LYS A . n 
C 2 24 ARG 24 25 25 ARG ARG A . n 
C 2 25 GLU 25 26 26 GLU GLU A . n 
C 2 26 ASN 26 27 27 ASN ASN A . n 
C 2 27 PRO 27 28 28 PRO PRO A . n 
C 2 28 GLY 28 29 29 GLY GLY A . n 
C 2 29 ILE 29 30 30 ILE ILE A . n 
C 2 30 LYS 30 31 31 LYS LYS A . n 
C 2 31 VAL 31 32 32 VAL VAL A . n 
C 2 32 THR 32 33 33 THR THR A . n 
C 2 33 GLU 33 34 34 GLU GLU A . n 
C 2 34 VAL 34 35 35 VAL VAL A . n 
C 2 35 ALA 35 36 36 ALA ALA A . n 
C 2 36 LYS 36 37 37 LYS LYS A . n 
C 2 37 ARG 37 38 38 ARG ARG A . n 
C 2 38 GLY 38 39 39 GLY GLY A . n 
C 2 39 GLY 39 40 40 GLY GLY A . n 
C 2 40 GLU 40 41 41 GLU GLU A . n 
C 2 41 LEU 41 42 42 LEU LEU A . n 
C 2 42 TRP 42 43 43 TRP TRP A . n 
C 2 43 ARG 43 44 44 ARG ARG A . n 
C 2 44 ALA 44 45 45 ALA ALA A . n 
C 2 45 MET 45 46 46 MET MET A . n 
C 2 46 LYS 46 47 47 LYS LYS A . n 
C 2 47 ASP 47 48 48 ASP ASP A . n 
C 2 48 LYS 48 49 49 LYS LYS A . n 
C 2 49 SER 49 50 50 SER SER A . n 
C 2 50 GLU 50 51 51 GLU GLU A . n 
C 2 51 TRP 51 52 52 TRP TRP A . n 
C 2 52 GLU 52 53 53 GLU GLU A . n 
C 2 53 ALA 53 54 54 ALA ALA A . n 
C 2 54 LYS 54 55 55 LYS LYS A . n 
C 2 55 ALA 55 56 56 ALA ALA A . n 
C 2 56 ALA 56 57 57 ALA ALA A . n 
C 2 57 LYS 57 58 58 LYS LYS A . n 
C 2 58 ALA 58 59 59 ALA ALA A . n 
C 2 59 LYS 59 60 60 LYS LYS A . n 
C 2 60 ASP 60 61 61 ASP ASP A . n 
C 2 61 ASP 61 62 62 ASP ASP A . n 
C 2 62 TYR 62 63 63 TYR TYR A . n 
C 2 63 ASP 63 64 64 ASP ASP A . n 
C 2 64 ARG 64 65 65 ARG ARG A . n 
C 2 65 ALA 65 66 66 ALA ALA A . n 
C 2 66 VAL 66 67 67 VAL VAL A . n 
C 2 67 LYS 67 68 68 LYS LYS A . n 
C 2 68 GLU 68 69 69 GLU GLU A . n 
C 2 69 PHE 69 70 70 PHE PHE A . n 
C 2 70 GLU 70 71 71 GLU GLU A . n 
C 2 71 ALA 71 72 72 ALA ALA A . n 
C 2 72 ASN 72 73 73 ASN ASN A . n 
C 2 73 GLY 73 74 74 GLY GLY A . n 
D 2 1  SER 1  2  ?  ?   ?   B . n 
D 2 2  ASP 2  3  3  ASP ASP B . n 
D 2 3  LYS 3  4  4  LYS LYS B . n 
D 2 4  PRO 4  5  5  PRO PRO B . n 
D 2 5  LYS 5  6  6  LYS LYS B . n 
D 2 6  ARG 6  7  7  ARG ARG B . n 
D 2 7  PRO 7  8  8  PRO PRO B . n 
D 2 8  LEU 8  9  9  LEU LEU B . n 
D 2 9  SER 9  10 10 SER SER B . n 
D 2 10 ALA 10 11 11 ALA ALA B . n 
D 2 11 TYR 11 12 12 TYR TYR B . n 
D 2 12 MET 12 13 13 MET MET B . n 
D 2 13 LEU 13 14 14 LEU LEU B . n 
D 2 14 TRP 14 15 15 TRP TRP B . n 
D 2 15 LEU 15 16 16 LEU LEU B . n 
D 2 16 ASN 16 17 17 ASN ASN B . n 
D 2 17 SER 17 18 18 SER SER B . n 
D 2 18 ALA 18 19 19 ALA ALA B . n 
D 2 19 ARG 19 20 20 ARG ARG B . n 
D 2 20 GLU 20 21 21 GLU GLU B . n 
D 2 21 SER 21 22 22 SER SER B . n 
D 2 22 ILE 22 23 23 ILE ILE B . n 
D 2 23 LYS 23 24 24 LYS LYS B . n 
D 2 24 ARG 24 25 25 ARG ARG B . n 
D 2 25 GLU 25 26 26 GLU GLU B . n 
D 2 26 ASN 26 27 27 ASN ASN B . n 
D 2 27 PRO 27 28 28 PRO PRO B . n 
D 2 28 GLY 28 29 29 GLY GLY B . n 
D 2 29 ILE 29 30 30 ILE ILE B . n 
D 2 30 LYS 30 31 31 LYS LYS B . n 
D 2 31 VAL 31 32 32 VAL VAL B . n 
D 2 32 THR 32 33 33 THR THR B . n 
D 2 33 GLU 33 34 34 GLU GLU B . n 
D 2 34 VAL 34 35 35 VAL VAL B . n 
D 2 35 ALA 35 36 36 ALA ALA B . n 
D 2 36 LYS 36 37 37 LYS LYS B . n 
D 2 37 ARG 37 38 38 ARG ARG B . n 
D 2 38 GLY 38 39 39 GLY GLY B . n 
D 2 39 GLY 39 40 40 GLY GLY B . n 
D 2 40 GLU 40 41 41 GLU GLU B . n 
D 2 41 LEU 41 42 42 LEU LEU B . n 
D 2 42 TRP 42 43 43 TRP TRP B . n 
D 2 43 ARG 43 44 44 ARG ARG B . n 
D 2 44 ALA 44 45 45 ALA ALA B . n 
D 2 45 MET 45 46 46 MET MET B . n 
D 2 46 LYS 46 47 47 LYS LYS B . n 
D 2 47 ASP 47 48 48 ASP ASP B . n 
D 2 48 LYS 48 49 49 LYS LYS B . n 
D 2 49 SER 49 50 50 SER SER B . n 
D 2 50 GLU 50 51 51 GLU GLU B . n 
D 2 51 TRP 51 52 52 TRP TRP B . n 
D 2 52 GLU 52 53 53 GLU GLU B . n 
D 2 53 ALA 53 54 54 ALA ALA B . n 
D 2 54 LYS 54 55 55 LYS LYS B . n 
D 2 55 ALA 55 56 56 ALA ALA B . n 
D 2 56 ALA 56 57 57 ALA ALA B . n 
D 2 57 LYS 57 58 58 LYS LYS B . n 
D 2 58 ALA 58 59 59 ALA ALA B . n 
D 2 59 LYS 59 60 60 LYS LYS B . n 
D 2 60 ASP 60 61 61 ASP ASP B . n 
D 2 61 ASP 61 62 62 ASP ASP B . n 
D 2 62 TYR 62 63 63 TYR TYR B . n 
D 2 63 ASP 63 64 64 ASP ASP B . n 
D 2 64 ARG 64 65 65 ARG ARG B . n 
D 2 65 ALA 65 66 66 ALA ALA B . n 
D 2 66 VAL 66 67 67 VAL VAL B . n 
D 2 67 LYS 67 68 68 LYS LYS B . n 
D 2 68 GLU 68 69 69 GLU GLU B . n 
D 2 69 PHE 69 70 70 PHE PHE B . n 
D 2 70 GLU 70 71 71 GLU GLU B . n 
D 2 71 ALA 71 72 72 ALA ALA B . n 
D 2 72 ASN 72 73 73 ASN ASN B . n 
D 2 73 GLY 73 74 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 NA  1  501 1   NA  NA  C . 
F 4 HOH 1  502 1   HOH WAT C . 
F 4 HOH 2  503 16  HOH WAT C . 
F 4 HOH 3  504 21  HOH WAT C . 
F 4 HOH 4  505 27  HOH WAT C . 
F 4 HOH 5  506 41  HOH WAT C . 
F 4 HOH 6  507 46  HOH WAT C . 
F 4 HOH 7  508 63  HOH WAT C . 
F 4 HOH 8  509 70  HOH WAT C . 
F 4 HOH 9  510 74  HOH WAT C . 
F 4 HOH 10 511 75  HOH WAT C . 
F 4 HOH 11 512 85  HOH WAT C . 
F 4 HOH 12 513 91  HOH WAT C . 
F 4 HOH 13 514 106 HOH WAT C . 
F 4 HOH 14 515 107 HOH WAT C . 
F 4 HOH 15 516 108 HOH WAT C . 
F 4 HOH 16 517 109 HOH WAT C . 
F 4 HOH 17 518 110 HOH WAT C . 
F 4 HOH 18 519 113 HOH WAT C . 
G 4 HOH 1  21  11  HOH WAT D . 
G 4 HOH 2  22  24  HOH WAT D . 
G 4 HOH 3  23  49  HOH WAT D . 
G 4 HOH 4  24  56  HOH WAT D . 
G 4 HOH 5  25  59  HOH WAT D . 
G 4 HOH 6  26  69  HOH WAT D . 
G 4 HOH 7  27  72  HOH WAT D . 
G 4 HOH 8  28  76  HOH WAT D . 
H 4 HOH 1  75  3   HOH WAT A . 
H 4 HOH 2  76  4   HOH WAT A . 
H 4 HOH 3  77  5   HOH WAT A . 
H 4 HOH 4  78  6   HOH WAT A . 
H 4 HOH 5  79  7   HOH WAT A . 
H 4 HOH 6  80  8   HOH WAT A . 
H 4 HOH 7  81  9   HOH WAT A . 
H 4 HOH 8  82  10  HOH WAT A . 
H 4 HOH 9  83  12  HOH WAT A . 
H 4 HOH 10 84  13  HOH WAT A . 
H 4 HOH 11 85  14  HOH WAT A . 
H 4 HOH 12 86  15  HOH WAT A . 
H 4 HOH 13 87  17  HOH WAT A . 
H 4 HOH 14 88  18  HOH WAT A . 
H 4 HOH 15 89  19  HOH WAT A . 
H 4 HOH 16 90  20  HOH WAT A . 
H 4 HOH 17 91  22  HOH WAT A . 
H 4 HOH 18 92  25  HOH WAT A . 
H 4 HOH 19 93  26  HOH WAT A . 
H 4 HOH 20 94  28  HOH WAT A . 
H 4 HOH 21 95  29  HOH WAT A . 
H 4 HOH 22 96  30  HOH WAT A . 
H 4 HOH 23 97  31  HOH WAT A . 
H 4 HOH 24 98  32  HOH WAT A . 
H 4 HOH 25 99  34  HOH WAT A . 
H 4 HOH 26 100 35  HOH WAT A . 
H 4 HOH 27 101 36  HOH WAT A . 
H 4 HOH 28 102 40  HOH WAT A . 
H 4 HOH 29 103 42  HOH WAT A . 
H 4 HOH 30 104 43  HOH WAT A . 
H 4 HOH 31 105 47  HOH WAT A . 
H 4 HOH 32 106 48  HOH WAT A . 
H 4 HOH 33 107 50  HOH WAT A . 
H 4 HOH 34 108 53  HOH WAT A . 
H 4 HOH 35 109 55  HOH WAT A . 
H 4 HOH 36 110 57  HOH WAT A . 
H 4 HOH 37 111 58  HOH WAT A . 
H 4 HOH 38 112 60  HOH WAT A . 
H 4 HOH 39 113 66  HOH WAT A . 
H 4 HOH 40 114 68  HOH WAT A . 
H 4 HOH 41 115 73  HOH WAT A . 
H 4 HOH 42 116 80  HOH WAT A . 
H 4 HOH 43 117 81  HOH WAT A . 
H 4 HOH 44 118 82  HOH WAT A . 
H 4 HOH 45 119 86  HOH WAT A . 
H 4 HOH 46 120 87  HOH WAT A . 
H 4 HOH 47 121 88  HOH WAT A . 
H 4 HOH 48 122 89  HOH WAT A . 
H 4 HOH 49 123 92  HOH WAT A . 
H 4 HOH 50 124 93  HOH WAT A . 
H 4 HOH 51 125 94  HOH WAT A . 
H 4 HOH 52 126 95  HOH WAT A . 
H 4 HOH 53 127 96  HOH WAT A . 
H 4 HOH 54 128 102 HOH WAT A . 
H 4 HOH 55 129 103 HOH WAT A . 
H 4 HOH 56 130 104 HOH WAT A . 
H 4 HOH 57 131 105 HOH WAT A . 
H 4 HOH 58 132 111 HOH WAT A . 
H 4 HOH 59 133 112 HOH WAT A . 
H 4 HOH 60 134 114 HOH WAT A . 
I 4 HOH 1  75  2   HOH WAT B . 
I 4 HOH 2  76  23  HOH WAT B . 
I 4 HOH 3  77  33  HOH WAT B . 
I 4 HOH 4  78  37  HOH WAT B . 
I 4 HOH 5  79  38  HOH WAT B . 
I 4 HOH 6  80  39  HOH WAT B . 
I 4 HOH 7  81  44  HOH WAT B . 
I 4 HOH 8  82  45  HOH WAT B . 
I 4 HOH 9  83  51  HOH WAT B . 
I 4 HOH 10 84  52  HOH WAT B . 
I 4 HOH 11 85  54  HOH WAT B . 
I 4 HOH 12 86  61  HOH WAT B . 
I 4 HOH 13 87  62  HOH WAT B . 
I 4 HOH 14 88  64  HOH WAT B . 
I 4 HOH 15 89  65  HOH WAT B . 
I 4 HOH 16 90  67  HOH WAT B . 
I 4 HOH 17 91  71  HOH WAT B . 
I 4 HOH 18 92  77  HOH WAT B . 
I 4 HOH 19 93  78  HOH WAT B . 
I 4 HOH 20 94  79  HOH WAT B . 
I 4 HOH 21 95  83  HOH WAT B . 
I 4 HOH 22 96  84  HOH WAT B . 
I 4 HOH 23 97  90  HOH WAT B . 
I 4 HOH 24 98  97  HOH WAT B . 
I 4 HOH 25 99  98  HOH WAT B . 
I 4 HOH 26 100 99  HOH WAT B . 
I 4 HOH 27 101 100 HOH WAT B . 
I 4 HOH 28 102 101 HOH WAT B . 
I 4 HOH 29 103 115 HOH WAT B . 
I 4 HOH 30 104 116 HOH WAT B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-12-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation_author.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE     phasing          .   ? 1 
SHARP     phasing          .   ? 2 
CNS       refinement       0.5 ? 3 
DENZO     'data reduction' .   ? 4 
SCALEPACK 'data scaling'   .   ? 5 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A SER 2 ? OG ? C SER 1 OG 
2 1 Y 1 A LYS 6 ? CG ? C LYS 5 CG 
3 1 Y 1 A LYS 6 ? CD ? C LYS 5 CD 
4 1 Y 1 A LYS 6 ? CE ? C LYS 5 CE 
5 1 Y 1 A LYS 6 ? NZ ? C LYS 5 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B SER 2  ? D SER 1  
2 1 Y 1 B GLY 74 ? D GLY 73 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1QRV 'double helix'        
1QRV 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1 1_555 B DC 10 1_555 -0.153 -0.314 -0.426 -5.521  -5.823  -6.950 1 C_DG1:DC20_D C 1 ? D 20 ? 19 1 
1 A DC 2 1_555 B DG 9  1_555 -0.130 -0.164 -0.172 2.638   -1.042  -2.720 2 C_DC2:DG19_D C 2 ? D 19 ? 19 1 
1 A DG 3 1_555 B DC 8  1_555 -0.173 -0.238 -0.178 3.547   -0.003  -3.369 3 C_DG3:DC18_D C 3 ? D 18 ? 19 1 
1 A DA 4 1_555 B DT 7  1_555 0.029  -0.089 -0.177 8.357   1.027   8.766  4 C_DA4:DT17_D C 4 ? D 17 ? 20 1 
1 A DT 5 1_555 B DA 6  1_555 -0.092 -0.287 0.155  18.030  20.760  -1.491 5 C_DT5:DA16_D C 5 ? D 16 ? 20 1 
1 A DA 6 1_555 B DT 5  1_555 0.081  -0.173 -0.097 -17.210 -0.332  3.082  6 C_DA6:DT15_D C 6 ? D 15 ? 20 1 
1 A DT 7 1_555 B DA 4  1_555 -0.028 -0.085 0.350  -3.767  -2.000  3.319  7 C_DT7:DA14_D C 7 ? D 14 ? 20 1 
1 A DC 8 1_555 B DG 3  1_555 0.315  -0.121 -0.492 6.092   -15.003 -3.262 8 C_DC8:DG13_D C 8 ? D 13 ? 19 1 
1 A DG 9 1_555 B DC 2  1_555 0.363  -0.291 -0.194 11.917  1.105   -3.609 9 C_DG9:DC12_D C 9 ? D 12 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1 1_555 B DC 10 1_555 A DC 2 1_555 B DG 9 1_555 0.081  -1.254 3.188 -1.476 5.232  28.832 -3.537 -0.459 2.912 10.391 2.931   
29.329 1 CC_DG1DC2:DG19DC20_DD C 1 ? D 20 ? C 2 ? D 19 ? 
1 A DC 2 1_555 B DG 9  1_555 A DG 3 1_555 B DC 8 1_555 0.695  0.816  3.389 2.917  6.664  34.530 0.291  -0.685 3.526 11.074 -4.847  
35.265 2 CC_DC2DG3:DC18DG19_DD C 2 ? D 19 ? C 3 ? D 18 ? 
1 A DG 3 1_555 B DC 8  1_555 A DA 4 1_555 B DT 7 1_555 0.664  0.845  3.717 -0.401 28.986 14.071 -5.335 -1.294 2.393 64.643 0.895   
32.157 3 CC_DG3DA4:DT17DC18_DD C 3 ? D 18 ? C 4 ? D 17 ? 
1 A DA 4 1_555 B DT 7  1_555 A DT 5 1_555 B DA 6 1_555 -0.422 -0.152 3.462 -1.442 22.061 14.626 -6.486 0.520  1.823 56.791 3.711   
26.458 4 CC_DA4DT5:DA16DT17_DD C 4 ? D 17 ? C 5 ? D 16 ? 
1 A DT 5 1_555 B DA 6  1_555 A DA 6 1_555 B DT 5 1_555 0.563  -0.519 4.693 5.332  51.601 20.950 -4.862 -0.157 1.405 69.137 -7.143  
55.674 5 CC_DT5DA6:DT15DA16_DD C 5 ? D 16 ? C 6 ? D 15 ? 
1 A DA 6 1_555 B DT 5  1_555 A DT 7 1_555 B DA 4 1_555 -0.803 -0.508 3.112 -0.269 8.656  28.512 -2.675 1.511  2.846 17.083 0.531   
29.772 6 CC_DA6DT7:DA14DT15_DD C 6 ? D 15 ? C 7 ? D 14 ? 
1 A DT 7 1_555 B DA 4  1_555 A DC 8 1_555 B DG 3 1_555 -0.436 -0.077 2.866 7.325  5.726  36.258 -0.770 1.512  2.688 9.020  -11.538 
37.393 7 CC_DT7DC8:DG13DA14_DD C 7 ? D 14 ? C 8 ? D 13 ? 
1 A DC 8 1_555 B DG 3  1_555 A DG 9 1_555 B DC 2 1_555 0.321  1.242  3.340 -0.958 9.005  34.604 0.635  -0.670 3.533 14.827 1.577   
35.734 8 CC_DC8DG9:DC12DG13_DD C 8 ? D 13 ? C 9 ? D 12 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SODIUM ION' NA  
4 water        HOH 
#