data_1QY4
# 
_entry.id   1QY4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QY4         
RCSB  RCSB020210   
WWPDB D_1000020210 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QXJ 'CRYSTAL STRUCTURE OF NATIVE PHOSPHOGLUCOSE ISOMERASE FROM PYROCOCCUS FURIOSUS'                               unspecified 
PDB 1QXR 'CRYSTAL STRUCTURE OF PHOSPHOGLUCOSE ISOMERASE FROM PYROCOCCUS FURIOSUS IN COMPLEX WITH 5-PHOSPHOARABINONATE' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QY4 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Swan, M.K.'       1 
'Solomons, J.T.G.' 2 
'Beeson, C.C.'     3 
'Hansen, T.'       4 
'Schonheit, P.'    5 
'Davies, C.'       6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus' 
J.Biol.Chem.         278 47261 47268 2003 JBCHA3 US 0021-9258 0071 ? 12970347 10.1074/jbc.M308603200 
1       'Crystallization and preliminary X-ray diffraction analysis of phosphoglucose isomerase from Pyrococcus furiosus'        
'Protein Pept.Lett.' 10  517   520   2003 PPELEN NE 0929-8665 2077 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Swan, M.K.'       1  
primary 'Solomons, J.T.G.' 2  
primary 'Beeson, C.C.'     3  
primary 'Hansen, T.'       4  
primary 'Schonheit, P.'    5  
primary 'Davies, C.'       6  
1       'Swan, M.K.'       7  
1       'Hansen, T.'       8  
1       'Schonheit, P.'    9  
1       'Davies, C.'       10 
# 
_cell.entry_id           1QY4 
_cell.length_a           36.0 
_cell.length_b           39.7 
_cell.length_c           74.7 
_cell.angle_alpha        73.7 
_cell.angle_beta         78.5 
_cell.angle_gamma        72.6 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QY4 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase' 21505.436 2   5.3.1.9 ? ? ? 
2 non-polymer syn '6-PHOSPHOGLUCONIC ACID'        276.135   2   ?       ? ? ? 
3 non-polymer syn 'NICKEL (II) ION'               58.693    2   ?       ? ? ? 
4 water       nat water                           18.015    202 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TYR n 
1 3   LYS n 
1 4   GLU n 
1 5   PRO n 
1 6   PHE n 
1 7   GLY n 
1 8   VAL n 
1 9   LYS n 
1 10  VAL n 
1 11  ASP n 
1 12  PHE n 
1 13  GLU n 
1 14  THR n 
1 15  GLY n 
1 16  ILE n 
1 17  ILE n 
1 18  GLU n 
1 19  GLY n 
1 20  ALA n 
1 21  LYS n 
1 22  LYS n 
1 23  SER n 
1 24  VAL n 
1 25  ARG n 
1 26  ARG n 
1 27  LEU n 
1 28  SER n 
1 29  ASP n 
1 30  MET n 
1 31  GLU n 
1 32  GLY n 
1 33  TYR n 
1 34  PHE n 
1 35  VAL n 
1 36  ASP n 
1 37  GLU n 
1 38  ARG n 
1 39  ALA n 
1 40  TRP n 
1 41  LYS n 
1 42  GLU n 
1 43  LEU n 
1 44  VAL n 
1 45  GLU n 
1 46  LYS n 
1 47  GLU n 
1 48  ASP n 
1 49  PRO n 
1 50  VAL n 
1 51  VAL n 
1 52  TYR n 
1 53  GLU n 
1 54  VAL n 
1 55  TYR n 
1 56  ALA n 
1 57  VAL n 
1 58  GLU n 
1 59  GLN n 
1 60  GLU n 
1 61  GLU n 
1 62  LYS n 
1 63  GLU n 
1 64  GLY n 
1 65  ASP n 
1 66  LEU n 
1 67  ASN n 
1 68  PHE n 
1 69  ALA n 
1 70  THR n 
1 71  THR n 
1 72  VAL n 
1 73  LEU n 
1 74  TYR n 
1 75  PRO n 
1 76  GLY n 
1 77  LYS n 
1 78  VAL n 
1 79  GLY n 
1 80  LYS n 
1 81  GLU n 
1 82  PHE n 
1 83  PHE n 
1 84  PHE n 
1 85  THR n 
1 86  LYS n 
1 87  GLY n 
1 88  HIS n 
1 89  PHE n 
1 90  HIS n 
1 91  ALA n 
1 92  LYS n 
1 93  LEU n 
1 94  ASP n 
1 95  ARG n 
1 96  ALA n 
1 97  GLU n 
1 98  VAL n 
1 99  TYR n 
1 100 VAL n 
1 101 ALA n 
1 102 LEU n 
1 103 LYS n 
1 104 GLY n 
1 105 LYS n 
1 106 GLY n 
1 107 GLY n 
1 108 MET n 
1 109 LEU n 
1 110 LEU n 
1 111 GLN n 
1 112 THR n 
1 113 PRO n 
1 114 GLU n 
1 115 GLY n 
1 116 ASP n 
1 117 ALA n 
1 118 LYS n 
1 119 TRP n 
1 120 ILE n 
1 121 SER n 
1 122 MET n 
1 123 GLU n 
1 124 PRO n 
1 125 GLY n 
1 126 THR n 
1 127 VAL n 
1 128 VAL n 
1 129 TYR n 
1 130 VAL n 
1 131 PRO n 
1 132 PRO n 
1 133 TYR n 
1 134 TRP n 
1 135 ALA n 
1 136 HIS n 
1 137 ARG n 
1 138 THR n 
1 139 VAL n 
1 140 ASN n 
1 141 ILE n 
1 142 GLY n 
1 143 ASP n 
1 144 GLU n 
1 145 PRO n 
1 146 PHE n 
1 147 ILE n 
1 148 PHE n 
1 149 LEU n 
1 150 ALA n 
1 151 ILE n 
1 152 TYR n 
1 153 PRO n 
1 154 ALA n 
1 155 ASP n 
1 156 ALA n 
1 157 GLY n 
1 158 HIS n 
1 159 ASP n 
1 160 TYR n 
1 161 GLY n 
1 162 THR n 
1 163 ILE n 
1 164 ALA n 
1 165 GLU n 
1 166 LYS n 
1 167 GLY n 
1 168 PHE n 
1 169 SER n 
1 170 LYS n 
1 171 ILE n 
1 172 VAL n 
1 173 ILE n 
1 174 GLU n 
1 175 GLU n 
1 176 ASN n 
1 177 GLY n 
1 178 GLU n 
1 179 VAL n 
1 180 LYS n 
1 181 VAL n 
1 182 VAL n 
1 183 ASP n 
1 184 ASN n 
1 185 PRO n 
1 186 ARG n 
1 187 TRP n 
1 188 LYS n 
1 189 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 'PGIA OR PF0196' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet17b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_PYRFU 
_struct_ref.pdbx_db_accession          P83194 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QY4 A 1 ? 189 ? P83194 1 ? 189 ? 1 189 
2 1 1QY4 B 1 ? 189 ? P83194 1 ? 189 ? 1 189 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6PG D-saccharide        . '6-PHOSPHOGLUCONIC ACID' ? 'C6 H13 O10 P'   276.135 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION'        ? 'Ni 2'           58.693  
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QY4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   45 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'25% PEG 4000, 0.2M ammonium acetate, 0.1 M sodium acetate pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-07-05 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1QY4 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.8 
_reflns.d_resolution_low             36.8 
_reflns.number_all                   ? 
_reflns.number_obs                   32924 
_reflns.percent_possible_obs         93.5 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.8 
_reflns.B_iso_Wilson_estimate        24.8 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   90.0 
_reflns_shell.Rmerge_I_obs           0.355 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3174 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QY4 
_refine.ls_number_reflns_obs                     30880 
_refine.ls_number_reflns_all                     32520 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    93.48 
_refine.ls_R_factor_obs                          0.22 
_refine.ls_R_factor_all                          0.22 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1640 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.935 
_refine.B_iso_mean                               33.652 
_refine.aniso_B[1][1]                            1.75 
_refine.aniso_B[2][2]                            -0.09 
_refine.aniso_B[3][3]                            -1.99 
_refine.aniso_B[1][2]                            -0.83 
_refine.aniso_B[1][3]                            -0.40 
_refine.aniso_B[2][3]                            1.74 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1QXJ' 
_refine.pdbx_method_to_determine_struct          'Simple refinement' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.174 
_refine.pdbx_overall_ESU_R_Free                  0.162 
_refine.overall_SU_ML                            0.165 
_refine.overall_SU_B                             5.533 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3004 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             202 
_refine_hist.number_atoms_total               3242 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.016  0.022  ? 3120 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.723  1.960  ? 4226 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.013  3.000  ? 372  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   19.326 15.000 ? 555  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.113  0.200  ? 442  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 2390 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.222  0.300  ? 1467 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.176  0.500  ? 396  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.182  0.300  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.279  0.500  ? 12   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.822  1.500  ? 1852 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.438  2.000  ? 2988 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.282  3.000  ? 1268 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.592  4.500  ? 1238 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.846 
_refine_ls_shell.number_reflns_R_work             2103 
_refine_ls_shell.R_factor_R_work                  0.385 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.441 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             126 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1QY4 
_struct.title                     
'Crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with gluconate 6-phosphate' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QY4 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
;phosphoglucose isomerase, cupin fold, Pyrococcus furiosus, hyperthermophile, extremophile, aldose-ketose isomerase, gluconate 6-phosphate, ISOMERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 28  ? GLU A 31  ? SER A 28  GLU A 31  5 ? 4  
HELX_P HELX_P2 2 ASP A 36  ? GLU A 47  ? ASP A 36  GLU A 47  1 ? 12 
HELX_P HELX_P3 3 TYR A 160 ? GLY A 167 ? TYR A 160 GLY A 167 1 ? 8  
HELX_P HELX_P4 4 SER B 28  ? GLU B 31  ? SER B 28  GLU B 31  5 ? 4  
HELX_P HELX_P5 5 ASP B 36  ? GLU B 47  ? ASP B 36  GLU B 47  1 ? 12 
HELX_P HELX_P6 6 TYR B 160 ? GLY B 167 ? TYR B 160 GLY B 167 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D NI . NI ? ? ? 1_555 A GLU 97  OE2 ? ? A NI 210 A GLU 97  1_555 ? ? ? ? ? ? ? 1.589 ? 
metalc2  metalc ? ? F NI . NI ? ? ? 1_555 B GLU 97  OE2 ? ? B NI 211 B GLU 97  1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc3  metalc ? ? D NI . NI ? ? ? 1_555 A GLU 97  OE1 ? ? A NI 210 A GLU 97  1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc4  metalc ? ? D NI . NI ? ? ? 1_555 A HIS 136 NE2 ? ? A NI 210 A HIS 136 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc5  metalc ? ? D NI . NI ? ? ? 1_555 C 6PG .   O2  ? ? A NI 210 A 6PG 300 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc6  metalc ? ? D NI . NI ? ? ? 1_555 A HIS 88  NE2 ? ? A NI 210 A HIS 88  1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc7  metalc ? ? D NI . NI ? ? ? 1_555 C 6PG .   O1A ? ? A NI 210 A 6PG 300 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc8  metalc ? ? F NI . NI ? ? ? 1_555 E 6PG .   O1A ? ? B NI 211 B 6PG 301 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc9  metalc ? ? F NI . NI ? ? ? 1_555 B HIS 88  NE2 ? ? B NI 211 B HIS 88  1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc10 metalc ? ? F NI . NI ? ? ? 1_555 B HIS 136 NE2 ? ? B NI 211 B HIS 136 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc11 metalc ? ? F NI . NI ? ? ? 1_555 B HIS 90  NE2 ? ? B NI 211 B HIS 90  1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc12 metalc ? ? F NI . NI ? ? ? 1_555 B GLU 97  OE1 ? ? B NI 211 B GLU 97  1_555 ? ? ? ? ? ? ? 1.412 ? 
metalc13 metalc ? ? F NI . NI ? ? ? 1_555 E 6PG .   O2  ? ? B NI 211 B 6PG 301 1_555 ? ? ? ? ? ? ? 2.413 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 6   ? LYS A 9   ? PHE A 6   LYS A 9   
A 2 THR B 126 ? VAL B 130 ? THR B 126 VAL B 130 
A 3 GLU B 97  ? LYS B 103 ? GLU B 97  LYS B 103 
A 4 PHE B 146 ? PRO B 153 ? PHE B 146 PRO B 153 
A 5 LEU B 66  ? LEU B 73  ? LEU B 66  LEU B 73  
A 6 VAL B 50  ? VAL B 57  ? VAL B 50  VAL B 57  
A 7 LYS B 21  ? ARG B 26  ? LYS B 21  ARG B 26  
B 1 LYS A 21  ? ARG A 26  ? LYS A 21  ARG A 26  
B 2 VAL A 50  ? VAL A 57  ? VAL A 50  VAL A 57  
B 3 LEU A 66  ? LEU A 73  ? LEU A 66  LEU A 73  
B 4 PHE A 146 ? PRO A 153 ? PHE A 146 PRO A 153 
B 5 GLU A 97  ? LYS A 103 ? GLU A 97  LYS A 103 
B 6 THR A 126 ? VAL A 130 ? THR A 126 VAL A 130 
B 7 PHE B 6   ? LYS B 9   ? PHE B 6   LYS B 9   
C 1 LYS A 77  ? VAL A 78  ? LYS A 77  VAL A 78  
C 2 GLU A 81  ? PHE A 82  ? GLU A 81  PHE A 82  
D 1 ALA A 117 ? MET A 122 ? ALA A 117 MET A 122 
D 2 GLY A 106 ? GLN A 111 ? GLY A 106 GLN A 111 
D 3 ALA A 135 ? ASN A 140 ? ALA A 135 ASN A 140 
E 1 LYS A 170 ? GLU A 175 ? LYS A 170 GLU A 175 
E 2 GLU A 178 ? ASP A 183 ? GLU A 178 ASP A 183 
F 1 LYS B 77  ? VAL B 78  ? LYS B 77  VAL B 78  
F 2 GLU B 81  ? PHE B 82  ? GLU B 81  PHE B 82  
G 1 ALA B 117 ? MET B 122 ? ALA B 117 MET B 122 
G 2 GLY B 106 ? GLN B 111 ? GLY B 106 GLN B 111 
G 3 ALA B 135 ? ASN B 140 ? ALA B 135 ASN B 140 
H 1 LYS B 170 ? GLU B 175 ? LYS B 170 GLU B 175 
H 2 GLU B 178 ? ASP B 183 ? GLU B 178 ASP B 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 8   ? N VAL A 8   O VAL B 127 ? O VAL B 127 
A 2 3 O VAL B 130 ? O VAL B 130 N GLU B 97  ? N GLU B 97  
A 3 4 N VAL B 98  ? N VAL B 98  O ILE B 151 ? O ILE B 151 
A 4 5 O ALA B 150 ? O ALA B 150 N ALA B 69  ? N ALA B 69  
A 5 6 O PHE B 68  ? O PHE B 68  N VAL B 57  ? N VAL B 57  
A 6 7 O VAL B 51  ? O VAL B 51  N ARG B 25  ? N ARG B 25  
B 1 2 N ARG A 25  ? N ARG A 25  O TYR A 52  ? O TYR A 52  
B 2 3 N TYR A 55  ? N TYR A 55  O THR A 70  ? O THR A 70  
B 3 4 N ALA A 69  ? N ALA A 69  O ALA A 150 ? O ALA A 150 
B 4 5 O LEU A 149 ? O LEU A 149 N VAL A 100 ? N VAL A 100 
B 5 6 N GLU A 97  ? N GLU A 97  O VAL A 130 ? O VAL A 130 
B 6 7 N VAL A 127 ? N VAL A 127 O VAL B 8   ? O VAL B 8   
C 1 2 N VAL A 78  ? N VAL A 78  O GLU A 81  ? O GLU A 81  
D 1 2 O LYS A 118 ? O LYS A 118 N LEU A 110 ? N LEU A 110 
D 2 3 N LEU A 109 ? N LEU A 109 O ARG A 137 ? O ARG A 137 
E 1 2 N ILE A 173 ? N ILE A 173 O LYS A 180 ? O LYS A 180 
F 1 2 N VAL B 78  ? N VAL B 78  O GLU B 81  ? O GLU B 81  
G 1 2 O ILE B 120 ? O ILE B 120 N MET B 108 ? N MET B 108 
G 2 3 N LEU B 109 ? N LEU B 109 O ARG B 137 ? O ARG B 137 
H 1 2 N ILE B 171 ? N ILE B 171 O VAL B 182 ? O VAL B 182 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE 6PG A 300' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 6PG B 301' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI A 210'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI B 211'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 TYR A 52  ? TYR A 52  . ? 1_555 ? 
2  AC1 16 THR A 71  ? THR A 71  . ? 1_555 ? 
3  AC1 16 THR A 85  ? THR A 85  . ? 1_555 ? 
4  AC1 16 GLY A 87  ? GLY A 87  . ? 1_555 ? 
5  AC1 16 HIS A 88  ? HIS A 88  . ? 1_555 ? 
6  AC1 16 GLU A 97  ? GLU A 97  . ? 1_555 ? 
7  AC1 16 TYR A 99  ? TYR A 99  . ? 1_555 ? 
8  AC1 16 HIS A 136 ? HIS A 136 . ? 1_555 ? 
9  AC1 16 PHE A 148 ? PHE A 148 . ? 1_555 ? 
10 AC1 16 TYR A 152 ? TYR A 152 . ? 1_555 ? 
11 AC1 16 HIS A 158 ? HIS A 158 . ? 1_555 ? 
12 AC1 16 TYR A 160 ? TYR A 160 . ? 1_555 ? 
13 AC1 16 NI  D .   ? NI  A 210 . ? 1_555 ? 
14 AC1 16 HOH G .   ? HOH A 302 . ? 1_555 ? 
15 AC1 16 HOH G .   ? HOH A 306 . ? 1_555 ? 
16 AC1 16 HOH G .   ? HOH A 337 . ? 1_555 ? 
17 AC2 17 TYR B 52  ? TYR B 52  . ? 1_555 ? 
18 AC2 17 THR B 71  ? THR B 71  . ? 1_555 ? 
19 AC2 17 THR B 85  ? THR B 85  . ? 1_555 ? 
20 AC2 17 GLY B 87  ? GLY B 87  . ? 1_555 ? 
21 AC2 17 HIS B 88  ? HIS B 88  . ? 1_555 ? 
22 AC2 17 GLU B 97  ? GLU B 97  . ? 1_555 ? 
23 AC2 17 TYR B 99  ? TYR B 99  . ? 1_555 ? 
24 AC2 17 HIS B 136 ? HIS B 136 . ? 1_555 ? 
25 AC2 17 PHE B 148 ? PHE B 148 . ? 1_555 ? 
26 AC2 17 TYR B 152 ? TYR B 152 . ? 1_555 ? 
27 AC2 17 HIS B 158 ? HIS B 158 . ? 1_555 ? 
28 AC2 17 TYR B 160 ? TYR B 160 . ? 1_555 ? 
29 AC2 17 NI  F .   ? NI  B 211 . ? 1_555 ? 
30 AC2 17 HOH H .   ? HOH B 302 . ? 1_555 ? 
31 AC2 17 HOH H .   ? HOH B 305 . ? 1_555 ? 
32 AC2 17 HOH H .   ? HOH B 313 . ? 1_555 ? 
33 AC2 17 HOH H .   ? HOH B 314 . ? 1_555 ? 
34 AC3 5  HIS A 88  ? HIS A 88  . ? 1_555 ? 
35 AC3 5  HIS A 90  ? HIS A 90  . ? 1_555 ? 
36 AC3 5  GLU A 97  ? GLU A 97  . ? 1_555 ? 
37 AC3 5  HIS A 136 ? HIS A 136 . ? 1_555 ? 
38 AC3 5  6PG C .   ? 6PG A 300 . ? 1_555 ? 
39 AC4 5  HIS B 88  ? HIS B 88  . ? 1_555 ? 
40 AC4 5  HIS B 90  ? HIS B 90  . ? 1_555 ? 
41 AC4 5  GLU B 97  ? GLU B 97  . ? 1_555 ? 
42 AC4 5  HIS B 136 ? HIS B 136 . ? 1_555 ? 
43 AC4 5  6PG E .   ? 6PG B 301 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QY4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QY4 
_atom_sites.fract_transf_matrix[1][1]   0.027797 
_atom_sites.fract_transf_matrix[1][2]   -0.008693 
_atom_sites.fract_transf_matrix[1][3]   -0.003708 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026370 
_atom_sites.fract_transf_matrix[2][3]   -0.006404 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014052 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NI 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 12.244  21.675  -7.269  1.00 37.36 ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 12.467  20.637  -8.330  1.00 37.49 ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 11.729  19.346  -7.979  1.00 36.39 ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 11.619  18.967  -6.798  1.00 36.52 ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 13.948  20.320  -8.516  1.00 38.87 ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 14.187  19.000  -9.298  1.00 40.87 ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 15.944  18.440  -9.457  1.00 52.56 ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 16.535  18.498  -7.717  1.00 50.31 ? 1   MET A CE  1 
ATOM   9    N  N   . TYR A 1 2   ? 11.233  18.674  -9.014  1.00 35.40 ? 2   TYR A N   1 
ATOM   10   C  CA  . TYR A 1 2   ? 10.499  17.423  -8.825  1.00 33.51 ? 2   TYR A CA  1 
ATOM   11   C  C   . TYR A 1 2   ? 11.385  16.259  -8.402  1.00 32.59 ? 2   TYR A C   1 
ATOM   12   O  O   . TYR A 1 2   ? 12.551  16.181  -8.800  1.00 32.86 ? 2   TYR A O   1 
ATOM   13   C  CB  . TYR A 1 2   ? 9.783   17.053  -10.109 1.00 33.13 ? 2   TYR A CB  1 
ATOM   14   C  CG  . TYR A 1 2   ? 8.902   18.134  -10.649 1.00 31.40 ? 2   TYR A CG  1 
ATOM   15   C  CD1 . TYR A 1 2   ? 9.059   18.600  -11.930 1.00 31.99 ? 2   TYR A CD1 1 
ATOM   16   C  CD2 . TYR A 1 2   ? 7.932   18.712  -9.854  1.00 31.71 ? 2   TYR A CD2 1 
ATOM   17   C  CE1 . TYR A 1 2   ? 8.241   19.593  -12.419 1.00 32.62 ? 2   TYR A CE1 1 
ATOM   18   C  CE2 . TYR A 1 2   ? 7.127   19.682  -10.331 1.00 30.97 ? 2   TYR A CE2 1 
ATOM   19   C  CZ  . TYR A 1 2   ? 7.279   20.129  -11.596 1.00 30.23 ? 2   TYR A CZ  1 
ATOM   20   O  OH  . TYR A 1 2   ? 6.433   21.112  -12.066 1.00 33.00 ? 2   TYR A OH  1 
ATOM   21   N  N   . LYS A 1 3   ? 10.819  15.345  -7.613  1.00 30.70 ? 3   LYS A N   1 
ATOM   22   C  CA  . LYS A 1 3   ? 11.536  14.158  -7.161  1.00 29.07 ? 3   LYS A CA  1 
ATOM   23   C  C   . LYS A 1 3   ? 11.333  13.112  -8.241  1.00 27.99 ? 3   LYS A C   1 
ATOM   24   O  O   . LYS A 1 3   ? 10.368  13.186  -8.978  1.00 27.20 ? 3   LYS A O   1 
ATOM   25   C  CB  . LYS A 1 3   ? 11.003  13.682  -5.799  1.00 29.08 ? 3   LYS A CB  1 
ATOM   26   C  CG  . LYS A 1 3   ? 11.319  14.689  -4.625  1.00 27.49 ? 3   LYS A CG  1 
ATOM   27   C  CD  . LYS A 1 3   ? 11.138  14.092  -3.211  1.00 28.92 ? 3   LYS A CD  1 
ATOM   28   C  CE  . LYS A 1 3   ? 9.668   13.797  -2.866  1.00 29.29 ? 3   LYS A CE  1 
ATOM   29   N  NZ  . LYS A 1 3   ? 9.576   13.264  -1.466  1.00 27.49 ? 3   LYS A NZ  1 
ATOM   30   N  N   . GLU A 1 4   ? 12.270  12.182  -8.356  1.00 27.50 ? 4   GLU A N   1 
ATOM   31   C  CA  . GLU A 1 4   ? 12.247  11.160  -9.378  1.00 27.86 ? 4   GLU A CA  1 
ATOM   32   C  C   . GLU A 1 4   ? 11.310  10.049  -8.958  1.00 26.40 ? 4   GLU A C   1 
ATOM   33   O  O   . GLU A 1 4   ? 11.426  9.522   -7.850  1.00 27.17 ? 4   GLU A O   1 
ATOM   34   C  CB  . GLU A 1 4   ? 13.609  10.464  -9.498  1.00 27.71 ? 4   GLU A CB  1 
ATOM   35   C  CG  . GLU A 1 4   ? 14.545  10.967  -10.586 1.00 32.18 ? 4   GLU A CG  1 
ATOM   36   C  CD  . GLU A 1 4   ? 13.849  11.272  -11.909 1.00 37.51 ? 4   GLU A CD  1 
ATOM   37   O  OE1 . GLU A 1 4   ? 13.546  10.321  -12.662 1.00 37.82 ? 4   GLU A OE1 1 
ATOM   38   O  OE2 . GLU A 1 4   ? 13.610  12.474  -12.205 1.00 39.75 ? 4   GLU A OE2 1 
ATOM   39   N  N   . PRO A 1 5   ? 10.381  9.692   -9.820  1.00 25.95 ? 5   PRO A N   1 
ATOM   40   C  CA  . PRO A 1 5   ? 9.553   8.529   -9.527  1.00 25.38 ? 5   PRO A CA  1 
ATOM   41   C  C   . PRO A 1 5   ? 10.503  7.322   -9.592  1.00 25.15 ? 5   PRO A C   1 
ATOM   42   O  O   . PRO A 1 5   ? 11.530  7.400   -10.284 1.00 23.81 ? 5   PRO A O   1 
ATOM   43   C  CB  . PRO A 1 5   ? 8.599   8.489   -10.692 1.00 25.74 ? 5   PRO A CB  1 
ATOM   44   C  CG  . PRO A 1 5   ? 8.596   9.909   -11.254 1.00 26.22 ? 5   PRO A CG  1 
ATOM   45   C  CD  . PRO A 1 5   ? 10.027  10.352  -11.086 1.00 25.31 ? 5   PRO A CD  1 
ATOM   46   N  N   . PHE A 1 6   ? 10.186  6.264   -8.868  1.00 25.18 ? 6   PHE A N   1 
ATOM   47   C  CA  . PHE A 1 6   ? 10.986  5.053   -8.932  1.00 25.62 ? 6   PHE A CA  1 
ATOM   48   C  C   . PHE A 1 6   ? 10.155  3.837   -8.611  1.00 25.82 ? 6   PHE A C   1 
ATOM   49   O  O   . PHE A 1 6   ? 9.090   3.923   -8.015  1.00 25.77 ? 6   PHE A O   1 
ATOM   50   C  CB  . PHE A 1 6   ? 12.200  5.140   -7.972  1.00 25.10 ? 6   PHE A CB  1 
ATOM   51   C  CG  . PHE A 1 6   ? 11.828  5.281   -6.501  1.00 24.25 ? 6   PHE A CG  1 
ATOM   52   C  CD1 . PHE A 1 6   ? 11.787  6.545   -5.897  1.00 24.97 ? 6   PHE A CD1 1 
ATOM   53   C  CD2 . PHE A 1 6   ? 11.497  4.168   -5.720  1.00 21.97 ? 6   PHE A CD2 1 
ATOM   54   C  CE1 . PHE A 1 6   ? 11.461  6.685   -4.581  1.00 24.94 ? 6   PHE A CE1 1 
ATOM   55   C  CE2 . PHE A 1 6   ? 11.136  4.317   -4.384  1.00 25.07 ? 6   PHE A CE2 1 
ATOM   56   C  CZ  . PHE A 1 6   ? 11.145  5.615   -3.808  1.00 24.72 ? 6   PHE A CZ  1 
ATOM   57   N  N   . GLY A 1 7   ? 10.648  2.685   -9.044  1.00 25.92 ? 7   GLY A N   1 
ATOM   58   C  CA  . GLY A 1 7   ? 10.041  1.435   -8.674  1.00 25.45 ? 7   GLY A CA  1 
ATOM   59   C  C   . GLY A 1 7   ? 11.115  0.618   -7.983  1.00 25.43 ? 7   GLY A C   1 
ATOM   60   O  O   . GLY A 1 7   ? 12.291  0.655   -8.390  1.00 25.85 ? 7   GLY A O   1 
ATOM   61   N  N   . VAL A 1 8   ? 10.718  -0.048  -6.913  1.00 26.32 ? 8   VAL A N   1 
ATOM   62   C  CA  . VAL A 1 8   ? 11.554  -0.974  -6.149  1.00 27.27 ? 8   VAL A CA  1 
ATOM   63   C  C   . VAL A 1 8   ? 10.893  -2.349  -6.054  1.00 29.16 ? 8   VAL A C   1 
ATOM   64   O  O   . VAL A 1 8   ? 9.687   -2.464  -5.929  1.00 28.96 ? 8   VAL A O   1 
ATOM   65   C  CB  . VAL A 1 8   ? 11.789  -0.515  -4.689  1.00 27.59 ? 8   VAL A CB  1 
ATOM   66   C  CG1 . VAL A 1 8   ? 12.701  0.704   -4.639  1.00 28.35 ? 8   VAL A CG1 1 
ATOM   67   C  CG2 . VAL A 1 8   ? 10.469  -0.323  -3.918  1.00 26.81 ? 8   VAL A CG2 1 
ATOM   68   N  N   . LYS A 1 9   ? 11.693  -3.411  -6.083  1.00 29.88 ? 9   LYS A N   1 
ATOM   69   C  CA  . LYS A 1 9   ? 11.138  -4.738  -5.940  1.00 31.74 ? 9   LYS A CA  1 
ATOM   70   C  C   . LYS A 1 9   ? 10.932  -5.089  -4.462  1.00 31.69 ? 9   LYS A C   1 
ATOM   71   O  O   . LYS A 1 9   ? 11.801  -4.857  -3.632  1.00 31.94 ? 9   LYS A O   1 
ATOM   72   C  CB  . LYS A 1 9   ? 12.058  -5.782  -6.592  1.00 32.09 ? 9   LYS A CB  1 
ATOM   73   C  CG  . LYS A 1 9   ? 11.519  -7.188  -6.505  1.00 36.24 ? 9   LYS A CG  1 
ATOM   74   C  CD  . LYS A 1 9   ? 11.079  -7.742  -7.879  1.00 41.99 ? 9   LYS A CD  1 
ATOM   75   C  CE  . LYS A 1 9   ? 12.232  -8.528  -8.573  1.00 45.83 ? 9   LYS A CE  1 
ATOM   76   N  NZ  . LYS A 1 9   ? 11.799  -9.914  -8.999  1.00 45.04 ? 9   LYS A NZ  1 
ATOM   77   N  N   . VAL A 1 10  ? 9.766   -5.639  -4.145  1.00 31.64 ? 10  VAL A N   1 
ATOM   78   C  CA  . VAL A 1 10  ? 9.482   -6.122  -2.821  1.00 31.75 ? 10  VAL A CA  1 
ATOM   79   C  C   . VAL A 1 10  ? 9.286   -7.625  -2.955  1.00 32.61 ? 10  VAL A C   1 
ATOM   80   O  O   . VAL A 1 10  ? 8.447   -8.080  -3.726  1.00 32.13 ? 10  VAL A O   1 
ATOM   81   C  CB  . VAL A 1 10  ? 8.225   -5.464  -2.206  1.00 31.80 ? 10  VAL A CB  1 
ATOM   82   C  CG1 . VAL A 1 10  ? 7.963   -6.008  -0.814  1.00 31.14 ? 10  VAL A CG1 1 
ATOM   83   C  CG2 . VAL A 1 10  ? 8.410   -3.944  -2.148  1.00 32.70 ? 10  VAL A CG2 1 
ATOM   84   N  N   . ASP A 1 11  ? 10.098  -8.390  -2.242  1.00 33.21 ? 11  ASP A N   1 
ATOM   85   C  CA  . ASP A 1 11  ? 9.949   -9.846  -2.231  1.00 34.18 ? 11  ASP A CA  1 
ATOM   86   C  C   . ASP A 1 11  ? 8.898   -10.269 -1.177  1.00 33.94 ? 11  ASP A C   1 
ATOM   87   O  O   . ASP A 1 11  ? 9.131   -10.142 0.022   1.00 32.88 ? 11  ASP A O   1 
ATOM   88   C  CB  . ASP A 1 11  ? 11.287  -10.486 -1.932  1.00 34.96 ? 11  ASP A CB  1 
ATOM   89   C  CG  . ASP A 1 11  ? 11.232  -11.986 -2.023  1.00 36.47 ? 11  ASP A CG  1 
ATOM   90   O  OD1 . ASP A 1 11  ? 10.140  -12.560 -1.847  1.00 34.63 ? 11  ASP A OD1 1 
ATOM   91   O  OD2 . ASP A 1 11  ? 12.233  -12.666 -2.295  1.00 41.71 ? 11  ASP A OD2 1 
ATOM   92   N  N   . PHE A 1 12  ? 7.748   -10.760 -1.639  1.00 33.91 ? 12  PHE A N   1 
ATOM   93   C  CA  . PHE A 1 12  ? 6.625   -11.124 -0.767  1.00 35.04 ? 12  PHE A CA  1 
ATOM   94   C  C   . PHE A 1 12  ? 6.878   -12.304 0.163   1.00 36.12 ? 12  PHE A C   1 
ATOM   95   O  O   . PHE A 1 12  ? 6.104   -12.566 1.080   1.00 37.23 ? 12  PHE A O   1 
ATOM   96   C  CB  . PHE A 1 12  ? 5.370   -11.398 -1.594  1.00 34.26 ? 12  PHE A CB  1 
ATOM   97   C  CG  . PHE A 1 12  ? 4.740   -10.161 -2.193  1.00 34.75 ? 12  PHE A CG  1 
ATOM   98   C  CD1 . PHE A 1 12  ? 5.378   -8.925  -2.130  1.00 34.11 ? 12  PHE A CD1 1 
ATOM   99   C  CD2 . PHE A 1 12  ? 3.515   -10.234 -2.814  1.00 36.63 ? 12  PHE A CD2 1 
ATOM   100  C  CE1 . PHE A 1 12  ? 4.804   -7.815  -2.691  1.00 33.32 ? 12  PHE A CE1 1 
ATOM   101  C  CE2 . PHE A 1 12  ? 2.930   -9.111  -3.376  1.00 36.36 ? 12  PHE A CE2 1 
ATOM   102  C  CZ  . PHE A 1 12  ? 3.577   -7.911  -3.316  1.00 35.76 ? 12  PHE A CZ  1 
ATOM   103  N  N   . GLU A 1 13  ? 7.978   -12.995 -0.067  1.00 36.67 ? 13  GLU A N   1 
ATOM   104  C  CA  . GLU A 1 13  ? 8.333   -14.160 0.715   1.00 37.64 ? 13  GLU A CA  1 
ATOM   105  C  C   . GLU A 1 13  ? 9.267   -13.783 1.849   1.00 37.11 ? 13  GLU A C   1 
ATOM   106  O  O   . GLU A 1 13  ? 9.219   -14.381 2.912   1.00 37.68 ? 13  GLU A O   1 
ATOM   107  C  CB  . GLU A 1 13  ? 8.980   -15.190 -0.195  1.00 37.60 ? 13  GLU A CB  1 
ATOM   108  C  CG  . GLU A 1 13  ? 7.980   -15.856 -1.120  1.00 40.91 ? 13  GLU A CG  1 
ATOM   109  C  CD  . GLU A 1 13  ? 7.256   -17.005 -0.445  1.00 44.61 ? 13  GLU A CD  1 
ATOM   110  O  OE1 . GLU A 1 13  ? 7.954   -17.880 0.118   1.00 47.43 ? 13  GLU A OE1 1 
ATOM   111  O  OE2 . GLU A 1 13  ? 6.000   -17.031 -0.459  1.00 46.62 ? 13  GLU A OE2 1 
ATOM   112  N  N   . THR A 1 14  ? 10.085  -12.762 1.631   1.00 36.81 ? 14  THR A N   1 
ATOM   113  C  CA  . THR A 1 14  ? 11.056  -12.333 2.636   1.00 36.24 ? 14  THR A CA  1 
ATOM   114  C  C   . THR A 1 14  ? 10.771  -10.961 3.228   1.00 36.22 ? 14  THR A C   1 
ATOM   115  O  O   . THR A 1 14  ? 11.367  -10.589 4.240   1.00 36.39 ? 14  THR A O   1 
ATOM   116  C  CB  . THR A 1 14  ? 12.440  -12.250 1.995   1.00 36.90 ? 14  THR A CB  1 
ATOM   117  O  OG1 . THR A 1 14  ? 12.431  -11.229 0.979   1.00 36.14 ? 14  THR A OG1 1 
ATOM   118  C  CG2 . THR A 1 14  ? 12.778  -13.555 1.221   1.00 36.64 ? 14  THR A CG2 1 
ATOM   119  N  N   . GLY A 1 15  ? 9.916   -10.192 2.569   1.00 35.65 ? 15  GLY A N   1 
ATOM   120  C  CA  . GLY A 1 15  ? 9.624   -8.837  3.010   1.00 35.42 ? 15  GLY A CA  1 
ATOM   121  C  C   . GLY A 1 15  ? 10.750  -7.878  2.669   1.00 34.39 ? 15  GLY A C   1 
ATOM   122  O  O   . GLY A 1 15  ? 10.732  -6.703  3.040   1.00 34.77 ? 15  GLY A O   1 
ATOM   123  N  N   . ILE A 1 16  ? 11.739  -8.345  1.933   1.00 34.61 ? 16  ILE A N   1 
ATOM   124  C  CA  . ILE A 1 16  ? 12.869  -7.462  1.646   1.00 35.19 ? 16  ILE A CA  1 
ATOM   125  C  C   . ILE A 1 16  ? 12.556  -6.431  0.534   1.00 34.80 ? 16  ILE A C   1 
ATOM   126  O  O   . ILE A 1 16  ? 12.023  -6.788  -0.526  1.00 35.40 ? 16  ILE A O   1 
ATOM   127  C  CB  . ILE A 1 16  ? 14.141  -8.307  1.346   1.00 35.50 ? 16  ILE A CB  1 
ATOM   128  C  CG1 . ILE A 1 16  ? 14.751  -8.825  2.660   1.00 36.94 ? 16  ILE A CG1 1 
ATOM   129  C  CG2 . ILE A 1 16  ? 15.179  -7.493  0.581   1.00 36.57 ? 16  ILE A CG2 1 
ATOM   130  C  CD1 . ILE A 1 16  ? 15.702  -10.044 2.487   1.00 38.05 ? 16  ILE A CD1 1 
ATOM   131  N  N   . ILE A 1 17  ? 12.877  -5.155  0.785   1.00 34.48 ? 17  ILE A N   1 
ATOM   132  C  CA  . ILE A 1 17  ? 12.732  -4.097  -0.217  1.00 33.89 ? 17  ILE A CA  1 
ATOM   133  C  C   . ILE A 1 17  ? 14.067  -3.552  -0.732  1.00 34.16 ? 17  ILE A C   1 
ATOM   134  O  O   . ILE A 1 17  ? 14.920  -3.102  0.045   1.00 33.55 ? 17  ILE A O   1 
ATOM   135  C  CB  . ILE A 1 17  ? 11.931  -2.855  0.328   1.00 33.38 ? 17  ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 17  ? 10.643  -3.260  1.039   1.00 32.57 ? 17  ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 17  ? 11.663  -1.844  -0.807  1.00 34.77 ? 17  ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 17  ? 9.870   -2.075  1.611   1.00 30.10 ? 17  ILE A CD1 1 
ATOM   139  N  N   . GLU A 1 18  ? 14.224  -3.552  -2.051  1.00 33.91 ? 18  GLU A N   1 
ATOM   140  C  CA  . GLU A 1 18  ? 15.371  -2.931  -2.683  1.00 34.59 ? 18  GLU A CA  1 
ATOM   141  C  C   . GLU A 1 18  ? 15.533  -1.507  -2.259  1.00 34.48 ? 18  GLU A C   1 
ATOM   142  O  O   . GLU A 1 18  ? 14.570  -0.746  -2.246  1.00 34.65 ? 18  GLU A O   1 
ATOM   143  C  CB  . GLU A 1 18  ? 15.158  -2.855  -4.165  1.00 34.85 ? 18  GLU A CB  1 
ATOM   144  C  CG  . GLU A 1 18  ? 15.077  -4.200  -4.836  1.00 37.30 ? 18  GLU A CG  1 
ATOM   145  C  CD  . GLU A 1 18  ? 15.120  -4.028  -6.332  1.00 39.88 ? 18  GLU A CD  1 
ATOM   146  O  OE1 . GLU A 1 18  ? 14.580  -2.989  -6.809  1.00 34.51 ? 18  GLU A OE1 1 
ATOM   147  O  OE2 . GLU A 1 18  ? 15.722  -4.913  -7.016  1.00 41.89 ? 18  GLU A OE2 1 
ATOM   148  N  N   . GLY A 1 19  ? 16.760  -1.134  -1.938  1.00 33.86 ? 19  GLY A N   1 
ATOM   149  C  CA  . GLY A 1 19  ? 17.072  0.236   -1.597  1.00 32.79 ? 19  GLY A CA  1 
ATOM   150  C  C   . GLY A 1 19  ? 16.455  0.798   -0.323  1.00 32.82 ? 19  GLY A C   1 
ATOM   151  O  O   . GLY A 1 19  ? 16.590  1.995   -0.061  1.00 32.21 ? 19  GLY A O   1 
ATOM   152  N  N   . ALA A 1 20  ? 15.791  -0.044  0.465   1.00 33.17 ? 20  ALA A N   1 
ATOM   153  C  CA  . ALA A 1 20  ? 15.199  0.400   1.724   1.00 33.18 ? 20  ALA A CA  1 
ATOM   154  C  C   . ALA A 1 20  ? 16.225  0.480   2.850   1.00 33.39 ? 20  ALA A C   1 
ATOM   155  O  O   . ALA A 1 20  ? 17.283  -0.146  2.801   1.00 33.72 ? 20  ALA A O   1 
ATOM   156  C  CB  . ALA A 1 20  ? 14.065  -0.526  2.141   1.00 33.19 ? 20  ALA A CB  1 
ATOM   157  N  N   . LYS A 1 21  ? 15.889  1.261   3.870   1.00 33.54 ? 21  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 21  ? 16.706  1.381   5.054   1.00 33.42 ? 21  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 21  ? 16.186  0.403   6.095   1.00 33.69 ? 21  LYS A C   1 
ATOM   160  O  O   . LYS A 1 21  ? 15.006  0.479   6.509   1.00 31.55 ? 21  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 21  ? 16.648  2.794   5.623   1.00 34.41 ? 21  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 21  ? 16.916  2.836   7.123   1.00 35.40 ? 21  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 21  ? 17.029  4.268   7.622   1.00 37.39 ? 21  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 21  ? 15.755  4.726   8.307   1.00 41.14 ? 21  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 21  ? 16.019  5.901   9.204   1.00 43.31 ? 21  LYS A NZ  1 
ATOM   166  N  N   . LYS A 1 22  ? 17.082  -0.489  6.521   1.00 33.19 ? 22  LYS A N   1 
ATOM   167  C  CA  . LYS A 1 22  ? 16.792  -1.520  7.500   1.00 36.12 ? 22  LYS A CA  1 
ATOM   168  C  C   . LYS A 1 22  ? 16.851  -1.110  8.988   1.00 36.36 ? 22  LYS A C   1 
ATOM   169  O  O   . LYS A 1 22  ? 17.766  -0.403  9.425   1.00 38.11 ? 22  LYS A O   1 
ATOM   170  C  CB  . LYS A 1 22  ? 17.732  -2.726  7.293   1.00 36.00 ? 22  LYS A CB  1 
ATOM   171  C  CG  . LYS A 1 22  ? 17.249  -4.018  7.980   1.00 38.67 ? 22  LYS A CG  1 
ATOM   172  C  CD  . LYS A 1 22  ? 17.970  -5.276  7.460   1.00 40.32 ? 22  LYS A CD  1 
ATOM   173  C  CE  . LYS A 1 22  ? 17.284  -6.584  7.967   1.00 42.26 ? 22  LYS A CE  1 
ATOM   174  N  NZ  . LYS A 1 22  ? 18.000  -7.893  7.597   1.00 43.79 ? 22  LYS A NZ  1 
ATOM   175  N  N   . SER A 1 23  ? 15.873  -1.570  9.754   1.00 36.62 ? 23  SER A N   1 
ATOM   176  C  CA  . SER A 1 23  ? 15.862  -1.432  11.219  1.00 36.37 ? 23  SER A CA  1 
ATOM   177  C  C   . SER A 1 23  ? 15.608  -2.804  11.856  1.00 36.20 ? 23  SER A C   1 
ATOM   178  O  O   . SER A 1 23  ? 14.659  -3.519  11.490  1.00 34.29 ? 23  SER A O   1 
ATOM   179  C  CB  . SER A 1 23  ? 14.808  -0.450  11.698  1.00 36.30 ? 23  SER A CB  1 
ATOM   180  O  OG  . SER A 1 23  ? 15.104  0.855   11.258  1.00 40.25 ? 23  SER A OG  1 
ATOM   181  N  N   . VAL A 1 24  ? 16.457  -3.162  12.815  1.00 36.08 ? 24  VAL A N   1 
ATOM   182  C  CA  . VAL A 1 24  ? 16.332  -4.444  13.494  1.00 37.25 ? 24  VAL A CA  1 
ATOM   183  C  C   . VAL A 1 24  ? 15.993  -4.282  14.960  1.00 37.54 ? 24  VAL A C   1 
ATOM   184  O  O   . VAL A 1 24  ? 16.635  -3.510  15.689  1.00 38.46 ? 24  VAL A O   1 
ATOM   185  C  CB  . VAL A 1 24  ? 17.633  -5.268  13.419  1.00 37.17 ? 24  VAL A CB  1 
ATOM   186  C  CG1 . VAL A 1 24  ? 17.488  -6.527  14.258  1.00 37.95 ? 24  VAL A CG1 1 
ATOM   187  C  CG2 . VAL A 1 24  ? 18.032  -5.565  11.968  1.00 35.35 ? 24  VAL A CG2 1 
ATOM   188  N  N   . ARG A 1 25  ? 14.985  -5.006  15.411  1.00 37.84 ? 25  ARG A N   1 
ATOM   189  C  CA  . ARG A 1 25  ? 14.611  -4.928  16.813  1.00 38.39 ? 25  ARG A CA  1 
ATOM   190  C  C   . ARG A 1 25  ? 14.727  -6.292  17.464  1.00 38.34 ? 25  ARG A C   1 
ATOM   191  O  O   . ARG A 1 25  ? 13.982  -7.214  17.125  1.00 38.40 ? 25  ARG A O   1 
ATOM   192  C  CB  . ARG A 1 25  ? 13.189  -4.388  16.957  1.00 38.57 ? 25  ARG A CB  1 
ATOM   193  C  CG  . ARG A 1 25  ? 13.009  -2.978  16.430  1.00 41.04 ? 25  ARG A CG  1 
ATOM   194  C  CD  . ARG A 1 25  ? 13.394  -1.903  17.404  1.00 45.48 ? 25  ARG A CD  1 
ATOM   195  N  NE  . ARG A 1 25  ? 13.458  -0.595  16.754  1.00 50.07 ? 25  ARG A NE  1 
ATOM   196  C  CZ  . ARG A 1 25  ? 14.524  -0.126  16.105  1.00 51.52 ? 25  ARG A CZ  1 
ATOM   197  N  NH1 . ARG A 1 25  ? 15.642  -0.850  16.022  1.00 51.72 ? 25  ARG A NH1 1 
ATOM   198  N  NH2 . ARG A 1 25  ? 14.472  1.075   15.538  1.00 51.71 ? 25  ARG A NH2 1 
ATOM   199  N  N   . ARG A 1 26  ? 15.685  -6.419  18.386  1.00 38.13 ? 26  ARG A N   1 
ATOM   200  C  CA  . ARG A 1 26  ? 15.837  -7.629  19.189  1.00 37.66 ? 26  ARG A CA  1 
ATOM   201  C  C   . ARG A 1 26  ? 14.971  -7.551  20.455  1.00 36.33 ? 26  ARG A C   1 
ATOM   202  O  O   . ARG A 1 26  ? 14.491  -6.488  20.834  1.00 35.01 ? 26  ARG A O   1 
ATOM   203  C  CB  . ARG A 1 26  ? 17.314  -7.849  19.571  1.00 37.70 ? 26  ARG A CB  1 
ATOM   204  C  CG  . ARG A 1 26  ? 18.238  -7.911  18.374  1.00 40.23 ? 26  ARG A CG  1 
ATOM   205  C  CD  . ARG A 1 26  ? 19.499  -8.766  18.520  1.00 41.85 ? 26  ARG A CD  1 
ATOM   206  N  NE  . ARG A 1 26  ? 19.957  -9.202  17.197  1.00 45.72 ? 26  ARG A NE  1 
ATOM   207  C  CZ  . ARG A 1 26  ? 20.185  -10.479 16.852  1.00 47.45 ? 26  ARG A CZ  1 
ATOM   208  N  NH1 . ARG A 1 26  ? 20.582  -10.778 15.617  1.00 47.58 ? 26  ARG A NH1 1 
ATOM   209  N  NH2 . ARG A 1 26  ? 20.019  -11.457 17.735  1.00 48.24 ? 26  ARG A NH2 1 
ATOM   210  N  N   . LEU A 1 27  ? 14.765  -8.680  21.116  1.00 36.99 ? 27  LEU A N   1 
ATOM   211  C  CA  . LEU A 1 27  ? 14.001  -8.653  22.354  1.00 36.94 ? 27  LEU A CA  1 
ATOM   212  C  C   . LEU A 1 27  ? 14.621  -7.658  23.352  1.00 37.65 ? 27  LEU A C   1 
ATOM   213  O  O   . LEU A 1 27  ? 13.892  -6.965  24.061  1.00 37.21 ? 27  LEU A O   1 
ATOM   214  C  CB  . LEU A 1 27  ? 13.860  -10.056 22.943  1.00 36.32 ? 27  LEU A CB  1 
ATOM   215  C  CG  . LEU A 1 27  ? 12.709  -10.434 23.898  1.00 33.69 ? 27  LEU A CG  1 
ATOM   216  C  CD1 . LEU A 1 27  ? 11.362  -9.912  23.434  1.00 28.83 ? 27  LEU A CD1 1 
ATOM   217  C  CD2 . LEU A 1 27  ? 12.623  -11.969 24.108  1.00 34.19 ? 27  LEU A CD2 1 
ATOM   218  N  N   . SER A 1 28  ? 15.951  -7.530  23.360  1.00 38.07 ? 28  SER A N   1 
ATOM   219  C  CA  . SER A 1 28  ? 16.580  -6.600  24.293  1.00 39.67 ? 28  SER A CA  1 
ATOM   220  C  C   . SER A 1 28  ? 16.105  -5.176  24.101  1.00 40.49 ? 28  SER A C   1 
ATOM   221  O  O   . SER A 1 28  ? 16.103  -4.385  25.043  1.00 41.64 ? 28  SER A O   1 
ATOM   222  C  CB  . SER A 1 28  ? 18.108  -6.635  24.192  1.00 40.02 ? 28  SER A CB  1 
ATOM   223  O  OG  . SER A 1 28  ? 18.563  -7.022  22.899  1.00 40.17 ? 28  SER A OG  1 
ATOM   224  N  N   . ASP A 1 29  ? 15.736  -4.836  22.871  1.00 40.86 ? 29  ASP A N   1 
ATOM   225  C  CA  . ASP A 1 29  ? 15.250  -3.511  22.567  1.00 40.51 ? 29  ASP A CA  1 
ATOM   226  C  C   . ASP A 1 29  ? 13.834  -3.245  23.053  1.00 40.05 ? 29  ASP A C   1 
ATOM   227  O  O   . ASP A 1 29  ? 13.305  -2.177  22.804  1.00 39.93 ? 29  ASP A O   1 
ATOM   228  C  CB  . ASP A 1 29  ? 15.306  -3.266  21.056  1.00 41.26 ? 29  ASP A CB  1 
ATOM   229  C  CG  . ASP A 1 29  ? 16.702  -3.349  20.521  1.00 41.89 ? 29  ASP A CG  1 
ATOM   230  O  OD1 . ASP A 1 29  ? 17.510  -2.475  20.917  1.00 44.41 ? 29  ASP A OD1 1 
ATOM   231  O  OD2 . ASP A 1 29  ? 17.087  -4.253  19.743  1.00 41.97 ? 29  ASP A OD2 1 
ATOM   232  N  N   . MET A 1 30  ? 13.226  -4.178  23.768  1.00 39.54 ? 30  MET A N   1 
ATOM   233  C  CA  . MET A 1 30  ? 11.828  -3.997  24.164  1.00 39.77 ? 30  MET A CA  1 
ATOM   234  C  C   . MET A 1 30  ? 11.567  -4.215  25.655  1.00 40.43 ? 30  MET A C   1 
ATOM   235  O  O   . MET A 1 30  ? 10.604  -4.904  26.029  1.00 39.84 ? 30  MET A O   1 
ATOM   236  C  CB  . MET A 1 30  ? 10.935  -4.953  23.348  1.00 39.18 ? 30  MET A CB  1 
ATOM   237  C  CG  . MET A 1 30  ? 10.942  -4.716  21.848  1.00 38.63 ? 30  MET A CG  1 
ATOM   238  S  SD  . MET A 1 30  ? 10.057  -6.013  20.886  1.00 37.64 ? 30  MET A SD  1 
ATOM   239  C  CE  . MET A 1 30  ? 8.333   -5.522  21.117  1.00 34.48 ? 30  MET A CE  1 
ATOM   240  N  N   . GLU A 1 31  ? 12.415  -3.637  26.513  1.00 41.33 ? 31  GLU A N   1 
ATOM   241  C  CA  . GLU A 1 31  ? 12.218  -3.767  27.958  1.00 41.62 ? 31  GLU A CA  1 
ATOM   242  C  C   . GLU A 1 31  ? 10.991  -2.973  28.349  1.00 41.23 ? 31  GLU A C   1 
ATOM   243  O  O   . GLU A 1 31  ? 10.815  -1.841  27.901  1.00 41.30 ? 31  GLU A O   1 
ATOM   244  C  CB  . GLU A 1 31  ? 13.437  -3.272  28.769  1.00 42.73 ? 31  GLU A CB  1 
ATOM   245  C  CG  . GLU A 1 31  ? 13.103  -2.944  30.235  1.00 45.50 ? 31  GLU A CG  1 
ATOM   246  C  CD  . GLU A 1 31  ? 14.314  -2.657  31.127  1.00 49.66 ? 31  GLU A CD  1 
ATOM   247  O  OE1 . GLU A 1 31  ? 14.725  -1.470  31.215  1.00 49.97 ? 31  GLU A OE1 1 
ATOM   248  O  OE2 . GLU A 1 31  ? 14.837  -3.609  31.771  1.00 51.31 ? 31  GLU A OE2 1 
ATOM   249  N  N   . GLY A 1 32  ? 10.143  -3.574  29.180  1.00 40.41 ? 32  GLY A N   1 
ATOM   250  C  CA  . GLY A 1 32  ? 8.939   -2.928  29.651  1.00 39.96 ? 32  GLY A CA  1 
ATOM   251  C  C   . GLY A 1 32  ? 7.736   -3.136  28.748  1.00 39.36 ? 32  GLY A C   1 
ATOM   252  O  O   . GLY A 1 32  ? 6.664   -2.547  28.971  1.00 38.93 ? 32  GLY A O   1 
ATOM   253  N  N   . TYR A 1 33  ? 7.908   -3.971  27.729  1.00 38.37 ? 33  TYR A N   1 
ATOM   254  C  CA  . TYR A 1 33  ? 6.841   -4.194  26.753  1.00 38.14 ? 33  TYR A CA  1 
ATOM   255  C  C   . TYR A 1 33  ? 6.004   -5.433  27.013  1.00 37.69 ? 33  TYR A C   1 
ATOM   256  O  O   . TYR A 1 33  ? 4.832   -5.465  26.698  1.00 37.56 ? 33  TYR A O   1 
ATOM   257  C  CB  . TYR A 1 33  ? 7.403   -4.244  25.331  1.00 37.69 ? 33  TYR A CB  1 
ATOM   258  C  CG  . TYR A 1 33  ? 7.554   -2.880  24.709  1.00 38.92 ? 33  TYR A CG  1 
ATOM   259  C  CD1 . TYR A 1 33  ? 8.766   -2.216  24.759  1.00 39.54 ? 33  TYR A CD1 1 
ATOM   260  C  CD2 . TYR A 1 33  ? 6.483   -2.248  24.077  1.00 37.23 ? 33  TYR A CD2 1 
ATOM   261  C  CE1 . TYR A 1 33  ? 8.925   -0.974  24.208  1.00 36.62 ? 33  TYR A CE1 1 
ATOM   262  C  CE2 . TYR A 1 33  ? 6.636   -1.002  23.515  1.00 35.30 ? 33  TYR A CE2 1 
ATOM   263  C  CZ  . TYR A 1 33  ? 7.867   -0.374  23.601  1.00 34.66 ? 33  TYR A CZ  1 
ATOM   264  O  OH  . TYR A 1 33  ? 8.081   0.851   23.054  1.00 33.86 ? 33  TYR A OH  1 
ATOM   265  N  N   . PHE A 1 34  ? 6.615   -6.458  27.576  1.00 37.93 ? 34  PHE A N   1 
ATOM   266  C  CA  . PHE A 1 34  ? 5.923   -7.710  27.807  1.00 38.46 ? 34  PHE A CA  1 
ATOM   267  C  C   . PHE A 1 34  ? 5.461   -7.860  29.270  1.00 38.92 ? 34  PHE A C   1 
ATOM   268  O  O   . PHE A 1 34  ? 6.051   -7.300  30.200  1.00 38.61 ? 34  PHE A O   1 
ATOM   269  C  CB  . PHE A 1 34  ? 6.812   -8.883  27.352  1.00 37.46 ? 34  PHE A CB  1 
ATOM   270  C  CG  . PHE A 1 34  ? 7.047   -8.936  25.843  1.00 38.24 ? 34  PHE A CG  1 
ATOM   271  C  CD1 . PHE A 1 34  ? 8.180   -8.355  25.264  1.00 36.41 ? 34  PHE A CD1 1 
ATOM   272  C  CD2 . PHE A 1 34  ? 6.145   -9.593  25.005  1.00 36.45 ? 34  PHE A CD2 1 
ATOM   273  C  CE1 . PHE A 1 34  ? 8.398   -8.425  23.867  1.00 34.81 ? 34  PHE A CE1 1 
ATOM   274  C  CE2 . PHE A 1 34  ? 6.354   -9.655  23.610  1.00 34.62 ? 34  PHE A CE2 1 
ATOM   275  C  CZ  . PHE A 1 34  ? 7.471   -9.079  23.049  1.00 34.32 ? 34  PHE A CZ  1 
ATOM   276  N  N   . VAL A 1 35  ? 4.376   -8.592  29.467  1.00 38.90 ? 35  VAL A N   1 
ATOM   277  C  CA  . VAL A 1 35  ? 3.840   -8.781  30.807  1.00 39.43 ? 35  VAL A CA  1 
ATOM   278  C  C   . VAL A 1 35  ? 4.742   -9.616  31.700  1.00 40.06 ? 35  VAL A C   1 
ATOM   279  O  O   . VAL A 1 35  ? 4.999   -9.263  32.852  1.00 40.17 ? 35  VAL A O   1 
ATOM   280  C  CB  . VAL A 1 35  ? 2.471   -9.464  30.752  1.00 39.21 ? 35  VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 35  ? 1.873   -9.607  32.174  1.00 39.19 ? 35  VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 35  ? 1.548   -8.682  29.853  1.00 38.72 ? 35  VAL A CG2 1 
ATOM   283  N  N   . ASP A 1 36  ? 5.215   -10.740 31.167  1.00 40.25 ? 36  ASP A N   1 
ATOM   284  C  CA  . ASP A 1 36  ? 6.035   -11.640 31.951  1.00 40.98 ? 36  ASP A CA  1 
ATOM   285  C  C   . ASP A 1 36  ? 7.491   -11.209 31.895  1.00 41.81 ? 36  ASP A C   1 
ATOM   286  O  O   . ASP A 1 36  ? 8.266   -11.723 31.065  1.00 42.97 ? 36  ASP A O   1 
ATOM   287  C  CB  . ASP A 1 36  ? 5.871   -13.061 31.423  1.00 39.88 ? 36  ASP A CB  1 
ATOM   288  C  CG  . ASP A 1 36  ? 6.440   -14.085 32.351  1.00 39.09 ? 36  ASP A CG  1 
ATOM   289  O  OD1 . ASP A 1 36  ? 7.394   -13.753 33.086  1.00 38.53 ? 36  ASP A OD1 1 
ATOM   290  O  OD2 . ASP A 1 36  ? 6.010   -15.253 32.397  1.00 37.18 ? 36  ASP A OD2 1 
ATOM   291  N  N   . GLU A 1 37  ? 7.852   -10.254 32.751  1.00 41.89 ? 37  GLU A N   1 
ATOM   292  C  CA  . GLU A 1 37  ? 9.217   -9.720  32.786  1.00 42.06 ? 37  GLU A CA  1 
ATOM   293  C  C   . GLU A 1 37  ? 10.224  -10.854 33.029  1.00 41.30 ? 37  GLU A C   1 
ATOM   294  O  O   . GLU A 1 37  ? 11.312  -10.867 32.440  1.00 41.13 ? 37  GLU A O   1 
ATOM   295  C  CB  . GLU A 1 37  ? 9.330   -8.575  33.816  1.00 42.81 ? 37  GLU A CB  1 
ATOM   296  C  CG  . GLU A 1 37  ? 10.569  -7.679  33.705  1.00 46.06 ? 37  GLU A CG  1 
ATOM   297  C  CD  . GLU A 1 37  ? 11.467  -7.724  34.952  1.00 51.19 ? 37  GLU A CD  1 
ATOM   298  O  OE1 . GLU A 1 37  ? 12.144  -6.695  35.274  1.00 51.63 ? 37  GLU A OE1 1 
ATOM   299  O  OE2 . GLU A 1 37  ? 11.502  -8.789  35.621  1.00 52.95 ? 37  GLU A OE2 1 
ATOM   300  N  N   . ARG A 1 38  ? 9.836   -11.847 33.834  1.00 40.49 ? 38  ARG A N   1 
ATOM   301  C  CA  . ARG A 1 38  ? 10.734  -12.960 34.115  1.00 39.84 ? 38  ARG A CA  1 
ATOM   302  C  C   . ARG A 1 38  ? 11.021  -13.757 32.853  1.00 39.36 ? 38  ARG A C   1 
ATOM   303  O  O   . ARG A 1 38  ? 12.160  -14.149 32.573  1.00 39.19 ? 38  ARG A O   1 
ATOM   304  C  CB  . ARG A 1 38  ? 10.171  -13.885 35.195  1.00 39.26 ? 38  ARG A CB  1 
ATOM   305  C  CG  . ARG A 1 38  ? 10.605  -13.541 36.580  1.00 38.27 ? 38  ARG A CG  1 
ATOM   306  C  CD  . ARG A 1 38  ? 10.221  -14.600 37.640  1.00 35.64 ? 38  ARG A CD  1 
ATOM   307  N  NE  . ARG A 1 38  ? 11.100  -15.773 37.697  1.00 34.93 ? 38  ARG A NE  1 
ATOM   308  C  CZ  . ARG A 1 38  ? 12.337  -15.756 38.181  1.00 36.34 ? 38  ARG A CZ  1 
ATOM   309  N  NH1 . ARG A 1 38  ? 13.071  -16.866 38.199  1.00 34.80 ? 38  ARG A NH1 1 
ATOM   310  N  NH2 . ARG A 1 38  ? 12.857  -14.629 38.645  1.00 34.29 ? 38  ARG A NH2 1 
ATOM   311  N  N   . ALA A 1 39  ? 9.984   -14.007 32.086  1.00 39.24 ? 39  ALA A N   1 
ATOM   312  C  CA  . ALA A 1 39  ? 10.175  -14.762 30.858  1.00 39.25 ? 39  ALA A CA  1 
ATOM   313  C  C   . ALA A 1 39  ? 11.016  -13.941 29.867  1.00 39.17 ? 39  ALA A C   1 
ATOM   314  O  O   . ALA A 1 39  ? 11.858  -14.490 29.146  1.00 38.15 ? 39  ALA A O   1 
ATOM   315  C  CB  . ALA A 1 39  ? 8.838   -15.156 30.272  1.00 39.64 ? 39  ALA A CB  1 
ATOM   316  N  N   . TRP A 1 40  ? 10.815  -12.624 29.890  1.00 39.00 ? 40  TRP A N   1 
ATOM   317  C  CA  . TRP A 1 40  ? 11.547  -11.687 29.038  1.00 39.72 ? 40  TRP A CA  1 
ATOM   318  C  C   . TRP A 1 40  ? 13.041  -11.653 29.338  1.00 40.53 ? 40  TRP A C   1 
ATOM   319  O  O   . TRP A 1 40  ? 13.877  -11.745 28.417  1.00 40.89 ? 40  TRP A O   1 
ATOM   320  C  CB  . TRP A 1 40  ? 10.991  -10.269 29.179  1.00 38.90 ? 40  TRP A CB  1 
ATOM   321  C  CG  . TRP A 1 40  ? 11.733  -9.288  28.353  1.00 39.28 ? 40  TRP A CG  1 
ATOM   322  C  CD1 . TRP A 1 40  ? 11.558  -9.038  27.012  1.00 39.66 ? 40  TRP A CD1 1 
ATOM   323  C  CD2 . TRP A 1 40  ? 12.793  -8.427  28.779  1.00 40.89 ? 40  TRP A CD2 1 
ATOM   324  N  NE1 . TRP A 1 40  ? 12.428  -8.064  26.589  1.00 41.20 ? 40  TRP A NE1 1 
ATOM   325  C  CE2 . TRP A 1 40  ? 13.206  -7.674  27.647  1.00 41.23 ? 40  TRP A CE2 1 
ATOM   326  C  CE3 . TRP A 1 40  ? 13.437  -8.204  30.002  1.00 41.32 ? 40  TRP A CE3 1 
ATOM   327  C  CZ2 . TRP A 1 40  ? 14.231  -6.721  27.708  1.00 41.86 ? 40  TRP A CZ2 1 
ATOM   328  C  CZ3 . TRP A 1 40  ? 14.456  -7.250  30.062  1.00 41.56 ? 40  TRP A CZ3 1 
ATOM   329  C  CH2 . TRP A 1 40  ? 14.844  -6.525  28.919  1.00 41.35 ? 40  TRP A CH2 1 
ATOM   330  N  N   . LYS A 1 41  ? 13.374  -11.479 30.616  1.00 40.85 ? 41  LYS A N   1 
ATOM   331  C  CA  . LYS A 1 41  ? 14.764  -11.475 31.051  1.00 41.25 ? 41  LYS A CA  1 
ATOM   332  C  C   . LYS A 1 41  ? 15.352  -12.849 30.733  1.00 41.52 ? 41  LYS A C   1 
ATOM   333  O  O   . LYS A 1 41  ? 16.473  -12.961 30.284  1.00 41.78 ? 41  LYS A O   1 
ATOM   334  C  CB  . LYS A 1 41  ? 14.871  -11.161 32.552  1.00 41.34 ? 41  LYS A CB  1 
ATOM   335  C  CG  . LYS A 1 41  ? 15.913  -10.082 32.903  1.00 42.13 ? 41  LYS A CG  1 
ATOM   336  C  CD  . LYS A 1 41  ? 15.944  -9.678  34.397  1.00 42.25 ? 41  LYS A CD  1 
ATOM   337  C  CE  . LYS A 1 41  ? 15.325  -8.275  34.671  1.00 42.14 ? 41  LYS A CE  1 
ATOM   338  N  NZ  . LYS A 1 41  ? 15.862  -7.656  35.945  1.00 43.55 ? 41  LYS A NZ  1 
ATOM   339  N  N   . GLU A 1 42  ? 14.590  -13.910 30.933  1.00 42.54 ? 42  GLU A N   1 
ATOM   340  C  CA  . GLU A 1 42  ? 15.142  -15.220 30.630  1.00 42.93 ? 42  GLU A CA  1 
ATOM   341  C  C   . GLU A 1 42  ? 15.563  -15.264 29.170  1.00 42.72 ? 42  GLU A C   1 
ATOM   342  O  O   . GLU A 1 42  ? 16.727  -15.503 28.874  1.00 42.66 ? 42  GLU A O   1 
ATOM   343  C  CB  . GLU A 1 42  ? 14.161  -16.347 30.986  1.00 43.34 ? 42  GLU A CB  1 
ATOM   344  C  CG  . GLU A 1 42  ? 14.311  -17.614 30.147  1.00 45.94 ? 42  GLU A CG  1 
ATOM   345  C  CD  . GLU A 1 42  ? 14.203  -18.900 30.959  1.00 51.14 ? 42  GLU A CD  1 
ATOM   346  O  OE1 . GLU A 1 42  ? 15.185  -19.210 31.674  1.00 52.46 ? 42  GLU A OE1 1 
ATOM   347  O  OE2 . GLU A 1 42  ? 13.155  -19.609 30.882  1.00 52.70 ? 42  GLU A OE2 1 
ATOM   348  N  N   . LEU A 1 43  ? 14.617  -15.000 28.266  1.00 42.19 ? 43  LEU A N   1 
ATOM   349  C  CA  . LEU A 1 43  ? 14.846  -15.062 26.821  1.00 41.96 ? 43  LEU A CA  1 
ATOM   350  C  C   . LEU A 1 43  ? 15.927  -14.101 26.301  1.00 41.90 ? 43  LEU A C   1 
ATOM   351  O  O   . LEU A 1 43  ? 16.704  -14.449 25.421  1.00 41.18 ? 43  LEU A O   1 
ATOM   352  C  CB  . LEU A 1 43  ? 13.517  -14.839 26.082  1.00 41.97 ? 43  LEU A CB  1 
ATOM   353  C  CG  . LEU A 1 43  ? 13.429  -15.310 24.631  1.00 41.85 ? 43  LEU A CG  1 
ATOM   354  C  CD1 . LEU A 1 43  ? 14.117  -16.640 24.415  1.00 42.81 ? 43  LEU A CD1 1 
ATOM   355  C  CD2 . LEU A 1 43  ? 11.964  -15.388 24.157  1.00 43.18 ? 43  LEU A CD2 1 
ATOM   356  N  N   . VAL A 1 44  ? 15.985  -12.896 26.851  1.00 42.29 ? 44  VAL A N   1 
ATOM   357  C  CA  . VAL A 1 44  ? 17.005  -11.937 26.436  1.00 43.39 ? 44  VAL A CA  1 
ATOM   358  C  C   . VAL A 1 44  ? 18.406  -12.433 26.807  1.00 44.42 ? 44  VAL A C   1 
ATOM   359  O  O   . VAL A 1 44  ? 19.288  -12.501 25.944  1.00 44.77 ? 44  VAL A O   1 
ATOM   360  C  CB  . VAL A 1 44  ? 16.757  -10.538 27.039  1.00 43.23 ? 44  VAL A CB  1 
ATOM   361  C  CG1 . VAL A 1 44  ? 18.027  -9.737  27.082  1.00 43.35 ? 44  VAL A CG1 1 
ATOM   362  C  CG2 . VAL A 1 44  ? 15.695  -9.788  26.226  1.00 43.80 ? 44  VAL A CG2 1 
ATOM   363  N  N   . GLU A 1 45  ? 18.581  -12.800 28.080  1.00 45.11 ? 45  GLU A N   1 
ATOM   364  C  CA  . GLU A 1 45  ? 19.851  -13.288 28.630  1.00 46.47 ? 45  GLU A CA  1 
ATOM   365  C  C   . GLU A 1 45  ? 20.307  -14.528 27.874  1.00 46.53 ? 45  GLU A C   1 
ATOM   366  O  O   . GLU A 1 45  ? 21.484  -14.653 27.545  1.00 46.88 ? 45  GLU A O   1 
ATOM   367  C  CB  . GLU A 1 45  ? 19.730  -13.606 30.145  1.00 46.62 ? 45  GLU A CB  1 
ATOM   368  C  CG  . GLU A 1 45  ? 19.804  -12.403 31.085  1.00 47.77 ? 45  GLU A CG  1 
ATOM   369  C  CD  . GLU A 1 45  ? 19.715  -12.781 32.566  1.00 49.65 ? 45  GLU A CD  1 
ATOM   370  O  OE1 . GLU A 1 45  ? 19.557  -11.861 33.413  1.00 48.65 ? 45  GLU A OE1 1 
ATOM   371  O  OE2 . GLU A 1 45  ? 19.798  -13.994 32.887  1.00 49.32 ? 45  GLU A OE2 1 
ATOM   372  N  N   . LYS A 1 46  ? 19.356  -15.418 27.596  1.00 46.97 ? 46  LYS A N   1 
ATOM   373  C  CA  . LYS A 1 46  ? 19.570  -16.664 26.845  1.00 47.62 ? 46  LYS A CA  1 
ATOM   374  C  C   . LYS A 1 46  ? 20.016  -16.477 25.387  1.00 47.44 ? 46  LYS A C   1 
ATOM   375  O  O   . LYS A 1 46  ? 21.147  -16.828 25.043  1.00 48.10 ? 46  LYS A O   1 
ATOM   376  C  CB  . LYS A 1 46  ? 18.286  -17.515 26.911  1.00 48.04 ? 46  LYS A CB  1 
ATOM   377  C  CG  . LYS A 1 46  ? 18.046  -18.509 25.750  1.00 50.13 ? 46  LYS A CG  1 
ATOM   378  C  CD  . LYS A 1 46  ? 16.604  -19.108 25.841  1.00 52.81 ? 46  LYS A CD  1 
ATOM   379  C  CE  . LYS A 1 46  ? 16.334  -20.274 24.849  1.00 52.91 ? 46  LYS A CE  1 
ATOM   380  N  NZ  . LYS A 1 46  ? 15.561  -19.875 23.609  1.00 53.37 ? 46  LYS A NZ  1 
ATOM   381  N  N   . GLU A 1 47  ? 19.141  -15.934 24.533  1.00 46.92 ? 47  GLU A N   1 
ATOM   382  C  CA  . GLU A 1 47  ? 19.473  -15.740 23.108  1.00 47.02 ? 47  GLU A CA  1 
ATOM   383  C  C   . GLU A 1 47  ? 19.183  -14.365 22.459  1.00 45.72 ? 47  GLU A C   1 
ATOM   384  O  O   . GLU A 1 47  ? 19.653  -14.114 21.351  1.00 45.97 ? 47  GLU A O   1 
ATOM   385  C  CB  . GLU A 1 47  ? 18.861  -16.836 22.234  1.00 47.29 ? 47  GLU A CB  1 
ATOM   386  C  CG  . GLU A 1 47  ? 17.365  -17.013 22.395  1.00 49.74 ? 47  GLU A CG  1 
ATOM   387  C  CD  . GLU A 1 47  ? 16.685  -17.466 21.109  1.00 52.94 ? 47  GLU A CD  1 
ATOM   388  O  OE1 . GLU A 1 47  ? 17.359  -18.076 20.248  1.00 54.56 ? 47  GLU A OE1 1 
ATOM   389  O  OE2 . GLU A 1 47  ? 15.473  -17.197 20.952  1.00 55.05 ? 47  GLU A OE2 1 
ATOM   390  N  N   . ASP A 1 48  ? 18.430  -13.499 23.136  1.00 44.67 ? 48  ASP A N   1 
ATOM   391  C  CA  . ASP A 1 48  ? 18.093  -12.165 22.610  1.00 43.53 ? 48  ASP A CA  1 
ATOM   392  C  C   . ASP A 1 48  ? 17.644  -12.211 21.154  1.00 42.17 ? 48  ASP A C   1 
ATOM   393  O  O   . ASP A 1 48  ? 18.333  -11.706 20.276  1.00 42.75 ? 48  ASP A O   1 
ATOM   394  C  CB  . ASP A 1 48  ? 19.279  -11.202 22.723  1.00 43.18 ? 48  ASP A CB  1 
ATOM   395  C  CG  . ASP A 1 48  ? 18.856  -9.746  22.621  1.00 44.46 ? 48  ASP A CG  1 
ATOM   396  O  OD1 . ASP A 1 48  ? 17.642  -9.469  22.799  1.00 44.10 ? 48  ASP A OD1 1 
ATOM   397  O  OD2 . ASP A 1 48  ? 19.652  -8.808  22.344  1.00 43.11 ? 48  ASP A OD2 1 
ATOM   398  N  N   . PRO A 1 49  ? 16.467  -12.758 20.892  1.00 40.47 ? 49  PRO A N   1 
ATOM   399  C  CA  . PRO A 1 49  ? 16.017  -12.914 19.511  1.00 39.07 ? 49  PRO A CA  1 
ATOM   400  C  C   . PRO A 1 49  ? 15.584  -11.610 18.901  1.00 37.26 ? 49  PRO A C   1 
ATOM   401  O  O   . PRO A 1 49  ? 15.104  -10.688 19.579  1.00 36.85 ? 49  PRO A O   1 
ATOM   402  C  CB  . PRO A 1 49  ? 14.773  -13.812 19.619  1.00 38.75 ? 49  PRO A CB  1 
ATOM   403  C  CG  . PRO A 1 49  ? 14.527  -14.034 21.059  1.00 39.21 ? 49  PRO A CG  1 
ATOM   404  C  CD  . PRO A 1 49  ? 15.450  -13.170 21.874  1.00 40.32 ? 49  PRO A CD  1 
ATOM   405  N  N   . VAL A 1 50  ? 15.766  -11.553 17.589  1.00 35.91 ? 50  VAL A N   1 
ATOM   406  C  CA  . VAL A 1 50  ? 15.234  -10.485 16.784  1.00 33.95 ? 50  VAL A CA  1 
ATOM   407  C  C   . VAL A 1 50  ? 13.724  -10.696 16.821  1.00 32.32 ? 50  VAL A C   1 
ATOM   408  O  O   . VAL A 1 50  ? 13.252  -11.777 16.525  1.00 32.16 ? 50  VAL A O   1 
ATOM   409  C  CB  . VAL A 1 50  ? 15.679  -10.634 15.322  1.00 34.42 ? 50  VAL A CB  1 
ATOM   410  C  CG1 . VAL A 1 50  ? 14.938  -9.615  14.471  1.00 34.26 ? 50  VAL A CG1 1 
ATOM   411  C  CG2 . VAL A 1 50  ? 17.198  -10.476 15.177  1.00 35.05 ? 50  VAL A CG2 1 
ATOM   412  N  N   . VAL A 1 51  ? 12.966  -9.691  17.233  1.00 30.57 ? 51  VAL A N   1 
ATOM   413  C  CA  . VAL A 1 51  ? 11.512  -9.824  17.271  1.00 28.86 ? 51  VAL A CA  1 
ATOM   414  C  C   . VAL A 1 51  ? 10.975  -9.380  15.917  1.00 28.28 ? 51  VAL A C   1 
ATOM   415  O  O   . VAL A 1 51  ? 10.043  -9.972  15.387  1.00 27.39 ? 51  VAL A O   1 
ATOM   416  C  CB  . VAL A 1 51  ? 10.867  -9.021  18.451  1.00 28.56 ? 51  VAL A CB  1 
ATOM   417  C  CG1 . VAL A 1 51  ? 9.344   -9.182  18.445  1.00 28.15 ? 51  VAL A CG1 1 
ATOM   418  C  CG2 . VAL A 1 51  ? 11.416  -9.483  19.798  1.00 28.77 ? 51  VAL A CG2 1 
ATOM   419  N  N   . TYR A 1 52  ? 11.575  -8.335  15.347  1.00 27.58 ? 52  TYR A N   1 
ATOM   420  C  CA  . TYR A 1 52  ? 11.221  -7.907  14.011  1.00 27.83 ? 52  TYR A CA  1 
ATOM   421  C  C   . TYR A 1 52  ? 12.245  -7.048  13.291  1.00 28.45 ? 52  TYR A C   1 
ATOM   422  O  O   . TYR A 1 52  ? 13.125  -6.432  13.915  1.00 28.74 ? 52  TYR A O   1 
ATOM   423  C  CB  . TYR A 1 52  ? 9.840   -7.237  13.974  1.00 28.50 ? 52  TYR A CB  1 
ATOM   424  C  CG  . TYR A 1 52  ? 9.690   -5.974  14.803  1.00 28.82 ? 52  TYR A CG  1 
ATOM   425  C  CD1 . TYR A 1 52  ? 9.720   -4.721  14.193  1.00 30.14 ? 52  TYR A CD1 1 
ATOM   426  C  CD2 . TYR A 1 52  ? 9.473   -6.041  16.171  1.00 30.08 ? 52  TYR A CD2 1 
ATOM   427  C  CE1 . TYR A 1 52  ? 9.567   -3.549  14.953  1.00 30.75 ? 52  TYR A CE1 1 
ATOM   428  C  CE2 . TYR A 1 52  ? 9.298   -4.891  16.927  1.00 30.59 ? 52  TYR A CE2 1 
ATOM   429  C  CZ  . TYR A 1 52  ? 9.341   -3.654  16.300  1.00 29.83 ? 52  TYR A CZ  1 
ATOM   430  O  OH  . TYR A 1 52  ? 9.192   -2.510  17.036  1.00 29.93 ? 52  TYR A OH  1 
ATOM   431  N  N   . GLU A 1 53  ? 12.109  -7.021  11.971  1.00 28.48 ? 53  GLU A N   1 
ATOM   432  C  CA  . GLU A 1 53  ? 12.921  -6.200  11.074  1.00 28.68 ? 53  GLU A CA  1 
ATOM   433  C  C   . GLU A 1 53  ? 11.983  -5.341  10.243  1.00 28.57 ? 53  GLU A C   1 
ATOM   434  O  O   . GLU A 1 53  ? 10.883  -5.768  9.885   1.00 28.80 ? 53  GLU A O   1 
ATOM   435  C  CB  . GLU A 1 53  ? 13.738  -7.082  10.134  1.00 29.46 ? 53  GLU A CB  1 
ATOM   436  C  CG  . GLU A 1 53  ? 14.847  -7.830  10.837  1.00 30.89 ? 53  GLU A CG  1 
ATOM   437  C  CD  . GLU A 1 53  ? 15.360  -9.016  10.040  1.00 33.86 ? 53  GLU A CD  1 
ATOM   438  O  OE1 . GLU A 1 53  ? 14.555  -9.713  9.372   1.00 35.84 ? 53  GLU A OE1 1 
ATOM   439  O  OE2 . GLU A 1 53  ? 16.573  -9.259  10.109  1.00 40.26 ? 53  GLU A OE2 1 
ATOM   440  N  N   . VAL A 1 54  ? 12.410  -4.120  9.953   1.00 28.56 ? 54  VAL A N   1 
ATOM   441  C  CA  . VAL A 1 54  ? 11.622  -3.214  9.132   1.00 27.92 ? 54  VAL A CA  1 
ATOM   442  C  C   . VAL A 1 54  ? 12.445  -2.711  7.957   1.00 27.39 ? 54  VAL A C   1 
ATOM   443  O  O   . VAL A 1 54  ? 13.585  -2.249  8.144   1.00 27.15 ? 54  VAL A O   1 
ATOM   444  C  CB  . VAL A 1 54  ? 11.153  -1.984  9.927   1.00 27.47 ? 54  VAL A CB  1 
ATOM   445  C  CG1 . VAL A 1 54  ? 10.281  -1.101  9.062   1.00 29.37 ? 54  VAL A CG1 1 
ATOM   446  C  CG2 . VAL A 1 54  ? 10.395  -2.408  11.228  1.00 26.74 ? 54  VAL A CG2 1 
ATOM   447  N  N   . TYR A 1 55  ? 11.867  -2.784  6.756   1.00 26.32 ? 55  TYR A N   1 
ATOM   448  C  CA  . TYR A 1 55  ? 12.493  -2.208  5.568   1.00 26.98 ? 55  TYR A CA  1 
ATOM   449  C  C   . TYR A 1 55  ? 11.731  -0.981  5.124   1.00 26.57 ? 55  TYR A C   1 
ATOM   450  O  O   . TYR A 1 55  ? 10.641  -1.080  4.559   1.00 25.82 ? 55  TYR A O   1 
ATOM   451  C  CB  . TYR A 1 55  ? 12.525  -3.190  4.444   1.00 27.86 ? 55  TYR A CB  1 
ATOM   452  C  CG  . TYR A 1 55  ? 13.406  -4.340  4.765   1.00 29.77 ? 55  TYR A CG  1 
ATOM   453  C  CD1 . TYR A 1 55  ? 12.895  -5.485  5.343   1.00 30.67 ? 55  TYR A CD1 1 
ATOM   454  C  CD2 . TYR A 1 55  ? 14.775  -4.264  4.507   1.00 31.26 ? 55  TYR A CD2 1 
ATOM   455  C  CE1 . TYR A 1 55  ? 13.720  -6.563  5.644   1.00 33.21 ? 55  TYR A CE1 1 
ATOM   456  C  CE2 . TYR A 1 55  ? 15.600  -5.328  4.790   1.00 34.51 ? 55  TYR A CE2 1 
ATOM   457  C  CZ  . TYR A 1 55  ? 15.073  -6.461  5.365   1.00 33.16 ? 55  TYR A CZ  1 
ATOM   458  O  OH  . TYR A 1 55  ? 15.909  -7.496  5.634   1.00 38.47 ? 55  TYR A OH  1 
ATOM   459  N  N   . ALA A 1 56  ? 12.329  0.168   5.359   1.00 26.39 ? 56  ALA A N   1 
ATOM   460  C  CA  . ALA A 1 56  ? 11.608  1.414   5.132   1.00 25.87 ? 56  ALA A CA  1 
ATOM   461  C  C   . ALA A 1 56  ? 12.125  2.237   3.959   1.00 26.33 ? 56  ALA A C   1 
ATOM   462  O  O   . ALA A 1 56  ? 13.335  2.431   3.793   1.00 26.83 ? 56  ALA A O   1 
ATOM   463  C  CB  . ALA A 1 56  ? 11.597  2.220   6.419   1.00 26.53 ? 56  ALA A CB  1 
ATOM   464  N  N   . VAL A 1 57  ? 11.198  2.728   3.152   1.00 26.10 ? 57  VAL A N   1 
ATOM   465  C  CA  . VAL A 1 57  ? 11.525  3.669   2.108   1.00 26.65 ? 57  VAL A CA  1 
ATOM   466  C  C   . VAL A 1 57  ? 10.785  4.904   2.534   1.00 28.35 ? 57  VAL A C   1 
ATOM   467  O  O   . VAL A 1 57  ? 9.574   4.940   2.382   1.00 28.89 ? 57  VAL A O   1 
ATOM   468  C  CB  . VAL A 1 57  ? 10.970  3.209   0.762   1.00 26.70 ? 57  VAL A CB  1 
ATOM   469  C  CG1 . VAL A 1 57  ? 11.111  4.320   -0.356  1.00 22.16 ? 57  VAL A CG1 1 
ATOM   470  C  CG2 . VAL A 1 57  ? 11.630  1.907   0.369   1.00 24.39 ? 57  VAL A CG2 1 
ATOM   471  N  N   . GLU A 1 58  ? 11.501  5.905   3.042   1.00 28.94 ? 58  GLU A N   1 
ATOM   472  C  CA  . GLU A 1 58  ? 10.825  7.086   3.599   1.00 31.30 ? 58  GLU A CA  1 
ATOM   473  C  C   . GLU A 1 58  ? 11.156  8.364   2.863   1.00 31.59 ? 58  GLU A C   1 
ATOM   474  O  O   . GLU A 1 58  ? 12.257  8.505   2.305   1.00 31.88 ? 58  GLU A O   1 
ATOM   475  C  CB  . GLU A 1 58  ? 11.157  7.276   5.093   1.00 31.33 ? 58  GLU A CB  1 
ATOM   476  C  CG  . GLU A 1 58  ? 10.781  6.112   6.001   1.00 35.06 ? 58  GLU A CG  1 
ATOM   477  C  CD  . GLU A 1 58  ? 11.250  6.257   7.458   1.00 39.86 ? 58  GLU A CD  1 
ATOM   478  O  OE1 . GLU A 1 58  ? 12.307  6.890   7.719   1.00 41.90 ? 58  GLU A OE1 1 
ATOM   479  O  OE2 . GLU A 1 58  ? 10.566  5.702   8.349   1.00 41.56 ? 58  GLU A OE2 1 
ATOM   480  N  N   . GLN A 1 59  ? 10.210  9.308   2.892   1.00 32.61 ? 59  GLN A N   1 
ATOM   481  C  CA  . GLN A 1 59  ? 10.393  10.632  2.295   1.00 33.17 ? 59  GLN A CA  1 
ATOM   482  C  C   . GLN A 1 59  ? 10.585  11.706  3.374   1.00 33.73 ? 59  GLN A C   1 
ATOM   483  O  O   . GLN A 1 59  ? 10.403  11.454  4.549   1.00 34.32 ? 59  GLN A O   1 
ATOM   484  C  CB  . GLN A 1 59  ? 9.169   11.019  1.463   1.00 32.24 ? 59  GLN A CB  1 
ATOM   485  C  CG  . GLN A 1 59  ? 8.789   9.987   0.407   1.00 29.80 ? 59  GLN A CG  1 
ATOM   486  C  CD  . GLN A 1 59  ? 9.897   9.769   -0.580  1.00 26.53 ? 59  GLN A CD  1 
ATOM   487  O  OE1 . GLN A 1 59  ? 10.569  10.730  -1.001  1.00 27.94 ? 59  GLN A OE1 1 
ATOM   488  N  NE2 . GLN A 1 59  ? 10.087  8.507   -0.993  1.00 27.06 ? 59  GLN A NE2 1 
ATOM   489  N  N   . GLU A 1 60  ? 10.944  12.901  2.964   1.00 35.57 ? 60  GLU A N   1 
ATOM   490  C  CA  . GLU A 1 60  ? 11.013  13.987  3.928   1.00 37.77 ? 60  GLU A CA  1 
ATOM   491  C  C   . GLU A 1 60  ? 9.617   14.192  4.472   1.00 38.14 ? 60  GLU A C   1 
ATOM   492  O  O   . GLU A 1 60  ? 8.648   14.102  3.733   1.00 38.34 ? 60  GLU A O   1 
ATOM   493  C  CB  . GLU A 1 60  ? 11.511  15.267  3.267   1.00 38.62 ? 60  GLU A CB  1 
ATOM   494  C  CG  . GLU A 1 60  ? 12.979  15.200  2.867   1.00 42.20 ? 60  GLU A CG  1 
ATOM   495  C  CD  . GLU A 1 60  ? 13.620  16.577  2.833   1.00 45.54 ? 60  GLU A CD  1 
ATOM   496  O  OE1 . GLU A 1 60  ? 14.766  16.721  3.332   1.00 45.42 ? 60  GLU A OE1 1 
ATOM   497  O  OE2 . GLU A 1 60  ? 12.963  17.518  2.318   1.00 46.11 ? 60  GLU A OE2 1 
ATOM   498  N  N   . GLU A 1 61  ? 9.512   14.438  5.773   1.00 38.62 ? 61  GLU A N   1 
ATOM   499  C  CA  . GLU A 1 61  ? 8.236   14.648  6.428   1.00 39.64 ? 61  GLU A CA  1 
ATOM   500  C  C   . GLU A 1 61  ? 7.555   15.878  5.848   1.00 38.95 ? 61  GLU A C   1 
ATOM   501  O  O   . GLU A 1 61  ? 7.927   16.997  6.167   1.00 39.91 ? 61  GLU A O   1 
ATOM   502  C  CB  . GLU A 1 61  ? 8.444   14.790  7.930   1.00 39.57 ? 61  GLU A CB  1 
ATOM   503  C  CG  . GLU A 1 61  ? 7.457   15.746  8.586   1.00 44.83 ? 61  GLU A CG  1 
ATOM   504  C  CD  . GLU A 1 61  ? 7.496   15.708  10.107  1.00 48.22 ? 61  GLU A CD  1 
ATOM   505  O  OE1 . GLU A 1 61  ? 6.460   16.081  10.725  1.00 50.22 ? 61  GLU A OE1 1 
ATOM   506  O  OE2 . GLU A 1 61  ? 8.551   15.307  10.675  1.00 49.63 ? 61  GLU A OE2 1 
ATOM   507  N  N   . LYS A 1 62  ? 6.557   15.656  4.997   1.00 38.36 ? 62  LYS A N   1 
ATOM   508  C  CA  . LYS A 1 62  ? 5.884   16.715  4.266   1.00 37.55 ? 62  LYS A CA  1 
ATOM   509  C  C   . LYS A 1 62  ? 4.449   16.291  4.014   1.00 36.65 ? 62  LYS A C   1 
ATOM   510  O  O   . LYS A 1 62  ? 4.195   15.156  3.624   1.00 36.26 ? 62  LYS A O   1 
ATOM   511  C  CB  . LYS A 1 62  ? 6.572   16.892  2.917   1.00 38.85 ? 62  LYS A CB  1 
ATOM   512  C  CG  . LYS A 1 62  ? 6.688   18.313  2.376   1.00 42.53 ? 62  LYS A CG  1 
ATOM   513  C  CD  . LYS A 1 62  ? 8.117   18.800  2.586   1.00 47.69 ? 62  LYS A CD  1 
ATOM   514  C  CE  . LYS A 1 62  ? 8.709   19.429  1.328   1.00 50.28 ? 62  LYS A CE  1 
ATOM   515  N  NZ  . LYS A 1 62  ? 10.183  19.221  1.354   1.00 52.58 ? 62  LYS A NZ  1 
ATOM   516  N  N   . GLU A 1 63  ? 3.496   17.187  4.220   1.00 35.09 ? 63  GLU A N   1 
ATOM   517  C  CA  . GLU A 1 63  ? 2.112   16.830  3.985   1.00 34.65 ? 63  GLU A CA  1 
ATOM   518  C  C   . GLU A 1 63  ? 1.874   16.265  2.594   1.00 33.50 ? 63  GLU A C   1 
ATOM   519  O  O   . GLU A 1 63  ? 2.382   16.765  1.598   1.00 32.95 ? 63  GLU A O   1 
ATOM   520  C  CB  . GLU A 1 63  ? 1.209   18.046  4.123   1.00 35.37 ? 63  GLU A CB  1 
ATOM   521  C  CG  . GLU A 1 63  ? 1.079   18.563  5.528   1.00 38.57 ? 63  GLU A CG  1 
ATOM   522  C  CD  . GLU A 1 63  ? 0.311   19.890  5.584   1.00 42.85 ? 63  GLU A CD  1 
ATOM   523  O  OE1 . GLU A 1 63  ? 0.732   20.751  6.381   1.00 44.98 ? 63  GLU A OE1 1 
ATOM   524  O  OE2 . GLU A 1 63  ? -0.702  20.060  4.844   1.00 41.18 ? 63  GLU A OE2 1 
ATOM   525  N  N   . GLY A 1 64  ? 1.062   15.227  2.531   1.00 32.03 ? 64  GLY A N   1 
ATOM   526  C  CA  . GLY A 1 64  ? 0.624   14.752  1.246   1.00 30.51 ? 64  GLY A CA  1 
ATOM   527  C  C   . GLY A 1 64  ? 1.550   13.714  0.648   1.00 30.02 ? 64  GLY A C   1 
ATOM   528  O  O   . GLY A 1 64  ? 1.118   13.019  -0.250  1.00 29.95 ? 64  GLY A O   1 
ATOM   529  N  N   . ASP A 1 65  ? 2.776   13.593  1.160   1.00 28.45 ? 65  ASP A N   1 
ATOM   530  C  CA  . ASP A 1 65  ? 3.727   12.607  0.643   1.00 27.87 ? 65  ASP A CA  1 
ATOM   531  C  C   . ASP A 1 65  ? 3.515   11.271  1.398   1.00 26.18 ? 65  ASP A C   1 
ATOM   532  O  O   . ASP A 1 65  ? 2.846   11.230  2.415   1.00 24.26 ? 65  ASP A O   1 
ATOM   533  C  CB  . ASP A 1 65  ? 5.167   13.111  0.793   1.00 27.91 ? 65  ASP A CB  1 
ATOM   534  C  CG  . ASP A 1 65  ? 6.103   12.623  -0.314  1.00 30.52 ? 65  ASP A CG  1 
ATOM   535  O  OD1 . ASP A 1 65  ? 5.848   11.557  -0.956  1.00 30.81 ? 65  ASP A OD1 1 
ATOM   536  O  OD2 . ASP A 1 65  ? 7.147   13.242  -0.605  1.00 25.08 ? 65  ASP A OD2 1 
ATOM   537  N  N   . LEU A 1 66  ? 4.094   10.181  0.895   1.00 25.44 ? 66  LEU A N   1 
ATOM   538  C  CA  . LEU A 1 66  ? 3.890   8.871   1.503   1.00 25.64 ? 66  LEU A CA  1 
ATOM   539  C  C   . LEU A 1 66  ? 5.184   8.075   1.700   1.00 23.99 ? 66  LEU A C   1 
ATOM   540  O  O   . LEU A 1 66  ? 6.107   8.141   0.900   1.00 24.35 ? 66  LEU A O   1 
ATOM   541  C  CB  . LEU A 1 66  ? 2.968   8.026   0.634   1.00 23.81 ? 66  LEU A CB  1 
ATOM   542  C  CG  . LEU A 1 66  ? 1.568   8.530   0.300   1.00 26.04 ? 66  LEU A CG  1 
ATOM   543  C  CD1 . LEU A 1 66  ? 0.954   7.724   -0.860  1.00 23.58 ? 66  LEU A CD1 1 
ATOM   544  C  CD2 . LEU A 1 66  ? 0.650   8.481   1.510   1.00 22.92 ? 66  LEU A CD2 1 
ATOM   545  N  N   . ASN A 1 67  ? 5.205   7.327   2.776   1.00 25.16 ? 67  ASN A N   1 
ATOM   546  C  CA  . ASN A 1 67  ? 6.286   6.419   3.106   1.00 24.88 ? 67  ASN A CA  1 
ATOM   547  C  C   . ASN A 1 67  ? 5.703   5.027   2.972   1.00 24.97 ? 67  ASN A C   1 
ATOM   548  O  O   . ASN A 1 67  ? 4.498   4.832   3.057   1.00 25.20 ? 67  ASN A O   1 
ATOM   549  C  CB  . ASN A 1 67  ? 6.638   6.561   4.574   1.00 25.52 ? 67  ASN A CB  1 
ATOM   550  C  CG  . ASN A 1 67  ? 7.444   7.813   4.873   1.00 26.08 ? 67  ASN A CG  1 
ATOM   551  O  OD1 . ASN A 1 67  ? 7.781   8.591   3.973   1.00 27.40 ? 67  ASN A OD1 1 
ATOM   552  N  ND2 . ASN A 1 67  ? 7.775   7.987   6.138   1.00 28.29 ? 67  ASN A ND2 1 
ATOM   553  N  N   . PHE A 1 68  ? 6.551   4.050   2.770   1.00 24.47 ? 68  PHE A N   1 
ATOM   554  C  CA  . PHE A 1 68  ? 6.087   2.690   2.879   1.00 23.43 ? 68  PHE A CA  1 
ATOM   555  C  C   . PHE A 1 68  ? 7.185   1.825   3.477   1.00 22.98 ? 68  PHE A C   1 
ATOM   556  O  O   . PHE A 1 68  ? 8.346   2.185   3.420   1.00 23.02 ? 68  PHE A O   1 
ATOM   557  C  CB  . PHE A 1 68  ? 5.581   2.166   1.568   1.00 23.63 ? 68  PHE A CB  1 
ATOM   558  C  CG  . PHE A 1 68  ? 6.584   2.150   0.484   1.00 22.59 ? 68  PHE A CG  1 
ATOM   559  C  CD1 . PHE A 1 68  ? 7.322   0.974   0.224   1.00 23.28 ? 68  PHE A CD1 1 
ATOM   560  C  CD2 . PHE A 1 68  ? 6.749   3.239   -0.336  1.00 23.23 ? 68  PHE A CD2 1 
ATOM   561  C  CE1 . PHE A 1 68  ? 8.213   0.953   -0.830  1.00 24.93 ? 68  PHE A CE1 1 
ATOM   562  C  CE2 . PHE A 1 68  ? 7.644   3.229   -1.380  1.00 23.91 ? 68  PHE A CE2 1 
ATOM   563  C  CZ  . PHE A 1 68  ? 8.382   2.068   -1.629  1.00 23.44 ? 68  PHE A CZ  1 
ATOM   564  N  N   . ALA A 1 69  ? 6.787   0.705   4.065   1.00 22.48 ? 69  ALA A N   1 
ATOM   565  C  CA  . ALA A 1 69  ? 7.692   -0.188  4.799   1.00 23.12 ? 69  ALA A CA  1 
ATOM   566  C  C   . ALA A 1 69  ? 7.159   -1.594  4.955   1.00 22.89 ? 69  ALA A C   1 
ATOM   567  O  O   . ALA A 1 69  ? 5.986   -1.806  5.194   1.00 23.03 ? 69  ALA A O   1 
ATOM   568  C  CB  . ALA A 1 69  ? 8.049   0.388   6.199   1.00 23.21 ? 69  ALA A CB  1 
ATOM   569  N  N   . THR A 1 70  ? 8.030   -2.575  4.818   1.00 23.72 ? 70  THR A N   1 
ATOM   570  C  CA  . THR A 1 70  ? 7.607   -3.900  5.204   1.00 23.71 ? 70  THR A CA  1 
ATOM   571  C  C   . THR A 1 70  ? 8.189   -4.140  6.567   1.00 24.34 ? 70  THR A C   1 
ATOM   572  O  O   . THR A 1 70  ? 9.240   -3.533  6.949   1.00 23.84 ? 70  THR A O   1 
ATOM   573  C  CB  . THR A 1 70  ? 8.187   -4.935  4.305   1.00 23.78 ? 70  THR A CB  1 
ATOM   574  O  OG1 . THR A 1 70  ? 9.590   -4.674  4.198   1.00 22.94 ? 70  THR A OG1 1 
ATOM   575  C  CG2 . THR A 1 70  ? 7.588   -4.828  2.896   1.00 23.50 ? 70  THR A CG2 1 
ATOM   576  N  N   . THR A 1 71  ? 7.511   -5.018  7.293   1.00 24.15 ? 71  THR A N   1 
ATOM   577  C  CA  . THR A 1 71  ? 7.952   -5.520  8.570   1.00 25.01 ? 71  THR A CA  1 
ATOM   578  C  C   . THR A 1 71  ? 7.929   -7.038  8.457   1.00 25.79 ? 71  THR A C   1 
ATOM   579  O  O   . THR A 1 71  ? 6.976   -7.615  7.945   1.00 25.56 ? 71  THR A O   1 
ATOM   580  C  CB  . THR A 1 71  ? 7.007   -5.095  9.717   1.00 24.43 ? 71  THR A CB  1 
ATOM   581  O  OG1 . THR A 1 71  ? 7.023   -3.669  9.872   1.00 25.91 ? 71  THR A OG1 1 
ATOM   582  C  CG2 . THR A 1 71  ? 7.476   -5.643  11.091  1.00 25.50 ? 71  THR A CG2 1 
ATOM   583  N  N   . VAL A 1 72  ? 8.992   -7.672  8.931   1.00 26.28 ? 72  VAL A N   1 
ATOM   584  C  CA  . VAL A 1 72  ? 8.992   -9.111  9.118   1.00 27.00 ? 72  VAL A CA  1 
ATOM   585  C  C   . VAL A 1 72  ? 8.971   -9.280  10.625  1.00 27.66 ? 72  VAL A C   1 
ATOM   586  O  O   . VAL A 1 72  ? 9.953   -8.937  11.299  1.00 28.86 ? 72  VAL A O   1 
ATOM   587  C  CB  . VAL A 1 72  ? 10.263  -9.773  8.533   1.00 26.49 ? 72  VAL A CB  1 
ATOM   588  C  CG1 . VAL A 1 72  ? 10.159  -11.325 8.610   1.00 27.56 ? 72  VAL A CG1 1 
ATOM   589  C  CG2 . VAL A 1 72  ? 10.508  -9.312  7.110   1.00 28.25 ? 72  VAL A CG2 1 
ATOM   590  N  N   . LEU A 1 73  ? 7.851   -9.774  11.150  1.00 28.32 ? 73  LEU A N   1 
ATOM   591  C  CA  . LEU A 1 73  ? 7.641   -10.012 12.578  1.00 28.93 ? 73  LEU A CA  1 
ATOM   592  C  C   . LEU A 1 73  ? 7.885   -11.505 12.843  1.00 29.54 ? 73  LEU A C   1 
ATOM   593  O  O   . LEU A 1 73  ? 7.127   -12.347 12.357  1.00 29.34 ? 73  LEU A O   1 
ATOM   594  C  CB  . LEU A 1 73  ? 6.199   -9.696  12.943  1.00 29.10 ? 73  LEU A CB  1 
ATOM   595  C  CG  . LEU A 1 73  ? 5.808   -9.086  14.301  1.00 29.92 ? 73  LEU A CG  1 
ATOM   596  C  CD1 . LEU A 1 73  ? 4.348   -9.321  14.639  1.00 29.60 ? 73  LEU A CD1 1 
ATOM   597  C  CD2 . LEU A 1 73  ? 6.692   -9.498  15.450  1.00 33.28 ? 73  LEU A CD2 1 
ATOM   598  N  N   . TYR A 1 74  ? 8.920   -11.826 13.609  1.00 29.86 ? 74  TYR A N   1 
ATOM   599  C  CA  . TYR A 1 74  ? 9.257   -13.234 13.856  1.00 30.28 ? 74  TYR A CA  1 
ATOM   600  C  C   . TYR A 1 74  ? 8.307   -13.991 14.801  1.00 30.32 ? 74  TYR A C   1 
ATOM   601  O  O   . TYR A 1 74  ? 7.700   -13.386 15.680  1.00 30.32 ? 74  TYR A O   1 
ATOM   602  C  CB  . TYR A 1 74  ? 10.742  -13.330 14.246  1.00 29.89 ? 74  TYR A CB  1 
ATOM   603  C  CG  . TYR A 1 74  ? 11.592  -13.019 13.047  1.00 30.41 ? 74  TYR A CG  1 
ATOM   604  C  CD1 . TYR A 1 74  ? 11.729  -13.941 12.037  1.00 29.29 ? 74  TYR A CD1 1 
ATOM   605  C  CD2 . TYR A 1 74  ? 12.206  -11.778 12.879  1.00 30.28 ? 74  TYR A CD2 1 
ATOM   606  C  CE1 . TYR A 1 74  ? 12.465  -13.661 10.894  1.00 32.54 ? 74  TYR A CE1 1 
ATOM   607  C  CE2 . TYR A 1 74  ? 12.943  -11.487 11.730  1.00 31.63 ? 74  TYR A CE2 1 
ATOM   608  C  CZ  . TYR A 1 74  ? 13.084  -12.434 10.744  1.00 32.46 ? 74  TYR A CZ  1 
ATOM   609  O  OH  . TYR A 1 74  ? 13.804  -12.183 9.582   1.00 33.79 ? 74  TYR A OH  1 
ATOM   610  N  N   . PRO A 1 75  ? 8.133   -15.303 14.615  1.00 31.34 ? 75  PRO A N   1 
ATOM   611  C  CA  . PRO A 1 75  ? 7.292   -16.081 15.533  1.00 31.60 ? 75  PRO A CA  1 
ATOM   612  C  C   . PRO A 1 75  ? 8.003   -16.220 16.891  1.00 32.24 ? 75  PRO A C   1 
ATOM   613  O  O   . PRO A 1 75  ? 9.240   -16.209 16.940  1.00 32.50 ? 75  PRO A O   1 
ATOM   614  C  CB  . PRO A 1 75  ? 7.155   -17.456 14.849  1.00 31.98 ? 75  PRO A CB  1 
ATOM   615  C  CG  . PRO A 1 75  ? 8.336   -17.576 13.954  1.00 31.04 ? 75  PRO A CG  1 
ATOM   616  C  CD  . PRO A 1 75  ? 8.715   -16.136 13.543  1.00 31.33 ? 75  PRO A CD  1 
ATOM   617  N  N   . GLY A 1 76  ? 7.227   -16.270 17.967  1.00 32.91 ? 76  GLY A N   1 
ATOM   618  C  CA  . GLY A 1 76  ? 7.761   -16.462 19.304  1.00 33.28 ? 76  GLY A CA  1 
ATOM   619  C  C   . GLY A 1 76  ? 6.776   -16.063 20.366  1.00 34.16 ? 76  GLY A C   1 
ATOM   620  O  O   . GLY A 1 76  ? 5.720   -15.539 20.052  1.00 34.33 ? 76  GLY A O   1 
ATOM   621  N  N   . LYS A 1 77  ? 7.090   -16.389 21.620  1.00 34.64 ? 77  LYS A N   1 
ATOM   622  C  CA  . LYS A 1 77  ? 6.305   -15.943 22.764  1.00 35.02 ? 77  LYS A CA  1 
ATOM   623  C  C   . LYS A 1 77  ? 7.224   -15.469 23.873  1.00 35.61 ? 77  LYS A C   1 
ATOM   624  O  O   . LYS A 1 77  ? 8.386   -15.873 23.966  1.00 35.44 ? 77  LYS A O   1 
ATOM   625  C  CB  . LYS A 1 77  ? 5.416   -17.061 23.307  1.00 34.98 ? 77  LYS A CB  1 
ATOM   626  C  CG  . LYS A 1 77  ? 4.280   -17.464 22.393  1.00 34.83 ? 77  LYS A CG  1 
ATOM   627  C  CD  . LYS A 1 77  ? 3.704   -18.816 22.833  1.00 38.35 ? 77  LYS A CD  1 
ATOM   628  C  CE  . LYS A 1 77  ? 3.073   -19.506 21.639  1.00 40.49 ? 77  LYS A CE  1 
ATOM   629  N  NZ  . LYS A 1 77  ? 2.578   -20.886 21.959  1.00 44.33 ? 77  LYS A NZ  1 
ATOM   630  N  N   . VAL A 1 78  ? 6.719   -14.539 24.669  1.00 36.17 ? 78  VAL A N   1 
ATOM   631  C  CA  . VAL A 1 78  ? 7.372   -14.156 25.905  1.00 36.54 ? 78  VAL A CA  1 
ATOM   632  C  C   . VAL A 1 78  ? 6.357   -14.624 26.946  1.00 37.20 ? 78  VAL A C   1 
ATOM   633  O  O   . VAL A 1 78  ? 5.358   -13.945 27.222  1.00 36.19 ? 78  VAL A O   1 
ATOM   634  C  CB  . VAL A 1 78  ? 7.654   -12.652 25.978  1.00 36.99 ? 78  VAL A CB  1 
ATOM   635  C  CG1 . VAL A 1 78  ? 8.236   -12.292 27.352  1.00 36.12 ? 78  VAL A CG1 1 
ATOM   636  C  CG2 . VAL A 1 78  ? 8.596   -12.226 24.841  1.00 37.10 ? 78  VAL A CG2 1 
ATOM   637  N  N   . GLY A 1 79  ? 6.604   -15.820 27.485  1.00 37.71 ? 79  GLY A N   1 
ATOM   638  C  CA  . GLY A 1 79  ? 5.678   -16.462 28.410  1.00 38.28 ? 79  GLY A CA  1 
ATOM   639  C  C   . GLY A 1 79  ? 4.452   -16.947 27.645  1.00 38.10 ? 79  GLY A C   1 
ATOM   640  O  O   . GLY A 1 79  ? 4.527   -17.888 26.855  1.00 38.96 ? 79  GLY A O   1 
ATOM   641  N  N   . LYS A 1 80  ? 3.314   -16.304 27.871  1.00 37.96 ? 80  LYS A N   1 
ATOM   642  C  CA  . LYS A 1 80  ? 2.114   -16.642 27.121  1.00 38.14 ? 80  LYS A CA  1 
ATOM   643  C  C   . LYS A 1 80  ? 1.897   -15.616 25.999  1.00 37.22 ? 80  LYS A C   1 
ATOM   644  O  O   . LYS A 1 80  ? 0.998   -15.774 25.173  1.00 36.93 ? 80  LYS A O   1 
ATOM   645  C  CB  . LYS A 1 80  ? 0.880   -16.639 28.028  1.00 38.46 ? 80  LYS A CB  1 
ATOM   646  C  CG  . LYS A 1 80  ? 1.035   -17.427 29.337  1.00 40.00 ? 80  LYS A CG  1 
ATOM   647  C  CD  . LYS A 1 80  ? -0.284  -18.052 29.763  1.00 43.81 ? 80  LYS A CD  1 
ATOM   648  C  CE  . LYS A 1 80  ? -0.247  -18.452 31.233  1.00 47.31 ? 80  LYS A CE  1 
ATOM   649  N  NZ  . LYS A 1 80  ? -0.020  -17.265 32.146  1.00 47.41 ? 80  LYS A NZ  1 
ATOM   650  N  N   . GLU A 1 81  ? 2.703   -14.559 25.988  1.00 36.25 ? 81  GLU A N   1 
ATOM   651  C  CA  . GLU A 1 81  ? 2.506   -13.463 25.025  1.00 35.56 ? 81  GLU A CA  1 
ATOM   652  C  C   . GLU A 1 81  ? 3.267   -13.578 23.711  1.00 34.03 ? 81  GLU A C   1 
ATOM   653  O  O   . GLU A 1 81  ? 4.509   -13.567 23.695  1.00 33.16 ? 81  GLU A O   1 
ATOM   654  C  CB  . GLU A 1 81  ? 2.868   -12.123 25.657  1.00 36.24 ? 81  GLU A CB  1 
ATOM   655  C  CG  . GLU A 1 81  ? 1.699   -11.222 25.971  1.00 37.77 ? 81  GLU A CG  1 
ATOM   656  C  CD  . GLU A 1 81  ? 2.179   -9.893  26.487  1.00 37.33 ? 81  GLU A CD  1 
ATOM   657  O  OE1 . GLU A 1 81  ? 3.149   -9.890  27.270  1.00 37.45 ? 81  GLU A OE1 1 
ATOM   658  O  OE2 . GLU A 1 81  ? 1.631   -8.863  26.073  1.00 36.32 ? 81  GLU A OE2 1 
ATOM   659  N  N   . PHE A 1 82  ? 2.512   -13.622 22.614  1.00 32.24 ? 82  PHE A N   1 
ATOM   660  C  CA  . PHE A 1 82  ? 3.082   -13.647 21.253  1.00 31.59 ? 82  PHE A CA  1 
ATOM   661  C  C   . PHE A 1 82  ? 3.930   -12.432 20.955  1.00 30.65 ? 82  PHE A C   1 
ATOM   662  O  O   . PHE A 1 82  ? 3.627   -11.311 21.427  1.00 29.01 ? 82  PHE A O   1 
ATOM   663  C  CB  . PHE A 1 82  ? 1.969   -13.705 20.196  1.00 32.50 ? 82  PHE A CB  1 
ATOM   664  C  CG  . PHE A 1 82  ? 1.204   -15.001 20.187  1.00 31.84 ? 82  PHE A CG  1 
ATOM   665  C  CD1 . PHE A 1 82  ? -0.086  -15.056 20.653  1.00 32.28 ? 82  PHE A CD1 1 
ATOM   666  C  CD2 . PHE A 1 82  ? 1.784   -16.166 19.697  1.00 33.89 ? 82  PHE A CD2 1 
ATOM   667  C  CE1 . PHE A 1 82  ? -0.786  -16.233 20.654  1.00 34.82 ? 82  PHE A CE1 1 
ATOM   668  C  CE2 . PHE A 1 82  ? 1.072   -17.369 19.705  1.00 33.13 ? 82  PHE A CE2 1 
ATOM   669  C  CZ  . PHE A 1 82  ? -0.207  -17.390 20.179  1.00 31.58 ? 82  PHE A CZ  1 
ATOM   670  N  N   . PHE A 1 83  ? 4.986   -12.665 20.176  1.00 29.35 ? 83  PHE A N   1 
ATOM   671  C  CA  . PHE A 1 83  ? 5.844   -11.605 19.667  1.00 29.01 ? 83  PHE A CA  1 
ATOM   672  C  C   . PHE A 1 83  ? 4.998   -10.542 18.961  1.00 28.65 ? 83  PHE A C   1 
ATOM   673  O  O   . PHE A 1 83  ? 4.030   -10.862 18.254  1.00 27.62 ? 83  PHE A O   1 
ATOM   674  C  CB  . PHE A 1 83  ? 6.883   -12.171 18.694  1.00 29.43 ? 83  PHE A CB  1 
ATOM   675  C  CG  . PHE A 1 83  ? 8.139   -12.741 19.360  1.00 30.13 ? 83  PHE A CG  1 
ATOM   676  C  CD1 . PHE A 1 83  ? 8.196   -12.980 20.736  1.00 33.00 ? 83  PHE A CD1 1 
ATOM   677  C  CD2 . PHE A 1 83  ? 9.252   -13.050 18.594  1.00 32.77 ? 83  PHE A CD2 1 
ATOM   678  C  CE1 . PHE A 1 83  ? 9.328   -13.479 21.325  1.00 31.71 ? 83  PHE A CE1 1 
ATOM   679  C  CE2 . PHE A 1 83  ? 10.411  -13.565 19.186  1.00 35.23 ? 83  PHE A CE2 1 
ATOM   680  C  CZ  . PHE A 1 83  ? 10.449  -13.783 20.539  1.00 34.94 ? 83  PHE A CZ  1 
ATOM   681  N  N   . PHE A 1 84  ? 5.361   -9.287  19.185  1.00 28.08 ? 84  PHE A N   1 
ATOM   682  C  CA  . PHE A 1 84  ? 4.671   -8.139  18.623  1.00 27.28 ? 84  PHE A CA  1 
ATOM   683  C  C   . PHE A 1 84  ? 5.609   -6.975  18.336  1.00 27.18 ? 84  PHE A C   1 
ATOM   684  O  O   . PHE A 1 84  ? 6.740   -6.981  18.762  1.00 27.54 ? 84  PHE A O   1 
ATOM   685  C  CB  . PHE A 1 84  ? 3.479   -7.689  19.514  1.00 27.10 ? 84  PHE A CB  1 
ATOM   686  C  CG  . PHE A 1 84  ? 3.834   -7.336  20.943  1.00 27.87 ? 84  PHE A CG  1 
ATOM   687  C  CD1 . PHE A 1 84  ? 4.702   -6.284  21.240  1.00 29.22 ? 84  PHE A CD1 1 
ATOM   688  C  CD2 . PHE A 1 84  ? 3.239   -8.023  21.995  1.00 29.33 ? 84  PHE A CD2 1 
ATOM   689  C  CE1 . PHE A 1 84  ? 4.996   -5.944  22.565  1.00 30.46 ? 84  PHE A CE1 1 
ATOM   690  C  CE2 . PHE A 1 84  ? 3.535   -7.687  23.338  1.00 31.56 ? 84  PHE A CE2 1 
ATOM   691  C  CZ  . PHE A 1 84  ? 4.421   -6.638  23.607  1.00 29.91 ? 84  PHE A CZ  1 
ATOM   692  N  N   . THR A 1 85  ? 5.154   -6.009  17.556  1.00 26.87 ? 85  THR A N   1 
ATOM   693  C  CA  . THR A 1 85  ? 5.926   -4.780  17.344  1.00 27.26 ? 85  THR A CA  1 
ATOM   694  C  C   . THR A 1 85  ? 5.664   -3.878  18.531  1.00 27.62 ? 85  THR A C   1 
ATOM   695  O  O   . THR A 1 85  ? 4.651   -4.013  19.202  1.00 28.12 ? 85  THR A O   1 
ATOM   696  C  CB  . THR A 1 85  ? 5.452   -4.015  16.099  1.00 26.33 ? 85  THR A CB  1 
ATOM   697  O  OG1 . THR A 1 85  ? 4.025   -3.843  16.157  1.00 25.08 ? 85  THR A OG1 1 
ATOM   698  C  CG2 . THR A 1 85  ? 5.743   -4.772  14.795  1.00 25.68 ? 85  THR A CG2 1 
ATOM   699  N  N   . LYS A 1 86  ? 6.533   -2.896  18.754  1.00 28.23 ? 86  LYS A N   1 
ATOM   700  C  CA  . LYS A 1 86  ? 6.368   -2.025  19.907  1.00 29.74 ? 86  LYS A CA  1 
ATOM   701  C  C   . LYS A 1 86  ? 5.000   -1.324  19.926  1.00 29.65 ? 86  LYS A C   1 
ATOM   702  O  O   . LYS A 1 86  ? 4.389   -1.212  20.981  1.00 29.94 ? 86  LYS A O   1 
ATOM   703  C  CB  . LYS A 1 86  ? 7.512   -1.012  19.978  1.00 29.44 ? 86  LYS A CB  1 
ATOM   704  C  CG  . LYS A 1 86  ? 8.844   -1.667  20.195  1.00 34.56 ? 86  LYS A CG  1 
ATOM   705  C  CD  . LYS A 1 86  ? 9.950   -0.670  20.035  1.00 40.93 ? 86  LYS A CD  1 
ATOM   706  C  CE  . LYS A 1 86  ? 10.894  -0.752  21.202  1.00 44.33 ? 86  LYS A CE  1 
ATOM   707  N  NZ  . LYS A 1 86  ? 11.452  0.584   21.549  1.00 47.44 ? 86  LYS A NZ  1 
ATOM   708  N  N   . GLY A 1 87  ? 4.544   -0.875  18.760  1.00 29.82 ? 87  GLY A N   1 
ATOM   709  C  CA  . GLY A 1 87  ? 3.263   -0.196  18.611  1.00 30.88 ? 87  GLY A CA  1 
ATOM   710  C  C   . GLY A 1 87  ? 3.419   1.296   18.877  1.00 31.93 ? 87  GLY A C   1 
ATOM   711  O  O   . GLY A 1 87  ? 4.263   1.686   19.684  1.00 32.08 ? 87  GLY A O   1 
ATOM   712  N  N   . HIS A 1 88  ? 2.627   2.130   18.211  1.00 32.95 ? 88  HIS A N   1 
ATOM   713  C  CA  . HIS A 1 88  ? 2.683   3.567   18.455  1.00 34.42 ? 88  HIS A CA  1 
ATOM   714  C  C   . HIS A 1 88  ? 1.395   4.230   18.037  1.00 34.37 ? 88  HIS A C   1 
ATOM   715  O  O   . HIS A 1 88  ? 0.560   3.647   17.340  1.00 34.88 ? 88  HIS A O   1 
ATOM   716  C  CB  . HIS A 1 88  ? 3.769   4.189   17.590  1.00 34.68 ? 88  HIS A CB  1 
ATOM   717  C  CG  . HIS A 1 88  ? 3.602   3.859   16.145  1.00 36.61 ? 88  HIS A CG  1 
ATOM   718  N  ND1 . HIS A 1 88  ? 4.078   2.684   15.598  1.00 39.27 ? 88  HIS A ND1 1 
ATOM   719  C  CD2 . HIS A 1 88  ? 2.938   4.496   15.152  1.00 36.52 ? 88  HIS A CD2 1 
ATOM   720  C  CE1 . HIS A 1 88  ? 3.753   2.633   14.319  1.00 37.73 ? 88  HIS A CE1 1 
ATOM   721  N  NE2 . HIS A 1 88  ? 3.061   3.719   14.024  1.00 38.75 ? 88  HIS A NE2 1 
ATOM   722  N  N   . PHE A 1 89  ? 1.244   5.468   18.474  1.00 35.11 ? 89  PHE A N   1 
ATOM   723  C  CA  . PHE A 1 89  ? 0.255   6.354   17.899  1.00 34.77 ? 89  PHE A CA  1 
ATOM   724  C  C   . PHE A 1 89  ? 1.038   7.156   16.864  1.00 35.42 ? 89  PHE A C   1 
ATOM   725  O  O   . PHE A 1 89  ? 2.257   7.110   16.845  1.00 35.17 ? 89  PHE A O   1 
ATOM   726  C  CB  . PHE A 1 89  ? -0.250  7.324   18.949  1.00 34.71 ? 89  PHE A CB  1 
ATOM   727  C  CG  . PHE A 1 89  ? -1.329  6.781   19.793  1.00 33.34 ? 89  PHE A CG  1 
ATOM   728  C  CD1 . PHE A 1 89  ? -2.646  6.815   19.351  1.00 32.20 ? 89  PHE A CD1 1 
ATOM   729  C  CD2 . PHE A 1 89  ? -1.041  6.264   21.049  1.00 32.64 ? 89  PHE A CD2 1 
ATOM   730  C  CE1 . PHE A 1 89  ? -3.657  6.321   20.150  1.00 33.01 ? 89  PHE A CE1 1 
ATOM   731  C  CE2 . PHE A 1 89  ? -2.037  5.774   21.850  1.00 33.31 ? 89  PHE A CE2 1 
ATOM   732  C  CZ  . PHE A 1 89  ? -3.355  5.796   21.398  1.00 34.66 ? 89  PHE A CZ  1 
ATOM   733  N  N   . HIS A 1 90  ? 0.358   7.896   16.003  1.00 35.74 ? 90  HIS A N   1 
ATOM   734  C  CA  . HIS A 1 90  ? 1.086   8.777   15.123  1.00 36.85 ? 90  HIS A CA  1 
ATOM   735  C  C   . HIS A 1 90  ? 1.419   10.043  15.930  1.00 36.95 ? 90  HIS A C   1 
ATOM   736  O  O   . HIS A 1 90  ? 0.804   10.306  16.954  1.00 36.90 ? 90  HIS A O   1 
ATOM   737  C  CB  . HIS A 1 90  ? 0.271   9.098   13.884  1.00 36.61 ? 90  HIS A CB  1 
ATOM   738  C  CG  . HIS A 1 90  ? 0.152   7.944   12.952  1.00 38.52 ? 90  HIS A CG  1 
ATOM   739  N  ND1 . HIS A 1 90  ? -1.035  7.583   12.353  1.00 39.31 ? 90  HIS A ND1 1 
ATOM   740  C  CD2 . HIS A 1 90  ? 1.077   7.044   12.540  1.00 37.61 ? 90  HIS A CD2 1 
ATOM   741  C  CE1 . HIS A 1 90  ? -0.826  6.526   11.585  1.00 38.10 ? 90  HIS A CE1 1 
ATOM   742  N  NE2 . HIS A 1 90  ? 0.445   6.180   11.682  1.00 37.98 ? 90  HIS A NE2 1 
ATOM   743  N  N   . ALA A 1 91  ? 2.432   10.774  15.492  1.00 37.83 ? 91  ALA A N   1 
ATOM   744  C  CA  . ALA A 1 91  ? 2.783   12.051  16.098  1.00 37.72 ? 91  ALA A CA  1 
ATOM   745  C  C   . ALA A 1 91  ? 1.712   13.026  15.660  1.00 37.99 ? 91  ALA A C   1 
ATOM   746  O  O   . ALA A 1 91  ? 1.269   13.869  16.438  1.00 38.64 ? 91  ALA A O   1 
ATOM   747  C  CB  . ALA A 1 91  ? 4.148   12.515  15.614  1.00 37.62 ? 91  ALA A CB  1 
ATOM   748  N  N   . LYS A 1 92  ? 1.345   12.938  14.376  1.00 37.78 ? 92  LYS A N   1 
ATOM   749  C  CA  . LYS A 1 92  ? 0.208   13.674  13.859  1.00 37.38 ? 92  LYS A CA  1 
ATOM   750  C  C   . LYS A 1 92  ? -0.910  12.653  13.965  1.00 37.67 ? 92  LYS A C   1 
ATOM   751  O  O   . LYS A 1 92  ? -1.162  11.848  13.043  1.00 36.68 ? 92  LYS A O   1 
ATOM   752  C  CB  . LYS A 1 92  ? 0.412   14.145  12.421  1.00 37.97 ? 92  LYS A CB  1 
ATOM   753  C  CG  . LYS A 1 92  ? 1.465   15.276  12.239  1.00 38.06 ? 92  LYS A CG  1 
ATOM   754  C  CD  . LYS A 1 92  ? 1.209   16.110  10.983  1.00 37.57 ? 92  LYS A CD  1 
ATOM   755  C  CE  . LYS A 1 92  ? 2.395   17.044  10.644  1.00 36.57 ? 92  LYS A CE  1 
ATOM   756  N  NZ  . LYS A 1 92  ? 2.183   17.727  9.311   1.00 34.57 ? 92  LYS A NZ  1 
ATOM   757  N  N   . LEU A 1 93  ? -1.554  12.675  15.124  1.00 37.50 ? 93  LEU A N   1 
ATOM   758  C  CA  . LEU A 1 93  ? -2.569  11.693  15.469  1.00 37.45 ? 93  LEU A CA  1 
ATOM   759  C  C   . LEU A 1 93  ? -3.537  11.352  14.356  1.00 37.17 ? 93  LEU A C   1 
ATOM   760  O  O   . LEU A 1 93  ? -3.864  10.177  14.192  1.00 36.76 ? 93  LEU A O   1 
ATOM   761  C  CB  . LEU A 1 93  ? -3.353  12.115  16.715  1.00 37.54 ? 93  LEU A CB  1 
ATOM   762  C  CG  . LEU A 1 93  ? -2.792  11.721  18.082  1.00 40.30 ? 93  LEU A CG  1 
ATOM   763  C  CD1 . LEU A 1 93  ? -3.333  12.635  19.190  1.00 41.30 ? 93  LEU A CD1 1 
ATOM   764  C  CD2 . LEU A 1 93  ? -3.127  10.259  18.393  1.00 42.24 ? 93  LEU A CD2 1 
ATOM   765  N  N   . ASP A 1 94  ? -3.982  12.342  13.583  1.00 35.76 ? 94  ASP A N   1 
ATOM   766  C  CA  . ASP A 1 94  ? -5.037  12.074  12.616  1.00 36.22 ? 94  ASP A CA  1 
ATOM   767  C  C   . ASP A 1 94  ? -4.540  11.445  11.297  1.00 35.46 ? 94  ASP A C   1 
ATOM   768  O  O   . ASP A 1 94  ? -5.280  11.382  10.312  1.00 36.51 ? 94  ASP A O   1 
ATOM   769  C  CB  . ASP A 1 94  ? -5.887  13.315  12.351  1.00 37.12 ? 94  ASP A CB  1 
ATOM   770  C  CG  . ASP A 1 94  ? -5.103  14.388  11.683  1.00 40.07 ? 94  ASP A CG  1 
ATOM   771  O  OD1 . ASP A 1 94  ? -5.710  15.367  11.188  1.00 43.62 ? 94  ASP A OD1 1 
ATOM   772  O  OD2 . ASP A 1 94  ? -3.854  14.297  11.588  1.00 42.66 ? 94  ASP A OD2 1 
ATOM   773  N  N   . ARG A 1 95  ? -3.302  10.958  11.275  1.00 33.18 ? 95  ARG A N   1 
ATOM   774  C  CA  . ARG A 1 95  ? -2.831  10.285  10.067  1.00 32.10 ? 95  ARG A CA  1 
ATOM   775  C  C   . ARG A 1 95  ? -3.319  8.829   10.072  1.00 30.16 ? 95  ARG A C   1 
ATOM   776  O  O   . ARG A 1 95  ? -3.297  8.183   11.110  1.00 30.61 ? 95  ARG A O   1 
ATOM   777  C  CB  . ARG A 1 95  ? -1.308  10.336  9.969   1.00 31.03 ? 95  ARG A CB  1 
ATOM   778  C  CG  . ARG A 1 95  ? -0.782  11.514  9.146   1.00 34.34 ? 95  ARG A CG  1 
ATOM   779  C  CD  . ARG A 1 95  ? -1.352  12.858  9.554   1.00 31.89 ? 95  ARG A CD  1 
ATOM   780  N  NE  . ARG A 1 95  ? -0.826  13.954  8.738   1.00 28.21 ? 95  ARG A NE  1 
ATOM   781  C  CZ  . ARG A 1 95  ? -1.493  15.094  8.540   1.00 29.05 ? 95  ARG A CZ  1 
ATOM   782  N  NH1 . ARG A 1 95  ? -2.690  15.235  9.072   1.00 26.26 ? 95  ARG A NH1 1 
ATOM   783  N  NH2 . ARG A 1 95  ? -0.971  16.066  7.795   1.00 29.49 ? 95  ARG A NH2 1 
ATOM   784  N  N   . ALA A 1 96  ? -3.767  8.333   8.922   1.00 29.74 ? 96  ALA A N   1 
ATOM   785  C  CA  . ALA A 1 96  ? -4.190  6.934   8.784   1.00 28.02 ? 96  ALA A CA  1 
ATOM   786  C  C   . ALA A 1 96  ? -3.044  6.099   8.224   1.00 27.84 ? 96  ALA A C   1 
ATOM   787  O  O   . ALA A 1 96  ? -2.031  6.653   7.800   1.00 28.17 ? 96  ALA A O   1 
ATOM   788  C  CB  . ALA A 1 96  ? -5.409  6.820   7.865   1.00 27.98 ? 96  ALA A CB  1 
ATOM   789  N  N   . GLU A 1 97  ? -3.226  4.776   8.185   1.00 26.17 ? 97  GLU A N   1 
ATOM   790  C  CA  . GLU A 1 97  ? -2.246  3.857   7.579   1.00 24.78 ? 97  GLU A CA  1 
ATOM   791  C  C   . GLU A 1 97  ? -2.993  2.714   6.909   1.00 23.25 ? 97  GLU A C   1 
ATOM   792  O  O   . GLU A 1 97  ? -4.108  2.398   7.260   1.00 22.30 ? 97  GLU A O   1 
ATOM   793  C  CB  . GLU A 1 97  ? -1.306  3.268   8.635   1.00 25.08 ? 97  GLU A CB  1 
ATOM   794  C  CG  . GLU A 1 97  ? -0.253  4.212   9.147   1.00 29.64 ? 97  GLU A CG  1 
ATOM   795  C  CD  . GLU A 1 97  ? 0.737   3.553   10.077  1.00 34.52 ? 97  GLU A CD  1 
ATOM   796  O  OE1 . GLU A 1 97  ? 0.985   2.341   9.929   1.00 36.64 ? 97  GLU A OE1 1 
ATOM   797  O  OE2 . GLU A 1 97  ? 1.263   4.246   10.972  1.00 40.50 ? 97  GLU A OE2 1 
ATOM   798  N  N   . VAL A 1 98  ? -2.361  2.096   5.936   1.00 22.29 ? 98  VAL A N   1 
ATOM   799  C  CA  . VAL A 1 98  ? -2.988  0.955   5.299   1.00 21.29 ? 98  VAL A CA  1 
ATOM   800  C  C   . VAL A 1 98  ? -1.920  -0.103  5.406   1.00 21.42 ? 98  VAL A C   1 
ATOM   801  O  O   . VAL A 1 98  ? -0.753  0.178   5.138   1.00 22.93 ? 98  VAL A O   1 
ATOM   802  C  CB  . VAL A 1 98  ? -3.308  1.209   3.837   1.00 22.06 ? 98  VAL A CB  1 
ATOM   803  C  CG1 . VAL A 1 98  ? -3.736  -0.150  3.100   1.00 20.49 ? 98  VAL A CG1 1 
ATOM   804  C  CG2 . VAL A 1 98  ? -4.412  2.255   3.721   1.00 20.90 ? 98  VAL A CG2 1 
ATOM   805  N  N   . TYR A 1 99  ? -2.335  -1.303  5.768   1.00 21.17 ? 99  TYR A N   1 
ATOM   806  C  CA  . TYR A 1 99  ? -1.404  -2.417  5.902   1.00 21.90 ? 99  TYR A CA  1 
ATOM   807  C  C   . TYR A 1 99  ? -1.826  -3.462  4.884   1.00 21.85 ? 99  TYR A C   1 
ATOM   808  O  O   . TYR A 1 99  ? -3.017  -3.669  4.632   1.00 21.86 ? 99  TYR A O   1 
ATOM   809  C  CB  . TYR A 1 99  ? -1.494  -3.011  7.316   1.00 22.57 ? 99  TYR A CB  1 
ATOM   810  C  CG  . TYR A 1 99  ? -0.635  -2.389  8.387   1.00 25.30 ? 99  TYR A CG  1 
ATOM   811  C  CD1 . TYR A 1 99  ? -0.827  -1.061  8.782   1.00 27.56 ? 99  TYR A CD1 1 
ATOM   812  C  CD2 . TYR A 1 99  ? 0.332   -3.148  9.046   1.00 27.99 ? 99  TYR A CD2 1 
ATOM   813  C  CE1 . TYR A 1 99  ? -0.037  -0.502  9.803   1.00 27.51 ? 99  TYR A CE1 1 
ATOM   814  C  CE2 . TYR A 1 99  ? 1.129   -2.618  10.026  1.00 30.12 ? 99  TYR A CE2 1 
ATOM   815  C  CZ  . TYR A 1 99  ? 0.942   -1.288  10.405  1.00 29.80 ? 99  TYR A CZ  1 
ATOM   816  O  OH  . TYR A 1 99  ? 1.730   -0.799  11.400  1.00 35.46 ? 99  TYR A OH  1 
ATOM   817  N  N   . VAL A 1 100 ? -0.854  -4.179  4.325   1.00 22.62 ? 100 VAL A N   1 
ATOM   818  C  CA  . VAL A 1 100 ? -1.218  -5.276  3.457   1.00 22.65 ? 100 VAL A CA  1 
ATOM   819  C  C   . VAL A 1 100 ? -0.449  -6.469  3.951   1.00 23.32 ? 100 VAL A C   1 
ATOM   820  O  O   . VAL A 1 100 ? 0.783   -6.417  4.022   1.00 22.43 ? 100 VAL A O   1 
ATOM   821  C  CB  . VAL A 1 100 ? -0.794  -5.035  2.020   1.00 22.46 ? 100 VAL A CB  1 
ATOM   822  C  CG1 . VAL A 1 100 ? -1.328  -6.187  1.138   1.00 22.45 ? 100 VAL A CG1 1 
ATOM   823  C  CG2 . VAL A 1 100 ? -1.207  -3.602  1.514   1.00 24.35 ? 100 VAL A CG2 1 
ATOM   824  N  N   . ALA A 1 101 ? -1.168  -7.529  4.319   1.00 24.23 ? 101 ALA A N   1 
ATOM   825  C  CA  . ALA A 1 101 ? -0.527  -8.715  4.865   1.00 24.61 ? 101 ALA A CA  1 
ATOM   826  C  C   . ALA A 1 101 ? -0.022  -9.523  3.686   1.00 25.14 ? 101 ALA A C   1 
ATOM   827  O  O   . ALA A 1 101 ? -0.725  -9.691  2.688   1.00 25.72 ? 101 ALA A O   1 
ATOM   828  C  CB  . ALA A 1 101 ? -1.490  -9.539  5.764   1.00 24.90 ? 101 ALA A CB  1 
ATOM   829  N  N   . LEU A 1 102 ? 1.190   -10.027 3.796   1.00 26.45 ? 102 LEU A N   1 
ATOM   830  C  CA  . LEU A 1 102 ? 1.812   -10.684 2.648   1.00 27.19 ? 102 LEU A CA  1 
ATOM   831  C  C   . LEU A 1 102 ? 2.047   -12.138 2.959   1.00 28.30 ? 102 LEU A C   1 
ATOM   832  O  O   . LEU A 1 102 ? 1.966   -12.977 2.080   1.00 28.80 ? 102 LEU A O   1 
ATOM   833  C  CB  . LEU A 1 102 ? 3.146   -10.032 2.323   1.00 26.33 ? 102 LEU A CB  1 
ATOM   834  C  CG  . LEU A 1 102 ? 3.110   -8.554  1.895   1.00 26.74 ? 102 LEU A CG  1 
ATOM   835  C  CD1 . LEU A 1 102 ? 4.500   -7.988  1.557   1.00 28.16 ? 102 LEU A CD1 1 
ATOM   836  C  CD2 . LEU A 1 102 ? 2.159   -8.391  0.765   1.00 25.36 ? 102 LEU A CD2 1 
ATOM   837  N  N   . LYS A 1 103 ? 2.352   -12.403 4.219   1.00 28.58 ? 103 LYS A N   1 
ATOM   838  C  CA  . LYS A 1 103 ? 2.720   -13.736 4.627   1.00 29.83 ? 103 LYS A CA  1 
ATOM   839  C  C   . LYS A 1 103 ? 2.535   -14.020 6.108   1.00 29.73 ? 103 LYS A C   1 
ATOM   840  O  O   . LYS A 1 103 ? 2.708   -13.131 6.972   1.00 28.54 ? 103 LYS A O   1 
ATOM   841  C  CB  . LYS A 1 103 ? 4.172   -13.943 4.214   1.00 30.56 ? 103 LYS A CB  1 
ATOM   842  C  CG  . LYS A 1 103 ? 4.730   -15.275 4.547   1.00 33.39 ? 103 LYS A CG  1 
ATOM   843  C  CD  . LYS A 1 103 ? 5.523   -15.787 3.362   1.00 35.37 ? 103 LYS A CD  1 
ATOM   844  C  CE  . LYS A 1 103 ? 6.040   -17.185 3.635   1.00 36.60 ? 103 LYS A CE  1 
ATOM   845  N  NZ  . LYS A 1 103 ? 6.016   -17.928 2.356   1.00 38.16 ? 103 LYS A NZ  1 
ATOM   846  N  N   . GLY A 1 104 ? 2.201   -15.284 6.397   1.00 29.13 ? 104 GLY A N   1 
ATOM   847  C  CA  . GLY A 1 104 ? 2.100   -15.775 7.750   1.00 29.69 ? 104 GLY A CA  1 
ATOM   848  C  C   . GLY A 1 104 ? 0.734   -15.512 8.351   1.00 30.45 ? 104 GLY A C   1 
ATOM   849  O  O   . GLY A 1 104 ? -0.177  -15.056 7.665   1.00 30.55 ? 104 GLY A O   1 
ATOM   850  N  N   . LYS A 1 105 ? 0.652   -15.741 9.654   1.00 30.74 ? 105 LYS A N   1 
ATOM   851  C  CA  . LYS A 1 105 ? -0.573  -15.687 10.440  1.00 31.89 ? 105 LYS A CA  1 
ATOM   852  C  C   . LYS A 1 105 ? -0.419  -14.627 11.508  1.00 30.55 ? 105 LYS A C   1 
ATOM   853  O  O   . LYS A 1 105 ? 0.484   -14.693 12.326  1.00 30.94 ? 105 LYS A O   1 
ATOM   854  C  CB  . LYS A 1 105 ? -0.754  -17.038 11.131  1.00 32.48 ? 105 LYS A CB  1 
ATOM   855  C  CG  . LYS A 1 105 ? -2.144  -17.589 11.146  1.00 37.74 ? 105 LYS A CG  1 
ATOM   856  C  CD  . LYS A 1 105 ? -2.322  -18.559 12.333  1.00 42.63 ? 105 LYS A CD  1 
ATOM   857  C  CE  . LYS A 1 105 ? -1.786  -19.982 12.021  1.00 44.95 ? 105 LYS A CE  1 
ATOM   858  N  NZ  . LYS A 1 105 ? -2.097  -20.977 13.118  1.00 45.49 ? 105 LYS A NZ  1 
ATOM   859  N  N   . GLY A 1 106 ? -1.305  -13.653 11.535  1.00 30.68 ? 106 GLY A N   1 
ATOM   860  C  CA  . GLY A 1 106 ? -1.127  -12.606 12.502  1.00 29.38 ? 106 GLY A CA  1 
ATOM   861  C  C   . GLY A 1 106 ? -2.352  -11.786 12.775  1.00 29.48 ? 106 GLY A C   1 
ATOM   862  O  O   . GLY A 1 106 ? -3.463  -12.181 12.469  1.00 28.62 ? 106 GLY A O   1 
ATOM   863  N  N   . GLY A 1 107 ? -2.139  -10.629 13.377  1.00 28.95 ? 107 GLY A N   1 
ATOM   864  C  CA  . GLY A 1 107 ? -3.236  -9.728  13.609  1.00 28.20 ? 107 GLY A CA  1 
ATOM   865  C  C   . GLY A 1 107 ? -2.733  -8.389  14.102  1.00 28.12 ? 107 GLY A C   1 
ATOM   866  O  O   . GLY A 1 107 ? -1.575  -8.228  14.491  1.00 28.92 ? 107 GLY A O   1 
ATOM   867  N  N   . MET A 1 108 ? -3.629  -7.433  14.103  1.00 27.56 ? 108 MET A N   1 
ATOM   868  C  CA  . MET A 1 108 ? -3.306  -6.113  14.604  1.00 27.85 ? 108 MET A CA  1 
ATOM   869  C  C   . MET A 1 108 ? -4.224  -5.787  15.782  1.00 28.20 ? 108 MET A C   1 
ATOM   870  O  O   . MET A 1 108 ? -5.452  -6.036  15.752  1.00 27.37 ? 108 MET A O   1 
ATOM   871  C  CB  . MET A 1 108 ? -3.485  -5.090  13.493  1.00 27.17 ? 108 MET A CB  1 
ATOM   872  C  CG  . MET A 1 108 ? -2.829  -3.712  13.753  1.00 27.74 ? 108 MET A CG  1 
ATOM   873  S  SD  . MET A 1 108 ? -3.371  -2.527  12.599  1.00 29.89 ? 108 MET A SD  1 
ATOM   874  C  CE  . MET A 1 108 ? -2.491  -3.251  11.052  1.00 26.81 ? 108 MET A CE  1 
ATOM   875  N  N   . LEU A 1 109 ? -3.601  -5.182  16.785  1.00 28.01 ? 109 LEU A N   1 
ATOM   876  C  CA  . LEU A 1 109 ? -4.232  -4.715  17.987  1.00 29.39 ? 109 LEU A CA  1 
ATOM   877  C  C   . LEU A 1 109 ? -4.293  -3.226  17.780  1.00 29.40 ? 109 LEU A C   1 
ATOM   878  O  O   . LEU A 1 109 ? -3.270  -2.616  17.474  1.00 29.98 ? 109 LEU A O   1 
ATOM   879  C  CB  . LEU A 1 109 ? -3.273  -5.000  19.122  1.00 29.62 ? 109 LEU A CB  1 
ATOM   880  C  CG  . LEU A 1 109 ? -3.756  -5.482  20.471  1.00 34.49 ? 109 LEU A CG  1 
ATOM   881  C  CD1 . LEU A 1 109 ? -2.575  -5.983  21.290  1.00 36.05 ? 109 LEU A CD1 1 
ATOM   882  C  CD2 . LEU A 1 109 ? -4.455  -4.356  21.187  1.00 36.56 ? 109 LEU A CD2 1 
ATOM   883  N  N   . LEU A 1 110 ? -5.471  -2.635  17.915  1.00 28.69 ? 110 LEU A N   1 
ATOM   884  C  CA  . LEU A 1 110 ? -5.576  -1.200  17.788  1.00 28.86 ? 110 LEU A CA  1 
ATOM   885  C  C   . LEU A 1 110 ? -6.221  -0.685  19.059  1.00 29.64 ? 110 LEU A C   1 
ATOM   886  O  O   . LEU A 1 110 ? -6.971  -1.405  19.716  1.00 29.75 ? 110 LEU A O   1 
ATOM   887  C  CB  . LEU A 1 110 ? -6.449  -0.815  16.595  1.00 27.70 ? 110 LEU A CB  1 
ATOM   888  C  CG  . LEU A 1 110 ? -6.025  -1.379  15.234  1.00 28.96 ? 110 LEU A CG  1 
ATOM   889  C  CD1 . LEU A 1 110 ? -6.903  -2.563  14.812  1.00 31.37 ? 110 LEU A CD1 1 
ATOM   890  C  CD2 . LEU A 1 110 ? -6.079  -0.265  14.178  1.00 29.14 ? 110 LEU A CD2 1 
ATOM   891  N  N   . GLN A 1 111 ? -5.965  0.578   19.381  1.00 30.51 ? 111 GLN A N   1 
ATOM   892  C  CA  . GLN A 1 111 ? -6.656  1.174   20.506  1.00 31.19 ? 111 GLN A CA  1 
ATOM   893  C  C   . GLN A 1 111 ? -6.681  2.679   20.336  1.00 31.34 ? 111 GLN A C   1 
ATOM   894  O  O   . GLN A 1 111 ? -5.813  3.250   19.696  1.00 29.93 ? 111 GLN A O   1 
ATOM   895  C  CB  . GLN A 1 111 ? -6.031  0.763   21.835  1.00 31.98 ? 111 GLN A CB  1 
ATOM   896  C  CG  . GLN A 1 111 ? -4.893  1.623   22.329  1.00 32.83 ? 111 GLN A CG  1 
ATOM   897  C  CD  . GLN A 1 111 ? -4.508  1.257   23.757  1.00 37.61 ? 111 GLN A CD  1 
ATOM   898  O  OE1 . GLN A 1 111 ? -3.921  2.066   24.474  1.00 38.74 ? 111 GLN A OE1 1 
ATOM   899  N  NE2 . GLN A 1 111 ? -4.847  0.035   24.173  1.00 35.77 ? 111 GLN A NE2 1 
ATOM   900  N  N   . THR A 1 112 ? -7.717  3.315   20.869  1.00 33.10 ? 112 THR A N   1 
ATOM   901  C  CA  . THR A 1 112 ? -7.839  4.769   20.778  1.00 34.47 ? 112 THR A CA  1 
ATOM   902  C  C   . THR A 1 112 ? -7.078  5.408   21.926  1.00 35.51 ? 112 THR A C   1 
ATOM   903  O  O   . THR A 1 112 ? -6.610  4.719   22.807  1.00 35.93 ? 112 THR A O   1 
ATOM   904  C  CB  . THR A 1 112 ? -9.302  5.140   20.955  1.00 34.45 ? 112 THR A CB  1 
ATOM   905  O  OG1 . THR A 1 112 ? -9.701  4.702   22.251  1.00 36.22 ? 112 THR A OG1 1 
ATOM   906  C  CG2 . THR A 1 112 ? -10.187 4.313   20.023  1.00 34.88 ? 112 THR A CG2 1 
ATOM   907  N  N   . PRO A 1 113 ? -6.941  6.731   21.913  1.00 36.42 ? 113 PRO A N   1 
ATOM   908  C  CA  . PRO A 1 113 ? -6.318  7.452   23.035  1.00 37.28 ? 113 PRO A CA  1 
ATOM   909  C  C   . PRO A 1 113 ? -6.955  7.062   24.359  1.00 38.00 ? 113 PRO A C   1 
ATOM   910  O  O   . PRO A 1 113 ? -6.255  7.032   25.369  1.00 38.95 ? 113 PRO A O   1 
ATOM   911  C  CB  . PRO A 1 113 ? -6.596  8.927   22.706  1.00 36.90 ? 113 PRO A CB  1 
ATOM   912  C  CG  . PRO A 1 113 ? -6.632  8.955   21.204  1.00 36.27 ? 113 PRO A CG  1 
ATOM   913  C  CD  . PRO A 1 113 ? -7.312  7.635   20.816  1.00 36.30 ? 113 PRO A CD  1 
ATOM   914  N  N   . GLU A 1 114 ? -8.235  6.710   24.349  1.00 38.76 ? 114 GLU A N   1 
ATOM   915  C  CA  . GLU A 1 114 ? -8.947  6.321   25.582  1.00 39.54 ? 114 GLU A CA  1 
ATOM   916  C  C   . GLU A 1 114 ? -8.800  4.839   25.931  1.00 39.44 ? 114 GLU A C   1 
ATOM   917  O  O   . GLU A 1 114 ? -9.299  4.373   26.957  1.00 39.41 ? 114 GLU A O   1 
ATOM   918  C  CB  . GLU A 1 114 ? -10.423 6.714   25.515  1.00 39.47 ? 114 GLU A CB  1 
ATOM   919  C  CG  . GLU A 1 114 ? -10.673 8.219   25.599  1.00 42.36 ? 114 GLU A CG  1 
ATOM   920  C  CD  . GLU A 1 114 ? -10.405 8.965   24.295  1.00 45.00 ? 114 GLU A CD  1 
ATOM   921  O  OE1 . GLU A 1 114 ? -11.092 8.679   23.294  1.00 45.30 ? 114 GLU A OE1 1 
ATOM   922  O  OE2 . GLU A 1 114 ? -9.502  9.840   24.260  1.00 47.15 ? 114 GLU A OE2 1 
ATOM   923  N  N   . GLY A 1 115 ? -8.123  4.095   25.066  1.00 39.27 ? 115 GLY A N   1 
ATOM   924  C  CA  . GLY A 1 115 ? -7.800  2.717   25.368  1.00 38.19 ? 115 GLY A CA  1 
ATOM   925  C  C   . GLY A 1 115 ? -8.825  1.682   24.987  1.00 37.01 ? 115 GLY A C   1 
ATOM   926  O  O   . GLY A 1 115 ? -8.723  0.538   25.394  1.00 37.18 ? 115 GLY A O   1 
ATOM   927  N  N   . ASP A 1 116 ? -9.833  2.076   24.233  1.00 36.68 ? 116 ASP A N   1 
ATOM   928  C  CA  . ASP A 1 116 ? -10.747 1.083   23.718  1.00 36.32 ? 116 ASP A CA  1 
ATOM   929  C  C   . ASP A 1 116 ? -10.010 0.305   22.627  1.00 35.44 ? 116 ASP A C   1 
ATOM   930  O  O   . ASP A 1 116 ? -9.426  0.896   21.727  1.00 34.89 ? 116 ASP A O   1 
ATOM   931  C  CB  . ASP A 1 116 ? -11.999 1.750   23.184  1.00 36.68 ? 116 ASP A CB  1 
ATOM   932  C  CG  . ASP A 1 116 ? -12.812 2.378   24.303  1.00 38.71 ? 116 ASP A CG  1 
ATOM   933  O  OD1 . ASP A 1 116 ? -13.191 1.632   25.229  1.00 39.88 ? 116 ASP A OD1 1 
ATOM   934  O  OD2 . ASP A 1 116 ? -13.054 3.603   24.363  1.00 39.65 ? 116 ASP A OD2 1 
ATOM   935  N  N   . ALA A 1 117 ? -10.040 -1.018  22.728  1.00 34.60 ? 117 ALA A N   1 
ATOM   936  C  CA  . ALA A 1 117 ? -9.235  -1.844  21.857  1.00 34.14 ? 117 ALA A CA  1 
ATOM   937  C  C   . ALA A 1 117 ? -10.029 -2.563  20.785  1.00 33.79 ? 117 ALA A C   1 
ATOM   938  O  O   . ALA A 1 117 ? -11.208 -2.828  20.966  1.00 33.98 ? 117 ALA A O   1 
ATOM   939  C  CB  . ALA A 1 117 ? -8.462  -2.834  22.686  1.00 33.98 ? 117 ALA A CB  1 
ATOM   940  N  N   . LYS A 1 118 ? -9.381  -2.817  19.646  1.00 32.89 ? 118 LYS A N   1 
ATOM   941  C  CA  . LYS A 1 118 ? -9.950  -3.658  18.607  1.00 32.50 ? 118 LYS A CA  1 
ATOM   942  C  C   . LYS A 1 118 ? -8.849  -4.597  18.157  1.00 32.90 ? 118 LYS A C   1 
ATOM   943  O  O   . LYS A 1 118 ? -7.643  -4.269  18.252  1.00 31.84 ? 118 LYS A O   1 
ATOM   944  C  CB  . LYS A 1 118 ? -10.451 -2.853  17.398  1.00 33.42 ? 118 LYS A CB  1 
ATOM   945  C  CG  . LYS A 1 118 ? -11.714 -1.989  17.615  1.00 33.93 ? 118 LYS A CG  1 
ATOM   946  C  CD  . LYS A 1 118 ? -12.906 -2.828  18.129  1.00 36.74 ? 118 LYS A CD  1 
ATOM   947  C  CE  . LYS A 1 118 ? -14.250 -2.143  17.866  1.00 39.18 ? 118 LYS A CE  1 
ATOM   948  N  NZ  . LYS A 1 118 ? -14.138 -0.693  18.226  1.00 42.55 ? 118 LYS A NZ  1 
ATOM   949  N  N   . TRP A 1 119 ? -9.265  -5.773  17.699  1.00 31.25 ? 119 TRP A N   1 
ATOM   950  C  CA  . TRP A 1 119 ? -8.338  -6.759  17.156  1.00 32.07 ? 119 TRP A CA  1 
ATOM   951  C  C   . TRP A 1 119 ? -8.827  -7.119  15.771  1.00 31.65 ? 119 TRP A C   1 
ATOM   952  O  O   . TRP A 1 119 ? -10.023 -7.343  15.566  1.00 32.42 ? 119 TRP A O   1 
ATOM   953  C  CB  . TRP A 1 119 ? -8.269  -7.991  18.053  1.00 32.00 ? 119 TRP A CB  1 
ATOM   954  C  CG  . TRP A 1 119 ? -7.701  -9.245  17.427  1.00 32.12 ? 119 TRP A CG  1 
ATOM   955  C  CD1 . TRP A 1 119 ? -8.407  -10.321 16.954  1.00 32.33 ? 119 TRP A CD1 1 
ATOM   956  C  CD2 . TRP A 1 119 ? -6.320  -9.568  17.252  1.00 31.11 ? 119 TRP A CD2 1 
ATOM   957  N  NE1 . TRP A 1 119 ? -7.549  -11.287 16.482  1.00 32.22 ? 119 TRP A NE1 1 
ATOM   958  C  CE2 . TRP A 1 119 ? -6.259  -10.850 16.652  1.00 31.98 ? 119 TRP A CE2 1 
ATOM   959  C  CE3 . TRP A 1 119 ? -5.120  -8.891  17.512  1.00 30.20 ? 119 TRP A CE3 1 
ATOM   960  C  CZ2 . TRP A 1 119 ? -5.056  -11.465 16.335  1.00 31.57 ? 119 TRP A CZ2 1 
ATOM   961  C  CZ3 . TRP A 1 119 ? -3.936  -9.499  17.212  1.00 31.39 ? 119 TRP A CZ3 1 
ATOM   962  C  CH2 . TRP A 1 119 ? -3.895  -10.773 16.629  1.00 31.34 ? 119 TRP A CH2 1 
ATOM   963  N  N   . ILE A 1 120 ? -7.911  -7.115  14.810  1.00 31.14 ? 120 ILE A N   1 
ATOM   964  C  CA  . ILE A 1 120 ? -8.235  -7.462  13.440  1.00 30.66 ? 120 ILE A CA  1 
ATOM   965  C  C   . ILE A 1 120 ? -7.264  -8.534  13.008  1.00 30.03 ? 120 ILE A C   1 
ATOM   966  O  O   . ILE A 1 120 ? -6.061  -8.300  12.948  1.00 29.84 ? 120 ILE A O   1 
ATOM   967  C  CB  . ILE A 1 120 ? -8.091  -6.265  12.507  1.00 30.44 ? 120 ILE A CB  1 
ATOM   968  C  CG1 . ILE A 1 120 ? -8.960  -5.094  13.010  1.00 29.88 ? 120 ILE A CG1 1 
ATOM   969  C  CG2 . ILE A 1 120 ? -8.416  -6.714  11.022  1.00 30.11 ? 120 ILE A CG2 1 
ATOM   970  C  CD1 . ILE A 1 120 ? -9.219  -4.058  11.973  1.00 32.34 ? 120 ILE A CD1 1 
ATOM   971  N  N   . SER A 1 121 ? -7.786  -9.709  12.703  1.00 29.97 ? 121 SER A N   1 
ATOM   972  C  CA  . SER A 1 121 ? -6.929  -10.792 12.265  1.00 29.50 ? 121 SER A CA  1 
ATOM   973  C  C   . SER A 1 121 ? -6.399  -10.537 10.850  1.00 28.61 ? 121 SER A C   1 
ATOM   974  O  O   . SER A 1 121 ? -7.037  -9.875  10.028  1.00 28.83 ? 121 SER A O   1 
ATOM   975  C  CB  . SER A 1 121 ? -7.637  -12.151 12.400  1.00 29.79 ? 121 SER A CB  1 
ATOM   976  O  OG  . SER A 1 121 ? -8.534  -12.363 11.339  1.00 33.43 ? 121 SER A OG  1 
ATOM   977  N  N   . MET A 1 122 ? -5.197  -11.031 10.585  1.00 28.08 ? 122 MET A N   1 
ATOM   978  C  CA  . MET A 1 122 ? -4.551  -10.813 9.315   1.00 28.49 ? 122 MET A CA  1 
ATOM   979  C  C   . MET A 1 122 ? -3.926  -12.109 8.813   1.00 28.58 ? 122 MET A C   1 
ATOM   980  O  O   . MET A 1 122 ? -3.221  -12.806 9.560   1.00 30.54 ? 122 MET A O   1 
ATOM   981  C  CB  . MET A 1 122 ? -3.463  -9.738  9.432   1.00 27.84 ? 122 MET A CB  1 
ATOM   982  C  CG  . MET A 1 122 ? -4.009  -8.362  9.760   1.00 26.51 ? 122 MET A CG  1 
ATOM   983  S  SD  . MET A 1 122 ? -2.714  -7.236  10.363  1.00 26.75 ? 122 MET A SD  1 
ATOM   984  C  CE  . MET A 1 122 ? -1.943  -6.945  8.940   1.00 28.73 ? 122 MET A CE  1 
ATOM   985  N  N   . GLU A 1 123 ? -4.239  -12.406 7.566   1.00 28.51 ? 123 GLU A N   1 
ATOM   986  C  CA  . GLU A 1 123 ? -3.677  -13.504 6.791   1.00 29.04 ? 123 GLU A CA  1 
ATOM   987  C  C   . GLU A 1 123 ? -3.322  -12.882 5.453   1.00 28.65 ? 123 GLU A C   1 
ATOM   988  O  O   . GLU A 1 123 ? -3.818  -11.764 5.104   1.00 28.21 ? 123 GLU A O   1 
ATOM   989  C  CB  . GLU A 1 123 ? -4.696  -14.625 6.621   1.00 29.21 ? 123 GLU A CB  1 
ATOM   990  C  CG  . GLU A 1 123 ? -5.941  -14.222 5.874   1.00 33.03 ? 123 GLU A CG  1 
ATOM   991  C  CD  . GLU A 1 123 ? -7.041  -15.279 5.951   1.00 38.48 ? 123 GLU A CD  1 
ATOM   992  O  OE1 . GLU A 1 123 ? -7.939  -15.279 5.059   1.00 41.32 ? 123 GLU A OE1 1 
ATOM   993  O  OE2 . GLU A 1 123 ? -6.989  -16.103 6.905   1.00 38.96 ? 123 GLU A OE2 1 
ATOM   994  N  N   . PRO A 1 124 ? -2.497  -13.572 4.662   1.00 28.02 ? 124 PRO A N   1 
ATOM   995  C  CA  . PRO A 1 124 ? -2.029  -12.989 3.409   1.00 27.53 ? 124 PRO A CA  1 
ATOM   996  C  C   . PRO A 1 124 ? -3.226  -12.512 2.621   1.00 27.52 ? 124 PRO A C   1 
ATOM   997  O  O   . PRO A 1 124 ? -4.230  -13.231 2.494   1.00 28.69 ? 124 PRO A O   1 
ATOM   998  C  CB  . PRO A 1 124 ? -1.343  -14.158 2.711   1.00 27.68 ? 124 PRO A CB  1 
ATOM   999  C  CG  . PRO A 1 124 ? -0.861  -14.993 3.894   1.00 26.43 ? 124 PRO A CG  1 
ATOM   1000 C  CD  . PRO A 1 124 ? -1.996  -14.947 4.857   1.00 27.87 ? 124 PRO A CD  1 
ATOM   1001 N  N   . GLY A 1 125 ? -3.121  -11.295 2.125   1.00 25.12 ? 125 GLY A N   1 
ATOM   1002 C  CA  . GLY A 1 125 ? -4.169  -10.724 1.321   1.00 26.30 ? 125 GLY A CA  1 
ATOM   1003 C  C   . GLY A 1 125 ? -5.032  -9.754  2.103   1.00 26.01 ? 125 GLY A C   1 
ATOM   1004 O  O   . GLY A 1 125 ? -5.671  -8.912  1.513   1.00 26.53 ? 125 GLY A O   1 
ATOM   1005 N  N   . THR A 1 126 ? -5.072  -9.920  3.417   1.00 26.11 ? 126 THR A N   1 
ATOM   1006 C  CA  . THR A 1 126 ? -5.820  -8.982  4.250   1.00 24.77 ? 126 THR A CA  1 
ATOM   1007 C  C   . THR A 1 126 ? -5.200  -7.593  4.120   1.00 24.29 ? 126 THR A C   1 
ATOM   1008 O  O   . THR A 1 126 ? -3.986  -7.418  4.268   1.00 23.21 ? 126 THR A O   1 
ATOM   1009 C  CB  . THR A 1 126 ? -5.792  -9.385  5.711   1.00 26.10 ? 126 THR A CB  1 
ATOM   1010 O  OG1 . THR A 1 126 ? -6.429  -10.660 5.907   1.00 25.52 ? 126 THR A OG1 1 
ATOM   1011 C  CG2 . THR A 1 126 ? -6.693  -8.400  6.509   1.00 25.53 ? 126 THR A CG2 1 
ATOM   1012 N  N   . VAL A 1 127 ? -6.052  -6.604  3.867   1.00 21.92 ? 127 VAL A N   1 
ATOM   1013 C  CA  . VAL A 1 127 ? -5.616  -5.233  3.905   1.00 22.35 ? 127 VAL A CA  1 
ATOM   1014 C  C   . VAL A 1 127 ? -6.344  -4.626  5.124   1.00 22.06 ? 127 VAL A C   1 
ATOM   1015 O  O   . VAL A 1 127 ? -7.557  -4.794  5.293   1.00 22.24 ? 127 VAL A O   1 
ATOM   1016 C  CB  . VAL A 1 127 ? -6.006  -4.490  2.637   1.00 21.93 ? 127 VAL A CB  1 
ATOM   1017 C  CG1 . VAL A 1 127 ? -5.824  -2.961  2.788   1.00 23.33 ? 127 VAL A CG1 1 
ATOM   1018 C  CG2 . VAL A 1 127 ? -5.226  -5.027  1.440   1.00 21.17 ? 127 VAL A CG2 1 
ATOM   1019 N  N   . VAL A 1 128 ? -5.608  -3.931  5.963   1.00 21.75 ? 128 VAL A N   1 
ATOM   1020 C  CA  . VAL A 1 128 ? -6.214  -3.330  7.141   1.00 21.99 ? 128 VAL A CA  1 
ATOM   1021 C  C   . VAL A 1 128 ? -6.099  -1.833  7.010   1.00 22.75 ? 128 VAL A C   1 
ATOM   1022 O  O   . VAL A 1 128 ? -5.012  -1.301  6.712   1.00 21.21 ? 128 VAL A O   1 
ATOM   1023 C  CB  . VAL A 1 128 ? -5.504  -3.738  8.430   1.00 20.97 ? 128 VAL A CB  1 
ATOM   1024 C  CG1 . VAL A 1 128 ? -6.165  -3.054  9.661   1.00 21.06 ? 128 VAL A CG1 1 
ATOM   1025 C  CG2 . VAL A 1 128 ? -5.392  -5.322  8.616   1.00 24.92 ? 128 VAL A CG2 1 
ATOM   1026 N  N   . TYR A 1 129 ? -7.228  -1.176  7.276   1.00 22.37 ? 129 TYR A N   1 
ATOM   1027 C  CA  . TYR A 1 129 ? -7.347  0.253   7.319   1.00 22.86 ? 129 TYR A CA  1 
ATOM   1028 C  C   . TYR A 1 129 ? -7.177  0.710   8.774   1.00 22.83 ? 129 TYR A C   1 
ATOM   1029 O  O   . TYR A 1 129 ? -7.939  0.319   9.667   1.00 23.43 ? 129 TYR A O   1 
ATOM   1030 C  CB  . TYR A 1 129 ? -8.719  0.655   6.740   1.00 23.02 ? 129 TYR A CB  1 
ATOM   1031 C  CG  . TYR A 1 129 ? -8.997  2.134   6.948   1.00 23.83 ? 129 TYR A CG  1 
ATOM   1032 C  CD1 . TYR A 1 129 ? -9.850  2.557   7.962   1.00 25.62 ? 129 TYR A CD1 1 
ATOM   1033 C  CD2 . TYR A 1 129 ? -8.343  3.092   6.182   1.00 24.22 ? 129 TYR A CD2 1 
ATOM   1034 C  CE1 . TYR A 1 129 ? -10.080 3.932   8.173   1.00 26.65 ? 129 TYR A CE1 1 
ATOM   1035 C  CE2 . TYR A 1 129 ? -8.564  4.448   6.386   1.00 24.02 ? 129 TYR A CE2 1 
ATOM   1036 C  CZ  . TYR A 1 129 ? -9.429  4.859   7.394   1.00 27.15 ? 129 TYR A CZ  1 
ATOM   1037 O  OH  . TYR A 1 129 ? -9.627  6.211   7.622   1.00 22.53 ? 129 TYR A OH  1 
ATOM   1038 N  N   . VAL A 1 130 ? -6.112  1.461   9.046   1.00 23.30 ? 130 VAL A N   1 
ATOM   1039 C  CA  . VAL A 1 130 ? -5.869  1.908   10.391  1.00 24.43 ? 130 VAL A CA  1 
ATOM   1040 C  C   . VAL A 1 130 ? -6.405  3.349   10.373  1.00 24.80 ? 130 VAL A C   1 
ATOM   1041 O  O   . VAL A 1 130 ? -5.851  4.193   9.697   1.00 25.22 ? 130 VAL A O   1 
ATOM   1042 C  CB  . VAL A 1 130 ? -4.368  1.879   10.732  1.00 23.36 ? 130 VAL A CB  1 
ATOM   1043 C  CG1 . VAL A 1 130 ? -4.163  2.293   12.181  1.00 24.42 ? 130 VAL A CG1 1 
ATOM   1044 C  CG2 . VAL A 1 130 ? -3.779  0.443   10.539  1.00 26.27 ? 130 VAL A CG2 1 
ATOM   1045 N  N   . PRO A 1 131 ? -7.511  3.625   11.033  1.00 25.91 ? 131 PRO A N   1 
ATOM   1046 C  CA  . PRO A 1 131 ? -8.081  4.970   10.913  1.00 27.19 ? 131 PRO A CA  1 
ATOM   1047 C  C   . PRO A 1 131 ? -7.268  6.022   11.653  1.00 27.73 ? 131 PRO A C   1 
ATOM   1048 O  O   . PRO A 1 131 ? -6.445  5.691   12.482  1.00 27.40 ? 131 PRO A O   1 
ATOM   1049 C  CB  . PRO A 1 131 ? -9.436  4.824   11.610  1.00 27.62 ? 131 PRO A CB  1 
ATOM   1050 C  CG  . PRO A 1 131 ? -9.707  3.395   11.659  1.00 25.00 ? 131 PRO A CG  1 
ATOM   1051 C  CD  . PRO A 1 131 ? -8.324  2.781   11.915  1.00 25.97 ? 131 PRO A CD  1 
ATOM   1052 N  N   . PRO A 1 132 ? -7.532  7.292   11.373  1.00 28.19 ? 132 PRO A N   1 
ATOM   1053 C  CA  . PRO A 1 132 ? -6.934  8.373   12.174  1.00 29.09 ? 132 PRO A CA  1 
ATOM   1054 C  C   . PRO A 1 132 ? -7.165  8.087   13.655  1.00 28.94 ? 132 PRO A C   1 
ATOM   1055 O  O   . PRO A 1 132 ? -8.200  7.526   14.037  1.00 28.85 ? 132 PRO A O   1 
ATOM   1056 C  CB  . PRO A 1 132 ? -7.776  9.594   11.797  1.00 27.77 ? 132 PRO A CB  1 
ATOM   1057 C  CG  . PRO A 1 132 ? -8.232  9.316   10.426  1.00 30.23 ? 132 PRO A CG  1 
ATOM   1058 C  CD  . PRO A 1 132 ? -8.399  7.795   10.304  1.00 28.57 ? 132 PRO A CD  1 
ATOM   1059 N  N   . TYR A 1 133 ? -6.194  8.469   14.475  1.00 29.11 ? 133 TYR A N   1 
ATOM   1060 C  CA  . TYR A 1 133 ? -6.274  8.373   15.933  1.00 30.95 ? 133 TYR A CA  1 
ATOM   1061 C  C   . TYR A 1 133 ? -6.115  7.024   16.587  1.00 30.38 ? 133 TYR A C   1 
ATOM   1062 O  O   . TYR A 1 133 ? -6.197  6.935   17.802  1.00 31.27 ? 133 TYR A O   1 
ATOM   1063 C  CB  . TYR A 1 133 ? -7.545  9.061   16.499  1.00 30.99 ? 133 TYR A CB  1 
ATOM   1064 C  CG  . TYR A 1 133 ? -7.708  10.515  16.117  1.00 34.83 ? 133 TYR A CG  1 
ATOM   1065 C  CD1 . TYR A 1 133 ? -6.927  11.501  16.709  1.00 38.82 ? 133 TYR A CD1 1 
ATOM   1066 C  CD2 . TYR A 1 133 ? -8.656  10.912  15.182  1.00 37.26 ? 133 TYR A CD2 1 
ATOM   1067 C  CE1 . TYR A 1 133 ? -7.085  12.850  16.382  1.00 39.83 ? 133 TYR A CE1 1 
ATOM   1068 C  CE2 . TYR A 1 133 ? -8.812  12.264  14.835  1.00 40.47 ? 133 TYR A CE2 1 
ATOM   1069 C  CZ  . TYR A 1 133 ? -8.021  13.228  15.447  1.00 40.37 ? 133 TYR A CZ  1 
ATOM   1070 O  OH  . TYR A 1 133 ? -8.164  14.570  15.104  1.00 39.77 ? 133 TYR A OH  1 
ATOM   1071 N  N   . TRP A 1 134 ? -5.871  5.959   15.823  1.00 29.49 ? 134 TRP A N   1 
ATOM   1072 C  CA  . TRP A 1 134 ? -5.712  4.668   16.473  1.00 28.75 ? 134 TRP A CA  1 
ATOM   1073 C  C   . TRP A 1 134 ? -4.231  4.224   16.551  1.00 28.84 ? 134 TRP A C   1 
ATOM   1074 O  O   . TRP A 1 134 ? -3.517  4.194   15.523  1.00 29.77 ? 134 TRP A O   1 
ATOM   1075 C  CB  . TRP A 1 134 ? -6.526  3.571   15.772  1.00 27.59 ? 134 TRP A CB  1 
ATOM   1076 C  CG  . TRP A 1 134 ? -8.052  3.647   15.837  1.00 28.12 ? 134 TRP A CG  1 
ATOM   1077 C  CD1 . TRP A 1 134 ? -8.848  4.451   15.104  1.00 27.44 ? 134 TRP A CD1 1 
ATOM   1078 C  CD2 . TRP A 1 134 ? -8.937  2.815   16.610  1.00 30.00 ? 134 TRP A CD2 1 
ATOM   1079 N  NE1 . TRP A 1 134 ? -10.174 4.186   15.363  1.00 26.98 ? 134 TRP A NE1 1 
ATOM   1080 C  CE2 . TRP A 1 134 ? -10.254 3.209   16.310  1.00 27.76 ? 134 TRP A CE2 1 
ATOM   1081 C  CE3 . TRP A 1 134 ? -8.747  1.792   17.539  1.00 29.39 ? 134 TRP A CE3 1 
ATOM   1082 C  CZ2 . TRP A 1 134 ? -11.368 2.605   16.878  1.00 29.10 ? 134 TRP A CZ2 1 
ATOM   1083 C  CZ3 . TRP A 1 134 ? -9.857  1.198   18.119  1.00 31.69 ? 134 TRP A CZ3 1 
ATOM   1084 C  CH2 . TRP A 1 134 ? -11.154 1.614   17.790  1.00 29.52 ? 134 TRP A CH2 1 
ATOM   1085 N  N   . ALA A 1 135 ? -3.798  3.842   17.744  1.00 28.92 ? 135 ALA A N   1 
ATOM   1086 C  CA  . ALA A 1 135 ? -2.457  3.302   17.935  1.00 28.77 ? 135 ALA A CA  1 
ATOM   1087 C  C   . ALA A 1 135 ? -2.573  1.889   17.418  1.00 28.50 ? 135 ALA A C   1 
ATOM   1088 O  O   . ALA A 1 135 ? -3.660  1.309   17.433  1.00 26.93 ? 135 ALA A O   1 
ATOM   1089 C  CB  . ALA A 1 135 ? -2.080  3.274   19.389  1.00 29.75 ? 135 ALA A CB  1 
ATOM   1090 N  N   . HIS A 1 136 ? -1.456  1.325   16.993  1.00 29.10 ? 136 HIS A N   1 
ATOM   1091 C  CA  . HIS A 1 136 ? -1.527  -0.012  16.418  1.00 28.46 ? 136 HIS A CA  1 
ATOM   1092 C  C   . HIS A 1 136 ? -0.251  -0.795  16.660  1.00 28.28 ? 136 HIS A C   1 
ATOM   1093 O  O   . HIS A 1 136 ? 0.854   -0.242  16.648  1.00 27.76 ? 136 HIS A O   1 
ATOM   1094 C  CB  . HIS A 1 136 ? -1.821  0.082   14.923  1.00 28.78 ? 136 HIS A CB  1 
ATOM   1095 C  CG  . HIS A 1 136 ? -1.011  1.113   14.197  1.00 29.63 ? 136 HIS A CG  1 
ATOM   1096 N  ND1 . HIS A 1 136 ? -1.336  2.453   14.196  1.00 30.74 ? 136 HIS A ND1 1 
ATOM   1097 C  CD2 . HIS A 1 136 ? 0.096   0.996   13.429  1.00 30.19 ? 136 HIS A CD2 1 
ATOM   1098 C  CE1 . HIS A 1 136 ? -0.459  3.114   13.466  1.00 33.10 ? 136 HIS A CE1 1 
ATOM   1099 N  NE2 . HIS A 1 136 ? 0.408   2.249   12.972  1.00 35.40 ? 136 HIS A NE2 1 
ATOM   1100 N  N   . ARG A 1 137 ? -0.435  -2.098  16.836  1.00 27.10 ? 137 ARG A N   1 
ATOM   1101 C  CA  . ARG A 1 137 ? 0.637   -3.023  17.104  1.00 26.33 ? 137 ARG A CA  1 
ATOM   1102 C  C   . ARG A 1 137 ? 0.256   -4.266  16.343  1.00 26.57 ? 137 ARG A C   1 
ATOM   1103 O  O   . ARG A 1 137 ? -0.912  -4.605  16.305  1.00 26.54 ? 137 ARG A O   1 
ATOM   1104 C  CB  . ARG A 1 137 ? 0.648   -3.312  18.610  1.00 26.30 ? 137 ARG A CB  1 
ATOM   1105 C  CG  . ARG A 1 137 ? 1.301   -4.637  19.059  1.00 24.66 ? 137 ARG A CG  1 
ATOM   1106 C  CD  . ARG A 1 137 ? 1.320   -4.831  20.605  1.00 26.87 ? 137 ARG A CD  1 
ATOM   1107 N  NE  . ARG A 1 137 ? 2.227   -3.855  21.232  1.00 26.83 ? 137 ARG A NE  1 
ATOM   1108 C  CZ  . ARG A 1 137 ? 2.327   -3.655  22.533  1.00 25.91 ? 137 ARG A CZ  1 
ATOM   1109 N  NH1 . ARG A 1 137 ? 1.546   -4.306  23.375  1.00 28.86 ? 137 ARG A NH1 1 
ATOM   1110 N  NH2 . ARG A 1 137 ? 3.206   -2.769  22.991  1.00 29.30 ? 137 ARG A NH2 1 
ATOM   1111 N  N   . THR A 1 138 ? 1.215   -4.943  15.722  1.00 26.58 ? 138 THR A N   1 
ATOM   1112 C  CA  . THR A 1 138 ? 0.881   -6.231  15.077  1.00 26.77 ? 138 THR A CA  1 
ATOM   1113 C  C   . THR A 1 138 ? 1.461   -7.336  15.899  1.00 25.91 ? 138 THR A C   1 
ATOM   1114 O  O   . THR A 1 138 ? 2.443   -7.146  16.587  1.00 25.89 ? 138 THR A O   1 
ATOM   1115 C  CB  . THR A 1 138 ? 1.396   -6.304  13.650  1.00 26.80 ? 138 THR A CB  1 
ATOM   1116 O  OG1 . THR A 1 138 ? 2.659   -5.623  13.564  1.00 27.92 ? 138 THR A OG1 1 
ATOM   1117 C  CG2 . THR A 1 138 ? 0.475   -5.517  12.751  1.00 28.04 ? 138 THR A CG2 1 
ATOM   1118 N  N   . VAL A 1 139 ? 0.900   -8.526  15.752  1.00 26.32 ? 139 VAL A N   1 
ATOM   1119 C  CA  . VAL A 1 139 ? 1.217   -9.617  16.610  1.00 26.02 ? 139 VAL A CA  1 
ATOM   1120 C  C   . VAL A 1 139 ? 1.248   -10.821 15.724  1.00 25.88 ? 139 VAL A C   1 
ATOM   1121 O  O   . VAL A 1 139 ? 0.385   -10.971 14.873  1.00 25.76 ? 139 VAL A O   1 
ATOM   1122 C  CB  . VAL A 1 139 ? 0.068   -9.846  17.592  1.00 26.45 ? 139 VAL A CB  1 
ATOM   1123 C  CG1 . VAL A 1 139 ? 0.343   -11.023 18.503  1.00 26.13 ? 139 VAL A CG1 1 
ATOM   1124 C  CG2 . VAL A 1 139 ? -0.214  -8.597  18.417  1.00 25.66 ? 139 VAL A CG2 1 
ATOM   1125 N  N   . ASN A 1 140 ? 2.244   -11.659 15.934  1.00 26.30 ? 140 ASN A N   1 
ATOM   1126 C  CA  . ASN A 1 140 ? 2.425   -12.870 15.145  1.00 27.43 ? 140 ASN A CA  1 
ATOM   1127 C  C   . ASN A 1 140 ? 1.858   -14.012 15.968  1.00 27.50 ? 140 ASN A C   1 
ATOM   1128 O  O   . ASN A 1 140 ? 2.409   -14.359 17.030  1.00 26.85 ? 140 ASN A O   1 
ATOM   1129 C  CB  . ASN A 1 140 ? 3.924   -13.096 14.855  1.00 26.96 ? 140 ASN A CB  1 
ATOM   1130 C  CG  . ASN A 1 140 ? 4.174   -14.340 13.974  1.00 29.95 ? 140 ASN A CG  1 
ATOM   1131 O  OD1 . ASN A 1 140 ? 3.305   -15.204 13.867  1.00 28.13 ? 140 ASN A OD1 1 
ATOM   1132 N  ND2 . ASN A 1 140 ? 5.338   -14.406 13.327  1.00 26.19 ? 140 ASN A ND2 1 
ATOM   1133 N  N   . ILE A 1 141 ? 0.738   -14.570 15.521  1.00 28.78 ? 141 ILE A N   1 
ATOM   1134 C  CA  . ILE A 1 141 ? 0.097   -15.613 16.296  1.00 30.81 ? 141 ILE A CA  1 
ATOM   1135 C  C   . ILE A 1 141 ? 0.381   -16.984 15.719  1.00 31.72 ? 141 ILE A C   1 
ATOM   1136 O  O   . ILE A 1 141 ? -0.271  -17.949 16.098  1.00 31.78 ? 141 ILE A O   1 
ATOM   1137 C  CB  . ILE A 1 141 ? -1.417  -15.391 16.359  1.00 30.94 ? 141 ILE A CB  1 
ATOM   1138 C  CG1 . ILE A 1 141 ? -2.002  -15.503 14.965  1.00 32.34 ? 141 ILE A CG1 1 
ATOM   1139 C  CG2 . ILE A 1 141 ? -1.740  -14.012 17.012  1.00 31.62 ? 141 ILE A CG2 1 
ATOM   1140 C  CD1 . ILE A 1 141 ? -3.520  -15.584 14.951  1.00 34.06 ? 141 ILE A CD1 1 
ATOM   1141 N  N   . GLY A 1 142 ? 1.347   -17.076 14.807  1.00 32.09 ? 142 GLY A N   1 
ATOM   1142 C  CA  . GLY A 1 142 ? 1.640   -18.367 14.200  1.00 33.61 ? 142 GLY A CA  1 
ATOM   1143 C  C   . GLY A 1 142 ? 3.070   -18.846 14.399  1.00 34.77 ? 142 GLY A C   1 
ATOM   1144 O  O   . GLY A 1 142 ? 3.809   -18.349 15.275  1.00 33.56 ? 142 GLY A O   1 
ATOM   1145 N  N   . ASP A 1 143 ? 3.463   -19.800 13.552  1.00 35.84 ? 143 ASP A N   1 
ATOM   1146 C  CA  . ASP A 1 143 ? 4.735   -20.484 13.707  1.00 37.37 ? 143 ASP A CA  1 
ATOM   1147 C  C   . ASP A 1 143 ? 5.810   -20.002 12.739  1.00 37.45 ? 143 ASP A C   1 
ATOM   1148 O  O   . ASP A 1 143 ? 6.979   -20.404 12.847  1.00 37.43 ? 143 ASP A O   1 
ATOM   1149 C  CB  . ASP A 1 143 ? 4.509   -21.994 13.528  1.00 39.01 ? 143 ASP A CB  1 
ATOM   1150 C  CG  . ASP A 1 143 ? 3.641   -22.587 14.629  1.00 42.26 ? 143 ASP A CG  1 
ATOM   1151 O  OD1 . ASP A 1 143 ? 3.889   -22.254 15.816  1.00 43.79 ? 143 ASP A OD1 1 
ATOM   1152 O  OD2 . ASP A 1 143 ? 2.703   -23.398 14.410  1.00 44.97 ? 143 ASP A OD2 1 
ATOM   1153 N  N   . GLU A 1 144 ? 5.420   -19.139 11.804  1.00 36.52 ? 144 GLU A N   1 
ATOM   1154 C  CA  . GLU A 1 144 ? 6.349   -18.600 10.814  1.00 36.98 ? 144 GLU A CA  1 
ATOM   1155 C  C   . GLU A 1 144 ? 6.332   -17.071 10.849  1.00 35.06 ? 144 GLU A C   1 
ATOM   1156 O  O   . GLU A 1 144 ? 5.528   -16.467 11.549  1.00 34.68 ? 144 GLU A O   1 
ATOM   1157 C  CB  . GLU A 1 144 ? 6.014   -19.085 9.405   1.00 36.91 ? 144 GLU A CB  1 
ATOM   1158 C  CG  . GLU A 1 144 ? 5.961   -20.605 9.256   1.00 43.12 ? 144 GLU A CG  1 
ATOM   1159 C  CD  . GLU A 1 144 ? 7.326   -21.256 9.065   1.00 49.68 ? 144 GLU A CD  1 
ATOM   1160 O  OE1 . GLU A 1 144 ? 8.234   -21.034 9.905   1.00 49.81 ? 144 GLU A OE1 1 
ATOM   1161 O  OE2 . GLU A 1 144 ? 7.477   -22.018 8.073   1.00 53.26 ? 144 GLU A OE2 1 
ATOM   1162 N  N   . PRO A 1 145 ? 7.236   -16.451 10.113  1.00 34.36 ? 145 PRO A N   1 
ATOM   1163 C  CA  . PRO A 1 145 ? 7.253   -14.996 10.059  1.00 32.86 ? 145 PRO A CA  1 
ATOM   1164 C  C   . PRO A 1 145 ? 5.943   -14.408 9.520   1.00 31.63 ? 145 PRO A C   1 
ATOM   1165 O  O   . PRO A 1 145 ? 5.291   -14.945 8.633   1.00 30.25 ? 145 PRO A O   1 
ATOM   1166 C  CB  . PRO A 1 145 ? 8.444   -14.701 9.145   1.00 33.29 ? 145 PRO A CB  1 
ATOM   1167 C  CG  . PRO A 1 145 ? 9.350   -15.919 9.377   1.00 33.42 ? 145 PRO A CG  1 
ATOM   1168 C  CD  . PRO A 1 145 ? 8.338   -17.052 9.325   1.00 34.01 ? 145 PRO A CD  1 
ATOM   1169 N  N   . PHE A 1 146 ? 5.562   -13.279 10.109  1.00 29.85 ? 146 PHE A N   1 
ATOM   1170 C  CA  . PHE A 1 146 ? 4.361   -12.570 9.726   1.00 28.95 ? 146 PHE A CA  1 
ATOM   1171 C  C   . PHE A 1 146 ? 4.913   -11.343 9.016   1.00 28.05 ? 146 PHE A C   1 
ATOM   1172 O  O   . PHE A 1 146 ? 5.654   -10.562 9.602   1.00 26.73 ? 146 PHE A O   1 
ATOM   1173 C  CB  . PHE A 1 146 ? 3.557   -12.184 10.981  1.00 28.79 ? 146 PHE A CB  1 
ATOM   1174 C  CG  . PHE A 1 146 ? 2.340   -11.375 10.671  1.00 30.23 ? 146 PHE A CG  1 
ATOM   1175 C  CD1 . PHE A 1 146 ? 1.414   -11.835 9.743   1.00 29.49 ? 146 PHE A CD1 1 
ATOM   1176 C  CD2 . PHE A 1 146 ? 2.113   -10.164 11.301  1.00 31.32 ? 146 PHE A CD2 1 
ATOM   1177 C  CE1 . PHE A 1 146 ? 0.308   -11.095 9.428   1.00 33.26 ? 146 PHE A CE1 1 
ATOM   1178 C  CE2 . PHE A 1 146 ? 0.971   -9.419  11.006  1.00 32.20 ? 146 PHE A CE2 1 
ATOM   1179 C  CZ  . PHE A 1 146 ? 0.076   -9.890  10.071  1.00 31.67 ? 146 PHE A CZ  1 
ATOM   1180 N  N   . ILE A 1 147 ? 4.592   -11.215 7.738   1.00 27.61 ? 147 ILE A N   1 
ATOM   1181 C  CA  . ILE A 1 147 ? 5.185   -10.196 6.905   1.00 27.40 ? 147 ILE A CA  1 
ATOM   1182 C  C   . ILE A 1 147 ? 4.068   -9.379  6.317   1.00 26.25 ? 147 ILE A C   1 
ATOM   1183 O  O   . ILE A 1 147 ? 3.076   -9.901  5.781   1.00 25.36 ? 147 ILE A O   1 
ATOM   1184 C  CB  . ILE A 1 147 ? 6.022   -10.859 5.787   1.00 27.47 ? 147 ILE A CB  1 
ATOM   1185 C  CG1 . ILE A 1 147 ? 7.184   -11.683 6.363   1.00 29.23 ? 147 ILE A CG1 1 
ATOM   1186 C  CG2 . ILE A 1 147 ? 6.584   -9.848  4.845   1.00 28.15 ? 147 ILE A CG2 1 
ATOM   1187 C  CD1 . ILE A 1 147 ? 7.932   -12.486 5.236   1.00 25.87 ? 147 ILE A CD1 1 
ATOM   1188 N  N   . PHE A 1 148 ? 4.224   -8.075  6.424   1.00 26.16 ? 148 PHE A N   1 
ATOM   1189 C  CA  . PHE A 1 148 ? 3.248   -7.162  5.870   1.00 24.36 ? 148 PHE A CA  1 
ATOM   1190 C  C   . PHE A 1 148 ? 3.914   -5.912  5.300   1.00 23.65 ? 148 PHE A C   1 
ATOM   1191 O  O   . PHE A 1 148 ? 5.073   -5.611  5.607   1.00 24.36 ? 148 PHE A O   1 
ATOM   1192 C  CB  . PHE A 1 148 ? 2.215   -6.799  6.949   1.00 24.51 ? 148 PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1 148 ? 2.807   -6.230  8.212   1.00 24.27 ? 148 PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1 148 ? 3.067   -7.046  9.317   1.00 24.40 ? 148 PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1 148 ? 3.117   -4.879  8.290   1.00 26.29 ? 148 PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1 148 ? 3.570   -6.519  10.497  1.00 24.75 ? 148 PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1 148 ? 3.657   -4.341  9.461   1.00 25.89 ? 148 PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1 148 ? 3.881   -5.136  10.572  1.00 23.31 ? 148 PHE A CZ  1 
ATOM   1199 N  N   . LEU A 1 149 ? 3.170   -5.181  4.488   1.00 24.02 ? 149 LEU A N   1 
ATOM   1200 C  CA  . LEU A 1 149 ? 3.634   -3.906  3.952   1.00 23.80 ? 149 LEU A CA  1 
ATOM   1201 C  C   . LEU A 1 149 ? 2.723   -2.817  4.518   1.00 23.93 ? 149 LEU A C   1 
ATOM   1202 O  O   . LEU A 1 149 ? 1.518   -2.986  4.553   1.00 24.06 ? 149 LEU A O   1 
ATOM   1203 C  CB  . LEU A 1 149 ? 3.588   -3.891  2.435   1.00 24.21 ? 149 LEU A CB  1 
ATOM   1204 C  CG  . LEU A 1 149 ? 3.758   -2.540  1.696   1.00 22.32 ? 149 LEU A CG  1 
ATOM   1205 C  CD1 . LEU A 1 149 ? 5.173   -1.977  1.846   1.00 20.72 ? 149 LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A 1 149 ? 3.407   -2.577  0.177   1.00 24.55 ? 149 LEU A CD2 1 
ATOM   1207 N  N   . ALA A 1 150 ? 3.304   -1.723  4.964   1.00 23.28 ? 150 ALA A N   1 
ATOM   1208 C  CA  . ALA A 1 150 ? 2.523   -0.609  5.503   1.00 24.48 ? 150 ALA A CA  1 
ATOM   1209 C  C   . ALA A 1 150 ? 2.797   0.607   4.650   1.00 24.51 ? 150 ALA A C   1 
ATOM   1210 O  O   . ALA A 1 150 ? 3.931   0.820   4.222   1.00 24.24 ? 150 ALA A O   1 
ATOM   1211 C  CB  . ALA A 1 150 ? 2.865   -0.347  6.941   1.00 24.23 ? 150 ALA A CB  1 
ATOM   1212 N  N   . ILE A 1 151 ? 1.762   1.402   4.396   1.00 25.38 ? 151 ILE A N   1 
ATOM   1213 C  CA  . ILE A 1 151 ? 1.894   2.645   3.646   1.00 26.50 ? 151 ILE A CA  1 
ATOM   1214 C  C   . ILE A 1 151 ? 1.322   3.692   4.577   1.00 26.50 ? 151 ILE A C   1 
ATOM   1215 O  O   . ILE A 1 151 ? 0.202   3.543   5.058   1.00 26.71 ? 151 ILE A O   1 
ATOM   1216 C  CB  . ILE A 1 151 ? 1.130   2.651   2.280   1.00 27.11 ? 151 ILE A CB  1 
ATOM   1217 C  CG1 . ILE A 1 151 ? 1.697   1.639   1.286   1.00 27.50 ? 151 ILE A CG1 1 
ATOM   1218 C  CG2 . ILE A 1 151 ? 1.251   4.007   1.581   1.00 26.85 ? 151 ILE A CG2 1 
ATOM   1219 C  CD1 . ILE A 1 151 ? 1.074   0.289   1.433   1.00 31.17 ? 151 ILE A CD1 1 
ATOM   1220 N  N   . TYR A 1 152 ? 2.110   4.725   4.869   1.00 26.27 ? 152 TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 152 ? 1.722   5.755   5.851   1.00 27.33 ? 152 TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 152 ? 2.087   7.161   5.382   1.00 26.92 ? 152 TYR A C   1 
ATOM   1223 O  O   . TYR A 1 152 ? 3.054   7.352   4.662   1.00 27.40 ? 152 TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 152 ? 2.339   5.448   7.252   1.00 27.83 ? 152 TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 152 ? 3.841   5.133   7.288   1.00 31.20 ? 152 TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 152 ? 4.337   3.945   6.758   1.00 33.50 ? 152 TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 152 ? 4.755   6.019   7.851   1.00 32.08 ? 152 TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 152 ? 5.690   3.650   6.766   1.00 34.57 ? 152 TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 152 ? 6.131   5.737   7.878   1.00 33.51 ? 152 TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 152 ? 6.580   4.535   7.326   1.00 35.91 ? 152 TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 152 ? 7.909   4.201   7.321   1.00 37.59 ? 152 TYR A OH  1 
ATOM   1232 N  N   . PRO A 1 153 ? 1.298   8.174   5.732   1.00 26.99 ? 153 PRO A N   1 
ATOM   1233 C  CA  . PRO A 1 153 ? 1.678   9.538   5.348   1.00 26.78 ? 153 PRO A CA  1 
ATOM   1234 C  C   . PRO A 1 153 ? 3.078   9.887   5.845   1.00 26.37 ? 153 PRO A C   1 
ATOM   1235 O  O   . PRO A 1 153 ? 3.402   9.613   6.984   1.00 27.88 ? 153 PRO A O   1 
ATOM   1236 C  CB  . PRO A 1 153 ? 0.622   10.400  6.053   1.00 26.49 ? 153 PRO A CB  1 
ATOM   1237 C  CG  . PRO A 1 153 ? -0.569  9.490   6.076   1.00 26.43 ? 153 PRO A CG  1 
ATOM   1238 C  CD  . PRO A 1 153 ? 0.031   8.137   6.468   1.00 26.80 ? 153 PRO A CD  1 
ATOM   1239 N  N   . ALA A 1 154 ? 3.882   10.463  4.969   1.00 26.76 ? 154 ALA A N   1 
ATOM   1240 C  CA  . ALA A 1 154 ? 5.262   10.865  5.252   1.00 27.67 ? 154 ALA A CA  1 
ATOM   1241 C  C   . ALA A 1 154 ? 5.390   11.721  6.509   1.00 29.07 ? 154 ALA A C   1 
ATOM   1242 O  O   . ALA A 1 154 ? 6.454   11.790  7.116   1.00 28.79 ? 154 ALA A O   1 
ATOM   1243 C  CB  . ALA A 1 154 ? 5.814   11.640  4.075   1.00 26.01 ? 154 ALA A CB  1 
ATOM   1244 N  N   . ASP A 1 155 ? 4.307   12.375  6.897   1.00 29.87 ? 155 ASP A N   1 
ATOM   1245 C  CA  . ASP A 1 155 ? 4.384   13.283  8.032   1.00 31.79 ? 155 ASP A CA  1 
ATOM   1246 C  C   . ASP A 1 155 ? 3.683   12.746  9.280   1.00 32.12 ? 155 ASP A C   1 
ATOM   1247 O  O   . ASP A 1 155 ? 3.493   13.450  10.263  1.00 31.22 ? 155 ASP A O   1 
ATOM   1248 C  CB  . ASP A 1 155 ? 3.880   14.675  7.611   1.00 31.19 ? 155 ASP A CB  1 
ATOM   1249 C  CG  . ASP A 1 155 ? 2.417   14.692  7.322   1.00 33.35 ? 155 ASP A CG  1 
ATOM   1250 O  OD1 . ASP A 1 155 ? 1.814   13.597  7.170   1.00 30.82 ? 155 ASP A OD1 1 
ATOM   1251 O  OD2 . ASP A 1 155 ? 1.772   15.756  7.235   1.00 31.68 ? 155 ASP A OD2 1 
ATOM   1252 N  N   . ALA A 1 156 ? 3.360   11.456  9.257   1.00 32.25 ? 156 ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 156 ? 2.667   10.820  10.372  1.00 33.27 ? 156 ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 156 ? 3.539   10.717  11.617  1.00 33.77 ? 156 ALA A C   1 
ATOM   1255 O  O   . ALA A 1 156 ? 3.062   10.920  12.754  1.00 33.98 ? 156 ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 156 ? 2.155   9.417   9.967   1.00 32.84 ? 156 ALA A CB  1 
ATOM   1257 N  N   . GLY A 1 157 ? 4.804   10.384  11.395  1.00 34.63 ? 157 GLY A N   1 
ATOM   1258 C  CA  . GLY A 1 157 ? 5.774   10.255  12.449  1.00 36.43 ? 157 GLY A CA  1 
ATOM   1259 C  C   . GLY A 1 157 ? 5.325   9.154   13.374  1.00 37.99 ? 157 GLY A C   1 
ATOM   1260 O  O   . GLY A 1 157 ? 4.289   8.529   13.130  1.00 39.21 ? 157 GLY A O   1 
ATOM   1261 N  N   . HIS A 1 158 ? 6.073   8.912   14.442  1.00 38.78 ? 158 HIS A N   1 
ATOM   1262 C  CA  . HIS A 1 158 ? 5.681   7.868   15.365  1.00 39.91 ? 158 HIS A CA  1 
ATOM   1263 C  C   . HIS A 1 158 ? 5.754   8.297   16.840  1.00 41.05 ? 158 HIS A C   1 
ATOM   1264 O  O   . HIS A 1 158 ? 6.797   8.737   17.316  1.00 41.53 ? 158 HIS A O   1 
ATOM   1265 C  CB  . HIS A 1 158 ? 6.545   6.615   15.157  1.00 39.15 ? 158 HIS A CB  1 
ATOM   1266 C  CG  . HIS A 1 158 ? 6.644   6.150   13.731  1.00 41.12 ? 158 HIS A CG  1 
ATOM   1267 N  ND1 . HIS A 1 158 ? 7.553   6.667   12.831  1.00 40.14 ? 158 HIS A ND1 1 
ATOM   1268 C  CD2 . HIS A 1 158 ? 5.974   5.177   13.067  1.00 41.06 ? 158 HIS A CD2 1 
ATOM   1269 C  CE1 . HIS A 1 158 ? 7.425   6.049   11.669  1.00 42.78 ? 158 HIS A CE1 1 
ATOM   1270 N  NE2 . HIS A 1 158 ? 6.469   5.143   11.785  1.00 42.85 ? 158 HIS A NE2 1 
ATOM   1271 N  N   . ASP A 1 159 ? 4.650   8.124   17.561  1.00 41.40 ? 159 ASP A N   1 
ATOM   1272 C  CA  . ASP A 1 159 ? 4.598   8.360   18.997  1.00 42.21 ? 159 ASP A CA  1 
ATOM   1273 C  C   . ASP A 1 159 ? 4.610   6.987   19.721  1.00 42.11 ? 159 ASP A C   1 
ATOM   1274 O  O   . ASP A 1 159 ? 3.577   6.333   19.817  1.00 41.14 ? 159 ASP A O   1 
ATOM   1275 C  CB  . ASP A 1 159 ? 3.330   9.146   19.327  1.00 42.57 ? 159 ASP A CB  1 
ATOM   1276 C  CG  . ASP A 1 159 ? 3.175   9.446   20.813  1.00 45.06 ? 159 ASP A CG  1 
ATOM   1277 O  OD1 . ASP A 1 159 ? 4.084   9.102   21.603  1.00 47.29 ? 159 ASP A OD1 1 
ATOM   1278 O  OD2 . ASP A 1 159 ? 2.154   10.020  21.276  1.00 47.08 ? 159 ASP A OD2 1 
ATOM   1279 N  N   . TYR A 1 160 ? 5.785   6.579   20.215  1.00 42.46 ? 160 TYR A N   1 
ATOM   1280 C  CA  . TYR A 1 160 ? 5.995   5.299   20.928  1.00 43.01 ? 160 TYR A CA  1 
ATOM   1281 C  C   . TYR A 1 160 ? 5.882   5.395   22.452  1.00 43.57 ? 160 TYR A C   1 
ATOM   1282 O  O   . TYR A 1 160 ? 5.670   4.378   23.131  1.00 43.39 ? 160 TYR A O   1 
ATOM   1283 C  CB  . TYR A 1 160 ? 7.399   4.733   20.631  1.00 42.61 ? 160 TYR A CB  1 
ATOM   1284 C  CG  . TYR A 1 160 ? 7.627   4.259   19.207  1.00 42.73 ? 160 TYR A CG  1 
ATOM   1285 C  CD1 . TYR A 1 160 ? 8.351   5.024   18.303  1.00 42.49 ? 160 TYR A CD1 1 
ATOM   1286 C  CD2 . TYR A 1 160 ? 7.126   3.037   18.772  1.00 41.37 ? 160 TYR A CD2 1 
ATOM   1287 C  CE1 . TYR A 1 160 ? 8.556   4.585   16.987  1.00 43.91 ? 160 TYR A CE1 1 
ATOM   1288 C  CE2 . TYR A 1 160 ? 7.325   2.596   17.474  1.00 41.65 ? 160 TYR A CE2 1 
ATOM   1289 C  CZ  . TYR A 1 160 ? 8.034   3.373   16.581  1.00 42.56 ? 160 TYR A CZ  1 
ATOM   1290 O  OH  . TYR A 1 160 ? 8.237   2.939   15.285  1.00 42.29 ? 160 TYR A OH  1 
ATOM   1291 N  N   . GLY A 1 161 ? 6.060   6.601   22.986  1.00 44.23 ? 161 GLY A N   1 
ATOM   1292 C  CA  . GLY A 1 161 ? 6.116   6.831   24.426  1.00 44.84 ? 161 GLY A CA  1 
ATOM   1293 C  C   . GLY A 1 161 ? 4.937   6.420   25.291  1.00 46.05 ? 161 GLY A C   1 
ATOM   1294 O  O   . GLY A 1 161 ? 5.100   5.771   26.326  1.00 46.11 ? 161 GLY A O   1 
ATOM   1295 N  N   . THR A 1 162 ? 3.744   6.825   24.877  1.00 46.98 ? 162 THR A N   1 
ATOM   1296 C  CA  . THR A 1 162 ? 2.507   6.496   25.570  1.00 47.54 ? 162 THR A CA  1 
ATOM   1297 C  C   . THR A 1 162 ? 2.235   4.981   25.673  1.00 47.46 ? 162 THR A C   1 
ATOM   1298 O  O   . THR A 1 162 ? 1.722   4.491   26.685  1.00 47.46 ? 162 THR A O   1 
ATOM   1299 C  CB  . THR A 1 162 ? 1.367   7.191   24.839  1.00 47.71 ? 162 THR A CB  1 
ATOM   1300 O  OG1 . THR A 1 162 ? 1.491   8.608   25.040  1.00 49.64 ? 162 THR A OG1 1 
ATOM   1301 C  CG2 . THR A 1 162 ? 0.030   6.842   25.480  1.00 47.94 ? 162 THR A CG2 1 
ATOM   1302 N  N   . ILE A 1 163 ? 2.574   4.250   24.618  1.00 47.29 ? 163 ILE A N   1 
ATOM   1303 C  CA  . ILE A 1 163 ? 2.440   2.792   24.599  1.00 46.74 ? 163 ILE A CA  1 
ATOM   1304 C  C   . ILE A 1 163 ? 3.559   2.145   25.428  1.00 46.98 ? 163 ILE A C   1 
ATOM   1305 O  O   . ILE A 1 163 ? 3.348   1.158   26.136  1.00 46.60 ? 163 ILE A O   1 
ATOM   1306 C  CB  . ILE A 1 163 ? 2.504   2.296   23.126  1.00 46.59 ? 163 ILE A CB  1 
ATOM   1307 C  CG1 . ILE A 1 163 ? 1.281   2.778   22.334  1.00 46.89 ? 163 ILE A CG1 1 
ATOM   1308 C  CG2 . ILE A 1 163 ? 2.673   0.797   23.055  1.00 45.78 ? 163 ILE A CG2 1 
ATOM   1309 C  CD1 . ILE A 1 163 ? -0.045  2.566   23.041  1.00 46.77 ? 163 ILE A CD1 1 
ATOM   1310 N  N   . ALA A 1 164 ? 4.762   2.704   25.330  1.00 47.33 ? 164 ALA A N   1 
ATOM   1311 C  CA  . ALA A 1 164 ? 5.929   2.179   26.049  1.00 47.50 ? 164 ALA A CA  1 
ATOM   1312 C  C   . ALA A 1 164 ? 5.680   2.123   27.546  1.00 47.84 ? 164 ALA A C   1 
ATOM   1313 O  O   . ALA A 1 164 ? 6.125   1.197   28.223  1.00 48.01 ? 164 ALA A O   1 
ATOM   1314 C  CB  . ALA A 1 164 ? 7.154   3.049   25.767  1.00 47.20 ? 164 ALA A CB  1 
ATOM   1315 N  N   . GLU A 1 165 ? 4.966   3.125   28.054  1.00 48.16 ? 165 GLU A N   1 
ATOM   1316 C  CA  . GLU A 1 165 ? 4.681   3.225   29.478  1.00 48.77 ? 165 GLU A CA  1 
ATOM   1317 C  C   . GLU A 1 165 ? 3.512   2.346   29.970  1.00 48.47 ? 165 GLU A C   1 
ATOM   1318 O  O   . GLU A 1 165 ? 3.675   1.578   30.933  1.00 48.73 ? 165 GLU A O   1 
ATOM   1319 C  CB  . GLU A 1 165 ? 4.441   4.697   29.855  1.00 48.98 ? 165 GLU A CB  1 
ATOM   1320 C  CG  . GLU A 1 165 ? 4.541   4.992   31.350  1.00 52.01 ? 165 GLU A CG  1 
ATOM   1321 C  CD  . GLU A 1 165 ? 3.806   6.267   31.754  1.00 54.41 ? 165 GLU A CD  1 
ATOM   1322 O  OE1 . GLU A 1 165 ? 3.230   6.932   30.855  1.00 57.05 ? 165 GLU A OE1 1 
ATOM   1323 O  OE2 . GLU A 1 165 ? 3.788   6.598   32.967  1.00 54.31 ? 165 GLU A OE2 1 
ATOM   1324 N  N   . LYS A 1 166 ? 2.355   2.459   29.303  1.00 47.84 ? 166 LYS A N   1 
ATOM   1325 C  CA  . LYS A 1 166 ? 1.109   1.757   29.684  1.00 47.38 ? 166 LYS A CA  1 
ATOM   1326 C  C   . LYS A 1 166 ? 0.822   0.490   28.878  1.00 46.55 ? 166 LYS A C   1 
ATOM   1327 O  O   . LYS A 1 166 ? 0.126   -0.434  29.327  1.00 46.57 ? 166 LYS A O   1 
ATOM   1328 C  CB  . LYS A 1 166 ? -0.087  2.701   29.512  1.00 47.95 ? 166 LYS A CB  1 
ATOM   1329 C  CG  . LYS A 1 166 ? 0.276   4.199   29.540  1.00 48.25 ? 166 LYS A CG  1 
ATOM   1330 C  CD  . LYS A 1 166 ? -0.938  5.101   29.816  1.00 50.26 ? 166 LYS A CD  1 
ATOM   1331 C  CE  . LYS A 1 166 ? -1.972  5.137   28.674  1.00 50.42 ? 166 LYS A CE  1 
ATOM   1332 N  NZ  . LYS A 1 166 ? -3.317  5.678   29.147  1.00 52.86 ? 166 LYS A NZ  1 
ATOM   1333 N  N   . GLY A 1 167 ? 1.346   0.444   27.668  1.00 44.93 ? 167 GLY A N   1 
ATOM   1334 C  CA  . GLY A 1 167 ? 1.087   -0.704  26.836  1.00 42.89 ? 167 GLY A CA  1 
ATOM   1335 C  C   . GLY A 1 167 ? -0.297  -0.531  26.253  1.00 41.85 ? 167 GLY A C   1 
ATOM   1336 O  O   . GLY A 1 167 ? -0.848  0.577   26.216  1.00 41.13 ? 167 GLY A O   1 
ATOM   1337 N  N   . PHE A 1 168 ? -0.861  -1.637  25.809  1.00 40.24 ? 168 PHE A N   1 
ATOM   1338 C  CA  . PHE A 1 168 ? -2.177  -1.624  25.226  1.00 40.20 ? 168 PHE A CA  1 
ATOM   1339 C  C   . PHE A 1 168 ? -3.138  -2.142  26.282  1.00 40.11 ? 168 PHE A C   1 
ATOM   1340 O  O   . PHE A 1 168 ? -2.760  -2.945  27.119  1.00 39.95 ? 168 PHE A O   1 
ATOM   1341 C  CB  . PHE A 1 168 ? -2.193  -2.535  23.996  1.00 40.13 ? 168 PHE A CB  1 
ATOM   1342 C  CG  . PHE A 1 168 ? -1.663  -1.876  22.739  1.00 39.48 ? 168 PHE A CG  1 
ATOM   1343 C  CD1 . PHE A 1 168 ? -0.319  -1.575  22.608  1.00 38.49 ? 168 PHE A CD1 1 
ATOM   1344 C  CD2 . PHE A 1 168 ? -2.514  -1.575  21.686  1.00 37.07 ? 168 PHE A CD2 1 
ATOM   1345 C  CE1 . PHE A 1 168 ? 0.166   -0.983  21.454  1.00 37.88 ? 168 PHE A CE1 1 
ATOM   1346 C  CE2 . PHE A 1 168 ? -2.038  -0.982  20.523  1.00 38.05 ? 168 PHE A CE2 1 
ATOM   1347 C  CZ  . PHE A 1 168 ? -0.697  -0.669  20.412  1.00 38.92 ? 168 PHE A CZ  1 
ATOM   1348 N  N   . SER A 1 169 ? -4.376  -1.675  26.255  1.00 40.11 ? 169 SER A N   1 
ATOM   1349 C  CA  . SER A 1 169 ? -5.355  -2.147  27.216  1.00 39.93 ? 169 SER A CA  1 
ATOM   1350 C  C   . SER A 1 169 ? -5.570  -3.676  27.135  1.00 39.91 ? 169 SER A C   1 
ATOM   1351 O  O   . SER A 1 169 ? -6.101  -4.294  28.070  1.00 39.71 ? 169 SER A O   1 
ATOM   1352 C  CB  . SER A 1 169 ? -6.672  -1.416  27.023  1.00 40.12 ? 169 SER A CB  1 
ATOM   1353 O  OG  . SER A 1 169 ? -7.298  -1.824  25.827  1.00 39.70 ? 169 SER A OG  1 
ATOM   1354 N  N   . LYS A 1 170 ? -5.162  -4.283  26.024  1.00 39.00 ? 170 LYS A N   1 
ATOM   1355 C  CA  . LYS A 1 170 ? -5.302  -5.729  25.864  1.00 38.31 ? 170 LYS A CA  1 
ATOM   1356 C  C   . LYS A 1 170 ? -3.968  -6.383  25.543  1.00 37.49 ? 170 LYS A C   1 
ATOM   1357 O  O   . LYS A 1 170 ? -3.016  -5.723  25.146  1.00 37.37 ? 170 LYS A O   1 
ATOM   1358 C  CB  . LYS A 1 170 ? -6.288  -6.048  24.744  1.00 38.27 ? 170 LYS A CB  1 
ATOM   1359 C  CG  . LYS A 1 170 ? -7.719  -5.630  25.018  1.00 39.63 ? 170 LYS A CG  1 
ATOM   1360 C  CD  . LYS A 1 170 ? -8.523  -6.703  25.726  1.00 41.22 ? 170 LYS A CD  1 
ATOM   1361 C  CE  . LYS A 1 170 ? -9.978  -6.222  25.891  1.00 44.65 ? 170 LYS A CE  1 
ATOM   1362 N  NZ  . LYS A 1 170 ? -10.722 -6.880  27.012  1.00 45.12 ? 170 LYS A NZ  1 
ATOM   1363 N  N   . ILE A 1 171 ? -3.918  -7.698  25.690  1.00 36.55 ? 171 ILE A N   1 
ATOM   1364 C  CA  . ILE A 1 171 ? -2.730  -8.474  25.347  1.00 35.46 ? 171 ILE A CA  1 
ATOM   1365 C  C   . ILE A 1 171 ? -3.201  -9.704  24.595  1.00 34.28 ? 171 ILE A C   1 
ATOM   1366 O  O   . ILE A 1 171 ? -4.363  -10.086 24.707  1.00 34.20 ? 171 ILE A O   1 
ATOM   1367 C  CB  . ILE A 1 171 ? -1.954  -8.882  26.606  1.00 36.03 ? 171 ILE A CB  1 
ATOM   1368 C  CG1 . ILE A 1 171 ? -2.851  -9.663  27.568  1.00 36.22 ? 171 ILE A CG1 1 
ATOM   1369 C  CG2 . ILE A 1 171 ? -1.405  -7.661  27.324  1.00 35.80 ? 171 ILE A CG2 1 
ATOM   1370 C  CD1 . ILE A 1 171 ? -2.067  -10.329 28.673  1.00 37.55 ? 171 ILE A CD1 1 
ATOM   1371 N  N   . VAL A 1 172 ? -2.308  -10.313 23.822  1.00 33.79 ? 172 VAL A N   1 
ATOM   1372 C  CA  . VAL A 1 172 ? -2.657  -11.445 22.979  1.00 33.31 ? 172 VAL A CA  1 
ATOM   1373 C  C   . VAL A 1 172 ? -1.782  -12.616 23.391  1.00 33.36 ? 172 VAL A C   1 
ATOM   1374 O  O   . VAL A 1 172 ? -0.556  -12.550 23.304  1.00 33.12 ? 172 VAL A O   1 
ATOM   1375 C  CB  . VAL A 1 172 ? -2.476  -11.095 21.476  1.00 33.14 ? 172 VAL A CB  1 
ATOM   1376 C  CG1 . VAL A 1 172 ? -3.071  -12.165 20.595  1.00 32.40 ? 172 VAL A CG1 1 
ATOM   1377 C  CG2 . VAL A 1 172 ? -3.156  -9.762  21.160  1.00 33.10 ? 172 VAL A CG2 1 
ATOM   1378 N  N   . ILE A 1 173 ? -2.422  -13.693 23.829  1.00 33.88 ? 173 ILE A N   1 
ATOM   1379 C  CA  . ILE A 1 173 ? -1.697  -14.808 24.419  1.00 34.89 ? 173 ILE A CA  1 
ATOM   1380 C  C   . ILE A 1 173 ? -2.207  -16.142 23.937  1.00 35.81 ? 173 ILE A C   1 
ATOM   1381 O  O   . ILE A 1 173 ? -3.302  -16.224 23.355  1.00 36.28 ? 173 ILE A O   1 
ATOM   1382 C  CB  . ILE A 1 173 ? -1.885  -14.766 25.960  1.00 34.19 ? 173 ILE A CB  1 
ATOM   1383 C  CG1 . ILE A 1 173 ? -3.380  -14.756 26.336  1.00 34.51 ? 173 ILE A CG1 1 
ATOM   1384 C  CG2 . ILE A 1 173 ? -1.194  -13.592 26.532  1.00 33.99 ? 173 ILE A CG2 1 
ATOM   1385 C  CD1 . ILE A 1 173 ? -3.682  -15.174 27.784  1.00 38.18 ? 173 ILE A CD1 1 
ATOM   1386 N  N   . GLU A 1 174 ? -1.417  -17.179 24.195  1.00 37.25 ? 174 GLU A N   1 
ATOM   1387 C  CA  . GLU A 1 174 ? -1.860  -18.562 24.016  1.00 38.75 ? 174 GLU A CA  1 
ATOM   1388 C  C   . GLU A 1 174 ? -2.358  -19.119 25.366  1.00 39.19 ? 174 GLU A C   1 
ATOM   1389 O  O   . GLU A 1 174 ? -1.616  -19.196 26.324  1.00 38.97 ? 174 GLU A O   1 
ATOM   1390 C  CB  . GLU A 1 174 ? -0.735  -19.457 23.462  1.00 39.07 ? 174 GLU A CB  1 
ATOM   1391 C  CG  . GLU A 1 174 ? -1.246  -20.768 22.856  1.00 40.81 ? 174 GLU A CG  1 
ATOM   1392 C  CD  . GLU A 1 174 ? -0.152  -21.639 22.225  1.00 44.85 ? 174 GLU A CD  1 
ATOM   1393 O  OE1 . GLU A 1 174 ? 0.244   -21.394 21.054  1.00 48.14 ? 174 GLU A OE1 1 
ATOM   1394 O  OE2 . GLU A 1 174 ? 0.301   -22.598 22.892  1.00 47.42 ? 174 GLU A OE2 1 
ATOM   1395 N  N   . GLU A 1 175 ? -3.622  -19.521 25.427  1.00 40.49 ? 175 GLU A N   1 
ATOM   1396 C  CA  . GLU A 1 175 ? -4.219  -20.078 26.645  1.00 41.69 ? 175 GLU A CA  1 
ATOM   1397 C  C   . GLU A 1 175 ? -4.945  -21.345 26.179  1.00 43.11 ? 175 GLU A C   1 
ATOM   1398 O  O   . GLU A 1 175 ? -5.770  -21.277 25.262  1.00 42.84 ? 175 GLU A O   1 
ATOM   1399 C  CB  . GLU A 1 175 ? -5.196  -19.051 27.259  1.00 41.62 ? 175 GLU A CB  1 
ATOM   1400 C  CG  . GLU A 1 175 ? -5.733  -19.336 28.664  1.00 41.77 ? 175 GLU A CG  1 
ATOM   1401 C  CD  . GLU A 1 175 ? -6.440  -18.128 29.261  1.00 42.58 ? 175 GLU A CD  1 
ATOM   1402 O  OE1 . GLU A 1 175 ? -5.780  -17.328 29.972  1.00 40.63 ? 175 GLU A OE1 1 
ATOM   1403 O  OE2 . GLU A 1 175 ? -7.661  -17.957 29.013  1.00 43.28 ? 175 GLU A OE2 1 
ATOM   1404 N  N   . ASN A 1 176 ? -4.604  -22.493 26.762  1.00 44.56 ? 176 ASN A N   1 
ATOM   1405 C  CA  . ASN A 1 176 ? -5.217  -23.771 26.387  1.00 46.32 ? 176 ASN A CA  1 
ATOM   1406 C  C   . ASN A 1 176 ? -5.187  -23.996 24.879  1.00 46.93 ? 176 ASN A C   1 
ATOM   1407 O  O   . ASN A 1 176 ? -6.205  -24.351 24.281  1.00 47.94 ? 176 ASN A O   1 
ATOM   1408 C  CB  . ASN A 1 176 ? -6.673  -23.867 26.891  1.00 46.21 ? 176 ASN A CB  1 
ATOM   1409 C  CG  . ASN A 1 176 ? -6.801  -23.651 28.399  1.00 47.17 ? 176 ASN A CG  1 
ATOM   1410 O  OD1 . ASN A 1 176 ? -7.707  -22.949 28.862  1.00 49.43 ? 176 ASN A OD1 1 
ATOM   1411 N  ND2 . ASN A 1 176 ? -5.899  -24.252 29.167  1.00 46.63 ? 176 ASN A ND2 1 
ATOM   1412 N  N   . GLY A 1 177 ? -4.033  -23.766 24.255  1.00 47.13 ? 177 GLY A N   1 
ATOM   1413 C  CA  . GLY A 1 177 ? -3.890  -23.982 22.823  1.00 46.62 ? 177 GLY A CA  1 
ATOM   1414 C  C   . GLY A 1 177 ? -4.514  -22.934 21.916  1.00 46.15 ? 177 GLY A C   1 
ATOM   1415 O  O   . GLY A 1 177 ? -4.205  -22.889 20.724  1.00 46.48 ? 177 GLY A O   1 
ATOM   1416 N  N   . GLU A 1 178 ? -5.381  -22.080 22.463  1.00 45.47 ? 178 GLU A N   1 
ATOM   1417 C  CA  . GLU A 1 178 ? -6.075  -21.085 21.657  1.00 44.48 ? 178 GLU A CA  1 
ATOM   1418 C  C   . GLU A 1 178 ? -5.552  -19.684 21.838  1.00 43.70 ? 178 GLU A C   1 
ATOM   1419 O  O   . GLU A 1 178 ? -5.185  -19.283 22.933  1.00 43.06 ? 178 GLU A O   1 
ATOM   1420 C  CB  . GLU A 1 178 ? -7.556  -21.050 22.020  1.00 45.51 ? 178 GLU A CB  1 
ATOM   1421 C  CG  . GLU A 1 178 ? -8.150  -22.389 22.404  1.00 47.15 ? 178 GLU A CG  1 
ATOM   1422 C  CD  . GLU A 1 178 ? -9.585  -22.248 22.879  1.00 49.90 ? 178 GLU A CD  1 
ATOM   1423 O  OE1 . GLU A 1 178 ? -10.094 -21.103 22.903  1.00 49.59 ? 178 GLU A OE1 1 
ATOM   1424 O  OE2 . GLU A 1 178 ? -10.201 -23.283 23.222  1.00 52.15 ? 178 GLU A OE2 1 
ATOM   1425 N  N   . VAL A 1 179 ? -5.558  -18.924 20.753  1.00 42.36 ? 179 VAL A N   1 
ATOM   1426 C  CA  . VAL A 1 179 ? -5.138  -17.550 20.798  1.00 41.01 ? 179 VAL A CA  1 
ATOM   1427 C  C   . VAL A 1 179 ? -6.267  -16.807 21.470  1.00 40.01 ? 179 VAL A C   1 
ATOM   1428 O  O   . VAL A 1 179 ? -7.403  -16.987 21.106  1.00 40.22 ? 179 VAL A O   1 
ATOM   1429 C  CB  . VAL A 1 179 ? -4.920  -17.003 19.357  1.00 41.38 ? 179 VAL A CB  1 
ATOM   1430 C  CG1 . VAL A 1 179 ? -4.521  -15.549 19.390  1.00 40.44 ? 179 VAL A CG1 1 
ATOM   1431 C  CG2 . VAL A 1 179 ? -3.883  -17.832 18.621  1.00 41.14 ? 179 VAL A CG2 1 
ATOM   1432 N  N   . LYS A 1 180 ? -5.962  -15.987 22.463  1.00 38.91 ? 180 LYS A N   1 
ATOM   1433 C  CA  . LYS A 1 180 ? -6.988  -15.207 23.136  1.00 38.20 ? 180 LYS A CA  1 
ATOM   1434 C  C   . LYS A 1 180 ? -6.519  -13.780 23.332  1.00 37.11 ? 180 LYS A C   1 
ATOM   1435 O  O   . LYS A 1 180 ? -5.351  -13.525 23.605  1.00 36.80 ? 180 LYS A O   1 
ATOM   1436 C  CB  . LYS A 1 180 ? -7.325  -15.804 24.501  1.00 38.62 ? 180 LYS A CB  1 
ATOM   1437 C  CG  . LYS A 1 180 ? -8.388  -16.936 24.497  1.00 40.85 ? 180 LYS A CG  1 
ATOM   1438 C  CD  . LYS A 1 180 ? -8.358  -17.737 25.821  1.00 44.26 ? 180 LYS A CD  1 
ATOM   1439 C  CE  . LYS A 1 180 ? -9.749  -18.270 26.246  1.00 46.67 ? 180 LYS A CE  1 
ATOM   1440 N  NZ  . LYS A 1 180 ? -9.695  -19.216 27.438  1.00 48.26 ? 180 LYS A NZ  1 
ATOM   1441 N  N   . VAL A 1 181 ? -7.452  -12.857 23.205  1.00 37.20 ? 181 VAL A N   1 
ATOM   1442 C  CA  . VAL A 1 181 ? -7.182  -11.454 23.397  1.00 37.16 ? 181 VAL A CA  1 
ATOM   1443 C  C   . VAL A 1 181 ? -7.831  -11.125 24.730  1.00 37.98 ? 181 VAL A C   1 
ATOM   1444 O  O   . VAL A 1 181 ? -9.040  -11.261 24.889  1.00 38.40 ? 181 VAL A O   1 
ATOM   1445 C  CB  . VAL A 1 181 ? -7.808  -10.636 22.267  1.00 37.74 ? 181 VAL A CB  1 
ATOM   1446 C  CG1 . VAL A 1 181 ? -7.481  -9.175  22.439  1.00 35.93 ? 181 VAL A CG1 1 
ATOM   1447 C  CG2 . VAL A 1 181 ? -7.315  -11.146 20.923  1.00 37.77 ? 181 VAL A CG2 1 
ATOM   1448 N  N   . VAL A 1 182 ? -7.024  -10.727 25.701  1.00 38.56 ? 182 VAL A N   1 
ATOM   1449 C  CA  . VAL A 1 182 ? -7.526  -10.540 27.047  1.00 39.98 ? 182 VAL A CA  1 
ATOM   1450 C  C   . VAL A 1 182 ? -7.070  -9.238  27.637  1.00 40.85 ? 182 VAL A C   1 
ATOM   1451 O  O   . VAL A 1 182 ? -6.205  -8.564  27.093  1.00 40.51 ? 182 VAL A O   1 
ATOM   1452 C  CB  . VAL A 1 182 ? -7.083  -11.701 27.962  1.00 40.04 ? 182 VAL A CB  1 
ATOM   1453 C  CG1 . VAL A 1 182 ? -7.642  -13.014 27.440  1.00 40.60 ? 182 VAL A CG1 1 
ATOM   1454 C  CG2 . VAL A 1 182 ? -5.560  -11.766 28.045  1.00 39.54 ? 182 VAL A CG2 1 
ATOM   1455 N  N   . ASP A 1 183 ? -7.673  -8.880  28.760  1.00 42.24 ? 183 ASP A N   1 
ATOM   1456 C  CA  . ASP A 1 183 ? -7.288  -7.677  29.462  1.00 43.18 ? 183 ASP A CA  1 
ATOM   1457 C  C   . ASP A 1 183 ? -5.825  -7.778  29.837  1.00 43.34 ? 183 ASP A C   1 
ATOM   1458 O  O   . ASP A 1 183 ? -5.316  -8.850  30.214  1.00 43.46 ? 183 ASP A O   1 
ATOM   1459 C  CB  . ASP A 1 183 ? -8.136  -7.500  30.735  1.00 43.82 ? 183 ASP A CB  1 
ATOM   1460 C  CG  . ASP A 1 183 ? -9.472  -6.767  30.477  1.00 46.19 ? 183 ASP A CG  1 
ATOM   1461 O  OD1 . ASP A 1 183 ? -9.740  -6.327  29.324  1.00 47.77 ? 183 ASP A OD1 1 
ATOM   1462 O  OD2 . ASP A 1 183 ? -10.329 -6.598  31.375  1.00 48.16 ? 183 ASP A OD2 1 
ATOM   1463 N  N   . ASN A 1 184 ? -5.142  -6.656  29.688  1.00 43.93 ? 184 ASN A N   1 
ATOM   1464 C  CA  . ASN A 1 184 ? -3.767  -6.489  30.121  1.00 44.36 ? 184 ASN A CA  1 
ATOM   1465 C  C   . ASN A 1 184 ? -3.849  -6.204  31.627  1.00 45.38 ? 184 ASN A C   1 
ATOM   1466 O  O   . ASN A 1 184 ? -4.487  -5.234  32.023  1.00 45.45 ? 184 ASN A O   1 
ATOM   1467 C  CB  . ASN A 1 184 ? -3.184  -5.277  29.379  1.00 44.06 ? 184 ASN A CB  1 
ATOM   1468 C  CG  . ASN A 1 184 ? -1.741  -4.981  29.744  1.00 43.00 ? 184 ASN A CG  1 
ATOM   1469 O  OD1 . ASN A 1 184 ? -1.222  -5.508  30.715  1.00 47.30 ? 184 ASN A OD1 1 
ATOM   1470 N  ND2 . ASN A 1 184 ? -1.092  -4.116  28.968  1.00 41.66 ? 184 ASN A ND2 1 
ATOM   1471 N  N   . PRO A 1 185 ? -3.246  -7.035  32.475  1.00 46.09 ? 185 PRO A N   1 
ATOM   1472 C  CA  . PRO A 1 185 ? -3.262  -6.766  33.920  1.00 46.63 ? 185 PRO A CA  1 
ATOM   1473 C  C   . PRO A 1 185 ? -2.455  -5.517  34.285  1.00 47.71 ? 185 PRO A C   1 
ATOM   1474 O  O   . PRO A 1 185 ? -2.722  -4.885  35.304  1.00 48.40 ? 185 PRO A O   1 
ATOM   1475 C  CB  . PRO A 1 185 ? -2.619  -8.020  34.509  1.00 46.68 ? 185 PRO A CB  1 
ATOM   1476 C  CG  . PRO A 1 185 ? -1.738  -8.503  33.407  1.00 46.28 ? 185 PRO A CG  1 
ATOM   1477 C  CD  . PRO A 1 185 ? -2.565  -8.305  32.161  1.00 45.85 ? 185 PRO A CD  1 
ATOM   1478 N  N   . ARG A 1 186 ? -1.483  -5.155  33.459  1.00 48.61 ? 186 ARG A N   1 
ATOM   1479 C  CA  . ARG A 1 186 ? -0.677  -3.971  33.728  1.00 49.66 ? 186 ARG A CA  1 
ATOM   1480 C  C   . ARG A 1 186 ? -1.446  -2.661  33.516  1.00 50.00 ? 186 ARG A C   1 
ATOM   1481 O  O   . ARG A 1 186 ? -0.974  -1.605  33.911  1.00 50.39 ? 186 ARG A O   1 
ATOM   1482 C  CB  . ARG A 1 186 ? 0.542   -3.950  32.802  1.00 50.05 ? 186 ARG A CB  1 
ATOM   1483 C  CG  . ARG A 1 186 ? 1.839   -4.532  33.366  1.00 51.19 ? 186 ARG A CG  1 
ATOM   1484 C  CD  . ARG A 1 186 ? 2.952   -4.632  32.313  1.00 51.46 ? 186 ARG A CD  1 
ATOM   1485 N  NE  . ARG A 1 186 ? 3.143   -3.372  31.592  1.00 50.83 ? 186 ARG A NE  1 
ATOM   1486 C  CZ  . ARG A 1 186 ? 2.880   -3.182  30.298  1.00 50.24 ? 186 ARG A CZ  1 
ATOM   1487 N  NH1 . ARG A 1 186 ? 2.402   -4.174  29.534  1.00 50.43 ? 186 ARG A NH1 1 
ATOM   1488 N  NH2 . ARG A 1 186 ? 3.102   -1.990  29.770  1.00 47.30 ? 186 ARG A NH2 1 
ATOM   1489 N  N   . TRP A 1 187 ? -2.631  -2.725  32.910  1.00 50.64 ? 187 TRP A N   1 
ATOM   1490 C  CA  . TRP A 1 187 ? -3.332  -1.507  32.492  1.00 50.85 ? 187 TRP A CA  1 
ATOM   1491 C  C   . TRP A 1 187 ? -4.296  -0.927  33.525  1.00 50.91 ? 187 TRP A C   1 
ATOM   1492 O  O   . TRP A 1 187 ? -5.353  -1.506  33.795  1.00 51.44 ? 187 TRP A O   1 
ATOM   1493 C  CB  . TRP A 1 187 ? -4.061  -1.769  31.168  1.00 50.70 ? 187 TRP A CB  1 
ATOM   1494 C  CG  . TRP A 1 187 ? -3.970  -0.645  30.206  1.00 50.46 ? 187 TRP A CG  1 
ATOM   1495 C  CD1 . TRP A 1 187 ? -2.893  -0.310  29.442  1.00 50.21 ? 187 TRP A CD1 1 
ATOM   1496 C  CD2 . TRP A 1 187 ? -4.989  0.309   29.896  1.00 50.15 ? 187 TRP A CD2 1 
ATOM   1497 N  NE1 . TRP A 1 187 ? -3.180  0.794   28.676  1.00 49.55 ? 187 TRP A NE1 1 
ATOM   1498 C  CE2 . TRP A 1 187 ? -4.460  1.195   28.939  1.00 50.01 ? 187 TRP A CE2 1 
ATOM   1499 C  CE3 . TRP A 1 187 ? -6.299  0.508   30.334  1.00 50.42 ? 187 TRP A CE3 1 
ATOM   1500 C  CZ2 . TRP A 1 187 ? -5.192  2.256   28.412  1.00 49.58 ? 187 TRP A CZ2 1 
ATOM   1501 C  CZ3 . TRP A 1 187 ? -7.020  1.563   29.816  1.00 49.42 ? 187 TRP A CZ3 1 
ATOM   1502 C  CH2 . TRP A 1 187 ? -6.469  2.421   28.865  1.00 50.17 ? 187 TRP A CH2 1 
ATOM   1503 N  N   . MET B 1 1   ? -15.977 10.764  18.079  1.00 45.04 ? 1   MET B N   1 
ATOM   1504 C  CA  . MET B 1 1   ? -16.176 9.436   17.435  1.00 44.01 ? 1   MET B CA  1 
ATOM   1505 C  C   . MET B 1 1   ? -15.024 9.128   16.482  1.00 42.16 ? 1   MET B C   1 
ATOM   1506 O  O   . MET B 1 1   ? -14.799 9.831   15.495  1.00 41.77 ? 1   MET B O   1 
ATOM   1507 C  CB  . MET B 1 1   ? -17.500 9.383   16.669  1.00 44.92 ? 1   MET B CB  1 
ATOM   1508 C  CG  . MET B 1 1   ? -18.166 7.993   16.676  1.00 48.38 ? 1   MET B CG  1 
ATOM   1509 S  SD  . MET B 1 1   ? -19.112 7.613   15.155  1.00 56.15 ? 1   MET B SD  1 
ATOM   1510 C  CE  . MET B 1 1   ? -17.719 7.481   13.885  1.00 55.60 ? 1   MET B CE  1 
ATOM   1511 N  N   . TYR B 1 2   ? -14.294 8.076   16.812  1.00 39.71 ? 2   TYR B N   1 
ATOM   1512 C  CA  . TYR B 1 2   ? -13.233 7.583   15.948  1.00 37.91 ? 2   TYR B CA  1 
ATOM   1513 C  C   . TYR B 1 2   ? -13.854 6.647   14.940  1.00 36.36 ? 2   TYR B C   1 
ATOM   1514 O  O   . TYR B 1 2   ? -14.895 6.047   15.221  1.00 36.03 ? 2   TYR B O   1 
ATOM   1515 C  CB  . TYR B 1 2   ? -12.249 6.793   16.792  1.00 37.32 ? 2   TYR B CB  1 
ATOM   1516 C  CG  . TYR B 1 2   ? -11.644 7.632   17.857  1.00 37.54 ? 2   TYR B CG  1 
ATOM   1517 C  CD1 . TYR B 1 2   ? -11.992 7.461   19.186  1.00 38.75 ? 2   TYR B CD1 1 
ATOM   1518 C  CD2 . TYR B 1 2   ? -10.745 8.626   17.529  1.00 38.02 ? 2   TYR B CD2 1 
ATOM   1519 C  CE1 . TYR B 1 2   ? -11.436 8.251   20.167  1.00 40.48 ? 2   TYR B CE1 1 
ATOM   1520 C  CE2 . TYR B 1 2   ? -10.187 9.425   18.498  1.00 39.40 ? 2   TYR B CE2 1 
ATOM   1521 C  CZ  . TYR B 1 2   ? -10.529 9.234   19.814  1.00 39.98 ? 2   TYR B CZ  1 
ATOM   1522 O  OH  . TYR B 1 2   ? -9.953  10.038  20.779  1.00 40.70 ? 2   TYR B OH  1 
ATOM   1523 N  N   . LYS B 1 3   ? -13.221 6.509   13.780  1.00 34.76 ? 3   LYS B N   1 
ATOM   1524 C  CA  . LYS B 1 3   ? -13.702 5.556   12.784  1.00 33.35 ? 3   LYS B CA  1 
ATOM   1525 C  C   . LYS B 1 3   ? -13.275 4.123   13.173  1.00 32.69 ? 3   LYS B C   1 
ATOM   1526 O  O   . LYS B 1 3   ? -12.280 3.928   13.852  1.00 31.45 ? 3   LYS B O   1 
ATOM   1527 C  CB  . LYS B 1 3   ? -13.157 5.911   11.403  1.00 33.00 ? 3   LYS B CB  1 
ATOM   1528 C  CG  . LYS B 1 3   ? -13.721 7.201   10.796  1.00 31.85 ? 3   LYS B CG  1 
ATOM   1529 C  CD  . LYS B 1 3   ? -13.560 7.244   9.279   1.00 28.95 ? 3   LYS B CD  1 
ATOM   1530 C  CE  . LYS B 1 3   ? -12.141 7.580   8.863   1.00 28.18 ? 3   LYS B CE  1 
ATOM   1531 N  NZ  . LYS B 1 3   ? -12.155 8.018   7.461   1.00 26.73 ? 3   LYS B NZ  1 
ATOM   1532 N  N   . GLU B 1 4   ? -14.052 3.139   12.746  1.00 32.06 ? 4   GLU B N   1 
ATOM   1533 C  CA  . GLU B 1 4   ? -13.761 1.732   13.000  1.00 32.52 ? 4   GLU B CA  1 
ATOM   1534 C  C   . GLU B 1 4   ? -12.661 1.207   12.110  1.00 31.35 ? 4   GLU B C   1 
ATOM   1535 O  O   . GLU B 1 4   ? -12.782 1.265   10.898  1.00 32.10 ? 4   GLU B O   1 
ATOM   1536 C  CB  . GLU B 1 4   ? -14.991 0.872   12.671  1.00 32.69 ? 4   GLU B CB  1 
ATOM   1537 C  CG  . GLU B 1 4   ? -15.618 0.102   13.822  1.00 35.27 ? 4   GLU B CG  1 
ATOM   1538 C  CD  . GLU B 1 4   ? -17.039 -0.358  13.498  1.00 39.03 ? 4   GLU B CD  1 
ATOM   1539 O  OE1 . GLU B 1 4   ? -17.981 0.464   13.638  1.00 38.29 ? 4   GLU B OE1 1 
ATOM   1540 O  OE2 . GLU B 1 4   ? -17.207 -1.532  13.097  1.00 38.54 ? 4   GLU B OE2 1 
ATOM   1541 N  N   . PRO B 1 5   ? -11.607 0.660   12.699  1.00 30.57 ? 5   PRO B N   1 
ATOM   1542 C  CA  . PRO B 1 5   ? -10.598 -0.034  11.907  1.00 29.83 ? 5   PRO B CA  1 
ATOM   1543 C  C   . PRO B 1 5   ? -11.262 -1.238  11.287  1.00 28.97 ? 5   PRO B C   1 
ATOM   1544 O  O   . PRO B 1 5   ? -12.166 -1.804  11.887  1.00 29.06 ? 5   PRO B O   1 
ATOM   1545 C  CB  . PRO B 1 5   ? -9.591  -0.522  12.940  1.00 30.00 ? 5   PRO B CB  1 
ATOM   1546 C  CG  . PRO B 1 5   ? -9.839  0.309   14.159  1.00 30.58 ? 5   PRO B CG  1 
ATOM   1547 C  CD  . PRO B 1 5   ? -11.289 0.684   14.136  1.00 31.18 ? 5   PRO B CD  1 
ATOM   1548 N  N   . PHE B 1 6   ? -10.798 -1.657  10.127  1.00 27.35 ? 6   PHE B N   1 
ATOM   1549 C  CA  . PHE B 1 6   ? -11.353 -2.863  9.538   1.00 26.90 ? 6   PHE B CA  1 
ATOM   1550 C  C   . PHE B 1 6   ? -10.315 -3.505  8.650   1.00 26.36 ? 6   PHE B C   1 
ATOM   1551 O  O   . PHE B 1 6   ? -9.364  -2.854  8.205   1.00 26.45 ? 6   PHE B O   1 
ATOM   1552 C  CB  . PHE B 1 6   ? -12.615 -2.509  8.714   1.00 26.15 ? 6   PHE B CB  1 
ATOM   1553 C  CG  . PHE B 1 6   ? -12.363 -1.576  7.567   1.00 26.73 ? 6   PHE B CG  1 
ATOM   1554 C  CD1 . PHE B 1 6   ? -12.623 -0.208  7.671   1.00 21.59 ? 6   PHE B CD1 1 
ATOM   1555 C  CD2 . PHE B 1 6   ? -11.860 -2.049  6.358   1.00 23.36 ? 6   PHE B CD2 1 
ATOM   1556 C  CE1 . PHE B 1 6   ? -12.405 0.655   6.611   1.00 23.84 ? 6   PHE B CE1 1 
ATOM   1557 C  CE2 . PHE B 1 6   ? -11.631 -1.168  5.309   1.00 24.61 ? 6   PHE B CE2 1 
ATOM   1558 C  CZ  . PHE B 1 6   ? -11.914 0.192   5.443   1.00 26.89 ? 6   PHE B CZ  1 
ATOM   1559 N  N   . GLY B 1 7   ? -10.516 -4.789  8.394   1.00 26.85 ? 7   GLY B N   1 
ATOM   1560 C  CA  . GLY B 1 7   ? -9.703  -5.510  7.452   1.00 25.89 ? 7   GLY B CA  1 
ATOM   1561 C  C   . GLY B 1 7   ? -10.582 -6.005  6.322   1.00 27.47 ? 7   GLY B C   1 
ATOM   1562 O  O   . GLY B 1 7   ? -11.763 -6.296  6.540   1.00 27.31 ? 7   GLY B O   1 
ATOM   1563 N  N   . VAL B 1 8   ? -10.041 -6.041  5.109   1.00 27.58 ? 8   VAL B N   1 
ATOM   1564 C  CA  . VAL B 1 8   ? -10.762 -6.588  3.948   1.00 27.22 ? 8   VAL B CA  1 
ATOM   1565 C  C   . VAL B 1 8   ? -9.810  -7.506  3.221   1.00 28.24 ? 8   VAL B C   1 
ATOM   1566 O  O   . VAL B 1 8   ? -8.582  -7.340  3.267   1.00 28.22 ? 8   VAL B O   1 
ATOM   1567 C  CB  . VAL B 1 8   ? -11.262 -5.534  2.912   1.00 27.99 ? 8   VAL B CB  1 
ATOM   1568 C  CG1 . VAL B 1 8   ? -12.060 -4.443  3.564   1.00 26.91 ? 8   VAL B CG1 1 
ATOM   1569 C  CG2 . VAL B 1 8   ? -10.104 -4.911  2.165   1.00 27.63 ? 8   VAL B CG2 1 
ATOM   1570 N  N   . LYS B 1 9   ? -10.374 -8.492  2.550   1.00 28.28 ? 9   LYS B N   1 
ATOM   1571 C  CA  . LYS B 1 9   ? -9.541  -9.417  1.826   1.00 28.61 ? 9   LYS B CA  1 
ATOM   1572 C  C   . LYS B 1 9   ? -9.377  -8.927  0.412   1.00 27.66 ? 9   LYS B C   1 
ATOM   1573 O  O   . LYS B 1 9   ? -10.339 -8.558  -0.254  1.00 27.73 ? 9   LYS B O   1 
ATOM   1574 C  CB  . LYS B 1 9   ? -10.162 -10.838 1.858   1.00 29.35 ? 9   LYS B CB  1 
ATOM   1575 C  CG  . LYS B 1 9   ? -9.276  -11.906 1.221   1.00 32.77 ? 9   LYS B CG  1 
ATOM   1576 C  CD  . LYS B 1 9   ? -9.359  -13.199 2.075   1.00 38.00 ? 9   LYS B CD  1 
ATOM   1577 C  CE  . LYS B 1 9   ? -9.579  -14.451 1.231   1.00 41.49 ? 9   LYS B CE  1 
ATOM   1578 N  NZ  . LYS B 1 9   ? -10.049 -15.611 2.078   1.00 41.79 ? 9   LYS B NZ  1 
ATOM   1579 N  N   . VAL B 1 10  ? -8.131  -8.863  -0.030  1.00 26.45 ? 10  VAL B N   1 
ATOM   1580 C  CA  . VAL B 1 10  ? -7.838  -8.547  -1.400  1.00 25.73 ? 10  VAL B CA  1 
ATOM   1581 C  C   . VAL B 1 10  ? -7.325  -9.844  -2.006  1.00 26.01 ? 10  VAL B C   1 
ATOM   1582 O  O   . VAL B 1 10  ? -6.434  -10.456 -1.450  1.00 26.05 ? 10  VAL B O   1 
ATOM   1583 C  CB  . VAL B 1 10  ? -6.735  -7.491  -1.540  1.00 27.10 ? 10  VAL B CB  1 
ATOM   1584 C  CG1 . VAL B 1 10  ? -6.377  -7.276  -3.017  1.00 25.12 ? 10  VAL B CG1 1 
ATOM   1585 C  CG2 . VAL B 1 10  ? -7.198  -6.160  -0.930  1.00 27.31 ? 10  VAL B CG2 1 
ATOM   1586 N  N   . ASP B 1 11  ? -7.933  -10.270 -3.096  1.00 24.20 ? 11  ASP B N   1 
ATOM   1587 C  CA  . ASP B 1 11  ? -7.489  -11.451 -3.842  1.00 26.23 ? 11  ASP B CA  1 
ATOM   1588 C  C   . ASP B 1 11  ? -6.437  -11.044 -4.880  1.00 24.43 ? 11  ASP B C   1 
ATOM   1589 O  O   . ASP B 1 11  ? -6.741  -10.371 -5.848  1.00 24.50 ? 11  ASP B O   1 
ATOM   1590 C  CB  . ASP B 1 11  ? -8.713  -12.119 -4.487  1.00 25.76 ? 11  ASP B CB  1 
ATOM   1591 C  CG  . ASP B 1 11  ? -8.404  -13.496 -5.037  1.00 30.64 ? 11  ASP B CG  1 
ATOM   1592 O  OD1 . ASP B 1 11  ? -7.319  -13.659 -5.641  1.00 29.09 ? 11  ASP B OD1 1 
ATOM   1593 O  OD2 . ASP B 1 11  ? -9.184  -14.466 -4.888  1.00 33.27 ? 11  ASP B OD2 1 
ATOM   1594 N  N   . PHE B 1 12  ? -5.197  -11.467 -4.659  1.00 25.59 ? 12  PHE B N   1 
ATOM   1595 C  CA  . PHE B 1 12  ? -4.035  -11.167 -5.507  1.00 26.36 ? 12  PHE B CA  1 
ATOM   1596 C  C   . PHE B 1 12  ? -4.100  -11.798 -6.897  1.00 26.15 ? 12  PHE B C   1 
ATOM   1597 O  O   . PHE B 1 12  ? -3.388  -11.390 -7.772  1.00 26.15 ? 12  PHE B O   1 
ATOM   1598 C  CB  . PHE B 1 12  ? -2.727  -11.618 -4.828  1.00 26.43 ? 12  PHE B CB  1 
ATOM   1599 C  CG  . PHE B 1 12  ? -2.294  -10.748 -3.675  1.00 28.68 ? 12  PHE B CG  1 
ATOM   1600 C  CD1 . PHE B 1 12  ? -3.110  -9.727  -3.217  1.00 30.39 ? 12  PHE B CD1 1 
ATOM   1601 C  CD2 . PHE B 1 12  ? -1.068  -10.934 -3.063  1.00 29.53 ? 12  PHE B CD2 1 
ATOM   1602 C  CE1 . PHE B 1 12  ? -2.724  -8.921  -2.161  1.00 29.34 ? 12  PHE B CE1 1 
ATOM   1603 C  CE2 . PHE B 1 12  ? -0.680  -10.117 -1.998  1.00 33.37 ? 12  PHE B CE2 1 
ATOM   1604 C  CZ  . PHE B 1 12  ? -1.513  -9.105  -1.559  1.00 32.86 ? 12  PHE B CZ  1 
ATOM   1605 N  N   . GLU B 1 13  ? -4.960  -12.801 -7.084  1.00 26.39 ? 13  GLU B N   1 
ATOM   1606 C  CA  . GLU B 1 13  ? -5.090  -13.451 -8.376  1.00 26.14 ? 13  GLU B CA  1 
ATOM   1607 C  C   . GLU B 1 13  ? -6.155  -12.798 -9.257  1.00 24.87 ? 13  GLU B C   1 
ATOM   1608 O  O   . GLU B 1 13  ? -6.059  -12.798 -10.481 1.00 23.47 ? 13  GLU B O   1 
ATOM   1609 C  CB  . GLU B 1 13  ? -5.350  -14.949 -8.192  1.00 25.93 ? 13  GLU B CB  1 
ATOM   1610 C  CG  . GLU B 1 13  ? -4.314  -15.609 -7.300  1.00 28.33 ? 13  GLU B CG  1 
ATOM   1611 C  CD  . GLU B 1 13  ? -2.966  -15.833 -7.984  1.00 26.55 ? 13  GLU B CD  1 
ATOM   1612 O  OE1 . GLU B 1 13  ? -2.832  -15.619 -9.175  1.00 26.43 ? 13  GLU B OE1 1 
ATOM   1613 O  OE2 . GLU B 1 13  ? -2.021  -16.228 -7.290  1.00 35.69 ? 13  GLU B OE2 1 
ATOM   1614 N  N   . THR B 1 14  ? -7.151  -12.187 -8.627  1.00 24.40 ? 14  THR B N   1 
ATOM   1615 C  CA  . THR B 1 14  ? -8.230  -11.566 -9.368  1.00 24.46 ? 14  THR B CA  1 
ATOM   1616 C  C   . THR B 1 14  ? -8.350  -10.046 -9.199  1.00 24.51 ? 14  THR B C   1 
ATOM   1617 O  O   . THR B 1 14  ? -9.117  -9.403  -9.924  1.00 25.05 ? 14  THR B O   1 
ATOM   1618 C  CB  . THR B 1 14  ? -9.588  -12.168 -8.909  1.00 23.71 ? 14  THR B CB  1 
ATOM   1619 O  OG1 . THR B 1 14  ? -9.840  -11.811 -7.546  1.00 22.85 ? 14  THR B OG1 1 
ATOM   1620 C  CG2 . THR B 1 14  ? -9.553  -13.715 -8.886  1.00 24.42 ? 14  THR B CG2 1 
ATOM   1621 N  N   . GLY B 1 15  ? -7.606  -9.514  -8.255  1.00 25.04 ? 15  GLY B N   1 
ATOM   1622 C  CA  . GLY B 1 15  ? -7.673  -8.110  -7.918  1.00 26.67 ? 15  GLY B CA  1 
ATOM   1623 C  C   . GLY B 1 15  ? -8.962  -7.700  -7.218  1.00 27.67 ? 15  GLY B C   1 
ATOM   1624 O  O   . GLY B 1 15  ? -9.125  -6.545  -6.843  1.00 27.50 ? 15  GLY B O   1 
ATOM   1625 N  N   . ILE B 1 16  ? -9.906  -8.614  -7.047  1.00 28.83 ? 16  ILE B N   1 
ATOM   1626 C  CA  . ILE B 1 16  ? -11.153 -8.236  -6.442  1.00 29.37 ? 16  ILE B CA  1 
ATOM   1627 C  C   . ILE B 1 16  ? -11.004 -7.931  -4.941  1.00 30.00 ? 16  ILE B C   1 
ATOM   1628 O  O   . ILE B 1 16  ? -10.350 -8.673  -4.192  1.00 31.14 ? 16  ILE B O   1 
ATOM   1629 C  CB  . ILE B 1 16  ? -12.225 -9.349  -6.698  1.00 30.04 ? 16  ILE B CB  1 
ATOM   1630 C  CG1 . ILE B 1 16  ? -12.404 -9.591  -8.215  1.00 28.22 ? 16  ILE B CG1 1 
ATOM   1631 C  CG2 . ILE B 1 16  ? -13.564 -8.937  -6.065  1.00 30.02 ? 16  ILE B CG2 1 
ATOM   1632 C  CD1 . ILE B 1 16  ? -13.210 -10.879 -8.574  1.00 29.63 ? 16  ILE B CD1 1 
ATOM   1633 N  N   . ILE B 1 17  ? -11.571 -6.817  -4.491  1.00 30.37 ? 17  ILE B N   1 
ATOM   1634 C  CA  . ILE B 1 17  ? -11.690 -6.610  -3.048  1.00 31.16 ? 17  ILE B CA  1 
ATOM   1635 C  C   . ILE B 1 17  ? -13.143 -6.870  -2.663  1.00 31.57 ? 17  ILE B C   1 
ATOM   1636 O  O   . ILE B 1 17  ? -14.061 -6.277  -3.244  1.00 31.68 ? 17  ILE B O   1 
ATOM   1637 C  CB  . ILE B 1 17  ? -11.281 -5.190  -2.607  1.00 30.38 ? 17  ILE B CB  1 
ATOM   1638 C  CG1 . ILE B 1 17  ? -9.940  -4.782  -3.211  1.00 29.73 ? 17  ILE B CG1 1 
ATOM   1639 C  CG2 . ILE B 1 17  ? -11.250 -5.100  -1.089  1.00 31.53 ? 17  ILE B CG2 1 
ATOM   1640 C  CD1 . ILE B 1 17  ? -9.547  -3.369  -2.873  1.00 31.59 ? 17  ILE B CD1 1 
ATOM   1641 N  N   . GLU B 1 18  ? -13.326 -7.771  -1.702  1.00 32.59 ? 18  GLU B N   1 
ATOM   1642 C  CA  . GLU B 1 18  ? -14.624 -8.141  -1.148  1.00 33.70 ? 18  GLU B CA  1 
ATOM   1643 C  C   . GLU B 1 18  ? -15.375 -6.926  -0.674  1.00 32.75 ? 18  GLU B C   1 
ATOM   1644 O  O   . GLU B 1 18  ? -14.910 -6.255  0.248   1.00 32.49 ? 18  GLU B O   1 
ATOM   1645 C  CB  . GLU B 1 18  ? -14.440 -9.054  0.082   1.00 35.16 ? 18  GLU B CB  1 
ATOM   1646 C  CG  . GLU B 1 18  ? -13.585 -10.298 -0.128  1.00 40.15 ? 18  GLU B CG  1 
ATOM   1647 C  CD  . GLU B 1 18  ? -14.013 -11.470 0.772   1.00 46.63 ? 18  GLU B CD  1 
ATOM   1648 O  OE1 . GLU B 1 18  ? -13.908 -11.364 2.028   1.00 47.09 ? 18  GLU B OE1 1 
ATOM   1649 O  OE2 . GLU B 1 18  ? -14.468 -12.507 0.222   1.00 48.46 ? 18  GLU B OE2 1 
ATOM   1650 N  N   . GLY B 1 19  ? -16.494 -6.630  -1.327  1.00 32.68 ? 19  GLY B N   1 
ATOM   1651 C  CA  . GLY B 1 19  ? -17.368 -5.526  -0.942  1.00 32.60 ? 19  GLY B CA  1 
ATOM   1652 C  C   . GLY B 1 19  ? -16.912 -4.111  -1.267  1.00 32.58 ? 19  GLY B C   1 
ATOM   1653 O  O   . GLY B 1 19  ? -17.476 -3.143  -0.731  1.00 32.67 ? 19  GLY B O   1 
ATOM   1654 N  N   . ALA B 1 20  ? -15.905 -3.971  -2.134  1.00 32.45 ? 20  ALA B N   1 
ATOM   1655 C  CA  . ALA B 1 20  ? -15.431 -2.635  -2.518  1.00 31.89 ? 20  ALA B CA  1 
ATOM   1656 C  C   . ALA B 1 20  ? -16.349 -2.003  -3.567  1.00 32.08 ? 20  ALA B C   1 
ATOM   1657 O  O   . ALA B 1 20  ? -17.114 -2.687  -4.229  1.00 31.20 ? 20  ALA B O   1 
ATOM   1658 C  CB  . ALA B 1 20  ? -13.999 -2.674  -3.059  1.00 31.40 ? 20  ALA B CB  1 
ATOM   1659 N  N   . LYS B 1 21  ? -16.227 -0.692  -3.731  1.00 32.00 ? 21  LYS B N   1 
ATOM   1660 C  CA  . LYS B 1 21  ? -16.945 0.012   -4.770  1.00 32.84 ? 21  LYS B CA  1 
ATOM   1661 C  C   . LYS B 1 21  ? -16.245 -0.383  -6.085  1.00 33.05 ? 21  LYS B C   1 
ATOM   1662 O  O   . LYS B 1 21  ? -15.029 -0.219  -6.210  1.00 33.28 ? 21  LYS B O   1 
ATOM   1663 C  CB  . LYS B 1 21  ? -16.885 1.531   -4.479  1.00 33.64 ? 21  LYS B CB  1 
ATOM   1664 C  CG  . LYS B 1 21  ? -17.094 2.518   -5.647  1.00 35.55 ? 21  LYS B CG  1 
ATOM   1665 C  CD  . LYS B 1 21  ? -18.380 2.265   -6.454  1.00 39.91 ? 21  LYS B CD  1 
ATOM   1666 C  CE  . LYS B 1 21  ? -19.672 2.526   -5.648  1.00 43.91 ? 21  LYS B CE  1 
ATOM   1667 N  NZ  . LYS B 1 21  ? -20.411 3.808   -5.984  1.00 44.86 ? 21  LYS B NZ  1 
ATOM   1668 N  N   . LYS B 1 22  ? -17.005 -0.951  -7.035  1.00 32.22 ? 22  LYS B N   1 
ATOM   1669 C  CA  . LYS B 1 22  ? -16.480 -1.363  -8.348  1.00 32.69 ? 22  LYS B CA  1 
ATOM   1670 C  C   . LYS B 1 22  ? -16.775 -0.375  -9.505  1.00 32.71 ? 22  LYS B C   1 
ATOM   1671 O  O   . LYS B 1 22  ? -17.919 0.108   -9.667  1.00 32.78 ? 22  LYS B O   1 
ATOM   1672 C  CB  . LYS B 1 22  ? -16.971 -2.771  -8.721  1.00 32.57 ? 22  LYS B CB  1 
ATOM   1673 C  CG  . LYS B 1 22  ? -16.345 -3.359  -10.008 1.00 32.85 ? 22  LYS B CG  1 
ATOM   1674 C  CD  . LYS B 1 22  ? -16.813 -4.825  -10.231 1.00 33.45 ? 22  LYS B CD  1 
ATOM   1675 C  CE  . LYS B 1 22  ? -16.310 -5.384  -11.553 1.00 35.11 ? 22  LYS B CE  1 
ATOM   1676 N  NZ  . LYS B 1 22  ? -17.141 -6.557  -12.017 1.00 36.23 ? 22  LYS B NZ  1 
ATOM   1677 N  N   . SER B 1 23  ? -15.744 -0.062  -10.292 1.00 32.91 ? 23  SER B N   1 
ATOM   1678 C  CA  . SER B 1 23  ? -15.879 0.813   -11.465 1.00 32.81 ? 23  SER B CA  1 
ATOM   1679 C  C   . SER B 1 23  ? -15.380 0.102   -12.705 1.00 32.95 ? 23  SER B C   1 
ATOM   1680 O  O   . SER B 1 23  ? -14.343 -0.595  -12.677 1.00 32.98 ? 23  SER B O   1 
ATOM   1681 C  CB  . SER B 1 23  ? -15.082 2.131   -11.330 1.00 32.66 ? 23  SER B CB  1 
ATOM   1682 O  OG  . SER B 1 23  ? -15.561 2.919   -10.284 1.00 34.55 ? 23  SER B OG  1 
ATOM   1683 N  N   . VAL B 1 24  ? -16.108 0.276   -13.795 1.00 32.86 ? 24  VAL B N   1 
ATOM   1684 C  CA  . VAL B 1 24  ? -15.739 -0.343  -15.064 1.00 32.30 ? 24  VAL B CA  1 
ATOM   1685 C  C   . VAL B 1 24  ? -15.507 0.715   -16.148 1.00 32.87 ? 24  VAL B C   1 
ATOM   1686 O  O   . VAL B 1 24  ? -16.343 1.632   -16.356 1.00 31.98 ? 24  VAL B O   1 
ATOM   1687 C  CB  . VAL B 1 24  ? -16.807 -1.381  -15.525 1.00 32.52 ? 24  VAL B CB  1 
ATOM   1688 C  CG1 . VAL B 1 24  ? -16.281 -2.233  -16.682 1.00 32.82 ? 24  VAL B CG1 1 
ATOM   1689 C  CG2 . VAL B 1 24  ? -17.223 -2.266  -14.393 1.00 32.69 ? 24  VAL B CG2 1 
ATOM   1690 N  N   . ARG B 1 25  ? -14.351 0.638   -16.801 1.00 32.23 ? 25  ARG B N   1 
ATOM   1691 C  CA  . ARG B 1 25  ? -14.078 1.487   -17.951 1.00 33.35 ? 25  ARG B CA  1 
ATOM   1692 C  C   . ARG B 1 25  ? -14.048 0.648   -19.188 1.00 32.96 ? 25  ARG B C   1 
ATOM   1693 O  O   . ARG B 1 25  ? -13.145 -0.148  -19.351 1.00 31.84 ? 25  ARG B O   1 
ATOM   1694 C  CB  . ARG B 1 25  ? -12.699 2.139   -17.905 1.00 33.89 ? 25  ARG B CB  1 
ATOM   1695 C  CG  . ARG B 1 25  ? -12.390 3.021   -16.747 1.00 36.89 ? 25  ARG B CG  1 
ATOM   1696 C  CD  . ARG B 1 25  ? -13.039 4.351   -16.839 1.00 43.27 ? 25  ARG B CD  1 
ATOM   1697 N  NE  . ARG B 1 25  ? -14.379 4.276   -16.277 1.00 47.97 ? 25  ARG B NE  1 
ATOM   1698 C  CZ  . ARG B 1 25  ? -14.899 5.219   -15.510 1.00 51.47 ? 25  ARG B CZ  1 
ATOM   1699 N  NH1 . ARG B 1 25  ? -14.176 6.295   -15.221 1.00 51.84 ? 25  ARG B NH1 1 
ATOM   1700 N  NH2 . ARG B 1 25  ? -16.130 5.079   -15.033 1.00 53.53 ? 25  ARG B NH2 1 
ATOM   1701 N  N   . ARG B 1 26  ? -15.019 0.835   -20.071 1.00 33.96 ? 26  ARG B N   1 
ATOM   1702 C  CA  . ARG B 1 26  ? -14.972 0.190   -21.370 1.00 34.39 ? 26  ARG B CA  1 
ATOM   1703 C  C   . ARG B 1 26  ? -14.248 1.177   -22.275 1.00 33.70 ? 26  ARG B C   1 
ATOM   1704 O  O   . ARG B 1 26  ? -14.060 2.354   -21.926 1.00 33.38 ? 26  ARG B O   1 
ATOM   1705 C  CB  . ARG B 1 26  ? -16.374 -0.113  -21.935 1.00 34.94 ? 26  ARG B CB  1 
ATOM   1706 C  CG  . ARG B 1 26  ? -17.275 -0.999  -21.059 1.00 36.22 ? 26  ARG B CG  1 
ATOM   1707 C  CD  . ARG B 1 26  ? -18.338 -1.843  -21.848 1.00 39.47 ? 26  ARG B CD  1 
ATOM   1708 N  NE  . ARG B 1 26  ? -18.792 -3.000  -21.074 1.00 41.81 ? 26  ARG B NE  1 
ATOM   1709 C  CZ  . ARG B 1 26  ? -18.559 -4.283  -21.389 1.00 44.36 ? 26  ARG B CZ  1 
ATOM   1710 N  NH1 . ARG B 1 26  ? -17.866 -4.609  -22.479 1.00 43.71 ? 26  ARG B NH1 1 
ATOM   1711 N  NH2 . ARG B 1 26  ? -19.023 -5.252  -20.598 1.00 44.31 ? 26  ARG B NH2 1 
ATOM   1712 N  N   . LEU B 1 27  ? -13.836 0.698   -23.436 1.00 34.19 ? 27  LEU B N   1 
ATOM   1713 C  CA  . LEU B 1 27  ? -13.163 1.525   -24.433 1.00 34.76 ? 27  LEU B CA  1 
ATOM   1714 C  C   . LEU B 1 27  ? -14.007 2.727   -24.893 1.00 35.38 ? 27  LEU B C   1 
ATOM   1715 O  O   . LEU B 1 27  ? -13.477 3.793   -25.156 1.00 35.07 ? 27  LEU B O   1 
ATOM   1716 C  CB  . LEU B 1 27  ? -12.703 0.659   -25.614 1.00 34.47 ? 27  LEU B CB  1 
ATOM   1717 C  CG  . LEU B 1 27  ? -11.672 1.175   -26.624 1.00 35.04 ? 27  LEU B CG  1 
ATOM   1718 C  CD1 . LEU B 1 27  ? -10.422 1.692   -25.935 1.00 31.79 ? 27  LEU B CD1 1 
ATOM   1719 C  CD2 . LEU B 1 27  ? -11.304 0.075   -27.648 1.00 33.85 ? 27  LEU B CD2 1 
ATOM   1720 N  N   . SER B 1 28  ? -15.325 2.577   -24.937 1.00 36.03 ? 28  SER B N   1 
ATOM   1721 C  CA  . SER B 1 28  ? -16.169 3.712   -25.316 1.00 37.41 ? 28  SER B CA  1 
ATOM   1722 C  C   . SER B 1 28  ? -16.077 4.851   -24.316 1.00 37.71 ? 28  SER B C   1 
ATOM   1723 O  O   . SER B 1 28  ? -16.392 6.006   -24.642 1.00 38.07 ? 28  SER B O   1 
ATOM   1724 C  CB  . SER B 1 28  ? -17.641 3.299   -25.474 1.00 37.55 ? 28  SER B CB  1 
ATOM   1725 O  OG  . SER B 1 28  ? -18.051 2.392   -24.466 1.00 38.51 ? 28  SER B OG  1 
ATOM   1726 N  N   . ASP B 1 29  ? -15.670 4.541   -23.092 1.00 37.73 ? 29  ASP B N   1 
ATOM   1727 C  CA  . ASP B 1 29  ? -15.535 5.572   -22.076 1.00 37.46 ? 29  ASP B CA  1 
ATOM   1728 C  C   . ASP B 1 29  ? -14.205 6.302   -22.256 1.00 37.69 ? 29  ASP B C   1 
ATOM   1729 O  O   . ASP B 1 29  ? -13.895 7.200   -21.479 1.00 37.33 ? 29  ASP B O   1 
ATOM   1730 C  CB  . ASP B 1 29  ? -15.618 4.987   -20.655 1.00 38.05 ? 29  ASP B CB  1 
ATOM   1731 C  CG  . ASP B 1 29  ? -16.903 4.204   -20.402 1.00 39.90 ? 29  ASP B CG  1 
ATOM   1732 O  OD1 . ASP B 1 29  ? -18.012 4.758   -20.609 1.00 42.12 ? 29  ASP B OD1 1 
ATOM   1733 O  OD2 . ASP B 1 29  ? -16.909 3.019   -20.004 1.00 38.87 ? 29  ASP B OD2 1 
ATOM   1734 N  N   . MET B 1 30  ? -13.420 5.936   -23.278 1.00 37.02 ? 30  MET B N   1 
ATOM   1735 C  CA  . MET B 1 30  ? -12.091 6.556   -23.468 1.00 37.26 ? 30  MET B CA  1 
ATOM   1736 C  C   . MET B 1 30  ? -11.825 7.187   -24.841 1.00 37.60 ? 30  MET B C   1 
ATOM   1737 O  O   . MET B 1 30  ? -10.756 7.038   -25.423 1.00 37.16 ? 30  MET B O   1 
ATOM   1738 C  CB  . MET B 1 30  ? -10.961 5.574   -23.126 1.00 36.75 ? 30  MET B CB  1 
ATOM   1739 C  CG  . MET B 1 30  ? -11.055 4.972   -21.739 1.00 36.34 ? 30  MET B CG  1 
ATOM   1740 S  SD  . MET B 1 30  ? -9.802  3.677   -21.453 1.00 31.88 ? 30  MET B SD  1 
ATOM   1741 C  CE  . MET B 1 30  ? -8.246  4.601   -21.553 1.00 29.60 ? 30  MET B CE  1 
ATOM   1742 N  N   . GLU B 1 31  ? -12.803 7.919   -25.343 1.00 39.00 ? 31  GLU B N   1 
ATOM   1743 C  CA  . GLU B 1 31  ? -12.652 8.659   -26.586 1.00 39.30 ? 31  GLU B CA  1 
ATOM   1744 C  C   . GLU B 1 31  ? -11.662 9.819   -26.413 1.00 38.84 ? 31  GLU B C   1 
ATOM   1745 O  O   . GLU B 1 31  ? -11.695 10.531  -25.403 1.00 39.40 ? 31  GLU B O   1 
ATOM   1746 C  CB  . GLU B 1 31  ? -14.034 9.169   -27.005 1.00 39.53 ? 31  GLU B CB  1 
ATOM   1747 C  CG  . GLU B 1 31  ? -14.158 10.662  -27.270 1.00 43.28 ? 31  GLU B CG  1 
ATOM   1748 C  CD  . GLU B 1 31  ? -15.535 10.994  -27.804 1.00 47.09 ? 31  GLU B CD  1 
ATOM   1749 O  OE1 . GLU B 1 31  ? -16.486 10.223  -27.520 1.00 48.55 ? 31  GLU B OE1 1 
ATOM   1750 O  OE2 . GLU B 1 31  ? -15.664 12.009  -28.516 1.00 48.54 ? 31  GLU B OE2 1 
ATOM   1751 N  N   . GLY B 1 32  ? -10.768 9.993   -27.382 1.00 37.61 ? 32  GLY B N   1 
ATOM   1752 C  CA  . GLY B 1 32  ? -9.810  11.081  -27.323 1.00 36.90 ? 32  GLY B CA  1 
ATOM   1753 C  C   . GLY B 1 32  ? -8.498  10.720  -26.641 1.00 36.26 ? 32  GLY B C   1 
ATOM   1754 O  O   . GLY B 1 32  ? -7.562  11.536  -26.565 1.00 36.21 ? 32  GLY B O   1 
ATOM   1755 N  N   . TYR B 1 33  ? -8.424  9.477   -26.171 1.00 34.86 ? 33  TYR B N   1 
ATOM   1756 C  CA  . TYR B 1 33  ? -7.276  9.003   -25.420 1.00 33.87 ? 33  TYR B CA  1 
ATOM   1757 C  C   . TYR B 1 33  ? -6.215  8.309   -26.233 1.00 33.59 ? 33  TYR B C   1 
ATOM   1758 O  O   . TYR B 1 33  ? -5.027  8.464   -25.950 1.00 34.07 ? 33  TYR B O   1 
ATOM   1759 C  CB  . TYR B 1 33  ? -7.750  8.095   -24.294 1.00 33.24 ? 33  TYR B CB  1 
ATOM   1760 C  CG  . TYR B 1 33  ? -8.183  8.895   -23.098 1.00 33.57 ? 33  TYR B CG  1 
ATOM   1761 C  CD1 . TYR B 1 33  ? -9.508  9.276   -22.945 1.00 33.56 ? 33  TYR B CD1 1 
ATOM   1762 C  CD2 . TYR B 1 33  ? -7.259  9.300   -22.133 1.00 32.84 ? 33  TYR B CD2 1 
ATOM   1763 C  CE1 . TYR B 1 33  ? -9.909  10.008  -21.848 1.00 32.90 ? 33  TYR B CE1 1 
ATOM   1764 C  CE2 . TYR B 1 33  ? -7.648  10.037  -21.032 1.00 31.97 ? 33  TYR B CE2 1 
ATOM   1765 C  CZ  . TYR B 1 33  ? -8.969  10.392  -20.904 1.00 33.69 ? 33  TYR B CZ  1 
ATOM   1766 O  OH  . TYR B 1 33  ? -9.375  11.119  -19.828 1.00 34.43 ? 33  TYR B OH  1 
ATOM   1767 N  N   . PHE B 1 34  ? -6.636  7.549   -27.239 1.00 32.54 ? 34  PHE B N   1 
ATOM   1768 C  CA  . PHE B 1 34  ? -5.700  6.804   -28.063 1.00 32.47 ? 34  PHE B CA  1 
ATOM   1769 C  C   . PHE B 1 34  ? -5.346  7.575   -29.354 1.00 32.93 ? 34  PHE B C   1 
ATOM   1770 O  O   . PHE B 1 34  ? -6.193  8.242   -29.965 1.00 31.82 ? 34  PHE B O   1 
ATOM   1771 C  CB  . PHE B 1 34  ? -6.213  5.361   -28.337 1.00 32.12 ? 34  PHE B CB  1 
ATOM   1772 C  CG  . PHE B 1 34  ? -6.335  4.487   -27.084 1.00 30.21 ? 34  PHE B CG  1 
ATOM   1773 C  CD1 . PHE B 1 34  ? -7.501  4.501   -26.315 1.00 28.27 ? 34  PHE B CD1 1 
ATOM   1774 C  CD2 . PHE B 1 34  ? -5.281  3.674   -26.669 1.00 28.90 ? 34  PHE B CD2 1 
ATOM   1775 C  CE1 . PHE B 1 34  ? -7.634  3.742   -25.160 1.00 26.11 ? 34  PHE B CE1 1 
ATOM   1776 C  CE2 . PHE B 1 34  ? -5.400  2.912   -25.523 1.00 28.02 ? 34  PHE B CE2 1 
ATOM   1777 C  CZ  . PHE B 1 34  ? -6.590  2.926   -24.764 1.00 28.62 ? 34  PHE B CZ  1 
ATOM   1778 N  N   . VAL B 1 35  ? -4.081  7.479   -29.742 1.00 33.62 ? 35  VAL B N   1 
ATOM   1779 C  CA  . VAL B 1 35  ? -3.577  8.139   -30.943 1.00 34.99 ? 35  VAL B CA  1 
ATOM   1780 C  C   . VAL B 1 35  ? -4.356  7.749   -32.175 1.00 35.73 ? 35  VAL B C   1 
ATOM   1781 O  O   . VAL B 1 35  ? -4.704  8.596   -32.991 1.00 36.14 ? 35  VAL B O   1 
ATOM   1782 C  CB  . VAL B 1 35  ? -2.095  7.795   -31.158 1.00 34.42 ? 35  VAL B CB  1 
ATOM   1783 C  CG1 . VAL B 1 35  ? -1.566  8.385   -32.458 1.00 36.15 ? 35  VAL B CG1 1 
ATOM   1784 C  CG2 . VAL B 1 35  ? -1.301  8.324   -30.012 1.00 36.48 ? 35  VAL B CG2 1 
ATOM   1785 N  N   . ASP B 1 36  ? -4.665  6.465   -32.296 1.00 36.66 ? 36  ASP B N   1 
ATOM   1786 C  CA  . ASP B 1 36  ? -5.335  5.975   -33.487 1.00 36.84 ? 36  ASP B CA  1 
ATOM   1787 C  C   . ASP B 1 36  ? -6.833  5.979   -33.321 1.00 37.49 ? 36  ASP B C   1 
ATOM   1788 O  O   . ASP B 1 36  ? -7.417  4.962   -32.957 1.00 37.61 ? 36  ASP B O   1 
ATOM   1789 C  CB  . ASP B 1 36  ? -4.855  4.577   -33.812 1.00 36.57 ? 36  ASP B CB  1 
ATOM   1790 C  CG  . ASP B 1 36  ? -5.262  4.142   -35.190 1.00 35.20 ? 36  ASP B CG  1 
ATOM   1791 O  OD1 . ASP B 1 36  ? -6.231  4.723   -35.731 1.00 34.73 ? 36  ASP B OD1 1 
ATOM   1792 O  OD2 . ASP B 1 36  ? -4.675  3.228   -35.793 1.00 33.53 ? 36  ASP B OD2 1 
ATOM   1793 N  N   . GLU B 1 37  ? -7.436  7.124   -33.621 1.00 38.00 ? 37  GLU B N   1 
ATOM   1794 C  CA  . GLU B 1 37  ? -8.875  7.362   -33.441 1.00 39.43 ? 37  GLU B CA  1 
ATOM   1795 C  C   . GLU B 1 37  ? -9.732  6.365   -34.229 1.00 39.22 ? 37  GLU B C   1 
ATOM   1796 O  O   . GLU B 1 37  ? -10.883 6.055   -33.843 1.00 39.74 ? 37  GLU B O   1 
ATOM   1797 C  CB  . GLU B 1 37  ? -9.188  8.791   -33.885 1.00 39.61 ? 37  GLU B CB  1 
ATOM   1798 C  CG  . GLU B 1 37  ? -10.491 9.401   -33.387 1.00 43.27 ? 37  GLU B CG  1 
ATOM   1799 C  CD  . GLU B 1 37  ? -11.585 9.456   -34.449 1.00 48.19 ? 37  GLU B CD  1 
ATOM   1800 O  OE1 . GLU B 1 37  ? -12.712 8.954   -34.168 1.00 49.87 ? 37  GLU B OE1 1 
ATOM   1801 O  OE2 . GLU B 1 37  ? -11.336 9.998   -35.570 1.00 49.50 ? 37  GLU B OE2 1 
ATOM   1802 N  N   . ARG B 1 38  ? -9.178  5.877   -35.332 1.00 38.55 ? 38  ARG B N   1 
ATOM   1803 C  CA  . ARG B 1 38  ? -9.914  4.965   -36.193 1.00 38.89 ? 38  ARG B CA  1 
ATOM   1804 C  C   . ARG B 1 38  ? -9.902  3.574   -35.603 1.00 38.64 ? 38  ARG B C   1 
ATOM   1805 O  O   . ARG B 1 38  ? -10.938 2.891   -35.588 1.00 38.64 ? 38  ARG B O   1 
ATOM   1806 C  CB  . ARG B 1 38  ? -9.379  4.963   -37.625 1.00 38.69 ? 38  ARG B CB  1 
ATOM   1807 C  CG  . ARG B 1 38  ? -9.705  6.230   -38.414 1.00 39.27 ? 38  ARG B CG  1 
ATOM   1808 C  CD  . ARG B 1 38  ? -9.354  6.125   -39.904 1.00 37.45 ? 38  ARG B CD  1 
ATOM   1809 N  NE  . ARG B 1 38  ? -10.266 5.226   -40.612 1.00 34.82 ? 38  ARG B NE  1 
ATOM   1810 C  CZ  . ARG B 1 38  ? -11.488 5.576   -40.991 1.00 34.80 ? 38  ARG B CZ  1 
ATOM   1811 N  NH1 . ARG B 1 38  ? -12.289 4.709   -41.614 1.00 33.66 ? 38  ARG B NH1 1 
ATOM   1812 N  NH2 . ARG B 1 38  ? -11.917 6.792   -40.742 1.00 36.16 ? 38  ARG B NH2 1 
ATOM   1813 N  N   . ALA B 1 39  ? -8.734  3.135   -35.130 1.00 38.19 ? 39  ALA B N   1 
ATOM   1814 C  CA  . ALA B 1 39  ? -8.703  1.869   -34.429 1.00 38.12 ? 39  ALA B CA  1 
ATOM   1815 C  C   . ALA B 1 39  ? -9.583  1.938   -33.169 1.00 37.74 ? 39  ALA B C   1 
ATOM   1816 O  O   . ALA B 1 39  ? -10.286 0.967   -32.860 1.00 37.52 ? 39  ALA B O   1 
ATOM   1817 C  CB  . ALA B 1 39  ? -7.276  1.420   -34.114 1.00 37.72 ? 39  ALA B CB  1 
ATOM   1818 N  N   . TRP B 1 40  ? -9.600  3.084   -32.485 1.00 37.57 ? 40  TRP B N   1 
ATOM   1819 C  CA  . TRP B 1 40  ? -10.456 3.223   -31.304 1.00 38.05 ? 40  TRP B CA  1 
ATOM   1820 C  C   . TRP B 1 40  ? -11.879 2.975   -31.748 1.00 38.70 ? 40  TRP B C   1 
ATOM   1821 O  O   . TRP B 1 40  ? -12.574 2.106   -31.207 1.00 38.55 ? 40  TRP B O   1 
ATOM   1822 C  CB  . TRP B 1 40  ? -10.349 4.615   -30.661 1.00 38.07 ? 40  TRP B CB  1 
ATOM   1823 C  CG  . TRP B 1 40  ? -11.310 4.857   -29.525 1.00 37.69 ? 40  TRP B CG  1 
ATOM   1824 C  CD1 . TRP B 1 40  ? -11.134 4.524   -28.202 1.00 37.41 ? 40  TRP B CD1 1 
ATOM   1825 C  CD2 . TRP B 1 40  ? -12.598 5.505   -29.595 1.00 40.22 ? 40  TRP B CD2 1 
ATOM   1826 N  NE1 . TRP B 1 40  ? -12.224 4.922   -27.458 1.00 38.75 ? 40  TRP B NE1 1 
ATOM   1827 C  CE2 . TRP B 1 40  ? -13.143 5.508   -28.288 1.00 38.47 ? 40  TRP B CE2 1 
ATOM   1828 C  CE3 . TRP B 1 40  ? -13.355 6.068   -30.634 1.00 41.50 ? 40  TRP B CE3 1 
ATOM   1829 C  CZ2 . TRP B 1 40  ? -14.393 6.058   -27.998 1.00 40.71 ? 40  TRP B CZ2 1 
ATOM   1830 C  CZ3 . TRP B 1 40  ? -14.611 6.614   -30.338 1.00 40.88 ? 40  TRP B CZ3 1 
ATOM   1831 C  CH2 . TRP B 1 40  ? -15.111 6.604   -29.039 1.00 41.02 ? 40  TRP B CH2 1 
ATOM   1832 N  N   . LYS B 1 41  ? -12.298 3.733   -32.759 1.00 39.25 ? 41  LYS B N   1 
ATOM   1833 C  CA  . LYS B 1 41  ? -13.652 3.637   -33.266 1.00 39.71 ? 41  LYS B CA  1 
ATOM   1834 C  C   . LYS B 1 41  ? -14.041 2.203   -33.637 1.00 39.69 ? 41  LYS B C   1 
ATOM   1835 O  O   . LYS B 1 41  ? -15.108 1.725   -33.294 1.00 39.60 ? 41  LYS B O   1 
ATOM   1836 C  CB  . LYS B 1 41  ? -13.818 4.542   -34.480 1.00 40.50 ? 41  LYS B CB  1 
ATOM   1837 C  CG  . LYS B 1 41  ? -15.237 4.671   -34.990 1.00 40.19 ? 41  LYS B CG  1 
ATOM   1838 C  CD  . LYS B 1 41  ? -15.189 4.945   -36.487 1.00 42.73 ? 41  LYS B CD  1 
ATOM   1839 C  CE  . LYS B 1 41  ? -14.118 6.003   -36.810 1.00 41.95 ? 41  LYS B CE  1 
ATOM   1840 N  NZ  . LYS B 1 41  ? -13.890 6.178   -38.263 1.00 41.48 ? 41  LYS B NZ  1 
ATOM   1841 N  N   . GLU B 1 42  ? -13.157 1.502   -34.314 1.00 40.07 ? 42  GLU B N   1 
ATOM   1842 C  CA  . GLU B 1 42  ? -13.504 0.188   -34.807 1.00 40.60 ? 42  GLU B CA  1 
ATOM   1843 C  C   . GLU B 1 42  ? -13.582 -0.885  -33.734 1.00 40.17 ? 42  GLU B C   1 
ATOM   1844 O  O   . GLU B 1 42  ? -14.419 -1.805  -33.806 1.00 39.34 ? 42  GLU B O   1 
ATOM   1845 C  CB  . GLU B 1 42  ? -12.502 -0.226  -35.864 1.00 41.02 ? 42  GLU B CB  1 
ATOM   1846 C  CG  . GLU B 1 42  ? -12.859 -1.518  -36.551 1.00 45.07 ? 42  GLU B CG  1 
ATOM   1847 C  CD  . GLU B 1 42  ? -11.682 -2.446  -36.521 1.00 48.18 ? 42  GLU B CD  1 
ATOM   1848 O  OE1 . GLU B 1 42  ? -11.544 -3.159  -35.500 1.00 50.91 ? 42  GLU B OE1 1 
ATOM   1849 O  OE2 . GLU B 1 42  ? -10.882 -2.416  -37.483 1.00 49.47 ? 42  GLU B OE2 1 
ATOM   1850 N  N   . LEU B 1 43  ? -12.702 -0.784  -32.746 1.00 39.45 ? 43  LEU B N   1 
ATOM   1851 C  CA  . LEU B 1 43  ? -12.693 -1.751  -31.657 1.00 39.26 ? 43  LEU B CA  1 
ATOM   1852 C  C   . LEU B 1 43  ? -13.925 -1.547  -30.788 1.00 39.44 ? 43  LEU B C   1 
ATOM   1853 O  O   . LEU B 1 43  ? -14.451 -2.496  -30.232 1.00 39.70 ? 43  LEU B O   1 
ATOM   1854 C  CB  . LEU B 1 43  ? -11.396 -1.639  -30.850 1.00 38.78 ? 43  LEU B CB  1 
ATOM   1855 C  CG  . LEU B 1 43  ? -11.142 -2.660  -29.735 1.00 38.44 ? 43  LEU B CG  1 
ATOM   1856 C  CD1 . LEU B 1 43  ? -11.618 -4.062  -30.133 1.00 36.25 ? 43  LEU B CD1 1 
ATOM   1857 C  CD2 . LEU B 1 43  ? -9.651  -2.669  -29.362 1.00 36.66 ? 43  LEU B CD2 1 
ATOM   1858 N  N   . VAL B 1 44  ? -14.404 -0.312  -30.685 1.00 39.71 ? 44  VAL B N   1 
ATOM   1859 C  CA  . VAL B 1 44  ? -15.623 -0.055  -29.925 1.00 40.80 ? 44  VAL B CA  1 
ATOM   1860 C  C   . VAL B 1 44  ? -16.856 -0.700  -30.587 1.00 41.06 ? 44  VAL B C   1 
ATOM   1861 O  O   . VAL B 1 44  ? -17.667 -1.322  -29.913 1.00 40.86 ? 44  VAL B O   1 
ATOM   1862 C  CB  . VAL B 1 44  ? -15.858 1.436   -29.764 1.00 40.93 ? 44  VAL B CB  1 
ATOM   1863 C  CG1 . VAL B 1 44  ? -17.274 1.696   -29.312 1.00 41.90 ? 44  VAL B CG1 1 
ATOM   1864 C  CG2 . VAL B 1 44  ? -14.862 2.017   -28.774 1.00 42.68 ? 44  VAL B CG2 1 
ATOM   1865 N  N   . GLU B 1 45  ? -16.962 -0.583  -31.912 1.00 42.18 ? 45  GLU B N   1 
ATOM   1866 C  CA  . GLU B 1 45  ? -18.109 -1.121  -32.663 1.00 42.63 ? 45  GLU B CA  1 
ATOM   1867 C  C   . GLU B 1 45  ? -18.162 -2.639  -32.617 1.00 42.34 ? 45  GLU B C   1 
ATOM   1868 O  O   . GLU B 1 45  ? -19.219 -3.236  -32.430 1.00 42.60 ? 45  GLU B O   1 
ATOM   1869 C  CB  . GLU B 1 45  ? -18.018 -0.690  -34.136 1.00 43.01 ? 45  GLU B CB  1 
ATOM   1870 C  CG  . GLU B 1 45  ? -18.140 0.799   -34.362 1.00 45.16 ? 45  GLU B CG  1 
ATOM   1871 C  CD  . GLU B 1 45  ? -19.423 1.349   -33.778 1.00 48.37 ? 45  GLU B CD  1 
ATOM   1872 O  OE1 . GLU B 1 45  ? -20.504 1.071   -34.347 1.00 49.98 ? 45  GLU B OE1 1 
ATOM   1873 O  OE2 . GLU B 1 45  ? -19.348 2.051   -32.747 1.00 51.06 ? 45  GLU B OE2 1 
ATOM   1874 N  N   . LYS B 1 46  ? -16.992 -3.236  -32.807 1.00 42.26 ? 46  LYS B N   1 
ATOM   1875 C  CA  . LYS B 1 46  ? -16.772 -4.672  -32.865 1.00 42.20 ? 46  LYS B CA  1 
ATOM   1876 C  C   . LYS B 1 46  ? -16.951 -5.397  -31.553 1.00 41.86 ? 46  LYS B C   1 
ATOM   1877 O  O   . LYS B 1 46  ? -17.317 -6.584  -31.551 1.00 41.74 ? 46  LYS B O   1 
ATOM   1878 C  CB  . LYS B 1 46  ? -15.309 -4.930  -33.281 1.00 42.86 ? 46  LYS B CB  1 
ATOM   1879 C  CG  . LYS B 1 46  ? -15.022 -6.330  -33.834 1.00 45.03 ? 46  LYS B CG  1 
ATOM   1880 C  CD  . LYS B 1 46  ? -13.801 -6.974  -33.165 1.00 47.47 ? 46  LYS B CD  1 
ATOM   1881 C  CE  . LYS B 1 46  ? -13.305 -8.209  -33.933 1.00 49.05 ? 46  LYS B CE  1 
ATOM   1882 N  NZ  . LYS B 1 46  ? -12.159 -7.911  -34.861 1.00 49.79 ? 46  LYS B NZ  1 
ATOM   1883 N  N   . GLU B 1 47  ? -16.695 -4.694  -30.440 1.00 41.28 ? 47  GLU B N   1 
ATOM   1884 C  CA  . GLU B 1 47  ? -16.562 -5.361  -29.141 1.00 40.30 ? 47  GLU B CA  1 
ATOM   1885 C  C   . GLU B 1 47  ? -16.684 -4.523  -27.863 1.00 38.47 ? 47  GLU B C   1 
ATOM   1886 O  O   . GLU B 1 47  ? -17.007 -5.058  -26.812 1.00 38.65 ? 47  GLU B O   1 
ATOM   1887 C  CB  . GLU B 1 47  ? -15.199 -6.085  -29.142 1.00 40.67 ? 47  GLU B CB  1 
ATOM   1888 C  CG  . GLU B 1 47  ? -14.632 -6.498  -27.785 1.00 43.34 ? 47  GLU B CG  1 
ATOM   1889 C  CD  . GLU B 1 47  ? -13.413 -7.397  -27.932 1.00 45.94 ? 47  GLU B CD  1 
ATOM   1890 O  OE1 . GLU B 1 47  ? -13.070 -8.108  -26.951 1.00 45.27 ? 47  GLU B OE1 1 
ATOM   1891 O  OE2 . GLU B 1 47  ? -12.814 -7.412  -29.045 1.00 48.25 ? 47  GLU B OE2 1 
ATOM   1892 N  N   . ASP B 1 48  ? -16.418 -3.222  -27.958 1.00 36.92 ? 48  ASP B N   1 
ATOM   1893 C  CA  . ASP B 1 48  ? -16.330 -2.326  -26.792 1.00 34.69 ? 48  ASP B CA  1 
ATOM   1894 C  C   . ASP B 1 48  ? -15.777 -2.975  -25.507 1.00 32.73 ? 48  ASP B C   1 
ATOM   1895 O  O   . ASP B 1 48  ? -16.433 -2.957  -24.474 1.00 31.55 ? 48  ASP B O   1 
ATOM   1896 C  CB  . ASP B 1 48  ? -17.664 -1.645  -26.497 1.00 34.30 ? 48  ASP B CB  1 
ATOM   1897 C  CG  . ASP B 1 48  ? -17.478 -0.393  -25.663 1.00 36.39 ? 48  ASP B CG  1 
ATOM   1898 O  OD1 . ASP B 1 48  ? -16.292 0.022   -25.574 1.00 35.40 ? 48  ASP B OD1 1 
ATOM   1899 O  OD2 . ASP B 1 48  ? -18.403 0.232   -25.067 1.00 33.41 ? 48  ASP B OD2 1 
ATOM   1900 N  N   . PRO B 1 49  ? -14.556 -3.519  -25.546 1.00 31.42 ? 49  PRO B N   1 
ATOM   1901 C  CA  . PRO B 1 49  ? -14.032 -4.244  -24.404 1.00 30.87 ? 49  PRO B CA  1 
ATOM   1902 C  C   . PRO B 1 49  ? -13.908 -3.388  -23.155 1.00 29.49 ? 49  PRO B C   1 
ATOM   1903 O  O   . PRO B 1 49  ? -13.786 -2.150  -23.224 1.00 30.07 ? 49  PRO B O   1 
ATOM   1904 C  CB  . PRO B 1 49  ? -12.617 -4.654  -24.878 1.00 31.63 ? 49  PRO B CB  1 
ATOM   1905 C  CG  . PRO B 1 49  ? -12.261 -3.591  -25.887 1.00 31.48 ? 49  PRO B CG  1 
ATOM   1906 C  CD  . PRO B 1 49  ? -13.558 -3.430  -26.627 1.00 30.80 ? 49  PRO B CD  1 
ATOM   1907 N  N   . VAL B 1 50  ? -13.957 -4.072  -22.015 1.00 29.38 ? 50  VAL B N   1 
ATOM   1908 C  CA  . VAL B 1 50  ? -13.637 -3.458  -20.745 1.00 28.16 ? 50  VAL B CA  1 
ATOM   1909 C  C   . VAL B 1 50  ? -12.121 -3.214  -20.776 1.00 27.04 ? 50  VAL B C   1 
ATOM   1910 O  O   . VAL B 1 50  ? -11.319 -4.097  -21.082 1.00 27.05 ? 50  VAL B O   1 
ATOM   1911 C  CB  . VAL B 1 50  ? -14.058 -4.337  -19.539 1.00 29.01 ? 50  VAL B CB  1 
ATOM   1912 C  CG1 . VAL B 1 50  ? -13.466 -3.821  -18.244 1.00 25.93 ? 50  VAL B CG1 1 
ATOM   1913 C  CG2 . VAL B 1 50  ? -15.618 -4.478  -19.435 1.00 28.00 ? 50  VAL B CG2 1 
ATOM   1914 N  N   . VAL B 1 51  ? -11.722 -1.996  -20.503 1.00 25.92 ? 51  VAL B N   1 
ATOM   1915 C  CA  . VAL B 1 51  ? -10.300 -1.690  -20.506 1.00 25.24 ? 51  VAL B CA  1 
ATOM   1916 C  C   . VAL B 1 51  ? -9.743  -1.987  -19.107 1.00 24.20 ? 51  VAL B C   1 
ATOM   1917 O  O   . VAL B 1 51  ? -8.714  -2.672  -18.968 1.00 25.95 ? 51  VAL B O   1 
ATOM   1918 C  CB  . VAL B 1 51  ? -10.006 -0.240  -21.037 1.00 24.04 ? 51  VAL B CB  1 
ATOM   1919 C  CG1 . VAL B 1 51  ? -8.534  0.098   -20.882 1.00 24.11 ? 51  VAL B CG1 1 
ATOM   1920 C  CG2 . VAL B 1 51  ? -10.439 -0.109  -22.540 1.00 23.61 ? 51  VAL B CG2 1 
ATOM   1921 N  N   . TYR B 1 52  ? -10.435 -1.515  -18.078 1.00 24.31 ? 52  TYR B N   1 
ATOM   1922 C  CA  . TYR B 1 52  ? -10.085 -1.790  -16.699 1.00 25.64 ? 52  TYR B CA  1 
ATOM   1923 C  C   . TYR B 1 52  ? -11.265 -1.684  -15.750 1.00 26.11 ? 52  TYR B C   1 
ATOM   1924 O  O   . TYR B 1 52  ? -12.304 -1.084  -16.060 1.00 27.66 ? 52  TYR B O   1 
ATOM   1925 C  CB  . TYR B 1 52  ? -8.914  -0.918  -16.187 1.00 26.56 ? 52  TYR B CB  1 
ATOM   1926 C  CG  . TYR B 1 52  ? -9.105  0.600   -16.266 1.00 27.19 ? 52  TYR B CG  1 
ATOM   1927 C  CD1 . TYR B 1 52  ? -9.284  1.364   -15.113 1.00 30.79 ? 52  TYR B CD1 1 
ATOM   1928 C  CD2 . TYR B 1 52  ? -8.971  1.272   -17.477 1.00 31.62 ? 52  TYR B CD2 1 
ATOM   1929 C  CE1 . TYR B 1 52  ? -9.421  2.770   -15.177 1.00 31.30 ? 52  TYR B CE1 1 
ATOM   1930 C  CE2 . TYR B 1 52  ? -9.109  2.667   -17.556 1.00 31.74 ? 52  TYR B CE2 1 
ATOM   1931 C  CZ  . TYR B 1 52  ? -9.329  3.409   -16.395 1.00 31.49 ? 52  TYR B CZ  1 
ATOM   1932 O  OH  . TYR B 1 52  ? -9.436  4.795   -16.486 1.00 30.28 ? 52  TYR B OH  1 
ATOM   1933 N  N   . GLU B 1 53  ? -11.102 -2.319  -14.613 1.00 26.17 ? 53  GLU B N   1 
ATOM   1934 C  CA  . GLU B 1 53  ? -12.038 -2.262  -13.519 1.00 26.64 ? 53  GLU B CA  1 
ATOM   1935 C  C   . GLU B 1 53  ? -11.233 -1.873  -12.296 1.00 27.00 ? 53  GLU B C   1 
ATOM   1936 O  O   . GLU B 1 53  ? -10.067 -2.309  -12.110 1.00 26.99 ? 53  GLU B O   1 
ATOM   1937 C  CB  . GLU B 1 53  ? -12.712 -3.619  -13.293 1.00 27.30 ? 53  GLU B CB  1 
ATOM   1938 C  CG  . GLU B 1 53  ? -13.402 -4.148  -14.522 1.00 29.33 ? 53  GLU B CG  1 
ATOM   1939 C  CD  . GLU B 1 53  ? -13.830 -5.602  -14.403 1.00 32.51 ? 53  GLU B CD  1 
ATOM   1940 O  OE1 . GLU B 1 53  ? -12.980 -6.478  -14.142 1.00 33.88 ? 53  GLU B OE1 1 
ATOM   1941 O  OE2 . GLU B 1 53  ? -15.029 -5.842  -14.568 1.00 33.89 ? 53  GLU B OE2 1 
ATOM   1942 N  N   . VAL B 1 54  ? -11.866 -1.064  -11.450 1.00 26.23 ? 54  VAL B N   1 
ATOM   1943 C  CA  . VAL B 1 54  ? -11.289 -0.589  -10.212 1.00 25.56 ? 54  VAL B CA  1 
ATOM   1944 C  C   . VAL B 1 54  ? -12.163 -0.981  -9.001  1.00 25.41 ? 54  VAL B C   1 
ATOM   1945 O  O   . VAL B 1 54  ? -13.407 -0.856  -9.029  1.00 26.11 ? 54  VAL B O   1 
ATOM   1946 C  CB  . VAL B 1 54  ? -11.131 0.967   -10.257 1.00 26.23 ? 54  VAL B CB  1 
ATOM   1947 C  CG1 . VAL B 1 54  ? -10.552 1.502   -8.982  1.00 27.53 ? 54  VAL B CG1 1 
ATOM   1948 C  CG2 . VAL B 1 54  ? -10.316 1.425   -11.503 1.00 25.45 ? 54  VAL B CG2 1 
ATOM   1949 N  N   . TYR B 1 55  ? -11.526 -1.509  -7.968  1.00 23.92 ? 55  TYR B N   1 
ATOM   1950 C  CA  . TYR B 1 55  ? -12.181 -1.823  -6.705  1.00 23.93 ? 55  TYR B CA  1 
ATOM   1951 C  C   . TYR B 1 55  ? -11.659 -0.893  -5.636  1.00 23.96 ? 55  TYR B C   1 
ATOM   1952 O  O   . TYR B 1 55  ? -10.530 -1.037  -5.140  1.00 23.02 ? 55  TYR B O   1 
ATOM   1953 C  CB  . TYR B 1 55  ? -11.923 -3.235  -6.304  1.00 23.94 ? 55  TYR B CB  1 
ATOM   1954 C  CG  . TYR B 1 55  ? -12.519 -4.203  -7.256  1.00 23.97 ? 55  TYR B CG  1 
ATOM   1955 C  CD1 . TYR B 1 55  ? -11.794 -4.653  -8.352  1.00 24.00 ? 55  TYR B CD1 1 
ATOM   1956 C  CD2 . TYR B 1 55  ? -13.803 -4.678  -7.057  1.00 28.12 ? 55  TYR B CD2 1 
ATOM   1957 C  CE1 . TYR B 1 55  ? -12.362 -5.567  -9.254  1.00 28.53 ? 55  TYR B CE1 1 
ATOM   1958 C  CE2 . TYR B 1 55  ? -14.353 -5.584  -7.913  1.00 26.35 ? 55  TYR B CE2 1 
ATOM   1959 C  CZ  . TYR B 1 55  ? -13.646 -6.013  -9.007  1.00 27.50 ? 55  TYR B CZ  1 
ATOM   1960 O  OH  . TYR B 1 55  ? -14.216 -6.930  -9.846  1.00 31.48 ? 55  TYR B OH  1 
ATOM   1961 N  N   . ALA B 1 56  ? -12.500 0.051   -5.234  1.00 23.27 ? 56  ALA B N   1 
ATOM   1962 C  CA  . ALA B 1 56  ? -12.011 1.119   -4.385  1.00 24.38 ? 56  ALA B CA  1 
ATOM   1963 C  C   . ALA B 1 56  ? -12.581 1.094   -2.952  1.00 24.16 ? 56  ALA B C   1 
ATOM   1964 O  O   . ALA B 1 56  ? -13.751 0.737   -2.730  1.00 24.03 ? 56  ALA B O   1 
ATOM   1965 C  CB  . ALA B 1 56  ? -12.269 2.490   -5.082  1.00 23.23 ? 56  ALA B CB  1 
ATOM   1966 N  N   . VAL B 1 57  ? -11.722 1.399   -1.985  1.00 23.39 ? 57  VAL B N   1 
ATOM   1967 C  CA  . VAL B 1 57  ? -12.124 1.531   -0.604  1.00 25.20 ? 57  VAL B CA  1 
ATOM   1968 C  C   . VAL B 1 57  ? -11.719 2.966   -0.253  1.00 26.41 ? 57  VAL B C   1 
ATOM   1969 O  O   . VAL B 1 57  ? -10.533 3.264   0.000   1.00 26.71 ? 57  VAL B O   1 
ATOM   1970 C  CB  . VAL B 1 57  ? -11.442 0.527   0.338   1.00 25.71 ? 57  VAL B CB  1 
ATOM   1971 C  CG1 . VAL B 1 57  ? -11.861 0.828   1.814   1.00 23.69 ? 57  VAL B CG1 1 
ATOM   1972 C  CG2 . VAL B 1 57  ? -11.842 -0.885  -0.012  1.00 23.78 ? 57  VAL B CG2 1 
ATOM   1973 N  N   . GLU B 1 58  ? -12.693 3.861   -0.267  1.00 27.77 ? 58  GLU B N   1 
ATOM   1974 C  CA  . GLU B 1 58  ? -12.380 5.280   -0.106  1.00 29.60 ? 58  GLU B CA  1 
ATOM   1975 C  C   . GLU B 1 58  ? -12.950 5.890   1.174   1.00 29.67 ? 58  GLU B C   1 
ATOM   1976 O  O   . GLU B 1 58  ? -13.954 5.438   1.698   1.00 29.85 ? 58  GLU B O   1 
ATOM   1977 C  CB  . GLU B 1 58  ? -12.788 6.061   -1.360  1.00 29.30 ? 58  GLU B CB  1 
ATOM   1978 C  CG  . GLU B 1 58  ? -12.154 5.505   -2.652  1.00 32.83 ? 58  GLU B CG  1 
ATOM   1979 C  CD  . GLU B 1 58  ? -12.335 6.384   -3.900  1.00 37.63 ? 58  GLU B CD  1 
ATOM   1980 O  OE1 . GLU B 1 58  ? -13.485 6.707   -4.258  1.00 37.61 ? 58  GLU B OE1 1 
ATOM   1981 O  OE2 . GLU B 1 58  ? -11.326 6.744   -4.559  1.00 39.91 ? 58  GLU B OE2 1 
ATOM   1982 N  N   . GLN B 1 59  ? -12.250 6.897   1.680   1.00 30.45 ? 59  GLN B N   1 
ATOM   1983 C  CA  . GLN B 1 59  ? -12.629 7.592   2.892   1.00 30.95 ? 59  GLN B CA  1 
ATOM   1984 C  C   . GLN B 1 59  ? -13.054 9.006   2.479   1.00 32.04 ? 59  GLN B C   1 
ATOM   1985 O  O   . GLN B 1 59  ? -12.945 9.395   1.326   1.00 32.56 ? 59  GLN B O   1 
ATOM   1986 C  CB  . GLN B 1 59  ? -11.439 7.684   3.862   1.00 29.67 ? 59  GLN B CB  1 
ATOM   1987 C  CG  . GLN B 1 59  ? -10.831 6.333   4.273   1.00 27.94 ? 59  GLN B CG  1 
ATOM   1988 C  CD  . GLN B 1 59  ? -11.811 5.433   5.000   1.00 29.20 ? 59  GLN B CD  1 
ATOM   1989 O  OE1 . GLN B 1 59  ? -12.577 5.895   5.838   1.00 28.02 ? 59  GLN B OE1 1 
ATOM   1990 N  NE2 . GLN B 1 59  ? -11.757 4.120   4.714   1.00 29.88 ? 59  GLN B NE2 1 
ATOM   1991 N  N   . GLU B 1 60  ? -13.550 9.783   3.425   1.00 34.10 ? 60  GLU B N   1 
ATOM   1992 C  CA  . GLU B 1 60  ? -13.891 11.148  3.089   1.00 36.27 ? 60  GLU B CA  1 
ATOM   1993 C  C   . GLU B 1 60  ? -12.613 11.898  2.744   1.00 36.47 ? 60  GLU B C   1 
ATOM   1994 O  O   . GLU B 1 60  ? -11.538 11.493  3.171   1.00 36.95 ? 60  GLU B O   1 
ATOM   1995 C  CB  . GLU B 1 60  ? -14.661 11.788  4.250   1.00 36.95 ? 60  GLU B CB  1 
ATOM   1996 C  CG  . GLU B 1 60  ? -15.978 11.062  4.458   1.00 41.45 ? 60  GLU B CG  1 
ATOM   1997 C  CD  . GLU B 1 60  ? -16.902 11.750  5.440   1.00 46.27 ? 60  GLU B CD  1 
ATOM   1998 O  OE1 . GLU B 1 60  ? -16.436 12.655  6.169   1.00 48.53 ? 60  GLU B OE1 1 
ATOM   1999 O  OE2 . GLU B 1 60  ? -18.099 11.373  5.477   1.00 49.63 ? 60  GLU B OE2 1 
ATOM   2000 N  N   . GLU B 1 61  ? -12.729 12.970  1.965   1.00 37.22 ? 61  GLU B N   1 
ATOM   2001 C  CA  . GLU B 1 61  ? -11.551 13.758  1.565   1.00 38.71 ? 61  GLU B CA  1 
ATOM   2002 C  C   . GLU B 1 61  ? -11.001 14.657  2.659   1.00 38.66 ? 61  GLU B C   1 
ATOM   2003 O  O   . GLU B 1 61  ? -11.183 15.885  2.637   1.00 39.98 ? 61  GLU B O   1 
ATOM   2004 C  CB  . GLU B 1 61  ? -11.820 14.586  0.305   1.00 38.25 ? 61  GLU B CB  1 
ATOM   2005 C  CG  . GLU B 1 61  ? -12.601 13.849  -0.773  1.00 42.85 ? 61  GLU B CG  1 
ATOM   2006 C  CD  . GLU B 1 61  ? -12.760 14.640  -2.058  1.00 45.98 ? 61  GLU B CD  1 
ATOM   2007 O  OE1 . GLU B 1 61  ? -11.740 15.097  -2.638  1.00 49.00 ? 61  GLU B OE1 1 
ATOM   2008 O  OE2 . GLU B 1 61  ? -13.915 14.810  -2.489  1.00 49.06 ? 61  GLU B OE2 1 
ATOM   2009 N  N   . LYS B 1 62  ? -10.311 14.057  3.606   1.00 38.38 ? 62  LYS B N   1 
ATOM   2010 C  CA  . LYS B 1 62  ? -9.691  14.804  4.668   1.00 37.58 ? 62  LYS B CA  1 
ATOM   2011 C  C   . LYS B 1 62  ? -8.208  14.666  4.554   1.00 36.55 ? 62  LYS B C   1 
ATOM   2012 O  O   . LYS B 1 62  ? -7.721  13.655  4.056   1.00 36.37 ? 62  LYS B O   1 
ATOM   2013 C  CB  . LYS B 1 62  ? -10.128 14.259  6.019   1.00 38.06 ? 62  LYS B CB  1 
ATOM   2014 C  CG  . LYS B 1 62  ? -11.359 14.921  6.557   1.00 40.91 ? 62  LYS B CG  1 
ATOM   2015 C  CD  . LYS B 1 62  ? -12.224 13.919  7.288   1.00 43.72 ? 62  LYS B CD  1 
ATOM   2016 C  CE  . LYS B 1 62  ? -13.613 14.505  7.534   1.00 44.17 ? 62  LYS B CE  1 
ATOM   2017 N  NZ  . LYS B 1 62  ? -14.243 13.964  8.790   1.00 44.01 ? 62  LYS B NZ  1 
ATOM   2018 N  N   . GLU B 1 63  ? -7.482  15.670  5.033   1.00 34.96 ? 63  GLU B N   1 
ATOM   2019 C  CA  . GLU B 1 63  ? -6.033  15.584  5.066   1.00 33.90 ? 63  GLU B CA  1 
ATOM   2020 C  C   . GLU B 1 63  ? -5.508  14.453  5.948   1.00 31.94 ? 63  GLU B C   1 
ATOM   2021 O  O   . GLU B 1 63  ? -6.007  14.219  7.012   1.00 32.16 ? 63  GLU B O   1 
ATOM   2022 C  CB  . GLU B 1 63  ? -5.425  16.924  5.525   1.00 34.29 ? 63  GLU B CB  1 
ATOM   2023 C  CG  . GLU B 1 63  ? -5.496  17.983  4.438   1.00 37.37 ? 63  GLU B CG  1 
ATOM   2024 C  CD  . GLU B 1 63  ? -4.923  19.318  4.885   1.00 41.93 ? 63  GLU B CD  1 
ATOM   2025 O  OE1 . GLU B 1 63  ? -4.334  19.380  6.001   1.00 41.49 ? 63  GLU B OE1 1 
ATOM   2026 O  OE2 . GLU B 1 63  ? -5.062  20.293  4.111   1.00 43.22 ? 63  GLU B OE2 1 
ATOM   2027 N  N   . GLY B 1 64  ? -4.482  13.761  5.489   1.00 30.53 ? 64  GLY B N   1 
ATOM   2028 C  CA  . GLY B 1 64  ? -3.909  12.672  6.248   1.00 29.38 ? 64  GLY B CA  1 
ATOM   2029 C  C   . GLY B 1 64  ? -4.615  11.323  6.185   1.00 28.82 ? 64  GLY B C   1 
ATOM   2030 O  O   . GLY B 1 64  ? -4.077  10.339  6.704   1.00 29.52 ? 64  GLY B O   1 
ATOM   2031 N  N   . ASP B 1 65  ? -5.794  11.249  5.574   1.00 27.77 ? 65  ASP B N   1 
ATOM   2032 C  CA  . ASP B 1 65  ? -6.493  9.964   5.550   1.00 27.18 ? 65  ASP B CA  1 
ATOM   2033 C  C   . ASP B 1 65  ? -6.059  9.241   4.280   1.00 25.30 ? 65  ASP B C   1 
ATOM   2034 O  O   . ASP B 1 65  ? -5.369  9.815   3.447   1.00 24.96 ? 65  ASP B O   1 
ATOM   2035 C  CB  . ASP B 1 65  ? -8.003  10.142  5.578   1.00 28.24 ? 65  ASP B CB  1 
ATOM   2036 C  CG  . ASP B 1 65  ? -8.711  9.034   6.315   1.00 29.73 ? 65  ASP B CG  1 
ATOM   2037 O  OD1 . ASP B 1 65  ? -8.134  7.935   6.453   1.00 32.56 ? 65  ASP B OD1 1 
ATOM   2038 O  OD2 . ASP B 1 65  ? -9.868  9.163   6.791   1.00 30.33 ? 65  ASP B OD2 1 
ATOM   2039 N  N   . LEU B 1 66  ? -6.473  7.987   4.115   1.00 23.84 ? 66  LEU B N   1 
ATOM   2040 C  CA  . LEU B 1 66  ? -5.983  7.264   2.943   1.00 22.52 ? 66  LEU B CA  1 
ATOM   2041 C  C   . LEU B 1 66  ? -7.039  6.402   2.329   1.00 20.96 ? 66  LEU B C   1 
ATOM   2042 O  O   . LEU B 1 66  ? -7.831  5.793   3.050   1.00 21.48 ? 66  LEU B O   1 
ATOM   2043 C  CB  . LEU B 1 66  ? -4.873  6.314   3.374   1.00 22.01 ? 66  LEU B CB  1 
ATOM   2044 C  CG  . LEU B 1 66  ? -3.527  6.958   3.733   1.00 22.23 ? 66  LEU B CG  1 
ATOM   2045 C  CD1 . LEU B 1 66  ? -2.596  5.940   4.435   1.00 21.77 ? 66  LEU B CD1 1 
ATOM   2046 C  CD2 . LEU B 1 66  ? -2.920  7.565   2.483   1.00 21.48 ? 66  LEU B CD2 1 
ATOM   2047 N  N   . ASN B 1 67  ? -6.974  6.342   1.014   1.00 22.11 ? 67  ASN B N   1 
ATOM   2048 C  CA  . ASN B 1 67  ? -7.787  5.476   0.191   1.00 22.63 ? 67  ASN B CA  1 
ATOM   2049 C  C   . ASN B 1 67  ? -6.896  4.390   -0.414  1.00 22.76 ? 67  ASN B C   1 
ATOM   2050 O  O   . ASN B 1 67  ? -5.683  4.545   -0.523  1.00 22.55 ? 67  ASN B O   1 
ATOM   2051 C  CB  . ASN B 1 67  ? -8.375  6.287   -0.950  1.00 23.76 ? 67  ASN B CB  1 
ATOM   2052 C  CG  . ASN B 1 67  ? -9.407  7.301   -0.455  1.00 24.81 ? 67  ASN B CG  1 
ATOM   2053 O  OD1 . ASN B 1 67  ? -9.830  7.232   0.704   1.00 25.32 ? 67  ASN B OD1 1 
ATOM   2054 N  ND2 . ASN B 1 67  ? -9.803  8.223   -1.321  1.00 27.94 ? 67  ASN B ND2 1 
ATOM   2055 N  N   . PHE B 1 68  ? -7.534  3.321   -0.868  1.00 20.91 ? 68  PHE B N   1 
ATOM   2056 C  CA  . PHE B 1 68  ? -6.797  2.274   -1.559  1.00 21.62 ? 68  PHE B CA  1 
ATOM   2057 C  C   . PHE B 1 68  ? -7.727  1.599   -2.533  1.00 20.56 ? 68  PHE B C   1 
ATOM   2058 O  O   . PHE B 1 68  ? -8.940  1.542   -2.333  1.00 22.19 ? 68  PHE B O   1 
ATOM   2059 C  CB  . PHE B 1 68  ? -6.123  1.320   -0.620  1.00 18.81 ? 68  PHE B CB  1 
ATOM   2060 C  CG  . PHE B 1 68  ? -7.063  0.493   0.249   1.00 21.75 ? 68  PHE B CG  1 
ATOM   2061 C  CD1 . PHE B 1 68  ? -7.508  -0.758  -0.168  1.00 20.76 ? 68  PHE B CD1 1 
ATOM   2062 C  CD2 . PHE B 1 68  ? -7.440  0.926   1.508   1.00 20.08 ? 68  PHE B CD2 1 
ATOM   2063 C  CE1 . PHE B 1 68  ? -8.331  -1.531  0.680   1.00 24.25 ? 68  PHE B CE1 1 
ATOM   2064 C  CE2 . PHE B 1 68  ? -8.265  0.165   2.352   1.00 19.04 ? 68  PHE B CE2 1 
ATOM   2065 C  CZ  . PHE B 1 68  ? -8.733  -1.059  1.920   1.00 20.47 ? 68  PHE B CZ  1 
ATOM   2066 N  N   . ALA B 1 69  ? -7.154  1.151   -3.629  1.00 20.77 ? 69  ALA B N   1 
ATOM   2067 C  CA  . ALA B 1 69  ? -7.938  0.605   -4.723  1.00 19.35 ? 69  ALA B CA  1 
ATOM   2068 C  C   . ALA B 1 69  ? -7.082  -0.382  -5.464  1.00 19.11 ? 69  ALA B C   1 
ATOM   2069 O  O   . ALA B 1 69  ? -5.875  -0.159  -5.627  1.00 19.32 ? 69  ALA B O   1 
ATOM   2070 C  CB  . ALA B 1 69  ? -8.391  1.647   -5.687  1.00 17.78 ? 69  ALA B CB  1 
ATOM   2071 N  N   . THR B 1 70  ? -7.696  -1.499  -5.850  1.00 18.85 ? 70  THR B N   1 
ATOM   2072 C  CA  . THR B 1 70  ? -7.069  -2.304  -6.906  1.00 19.78 ? 70  THR B CA  1 
ATOM   2073 C  C   . THR B 1 70  ? -7.616  -1.939  -8.297  1.00 19.68 ? 70  THR B C   1 
ATOM   2074 O  O   . THR B 1 70  ? -8.758  -1.501  -8.456  1.00 20.38 ? 70  THR B O   1 
ATOM   2075 C  CB  . THR B 1 70  ? -7.292  -3.823  -6.685  1.00 19.71 ? 70  THR B CB  1 
ATOM   2076 O  OG1 . THR B 1 70  ? -8.696  -4.133  -6.593  1.00 19.80 ? 70  THR B OG1 1 
ATOM   2077 C  CG2 . THR B 1 70  ? -6.721  -4.258  -5.395  1.00 20.71 ? 70  THR B CG2 1 
ATOM   2078 N  N   . THR B 1 71  ? -6.805  -2.171  -9.322  1.00 19.69 ? 71  THR B N   1 
ATOM   2079 C  CA  . THR B 1 71  ? -7.171  -2.006  -10.687 1.00 20.28 ? 71  THR B CA  1 
ATOM   2080 C  C   . THR B 1 71  ? -6.796  -3.323  -11.366 1.00 22.02 ? 71  THR B C   1 
ATOM   2081 O  O   . THR B 1 71  ? -5.753  -3.921  -11.064 1.00 20.40 ? 71  THR B O   1 
ATOM   2082 C  CB  . THR B 1 71  ? -6.385  -0.862  -11.357 1.00 21.30 ? 71  THR B CB  1 
ATOM   2083 O  OG1 . THR B 1 71  ? -6.753  0.398   -10.751 1.00 19.58 ? 71  THR B OG1 1 
ATOM   2084 C  CG2 . THR B 1 71  ? -6.726  -0.735  -12.910 1.00 20.85 ? 71  THR B CG2 1 
ATOM   2085 N  N   . VAL B 1 72  ? -7.715  -3.769  -12.198 1.00 21.97 ? 72  VAL B N   1 
ATOM   2086 C  CA  . VAL B 1 72  ? -7.488  -4.887  -13.110 1.00 23.08 ? 72  VAL B CA  1 
ATOM   2087 C  C   . VAL B 1 72  ? -7.509  -4.253  -14.481 1.00 23.19 ? 72  VAL B C   1 
ATOM   2088 O  O   . VAL B 1 72  ? -8.576  -3.937  -15.038 1.00 24.36 ? 72  VAL B O   1 
ATOM   2089 C  CB  . VAL B 1 72  ? -8.611  -5.937  -12.983 1.00 22.43 ? 72  VAL B CB  1 
ATOM   2090 C  CG1 . VAL B 1 72  ? -8.311  -7.102  -13.931 1.00 22.46 ? 72  VAL B CG1 1 
ATOM   2091 C  CG2 . VAL B 1 72  ? -8.718  -6.431  -11.542 1.00 22.86 ? 72  VAL B CG2 1 
ATOM   2092 N  N   . LEU B 1 73  ? -6.334  -4.072  -15.061 1.00 23.83 ? 73  LEU B N   1 
ATOM   2093 C  CA  . LEU B 1 73  ? -6.183  -3.427  -16.343 1.00 22.92 ? 73  LEU B CA  1 
ATOM   2094 C  C   . LEU B 1 73  ? -6.059  -4.547  -17.362 1.00 24.28 ? 73  LEU B C   1 
ATOM   2095 O  O   . LEU B 1 73  ? -5.077  -5.284  -17.339 1.00 24.15 ? 73  LEU B O   1 
ATOM   2096 C  CB  . LEU B 1 73  ? -4.875  -2.652  -16.336 1.00 21.30 ? 73  LEU B CB  1 
ATOM   2097 C  CG  . LEU B 1 73  ? -4.609  -1.448  -17.256 1.00 25.18 ? 73  LEU B CG  1 
ATOM   2098 C  CD1 . LEU B 1 73  ? -3.069  -1.122  -17.447 1.00 22.88 ? 73  LEU B CD1 1 
ATOM   2099 C  CD2 . LEU B 1 73  ? -5.373  -1.211  -18.543 1.00 23.80 ? 73  LEU B CD2 1 
ATOM   2100 N  N   . TYR B 1 74  ? -7.070  -4.696  -18.212 1.00 24.63 ? 74  TYR B N   1 
ATOM   2101 C  CA  . TYR B 1 74  ? -7.093  -5.797  -19.174 1.00 26.30 ? 74  TYR B CA  1 
ATOM   2102 C  C   . TYR B 1 74  ? -6.102  -5.695  -20.329 1.00 26.22 ? 74  TYR B C   1 
ATOM   2103 O  O   . TYR B 1 74  ? -5.658  -4.623  -20.748 1.00 24.33 ? 74  TYR B O   1 
ATOM   2104 C  CB  . TYR B 1 74  ? -8.533  -6.035  -19.654 1.00 26.57 ? 74  TYR B CB  1 
ATOM   2105 C  CG  . TYR B 1 74  ? -9.404  -6.589  -18.553 1.00 26.65 ? 74  TYR B CG  1 
ATOM   2106 C  CD1 . TYR B 1 74  ? -9.465  -7.959  -18.294 1.00 27.24 ? 74  TYR B CD1 1 
ATOM   2107 C  CD2 . TYR B 1 74  ? -10.154 -5.748  -17.731 1.00 26.46 ? 74  TYR B CD2 1 
ATOM   2108 C  CE1 . TYR B 1 74  ? -10.256 -8.472  -17.259 1.00 29.67 ? 74  TYR B CE1 1 
ATOM   2109 C  CE2 . TYR B 1 74  ? -10.936 -6.257  -16.699 1.00 26.98 ? 74  TYR B CE2 1 
ATOM   2110 C  CZ  . TYR B 1 74  ? -11.015 -7.619  -16.478 1.00 26.20 ? 74  TYR B CZ  1 
ATOM   2111 O  OH  . TYR B 1 74  ? -11.770 -8.122  -15.440 1.00 25.65 ? 74  TYR B OH  1 
ATOM   2112 N  N   . PRO B 1 75  ? -5.700  -6.831  -20.855 1.00 27.04 ? 75  PRO B N   1 
ATOM   2113 C  CA  . PRO B 1 75  ? -4.754  -6.809  -21.974 1.00 28.15 ? 75  PRO B CA  1 
ATOM   2114 C  C   . PRO B 1 75  ? -5.411  -6.368  -23.278 1.00 28.64 ? 75  PRO B C   1 
ATOM   2115 O  O   . PRO B 1 75  ? -6.580  -6.703  -23.531 1.00 29.16 ? 75  PRO B O   1 
ATOM   2116 C  CB  . PRO B 1 75  ? -4.332  -8.264  -22.087 1.00 29.06 ? 75  PRO B CB  1 
ATOM   2117 C  CG  . PRO B 1 75  ? -5.490  -9.045  -21.565 1.00 27.63 ? 75  PRO B CG  1 
ATOM   2118 C  CD  . PRO B 1 75  ? -6.068  -8.193  -20.430 1.00 28.30 ? 75  PRO B CD  1 
ATOM   2119 N  N   . GLY B 1 76  ? -4.670  -5.627  -24.093 1.00 28.36 ? 76  GLY B N   1 
ATOM   2120 C  CA  . GLY B 1 76  ? -5.169  -5.163  -25.370 1.00 29.54 ? 76  GLY B CA  1 
ATOM   2121 C  C   . GLY B 1 76  ? -4.366  -4.054  -26.018 1.00 30.18 ? 76  GLY B C   1 
ATOM   2122 O  O   . GLY B 1 76  ? -3.425  -3.538  -25.418 1.00 30.33 ? 76  GLY B O   1 
ATOM   2123 N  N   . LYS B 1 77  ? -4.751  -3.714  -27.249 1.00 30.11 ? 77  LYS B N   1 
ATOM   2124 C  CA  . LYS B 1 77  ? -4.153  -2.633  -28.020 1.00 31.27 ? 77  LYS B CA  1 
ATOM   2125 C  C   . LYS B 1 77  ? -5.192  -1.793  -28.751 1.00 31.39 ? 77  LYS B C   1 
ATOM   2126 O  O   . LYS B 1 77  ? -6.268  -2.262  -29.094 1.00 31.08 ? 77  LYS B O   1 
ATOM   2127 C  CB  . LYS B 1 77  ? -3.146  -3.201  -29.016 1.00 30.70 ? 77  LYS B CB  1 
ATOM   2128 C  CG  . LYS B 1 77  ? -1.873  -3.747  -28.378 1.00 31.35 ? 77  LYS B CG  1 
ATOM   2129 C  CD  . LYS B 1 77  ? -0.921  -4.354  -29.424 1.00 35.71 ? 77  LYS B CD  1 
ATOM   2130 C  CE  . LYS B 1 77  ? -1.541  -5.589  -30.101 1.00 38.41 ? 77  LYS B CE  1 
ATOM   2131 N  NZ  . LYS B 1 77  ? -1.163  -6.892  -29.451 1.00 40.92 ? 77  LYS B NZ  1 
ATOM   2132 N  N   . VAL B 1 78  ? -4.902  -0.513  -28.943 1.00 31.89 ? 78  VAL B N   1 
ATOM   2133 C  CA  . VAL B 1 78  ? -5.753  0.307   -29.780 1.00 31.87 ? 78  VAL B CA  1 
ATOM   2134 C  C   . VAL B 1 78  ? -4.772  0.710   -30.848 1.00 31.99 ? 78  VAL B C   1 
ATOM   2135 O  O   . VAL B 1 78  ? -3.861  1.491   -30.608 1.00 31.19 ? 78  VAL B O   1 
ATOM   2136 C  CB  . VAL B 1 78  ? -6.374  1.512   -29.035 1.00 31.65 ? 78  VAL B CB  1 
ATOM   2137 C  CG1 . VAL B 1 78  ? -7.205  2.394   -30.000 1.00 30.21 ? 78  VAL B CG1 1 
ATOM   2138 C  CG2 . VAL B 1 78  ? -7.234  1.011   -27.882 1.00 32.57 ? 78  VAL B CG2 1 
ATOM   2139 N  N   . GLY B 1 79  ? -4.946  0.139   -32.036 1.00 32.87 ? 79  GLY B N   1 
ATOM   2140 C  CA  . GLY B 1 79  ? -3.974  0.310   -33.101 1.00 32.58 ? 79  GLY B CA  1 
ATOM   2141 C  C   . GLY B 1 79  ? -2.744  -0.377  -32.534 1.00 32.53 ? 79  GLY B C   1 
ATOM   2142 O  O   . GLY B 1 79  ? -2.801  -1.543  -32.132 1.00 34.46 ? 79  GLY B O   1 
ATOM   2143 N  N   . LYS B 1 80  ? -1.640  0.364   -32.455 1.00 32.67 ? 80  LYS B N   1 
ATOM   2144 C  CA  . LYS B 1 80  ? -0.411  -0.137  -31.851 1.00 32.52 ? 80  LYS B CA  1 
ATOM   2145 C  C   . LYS B 1 80  ? -0.288  0.190   -30.363 1.00 31.40 ? 80  LYS B C   1 
ATOM   2146 O  O   . LYS B 1 80  ? 0.583   -0.330  -29.726 1.00 30.36 ? 80  LYS B O   1 
ATOM   2147 C  CB  . LYS B 1 80  ? 0.820   0.429   -32.575 1.00 33.67 ? 80  LYS B CB  1 
ATOM   2148 C  CG  . LYS B 1 80  ? 0.986   -0.030  -34.029 1.00 36.61 ? 80  LYS B CG  1 
ATOM   2149 C  CD  . LYS B 1 80  ? 1.982   0.887   -34.738 1.00 41.09 ? 80  LYS B CD  1 
ATOM   2150 C  CE  . LYS B 1 80  ? 2.628   0.188   -35.942 1.00 43.62 ? 80  LYS B CE  1 
ATOM   2151 N  NZ  . LYS B 1 80  ? 3.820   0.953   -36.429 1.00 45.73 ? 80  LYS B NZ  1 
ATOM   2152 N  N   . GLU B 1 81  ? -1.127  1.085   -29.827 1.00 30.17 ? 81  GLU B N   1 
ATOM   2153 C  CA  . GLU B 1 81  ? -1.048  1.455   -28.407 1.00 29.36 ? 81  GLU B CA  1 
ATOM   2154 C  C   . GLU B 1 81  ? -1.647  0.463   -27.401 1.00 28.42 ? 81  GLU B C   1 
ATOM   2155 O  O   . GLU B 1 81  ? -2.832  0.107   -27.503 1.00 27.76 ? 81  GLU B O   1 
ATOM   2156 C  CB  . GLU B 1 81  ? -1.809  2.750   -28.228 1.00 30.16 ? 81  GLU B CB  1 
ATOM   2157 C  CG  . GLU B 1 81  ? -0.984  3.854   -27.656 1.00 30.88 ? 81  GLU B CG  1 
ATOM   2158 C  CD  . GLU B 1 81  ? -1.738  5.154   -27.662 1.00 33.25 ? 81  GLU B CD  1 
ATOM   2159 O  OE1 . GLU B 1 81  ? -2.762  5.260   -28.375 1.00 29.45 ? 81  GLU B OE1 1 
ATOM   2160 O  OE2 . GLU B 1 81  ? -1.291  6.068   -26.946 1.00 35.05 ? 81  GLU B OE2 1 
ATOM   2161 N  N   . PHE B 1 82  ? -0.861  0.062   -26.400 1.00 27.68 ? 82  PHE B N   1 
ATOM   2162 C  CA  . PHE B 1 82  ? -1.348  -0.808  -25.322 1.00 27.66 ? 82  PHE B CA  1 
ATOM   2163 C  C   . PHE B 1 82  ? -2.433  -0.150  -24.494 1.00 27.12 ? 82  PHE B C   1 
ATOM   2164 O  O   . PHE B 1 82  ? -2.374  1.057   -24.290 1.00 26.62 ? 82  PHE B O   1 
ATOM   2165 C  CB  . PHE B 1 82  ? -0.224  -1.149  -24.364 1.00 27.80 ? 82  PHE B CB  1 
ATOM   2166 C  CG  . PHE B 1 82  ? 0.768   -2.084  -24.943 1.00 29.56 ? 82  PHE B CG  1 
ATOM   2167 C  CD1 . PHE B 1 82  ? 2.037   -1.648  -25.273 1.00 32.43 ? 82  PHE B CD1 1 
ATOM   2168 C  CD2 . PHE B 1 82  ? 0.416   -3.401  -25.184 1.00 32.29 ? 82  PHE B CD2 1 
ATOM   2169 C  CE1 . PHE B 1 82  ? 2.960   -2.514  -25.815 1.00 33.14 ? 82  PHE B CE1 1 
ATOM   2170 C  CE2 . PHE B 1 82  ? 1.318   -4.261  -25.698 1.00 30.83 ? 82  PHE B CE2 1 
ATOM   2171 C  CZ  . PHE B 1 82  ? 2.602   -3.809  -26.020 1.00 31.19 ? 82  PHE B CZ  1 
ATOM   2172 N  N   . PHE B 1 83  ? -3.391  -0.958  -24.049 1.00 25.74 ? 83  PHE B N   1 
ATOM   2173 C  CA  . PHE B 1 83  ? -4.439  -0.553  -23.125 1.00 25.49 ? 83  PHE B CA  1 
ATOM   2174 C  C   . PHE B 1 83  ? -3.838  0.123   -21.898 1.00 24.16 ? 83  PHE B C   1 
ATOM   2175 O  O   . PHE B 1 83  ? -2.852  -0.337  -21.315 1.00 21.59 ? 83  PHE B O   1 
ATOM   2176 C  CB  . PHE B 1 83  ? -5.263  -1.773  -22.646 1.00 26.38 ? 83  PHE B CB  1 
ATOM   2177 C  CG  . PHE B 1 83  ? -6.423  -2.185  -23.579 1.00 24.16 ? 83  PHE B CG  1 
ATOM   2178 C  CD1 . PHE B 1 83  ? -6.533  -1.697  -24.887 1.00 24.66 ? 83  PHE B CD1 1 
ATOM   2179 C  CD2 . PHE B 1 83  ? -7.405  -3.076  -23.128 1.00 25.47 ? 83  PHE B CD2 1 
ATOM   2180 C  CE1 . PHE B 1 83  ? -7.573  -2.097  -25.720 1.00 26.20 ? 83  PHE B CE1 1 
ATOM   2181 C  CE2 . PHE B 1 83  ? -8.453  -3.495  -23.975 1.00 24.90 ? 83  PHE B CE2 1 
ATOM   2182 C  CZ  . PHE B 1 83  ? -8.545  -2.996  -25.253 1.00 25.65 ? 83  PHE B CZ  1 
ATOM   2183 N  N   . PHE B 1 84  ? -4.499  1.168   -21.432 1.00 25.10 ? 84  PHE B N   1 
ATOM   2184 C  CA  . PHE B 1 84  ? -3.944  1.906   -20.310 1.00 25.21 ? 84  PHE B CA  1 
ATOM   2185 C  C   . PHE B 1 84  ? -5.069  2.586   -19.553 1.00 24.35 ? 84  PHE B C   1 
ATOM   2186 O  O   . PHE B 1 84  ? -6.194  2.558   -19.999 1.00 24.05 ? 84  PHE B O   1 
ATOM   2187 C  CB  . PHE B 1 84  ? -2.908  2.936   -20.792 1.00 24.01 ? 84  PHE B CB  1 
ATOM   2188 C  CG  . PHE B 1 84  ? -3.428  3.957   -21.823 1.00 26.16 ? 84  PHE B CG  1 
ATOM   2189 C  CD1 . PHE B 1 84  ? -4.568  4.731   -21.608 1.00 23.76 ? 84  PHE B CD1 1 
ATOM   2190 C  CD2 . PHE B 1 84  ? -2.719  4.157   -22.998 1.00 26.15 ? 84  PHE B CD2 1 
ATOM   2191 C  CE1 . PHE B 1 84  ? -4.991  5.648   -22.539 1.00 27.99 ? 84  PHE B CE1 1 
ATOM   2192 C  CE2 . PHE B 1 84  ? -3.170  5.090   -23.979 1.00 30.74 ? 84  PHE B CE2 1 
ATOM   2193 C  CZ  . PHE B 1 84  ? -4.306  5.840   -23.726 1.00 29.45 ? 84  PHE B CZ  1 
ATOM   2194 N  N   . THR B 1 85  ? -4.753  3.147   -18.400 1.00 23.97 ? 85  THR B N   1 
ATOM   2195 C  CA  . THR B 1 85  ? -5.757  3.862   -17.612 1.00 24.06 ? 85  THR B CA  1 
ATOM   2196 C  C   . THR B 1 85  ? -5.784  5.283   -18.150 1.00 24.53 ? 85  THR B C   1 
ATOM   2197 O  O   . THR B 1 85  ? -4.817  5.764   -18.736 1.00 22.80 ? 85  THR B O   1 
ATOM   2198 C  CB  . THR B 1 85  ? -5.459  3.858   -16.121 1.00 24.34 ? 85  THR B CB  1 
ATOM   2199 O  OG1 . THR B 1 85  ? -4.102  4.325   -15.845 1.00 21.79 ? 85  THR B OG1 1 
ATOM   2200 C  CG2 . THR B 1 85  ? -5.549  2.428   -15.535 1.00 24.58 ? 85  THR B CG2 1 
ATOM   2201 N  N   . LYS B 1 86  ? -6.904  5.962   -17.973 1.00 25.46 ? 86  LYS B N   1 
ATOM   2202 C  CA  . LYS B 1 86  ? -6.998  7.324   -18.457 1.00 27.00 ? 86  LYS B CA  1 
ATOM   2203 C  C   . LYS B 1 86  ? -5.764  8.139   -18.018 1.00 26.64 ? 86  LYS B C   1 
ATOM   2204 O  O   . LYS B 1 86  ? -5.173  8.857   -18.829 1.00 26.57 ? 86  LYS B O   1 
ATOM   2205 C  CB  . LYS B 1 86  ? -8.268  7.979   -17.898 1.00 27.26 ? 86  LYS B CB  1 
ATOM   2206 C  CG  . LYS B 1 86  ? -9.609  7.606   -18.608 1.00 29.22 ? 86  LYS B CG  1 
ATOM   2207 C  CD  . LYS B 1 86  ? -10.743 8.021   -17.665 1.00 31.19 ? 86  LYS B CD  1 
ATOM   2208 C  CE  . LYS B 1 86  ? -11.830 8.776   -18.386 1.00 38.01 ? 86  LYS B CE  1 
ATOM   2209 N  NZ  . LYS B 1 86  ? -12.737 9.479   -17.395 1.00 41.32 ? 86  LYS B NZ  1 
ATOM   2210 N  N   . GLY B 1 87  ? -5.379  8.008   -16.748 1.00 27.16 ? 87  GLY B N   1 
ATOM   2211 C  CA  . GLY B 1 87  ? -4.250  8.775   -16.224 1.00 27.63 ? 87  GLY B CA  1 
ATOM   2212 C  C   . GLY B 1 87  ? -4.726  10.101  -15.617 1.00 27.03 ? 87  GLY B C   1 
ATOM   2213 O  O   . GLY B 1 87  ? -5.750  10.629  -16.018 1.00 26.80 ? 87  GLY B O   1 
ATOM   2214 N  N   . HIS B 1 88  ? -4.016  10.614  -14.635 1.00 27.80 ? 88  HIS B N   1 
ATOM   2215 C  CA  . HIS B 1 88  ? -4.418  11.898  -14.024 1.00 28.84 ? 88  HIS B CA  1 
ATOM   2216 C  C   . HIS B 1 88  ? -3.295  12.539  -13.236 1.00 29.14 ? 88  HIS B C   1 
ATOM   2217 O  O   . HIS B 1 88  ? -2.334  11.862  -12.849 1.00 28.44 ? 88  HIS B O   1 
ATOM   2218 C  CB  . HIS B 1 88  ? -5.605  11.714  -13.063 1.00 28.35 ? 88  HIS B CB  1 
ATOM   2219 C  CG  . HIS B 1 88  ? -5.363  10.710  -11.969 1.00 29.17 ? 88  HIS B CG  1 
ATOM   2220 N  ND1 . HIS B 1 88  ? -5.767  9.392   -12.076 1.00 31.65 ? 88  HIS B ND1 1 
ATOM   2221 C  CD2 . HIS B 1 88  ? -4.737  10.815  -10.768 1.00 25.11 ? 88  HIS B CD2 1 
ATOM   2222 C  CE1 . HIS B 1 88  ? -5.415  8.738   -10.985 1.00 28.51 ? 88  HIS B CE1 1 
ATOM   2223 N  NE2 . HIS B 1 88  ? -4.794  9.577   -10.174 1.00 29.84 ? 88  HIS B NE2 1 
ATOM   2224 N  N   . PHE B 1 89  ? -3.415  13.856  -13.031 1.00 29.53 ? 89  PHE B N   1 
ATOM   2225 C  CA  . PHE B 1 89  ? -2.625  14.544  -12.016 1.00 30.25 ? 89  PHE B CA  1 
ATOM   2226 C  C   . PHE B 1 89  ? -3.587  14.506  -10.837 1.00 31.02 ? 89  PHE B C   1 
ATOM   2227 O  O   . PHE B 1 89  ? -4.758  14.161  -10.980 1.00 31.20 ? 89  PHE B O   1 
ATOM   2228 C  CB  . PHE B 1 89  ? -2.344  16.026  -12.366 1.00 30.24 ? 89  PHE B CB  1 
ATOM   2229 C  CG  . PHE B 1 89  ? -1.296  16.226  -13.412 1.00 29.88 ? 89  PHE B CG  1 
ATOM   2230 C  CD1 . PHE B 1 89  ? 0.035   16.364  -13.053 1.00 27.74 ? 89  PHE B CD1 1 
ATOM   2231 C  CD2 . PHE B 1 89  ? -1.645  16.347  -14.754 1.00 29.24 ? 89  PHE B CD2 1 
ATOM   2232 C  CE1 . PHE B 1 89  ? 1.020   16.567  -14.029 1.00 27.03 ? 89  PHE B CE1 1 
ATOM   2233 C  CE2 . PHE B 1 89  ? -0.672  16.566  -15.735 1.00 31.17 ? 89  PHE B CE2 1 
ATOM   2234 C  CZ  . PHE B 1 89  ? 0.678   16.656  -15.371 1.00 28.35 ? 89  PHE B CZ  1 
ATOM   2235 N  N   . HIS B 1 90  ? -3.115  14.878  -9.669  1.00 32.62 ? 90  HIS B N   1 
ATOM   2236 C  CA  . HIS B 1 90  ? -4.005  14.957  -8.533  1.00 33.85 ? 90  HIS B CA  1 
ATOM   2237 C  C   . HIS B 1 90  ? -4.511  16.389  -8.477  1.00 33.57 ? 90  HIS B C   1 
ATOM   2238 O  O   . HIS B 1 90  ? -3.805  17.309  -8.897  1.00 33.74 ? 90  HIS B O   1 
ATOM   2239 C  CB  . HIS B 1 90  ? -3.275  14.593  -7.249  1.00 33.69 ? 90  HIS B CB  1 
ATOM   2240 C  CG  . HIS B 1 90  ? -2.968  13.141  -7.131  1.00 36.24 ? 90  HIS B CG  1 
ATOM   2241 N  ND1 . HIS B 1 90  ? -1.821  12.670  -6.531  1.00 37.82 ? 90  HIS B ND1 1 
ATOM   2242 C  CD2 . HIS B 1 90  ? -3.656  12.050  -7.546  1.00 35.76 ? 90  HIS B CD2 1 
ATOM   2243 C  CE1 . HIS B 1 90  ? -1.826  11.349  -6.562  1.00 37.70 ? 90  HIS B CE1 1 
ATOM   2244 N  NE2 . HIS B 1 90  ? -2.920  10.947  -7.188  1.00 35.53 ? 90  HIS B NE2 1 
ATOM   2245 N  N   . ALA B 1 91  ? -5.736  16.549  -8.005  1.00 34.33 ? 91  ALA B N   1 
ATOM   2246 C  CA  . ALA B 1 91  ? -6.328  17.866  -7.750  1.00 34.58 ? 91  ALA B CA  1 
ATOM   2247 C  C   . ALA B 1 91  ? -5.434  18.625  -6.776  1.00 34.75 ? 91  ALA B C   1 
ATOM   2248 O  O   . ALA B 1 91  ? -5.117  19.788  -6.989  1.00 35.21 ? 91  ALA B O   1 
ATOM   2249 C  CB  . ALA B 1 91  ? -7.720  17.715  -7.179  1.00 34.50 ? 91  ALA B CB  1 
ATOM   2250 N  N   . LYS B 1 92  ? -5.069  17.978  -5.673  1.00 34.73 ? 92  LYS B N   1 
ATOM   2251 C  CA  . LYS B 1 92  ? -4.053  18.553  -4.814  1.00 33.69 ? 92  LYS B CA  1 
ATOM   2252 C  C   . LYS B 1 92  ? -2.754  17.996  -5.359  1.00 33.64 ? 92  LYS B C   1 
ATOM   2253 O  O   . LYS B 1 92  ? -2.352  16.869  -5.049  1.00 33.20 ? 92  LYS B O   1 
ATOM   2254 C  CB  . LYS B 1 92  ? -4.257  18.176  -3.365  1.00 33.97 ? 92  LYS B CB  1 
ATOM   2255 C  CG  . LYS B 1 92  ? -5.437  18.881  -2.709  1.00 35.49 ? 92  LYS B CG  1 
ATOM   2256 C  CD  . LYS B 1 92  ? -5.399  18.644  -1.210  1.00 37.19 ? 92  LYS B CD  1 
ATOM   2257 C  CE  . LYS B 1 92  ? -6.579  19.270  -0.512  1.00 36.35 ? 92  LYS B CE  1 
ATOM   2258 N  NZ  . LYS B 1 92  ? -6.351  19.214  0.953   1.00 38.68 ? 92  LYS B NZ  1 
ATOM   2259 N  N   . LEU B 1 93  ? -2.134  18.807  -6.199  1.00 33.12 ? 93  LEU B N   1 
ATOM   2260 C  CA  . LEU B 1 93  ? -0.949  18.437  -6.946  1.00 33.49 ? 93  LEU B CA  1 
ATOM   2261 C  C   . LEU B 1 93  ? 0.160   17.722  -6.226  1.00 32.62 ? 93  LEU B C   1 
ATOM   2262 O  O   . LEU B 1 93  ? 0.738   16.801  -6.799  1.00 32.19 ? 93  LEU B O   1 
ATOM   2263 C  CB  . LEU B 1 93  ? -0.350  19.647  -7.689  1.00 33.52 ? 93  LEU B CB  1 
ATOM   2264 C  CG  . LEU B 1 93  ? -0.825  19.797  -9.127  1.00 35.81 ? 93  LEU B CG  1 
ATOM   2265 C  CD1 . LEU B 1 93  ? -0.287  21.130  -9.748  1.00 36.20 ? 93  LEU B CD1 1 
ATOM   2266 C  CD2 . LEU B 1 93  ? -0.459  18.562  -10.003 1.00 36.78 ? 93  LEU B CD2 1 
ATOM   2267 N  N   . ASP B 1 94  ? 0.462   18.127  -5.002  1.00 31.53 ? 94  ASP B N   1 
ATOM   2268 C  CA  . ASP B 1 94  ? 1.628   17.592  -4.303  1.00 32.55 ? 94  ASP B CA  1 
ATOM   2269 C  C   . ASP B 1 94  ? 1.388   16.269  -3.543  1.00 30.56 ? 94  ASP B C   1 
ATOM   2270 O  O   . ASP B 1 94  ? 2.210   15.828  -2.746  1.00 32.72 ? 94  ASP B O   1 
ATOM   2271 C  CB  . ASP B 1 94  ? 2.169   18.636  -3.349  1.00 31.92 ? 94  ASP B CB  1 
ATOM   2272 C  CG  . ASP B 1 94  ? 1.095   19.123  -2.406  1.00 34.69 ? 94  ASP B CG  1 
ATOM   2273 O  OD1 . ASP B 1 94  ? 1.291   20.151  -1.747  1.00 33.09 ? 94  ASP B OD1 1 
ATOM   2274 O  OD2 . ASP B 1 94  ? 0.009   18.510  -2.290  1.00 35.58 ? 94  ASP B OD2 1 
ATOM   2275 N  N   . ARG B 1 95  ? 0.265   15.638  -3.788  1.00 29.32 ? 95  ARG B N   1 
ATOM   2276 C  CA  . ARG B 1 95  ? -0.040  14.375  -3.155  1.00 27.55 ? 95  ARG B CA  1 
ATOM   2277 C  C   . ARG B 1 95  ? 0.717   13.241  -3.885  1.00 27.01 ? 95  ARG B C   1 
ATOM   2278 O  O   . ARG B 1 95  ? 0.745   13.221  -5.114  1.00 29.61 ? 95  ARG B O   1 
ATOM   2279 C  CB  . ARG B 1 95  ? -1.550  14.147  -3.198  1.00 26.57 ? 95  ARG B CB  1 
ATOM   2280 C  CG  . ARG B 1 95  ? -2.286  14.608  -1.924  1.00 28.08 ? 95  ARG B CG  1 
ATOM   2281 C  CD  . ARG B 1 95  ? -1.850  15.979  -1.397  1.00 28.44 ? 95  ARG B CD  1 
ATOM   2282 N  NE  . ARG B 1 95  ? -2.612  16.347  -0.208  1.00 27.24 ? 95  ARG B NE  1 
ATOM   2283 C  CZ  . ARG B 1 95  ? -2.287  17.343  0.590   1.00 27.73 ? 95  ARG B CZ  1 
ATOM   2284 N  NH1 . ARG B 1 95  ? -1.217  18.087  0.328   1.00 30.50 ? 95  ARG B NH1 1 
ATOM   2285 N  NH2 . ARG B 1 95  ? -3.022  17.580  1.663   1.00 26.91 ? 95  ARG B NH2 1 
ATOM   2286 N  N   . ALA B 1 96  ? 1.369   12.368  -3.128  1.00 26.54 ? 96  ALA B N   1 
ATOM   2287 C  CA  . ALA B 1 96  ? 2.085   11.194  -3.677  1.00 25.41 ? 96  ALA B CA  1 
ATOM   2288 C  C   . ALA B 1 96  ? 1.141   10.015  -3.747  1.00 24.53 ? 96  ALA B C   1 
ATOM   2289 O  O   . ALA B 1 96  ? 0.009   10.117  -3.305  1.00 25.31 ? 96  ALA B O   1 
ATOM   2290 C  CB  . ALA B 1 96  ? 3.244   10.820  -2.789  1.00 25.67 ? 96  ALA B CB  1 
ATOM   2291 N  N   . GLU B 1 97  ? 1.600   8.890   -4.318  1.00 22.92 ? 97  GLU B N   1 
ATOM   2292 C  CA  . GLU B 1 97  ? 0.811   7.655   -4.292  1.00 22.18 ? 97  GLU B CA  1 
ATOM   2293 C  C   . GLU B 1 97  ? 1.808   6.519   -4.290  1.00 21.08 ? 97  GLU B C   1 
ATOM   2294 O  O   . GLU B 1 97  ? 2.954   6.714   -4.699  1.00 20.12 ? 97  GLU B O   1 
ATOM   2295 C  CB  . GLU B 1 97  ? -0.035  7.484   -5.524  1.00 22.12 ? 97  GLU B CB  1 
ATOM   2296 C  CG  . GLU B 1 97  ? -1.238  8.374   -5.672  1.00 26.70 ? 97  GLU B CG  1 
ATOM   2297 C  CD  . GLU B 1 97  ? -2.135  7.895   -6.789  1.00 28.01 ? 97  GLU B CD  1 
ATOM   2298 O  OE1 . GLU B 1 97  ? -2.722  8.713   -7.510  1.00 34.32 ? 97  GLU B OE1 1 
ATOM   2299 O  OE2 . GLU B 1 97  ? -2.233  6.675   -6.974  1.00 33.38 ? 97  GLU B OE2 1 
ATOM   2300 N  N   . VAL B 1 98  ? 1.367   5.372   -3.793  1.00 19.58 ? 98  VAL B N   1 
ATOM   2301 C  CA  . VAL B 1 98  ? 2.195   4.160   -3.791  1.00 20.27 ? 98  VAL B CA  1 
ATOM   2302 C  C   . VAL B 1 98  ? 1.328   3.107   -4.466  1.00 21.05 ? 98  VAL B C   1 
ATOM   2303 O  O   . VAL B 1 98  ? 0.137   2.956   -4.119  1.00 20.52 ? 98  VAL B O   1 
ATOM   2304 C  CB  . VAL B 1 98  ? 2.580   3.712   -2.386  1.00 21.40 ? 98  VAL B CB  1 
ATOM   2305 C  CG1 . VAL B 1 98  ? 3.245   2.287   -2.411  1.00 20.42 ? 98  VAL B CG1 1 
ATOM   2306 C  CG2 . VAL B 1 98  ? 3.568   4.734   -1.723  1.00 19.76 ? 98  VAL B CG2 1 
ATOM   2307 N  N   . TYR B 1 99  ? 1.950   2.376   -5.394  1.00 19.90 ? 99  TYR B N   1 
ATOM   2308 C  CA  . TYR B 1 99  ? 1.265   1.333   -6.221  1.00 21.16 ? 99  TYR B CA  1 
ATOM   2309 C  C   . TYR B 1 99  ? 2.034   0.061   -5.871  1.00 20.44 ? 99  TYR B C   1 
ATOM   2310 O  O   . TYR B 1 99  ? 3.226   0.120   -5.578  1.00 20.55 ? 99  TYR B O   1 
ATOM   2311 C  CB  . TYR B 1 99  ? 1.480   1.596   -7.718  1.00 22.13 ? 99  TYR B CB  1 
ATOM   2312 C  CG  . TYR B 1 99  ? 0.510   2.507   -8.421  1.00 24.01 ? 99  TYR B CG  1 
ATOM   2313 C  CD1 . TYR B 1 99  ? 0.314   3.837   -7.981  1.00 25.83 ? 99  TYR B CD1 1 
ATOM   2314 C  CD2 . TYR B 1 99  ? -0.229  2.057   -9.493  1.00 25.32 ? 99  TYR B CD2 1 
ATOM   2315 C  CE1 . TYR B 1 99  ? -0.557  4.682   -8.636  1.00 26.29 ? 99  TYR B CE1 1 
ATOM   2316 C  CE2 . TYR B 1 99  ? -1.120  2.892   -10.146 1.00 25.60 ? 99  TYR B CE2 1 
ATOM   2317 C  CZ  . TYR B 1 99  ? -1.290  4.195   -9.714  1.00 28.43 ? 99  TYR B CZ  1 
ATOM   2318 O  OH  . TYR B 1 99  ? -2.158  5.009   -10.409 1.00 27.26 ? 99  TYR B OH  1 
ATOM   2319 N  N   . VAL B 1 100 ? 1.354   -1.070  -5.847  1.00 20.73 ? 100 VAL B N   1 
ATOM   2320 C  CA  . VAL B 1 100 ? 2.043   -2.318  -5.613  1.00 21.03 ? 100 VAL B CA  1 
ATOM   2321 C  C   . VAL B 1 100 ? 1.580   -3.287  -6.685  1.00 20.67 ? 100 VAL B C   1 
ATOM   2322 O  O   . VAL B 1 100 ? 0.380   -3.611  -6.759  1.00 20.81 ? 100 VAL B O   1 
ATOM   2323 C  CB  . VAL B 1 100 ? 1.693   -2.922  -4.282  1.00 21.18 ? 100 VAL B CB  1 
ATOM   2324 C  CG1 . VAL B 1 100 ? 2.546   -4.203  -4.064  1.00 22.42 ? 100 VAL B CG1 1 
ATOM   2325 C  CG2 . VAL B 1 100 ? 1.824   -1.924  -3.098  1.00 21.66 ? 100 VAL B CG2 1 
ATOM   2326 N  N   . ALA B 1 101 ? 2.480   -3.719  -7.557  1.00 22.09 ? 101 ALA B N   1 
ATOM   2327 C  CA  . ALA B 1 101 ? 2.059   -4.637  -8.603  1.00 22.06 ? 101 ALA B CA  1 
ATOM   2328 C  C   . ALA B 1 101 ? 1.834   -6.018  -7.992  1.00 21.95 ? 101 ALA B C   1 
ATOM   2329 O  O   . ALA B 1 101 ? 2.629   -6.508  -7.185  1.00 21.30 ? 101 ALA B O   1 
ATOM   2330 C  CB  . ALA B 1 101 ? 3.023   -4.654  -9.818  1.00 21.56 ? 101 ALA B CB  1 
ATOM   2331 N  N   . LEU B 1 102 ? 0.709   -6.615  -8.371  1.00 23.12 ? 102 LEU B N   1 
ATOM   2332 C  CA  . LEU B 1 102 ? 0.244   -7.888  -7.821  1.00 22.99 ? 102 LEU B CA  1 
ATOM   2333 C  C   . LEU B 1 102 ? 0.320   -9.016  -8.851  1.00 23.74 ? 102 LEU B C   1 
ATOM   2334 O  O   . LEU B 1 102 ? 0.699   -10.139 -8.509  1.00 24.03 ? 102 LEU B O   1 
ATOM   2335 C  CB  . LEU B 1 102 ? -1.189  -7.755  -7.366  1.00 21.79 ? 102 LEU B CB  1 
ATOM   2336 C  CG  . LEU B 1 102 ? -1.350  -6.770  -6.173  1.00 23.18 ? 102 LEU B CG  1 
ATOM   2337 C  CD1 . LEU B 1 102 ? -2.709  -6.819  -5.516  1.00 22.78 ? 102 LEU B CD1 1 
ATOM   2338 C  CD2 . LEU B 1 102 ? -0.311  -7.002  -5.116  1.00 18.73 ? 102 LEU B CD2 1 
ATOM   2339 N  N   . LYS B 1 103 ? -0.005  -8.682  -10.093 1.00 24.17 ? 103 LYS B N   1 
ATOM   2340 C  CA  . LYS B 1 103 ? -0.072  -9.668  -11.181 1.00 24.98 ? 103 LYS B CA  1 
ATOM   2341 C  C   . LYS B 1 103 ? 0.095   -9.081  -12.580 1.00 25.35 ? 103 LYS B C   1 
ATOM   2342 O  O   . LYS B 1 103 ? -0.204  -7.901  -12.841 1.00 25.31 ? 103 LYS B O   1 
ATOM   2343 C  CB  . LYS B 1 103 ? -1.409  -10.432 -11.054 1.00 24.75 ? 103 LYS B CB  1 
ATOM   2344 C  CG  . LYS B 1 103 ? -1.531  -11.687 -11.953 1.00 24.06 ? 103 LYS B CG  1 
ATOM   2345 C  CD  . LYS B 1 103 ? -2.495  -12.625 -11.273 1.00 21.60 ? 103 LYS B CD  1 
ATOM   2346 C  CE  . LYS B 1 103 ? -2.878  -13.831 -12.181 1.00 26.29 ? 103 LYS B CE  1 
ATOM   2347 N  NZ  . LYS B 1 103 ? -4.035  -14.550 -11.582 1.00 27.27 ? 103 LYS B NZ  1 
ATOM   2348 N  N   . GLY B 1 104 ? 0.609   -9.893  -13.513 1.00 24.09 ? 104 GLY B N   1 
ATOM   2349 C  CA  . GLY B 1 104 ? 0.708   -9.450  -14.886 1.00 25.49 ? 104 GLY B CA  1 
ATOM   2350 C  C   . GLY B 1 104 ? 1.940   -8.608  -15.158 1.00 24.59 ? 104 GLY B C   1 
ATOM   2351 O  O   . GLY B 1 104 ? 2.798   -8.486  -14.286 1.00 26.78 ? 104 GLY B O   1 
ATOM   2352 N  N   . LYS B 1 105 ? 2.013   -8.077  -16.362 1.00 25.72 ? 105 LYS B N   1 
ATOM   2353 C  CA  . LYS B 1 105 ? 3.110   -7.246  -16.872 1.00 26.10 ? 105 LYS B CA  1 
ATOM   2354 C  C   . LYS B 1 105 ? 2.564   -5.923  -17.413 1.00 25.24 ? 105 LYS B C   1 
ATOM   2355 O  O   . LYS B 1 105 ? 1.703   -5.850  -18.287 1.00 23.90 ? 105 LYS B O   1 
ATOM   2356 C  CB  . LYS B 1 105 ? 3.951   -7.965  -17.933 1.00 28.15 ? 105 LYS B CB  1 
ATOM   2357 C  CG  . LYS B 1 105 ? 4.304   -9.356  -17.494 1.00 30.02 ? 105 LYS B CG  1 
ATOM   2358 C  CD  . LYS B 1 105 ? 5.617   -9.845  -18.094 1.00 37.72 ? 105 LYS B CD  1 
ATOM   2359 C  CE  . LYS B 1 105 ? 6.389   -10.674 -17.064 1.00 39.96 ? 105 LYS B CE  1 
ATOM   2360 N  NZ  . LYS B 1 105 ? 7.722   -11.192 -17.572 1.00 43.14 ? 105 LYS B NZ  1 
ATOM   2361 N  N   . GLY B 1 106 ? 3.116   -4.859  -16.865 1.00 24.64 ? 106 GLY B N   1 
ATOM   2362 C  CA  . GLY B 1 106 ? 2.656   -3.541  -17.167 1.00 23.44 ? 106 GLY B CA  1 
ATOM   2363 C  C   . GLY B 1 106 ? 3.750   -2.554  -16.819 1.00 23.75 ? 106 GLY B C   1 
ATOM   2364 O  O   . GLY B 1 106 ? 4.928   -2.879  -16.716 1.00 23.23 ? 106 GLY B O   1 
ATOM   2365 N  N   . GLY B 1 107 ? 3.367   -1.308  -16.652 1.00 22.85 ? 107 GLY B N   1 
ATOM   2366 C  CA  . GLY B 1 107 ? 4.357   -0.351  -16.204 1.00 23.39 ? 107 GLY B CA  1 
ATOM   2367 C  C   . GLY B 1 107 ? 3.618   0.947   -15.989 1.00 23.91 ? 107 GLY B C   1 
ATOM   2368 O  O   . GLY B 1 107 ? 2.467   1.031   -16.285 1.00 23.35 ? 107 GLY B O   1 
ATOM   2369 N  N   . MET B 1 108 ? 4.302   1.958   -15.485 1.00 24.41 ? 108 MET B N   1 
ATOM   2370 C  CA  . MET B 1 108 ? 3.625   3.204   -15.267 1.00 24.20 ? 108 MET B CA  1 
ATOM   2371 C  C   . MET B 1 108 ? 4.278   4.289   -16.094 1.00 24.75 ? 108 MET B C   1 
ATOM   2372 O  O   . MET B 1 108 ? 5.512   4.401   -16.122 1.00 24.86 ? 108 MET B O   1 
ATOM   2373 C  CB  . MET B 1 108 ? 3.640   3.550   -13.786 1.00 23.48 ? 108 MET B CB  1 
ATOM   2374 C  CG  . MET B 1 108 ? 2.897   4.869   -13.463 1.00 25.96 ? 108 MET B CG  1 
ATOM   2375 S  SD  . MET B 1 108 ? 2.990   5.262   -11.782 1.00 26.47 ? 108 MET B SD  1 
ATOM   2376 C  CE  . MET B 1 108 ? 2.342   3.643   -11.035 1.00 26.62 ? 108 MET B CE  1 
ATOM   2377 N  N   . LEU B 1 109 ? 3.442   5.085   -16.759 1.00 24.21 ? 109 LEU B N   1 
ATOM   2378 C  CA  . LEU B 1 109 ? 3.893   6.242   -17.487 1.00 24.94 ? 109 LEU B CA  1 
ATOM   2379 C  C   . LEU B 1 109 ? 3.618   7.435   -16.557 1.00 24.38 ? 109 LEU B C   1 
ATOM   2380 O  O   . LEU B 1 109 ? 2.517   7.525   -16.024 1.00 24.51 ? 109 LEU B O   1 
ATOM   2381 C  CB  . LEU B 1 109 ? 3.121   6.376   -18.797 1.00 25.38 ? 109 LEU B CB  1 
ATOM   2382 C  CG  . LEU B 1 109 ? 3.632   7.507   -19.715 1.00 29.71 ? 109 LEU B CG  1 
ATOM   2383 C  CD1 . LEU B 1 109 ? 5.130   7.312   -20.067 1.00 29.25 ? 109 LEU B CD1 1 
ATOM   2384 C  CD2 . LEU B 1 109 ? 2.822   7.633   -20.976 1.00 33.19 ? 109 LEU B CD2 1 
ATOM   2385 N  N   . LEU B 1 110 ? 4.631   8.273   -16.326 1.00 23.58 ? 110 LEU B N   1 
ATOM   2386 C  CA  . LEU B 1 110 ? 4.480   9.459   -15.452 1.00 24.63 ? 110 LEU B CA  1 
ATOM   2387 C  C   . LEU B 1 110 ? 4.953   10.722  -16.187 1.00 24.43 ? 110 LEU B C   1 
ATOM   2388 O  O   . LEU B 1 110 ? 5.802   10.645  -17.066 1.00 25.21 ? 110 LEU B O   1 
ATOM   2389 C  CB  . LEU B 1 110 ? 5.270   9.300   -14.153 1.00 24.77 ? 110 LEU B CB  1 
ATOM   2390 C  CG  . LEU B 1 110 ? 4.963   8.120   -13.253 1.00 24.40 ? 110 LEU B CG  1 
ATOM   2391 C  CD1 . LEU B 1 110 ? 6.107   7.126   -13.422 1.00 25.00 ? 110 LEU B CD1 1 
ATOM   2392 C  CD2 . LEU B 1 110 ? 4.848   8.543   -11.777 1.00 20.34 ? 110 LEU B CD2 1 
ATOM   2393 N  N   . GLN B 1 111 ? 4.373   11.892  -15.874 1.00 24.83 ? 111 GLN B N   1 
ATOM   2394 C  CA  . GLN B 1 111 ? 4.891   13.126  -16.469 1.00 25.09 ? 111 GLN B CA  1 
ATOM   2395 C  C   . GLN B 1 111 ? 4.662   14.306  -15.539 1.00 25.41 ? 111 GLN B C   1 
ATOM   2396 O  O   . GLN B 1 111 ? 3.727   14.317  -14.737 1.00 24.59 ? 111 GLN B O   1 
ATOM   2397 C  CB  . GLN B 1 111 ? 4.324   13.430  -17.863 1.00 24.52 ? 111 GLN B CB  1 
ATOM   2398 C  CG  . GLN B 1 111 ? 2.954   14.096  -17.942 1.00 26.05 ? 111 GLN B CG  1 
ATOM   2399 C  CD  . GLN B 1 111 ? 2.582   14.456  -19.386 1.00 32.22 ? 111 GLN B CD  1 
ATOM   2400 O  OE1 . GLN B 1 111 ? 3.129   13.895  -20.329 1.00 34.24 ? 111 GLN B OE1 1 
ATOM   2401 N  NE2 . GLN B 1 111 ? 1.656   15.396  -19.555 1.00 33.59 ? 111 GLN B NE2 1 
ATOM   2402 N  N   . THR B 1 112 ? 5.558   15.276  -15.620 1.00 27.11 ? 112 THR B N   1 
ATOM   2403 C  CA  . THR B 1 112 ? 5.404   16.466  -14.793 1.00 26.55 ? 112 THR B CA  1 
ATOM   2404 C  C   . THR B 1 112 ? 4.407   17.423  -15.440 1.00 27.61 ? 112 THR B C   1 
ATOM   2405 O  O   . THR B 1 112 ? 3.942   17.223  -16.544 1.00 26.53 ? 112 THR B O   1 
ATOM   2406 C  CB  . THR B 1 112 ? 6.753   17.167  -14.686 1.00 26.94 ? 112 THR B CB  1 
ATOM   2407 O  OG1 . THR B 1 112 ? 7.070   17.703  -15.962 1.00 24.04 ? 112 THR B OG1 1 
ATOM   2408 C  CG2 . THR B 1 112 ? 7.866   16.170  -14.443 1.00 27.48 ? 112 THR B CG2 1 
ATOM   2409 N  N   . PRO B 1 113 ? 4.042   18.497  -14.752 1.00 28.45 ? 113 PRO B N   1 
ATOM   2410 C  CA  . PRO B 1 113 ? 3.201   19.509  -15.392 1.00 29.65 ? 113 PRO B CA  1 
ATOM   2411 C  C   . PRO B 1 113 ? 3.844   20.054  -16.669 1.00 30.22 ? 113 PRO B C   1 
ATOM   2412 O  O   . PRO B 1 113 ? 3.113   20.306  -17.614 1.00 32.17 ? 113 PRO B O   1 
ATOM   2413 C  CB  . PRO B 1 113 ? 3.079   20.573  -14.310 1.00 29.48 ? 113 PRO B CB  1 
ATOM   2414 C  CG  . PRO B 1 113 ? 3.185   19.768  -13.087 1.00 29.31 ? 113 PRO B CG  1 
ATOM   2415 C  CD  . PRO B 1 113 ? 4.305   18.800  -13.344 1.00 28.03 ? 113 PRO B CD  1 
ATOM   2416 N  N   . GLU B 1 114 ? 5.165   20.161  -16.734 1.00 30.55 ? 114 GLU B N   1 
ATOM   2417 C  CA  . GLU B 1 114 ? 5.849   20.635  -17.949 1.00 31.36 ? 114 GLU B CA  1 
ATOM   2418 C  C   . GLU B 1 114 ? 5.989   19.596  -19.076 1.00 31.67 ? 114 GLU B C   1 
ATOM   2419 O  O   . GLU B 1 114 ? 6.538   19.912  -20.141 1.00 32.20 ? 114 GLU B O   1 
ATOM   2420 C  CB  . GLU B 1 114 ? 7.238   21.166  -17.614 1.00 31.87 ? 114 GLU B CB  1 
ATOM   2421 C  CG  . GLU B 1 114 ? 7.232   22.468  -16.800 1.00 33.29 ? 114 GLU B CG  1 
ATOM   2422 C  CD  . GLU B 1 114 ? 6.809   22.296  -15.345 1.00 37.18 ? 114 GLU B CD  1 
ATOM   2423 O  OE1 . GLU B 1 114 ? 7.275   21.353  -14.684 1.00 37.29 ? 114 GLU B OE1 1 
ATOM   2424 O  OE2 . GLU B 1 114 ? 5.998   23.117  -14.847 1.00 39.12 ? 114 GLU B OE2 1 
ATOM   2425 N  N   . GLY B 1 115 ? 5.509   18.379  -18.824 1.00 31.60 ? 115 GLY B N   1 
ATOM   2426 C  CA  . GLY B 1 115 ? 5.370   17.372  -19.872 1.00 31.54 ? 115 GLY B CA  1 
ATOM   2427 C  C   . GLY B 1 115 ? 6.557   16.459  -19.999 1.00 31.53 ? 115 GLY B C   1 
ATOM   2428 O  O   . GLY B 1 115 ? 6.635   15.638  -20.909 1.00 31.72 ? 115 GLY B O   1 
ATOM   2429 N  N   . ASP B 1 116 ? 7.499   16.622  -19.095 1.00 31.48 ? 116 ASP B N   1 
ATOM   2430 C  CA  . ASP B 1 116 ? 8.633   15.705  -19.014 1.00 32.26 ? 116 ASP B CA  1 
ATOM   2431 C  C   . ASP B 1 116 ? 8.150   14.310  -18.565 1.00 31.16 ? 116 ASP B C   1 
ATOM   2432 O  O   . ASP B 1 116 ? 7.421   14.201  -17.597 1.00 30.51 ? 116 ASP B O   1 
ATOM   2433 C  CB  . ASP B 1 116 ? 9.616   16.249  -17.990 1.00 32.89 ? 116 ASP B CB  1 
ATOM   2434 C  CG  . ASP B 1 116 ? 10.863  15.430  -17.919 1.00 37.95 ? 116 ASP B CG  1 
ATOM   2435 O  OD1 . ASP B 1 116 ? 11.201  14.823  -18.962 1.00 43.45 ? 116 ASP B OD1 1 
ATOM   2436 O  OD2 . ASP B 1 116 ? 11.560  15.313  -16.881 1.00 44.06 ? 116 ASP B OD2 1 
ATOM   2437 N  N   . ALA B 1 117 ? 8.605   13.242  -19.233 1.00 30.89 ? 117 ALA B N   1 
ATOM   2438 C  CA  . ALA B 1 117 ? 8.073   11.912  -18.961 1.00 30.44 ? 117 ALA B CA  1 
ATOM   2439 C  C   . ALA B 1 117 ? 9.033   10.865  -18.397 1.00 30.41 ? 117 ALA B C   1 
ATOM   2440 O  O   . ALA B 1 117 ? 10.259  10.976  -18.493 1.00 29.95 ? 117 ALA B O   1 
ATOM   2441 C  CB  . ALA B 1 117 ? 7.362   11.375  -20.221 1.00 30.15 ? 117 ALA B CB  1 
ATOM   2442 N  N   . LYS B 1 118 ? 8.459   9.861   -17.748 1.00 30.42 ? 118 LYS B N   1 
ATOM   2443 C  CA  . LYS B 1 118 ? 9.242   8.735   -17.270 1.00 29.97 ? 118 LYS B CA  1 
ATOM   2444 C  C   . LYS B 1 118 ? 8.429   7.458   -17.317 1.00 29.14 ? 118 LYS B C   1 
ATOM   2445 O  O   . LYS B 1 118 ? 7.239   7.435   -17.000 1.00 28.67 ? 118 LYS B O   1 
ATOM   2446 C  CB  . LYS B 1 118 ? 9.727   8.963   -15.841 1.00 30.72 ? 118 LYS B CB  1 
ATOM   2447 C  CG  . LYS B 1 118 ? 10.499  7.795   -15.241 1.00 33.90 ? 118 LYS B CG  1 
ATOM   2448 C  CD  . LYS B 1 118 ? 12.008  7.985   -15.318 1.00 38.08 ? 118 LYS B CD  1 
ATOM   2449 C  CE  . LYS B 1 118 ? 12.707  7.283   -14.153 1.00 39.01 ? 118 LYS B CE  1 
ATOM   2450 N  NZ  . LYS B 1 118 ? 12.487  8.005   -12.869 1.00 39.23 ? 118 LYS B NZ  1 
ATOM   2451 N  N   . TRP B 1 119 ? 9.112   6.385   -17.683 1.00 28.68 ? 119 TRP B N   1 
ATOM   2452 C  CA  . TRP B 1 119 ? 8.515   5.059   -17.755 1.00 28.17 ? 119 TRP B CA  1 
ATOM   2453 C  C   . TRP B 1 119 ? 9.128   4.156   -16.697 1.00 27.13 ? 119 TRP B C   1 
ATOM   2454 O  O   . TRP B 1 119 ? 10.342  4.102   -16.553 1.00 27.55 ? 119 TRP B O   1 
ATOM   2455 C  CB  . TRP B 1 119 ? 8.738   4.480   -19.149 1.00 28.14 ? 119 TRP B CB  1 
ATOM   2456 C  CG  . TRP B 1 119 ? 8.415   3.044   -19.273 1.00 29.65 ? 119 TRP B CG  1 
ATOM   2457 C  CD1 . TRP B 1 119 ? 9.301   1.995   -19.352 1.00 30.15 ? 119 TRP B CD1 1 
ATOM   2458 C  CD2 . TRP B 1 119 ? 7.103   2.468   -19.361 1.00 31.08 ? 119 TRP B CD2 1 
ATOM   2459 N  NE1 . TRP B 1 119 ? 8.613   0.811   -19.488 1.00 31.22 ? 119 TRP B NE1 1 
ATOM   2460 C  CE2 . TRP B 1 119 ? 7.266   1.070   -19.503 1.00 31.33 ? 119 TRP B CE2 1 
ATOM   2461 C  CE3 . TRP B 1 119 ? 5.810   2.989   -19.318 1.00 28.53 ? 119 TRP B CE3 1 
ATOM   2462 C  CZ2 . TRP B 1 119 ? 6.177   0.194   -19.602 1.00 32.03 ? 119 TRP B CZ2 1 
ATOM   2463 C  CZ3 . TRP B 1 119 ? 4.727   2.124   -19.435 1.00 30.39 ? 119 TRP B CZ3 1 
ATOM   2464 C  CH2 . TRP B 1 119 ? 4.919   0.743   -19.574 1.00 29.38 ? 119 TRP B CH2 1 
ATOM   2465 N  N   . ILE B 1 120 ? 8.270   3.493   -15.922 1.00 26.25 ? 120 ILE B N   1 
ATOM   2466 C  CA  . ILE B 1 120 ? 8.675   2.571   -14.877 1.00 25.73 ? 120 ILE B CA  1 
ATOM   2467 C  C   . ILE B 1 120 ? 8.023   1.214   -15.057 1.00 26.07 ? 120 ILE B C   1 
ATOM   2468 O  O   . ILE B 1 120 ? 6.803   1.082   -14.911 1.00 25.77 ? 120 ILE B O   1 
ATOM   2469 C  CB  . ILE B 1 120 ? 8.310   3.074   -13.500 1.00 26.01 ? 120 ILE B CB  1 
ATOM   2470 C  CG1 . ILE B 1 120 ? 8.997   4.415   -13.235 1.00 26.36 ? 120 ILE B CG1 1 
ATOM   2471 C  CG2 . ILE B 1 120 ? 8.735   2.046   -12.432 1.00 22.79 ? 120 ILE B CG2 1 
ATOM   2472 C  CD1 . ILE B 1 120 ? 8.988   4.778   -11.810 1.00 28.97 ? 120 ILE B CD1 1 
ATOM   2473 N  N   . SER B 1 121 ? 8.846   0.202   -15.306 1.00 24.92 ? 121 SER B N   1 
ATOM   2474 C  CA  . SER B 1 121 ? 8.322   -1.138  -15.485 1.00 25.58 ? 121 SER B CA  1 
ATOM   2475 C  C   . SER B 1 121 ? 7.715   -1.675  -14.209 1.00 23.67 ? 121 SER B C   1 
ATOM   2476 O  O   . SER B 1 121 ? 8.163   -1.370  -13.098 1.00 23.66 ? 121 SER B O   1 
ATOM   2477 C  CB  . SER B 1 121 ? 9.446   -2.102  -15.958 1.00 24.16 ? 121 SER B CB  1 
ATOM   2478 O  OG  . SER B 1 121 ? 9.735   -1.883  -17.313 1.00 30.80 ? 121 SER B OG  1 
ATOM   2479 N  N   . MET B 1 122 ? 6.689   -2.514  -14.357 1.00 22.68 ? 122 MET B N   1 
ATOM   2480 C  CA  . MET B 1 122 ? 6.079   -3.140  -13.198 1.00 24.12 ? 122 MET B CA  1 
ATOM   2481 C  C   . MET B 1 122 ? 5.832   -4.639  -13.415 1.00 25.05 ? 122 MET B C   1 
ATOM   2482 O  O   . MET B 1 122 ? 5.124   -5.001  -14.337 1.00 24.74 ? 122 MET B O   1 
ATOM   2483 C  CB  . MET B 1 122 ? 4.734   -2.447  -12.902 1.00 24.17 ? 122 MET B CB  1 
ATOM   2484 C  CG  . MET B 1 122 ? 4.972   -0.994  -12.410 1.00 24.32 ? 122 MET B CG  1 
ATOM   2485 S  SD  . MET B 1 122 ? 3.508   -0.003  -12.476 1.00 25.04 ? 122 MET B SD  1 
ATOM   2486 C  CE  . MET B 1 122 ? 2.807   -0.578  -11.238 1.00 23.89 ? 122 MET B CE  1 
ATOM   2487 N  N   . GLU B 1 123 ? 6.428   -5.479  -12.582 1.00 25.70 ? 123 GLU B N   1 
ATOM   2488 C  CA  . GLU B 1 123 ? 6.067   -6.900  -12.547 1.00 27.69 ? 123 GLU B CA  1 
ATOM   2489 C  C   . GLU B 1 123 ? 5.581   -7.176  -11.125 1.00 27.10 ? 123 GLU B C   1 
ATOM   2490 O  O   . GLU B 1 123 ? 5.716   -6.285  -10.256 1.00 26.82 ? 123 GLU B O   1 
ATOM   2491 C  CB  . GLU B 1 123 ? 7.258   -7.769  -12.941 1.00 29.21 ? 123 GLU B CB  1 
ATOM   2492 C  CG  . GLU B 1 123 ? 8.596   -7.252  -12.423 1.00 33.80 ? 123 GLU B CG  1 
ATOM   2493 C  CD  . GLU B 1 123 ? 9.729   -8.281  -12.504 1.00 41.80 ? 123 GLU B CD  1 
ATOM   2494 O  OE1 . GLU B 1 123 ? 10.639  -8.214  -11.624 1.00 41.92 ? 123 GLU B OE1 1 
ATOM   2495 O  OE2 . GLU B 1 123 ? 9.711   -9.155  -13.427 1.00 43.15 ? 123 GLU B OE2 1 
ATOM   2496 N  N   . PRO B 1 124 ? 4.989   -8.351  -10.849 1.00 26.50 ? 124 PRO B N   1 
ATOM   2497 C  CA  . PRO B 1 124 ? 4.479   -8.634  -9.495  1.00 25.97 ? 124 PRO B CA  1 
ATOM   2498 C  C   . PRO B 1 124 ? 5.529   -8.378  -8.401  1.00 25.17 ? 124 PRO B C   1 
ATOM   2499 O  O   . PRO B 1 124 ? 6.666   -8.825  -8.514  1.00 24.81 ? 124 PRO B O   1 
ATOM   2500 C  CB  . PRO B 1 124 ? 4.037   -10.112 -9.572  1.00 25.76 ? 124 PRO B CB  1 
ATOM   2501 C  CG  . PRO B 1 124 ? 3.735   -10.301 -11.030 1.00 26.49 ? 124 PRO B CG  1 
ATOM   2502 C  CD  . PRO B 1 124 ? 4.720   -9.450  -11.798 1.00 26.60 ? 124 PRO B CD  1 
ATOM   2503 N  N   . GLY B 1 125 ? 5.170   -7.533  -7.428  1.00 23.98 ? 125 GLY B N   1 
ATOM   2504 C  CA  . GLY B 1 125 ? 6.047   -7.218  -6.314  1.00 24.42 ? 125 GLY B CA  1 
ATOM   2505 C  C   . GLY B 1 125 ? 6.741   -5.877  -6.483  1.00 24.31 ? 125 GLY B C   1 
ATOM   2506 O  O   . GLY B 1 125 ? 7.405   -5.396  -5.544  1.00 24.00 ? 125 GLY B O   1 
ATOM   2507 N  N   . THR B 1 126 ? 6.635   -5.311  -7.686  1.00 24.91 ? 126 THR B N   1 
ATOM   2508 C  CA  . THR B 1 126 ? 7.209   -3.996  -7.947  1.00 25.59 ? 126 THR B CA  1 
ATOM   2509 C  C   . THR B 1 126 ? 6.379   -2.965  -7.163  1.00 23.79 ? 126 THR B C   1 
ATOM   2510 O  O   . THR B 1 126 ? 5.148   -2.932  -7.285  1.00 23.88 ? 126 THR B O   1 
ATOM   2511 C  CB  . THR B 1 126 ? 7.202   -3.640  -9.443  1.00 26.76 ? 126 THR B CB  1 
ATOM   2512 O  OG1 . THR B 1 126 ? 8.137   -4.462  -10.163 1.00 26.43 ? 126 THR B OG1 1 
ATOM   2513 C  CG2 . THR B 1 126 ? 7.749   -2.238  -9.655  1.00 27.08 ? 126 THR B CG2 1 
ATOM   2514 N  N   . VAL B 1 127 ? 7.047   -2.163  -6.342  1.00 24.25 ? 127 VAL B N   1 
ATOM   2515 C  CA  . VAL B 1 127 ? 6.364   -1.050  -5.696  1.00 24.47 ? 127 VAL B CA  1 
ATOM   2516 C  C   . VAL B 1 127 ? 6.833   0.282   -6.337  1.00 23.43 ? 127 VAL B C   1 
ATOM   2517 O  O   . VAL B 1 127 ? 8.001   0.560   -6.395  1.00 24.37 ? 127 VAL B O   1 
ATOM   2518 C  CB  . VAL B 1 127 ? 6.547   -1.061  -4.151  1.00 23.99 ? 127 VAL B CB  1 
ATOM   2519 C  CG1 . VAL B 1 127 ? 5.990   0.227   -3.527  1.00 24.89 ? 127 VAL B CG1 1 
ATOM   2520 C  CG2 . VAL B 1 127 ? 5.882   -2.299  -3.534  1.00 25.89 ? 127 VAL B CG2 1 
ATOM   2521 N  N   . VAL B 1 128 ? 5.915   1.109   -6.819  1.00 23.45 ? 128 VAL B N   1 
ATOM   2522 C  CA  . VAL B 1 128 ? 6.295   2.354   -7.477  1.00 23.21 ? 128 VAL B CA  1 
ATOM   2523 C  C   . VAL B 1 128 ? 5.922   3.493   -6.565  1.00 24.20 ? 128 VAL B C   1 
ATOM   2524 O  O   . VAL B 1 128 ? 4.814   3.516   -6.061  1.00 22.62 ? 128 VAL B O   1 
ATOM   2525 C  CB  . VAL B 1 128 ? 5.482   2.600   -8.790  1.00 23.59 ? 128 VAL B CB  1 
ATOM   2526 C  CG1 . VAL B 1 128 ? 5.784   3.938   -9.371  1.00 21.48 ? 128 VAL B CG1 1 
ATOM   2527 C  CG2 . VAL B 1 128 ? 5.737   1.492   -9.835  1.00 23.23 ? 128 VAL B CG2 1 
ATOM   2528 N  N   . TYR B 1 129 ? 6.865   4.406   -6.341  1.00 23.82 ? 129 TYR B N   1 
ATOM   2529 C  CA  . TYR B 1 129 ? 6.593   5.681   -5.658  1.00 23.62 ? 129 TYR B CA  1 
ATOM   2530 C  C   . TYR B 1 129 ? 6.238   6.766   -6.713  1.00 23.25 ? 129 TYR B C   1 
ATOM   2531 O  O   . TYR B 1 129 ? 7.041   7.141   -7.576  1.00 23.64 ? 129 TYR B O   1 
ATOM   2532 C  CB  . TYR B 1 129 ? 7.819   6.079   -4.845  1.00 23.02 ? 129 TYR B CB  1 
ATOM   2533 C  CG  . TYR B 1 129 ? 7.755   7.467   -4.241  1.00 22.96 ? 129 TYR B CG  1 
ATOM   2534 C  CD1 . TYR B 1 129 ? 8.494   8.488   -4.795  1.00 24.54 ? 129 TYR B CD1 1 
ATOM   2535 C  CD2 . TYR B 1 129 ? 6.946   7.741   -3.129  1.00 23.18 ? 129 TYR B CD2 1 
ATOM   2536 C  CE1 . TYR B 1 129 ? 8.482   9.773   -4.250  1.00 24.35 ? 129 TYR B CE1 1 
ATOM   2537 C  CE2 . TYR B 1 129 ? 6.891   9.055   -2.568  1.00 23.46 ? 129 TYR B CE2 1 
ATOM   2538 C  CZ  . TYR B 1 129 ? 7.680   10.058  -3.158  1.00 22.37 ? 129 TYR B CZ  1 
ATOM   2539 O  OH  . TYR B 1 129 ? 7.693   11.384  -2.696  1.00 25.14 ? 129 TYR B OH  1 
ATOM   2540 N  N   . VAL B 1 130 ? 5.007   7.236   -6.681  1.00 23.37 ? 130 VAL B N   1 
ATOM   2541 C  CA  . VAL B 1 130 ? 4.542   8.292   -7.563  1.00 22.32 ? 130 VAL B CA  1 
ATOM   2542 C  C   . VAL B 1 130 ? 4.713   9.574   -6.746  1.00 22.95 ? 130 VAL B C   1 
ATOM   2543 O  O   . VAL B 1 130 ? 3.990   9.781   -5.790  1.00 22.50 ? 130 VAL B O   1 
ATOM   2544 C  CB  . VAL B 1 130 ? 3.084   8.113   -7.899  1.00 22.84 ? 130 VAL B CB  1 
ATOM   2545 C  CG1 . VAL B 1 130 ? 2.620   9.190   -8.906  1.00 19.20 ? 130 VAL B CG1 1 
ATOM   2546 C  CG2 . VAL B 1 130 ? 2.902   6.674   -8.547  1.00 23.10 ? 130 VAL B CG2 1 
ATOM   2547 N  N   . PRO B 1 131 ? 5.716   10.377  -7.065  1.00 23.86 ? 131 PRO B N   1 
ATOM   2548 C  CA  . PRO B 1 131 ? 5.994   11.559  -6.222  1.00 24.22 ? 131 PRO B CA  1 
ATOM   2549 C  C   . PRO B 1 131 ? 4.941   12.634  -6.460  1.00 23.85 ? 131 PRO B C   1 
ATOM   2550 O  O   . PRO B 1 131 ? 4.178   12.629  -7.414  1.00 23.08 ? 131 PRO B O   1 
ATOM   2551 C  CB  . PRO B 1 131 ? 7.405   12.031  -6.697  1.00 24.74 ? 131 PRO B CB  1 
ATOM   2552 C  CG  . PRO B 1 131 ? 7.935   10.890  -7.658  1.00 24.60 ? 131 PRO B CG  1 
ATOM   2553 C  CD  . PRO B 1 131 ? 6.648   10.258  -8.191  1.00 24.20 ? 131 PRO B CD  1 
ATOM   2554 N  N   . PRO B 1 132 ? 4.912   13.597  -5.550  1.00 24.74 ? 132 PRO B N   1 
ATOM   2555 C  CA  . PRO B 1 132 ? 4.087   14.780  -5.758  1.00 25.74 ? 132 PRO B CA  1 
ATOM   2556 C  C   . PRO B 1 132 ? 4.378   15.399  -7.133  1.00 24.84 ? 132 PRO B C   1 
ATOM   2557 O  O   . PRO B 1 132 ? 5.519   15.362  -7.565  1.00 25.39 ? 132 PRO B O   1 
ATOM   2558 C  CB  . PRO B 1 132 ? 4.637   15.751  -4.705  1.00 23.86 ? 132 PRO B CB  1 
ATOM   2559 C  CG  . PRO B 1 132 ? 5.099   14.906  -3.591  1.00 26.63 ? 132 PRO B CG  1 
ATOM   2560 C  CD  . PRO B 1 132 ? 5.684   13.658  -4.299  1.00 24.75 ? 132 PRO B CD  1 
ATOM   2561 N  N   . TYR B 1 133 ? 3.355   15.992  -7.751  1.00 24.14 ? 133 TYR B N   1 
ATOM   2562 C  CA  . TYR B 1 133 ? 3.355   16.686  -9.039  1.00 24.72 ? 133 TYR B CA  1 
ATOM   2563 C  C   . TYR B 1 133 ? 3.346   15.814  -10.264 1.00 25.27 ? 133 TYR B C   1 
ATOM   2564 O  O   . TYR B 1 133 ? 3.153   16.318  -11.368 1.00 27.14 ? 133 TYR B O   1 
ATOM   2565 C  CB  . TYR B 1 133 ? 4.495   17.709  -9.194  1.00 25.31 ? 133 TYR B CB  1 
ATOM   2566 C  CG  . TYR B 1 133 ? 4.477   18.669  -8.077  1.00 24.24 ? 133 TYR B CG  1 
ATOM   2567 C  CD1 . TYR B 1 133 ? 3.606   19.748  -8.094  1.00 27.48 ? 133 TYR B CD1 1 
ATOM   2568 C  CD2 . TYR B 1 133 ? 5.299   18.488  -6.977  1.00 26.21 ? 133 TYR B CD2 1 
ATOM   2569 C  CE1 . TYR B 1 133 ? 3.571   20.628  -7.052  1.00 29.34 ? 133 TYR B CE1 1 
ATOM   2570 C  CE2 . TYR B 1 133 ? 5.280   19.396  -5.913  1.00 30.36 ? 133 TYR B CE2 1 
ATOM   2571 C  CZ  . TYR B 1 133 ? 4.398   20.457  -5.966  1.00 30.17 ? 133 TYR B CZ  1 
ATOM   2572 O  OH  . TYR B 1 133 ? 4.345   21.377  -4.936  1.00 32.64 ? 133 TYR B OH  1 
ATOM   2573 N  N   . TRP B 1 134 ? 3.512   14.517  -10.084 1.00 24.28 ? 134 TRP B N   1 
ATOM   2574 C  CA  . TRP B 1 134 ? 3.557   13.658  -11.259 1.00 24.64 ? 134 TRP B CA  1 
ATOM   2575 C  C   . TRP B 1 134 ? 2.244   12.958  -11.598 1.00 24.67 ? 134 TRP B C   1 
ATOM   2576 O  O   . TRP B 1 134 ? 1.779   12.104  -10.809 1.00 25.08 ? 134 TRP B O   1 
ATOM   2577 C  CB  . TRP B 1 134 ? 4.590   12.585  -11.040 1.00 23.39 ? 134 TRP B CB  1 
ATOM   2578 C  CG  . TRP B 1 134 ? 5.997   13.021  -10.989 1.00 24.29 ? 134 TRP B CG  1 
ATOM   2579 C  CD1 . TRP B 1 134 ? 6.659   13.512  -9.917  1.00 24.59 ? 134 TRP B CD1 1 
ATOM   2580 C  CD2 . TRP B 1 134 ? 6.941   12.980  -12.065 1.00 27.51 ? 134 TRP B CD2 1 
ATOM   2581 N  NE1 . TRP B 1 134 ? 7.966   13.804  -10.252 1.00 25.75 ? 134 TRP B NE1 1 
ATOM   2582 C  CE2 . TRP B 1 134 ? 8.169   13.470  -11.565 1.00 26.34 ? 134 TRP B CE2 1 
ATOM   2583 C  CE3 . TRP B 1 134 ? 6.876   12.576  -13.407 1.00 26.06 ? 134 TRP B CE3 1 
ATOM   2584 C  CZ2 . TRP B 1 134 ? 9.327   13.550  -12.359 1.00 24.78 ? 134 TRP B CZ2 1 
ATOM   2585 C  CZ3 . TRP B 1 134 ? 8.013   12.648  -14.195 1.00 29.51 ? 134 TRP B CZ3 1 
ATOM   2586 C  CH2 . TRP B 1 134 ? 9.234   13.137  -13.667 1.00 28.73 ? 134 TRP B CH2 1 
ATOM   2587 N  N   . ALA B 1 135 ? 1.745   13.253  -12.796 1.00 25.63 ? 135 ALA B N   1 
ATOM   2588 C  CA  . ALA B 1 135 ? 0.579   12.617  -13.386 1.00 24.60 ? 135 ALA B CA  1 
ATOM   2589 C  C   . ALA B 1 135 ? 1.030   11.197  -13.673 1.00 24.59 ? 135 ALA B C   1 
ATOM   2590 O  O   . ALA B 1 135 ? 2.227   10.958  -13.882 1.00 24.42 ? 135 ALA B O   1 
ATOM   2591 C  CB  . ALA B 1 135 ? 0.188   13.300  -14.674 1.00 25.70 ? 135 ALA B CB  1 
ATOM   2592 N  N   . HIS B 1 136 ? 0.093   10.265  -13.706 1.00 24.07 ? 136 HIS B N   1 
ATOM   2593 C  CA  . HIS B 1 136 ? 0.481   8.856   -13.818 1.00 23.43 ? 136 HIS B CA  1 
ATOM   2594 C  C   . HIS B 1 136 ? -0.617  8.075   -14.497 1.00 23.63 ? 136 HIS B C   1 
ATOM   2595 O  O   . HIS B 1 136 ? -1.809  8.283   -14.229 1.00 24.51 ? 136 HIS B O   1 
ATOM   2596 C  CB  . HIS B 1 136 ? 0.808   8.258   -12.436 1.00 23.12 ? 136 HIS B CB  1 
ATOM   2597 C  CG  . HIS B 1 136 ? -0.174  8.642   -11.364 1.00 24.55 ? 136 HIS B CG  1 
ATOM   2598 N  ND1 . HIS B 1 136 ? -0.126  9.860   -10.723 1.00 25.37 ? 136 HIS B ND1 1 
ATOM   2599 C  CD2 . HIS B 1 136 ? -1.262  8.008   -10.876 1.00 23.60 ? 136 HIS B CD2 1 
ATOM   2600 C  CE1 . HIS B 1 136 ? -1.127  9.959   -9.875  1.00 25.97 ? 136 HIS B CE1 1 
ATOM   2601 N  NE2 . HIS B 1 136 ? -1.827  8.841   -9.934  1.00 30.69 ? 136 HIS B NE2 1 
ATOM   2602 N  N   . ARG B 1 137 ? -0.179  7.172   -15.377 1.00 23.88 ? 137 ARG B N   1 
ATOM   2603 C  CA  . ARG B 1 137 ? -1.050  6.307   -16.136 1.00 23.64 ? 137 ARG B CA  1 
ATOM   2604 C  C   . ARG B 1 137 ? -0.364  4.940   -16.075 1.00 23.93 ? 137 ARG B C   1 
ATOM   2605 O  O   . ARG B 1 137 ? 0.857   4.882   -16.119 1.00 22.55 ? 137 ARG B O   1 
ATOM   2606 C  CB  . ARG B 1 137 ? -1.144  6.835   -17.577 1.00 23.46 ? 137 ARG B CB  1 
ATOM   2607 C  CG  . ARG B 1 137 ? -1.475  5.777   -18.648 1.00 25.22 ? 137 ARG B CG  1 
ATOM   2608 C  CD  . ARG B 1 137 ? -1.548  6.339   -20.063 1.00 24.59 ? 137 ARG B CD  1 
ATOM   2609 N  NE  . ARG B 1 137 ? -2.637  7.297   -20.191 1.00 25.83 ? 137 ARG B NE  1 
ATOM   2610 C  CZ  . ARG B 1 137 ? -2.766  8.156   -21.192 1.00 25.15 ? 137 ARG B CZ  1 
ATOM   2611 N  NH1 . ARG B 1 137 ? -1.895  8.192   -22.195 1.00 25.24 ? 137 ARG B NH1 1 
ATOM   2612 N  NH2 . ARG B 1 137 ? -3.792  8.983   -21.204 1.00 26.13 ? 137 ARG B NH2 1 
ATOM   2613 N  N   . THR B 1 138 ? -1.131  3.873   -15.899 1.00 22.15 ? 138 THR B N   1 
ATOM   2614 C  CA  . THR B 1 138 ? -0.564  2.517   -15.991 1.00 23.64 ? 138 THR B CA  1 
ATOM   2615 C  C   . THR B 1 138 ? -0.895  1.896   -17.329 1.00 21.97 ? 138 THR B C   1 
ATOM   2616 O  O   . THR B 1 138 ? -1.916  2.181   -17.910 1.00 19.59 ? 138 THR B O   1 
ATOM   2617 C  CB  . THR B 1 138 ? -1.054  1.631   -14.846 1.00 23.45 ? 138 THR B CB  1 
ATOM   2618 O  OG1 . THR B 1 138 ? -2.482  1.803   -14.664 1.00 25.09 ? 138 THR B OG1 1 
ATOM   2619 C  CG2 . THR B 1 138 ? -0.457  2.127   -13.555 1.00 25.73 ? 138 THR B CG2 1 
ATOM   2620 N  N   . VAL B 1 139 ? -0.039  0.976   -17.791 1.00 22.32 ? 139 VAL B N   1 
ATOM   2621 C  CA  . VAL B 1 139 ? -0.160  0.465   -19.133 1.00 22.22 ? 139 VAL B CA  1 
ATOM   2622 C  C   . VAL B 1 139 ? -0.018  -1.062  -19.044 1.00 20.83 ? 139 VAL B C   1 
ATOM   2623 O  O   . VAL B 1 139 ? 0.779   -1.529  -18.267 1.00 19.05 ? 139 VAL B O   1 
ATOM   2624 C  CB  . VAL B 1 139 ? 1.003   1.009   -19.977 1.00 23.52 ? 139 VAL B CB  1 
ATOM   2625 C  CG1 . VAL B 1 139 ? 1.043   0.363   -21.351 1.00 20.12 ? 139 VAL B CG1 1 
ATOM   2626 C  CG2 . VAL B 1 139 ? 0.936   2.530   -20.111 1.00 22.38 ? 139 VAL B CG2 1 
ATOM   2627 N  N   . ASN B 1 140 ? -0.868  -1.811  -19.747 1.00 21.64 ? 140 ASN B N   1 
ATOM   2628 C  CA  . ASN B 1 140 ? -0.720  -3.290  -19.777 1.00 23.46 ? 140 ASN B CA  1 
ATOM   2629 C  C   . ASN B 1 140 ? 0.046   -3.733  -21.061 1.00 23.28 ? 140 ASN B C   1 
ATOM   2630 O  O   . ASN B 1 140 ? -0.434  -3.620  -22.167 1.00 21.85 ? 140 ASN B O   1 
ATOM   2631 C  CB  . ASN B 1 140 ? -2.098  -3.985  -19.616 1.00 22.98 ? 140 ASN B CB  1 
ATOM   2632 C  CG  . ASN B 1 140 ? -1.996  -5.508  -19.533 1.00 24.57 ? 140 ASN B CG  1 
ATOM   2633 O  OD1 . ASN B 1 140 ? -0.947  -6.062  -19.878 1.00 25.08 ? 140 ASN B OD1 1 
ATOM   2634 N  ND2 . ASN B 1 140 ? -3.087  -6.194  -19.049 1.00 20.26 ? 140 ASN B ND2 1 
ATOM   2635 N  N   . ILE B 1 141 ? 1.263   -4.195  -20.895 1.00 24.58 ? 141 ILE B N   1 
ATOM   2636 C  CA  . ILE B 1 141 ? 2.062   -4.516  -22.055 1.00 27.22 ? 141 ILE B CA  1 
ATOM   2637 C  C   . ILE B 1 141 ? 2.161   -6.019  -22.225 1.00 27.97 ? 141 ILE B C   1 
ATOM   2638 O  O   . ILE B 1 141 ? 3.059   -6.486  -22.953 1.00 29.52 ? 141 ILE B O   1 
ATOM   2639 C  CB  . ILE B 1 141 ? 3.454   -3.936  -21.875 1.00 27.54 ? 141 ILE B CB  1 
ATOM   2640 C  CG1 . ILE B 1 141 ? 4.127   -4.629  -20.675 1.00 27.64 ? 141 ILE B CG1 1 
ATOM   2641 C  CG2 . ILE B 1 141 ? 3.362   -2.371  -21.741 1.00 27.22 ? 141 ILE B CG2 1 
ATOM   2642 C  CD1 . ILE B 1 141 ? 5.663   -4.502  -20.662 1.00 30.64 ? 141 ILE B CD1 1 
ATOM   2643 N  N   . GLY B 1 142 ? 1.263   -6.764  -21.561 1.00 28.80 ? 142 GLY B N   1 
ATOM   2644 C  CA  . GLY B 1 142 ? 1.258   -8.234  -21.662 1.00 29.42 ? 142 GLY B CA  1 
ATOM   2645 C  C   . GLY B 1 142 ? -0.035  -8.792  -22.244 1.00 30.04 ? 142 GLY B C   1 
ATOM   2646 O  O   . GLY B 1 142 ? -0.843  -8.050  -22.803 1.00 30.15 ? 142 GLY B O   1 
ATOM   2647 N  N   . ASP B 1 143 ? -0.234  -10.103 -22.149 1.00 30.99 ? 143 ASP B N   1 
ATOM   2648 C  CA  . ASP B 1 143 ? -1.456  -10.678 -22.701 1.00 31.47 ? 143 ASP B CA  1 
ATOM   2649 C  C   . ASP B 1 143 ? -2.373  -11.228 -21.637 1.00 30.96 ? 143 ASP B C   1 
ATOM   2650 O  O   . ASP B 1 143 ? -3.341  -11.924 -21.935 1.00 29.72 ? 143 ASP B O   1 
ATOM   2651 C  CB  . ASP B 1 143 ? -1.138  -11.743 -23.755 1.00 33.10 ? 143 ASP B CB  1 
ATOM   2652 C  CG  . ASP B 1 143 ? -0.440  -12.917 -23.173 1.00 34.55 ? 143 ASP B CG  1 
ATOM   2653 O  OD1 . ASP B 1 143 ? 0.085   -12.780 -22.068 1.00 36.98 ? 143 ASP B OD1 1 
ATOM   2654 O  OD2 . ASP B 1 143 ? -0.327  -14.023 -23.758 1.00 41.95 ? 143 ASP B OD2 1 
ATOM   2655 N  N   . GLU B 1 144 ? -2.081  -10.891 -20.389 1.00 30.40 ? 144 GLU B N   1 
ATOM   2656 C  CA  . GLU B 1 144 ? -2.965  -11.217 -19.287 1.00 30.20 ? 144 GLU B CA  1 
ATOM   2657 C  C   . GLU B 1 144 ? -3.250  -9.934  -18.476 1.00 29.27 ? 144 GLU B C   1 
ATOM   2658 O  O   . GLU B 1 144 ? -2.540  -8.923  -18.623 1.00 29.06 ? 144 GLU B O   1 
ATOM   2659 C  CB  . GLU B 1 144 ? -2.379  -12.312 -18.402 1.00 29.48 ? 144 GLU B CB  1 
ATOM   2660 C  CG  . GLU B 1 144 ? -2.353  -13.668 -19.140 1.00 33.80 ? 144 GLU B CG  1 
ATOM   2661 C  CD  . GLU B 1 144 ? -1.526  -14.764 -18.466 1.00 39.15 ? 144 GLU B CD  1 
ATOM   2662 O  OE1 . GLU B 1 144 ? -1.585  -15.938 -18.958 1.00 38.97 ? 144 GLU B OE1 1 
ATOM   2663 O  OE2 . GLU B 1 144 ? -0.816  -14.481 -17.471 1.00 39.55 ? 144 GLU B OE2 1 
ATOM   2664 N  N   . PRO B 1 145 ? -4.275  -10.001 -17.633 1.00 28.41 ? 145 PRO B N   1 
ATOM   2665 C  CA  . PRO B 1 145 ? -4.605  -8.863  -16.770 1.00 27.13 ? 145 PRO B CA  1 
ATOM   2666 C  C   . PRO B 1 145 ? -3.422  -8.415  -15.911 1.00 26.10 ? 145 PRO B C   1 
ATOM   2667 O  O   . PRO B 1 145 ? -2.667  -9.221  -15.335 1.00 25.64 ? 145 PRO B O   1 
ATOM   2668 C  CB  . PRO B 1 145 ? -5.750  -9.398  -15.912 1.00 27.92 ? 145 PRO B CB  1 
ATOM   2669 C  CG  . PRO B 1 145 ? -6.416  -10.454 -16.837 1.00 28.20 ? 145 PRO B CG  1 
ATOM   2670 C  CD  . PRO B 1 145 ? -5.221  -11.125 -17.459 1.00 28.64 ? 145 PRO B CD  1 
ATOM   2671 N  N   . PHE B 1 146 ? -3.280  -7.094  -15.818 1.00 24.45 ? 146 PHE B N   1 
ATOM   2672 C  CA  . PHE B 1 146 ? -2.246  -6.455  -15.035 1.00 23.68 ? 146 PHE B CA  1 
ATOM   2673 C  C   . PHE B 1 146 ? -3.031  -5.902  -13.829 1.00 23.54 ? 146 PHE B C   1 
ATOM   2674 O  O   . PHE B 1 146 ? -3.999  -5.178  -14.007 1.00 23.71 ? 146 PHE B O   1 
ATOM   2675 C  CB  . PHE B 1 146 ? -1.546  -5.356  -15.880 1.00 22.76 ? 146 PHE B CB  1 
ATOM   2676 C  CG  . PHE B 1 146 ? -0.555  -4.507  -15.114 1.00 22.98 ? 146 PHE B CG  1 
ATOM   2677 C  CD1 . PHE B 1 146 ? 0.412   -5.066  -14.323 1.00 22.10 ? 146 PHE B CD1 1 
ATOM   2678 C  CD2 . PHE B 1 146 ? -0.632  -3.132  -15.182 1.00 26.83 ? 146 PHE B CD2 1 
ATOM   2679 C  CE1 . PHE B 1 146 ? 1.313   -4.273  -13.612 1.00 24.67 ? 146 PHE B CE1 1 
ATOM   2680 C  CE2 . PHE B 1 146 ? 0.286   -2.321  -14.488 1.00 26.18 ? 146 PHE B CE2 1 
ATOM   2681 C  CZ  . PHE B 1 146 ? 1.224   -2.882  -13.702 1.00 23.38 ? 146 PHE B CZ  1 
ATOM   2682 N  N   . ILE B 1 147 ? -2.645  -6.348  -12.647 1.00 24.00 ? 147 ILE B N   1 
ATOM   2683 C  CA  . ILE B 1 147 ? -3.373  -6.084  -11.410 1.00 23.06 ? 147 ILE B CA  1 
ATOM   2684 C  C   . ILE B 1 147 ? -2.462  -5.436  -10.441 1.00 23.02 ? 147 ILE B C   1 
ATOM   2685 O  O   . ILE B 1 147 ? -1.388  -5.902  -10.134 1.00 21.46 ? 147 ILE B O   1 
ATOM   2686 C  CB  . ILE B 1 147 ? -3.940  -7.357  -10.785 1.00 24.32 ? 147 ILE B CB  1 
ATOM   2687 C  CG1 . ILE B 1 147 ? -4.845  -8.084  -11.785 1.00 23.59 ? 147 ILE B CG1 1 
ATOM   2688 C  CG2 . ILE B 1 147 ? -4.715  -7.023  -9.534  1.00 24.68 ? 147 ILE B CG2 1 
ATOM   2689 C  CD1 . ILE B 1 147 ? -5.423  -9.453  -11.236 1.00 25.12 ? 147 ILE B CD1 1 
ATOM   2690 N  N   . PHE B 1 148 ? -2.937  -4.344  -9.888  1.00 22.35 ? 148 PHE B N   1 
ATOM   2691 C  CA  . PHE B 1 148 ? -2.096  -3.693  -8.945  1.00 21.24 ? 148 PHE B CA  1 
ATOM   2692 C  C   . PHE B 1 148 ? -2.968  -3.072  -7.833  1.00 21.14 ? 148 PHE B C   1 
ATOM   2693 O  O   . PHE B 1 148 ? -4.210  -3.009  -7.952  1.00 20.11 ? 148 PHE B O   1 
ATOM   2694 C  CB  . PHE B 1 148 ? -1.186  -2.712  -9.718  1.00 20.67 ? 148 PHE B CB  1 
ATOM   2695 C  CG  . PHE B 1 148 ? -1.943  -1.652  -10.513 1.00 20.30 ? 148 PHE B CG  1 
ATOM   2696 C  CD1 . PHE B 1 148 ? -2.097  -1.715  -11.883 1.00 22.37 ? 148 PHE B CD1 1 
ATOM   2697 C  CD2 . PHE B 1 148 ? -2.541  -0.584  -9.834  1.00 21.83 ? 148 PHE B CD2 1 
ATOM   2698 C  CE1 . PHE B 1 148 ? -2.797  -0.693  -12.575 1.00 20.63 ? 148 PHE B CE1 1 
ATOM   2699 C  CE2 . PHE B 1 148 ? -3.246  0.401   -10.525 1.00 21.59 ? 148 PHE B CE2 1 
ATOM   2700 C  CZ  . PHE B 1 148 ? -3.361  0.362   -11.885 1.00 20.55 ? 148 PHE B CZ  1 
ATOM   2701 N  N   . LEU B 1 149 ? -2.307  -2.638  -6.767  1.00 22.17 ? 149 LEU B N   1 
ATOM   2702 C  CA  . LEU B 1 149 ? -2.988  -2.041  -5.627  1.00 20.71 ? 149 LEU B CA  1 
ATOM   2703 C  C   . LEU B 1 149 ? -2.454  -0.615  -5.454  1.00 21.50 ? 149 LEU B C   1 
ATOM   2704 O  O   . LEU B 1 149 ? -1.267  -0.405  -5.405  1.00 21.19 ? 149 LEU B O   1 
ATOM   2705 C  CB  . LEU B 1 149 ? -2.776  -2.884  -4.391  1.00 21.34 ? 149 LEU B CB  1 
ATOM   2706 C  CG  . LEU B 1 149 ? -3.098  -2.243  -3.028  1.00 19.01 ? 149 LEU B CG  1 
ATOM   2707 C  CD1 . LEU B 1 149 ? -4.673  -1.983  -2.946  1.00 20.61 ? 149 LEU B CD1 1 
ATOM   2708 C  CD2 . LEU B 1 149 ? -2.498  -2.923  -1.751  1.00 20.71 ? 149 LEU B CD2 1 
ATOM   2709 N  N   . ALA B 1 150 ? -3.330  0.370   -5.379  1.00 20.52 ? 150 ALA B N   1 
ATOM   2710 C  CA  . ALA B 1 150 ? -2.774  1.684   -5.173  1.00 19.79 ? 150 ALA B CA  1 
ATOM   2711 C  C   . ALA B 1 150 ? -3.294  2.254   -3.843  1.00 21.22 ? 150 ALA B C   1 
ATOM   2712 O  O   . ALA B 1 150 ? -4.395  1.919   -3.424  1.00 20.24 ? 150 ALA B O   1 
ATOM   2713 C  CB  . ALA B 1 150 ? -3.050  2.542   -6.350  1.00 20.59 ? 150 ALA B CB  1 
ATOM   2714 N  N   . ILE B 1 151 ? -2.460  3.055   -3.171  1.00 19.60 ? 151 ILE B N   1 
ATOM   2715 C  CA  . ILE B 1 151 ? -2.818  3.640   -1.886  1.00 22.37 ? 151 ILE B CA  1 
ATOM   2716 C  C   . ILE B 1 151 ? -2.516  5.117   -2.104  1.00 21.32 ? 151 ILE B C   1 
ATOM   2717 O  O   . ILE B 1 151 ? -1.433  5.489   -2.552  1.00 21.50 ? 151 ILE B O   1 
ATOM   2718 C  CB  . ILE B 1 151 ? -2.006  3.100   -0.680  1.00 22.89 ? 151 ILE B CB  1 
ATOM   2719 C  CG1 . ILE B 1 151 ? -2.059  1.575   -0.517  1.00 25.55 ? 151 ILE B CG1 1 
ATOM   2720 C  CG2 . ILE B 1 151 ? -2.499  3.737   0.636   1.00 22.76 ? 151 ILE B CG2 1 
ATOM   2721 C  CD1 . ILE B 1 151 ? -0.894  0.866   -1.247  1.00 24.87 ? 151 ILE B CD1 1 
ATOM   2722 N  N   . TYR B 1 152 ? -3.483  5.968   -1.839  1.00 22.89 ? 152 TYR B N   1 
ATOM   2723 C  CA  . TYR B 1 152 ? -3.301  7.353   -2.218  1.00 23.33 ? 152 TYR B CA  1 
ATOM   2724 C  C   . TYR B 1 152 ? -3.966  8.243   -1.171  1.00 23.62 ? 152 TYR B C   1 
ATOM   2725 O  O   . TYR B 1 152 ? -4.874  7.788   -0.463  1.00 23.87 ? 152 TYR B O   1 
ATOM   2726 C  CB  . TYR B 1 152 ? -3.850  7.586   -3.652  1.00 23.02 ? 152 TYR B CB  1 
ATOM   2727 C  CG  . TYR B 1 152 ? -5.250  7.061   -3.921  1.00 27.71 ? 152 TYR B CG  1 
ATOM   2728 C  CD1 . TYR B 1 152 ? -5.483  5.695   -4.114  1.00 29.17 ? 152 TYR B CD1 1 
ATOM   2729 C  CD2 . TYR B 1 152 ? -6.337  7.920   -3.980  1.00 31.71 ? 152 TYR B CD2 1 
ATOM   2730 C  CE1 . TYR B 1 152 ? -6.757  5.206   -4.345  1.00 32.16 ? 152 TYR B CE1 1 
ATOM   2731 C  CE2 . TYR B 1 152 ? -7.629  7.443   -4.230  1.00 30.86 ? 152 TYR B CE2 1 
ATOM   2732 C  CZ  . TYR B 1 152 ? -7.824  6.080   -4.413  1.00 34.74 ? 152 TYR B CZ  1 
ATOM   2733 O  OH  . TYR B 1 152 ? -9.094  5.587   -4.640  1.00 34.04 ? 152 TYR B OH  1 
ATOM   2734 N  N   . PRO B 1 153 ? -3.467  9.460   -0.985  1.00 23.88 ? 153 PRO B N   1 
ATOM   2735 C  CA  . PRO B 1 153 ? -4.098  10.340  -0.008  1.00 24.23 ? 153 PRO B CA  1 
ATOM   2736 C  C   . PRO B 1 153 ? -5.562  10.523  -0.348  1.00 24.22 ? 153 PRO B C   1 
ATOM   2737 O  O   . PRO B 1 153 ? -5.874  10.718  -1.501  1.00 23.48 ? 153 PRO B O   1 
ATOM   2738 C  CB  . PRO B 1 153 ? -3.311  11.641  -0.182  1.00 24.87 ? 153 PRO B CB  1 
ATOM   2739 C  CG  . PRO B 1 153 ? -1.924  11.130  -0.522  1.00 24.67 ? 153 PRO B CG  1 
ATOM   2740 C  CD  . PRO B 1 153 ? -2.342  10.133  -1.656  1.00 22.59 ? 153 PRO B CD  1 
ATOM   2741 N  N   . ALA B 1 154 ? -6.423  10.429  0.669   1.00 25.42 ? 154 ALA B N   1 
ATOM   2742 C  CA  . ALA B 1 154 ? -7.874  10.627  0.529   1.00 26.96 ? 154 ALA B CA  1 
ATOM   2743 C  C   . ALA B 1 154 ? -8.210  12.022  -0.007  1.00 26.95 ? 154 ALA B C   1 
ATOM   2744 O  O   . ALA B 1 154 ? -9.212  12.200  -0.671  1.00 28.82 ? 154 ALA B O   1 
ATOM   2745 C  CB  . ALA B 1 154 ? -8.565  10.401  1.852   1.00 25.78 ? 154 ALA B CB  1 
ATOM   2746 N  N   . ASP B 1 155 ? -7.379  13.007  0.262   1.00 28.24 ? 155 ASP B N   1 
ATOM   2747 C  CA  . ASP B 1 155 ? -7.649  14.348  -0.282  1.00 30.03 ? 155 ASP B CA  1 
ATOM   2748 C  C   . ASP B 1 155 ? -6.979  14.677  -1.617  1.00 30.12 ? 155 ASP B C   1 
ATOM   2749 O  O   . ASP B 1 155 ? -7.186  15.757  -2.147  1.00 31.01 ? 155 ASP B O   1 
ATOM   2750 C  CB  . ASP B 1 155 ? -7.348  15.452  0.762   1.00 30.36 ? 155 ASP B CB  1 
ATOM   2751 C  CG  . ASP B 1 155 ? -5.877  15.569  1.072   1.00 33.90 ? 155 ASP B CG  1 
ATOM   2752 O  OD1 . ASP B 1 155 ? -5.093  14.686  0.600   1.00 32.22 ? 155 ASP B OD1 1 
ATOM   2753 O  OD2 . ASP B 1 155 ? -5.401  16.514  1.766   1.00 34.57 ? 155 ASP B OD2 1 
ATOM   2754 N  N   . ALA B 1 156 ? -6.214  13.746  -2.192  1.00 30.00 ? 156 ALA B N   1 
ATOM   2755 C  CA  . ALA B 1 156 ? -5.538  13.996  -3.464  1.00 30.30 ? 156 ALA B CA  1 
ATOM   2756 C  C   . ALA B 1 156 ? -6.471  14.348  -4.623  1.00 30.72 ? 156 ALA B C   1 
ATOM   2757 O  O   . ALA B 1 156 ? -6.142  15.178  -5.472  1.00 30.20 ? 156 ALA B O   1 
ATOM   2758 C  CB  . ALA B 1 156 ? -4.643  12.768  -3.865  1.00 30.64 ? 156 ALA B CB  1 
ATOM   2759 N  N   . GLY B 1 157 ? -7.610  13.669  -4.699  1.00 31.10 ? 157 GLY B N   1 
ATOM   2760 C  CA  . GLY B 1 157 ? -8.508  13.845  -5.816  1.00 32.77 ? 157 GLY B CA  1 
ATOM   2761 C  C   . GLY B 1 157 ? -7.909  13.423  -7.142  1.00 34.10 ? 157 GLY B C   1 
ATOM   2762 O  O   . GLY B 1 157 ? -6.767  12.961  -7.219  1.00 33.93 ? 157 GLY B O   1 
ATOM   2763 N  N   . HIS B 1 158 ? -8.685  13.591  -8.195  1.00 35.16 ? 158 HIS B N   1 
ATOM   2764 C  CA  . HIS B 1 158 ? -8.269  13.183  -9.519  1.00 36.63 ? 158 HIS B CA  1 
ATOM   2765 C  C   . HIS B 1 158 ? -8.556  14.286  -10.521 1.00 37.39 ? 158 HIS B C   1 
ATOM   2766 O  O   . HIS B 1 158 ? -9.720  14.642  -10.724 1.00 37.21 ? 158 HIS B O   1 
ATOM   2767 C  CB  . HIS B 1 158 ? -9.026  11.920  -9.961  1.00 37.08 ? 158 HIS B CB  1 
ATOM   2768 C  CG  . HIS B 1 158 ? -8.752  10.721  -9.117  1.00 40.13 ? 158 HIS B CG  1 
ATOM   2769 N  ND1 . HIS B 1 158 ? -9.528  10.388  -8.026  1.00 40.60 ? 158 HIS B ND1 1 
ATOM   2770 C  CD2 . HIS B 1 158 ? -7.777  9.786   -9.188  1.00 40.05 ? 158 HIS B CD2 1 
ATOM   2771 C  CE1 . HIS B 1 158 ? -9.047  9.293   -7.465  1.00 42.62 ? 158 HIS B CE1 1 
ATOM   2772 N  NE2 . HIS B 1 158 ? -7.986  8.906   -8.154  1.00 44.18 ? 158 HIS B NE2 1 
ATOM   2773 N  N   . ASP B 1 159 ? -7.497  14.817  -11.137 1.00 37.36 ? 159 ASP B N   1 
ATOM   2774 C  CA  . ASP B 1 159 ? -7.596  15.813  -12.197 1.00 37.82 ? 159 ASP B CA  1 
ATOM   2775 C  C   . ASP B 1 159 ? -7.340  15.127  -13.539 1.00 37.58 ? 159 ASP B C   1 
ATOM   2776 O  O   . ASP B 1 159 ? -6.192  14.883  -13.889 1.00 37.09 ? 159 ASP B O   1 
ATOM   2777 C  CB  . ASP B 1 159 ? -6.541  16.909  -11.969 1.00 38.58 ? 159 ASP B CB  1 
ATOM   2778 C  CG  . ASP B 1 159 ? -6.451  17.904  -13.116 1.00 39.79 ? 159 ASP B CG  1 
ATOM   2779 O  OD1 . ASP B 1 159 ? -7.172  17.760  -14.136 1.00 42.44 ? 159 ASP B OD1 1 
ATOM   2780 O  OD2 . ASP B 1 159 ? -5.657  18.869  -13.093 1.00 43.05 ? 159 ASP B OD2 1 
ATOM   2781 N  N   . TYR B 1 160 ? -8.412  14.812  -14.269 1.00 37.66 ? 160 TYR B N   1 
ATOM   2782 C  CA  . TYR B 1 160 ? -8.336  14.134  -15.571 1.00 38.03 ? 160 TYR B CA  1 
ATOM   2783 C  C   . TYR B 1 160 ? -8.171  15.035  -16.788 1.00 38.37 ? 160 TYR B C   1 
ATOM   2784 O  O   . TYR B 1 160 ? -7.475  14.676  -17.749 1.00 38.04 ? 160 TYR B O   1 
ATOM   2785 C  CB  . TYR B 1 160 ? -9.582  13.265  -15.788 1.00 37.83 ? 160 TYR B CB  1 
ATOM   2786 C  CG  . TYR B 1 160 ? -9.628  12.072  -14.877 1.00 37.75 ? 160 TYR B CG  1 
ATOM   2787 C  CD1 . TYR B 1 160 ? -10.461 12.058  -13.772 1.00 37.52 ? 160 TYR B CD1 1 
ATOM   2788 C  CD2 . TYR B 1 160 ? -8.829  10.958  -15.111 1.00 36.98 ? 160 TYR B CD2 1 
ATOM   2789 C  CE1 . TYR B 1 160 ? -10.509 10.977  -12.919 1.00 38.08 ? 160 TYR B CE1 1 
ATOM   2790 C  CE2 . TYR B 1 160 ? -8.871  9.859   -14.249 1.00 36.63 ? 160 TYR B CE2 1 
ATOM   2791 C  CZ  . TYR B 1 160 ? -9.709  9.886   -13.153 1.00 35.63 ? 160 TYR B CZ  1 
ATOM   2792 O  OH  . TYR B 1 160 ? -9.791  8.835   -12.283 1.00 37.30 ? 160 TYR B OH  1 
ATOM   2793 N  N   . GLY B 1 161 ? -8.850  16.179  -16.769 1.00 38.60 ? 161 GLY B N   1 
ATOM   2794 C  CA  . GLY B 1 161 ? -8.862  17.118  -17.883 1.00 39.17 ? 161 GLY B CA  1 
ATOM   2795 C  C   . GLY B 1 161 ? -7.572  17.448  -18.631 1.00 40.16 ? 161 GLY B C   1 
ATOM   2796 O  O   . GLY B 1 161 ? -7.548  17.390  -19.867 1.00 40.02 ? 161 GLY B O   1 
ATOM   2797 N  N   . THR B 1 162 ? -6.517  17.805  -17.905 1.00 41.17 ? 162 THR B N   1 
ATOM   2798 C  CA  . THR B 1 162 ? -5.234  18.137  -18.523 1.00 42.45 ? 162 THR B CA  1 
ATOM   2799 C  C   . THR B 1 162 ? -4.837  17.008  -19.469 1.00 42.69 ? 162 THR B C   1 
ATOM   2800 O  O   . THR B 1 162 ? -4.550  17.223  -20.661 1.00 42.67 ? 162 THR B O   1 
ATOM   2801 C  CB  . THR B 1 162 ? -4.146  18.296  -17.447 1.00 42.84 ? 162 THR B CB  1 
ATOM   2802 O  OG1 . THR B 1 162 ? -4.479  19.376  -16.563 1.00 44.85 ? 162 THR B OG1 1 
ATOM   2803 C  CG2 . THR B 1 162 ? -2.843  18.740  -18.084 1.00 43.10 ? 162 THR B CG2 1 
ATOM   2804 N  N   . ILE B 1 163 ? -4.865  15.797  -18.919 1.00 42.48 ? 163 ILE B N   1 
ATOM   2805 C  CA  . ILE B 1 163 ? -4.534  14.589  -19.660 1.00 42.31 ? 163 ILE B CA  1 
ATOM   2806 C  C   . ILE B 1 163 ? -5.547  14.271  -20.761 1.00 42.36 ? 163 ILE B C   1 
ATOM   2807 O  O   . ILE B 1 163 ? -5.167  13.871  -21.847 1.00 42.03 ? 163 ILE B O   1 
ATOM   2808 C  CB  . ILE B 1 163 ? -4.412  13.394  -18.695 1.00 42.04 ? 163 ILE B CB  1 
ATOM   2809 C  CG1 . ILE B 1 163 ? -3.383  13.696  -17.600 1.00 40.99 ? 163 ILE B CG1 1 
ATOM   2810 C  CG2 . ILE B 1 163 ? -4.064  12.148  -19.460 1.00 41.94 ? 163 ILE B CG2 1 
ATOM   2811 C  CD1 . ILE B 1 163 ? -2.095  14.226  -18.138 1.00 38.37 ? 163 ILE B CD1 1 
ATOM   2812 N  N   . ALA B 1 164 ? -6.833  14.443  -20.469 1.00 42.86 ? 164 ALA B N   1 
ATOM   2813 C  CA  . ALA B 1 164 ? -7.907  14.165  -21.429 1.00 43.42 ? 164 ALA B CA  1 
ATOM   2814 C  C   . ALA B 1 164 ? -7.760  14.969  -22.738 1.00 44.04 ? 164 ALA B C   1 
ATOM   2815 O  O   . ALA B 1 164 ? -8.049  14.477  -23.830 1.00 44.03 ? 164 ALA B O   1 
ATOM   2816 C  CB  . ALA B 1 164 ? -9.267  14.440  -20.783 1.00 43.39 ? 164 ALA B CB  1 
ATOM   2817 N  N   . GLU B 1 165 ? -7.300  16.209  -22.615 1.00 44.54 ? 165 GLU B N   1 
ATOM   2818 C  CA  . GLU B 1 165 ? -7.131  17.086  -23.767 1.00 44.96 ? 165 GLU B CA  1 
ATOM   2819 C  C   . GLU B 1 165 ? -5.890  16.789  -24.625 1.00 44.34 ? 165 GLU B C   1 
ATOM   2820 O  O   . GLU B 1 165 ? -5.984  16.647  -25.845 1.00 44.82 ? 165 GLU B O   1 
ATOM   2821 C  CB  . GLU B 1 165 ? -7.031  18.541  -23.287 1.00 45.61 ? 165 GLU B CB  1 
ATOM   2822 C  CG  . GLU B 1 165 ? -8.303  19.367  -23.370 1.00 48.10 ? 165 GLU B CG  1 
ATOM   2823 C  CD  . GLU B 1 165 ? -8.001  20.801  -23.793 1.00 52.30 ? 165 GLU B CD  1 
ATOM   2824 O  OE1 . GLU B 1 165 ? -6.804  21.175  -23.776 1.00 53.28 ? 165 GLU B OE1 1 
ATOM   2825 O  OE2 . GLU B 1 165 ? -8.946  21.553  -24.157 1.00 53.40 ? 165 GLU B OE2 1 
ATOM   2826 N  N   . LYS B 1 166 ? -4.727  16.718  -23.985 1.00 43.50 ? 166 LYS B N   1 
ATOM   2827 C  CA  . LYS B 1 166 ? -3.467  16.656  -24.715 1.00 42.63 ? 166 LYS B CA  1 
ATOM   2828 C  C   . LYS B 1 166 ? -2.664  15.388  -24.515 1.00 40.93 ? 166 LYS B C   1 
ATOM   2829 O  O   . LYS B 1 166 ? -1.602  15.223  -25.113 1.00 40.95 ? 166 LYS B O   1 
ATOM   2830 C  CB  . LYS B 1 166 ? -2.618  17.873  -24.346 1.00 43.45 ? 166 LYS B CB  1 
ATOM   2831 C  CG  . LYS B 1 166 ? -3.202  18.667  -23.190 1.00 45.74 ? 166 LYS B CG  1 
ATOM   2832 C  CD  . LYS B 1 166 ? -2.970  20.181  -23.364 1.00 48.81 ? 166 LYS B CD  1 
ATOM   2833 C  CE  . LYS B 1 166 ? -3.659  20.974  -22.239 1.00 49.38 ? 166 LYS B CE  1 
ATOM   2834 N  NZ  . LYS B 1 166 ? -2.971  22.279  -21.918 1.00 51.18 ? 166 LYS B NZ  1 
ATOM   2835 N  N   . GLY B 1 167 ? -3.166  14.503  -23.665 1.00 39.58 ? 167 GLY B N   1 
ATOM   2836 C  CA  . GLY B 1 167 ? -2.510  13.232  -23.421 1.00 37.00 ? 167 GLY B CA  1 
ATOM   2837 C  C   . GLY B 1 167 ? -1.161  13.328  -22.729 1.00 35.73 ? 167 GLY B C   1 
ATOM   2838 O  O   . GLY B 1 167 ? -0.790  14.336  -22.122 1.00 34.57 ? 167 GLY B O   1 
ATOM   2839 N  N   . PHE B 1 168 ? -0.421  12.233  -22.786 1.00 34.03 ? 168 PHE B N   1 
ATOM   2840 C  CA  . PHE B 1 168 ? 0.899   12.231  -22.200 1.00 32.14 ? 168 PHE B CA  1 
ATOM   2841 C  C   . PHE B 1 168 ? 1.878   12.547  -23.312 1.00 32.24 ? 168 PHE B C   1 
ATOM   2842 O  O   . PHE B 1 168 ? 1.602   12.296  -24.480 1.00 31.28 ? 168 PHE B O   1 
ATOM   2843 C  CB  . PHE B 1 168 ? 1.198   10.877  -21.555 1.00 32.60 ? 168 PHE B CB  1 
ATOM   2844 C  CG  . PHE B 1 168 ? 0.621   10.714  -20.161 1.00 30.31 ? 168 PHE B CG  1 
ATOM   2845 C  CD1 . PHE B 1 168 ? -0.739  10.554  -19.965 1.00 28.34 ? 168 PHE B CD1 1 
ATOM   2846 C  CD2 . PHE B 1 168 ? 1.446   10.686  -19.055 1.00 30.31 ? 168 PHE B CD2 1 
ATOM   2847 C  CE1 . PHE B 1 168 ? -1.263  10.380  -18.692 1.00 23.81 ? 168 PHE B CE1 1 
ATOM   2848 C  CE2 . PHE B 1 168 ? 0.933   10.505  -17.772 1.00 30.26 ? 168 PHE B CE2 1 
ATOM   2849 C  CZ  . PHE B 1 168 ? -0.428  10.366  -17.583 1.00 29.57 ? 168 PHE B CZ  1 
ATOM   2850 N  N   . SER B 1 169 ? 3.022   13.110  -22.965 1.00 31.94 ? 169 SER B N   1 
ATOM   2851 C  CA  . SER B 1 169 ? 3.994   13.450  -23.980 1.00 32.68 ? 169 SER B CA  1 
ATOM   2852 C  C   . SER B 1 169 ? 4.602   12.209  -24.608 1.00 32.70 ? 169 SER B C   1 
ATOM   2853 O  O   . SER B 1 169 ? 5.274   12.330  -25.622 1.00 33.07 ? 169 SER B O   1 
ATOM   2854 C  CB  . SER B 1 169 ? 5.101   14.318  -23.403 1.00 32.03 ? 169 SER B CB  1 
ATOM   2855 O  OG  . SER B 1 169 ? 5.729   13.665  -22.333 1.00 32.80 ? 169 SER B OG  1 
ATOM   2856 N  N   . LYS B 1 170 ? 4.386   11.035  -24.012 1.00 32.61 ? 170 LYS B N   1 
ATOM   2857 C  CA  . LYS B 1 170 ? 4.892   9.767   -24.582 1.00 32.41 ? 170 LYS B CA  1 
ATOM   2858 C  C   . LYS B 1 170 ? 3.753   8.753   -24.723 1.00 32.13 ? 170 LYS B C   1 
ATOM   2859 O  O   . LYS B 1 170 ? 2.768   8.802   -23.983 1.00 31.44 ? 170 LYS B O   1 
ATOM   2860 C  CB  . LYS B 1 170 ? 5.960   9.102   -23.706 1.00 33.13 ? 170 LYS B CB  1 
ATOM   2861 C  CG  . LYS B 1 170 ? 7.249   9.888   -23.435 1.00 34.14 ? 170 LYS B CG  1 
ATOM   2862 C  CD  . LYS B 1 170 ? 7.966   10.113  -24.705 1.00 37.09 ? 170 LYS B CD  1 
ATOM   2863 C  CE  . LYS B 1 170 ? 9.422   10.471  -24.474 1.00 41.62 ? 170 LYS B CE  1 
ATOM   2864 N  NZ  . LYS B 1 170 ? 10.079  10.678  -25.818 1.00 42.57 ? 170 LYS B NZ  1 
ATOM   2865 N  N   . ILE B 1 171 ? 3.900   7.830   -25.672 1.00 31.93 ? 171 ILE B N   1 
ATOM   2866 C  CA  . ILE B 1 171 ? 2.928   6.738   -25.834 1.00 31.07 ? 171 ILE B CA  1 
ATOM   2867 C  C   . ILE B 1 171 ? 3.686   5.421   -25.777 1.00 29.86 ? 171 ILE B C   1 
ATOM   2868 O  O   . ILE B 1 171 ? 4.896   5.409   -25.928 1.00 29.32 ? 171 ILE B O   1 
ATOM   2869 C  CB  . ILE B 1 171 ? 2.131   6.873   -27.128 1.00 31.33 ? 171 ILE B CB  1 
ATOM   2870 C  CG1 . ILE B 1 171 ? 3.074   6.985   -28.330 1.00 31.65 ? 171 ILE B CG1 1 
ATOM   2871 C  CG2 . ILE B 1 171 ? 1.197   8.059   -27.025 1.00 32.64 ? 171 ILE B CG2 1 
ATOM   2872 C  CD1 . ILE B 1 171 ? 2.435   6.545   -29.639 1.00 33.83 ? 171 ILE B CD1 1 
ATOM   2873 N  N   . VAL B 1 172 ? 2.975   4.325   -25.519 1.00 29.61 ? 172 VAL B N   1 
ATOM   2874 C  CA  . VAL B 1 172 ? 3.611   3.038   -25.305 1.00 29.14 ? 172 VAL B CA  1 
ATOM   2875 C  C   . VAL B 1 172 ? 3.002   2.103   -26.312 1.00 29.65 ? 172 VAL B C   1 
ATOM   2876 O  O   . VAL B 1 172 ? 1.819   1.787   -26.242 1.00 29.19 ? 172 VAL B O   1 
ATOM   2877 C  CB  . VAL B 1 172 ? 3.408   2.527   -23.838 1.00 29.79 ? 172 VAL B CB  1 
ATOM   2878 C  CG1 . VAL B 1 172 ? 4.259   1.237   -23.514 1.00 27.66 ? 172 VAL B CG1 1 
ATOM   2879 C  CG2 . VAL B 1 172 ? 3.708   3.679   -22.821 1.00 28.50 ? 172 VAL B CG2 1 
ATOM   2880 N  N   . ILE B 1 173 ? 3.837   1.631   -27.225 1.00 31.06 ? 173 ILE B N   1 
ATOM   2881 C  CA  . ILE B 1 173 ? 3.348   0.893   -28.376 1.00 31.28 ? 173 ILE B CA  1 
ATOM   2882 C  C   . ILE B 1 173 ? 4.060   -0.424  -28.543 1.00 32.84 ? 173 ILE B C   1 
ATOM   2883 O  O   . ILE B 1 173 ? 5.072   -0.686  -27.919 1.00 33.01 ? 173 ILE B O   1 
ATOM   2884 C  CB  . ILE B 1 173 ? 3.533   1.742   -29.678 1.00 32.02 ? 173 ILE B CB  1 
ATOM   2885 C  CG1 . ILE B 1 173 ? 4.998   2.150   -29.884 1.00 31.79 ? 173 ILE B CG1 1 
ATOM   2886 C  CG2 . ILE B 1 173 ? 2.688   2.978   -29.617 1.00 26.94 ? 173 ILE B CG2 1 
ATOM   2887 C  CD1 . ILE B 1 173 ? 5.292   2.836   -31.235 1.00 35.90 ? 173 ILE B CD1 1 
ATOM   2888 N  N   . GLU B 1 174 ? 3.477   -1.257  -29.377 1.00 34.41 ? 174 GLU B N   1 
ATOM   2889 C  CA  . GLU B 1 174 ? 4.112   -2.492  -29.792 1.00 36.60 ? 174 GLU B CA  1 
ATOM   2890 C  C   . GLU B 1 174 ? 4.601   -2.287  -31.243 1.00 36.88 ? 174 GLU B C   1 
ATOM   2891 O  O   . GLU B 1 174 ? 3.844   -1.922  -32.135 1.00 35.82 ? 174 GLU B O   1 
ATOM   2892 C  CB  . GLU B 1 174 ? 3.137   -3.650  -29.709 1.00 36.49 ? 174 GLU B CB  1 
ATOM   2893 C  CG  . GLU B 1 174 ? 3.754   -4.958  -30.172 1.00 39.26 ? 174 GLU B CG  1 
ATOM   2894 C  CD  . GLU B 1 174 ? 3.044   -6.139  -29.562 1.00 43.01 ? 174 GLU B CD  1 
ATOM   2895 O  OE1 . GLU B 1 174 ? 1.914   -6.434  -30.016 1.00 45.24 ? 174 GLU B OE1 1 
ATOM   2896 O  OE2 . GLU B 1 174 ? 3.591   -6.735  -28.604 1.00 46.24 ? 174 GLU B OE2 1 
ATOM   2897 N  N   . GLU B 1 175 ? 5.886   -2.480  -31.470 1.00 38.50 ? 175 GLU B N   1 
ATOM   2898 C  CA  . GLU B 1 175 ? 6.406   -2.301  -32.810 1.00 40.65 ? 175 GLU B CA  1 
ATOM   2899 C  C   . GLU B 1 175 ? 7.343   -3.467  -33.049 1.00 41.89 ? 175 GLU B C   1 
ATOM   2900 O  O   . GLU B 1 175 ? 8.343   -3.614  -32.331 1.00 42.23 ? 175 GLU B O   1 
ATOM   2901 C  CB  . GLU B 1 175 ? 7.173   -0.979  -32.878 1.00 40.34 ? 175 GLU B CB  1 
ATOM   2902 C  CG  . GLU B 1 175 ? 6.873   -0.088  -34.071 1.00 40.40 ? 175 GLU B CG  1 
ATOM   2903 C  CD  . GLU B 1 175 ? 7.708   1.181   -34.025 1.00 41.33 ? 175 GLU B CD  1 
ATOM   2904 O  OE1 . GLU B 1 175 ? 8.950   1.066   -33.923 1.00 40.38 ? 175 GLU B OE1 1 
ATOM   2905 O  OE2 . GLU B 1 175 ? 7.134   2.295   -34.064 1.00 41.20 ? 175 GLU B OE2 1 
ATOM   2906 N  N   . ASN B 1 176 ? 7.011   -4.302  -34.034 1.00 43.54 ? 176 ASN B N   1 
ATOM   2907 C  CA  . ASN B 1 176 ? 7.833   -5.455  -34.381 1.00 44.99 ? 176 ASN B CA  1 
ATOM   2908 C  C   . ASN B 1 176 ? 7.996   -6.390  -33.181 1.00 45.59 ? 176 ASN B C   1 
ATOM   2909 O  O   . ASN B 1 176 ? 9.113   -6.820  -32.857 1.00 46.45 ? 176 ASN B O   1 
ATOM   2910 C  CB  . ASN B 1 176 ? 9.219   -5.020  -34.897 1.00 45.46 ? 176 ASN B CB  1 
ATOM   2911 C  CG  . ASN B 1 176 ? 9.146   -3.985  -36.023 1.00 47.03 ? 176 ASN B CG  1 
ATOM   2912 O  OD1 . ASN B 1 176 ? 9.947   -3.051  -36.064 1.00 49.41 ? 176 ASN B OD1 1 
ATOM   2913 N  ND2 . ASN B 1 176 ? 8.191   -4.145  -36.931 1.00 48.95 ? 176 ASN B ND2 1 
ATOM   2914 N  N   . GLY B 1 177 ? 6.880   -6.688  -32.516 1.00 45.55 ? 177 GLY B N   1 
ATOM   2915 C  CA  . GLY B 1 177 ? 6.865   -7.547  -31.344 1.00 44.41 ? 177 GLY B CA  1 
ATOM   2916 C  C   . GLY B 1 177 ? 7.496   -6.947  -30.098 1.00 43.65 ? 177 GLY B C   1 
ATOM   2917 O  O   . GLY B 1 177 ? 7.631   -7.626  -29.075 1.00 43.72 ? 177 GLY B O   1 
ATOM   2918 N  N   . GLU B 1 178 ? 7.871   -5.674  -30.162 1.00 42.08 ? 178 GLU B N   1 
ATOM   2919 C  CA  . GLU B 1 178 ? 8.581   -5.077  -29.036 1.00 41.40 ? 178 GLU B CA  1 
ATOM   2920 C  C   . GLU B 1 178 ? 7.868   -3.882  -28.482 1.00 40.03 ? 178 GLU B C   1 
ATOM   2921 O  O   . GLU B 1 178 ? 7.313   -3.092  -29.233 1.00 39.41 ? 178 GLU B O   1 
ATOM   2922 C  CB  . GLU B 1 178 ? 9.973   -4.653  -29.460 1.00 42.06 ? 178 GLU B CB  1 
ATOM   2923 C  CG  . GLU B 1 178 ? 10.537  -5.554  -30.528 1.00 44.93 ? 178 GLU B CG  1 
ATOM   2924 C  CD  . GLU B 1 178 ? 11.990  -5.861  -30.291 1.00 49.35 ? 178 GLU B CD  1 
ATOM   2925 O  OE1 . GLU B 1 178 ? 12.254  -6.596  -29.302 1.00 50.90 ? 178 GLU B OE1 1 
ATOM   2926 O  OE2 . GLU B 1 178 ? 12.843  -5.369  -31.085 1.00 49.42 ? 178 GLU B OE2 1 
ATOM   2927 N  N   . VAL B 1 179 ? 7.913   -3.752  -27.161 1.00 39.09 ? 179 VAL B N   1 
ATOM   2928 C  CA  . VAL B 1 179 ? 7.259   -2.668  -26.483 1.00 37.81 ? 179 VAL B CA  1 
ATOM   2929 C  C   . VAL B 1 179 ? 8.155   -1.449  -26.591 1.00 37.00 ? 179 VAL B C   1 
ATOM   2930 O  O   . VAL B 1 179 ? 9.323   -1.507  -26.269 1.00 36.30 ? 179 VAL B O   1 
ATOM   2931 C  CB  . VAL B 1 179 ? 7.003   -3.006  -24.985 1.00 38.37 ? 179 VAL B CB  1 
ATOM   2932 C  CG1 . VAL B 1 179 ? 6.408   -1.812  -24.280 1.00 36.05 ? 179 VAL B CG1 1 
ATOM   2933 C  CG2 . VAL B 1 179 ? 6.097   -4.237  -24.845 1.00 39.23 ? 179 VAL B CG2 1 
ATOM   2934 N  N   . LYS B 1 180 ? 7.602   -0.337  -27.047 1.00 36.82 ? 180 LYS B N   1 
ATOM   2935 C  CA  . LYS B 1 180 ? 8.399   0.864   -27.166 1.00 36.02 ? 180 LYS B CA  1 
ATOM   2936 C  C   . LYS B 1 180 ? 7.694   2.067   -26.567 1.00 35.51 ? 180 LYS B C   1 
ATOM   2937 O  O   . LYS B 1 180 ? 6.475   2.207   -26.625 1.00 35.27 ? 180 LYS B O   1 
ATOM   2938 C  CB  . LYS B 1 180 ? 8.791   1.129   -28.635 1.00 36.10 ? 180 LYS B CB  1 
ATOM   2939 C  CG  . LYS B 1 180 ? 9.280   -0.115  -29.391 1.00 36.94 ? 180 LYS B CG  1 
ATOM   2940 C  CD  . LYS B 1 180 ? 10.131  0.277   -30.598 1.00 42.08 ? 180 LYS B CD  1 
ATOM   2941 C  CE  . LYS B 1 180 ? 11.158  -0.812  -30.907 1.00 42.27 ? 180 LYS B CE  1 
ATOM   2942 N  NZ  . LYS B 1 180 ? 10.861  -1.364  -32.252 1.00 44.60 ? 180 LYS B NZ  1 
ATOM   2943 N  N   . VAL B 1 181 ? 8.485   2.917   -25.954 1.00 35.65 ? 181 VAL B N   1 
ATOM   2944 C  CA  . VAL B 1 181 ? 7.976   4.147   -25.385 1.00 36.18 ? 181 VAL B CA  1 
ATOM   2945 C  C   . VAL B 1 181 ? 8.465   5.262   -26.304 1.00 36.61 ? 181 VAL B C   1 
ATOM   2946 O  O   . VAL B 1 181 ? 9.665   5.467   -26.455 1.00 37.76 ? 181 VAL B O   1 
ATOM   2947 C  CB  . VAL B 1 181 ? 8.507   4.339   -23.950 1.00 36.19 ? 181 VAL B CB  1 
ATOM   2948 C  CG1 . VAL B 1 181 ? 8.033   5.652   -23.401 1.00 33.68 ? 181 VAL B CG1 1 
ATOM   2949 C  CG2 . VAL B 1 181 ? 8.087   3.150   -23.047 1.00 37.13 ? 181 VAL B CG2 1 
ATOM   2950 N  N   . VAL B 1 182 ? 7.547   5.986   -26.922 1.00 36.26 ? 182 VAL B N   1 
ATOM   2951 C  CA  . VAL B 1 182 ? 7.958   6.961   -27.902 1.00 36.39 ? 182 VAL B CA  1 
ATOM   2952 C  C   . VAL B 1 182 ? 7.163   8.207   -27.759 1.00 36.82 ? 182 VAL B C   1 
ATOM   2953 O  O   . VAL B 1 182 ? 6.146   8.220   -27.070 1.00 36.70 ? 182 VAL B O   1 
ATOM   2954 C  CB  . VAL B 1 182 ? 7.776   6.434   -29.313 1.00 36.05 ? 182 VAL B CB  1 
ATOM   2955 C  CG1 . VAL B 1 182 ? 8.576   5.165   -29.479 1.00 35.43 ? 182 VAL B CG1 1 
ATOM   2956 C  CG2 . VAL B 1 182 ? 6.287   6.175   -29.595 1.00 35.85 ? 182 VAL B CG2 1 
ATOM   2957 N  N   . ASP B 1 183 ? 7.641   9.259   -28.415 1.00 37.75 ? 183 ASP B N   1 
ATOM   2958 C  CA  . ASP B 1 183 ? 6.996   10.553  -28.366 1.00 38.30 ? 183 ASP B CA  1 
ATOM   2959 C  C   . ASP B 1 183 ? 5.584   10.401  -28.871 1.00 38.81 ? 183 ASP B C   1 
ATOM   2960 O  O   . ASP B 1 183 ? 5.320   9.662   -29.827 1.00 38.22 ? 183 ASP B O   1 
ATOM   2961 C  CB  . ASP B 1 183 ? 7.714   11.577  -29.265 1.00 39.36 ? 183 ASP B CB  1 
ATOM   2962 C  CG  . ASP B 1 183 ? 9.038   12.069  -28.683 1.00 40.54 ? 183 ASP B CG  1 
ATOM   2963 O  OD1 . ASP B 1 183 ? 9.481   11.566  -27.623 1.00 41.48 ? 183 ASP B OD1 1 
ATOM   2964 O  OD2 . ASP B 1 183 ? 9.709   12.971  -29.242 1.00 45.64 ? 183 ASP B OD2 1 
ATOM   2965 N  N   . ASN B 1 184 ? 4.673   11.095  -28.209 1.00 38.78 ? 184 ASN B N   1 
ATOM   2966 C  CA  . ASN B 1 184 ? 3.313   11.170  -28.668 1.00 39.16 ? 184 ASN B CA  1 
ATOM   2967 C  C   . ASN B 1 184 ? 3.307   12.252  -29.718 1.00 40.66 ? 184 ASN B C   1 
ATOM   2968 O  O   . ASN B 1 184 ? 3.639   13.397  -29.435 1.00 40.59 ? 184 ASN B O   1 
ATOM   2969 C  CB  . ASN B 1 184 ? 2.400   11.595  -27.540 1.00 38.62 ? 184 ASN B CB  1 
ATOM   2970 C  CG  . ASN B 1 184 ? 0.947   11.474  -27.902 1.00 37.10 ? 184 ASN B CG  1 
ATOM   2971 O  OD1 . ASN B 1 184 ? 0.604   11.195  -29.051 1.00 37.69 ? 184 ASN B OD1 1 
ATOM   2972 N  ND2 . ASN B 1 184 ? 0.079   11.638  -26.920 1.00 34.85 ? 184 ASN B ND2 1 
ATOM   2973 N  N   . PRO B 1 185 ? 2.983   11.876  -30.941 1.00 41.78 ? 185 PRO B N   1 
ATOM   2974 C  CA  . PRO B 1 185 ? 2.875   12.839  -32.045 1.00 42.92 ? 185 PRO B CA  1 
ATOM   2975 C  C   . PRO B 1 185 ? 1.737   13.853  -31.849 1.00 43.97 ? 185 PRO B C   1 
ATOM   2976 O  O   . PRO B 1 185 ? 1.903   15.014  -32.236 1.00 44.91 ? 185 PRO B O   1 
ATOM   2977 C  CB  . PRO B 1 185 ? 2.647   11.938  -33.259 1.00 42.72 ? 185 PRO B CB  1 
ATOM   2978 C  CG  . PRO B 1 185 ? 3.216   10.588  -32.797 1.00 43.30 ? 185 PRO B CG  1 
ATOM   2979 C  CD  . PRO B 1 185 ? 2.778   10.482  -31.372 1.00 41.72 ? 185 PRO B CD  1 
ATOM   2980 N  N   . ARG B 1 186 ? 0.614   13.465  -31.243 1.00 44.65 ? 186 ARG B N   1 
ATOM   2981 C  CA  . ARG B 1 186 ? -0.457  14.453  -31.038 1.00 45.82 ? 186 ARG B CA  1 
ATOM   2982 C  C   . ARG B 1 186 ? -0.316  15.288  -29.757 1.00 45.43 ? 186 ARG B C   1 
ATOM   2983 O  O   . ARG B 1 186 ? -1.278  15.927  -29.316 1.00 46.12 ? 186 ARG B O   1 
ATOM   2984 C  CB  . ARG B 1 186 ? -1.880  13.857  -31.222 1.00 46.08 ? 186 ARG B CB  1 
ATOM   2985 C  CG  . ARG B 1 186 ? -2.471  13.002  -30.068 1.00 49.41 ? 186 ARG B CG  1 
ATOM   2986 C  CD  . ARG B 1 186 ? -4.035  12.872  -30.117 1.00 53.28 ? 186 ARG B CD  1 
ATOM   2987 N  NE  . ARG B 1 186 ? -4.602  11.954  -29.114 1.00 54.81 ? 186 ARG B NE  1 
ATOM   2988 C  CZ  . ARG B 1 186 ? -4.569  12.158  -27.789 1.00 57.28 ? 186 ARG B CZ  1 
ATOM   2989 N  NH1 . ARG B 1 186 ? -5.115  11.269  -26.972 1.00 56.41 ? 186 ARG B NH1 1 
ATOM   2990 N  NH2 . ARG B 1 186 ? -4.008  13.255  -27.271 1.00 57.02 ? 186 ARG B NH2 1 
ATOM   2991 N  N   . TRP B 1 187 ? 0.883   15.316  -29.170 1.00 45.49 ? 187 TRP B N   1 
ATOM   2992 C  CA  . TRP B 1 187 ? 1.091   16.087  -27.930 1.00 45.50 ? 187 TRP B CA  1 
ATOM   2993 C  C   . TRP B 1 187 ? 1.769   17.425  -28.214 1.00 45.73 ? 187 TRP B C   1 
ATOM   2994 O  O   . TRP B 1 187 ? 2.819   17.455  -28.845 1.00 46.12 ? 187 TRP B O   1 
ATOM   2995 C  CB  . TRP B 1 187 ? 1.908   15.313  -26.877 1.00 45.02 ? 187 TRP B CB  1 
ATOM   2996 C  CG  . TRP B 1 187 ? 2.200   16.136  -25.638 1.00 44.49 ? 187 TRP B CG  1 
ATOM   2997 C  CD1 . TRP B 1 187 ? 1.356   16.364  -24.587 1.00 43.04 ? 187 TRP B CD1 1 
ATOM   2998 C  CD2 . TRP B 1 187 ? 3.408   16.852  -25.338 1.00 43.70 ? 187 TRP B CD2 1 
ATOM   2999 N  NE1 . TRP B 1 187 ? 1.965   17.163  -23.652 1.00 44.18 ? 187 TRP B NE1 1 
ATOM   3000 C  CE2 . TRP B 1 187 ? 3.222   17.488  -24.094 1.00 44.31 ? 187 TRP B CE2 1 
ATOM   3001 C  CE3 . TRP B 1 187 ? 4.629   17.027  -25.999 1.00 44.78 ? 187 TRP B CE3 1 
ATOM   3002 C  CZ2 . TRP B 1 187 ? 4.206   18.264  -23.498 1.00 43.72 ? 187 TRP B CZ2 1 
ATOM   3003 C  CZ3 . TRP B 1 187 ? 5.612   17.803  -25.403 1.00 44.86 ? 187 TRP B CZ3 1 
ATOM   3004 C  CH2 . TRP B 1 187 ? 5.395   18.407  -24.162 1.00 45.59 ? 187 TRP B CH2 1 
HETATM 3005 C  C1  . 6PG C 2 .   ? 4.654   2.787   10.388  0.75 31.72 ? 300 6PG A C1  1 
HETATM 3006 C  C2  . 6PG C 2 .   ? 3.960   1.470   10.276  0.75 27.18 ? 300 6PG A C2  1 
HETATM 3007 C  C3  . 6PG C 2 .   ? 4.942   0.290   10.265  0.75 29.74 ? 300 6PG A C3  1 
HETATM 3008 C  C4  . 6PG C 2 .   ? 5.563   0.055   11.665  0.75 30.86 ? 300 6PG A C4  1 
HETATM 3009 C  C5  . 6PG C 2 .   ? 6.430   -1.211  11.756  0.75 30.75 ? 300 6PG A C5  1 
HETATM 3010 C  C6  . 6PG C 2 .   ? 7.229   -1.311  13.054  0.75 33.36 ? 300 6PG A C6  1 
HETATM 3011 O  O1A . 6PG C 2 .   ? 4.076   3.737   10.936  0.75 31.54 ? 300 6PG A O1A 1 
HETATM 3012 O  O1  . 6PG C 2 .   ? 5.882   2.927   9.906   0.75 29.34 ? 300 6PG A O1  1 
HETATM 3013 O  O2  . 6PG C 2 .   ? 3.191   1.332   11.438  0.75 27.85 ? 300 6PG A O2  1 
HETATM 3014 O  O3  . 6PG C 2 .   ? 5.863   0.536   9.211   0.75 25.66 ? 300 6PG A O3  1 
HETATM 3015 O  O4  . 6PG C 2 .   ? 6.345   1.163   12.111  0.75 32.86 ? 300 6PG A O4  1 
HETATM 3016 O  O5  . 6PG C 2 .   ? 5.596   -2.332  11.585  0.75 26.96 ? 300 6PG A O5  1 
HETATM 3017 O  O6  . 6PG C 2 .   ? 6.407   -1.344  14.223  1.00 35.56 ? 300 6PG A O6  1 
HETATM 3018 P  P   . 6PG C 2 .   ? 6.651   -0.292  15.297  1.00 38.02 ? 300 6PG A P   1 
HETATM 3019 O  O1P . 6PG C 2 .   ? 6.861   1.033   14.637  1.00 36.23 ? 300 6PG A O1P 1 
HETATM 3020 O  O2P . 6PG C 2 .   ? 7.885   -0.613  16.092  1.00 35.54 ? 300 6PG A O2P 1 
HETATM 3021 O  O3P . 6PG C 2 .   ? 5.497   -0.246  16.248  1.00 37.05 ? 300 6PG A O3P 1 
HETATM 3022 NI NI  . NI  D 3 .   ? 2.141   3.429   12.015  1.00 42.87 ? 210 NI  A NI  1 
HETATM 3023 C  C1  . 6PG E 2 .   ? -5.754  6.746   -7.793  0.75 28.82 ? 301 6PG B C1  1 
HETATM 3024 C  C2  . 6PG E 2 .   ? -4.803  5.728   -8.366  0.75 27.45 ? 301 6PG B C2  1 
HETATM 3025 C  C3  . 6PG E 2 .   ? -5.515  4.492   -8.967  0.75 27.80 ? 301 6PG B C3  1 
HETATM 3026 C  C4  . 6PG E 2 .   ? -6.180  4.827   -10.326 0.75 28.15 ? 301 6PG B C4  1 
HETATM 3027 C  C5  . 6PG E 2 .   ? -6.770  3.636   -11.122 0.75 26.92 ? 301 6PG B C5  1 
HETATM 3028 C  C6  . 6PG E 2 .   ? -7.472  4.027   -12.427 0.75 27.06 ? 301 6PG B C6  1 
HETATM 3029 O  O1A . 6PG E 2 .   ? -5.371  7.904   -7.673  0.75 30.36 ? 301 6PG B O1A 1 
HETATM 3030 O  O1  . 6PG E 2 .   ? -6.997  6.434   -7.426  0.75 30.22 ? 301 6PG B O1  1 
HETATM 3031 O  O2  . 6PG E 2 .   ? -4.008  6.407   -9.346  0.75 20.23 ? 301 6PG B O2  1 
HETATM 3032 O  O3  . 6PG E 2 .   ? -6.450  3.980   -8.034  0.75 25.67 ? 301 6PG B O3  1 
HETATM 3033 O  O4  . 6PG E 2 .   ? -7.169  5.847   -10.185 0.75 32.12 ? 301 6PG B O4  1 
HETATM 3034 O  O5  . 6PG E 2 .   ? -5.704  2.777   -11.436 0.75 23.41 ? 301 6PG B O5  1 
HETATM 3035 O  O6  . 6PG E 2 .   ? -6.730  4.961   -13.217 1.00 30.40 ? 301 6PG B O6  1 
HETATM 3036 P  P   . 6PG E 2 .   ? -7.365  6.304   -13.578 1.00 31.93 ? 301 6PG B P   1 
HETATM 3037 O  O1P . 6PG E 2 .   ? -7.833  6.994   -12.333 1.00 31.82 ? 301 6PG B O1P 1 
HETATM 3038 O  O2P . 6PG E 2 .   ? -8.574  6.108   -14.485 1.00 32.87 ? 301 6PG B O2P 1 
HETATM 3039 O  O3P . 6PG E 2 .   ? -6.429  7.155   -14.374 1.00 28.12 ? 301 6PG B O3P 1 
HETATM 3040 NI NI  . NI  F 3 .   ? -3.607  8.670   -8.610  1.00 36.80 ? 211 NI  B NI  1 
HETATM 3041 O  O   . HOH G 4 .   ? 0.882   -10.662 21.994  1.00 28.08 ? 301 HOH A O   1 
HETATM 3042 O  O   . HOH G 4 .   ? 5.967   -1.974  8.173   1.00 27.21 ? 302 HOH A O   1 
HETATM 3043 O  O   . HOH G 4 .   ? 8.188   6.708   0.097   1.00 25.83 ? 303 HOH A O   1 
HETATM 3044 O  O   . HOH G 4 .   ? -0.168  11.880  2.984   1.00 32.06 ? 304 HOH A O   1 
HETATM 3045 O  O   . HOH G 4 .   ? 0.227   -8.943  23.914  1.00 26.01 ? 305 HOH A O   1 
HETATM 3046 O  O   . HOH G 4 .   ? 3.142   -2.586  13.145  1.00 36.57 ? 306 HOH A O   1 
HETATM 3047 O  O   . HOH G 4 .   ? 4.153   -16.242 16.949  1.00 30.08 ? 307 HOH A O   1 
HETATM 3048 O  O   . HOH G 4 .   ? 3.092   -16.373 11.405  1.00 30.19 ? 308 HOH A O   1 
HETATM 3049 O  O   . HOH G 4 .   ? -12.225 -5.213  14.979  1.00 38.20 ? 309 HOH A O   1 
HETATM 3050 O  O   . HOH G 4 .   ? -3.286  6.078   13.258  1.00 37.67 ? 310 HOH A O   1 
HETATM 3051 O  O   . HOH G 4 .   ? -12.088 -6.513  18.231  1.00 40.74 ? 311 HOH A O   1 
HETATM 3052 O  O   . HOH G 4 .   ? 20.456  -6.178  16.490  1.00 39.02 ? 312 HOH A O   1 
HETATM 3053 O  O   . HOH G 4 .   ? 13.256  9.801   -5.845  1.00 29.55 ? 313 HOH A O   1 
HETATM 3054 O  O   . HOH G 4 .   ? 13.845  1.184   8.941   1.00 31.29 ? 314 HOH A O   1 
HETATM 3055 O  O   . HOH G 4 .   ? 0.705   -4.641  25.869  1.00 44.48 ? 315 HOH A O   1 
HETATM 3056 O  O   . HOH G 4 .   ? 12.905  3.102   -10.796 1.00 37.09 ? 316 HOH A O   1 
HETATM 3057 O  O   . HOH G 4 .   ? 20.029  -0.335  5.703   1.00 36.77 ? 317 HOH A O   1 
HETATM 3058 O  O   . HOH G 4 .   ? 8.769   10.744  6.682   1.00 29.41 ? 318 HOH A O   1 
HETATM 3059 O  O   . HOH G 4 .   ? 5.663   2.119   22.005  1.00 38.16 ? 319 HOH A O   1 
HETATM 3060 O  O   . HOH G 4 .   ? 14.441  -1.408  25.873  1.00 32.35 ? 320 HOH A O   1 
HETATM 3061 O  O   . HOH G 4 .   ? -5.010  -14.115 11.777  1.00 37.47 ? 321 HOH A O   1 
HETATM 3062 O  O   . HOH G 4 .   ? 6.413   9.795   22.004  1.00 45.50 ? 322 HOH A O   1 
HETATM 3063 O  O   . HOH G 4 .   ? 8.043   10.721  14.847  1.00 37.34 ? 323 HOH A O   1 
HETATM 3064 O  O   . HOH G 4 .   ? -0.087  13.825  4.899   1.00 32.96 ? 324 HOH A O   1 
HETATM 3065 O  O   . HOH G 4 .   ? 11.748  13.532  0.063   1.00 36.69 ? 325 HOH A O   1 
HETATM 3066 O  O   . HOH G 4 .   ? -1.038  15.211  16.596  1.00 41.40 ? 326 HOH A O   1 
HETATM 3067 O  O   . HOH G 4 .   ? 16.230  -1.575  -6.949  1.00 41.48 ? 327 HOH A O   1 
HETATM 3068 O  O   . HOH G 4 .   ? 20.979  -5.727  8.564   1.00 46.23 ? 328 HOH A O   1 
HETATM 3069 O  O   . HOH G 4 .   ? -0.592  -6.077  23.625  1.00 31.99 ? 329 HOH A O   1 
HETATM 3070 O  O   . HOH G 4 .   ? 13.460  -14.155 16.388  1.00 32.73 ? 330 HOH A O   1 
HETATM 3071 O  O   . HOH G 4 .   ? 20.224  0.074   8.539   1.00 42.96 ? 331 HOH A O   1 
HETATM 3072 O  O   . HOH G 4 .   ? 3.742   -3.328  25.692  1.00 36.51 ? 332 HOH A O   1 
HETATM 3073 O  O   . HOH G 4 .   ? 2.869   -19.653 7.966   1.00 47.88 ? 333 HOH A O   1 
HETATM 3074 O  O   . HOH G 4 .   ? 18.865  -4.010  22.175  1.00 39.61 ? 334 HOH A O   1 
HETATM 3075 O  O   . HOH G 4 .   ? 11.902  14.781  7.589   1.00 38.71 ? 335 HOH A O   1 
HETATM 3076 O  O   . HOH G 4 .   ? 8.687   14.961  1.137   1.00 42.24 ? 336 HOH A O   1 
HETATM 3077 O  O   . HOH G 4 .   ? 3.282   -1.134  15.236  1.00 28.07 ? 337 HOH A O   1 
HETATM 3078 O  O   . HOH G 4 .   ? -7.159  12.123  8.820   1.00 38.39 ? 338 HOH A O   1 
HETATM 3079 O  O   . HOH G 4 .   ? 17.245  -3.183  1.848   1.00 39.83 ? 339 HOH A O   1 
HETATM 3080 O  O   . HOH G 4 .   ? 9.529   -17.298 33.252  1.00 43.44 ? 340 HOH A O   1 
HETATM 3081 O  O   . HOH G 4 .   ? 12.415  10.088  -2.862  1.00 32.69 ? 341 HOH A O   1 
HETATM 3082 O  O   . HOH G 4 .   ? 0.863   11.558  19.419  1.00 42.15 ? 342 HOH A O   1 
HETATM 3083 O  O   . HOH G 4 .   ? 4.488   -11.928 28.422  1.00 42.14 ? 343 HOH A O   1 
HETATM 3084 O  O   . HOH G 4 .   ? -11.940 -2.148  24.680  1.00 45.97 ? 344 HOH A O   1 
HETATM 3085 O  O   . HOH G 4 .   ? 2.294   -6.541  27.098  1.00 28.14 ? 345 HOH A O   1 
HETATM 3086 O  O   . HOH G 4 .   ? 14.153  5.446   3.640   1.00 33.85 ? 346 HOH A O   1 
HETATM 3087 O  O   . HOH G 4 .   ? 21.307  -6.322  13.541  1.00 57.05 ? 347 HOH A O   1 
HETATM 3088 O  O   . HOH G 4 .   ? 9.567   -18.280 21.667  1.00 45.62 ? 348 HOH A O   1 
HETATM 3089 O  O   . HOH G 4 .   ? -4.841  -16.040 2.559   1.00 38.55 ? 349 HOH A O   1 
HETATM 3090 O  O   . HOH G 4 .   ? -14.035 -5.214  26.662  1.00 52.49 ? 350 HOH A O   1 
HETATM 3091 O  O   . HOH G 4 .   ? 4.231   22.848  -11.568 1.00 43.86 ? 351 HOH A O   1 
HETATM 3092 O  O   . HOH G 4 .   ? -13.468 -6.007  20.326  1.00 43.64 ? 352 HOH A O   1 
HETATM 3093 O  O   . HOH G 4 .   ? 8.912   0.519   27.971  1.00 41.83 ? 353 HOH A O   1 
HETATM 3094 O  O   . HOH G 4 .   ? 10.045  1.869   23.528  1.00 44.08 ? 354 HOH A O   1 
HETATM 3095 O  O   . HOH G 4 .   ? 20.574  -2.546  3.771   1.00 61.93 ? 355 HOH A O   1 
HETATM 3096 O  O   . HOH G 4 .   ? -10.258 -13.346 22.304  1.00 42.71 ? 356 HOH A O   1 
HETATM 3097 O  O   . HOH G 4 .   ? 13.838  6.033   -10.682 1.00 41.09 ? 357 HOH A O   1 
HETATM 3098 O  O   . HOH G 4 .   ? 12.366  -4.965  33.000  1.00 42.94 ? 358 HOH A O   1 
HETATM 3099 O  O   . HOH G 4 .   ? -1.274  -18.030 6.118   1.00 43.67 ? 359 HOH A O   1 
HETATM 3100 O  O   . HOH G 4 .   ? -11.434 -9.501  14.076  1.00 51.99 ? 360 HOH A O   1 
HETATM 3101 O  O   . HOH G 4 .   ? -9.676  -9.327  9.005   1.00 44.14 ? 361 HOH A O   1 
HETATM 3102 O  O   . HOH G 4 .   ? 11.768  -2.401  -9.903  1.00 56.26 ? 362 HOH A O   1 
HETATM 3103 O  O   . HOH G 4 .   ? -2.732  7.803   15.324  1.00 39.84 ? 363 HOH A O   1 
HETATM 3104 O  O   . HOH G 4 .   ? 17.358  -4.529  27.151  1.00 43.13 ? 364 HOH A O   1 
HETATM 3105 O  O   . HOH G 4 .   ? 4.431   -18.709 6.540   1.00 45.67 ? 365 HOH A O   1 
HETATM 3106 O  O   . HOH G 4 .   ? -9.993  -10.289 29.690  1.00 45.39 ? 366 HOH A O   1 
HETATM 3107 O  O   . HOH G 4 .   ? 15.519  4.480   1.359   1.00 55.55 ? 367 HOH A O   1 
HETATM 3108 O  O   . HOH G 4 .   ? -8.940  -14.845 18.268  1.00 44.39 ? 368 HOH A O   1 
HETATM 3109 O  O   . HOH G 4 .   ? 16.986  -11.743 8.454   1.00 50.24 ? 369 HOH A O   1 
HETATM 3110 O  O   . HOH G 4 .   ? 20.077  -8.843  11.818  1.00 54.54 ? 370 HOH A O   1 
HETATM 3111 O  O   . HOH G 4 .   ? 1.648   -17.696 4.546   1.00 34.34 ? 371 HOH A O   1 
HETATM 3112 O  O   . HOH G 4 .   ? 13.529  -7.213  -3.057  1.00 44.73 ? 372 HOH A O   1 
HETATM 3113 O  O   . HOH G 4 .   ? 17.918  2.289   10.961  1.00 42.43 ? 373 HOH A O   1 
HETATM 3114 O  O   . HOH G 4 .   ? 10.997  -16.955 28.829  1.00 48.54 ? 374 HOH A O   1 
HETATM 3115 O  O   . HOH G 4 .   ? 9.723   -8.587  37.644  1.00 45.40 ? 375 HOH A O   1 
HETATM 3116 O  O   . HOH G 4 .   ? 11.537  21.103  -12.299 1.00 47.46 ? 376 HOH A O   1 
HETATM 3117 O  O   . HOH G 4 .   ? -14.665 -3.747  20.261  1.00 50.40 ? 377 HOH A O   1 
HETATM 3118 O  O   . HOH G 4 .   ? -1.801  15.448  4.140   1.00 40.72 ? 378 HOH A O   1 
HETATM 3119 O  O   . HOH G 4 .   ? 1.975   23.717  -12.885 1.00 45.57 ? 379 HOH A O   1 
HETATM 3120 O  O   . HOH G 4 .   ? 18.548  -6.058  3.190   1.00 44.69 ? 380 HOH A O   1 
HETATM 3121 O  O   . HOH G 4 .   ? 15.146  8.514   -5.933  1.00 40.61 ? 381 HOH A O   1 
HETATM 3122 O  O   . HOH G 4 .   ? 4.782   10.577  23.672  1.00 44.90 ? 382 HOH A O   1 
HETATM 3123 O  O   . HOH G 4 .   ? 11.484  -16.417 15.927  1.00 38.33 ? 383 HOH A O   1 
HETATM 3124 O  O   . HOH G 4 .   ? 22.523  -12.729 24.485  1.00 43.10 ? 384 HOH A O   1 
HETATM 3125 O  O   . HOH G 4 .   ? 9.062   -17.320 27.445  1.00 39.60 ? 385 HOH A O   1 
HETATM 3126 O  O   . HOH G 4 .   ? -11.330 -6.283  22.464  1.00 52.25 ? 386 HOH A O   1 
HETATM 3127 O  O   . HOH G 4 .   ? 7.429   -10.857 -4.600  1.00 44.50 ? 387 HOH A O   1 
HETATM 3128 O  O   . HOH G 4 .   ? 10.704  -18.127 11.773  1.00 51.16 ? 388 HOH A O   1 
HETATM 3129 O  O   . HOH G 4 .   ? -11.150 -12.122 14.876  1.00 59.94 ? 389 HOH A O   1 
HETATM 3130 O  O   . HOH H 4 .   ? -5.774  1.111   -8.310  1.00 20.66 ? 302 HOH B O   1 
HETATM 3131 O  O   . HOH H 4 .   ? -0.118  2.507   -24.252 1.00 24.20 ? 303 HOH B O   1 
HETATM 3132 O  O   . HOH H 4 .   ? 0.272   5.139   -24.813 1.00 25.30 ? 304 HOH B O   1 
HETATM 3133 O  O   . HOH H 4 .   ? -3.319  3.786   -12.586 1.00 21.84 ? 305 HOH B O   1 
HETATM 3134 O  O   . HOH H 4 .   ? -3.652  4.123   -30.684 1.00 25.19 ? 306 HOH B O   1 
HETATM 3135 O  O   . HOH H 4 .   ? -2.843  11.419  3.331   1.00 33.60 ? 307 HOH B O   1 
HETATM 3136 O  O   . HOH H 4 .   ? -0.137  -8.263  -18.212 1.00 24.29 ? 308 HOH B O   1 
HETATM 3137 O  O   . HOH H 4 .   ? 0.874   12.610  -8.143  1.00 25.68 ? 309 HOH B O   1 
HETATM 3138 O  O   . HOH H 4 .   ? -10.932 7.960   13.403  1.00 36.64 ? 310 HOH B O   1 
HETATM 3139 O  O   . HOH H 4 .   ? 0.028   15.107  -8.861  1.00 34.71 ? 311 HOH B O   1 
HETATM 3140 O  O   . HOH H 4 .   ? 0.500   7.095   -22.957 1.00 28.50 ? 312 HOH B O   1 
HETATM 3141 O  O   . HOH H 4 .   ? -3.945  6.300   -13.900 1.00 27.76 ? 313 HOH B O   1 
HETATM 3142 O  O   . HOH H 4 .   ? -6.476  10.200  -5.960  1.00 38.21 ? 314 HOH B O   1 
HETATM 3143 O  O   . HOH H 4 .   ? -11.113 10.381  -0.802  1.00 28.17 ? 315 HOH B O   1 
HETATM 3144 O  O   . HOH H 4 .   ? -9.550  3.812   2.825   1.00 25.86 ? 316 HOH B O   1 
HETATM 3145 O  O   . HOH H 4 .   ? -6.923  9.312   -35.598 1.00 38.62 ? 317 HOH B O   1 
HETATM 3146 O  O   . HOH H 4 .   ? -14.193 1.928   -7.897  1.00 33.46 ? 318 HOH B O   1 
HETATM 3147 O  O   . HOH H 4 .   ? -1.843  -5.601  -23.141 1.00 26.25 ? 319 HOH B O   1 
HETATM 3148 O  O   . HOH H 4 .   ? 8.127   16.038  -6.783  1.00 30.44 ? 320 HOH B O   1 
HETATM 3149 O  O   . HOH H 4 .   ? -18.524 1.809   -13.370 1.00 35.25 ? 321 HOH B O   1 
HETATM 3150 O  O   . HOH H 4 .   ? -4.261  10.191  -23.753 1.00 30.12 ? 322 HOH B O   1 
HETATM 3151 O  O   . HOH H 4 .   ? -10.879 15.015  -7.825  1.00 29.08 ? 323 HOH B O   1 
HETATM 3152 O  O   . HOH H 4 .   ? -4.229  19.423  -10.566 1.00 34.92 ? 324 HOH B O   1 
HETATM 3153 O  O   . HOH H 4 .   ? -15.282 2.921   -0.649  1.00 38.70 ? 325 HOH B O   1 
HETATM 3154 O  O   . HOH H 4 .   ? -11.709 -13.182 -5.905  1.00 28.91 ? 326 HOH B O   1 
HETATM 3155 O  O   . HOH H 4 .   ? -2.756  21.604  -5.959  1.00 32.27 ? 327 HOH B O   1 
HETATM 3156 O  O   . HOH H 4 .   ? -15.115 8.522   -24.028 1.00 37.71 ? 328 HOH B O   1 
HETATM 3157 O  O   . HOH H 4 .   ? 7.024   21.931  -3.572  1.00 42.53 ? 329 HOH B O   1 
HETATM 3158 O  O   . HOH H 4 .   ? 1.718   -12.575 -12.988 1.00 36.76 ? 330 HOH B O   1 
HETATM 3159 O  O   . HOH H 4 .   ? -4.568  -13.320 -2.446  1.00 30.71 ? 331 HOH B O   1 
HETATM 3160 O  O   . HOH H 4 .   ? 3.755   16.518  -1.124  1.00 38.85 ? 332 HOH B O   1 
HETATM 3161 O  O   . HOH H 4 .   ? -15.934 -8.296  -13.919 1.00 47.89 ? 333 HOH B O   1 
HETATM 3162 O  O   . HOH H 4 .   ? -14.546 -5.470  6.220   1.00 40.79 ? 334 HOH B O   1 
HETATM 3163 O  O   . HOH H 4 .   ? -12.400 -6.221  9.817   1.00 36.18 ? 335 HOH B O   1 
HETATM 3164 O  O   . HOH H 4 .   ? -15.631 2.762   2.356   1.00 42.89 ? 336 HOH B O   1 
HETATM 3165 O  O   . HOH H 4 .   ? -10.937 -9.650  -11.735 1.00 38.39 ? 337 HOH B O   1 
HETATM 3166 O  O   . HOH H 4 .   ? 11.663  6.890   -18.516 1.00 37.83 ? 338 HOH B O   1 
HETATM 3167 O  O   . HOH H 4 .   ? -7.534  11.910  -18.219 1.00 30.58 ? 339 HOH B O   1 
HETATM 3168 O  O   . HOH H 4 .   ? 11.707  0.780   -16.057 1.00 41.55 ? 340 HOH B O   1 
HETATM 3169 O  O   . HOH H 4 .   ? -14.026 10.876  -22.932 1.00 47.01 ? 341 HOH B O   1 
HETATM 3170 O  O   . HOH H 4 .   ? -1.910  -13.770 -0.857  1.00 40.01 ? 342 HOH B O   1 
HETATM 3171 O  O   . HOH H 4 .   ? -8.969  -7.796  -22.631 1.00 33.97 ? 343 HOH B O   1 
HETATM 3172 O  O   . HOH H 4 .   ? -0.857  -12.968 -15.575 1.00 34.96 ? 344 HOH B O   1 
HETATM 3173 O  O   . HOH H 4 .   ? -0.792  -12.295 -7.968  1.00 38.77 ? 345 HOH B O   1 
HETATM 3174 O  O   . HOH H 4 .   ? -16.267 3.770   11.322  1.00 40.02 ? 346 HOH B O   1 
HETATM 3175 O  O   . HOH H 4 .   ? 3.665   10.686  -35.720 1.00 40.23 ? 347 HOH B O   1 
HETATM 3176 O  O   . HOH H 4 .   ? -15.369 2.289   5.051   1.00 45.61 ? 348 HOH B O   1 
HETATM 3177 O  O   . HOH H 4 .   ? 8.556   -6.758  -9.153  1.00 40.07 ? 349 HOH B O   1 
HETATM 3178 O  O   . HOH H 4 .   ? -13.029 -7.998  -11.533 1.00 31.87 ? 350 HOH B O   1 
HETATM 3179 O  O   . HOH H 4 .   ? -1.477  -6.777  -26.069 1.00 29.13 ? 351 HOH B O   1 
HETATM 3180 O  O   . HOH H 4 .   ? 10.648  8.876   -29.822 1.00 37.26 ? 352 HOH B O   1 
HETATM 3181 O  O   . HOH H 4 .   ? -17.368 -4.966  -5.009  1.00 49.49 ? 353 HOH B O   1 
HETATM 3182 O  O   . HOH H 4 .   ? -7.152  7.564   -36.920 1.00 41.78 ? 354 HOH B O   1 
HETATM 3183 O  O   . HOH H 4 .   ? 10.122  21.261  -15.543 1.00 35.72 ? 355 HOH B O   1 
HETATM 3184 O  O   . HOH H 4 .   ? -16.089 0.886   -0.429  1.00 45.99 ? 356 HOH B O   1 
HETATM 3185 O  O   . HOH H 4 .   ? -2.431  8.253   -26.504 1.00 33.39 ? 357 HOH B O   1 
HETATM 3186 O  O   . HOH H 4 .   ? -1.206  9.818   -24.258 1.00 32.63 ? 358 HOH B O   1 
HETATM 3187 O  O   . HOH H 4 .   ? -6.921  -5.586  -28.509 1.00 44.04 ? 359 HOH B O   1 
HETATM 3188 O  O   . HOH H 4 .   ? -1.527  3.807   -32.258 1.00 51.56 ? 360 HOH B O   1 
HETATM 3189 O  O   . HOH H 4 .   ? -17.944 6.690   -26.505 1.00 41.82 ? 361 HOH B O   1 
HETATM 3190 O  O   . HOH H 4 .   ? -16.624 -8.366  -9.417  1.00 33.07 ? 362 HOH B O   1 
HETATM 3191 O  O   . HOH H 4 .   ? -5.545  -12.680 -14.114 1.00 42.44 ? 363 HOH B O   1 
HETATM 3192 O  O   . HOH H 4 .   ? 1.009   -10.380 -19.342 1.00 38.23 ? 364 HOH B O   1 
HETATM 3193 O  O   . HOH H 4 .   ? -18.739 0.922   -18.390 1.00 50.61 ? 365 HOH B O   1 
HETATM 3194 O  O   . HOH H 4 .   ? 6.220   17.914  -2.070  1.00 36.51 ? 366 HOH B O   1 
HETATM 3195 O  O   . HOH H 4 .   ? -9.002  -1.662  -34.054 1.00 37.42 ? 367 HOH B O   1 
HETATM 3196 O  O   . HOH H 4 .   ? -8.610  -11.474 -13.547 1.00 56.10 ? 368 HOH B O   1 
HETATM 3197 O  O   . HOH H 4 .   ? -14.380 4.041   6.829   1.00 35.52 ? 369 HOH B O   1 
HETATM 3198 O  O   . HOH H 4 .   ? 5.119   -8.069  -22.804 1.00 41.06 ? 370 HOH B O   1 
HETATM 3199 O  O   . HOH H 4 .   ? -14.368 -3.786  11.397  1.00 34.55 ? 371 HOH B O   1 
HETATM 3200 O  O   . HOH H 4 .   ? 7.877   -10.826 -10.212 1.00 37.95 ? 372 HOH B O   1 
HETATM 3201 O  O   . HOH H 4 .   ? -14.389 -7.168  -22.311 1.00 37.21 ? 373 HOH B O   1 
HETATM 3202 O  O   . HOH H 4 .   ? -14.723 2.371   9.171   1.00 32.52 ? 374 HOH B O   1 
HETATM 3203 O  O   . HOH H 4 .   ? -12.161 -11.153 -3.196  1.00 40.54 ? 375 HOH B O   1 
HETATM 3204 O  O   . HOH H 4 .   ? -8.981  20.326  -15.385 1.00 43.39 ? 376 HOH B O   1 
HETATM 3205 O  O   . HOH H 4 .   ? -2.897  14.146  2.822   1.00 31.84 ? 377 HOH B O   1 
HETATM 3206 O  O   . HOH H 4 .   ? -14.270 8.809   6.038   1.00 36.68 ? 378 HOH B O   1 
HETATM 3207 O  O   . HOH H 4 .   ? -19.590 -1.891  -18.448 1.00 40.12 ? 379 HOH B O   1 
HETATM 3208 O  O   . HOH H 4 .   ? -16.062 -2.319  10.495  1.00 36.32 ? 380 HOH B O   1 
HETATM 3209 O  O   . HOH H 4 .   ? 6.383   9.414   -32.414 1.00 39.54 ? 381 HOH B O   1 
HETATM 3210 O  O   . HOH H 4 .   ? -4.789  0.846   -37.612 1.00 46.14 ? 382 HOH B O   1 
HETATM 3211 O  O   . HOH H 4 .   ? 3.657   -6.233  -33.401 1.00 42.75 ? 383 HOH B O   1 
HETATM 3212 O  O   . HOH H 4 .   ? -6.714  -2.317  -32.762 1.00 33.92 ? 384 HOH B O   1 
HETATM 3213 O  O   . HOH H 4 .   ? 10.814  -0.928  -11.893 1.00 43.61 ? 385 HOH B O   1 
HETATM 3214 O  O   . HOH H 4 .   ? -10.147 12.623  -3.260  1.00 49.49 ? 386 HOH B O   1 
HETATM 3215 O  O   . HOH H 4 .   ? -11.207 10.721  12.947  1.00 45.75 ? 387 HOH B O   1 
HETATM 3216 O  O   . HOH H 4 .   ? -11.808 12.780  15.976  1.00 59.13 ? 388 HOH B O   1 
HETATM 3217 O  O   . HOH H 4 .   ? 10.282  13.276  -21.657 1.00 44.33 ? 389 HOH B O   1 
HETATM 3218 O  O   . HOH H 4 .   ? -15.364 13.530  0.886   1.00 47.69 ? 390 HOH B O   1 
HETATM 3219 O  O   . HOH H 4 .   ? -15.518 5.165   -3.961  1.00 50.49 ? 391 HOH B O   1 
HETATM 3220 O  O   . HOH H 4 .   ? -3.092  -17.383 -4.621  1.00 47.68 ? 392 HOH B O   1 
HETATM 3221 O  O   . HOH H 4 .   ? 11.108  7.052   -21.557 1.00 58.38 ? 393 HOH B O   1 
HETATM 3222 O  O   . HOH H 4 .   ? -10.938 -6.670  -22.066 1.00 33.65 ? 394 HOH B O   1 
HETATM 3223 O  O   . HOH H 4 .   ? -11.087 9.497   -5.165  1.00 44.77 ? 395 HOH B O   1 
HETATM 3224 O  O   . HOH H 4 .   ? -15.490 -2.861  15.308  1.00 38.26 ? 396 HOH B O   1 
HETATM 3225 O  O   . HOH H 4 .   ? -2.409  18.193  5.290   1.00 44.16 ? 397 HOH B O   1 
HETATM 3226 O  O   . HOH H 4 .   ? -12.720 -2.817  14.450  1.00 31.67 ? 398 HOH B O   1 
HETATM 3227 O  O   . HOH H 4 .   ? -8.771  18.048  5.868   1.00 38.63 ? 399 HOH B O   1 
HETATM 3228 O  O   . HOH H 4 .   ? -11.553 9.286   -39.189 1.00 44.69 ? 400 HOH B O   1 
HETATM 3229 O  O   . HOH H 4 .   ? -10.431 12.987  -24.209 1.00 43.60 ? 401 HOH B O   1 
HETATM 3230 O  O   . HOH H 4 .   ? 11.319  7.140   -24.380 1.00 40.52 ? 402 HOH B O   1 
HETATM 3231 O  O   . HOH H 4 .   ? 8.230   17.596  -4.862  1.00 43.64 ? 403 HOH B O   1 
HETATM 3232 O  O   . HOH H 4 .   ? -13.325 4.617   -7.713  1.00 48.74 ? 404 HOH B O   1 
HETATM 3233 O  O   . HOH H 4 .   ? 11.390  1.928   -25.097 1.00 55.84 ? 405 HOH B O   1 
HETATM 3234 O  O   . HOH H 4 .   ? -14.133 10.944  19.352  1.00 49.33 ? 406 HOH B O   1 
HETATM 3235 O  O   . HOH H 4 .   ? -15.385 -10.245 -11.820 1.00 46.33 ? 407 HOH B O   1 
HETATM 3236 O  O   . HOH H 4 .   ? -4.697  -12.185 -24.324 1.00 44.54 ? 408 HOH B O   1 
HETATM 3237 O  O   . HOH H 4 .   ? 7.011   -4.593  -17.177 1.00 34.94 ? 409 HOH B O   1 
HETATM 3238 O  O   . HOH H 4 .   ? -5.609  15.538  -27.767 1.00 46.29 ? 410 HOH B O   1 
HETATM 3239 O  O   . HOH H 4 .   ? -12.510 12.445  18.221  1.00 47.70 ? 411 HOH B O   1 
HETATM 3240 O  O   . HOH H 4 .   ? 5.750   20.600  -0.868  1.00 54.10 ? 412 HOH B O   1 
HETATM 3241 O  O   . HOH H 4 .   ? -9.861  17.868  -14.568 1.00 43.61 ? 413 HOH B O   1 
HETATM 3242 O  O   . HOH H 4 .   ? -17.735 3.911   -13.364 1.00 57.02 ? 414 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  TRP 40  40  40  TRP TRP A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 MET 122 122 122 MET MET A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 TYR 129 129 129 TYR TYR A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 TRP 134 134 134 TRP TRP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 HIS 136 136 136 HIS HIS A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 TRP 187 187 187 TRP TRP A . n 
A 1 188 LYS 188 188 ?   ?   ?   A . n 
A 1 189 LYS 189 189 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   PHE 6   6   6   PHE PHE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   LYS 9   9   9   LYS LYS B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  PHE 12  12  12  PHE PHE B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  THR 14  14  14  THR THR B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  ILE 17  17  17  ILE ILE B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  LYS 21  21  21  LYS LYS B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ARG 25  25  25  ARG ARG B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  ASP 29  29  29  ASP ASP B . n 
B 1 30  MET 30  30  30  MET MET B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  TYR 33  33  33  TYR TYR B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  ARG 38  38  38  ARG ARG B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  TRP 40  40  40  TRP TRP B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  GLU 45  45  45  GLU GLU B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  ASP 48  48  48  ASP ASP B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  VAL 50  50  50  VAL VAL B . n 
B 1 51  VAL 51  51  51  VAL VAL B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  TYR 55  55  55  TYR TYR B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  GLN 59  59  59  GLN GLN B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  PHE 68  68  68  PHE PHE B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  VAL 72  72  72  VAL VAL B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  TYR 74  74  74  TYR TYR B . n 
B 1 75  PRO 75  75  75  PRO PRO B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  LYS 77  77  77  LYS LYS B . n 
B 1 78  VAL 78  78  78  VAL VAL B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  LYS 80  80  80  LYS LYS B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  PHE 83  83  83  PHE PHE B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  THR 85  85  85  THR THR B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  HIS 88  88  88  HIS HIS B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  HIS 90  90  90  HIS HIS B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  LYS 92  92  92  LYS LYS B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  ASP 94  94  94  ASP ASP B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  TYR 99  99  99  TYR TYR B . n 
B 1 100 VAL 100 100 100 VAL VAL B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 LYS 105 105 105 LYS LYS B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 MET 108 108 108 MET MET B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 GLN 111 111 111 GLN GLN B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLU 114 114 114 GLU GLU B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 TRP 119 119 119 TRP TRP B . n 
B 1 120 ILE 120 120 120 ILE ILE B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 MET 122 122 122 MET MET B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 THR 126 126 126 THR THR B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 TYR 129 129 129 TYR TYR B . n 
B 1 130 VAL 130 130 130 VAL VAL B . n 
B 1 131 PRO 131 131 131 PRO PRO B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 TRP 134 134 134 TRP TRP B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 HIS 136 136 136 HIS HIS B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 ASN 140 140 140 ASN ASN B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 ASP 143 143 143 ASP ASP B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 ALA 150 150 150 ALA ALA B . n 
B 1 151 ILE 151 151 151 ILE ILE B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ASP 155 155 155 ASP ASP B . n 
B 1 156 ALA 156 156 156 ALA ALA B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 HIS 158 158 158 HIS HIS B . n 
B 1 159 ASP 159 159 159 ASP ASP B . n 
B 1 160 TYR 160 160 160 TYR TYR B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 THR 162 162 162 THR THR B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 PHE 168 168 168 PHE PHE B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 LYS 170 170 170 LYS LYS B . n 
B 1 171 ILE 171 171 171 ILE ILE B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 ILE 173 173 173 ILE ILE B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 GLU 175 175 175 GLU GLU B . n 
B 1 176 ASN 176 176 176 ASN ASN B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 LYS 180 180 180 LYS LYS B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 PRO 185 185 185 PRO PRO B . n 
B 1 186 ARG 186 186 186 ARG ARG B . n 
B 1 187 TRP 187 187 187 TRP TRP B . n 
B 1 188 LYS 188 188 ?   ?   ?   B . n 
B 1 189 LYS 189 189 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 6PG 1   300 300 6PG 6PG A . 
D 3 NI  1   210 200 NI  FE  A . 
E 2 6PG 1   301 300 6PG 6PG B . 
F 3 NI  1   211 200 NI  FE  B . 
G 4 HOH 1   301 4   HOH HOH A . 
G 4 HOH 2   302 5   HOH HOH A . 
G 4 HOH 3   303 6   HOH HOH A . 
G 4 HOH 4   304 7   HOH HOH A . 
G 4 HOH 5   305 10  HOH HOH A . 
G 4 HOH 6   306 12  HOH HOH A . 
G 4 HOH 7   307 19  HOH HOH A . 
G 4 HOH 8   308 20  HOH HOH A . 
G 4 HOH 9   309 22  HOH HOH A . 
G 4 HOH 10  310 23  HOH HOH A . 
G 4 HOH 11  311 24  HOH HOH A . 
G 4 HOH 12  312 28  HOH HOH A . 
G 4 HOH 13  313 32  HOH HOH A . 
G 4 HOH 14  314 33  HOH HOH A . 
G 4 HOH 15  315 34  HOH HOH A . 
G 4 HOH 16  316 39  HOH HOH A . 
G 4 HOH 17  317 40  HOH HOH A . 
G 4 HOH 18  318 41  HOH HOH A . 
G 4 HOH 19  319 46  HOH HOH A . 
G 4 HOH 20  320 50  HOH HOH A . 
G 4 HOH 21  321 51  HOH HOH A . 
G 4 HOH 22  322 52  HOH HOH A . 
G 4 HOH 23  323 53  HOH HOH A . 
G 4 HOH 24  324 59  HOH HOH A . 
G 4 HOH 25  325 61  HOH HOH A . 
G 4 HOH 26  326 62  HOH HOH A . 
G 4 HOH 27  327 64  HOH HOH A . 
G 4 HOH 28  328 65  HOH HOH A . 
G 4 HOH 29  329 69  HOH HOH A . 
G 4 HOH 30  330 70  HOH HOH A . 
G 4 HOH 31  331 71  HOH HOH A . 
G 4 HOH 32  332 72  HOH HOH A . 
G 4 HOH 33  333 78  HOH HOH A . 
G 4 HOH 34  334 80  HOH HOH A . 
G 4 HOH 35  335 82  HOH HOH A . 
G 4 HOH 36  336 84  HOH HOH A . 
G 4 HOH 37  337 88  HOH HOH A . 
G 4 HOH 38  338 89  HOH HOH A . 
G 4 HOH 39  339 90  HOH HOH A . 
G 4 HOH 40  340 91  HOH HOH A . 
G 4 HOH 41  341 93  HOH HOH A . 
G 4 HOH 42  342 98  HOH HOH A . 
G 4 HOH 43  343 100 HOH HOH A . 
G 4 HOH 44  344 102 HOH HOH A . 
G 4 HOH 45  345 104 HOH HOH A . 
G 4 HOH 46  346 107 HOH HOH A . 
G 4 HOH 47  347 109 HOH HOH A . 
G 4 HOH 48  348 111 HOH HOH A . 
G 4 HOH 49  349 112 HOH HOH A . 
G 4 HOH 50  350 113 HOH HOH A . 
G 4 HOH 51  351 116 HOH HOH A . 
G 4 HOH 52  352 120 HOH HOH A . 
G 4 HOH 53  353 122 HOH HOH A . 
G 4 HOH 54  354 124 HOH HOH A . 
G 4 HOH 55  355 125 HOH HOH A . 
G 4 HOH 56  356 127 HOH HOH A . 
G 4 HOH 57  357 130 HOH HOH A . 
G 4 HOH 58  358 131 HOH HOH A . 
G 4 HOH 59  359 133 HOH HOH A . 
G 4 HOH 60  360 134 HOH HOH A . 
G 4 HOH 61  361 135 HOH HOH A . 
G 4 HOH 62  362 136 HOH HOH A . 
G 4 HOH 63  363 137 HOH HOH A . 
G 4 HOH 64  364 138 HOH HOH A . 
G 4 HOH 65  365 141 HOH HOH A . 
G 4 HOH 66  366 144 HOH HOH A . 
G 4 HOH 67  367 145 HOH HOH A . 
G 4 HOH 68  368 147 HOH HOH A . 
G 4 HOH 69  369 148 HOH HOH A . 
G 4 HOH 70  370 150 HOH HOH A . 
G 4 HOH 71  371 152 HOH HOH A . 
G 4 HOH 72  372 156 HOH HOH A . 
G 4 HOH 73  373 161 HOH HOH A . 
G 4 HOH 74  374 162 HOH HOH A . 
G 4 HOH 75  375 164 HOH HOH A . 
G 4 HOH 76  376 166 HOH HOH A . 
G 4 HOH 77  377 175 HOH HOH A . 
G 4 HOH 78  378 178 HOH HOH A . 
G 4 HOH 79  379 179 HOH HOH A . 
G 4 HOH 80  380 183 HOH HOH A . 
G 4 HOH 81  381 190 HOH HOH A . 
G 4 HOH 82  382 193 HOH HOH A . 
G 4 HOH 83  383 194 HOH HOH A . 
G 4 HOH 84  384 195 HOH HOH A . 
G 4 HOH 85  385 196 HOH HOH A . 
G 4 HOH 86  386 198 HOH HOH A . 
G 4 HOH 87  387 199 HOH HOH A . 
G 4 HOH 88  388 201 HOH HOH A . 
G 4 HOH 89  389 202 HOH HOH A . 
H 4 HOH 1   302 1   HOH HOH B . 
H 4 HOH 2   303 2   HOH HOH B . 
H 4 HOH 3   304 3   HOH HOH B . 
H 4 HOH 4   305 8   HOH HOH B . 
H 4 HOH 5   306 9   HOH HOH B . 
H 4 HOH 6   307 11  HOH HOH B . 
H 4 HOH 7   308 13  HOH HOH B . 
H 4 HOH 8   309 14  HOH HOH B . 
H 4 HOH 9   310 15  HOH HOH B . 
H 4 HOH 10  311 16  HOH HOH B . 
H 4 HOH 11  312 17  HOH HOH B . 
H 4 HOH 12  313 18  HOH HOH B . 
H 4 HOH 13  314 21  HOH HOH B . 
H 4 HOH 14  315 25  HOH HOH B . 
H 4 HOH 15  316 26  HOH HOH B . 
H 4 HOH 16  317 27  HOH HOH B . 
H 4 HOH 17  318 29  HOH HOH B . 
H 4 HOH 18  319 30  HOH HOH B . 
H 4 HOH 19  320 31  HOH HOH B . 
H 4 HOH 20  321 35  HOH HOH B . 
H 4 HOH 21  322 36  HOH HOH B . 
H 4 HOH 22  323 37  HOH HOH B . 
H 4 HOH 23  324 38  HOH HOH B . 
H 4 HOH 24  325 42  HOH HOH B . 
H 4 HOH 25  326 43  HOH HOH B . 
H 4 HOH 26  327 44  HOH HOH B . 
H 4 HOH 27  328 45  HOH HOH B . 
H 4 HOH 28  329 47  HOH HOH B . 
H 4 HOH 29  330 48  HOH HOH B . 
H 4 HOH 30  331 49  HOH HOH B . 
H 4 HOH 31  332 54  HOH HOH B . 
H 4 HOH 32  333 55  HOH HOH B . 
H 4 HOH 33  334 56  HOH HOH B . 
H 4 HOH 34  335 57  HOH HOH B . 
H 4 HOH 35  336 58  HOH HOH B . 
H 4 HOH 36  337 60  HOH HOH B . 
H 4 HOH 37  338 63  HOH HOH B . 
H 4 HOH 38  339 66  HOH HOH B . 
H 4 HOH 39  340 67  HOH HOH B . 
H 4 HOH 40  341 68  HOH HOH B . 
H 4 HOH 41  342 73  HOH HOH B . 
H 4 HOH 42  343 74  HOH HOH B . 
H 4 HOH 43  344 75  HOH HOH B . 
H 4 HOH 44  345 76  HOH HOH B . 
H 4 HOH 45  346 77  HOH HOH B . 
H 4 HOH 46  347 79  HOH HOH B . 
H 4 HOH 47  348 81  HOH HOH B . 
H 4 HOH 48  349 83  HOH HOH B . 
H 4 HOH 49  350 85  HOH HOH B . 
H 4 HOH 50  351 86  HOH HOH B . 
H 4 HOH 51  352 87  HOH HOH B . 
H 4 HOH 52  353 92  HOH HOH B . 
H 4 HOH 53  354 94  HOH HOH B . 
H 4 HOH 54  355 95  HOH HOH B . 
H 4 HOH 55  356 96  HOH HOH B . 
H 4 HOH 56  357 97  HOH HOH B . 
H 4 HOH 57  358 99  HOH HOH B . 
H 4 HOH 58  359 101 HOH HOH B . 
H 4 HOH 59  360 103 HOH HOH B . 
H 4 HOH 60  361 105 HOH HOH B . 
H 4 HOH 61  362 106 HOH HOH B . 
H 4 HOH 62  363 108 HOH HOH B . 
H 4 HOH 63  364 110 HOH HOH B . 
H 4 HOH 64  365 114 HOH HOH B . 
H 4 HOH 65  366 115 HOH HOH B . 
H 4 HOH 66  367 117 HOH HOH B . 
H 4 HOH 67  368 118 HOH HOH B . 
H 4 HOH 68  369 119 HOH HOH B . 
H 4 HOH 69  370 121 HOH HOH B . 
H 4 HOH 70  371 123 HOH HOH B . 
H 4 HOH 71  372 126 HOH HOH B . 
H 4 HOH 72  373 128 HOH HOH B . 
H 4 HOH 73  374 129 HOH HOH B . 
H 4 HOH 74  375 132 HOH HOH B . 
H 4 HOH 75  376 139 HOH HOH B . 
H 4 HOH 76  377 140 HOH HOH B . 
H 4 HOH 77  378 142 HOH HOH B . 
H 4 HOH 78  379 143 HOH HOH B . 
H 4 HOH 79  380 146 HOH HOH B . 
H 4 HOH 80  381 149 HOH HOH B . 
H 4 HOH 81  382 151 HOH HOH B . 
H 4 HOH 82  383 153 HOH HOH B . 
H 4 HOH 83  384 154 HOH HOH B . 
H 4 HOH 84  385 155 HOH HOH B . 
H 4 HOH 85  386 157 HOH HOH B . 
H 4 HOH 86  387 158 HOH HOH B . 
H 4 HOH 87  388 159 HOH HOH B . 
H 4 HOH 88  389 160 HOH HOH B . 
H 4 HOH 89  390 163 HOH HOH B . 
H 4 HOH 90  391 165 HOH HOH B . 
H 4 HOH 91  392 167 HOH HOH B . 
H 4 HOH 92  393 168 HOH HOH B . 
H 4 HOH 93  394 169 HOH HOH B . 
H 4 HOH 94  395 170 HOH HOH B . 
H 4 HOH 95  396 171 HOH HOH B . 
H 4 HOH 96  397 172 HOH HOH B . 
H 4 HOH 97  398 173 HOH HOH B . 
H 4 HOH 98  399 174 HOH HOH B . 
H 4 HOH 99  400 176 HOH HOH B . 
H 4 HOH 100 401 177 HOH HOH B . 
H 4 HOH 101 402 180 HOH HOH B . 
H 4 HOH 102 403 181 HOH HOH B . 
H 4 HOH 103 404 182 HOH HOH B . 
H 4 HOH 104 405 184 HOH HOH B . 
H 4 HOH 105 406 185 HOH HOH B . 
H 4 HOH 106 407 186 HOH HOH B . 
H 4 HOH 107 408 187 HOH HOH B . 
H 4 HOH 108 409 188 HOH HOH B . 
H 4 HOH 109 410 189 HOH HOH B . 
H 4 HOH 110 411 191 HOH HOH B . 
H 4 HOH 111 412 192 HOH HOH B . 
H 4 HOH 112 413 197 HOH HOH B . 
H 4 HOH 113 414 200 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4920  ? 
1 MORE         -65   ? 
1 'SSA (A^2)'  16020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 OE1 ? A GLU 97  ? A GLU 97  ? 1_555 56.5  ? 
2  OE2 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 NE2 ? A HIS 136 ? A HIS 136 ? 1_555 96.9  ? 
3  OE1 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 NE2 ? A HIS 136 ? A HIS 136 ? 1_555 77.7  ? 
4  OE2 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O2  ? C 6PG .   ? A 6PG 300 ? 1_555 122.0 ? 
5  OE1 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O2  ? C 6PG .   ? A 6PG 300 ? 1_555 69.0  ? 
6  NE2 ? A HIS 136 ? A HIS 136 ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O2  ? C 6PG .   ? A 6PG 300 ? 1_555 88.9  ? 
7  OE2 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 NE2 ? A HIS 88  ? A HIS 88  ? 1_555 138.8 ? 
8  OE1 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 NE2 ? A HIS 88  ? A HIS 88  ? 1_555 162.4 ? 
9  NE2 ? A HIS 136 ? A HIS 136 ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 NE2 ? A HIS 88  ? A HIS 88  ? 1_555 90.2  ? 
10 O2  ? C 6PG .   ? A 6PG 300 ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 NE2 ? A HIS 88  ? A HIS 88  ? 1_555 98.6  ? 
11 OE2 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O1A ? C 6PG .   ? A 6PG 300 ? 1_555 95.2  ? 
12 OE1 ? A GLU 97  ? A GLU 97  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O1A ? C 6PG .   ? A 6PG 300 ? 1_555 93.1  ? 
13 NE2 ? A HIS 136 ? A HIS 136 ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O1A ? C 6PG .   ? A 6PG 300 ? 1_555 157.1 ? 
14 O2  ? C 6PG .   ? A 6PG 300 ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O1A ? C 6PG .   ? A 6PG 300 ? 1_555 68.2  ? 
15 NE2 ? A HIS 88  ? A HIS 88  ? 1_555 NI ? D NI . ? A NI 210 ? 1_555 O1A ? C 6PG .   ? A 6PG 300 ? 1_555 93.4  ? 
16 OE2 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O1A ? E 6PG .   ? B 6PG 301 ? 1_555 84.1  ? 
17 OE2 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 88  ? B HIS 88  ? 1_555 161.6 ? 
18 O1A ? E 6PG .   ? B 6PG 301 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 88  ? B HIS 88  ? 1_555 90.8  ? 
19 OE2 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 136 ? B HIS 136 ? 1_555 90.5  ? 
20 O1A ? E 6PG .   ? B 6PG 301 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 136 ? B HIS 136 ? 1_555 161.4 ? 
21 NE2 ? B HIS 88  ? B HIS 88  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 136 ? B HIS 136 ? 1_555 88.7  ? 
22 OE2 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 90  ? B HIS 90  ? 1_555 99.0  ? 
23 O1A ? E 6PG .   ? B 6PG 301 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 90  ? B HIS 90  ? 1_555 105.9 ? 
24 NE2 ? B HIS 88  ? B HIS 88  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 90  ? B HIS 90  ? 1_555 99.4  ? 
25 NE2 ? B HIS 136 ? B HIS 136 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 NE2 ? B HIS 90  ? B HIS 90  ? 1_555 92.5  ? 
26 OE2 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 OE1 ? B GLU 97  ? B GLU 97  ? 1_555 44.8  ? 
27 O1A ? E 6PG .   ? B 6PG 301 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 OE1 ? B GLU 97  ? B GLU 97  ? 1_555 100.7 ? 
28 NE2 ? B HIS 88  ? B HIS 88  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 OE1 ? B GLU 97  ? B GLU 97  ? 1_555 153.4 ? 
29 NE2 ? B HIS 136 ? B HIS 136 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 OE1 ? B GLU 97  ? B GLU 97  ? 1_555 87.7  ? 
30 NE2 ? B HIS 90  ? B HIS 90  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 OE1 ? B GLU 97  ? B GLU 97  ? 1_555 54.6  ? 
31 OE2 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O2  ? E 6PG .   ? B 6PG 301 ? 1_555 67.0  ? 
32 O1A ? E 6PG .   ? B 6PG 301 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O2  ? E 6PG .   ? B 6PG 301 ? 1_555 70.2  ? 
33 NE2 ? B HIS 88  ? B HIS 88  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O2  ? E 6PG .   ? B 6PG 301 ? 1_555 94.7  ? 
34 NE2 ? B HIS 136 ? B HIS 136 ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O2  ? E 6PG .   ? B 6PG 301 ? 1_555 91.3  ? 
35 NE2 ? B HIS 90  ? B HIS 90  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O2  ? E 6PG .   ? B 6PG 301 ? 1_555 165.5 ? 
36 OE1 ? B GLU 97  ? B GLU 97  ? 1_555 NI ? F NI . ? B NI 211 ? 1_555 O2  ? E 6PG .   ? B 6PG 301 ? 1_555 111.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-09 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement       5.0            ? 1 
CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 
CrystalClear 'data scaling'   '(MSC/RIGAKU)' ? 3 
# 
_pdbx_database_remark.id     600 
_pdbx_database_remark.text   
;HETEROGEN
The carboxylate oxygens of gluconate 6-phosphate are labeled O1 and O1A in the PDB file whereas in the published paper describing this structure these atoms are referred to as O1A and O1B, respectively. 
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ  B LYS 170 ? ? OD1 B ASP 183 ? ? 2.10 
2 1 O   A HOH 378 ? ? O   B HOH 377 ? ? 2.15 
3 1 OG  A SER 28  ? ? OD2 A ASP 48  ? ? 2.16 
4 1 OE1 A GLU 18  ? ? O   A HOH 327 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B ASP 48  ? ? CG B ASP 48  ? ? OD2 B ASP 48  ? ? 125.27 118.30 6.97  0.90 N 
2 1 CB B LEU 73  ? ? CG B LEU 73  ? ? CD2 B LEU 73  ? ? 122.90 111.00 11.90 1.70 N 
3 1 CB B ASP 143 ? ? CG B ASP 143 ? ? OD2 B ASP 143 ? ? 123.77 118.30 5.47  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 48  ? ? 45.90   70.26  
2 1 GLU B 47  ? ? -162.15 -23.98 
3 1 ASP B 48  ? ? 33.19   58.40  
4 1 TYR B 133 ? ? 77.77   -8.48  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 188 ? A LYS 188 
2 1 Y 1 A LYS 189 ? A LYS 189 
3 1 Y 1 B LYS 188 ? B LYS 188 
4 1 Y 1 B LYS 189 ? B LYS 189 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '6-PHOSPHOGLUCONIC ACID' 6PG 
3 'NICKEL (II) ION'        NI  
4 water                    HOH 
#