data_1QVA
# 
_entry.id   1QVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QVA         
RCSB  RCSB009300   
WWPDB D_1000009300 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QVA 
_pdbx_database_status.recvd_initial_deposition_date   1999-07-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Johnson, E.R.' 1 
'McKay, D.B.'   2 
# 
_citation.id                        primary 
_citation.title                     
'Crystallographic structure of the amino terminal domain of yeast initiation factor 4A, a representative DEAD-box RNA helicase' 
_citation.journal_abbrev            RNA 
_citation.journal_volume            5 
_citation.page_first                1526 
_citation.page_last                 1534 
_citation.year                      1999 
_citation.journal_id_ASTM           RNARFU 
_citation.country                   UK 
_citation.journal_id_ISSN           1355-8382 
_citation.journal_id_CSD            2122 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10606264 
_citation.pdbx_database_id_DOI      10.1017/S1355838299991410 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Johnson, E.R.' 1 
primary 'McKay, D.B.'   2 
# 
_cell.entry_id           1QVA 
_cell.length_a           38.800 
_cell.length_b           74.300 
_cell.length_c           81.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QVA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INITIATION FACTOR 4A' 24949.701 1  ? ? 'residues 2-224' ? 
2 water   nat water                  18.015    55 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'EIF-4A, STIMULATOR FACTOR I 37, KD COMPONENT' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SEGITDIEESQIQTNYQKVVYKFDDMELDEQLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAAL
QRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRT
DKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SEGITDIEESQIQTNYQKVVYKFDDMELDEQLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAAL
QRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRT
DKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   GLY n 
1 4   ILE n 
1 5   THR n 
1 6   ASP n 
1 7   ILE n 
1 8   GLU n 
1 9   GLU n 
1 10  SER n 
1 11  GLN n 
1 12  ILE n 
1 13  GLN n 
1 14  THR n 
1 15  ASN n 
1 16  TYR n 
1 17  GLN n 
1 18  LYS n 
1 19  VAL n 
1 20  VAL n 
1 21  TYR n 
1 22  LYS n 
1 23  PHE n 
1 24  ASP n 
1 25  ASP n 
1 26  MET n 
1 27  GLU n 
1 28  LEU n 
1 29  ASP n 
1 30  GLU n 
1 31  GLN n 
1 32  LEU n 
1 33  LEU n 
1 34  ARG n 
1 35  GLY n 
1 36  VAL n 
1 37  PHE n 
1 38  GLY n 
1 39  TYR n 
1 40  GLY n 
1 41  PHE n 
1 42  GLU n 
1 43  GLU n 
1 44  PRO n 
1 45  SER n 
1 46  ALA n 
1 47  ILE n 
1 48  GLN n 
1 49  GLN n 
1 50  ARG n 
1 51  ALA n 
1 52  ILE n 
1 53  MET n 
1 54  PRO n 
1 55  ILE n 
1 56  ILE n 
1 57  GLU n 
1 58  GLY n 
1 59  HIS n 
1 60  ASP n 
1 61  VAL n 
1 62  LEU n 
1 63  ALA n 
1 64  GLN n 
1 65  ALA n 
1 66  GLN n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  GLY n 
1 71  LYS n 
1 72  THR n 
1 73  GLY n 
1 74  THR n 
1 75  PHE n 
1 76  SER n 
1 77  ILE n 
1 78  ALA n 
1 79  ALA n 
1 80  LEU n 
1 81  GLN n 
1 82  ARG n 
1 83  ILE n 
1 84  ASP n 
1 85  THR n 
1 86  SER n 
1 87  VAL n 
1 88  LYS n 
1 89  ALA n 
1 90  PRO n 
1 91  GLN n 
1 92  ALA n 
1 93  LEU n 
1 94  MET n 
1 95  LEU n 
1 96  ALA n 
1 97  PRO n 
1 98  THR n 
1 99  ARG n 
1 100 GLU n 
1 101 LEU n 
1 102 ALA n 
1 103 LEU n 
1 104 GLN n 
1 105 ILE n 
1 106 GLN n 
1 107 LYS n 
1 108 VAL n 
1 109 VAL n 
1 110 MET n 
1 111 ALA n 
1 112 LEU n 
1 113 ALA n 
1 114 PHE n 
1 115 HIS n 
1 116 MET n 
1 117 ASP n 
1 118 ILE n 
1 119 LYS n 
1 120 VAL n 
1 121 HIS n 
1 122 ALA n 
1 123 CYS n 
1 124 ILE n 
1 125 GLY n 
1 126 GLY n 
1 127 THR n 
1 128 SER n 
1 129 PHE n 
1 130 VAL n 
1 131 GLU n 
1 132 ASP n 
1 133 ALA n 
1 134 GLU n 
1 135 GLY n 
1 136 LEU n 
1 137 ARG n 
1 138 ASP n 
1 139 ALA n 
1 140 GLN n 
1 141 ILE n 
1 142 VAL n 
1 143 VAL n 
1 144 GLY n 
1 145 THR n 
1 146 PRO n 
1 147 GLY n 
1 148 ARG n 
1 149 VAL n 
1 150 PHE n 
1 151 ASP n 
1 152 ASN n 
1 153 ILE n 
1 154 GLN n 
1 155 ARG n 
1 156 ARG n 
1 157 ARG n 
1 158 PHE n 
1 159 ARG n 
1 160 THR n 
1 161 ASP n 
1 162 LYS n 
1 163 ILE n 
1 164 LYS n 
1 165 MET n 
1 166 PHE n 
1 167 ILE n 
1 168 LEU n 
1 169 ASP n 
1 170 GLU n 
1 171 ALA n 
1 172 ASP n 
1 173 GLU n 
1 174 MET n 
1 175 LEU n 
1 176 SER n 
1 177 SER n 
1 178 GLY n 
1 179 PHE n 
1 180 LYS n 
1 181 GLU n 
1 182 GLN n 
1 183 ILE n 
1 184 TYR n 
1 185 GLN n 
1 186 ILE n 
1 187 PHE n 
1 188 THR n 
1 189 LEU n 
1 190 LEU n 
1 191 PRO n 
1 192 PRO n 
1 193 THR n 
1 194 THR n 
1 195 GLN n 
1 196 VAL n 
1 197 VAL n 
1 198 LEU n 
1 199 LEU n 
1 200 SER n 
1 201 ALA n 
1 202 THR n 
1 203 MET n 
1 204 PRO n 
1 205 ASN n 
1 206 ASP n 
1 207 VAL n 
1 208 LEU n 
1 209 GLU n 
1 210 VAL n 
1 211 THR n 
1 212 THR n 
1 213 LYS n 
1 214 PHE n 
1 215 MET n 
1 216 ARG n 
1 217 ASN n 
1 218 PRO n 
1 219 VAL n 
1 220 ARG n 
1 221 ILE n 
1 222 LEU n 
1 223 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IF4A_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10081 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1qva 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 223 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10081 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  224 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       223 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1qva GLN A 17 ? UNP P10081 ASP 18 conflict 17 1 
1 1qva GLN A 31 ? UNP P10081 ASN 32 conflict 31 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   47.41 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'POLYETHYLENE GLYCOL, POTASSIUM ACETATE, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL1-5' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL1-5 
_diffrn_source.pdbx_wavelength             0.9999 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QVA 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40. 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   8094 
_reflns.number_all                   8094 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            0.0620000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.1 
_reflns.B_iso_Wilson_estimate        29.7 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.66 
_reflns_shell.percent_possible_all   78.8 
_reflns_shell.Rmerge_I_obs           0.1460000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1095 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QVA 
_refine.ls_number_reflns_obs                     8026 
_refine.ls_number_reflns_all                     8026 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               415484.08 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    94.0 
_refine.ls_R_factor_obs                          0.2230000 
_refine.ls_R_factor_all                          0.2280000 
_refine.ls_R_factor_R_work                       0.2230000 
_refine.ls_R_factor_R_free                       0.2740000 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.3 
_refine.ls_number_reflns_R_free                  830 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               30.7 
_refine.aniso_B[1][1]                            -11.67 
_refine.aniso_B[2][2]                            -5.77 
_refine.aniso_B[3][3]                            17.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.345 
_refine.solvent_model_param_bsol                 50.24 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;The sidechains of the following residues were not observed in the electron 
density and are modeled as ALA:  
GLN 11, ARG 137, GLN 154, ARG 156, ARG 157, ARG 159
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber, Konnert & Hendrickson' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QVA 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.39 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1643 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               1698 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.83  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.93  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.77  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.57  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             952 
_refine_ls_shell.R_factor_R_work                  0.2670000 
_refine_ls_shell.percent_reflns_obs               76.9 
_refine_ls_shell.R_factor_R_free                  0.3170000 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            10.7 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 TOPPAR_EJ:PROTEIN_REP.PAR TOPPAR_EJ:PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 TOPPAR_EJ:WATER_REP.PARAM TOPPAR_EJ:WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QVA 
_struct.title                     'YEAST INITIATION FACTOR 4A N-TERMINAL DOMAIN' 
_struct.pdbx_descriptor           'INITIATION FACTOR 4A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QVA 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            'RNA HELICASE, DEAD BOX, EIF4A, GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 22  ? MET A 26  ? LYS A 22  MET A 26  5 ? 5  
HELX_P HELX_P2  2  ASP A 29  ? TYR A 39  ? ASP A 29  TYR A 39  1 ? 11 
HELX_P HELX_P3  3  ILE A 47  ? GLU A 57  ? ILE A 47  GLU A 57  1 ? 11 
HELX_P HELX_P4  4  GLY A 68  ? ILE A 83  ? GLY A 68  ILE A 83  1 ? 16 
HELX_P HELX_P5  5  THR A 98  ? ALA A 113 ? THR A 98  ALA A 113 1 ? 16 
HELX_P HELX_P6  6  SER A 128 ? ALA A 139 ? SER A 128 ALA A 139 1 ? 12 
HELX_P HELX_P7  7  THR A 145 ? GLN A 154 ? THR A 145 GLN A 154 1 ? 10 
HELX_P HELX_P8  8  GLU A 170 ? SER A 176 ? GLU A 170 SER A 176 1 ? 7  
HELX_P HELX_P9  9  PHE A 179 ? LEU A 189 ? PHE A 179 LEU A 189 1 ? 11 
HELX_P HELX_P10 10 PRO A 204 ? MET A 215 ? PRO A 204 MET A 215 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 13  ? THR A 14  ? GLN A 13  THR A 14  
A 2 VAL A 219 ? LEU A 222 ? VAL A 219 LEU A 222 
A 3 VAL A 61  ? GLN A 64  ? VAL A 61  GLN A 64  
A 4 GLN A 195 ? SER A 200 ? GLN A 195 SER A 200 
A 5 MET A 165 ? LEU A 168 ? MET A 165 LEU A 168 
A 6 ALA A 92  ? LEU A 95  ? ALA A 92  LEU A 95  
A 7 ILE A 141 ? GLY A 144 ? ILE A 141 GLY A 144 
A 8 VAL A 120 ? CYS A 123 ? VAL A 120 CYS A 123 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 13  ? O GLN A 13  N LEU A 222 ? N LEU A 222 
A 2 3 N ILE A 221 ? N ILE A 221 O LEU A 62  ? O LEU A 62  
A 3 4 N VAL A 61  ? N VAL A 61  O VAL A 196 ? O VAL A 196 
A 4 5 N VAL A 197 ? N VAL A 197 O PHE A 166 ? O PHE A 166 
A 5 6 N ILE A 167 ? N ILE A 167 O LEU A 93  ? O LEU A 93  
A 6 7 N MET A 94  ? N MET A 94  O VAL A 142 ? O VAL A 142 
A 7 8 N VAL A 143 ? N VAL A 143 O HIS A 121 ? O HIS A 121 
# 
_database_PDB_matrix.entry_id          1QVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QVA 
_atom_sites.fract_transf_matrix[1][1]   0.025773 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013459 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012346 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 11  ? 45.030 116.966 -11.326 1.00 39.23 ? 11  GLN A N   1 
ATOM   2    C CA  . GLN A 1 11  ? 44.303 115.668 -11.165 1.00 39.48 ? 11  GLN A CA  1 
ATOM   3    C C   . GLN A 1 11  ? 44.208 114.901 -12.484 1.00 39.51 ? 11  GLN A C   1 
ATOM   4    O O   . GLN A 1 11  ? 44.735 113.790 -12.621 1.00 40.48 ? 11  GLN A O   1 
ATOM   5    C CB  . GLN A 1 11  ? 42.906 115.926 -10.621 1.00 39.46 ? 11  GLN A CB  1 
ATOM   6    N N   . ILE A 1 12  ? 43.522 115.500 -13.449 1.00 37.82 ? 12  ILE A N   1 
ATOM   7    C CA  . ILE A 1 12  ? 43.333 114.887 -14.757 1.00 37.22 ? 12  ILE A CA  1 
ATOM   8    C C   . ILE A 1 12  ? 44.475 115.288 -15.680 1.00 37.37 ? 12  ILE A C   1 
ATOM   9    O O   . ILE A 1 12  ? 45.159 116.282 -15.438 1.00 38.34 ? 12  ILE A O   1 
ATOM   10   C CB  . ILE A 1 12  ? 41.973 115.320 -15.373 1.00 36.01 ? 12  ILE A CB  1 
ATOM   11   C CG1 . ILE A 1 12  ? 40.831 114.858 -14.467 1.00 34.31 ? 12  ILE A CG1 1 
ATOM   12   C CG2 . ILE A 1 12  ? 41.808 114.734 -16.768 1.00 34.19 ? 12  ILE A CG2 1 
ATOM   13   C CD1 . ILE A 1 12  ? 39.477 115.434 -14.830 1.00 35.38 ? 12  ILE A CD1 1 
ATOM   14   N N   . GLN A 1 13  ? 44.676 114.507 -16.735 1.00 36.54 ? 13  GLN A N   1 
ATOM   15   C CA  . GLN A 1 13  ? 45.740 114.764 -17.694 1.00 36.50 ? 13  GLN A CA  1 
ATOM   16   C C   . GLN A 1 13  ? 45.155 114.587 -19.088 1.00 34.90 ? 13  GLN A C   1 
ATOM   17   O O   . GLN A 1 13  ? 44.557 113.555 -19.383 1.00 36.08 ? 13  GLN A O   1 
ATOM   18   C CB  . GLN A 1 13  ? 46.872 113.770 -17.466 1.00 38.42 ? 13  GLN A CB  1 
ATOM   19   C CG  . GLN A 1 13  ? 48.094 114.005 -18.299 1.00 43.27 ? 13  GLN A CG  1 
ATOM   20   C CD  . GLN A 1 13  ? 49.214 113.055 -17.937 1.00 47.29 ? 13  GLN A CD  1 
ATOM   21   O OE1 . GLN A 1 13  ? 49.536 112.881 -16.755 1.00 49.18 ? 13  GLN A OE1 1 
ATOM   22   N NE2 . GLN A 1 13  ? 49.824 112.437 -18.950 1.00 48.13 ? 13  GLN A NE2 1 
ATOM   23   N N   . THR A 1 14  ? 45.328 115.584 -19.948 1.00 31.92 ? 14  THR A N   1 
ATOM   24   C CA  . THR A 1 14  ? 44.775 115.509 -21.296 1.00 28.20 ? 14  THR A CA  1 
ATOM   25   C C   . THR A 1 14  ? 45.670 116.169 -22.328 1.00 27.35 ? 14  THR A C   1 
ATOM   26   O O   . THR A 1 14  ? 46.426 117.077 -22.005 1.00 24.94 ? 14  THR A O   1 
ATOM   27   C CB  . THR A 1 14  ? 43.386 116.195 -21.351 1.00 26.18 ? 14  THR A CB  1 
ATOM   28   O OG1 . THR A 1 14  ? 42.911 116.208 -22.697 1.00 22.81 ? 14  THR A OG1 1 
ATOM   29   C CG2 . THR A 1 14  ? 43.474 117.640 -20.844 1.00 25.10 ? 14  THR A CG2 1 
ATOM   30   N N   . ASN A 1 15  ? 45.590 115.705 -23.569 1.00 27.18 ? 15  ASN A N   1 
ATOM   31   C CA  . ASN A 1 15  ? 46.374 116.313 -24.636 1.00 27.61 ? 15  ASN A CA  1 
ATOM   32   C C   . ASN A 1 15  ? 45.490 117.228 -25.489 1.00 28.40 ? 15  ASN A C   1 
ATOM   33   O O   . ASN A 1 15  ? 45.866 117.635 -26.594 1.00 26.08 ? 15  ASN A O   1 
ATOM   34   C CB  . ASN A 1 15  ? 47.056 115.248 -25.506 1.00 27.94 ? 15  ASN A CB  1 
ATOM   35   C CG  . ASN A 1 15  ? 46.110 114.162 -25.957 1.00 27.69 ? 15  ASN A CG  1 
ATOM   36   O OD1 . ASN A 1 15  ? 44.892 114.332 -25.927 1.00 27.67 ? 15  ASN A OD1 1 
ATOM   37   N ND2 . ASN A 1 15  ? 46.668 113.041 -26.399 1.00 24.99 ? 15  ASN A ND2 1 
ATOM   38   N N   . TYR A 1 16  ? 44.313 117.543 -24.949 1.00 28.59 ? 16  TYR A N   1 
ATOM   39   C CA  . TYR A 1 16  ? 43.344 118.436 -25.582 1.00 30.79 ? 16  TYR A CA  1 
ATOM   40   C C   . TYR A 1 16  ? 43.323 119.672 -24.672 1.00 32.25 ? 16  TYR A C   1 
ATOM   41   O O   . TYR A 1 16  ? 42.983 119.577 -23.491 1.00 31.77 ? 16  TYR A O   1 
ATOM   42   C CB  . TYR A 1 16  ? 41.966 117.776 -25.611 1.00 30.14 ? 16  TYR A CB  1 
ATOM   43   C CG  . TYR A 1 16  ? 40.903 118.555 -26.346 1.00 28.47 ? 16  TYR A CG  1 
ATOM   44   C CD1 . TYR A 1 16  ? 40.829 118.532 -27.733 1.00 28.26 ? 16  TYR A CD1 1 
ATOM   45   C CD2 . TYR A 1 16  ? 39.953 119.302 -25.645 1.00 28.68 ? 16  TYR A CD2 1 
ATOM   46   C CE1 . TYR A 1 16  ? 39.831 119.231 -28.413 1.00 27.24 ? 16  TYR A CE1 1 
ATOM   47   C CE2 . TYR A 1 16  ? 38.952 120.004 -26.311 1.00 27.14 ? 16  TYR A CE2 1 
ATOM   48   C CZ  . TYR A 1 16  ? 38.895 119.961 -27.694 1.00 27.85 ? 16  TYR A CZ  1 
ATOM   49   O OH  . TYR A 1 16  ? 37.897 120.638 -28.354 1.00 26.27 ? 16  TYR A OH  1 
ATOM   50   N N   . GLN A 1 17  ? 43.673 120.828 -25.226 1.00 34.43 ? 17  GLN A N   1 
ATOM   51   C CA  . GLN A 1 17  ? 43.767 122.057 -24.435 1.00 36.01 ? 17  GLN A CA  1 
ATOM   52   C C   . GLN A 1 17  ? 42.602 123.039 -24.377 1.00 35.17 ? 17  GLN A C   1 
ATOM   53   O O   . GLN A 1 17  ? 42.810 124.251 -24.277 1.00 35.72 ? 17  GLN A O   1 
ATOM   54   C CB  . GLN A 1 17  ? 45.027 122.805 -24.856 1.00 39.51 ? 17  GLN A CB  1 
ATOM   55   C CG  . GLN A 1 17  ? 45.249 122.790 -26.348 1.00 42.49 ? 17  GLN A CG  1 
ATOM   56   C CD  . GLN A 1 17  ? 46.702 122.633 -26.693 1.00 44.44 ? 17  GLN A CD  1 
ATOM   57   O OE1 . GLN A 1 17  ? 47.394 121.787 -26.122 1.00 45.99 ? 17  GLN A OE1 1 
ATOM   58   N NE2 . GLN A 1 17  ? 47.181 123.438 -27.639 1.00 46.54 ? 17  GLN A NE2 1 
ATOM   59   N N   . LYS A 1 18  ? 41.382 122.531 -24.419 1.00 33.23 ? 18  LYS A N   1 
ATOM   60   C CA  . LYS A 1 18  ? 40.230 123.401 -24.332 1.00 32.61 ? 18  LYS A CA  1 
ATOM   61   C C   . LYS A 1 18  ? 39.261 122.806 -23.317 1.00 30.68 ? 18  LYS A C   1 
ATOM   62   O O   . LYS A 1 18  ? 38.853 121.654 -23.440 1.00 30.09 ? 18  LYS A O   1 
ATOM   63   C CB  . LYS A 1 18  ? 39.565 123.542 -25.701 1.00 35.20 ? 18  LYS A CB  1 
ATOM   64   C CG  . LYS A 1 18  ? 38.622 124.742 -25.818 1.00 38.25 ? 18  LYS A CG  1 
ATOM   65   C CD  . LYS A 1 18  ? 38.173 124.929 -27.267 1.00 41.10 ? 18  LYS A CD  1 
ATOM   66   C CE  . LYS A 1 18  ? 37.188 126.077 -27.434 1.00 43.12 ? 18  LYS A CE  1 
ATOM   67   N NZ  . LYS A 1 18  ? 36.754 126.218 -28.867 1.00 44.13 ? 18  LYS A NZ  1 
ATOM   68   N N   . VAL A 1 19  ? 38.926 123.591 -22.301 1.00 27.48 ? 19  VAL A N   1 
ATOM   69   C CA  . VAL A 1 19  ? 38.000 123.154 -21.267 1.00 26.25 ? 19  VAL A CA  1 
ATOM   70   C C   . VAL A 1 19  ? 36.748 124.016 -21.315 1.00 26.01 ? 19  VAL A C   1 
ATOM   71   O O   . VAL A 1 19  ? 36.830 125.220 -21.538 1.00 24.55 ? 19  VAL A O   1 
ATOM   72   C CB  . VAL A 1 19  ? 38.641 123.267 -19.870 1.00 26.12 ? 19  VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 19  ? 37.620 122.955 -18.793 1.00 22.88 ? 19  VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 19  ? 39.839 122.321 -19.776 1.00 22.17 ? 19  VAL A CG2 1 
ATOM   75   N N   . VAL A 1 20  ? 35.590 123.384 -21.127 1.00 26.86 ? 20  VAL A N   1 
ATOM   76   C CA  . VAL A 1 20  ? 34.305 124.081 -21.140 1.00 26.96 ? 20  VAL A CA  1 
ATOM   77   C C   . VAL A 1 20  ? 33.582 123.769 -19.840 1.00 28.33 ? 20  VAL A C   1 
ATOM   78   O O   . VAL A 1 20  ? 33.313 122.604 -19.533 1.00 29.28 ? 20  VAL A O   1 
ATOM   79   C CB  . VAL A 1 20  ? 33.421 123.637 -22.337 1.00 26.87 ? 20  VAL A CB  1 
ATOM   80   C CG1 . VAL A 1 20  ? 32.078 124.350 -22.288 1.00 25.08 ? 20  VAL A CG1 1 
ATOM   81   C CG2 . VAL A 1 20  ? 34.121 123.954 -23.649 1.00 24.86 ? 20  VAL A CG2 1 
ATOM   82   N N   . TYR A 1 21  ? 33.258 124.815 -19.084 1.00 28.63 ? 21  TYR A N   1 
ATOM   83   C CA  . TYR A 1 21  ? 32.601 124.660 -17.794 1.00 28.28 ? 21  TYR A CA  1 
ATOM   84   C C   . TYR A 1 21  ? 31.079 124.760 -17.759 1.00 28.17 ? 21  TYR A C   1 
ATOM   85   O O   . TYR A 1 21  ? 30.481 124.564 -16.703 1.00 27.59 ? 21  TYR A O   1 
ATOM   86   C CB  . TYR A 1 21  ? 33.169 125.679 -16.814 1.00 29.53 ? 21  TYR A CB  1 
ATOM   87   C CG  . TYR A 1 21  ? 34.656 125.594 -16.652 1.00 30.30 ? 21  TYR A CG  1 
ATOM   88   C CD1 . TYR A 1 21  ? 35.501 126.496 -17.309 1.00 31.97 ? 21  TYR A CD1 1 
ATOM   89   C CD2 . TYR A 1 21  ? 35.229 124.608 -15.846 1.00 30.74 ? 21  TYR A CD2 1 
ATOM   90   C CE1 . TYR A 1 21  ? 36.888 126.417 -17.164 1.00 31.94 ? 21  TYR A CE1 1 
ATOM   91   C CE2 . TYR A 1 21  ? 36.609 124.517 -15.693 1.00 31.24 ? 21  TYR A CE2 1 
ATOM   92   C CZ  . TYR A 1 21  ? 37.432 125.425 -16.355 1.00 32.63 ? 21  TYR A CZ  1 
ATOM   93   O OH  . TYR A 1 21  ? 38.793 125.328 -16.211 1.00 33.99 ? 21  TYR A OH  1 
ATOM   94   N N   . LYS A 1 22  ? 30.453 125.072 -18.890 1.00 27.22 ? 22  LYS A N   1 
ATOM   95   C CA  . LYS A 1 22  ? 28.997 125.198 -18.939 1.00 27.53 ? 22  LYS A CA  1 
ATOM   96   C C   . LYS A 1 22  ? 28.409 124.605 -20.214 1.00 26.28 ? 22  LYS A C   1 
ATOM   97   O O   . LYS A 1 22  ? 28.899 124.892 -21.310 1.00 27.74 ? 22  LYS A O   1 
ATOM   98   C CB  . LYS A 1 22  ? 28.591 126.676 -18.846 1.00 29.51 ? 22  LYS A CB  1 
ATOM   99   C CG  . LYS A 1 22  ? 28.150 127.149 -17.462 1.00 33.36 ? 22  LYS A CG  1 
ATOM   100  C CD  . LYS A 1 22  ? 29.290 127.175 -16.464 1.00 35.95 ? 22  LYS A CD  1 
ATOM   101  C CE  . LYS A 1 22  ? 28.858 127.841 -15.172 1.00 38.12 ? 22  LYS A CE  1 
ATOM   102  N NZ  . LYS A 1 22  ? 27.661 127.181 -14.563 1.00 39.65 ? 22  LYS A NZ  1 
ATOM   103  N N   . PHE A 1 23  ? 27.359 123.794 -20.081 1.00 23.52 ? 23  PHE A N   1 
ATOM   104  C CA  . PHE A 1 23  ? 26.727 123.187 -21.250 1.00 22.23 ? 23  PHE A CA  1 
ATOM   105  C C   . PHE A 1 23  ? 26.279 124.229 -22.279 1.00 23.72 ? 23  PHE A C   1 
ATOM   106  O O   . PHE A 1 23  ? 26.189 123.934 -23.468 1.00 22.27 ? 23  PHE A O   1 
ATOM   107  C CB  . PHE A 1 23  ? 25.516 122.344 -20.843 1.00 21.20 ? 23  PHE A CB  1 
ATOM   108  C CG  . PHE A 1 23  ? 25.859 121.141 -20.013 1.00 20.68 ? 23  PHE A CG  1 
ATOM   109  C CD1 . PHE A 1 23  ? 25.495 121.079 -18.674 1.00 20.30 ? 23  PHE A CD1 1 
ATOM   110  C CD2 . PHE A 1 23  ? 26.527 120.058 -20.574 1.00 20.03 ? 23  PHE A CD2 1 
ATOM   111  C CE1 . PHE A 1 23  ? 25.787 119.969 -17.912 1.00 16.67 ? 23  PHE A CE1 1 
ATOM   112  C CE2 . PHE A 1 23  ? 26.821 118.940 -19.811 1.00 17.95 ? 23  PHE A CE2 1 
ATOM   113  C CZ  . PHE A 1 23  ? 26.452 118.895 -18.481 1.00 19.91 ? 23  PHE A CZ  1 
ATOM   114  N N   . ASP A 1 24  ? 25.993 125.444 -21.815 1.00 25.75 ? 24  ASP A N   1 
ATOM   115  C CA  . ASP A 1 24  ? 25.559 126.527 -22.698 1.00 28.06 ? 24  ASP A CA  1 
ATOM   116  C C   . ASP A 1 24  ? 26.691 126.992 -23.624 1.00 29.21 ? 24  ASP A C   1 
ATOM   117  O O   . ASP A 1 24  ? 26.451 127.659 -24.632 1.00 29.61 ? 24  ASP A O   1 
ATOM   118  C CB  . ASP A 1 24  ? 25.040 127.711 -21.872 1.00 28.96 ? 24  ASP A CB  1 
ATOM   119  C CG  . ASP A 1 24  ? 23.998 127.289 -20.852 1.00 31.25 ? 24  ASP A CG  1 
ATOM   120  O OD1 . ASP A 1 24  ? 24.375 126.874 -19.729 1.00 33.23 ? 24  ASP A OD1 1 
ATOM   121  O OD2 . ASP A 1 24  ? 22.799 127.351 -21.184 1.00 30.75 ? 24  ASP A OD2 1 
ATOM   122  N N   . ASP A 1 25  ? 27.925 126.630 -23.290 1.00 29.11 ? 25  ASP A N   1 
ATOM   123  C CA  . ASP A 1 25  ? 29.061 127.019 -24.114 1.00 28.42 ? 25  ASP A CA  1 
ATOM   124  C C   . ASP A 1 25  ? 29.524 125.910 -25.053 1.00 27.77 ? 25  ASP A C   1 
ATOM   125  O O   . ASP A 1 25  ? 30.515 126.063 -25.766 1.00 24.92 ? 25  ASP A O   1 
ATOM   126  C CB  . ASP A 1 25  ? 30.213 127.478 -23.221 1.00 29.06 ? 25  ASP A CB  1 
ATOM   127  C CG  . ASP A 1 25  ? 29.916 128.801 -22.535 1.00 29.58 ? 25  ASP A CG  1 
ATOM   128  O OD1 . ASP A 1 25  ? 29.434 129.723 -23.226 1.00 30.64 ? 25  ASP A OD1 1 
ATOM   129  O OD2 . ASP A 1 25  ? 30.168 128.926 -21.320 1.00 28.89 ? 25  ASP A OD2 1 
ATOM   130  N N   . MET A 1 26  ? 28.788 124.803 -25.059 1.00 28.16 ? 26  MET A N   1 
ATOM   131  C CA  . MET A 1 26  ? 29.123 123.665 -25.900 1.00 29.15 ? 26  MET A CA  1 
ATOM   132  C C   . MET A 1 26  ? 28.419 123.676 -27.253 1.00 30.18 ? 26  MET A C   1 
ATOM   133  O O   . MET A 1 26  ? 28.592 122.760 -28.062 1.00 30.61 ? 26  MET A O   1 
ATOM   134  C CB  . MET A 1 26  ? 28.804 122.367 -25.158 1.00 29.67 ? 26  MET A CB  1 
ATOM   135  C CG  . MET A 1 26  ? 29.776 122.067 -24.025 1.00 28.81 ? 26  MET A CG  1 
ATOM   136  S SD  . MET A 1 26  ? 29.299 120.624 -23.069 1.00 29.29 ? 26  MET A SD  1 
ATOM   137  C CE  . MET A 1 26  ? 30.488 120.694 -21.752 1.00 25.51 ? 26  MET A CE  1 
ATOM   138  N N   . GLU A 1 27  ? 27.629 124.714 -27.505 1.00 29.98 ? 27  GLU A N   1 
ATOM   139  C CA  . GLU A 1 27  ? 26.919 124.818 -28.771 1.00 29.26 ? 27  GLU A CA  1 
ATOM   140  C C   . GLU A 1 27  ? 26.113 123.556 -29.069 1.00 28.04 ? 27  GLU A C   1 
ATOM   141  O O   . GLU A 1 27  ? 26.050 123.080 -30.199 1.00 25.43 ? 27  GLU A O   1 
ATOM   142  C CB  . GLU A 1 27  ? 27.910 125.108 -29.895 1.00 30.03 ? 27  GLU A CB  1 
ATOM   143  C CG  . GLU A 1 27  ? 28.609 126.451 -29.712 1.00 31.99 ? 27  GLU A CG  1 
ATOM   144  C CD  . GLU A 1 27  ? 29.639 126.740 -30.787 1.00 35.72 ? 27  GLU A CD  1 
ATOM   145  O OE1 . GLU A 1 27  ? 30.745 126.154 -30.736 1.00 34.88 ? 27  GLU A OE1 1 
ATOM   146  O OE2 . GLU A 1 27  ? 29.331 127.554 -31.688 1.00 37.82 ? 27  GLU A OE2 1 
ATOM   147  N N   . LEU A 1 28  ? 25.493 123.028 -28.023 1.00 27.76 ? 28  LEU A N   1 
ATOM   148  C CA  . LEU A 1 28  ? 24.656 121.849 -28.130 1.00 28.54 ? 28  LEU A CA  1 
ATOM   149  C C   . LEU A 1 28  ? 23.403 122.188 -28.935 1.00 29.06 ? 28  LEU A C   1 
ATOM   150  O O   . LEU A 1 28  ? 23.075 123.357 -29.149 1.00 28.73 ? 28  LEU A O   1 
ATOM   151  C CB  . LEU A 1 28  ? 24.231 121.387 -26.731 1.00 27.39 ? 28  LEU A CB  1 
ATOM   152  C CG  . LEU A 1 28  ? 24.917 120.201 -26.061 1.00 28.63 ? 28  LEU A CG  1 
ATOM   153  C CD1 . LEU A 1 28  ? 26.421 120.258 -26.281 1.00 28.01 ? 28  LEU A CD1 1 
ATOM   154  C CD2 . LEU A 1 28  ? 24.567 120.200 -24.585 1.00 25.66 ? 28  LEU A CD2 1 
ATOM   155  N N   . ASP A 1 29  ? 22.706 121.145 -29.367 1.00 30.57 ? 29  ASP A N   1 
ATOM   156  C CA  . ASP A 1 29  ? 21.459 121.294 -30.097 1.00 29.71 ? 29  ASP A CA  1 
ATOM   157  C C   . ASP A 1 29  ? 20.395 121.679 -29.063 1.00 28.62 ? 29  ASP A C   1 
ATOM   158  O O   . ASP A 1 29  ? 20.318 121.076 -27.997 1.00 24.17 ? 29  ASP A O   1 
ATOM   159  C CB  . ASP A 1 29  ? 21.110 119.966 -30.763 1.00 30.56 ? 29  ASP A CB  1 
ATOM   160  C CG  . ASP A 1 29  ? 19.774 119.994 -31.469 1.00 32.75 ? 29  ASP A CG  1 
ATOM   161  O OD1 . ASP A 1 29  ? 18.730 119.954 -30.787 1.00 34.84 ? 29  ASP A OD1 1 
ATOM   162  O OD2 . ASP A 1 29  ? 19.767 120.052 -32.710 1.00 33.47 ? 29  ASP A OD2 1 
ATOM   163  N N   . GLU A 1 30  ? 19.598 122.695 -29.388 1.00 29.71 ? 30  GLU A N   1 
ATOM   164  C CA  . GLU A 1 30  ? 18.527 123.205 -28.524 1.00 30.66 ? 30  GLU A CA  1 
ATOM   165  C C   . GLU A 1 30  ? 17.739 122.089 -27.836 1.00 30.06 ? 30  GLU A C   1 
ATOM   166  O O   . GLU A 1 30  ? 17.605 122.066 -26.606 1.00 27.75 ? 30  GLU A O   1 
ATOM   167  C CB  . GLU A 1 30  ? 17.545 124.054 -29.342 1.00 33.56 ? 30  GLU A CB  1 
ATOM   168  C CG  . GLU A 1 30  ? 18.110 124.644 -30.640 1.00 39.45 ? 30  GLU A CG  1 
ATOM   169  C CD  . GLU A 1 30  ? 18.545 123.581 -31.664 1.00 42.36 ? 30  GLU A CD  1 
ATOM   170  O OE1 . GLU A 1 30  ? 17.823 122.566 -31.840 1.00 41.96 ? 30  GLU A OE1 1 
ATOM   171  O OE2 . GLU A 1 30  ? 19.610 123.772 -32.301 1.00 41.91 ? 30  GLU A OE2 1 
ATOM   172  N N   . GLN A 1 31  ? 17.203 121.174 -28.636 1.00 29.47 ? 31  GLN A N   1 
ATOM   173  C CA  . GLN A 1 31  ? 16.435 120.064 -28.093 1.00 29.50 ? 31  GLN A CA  1 
ATOM   174  C C   . GLN A 1 31  ? 17.279 119.265 -27.118 1.00 27.63 ? 31  GLN A C   1 
ATOM   175  O O   . GLN A 1 31  ? 16.806 118.897 -26.041 1.00 28.55 ? 31  GLN A O   1 
ATOM   176  C CB  . GLN A 1 31  ? 15.947 119.150 -29.214 1.00 32.00 ? 31  GLN A CB  1 
ATOM   177  C CG  . GLN A 1 31  ? 15.021 119.838 -30.196 1.00 37.15 ? 31  GLN A CG  1 
ATOM   178  C CD  . GLN A 1 31  ? 13.926 120.612 -29.495 1.00 39.60 ? 31  GLN A CD  1 
ATOM   179  O OE1 . GLN A 1 31  ? 13.230 120.080 -28.625 1.00 43.78 ? 31  GLN A OE1 1 
ATOM   180  N NE2 . GLN A 1 31  ? 13.766 121.875 -29.867 1.00 42.56 ? 31  GLN A NE2 1 
ATOM   181  N N   . LEU A 1 32  ? 18.529 119.006 -27.499 1.00 25.70 ? 32  LEU A N   1 
ATOM   182  C CA  . LEU A 1 32  ? 19.462 118.239 -26.664 1.00 22.74 ? 32  LEU A CA  1 
ATOM   183  C C   . LEU A 1 32  ? 19.710 118.974 -25.349 1.00 21.68 ? 32  LEU A C   1 
ATOM   184  O O   . LEU A 1 32  ? 19.627 118.384 -24.270 1.00 19.77 ? 32  LEU A O   1 
ATOM   185  C CB  . LEU A 1 32  ? 20.790 118.034 -27.406 1.00 20.22 ? 32  LEU A CB  1 
ATOM   186  C CG  . LEU A 1 32  ? 21.956 117.369 -26.667 1.00 21.47 ? 32  LEU A CG  1 
ATOM   187  C CD1 . LEU A 1 32  ? 21.540 115.981 -26.175 1.00 22.00 ? 32  LEU A CD1 1 
ATOM   188  C CD2 . LEU A 1 32  ? 23.155 117.261 -27.599 1.00 20.88 ? 32  LEU A CD2 1 
ATOM   189  N N   . LEU A 1 33  ? 20.017 120.267 -25.448 1.00 21.88 ? 33  LEU A N   1 
ATOM   190  C CA  . LEU A 1 33  ? 20.260 121.090 -24.268 1.00 22.40 ? 33  LEU A CA  1 
ATOM   191  C C   . LEU A 1 33  ? 19.080 120.979 -23.297 1.00 23.42 ? 33  LEU A C   1 
ATOM   192  O O   . LEU A 1 33  ? 19.271 120.902 -22.085 1.00 25.00 ? 33  LEU A O   1 
ATOM   193  C CB  . LEU A 1 33  ? 20.471 122.551 -24.672 1.00 19.95 ? 33  LEU A CB  1 
ATOM   194  C CG  . LEU A 1 33  ? 20.836 123.543 -23.566 1.00 18.55 ? 33  LEU A CG  1 
ATOM   195  C CD1 . LEU A 1 33  ? 21.966 122.996 -22.719 1.00 19.36 ? 33  LEU A CD1 1 
ATOM   196  C CD2 . LEU A 1 33  ? 21.238 124.861 -24.205 1.00 17.24 ? 33  LEU A CD2 1 
ATOM   197  N N   . ARG A 1 34  ? 17.862 120.955 -23.829 1.00 22.79 ? 34  ARG A N   1 
ATOM   198  C CA  . ARG A 1 34  ? 16.687 120.837 -22.971 1.00 24.06 ? 34  ARG A CA  1 
ATOM   199  C C   . ARG A 1 34  ? 16.718 119.494 -22.252 1.00 22.39 ? 34  ARG A C   1 
ATOM   200  O O   . ARG A 1 34  ? 16.354 119.403 -21.078 1.00 21.18 ? 34  ARG A O   1 
ATOM   201  C CB  . ARG A 1 34  ? 15.388 120.982 -23.784 1.00 24.33 ? 34  ARG A CB  1 
ATOM   202  C CG  . ARG A 1 34  ? 15.132 122.402 -24.279 1.00 25.57 ? 34  ARG A CG  1 
ATOM   203  C CD  . ARG A 1 34  ? 13.744 122.568 -24.900 1.00 27.44 ? 34  ARG A CD  1 
ATOM   204  N NE  . ARG A 1 34  ? 12.673 122.192 -23.975 1.00 28.68 ? 34  ARG A NE  1 
ATOM   205  C CZ  . ARG A 1 34  ? 11.374 122.316 -24.243 1.00 30.77 ? 34  ARG A CZ  1 
ATOM   206  N NH1 . ARG A 1 34  ? 10.973 122.816 -25.408 1.00 30.86 ? 34  ARG A NH1 1 
ATOM   207  N NH2 . ARG A 1 34  ? 10.473 121.922 -23.353 1.00 29.52 ? 34  ARG A NH2 1 
ATOM   208  N N   . GLY A 1 35  ? 17.171 118.460 -22.961 1.00 23.30 ? 35  GLY A N   1 
ATOM   209  C CA  . GLY A 1 35  ? 17.266 117.134 -22.375 1.00 22.08 ? 35  GLY A CA  1 
ATOM   210  C C   . GLY A 1 35  ? 18.260 117.119 -21.232 1.00 23.27 ? 35  GLY A C   1 
ATOM   211  O O   . GLY A 1 35  ? 17.961 116.606 -20.152 1.00 24.31 ? 35  GLY A O   1 
ATOM   212  N N   . VAL A 1 36  ? 19.432 117.712 -21.458 1.00 23.65 ? 36  VAL A N   1 
ATOM   213  C CA  . VAL A 1 36  ? 20.491 117.763 -20.449 1.00 22.80 ? 36  VAL A CA  1 
ATOM   214  C C   . VAL A 1 36  ? 20.017 118.403 -19.132 1.00 23.71 ? 36  VAL A C   1 
ATOM   215  O O   . VAL A 1 36  ? 20.203 117.831 -18.057 1.00 22.34 ? 36  VAL A O   1 
ATOM   216  C CB  . VAL A 1 36  ? 21.736 118.508 -21.005 1.00 21.57 ? 36  VAL A CB  1 
ATOM   217  C CG1 . VAL A 1 36  ? 22.856 118.508 -19.983 1.00 21.24 ? 36  VAL A CG1 1 
ATOM   218  C CG2 . VAL A 1 36  ? 22.205 117.845 -22.285 1.00 18.19 ? 36  VAL A CG2 1 
ATOM   219  N N   . PHE A 1 37  ? 19.401 119.578 -19.204 1.00 24.81 ? 37  PHE A N   1 
ATOM   220  C CA  . PHE A 1 37  ? 18.900 120.212 -17.980 1.00 26.72 ? 37  PHE A CA  1 
ATOM   221  C C   . PHE A 1 37  ? 17.683 119.454 -17.441 1.00 26.83 ? 37  PHE A C   1 
ATOM   222  O O   . PHE A 1 37  ? 17.516 119.305 -16.230 1.00 27.59 ? 37  PHE A O   1 
ATOM   223  C CB  . PHE A 1 37  ? 18.511 121.667 -18.227 1.00 25.72 ? 37  PHE A CB  1 
ATOM   224  C CG  . PHE A 1 37  ? 19.662 122.550 -18.598 1.00 27.60 ? 37  PHE A CG  1 
ATOM   225  C CD1 . PHE A 1 37  ? 20.887 122.415 -17.966 1.00 27.73 ? 37  PHE A CD1 1 
ATOM   226  C CD2 . PHE A 1 37  ? 19.514 123.532 -19.571 1.00 27.77 ? 37  PHE A CD2 1 
ATOM   227  C CE1 . PHE A 1 37  ? 21.950 123.245 -18.300 1.00 30.42 ? 37  PHE A CE1 1 
ATOM   228  C CE2 . PHE A 1 37  ? 20.562 124.364 -19.910 1.00 28.50 ? 37  PHE A CE2 1 
ATOM   229  C CZ  . PHE A 1 37  ? 21.787 124.222 -19.275 1.00 29.56 ? 37  PHE A CZ  1 
ATOM   230  N N   . GLY A 1 38  ? 16.837 118.973 -18.348 1.00 27.46 ? 38  GLY A N   1 
ATOM   231  C CA  . GLY A 1 38  ? 15.657 118.233 -17.939 1.00 27.05 ? 38  GLY A CA  1 
ATOM   232  C C   . GLY A 1 38  ? 15.972 116.953 -17.184 1.00 26.70 ? 38  GLY A C   1 
ATOM   233  O O   . GLY A 1 38  ? 15.182 116.520 -16.354 1.00 26.66 ? 38  GLY A O   1 
ATOM   234  N N   . TYR A 1 39  ? 17.121 116.347 -17.472 1.00 26.01 ? 39  TYR A N   1 
ATOM   235  C CA  . TYR A 1 39  ? 17.530 115.105 -16.813 1.00 27.82 ? 39  TYR A CA  1 
ATOM   236  C C   . TYR A 1 39  ? 18.131 115.390 -15.432 1.00 27.36 ? 39  TYR A C   1 
ATOM   237  O O   . TYR A 1 39  ? 18.292 114.487 -14.612 1.00 26.91 ? 39  TYR A O   1 
ATOM   238  C CB  . TYR A 1 39  ? 18.546 114.358 -17.690 1.00 28.08 ? 39  TYR A CB  1 
ATOM   239  C CG  . TYR A 1 39  ? 18.962 112.994 -17.179 1.00 29.41 ? 39  TYR A CG  1 
ATOM   240  C CD1 . TYR A 1 39  ? 20.308 112.669 -17.039 1.00 31.04 ? 39  TYR A CD1 1 
ATOM   241  C CD2 . TYR A 1 39  ? 18.015 112.035 -16.825 1.00 30.66 ? 39  TYR A CD2 1 
ATOM   242  C CE1 . TYR A 1 39  ? 20.706 111.428 -16.556 1.00 32.62 ? 39  TYR A CE1 1 
ATOM   243  C CE2 . TYR A 1 39  ? 18.399 110.783 -16.340 1.00 30.98 ? 39  TYR A CE2 1 
ATOM   244  C CZ  . TYR A 1 39  ? 19.750 110.489 -16.207 1.00 33.58 ? 39  TYR A CZ  1 
ATOM   245  O OH  . TYR A 1 39  ? 20.154 109.266 -15.717 1.00 33.56 ? 39  TYR A OH  1 
ATOM   246  N N   . GLY A 1 40  ? 18.459 116.652 -15.180 1.00 27.24 ? 40  GLY A N   1 
ATOM   247  C CA  . GLY A 1 40  ? 19.022 117.019 -13.894 1.00 28.29 ? 40  GLY A CA  1 
ATOM   248  C C   . GLY A 1 40  ? 20.462 117.498 -13.926 1.00 28.72 ? 40  GLY A C   1 
ATOM   249  O O   . GLY A 1 40  ? 21.025 117.827 -12.885 1.00 28.71 ? 40  GLY A O   1 
ATOM   250  N N   . PHE A 1 41  ? 21.071 117.525 -15.104 1.00 28.75 ? 41  PHE A N   1 
ATOM   251  C CA  . PHE A 1 41  ? 22.442 117.994 -15.208 1.00 30.90 ? 41  PHE A CA  1 
ATOM   252  C C   . PHE A 1 41  ? 22.424 119.504 -15.012 1.00 31.71 ? 41  PHE A C   1 
ATOM   253  O O   . PHE A 1 41  ? 21.541 120.192 -15.530 1.00 33.08 ? 41  PHE A O   1 
ATOM   254  C CB  . PHE A 1 41  ? 23.032 117.652 -16.584 1.00 31.17 ? 41  PHE A CB  1 
ATOM   255  C CG  . PHE A 1 41  ? 23.469 116.216 -16.721 1.00 32.50 ? 41  PHE A CG  1 
ATOM   256  C CD1 . PHE A 1 41  ? 22.947 115.405 -17.722 1.00 31.97 ? 41  PHE A CD1 1 
ATOM   257  C CD2 . PHE A 1 41  ? 24.414 115.679 -15.854 1.00 32.09 ? 41  PHE A CD2 1 
ATOM   258  C CE1 . PHE A 1 41  ? 23.360 114.084 -17.855 1.00 32.26 ? 41  PHE A CE1 1 
ATOM   259  C CE2 . PHE A 1 41  ? 24.832 114.362 -15.981 1.00 31.52 ? 41  PHE A CE2 1 
ATOM   260  C CZ  . PHE A 1 41  ? 24.306 113.561 -16.981 1.00 31.78 ? 41  PHE A CZ  1 
ATOM   261  N N   . GLU A 1 42  ? 23.376 120.021 -14.244 1.00 32.20 ? 42  GLU A N   1 
ATOM   262  C CA  . GLU A 1 42  ? 23.444 121.460 -14.018 1.00 34.24 ? 42  GLU A CA  1 
ATOM   263  C C   . GLU A 1 42  ? 24.694 121.992 -14.684 1.00 33.46 ? 42  GLU A C   1 
ATOM   264  O O   . GLU A 1 42  ? 24.616 122.753 -15.642 1.00 34.31 ? 42  GLU A O   1 
ATOM   265  C CB  . GLU A 1 42  ? 23.445 121.770 -12.519 1.00 35.91 ? 42  GLU A CB  1 
ATOM   266  C CG  . GLU A 1 42  ? 22.105 121.472 -11.865 1.00 41.10 ? 42  GLU A CG  1 
ATOM   267  C CD  . GLU A 1 42  ? 20.954 122.232 -12.529 1.00 44.52 ? 42  GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 42  ? 20.860 123.467 -12.324 1.00 45.43 ? 42  GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 42  ? 20.155 121.597 -13.264 1.00 44.33 ? 42  GLU A OE2 1 
ATOM   270  N N   . GLU A 1 43  ? 25.849 121.582 -14.177 1.00 33.61 ? 43  GLU A N   1 
ATOM   271  C CA  . GLU A 1 43  ? 27.112 121.995 -14.763 1.00 33.29 ? 43  GLU A CA  1 
ATOM   272  C C   . GLU A 1 43  ? 27.905 120.729 -15.072 1.00 31.29 ? 43  GLU A C   1 
ATOM   273  O O   . GLU A 1 43  ? 27.778 119.726 -14.381 1.00 29.64 ? 43  GLU A O   1 
ATOM   274  C CB  . GLU A 1 43  ? 27.894 122.902 -13.812 1.00 35.12 ? 43  GLU A CB  1 
ATOM   275  C CG  . GLU A 1 43  ? 28.291 122.255 -12.501 1.00 39.92 ? 43  GLU A CG  1 
ATOM   276  C CD  . GLU A 1 43  ? 29.498 122.924 -11.878 1.00 41.74 ? 43  GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 43  ? 29.477 124.164 -11.704 1.00 43.82 ? 43  GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 43  ? 30.472 122.207 -11.564 1.00 43.55 ? 43  GLU A OE2 1 
ATOM   279  N N   . PRO A 1 44  ? 28.719 120.757 -16.135 1.00 31.02 ? 44  PRO A N   1 
ATOM   280  C CA  . PRO A 1 44  ? 29.528 119.600 -16.533 1.00 30.44 ? 44  PRO A CA  1 
ATOM   281  C C   . PRO A 1 44  ? 30.491 119.136 -15.441 1.00 29.68 ? 44  PRO A C   1 
ATOM   282  O O   . PRO A 1 44  ? 31.050 119.948 -14.709 1.00 29.58 ? 44  PRO A O   1 
ATOM   283  C CB  . PRO A 1 44  ? 30.286 120.108 -17.764 1.00 30.94 ? 44  PRO A CB  1 
ATOM   284  C CG  . PRO A 1 44  ? 29.402 121.204 -18.302 1.00 32.01 ? 44  PRO A CG  1 
ATOM   285  C CD  . PRO A 1 44  ? 28.933 121.893 -17.049 1.00 31.36 ? 44  PRO A CD  1 
ATOM   286  N N   . SER A 1 45  ? 30.687 117.828 -15.343 1.00 27.51 ? 45  SER A N   1 
ATOM   287  C CA  . SER A 1 45  ? 31.614 117.271 -14.370 1.00 26.86 ? 45  SER A CA  1 
ATOM   288  C C   . SER A 1 45  ? 33.023 117.486 -14.924 1.00 25.39 ? 45  SER A C   1 
ATOM   289  O O   . SER A 1 45  ? 33.177 117.983 -16.041 1.00 23.78 ? 45  SER A O   1 
ATOM   290  C CB  . SER A 1 45  ? 31.328 115.776 -14.161 1.00 27.54 ? 45  SER A CB  1 
ATOM   291  O OG  . SER A 1 45  ? 31.409 115.058 -15.383 1.00 31.49 ? 45  SER A OG  1 
ATOM   292  N N   . ALA A 1 46  ? 34.043 117.110 -14.154 1.00 24.77 ? 46  ALA A N   1 
ATOM   293  C CA  . ALA A 1 46  ? 35.432 117.290 -14.577 1.00 24.74 ? 46  ALA A CA  1 
ATOM   294  C C   . ALA A 1 46  ? 35.772 116.569 -15.886 1.00 25.39 ? 46  ALA A C   1 
ATOM   295  O O   . ALA A 1 46  ? 36.501 117.103 -16.720 1.00 25.35 ? 46  ALA A O   1 
ATOM   296  C CB  . ALA A 1 46  ? 36.378 116.842 -13.470 1.00 23.73 ? 46  ALA A CB  1 
ATOM   297  N N   . ILE A 1 47  ? 35.260 115.355 -16.067 1.00 26.59 ? 47  ILE A N   1 
ATOM   298  C CA  . ILE A 1 47  ? 35.520 114.631 -17.304 1.00 24.65 ? 47  ILE A CA  1 
ATOM   299  C C   . ILE A 1 47  ? 34.684 115.262 -18.420 1.00 23.87 ? 47  ILE A C   1 
ATOM   300  O O   . ILE A 1 47  ? 35.135 115.369 -19.559 1.00 21.94 ? 47  ILE A O   1 
ATOM   301  C CB  . ILE A 1 47  ? 35.190 113.108 -17.157 1.00 24.99 ? 47  ILE A CB  1 
ATOM   302  C CG1 . ILE A 1 47  ? 36.486 112.288 -17.028 1.00 26.59 ? 47  ILE A CG1 1 
ATOM   303  C CG2 . ILE A 1 47  ? 34.469 112.595 -18.388 1.00 23.32 ? 47  ILE A CG2 1 
ATOM   304  C CD1 . ILE A 1 47  ? 37.471 112.784 -15.985 1.00 26.33 ? 47  ILE A CD1 1 
ATOM   305  N N   . GLN A 1 48  ? 33.470 115.692 -18.083 1.00 25.51 ? 48  GLN A N   1 
ATOM   306  C CA  . GLN A 1 48  ? 32.575 116.306 -19.066 1.00 26.08 ? 48  GLN A CA  1 
ATOM   307  C C   . GLN A 1 48  ? 33.120 117.617 -19.610 1.00 26.13 ? 48  GLN A C   1 
ATOM   308  O O   . GLN A 1 48  ? 32.996 117.893 -20.800 1.00 26.22 ? 48  GLN A O   1 
ATOM   309  C CB  . GLN A 1 48  ? 31.178 116.514 -18.464 1.00 26.96 ? 48  GLN A CB  1 
ATOM   310  C CG  . GLN A 1 48  ? 30.321 115.230 -18.421 1.00 28.11 ? 48  GLN A CG  1 
ATOM   311  C CD  . GLN A 1 48  ? 29.069 115.348 -17.540 1.00 29.50 ? 48  GLN A CD  1 
ATOM   312  O OE1 . GLN A 1 48  ? 28.211 114.464 -17.539 1.00 32.19 ? 48  GLN A OE1 1 
ATOM   313  N NE2 . GLN A 1 48  ? 28.971 116.431 -16.786 1.00 30.63 ? 48  GLN A NE2 1 
ATOM   314  N N   . GLN A 1 49  ? 33.743 118.412 -18.746 1.00 26.90 ? 49  GLN A N   1 
ATOM   315  C CA  . GLN A 1 49  ? 34.312 119.699 -19.155 1.00 28.12 ? 49  GLN A CA  1 
ATOM   316  C C   . GLN A 1 49  ? 35.450 119.494 -20.144 1.00 27.93 ? 49  GLN A C   1 
ATOM   317  O O   . GLN A 1 49  ? 35.838 120.420 -20.853 1.00 26.16 ? 49  GLN A O   1 
ATOM   318  C CB  . GLN A 1 49  ? 34.901 120.448 -17.955 1.00 28.63 ? 49  GLN A CB  1 
ATOM   319  C CG  . GLN A 1 49  ? 33.955 120.809 -16.830 1.00 27.36 ? 49  GLN A CG  1 
ATOM   320  C CD  . GLN A 1 49  ? 34.713 120.971 -15.519 1.00 28.35 ? 49  GLN A CD  1 
ATOM   321  O OE1 . GLN A 1 49  ? 35.942 121.067 -15.514 1.00 27.68 ? 49  GLN A OE1 1 
ATOM   322  N NE2 . GLN A 1 49  ? 33.989 121.000 -14.407 1.00 27.22 ? 49  GLN A NE2 1 
ATOM   323  N N   . ARG A 1 50  ? 35.981 118.275 -20.170 1.00 27.60 ? 50  ARG A N   1 
ATOM   324  C CA  . ARG A 1 50  ? 37.120 117.941 -21.018 1.00 27.60 ? 50  ARG A CA  1 
ATOM   325  C C   . ARG A 1 50  ? 36.875 116.930 -22.138 1.00 26.68 ? 50  ARG A C   1 
ATOM   326  O O   . ARG A 1 50  ? 37.517 116.997 -23.181 1.00 26.31 ? 50  ARG A O   1 
ATOM   327  C CB  . ARG A 1 50  ? 38.264 117.426 -20.136 1.00 26.37 ? 50  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 50  ? 38.752 118.426 -19.119 1.00 26.78 ? 50  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 50  ? 39.790 117.820 -18.209 1.00 29.02 ? 50  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 50  ? 40.344 118.810 -17.290 1.00 30.33 ? 50  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 50  ? 39.629 119.522 -16.421 1.00 31.45 ? 50  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 50  ? 38.313 119.364 -16.336 1.00 31.36 ? 50  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 50  ? 40.234 120.400 -15.635 1.00 30.06 ? 50  ARG A NH2 1 
ATOM   334  N N   . ALA A 1 51  ? 35.948 116.003 -21.926 1.00 26.00 ? 51  ALA A N   1 
ATOM   335  C CA  . ALA A 1 51  ? 35.684 114.969 -22.917 1.00 24.70 ? 51  ALA A CA  1 
ATOM   336  C C   . ALA A 1 51  ? 34.552 115.208 -23.922 1.00 24.08 ? 51  ALA A C   1 
ATOM   337  O O   . ALA A 1 51  ? 34.565 114.614 -25.004 1.00 23.33 ? 51  ALA A O   1 
ATOM   338  C CB  . ALA A 1 51  ? 35.460 113.645 -22.202 1.00 22.95 ? 51  ALA A CB  1 
ATOM   339  N N   . ILE A 1 52  ? 33.588 116.063 -23.586 1.00 21.81 ? 52  ILE A N   1 
ATOM   340  C CA  . ILE A 1 52  ? 32.459 116.295 -24.483 1.00 21.54 ? 52  ILE A CA  1 
ATOM   341  C C   . ILE A 1 52  ? 32.764 116.954 -25.823 1.00 20.83 ? 52  ILE A C   1 
ATOM   342  O O   . ILE A 1 52  ? 32.343 116.453 -26.867 1.00 20.38 ? 52  ILE A O   1 
ATOM   343  C CB  . ILE A 1 52  ? 31.329 117.104 -23.795 1.00 20.84 ? 52  ILE A CB  1 
ATOM   344  C CG1 . ILE A 1 52  ? 30.630 116.248 -22.741 1.00 20.35 ? 52  ILE A CG1 1 
ATOM   345  C CG2 . ILE A 1 52  ? 30.285 117.526 -24.820 1.00 20.36 ? 52  ILE A CG2 1 
ATOM   346  C CD1 . ILE A 1 52  ? 29.529 116.991 -21.997 1.00 21.32 ? 52  ILE A CD1 1 
ATOM   347  N N   . MET A 1 53  ? 33.491 118.065 -25.803 1.00 20.76 ? 53  MET A N   1 
ATOM   348  C CA  . MET A 1 53  ? 33.792 118.766 -27.037 1.00 21.32 ? 53  MET A CA  1 
ATOM   349  C C   . MET A 1 53  ? 34.703 117.994 -27.992 1.00 20.85 ? 53  MET A C   1 
ATOM   350  O O   . MET A 1 53  ? 34.510 118.047 -29.203 1.00 19.93 ? 53  MET A O   1 
ATOM   351  C CB  . MET A 1 53  ? 34.364 120.158 -26.734 1.00 24.78 ? 53  MET A CB  1 
ATOM   352  C CG  . MET A 1 53  ? 33.355 121.140 -26.094 1.00 24.81 ? 53  MET A CG  1 
ATOM   353  S SD  . MET A 1 53  ? 31.687 121.186 -26.857 1.00 28.05 ? 53  MET A SD  1 
ATOM   354  C CE  . MET A 1 53  ? 32.035 121.868 -28.467 1.00 26.24 ? 53  MET A CE  1 
ATOM   355  N N   . PRO A 1 54  ? 35.724 117.291 -27.472 1.00 20.57 ? 54  PRO A N   1 
ATOM   356  C CA  . PRO A 1 54  ? 36.558 116.553 -28.433 1.00 20.65 ? 54  PRO A CA  1 
ATOM   357  C C   . PRO A 1 54  ? 35.762 115.458 -29.162 1.00 19.92 ? 54  PRO A C   1 
ATOM   358  O O   . PRO A 1 54  ? 35.984 115.211 -30.343 1.00 22.01 ? 54  PRO A O   1 
ATOM   359  C CB  . PRO A 1 54  ? 37.708 115.996 -27.574 1.00 20.65 ? 54  PRO A CB  1 
ATOM   360  C CG  . PRO A 1 54  ? 37.189 116.072 -26.152 1.00 23.36 ? 54  PRO A CG  1 
ATOM   361  C CD  . PRO A 1 54  ? 36.349 117.331 -26.140 1.00 20.65 ? 54  PRO A CD  1 
ATOM   362  N N   . ILE A 1 55  ? 34.829 114.810 -28.472 1.00 17.80 ? 55  ILE A N   1 
ATOM   363  C CA  . ILE A 1 55  ? 34.015 113.782 -29.116 1.00 18.18 ? 55  ILE A CA  1 
ATOM   364  C C   . ILE A 1 55  ? 33.114 114.462 -30.162 1.00 19.69 ? 55  ILE A C   1 
ATOM   365  O O   . ILE A 1 55  ? 33.115 114.108 -31.346 1.00 21.41 ? 55  ILE A O   1 
ATOM   366  C CB  . ILE A 1 55  ? 33.109 113.037 -28.100 1.00 16.63 ? 55  ILE A CB  1 
ATOM   367  C CG1 . ILE A 1 55  ? 33.957 112.362 -27.025 1.00 15.20 ? 55  ILE A CG1 1 
ATOM   368  C CG2 . ILE A 1 55  ? 32.286 111.978 -28.818 1.00 16.87 ? 55  ILE A CG2 1 
ATOM   369  C CD1 . ILE A 1 55  ? 33.135 111.677 -25.938 1.00 13.84 ? 55  ILE A CD1 1 
ATOM   370  N N   . ILE A 1 56  ? 32.340 115.444 -29.717 1.00 18.49 ? 56  ILE A N   1 
ATOM   371  C CA  . ILE A 1 56  ? 31.460 116.173 -30.622 1.00 18.56 ? 56  ILE A CA  1 
ATOM   372  C C   . ILE A 1 56  ? 32.217 116.558 -31.892 1.00 19.36 ? 56  ILE A C   1 
ATOM   373  O O   . ILE A 1 56  ? 31.667 116.519 -32.988 1.00 20.50 ? 56  ILE A O   1 
ATOM   374  C CB  . ILE A 1 56  ? 30.916 117.469 -29.945 1.00 16.95 ? 56  ILE A CB  1 
ATOM   375  C CG1 . ILE A 1 56  ? 29.928 117.095 -28.836 1.00 16.76 ? 56  ILE A CG1 1 
ATOM   376  C CG2 . ILE A 1 56  ? 30.254 118.390 -30.987 1.00 13.39 ? 56  ILE A CG2 1 
ATOM   377  C CD1 . ILE A 1 56  ? 29.435 118.302 -28.041 1.00 19.65 ? 56  ILE A CD1 1 
ATOM   378  N N   . GLU A 1 57  ? 33.487 116.905 -31.735 1.00 19.52 ? 57  GLU A N   1 
ATOM   379  C CA  . GLU A 1 57  ? 34.317 117.336 -32.855 1.00 22.47 ? 57  GLU A CA  1 
ATOM   380  C C   . GLU A 1 57  ? 34.926 116.281 -33.785 1.00 23.49 ? 57  GLU A C   1 
ATOM   381  O O   . GLU A 1 57  ? 35.636 116.627 -34.728 1.00 24.72 ? 57  GLU A O   1 
ATOM   382  C CB  . GLU A 1 57  ? 35.417 118.247 -32.325 1.00 21.63 ? 57  GLU A CB  1 
ATOM   383  C CG  . GLU A 1 57  ? 34.937 119.651 -32.056 1.00 23.62 ? 57  GLU A CG  1 
ATOM   384  C CD  . GLU A 1 57  ? 35.726 120.342 -30.964 1.00 24.86 ? 57  GLU A CD  1 
ATOM   385  O OE1 . GLU A 1 57  ? 36.887 119.947 -30.720 1.00 24.79 ? 57  GLU A OE1 1 
ATOM   386  O OE2 . GLU A 1 57  ? 35.182 121.289 -30.359 1.00 25.77 ? 57  GLU A OE2 1 
ATOM   387  N N   . GLY A 1 58  ? 34.672 115.004 -33.522 1.00 25.91 ? 58  GLY A N   1 
ATOM   388  C CA  . GLY A 1 58  ? 35.196 113.962 -34.395 1.00 24.81 ? 58  GLY A CA  1 
ATOM   389  C C   . GLY A 1 58  ? 36.472 113.233 -34.009 1.00 25.24 ? 58  GLY A C   1 
ATOM   390  O O   . GLY A 1 58  ? 36.809 112.235 -34.641 1.00 25.27 ? 58  GLY A O   1 
ATOM   391  N N   . HIS A 1 59  ? 37.185 113.705 -32.988 1.00 25.31 ? 59  HIS A N   1 
ATOM   392  C CA  . HIS A 1 59  ? 38.431 113.054 -32.571 1.00 23.77 ? 59  HIS A CA  1 
ATOM   393  C C   . HIS A 1 59  ? 38.195 111.701 -31.913 1.00 23.09 ? 59  HIS A C   1 
ATOM   394  O O   . HIS A 1 59  ? 37.180 111.506 -31.256 1.00 23.24 ? 59  HIS A O   1 
ATOM   395  C CB  . HIS A 1 59  ? 39.192 113.916 -31.557 1.00 23.78 ? 59  HIS A CB  1 
ATOM   396  C CG  . HIS A 1 59  ? 39.611 115.259 -32.071 1.00 25.11 ? 59  HIS A CG  1 
ATOM   397  N ND1 . HIS A 1 59  ? 38.817 116.380 -31.963 1.00 26.15 ? 59  HIS A ND1 1 
ATOM   398  C CD2 . HIS A 1 59  ? 40.746 115.660 -32.688 1.00 24.89 ? 59  HIS A CD2 1 
ATOM   399  C CE1 . HIS A 1 59  ? 39.444 117.416 -32.491 1.00 25.28 ? 59  HIS A CE1 1 
ATOM   400  N NE2 . HIS A 1 59  ? 40.618 117.006 -32.940 1.00 25.83 ? 59  HIS A NE2 1 
ATOM   401  N N   . ASP A 1 60  ? 39.130 110.770 -32.097 1.00 23.23 ? 60  ASP A N   1 
ATOM   402  C CA  . ASP A 1 60  ? 39.051 109.464 -31.438 1.00 22.22 ? 60  ASP A CA  1 
ATOM   403  C C   . ASP A 1 60  ? 39.358 109.845 -30.001 1.00 22.36 ? 60  ASP A C   1 
ATOM   404  O O   . ASP A 1 60  ? 40.238 110.666 -29.770 1.00 20.82 ? 60  ASP A O   1 
ATOM   405  C CB  . ASP A 1 60  ? 40.144 108.495 -31.927 1.00 21.00 ? 60  ASP A CB  1 
ATOM   406  C CG  . ASP A 1 60  ? 39.880 107.962 -33.323 1.00 23.14 ? 60  ASP A CG  1 
ATOM   407  O OD1 . ASP A 1 60  ? 38.699 107.891 -33.727 1.00 25.12 ? 60  ASP A OD1 1 
ATOM   408  O OD2 . ASP A 1 60  ? 40.856 107.592 -34.015 1.00 23.27 ? 60  ASP A OD2 1 
ATOM   409  N N   . VAL A 1 61  ? 38.665 109.253 -29.031 1.00 23.29 ? 61  VAL A N   1 
ATOM   410  C CA  . VAL A 1 61  ? 38.901 109.629 -27.643 1.00 23.07 ? 61  VAL A CA  1 
ATOM   411  C C   . VAL A 1 61  ? 39.089 108.486 -26.655 1.00 23.31 ? 61  VAL A C   1 
ATOM   412  O O   . VAL A 1 61  ? 38.314 107.530 -26.623 1.00 23.43 ? 61  VAL A O   1 
ATOM   413  C CB  . VAL A 1 61  ? 37.744 110.531 -27.128 1.00 23.21 ? 61  VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 61  ? 38.027 111.004 -25.710 1.00 21.75 ? 61  VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 61  ? 37.541 111.699 -28.070 1.00 20.97 ? 61  VAL A CG2 1 
ATOM   416  N N   . LEU A 1 62  ? 40.136 108.616 -25.850 1.00 25.00 ? 62  LEU A N   1 
ATOM   417  C CA  . LEU A 1 62  ? 40.487 107.669 -24.799 1.00 23.88 ? 62  LEU A CA  1 
ATOM   418  C C   . LEU A 1 62  ? 40.302 108.456 -23.508 1.00 23.73 ? 62  LEU A C   1 
ATOM   419  O O   . LEU A 1 62  ? 41.051 109.400 -23.240 1.00 23.29 ? 62  LEU A O   1 
ATOM   420  C CB  . LEU A 1 62  ? 41.954 107.258 -24.902 1.00 24.84 ? 62  LEU A CB  1 
ATOM   421  C CG  . LEU A 1 62  ? 42.466 106.579 -23.622 1.00 27.26 ? 62  LEU A CG  1 
ATOM   422  C CD1 . LEU A 1 62  ? 41.811 105.203 -23.472 1.00 26.44 ? 62  LEU A CD1 1 
ATOM   423  C CD2 . LEU A 1 62  ? 43.980 106.447 -23.674 1.00 27.42 ? 62  LEU A CD2 1 
ATOM   424  N N   . ALA A 1 63  ? 39.316 108.076 -22.708 1.00 23.19 ? 63  ALA A N   1 
ATOM   425  C CA  . ALA A 1 63  ? 39.050 108.794 -21.467 1.00 22.16 ? 63  ALA A CA  1 
ATOM   426  C C   . ALA A 1 63  ? 38.948 107.831 -20.317 1.00 21.72 ? 63  ALA A C   1 
ATOM   427  O O   . ALA A 1 63  ? 38.192 106.877 -20.375 1.00 21.03 ? 63  ALA A O   1 
ATOM   428  C CB  . ALA A 1 63  ? 37.748 109.603 -21.588 1.00 19.58 ? 63  ALA A CB  1 
ATOM   429  N N   . GLN A 1 64  ? 39.721 108.090 -19.272 1.00 23.03 ? 64  GLN A N   1 
ATOM   430  C CA  . GLN A 1 64  ? 39.712 107.254 -18.092 1.00 24.59 ? 64  GLN A CA  1 
ATOM   431  C C   . GLN A 1 64  ? 38.665 107.785 -17.114 1.00 26.66 ? 64  GLN A C   1 
ATOM   432  O O   . GLN A 1 64  ? 38.830 108.857 -16.532 1.00 27.16 ? 64  GLN A O   1 
ATOM   433  C CB  . GLN A 1 64  ? 41.099 107.258 -17.462 1.00 24.23 ? 64  GLN A CB  1 
ATOM   434  C CG  . GLN A 1 64  ? 41.210 106.509 -16.147 1.00 25.41 ? 64  GLN A CG  1 
ATOM   435  C CD  . GLN A 1 64  ? 42.641 106.127 -15.835 1.00 25.68 ? 64  GLN A CD  1 
ATOM   436  O OE1 . GLN A 1 64  ? 43.584 106.764 -16.317 1.00 26.70 ? 64  GLN A OE1 1 
ATOM   437  N NE2 . GLN A 1 64  ? 42.816 105.091 -15.022 1.00 22.98 ? 64  GLN A NE2 1 
ATOM   438  N N   . ALA A 1 65  ? 37.577 107.040 -16.944 1.00 28.48 ? 65  ALA A N   1 
ATOM   439  C CA  . ALA A 1 65  ? 36.511 107.467 -16.041 1.00 31.67 ? 65  ALA A CA  1 
ATOM   440  C C   . ALA A 1 65  ? 35.715 106.304 -15.442 1.00 33.18 ? 65  ALA A C   1 
ATOM   441  O O   . ALA A 1 65  ? 35.433 105.305 -16.108 1.00 35.36 ? 65  ALA A O   1 
ATOM   442  C CB  . ALA A 1 65  ? 35.568 108.434 -16.773 1.00 31.34 ? 65  ALA A CB  1 
ATOM   443  N N   . GLN A 1 66  ? 35.360 106.450 -14.172 1.00 35.59 ? 66  GLN A N   1 
ATOM   444  C CA  . GLN A 1 66  ? 34.596 105.438 -13.449 1.00 36.76 ? 66  GLN A CA  1 
ATOM   445  C C   . GLN A 1 66  ? 33.127 105.535 -13.850 1.00 36.29 ? 66  GLN A C   1 
ATOM   446  O O   . GLN A 1 66  ? 32.684 106.552 -14.384 1.00 36.01 ? 66  GLN A O   1 
ATOM   447  C CB  . GLN A 1 66  ? 34.730 105.674 -11.942 1.00 39.29 ? 66  GLN A CB  1 
ATOM   448  C CG  . GLN A 1 66  ? 34.789 104.409 -11.088 1.00 43.77 ? 66  GLN A CG  1 
ATOM   449  C CD  . GLN A 1 66  ? 33.736 103.387 -11.457 1.00 45.19 ? 66  GLN A CD  1 
ATOM   450  O OE1 . GLN A 1 66  ? 33.836 102.727 -12.493 1.00 46.70 ? 66  GLN A OE1 1 
ATOM   451  N NE2 . GLN A 1 66  ? 32.716 103.250 -10.612 1.00 46.12 ? 66  GLN A NE2 1 
ATOM   452  N N   . SER A 1 67  ? 32.367 104.482 -13.586 1.00 36.61 ? 67  SER A N   1 
ATOM   453  C CA  . SER A 1 67  ? 30.957 104.479 -13.929 1.00 37.07 ? 67  SER A CA  1 
ATOM   454  C C   . SER A 1 67  ? 30.219 105.591 -13.204 1.00 36.15 ? 67  SER A C   1 
ATOM   455  O O   . SER A 1 67  ? 30.619 106.021 -12.120 1.00 36.44 ? 67  SER A O   1 
ATOM   456  C CB  . SER A 1 67  ? 30.325 103.123 -13.595 1.00 39.05 ? 67  SER A CB  1 
ATOM   457  O OG  . SER A 1 67  ? 30.565 102.179 -14.633 1.00 41.68 ? 67  SER A OG  1 
ATOM   458  N N   . GLY A 1 68  ? 29.142 106.065 -13.818 1.00 35.52 ? 68  GLY A N   1 
ATOM   459  C CA  . GLY A 1 68  ? 28.371 107.120 -13.202 1.00 33.23 ? 68  GLY A CA  1 
ATOM   460  C C   . GLY A 1 68  ? 27.830 108.146 -14.171 1.00 32.19 ? 68  GLY A C   1 
ATOM   461  O O   . GLY A 1 68  ? 28.138 108.141 -15.355 1.00 30.09 ? 68  GLY A O   1 
ATOM   462  N N   . THR A 1 69  ? 27.009 109.033 -13.625 1.00 32.37 ? 69  THR A N   1 
ATOM   463  C CA  . THR A 1 69  ? 26.364 110.108 -14.358 1.00 32.61 ? 69  THR A CA  1 
ATOM   464  C C   . THR A 1 69  ? 27.319 110.991 -15.172 1.00 32.47 ? 69  THR A C   1 
ATOM   465  O O   . THR A 1 69  ? 26.924 111.563 -16.184 1.00 34.03 ? 69  THR A O   1 
ATOM   466  C CB  . THR A 1 69  ? 25.537 110.961 -13.362 1.00 32.59 ? 69  THR A CB  1 
ATOM   467  O OG1 . THR A 1 69  ? 24.152 110.621 -13.498 1.00 33.70 ? 69  THR A OG1 1 
ATOM   468  C CG2 . THR A 1 69  ? 25.748 112.442 -13.573 1.00 30.42 ? 69  THR A CG2 1 
ATOM   469  N N   . GLY A 1 70  ? 28.571 111.091 -14.742 1.00 31.35 ? 70  GLY A N   1 
ATOM   470  C CA  . GLY A 1 70  ? 29.525 111.910 -15.462 1.00 31.46 ? 70  GLY A CA  1 
ATOM   471  C C   . GLY A 1 70  ? 29.974 111.278 -16.766 1.00 30.69 ? 70  GLY A C   1 
ATOM   472  O O   . GLY A 1 70  ? 29.828 111.859 -17.844 1.00 31.19 ? 70  GLY A O   1 
ATOM   473  N N   . LYS A 1 71  ? 30.530 110.082 -16.654 1.00 29.04 ? 71  LYS A N   1 
ATOM   474  C CA  . LYS A 1 71  ? 31.016 109.327 -17.793 1.00 27.18 ? 71  LYS A CA  1 
ATOM   475  C C   . LYS A 1 71  ? 29.911 109.077 -18.827 1.00 27.93 ? 71  LYS A C   1 
ATOM   476  O O   . LYS A 1 71  ? 30.019 109.496 -19.979 1.00 28.76 ? 71  LYS A O   1 
ATOM   477  C CB  . LYS A 1 71  ? 31.561 107.994 -17.294 1.00 25.72 ? 71  LYS A CB  1 
ATOM   478  C CG  . LYS A 1 71  ? 32.252 107.141 -18.324 1.00 24.80 ? 71  LYS A CG  1 
ATOM   479  C CD  . LYS A 1 71  ? 32.428 105.718 -17.794 1.00 25.40 ? 71  LYS A CD  1 
ATOM   480  C CE  . LYS A 1 71  ? 31.075 105.040 -17.601 1.00 22.70 ? 71  LYS A CE  1 
ATOM   481  N NZ  . LYS A 1 71  ? 31.199 103.696 -16.998 1.00 24.70 ? 71  LYS A NZ  1 
ATOM   482  N N   . THR A 1 72  ? 28.849 108.393 -18.412 1.00 27.39 ? 72  THR A N   1 
ATOM   483  C CA  . THR A 1 72  ? 27.747 108.064 -19.315 1.00 26.55 ? 72  THR A CA  1 
ATOM   484  C C   . THR A 1 72  ? 27.208 109.306 -20.019 1.00 25.18 ? 72  THR A C   1 
ATOM   485  O O   . THR A 1 72  ? 26.899 109.276 -21.215 1.00 21.72 ? 72  THR A O   1 
ATOM   486  C CB  . THR A 1 72  ? 26.587 107.374 -18.551 1.00 27.74 ? 72  THR A CB  1 
ATOM   487  O OG1 . THR A 1 72  ? 27.089 106.230 -17.853 1.00 28.77 ? 72  THR A OG1 1 
ATOM   488  C CG2 . THR A 1 72  ? 25.501 106.908 -19.523 1.00 28.59 ? 72  THR A CG2 1 
ATOM   489  N N   . GLY A 1 73  ? 27.095 110.393 -19.257 1.00 24.53 ? 73  GLY A N   1 
ATOM   490  C CA  . GLY A 1 73  ? 26.594 111.635 -19.806 1.00 21.96 ? 73  GLY A CA  1 
ATOM   491  C C   . GLY A 1 73  ? 27.529 112.110 -20.893 1.00 22.02 ? 73  GLY A C   1 
ATOM   492  O O   . GLY A 1 73  ? 27.081 112.547 -21.957 1.00 23.13 ? 73  GLY A O   1 
ATOM   493  N N   . THR A 1 74  ? 28.828 112.007 -20.627 1.00 19.30 ? 74  THR A N   1 
ATOM   494  C CA  . THR A 1 74  ? 29.844 112.431 -21.574 1.00 19.05 ? 74  THR A CA  1 
ATOM   495  C C   . THR A 1 74  ? 29.584 111.898 -22.969 1.00 18.58 ? 74  THR A C   1 
ATOM   496  O O   . THR A 1 74  ? 29.419 112.670 -23.909 1.00 17.28 ? 74  THR A O   1 
ATOM   497  C CB  . THR A 1 74  ? 31.266 111.985 -21.133 1.00 19.77 ? 74  THR A CB  1 
ATOM   498  O OG1 . THR A 1 74  ? 31.691 112.766 -20.006 1.00 21.80 ? 74  THR A OG1 1 
ATOM   499  C CG2 . THR A 1 74  ? 32.261 112.165 -22.267 1.00 18.28 ? 74  THR A CG2 1 
ATOM   500  N N   . PHE A 1 75  ? 29.534 110.580 -23.117 1.00 19.26 ? 75  PHE A N   1 
ATOM   501  C CA  . PHE A 1 75  ? 29.320 110.027 -24.448 1.00 19.76 ? 75  PHE A CA  1 
ATOM   502  C C   . PHE A 1 75  ? 27.881 110.043 -24.916 1.00 19.79 ? 75  PHE A C   1 
ATOM   503  O O   . PHE A 1 75  ? 27.637 110.119 -26.112 1.00 21.87 ? 75  PHE A O   1 
ATOM   504  C CB  . PHE A 1 75  ? 29.912 108.614 -24.565 1.00 19.60 ? 75  PHE A CB  1 
ATOM   505  C CG  . PHE A 1 75  ? 29.231 107.570 -23.720 1.00 18.50 ? 75  PHE A CG  1 
ATOM   506  C CD1 . PHE A 1 75  ? 28.035 106.999 -24.126 1.00 16.72 ? 75  PHE A CD1 1 
ATOM   507  C CD2 . PHE A 1 75  ? 29.851 107.083 -22.566 1.00 19.26 ? 75  PHE A CD2 1 
ATOM   508  C CE1 . PHE A 1 75  ? 27.464 105.948 -23.408 1.00 16.25 ? 75  PHE A CE1 1 
ATOM   509  C CE2 . PHE A 1 75  ? 29.286 106.026 -21.835 1.00 18.76 ? 75  PHE A CE2 1 
ATOM   510  C CZ  . PHE A 1 75  ? 28.091 105.459 -22.263 1.00 17.33 ? 75  PHE A CZ  1 
ATOM   511  N N   . SER A 1 76  ? 26.921 109.987 -23.999 1.00 19.47 ? 76  SER A N   1 
ATOM   512  C CA  . SER A 1 76  ? 25.527 110.022 -24.428 1.00 19.25 ? 76  SER A CA  1 
ATOM   513  C C   . SER A 1 76  ? 25.262 111.420 -24.989 1.00 19.86 ? 76  SER A C   1 
ATOM   514  O O   . SER A 1 76  ? 24.774 111.558 -26.114 1.00 20.57 ? 76  SER A O   1 
ATOM   515  C CB  . SER A 1 76  ? 24.578 109.708 -23.263 1.00 19.03 ? 76  SER A CB  1 
ATOM   516  O OG  . SER A 1 76  ? 24.854 108.431 -22.702 1.00 18.87 ? 76  SER A OG  1 
ATOM   517  N N   . ILE A 1 77  ? 25.619 112.453 -24.227 1.00 18.76 ? 77  ILE A N   1 
ATOM   518  C CA  . ILE A 1 77  ? 25.416 113.832 -24.683 1.00 20.28 ? 77  ILE A CA  1 
ATOM   519  C C   . ILE A 1 77  ? 26.126 114.063 -26.016 1.00 20.35 ? 77  ILE A C   1 
ATOM   520  O O   . ILE A 1 77  ? 25.533 114.624 -26.947 1.00 21.49 ? 77  ILE A O   1 
ATOM   521  C CB  . ILE A 1 77  ? 25.952 114.880 -23.647 1.00 18.74 ? 77  ILE A CB  1 
ATOM   522  C CG1 . ILE A 1 77  ? 25.108 114.848 -22.370 1.00 17.69 ? 77  ILE A CG1 1 
ATOM   523  C CG2 . ILE A 1 77  ? 25.906 116.274 -24.233 1.00 19.15 ? 77  ILE A CG2 1 
ATOM   524  C CD1 . ILE A 1 77  ? 25.726 115.606 -21.220 1.00 14.61 ? 77  ILE A CD1 1 
ATOM   525  N N   . ALA A 1 78  ? 27.386 113.623 -26.108 1.00 18.83 ? 78  ALA A N   1 
ATOM   526  C CA  . ALA A 1 78  ? 28.176 113.799 -27.327 1.00 17.87 ? 78  ALA A CA  1 
ATOM   527  C C   . ALA A 1 78  ? 27.609 113.064 -28.545 1.00 19.32 ? 78  ALA A C   1 
ATOM   528  O O   . ALA A 1 78  ? 27.608 113.601 -29.652 1.00 18.90 ? 78  ALA A O   1 
ATOM   529  C CB  . ALA A 1 78  ? 29.606 113.370 -27.089 1.00 16.22 ? 78  ALA A CB  1 
ATOM   530  N N   . ALA A 1 79  ? 27.130 111.838 -28.346 1.00 19.32 ? 79  ALA A N   1 
ATOM   531  C CA  . ALA A 1 79  ? 26.575 111.063 -29.452 1.00 19.96 ? 79  ALA A CA  1 
ATOM   532  C C   . ALA A 1 79  ? 25.296 111.685 -30.007 1.00 20.53 ? 79  ALA A C   1 
ATOM   533  O O   . ALA A 1 79  ? 25.117 111.744 -31.218 1.00 20.47 ? 79  ALA A O   1 
ATOM   534  C CB  . ALA A 1 79  ? 26.301 109.637 -29.007 1.00 18.14 ? 79  ALA A CB  1 
ATOM   535  N N   . LEU A 1 80  ? 24.413 112.139 -29.116 1.00 20.79 ? 80  LEU A N   1 
ATOM   536  C CA  . LEU A 1 80  ? 23.147 112.750 -29.521 1.00 22.92 ? 80  LEU A CA  1 
ATOM   537  C C   . LEU A 1 80  ? 23.380 114.008 -30.369 1.00 25.14 ? 80  LEU A C   1 
ATOM   538  O O   . LEU A 1 80  ? 22.598 114.323 -31.269 1.00 25.72 ? 80  LEU A O   1 
ATOM   539  C CB  . LEU A 1 80  ? 22.308 113.088 -28.279 1.00 21.38 ? 80  LEU A CB  1 
ATOM   540  C CG  . LEU A 1 80  ? 21.694 111.889 -27.538 1.00 20.99 ? 80  LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 80  ? 21.203 112.284 -26.154 1.00 18.60 ? 80  LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 80  ? 20.555 111.335 -28.368 1.00 22.56 ? 80  LEU A CD2 1 
ATOM   543  N N   . GLN A 1 81  ? 24.471 114.711 -30.082 1.00 26.68 ? 81  GLN A N   1 
ATOM   544  C CA  . GLN A 1 81  ? 24.839 115.924 -30.798 1.00 26.50 ? 81  GLN A CA  1 
ATOM   545  C C   . GLN A 1 81  ? 25.314 115.628 -32.224 1.00 29.06 ? 81  GLN A C   1 
ATOM   546  O O   . GLN A 1 81  ? 25.123 116.442 -33.134 1.00 29.16 ? 81  GLN A O   1 
ATOM   547  C CB  . GLN A 1 81  ? 25.943 116.649 -30.029 1.00 24.41 ? 81  GLN A CB  1 
ATOM   548  C CG  . GLN A 1 81  ? 26.416 117.946 -30.667 1.00 24.75 ? 81  GLN A CG  1 
ATOM   549  C CD  . GLN A 1 81  ? 25.279 118.918 -30.891 1.00 24.89 ? 81  GLN A CD  1 
ATOM   550  O OE1 . GLN A 1 81  ? 24.483 119.187 -29.985 1.00 24.87 ? 81  GLN A OE1 1 
ATOM   551  N NE2 . GLN A 1 81  ? 25.191 119.451 -32.102 1.00 25.14 ? 81  GLN A NE2 1 
ATOM   552  N N   . ARG A 1 82  ? 25.945 114.471 -32.420 1.00 29.82 ? 82  ARG A N   1 
ATOM   553  C CA  . ARG A 1 82  ? 26.435 114.100 -33.744 1.00 31.43 ? 82  ARG A CA  1 
ATOM   554  C C   . ARG A 1 82  ? 25.365 113.447 -34.614 1.00 32.37 ? 82  ARG A C   1 
ATOM   555  O O   . ARG A 1 82  ? 25.510 113.377 -35.830 1.00 32.00 ? 82  ARG A O   1 
ATOM   556  C CB  . ARG A 1 82  ? 27.638 113.167 -33.631 1.00 31.14 ? 82  ARG A CB  1 
ATOM   557  C CG  . ARG A 1 82  ? 28.911 113.846 -33.162 1.00 34.07 ? 82  ARG A CG  1 
ATOM   558  C CD  . ARG A 1 82  ? 30.126 113.197 -33.816 1.00 37.00 ? 82  ARG A CD  1 
ATOM   559  N NE  . ARG A 1 82  ? 30.050 113.278 -35.272 1.00 38.50 ? 82  ARG A NE  1 
ATOM   560  C CZ  . ARG A 1 82  ? 30.717 112.486 -36.107 1.00 41.56 ? 82  ARG A CZ  1 
ATOM   561  N NH1 . ARG A 1 82  ? 31.527 111.539 -35.638 1.00 43.10 ? 82  ARG A NH1 1 
ATOM   562  N NH2 . ARG A 1 82  ? 30.563 112.630 -37.419 1.00 42.94 ? 82  ARG A NH2 1 
ATOM   563  N N   . ILE A 1 83  ? 24.292 112.978 -33.983 1.00 33.75 ? 83  ILE A N   1 
ATOM   564  C CA  . ILE A 1 83  ? 23.187 112.329 -34.688 1.00 34.64 ? 83  ILE A CA  1 
ATOM   565  C C   . ILE A 1 83  ? 22.445 113.271 -35.634 1.00 35.74 ? 83  ILE A C   1 
ATOM   566  O O   . ILE A 1 83  ? 22.134 114.412 -35.287 1.00 34.24 ? 83  ILE A O   1 
ATOM   567  C CB  . ILE A 1 83  ? 22.147 111.753 -33.693 1.00 34.20 ? 83  ILE A CB  1 
ATOM   568  C CG1 . ILE A 1 83  ? 22.717 110.532 -32.974 1.00 33.10 ? 83  ILE A CG1 1 
ATOM   569  C CG2 . ILE A 1 83  ? 20.862 111.380 -34.431 1.00 35.30 ? 83  ILE A CG2 1 
ATOM   570  C CD1 . ILE A 1 83  ? 22.864 109.324 -33.859 1.00 33.27 ? 83  ILE A CD1 1 
ATOM   571  N N   . ASP A 1 84  ? 22.163 112.771 -36.833 1.00 37.74 ? 84  ASP A N   1 
ATOM   572  C CA  . ASP A 1 84  ? 21.425 113.525 -37.838 1.00 38.63 ? 84  ASP A CA  1 
ATOM   573  C C   . ASP A 1 84  ? 19.994 112.992 -37.827 1.00 38.45 ? 84  ASP A C   1 
ATOM   574  O O   . ASP A 1 84  ? 19.668 112.031 -38.522 1.00 38.31 ? 84  ASP A O   1 
ATOM   575  C CB  . ASP A 1 84  ? 22.054 113.332 -39.212 1.00 40.83 ? 84  ASP A CB  1 
ATOM   576  C CG  . ASP A 1 84  ? 21.313 114.072 -40.285 1.00 43.55 ? 84  ASP A CG  1 
ATOM   577  O OD1 . ASP A 1 84  ? 21.048 115.275 -40.085 1.00 46.73 ? 84  ASP A OD1 1 
ATOM   578  O OD2 . ASP A 1 84  ? 20.996 113.461 -41.325 1.00 44.64 ? 84  ASP A OD2 1 
ATOM   579  N N   . THR A 1 85  ? 19.164 113.630 -37.009 1.00 38.24 ? 85  THR A N   1 
ATOM   580  C CA  . THR A 1 85  ? 17.763 113.275 -36.801 1.00 38.22 ? 85  THR A CA  1 
ATOM   581  C C   . THR A 1 85  ? 16.936 112.757 -37.975 1.00 38.01 ? 85  THR A C   1 
ATOM   582  O O   . THR A 1 85  ? 16.033 111.944 -37.779 1.00 37.35 ? 85  THR A O   1 
ATOM   583  C CB  . THR A 1 85  ? 17.009 114.451 -36.189 1.00 39.02 ? 85  THR A CB  1 
ATOM   584  O OG1 . THR A 1 85  ? 15.599 114.226 -36.315 1.00 41.13 ? 85  THR A OG1 1 
ATOM   585  C CG2 . THR A 1 85  ? 17.401 115.755 -36.887 1.00 39.24 ? 85  THR A CG2 1 
ATOM   586  N N   . SER A 1 86  ? 17.220 113.229 -39.183 1.00 38.53 ? 86  SER A N   1 
ATOM   587  C CA  . SER A 1 86  ? 16.477 112.777 -40.353 1.00 38.90 ? 86  SER A CA  1 
ATOM   588  C C   . SER A 1 86  ? 16.862 111.338 -40.715 1.00 38.66 ? 86  SER A C   1 
ATOM   589  O O   . SER A 1 86  ? 15.991 110.485 -40.887 1.00 39.64 ? 86  SER A O   1 
ATOM   590  C CB  . SER A 1 86  ? 16.752 113.689 -41.546 1.00 38.39 ? 86  SER A CB  1 
ATOM   591  O OG  . SER A 1 86  ? 18.072 113.496 -42.025 1.00 41.28 ? 86  SER A OG  1 
ATOM   592  N N   . VAL A 1 87  ? 18.164 111.077 -40.831 1.00 37.80 ? 87  VAL A N   1 
ATOM   593  C CA  . VAL A 1 87  ? 18.660 109.744 -41.170 1.00 36.37 ? 87  VAL A CA  1 
ATOM   594  C C   . VAL A 1 87  ? 18.187 108.690 -40.173 1.00 36.36 ? 87  VAL A C   1 
ATOM   595  O O   . VAL A 1 87  ? 18.693 108.603 -39.053 1.00 36.75 ? 87  VAL A O   1 
ATOM   596  C CB  . VAL A 1 87  ? 20.203 109.699 -41.206 1.00 36.69 ? 87  VAL A CB  1 
ATOM   597  C CG1 . VAL A 1 87  ? 20.671 108.278 -41.516 1.00 36.40 ? 87  VAL A CG1 1 
ATOM   598  C CG2 . VAL A 1 87  ? 20.735 110.672 -42.246 1.00 34.88 ? 87  VAL A CG2 1 
ATOM   599  N N   . LYS A 1 88  ? 17.219 107.884 -40.592 1.00 35.48 ? 88  LYS A N   1 
ATOM   600  C CA  . LYS A 1 88  ? 16.677 106.843 -39.735 1.00 35.69 ? 88  LYS A CA  1 
ATOM   601  C C   . LYS A 1 88  ? 17.457 105.542 -39.882 1.00 34.44 ? 88  LYS A C   1 
ATOM   602  O O   . LYS A 1 88  ? 16.957 104.553 -40.418 1.00 33.64 ? 88  LYS A O   1 
ATOM   603  C CB  . LYS A 1 88  ? 15.204 106.616 -40.066 1.00 36.00 ? 88  LYS A CB  1 
ATOM   604  C CG  . LYS A 1 88  ? 14.367 107.880 -40.012 1.00 37.56 ? 88  LYS A CG  1 
ATOM   605  C CD  . LYS A 1 88  ? 14.355 108.487 -38.619 1.00 39.73 ? 88  LYS A CD  1 
ATOM   606  C CE  . LYS A 1 88  ? 13.470 109.733 -38.571 1.00 40.02 ? 88  LYS A CE  1 
ATOM   607  N NZ  . LYS A 1 88  ? 13.251 110.239 -37.183 1.00 39.23 ? 88  LYS A NZ  1 
ATOM   608  N N   . ALA A 1 89  ? 18.695 105.559 -39.401 1.00 33.64 ? 89  ALA A N   1 
ATOM   609  C CA  . ALA A 1 89  ? 19.561 104.390 -39.460 1.00 32.05 ? 89  ALA A CA  1 
ATOM   610  C C   . ALA A 1 89  ? 20.673 104.570 -38.443 1.00 30.59 ? 89  ALA A C   1 
ATOM   611  O O   . ALA A 1 89  ? 21.075 105.699 -38.148 1.00 30.69 ? 89  ALA A O   1 
ATOM   612  C CB  . ALA A 1 89  ? 20.153 104.231 -40.864 1.00 32.00 ? 89  ALA A CB  1 
ATOM   613  N N   . PRO A 1 90  ? 21.179 103.455 -37.889 1.00 28.49 ? 90  PRO A N   1 
ATOM   614  C CA  . PRO A 1 90  ? 22.251 103.429 -36.892 1.00 26.76 ? 90  PRO A CA  1 
ATOM   615  C C   . PRO A 1 90  ? 23.402 104.354 -37.254 1.00 26.58 ? 90  PRO A C   1 
ATOM   616  O O   . PRO A 1 90  ? 23.979 104.249 -38.336 1.00 28.12 ? 90  PRO A O   1 
ATOM   617  C CB  . PRO A 1 90  ? 22.674 101.970 -36.895 1.00 26.06 ? 90  PRO A CB  1 
ATOM   618  C CG  . PRO A 1 90  ? 21.386 101.271 -37.143 1.00 26.08 ? 90  PRO A CG  1 
ATOM   619  C CD  . PRO A 1 90  ? 20.786 102.084 -38.256 1.00 27.56 ? 90  PRO A CD  1 
ATOM   620  N N   . GLN A 1 91  ? 23.737 105.253 -36.344 1.00 24.91 ? 91  GLN A N   1 
ATOM   621  C CA  . GLN A 1 91  ? 24.821 106.196 -36.574 1.00 25.09 ? 91  GLN A CA  1 
ATOM   622  C C   . GLN A 1 91  ? 25.825 106.115 -35.434 1.00 23.95 ? 91  GLN A C   1 
ATOM   623  O O   . GLN A 1 91  ? 26.991 106.458 -35.597 1.00 24.45 ? 91  GLN A O   1 
ATOM   624  C CB  . GLN A 1 91  ? 24.265 107.620 -36.669 1.00 25.09 ? 91  GLN A CB  1 
ATOM   625  C CG  . GLN A 1 91  ? 23.317 107.857 -37.838 1.00 24.35 ? 91  GLN A CG  1 
ATOM   626  C CD  . GLN A 1 91  ? 22.696 109.244 -37.789 1.00 26.86 ? 91  GLN A CD  1 
ATOM   627  O OE1 . GLN A 1 91  ? 23.398 110.252 -37.654 1.00 25.30 ? 91  GLN A OE1 1 
ATOM   628  N NE2 . GLN A 1 91  ? 21.376 109.303 -37.896 1.00 27.69 ? 91  GLN A NE2 1 
ATOM   629  N N   . ALA A 1 92  ? 25.357 105.657 -34.279 1.00 23.25 ? 92  ALA A N   1 
ATOM   630  C CA  . ALA A 1 92  ? 26.198 105.522 -33.105 1.00 22.09 ? 92  ALA A CA  1 
ATOM   631  C C   . ALA A 1 92  ? 25.979 104.159 -32.461 1.00 20.99 ? 92  ALA A C   1 
ATOM   632  O O   . ALA A 1 92  ? 24.841 103.746 -32.251 1.00 22.83 ? 92  ALA A O   1 
ATOM   633  C CB  . ALA A 1 92  ? 25.874 106.634 -32.115 1.00 22.48 ? 92  ALA A CB  1 
ATOM   634  N N   . LEU A 1 93  ? 27.070 103.463 -32.155 1.00 20.99 ? 93  LEU A N   1 
ATOM   635  C CA  . LEU A 1 93  ? 27.004 102.144 -31.534 1.00 20.54 ? 93  LEU A CA  1 
ATOM   636  C C   . LEU A 1 93  ? 27.741 102.171 -30.200 1.00 20.41 ? 93  LEU A C   1 
ATOM   637  O O   . LEU A 1 93  ? 28.950 102.432 -30.148 1.00 20.41 ? 93  LEU A O   1 
ATOM   638  C CB  . LEU A 1 93  ? 27.654 101.086 -32.433 1.00 19.69 ? 93  LEU A CB  1 
ATOM   639  C CG  . LEU A 1 93  ? 27.308 99.595  -32.240 1.00 21.74 ? 93  LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 93  ? 28.563 98.772  -32.512 1.00 20.64 ? 93  LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 93  ? 26.793 99.300  -30.852 1.00 21.30 ? 93  LEU A CD2 1 
ATOM   642  N N   . MET A 1 94  ? 27.006 101.879 -29.134 1.00 18.64 ? 94  MET A N   1 
ATOM   643  C CA  . MET A 1 94  ? 27.554 101.857 -27.786 1.00 18.67 ? 94  MET A CA  1 
ATOM   644  C C   . MET A 1 94  ? 27.609 100.414 -27.252 1.00 19.65 ? 94  MET A C   1 
ATOM   645  O O   . MET A 1 94  ? 26.635 99.676  -27.350 1.00 20.09 ? 94  MET A O   1 
ATOM   646  C CB  . MET A 1 94  ? 26.680 102.727 -26.882 1.00 18.53 ? 94  MET A CB  1 
ATOM   647  C CG  . MET A 1 94  ? 26.413 104.109 -27.470 1.00 21.16 ? 94  MET A CG  1 
ATOM   648  S SD  . MET A 1 94  ? 25.371 105.212 -26.482 1.00 24.80 ? 94  MET A SD  1 
ATOM   649  C CE  . MET A 1 94  ? 25.526 106.744 -27.388 1.00 19.52 ? 94  MET A CE  1 
ATOM   650  N N   . LEU A 1 95  ? 28.758 100.012 -26.715 1.00 18.60 ? 95  LEU A N   1 
ATOM   651  C CA  . LEU A 1 95  ? 28.925 98.673  -26.156 1.00 19.38 ? 95  LEU A CA  1 
ATOM   652  C C   . LEU A 1 95  ? 29.160 98.765  -24.650 1.00 19.94 ? 95  LEU A C   1 
ATOM   653  O O   . LEU A 1 95  ? 29.875 99.646  -24.185 1.00 20.63 ? 95  LEU A O   1 
ATOM   654  C CB  . LEU A 1 95  ? 30.112 97.935  -26.812 1.00 16.72 ? 95  LEU A CB  1 
ATOM   655  C CG  . LEU A 1 95  ? 30.015 97.535  -28.291 1.00 15.82 ? 95  LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 95  ? 31.141 96.568  -28.631 1.00 16.41 ? 95  LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 95  ? 28.671 96.879  -28.569 1.00 14.28 ? 95  LEU A CD2 1 
ATOM   658  N N   . ALA A 1 96  ? 28.548 97.856  -23.896 1.00 22.04 ? 96  ALA A N   1 
ATOM   659  C CA  . ALA A 1 96  ? 28.689 97.817  -22.435 1.00 22.57 ? 96  ALA A CA  1 
ATOM   660  C C   . ALA A 1 96  ? 28.869 96.366  -22.010 1.00 22.22 ? 96  ALA A C   1 
ATOM   661  O O   . ALA A 1 96  ? 28.375 95.457  -22.676 1.00 22.37 ? 96  ALA A O   1 
ATOM   662  C CB  . ALA A 1 96  ? 27.448 98.425  -21.753 1.00 21.57 ? 96  ALA A CB  1 
ATOM   663  N N   . PRO A 1 97  ? 29.559 96.133  -20.881 1.00 23.01 ? 97  PRO A N   1 
ATOM   664  C CA  . PRO A 1 97  ? 29.830 94.794  -20.345 1.00 22.74 ? 97  PRO A CA  1 
ATOM   665  C C   . PRO A 1 97  ? 28.633 93.865  -20.185 1.00 23.69 ? 97  PRO A C   1 
ATOM   666  O O   . PRO A 1 97  ? 28.738 92.675  -20.451 1.00 24.55 ? 97  PRO A O   1 
ATOM   667  C CB  . PRO A 1 97  ? 30.484 95.083  -18.996 1.00 23.70 ? 97  PRO A CB  1 
ATOM   668  C CG  . PRO A 1 97  ? 31.055 96.459  -19.158 1.00 22.99 ? 97  PRO A CG  1 
ATOM   669  C CD  . PRO A 1 97  ? 29.975 97.165  -19.914 1.00 22.50 ? 97  PRO A CD  1 
ATOM   670  N N   . THR A 1 98  ? 27.497 94.401  -19.751 1.00 24.33 ? 98  THR A N   1 
ATOM   671  C CA  . THR A 1 98  ? 26.324 93.569  -19.523 1.00 24.78 ? 98  THR A CA  1 
ATOM   672  C C   . THR A 1 98  ? 24.997 94.169  -19.999 1.00 26.17 ? 98  THR A C   1 
ATOM   673  O O   . THR A 1 98  ? 24.904 95.365  -20.282 1.00 25.77 ? 98  THR A O   1 
ATOM   674  C CB  . THR A 1 98  ? 26.183 93.275  -18.028 1.00 25.34 ? 98  THR A CB  1 
ATOM   675  O OG1 . THR A 1 98  ? 25.768 94.466  -17.357 1.00 25.09 ? 98  THR A OG1 1 
ATOM   676  C CG2 . THR A 1 98  ? 27.515 92.850  -17.442 1.00 25.37 ? 98  THR A CG2 1 
ATOM   677  N N   . ARG A 1 99  ? 23.968 93.328  -20.066 1.00 26.33 ? 99  ARG A N   1 
ATOM   678  C CA  . ARG A 1 99  ? 22.646 93.780  -20.479 1.00 28.16 ? 99  ARG A CA  1 
ATOM   679  C C   . ARG A 1 99  ? 22.195 94.948  -19.595 1.00 28.17 ? 99  ARG A C   1 
ATOM   680  O O   . ARG A 1 99  ? 21.821 96.001  -20.105 1.00 28.92 ? 99  ARG A O   1 
ATOM   681  C CB  . ARG A 1 99  ? 21.632 92.629  -20.386 1.00 28.09 ? 99  ARG A CB  1 
ATOM   682  C CG  . ARG A 1 99  ? 22.017 91.427  -21.227 1.00 30.24 ? 99  ARG A CG  1 
ATOM   683  C CD  . ARG A 1 99  ? 21.014 90.285  -21.123 1.00 32.62 ? 99  ARG A CD  1 
ATOM   684  N NE  . ARG A 1 99  ? 19.663 90.696  -21.490 1.00 34.20 ? 99  ARG A NE  1 
ATOM   685  C CZ  . ARG A 1 99  ? 18.689 90.899  -20.608 1.00 36.00 ? 99  ARG A CZ  1 
ATOM   686  N NH1 . ARG A 1 99  ? 18.926 90.718  -19.318 1.00 37.88 ? 99  ARG A NH1 1 
ATOM   687  N NH2 . ARG A 1 99  ? 17.487 91.300  -21.009 1.00 35.02 ? 99  ARG A NH2 1 
ATOM   688  N N   . GLU A 1 100 ? 22.257 94.767  -18.277 1.00 27.93 ? 100 GLU A N   1 
ATOM   689  C CA  . GLU A 1 100 ? 21.855 95.813  -17.347 1.00 29.13 ? 100 GLU A CA  1 
ATOM   690  C C   . GLU A 1 100 ? 22.586 97.130  -17.588 1.00 28.61 ? 100 GLU A C   1 
ATOM   691  O O   . GLU A 1 100 ? 21.973 98.199  -17.527 1.00 27.75 ? 100 GLU A O   1 
ATOM   692  C CB  . GLU A 1 100 ? 22.050 95.368  -15.889 1.00 31.20 ? 100 GLU A CB  1 
ATOM   693  C CG  . GLU A 1 100 ? 23.305 94.565  -15.608 1.00 36.30 ? 100 GLU A CG  1 
ATOM   694  C CD  . GLU A 1 100 ? 23.094 93.054  -15.761 1.00 39.42 ? 100 GLU A CD  1 
ATOM   695  O OE1 . GLU A 1 100 ? 22.597 92.616  -16.826 1.00 38.76 ? 100 GLU A OE1 1 
ATOM   696  O OE2 . GLU A 1 100 ? 23.437 92.306  -14.814 1.00 41.14 ? 100 GLU A OE2 1 
ATOM   697  N N   . LEU A 1 101 ? 23.885 97.069  -17.865 1.00 28.30 ? 101 LEU A N   1 
ATOM   698  C CA  . LEU A 1 101 ? 24.641 98.300  -18.123 1.00 28.81 ? 101 LEU A CA  1 
ATOM   699  C C   . LEU A 1 101 ? 24.163 98.912  -19.439 1.00 27.47 ? 101 LEU A C   1 
ATOM   700  O O   . LEU A 1 101 ? 24.052 100.130 -19.568 1.00 27.46 ? 101 LEU A O   1 
ATOM   701  C CB  . LEU A 1 101 ? 26.142 98.007  -18.178 1.00 30.14 ? 101 LEU A CB  1 
ATOM   702  C CG  . LEU A 1 101 ? 26.693 97.441  -16.865 1.00 32.29 ? 101 LEU A CG  1 
ATOM   703  C CD1 . LEU A 1 101 ? 28.161 97.094  -17.030 1.00 33.57 ? 101 LEU A CD1 1 
ATOM   704  C CD2 . LEU A 1 101 ? 26.499 98.461  -15.736 1.00 31.77 ? 101 LEU A CD2 1 
ATOM   705  N N   . ALA A 1 102 ? 23.854 98.050  -20.403 1.00 27.61 ? 102 ALA A N   1 
ATOM   706  C CA  . ALA A 1 102 ? 23.358 98.486  -21.700 1.00 27.34 ? 102 ALA A CA  1 
ATOM   707  C C   . ALA A 1 102 ? 22.010 99.200  -21.512 1.00 27.91 ? 102 ALA A C   1 
ATOM   708  O O   . ALA A 1 102 ? 21.796 100.310 -22.016 1.00 27.54 ? 102 ALA A O   1 
ATOM   709  C CB  . ALA A 1 102 ? 23.195 97.281  -22.611 1.00 26.41 ? 102 ALA A CB  1 
ATOM   710  N N   . LEU A 1 103 ? 21.111 98.550  -20.777 1.00 27.30 ? 103 LEU A N   1 
ATOM   711  C CA  . LEU A 1 103 ? 19.791 99.092  -20.491 1.00 27.14 ? 103 LEU A CA  1 
ATOM   712  C C   . LEU A 1 103 ? 19.874 100.435 -19.763 1.00 26.74 ? 103 LEU A C   1 
ATOM   713  O O   . LEU A 1 103 ? 19.079 101.333 -20.009 1.00 28.24 ? 103 LEU A O   1 
ATOM   714  C CB  . LEU A 1 103 ? 18.995 98.096  -19.645 1.00 26.70 ? 103 LEU A CB  1 
ATOM   715  C CG  . LEU A 1 103 ? 18.382 96.887  -20.355 1.00 27.32 ? 103 LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 103 ? 17.781 95.933  -19.327 1.00 25.90 ? 103 LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 103 ? 17.315 97.356  -21.330 1.00 26.21 ? 103 LEU A CD2 1 
ATOM   718  N N   . GLN A 1 104 ? 20.829 100.572 -18.855 1.00 26.95 ? 104 GLN A N   1 
ATOM   719  C CA  . GLN A 1 104 ? 20.986 101.824 -18.128 1.00 27.75 ? 104 GLN A CA  1 
ATOM   720  C C   . GLN A 1 104 ? 21.394 102.957 -19.067 1.00 26.52 ? 104 GLN A C   1 
ATOM   721  O O   . GLN A 1 104 ? 20.922 104.087 -18.936 1.00 26.23 ? 104 GLN A O   1 
ATOM   722  C CB  . GLN A 1 104 ? 22.044 101.681 -17.041 1.00 30.05 ? 104 GLN A CB  1 
ATOM   723  C CG  . GLN A 1 104 ? 22.244 102.946 -16.236 1.00 33.93 ? 104 GLN A CG  1 
ATOM   724  C CD  . GLN A 1 104 ? 23.438 102.862 -15.310 1.00 38.30 ? 104 GLN A CD  1 
ATOM   725  O OE1 . GLN A 1 104 ? 23.627 101.864 -14.603 1.00 39.68 ? 104 GLN A OE1 1 
ATOM   726  N NE2 . GLN A 1 104 ? 24.252 103.916 -15.298 1.00 40.68 ? 104 GLN A NE2 1 
ATOM   727  N N   . ILE A 1 105 ? 22.292 102.650 -19.997 1.00 25.31 ? 105 ILE A N   1 
ATOM   728  C CA  . ILE A 1 105 ? 22.761 103.634 -20.967 1.00 24.72 ? 105 ILE A CA  1 
ATOM   729  C C   . ILE A 1 105 ? 21.563 104.058 -21.816 1.00 23.82 ? 105 ILE A C   1 
ATOM   730  O O   . ILE A 1 105 ? 21.400 105.239 -22.112 1.00 22.53 ? 105 ILE A O   1 
ATOM   731  C CB  . ILE A 1 105 ? 23.895 103.040 -21.872 1.00 24.68 ? 105 ILE A CB  1 
ATOM   732  C CG1 . ILE A 1 105 ? 25.165 102.811 -21.039 1.00 25.19 ? 105 ILE A CG1 1 
ATOM   733  C CG2 . ILE A 1 105 ? 24.194 103.975 -23.037 1.00 24.75 ? 105 ILE A CG2 1 
ATOM   734  C CD1 . ILE A 1 105 ? 26.303 102.089 -21.777 1.00 23.32 ? 105 ILE A CD1 1 
ATOM   735  N N   . GLN A 1 106 ? 20.714 103.096 -22.181 1.00 23.25 ? 106 GLN A N   1 
ATOM   736  C CA  . GLN A 1 106 ? 19.530 103.400 -22.973 1.00 24.66 ? 106 GLN A CA  1 
ATOM   737  C C   . GLN A 1 106 ? 18.635 104.360 -22.207 1.00 25.59 ? 106 GLN A C   1 
ATOM   738  O O   . GLN A 1 106 ? 18.157 105.347 -22.756 1.00 25.58 ? 106 GLN A O   1 
ATOM   739  C CB  . GLN A 1 106 ? 18.748 102.126 -23.306 1.00 25.66 ? 106 GLN A CB  1 
ATOM   740  C CG  . GLN A 1 106 ? 17.323 102.388 -23.819 1.00 27.39 ? 106 GLN A CG  1 
ATOM   741  C CD  . GLN A 1 106 ? 16.743 101.218 -24.614 1.00 29.26 ? 106 GLN A CD  1 
ATOM   742  O OE1 . GLN A 1 106 ? 16.726 100.079 -24.146 1.00 30.13 ? 106 GLN A OE1 1 
ATOM   743  N NE2 . GLN A 1 106 ? 16.268 101.502 -25.824 1.00 26.50 ? 106 GLN A NE2 1 
ATOM   744  N N   . LYS A 1 107 ? 18.422 104.067 -20.929 1.00 27.01 ? 107 LYS A N   1 
ATOM   745  C CA  . LYS A 1 107 ? 17.589 104.902 -20.080 1.00 27.13 ? 107 LYS A CA  1 
ATOM   746  C C   . LYS A 1 107 ? 18.069 106.344 -20.115 1.00 27.70 ? 107 LYS A C   1 
ATOM   747  O O   . LYS A 1 107 ? 17.277 107.257 -20.375 1.00 29.11 ? 107 LYS A O   1 
ATOM   748  C CB  . LYS A 1 107 ? 17.613 104.353 -18.657 1.00 29.11 ? 107 LYS A CB  1 
ATOM   749  C CG  . LYS A 1 107 ? 17.127 105.299 -17.575 1.00 33.53 ? 107 LYS A CG  1 
ATOM   750  C CD  . LYS A 1 107 ? 18.296 105.832 -16.731 1.00 35.20 ? 107 LYS A CD  1 
ATOM   751  C CE  . LYS A 1 107 ? 19.086 104.696 -16.072 1.00 35.10 ? 107 LYS A CE  1 
ATOM   752  N NZ  . LYS A 1 107 ? 20.282 105.172 -15.307 1.00 35.79 ? 107 LYS A NZ  1 
ATOM   753  N N   . VAL A 1 108 ? 19.368 106.538 -19.884 1.00 25.74 ? 108 VAL A N   1 
ATOM   754  C CA  . VAL A 1 108 ? 19.989 107.864 -19.874 1.00 22.86 ? 108 VAL A CA  1 
ATOM   755  C C   . VAL A 1 108 ? 19.886 108.584 -21.224 1.00 23.39 ? 108 VAL A C   1 
ATOM   756  O O   . VAL A 1 108 ? 19.419 109.722 -21.303 1.00 22.79 ? 108 VAL A O   1 
ATOM   757  C CB  . VAL A 1 108 ? 21.486 107.767 -19.481 1.00 21.44 ? 108 VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 108 ? 22.151 109.124 -19.575 1.00 20.52 ? 108 VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 108 ? 21.619 107.240 -18.077 1.00 22.01 ? 108 VAL A CG2 1 
ATOM   760  N N   . VAL A 1 109 ? 20.340 107.924 -22.280 1.00 21.73 ? 109 VAL A N   1 
ATOM   761  C CA  . VAL A 1 109 ? 20.301 108.508 -23.605 1.00 21.66 ? 109 VAL A CA  1 
ATOM   762  C C   . VAL A 1 109 ? 18.889 108.917 -24.014 1.00 22.98 ? 109 VAL A C   1 
ATOM   763  O O   . VAL A 1 109 ? 18.696 109.973 -24.622 1.00 21.90 ? 109 VAL A O   1 
ATOM   764  C CB  . VAL A 1 109 ? 20.846 107.529 -24.660 1.00 21.83 ? 109 VAL A CB  1 
ATOM   765  C CG1 . VAL A 1 109 ? 20.571 108.072 -26.054 1.00 21.68 ? 109 VAL A CG1 1 
ATOM   766  C CG2 . VAL A 1 109 ? 22.338 107.308 -24.447 1.00 21.10 ? 109 VAL A CG2 1 
ATOM   767  N N   . MET A 1 110 ? 17.907 108.074 -23.696 1.00 24.07 ? 110 MET A N   1 
ATOM   768  C CA  . MET A 1 110 ? 16.516 108.363 -24.039 1.00 25.14 ? 110 MET A CA  1 
ATOM   769  C C   . MET A 1 110 ? 15.969 109.549 -23.244 1.00 25.92 ? 110 MET A C   1 
ATOM   770  O O   . MET A 1 110 ? 15.115 110.307 -23.729 1.00 25.26 ? 110 MET A O   1 
ATOM   771  C CB  . MET A 1 110 ? 15.646 107.140 -23.785 1.00 27.27 ? 110 MET A CB  1 
ATOM   772  C CG  . MET A 1 110 ? 15.811 106.044 -24.826 1.00 30.17 ? 110 MET A CG  1 
ATOM   773  S SD  . MET A 1 110 ? 14.830 104.603 -24.405 1.00 32.92 ? 110 MET A SD  1 
ATOM   774  C CE  . MET A 1 110 ? 13.132 105.320 -24.442 1.00 32.69 ? 110 MET A CE  1 
ATOM   775  N N   . ALA A 1 111 ? 16.460 109.704 -22.022 1.00 23.64 ? 111 ALA A N   1 
ATOM   776  C CA  . ALA A 1 111 ? 16.028 110.798 -21.186 1.00 23.44 ? 111 ALA A CA  1 
ATOM   777  C C   . ALA A 1 111 ? 16.649 112.081 -21.741 1.00 24.18 ? 111 ALA A C   1 
ATOM   778  O O   . ALA A 1 111 ? 15.977 113.101 -21.847 1.00 25.15 ? 111 ALA A O   1 
ATOM   779  C CB  . ALA A 1 111 ? 16.462 110.557 -19.765 1.00 21.24 ? 111 ALA A CB  1 
ATOM   780  N N   . LEU A 1 112 ? 17.925 112.026 -22.120 1.00 23.73 ? 112 LEU A N   1 
ATOM   781  C CA  . LEU A 1 112 ? 18.587 113.206 -22.667 1.00 23.94 ? 112 LEU A CA  1 
ATOM   782  C C   . LEU A 1 112 ? 18.006 113.548 -24.035 1.00 24.94 ? 112 LEU A C   1 
ATOM   783  O O   . LEU A 1 112 ? 18.165 114.668 -24.526 1.00 23.72 ? 112 LEU A O   1 
ATOM   784  C CB  . LEU A 1 112 ? 20.101 112.979 -22.812 1.00 22.14 ? 112 LEU A CB  1 
ATOM   785  C CG  . LEU A 1 112 ? 21.032 113.142 -21.612 1.00 22.76 ? 112 LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 112 ? 20.927 114.560 -21.058 1.00 20.32 ? 112 LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 112 ? 20.676 112.128 -20.545 1.00 26.43 ? 112 LEU A CD2 1 
ATOM   788  N N   . ALA A 1 113 ? 17.335 112.574 -24.643 1.00 24.75 ? 113 ALA A N   1 
ATOM   789  C CA  . ALA A 1 113 ? 16.750 112.750 -25.964 1.00 25.65 ? 113 ALA A CA  1 
ATOM   790  C C   . ALA A 1 113 ? 15.233 112.915 -25.932 1.00 26.38 ? 113 ALA A C   1 
ATOM   791  O O   . ALA A 1 113 ? 14.564 112.772 -26.959 1.00 28.23 ? 113 ALA A O   1 
ATOM   792  C CB  . ALA A 1 113 ? 17.125 111.567 -26.844 1.00 24.43 ? 113 ALA A CB  1 
ATOM   793  N N   . PHE A 1 114 ? 14.697 113.230 -24.759 1.00 24.69 ? 114 PHE A N   1 
ATOM   794  C CA  . PHE A 1 114 ? 13.262 113.396 -24.589 1.00 24.78 ? 114 PHE A CA  1 
ATOM   795  C C   . PHE A 1 114 ? 12.625 114.447 -25.527 1.00 26.04 ? 114 PHE A C   1 
ATOM   796  O O   . PHE A 1 114 ? 11.454 114.322 -25.879 1.00 26.20 ? 114 PHE A O   1 
ATOM   797  C CB  . PHE A 1 114 ? 12.969 113.730 -23.120 1.00 23.93 ? 114 PHE A CB  1 
ATOM   798  C CG  . PHE A 1 114 ? 11.551 113.459 -22.695 1.00 22.51 ? 114 PHE A CG  1 
ATOM   799  C CD1 . PHE A 1 114 ? 10.997 112.189 -22.834 1.00 24.47 ? 114 PHE A CD1 1 
ATOM   800  C CD2 . PHE A 1 114 ? 10.776 114.469 -22.142 1.00 22.93 ? 114 PHE A CD2 1 
ATOM   801  C CE1 . PHE A 1 114 ? 9.686  111.927 -22.429 1.00 23.93 ? 114 PHE A CE1 1 
ATOM   802  C CE2 . PHE A 1 114 ? 9.466  114.223 -21.732 1.00 24.14 ? 114 PHE A CE2 1 
ATOM   803  C CZ  . PHE A 1 114 ? 8.918  112.947 -21.877 1.00 26.69 ? 114 PHE A CZ  1 
ATOM   804  N N   . HIS A 1 115 ? 13.383 115.460 -25.944 1.00 26.17 ? 115 HIS A N   1 
ATOM   805  C CA  . HIS A 1 115 ? 12.836 116.494 -26.826 1.00 27.31 ? 115 HIS A CA  1 
ATOM   806  C C   . HIS A 1 115 ? 13.330 116.391 -28.279 1.00 28.55 ? 115 HIS A C   1 
ATOM   807  O O   . HIS A 1 115 ? 13.160 117.322 -29.075 1.00 27.02 ? 115 HIS A O   1 
ATOM   808  C CB  . HIS A 1 115 ? 13.160 117.886 -26.268 1.00 28.05 ? 115 HIS A CB  1 
ATOM   809  C CG  . HIS A 1 115 ? 12.722 118.083 -24.849 1.00 29.29 ? 115 HIS A CG  1 
ATOM   810  N ND1 . HIS A 1 115 ? 11.401 118.256 -24.491 1.00 28.80 ? 115 HIS A ND1 1 
ATOM   811  C CD2 . HIS A 1 115 ? 13.425 118.080 -23.691 1.00 29.36 ? 115 HIS A CD2 1 
ATOM   812  C CE1 . HIS A 1 115 ? 11.312 118.347 -23.176 1.00 29.00 ? 115 HIS A CE1 1 
ATOM   813  N NE2 . HIS A 1 115 ? 12.525 118.243 -22.667 1.00 27.60 ? 115 HIS A NE2 1 
ATOM   814  N N   . MET A 1 116 ? 13.934 115.254 -28.619 1.00 29.37 ? 116 MET A N   1 
ATOM   815  C CA  . MET A 1 116 ? 14.446 115.022 -29.965 1.00 29.11 ? 116 MET A CA  1 
ATOM   816  C C   . MET A 1 116 ? 13.745 113.811 -30.578 1.00 31.22 ? 116 MET A C   1 
ATOM   817  O O   . MET A 1 116 ? 13.272 112.932 -29.862 1.00 30.97 ? 116 MET A O   1 
ATOM   818  C CB  . MET A 1 116 ? 15.944 114.747 -29.915 1.00 28.29 ? 116 MET A CB  1 
ATOM   819  C CG  . MET A 1 116 ? 16.731 115.730 -29.074 1.00 27.52 ? 116 MET A CG  1 
ATOM   820  S SD  . MET A 1 116 ? 18.481 115.344 -29.102 1.00 25.07 ? 116 MET A SD  1 
ATOM   821  C CE  . MET A 1 116 ? 18.679 114.486 -27.644 1.00 25.24 ? 116 MET A CE  1 
ATOM   822  N N   . ASP A 1 117 ? 13.677 113.768 -31.903 1.00 32.40 ? 117 ASP A N   1 
ATOM   823  C CA  . ASP A 1 117 ? 13.041 112.643 -32.584 1.00 33.25 ? 117 ASP A CA  1 
ATOM   824  C C   . ASP A 1 117 ? 14.139 111.634 -32.888 1.00 32.83 ? 117 ASP A C   1 
ATOM   825  O O   . ASP A 1 117 ? 14.625 111.545 -34.012 1.00 32.27 ? 117 ASP A O   1 
ATOM   826  C CB  . ASP A 1 117 ? 12.363 113.128 -33.870 1.00 35.24 ? 117 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 117 ? 11.748 111.997 -34.678 1.00 36.93 ? 117 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 117 ? 11.157 111.068 -34.078 1.00 37.02 ? 117 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 117 ? 11.849 112.052 -35.925 1.00 39.11 ? 117 ASP A OD2 1 
ATOM   830  N N   . ILE A 1 118 ? 14.527 110.881 -31.861 1.00 32.94 ? 118 ILE A N   1 
ATOM   831  C CA  . ILE A 1 118 ? 15.592 109.892 -31.975 1.00 32.28 ? 118 ILE A CA  1 
ATOM   832  C C   . ILE A 1 118 ? 15.212 108.563 -31.342 1.00 31.47 ? 118 ILE A C   1 
ATOM   833  O O   . ILE A 1 118 ? 14.738 108.518 -30.213 1.00 32.20 ? 118 ILE A O   1 
ATOM   834  C CB  . ILE A 1 118 ? 16.901 110.428 -31.309 1.00 32.47 ? 118 ILE A CB  1 
ATOM   835  C CG1 . ILE A 1 118 ? 17.435 111.624 -32.111 1.00 30.56 ? 118 ILE A CG1 1 
ATOM   836  C CG2 . ILE A 1 118 ? 17.950 109.317 -31.220 1.00 33.69 ? 118 ILE A CG2 1 
ATOM   837  C CD1 . ILE A 1 118 ? 18.750 112.198 -31.615 1.00 31.25 ? 118 ILE A CD1 1 
ATOM   838  N N   . LYS A 1 119 ? 15.411 107.472 -32.073 1.00 31.65 ? 119 LYS A N   1 
ATOM   839  C CA  . LYS A 1 119 ? 15.094 106.151 -31.532 1.00 30.80 ? 119 LYS A CA  1 
ATOM   840  C C   . LYS A 1 119 ? 16.367 105.434 -31.072 1.00 29.26 ? 119 LYS A C   1 
ATOM   841  O O   . LYS A 1 119 ? 17.366 105.390 -31.794 1.00 30.14 ? 119 LYS A O   1 
ATOM   842  C CB  . LYS A 1 119 ? 14.364 105.308 -32.585 1.00 32.51 ? 119 LYS A CB  1 
ATOM   843  C CG  . LYS A 1 119 ? 14.074 103.863 -32.149 1.00 34.80 ? 119 LYS A CG  1 
ATOM   844  C CD  . LYS A 1 119 ? 13.391 103.077 -33.262 1.00 34.44 ? 119 LYS A CD  1 
ATOM   845  C CE  . LYS A 1 119 ? 13.451 101.576 -33.006 1.00 36.92 ? 119 LYS A CE  1 
ATOM   846  N NZ  . LYS A 1 119 ? 12.914 100.788 -34.159 1.00 36.46 ? 119 LYS A NZ  1 
ATOM   847  N N   . VAL A 1 120 ? 16.324 104.896 -29.856 1.00 28.03 ? 120 VAL A N   1 
ATOM   848  C CA  . VAL A 1 120 ? 17.444 104.169 -29.270 1.00 26.22 ? 120 VAL A CA  1 
ATOM   849  C C   . VAL A 1 120 ? 17.068 102.705 -29.017 1.00 27.22 ? 120 VAL A C   1 
ATOM   850  O O   . VAL A 1 120 ? 16.215 102.393 -28.186 1.00 27.63 ? 120 VAL A O   1 
ATOM   851  C CB  . VAL A 1 120 ? 17.894 104.811 -27.939 1.00 26.06 ? 120 VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 120 ? 18.906 103.917 -27.226 1.00 26.60 ? 120 VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 120 ? 18.526 106.165 -28.217 1.00 26.73 ? 120 VAL A CG2 1 
ATOM   854  N N   . HIS A 1 121 ? 17.714 101.804 -29.739 1.00 26.24 ? 121 HIS A N   1 
ATOM   855  C CA  . HIS A 1 121 ? 17.432 100.395 -29.586 1.00 26.18 ? 121 HIS A CA  1 
ATOM   856  C C   . HIS A 1 121 ? 18.538 99.696  -28.806 1.00 26.05 ? 121 HIS A C   1 
ATOM   857  O O   . HIS A 1 121 ? 19.723 99.934  -29.036 1.00 25.96 ? 121 HIS A O   1 
ATOM   858  C CB  . HIS A 1 121 ? 17.259 99.741  -30.959 1.00 26.44 ? 121 HIS A CB  1 
ATOM   859  C CG  . HIS A 1 121 ? 17.118 98.251  -30.900 1.00 28.16 ? 121 HIS A CG  1 
ATOM   860  N ND1 . HIS A 1 121 ? 18.186 97.394  -31.063 1.00 29.51 ? 121 HIS A ND1 1 
ATOM   861  C CD2 . HIS A 1 121 ? 16.044 97.468  -30.637 1.00 27.54 ? 121 HIS A CD2 1 
ATOM   862  C CE1 . HIS A 1 121 ? 17.779 96.148  -30.902 1.00 30.56 ? 121 HIS A CE1 1 
ATOM   863  N NE2 . HIS A 1 121 ? 16.482 96.165  -30.641 1.00 30.77 ? 121 HIS A NE2 1 
ATOM   864  N N   . ALA A 1 122 ? 18.138 98.845  -27.869 1.00 25.12 ? 122 ALA A N   1 
ATOM   865  C CA  . ALA A 1 122 ? 19.084 98.100  -27.056 1.00 26.69 ? 122 ALA A CA  1 
ATOM   866  C C   . ALA A 1 122 ? 19.217 96.726  -27.666 1.00 27.23 ? 122 ALA A C   1 
ATOM   867  O O   . ALA A 1 122 ? 18.235 96.006  -27.781 1.00 27.49 ? 122 ALA A O   1 
ATOM   868  C CB  . ALA A 1 122 ? 18.580 97.979  -25.631 1.00 26.50 ? 122 ALA A CB  1 
ATOM   869  N N   . CYS A 1 123 ? 20.430 96.371  -28.073 1.00 28.80 ? 123 CYS A N   1 
ATOM   870  C CA  . CYS A 1 123 ? 20.682 95.063  -28.667 1.00 29.44 ? 123 CYS A CA  1 
ATOM   871  C C   . CYS A 1 123 ? 21.253 94.138  -27.594 1.00 30.32 ? 123 CYS A C   1 
ATOM   872  O O   . CYS A 1 123 ? 22.467 94.006  -27.443 1.00 30.76 ? 123 CYS A O   1 
ATOM   873  C CB  . CYS A 1 123 ? 21.663 95.186  -29.832 1.00 28.20 ? 123 CYS A CB  1 
ATOM   874  S SG  . CYS A 1 123 ? 21.900 93.637  -30.717 1.00 33.21 ? 123 CYS A SG  1 
ATOM   875  N N   . ILE A 1 124 ? 20.364 93.503  -26.845 1.00 30.94 ? 124 ILE A N   1 
ATOM   876  C CA  . ILE A 1 124 ? 20.781 92.617  -25.779 1.00 34.16 ? 124 ILE A CA  1 
ATOM   877  C C   . ILE A 1 124 ? 20.087 91.259  -25.873 1.00 37.07 ? 124 ILE A C   1 
ATOM   878  O O   . ILE A 1 124 ? 19.568 90.883  -26.925 1.00 38.16 ? 124 ILE A O   1 
ATOM   879  C CB  . ILE A 1 124 ? 20.485 93.266  -24.407 1.00 33.76 ? 124 ILE A CB  1 
ATOM   880  C CG1 . ILE A 1 124 ? 18.982 93.532  -24.273 1.00 30.79 ? 124 ILE A CG1 1 
ATOM   881  C CG2 . ILE A 1 124 ? 21.274 94.579  -24.272 1.00 32.45 ? 124 ILE A CG2 1 
ATOM   882  C CD1 . ILE A 1 124 ? 18.606 94.243  -23.002 1.00 31.42 ? 124 ILE A CD1 1 
ATOM   883  N N   . GLY A 1 125 ? 20.092 90.517  -24.775 1.00 39.69 ? 125 GLY A N   1 
ATOM   884  C CA  . GLY A 1 125 ? 19.454 89.217  -24.782 1.00 44.04 ? 125 GLY A CA  1 
ATOM   885  C C   . GLY A 1 125 ? 18.006 89.288  -24.340 1.00 45.92 ? 125 GLY A C   1 
ATOM   886  O O   . GLY A 1 125 ? 17.664 90.067  -23.445 1.00 46.42 ? 125 GLY A O   1 
ATOM   887  N N   . GLY A 1 126 ? 17.156 88.481  -24.972 1.00 46.88 ? 126 GLY A N   1 
ATOM   888  C CA  . GLY A 1 126 ? 15.747 88.458  -24.619 1.00 48.68 ? 126 GLY A CA  1 
ATOM   889  C C   . GLY A 1 126 ? 14.872 88.925  -25.758 1.00 49.58 ? 126 GLY A C   1 
ATOM   890  O O   . GLY A 1 126 ? 13.654 88.757  -25.744 1.00 49.85 ? 126 GLY A O   1 
ATOM   891  N N   . THR A 1 127 ? 15.511 89.505  -26.762 1.00 51.15 ? 127 THR A N   1 
ATOM   892  C CA  . THR A 1 127 ? 14.815 90.024  -27.932 1.00 52.52 ? 127 THR A CA  1 
ATOM   893  C C   . THR A 1 127 ? 14.671 88.993  -29.052 1.00 52.97 ? 127 THR A C   1 
ATOM   894  O O   . THR A 1 127 ? 15.661 88.442  -29.537 1.00 53.19 ? 127 THR A O   1 
ATOM   895  C CB  . THR A 1 127 ? 15.565 91.240  -28.486 1.00 52.59 ? 127 THR A CB  1 
ATOM   896  O OG1 . THR A 1 127 ? 14.994 91.629  -29.742 1.00 53.62 ? 127 THR A OG1 1 
ATOM   897  C CG2 . THR A 1 127 ? 17.029 90.897  -28.675 1.00 51.56 ? 127 THR A CG2 1 
ATOM   898  N N   . SER A 1 128 ? 13.436 88.734  -29.467 1.00 53.92 ? 128 SER A N   1 
ATOM   899  C CA  . SER A 1 128 ? 13.201 87.783  -30.544 1.00 53.98 ? 128 SER A CA  1 
ATOM   900  C C   . SER A 1 128 ? 13.917 88.322  -31.778 1.00 54.30 ? 128 SER A C   1 
ATOM   901  O O   . SER A 1 128 ? 14.359 89.469  -31.785 1.00 53.77 ? 128 SER A O   1 
ATOM   902  C CB  . SER A 1 128 ? 11.698 87.644  -30.812 1.00 53.41 ? 128 SER A CB  1 
ATOM   903  O OG  . SER A 1 128 ? 11.092 88.906  -31.032 1.00 52.66 ? 128 SER A OG  1 
ATOM   904  N N   . PHE A 1 129 ? 14.046 87.503  -32.814 1.00 55.06 ? 129 PHE A N   1 
ATOM   905  C CA  . PHE A 1 129 ? 14.720 87.944  -34.029 1.00 56.20 ? 129 PHE A CA  1 
ATOM   906  C C   . PHE A 1 129 ? 13.911 89.065  -34.694 1.00 56.62 ? 129 PHE A C   1 
ATOM   907  O O   . PHE A 1 129 ? 14.443 89.855  -35.479 1.00 56.74 ? 129 PHE A O   1 
ATOM   908  C CB  . PHE A 1 129 ? 14.893 86.762  -34.991 1.00 56.76 ? 129 PHE A CB  1 
ATOM   909  C CG  . PHE A 1 129 ? 13.617 86.325  -35.656 1.00 57.12 ? 129 PHE A CG  1 
ATOM   910  C CD1 . PHE A 1 129 ? 13.216 86.893  -36.863 1.00 57.69 ? 129 PHE A CD1 1 
ATOM   911  C CD2 . PHE A 1 129 ? 12.805 85.363  -35.068 1.00 57.14 ? 129 PHE A CD2 1 
ATOM   912  C CE1 . PHE A 1 129 ? 12.024 86.507  -37.471 1.00 57.71 ? 129 PHE A CE1 1 
ATOM   913  C CE2 . PHE A 1 129 ? 11.611 84.972  -35.667 1.00 56.91 ? 129 PHE A CE2 1 
ATOM   914  C CZ  . PHE A 1 129 ? 11.221 85.545  -36.870 1.00 57.40 ? 129 PHE A CZ  1 
ATOM   915  N N   . VAL A 1 130 ? 12.621 89.126  -34.370 1.00 56.36 ? 130 VAL A N   1 
ATOM   916  C CA  . VAL A 1 130 ? 11.737 90.142  -34.926 1.00 55.85 ? 130 VAL A CA  1 
ATOM   917  C C   . VAL A 1 130 ? 12.060 91.514  -34.357 1.00 55.78 ? 130 VAL A C   1 
ATOM   918  O O   . VAL A 1 130 ? 12.548 92.389  -35.072 1.00 56.43 ? 130 VAL A O   1 
ATOM   919  C CB  . VAL A 1 130 ? 10.253 89.821  -34.636 1.00 56.00 ? 130 VAL A CB  1 
ATOM   920  C CG1 . VAL A 1 130 ? 9.395  91.058  -34.870 1.00 56.13 ? 130 VAL A CG1 1 
ATOM   921  C CG2 . VAL A 1 130 ? 9.780  88.687  -35.541 1.00 55.58 ? 130 VAL A CG2 1 
ATOM   922  N N   . GLU A 1 131 ? 11.783 91.705  -33.073 1.00 54.99 ? 131 GLU A N   1 
ATOM   923  C CA  . GLU A 1 131 ? 12.059 92.987  -32.445 1.00 54.73 ? 131 GLU A CA  1 
ATOM   924  C C   . GLU A 1 131 ? 13.503 93.406  -32.694 1.00 53.01 ? 131 GLU A C   1 
ATOM   925  O O   . GLU A 1 131 ? 13.807 94.593  -32.820 1.00 53.28 ? 131 GLU A O   1 
ATOM   926  C CB  . GLU A 1 131 ? 11.811 92.924  -30.937 1.00 55.89 ? 131 GLU A CB  1 
ATOM   927  C CG  . GLU A 1 131 ? 12.112 94.242  -30.240 1.00 58.88 ? 131 GLU A CG  1 
ATOM   928  C CD  . GLU A 1 131 ? 11.938 94.171  -28.738 1.00 61.46 ? 131 GLU A CD  1 
ATOM   929  O OE1 . GLU A 1 131 ? 10.827 93.822  -28.281 1.00 62.53 ? 131 GLU A OE1 1 
ATOM   930  O OE2 . GLU A 1 131 ? 12.915 94.470  -28.016 1.00 62.21 ? 131 GLU A OE2 1 
ATOM   931  N N   . ASP A 1 132 ? 14.395 92.429  -32.774 1.00 49.95 ? 132 ASP A N   1 
ATOM   932  C CA  . ASP A 1 132 ? 15.793 92.739  -32.992 1.00 47.90 ? 132 ASP A CA  1 
ATOM   933  C C   . ASP A 1 132 ? 16.029 93.428  -34.327 1.00 46.52 ? 132 ASP A C   1 
ATOM   934  O O   . ASP A 1 132 ? 16.702 94.456  -34.392 1.00 44.77 ? 132 ASP A O   1 
ATOM   935  C CB  . ASP A 1 132 ? 16.635 91.475  -32.920 1.00 47.57 ? 132 ASP A CB  1 
ATOM   936  C CG  . ASP A 1 132 ? 17.854 91.652  -32.051 1.00 47.88 ? 132 ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 132 ? 18.507 92.708  -32.169 1.00 48.94 ? 132 ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 132 ? 18.160 90.740  -31.256 1.00 48.82 ? 132 ASP A OD2 1 
ATOM   939  N N   . ALA A 1 133 ? 15.465 92.864  -35.389 1.00 45.32 ? 133 ALA A N   1 
ATOM   940  C CA  . ALA A 1 133 ? 15.630 93.418  -36.726 1.00 44.20 ? 133 ALA A CA  1 
ATOM   941  C C   . ALA A 1 133 ? 14.870 94.729  -36.926 1.00 42.99 ? 133 ALA A C   1 
ATOM   942  O O   . ALA A 1 133 ? 15.322 95.605  -37.668 1.00 41.48 ? 133 ALA A O   1 
ATOM   943  C CB  . ALA A 1 133 ? 15.194 92.396  -37.767 1.00 45.56 ? 133 ALA A CB  1 
ATOM   944  N N   . GLU A 1 134 ? 13.722 94.863  -36.268 1.00 42.22 ? 134 GLU A N   1 
ATOM   945  C CA  . GLU A 1 134 ? 12.918 96.078  -36.389 1.00 42.25 ? 134 GLU A CA  1 
ATOM   946  C C   . GLU A 1 134 ? 13.543 97.255  -35.654 1.00 42.13 ? 134 GLU A C   1 
ATOM   947  O O   . GLU A 1 134 ? 13.466 98.399  -36.110 1.00 42.40 ? 134 GLU A O   1 
ATOM   948  C CB  . GLU A 1 134 ? 11.500 95.837  -35.867 1.00 43.59 ? 134 GLU A CB  1 
ATOM   949  C CG  . GLU A 1 134 ? 10.530 95.346  -36.931 1.00 45.84 ? 134 GLU A CG  1 
ATOM   950  C CD  . GLU A 1 134 ? 9.188  94.943  -36.357 1.00 47.70 ? 134 GLU A CD  1 
ATOM   951  O OE1 . GLU A 1 134 ? 8.652  95.694  -35.517 1.00 48.17 ? 134 GLU A OE1 1 
ATOM   952  O OE2 . GLU A 1 134 ? 8.665  93.876  -36.751 1.00 49.30 ? 134 GLU A OE2 1 
ATOM   953  N N   . GLY A 1 135 ? 14.163 96.969  -34.514 1.00 41.28 ? 135 GLY A N   1 
ATOM   954  C CA  . GLY A 1 135 ? 14.800 98.017  -33.743 1.00 39.07 ? 135 GLY A CA  1 
ATOM   955  C C   . GLY A 1 135 ? 16.128 98.430  -34.344 1.00 37.59 ? 135 GLY A C   1 
ATOM   956  O O   . GLY A 1 135 ? 16.428 99.618  -34.439 1.00 36.58 ? 135 GLY A O   1 
ATOM   957  N N   . LEU A 1 136 ? 16.921 97.446  -34.764 1.00 36.51 ? 136 LEU A N   1 
ATOM   958  C CA  . LEU A 1 136 ? 18.230 97.718  -35.341 1.00 36.64 ? 136 LEU A CA  1 
ATOM   959  C C   . LEU A 1 136 ? 18.191 98.464  -36.668 1.00 36.79 ? 136 LEU A C   1 
ATOM   960  O O   . LEU A 1 136 ? 19.154 99.121  -37.041 1.00 37.71 ? 136 LEU A O   1 
ATOM   961  C CB  . LEU A 1 136 ? 19.015 96.412  -35.524 1.00 35.42 ? 136 LEU A CB  1 
ATOM   962  C CG  . LEU A 1 136 ? 19.605 95.719  -34.288 1.00 35.89 ? 136 LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 136 ? 20.259 94.408  -34.708 1.00 35.94 ? 136 LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 136 ? 20.633 96.621  -33.610 1.00 34.83 ? 136 LEU A CD2 1 
ATOM   965  N N   . ARG A 1 137 ? 17.079 98.377  -37.381 1.00 37.61 ? 137 ARG A N   1 
ATOM   966  C CA  . ARG A 1 137 ? 16.980 99.030  -38.681 1.00 38.29 ? 137 ARG A CA  1 
ATOM   967  C C   . ARG A 1 137 ? 16.954 100.560 -38.689 1.00 37.40 ? 137 ARG A C   1 
ATOM   968  O O   . ARG A 1 137 ? 17.825 101.195 -39.288 1.00 38.62 ? 137 ARG A O   1 
ATOM   969  C CB  . ARG A 1 137 ? 15.764 98.488  -39.441 1.00 38.26 ? 137 ARG A CB  1 
ATOM   970  N N   . ASP A 1 138 ? 15.960 101.149 -38.033 1.00 35.57 ? 138 ASP A N   1 
ATOM   971  C CA  . ASP A 1 138 ? 15.802 102.603 -38.015 1.00 34.03 ? 138 ASP A CA  1 
ATOM   972  C C   . ASP A 1 138 ? 16.154 103.310 -36.709 1.00 32.77 ? 138 ASP A C   1 
ATOM   973  O O   . ASP A 1 138 ? 15.701 104.429 -36.476 1.00 33.79 ? 138 ASP A O   1 
ATOM   974  C CB  . ASP A 1 138 ? 14.366 102.954 -38.391 1.00 33.09 ? 138 ASP A CB  1 
ATOM   975  C CG  . ASP A 1 138 ? 13.355 102.314 -37.462 1.00 34.25 ? 138 ASP A CG  1 
ATOM   976  O OD1 . ASP A 1 138 ? 12.144 102.541 -37.648 1.00 37.86 ? 138 ASP A OD1 1 
ATOM   977  O OD2 . ASP A 1 138 ? 13.763 101.581 -36.539 1.00 35.15 ? 138 ASP A OD2 1 
ATOM   978  N N   . ALA A 1 139 ? 16.947 102.666 -35.859 1.00 30.36 ? 139 ALA A N   1 
ATOM   979  C CA  . ALA A 1 139 ? 17.349 103.263 -34.592 1.00 28.20 ? 139 ALA A CA  1 
ATOM   980  C C   . ALA A 1 139 ? 18.699 103.946 -34.776 1.00 26.89 ? 139 ALA A C   1 
ATOM   981  O O   . ALA A 1 139 ? 19.706 103.273 -34.993 1.00 25.79 ? 139 ALA A O   1 
ATOM   982  C CB  . ALA A 1 139 ? 17.451 102.194 -33.528 1.00 28.28 ? 139 ALA A CB  1 
ATOM   983  N N   . GLN A 1 140 ? 18.717 105.276 -34.677 1.00 26.47 ? 140 GLN A N   1 
ATOM   984  C CA  . GLN A 1 140 ? 19.945 106.055 -34.847 1.00 24.53 ? 140 GLN A CA  1 
ATOM   985  C C   . GLN A 1 140 ? 20.989 105.779 -33.781 1.00 23.88 ? 140 GLN A C   1 
ATOM   986  O O   . GLN A 1 140 ? 22.168 106.092 -33.958 1.00 24.41 ? 140 GLN A O   1 
ATOM   987  C CB  . GLN A 1 140 ? 19.635 107.548 -34.862 1.00 26.65 ? 140 GLN A CB  1 
ATOM   988  C CG  . GLN A 1 140 ? 18.673 107.954 -35.953 1.00 26.97 ? 140 GLN A CG  1 
ATOM   989  C CD  . GLN A 1 140 ? 17.387 108.490 -35.397 1.00 27.70 ? 140 GLN A CD  1 
ATOM   990  O OE1 . GLN A 1 140 ? 16.747 107.856 -34.560 1.00 29.76 ? 140 GLN A OE1 1 
ATOM   991  N NE2 . GLN A 1 140 ? 16.995 109.666 -35.856 1.00 29.53 ? 140 GLN A NE2 1 
ATOM   992  N N   . ILE A 1 141 ? 20.570 105.217 -32.658 1.00 23.07 ? 141 ILE A N   1 
ATOM   993  C CA  . ILE A 1 141 ? 21.537 104.897 -31.619 1.00 23.27 ? 141 ILE A CA  1 
ATOM   994  C C   . ILE A 1 141 ? 21.269 103.492 -31.124 1.00 23.34 ? 141 ILE A C   1 
ATOM   995  O O   . ILE A 1 141 ? 20.154 103.168 -30.722 1.00 23.86 ? 141 ILE A O   1 
ATOM   996  C CB  . ILE A 1 141 ? 21.483 105.889 -30.428 1.00 23.04 ? 141 ILE A CB  1 
ATOM   997  C CG1 . ILE A 1 141 ? 21.956 107.274 -30.880 1.00 22.27 ? 141 ILE A CG1 1 
ATOM   998  C CG2 . ILE A 1 141 ? 22.371 105.389 -29.290 1.00 24.76 ? 141 ILE A CG2 1 
ATOM   999  C CD1 . ILE A 1 141 ? 22.019 108.292 -29.779 1.00 20.36 ? 141 ILE A CD1 1 
ATOM   1000 N N   . VAL A 1 142 ? 22.291 102.648 -31.192 1.00 22.49 ? 142 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 142 ? 22.163 101.279 -30.735 1.00 20.26 ? 142 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 142 ? 23.130 101.032 -29.584 1.00 20.26 ? 142 VAL A C   1 
ATOM   1003 O O   . VAL A 1 142 ? 24.332 101.285 -29.692 1.00 17.60 ? 142 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 142 ? 22.472 100.272 -31.865 1.00 22.01 ? 142 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 142 ? 22.339 98.848  -31.344 1.00 21.49 ? 142 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 142 ? 21.523 100.489 -33.040 1.00 23.76 ? 142 VAL A CG2 1 
ATOM   1007 N N   . VAL A 1 143 ? 22.591 100.559 -28.470 1.00 21.23 ? 143 VAL A N   1 
ATOM   1008 C CA  . VAL A 1 143 ? 23.406 100.242 -27.304 1.00 22.28 ? 143 VAL A CA  1 
ATOM   1009 C C   . VAL A 1 143 ? 23.190 98.757  -27.010 1.00 22.10 ? 143 VAL A C   1 
ATOM   1010 O O   . VAL A 1 143 ? 22.064 98.272  -27.076 1.00 24.00 ? 143 VAL A O   1 
ATOM   1011 C CB  . VAL A 1 143 ? 22.998 101.110 -26.076 1.00 21.93 ? 143 VAL A CB  1 
ATOM   1012 C CG1 . VAL A 1 143 ? 21.502 101.038 -25.846 1.00 20.13 ? 143 VAL A CG1 1 
ATOM   1013 C CG2 . VAL A 1 143 ? 23.741 100.641 -24.842 1.00 19.36 ? 143 VAL A CG2 1 
ATOM   1014 N N   . GLY A 1 144 ? 24.264 98.032  -26.715 1.00 21.90 ? 144 GLY A N   1 
ATOM   1015 C CA  . GLY A 1 144 ? 24.137 96.614  -26.425 1.00 20.72 ? 144 GLY A CA  1 
ATOM   1016 C C   . GLY A 1 144 ? 25.414 95.979  -25.916 1.00 20.07 ? 144 GLY A C   1 
ATOM   1017 O O   . GLY A 1 144 ? 26.348 96.673  -25.535 1.00 20.41 ? 144 GLY A O   1 
ATOM   1018 N N   . THR A 1 145 ? 25.448 94.652  -25.900 1.00 21.08 ? 145 THR A N   1 
ATOM   1019 C CA  . THR A 1 145 ? 26.619 93.904  -25.448 1.00 21.22 ? 145 THR A CA  1 
ATOM   1020 C C   . THR A 1 145 ? 27.341 93.348  -26.670 1.00 21.94 ? 145 THR A C   1 
ATOM   1021 O O   . THR A 1 145 ? 26.715 93.086  -27.694 1.00 21.99 ? 145 THR A O   1 
ATOM   1022 C CB  . THR A 1 145 ? 26.215 92.741  -24.527 1.00 19.58 ? 145 THR A CB  1 
ATOM   1023 O OG1 . THR A 1 145 ? 25.137 92.025  -25.126 1.00 19.26 ? 145 THR A OG1 1 
ATOM   1024 C CG2 . THR A 1 145 ? 25.773 93.254  -23.168 1.00 20.27 ? 145 THR A CG2 1 
ATOM   1025 N N   . PRO A 1 146 ? 28.668 93.153  -26.578 1.00 22.32 ? 146 PRO A N   1 
ATOM   1026 C CA  . PRO A 1 146 ? 29.442 92.631  -27.711 1.00 23.90 ? 146 PRO A CA  1 
ATOM   1027 C C   . PRO A 1 146 ? 28.793 91.433  -28.416 1.00 26.29 ? 146 PRO A C   1 
ATOM   1028 O O   . PRO A 1 146 ? 28.543 91.481  -29.622 1.00 25.43 ? 146 PRO A O   1 
ATOM   1029 C CB  . PRO A 1 146 ? 30.790 92.279  -27.072 1.00 24.31 ? 146 PRO A CB  1 
ATOM   1030 C CG  . PRO A 1 146 ? 30.899 93.270  -25.947 1.00 19.51 ? 146 PRO A CG  1 
ATOM   1031 C CD  . PRO A 1 146 ? 29.510 93.263  -25.373 1.00 20.84 ? 146 PRO A CD  1 
ATOM   1032 N N   . GLY A 1 147 ? 28.517 90.374  -27.653 1.00 27.31 ? 147 GLY A N   1 
ATOM   1033 C CA  . GLY A 1 147 ? 27.908 89.171  -28.197 1.00 28.06 ? 147 GLY A CA  1 
ATOM   1034 C C   . GLY A 1 147 ? 26.619 89.327  -28.994 1.00 29.78 ? 147 GLY A C   1 
ATOM   1035 O O   . GLY A 1 147 ? 26.536 88.844  -30.121 1.00 28.66 ? 147 GLY A O   1 
ATOM   1036 N N   . ARG A 1 148 ? 25.610 89.983  -28.427 1.00 31.22 ? 148 ARG A N   1 
ATOM   1037 C CA  . ARG A 1 148 ? 24.344 90.156  -29.133 1.00 32.61 ? 148 ARG A CA  1 
ATOM   1038 C C   . ARG A 1 148 ? 24.577 90.971  -30.387 1.00 32.10 ? 148 ARG A C   1 
ATOM   1039 O O   . ARG A 1 148 ? 24.065 90.653  -31.454 1.00 31.60 ? 148 ARG A O   1 
ATOM   1040 C CB  . ARG A 1 148 ? 23.329 90.913  -28.282 1.00 35.83 ? 148 ARG A CB  1 
ATOM   1041 C CG  . ARG A 1 148 ? 23.401 90.655  -26.801 1.00 42.15 ? 148 ARG A CG  1 
ATOM   1042 C CD  . ARG A 1 148 ? 22.738 89.360  -26.388 1.00 45.07 ? 148 ARG A CD  1 
ATOM   1043 N NE  . ARG A 1 148 ? 22.564 89.328  -24.936 1.00 48.83 ? 148 ARG A NE  1 
ATOM   1044 C CZ  . ARG A 1 148 ? 23.566 89.353  -24.063 1.00 49.75 ? 148 ARG A CZ  1 
ATOM   1045 N NH1 . ARG A 1 148 ? 24.818 89.409  -24.493 1.00 51.52 ? 148 ARG A NH1 1 
ATOM   1046 N NH2 . ARG A 1 148 ? 23.318 89.316  -22.761 1.00 50.09 ? 148 ARG A NH2 1 
ATOM   1047 N N   . VAL A 1 149 ? 25.338 92.045  -30.239 1.00 32.13 ? 149 VAL A N   1 
ATOM   1048 C CA  . VAL A 1 149 ? 25.626 92.923  -31.359 1.00 32.90 ? 149 VAL A CA  1 
ATOM   1049 C C   . VAL A 1 149 ? 26.319 92.200  -32.510 1.00 33.84 ? 149 VAL A C   1 
ATOM   1050 O O   . VAL A 1 149 ? 25.946 92.382  -33.667 1.00 33.89 ? 149 VAL A O   1 
ATOM   1051 C CB  . VAL A 1 149 ? 26.475 94.126  -30.905 1.00 31.96 ? 149 VAL A CB  1 
ATOM   1052 C CG1 . VAL A 1 149 ? 26.945 94.920  -32.115 1.00 32.93 ? 149 VAL A CG1 1 
ATOM   1053 C CG2 . VAL A 1 149 ? 25.653 95.012  -29.984 1.00 30.45 ? 149 VAL A CG2 1 
ATOM   1054 N N   . PHE A 1 150 ? 27.318 91.379  -32.202 1.00 34.34 ? 150 PHE A N   1 
ATOM   1055 C CA  . PHE A 1 150 ? 28.020 90.653  -33.250 1.00 36.59 ? 150 PHE A CA  1 
ATOM   1056 C C   . PHE A 1 150 ? 27.124 89.596  -33.883 1.00 37.04 ? 150 PHE A C   1 
ATOM   1057 O O   . PHE A 1 150 ? 27.085 89.465  -35.102 1.00 37.25 ? 150 PHE A O   1 
ATOM   1058 C CB  . PHE A 1 150 ? 29.283 89.981  -32.710 1.00 37.83 ? 150 PHE A CB  1 
ATOM   1059 C CG  . PHE A 1 150 ? 30.015 89.168  -33.741 1.00 39.71 ? 150 PHE A CG  1 
ATOM   1060 C CD1 . PHE A 1 150 ? 30.486 89.765  -34.909 1.00 41.31 ? 150 PHE A CD1 1 
ATOM   1061 C CD2 . PHE A 1 150 ? 30.223 87.808  -33.555 1.00 41.38 ? 150 PHE A CD2 1 
ATOM   1062 C CE1 . PHE A 1 150 ? 31.155 89.016  -35.879 1.00 41.12 ? 150 PHE A CE1 1 
ATOM   1063 C CE2 . PHE A 1 150 ? 30.889 87.046  -34.517 1.00 41.75 ? 150 PHE A CE2 1 
ATOM   1064 C CZ  . PHE A 1 150 ? 31.356 87.653  -35.682 1.00 41.41 ? 150 PHE A CZ  1 
ATOM   1065 N N   . ASP A 1 151 ? 26.418 88.835  -33.050 1.00 38.04 ? 151 ASP A N   1 
ATOM   1066 C CA  . ASP A 1 151 ? 25.521 87.801  -33.544 1.00 38.85 ? 151 ASP A CA  1 
ATOM   1067 C C   . ASP A 1 151 ? 24.558 88.387  -34.572 1.00 39.64 ? 151 ASP A C   1 
ATOM   1068 O O   . ASP A 1 151 ? 24.189 87.717  -35.530 1.00 40.19 ? 151 ASP A O   1 
ATOM   1069 C CB  . ASP A 1 151 ? 24.736 87.169  -32.393 1.00 40.85 ? 151 ASP A CB  1 
ATOM   1070 C CG  . ASP A 1 151 ? 25.596 86.267  -31.517 1.00 43.03 ? 151 ASP A CG  1 
ATOM   1071 O OD1 . ASP A 1 151 ? 26.305 85.399  -32.072 1.00 46.07 ? 151 ASP A OD1 1 
ATOM   1072 O OD2 . ASP A 1 151 ? 25.556 86.412  -30.275 1.00 43.05 ? 151 ASP A OD2 1 
ATOM   1073 N N   . ASN A 1 152 ? 24.155 89.638  -34.375 1.00 39.55 ? 152 ASN A N   1 
ATOM   1074 C CA  . ASN A 1 152 ? 23.254 90.290  -35.313 1.00 40.76 ? 152 ASN A CA  1 
ATOM   1075 C C   . ASN A 1 152 ? 23.962 90.614  -36.624 1.00 42.07 ? 152 ASN A C   1 
ATOM   1076 O O   . ASN A 1 152 ? 23.395 90.433  -37.698 1.00 42.75 ? 152 ASN A O   1 
ATOM   1077 C CB  . ASN A 1 152 ? 22.665 91.572  -34.712 1.00 39.53 ? 152 ASN A CB  1 
ATOM   1078 C CG  . ASN A 1 152 ? 21.425 91.306  -33.872 1.00 38.80 ? 152 ASN A CG  1 
ATOM   1079 O OD1 . ASN A 1 152 ? 21.488 91.223  -32.643 1.00 37.34 ? 152 ASN A OD1 1 
ATOM   1080 N ND2 . ASN A 1 152 ? 20.289 91.160  -34.539 1.00 37.23 ? 152 ASN A ND2 1 
ATOM   1081 N N   . ILE A 1 153 ? 25.198 91.095  -36.543 1.00 44.10 ? 153 ILE A N   1 
ATOM   1082 C CA  . ILE A 1 153 ? 25.951 91.409  -37.750 1.00 45.87 ? 153 ILE A CA  1 
ATOM   1083 C C   . ILE A 1 153 ? 26.228 90.112  -38.516 1.00 47.14 ? 153 ILE A C   1 
ATOM   1084 O O   . ILE A 1 153 ? 26.027 90.041  -39.731 1.00 47.25 ? 153 ILE A O   1 
ATOM   1085 C CB  . ILE A 1 153 ? 27.294 92.084  -37.429 1.00 45.51 ? 153 ILE A CB  1 
ATOM   1086 C CG1 . ILE A 1 153 ? 27.061 93.403  -36.693 1.00 46.11 ? 153 ILE A CG1 1 
ATOM   1087 C CG2 . ILE A 1 153 ? 28.050 92.353  -38.715 1.00 46.53 ? 153 ILE A CG2 1 
ATOM   1088 C CD1 . ILE A 1 153 ? 28.346 94.122  -36.316 1.00 43.72 ? 153 ILE A CD1 1 
ATOM   1089 N N   . GLN A 1 154 ? 26.683 89.088  -37.796 1.00 47.79 ? 154 GLN A N   1 
ATOM   1090 C CA  . GLN A 1 154 ? 26.980 87.791  -38.401 1.00 47.80 ? 154 GLN A CA  1 
ATOM   1091 C C   . GLN A 1 154 ? 25.696 87.183  -38.944 1.00 47.69 ? 154 GLN A C   1 
ATOM   1092 O O   . GLN A 1 154 ? 25.723 86.193  -39.672 1.00 47.76 ? 154 GLN A O   1 
ATOM   1093 C CB  . GLN A 1 154 ? 27.598 86.856  -37.367 1.00 47.81 ? 154 GLN A CB  1 
ATOM   1094 N N   . ARG A 1 155 ? 24.575 87.795  -38.576 1.00 47.78 ? 155 ARG A N   1 
ATOM   1095 C CA  . ARG A 1 155 ? 23.251 87.350  -38.991 1.00 46.72 ? 155 ARG A CA  1 
ATOM   1096 C C   . ARG A 1 155 ? 22.757 88.320  -40.060 1.00 45.61 ? 155 ARG A C   1 
ATOM   1097 O O   . ARG A 1 155 ? 21.683 88.144  -40.629 1.00 45.37 ? 155 ARG A O   1 
ATOM   1098 C CB  . ARG A 1 155 ? 22.306 87.379  -37.788 1.00 48.13 ? 155 ARG A CB  1 
ATOM   1099 C CG  . ARG A 1 155 ? 21.049 86.530  -37.909 1.00 50.16 ? 155 ARG A CG  1 
ATOM   1100 C CD  . ARG A 1 155 ? 21.313 85.081  -37.508 1.00 52.24 ? 155 ARG A CD  1 
ATOM   1101 N NE  . ARG A 1 155 ? 21.864 84.977  -36.157 1.00 53.58 ? 155 ARG A NE  1 
ATOM   1102 C CZ  . ARG A 1 155 ? 22.022 83.833  -35.495 1.00 55.52 ? 155 ARG A CZ  1 
ATOM   1103 N NH1 . ARG A 1 155 ? 21.668 82.679  -36.052 1.00 55.01 ? 155 ARG A NH1 1 
ATOM   1104 N NH2 . ARG A 1 155 ? 22.537 83.840  -34.271 1.00 56.40 ? 155 ARG A NH2 1 
ATOM   1105 N N   . ARG A 1 156 ? 23.553 89.354  -40.312 1.00 44.76 ? 156 ARG A N   1 
ATOM   1106 C CA  . ARG A 1 156 ? 23.232 90.377  -41.308 1.00 43.77 ? 156 ARG A CA  1 
ATOM   1107 C C   . ARG A 1 156 ? 21.943 91.120  -40.985 1.00 42.65 ? 156 ARG A C   1 
ATOM   1108 O O   . ARG A 1 156 ? 21.187 91.478  -41.886 1.00 43.55 ? 156 ARG A O   1 
ATOM   1109 C CB  . ARG A 1 156 ? 23.134 89.747  -42.700 1.00 44.73 ? 156 ARG A CB  1 
ATOM   1110 N N   . ARG A 1 157 ? 21.697 91.353  -39.699 1.00 40.38 ? 157 ARG A N   1 
ATOM   1111 C CA  . ARG A 1 157 ? 20.498 92.055  -39.268 1.00 38.64 ? 157 ARG A CA  1 
ATOM   1112 C C   . ARG A 1 157 ? 20.820 93.467  -38.772 1.00 38.05 ? 157 ARG A C   1 
ATOM   1113 O O   . ARG A 1 157 ? 19.926 94.206  -38.349 1.00 37.94 ? 157 ARG A O   1 
ATOM   1114 C CB  . ARG A 1 157 ? 19.805 91.258  -38.171 1.00 38.80 ? 157 ARG A CB  1 
ATOM   1115 N N   . PHE A 1 158 ? 22.098 93.840  -38.832 1.00 36.80 ? 158 PHE A N   1 
ATOM   1116 C CA  . PHE A 1 158 ? 22.543 95.157  -38.374 1.00 34.54 ? 158 PHE A CA  1 
ATOM   1117 C C   . PHE A 1 158 ? 23.224 95.929  -39.503 1.00 33.04 ? 158 PHE A C   1 
ATOM   1118 O O   . PHE A 1 158 ? 24.279 95.530  -39.993 1.00 31.82 ? 158 PHE A O   1 
ATOM   1119 C CB  . PHE A 1 158 ? 23.524 94.998  -37.197 1.00 34.26 ? 158 PHE A CB  1 
ATOM   1120 C CG  . PHE A 1 158 ? 23.819 96.282  -36.447 1.00 32.30 ? 158 PHE A CG  1 
ATOM   1121 C CD1 . PHE A 1 158 ? 23.575 97.527  -37.016 1.00 31.25 ? 158 PHE A CD1 1 
ATOM   1122 C CD2 . PHE A 1 158 ? 24.383 96.234  -35.175 1.00 33.21 ? 158 PHE A CD2 1 
ATOM   1123 C CE1 . PHE A 1 158 ? 23.889 98.708  -36.339 1.00 31.19 ? 158 PHE A CE1 1 
ATOM   1124 C CE2 . PHE A 1 158 ? 24.702 97.410  -34.484 1.00 32.93 ? 158 PHE A CE2 1 
ATOM   1125 C CZ  . PHE A 1 158 ? 24.452 98.653  -35.074 1.00 31.30 ? 158 PHE A CZ  1 
ATOM   1126 N N   . ARG A 1 159 ? 22.620 97.044  -39.903 1.00 31.94 ? 159 ARG A N   1 
ATOM   1127 C CA  . ARG A 1 159 ? 23.188 97.876  -40.956 1.00 31.82 ? 159 ARG A CA  1 
ATOM   1128 C C   . ARG A 1 159 ? 24.199 98.823  -40.315 1.00 30.78 ? 159 ARG A C   1 
ATOM   1129 O O   . ARG A 1 159 ? 23.855 99.609  -39.435 1.00 29.76 ? 159 ARG A O   1 
ATOM   1130 C CB  . ARG A 1 159 ? 22.081 98.674  -41.659 1.00 31.68 ? 159 ARG A CB  1 
ATOM   1131 N N   . THR A 1 160 ? 25.443 98.755  -40.769 1.00 30.17 ? 160 THR A N   1 
ATOM   1132 C CA  . THR A 1 160 ? 26.490 99.597  -40.214 1.00 31.51 ? 160 THR A CA  1 
ATOM   1133 C C   . THR A 1 160 ? 27.042 100.661 -41.157 1.00 31.62 ? 160 THR A C   1 
ATOM   1134 O O   . THR A 1 160 ? 27.894 101.453 -40.756 1.00 31.29 ? 160 THR A O   1 
ATOM   1135 C CB  . THR A 1 160 ? 27.680 98.757  -39.761 1.00 31.59 ? 160 THR A CB  1 
ATOM   1136 O OG1 . THR A 1 160 ? 28.273 98.134  -40.905 1.00 32.25 ? 160 THR A OG1 1 
ATOM   1137 C CG2 . THR A 1 160 ? 27.232 97.693  -38.772 1.00 33.25 ? 160 THR A CG2 1 
ATOM   1138 N N   . ASP A 1 161 ? 26.569 100.692 -42.396 1.00 31.42 ? 161 ASP A N   1 
ATOM   1139 C CA  . ASP A 1 161 ? 27.094 101.661 -43.349 1.00 32.54 ? 161 ASP A CA  1 
ATOM   1140 C C   . ASP A 1 161 ? 26.912 103.130 -42.961 1.00 31.89 ? 161 ASP A C   1 
ATOM   1141 O O   . ASP A 1 161 ? 27.673 103.982 -43.413 1.00 31.25 ? 161 ASP A O   1 
ATOM   1142 C CB  . ASP A 1 161 ? 26.524 101.400 -44.757 1.00 33.97 ? 161 ASP A CB  1 
ATOM   1143 C CG  . ASP A 1 161 ? 25.011 101.407 -44.795 1.00 35.50 ? 161 ASP A CG  1 
ATOM   1144 O OD1 . ASP A 1 161 ? 24.415 102.477 -44.562 1.00 37.68 ? 161 ASP A OD1 1 
ATOM   1145 O OD2 . ASP A 1 161 ? 24.418 100.338 -45.063 1.00 37.57 ? 161 ASP A OD2 1 
ATOM   1146 N N   . LYS A 1 162 ? 25.924 103.428 -42.121 1.00 31.08 ? 162 LYS A N   1 
ATOM   1147 C CA  . LYS A 1 162 ? 25.692 104.811 -41.705 1.00 31.67 ? 162 LYS A CA  1 
ATOM   1148 C C   . LYS A 1 162 ? 26.290 105.147 -40.344 1.00 29.95 ? 162 LYS A C   1 
ATOM   1149 O O   . LYS A 1 162 ? 26.124 106.255 -39.852 1.00 29.93 ? 162 LYS A O   1 
ATOM   1150 C CB  . LYS A 1 162 ? 24.193 105.124 -41.692 1.00 32.63 ? 162 LYS A CB  1 
ATOM   1151 C CG  . LYS A 1 162 ? 23.624 105.485 -43.062 1.00 37.26 ? 162 LYS A CG  1 
ATOM   1152 C CD  . LYS A 1 162 ? 24.241 106.781 -43.594 1.00 39.37 ? 162 LYS A CD  1 
ATOM   1153 C CE  . LYS A 1 162 ? 23.608 107.201 -44.913 1.00 41.06 ? 162 LYS A CE  1 
ATOM   1154 N NZ  . LYS A 1 162 ? 23.779 106.169 -45.976 1.00 41.89 ? 162 LYS A NZ  1 
ATOM   1155 N N   . ILE A 1 163 ? 26.985 104.188 -39.740 1.00 28.88 ? 163 ILE A N   1 
ATOM   1156 C CA  . ILE A 1 163 ? 27.606 104.395 -38.435 1.00 27.55 ? 163 ILE A CA  1 
ATOM   1157 C C   . ILE A 1 163 ? 28.703 105.461 -38.504 1.00 26.40 ? 163 ILE A C   1 
ATOM   1158 O O   . ILE A 1 163 ? 29.496 105.484 -39.444 1.00 27.55 ? 163 ILE A O   1 
ATOM   1159 C CB  . ILE A 1 163 ? 28.221 103.078 -37.916 1.00 27.52 ? 163 ILE A CB  1 
ATOM   1160 C CG1 . ILE A 1 163 ? 27.120 102.029 -37.749 1.00 23.68 ? 163 ILE A CG1 1 
ATOM   1161 C CG2 . ILE A 1 163 ? 28.984 103.332 -36.606 1.00 25.51 ? 163 ILE A CG2 1 
ATOM   1162 C CD1 . ILE A 1 163 ? 26.239 102.266 -36.554 1.00 27.75 ? 163 ILE A CD1 1 
ATOM   1163 N N   . LYS A 1 164 ? 28.745 106.337 -37.507 1.00 25.35 ? 164 LYS A N   1 
ATOM   1164 C CA  . LYS A 1 164 ? 29.749 107.399 -37.457 1.00 24.88 ? 164 LYS A CA  1 
ATOM   1165 C C   . LYS A 1 164 ? 30.696 107.231 -36.271 1.00 23.77 ? 164 LYS A C   1 
ATOM   1166 O O   . LYS A 1 164 ? 31.888 107.541 -36.370 1.00 25.11 ? 164 LYS A O   1 
ATOM   1167 C CB  . LYS A 1 164 ? 29.087 108.778 -37.348 1.00 24.64 ? 164 LYS A CB  1 
ATOM   1168 C CG  . LYS A 1 164 ? 28.248 109.184 -38.536 1.00 28.44 ? 164 LYS A CG  1 
ATOM   1169 C CD  . LYS A 1 164 ? 28.140 110.713 -38.626 1.00 27.41 ? 164 LYS A CD  1 
ATOM   1170 C CE  . LYS A 1 164 ? 27.223 111.288 -37.578 1.00 26.84 ? 164 LYS A CE  1 
ATOM   1171 N NZ  . LYS A 1 164 ? 25.810 111.032 -37.930 1.00 28.40 ? 164 LYS A NZ  1 
ATOM   1172 N N   . MET A 1 165 ? 30.162 106.763 -35.148 1.00 21.35 ? 165 MET A N   1 
ATOM   1173 C CA  . MET A 1 165 ? 30.968 106.586 -33.948 1.00 20.49 ? 165 MET A CA  1 
ATOM   1174 C C   . MET A 1 165 ? 30.755 105.249 -33.239 1.00 18.78 ? 165 MET A C   1 
ATOM   1175 O O   . MET A 1 165 ? 29.658 104.689 -33.220 1.00 18.35 ? 165 MET A O   1 
ATOM   1176 C CB  . MET A 1 165 ? 30.726 107.752 -32.971 1.00 22.78 ? 165 MET A CB  1 
ATOM   1177 C CG  . MET A 1 165 ? 29.260 108.022 -32.620 1.00 24.77 ? 165 MET A CG  1 
ATOM   1178 S SD  . MET A 1 165 ? 29.015 109.685 -31.884 1.00 23.55 ? 165 MET A SD  1 
ATOM   1179 C CE  . MET A 1 165 ? 29.974 109.570 -30.415 1.00 24.44 ? 165 MET A CE  1 
ATOM   1180 N N   . PHE A 1 166 ? 31.837 104.760 -32.655 1.00 15.76 ? 166 PHE A N   1 
ATOM   1181 C CA  . PHE A 1 166 ? 31.861 103.495 -31.961 1.00 16.79 ? 166 PHE A CA  1 
ATOM   1182 C C   . PHE A 1 166 ? 32.315 103.785 -30.531 1.00 17.65 ? 166 PHE A C   1 
ATOM   1183 O O   . PHE A 1 166 ? 33.449 104.217 -30.297 1.00 16.59 ? 166 PHE A O   1 
ATOM   1184 C CB  . PHE A 1 166 ? 32.837 102.578 -32.703 1.00 15.92 ? 166 PHE A CB  1 
ATOM   1185 C CG  . PHE A 1 166 ? 32.852 101.162 -32.226 1.00 17.39 ? 166 PHE A CG  1 
ATOM   1186 C CD1 . PHE A 1 166 ? 31.682 100.520 -31.847 1.00 18.57 ? 166 PHE A CD1 1 
ATOM   1187 C CD2 . PHE A 1 166 ? 34.042 100.438 -32.233 1.00 18.04 ? 166 PHE A CD2 1 
ATOM   1188 C CE1 . PHE A 1 166 ? 31.695 99.175  -31.484 1.00 19.15 ? 166 PHE A CE1 1 
ATOM   1189 C CE2 . PHE A 1 166 ? 34.068 99.096  -31.875 1.00 17.37 ? 166 PHE A CE2 1 
ATOM   1190 C CZ  . PHE A 1 166 ? 32.893 98.460  -31.499 1.00 19.97 ? 166 PHE A CZ  1 
ATOM   1191 N N   . ILE A 1 167 ? 31.410 103.556 -29.585 1.00 17.93 ? 167 ILE A N   1 
ATOM   1192 C CA  . ILE A 1 167 ? 31.668 103.814 -28.176 1.00 19.55 ? 167 ILE A CA  1 
ATOM   1193 C C   . ILE A 1 167 ? 31.795 102.541 -27.327 1.00 20.49 ? 167 ILE A C   1 
ATOM   1194 O O   . ILE A 1 167 ? 30.860 101.739 -27.230 1.00 19.95 ? 167 ILE A O   1 
ATOM   1195 C CB  . ILE A 1 167 ? 30.544 104.702 -27.605 1.00 19.13 ? 167 ILE A CB  1 
ATOM   1196 C CG1 . ILE A 1 167 ? 30.472 106.000 -28.411 1.00 18.71 ? 167 ILE A CG1 1 
ATOM   1197 C CG2 . ILE A 1 167 ? 30.779 104.981 -26.136 1.00 19.07 ? 167 ILE A CG2 1 
ATOM   1198 C CD1 . ILE A 1 167 ? 29.172 106.775 -28.229 1.00 18.10 ? 167 ILE A CD1 1 
ATOM   1199 N N   . LEU A 1 168 ? 32.965 102.360 -26.722 1.00 21.27 ? 168 LEU A N   1 
ATOM   1200 C CA  . LEU A 1 168 ? 33.215 101.206 -25.866 1.00 21.84 ? 168 LEU A CA  1 
ATOM   1201 C C   . LEU A 1 168 ? 33.197 101.678 -24.421 1.00 21.24 ? 168 LEU A C   1 
ATOM   1202 O O   . LEU A 1 168 ? 34.159 102.282 -23.943 1.00 21.80 ? 168 LEU A O   1 
ATOM   1203 C CB  . LEU A 1 168 ? 34.578 100.587 -26.170 1.00 21.24 ? 168 LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 168 ? 34.879 100.161 -27.606 1.00 24.50 ? 168 LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 168 ? 36.322 99.686  -27.678 1.00 23.87 ? 168 LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 168 ? 33.927 99.046  -28.046 1.00 26.99 ? 168 LEU A CD2 1 
ATOM   1207 N N   . ASP A 1 169 ? 32.099 101.411 -23.728 1.00 21.64 ? 169 ASP A N   1 
ATOM   1208 C CA  . ASP A 1 169 ? 31.976 101.808 -22.338 1.00 21.80 ? 169 ASP A CA  1 
ATOM   1209 C C   . ASP A 1 169 ? 32.486 100.683 -21.432 1.00 23.38 ? 169 ASP A C   1 
ATOM   1210 O O   . ASP A 1 169 ? 32.202 99.496  -21.664 1.00 20.35 ? 169 ASP A O   1 
ATOM   1211 C CB  . ASP A 1 169 ? 30.521 102.143 -22.019 1.00 21.70 ? 169 ASP A CB  1 
ATOM   1212 C CG  . ASP A 1 169 ? 30.346 102.738 -20.627 1.00 25.35 ? 169 ASP A CG  1 
ATOM   1213 O OD1 . ASP A 1 169 ? 31.164 103.600 -20.230 1.00 26.49 ? 169 ASP A OD1 1 
ATOM   1214 O OD2 . ASP A 1 169 ? 29.377 102.354 -19.936 1.00 25.91 ? 169 ASP A OD2 1 
ATOM   1215 N N   . GLU A 1 170 ? 33.237 101.080 -20.403 1.00 23.10 ? 170 GLU A N   1 
ATOM   1216 C CA  . GLU A 1 170 ? 33.826 100.165 -19.439 1.00 24.36 ? 170 GLU A CA  1 
ATOM   1217 C C   . GLU A 1 170 ? 34.648 99.100  -20.160 1.00 25.91 ? 170 GLU A C   1 
ATOM   1218 O O   . GLU A 1 170 ? 34.506 97.900  -19.909 1.00 26.34 ? 170 GLU A O   1 
ATOM   1219 C CB  . GLU A 1 170 ? 32.737 99.527  -18.572 1.00 24.02 ? 170 GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 170 ? 32.141 100.494 -17.580 1.00 28.04 ? 170 GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 170 ? 31.175 99.841  -16.611 1.00 31.73 ? 170 GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 170 ? 30.090 99.409  -17.049 1.00 33.46 ? 170 GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 170 ? 31.493 99.763  -15.404 1.00 34.39 ? 170 GLU A OE2 1 
ATOM   1224 N N   . ALA A 1 171 ? 35.523 99.569  -21.047 1.00 25.49 ? 171 ALA A N   1 
ATOM   1225 C CA  . ALA A 1 171 ? 36.384 98.711  -21.848 1.00 27.06 ? 171 ALA A CA  1 
ATOM   1226 C C   . ALA A 1 171 ? 37.171 97.648  -21.080 1.00 27.55 ? 171 ALA A C   1 
ATOM   1227 O O   . ALA A 1 171 ? 37.295 96.519  -21.548 1.00 29.20 ? 171 ALA A O   1 
ATOM   1228 C CB  . ALA A 1 171 ? 37.338 99.567  -22.660 1.00 27.33 ? 171 ALA A CB  1 
ATOM   1229 N N   . ASP A 1 172 ? 37.712 97.993  -19.916 1.00 27.56 ? 172 ASP A N   1 
ATOM   1230 C CA  . ASP A 1 172 ? 38.468 97.011  -19.153 1.00 26.22 ? 172 ASP A CA  1 
ATOM   1231 C C   . ASP A 1 172 ? 37.588 95.837  -18.724 1.00 26.06 ? 172 ASP A C   1 
ATOM   1232 O O   . ASP A 1 172 ? 38.024 94.688  -18.769 1.00 25.78 ? 172 ASP A O   1 
ATOM   1233 C CB  . ASP A 1 172 ? 39.142 97.657  -17.934 1.00 24.21 ? 172 ASP A CB  1 
ATOM   1234 C CG  . ASP A 1 172 ? 38.210 98.565  -17.160 1.00 26.56 ? 172 ASP A CG  1 
ATOM   1235 O OD1 . ASP A 1 172 ? 36.981 98.431  -17.323 1.00 27.71 ? 172 ASP A OD1 1 
ATOM   1236 O OD2 . ASP A 1 172 ? 38.709 99.411  -16.380 1.00 24.41 ? 172 ASP A OD2 1 
ATOM   1237 N N   . GLU A 1 173 ? 36.349 96.119  -18.331 1.00 26.83 ? 173 GLU A N   1 
ATOM   1238 C CA  . GLU A 1 173 ? 35.419 95.067  -17.901 1.00 27.40 ? 173 GLU A CA  1 
ATOM   1239 C C   . GLU A 1 173 ? 34.958 94.223  -19.087 1.00 27.29 ? 173 GLU A C   1 
ATOM   1240 O O   . GLU A 1 173 ? 34.705 93.023  -18.953 1.00 26.36 ? 173 GLU A O   1 
ATOM   1241 C CB  . GLU A 1 173 ? 34.188 95.675  -17.216 1.00 29.79 ? 173 GLU A CB  1 
ATOM   1242 C CG  . GLU A 1 173 ? 34.476 96.386  -15.908 1.00 32.08 ? 173 GLU A CG  1 
ATOM   1243 C CD  . GLU A 1 173 ? 35.173 95.484  -14.910 1.00 35.36 ? 173 GLU A CD  1 
ATOM   1244 O OE1 . GLU A 1 173 ? 34.710 94.334  -14.728 1.00 34.94 ? 173 GLU A OE1 1 
ATOM   1245 O OE2 . GLU A 1 173 ? 36.180 95.927  -14.308 1.00 37.59 ? 173 GLU A OE2 1 
ATOM   1246 N N   . MET A 1 174 ? 34.837 94.857  -20.247 1.00 26.07 ? 174 MET A N   1 
ATOM   1247 C CA  . MET A 1 174 ? 34.411 94.153  -21.448 1.00 25.22 ? 174 MET A CA  1 
ATOM   1248 C C   . MET A 1 174 ? 35.474 93.125  -21.834 1.00 24.70 ? 174 MET A C   1 
ATOM   1249 O O   . MET A 1 174 ? 35.163 91.974  -22.125 1.00 23.19 ? 174 MET A O   1 
ATOM   1250 C CB  . MET A 1 174 ? 34.223 95.148  -22.589 1.00 24.90 ? 174 MET A CB  1 
ATOM   1251 C CG  . MET A 1 174 ? 33.017 94.886  -23.460 1.00 26.32 ? 174 MET A CG  1 
ATOM   1252 S SD  . MET A 1 174 ? 32.020 96.404  -23.678 1.00 22.97 ? 174 MET A SD  1 
ATOM   1253 C CE  . MET A 1 174 ? 33.074 97.304  -24.780 1.00 22.32 ? 174 MET A CE  1 
ATOM   1254 N N   . LEU A 1 175 ? 36.732 93.561  -21.833 1.00 25.17 ? 175 LEU A N   1 
ATOM   1255 C CA  . LEU A 1 175 ? 37.855 92.700  -22.184 1.00 25.08 ? 175 LEU A CA  1 
ATOM   1256 C C   . LEU A 1 175 ? 38.083 91.594  -21.152 1.00 26.51 ? 175 LEU A C   1 
ATOM   1257 O O   . LEU A 1 175 ? 38.300 90.437  -21.513 1.00 27.06 ? 175 LEU A O   1 
ATOM   1258 C CB  . LEU A 1 175 ? 39.118 93.548  -22.350 1.00 24.77 ? 175 LEU A CB  1 
ATOM   1259 C CG  . LEU A 1 175 ? 39.522 94.135  -23.721 1.00 26.08 ? 175 LEU A CG  1 
ATOM   1260 C CD1 . LEU A 1 175 ? 38.466 93.861  -24.794 1.00 22.22 ? 175 LEU A CD1 1 
ATOM   1261 C CD2 . LEU A 1 175 ? 39.787 95.630  -23.566 1.00 24.11 ? 175 LEU A CD2 1 
ATOM   1262 N N   . SER A 1 176 ? 38.032 91.948  -19.871 1.00 27.15 ? 176 SER A N   1 
ATOM   1263 C CA  . SER A 1 176 ? 38.217 90.973  -18.797 1.00 28.57 ? 176 SER A CA  1 
ATOM   1264 C C   . SER A 1 176 ? 37.111 89.927  -18.808 1.00 29.79 ? 176 SER A C   1 
ATOM   1265 O O   . SER A 1 176 ? 37.180 88.925  -18.091 1.00 28.94 ? 176 SER A O   1 
ATOM   1266 C CB  . SER A 1 176 ? 38.220 91.666  -17.442 1.00 28.06 ? 176 SER A CB  1 
ATOM   1267 O OG  . SER A 1 176 ? 39.275 92.595  -17.374 1.00 33.68 ? 176 SER A OG  1 
ATOM   1268 N N   . SER A 1 177 ? 36.083 90.174  -19.612 1.00 30.29 ? 177 SER A N   1 
ATOM   1269 C CA  . SER A 1 177 ? 34.976 89.245  -19.718 1.00 31.31 ? 177 SER A CA  1 
ATOM   1270 C C   . SER A 1 177 ? 35.127 88.344  -20.941 1.00 32.41 ? 177 SER A C   1 
ATOM   1271 O O   . SER A 1 177 ? 34.289 87.473  -21.179 1.00 33.61 ? 177 SER A O   1 
ATOM   1272 C CB  . SER A 1 177 ? 33.652 90.007  -19.781 1.00 32.39 ? 177 SER A CB  1 
ATOM   1273 O OG  . SER A 1 177 ? 33.416 90.720  -18.578 1.00 31.65 ? 177 SER A OG  1 
ATOM   1274 N N   . GLY A 1 178 ? 36.200 88.552  -21.707 1.00 32.57 ? 178 GLY A N   1 
ATOM   1275 C CA  . GLY A 1 178 ? 36.451 87.741  -22.892 1.00 32.98 ? 178 GLY A CA  1 
ATOM   1276 C C   . GLY A 1 178 ? 35.750 88.218  -24.156 1.00 33.49 ? 178 GLY A C   1 
ATOM   1277 O O   . GLY A 1 178 ? 35.383 87.415  -25.021 1.00 32.87 ? 178 GLY A O   1 
ATOM   1278 N N   . PHE A 1 179 ? 35.572 89.530  -24.268 1.00 33.23 ? 179 PHE A N   1 
ATOM   1279 C CA  . PHE A 1 179 ? 34.893 90.114  -25.414 1.00 32.57 ? 179 PHE A CA  1 
ATOM   1280 C C   . PHE A 1 179 ? 35.833 90.723  -26.446 1.00 32.31 ? 179 PHE A C   1 
ATOM   1281 O O   . PHE A 1 179 ? 35.372 91.328  -27.416 1.00 31.65 ? 179 PHE A O   1 
ATOM   1282 C CB  . PHE A 1 179 ? 33.903 91.175  -24.933 1.00 33.77 ? 179 PHE A CB  1 
ATOM   1283 C CG  . PHE A 1 179 ? 32.724 90.612  -24.181 1.00 35.64 ? 179 PHE A CG  1 
ATOM   1284 C CD1 . PHE A 1 179 ? 32.270 91.221  -23.014 1.00 36.55 ? 179 PHE A CD1 1 
ATOM   1285 C CD2 . PHE A 1 179 ? 32.046 89.488  -24.654 1.00 37.20 ? 179 PHE A CD2 1 
ATOM   1286 C CE1 . PHE A 1 179 ? 31.159 90.721  -22.326 1.00 36.53 ? 179 PHE A CE1 1 
ATOM   1287 C CE2 . PHE A 1 179 ? 30.933 88.979  -23.975 1.00 37.43 ? 179 PHE A CE2 1 
ATOM   1288 C CZ  . PHE A 1 179 ? 30.490 89.600  -22.807 1.00 37.02 ? 179 PHE A CZ  1 
ATOM   1289 N N   . LYS A 1 180 ? 37.142 90.562  -26.256 1.00 31.63 ? 180 LYS A N   1 
ATOM   1290 C CA  . LYS A 1 180 ? 38.102 91.127  -27.205 1.00 31.70 ? 180 LYS A CA  1 
ATOM   1291 C C   . LYS A 1 180 ? 37.777 90.711  -28.631 1.00 31.93 ? 180 LYS A C   1 
ATOM   1292 O O   . LYS A 1 180 ? 37.745 91.538  -29.546 1.00 31.09 ? 180 LYS A O   1 
ATOM   1293 C CB  . LYS A 1 180 ? 39.539 90.690  -26.894 1.00 31.96 ? 180 LYS A CB  1 
ATOM   1294 C CG  . LYS A 1 180 ? 40.552 91.281  -27.889 1.00 31.35 ? 180 LYS A CG  1 
ATOM   1295 C CD  . LYS A 1 180 ? 41.926 90.600  -27.868 1.00 32.01 ? 180 LYS A CD  1 
ATOM   1296 C CE  . LYS A 1 180 ? 42.667 90.817  -26.554 1.00 32.09 ? 180 LYS A CE  1 
ATOM   1297 N NZ  . LYS A 1 180 ? 44.080 90.369  -26.657 1.00 29.37 ? 180 LYS A NZ  1 
ATOM   1298 N N   . GLU A 1 181 ? 37.531 89.419  -28.804 1.00 31.39 ? 181 GLU A N   1 
ATOM   1299 C CA  . GLU A 1 181 ? 37.229 88.863  -30.110 1.00 32.40 ? 181 GLU A CA  1 
ATOM   1300 C C   . GLU A 1 181 ? 35.989 89.502  -30.727 1.00 31.53 ? 181 GLU A C   1 
ATOM   1301 O O   . GLU A 1 181 ? 36.032 89.957  -31.873 1.00 30.06 ? 181 GLU A O   1 
ATOM   1302 C CB  . GLU A 1 181 ? 37.057 87.345  -29.990 1.00 34.93 ? 181 GLU A CB  1 
ATOM   1303 C CG  . GLU A 1 181 ? 37.096 86.607  -31.306 1.00 38.96 ? 181 GLU A CG  1 
ATOM   1304 C CD  . GLU A 1 181 ? 38.276 87.009  -32.163 1.00 41.75 ? 181 GLU A CD  1 
ATOM   1305 O OE1 . GLU A 1 181 ? 39.403 87.082  -31.627 1.00 44.34 ? 181 GLU A OE1 1 
ATOM   1306 O OE2 . GLU A 1 181 ? 38.080 87.246  -33.375 1.00 43.55 ? 181 GLU A OE2 1 
ATOM   1307 N N   . GLN A 1 182 ? 34.887 89.540  -29.981 1.00 30.91 ? 182 GLN A N   1 
ATOM   1308 C CA  . GLN A 1 182 ? 33.667 90.150  -30.502 1.00 29.95 ? 182 GLN A CA  1 
ATOM   1309 C C   . GLN A 1 182 ? 33.928 91.610  -30.845 1.00 29.61 ? 182 GLN A C   1 
ATOM   1310 O O   . GLN A 1 182 ? 33.559 92.079  -31.924 1.00 28.69 ? 182 GLN A O   1 
ATOM   1311 C CB  . GLN A 1 182 ? 32.523 90.077  -29.489 1.00 31.70 ? 182 GLN A CB  1 
ATOM   1312 C CG  . GLN A 1 182 ? 31.937 88.697  -29.267 1.00 32.68 ? 182 GLN A CG  1 
ATOM   1313 C CD  . GLN A 1 182 ? 32.796 87.851  -28.368 1.00 34.74 ? 182 GLN A CD  1 
ATOM   1314 O OE1 . GLN A 1 182 ? 33.781 88.330  -27.798 1.00 34.58 ? 182 GLN A OE1 1 
ATOM   1315 N NE2 . GLN A 1 182 ? 32.427 86.581  -28.221 1.00 35.80 ? 182 GLN A NE2 1 
ATOM   1316 N N   . ILE A 1 183 ? 34.567 92.331  -29.927 1.00 29.14 ? 183 ILE A N   1 
ATOM   1317 C CA  . ILE A 1 183 ? 34.854 93.736  -30.163 1.00 29.68 ? 183 ILE A CA  1 
ATOM   1318 C C   . ILE A 1 183 ? 35.733 93.941  -31.389 1.00 30.93 ? 183 ILE A C   1 
ATOM   1319 O O   . ILE A 1 183 ? 35.456 94.818  -32.205 1.00 29.77 ? 183 ILE A O   1 
ATOM   1320 C CB  . ILE A 1 183 ? 35.530 94.386  -28.949 1.00 30.22 ? 183 ILE A CB  1 
ATOM   1321 C CG1 . ILE A 1 183 ? 34.539 94.440  -27.781 1.00 28.82 ? 183 ILE A CG1 1 
ATOM   1322 C CG2 . ILE A 1 183 ? 36.030 95.788  -29.322 1.00 29.12 ? 183 ILE A CG2 1 
ATOM   1323 C CD1 . ILE A 1 183 ? 35.111 95.015  -26.507 1.00 26.48 ? 183 ILE A CD1 1 
ATOM   1324 N N   . TYR A 1 184 ? 36.785 93.131  -31.520 1.00 32.12 ? 184 TYR A N   1 
ATOM   1325 C CA  . TYR A 1 184 ? 37.691 93.232  -32.664 1.00 31.33 ? 184 TYR A CA  1 
ATOM   1326 C C   . TYR A 1 184 ? 36.942 92.951  -33.957 1.00 31.52 ? 184 TYR A C   1 
ATOM   1327 O O   . TYR A 1 184 ? 37.053 93.696  -34.927 1.00 30.30 ? 184 TYR A O   1 
ATOM   1328 C CB  . TYR A 1 184 ? 38.856 92.253  -32.504 1.00 32.34 ? 184 TYR A CB  1 
ATOM   1329 C CG  . TYR A 1 184 ? 40.002 92.790  -31.673 1.00 33.08 ? 184 TYR A CG  1 
ATOM   1330 C CD1 . TYR A 1 184 ? 39.782 93.740  -30.676 1.00 34.46 ? 184 TYR A CD1 1 
ATOM   1331 C CD2 . TYR A 1 184 ? 41.307 92.357  -31.887 1.00 34.39 ? 184 TYR A CD2 1 
ATOM   1332 C CE1 . TYR A 1 184 ? 40.831 94.249  -29.921 1.00 34.95 ? 184 TYR A CE1 1 
ATOM   1333 C CE2 . TYR A 1 184 ? 42.366 92.859  -31.133 1.00 33.89 ? 184 TYR A CE2 1 
ATOM   1334 C CZ  . TYR A 1 184 ? 42.121 93.810  -30.154 1.00 35.37 ? 184 TYR A CZ  1 
ATOM   1335 O OH  . TYR A 1 184 ? 43.166 94.355  -29.426 1.00 36.14 ? 184 TYR A OH  1 
ATOM   1336 N N   . GLN A 1 185 ? 36.164 91.878  -33.965 1.00 33.64 ? 185 GLN A N   1 
ATOM   1337 C CA  . GLN A 1 185 ? 35.394 91.525  -35.147 1.00 34.57 ? 185 GLN A CA  1 
ATOM   1338 C C   . GLN A 1 185 ? 34.350 92.591  -35.460 1.00 34.69 ? 185 GLN A C   1 
ATOM   1339 O O   . GLN A 1 185 ? 34.000 92.809  -36.620 1.00 35.25 ? 185 GLN A O   1 
ATOM   1340 C CB  . GLN A 1 185 ? 34.750 90.157  -34.953 1.00 37.31 ? 185 GLN A CB  1 
ATOM   1341 C CG  . GLN A 1 185 ? 35.731 89.000  -35.192 1.00 41.48 ? 185 GLN A CG  1 
ATOM   1342 C CD  . GLN A 1 185 ? 35.233 87.663  -34.641 1.00 44.87 ? 185 GLN A CD  1 
ATOM   1343 O OE1 . GLN A 1 185 ? 35.631 86.593  -35.118 1.00 46.28 ? 185 GLN A OE1 1 
ATOM   1344 N NE2 . GLN A 1 185 ? 34.376 87.721  -33.618 1.00 43.36 ? 185 GLN A NE2 1 
ATOM   1345 N N   . ILE A 1 186 ? 33.862 93.272  -34.430 1.00 34.07 ? 186 ILE A N   1 
ATOM   1346 C CA  . ILE A 1 186 ? 32.880 94.322  -34.647 1.00 32.53 ? 186 ILE A CA  1 
ATOM   1347 C C   . ILE A 1 186 ? 33.534 95.500  -35.384 1.00 32.05 ? 186 ILE A C   1 
ATOM   1348 O O   . ILE A 1 186 ? 32.926 96.084  -36.282 1.00 30.57 ? 186 ILE A O   1 
ATOM   1349 C CB  . ILE A 1 186 ? 32.251 94.777  -33.307 1.00 32.23 ? 186 ILE A CB  1 
ATOM   1350 C CG1 . ILE A 1 186 ? 31.325 93.671  -32.784 1.00 31.60 ? 186 ILE A CG1 1 
ATOM   1351 C CG2 . ILE A 1 186 ? 31.469 96.085  -33.496 1.00 30.86 ? 186 ILE A CG2 1 
ATOM   1352 C CD1 . ILE A 1 186 ? 30.747 93.939  -31.407 1.00 30.48 ? 186 ILE A CD1 1 
ATOM   1353 N N   . PHE A 1 187 ? 34.770 95.835  -35.015 1.00 31.43 ? 187 PHE A N   1 
ATOM   1354 C CA  . PHE A 1 187 ? 35.498 96.922  -35.673 1.00 32.28 ? 187 PHE A CA  1 
ATOM   1355 C C   . PHE A 1 187 ? 35.507 96.736  -37.197 1.00 32.49 ? 187 PHE A C   1 
ATOM   1356 O O   . PHE A 1 187 ? 35.249 97.679  -37.942 1.00 32.18 ? 187 PHE A O   1 
ATOM   1357 C CB  . PHE A 1 187 ? 36.960 96.987  -35.195 1.00 32.87 ? 187 PHE A CB  1 
ATOM   1358 C CG  . PHE A 1 187 ? 37.162 97.722  -33.884 1.00 35.84 ? 187 PHE A CG  1 
ATOM   1359 C CD1 . PHE A 1 187 ? 37.273 97.023  -32.682 1.00 34.09 ? 187 PHE A CD1 1 
ATOM   1360 C CD2 . PHE A 1 187 ? 37.283 99.122  -33.860 1.00 36.08 ? 187 PHE A CD2 1 
ATOM   1361 C CE1 . PHE A 1 187 ? 37.506 97.702  -31.473 1.00 33.93 ? 187 PHE A CE1 1 
ATOM   1362 C CE2 . PHE A 1 187 ? 37.516 99.809  -32.655 1.00 34.77 ? 187 PHE A CE2 1 
ATOM   1363 C CZ  . PHE A 1 187 ? 37.628 99.097  -31.462 1.00 33.49 ? 187 PHE A CZ  1 
ATOM   1364 N N   . THR A 1 188 ? 35.804 95.516  -37.649 1.00 32.50 ? 188 THR A N   1 
ATOM   1365 C CA  . THR A 1 188 ? 35.881 95.202  -39.080 1.00 33.11 ? 188 THR A CA  1 
ATOM   1366 C C   . THR A 1 188 ? 34.593 95.415  -39.867 1.00 33.20 ? 188 THR A C   1 
ATOM   1367 O O   . THR A 1 188 ? 34.626 95.654  -41.072 1.00 33.08 ? 188 THR A O   1 
ATOM   1368 C CB  . THR A 1 188 ? 36.302 93.732  -39.327 1.00 32.51 ? 188 THR A CB  1 
ATOM   1369 O OG1 . THR A 1 188 ? 35.199 92.865  -39.041 1.00 33.18 ? 188 THR A OG1 1 
ATOM   1370 C CG2 . THR A 1 188 ? 37.477 93.352  -38.449 1.00 32.82 ? 188 THR A CG2 1 
ATOM   1371 N N   . LEU A 1 189 ? 33.461 95.337  -39.187 1.00 33.58 ? 189 LEU A N   1 
ATOM   1372 C CA  . LEU A 1 189 ? 32.170 95.479  -39.844 1.00 34.20 ? 189 LEU A CA  1 
ATOM   1373 C C   . LEU A 1 189 ? 31.624 96.900  -39.798 1.00 35.76 ? 189 LEU A C   1 
ATOM   1374 O O   . LEU A 1 189 ? 30.438 97.133  -40.047 1.00 36.55 ? 189 LEU A O   1 
ATOM   1375 C CB  . LEU A 1 189 ? 31.201 94.496  -39.199 1.00 34.18 ? 189 LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 189 ? 31.902 93.132  -39.089 1.00 33.94 ? 189 LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 189 ? 31.275 92.285  -37.998 1.00 35.58 ? 189 LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 189 ? 31.856 92.431  -40.439 1.00 34.18 ? 189 LEU A CD2 1 
ATOM   1379 N N   . LEU A 1 190 ? 32.507 97.846  -39.491 1.00 35.93 ? 190 LEU A N   1 
ATOM   1380 C CA  . LEU A 1 190 ? 32.149 99.257  -39.405 1.00 36.12 ? 190 LEU A CA  1 
ATOM   1381 C C   . LEU A 1 190 ? 32.942 100.044 -40.431 1.00 35.17 ? 190 LEU A C   1 
ATOM   1382 O O   . LEU A 1 190 ? 34.082 99.703  -40.734 1.00 35.61 ? 190 LEU A O   1 
ATOM   1383 C CB  . LEU A 1 190 ? 32.447 99.791  -37.993 1.00 36.28 ? 190 LEU A CB  1 
ATOM   1384 C CG  . LEU A 1 190 ? 31.371 99.645  -36.902 1.00 36.35 ? 190 LEU A CG  1 
ATOM   1385 C CD1 . LEU A 1 190 ? 30.700 98.283  -36.963 1.00 36.34 ? 190 LEU A CD1 1 
ATOM   1386 C CD2 . LEU A 1 190 ? 32.014 99.870  -35.545 1.00 36.64 ? 190 LEU A CD2 1 
ATOM   1387 N N   . PRO A 1 191 ? 32.345 101.101 -40.995 1.00 34.97 ? 191 PRO A N   1 
ATOM   1388 C CA  . PRO A 1 191 ? 33.055 101.907 -41.992 1.00 35.53 ? 191 PRO A CA  1 
ATOM   1389 C C   . PRO A 1 191 ? 34.376 102.457 -41.442 1.00 35.67 ? 191 PRO A C   1 
ATOM   1390 O O   . PRO A 1 191 ? 34.465 102.833 -40.277 1.00 37.10 ? 191 PRO A O   1 
ATOM   1391 C CB  . PRO A 1 191 ? 32.034 102.989 -42.361 1.00 36.96 ? 191 PRO A CB  1 
ATOM   1392 C CG  . PRO A 1 191 ? 31.087 103.026 -41.185 1.00 35.58 ? 191 PRO A CG  1 
ATOM   1393 C CD  . PRO A 1 191 ? 30.973 101.591 -40.788 1.00 35.35 ? 191 PRO A CD  1 
ATOM   1394 N N   . PRO A 1 192 ? 35.418 102.519 -42.284 1.00 36.15 ? 192 PRO A N   1 
ATOM   1395 C CA  . PRO A 1 192 ? 36.739 103.013 -41.876 1.00 35.76 ? 192 PRO A CA  1 
ATOM   1396 C C   . PRO A 1 192 ? 36.731 104.386 -41.226 1.00 35.41 ? 192 PRO A C   1 
ATOM   1397 O O   . PRO A 1 192 ? 37.560 104.691 -40.364 1.00 36.42 ? 192 PRO A O   1 
ATOM   1398 C CB  . PRO A 1 192 ? 37.527 103.006 -43.183 1.00 35.71 ? 192 PRO A CB  1 
ATOM   1399 C CG  . PRO A 1 192 ? 36.477 103.347 -44.196 1.00 36.01 ? 192 PRO A CG  1 
ATOM   1400 C CD  . PRO A 1 192 ? 35.320 102.462 -43.756 1.00 36.87 ? 192 PRO A CD  1 
ATOM   1401 N N   . THR A 1 193 ? 35.777 105.205 -41.641 1.00 34.31 ? 193 THR A N   1 
ATOM   1402 C CA  . THR A 1 193 ? 35.645 106.568 -41.152 1.00 33.03 ? 193 THR A CA  1 
ATOM   1403 C C   . THR A 1 193 ? 35.012 106.732 -39.766 1.00 31.01 ? 193 THR A C   1 
ATOM   1404 O O   . THR A 1 193 ? 34.891 107.852 -39.286 1.00 31.74 ? 193 THR A O   1 
ATOM   1405 C CB  . THR A 1 193 ? 34.826 107.394 -42.162 1.00 32.47 ? 193 THR A CB  1 
ATOM   1406 O OG1 . THR A 1 193 ? 34.619 108.718 -41.662 1.00 37.88 ? 193 THR A OG1 1 
ATOM   1407 C CG2 . THR A 1 193 ? 33.486 106.749 -42.394 1.00 34.94 ? 193 THR A CG2 1 
ATOM   1408 N N   . THR A 1 194 ? 34.625 105.642 -39.108 1.00 28.59 ? 194 THR A N   1 
ATOM   1409 C CA  . THR A 1 194 ? 33.967 105.785 -37.810 1.00 26.45 ? 194 THR A CA  1 
ATOM   1410 C C   . THR A 1 194 ? 34.855 106.235 -36.659 1.00 24.26 ? 194 THR A C   1 
ATOM   1411 O O   . THR A 1 194 ? 35.941 105.698 -36.429 1.00 22.11 ? 194 THR A O   1 
ATOM   1412 C CB  . THR A 1 194 ? 33.254 104.490 -37.359 1.00 26.66 ? 194 THR A CB  1 
ATOM   1413 O OG1 . THR A 1 194 ? 34.218 103.563 -36.862 1.00 28.84 ? 194 THR A OG1 1 
ATOM   1414 C CG2 . THR A 1 194 ? 32.512 103.854 -38.509 1.00 27.76 ? 194 THR A CG2 1 
ATOM   1415 N N   . GLN A 1 195 ? 34.369 107.240 -35.942 1.00 21.89 ? 195 GLN A N   1 
ATOM   1416 C CA  . GLN A 1 195 ? 35.056 107.778 -34.782 1.00 20.61 ? 195 GLN A CA  1 
ATOM   1417 C C   . GLN A 1 195 ? 35.041 106.690 -33.714 1.00 19.93 ? 195 GLN A C   1 
ATOM   1418 O O   . GLN A 1 195 ? 34.055 105.983 -33.560 1.00 21.49 ? 195 GLN A O   1 
ATOM   1419 C CB  . GLN A 1 195 ? 34.307 108.996 -34.271 1.00 19.50 ? 195 GLN A CB  1 
ATOM   1420 C CG  . GLN A 1 195 ? 34.900 109.640 -33.049 1.00 18.80 ? 195 GLN A CG  1 
ATOM   1421 C CD  . GLN A 1 195 ? 34.045 110.799 -32.575 1.00 20.41 ? 195 GLN A CD  1 
ATOM   1422 O OE1 . GLN A 1 195 ? 34.482 111.631 -31.770 1.00 20.11 ? 195 GLN A OE1 1 
ATOM   1423 N NE2 . GLN A 1 195 ? 32.810 110.854 -33.068 1.00 16.78 ? 195 GLN A NE2 1 
ATOM   1424 N N   . VAL A 1 196 ? 36.130 106.554 -32.980 1.00 19.59 ? 196 VAL A N   1 
ATOM   1425 C CA  . VAL A 1 196 ? 36.212 105.538 -31.946 1.00 20.75 ? 196 VAL A CA  1 
ATOM   1426 C C   . VAL A 1 196 ? 36.346 106.209 -30.587 1.00 20.82 ? 196 VAL A C   1 
ATOM   1427 O O   . VAL A 1 196 ? 37.196 107.078 -30.412 1.00 21.42 ? 196 VAL A O   1 
ATOM   1428 C CB  . VAL A 1 196 ? 37.442 104.615 -32.169 1.00 21.04 ? 196 VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 196 ? 37.485 103.540 -31.093 1.00 21.73 ? 196 VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 196 ? 37.386 103.992 -33.567 1.00 19.52 ? 196 VAL A CG2 1 
ATOM   1431 N N   . VAL A 1 197 ? 35.505 105.811 -29.636 1.00 21.49 ? 197 VAL A N   1 
ATOM   1432 C CA  . VAL A 1 197 ? 35.548 106.358 -28.280 1.00 22.85 ? 197 VAL A CA  1 
ATOM   1433 C C   . VAL A 1 197 ? 35.598 105.242 -27.238 1.00 23.28 ? 197 VAL A C   1 
ATOM   1434 O O   . VAL A 1 197 ? 34.731 104.370 -27.200 1.00 22.88 ? 197 VAL A O   1 
ATOM   1435 C CB  . VAL A 1 197 ? 34.325 107.235 -27.971 1.00 22.97 ? 197 VAL A CB  1 
ATOM   1436 C CG1 . VAL A 1 197 ? 34.439 107.792 -26.554 1.00 21.01 ? 197 VAL A CG1 1 
ATOM   1437 C CG2 . VAL A 1 197 ? 34.217 108.354 -28.990 1.00 24.85 ? 197 VAL A CG2 1 
ATOM   1438 N N   . LEU A 1 198 ? 36.612 105.285 -26.385 1.00 24.19 ? 198 LEU A N   1 
ATOM   1439 C CA  . LEU A 1 198 ? 36.774 104.268 -25.358 1.00 25.25 ? 198 LEU A CA  1 
ATOM   1440 C C   . LEU A 1 198 ? 36.837 104.836 -23.943 1.00 24.88 ? 198 LEU A C   1 
ATOM   1441 O O   . LEU A 1 198 ? 37.653 105.707 -23.656 1.00 26.01 ? 198 LEU A O   1 
ATOM   1442 C CB  . LEU A 1 198 ? 38.034 103.450 -25.654 1.00 25.84 ? 198 LEU A CB  1 
ATOM   1443 C CG  . LEU A 1 198 ? 38.416 102.368 -24.642 1.00 27.13 ? 198 LEU A CG  1 
ATOM   1444 C CD1 . LEU A 1 198 ? 39.169 101.264 -25.358 1.00 26.43 ? 198 LEU A CD1 1 
ATOM   1445 C CD2 . LEU A 1 198 ? 39.251 102.978 -23.498 1.00 27.30 ? 198 LEU A CD2 1 
ATOM   1446 N N   . LEU A 1 199 ? 35.973 104.338 -23.060 1.00 24.79 ? 199 LEU A N   1 
ATOM   1447 C CA  . LEU A 1 199 ? 35.947 104.787 -21.669 1.00 24.57 ? 199 LEU A CA  1 
ATOM   1448 C C   . LEU A 1 199 ? 36.295 103.598 -20.790 1.00 26.34 ? 199 LEU A C   1 
ATOM   1449 O O   . LEU A 1 199 ? 35.810 102.484 -21.018 1.00 25.59 ? 199 LEU A O   1 
ATOM   1450 C CB  . LEU A 1 199 ? 34.563 105.293 -21.254 1.00 23.57 ? 199 LEU A CB  1 
ATOM   1451 C CG  . LEU A 1 199 ? 33.841 106.356 -22.076 1.00 24.26 ? 199 LEU A CG  1 
ATOM   1452 C CD1 . LEU A 1 199 ? 34.779 107.521 -22.295 1.00 24.01 ? 199 LEU A CD1 1 
ATOM   1453 C CD2 . LEU A 1 199 ? 33.356 105.762 -23.403 1.00 24.45 ? 199 LEU A CD2 1 
ATOM   1454 N N   . SER A 1 200 ? 37.118 103.838 -19.774 1.00 24.37 ? 200 SER A N   1 
ATOM   1455 C CA  . SER A 1 200 ? 37.513 102.768 -18.887 1.00 24.07 ? 200 SER A CA  1 
ATOM   1456 C C   . SER A 1 200 ? 38.020 103.342 -17.578 1.00 22.83 ? 200 SER A C   1 
ATOM   1457 O O   . SER A 1 200 ? 38.730 104.340 -17.578 1.00 23.64 ? 200 SER A O   1 
ATOM   1458 C CB  . SER A 1 200 ? 38.603 101.930 -19.559 1.00 23.43 ? 200 SER A CB  1 
ATOM   1459 O OG  . SER A 1 200 ? 38.880 100.765 -18.821 1.00 22.67 ? 200 SER A OG  1 
ATOM   1460 N N   . ALA A 1 201 ? 37.664 102.708 -16.466 1.00 22.05 ? 201 ALA A N   1 
ATOM   1461 C CA  . ALA A 1 201 ? 38.113 103.186 -15.162 1.00 22.60 ? 201 ALA A CA  1 
ATOM   1462 C C   . ALA A 1 201 ? 39.618 102.961 -15.006 1.00 23.38 ? 201 ALA A C   1 
ATOM   1463 O O   . ALA A 1 201 ? 40.312 103.789 -14.421 1.00 24.01 ? 201 ALA A O   1 
ATOM   1464 C CB  . ALA A 1 201 ? 37.354 102.483 -14.047 1.00 21.16 ? 201 ALA A CB  1 
ATOM   1465 N N   . THR A 1 202 ? 40.112 101.845 -15.540 1.00 24.30 ? 202 THR A N   1 
ATOM   1466 C CA  . THR A 1 202 ? 41.532 101.511 -15.484 1.00 24.67 ? 202 THR A CA  1 
ATOM   1467 C C   . THR A 1 202 ? 42.108 101.464 -16.902 1.00 26.69 ? 202 THR A C   1 
ATOM   1468 O O   . THR A 1 202 ? 41.371 101.347 -17.883 1.00 28.98 ? 202 THR A O   1 
ATOM   1469 C CB  . THR A 1 202 ? 41.784 100.126 -14.800 1.00 22.15 ? 202 THR A CB  1 
ATOM   1470 O OG1 . THR A 1 202 ? 41.251 99.075  -15.612 1.00 22.97 ? 202 THR A OG1 1 
ATOM   1471 C CG2 . THR A 1 202 ? 41.120 100.070 -13.443 1.00 20.18 ? 202 THR A CG2 1 
ATOM   1472 N N   . MET A 1 203 ? 43.429 101.534 -17.009 1.00 28.20 ? 203 MET A N   1 
ATOM   1473 C CA  . MET A 1 203 ? 44.086 101.510 -18.310 1.00 27.67 ? 203 MET A CA  1 
ATOM   1474 C C   . MET A 1 203 ? 45.083 100.354 -18.428 1.00 26.85 ? 203 MET A C   1 
ATOM   1475 O O   . MET A 1 203 ? 46.280 100.579 -18.594 1.00 26.40 ? 203 MET A O   1 
ATOM   1476 C CB  . MET A 1 203 ? 44.805 102.850 -18.553 1.00 26.49 ? 203 MET A CB  1 
ATOM   1477 C CG  . MET A 1 203 ? 43.874 104.046 -18.748 1.00 27.50 ? 203 MET A CG  1 
ATOM   1478 S SD  . MET A 1 203 ? 42.882 103.944 -20.279 1.00 33.79 ? 203 MET A SD  1 
ATOM   1479 C CE  . MET A 1 203 ? 41.296 104.626 -19.743 1.00 29.81 ? 203 MET A CE  1 
ATOM   1480 N N   . PRO A 1 204 ? 44.598 99.096  -18.348 1.00 28.04 ? 204 PRO A N   1 
ATOM   1481 C CA  . PRO A 1 204 ? 45.479 97.925  -18.450 1.00 27.37 ? 204 PRO A CA  1 
ATOM   1482 C C   . PRO A 1 204 ? 45.854 97.601  -19.888 1.00 29.84 ? 204 PRO A C   1 
ATOM   1483 O O   . PRO A 1 204 ? 45.140 97.986  -20.821 1.00 29.93 ? 204 PRO A O   1 
ATOM   1484 C CB  . PRO A 1 204 ? 44.646 96.818  -17.825 1.00 25.41 ? 204 PRO A CB  1 
ATOM   1485 C CG  . PRO A 1 204 ? 43.268 97.177  -18.275 1.00 27.20 ? 204 PRO A CG  1 
ATOM   1486 C CD  . PRO A 1 204 ? 43.219 98.678  -18.032 1.00 25.72 ? 204 PRO A CD  1 
ATOM   1487 N N   . ASN A 1 205 ? 46.969 96.882  -20.042 1.00 31.87 ? 205 ASN A N   1 
ATOM   1488 C CA  . ASN A 1 205 ? 47.506 96.450  -21.337 1.00 33.62 ? 205 ASN A CA  1 
ATOM   1489 C C   . ASN A 1 205 ? 46.435 96.235  -22.406 1.00 33.21 ? 205 ASN A C   1 
ATOM   1490 O O   . ASN A 1 205 ? 46.468 96.844  -23.480 1.00 34.69 ? 205 ASN A O   1 
ATOM   1491 C CB  . ASN A 1 205 ? 48.286 95.132  -21.179 1.00 36.99 ? 205 ASN A CB  1 
ATOM   1492 C CG  . ASN A 1 205 ? 49.566 95.286  -20.375 1.00 38.76 ? 205 ASN A CG  1 
ATOM   1493 O OD1 . ASN A 1 205 ? 50.082 94.308  -19.833 1.00 40.47 ? 205 ASN A OD1 1 
ATOM   1494 N ND2 . ASN A 1 205 ? 50.094 96.507  -20.308 1.00 39.86 ? 205 ASN A ND2 1 
ATOM   1495 N N   . ASP A 1 206 ? 45.495 95.349  -22.115 1.00 31.44 ? 206 ASP A N   1 
ATOM   1496 C CA  . ASP A 1 206 ? 44.438 95.059  -23.062 1.00 31.57 ? 206 ASP A CA  1 
ATOM   1497 C C   . ASP A 1 206 ? 43.770 96.316  -23.600 1.00 30.17 ? 206 ASP A C   1 
ATOM   1498 O O   . ASP A 1 206 ? 43.506 96.408  -24.800 1.00 30.37 ? 206 ASP A O   1 
ATOM   1499 C CB  . ASP A 1 206 ? 43.407 94.125  -22.423 1.00 32.79 ? 206 ASP A CB  1 
ATOM   1500 C CG  . ASP A 1 206 ? 43.844 92.677  -22.477 1.00 34.02 ? 206 ASP A CG  1 
ATOM   1501 O OD1 . ASP A 1 206 ? 43.224 91.830  -21.801 1.00 36.35 ? 206 ASP A OD1 1 
ATOM   1502 O OD2 . ASP A 1 206 ? 44.808 92.387  -23.214 1.00 34.02 ? 206 ASP A OD2 1 
ATOM   1503 N N   . VAL A 1 207 ? 43.511 97.291  -22.728 1.00 28.68 ? 207 VAL A N   1 
ATOM   1504 C CA  . VAL A 1 207 ? 42.875 98.528  -23.173 1.00 26.06 ? 207 VAL A CA  1 
ATOM   1505 C C   . VAL A 1 207 ? 43.817 99.325  -24.062 1.00 25.45 ? 207 VAL A C   1 
ATOM   1506 O O   . VAL A 1 207 ? 43.423 99.790  -25.124 1.00 25.00 ? 207 VAL A O   1 
ATOM   1507 C CB  . VAL A 1 207 ? 42.441 99.410  -21.994 1.00 25.29 ? 207 VAL A CB  1 
ATOM   1508 C CG1 . VAL A 1 207 ? 41.972 100.752 -22.513 1.00 24.75 ? 207 VAL A CG1 1 
ATOM   1509 C CG2 . VAL A 1 207 ? 41.323 98.738  -21.227 1.00 24.63 ? 207 VAL A CG2 1 
ATOM   1510 N N   . LEU A 1 208 ? 45.066 99.472  -23.636 1.00 25.10 ? 208 LEU A N   1 
ATOM   1511 C CA  . LEU A 1 208 ? 46.038 100.208 -24.430 1.00 25.18 ? 208 LEU A CA  1 
ATOM   1512 C C   . LEU A 1 208 ? 46.147 99.560  -25.816 1.00 24.93 ? 208 LEU A C   1 
ATOM   1513 O O   . LEU A 1 208 ? 46.183 100.242 -26.837 1.00 23.95 ? 208 LEU A O   1 
ATOM   1514 C CB  . LEU A 1 208 ? 47.399 100.194 -23.732 1.00 26.56 ? 208 LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 208 ? 47.468 100.779 -22.312 1.00 29.28 ? 208 LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 208 ? 48.799 100.390 -21.666 1.00 29.11 ? 208 LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 208 ? 47.303 102.287 -22.349 1.00 26.55 ? 208 LEU A CD2 1 
ATOM   1518 N N   . GLU A 1 209 ? 46.184 98.234  -25.839 1.00 24.46 ? 209 GLU A N   1 
ATOM   1519 C CA  . GLU A 1 209 ? 46.288 97.490  -27.085 1.00 25.37 ? 209 GLU A CA  1 
ATOM   1520 C C   . GLU A 1 209 ? 45.232 97.925  -28.090 1.00 24.78 ? 209 GLU A C   1 
ATOM   1521 O O   . GLU A 1 209 ? 45.548 98.268  -29.231 1.00 24.32 ? 209 GLU A O   1 
ATOM   1522 C CB  . GLU A 1 209 ? 46.151 95.991  -26.809 1.00 26.83 ? 209 GLU A CB  1 
ATOM   1523 C CG  . GLU A 1 209 ? 46.251 95.127  -28.046 1.00 30.19 ? 209 GLU A CG  1 
ATOM   1524 C CD  . GLU A 1 209 ? 46.197 93.641  -27.727 1.00 31.75 ? 209 GLU A CD  1 
ATOM   1525 O OE1 . GLU A 1 209 ? 46.993 93.191  -26.863 1.00 31.72 ? 209 GLU A OE1 1 
ATOM   1526 O OE2 . GLU A 1 209 ? 45.367 92.932  -28.346 1.00 29.64 ? 209 GLU A OE2 1 
ATOM   1527 N N   . VAL A 1 210 ? 43.976 97.909  -27.661 1.00 25.15 ? 210 VAL A N   1 
ATOM   1528 C CA  . VAL A 1 210 ? 42.876 98.304  -28.526 1.00 26.46 ? 210 VAL A CA  1 
ATOM   1529 C C   . VAL A 1 210 ? 43.024 99.767  -28.965 1.00 26.31 ? 210 VAL A C   1 
ATOM   1530 O O   . VAL A 1 210 ? 42.671 100.133 -30.090 1.00 26.30 ? 210 VAL A O   1 
ATOM   1531 C CB  . VAL A 1 210 ? 41.514 98.118  -27.812 1.00 27.64 ? 210 VAL A CB  1 
ATOM   1532 C CG1 . VAL A 1 210 ? 40.382 98.307  -28.809 1.00 28.23 ? 210 VAL A CG1 1 
ATOM   1533 C CG2 . VAL A 1 210 ? 41.433 96.741  -27.178 1.00 25.93 ? 210 VAL A CG2 1 
ATOM   1534 N N   . THR A 1 211 ? 43.562 100.596 -28.075 1.00 27.07 ? 211 THR A N   1 
ATOM   1535 C CA  . THR A 1 211 ? 43.751 102.009 -28.371 1.00 27.11 ? 211 THR A CA  1 
ATOM   1536 C C   . THR A 1 211 ? 44.760 102.223 -29.485 1.00 28.05 ? 211 THR A C   1 
ATOM   1537 O O   . THR A 1 211 ? 44.501 102.964 -30.432 1.00 29.04 ? 211 THR A O   1 
ATOM   1538 C CB  . THR A 1 211 ? 44.234 102.797 -27.130 1.00 26.66 ? 211 THR A CB  1 
ATOM   1539 O OG1 . THR A 1 211 ? 43.213 102.788 -26.127 1.00 27.21 ? 211 THR A OG1 1 
ATOM   1540 C CG2 . THR A 1 211 ? 44.528 104.237 -27.503 1.00 25.76 ? 211 THR A CG2 1 
ATOM   1541 N N   . THR A 1 212 ? 45.918 101.588 -29.376 1.00 27.97 ? 212 THR A N   1 
ATOM   1542 C CA  . THR A 1 212 ? 46.930 101.755 -30.404 1.00 29.31 ? 212 THR A CA  1 
ATOM   1543 C C   . THR A 1 212 ? 46.501 101.052 -31.682 1.00 30.35 ? 212 THR A C   1 
ATOM   1544 O O   . THR A 1 212 ? 46.871 101.460 -32.776 1.00 30.69 ? 212 THR A O   1 
ATOM   1545 C CB  . THR A 1 212 ? 48.291 101.209 -29.941 1.00 29.60 ? 212 THR A CB  1 
ATOM   1546 O OG1 . THR A 1 212 ? 48.237 99.781  -29.877 1.00 32.46 ? 212 THR A OG1 1 
ATOM   1547 C CG2 . THR A 1 212 ? 48.637 101.758 -28.560 1.00 28.18 ? 212 THR A CG2 1 
ATOM   1548 N N   . LYS A 1 213 ? 45.701 100.003 -31.540 1.00 33.39 ? 213 LYS A N   1 
ATOM   1549 C CA  . LYS A 1 213 ? 45.229 99.252  -32.689 1.00 35.66 ? 213 LYS A CA  1 
ATOM   1550 C C   . LYS A 1 213 ? 44.155 99.962  -33.501 1.00 37.34 ? 213 LYS A C   1 
ATOM   1551 O O   . LYS A 1 213 ? 44.207 99.962  -34.737 1.00 37.28 ? 213 LYS A O   1 
ATOM   1552 C CB  . LYS A 1 213 ? 44.693 97.888  -32.252 1.00 37.94 ? 213 LYS A CB  1 
ATOM   1553 C CG  . LYS A 1 213 ? 45.772 96.894  -31.835 1.00 43.55 ? 213 LYS A CG  1 
ATOM   1554 C CD  . LYS A 1 213 ? 45.200 95.482  -31.699 1.00 46.12 ? 213 LYS A CD  1 
ATOM   1555 C CE  . LYS A 1 213 ? 46.300 94.457  -31.421 1.00 47.94 ? 213 LYS A CE  1 
ATOM   1556 N NZ  . LYS A 1 213 ? 47.331 94.423  -32.507 1.00 49.05 ? 213 LYS A NZ  1 
ATOM   1557 N N   . PHE A 1 214 ? 43.187 100.576 -32.825 1.00 36.88 ? 214 PHE A N   1 
ATOM   1558 C CA  . PHE A 1 214 ? 42.102 101.222 -33.550 1.00 37.87 ? 214 PHE A CA  1 
ATOM   1559 C C   . PHE A 1 214 ? 41.979 102.734 -33.461 1.00 37.21 ? 214 PHE A C   1 
ATOM   1560 O O   . PHE A 1 214 ? 41.075 103.304 -34.062 1.00 37.19 ? 214 PHE A O   1 
ATOM   1561 C CB  . PHE A 1 214 ? 40.769 100.582 -33.152 1.00 39.36 ? 214 PHE A CB  1 
ATOM   1562 C CG  . PHE A 1 214 ? 40.743 99.086  -33.321 1.00 42.44 ? 214 PHE A CG  1 
ATOM   1563 C CD1 . PHE A 1 214 ? 40.758 98.247  -32.214 1.00 43.72 ? 214 PHE A CD1 1 
ATOM   1564 C CD2 . PHE A 1 214 ? 40.725 98.516  -34.589 1.00 43.40 ? 214 PHE A CD2 1 
ATOM   1565 C CE1 . PHE A 1 214 ? 40.754 96.852  -32.366 1.00 45.33 ? 214 PHE A CE1 1 
ATOM   1566 C CE2 . PHE A 1 214 ? 40.723 97.130  -34.752 1.00 44.61 ? 214 PHE A CE2 1 
ATOM   1567 C CZ  . PHE A 1 214 ? 40.737 96.297  -33.634 1.00 44.19 ? 214 PHE A CZ  1 
ATOM   1568 N N   . MET A 1 215 ? 42.870 103.394 -32.733 1.00 36.65 ? 215 MET A N   1 
ATOM   1569 C CA  . MET A 1 215 ? 42.783 104.845 -32.638 1.00 37.93 ? 215 MET A CA  1 
ATOM   1570 C C   . MET A 1 215 ? 43.877 105.581 -33.395 1.00 38.95 ? 215 MET A C   1 
ATOM   1571 O O   . MET A 1 215 ? 45.032 105.156 -33.430 1.00 39.11 ? 215 MET A O   1 
ATOM   1572 C CB  . MET A 1 215 ? 42.769 105.292 -31.176 1.00 36.47 ? 215 MET A CB  1 
ATOM   1573 C CG  . MET A 1 215 ? 41.408 105.179 -30.559 1.00 36.42 ? 215 MET A CG  1 
ATOM   1574 S SD  . MET A 1 215 ? 41.311 105.773 -28.886 1.00 37.31 ? 215 MET A SD  1 
ATOM   1575 C CE  . MET A 1 215 ? 41.107 104.240 -28.037 1.00 37.43 ? 215 MET A CE  1 
ATOM   1576 N N   . ARG A 1 216 ? 43.484 106.702 -33.989 1.00 40.39 ? 216 ARG A N   1 
ATOM   1577 C CA  . ARG A 1 216 ? 44.369 107.552 -34.775 1.00 40.95 ? 216 ARG A CA  1 
ATOM   1578 C C   . ARG A 1 216 ? 44.671 108.815 -33.974 1.00 40.66 ? 216 ARG A C   1 
ATOM   1579 O O   . ARG A 1 216 ? 43.790 109.654 -33.784 1.00 40.15 ? 216 ARG A O   1 
ATOM   1580 C CB  . ARG A 1 216 ? 43.667 107.919 -36.087 1.00 43.08 ? 216 ARG A CB  1 
ATOM   1581 C CG  . ARG A 1 216 ? 44.526 108.629 -37.117 1.00 48.11 ? 216 ARG A CG  1 
ATOM   1582 C CD  . ARG A 1 216 ? 43.717 108.938 -38.376 1.00 50.83 ? 216 ARG A CD  1 
ATOM   1583 N NE  . ARG A 1 216 ? 44.567 109.345 -39.495 1.00 53.85 ? 216 ARG A NE  1 
ATOM   1584 C CZ  . ARG A 1 216 ? 44.115 109.660 -40.706 1.00 55.10 ? 216 ARG A CZ  1 
ATOM   1585 N NH1 . ARG A 1 216 ? 42.812 109.619 -40.966 1.00 55.14 ? 216 ARG A NH1 1 
ATOM   1586 N NH2 . ARG A 1 216 ? 44.965 110.010 -41.664 1.00 56.15 ? 216 ARG A NH2 1 
ATOM   1587 N N   . ASN A 1 217 ? 45.913 108.945 -33.507 1.00 40.40 ? 217 ASN A N   1 
ATOM   1588 C CA  . ASN A 1 217 ? 46.332 110.103 -32.716 1.00 39.05 ? 217 ASN A CA  1 
ATOM   1589 C C   . ASN A 1 217 ? 45.120 110.649 -31.969 1.00 38.56 ? 217 ASN A C   1 
ATOM   1590 O O   . ASN A 1 217 ? 44.682 111.774 -32.214 1.00 38.62 ? 217 ASN A O   1 
ATOM   1591 C CB  . ASN A 1 217 ? 46.892 111.192 -33.625 1.00 40.11 ? 217 ASN A CB  1 
ATOM   1592 C CG  . ASN A 1 217 ? 47.425 112.372 -32.847 1.00 41.86 ? 217 ASN A CG  1 
ATOM   1593 O OD1 . ASN A 1 217 ? 47.440 113.504 -33.338 1.00 41.87 ? 217 ASN A OD1 1 
ATOM   1594 N ND2 . ASN A 1 217 ? 47.878 112.114 -31.620 1.00 42.77 ? 217 ASN A ND2 1 
ATOM   1595 N N   . PRO A 1 218 ? 44.567 109.853 -31.042 1.00 37.44 ? 218 PRO A N   1 
ATOM   1596 C CA  . PRO A 1 218 ? 43.396 110.208 -30.240 1.00 36.45 ? 218 PRO A CA  1 
ATOM   1597 C C   . PRO A 1 218 ? 43.672 111.231 -29.154 1.00 35.62 ? 218 PRO A C   1 
ATOM   1598 O O   . PRO A 1 218 ? 44.818 111.499 -28.821 1.00 36.71 ? 218 PRO A O   1 
ATOM   1599 C CB  . PRO A 1 218 ? 42.996 108.869 -29.646 1.00 36.40 ? 218 PRO A CB  1 
ATOM   1600 C CG  . PRO A 1 218 ? 44.334 108.294 -29.316 1.00 36.01 ? 218 PRO A CG  1 
ATOM   1601 C CD  . PRO A 1 218 ? 45.126 108.567 -30.583 1.00 36.39 ? 218 PRO A CD  1 
ATOM   1602 N N   . VAL A 1 219 ? 42.609 111.815 -28.612 1.00 34.56 ? 219 VAL A N   1 
ATOM   1603 C CA  . VAL A 1 219 ? 42.765 112.753 -27.515 1.00 34.27 ? 219 VAL A CA  1 
ATOM   1604 C C   . VAL A 1 219 ? 42.838 111.827 -26.302 1.00 33.49 ? 219 VAL A C   1 
ATOM   1605 O O   . VAL A 1 219 ? 42.103 110.843 -26.222 1.00 33.83 ? 219 VAL A O   1 
ATOM   1606 C CB  . VAL A 1 219 ? 41.553 113.708 -27.389 1.00 33.70 ? 219 VAL A CB  1 
ATOM   1607 C CG1 . VAL A 1 219 ? 40.280 112.921 -27.329 1.00 35.91 ? 219 VAL A CG1 1 
ATOM   1608 C CG2 . VAL A 1 219 ? 41.682 114.546 -26.140 1.00 35.32 ? 219 VAL A CG2 1 
ATOM   1609 N N   . ARG A 1 220 ? 43.733 112.121 -25.372 1.00 32.32 ? 220 ARG A N   1 
ATOM   1610 C CA  . ARG A 1 220 ? 43.885 111.270 -24.214 1.00 32.47 ? 220 ARG A CA  1 
ATOM   1611 C C   . ARG A 1 220 ? 43.619 111.983 -22.901 1.00 31.82 ? 220 ARG A C   1 
ATOM   1612 O O   . ARG A 1 220 ? 44.335 112.907 -22.522 1.00 33.06 ? 220 ARG A O   1 
ATOM   1613 C CB  . ARG A 1 220 ? 45.287 110.651 -24.220 1.00 32.65 ? 220 ARG A CB  1 
ATOM   1614 C CG  . ARG A 1 220 ? 45.480 109.596 -25.314 1.00 34.82 ? 220 ARG A CG  1 
ATOM   1615 C CD  . ARG A 1 220 ? 46.953 109.218 -25.505 1.00 36.80 ? 220 ARG A CD  1 
ATOM   1616 N NE  . ARG A 1 220 ? 47.679 110.263 -26.224 1.00 39.21 ? 220 ARG A NE  1 
ATOM   1617 C CZ  . ARG A 1 220 ? 49.000 110.309 -26.370 1.00 39.58 ? 220 ARG A CZ  1 
ATOM   1618 N NH1 . ARG A 1 220 ? 49.553 111.308 -27.048 1.00 41.01 ? 220 ARG A NH1 1 
ATOM   1619 N NH2 . ARG A 1 220 ? 49.769 109.365 -25.837 1.00 40.41 ? 220 ARG A NH2 1 
ATOM   1620 N N   . ILE A 1 221 ? 42.569 111.544 -22.218 1.00 30.93 ? 221 ILE A N   1 
ATOM   1621 C CA  . ILE A 1 221 ? 42.185 112.103 -20.927 1.00 30.27 ? 221 ILE A CA  1 
ATOM   1622 C C   . ILE A 1 221 ? 42.500 111.010 -19.901 1.00 30.84 ? 221 ILE A C   1 
ATOM   1623 O O   . ILE A 1 221 ? 41.712 110.083 -19.707 1.00 29.42 ? 221 ILE A O   1 
ATOM   1624 C CB  . ILE A 1 221 ? 40.683 112.441 -20.922 1.00 29.08 ? 221 ILE A CB  1 
ATOM   1625 C CG1 . ILE A 1 221 ? 40.374 113.370 -22.103 1.00 28.88 ? 221 ILE A CG1 1 
ATOM   1626 C CG2 . ILE A 1 221 ? 40.298 113.095 -19.609 1.00 29.48 ? 221 ILE A CG2 1 
ATOM   1627 C CD1 . ILE A 1 221 ? 38.939 113.835 -22.205 1.00 26.03 ? 221 ILE A CD1 1 
ATOM   1628 N N   . LEU A 1 222 ? 43.665 111.117 -19.263 1.00 31.27 ? 222 LEU A N   1 
ATOM   1629 C CA  . LEU A 1 222 ? 44.109 110.113 -18.300 1.00 33.22 ? 222 LEU A CA  1 
ATOM   1630 C C   . LEU A 1 222 ? 44.026 110.519 -16.837 1.00 34.85 ? 222 LEU A C   1 
ATOM   1631 O O   . LEU A 1 222 ? 44.164 111.690 -16.493 1.00 35.94 ? 222 LEU A O   1 
ATOM   1632 C CB  . LEU A 1 222 ? 45.549 109.697 -18.608 1.00 32.39 ? 222 LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 222 ? 45.907 109.504 -20.081 1.00 32.10 ? 222 LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 222 ? 47.314 108.956 -20.192 1.00 31.66 ? 222 LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 222 ? 44.916 108.564 -20.732 1.00 32.26 ? 222 LEU A CD2 1 
ATOM   1636 N N   . VAL A 1 223 ? 43.818 109.516 -15.990 1.00 38.07 ? 223 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 223 ? 43.702 109.663 -14.542 1.00 41.06 ? 223 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 223 ? 42.416 110.373 -14.131 1.00 43.52 ? 223 VAL A C   1 
ATOM   1639 O O   . VAL A 1 223 ? 41.513 109.674 -13.626 1.00 43.75 ? 223 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 223 ? 44.897 110.432 -13.952 1.00 41.71 ? 223 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 223 ? 44.721 110.577 -12.441 1.00 43.45 ? 223 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 223 ? 46.194 109.705 -14.268 1.00 41.09 ? 223 VAL A CG2 1 
ATOM   1643 O OXT . VAL A 1 223 ? 42.319 111.610 -14.325 1.00 45.31 ? 223 VAL A OXT 1 
HETATM 1644 O O   . HOH B 2 .   ? 18.355 93.035  -29.102 1.00 34.78 ? 501 HOH A O   1 
HETATM 1645 O O   . HOH B 2 .   ? 13.783 99.078  -29.650 1.00 31.12 ? 502 HOH A O   1 
HETATM 1646 O O   . HOH B 2 .   ? 41.336 87.964  -30.263 1.00 27.58 ? 503 HOH A O   1 
HETATM 1647 O O   . HOH B 2 .   ? 28.388 115.166 -37.488 1.00 22.87 ? 504 HOH A O   1 
HETATM 1648 O O   . HOH B 2 .   ? 25.087 117.590 -36.676 1.00 26.13 ? 505 HOH A O   1 
HETATM 1649 O O   . HOH B 2 .   ? 15.979 116.188 -25.518 1.00 24.35 ? 506 HOH A O   1 
HETATM 1650 O O   . HOH B 2 .   ? 31.158 109.235 -14.179 1.00 19.96 ? 507 HOH A O   1 
HETATM 1651 O O   . HOH B 2 .   ? 32.846 110.077 -37.982 1.00 26.71 ? 508 HOH A O   1 
HETATM 1652 O O   . HOH B 2 .   ? 33.713 116.660 -11.094 1.00 36.17 ? 509 HOH A O   1 
HETATM 1653 O O   . HOH B 2 .   ? 19.084 117.199 -33.517 1.00 21.98 ? 510 HOH A O   1 
HETATM 1654 O O   . HOH B 2 .   ? 21.349 115.682 -33.113 1.00 18.94 ? 511 HOH A O   1 
HETATM 1655 O O   . HOH B 2 .   ? 24.558 90.551  -19.626 1.00 19.38 ? 512 HOH A O   1 
HETATM 1656 O O   . HOH B 2 .   ? 34.476 119.269 -23.159 1.00 22.67 ? 513 HOH A O   1 
HETATM 1657 O O   . HOH B 2 .   ? 38.588 106.327 -36.617 1.00 19.19 ? 514 HOH A O   1 
HETATM 1658 O O   . HOH B 2 .   ? 14.668 107.198 -19.528 1.00 24.13 ? 515 HOH A O   1 
HETATM 1659 O O   . HOH B 2 .   ? 13.297 108.722 -35.137 1.00 29.08 ? 516 HOH A O   1 
HETATM 1660 O O   . HOH B 2 .   ? 44.916 115.163 -30.269 1.00 27.98 ? 517 HOH A O   1 
HETATM 1661 O O   . HOH B 2 .   ? 32.770 115.622 -37.071 1.00 45.29 ? 518 HOH A O   1 
HETATM 1662 O O   . HOH B 2 .   ? 34.000 100.038 -14.582 1.00 26.10 ? 519 HOH A O   1 
HETATM 1663 O O   . HOH B 2 .   ? 33.392 92.339  -12.472 1.00 36.92 ? 520 HOH A O   1 
HETATM 1664 O O   . HOH B 2 .   ? 13.437 104.264 -20.183 1.00 45.32 ? 521 HOH A O   1 
HETATM 1665 O O   . HOH B 2 .   ? 15.026 111.652 -15.421 1.00 34.87 ? 522 HOH A O   1 
HETATM 1666 O O   . HOH B 2 .   ? 15.555 115.078 -20.152 1.00 27.73 ? 523 HOH A O   1 
HETATM 1667 O O   . HOH B 2 .   ? 31.241 96.529  -14.438 1.00 48.93 ? 524 HOH A O   1 
HETATM 1668 O O   . HOH B 2 .   ? 12.548 109.534 -20.760 1.00 38.87 ? 525 HOH A O   1 
HETATM 1669 O O   . HOH B 2 .   ? 49.356 115.598 -30.677 1.00 30.70 ? 526 HOH A O   1 
HETATM 1670 O O   . HOH B 2 .   ? 24.108 102.338 -40.236 1.00 35.64 ? 527 HOH A O   1 
HETATM 1671 O O   . HOH B 2 .   ? 43.014 107.401 -10.043 1.00 32.18 ? 528 HOH A O   1 
HETATM 1672 O O   . HOH B 2 .   ? 17.434 125.133 -25.881 1.00 33.07 ? 529 HOH A O   1 
HETATM 1673 O O   . HOH B 2 .   ? 42.970 119.237 -31.514 1.00 40.99 ? 530 HOH A O   1 
HETATM 1674 O O   . HOH B 2 .   ? 28.093 119.733 -34.003 1.00 43.08 ? 531 HOH A O   1 
HETATM 1675 O O   . HOH B 2 .   ? 31.924 123.224 -14.227 1.00 41.76 ? 532 HOH A O   1 
HETATM 1676 O O   . HOH B 2 .   ? 41.003 119.508 -21.788 1.00 33.95 ? 533 HOH A O   1 
HETATM 1677 O O   . HOH B 2 .   ? 46.577 104.744 -15.196 1.00 38.01 ? 534 HOH A O   1 
HETATM 1678 O O   . HOH B 2 .   ? 21.222 113.980 -44.107 1.00 31.28 ? 535 HOH A O   1 
HETATM 1679 O O   . HOH B 2 .   ? 12.130 96.274  -32.209 1.00 35.19 ? 536 HOH A O   1 
HETATM 1680 O O   . HOH B 2 .   ? 28.332 89.657  -41.205 1.00 33.81 ? 537 HOH A O   1 
HETATM 1681 O O   . HOH B 2 .   ? 41.322 91.935  -19.753 1.00 30.85 ? 538 HOH A O   1 
HETATM 1682 O O   . HOH B 2 .   ? 10.036 118.957 -26.506 1.00 47.81 ? 539 HOH A O   1 
HETATM 1683 O O   . HOH B 2 .   ? 35.389 101.021 -16.283 1.00 32.50 ? 540 HOH A O   1 
HETATM 1684 O O   . HOH B 2 .   ? 46.852 113.987 -8.331  1.00 31.02 ? 541 HOH A O   1 
HETATM 1685 O O   . HOH B 2 .   ? 22.027 100.595 -43.777 1.00 44.06 ? 542 HOH A O   1 
HETATM 1686 O O   . HOH B 2 .   ? 21.955 118.539 -35.564 1.00 47.06 ? 543 HOH A O   1 
HETATM 1687 O O   . HOH B 2 .   ? 18.884 124.835 -11.166 1.00 38.65 ? 544 HOH A O   1 
HETATM 1688 O O   . HOH B 2 .   ? 36.816 98.066  -40.894 1.00 41.64 ? 545 HOH A O   1 
HETATM 1689 O O   . HOH B 2 .   ? 13.086 117.068 -20.188 1.00 42.16 ? 546 HOH A O   1 
HETATM 1690 O O   . HOH B 2 .   ? 25.044 124.343 -25.790 1.00 29.12 ? 547 HOH A O   1 
HETATM 1691 O O   . HOH B 2 .   ? 25.510 119.333 -12.500 1.00 37.29 ? 548 HOH A O   1 
HETATM 1692 O O   . HOH B 2 .   ? 32.866 84.272  -20.311 1.00 35.32 ? 549 HOH A O   1 
HETATM 1693 O O   . HOH B 2 .   ? 19.283 85.130  -32.908 1.00 42.76 ? 550 HOH A O   1 
HETATM 1694 O O   . HOH B 2 .   ? 44.548 112.452 -36.741 1.00 51.30 ? 551 HOH A O   1 
HETATM 1695 O O   . HOH B 2 .   ? 20.948 112.846 -12.019 1.00 39.58 ? 552 HOH A O   1 
HETATM 1696 O O   . HOH B 2 .   ? 24.981 89.490  -17.405 1.00 34.94 ? 553 HOH A O   1 
HETATM 1697 O O   . HOH B 2 .   ? 28.088 94.271  -12.328 1.00 53.00 ? 554 HOH A O   1 
HETATM 1698 O O   . HOH B 2 .   ? 26.940 81.716  -28.914 1.00 32.13 ? 555 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ILE 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   ASP 6   6   ?   ?   ?   A . n 
A 1 7   ILE 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  SER 10  10  ?   ?   ?   A . n 
A 1 11  GLN 11  11  11  GLN ALA A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 MET 110 110 110 MET MET A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 MET 116 116 116 MET MET A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 HIS 121 121 121 HIS HIS A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 CYS 123 123 123 CYS CYS A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 ARG 137 137 137 ARG ALA A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 GLN 154 154 154 GLN ALA A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 ARG 156 156 156 ARG ALA A . n 
A 1 157 ARG 157 157 157 ARG ALA A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ARG 159 159 159 ARG ALA A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 MET 203 203 203 MET MET A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 PRO 218 218 218 PRO PRO A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-12-02 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       .                 ? 1 
QUANTUM   'data reduction' 'IV CCD SOFTWARE' ? 2 
SCALEPACK 'data scaling'   .                 ? 3 
CNS       phasing          .                 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 17  ? ? -95.96  34.17   
2 1 THR A 85  ? ? -35.89  -32.63  
3 1 VAL A 87  ? ? -57.55  104.98  
4 1 ILE A 124 ? ? -129.47 -161.63 
5 1 ASN A 205 ? ? -29.60  -58.26  
6 1 ASN A 217 ? ? 28.42   64.79   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 11  ? CG  ? A GLN 11  CG  
2  1 Y 1 A GLN 11  ? CD  ? A GLN 11  CD  
3  1 Y 1 A GLN 11  ? OE1 ? A GLN 11  OE1 
4  1 Y 1 A GLN 11  ? NE2 ? A GLN 11  NE2 
5  1 Y 1 A ARG 137 ? CG  ? A ARG 137 CG  
6  1 Y 1 A ARG 137 ? CD  ? A ARG 137 CD  
7  1 Y 1 A ARG 137 ? NE  ? A ARG 137 NE  
8  1 Y 1 A ARG 137 ? CZ  ? A ARG 137 CZ  
9  1 Y 1 A ARG 137 ? NH1 ? A ARG 137 NH1 
10 1 Y 1 A ARG 137 ? NH2 ? A ARG 137 NH2 
11 1 Y 1 A GLN 154 ? CG  ? A GLN 154 CG  
12 1 Y 1 A GLN 154 ? CD  ? A GLN 154 CD  
13 1 Y 1 A GLN 154 ? OE1 ? A GLN 154 OE1 
14 1 Y 1 A GLN 154 ? NE2 ? A GLN 154 NE2 
15 1 Y 1 A ARG 156 ? CG  ? A ARG 156 CG  
16 1 Y 1 A ARG 156 ? CD  ? A ARG 156 CD  
17 1 Y 1 A ARG 156 ? NE  ? A ARG 156 NE  
18 1 Y 1 A ARG 156 ? CZ  ? A ARG 156 CZ  
19 1 Y 1 A ARG 156 ? NH1 ? A ARG 156 NH1 
20 1 Y 1 A ARG 156 ? NH2 ? A ARG 156 NH2 
21 1 Y 1 A ARG 157 ? CG  ? A ARG 157 CG  
22 1 Y 1 A ARG 157 ? CD  ? A ARG 157 CD  
23 1 Y 1 A ARG 157 ? NE  ? A ARG 157 NE  
24 1 Y 1 A ARG 157 ? CZ  ? A ARG 157 CZ  
25 1 Y 1 A ARG 157 ? NH1 ? A ARG 157 NH1 
26 1 Y 1 A ARG 157 ? NH2 ? A ARG 157 NH2 
27 1 Y 1 A ARG 159 ? CG  ? A ARG 159 CG  
28 1 Y 1 A ARG 159 ? CD  ? A ARG 159 CD  
29 1 Y 1 A ARG 159 ? NE  ? A ARG 159 NE  
30 1 Y 1 A ARG 159 ? CZ  ? A ARG 159 CZ  
31 1 Y 1 A ARG 159 ? NH1 ? A ARG 159 NH1 
32 1 Y 1 A ARG 159 ? NH2 ? A ARG 159 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1  ? A SER 1  
2  1 Y 1 A GLU 2  ? A GLU 2  
3  1 Y 1 A GLY 3  ? A GLY 3  
4  1 Y 1 A ILE 4  ? A ILE 4  
5  1 Y 1 A THR 5  ? A THR 5  
6  1 Y 1 A ASP 6  ? A ASP 6  
7  1 Y 1 A ILE 7  ? A ILE 7  
8  1 Y 1 A GLU 8  ? A GLU 8  
9  1 Y 1 A GLU 9  ? A GLU 9  
10 1 Y 1 A SER 10 ? A SER 10 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  501 501 HOH HOH A . 
B 2 HOH 2  502 502 HOH HOH A . 
B 2 HOH 3  503 503 HOH HOH A . 
B 2 HOH 4  504 504 HOH HOH A . 
B 2 HOH 5  505 505 HOH HOH A . 
B 2 HOH 6  506 506 HOH HOH A . 
B 2 HOH 7  507 507 HOH HOH A . 
B 2 HOH 8  508 508 HOH HOH A . 
B 2 HOH 9  509 509 HOH HOH A . 
B 2 HOH 10 510 510 HOH HOH A . 
B 2 HOH 11 511 511 HOH HOH A . 
B 2 HOH 12 512 512 HOH HOH A . 
B 2 HOH 13 513 513 HOH HOH A . 
B 2 HOH 14 514 514 HOH HOH A . 
B 2 HOH 15 515 515 HOH HOH A . 
B 2 HOH 16 516 516 HOH HOH A . 
B 2 HOH 17 517 517 HOH HOH A . 
B 2 HOH 18 518 518 HOH HOH A . 
B 2 HOH 19 519 519 HOH HOH A . 
B 2 HOH 20 520 520 HOH HOH A . 
B 2 HOH 21 521 521 HOH HOH A . 
B 2 HOH 22 522 522 HOH HOH A . 
B 2 HOH 23 523 523 HOH HOH A . 
B 2 HOH 24 524 524 HOH HOH A . 
B 2 HOH 25 525 525 HOH HOH A . 
B 2 HOH 26 526 526 HOH HOH A . 
B 2 HOH 27 527 527 HOH HOH A . 
B 2 HOH 28 528 528 HOH HOH A . 
B 2 HOH 29 529 529 HOH HOH A . 
B 2 HOH 30 530 530 HOH HOH A . 
B 2 HOH 31 531 531 HOH HOH A . 
B 2 HOH 32 532 532 HOH HOH A . 
B 2 HOH 33 533 533 HOH HOH A . 
B 2 HOH 34 534 534 HOH HOH A . 
B 2 HOH 35 535 535 HOH HOH A . 
B 2 HOH 36 536 536 HOH HOH A . 
B 2 HOH 37 537 537 HOH HOH A . 
B 2 HOH 38 538 538 HOH HOH A . 
B 2 HOH 39 539 539 HOH HOH A . 
B 2 HOH 40 540 540 HOH HOH A . 
B 2 HOH 41 541 541 HOH HOH A . 
B 2 HOH 42 542 542 HOH HOH A . 
B 2 HOH 43 543 543 HOH HOH A . 
B 2 HOH 44 544 544 HOH HOH A . 
B 2 HOH 45 545 545 HOH HOH A . 
B 2 HOH 46 546 546 HOH HOH A . 
B 2 HOH 47 547 547 HOH HOH A . 
B 2 HOH 48 548 548 HOH HOH A . 
B 2 HOH 49 549 549 HOH HOH A . 
B 2 HOH 50 550 550 HOH HOH A . 
B 2 HOH 51 551 551 HOH HOH A . 
B 2 HOH 52 552 552 HOH HOH A . 
B 2 HOH 53 553 553 HOH HOH A . 
B 2 HOH 54 554 554 HOH HOH A . 
B 2 HOH 55 555 555 HOH HOH A . 
#