data_1QYF
# 
_entry.id   1QYF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QYF         
RCSB  RCSB020221   
WWPDB D_1000020221 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QXT 'Precyclization intermediate crystal structure of R96A GFP variant'     unspecified 
PDB 1QY3 'Precyclization intermediate crystal structure (B) of R96A GFP variant' unspecified 
PDB 1QYO .                                                                       unspecified 
PDB 1QYQ .                                                                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QYF 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barondeau, D.P.' 1 
'Putnam, C.D.'    2 
'Kassmann, C.J.'  3 
'Tainer, J.A.'    4 
'Getzoff, E.D.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Mechanism and energetics of green fluorescent protein chromophore synthesis revealed by trapped intermediate structures.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            100 
_citation.page_first                12111 
_citation.page_last                 12116 
_citation.year                      2003 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14523232 
_citation.pdbx_database_id_DOI      10.1073/pnas.2133463100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barondeau, D.P.' 1 
primary 'Putnam, C.D.'    2 
primary 'Kassmann, C.J.'  3 
primary 'Tainer, J.A.'    4 
primary 'Getzoff, E.D.'   5 
# 
_cell.entry_id           1QYF 
_cell.length_a           51.515 
_cell.length_b           62.388 
_cell.length_c           71.038 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1QYF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'green-fluorescent protein' 25671.809 1   ? 'R96A, F99S, M153T, V163A, F64L, S65CRO, Y66CRO, G67CRO' 
'residues 1-229' ? 
2 non-polymer syn 'MAGNESIUM ION'             24.305    1   ? ?                                                        ? ? 
3 non-polymer syn 1,2-ETHANEDIOL              62.068    1   ? ?                                                        ? ? 
4 water       nat water                       18.015    275 ? ?                                                        ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(CRO)VQCFSRYPDH
MKQHDFFKSAMPEGYVQEATISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQ
KNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK
QHDFFKSAMPEGYVQEATISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   GLY n 
1 6   GLU n 
1 7   GLU n 
1 8   LEU n 
1 9   PHE n 
1 10  THR n 
1 11  GLY n 
1 12  VAL n 
1 13  VAL n 
1 14  PRO n 
1 15  ILE n 
1 16  LEU n 
1 17  VAL n 
1 18  GLU n 
1 19  LEU n 
1 20  ASP n 
1 21  GLY n 
1 22  ASP n 
1 23  VAL n 
1 24  ASN n 
1 25  GLY n 
1 26  HIS n 
1 27  LYS n 
1 28  PHE n 
1 29  SER n 
1 30  VAL n 
1 31  SER n 
1 32  GLY n 
1 33  GLU n 
1 34  GLY n 
1 35  GLU n 
1 36  GLY n 
1 37  ASP n 
1 38  ALA n 
1 39  THR n 
1 40  TYR n 
1 41  GLY n 
1 42  LYS n 
1 43  LEU n 
1 44  THR n 
1 45  LEU n 
1 46  LYS n 
1 47  PHE n 
1 48  ILE n 
1 49  CYS n 
1 50  THR n 
1 51  THR n 
1 52  GLY n 
1 53  LYS n 
1 54  LEU n 
1 55  PRO n 
1 56  VAL n 
1 57  PRO n 
1 58  TRP n 
1 59  PRO n 
1 60  THR n 
1 61  LEU n 
1 62  VAL n 
1 63  THR n 
1 64  THR n 
1 65  LEU n 
1 66  CRO n 
1 67  VAL n 
1 68  GLN n 
1 69  CYS n 
1 70  PHE n 
1 71  SER n 
1 72  ARG n 
1 73  TYR n 
1 74  PRO n 
1 75  ASP n 
1 76  HIS n 
1 77  MET n 
1 78  LYS n 
1 79  GLN n 
1 80  HIS n 
1 81  ASP n 
1 82  PHE n 
1 83  PHE n 
1 84  LYS n 
1 85  SER n 
1 86  ALA n 
1 87  MET n 
1 88  PRO n 
1 89  GLU n 
1 90  GLY n 
1 91  TYR n 
1 92  VAL n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  THR n 
1 97  ILE n 
1 98  SER n 
1 99  PHE n 
1 100 LYS n 
1 101 ASP n 
1 102 ASP n 
1 103 GLY n 
1 104 ASN n 
1 105 TYR n 
1 106 LYS n 
1 107 THR n 
1 108 ARG n 
1 109 ALA n 
1 110 GLU n 
1 111 VAL n 
1 112 LYS n 
1 113 PHE n 
1 114 GLU n 
1 115 GLY n 
1 116 ASP n 
1 117 THR n 
1 118 LEU n 
1 119 VAL n 
1 120 ASN n 
1 121 ARG n 
1 122 ILE n 
1 123 GLU n 
1 124 LEU n 
1 125 LYS n 
1 126 GLY n 
1 127 ILE n 
1 128 ASP n 
1 129 PHE n 
1 130 LYS n 
1 131 GLU n 
1 132 ASP n 
1 133 GLY n 
1 134 ASN n 
1 135 ILE n 
1 136 LEU n 
1 137 GLY n 
1 138 HIS n 
1 139 LYS n 
1 140 LEU n 
1 141 GLU n 
1 142 TYR n 
1 143 ASN n 
1 144 TYR n 
1 145 ASN n 
1 146 SER n 
1 147 HIS n 
1 148 ASN n 
1 149 VAL n 
1 150 TYR n 
1 151 ILE n 
1 152 THR n 
1 153 ALA n 
1 154 ASP n 
1 155 LYS n 
1 156 GLN n 
1 157 LYS n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 LYS n 
1 162 ALA n 
1 163 ASN n 
1 164 PHE n 
1 165 LYS n 
1 166 ILE n 
1 167 ARG n 
1 168 HIS n 
1 169 ASN n 
1 170 ILE n 
1 171 GLU n 
1 172 ASP n 
1 173 GLY n 
1 174 SER n 
1 175 VAL n 
1 176 GLN n 
1 177 LEU n 
1 178 ALA n 
1 179 ASP n 
1 180 HIS n 
1 181 TYR n 
1 182 GLN n 
1 183 GLN n 
1 184 ASN n 
1 185 THR n 
1 186 PRO n 
1 187 ILE n 
1 188 GLY n 
1 189 ASP n 
1 190 GLY n 
1 191 PRO n 
1 192 VAL n 
1 193 LEU n 
1 194 LEU n 
1 195 PRO n 
1 196 ASP n 
1 197 ASN n 
1 198 HIS n 
1 199 TYR n 
1 200 LEU n 
1 201 SER n 
1 202 THR n 
1 203 GLN n 
1 204 SER n 
1 205 ALA n 
1 206 LEU n 
1 207 SER n 
1 208 LYS n 
1 209 ASP n 
1 210 PRO n 
1 211 ASN n 
1 212 GLU n 
1 213 LYS n 
1 214 ARG n 
1 215 ASP n 
1 216 HIS n 
1 217 MET n 
1 218 VAL n 
1 219 LEU n 
1 220 LEU n 
1 221 GLU n 
1 222 PHE n 
1 223 VAL n 
1 224 THR n 
1 225 ALA n 
1 226 ALA n 
1 227 GLY n 
1 228 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aequorea 
_entity_src_gen.pdbx_gene_src_gene                 GFP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aequorea victoria' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6100 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM109 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               pKEN2 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GFP_AEQVI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P42212 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QYF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 226 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P42212 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  229 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       227 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QYF ALA A 2   ? UNP P42212 ?   ?   'CLONING ARTIFACT' 1   1 
1 1QYF LEU A 65  ? UNP P42212 PHE 64  ENGINEERED         64  2 
1 1QYF CRO A 66  ? UNP P42212 SER 65  CHROMOPHORE        66  3 
1 1QYF CRO A 66  ? UNP P42212 TYR 66  CHROMOPHORE        66  4 
1 1QYF CRO A 66  ? UNP P42212 GLY 67  CHROMOPHORE        66  5 
1 1QYF ALA A 95  ? UNP P42212 ARG 96  ENGINEERED         96  6 
1 1QYF SER A 98  ? UNP P42212 PHE 99  ENGINEERED         99  7 
1 1QYF THR A 152 ? UNP P42212 MET 153 ENGINEERED         153 8 
1 1QYF ALA A 162 ? UNP P42212 VAL 163 ENGINEERED         163 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                             'C4 H7 N O4'     133.103 
CRO 'L-peptide linking' n 
'{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 
'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5'  319.313 
CYS 'L-peptide linking' y CYSTEINE ?                             'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL'             'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                             'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                             'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                             'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                             'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?                             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                             'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                             'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                             'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                             'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QYF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   44.68 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG 4000, Magnesium Chloride, Hepes, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-09-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1QYF 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   34756 
_reflns.number_all                   37602 
_reflns.percent_possible_obs         92.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.052 
_reflns.pdbx_netI_over_sigmaI        27.4 
_reflns.B_iso_Wilson_estimate        15.8 
_reflns.pdbx_redundancy              4.74 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   60.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.253 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QYF 
_refine.ls_number_reflns_obs                     34756 
_refine.ls_number_reflns_all                     34756 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    92.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.145 
_refine.ls_R_factor_R_free                       0.214 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  1734 
_refine.ls_number_parameters                     18771 
_refine.ls_number_restraints                     22556 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  'ANISOTROPIC REFINEMENT REDUCED FREE R (NO CUTOFF) BY 0.0196' 
_refine.pdbx_starting_model                      1ema 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QYF 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      0 
_refine_analyze.occupancy_sum_hydrogen          1737.00 
_refine_analyze.occupancy_sum_non_hydrogen      2084.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1790 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             270 
_refine_hist.number_atoms_total               2070 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.009  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.027  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.008  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0277 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.046  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.052  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.025  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.003  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.054  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.074  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1QYF 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.144 
_pdbx_refine.free_R_factor_no_cutoff                     0.214 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.3 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1734 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.129 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.194 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.2 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1420 
_pdbx_refine.number_reflns_obs_4sig_cutoff               27240 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1QYF 
_struct.title                     'Crystal structure of matured green fluorescent protein R96A variant' 
_struct.pdbx_descriptor           'green-fluorescent protein, ETHYLENE GLYCOL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QYF 
_struct_keywords.pdbx_keywords   'LUMINESCENT PROTEIN' 
_struct_keywords.text            'beta barrel, chromophore, LUMINESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 4   ? THR A 10  ? LYS A 3   THR A 9   5 ? 7 
HELX_P HELX_P2 2 ALA A 38  ? TYR A 40  ? ALA A 37  TYR A 39  5 ? 3 
HELX_P HELX_P3 3 PRO A 57  ? VAL A 62  ? PRO A 56  VAL A 61  5 ? 6 
HELX_P HELX_P4 4 VAL A 67  ? SER A 71  ? VAL A 68  SER A 72  5 ? 5 
HELX_P HELX_P5 5 PRO A 74  ? HIS A 80  ? PRO A 75  HIS A 81  5 ? 7 
HELX_P HELX_P6 6 ASP A 81  ? ALA A 86  ? ASP A 82  ALA A 87  1 ? 6 
HELX_P HELX_P7 7 LYS A 155 ? ASN A 158 ? LYS A 156 ASN A 159 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LEU 65 C  ? ? ? 1_555 A CRO 66 N1 ? ? A LEU 64  A CRO 66   1_555 ? ? ? ? ? ? ? 1.338 ? 
covale2 covale ? ? A VAL 67 N  ? ? ? 1_555 A CRO 66 C3 ? ? A VAL 68  A CRO 66   1_555 ? ? ? ? ? ? ? 1.319 ? 
metalc1 metalc ? ? B MG  .  MG ? ? ? 1_555 D HOH .  O  ? ? A MG  301 A HOH 1285 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc2 metalc ? ? B MG  .  MG ? ? ? 1_555 D HOH .  O  ? ? A MG  301 A HOH 1286 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc3 metalc ? ? B MG  .  MG ? ? ? 1_555 D HOH .  O  ? ? A MG  301 A HOH 1288 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc4 metalc ? ? B MG  .  MG ? ? ? 1_555 D HOH .  O  ? ? A MG  301 A HOH 1289 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc5 metalc ? ? B MG  .  MG ? ? ? 1_555 D HOH .  O  ? ? A MG  301 A HOH 1287 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc6 metalc ? ? B MG  .  MG ? ? ? 1_555 C EDO .  O2 ? ? A MG  301 A EDO 303  1_555 ? ? ? ? ? ? ? 1.983 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           87 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            88 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    88 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     89 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       5.71 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   12 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 13  ? VAL A 23  ? VAL A 12  VAL A 22  
A 2  HIS A 26  ? ASP A 37  ? HIS A 25  ASP A 36  
A 3  LYS A 42  ? CYS A 49  ? LYS A 41  CYS A 48  
A 4  HIS A 216 ? ALA A 226 ? HIS A 217 ALA A 227 
A 5  HIS A 198 ? SER A 207 ? HIS A 199 SER A 208 
A 6  HIS A 147 ? ASP A 154 ? HIS A 148 ASP A 155 
A 7  GLY A 159 ? ASN A 169 ? GLY A 160 ASN A 170 
A 8  VAL A 175 ? PRO A 186 ? VAL A 176 PRO A 187 
A 9  TYR A 91  ? PHE A 99  ? TYR A 92  PHE A 100 
A 10 ASN A 104 ? GLU A 114 ? ASN A 105 GLU A 115 
A 11 THR A 117 ? ILE A 127 ? THR A 118 ILE A 128 
A 12 VAL A 13  ? VAL A 23  ? VAL A 12  VAL A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLY A 21  ? N GLY A 20  O PHE A 28  ? O PHE A 27  
A 2  3  N ASP A 37  ? N ASP A 36  O LYS A 42  ? O LYS A 41  
A 3  4  N PHE A 47  ? N PHE A 46  O MET A 217 ? O MET A 218 
A 4  5  O THR A 224 ? O THR A 225 N SER A 201 ? N SER A 202 
A 5  6  O THR A 202 ? O THR A 203 N HIS A 147 ? N HIS A 148 
A 6  7  N THR A 152 ? N THR A 153 O LYS A 161 ? O LYS A 162 
A 7  8  N PHE A 164 ? N PHE A 165 O HIS A 180 ? O HIS A 181 
A 8  9  O GLN A 183 ? O GLN A 184 N GLU A 94  ? N GLU A 95  
A 9  10 N TYR A 91  ? N TYR A 92  O VAL A 111 ? O VAL A 112 
A 10 11 N LYS A 106 ? N LYS A 107 O LYS A 125 ? O LYS A 126 
A 11 12 O GLY A 126 ? O GLY A 127 N ASP A 22  ? N ASP A 21  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 301'  
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO A 303' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  EDO C .   ? EDO A 303  . ? 1_555 ? 
2  AC1 6  HOH D .   ? HOH A 1285 . ? 1_555 ? 
3  AC1 6  HOH D .   ? HOH A 1286 . ? 1_555 ? 
4  AC1 6  HOH D .   ? HOH A 1287 . ? 1_555 ? 
5  AC1 6  HOH D .   ? HOH A 1288 . ? 1_555 ? 
6  AC1 6  HOH D .   ? HOH A 1289 . ? 1_555 ? 
7  AC2 10 ASP A 128 ? ASP A 129  . ? 4_546 ? 
8  AC2 10 ASN A 169 ? ASN A 170  . ? 1_555 ? 
9  AC2 10 ILE A 170 ? ILE A 171  . ? 1_555 ? 
10 AC2 10 GLY A 173 ? GLY A 174  . ? 1_555 ? 
11 AC2 10 SER A 174 ? SER A 175  . ? 1_555 ? 
12 AC2 10 MG  B .   ? MG  A 301  . ? 1_555 ? 
13 AC2 10 HOH D .   ? HOH A 1285 . ? 1_555 ? 
14 AC2 10 HOH D .   ? HOH A 1286 . ? 1_555 ? 
15 AC2 10 HOH D .   ? HOH A 1287 . ? 1_555 ? 
16 AC2 10 HOH D .   ? HOH A 1288 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QYF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1QYF 
_atom_sites.fract_transf_matrix[1][1]   0.019412 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016029 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014077 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 4   ? 26.609 22.388  19.109 1.00 42.41 ? 3    LYS A N   1 
ATOM   2    C  CA  . LYS A 1 4   ? 25.681 23.081  19.989 1.00 36.51 ? 3    LYS A CA  1 
ATOM   3    C  C   . LYS A 1 4   ? 25.352 22.263  21.229 1.00 32.55 ? 3    LYS A C   1 
ATOM   4    O  O   . LYS A 1 4   ? 25.308 22.805  22.338 1.00 29.68 ? 3    LYS A O   1 
ATOM   5    C  CB  . LYS A 1 4   ? 24.403 23.470  19.240 1.00 42.65 ? 3    LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 4   ? 23.480 24.322  20.118 1.00 51.27 ? 3    LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 4   ? 22.610 25.244  19.261 1.00 58.44 ? 3    LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 4   ? 22.326 26.560  19.964 1.00 60.44 ? 3    LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 4   ? 21.379 27.442  19.207 1.00 49.94 ? 3    LYS A NZ  1 
ATOM   10   N  N   . GLY A 1 5   ? 25.126 20.954  21.169 1.00 30.75 ? 4    GLY A N   1 
ATOM   11   C  CA  . GLY A 1 5   ? 24.808 20.255  22.412 1.00 25.81 ? 4    GLY A CA  1 
ATOM   12   C  C   . GLY A 1 5   ? 25.858 20.306  23.501 1.00 19.04 ? 4    GLY A C   1 
ATOM   13   O  O   . GLY A 1 5   ? 25.527 20.305  24.698 1.00 19.17 ? 4    GLY A O   1 
ATOM   14   N  N   . GLU A 1 6   ? 27.152 20.340  23.137 1.00 18.13 ? 5    GLU A N   1 
ATOM   15   C  CA  . GLU A 1 6   ? 28.212 20.379  24.156 1.00 21.03 ? 5    GLU A CA  1 
ATOM   16   C  C   . GLU A 1 6   ? 28.098 21.600  25.055 1.00 19.29 ? 5    GLU A C   1 
ATOM   17   O  O   . GLU A 1 6   ? 28.538 21.615  26.202 1.00 19.48 ? 5    GLU A O   1 
ATOM   18   C  CB  . GLU A 1 6   ? 29.582 20.346  23.498 1.00 23.96 ? 5    GLU A CB  1 
ATOM   19   C  CG  . GLU A 1 6   ? 30.176 21.690  23.151 1.00 38.02 ? 5    GLU A CG  1 
ATOM   20   C  CD  . GLU A 1 6   ? 31.108 21.666  21.953 1.00 50.50 ? 5    GLU A CD  1 
ATOM   21   O  OE1 . GLU A 1 6   ? 30.744 22.272  20.909 1.00 75.79 ? 5    GLU A OE1 1 
ATOM   22   O  OE2 . GLU A 1 6   ? 32.204 21.059  22.026 1.00 62.06 ? 5    GLU A OE2 1 
ATOM   23   N  N   . GLU A 1 7   ? 27.492 22.655  24.549 1.00 20.36 ? 6    GLU A N   1 
ATOM   24   C  CA  . GLU A 1 7   ? 27.254 23.874  25.313 1.00 21.61 ? 6    GLU A CA  1 
ATOM   25   C  C   . GLU A 1 7   ? 26.413 23.627  26.551 1.00 19.64 ? 6    GLU A C   1 
ATOM   26   O  O   . GLU A 1 7   ? 26.441 24.403  27.517 1.00 24.62 ? 6    GLU A O   1 
ATOM   27   C  CB  . GLU A 1 7   ? 26.588 24.961  24.429 1.00 26.31 ? 6    GLU A CB  1 
ATOM   28   C  CG  . GLU A 1 7   ? 27.360 25.268  23.159 1.00 32.79 ? 6    GLU A CG  1 
ATOM   29   C  CD  . GLU A 1 7   ? 26.627 26.196  22.212 1.00 39.05 ? 6    GLU A CD  1 
ATOM   30   O  OE1 . GLU A 1 7   ? 27.242 26.606  21.195 1.00 39.12 ? 6    GLU A OE1 1 
ATOM   31   O  OE2 . GLU A 1 7   ? 25.449 26.507  22.489 1.00 52.94 ? 6    GLU A OE2 1 
ATOM   32   N  N   . LEU A 1 8   ? 25.634 22.565  26.576 1.00 16.61 ? 7    LEU A N   1 
ATOM   33   C  CA  . LEU A 1 8   ? 24.763 22.332  27.720 1.00 15.60 ? 7    LEU A CA  1 
ATOM   34   C  C   . LEU A 1 8   ? 25.468 21.665  28.886 1.00 15.72 ? 7    LEU A C   1 
ATOM   35   O  O   . LEU A 1 8   ? 24.869 21.481  29.937 1.00 17.28 ? 7    LEU A O   1 
ATOM   36   C  CB  . LEU A 1 8   ? 23.613 21.420  27.263 1.00 15.47 ? 7    LEU A CB  1 
ATOM   37   C  CG  . LEU A 1 8   ? 22.741 22.009  26.157 1.00 17.43 ? 7    LEU A CG  1 
ATOM   38   C  CD1 . LEU A 1 8   ? 21.738 20.990  25.653 1.00 20.86 ? 7    LEU A CD1 1 
ATOM   39   C  CD2 . LEU A 1 8   ? 22.016 23.249  26.660 1.00 23.74 ? 7    LEU A CD2 1 
ATOM   40   N  N   . PHE A 1 9   ? 26.721 21.288  28.717 1.00 16.09 ? 8    PHE A N   1 
ATOM   41   C  CA  . PHE A 1 9   ? 27.468 20.489  29.680 1.00 13.26 ? 8    PHE A CA  1 
ATOM   42   C  C   . PHE A 1 9   ? 28.660 21.221  30.281 1.00 13.04 ? 8    PHE A C   1 
ATOM   43   O  O   . PHE A 1 9   ? 29.579 20.617  30.876 1.00 18.66 ? 8    PHE A O   1 
ATOM   44   C  CB  . PHE A 1 9   ? 27.946 19.203  28.985 1.00 12.86 ? 8    PHE A CB  1 
ATOM   45   C  CG  . PHE A 1 9   ? 26.787 18.283  28.659 1.00 11.36 ? 8    PHE A CG  1 
ATOM   46   C  CD1 . PHE A 1 9   ? 26.164 18.388  27.417 1.00 12.69 ? 8    PHE A CD1 1 
ATOM   47   C  CD2 . PHE A 1 9   ? 26.352 17.359  29.602 1.00 13.09 ? 8    PHE A CD2 1 
ATOM   48   C  CE1 . PHE A 1 9   ? 25.095 17.562  27.133 1.00 13.97 ? 8    PHE A CE1 1 
ATOM   49   C  CE2 . PHE A 1 9   ? 25.279 16.516  29.293 1.00 13.83 ? 8    PHE A CE2 1 
ATOM   50   C  CZ  . PHE A 1 9   ? 24.674 16.624  28.055 1.00 14.29 ? 8    PHE A CZ  1 
ATOM   51   N  N   . THR A 1 10  ? 28.719 22.549  30.153 1.00 15.35 ? 9    THR A N   1 
ATOM   52   C  CA  . THR A 1 10  ? 29.917 23.181  30.730 1.00 16.79 ? 9    THR A CA  1 
ATOM   53   C  C   . THR A 1 10  ? 29.861 23.362  32.239 1.00 17.95 ? 9    THR A C   1 
ATOM   54   O  O   . THR A 1 10  ? 30.877 23.760  32.822 1.00 22.25 ? 9    THR A O   1 
ATOM   55   C  CB  . THR A 1 10  ? 30.143 24.555  30.075 1.00 22.47 ? 9    THR A CB  1 
ATOM   56   O  OG1 . THR A 1 10  ? 28.969 25.313  30.393 1.00 26.41 ? 9    THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 10  ? 30.229 24.493  28.563 1.00 28.40 ? 9    THR A CG2 1 
ATOM   58   N  N   . GLY A 1 11  ? 28.736 23.079  32.881 1.00 16.23 ? 10   GLY A N   1 
ATOM   59   C  CA  . GLY A 1 11  ? 28.628 23.153  34.319 1.00 18.42 ? 10   GLY A CA  1 
ATOM   60   C  C   . GLY A 1 11  ? 28.066 21.879  34.936 1.00 16.98 ? 10   GLY A C   1 
ATOM   61   O  O   . GLY A 1 11  ? 27.993 20.858  34.246 1.00 18.87 ? 10   GLY A O   1 
ATOM   62   N  N   . VAL A 1 12  ? 27.671 21.941  36.200 1.00 17.44 ? 11   VAL A N   1 
ATOM   63   C  CA  . VAL A 1 12  ? 27.011 20.799  36.844 1.00 15.85 ? 11   VAL A CA  1 
ATOM   64   C  C   . VAL A 1 12  ? 25.564 20.664  36.375 1.00 15.54 ? 11   VAL A C   1 
ATOM   65   O  O   . VAL A 1 12  ? 24.850 21.670  36.388 1.00 17.15 ? 11   VAL A O   1 
ATOM   66   C  CB  . VAL A 1 12  ? 27.034 20.916  38.377 1.00 17.69 ? 11   VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1 12  ? 26.255 19.807  39.050 1.00 20.54 ? 11   VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1 12  ? 28.483 20.904  38.889 1.00 18.47 ? 11   VAL A CG2 1 
ATOM   69   N  N   . VAL A 1 13  ? 25.172 19.461  35.984 1.00 13.37 ? 12   VAL A N   1 
ATOM   70   C  CA  . VAL A 1 13  ? 23.852 19.201  35.419 1.00 13.23 ? 12   VAL A CA  1 
ATOM   71   C  C   . VAL A 1 13  ? 23.135 18.174  36.285 1.00 12.26 ? 12   VAL A C   1 
ATOM   72   O  O   . VAL A 1 13  ? 23.716 17.158  36.631 1.00 13.36 ? 12   VAL A O   1 
ATOM   73   C  CB  . VAL A 1 13  ? 23.957 18.692  33.971 1.00 13.77 ? 12   VAL A CB  1 
ATOM   74   C  CG1 . VAL A 1 13  ? 22.606 18.298  33.412 1.00 15.85 ? 12   VAL A CG1 1 
ATOM   75   C  CG2 . VAL A 1 13  ? 24.645 19.759  33.113 1.00 16.48 ? 12   VAL A CG2 1 
ATOM   76   N  N   . PRO A 1 14  ? 21.911 18.433  36.698 1.00 12.98 ? 13   PRO A N   1 
ATOM   77   C  CA  . PRO A 1 14  ? 21.181 17.428  37.480 1.00 12.23 ? 13   PRO A CA  1 
ATOM   78   C  C   . PRO A 1 14  ? 20.767 16.278  36.580 1.00 11.32 ? 13   PRO A C   1 
ATOM   79   O  O   . PRO A 1 14  ? 20.477 16.502  35.407 1.00 12.05 ? 13   PRO A O   1 
ATOM   80   C  CB  . PRO A 1 14  ? 19.939 18.138  37.954 1.00 16.17 ? 13   PRO A CB  1 
ATOM   81   C  CG  . PRO A 1 14  ? 19.915 19.473  37.312 1.00 18.56 ? 13   PRO A CG  1 
ATOM   82   C  CD  . PRO A 1 14  ? 21.140 19.673  36.503 1.00 14.94 ? 13   PRO A CD  1 
ATOM   83   N  N   . ILE A 1 15  ? 20.750 15.099  37.180 1.00 10.92 ? 14   ILE A N   1 
ATOM   84   C  CA  . ILE A 1 15  ? 20.426 13.864  36.492 1.00 10.61 ? 14   ILE A CA  1 
ATOM   85   C  C   . ILE A 1 15  ? 19.298 13.138  37.217 1.00 10.40 ? 14   ILE A C   1 
ATOM   86   O  O   . ILE A 1 15  ? 19.287 13.049  38.440 1.00 12.69 ? 14   ILE A O   1 
ATOM   87   C  CB  . ILE A 1 15  ? 21.668 12.959  36.412 1.00 11.88 ? 14   ILE A CB  1 
ATOM   88   C  CG1 . ILE A 1 15  ? 22.846 13.597  35.708 1.00 10.49 ? 14   ILE A CG1 1 
ATOM   89   C  CG2 . ILE A 1 15  ? 21.335 11.635  35.743 1.00 13.35 ? 14   ILE A CG2 1 
ATOM   90   C  CD1 . ILE A 1 15  ? 24.155 12.847  35.855 1.00 13.21 ? 14   ILE A CD1 1 
ATOM   91   N  N   . LEU A 1 16  ? 18.391 12.621  36.404 1.00 12.37 ? 15   LEU A N   1 
ATOM   92   C  CA  . LEU A 1 16  ? 17.316 11.717  36.805 1.00 10.76 ? 15   LEU A CA  1 
ATOM   93   C  C   . LEU A 1 16  ? 17.388 10.434  35.979 1.00 8.96  ? 15   LEU A C   1 
ATOM   94   O  O   . LEU A 1 16  ? 17.475 10.492  34.761 1.00 12.11 ? 15   LEU A O   1 
ATOM   95   C  CB  . LEU A 1 16  ? 15.946 12.349  36.606 1.00 12.59 ? 15   LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 16  ? 15.699 13.653  37.365 1.00 15.20 ? 15   LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 16  ? 14.356 14.237  36.955 1.00 18.84 ? 15   LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 16  ? 15.774 13.397  38.869 1.00 17.65 ? 15   LEU A CD2 1 
ATOM   99   N  N   . VAL A 1 17  ? 17.295 9.288   36.667 1.00 10.92 ? 16   VAL A N   1 
ATOM   100  C  CA  . VAL A 1 17  ? 17.263 7.997   36.011 1.00 10.24 ? 16   VAL A CA  1 
ATOM   101  C  C   . VAL A 1 17  ? 16.035 7.242   36.488 1.00 9.93  ? 16   VAL A C   1 
ATOM   102  O  O   . VAL A 1 17  ? 15.800 7.162   37.713 1.00 11.79 ? 16   VAL A O   1 
ATOM   103  C  CB  . VAL A 1 17  ? 18.531 7.224   36.405 1.00 10.26 ? 16   VAL A CB  1 
ATOM   104  C  CG1 . VAL A 1 17  ? 18.510 5.841   35.755 1.00 15.67 ? 16   VAL A CG1 1 
ATOM   105  C  CG2 . VAL A 1 17  ? 19.790 7.997   36.058 1.00 14.01 ? 16   VAL A CG2 1 
ATOM   106  N  N   . GLU A 1 18  ? 15.254 6.710   35.566 1.00 11.32 ? 17   GLU A N   1 
ATOM   107  C  CA  . GLU A 1 18  ? 14.096 5.902   35.947 1.00 10.62 ? 17   GLU A CA  1 
ATOM   108  C  C   . GLU A 1 18  ? 14.133 4.607   35.137 1.00 10.99 ? 17   GLU A C   1 
ATOM   109  O  O   . GLU A 1 18  ? 14.194 4.643   33.897 1.00 12.50 ? 17   GLU A O   1 
ATOM   110  C  CB  . GLU A 1 18  ? 12.816 6.694   35.716 1.00 13.09 ? 17   GLU A CB  1 
ATOM   111  C  CG  . GLU A 1 18  ? 12.675 7.866   36.669 1.00 17.27 ? 17   GLU A CG  1 
ATOM   112  C  CD  . GLU A 1 18  ? 12.367 7.530   38.112 1.00 18.49 ? 17   GLU A CD  1 
ATOM   113  O  OE1 . GLU A 1 18  ? 12.727 8.335   38.995 1.00 22.13 ? 17   GLU A OE1 1 
ATOM   114  O  OE2 . GLU A 1 18  ? 11.745 6.495   38.438 1.00 21.47 ? 17   GLU A OE2 1 
ATOM   115  N  N   . LEU A 1 19  ? 14.130 3.483   35.843 1.00 11.70 ? 18   LEU A N   1 
ATOM   116  C  CA  . LEU A 1 19  ? 14.170 2.179   35.226 1.00 10.54 ? 18   LEU A CA  1 
ATOM   117  C  C   . LEU A 1 19  ? 12.993 1.307   35.695 1.00 11.94 ? 18   LEU A C   1 
ATOM   118  O  O   . LEU A 1 19  ? 12.720 1.193   36.888 1.00 13.56 ? 18   LEU A O   1 
ATOM   119  C  CB  . LEU A 1 19  ? 15.482 1.438   35.524 1.00 12.04 ? 18   LEU A CB  1 
ATOM   120  C  CG  . LEU A 1 19  ? 15.684 0.001   35.012 1.00 13.50 ? 18   LEU A CG  1 
ATOM   121  C  CD1 . LEU A 1 19  ? 17.154 -0.251  34.773 1.00 26.24 ? 18   LEU A CD1 1 
ATOM   122  C  CD2 . LEU A 1 19  ? 15.190 -1.084  35.957 1.00 24.79 ? 18   LEU A CD2 1 
ATOM   123  N  N   . ASP A 1 20  ? 12.413 0.648   34.710 1.00 11.61 ? 19   ASP A N   1 
ATOM   124  C  CA  . ASP A 1 20  ? 11.463 -0.441  34.944 1.00 13.75 ? 19   ASP A CA  1 
ATOM   125  C  C   . ASP A 1 20  ? 12.073 -1.734  34.410 1.00 13.07 ? 19   ASP A C   1 
ATOM   126  O  O   . ASP A 1 20  ? 12.473 -1.713  33.245 1.00 12.73 ? 19   ASP A O   1 
ATOM   127  C  CB  . ASP A 1 20  ? 10.124 -0.189  34.279 1.00 17.65 ? 19   ASP A CB  1 
ATOM   128  C  CG  . ASP A 1 20  ? 9.322  0.869   35.005 1.00 21.44 ? 19   ASP A CG  1 
ATOM   129  O  OD1 . ASP A 1 20  ? 8.493  1.490   34.301 1.00 34.03 ? 19   ASP A OD1 1 
ATOM   130  O  OD2 . ASP A 1 20  ? 9.475  1.115   36.228 1.00 22.45 ? 19   ASP A OD2 1 
ATOM   131  N  N   . GLY A 1 21  ? 12.087 -2.750  35.252 1.00 12.14 ? 20   GLY A N   1 
ATOM   132  C  CA  . GLY A 1 21  ? 12.728 -4.001  34.945 1.00 13.12 ? 20   GLY A CA  1 
ATOM   133  C  C   . GLY A 1 21  ? 11.835 -5.215  35.128 1.00 13.21 ? 20   GLY A C   1 
ATOM   134  O  O   . GLY A 1 21  ? 10.913 -5.235  35.949 1.00 14.99 ? 20   GLY A O   1 
ATOM   135  N  N   . ASP A 1 22  ? 12.141 -6.247  34.367 1.00 13.45 ? 21   ASP A N   1 
ATOM   136  C  CA  . ASP A 1 22  ? 11.550 -7.567  34.512 1.00 14.39 ? 21   ASP A CA  1 
ATOM   137  C  C   . ASP A 1 22  ? 12.665 -8.574  34.224 1.00 14.59 ? 21   ASP A C   1 
ATOM   138  O  O   . ASP A 1 22  ? 13.087 -8.657  33.076 1.00 15.75 ? 21   ASP A O   1 
ATOM   139  C  CB  . ASP A 1 22  ? 10.365 -7.701  33.556 1.00 18.24 ? 21   ASP A CB  1 
ATOM   140  C  CG  . ASP A 1 22  ? 9.725  -9.077  33.545 1.00 20.41 ? 21   ASP A CG  1 
ATOM   141  O  OD1 . ASP A 1 22  ? 10.387 -10.098 33.851 1.00 19.90 ? 21   ASP A OD1 1 
ATOM   142  O  OD2 . ASP A 1 22  ? 8.517  -9.178  33.253 1.00 23.76 ? 21   ASP A OD2 1 
ATOM   143  N  N   . VAL A 1 23  ? 13.071 -9.322  35.250 1.00 14.18 ? 22   VAL A N   1 
ATOM   144  C  CA  . VAL A 1 23  ? 14.088 -10.352 35.035 1.00 12.58 ? 22   VAL A CA  1 
ATOM   145  C  C   . VAL A 1 23  ? 13.511 -11.685 35.494 1.00 12.97 ? 22   VAL A C   1 
ATOM   146  O  O   . VAL A 1 23  ? 13.196 -11.894 36.678 1.00 15.28 ? 22   VAL A O   1 
ATOM   147  C  CB  . VAL A 1 23  ? 15.383 -10.027 35.785 1.00 13.45 ? 22   VAL A CB  1 
ATOM   148  C  CG1 . VAL A 1 23  ? 16.389 -11.158 35.738 1.00 16.26 ? 22   VAL A CG1 1 
ATOM   149  C  CG2 . VAL A 1 23  ? 16.041 -8.757  35.222 1.00 15.51 ? 22   VAL A CG2 1 
ATOM   150  N  N   . ASN A 1 24  ? 13.349 -12.603 34.559 1.00 14.40 ? 23   ASN A N   1 
ATOM   151  C  CA  . ASN A 1 24  ? 12.714 -13.891 34.797 1.00 16.77 ? 23   ASN A CA  1 
ATOM   152  C  C   . ASN A 1 24  ? 11.369 -13.760 35.503 1.00 19.33 ? 23   ASN A C   1 
ATOM   153  O  O   . ASN A 1 24  ? 10.996 -14.577 36.336 1.00 23.48 ? 23   ASN A O   1 
ATOM   154  C  CB  . ASN A 1 24  ? 13.619 -14.801 35.619 1.00 16.39 ? 23   ASN A CB  1 
ATOM   155  C  CG  . ASN A 1 24  ? 14.717 -15.503 34.875 1.00 17.11 ? 23   ASN A CG  1 
ATOM   156  O  OD1 . ASN A 1 24  ? 15.307 -15.020 33.907 1.00 19.98 ? 23   ASN A OD1 1 
ATOM   157  N  ND2 . ASN A 1 24  ? 15.036 -16.692 35.362 1.00 19.58 ? 23   ASN A ND2 1 
ATOM   158  N  N   . GLY A 1 25  ? 10.638 -12.701 35.162 1.00 18.21 ? 24   GLY A N   1 
ATOM   159  C  CA  . GLY A 1 25  ? 9.352  -12.483 35.768 1.00 19.77 ? 24   GLY A CA  1 
ATOM   160  C  C   . GLY A 1 25  ? 9.356  -11.705 37.063 1.00 20.80 ? 24   GLY A C   1 
ATOM   161  O  O   . GLY A 1 25  ? 8.270  -11.375 37.569 1.00 25.66 ? 24   GLY A O   1 
ATOM   162  N  N   . HIS A 1 26  ? 10.557 -11.422 37.586 1.00 17.41 ? 25   HIS A N   1 
ATOM   163  C  CA  . HIS A 1 26  ? 10.674 -10.582 38.774 1.00 19.94 ? 25   HIS A CA  1 
ATOM   164  C  C   . HIS A 1 26  ? 10.619 -9.117  38.333 1.00 18.24 ? 25   HIS A C   1 
ATOM   165  O  O   . HIS A 1 26  ? 11.568 -8.635  37.707 1.00 17.80 ? 25   HIS A O   1 
ATOM   166  C  CB  . HIS A 1 26  ? 11.966 -10.854 39.522 1.00 19.64 ? 25   HIS A CB  1 
ATOM   167  C  CG  . HIS A 1 26  ? 12.149 -12.208 40.108 1.00 23.76 ? 25   HIS A CG  1 
ATOM   168  N  ND1 . HIS A 1 26  ? 11.480 -12.642 41.232 1.00 29.22 ? 25   HIS A ND1 1 
ATOM   169  C  CD2 . HIS A 1 26  ? 12.947 -13.239 39.728 1.00 24.61 ? 25   HIS A CD2 1 
ATOM   170  C  CE1 . HIS A 1 26  ? 11.860 -13.884 41.509 1.00 29.53 ? 25   HIS A CE1 1 
ATOM   171  N  NE2 . HIS A 1 26  ? 12.757 -14.267 40.608 1.00 26.88 ? 25   HIS A NE2 1 
ATOM   172  N  N   . LYS A 1 27  ? 9.529  -8.432  38.636 1.00 17.08 ? 26   LYS A N   1 
ATOM   173  C  CA  . LYS A 1 27  ? 9.377  -7.034  38.275 1.00 16.91 ? 26   LYS A CA  1 
ATOM   174  C  C   . LYS A 1 27  ? 9.904  -6.141  39.394 1.00 15.28 ? 26   LYS A C   1 
ATOM   175  O  O   . LYS A 1 27  ? 9.735  -6.380  40.580 1.00 19.68 ? 26   LYS A O   1 
ATOM   176  C  CB  . LYS A 1 27  ? 7.896  -6.740  37.972 1.00 23.41 ? 26   LYS A CB  1 
ATOM   177  C  CG  . LYS A 1 27  ? 7.399  -7.684  36.875 1.00 29.77 ? 26   LYS A CG  1 
ATOM   178  C  CD  . LYS A 1 27  ? 6.216  -7.115  36.116 1.00 41.73 ? 26   LYS A CD  1 
ATOM   179  C  CE  . LYS A 1 27  ? 5.244  -8.174  35.632 1.00 48.67 ? 26   LYS A CE  1 
ATOM   180  N  NZ  . LYS A 1 27  ? 3.928  -7.582  35.243 1.00 57.78 ? 26   LYS A NZ  1 
ATOM   181  N  N   . PHE A 1 28  ? 10.540 -5.072  38.953 1.00 15.66 ? 27   PHE A N   1 
ATOM   182  C  CA  . PHE A 1 28  ? 11.106 -4.062  39.808 1.00 14.06 ? 27   PHE A CA  1 
ATOM   183  C  C   . PHE A 1 28  ? 11.313 -2.744  39.051 1.00 12.35 ? 27   PHE A C   1 
ATOM   184  O  O   . PHE A 1 28  ? 11.323 -2.636  37.831 1.00 14.49 ? 27   PHE A O   1 
ATOM   185  C  CB  . PHE A 1 28  ? 12.470 -4.513  40.332 1.00 14.34 ? 27   PHE A CB  1 
ATOM   186  C  CG  . PHE A 1 28  ? 13.529 -4.697  39.257 1.00 13.54 ? 27   PHE A CG  1 
ATOM   187  C  CD1 . PHE A 1 28  ? 13.584 -5.861  38.516 1.00 17.53 ? 27   PHE A CD1 1 
ATOM   188  C  CD2 . PHE A 1 28  ? 14.462 -3.713  39.016 1.00 13.47 ? 27   PHE A CD2 1 
ATOM   189  C  CE1 . PHE A 1 28  ? 14.562 -6.058  37.554 1.00 15.94 ? 27   PHE A CE1 1 
ATOM   190  C  CE2 . PHE A 1 28  ? 15.451 -3.883  38.067 1.00 14.69 ? 27   PHE A CE2 1 
ATOM   191  C  CZ  . PHE A 1 28  ? 15.503 -5.065  37.343 1.00 14.44 ? 27   PHE A CZ  1 
ATOM   192  N  N   . SER A 1 29  ? 11.498 -1.648  39.704 1.00 13.50 ? 28   SER A N   1 
ATOM   193  C  CA  . SER A 1 29  ? 11.827 -0.312  39.392 1.00 12.57 ? 28   SER A CA  1 
ATOM   194  C  C   . SER A 1 29  ? 12.927 0.250   40.304 1.00 13.36 ? 28   SER A C   1 
ATOM   195  O  O   . SER A 1 29  ? 13.077 -0.034  41.485 1.00 14.25 ? 28   SER A O   1 
ATOM   196  C  CB  . SER A 1 29  ? 10.596 0.602   39.515 1.00 15.18 ? 28   SER A CB  1 
ATOM   197  O  OG  . SER A 1 29  ? 9.553  0.033   38.725 1.00 18.92 ? 28   SER A OG  1 
ATOM   198  N  N   . VAL A 1 30  ? 13.703 1.098   39.638 1.00 12.53 ? 29   VAL A N   1 
ATOM   199  C  CA  . VAL A 1 30  ? 14.790 1.878   40.233 1.00 12.81 ? 29   VAL A CA  1 
ATOM   200  C  C   . VAL A 1 30  ? 14.653 3.348   39.835 1.00 11.28 ? 29   VAL A C   1 
ATOM   201  O  O   . VAL A 1 30  ? 14.393 3.649   38.668 1.00 13.65 ? 29   VAL A O   1 
ATOM   202  C  CB  . VAL A 1 30  ? 16.160 1.340   39.794 1.00 11.55 ? 29   VAL A CB  1 
ATOM   203  C  CG1 . VAL A 1 30  ? 17.317 2.180   40.302 1.00 10.83 ? 29   VAL A CG1 1 
ATOM   204  C  CG2 . VAL A 1 30  ? 16.268 -0.102  40.274 1.00 14.91 ? 29   VAL A CG2 1 
ATOM   205  N  N   . SER A 1 31  ? 14.849 4.203   40.825 1.00 11.70 ? 30   SER A N   1 
ATOM   206  C  CA  . SER A 1 31  ? 14.889 5.655   40.655 1.00 12.77 ? 30   SER A CA  1 
ATOM   207  C  C   . SER A 1 31  ? 16.242 6.170   41.111 1.00 12.33 ? 30   SER A C   1 
ATOM   208  O  O   . SER A 1 31  ? 16.667 5.833   42.219 1.00 15.11 ? 30   SER A O   1 
ATOM   209  C  CB  . SER A 1 31  ? 13.798 6.383   41.445 1.00 16.71 ? 30   SER A CB  1 
ATOM   210  O  OG  . SER A 1 31  ? 12.506 6.148   40.891 1.00 25.09 ? 30   SER A OG  1 
ATOM   211  N  N   . GLY A 1 32  ? 16.878 6.954   40.254 1.00 12.20 ? 31   GLY A N   1 
ATOM   212  C  CA  . GLY A 1 32  ? 18.171 7.547   40.604 1.00 12.82 ? 31   GLY A CA  1 
ATOM   213  C  C   . GLY A 1 32  ? 18.141 9.058   40.457 1.00 12.75 ? 31   GLY A C   1 
ATOM   214  O  O   . GLY A 1 32  ? 17.430 9.600   39.597 1.00 12.43 ? 31   GLY A O   1 
ATOM   215  N  N   . GLU A 1 33  ? 18.913 9.721   41.300 1.00 12.01 ? 32   GLU A N   1 
ATOM   216  C  CA  . GLU A 1 33  ? 19.090 11.139  41.309 1.00 11.22 ? 32   GLU A CA  1 
ATOM   217  C  C   . GLU A 1 33  ? 20.556 11.466  41.535 1.00 12.20 ? 32   GLU A C   1 
ATOM   218  O  O   . GLU A 1 33  ? 21.262 10.814  42.315 1.00 12.90 ? 32   GLU A O   1 
ATOM   219  C  CB  . GLU A 1 33  ? 18.306 11.778  42.450 1.00 14.33 ? 32   GLU A CB  1 
ATOM   220  C  CG  . GLU A 1 33  ? 16.804 11.646  42.333 1.00 15.93 ? 32   GLU A CG  1 
ATOM   221  C  CD  . GLU A 1 33  ? 16.051 12.360  43.443 1.00 16.60 ? 32   GLU A CD  1 
ATOM   222  O  OE1 . GLU A 1 33  ? 16.531 13.392  43.946 1.00 17.74 ? 32   GLU A OE1 1 
ATOM   223  O  OE2 . GLU A 1 33  ? 14.967 11.861  43.791 1.00 15.34 ? 32   GLU A OE2 1 
ATOM   224  N  N   . GLY A 1 34  ? 21.035 12.509  40.885 1.00 12.55 ? 33   GLY A N   1 
ATOM   225  C  CA  . GLY A 1 34  ? 22.378 12.967  41.167 1.00 14.10 ? 33   GLY A CA  1 
ATOM   226  C  C   . GLY A 1 34  ? 22.778 14.078  40.220 1.00 11.75 ? 33   GLY A C   1 
ATOM   227  O  O   . GLY A 1 34  ? 21.899 14.828  39.795 1.00 14.62 ? 33   GLY A O   1 
ATOM   228  N  N   . GLU A 1 35  ? 24.077 14.130  39.936 1.00 12.71 ? 34   GLU A N   1 
ATOM   229  C  CA  . GLU A 1 35  ? 24.498 15.222  39.047 1.00 13.58 ? 34   GLU A CA  1 
ATOM   230  C  C   . GLU A 1 35  ? 25.743 14.771  38.292 1.00 11.63 ? 34   GLU A C   1 
ATOM   231  O  O   . GLU A 1 35  ? 26.464 13.848  38.735 1.00 13.60 ? 34   GLU A O   1 
ATOM   232  C  CB  . GLU A 1 35  ? 24.672 16.507  39.847 1.00 18.04 ? 34   GLU A CB  1 
ATOM   233  C  CG  . GLU A 1 35  ? 25.635 16.456  40.993 1.00 28.58 ? 34   GLU A CG  1 
ATOM   234  C  CD  . GLU A 1 35  ? 25.858 17.720  41.798 1.00 33.81 ? 34   GLU A CD  1 
ATOM   235  O  OE1 . GLU A 1 35  ? 27.020 18.062  42.145 1.00 36.65 ? 34   GLU A OE1 1 
ATOM   236  O  OE2 . GLU A 1 35  ? 24.876 18.429  42.127 1.00 40.18 ? 34   GLU A OE2 1 
ATOM   237  N  N   . GLY A 1 36  ? 25.992 15.429  37.165 1.00 11.77 ? 35   GLY A N   1 
ATOM   238  C  CA  . GLY A 1 36  ? 27.167 15.152  36.381 1.00 13.39 ? 35   GLY A CA  1 
ATOM   239  C  C   . GLY A 1 36  ? 27.903 16.413  35.998 1.00 12.67 ? 35   GLY A C   1 
ATOM   240  O  O   . GLY A 1 36  ? 27.282 17.462  35.810 1.00 13.56 ? 35   GLY A O   1 
ATOM   241  N  N   . ASP A 1 37  ? 29.215 16.294  35.882 1.00 13.77 ? 36   ASP A N   1 
ATOM   242  C  CA  . ASP A 1 37  ? 30.055 17.453  35.562 1.00 13.86 ? 36   ASP A CA  1 
ATOM   243  C  C   . ASP A 1 37  ? 31.060 16.956  34.516 1.00 14.35 ? 36   ASP A C   1 
ATOM   244  O  O   . ASP A 1 37  ? 32.114 16.438  34.866 1.00 13.14 ? 36   ASP A O   1 
ATOM   245  C  CB  . ASP A 1 37  ? 30.715 17.973  36.829 1.00 16.76 ? 36   ASP A CB  1 
ATOM   246  C  CG  . ASP A 1 37  ? 31.342 19.331  36.738 1.00 22.69 ? 36   ASP A CG  1 
ATOM   247  O  OD1 . ASP A 1 37  ? 31.328 19.936  35.642 1.00 27.95 ? 36   ASP A OD1 1 
ATOM   248  O  OD2 . ASP A 1 37  ? 31.868 19.819  37.774 1.00 32.16 ? 36   ASP A OD2 1 
ATOM   249  N  N   . ALA A 1 38  ? 30.703 17.083  33.245 1.00 14.27 ? 37   ALA A N   1 
ATOM   250  C  CA  . ALA A 1 38  ? 31.440 16.545  32.109 1.00 13.44 ? 37   ALA A CA  1 
ATOM   251  C  C   . ALA A 1 38  ? 32.825 17.165  31.997 1.00 14.85 ? 37   ALA A C   1 
ATOM   252  O  O   . ALA A 1 38  ? 33.734 16.547  31.457 1.00 14.78 ? 37   ALA A O   1 
ATOM   253  C  CB  . ALA A 1 38  ? 30.687 16.728  30.815 1.00 15.88 ? 37   ALA A CB  1 
ATOM   254  N  N   . THR A 1 39  ? 32.969 18.364  32.543 1.00 14.24 ? 38   THR A N   1 
ATOM   255  C  CA  . THR A 1 39  ? 34.312 18.974  32.560 1.00 12.57 ? 38   THR A CA  1 
ATOM   256  C  C   . THR A 1 39  ? 35.350 18.070  33.193 1.00 12.63 ? 38   THR A C   1 
ATOM   257  O  O   . THR A 1 39  ? 36.541 18.102  32.825 1.00 15.06 ? 38   THR A O   1 
ATOM   258  C  CB  . THR A 1 39  ? 34.202 20.327  33.311 1.00 15.15 ? 38   THR A CB  1 
ATOM   259  O  OG1 . THR A 1 39  ? 33.301 21.194  32.606 1.00 21.23 ? 38   THR A OG1 1 
ATOM   260  C  CG2 . THR A 1 39  ? 35.571 20.989  33.418 1.00 15.73 ? 38   THR A CG2 1 
ATOM   261  N  N   . TYR A 1 40  ? 34.904 17.243  34.150 1.00 13.94 ? 39   TYR A N   1 
ATOM   262  C  CA  . TYR A 1 40  ? 35.777 16.330  34.881 1.00 13.67 ? 39   TYR A CA  1 
ATOM   263  C  C   . TYR A 1 40  ? 35.388 14.859  34.724 1.00 12.12 ? 39   TYR A C   1 
ATOM   264  O  O   . TYR A 1 40  ? 35.906 13.961  35.370 1.00 16.85 ? 39   TYR A O   1 
ATOM   265  C  CB  . TYR A 1 40  ? 35.774 16.703  36.358 1.00 14.28 ? 39   TYR A CB  1 
ATOM   266  C  CG  . TYR A 1 40  ? 36.037 18.176  36.599 1.00 17.51 ? 39   TYR A CG  1 
ATOM   267  C  CD1 . TYR A 1 40  ? 37.315 18.719  36.572 1.00 19.89 ? 39   TYR A CD1 1 
ATOM   268  C  CD2 . TYR A 1 40  ? 34.992 19.047  36.844 1.00 18.08 ? 39   TYR A CD2 1 
ATOM   269  C  CE1 . TYR A 1 40  ? 37.505 20.078  36.794 1.00 21.90 ? 39   TYR A CE1 1 
ATOM   270  C  CE2 . TYR A 1 40  ? 35.165 20.402  37.062 1.00 20.82 ? 39   TYR A CE2 1 
ATOM   271  C  CZ  . TYR A 1 40  ? 36.450 20.921  37.034 1.00 24.25 ? 39   TYR A CZ  1 
ATOM   272  O  OH  . TYR A 1 40  ? 36.675 22.271  37.251 1.00 25.96 ? 39   TYR A OH  1 
ATOM   273  N  N   . GLY A 1 41  ? 34.441 14.635  33.810 1.00 12.66 ? 40   GLY A N   1 
ATOM   274  C  CA  . GLY A 1 41  ? 33.975 13.291  33.515 1.00 12.92 ? 40   GLY A CA  1 
ATOM   275  C  C   . GLY A 1 41  ? 33.356 12.625  34.710 1.00 13.16 ? 40   GLY A C   1 
ATOM   276  O  O   . GLY A 1 41  ? 33.412 11.411  34.858 1.00 14.90 ? 40   GLY A O   1 
ATOM   277  N  N   . LYS A 1 42  ? 32.737 13.377  35.593 1.00 11.96 ? 41   LYS A N   1 
ATOM   278  C  CA  . LYS A 1 42  ? 32.336 12.950  36.919 1.00 11.23 ? 41   LYS A CA  1 
ATOM   279  C  C   . LYS A 1 42  ? 30.824 12.866  37.106 1.00 11.09 ? 41   LYS A C   1 
ATOM   280  O  O   . LYS A 1 42  ? 30.088 13.777  36.771 1.00 12.82 ? 41   LYS A O   1 
ATOM   281  C  CB  . LYS A 1 42  ? 32.890 13.966  37.944 1.00 13.06 ? 41   LYS A CB  1 
ATOM   282  C  CG  . LYS A 1 42  ? 32.725 13.511  39.404 1.00 13.66 ? 41   LYS A CG  1 
ATOM   283  C  CD  . LYS A 1 42  ? 33.267 14.571  40.348 1.00 14.52 ? 41   LYS A CD  1 
ATOM   284  C  CE  . LYS A 1 42  ? 33.356 14.116  41.794 1.00 16.60 ? 41   LYS A CE  1 
ATOM   285  N  NZ  . LYS A 1 42  ? 34.030 15.076  42.707 1.00 17.65 ? 41   LYS A NZ  1 
ATOM   286  N  N   . LEU A 1 43  ? 30.419 11.709  37.670 1.00 11.15 ? 42   LEU A N   1 
ATOM   287  C  CA  . LEU A 1 43  ? 29.057 11.400  38.025 1.00 11.76 ? 42   LEU A CA  1 
ATOM   288  C  C   . LEU A 1 43  ? 28.957 11.007  39.501 1.00 12.13 ? 42   LEU A C   1 
ATOM   289  O  O   . LEU A 1 43  ? 29.756 10.205  39.959 1.00 12.65 ? 42   LEU A O   1 
ATOM   290  C  CB  . LEU A 1 43  ? 28.502 10.202  37.243 1.00 17.89 ? 42   LEU A CB  1 
ATOM   291  C  CG  . LEU A 1 43  ? 28.443 10.347  35.737 1.00 19.56 ? 42   LEU A CG  1 
ATOM   292  C  CD1 . LEU A 1 43  ? 28.315 8.971   35.093 1.00 28.15 ? 42   LEU A CD1 1 
ATOM   293  C  CD2 . LEU A 1 43  ? 27.290 11.256  35.320 1.00 22.64 ? 42   LEU A CD2 1 
ATOM   294  N  N   . THR A 1 44  ? 27.951 11.560  40.153 1.00 12.70 ? 43   THR A N   1 
ATOM   295  C  CA  . THR A 1 44  ? 27.618 11.143  41.518 1.00 13.54 ? 43   THR A CA  1 
ATOM   296  C  C   . THR A 1 44  ? 26.118 10.900  41.539 1.00 13.11 ? 43   THR A C   1 
ATOM   297  O  O   . THR A 1 44  ? 25.360 11.814  41.224 1.00 13.71 ? 43   THR A O   1 
ATOM   298  C  CB  . THR A 1 44  ? 28.006 12.184  42.570 1.00 17.07 ? 43   THR A CB  1 
ATOM   299  O  OG1 . THR A 1 44  ? 27.540 13.480  42.164 1.00 26.83 ? 43   THR A OG1 1 
ATOM   300  C  CG2 . THR A 1 44  ? 29.507 12.350  42.630 1.00 16.34 ? 43   THR A CG2 1 
ATOM   301  N  N   . LEU A 1 45  ? 25.714 9.677   41.890 1.00 12.68 ? 44   LEU A N   1 
ATOM   302  C  CA  . LEU A 1 45  ? 24.316 9.296   41.833 1.00 11.44 ? 44   LEU A CA  1 
ATOM   303  C  C   . LEU A 1 45  ? 23.918 8.404   43.003 1.00 10.30 ? 44   LEU A C   1 
ATOM   304  O  O   . LEU A 1 45  ? 24.755 7.653   43.480 1.00 13.94 ? 44   LEU A O   1 
ATOM   305  C  CB  . LEU A 1 45  ? 24.087 8.550   40.527 1.00 14.81 ? 44   LEU A CB  1 
ATOM   306  C  CG  . LEU A 1 45  ? 24.146 9.370   39.231 1.00 17.15 ? 44   LEU A CG  1 
ATOM   307  C  CD1 . LEU A 1 45  ? 24.740 8.508   38.132 1.00 26.77 ? 44   LEU A CD1 1 
ATOM   308  C  CD2 . LEU A 1 45  ? 22.778 9.816   38.792 1.00 21.35 ? 44   LEU A CD2 1 
ATOM   309  N  N   . LYS A 1 46  ? 22.664 8.489   43.421 1.00 11.84 ? 45   LYS A N   1 
ATOM   310  C  CA  . LYS A 1 46  ? 22.082 7.543   44.360 1.00 11.14 ? 45   LYS A CA  1 
ATOM   311  C  C   . LYS A 1 46  ? 20.857 6.910   43.721 1.00 8.47  ? 45   LYS A C   1 
ATOM   312  O  O   . LYS A 1 46  ? 19.941 7.612   43.273 1.00 12.53 ? 45   LYS A O   1 
ATOM   313  C  CB  . LYS A 1 46  ? 21.725 8.214   45.679 1.00 11.66 ? 45   LYS A CB  1 
ATOM   314  C  CG  . LYS A 1 46  ? 21.080 7.260   46.690 1.00 12.81 ? 45   LYS A CG  1 
ATOM   315  C  CD  . LYS A 1 46  ? 20.737 7.910   48.019 1.00 15.62 ? 45   LYS A CD  1 
ATOM   316  C  CE  . LYS A 1 46  ? 19.884 7.003   48.904 1.00 15.64 ? 45   LYS A CE  1 
ATOM   317  N  NZ  . LYS A 1 46  ? 19.397 7.697   50.140 1.00 14.63 ? 45   LYS A NZ  1 
ATOM   318  N  N   . PHE A 1 47  ? 20.856 5.587   43.681 1.00 11.01 ? 46   PHE A N   1 
ATOM   319  C  CA  . PHE A 1 47  ? 19.748 4.798   43.125 1.00 10.48 ? 46   PHE A CA  1 
ATOM   320  C  C   . PHE A 1 47  ? 19.013 4.070   44.225 1.00 11.37 ? 46   PHE A C   1 
ATOM   321  O  O   . PHE A 1 47  ? 19.645 3.545   45.136 1.00 11.76 ? 46   PHE A O   1 
ATOM   322  C  CB  . PHE A 1 47  ? 20.253 3.734   42.129 1.00 11.42 ? 46   PHE A CB  1 
ATOM   323  C  CG  . PHE A 1 47  ? 21.017 4.336   40.966 1.00 11.60 ? 46   PHE A CG  1 
ATOM   324  C  CD1 . PHE A 1 47  ? 22.396 4.470   41.007 1.00 12.29 ? 46   PHE A CD1 1 
ATOM   325  C  CD2 . PHE A 1 47  ? 20.370 4.777   39.829 1.00 11.83 ? 46   PHE A CD2 1 
ATOM   326  C  CE1 . PHE A 1 47  ? 23.084 5.050   39.945 1.00 12.59 ? 46   PHE A CE1 1 
ATOM   327  C  CE2 . PHE A 1 47  ? 21.042 5.368   38.768 1.00 12.58 ? 46   PHE A CE2 1 
ATOM   328  C  CZ  . PHE A 1 47  ? 22.418 5.507   38.813 1.00 13.14 ? 46   PHE A CZ  1 
ATOM   329  N  N   . ILE A 1 48  ? 17.697 4.022   44.105 1.00 10.32 ? 47   ILE A N   1 
ATOM   330  C  CA  . ILE A 1 48  ? 16.867 3.350   45.121 1.00 11.92 ? 47   ILE A CA  1 
ATOM   331  C  C   . ILE A 1 48  ? 15.975 2.352   44.431 1.00 12.69 ? 47   ILE A C   1 
ATOM   332  O  O   . ILE A 1 48  ? 15.373 2.711   43.405 1.00 12.77 ? 47   ILE A O   1 
ATOM   333  C  CB  . ILE A 1 48  ? 15.999 4.380   45.901 1.00 12.38 ? 47   ILE A CB  1 
ATOM   334  C  CG1 . ILE A 1 48  ? 16.857 5.351   46.708 1.00 13.81 ? 47   ILE A CG1 1 
ATOM   335  C  CG2 . ILE A 1 48  ? 14.987 3.729   46.797 1.00 17.34 ? 47   ILE A CG2 1 
ATOM   336  C  CD1 . ILE A 1 48  ? 16.257 6.595   47.237 1.00 19.74 ? 47   ILE A CD1 1 
ATOM   337  N  N   . CYS A 1 49  ? 15.825 1.134   44.927 1.00 12.49 ? 48   CYS A N   1 
ATOM   338  C  CA  . CYS A 1 49  ? 14.782 0.253   44.378 1.00 12.34 ? 48   CYS A CA  1 
ATOM   339  C  C   . CYS A 1 49  ? 13.460 0.603   45.032 1.00 12.38 ? 48   CYS A C   1 
ATOM   340  O  O   . CYS A 1 49  ? 13.310 0.462   46.247 1.00 13.37 ? 48   CYS A O   1 
ATOM   341  C  CB  . CYS A 1 49  ? 15.154 -1.216  44.632 1.00 12.58 ? 48   CYS A CB  1 
ATOM   342  S  SG  . CYS A 1 49  ? 13.861 -2.330  44.012 1.00 15.53 ? 48   CYS A SG  1 
ATOM   343  N  N   . THR A 1 50  ? 12.529 1.118   44.246 1.00 13.81 ? 49   THR A N   1 
ATOM   344  C  CA  . THR A 1 50  ? 11.319 1.671   44.812 1.00 14.84 ? 49   THR A CA  1 
ATOM   345  C  C   . THR A 1 50  ? 10.254 0.612   44.989 1.00 14.33 ? 49   THR A C   1 
ATOM   346  O  O   . THR A 1 50  ? 9.197  0.903   45.547 1.00 20.41 ? 49   THR A O   1 
ATOM   347  C  CB  . THR A 1 50  ? 10.728 2.766   43.906 1.00 16.45 ? 49   THR A CB  1 
ATOM   348  O  OG1 . THR A 1 50  ? 10.492 2.220   42.612 1.00 17.05 ? 49   THR A OG1 1 
ATOM   349  C  CG2 . THR A 1 50  ? 11.751 3.866   43.716 1.00 18.12 ? 49   THR A CG2 1 
ATOM   350  N  N   . THR A 1 51  ? 10.550 -0.589  44.495 1.00 15.29 ? 50   THR A N   1 
ATOM   351  C  CA  . THR A 1 51  ? 9.528  -1.617  44.641 1.00 19.05 ? 50   THR A CA  1 
ATOM   352  C  C   . THR A 1 51  ? 9.802  -2.603  45.759 1.00 20.44 ? 50   THR A C   1 
ATOM   353  O  O   . THR A 1 51  ? 8.950  -3.449  46.031 1.00 23.85 ? 50   THR A O   1 
ATOM   354  C  CB  . THR A 1 51  ? 9.429  -2.473  43.350 1.00 18.87 ? 50   THR A CB  1 
ATOM   355  O  OG1 . THR A 1 51  ? 10.799 -2.815  43.124 1.00 19.84 ? 50   THR A OG1 1 
ATOM   356  C  CG2 . THR A 1 51  ? 8.766  -1.689  42.249 1.00 19.00 ? 50   THR A CG2 1 
ATOM   357  N  N   . GLY A 1 52  ? 10.937 -2.571  46.395 1.00 18.13 ? 51   GLY A N   1 
ATOM   358  C  CA  . GLY A 1 52  ? 11.307 -3.434  47.515 1.00 18.03 ? 51   GLY A CA  1 
ATOM   359  C  C   . GLY A 1 52  ? 12.771 -3.831  47.352 1.00 17.28 ? 51   GLY A C   1 
ATOM   360  O  O   . GLY A 1 52  ? 13.631 -2.988  47.124 1.00 19.15 ? 51   GLY A O   1 
ATOM   361  N  N   . LYS A 1 53  ? 13.005 -5.127  47.458 1.00 15.74 ? 52   LYS A N   1 
ATOM   362  C  CA  . LYS A 1 53  ? 14.347 -5.679  47.310 1.00 18.52 ? 52   LYS A CA  1 
ATOM   363  C  C   . LYS A 1 53  ? 14.670 -5.823  45.840 1.00 16.60 ? 52   LYS A C   1 
ATOM   364  O  O   . LYS A 1 53  ? 13.812 -6.316  45.098 1.00 18.29 ? 52   LYS A O   1 
ATOM   365  C  CB  . LYS A 1 53  ? 14.404 -7.049  48.005 1.00 25.81 ? 52   LYS A CB  1 
ATOM   366  C  CG  . LYS A 1 53  ? 14.779 -6.975  49.470 1.00 35.24 ? 52   LYS A CG  1 
ATOM   367  C  CD  . LYS A 1 53  ? 16.215 -6.460  49.629 1.00 45.37 ? 52   LYS A CD  1 
ATOM   368  C  CE  . LYS A 1 53  ? 16.231 -5.180  50.452 1.00 49.38 ? 52   LYS A CE  1 
ATOM   369  N  NZ  . LYS A 1 53  ? 17.609 -4.676  50.717 1.00 55.02 ? 52   LYS A NZ  1 
ATOM   370  N  N   . LEU A 1 54  ? 15.868 -5.420  45.443 1.00 16.60 ? 53   LEU A N   1 
ATOM   371  C  CA  . LEU A 1 54  ? 16.257 -5.631  44.040 1.00 15.81 ? 53   LEU A CA  1 
ATOM   372  C  C   . LEU A 1 54  ? 16.415 -7.113  43.756 1.00 15.81 ? 53   LEU A C   1 
ATOM   373  O  O   . LEU A 1 54  ? 17.086 -7.787  44.544 1.00 17.27 ? 53   LEU A O   1 
ATOM   374  C  CB  . LEU A 1 54  ? 17.533 -4.811  43.811 1.00 14.23 ? 53   LEU A CB  1 
ATOM   375  C  CG  . LEU A 1 54  ? 17.867 -4.532  42.348 1.00 14.91 ? 53   LEU A CG  1 
ATOM   376  C  CD1 . LEU A 1 54  ? 16.857 -3.629  41.678 1.00 13.73 ? 53   LEU A CD1 1 
ATOM   377  C  CD2 . LEU A 1 54  ? 19.280 -3.981  42.248 1.00 15.92 ? 53   LEU A CD2 1 
ATOM   378  N  N   . PRO A 1 55  ? 15.817 -7.678  42.710 1.00 16.09 ? 54   PRO A N   1 
ATOM   379  C  CA  . PRO A 1 55  ? 15.964 -9.112  42.453 1.00 16.20 ? 54   PRO A CA  1 
ATOM   380  C  C   . PRO A 1 55  ? 17.239 -9.562  41.756 1.00 16.38 ? 54   PRO A C   1 
ATOM   381  O  O   . PRO A 1 55  ? 17.432 -10.783 41.586 1.00 18.41 ? 54   PRO A O   1 
ATOM   382  C  CB  . PRO A 1 55  ? 14.746 -9.428  41.554 1.00 19.01 ? 54   PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 55  ? 14.490 -8.130  40.844 1.00 18.41 ? 54   PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 55  ? 14.936 -7.023  41.735 1.00 18.77 ? 54   PRO A CD  1 
ATOM   385  N  N   . VAL A 1 56  ? 18.112 -8.656  41.360 1.00 14.19 ? 55   VAL A N   1 
ATOM   386  C  CA  . VAL A 1 56  ? 19.402 -8.964  40.786 1.00 14.23 ? 55   VAL A CA  1 
ATOM   387  C  C   . VAL A 1 56  ? 20.432 -8.156  41.554 1.00 12.45 ? 55   VAL A C   1 
ATOM   388  O  O   . VAL A 1 56  ? 20.070 -7.199  42.243 1.00 12.91 ? 55   VAL A O   1 
ATOM   389  C  CB  . VAL A 1 56  ? 19.446 -8.605  39.290 1.00 13.22 ? 55   VAL A CB  1 
ATOM   390  C  CG1 . VAL A 1 56  ? 18.482 -9.454  38.485 1.00 14.95 ? 55   VAL A CG1 1 
ATOM   391  C  CG2 . VAL A 1 56  ? 19.151 -7.123  39.109 1.00 14.13 ? 55   VAL A CG2 1 
ATOM   392  N  N   . PRO A 1 57  ? 21.720 -8.497  41.477 1.00 13.00 ? 56   PRO A N   1 
ATOM   393  C  CA  . PRO A 1 57  ? 22.747 -7.678  42.109 1.00 12.40 ? 56   PRO A CA  1 
ATOM   394  C  C   . PRO A 1 57  ? 22.886 -6.279  41.496 1.00 12.54 ? 56   PRO A C   1 
ATOM   395  O  O   . PRO A 1 57  ? 22.868 -6.106  40.265 1.00 13.23 ? 56   PRO A O   1 
ATOM   396  C  CB  . PRO A 1 57  ? 24.036 -8.474  41.832 1.00 12.91 ? 56   PRO A CB  1 
ATOM   397  C  CG  . PRO A 1 57  ? 23.521 -9.889  41.639 1.00 14.45 ? 56   PRO A CG  1 
ATOM   398  C  CD  . PRO A 1 57  ? 22.262 -9.710  40.836 1.00 13.45 ? 56   PRO A CD  1 
ATOM   399  N  N   . TRP A 1 58  ? 23.035 -5.284  42.376 1.00 12.86 ? 57   TRP A N   1 
ATOM   400  C  CA  . TRP A 1 58  ? 23.229 -3.915  41.885 1.00 11.58 ? 57   TRP A CA  1 
ATOM   401  C  C   . TRP A 1 58  ? 24.318 -3.790  40.850 1.00 11.17 ? 57   TRP A C   1 
ATOM   402  O  O   . TRP A 1 58  ? 24.129 -3.047  39.875 1.00 11.21 ? 57   TRP A O   1 
ATOM   403  C  CB  . TRP A 1 58  ? 23.534 -2.976  43.058 1.00 11.50 ? 57   TRP A CB  1 
ATOM   404  C  CG  . TRP A 1 58  ? 22.323 -2.563  43.830 1.00 11.58 ? 57   TRP A CG  1 
ATOM   405  C  CD1 . TRP A 1 58  ? 21.934 -2.993  45.050 1.00 12.74 ? 57   TRP A CD1 1 
ATOM   406  C  CD2 . TRP A 1 58  ? 21.337 -1.606  43.415 1.00 12.05 ? 57   TRP A CD2 1 
ATOM   407  N  NE1 . TRP A 1 58  ? 20.774 -2.387  45.440 1.00 11.82 ? 57   TRP A NE1 1 
ATOM   408  C  CE2 . TRP A 1 58  ? 20.375 -1.518  44.448 1.00 10.08 ? 57   TRP A CE2 1 
ATOM   409  C  CE3 . TRP A 1 58  ? 21.173 -0.813  42.277 1.00 11.89 ? 57   TRP A CE3 1 
ATOM   410  C  CZ2 . TRP A 1 58  ? 19.265 -0.676  44.374 1.00 10.83 ? 57   TRP A CZ2 1 
ATOM   411  C  CZ3 . TRP A 1 58  ? 20.084 0.019   42.188 1.00 12.28 ? 57   TRP A CZ3 1 
ATOM   412  C  CH2 . TRP A 1 58  ? 19.147 0.076   43.243 1.00 12.71 ? 57   TRP A CH2 1 
ATOM   413  N  N   . PRO A 1 59  ? 25.480 -4.414  40.977 1.00 12.34 ? 58   PRO A N   1 
ATOM   414  C  CA  . PRO A 1 59  ? 26.511 -4.203  39.931 1.00 11.80 ? 58   PRO A CA  1 
ATOM   415  C  C   . PRO A 1 59  ? 26.038 -4.605  38.541 1.00 11.68 ? 58   PRO A C   1 
ATOM   416  O  O   . PRO A 1 59  ? 26.553 -4.064  37.563 1.00 11.81 ? 58   PRO A O   1 
ATOM   417  C  CB  . PRO A 1 59  ? 27.681 -5.073  40.417 1.00 11.94 ? 58   PRO A CB  1 
ATOM   418  C  CG  . PRO A 1 59  ? 27.488 -5.107  41.888 1.00 13.90 ? 58   PRO A CG  1 
ATOM   419  C  CD  . PRO A 1 59  ? 26.001 -5.224  42.081 1.00 12.28 ? 58   PRO A CD  1 
ATOM   420  N  N   . THR A 1 60  ? 25.080 -5.522  38.416 1.00 11.59 ? 59   THR A N   1 
ATOM   421  C  CA  . THR A 1 60  ? 24.658 -5.910  37.081 1.00 12.09 ? 59   THR A CA  1 
ATOM   422  C  C   . THR A 1 60  ? 23.860 -4.807  36.375 1.00 11.82 ? 59   THR A C   1 
ATOM   423  O  O   . THR A 1 60  ? 23.643 -4.931  35.161 1.00 12.18 ? 59   THR A O   1 
ATOM   424  C  CB  . THR A 1 60  ? 23.789 -7.185  37.044 1.00 11.81 ? 59   THR A CB  1 
ATOM   425  O  OG1 . THR A 1 60  ? 22.527 -6.959  37.667 1.00 13.43 ? 59   THR A OG1 1 
ATOM   426  C  CG2 . THR A 1 60  ? 24.471 -8.332  37.788 1.00 15.07 ? 59   THR A CG2 1 
ATOM   427  N  N   . LEU A 1 61  ? 23.449 -3.773  37.105 1.00 12.71 ? 60   LEU A N   1 
ATOM   428  C  CA  . LEU A 1 61  ? 22.669 -2.679  36.527 1.00 12.34 ? 60   LEU A CA  1 
ATOM   429  C  C   . LEU A 1 61  ? 23.486 -1.431  36.244 1.00 10.65 ? 60   LEU A C   1 
ATOM   430  O  O   . LEU A 1 61  ? 22.952 -0.459  35.700 1.00 12.24 ? 60   LEU A O   1 
ATOM   431  C  CB  . LEU A 1 61  ? 21.526 -2.270  37.471 1.00 13.90 ? 60   LEU A CB  1 
ATOM   432  C  CG  . LEU A 1 61  ? 20.455 -3.333  37.722 1.00 14.26 ? 60   LEU A CG  1 
ATOM   433  C  CD1 . LEU A 1 61  ? 19.336 -2.789  38.600 1.00 14.73 ? 60   LEU A CD1 1 
ATOM   434  C  CD2 . LEU A 1 61  ? 19.909 -3.894  36.410 1.00 15.35 ? 60   LEU A CD2 1 
ATOM   435  N  N   . VAL A 1 62  ? 24.767 -1.416  36.648 1.00 11.38 ? 61   VAL A N   1 
ATOM   436  C  CA  . VAL A 1 62  ? 25.511 -0.158  36.509 1.00 12.83 ? 61   VAL A CA  1 
ATOM   437  C  C   . VAL A 1 62  ? 25.573 0.308   35.076 1.00 12.93 ? 61   VAL A C   1 
ATOM   438  O  O   . VAL A 1 62  ? 25.354 1.508   34.825 1.00 14.00 ? 61   VAL A O   1 
ATOM   439  C  CB  . VAL A 1 62  ? 26.925 -0.343  37.091 1.00 13.41 ? 61   VAL A CB  1 
ATOM   440  C  CG1 . VAL A 1 62  ? 27.868 0.780   36.651 1.00 13.86 ? 61   VAL A CG1 1 
ATOM   441  C  CG2 . VAL A 1 62  ? 26.874 -0.410  38.601 1.00 14.95 ? 61   VAL A CG2 1 
ATOM   442  N  N   . THR A 1 63  ? 25.848 -0.572  34.100 1.00 13.96 ? 62   THR A N   1 
ATOM   443  C  CA  . THR A 1 63  ? 25.985 -0.015  32.734 1.00 15.22 ? 62   THR A CA  1 
ATOM   444  C  C   . THR A 1 63  ? 24.661 0.423   32.123 1.00 16.57 ? 62   THR A C   1 
ATOM   445  O  O   . THR A 1 63  ? 24.687 1.281   31.235 1.00 19.48 ? 62   THR A O   1 
ATOM   446  C  CB  . THR A 1 63  ? 26.648 -1.015  31.773 1.00 16.52 ? 62   THR A CB  1 
ATOM   447  O  OG1 . THR A 1 63  ? 25.801 -2.164  31.755 1.00 18.11 ? 62   THR A OG1 1 
ATOM   448  C  CG2 . THR A 1 63  ? 28.020 -1.409  32.304 1.00 17.35 ? 62   THR A CG2 1 
ATOM   449  N  N   . THR A 1 64  ? 23.561 -0.134  32.587 1.00 15.45 ? 63   THR A N   1 
ATOM   450  C  CA  . THR A 1 64  ? 22.237 0.312   32.158 1.00 14.29 ? 63   THR A CA  1 
ATOM   451  C  C   . THR A 1 64  ? 21.877 1.670   32.764 1.00 13.24 ? 63   THR A C   1 
ATOM   452  O  O   . THR A 1 64  ? 21.344 2.559   32.085 1.00 15.91 ? 63   THR A O   1 
ATOM   453  C  CB  . THR A 1 64  ? 21.214 -0.757  32.544 1.00 13.16 ? 63   THR A CB  1 
ATOM   454  O  OG1 . THR A 1 64  ? 21.510 -1.972  31.814 1.00 16.85 ? 63   THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 64  ? 19.787 -0.409  32.167 1.00 18.77 ? 63   THR A CG2 1 
ATOM   456  N  N   . LEU A 1 65  ? 22.144 1.869   34.049 1.00 12.65 ? 64   LEU A N   1 
ATOM   457  C  CA  . LEU A 1 65  ? 21.786 3.087   34.782 1.00 14.28 ? 64   LEU A CA  1 
ATOM   458  C  C   . LEU A 1 65  ? 22.714 4.226   34.406 1.00 14.52 ? 64   LEU A C   1 
ATOM   459  O  O   . LEU A 1 65  ? 22.321 5.383   34.406 1.00 17.89 ? 64   LEU A O   1 
ATOM   460  C  CB  . LEU A 1 65  ? 21.879 2.856   36.288 1.00 13.12 ? 64   LEU A CB  1 
ATOM   461  C  CG  . LEU A 1 65  ? 20.901 1.836   36.862 1.00 12.17 ? 64   LEU A CG  1 
ATOM   462  C  CD1 . LEU A 1 65  ? 21.285 1.454   38.283 1.00 16.23 ? 64   LEU A CD1 1 
ATOM   463  C  CD2 . LEU A 1 65  ? 19.477 2.360   36.819 1.00 14.58 ? 64   LEU A CD2 1 
HETATM 464  N  N1  . CRO A 1 66  ? 23.963 3.880   34.073 1.00 14.47 ? 66   CRO A N1  1 
HETATM 465  C  CA1 . CRO A 1 66  ? 24.881 4.931   33.701 1.00 16.64 ? 66   CRO A CA1 1 
HETATM 466  C  CB1 . CRO A 1 66  ? 25.837 5.378   34.805 1.00 18.54 ? 66   CRO A CB1 1 
HETATM 467  C  CG1 . CRO A 1 66  ? 25.049 6.026   35.907 1.00 23.71 ? 66   CRO A CG1 1 
HETATM 468  O  OG1 . CRO A 1 66  ? 26.623 4.294   35.215 1.00 19.53 ? 66   CRO A OG1 1 
HETATM 469  C  C1  . CRO A 1 66  ? 25.675 4.463   32.528 1.00 17.23 ? 66   CRO A C1  1 
HETATM 470  N  N2  . CRO A 1 66  ? 26.851 3.845   32.610 1.00 22.20 ? 66   CRO A N2  1 
HETATM 471  N  N3  . CRO A 1 66  ? 25.179 4.466   31.264 1.00 20.34 ? 66   CRO A N3  1 
HETATM 472  C  C2  . CRO A 1 66  ? 26.083 3.809   30.444 1.00 19.25 ? 66   CRO A C2  1 
HETATM 473  O  O2  . CRO A 1 66  ? 25.945 3.631   29.232 1.00 21.26 ? 66   CRO A O2  1 
HETATM 474  C  CA2 . CRO A 1 66  ? 27.140 3.423   31.326 1.00 20.20 ? 66   CRO A CA2 1 
HETATM 475  C  CA3 . CRO A 1 66  ? 23.906 4.918   30.785 1.00 19.73 ? 66   CRO A CA3 1 
HETATM 476  C  C3  . CRO A 1 66  ? 23.786 6.390   30.352 1.00 21.32 ? 66   CRO A C3  1 
HETATM 477  O  O3  . CRO A 1 66  ? 22.816 6.661   29.606 1.00 19.44 ? 66   CRO A O3  1 
HETATM 478  C  CB2 . CRO A 1 66  ? 28.166 2.561   30.980 1.00 25.02 ? 66   CRO A CB2 1 
HETATM 479  C  CG2 . CRO A 1 66  ? 29.280 2.007   31.591 1.00 24.77 ? 66   CRO A CG2 1 
HETATM 480  C  CD1 . CRO A 1 66  ? 29.564 2.175   32.943 1.00 25.08 ? 66   CRO A CD1 1 
HETATM 481  C  CD2 . CRO A 1 66  ? 30.154 1.251   30.812 1.00 25.84 ? 66   CRO A CD2 1 
HETATM 482  C  CE1 . CRO A 1 66  ? 30.704 1.600   33.517 1.00 29.79 ? 66   CRO A CE1 1 
HETATM 483  C  CE2 . CRO A 1 66  ? 31.294 0.655   31.335 1.00 27.98 ? 66   CRO A CE2 1 
HETATM 484  C  CZ  . CRO A 1 66  ? 31.527 0.853   32.687 1.00 29.58 ? 66   CRO A CZ  1 
HETATM 485  O  OH  . CRO A 1 66  ? 32.656 0.274   33.230 1.00 30.26 ? 66   CRO A OH  1 
ATOM   486  N  N   . VAL A 1 67  ? 24.655 7.279   30.793 1.00 17.49 ? 68   VAL A N   1 
ATOM   487  C  CA  . VAL A 1 67  ? 24.625 8.706   30.565 1.00 14.36 ? 68   VAL A CA  1 
ATOM   488  C  C   . VAL A 1 67  ? 26.050 9.161   30.206 1.00 14.95 ? 68   VAL A C   1 
ATOM   489  O  O   . VAL A 1 67  ? 26.742 9.955   30.830 1.00 14.21 ? 68   VAL A O   1 
ATOM   490  C  CB  . VAL A 1 67  ? 24.177 9.528   31.764 1.00 14.33 ? 68   VAL A CB  1 
ATOM   491  C  CG1 . VAL A 1 67  ? 22.685 9.310   32.022 1.00 21.29 ? 68   VAL A CG1 1 
ATOM   492  C  CG2 . VAL A 1 67  ? 24.985 9.190   32.994 1.00 18.84 ? 68   VAL A CG2 1 
ATOM   493  N  N   . GLN A 1 68  ? 26.430 8.558   29.091 1.00 13.57 ? 69   GLN A N   1 
ATOM   494  C  CA  . GLN A 1 68  ? 27.768 8.740   28.556 1.00 12.95 ? 69   GLN A CA  1 
ATOM   495  C  C   . GLN A 1 68  ? 27.977 10.130  27.989 1.00 11.42 ? 69   GLN A C   1 
ATOM   496  O  O   . GLN A 1 68  ? 29.114 10.491  27.674 1.00 13.19 ? 69   GLN A O   1 
ATOM   497  C  CB  . GLN A 1 68  ? 27.985 7.623   27.517 1.00 14.47 ? 69   GLN A CB  1 
ATOM   498  C  CG  . GLN A 1 68  ? 28.252 6.286   28.197 1.00 16.29 ? 69   GLN A CG  1 
ATOM   499  C  CD  . GLN A 1 68  ? 28.166 5.161   27.193 1.00 23.36 ? 69   GLN A CD  1 
ATOM   500  O  OE1 . GLN A 1 68  ? 27.403 5.211   26.222 1.00 28.50 ? 69   GLN A OE1 1 
ATOM   501  N  NE2 . GLN A 1 68  ? 28.970 4.146   27.456 1.00 40.80 ? 69   GLN A NE2 1 
ATOM   502  N  N   . CYS A 1 69  ? 26.940 10.960  27.926 1.00 12.04 ? 70   CYS A N   1 
ATOM   503  C  CA  . CYS A 1 69  ? 27.093 12.370  27.608 1.00 12.24 ? 70   CYS A CA  1 
ATOM   504  C  C   . CYS A 1 69  ? 27.881 13.081  28.693 1.00 11.90 ? 70   CYS A C   1 
ATOM   505  O  O   . CYS A 1 69  ? 28.349 14.199  28.408 1.00 13.25 ? 70   CYS A O   1 
ATOM   506  C  CB  . CYS A 1 69  ? 25.730 13.004  27.424 1.00 12.59 ? 70   CYS A CB  1 
ATOM   507  S  SG  . CYS A 1 69  ? 24.531 12.692  28.748 1.00 18.57 ? 70   CYS A SG  1 
ATOM   508  N  N   . PHE A 1 70  ? 28.074 12.492  29.887 1.00 11.62 ? 71   PHE A N   1 
ATOM   509  C  CA  . PHE A 1 70  ? 28.934 13.160  30.888 1.00 11.99 ? 71   PHE A CA  1 
ATOM   510  C  C   . PHE A 1 70  ? 30.389 12.741  30.808 1.00 11.49 ? 71   PHE A C   1 
ATOM   511  O  O   . PHE A 1 70  ? 31.204 13.142  31.675 1.00 13.20 ? 71   PHE A O   1 
ATOM   512  C  CB  . PHE A 1 70  ? 28.402 12.925  32.310 1.00 12.01 ? 71   PHE A CB  1 
ATOM   513  C  CG  . PHE A 1 70  ? 27.096 13.687  32.522 1.00 11.08 ? 71   PHE A CG  1 
ATOM   514  C  CD1 . PHE A 1 70  ? 27.139 15.038  32.756 1.00 11.57 ? 71   PHE A CD1 1 
ATOM   515  C  CD2 . PHE A 1 70  ? 25.871 13.046  32.444 1.00 11.01 ? 71   PHE A CD2 1 
ATOM   516  C  CE1 . PHE A 1 70  ? 25.977 15.756  32.871 1.00 11.74 ? 71   PHE A CE1 1 
ATOM   517  C  CE2 . PHE A 1 70  ? 24.695 13.772  32.604 1.00 12.30 ? 71   PHE A CE2 1 
ATOM   518  C  CZ  . PHE A 1 70  ? 24.772 15.127  32.843 1.00 11.10 ? 71   PHE A CZ  1 
ATOM   519  N  N   . SER A 1 71  ? 30.769 11.979  29.790 1.00 12.73 ? 72   SER A N   1 
ATOM   520  C  CA  . SER A 1 71  ? 32.201 11.683  29.593 1.00 12.77 ? 72   SER A CA  1 
ATOM   521  C  C   . SER A 1 71  ? 33.021 12.933  29.409 1.00 11.47 ? 72   SER A C   1 
ATOM   522  O  O   . SER A 1 71  ? 32.548 13.903  28.807 1.00 15.57 ? 72   SER A O   1 
ATOM   523  C  CB  . SER A 1 71  ? 32.385 10.818  28.343 1.00 16.11 ? 72   SER A CB  1 
ATOM   524  O  OG  . SER A 1 71  ? 31.680 9.607   28.437 1.00 17.75 ? 72   SER A OG  1 
ATOM   525  N  N   . ARG A 1 72  ? 34.256 12.918  29.892 1.00 12.46 ? 73   ARG A N   1 
ATOM   526  C  CA  . ARG A 1 72  ? 35.175 13.991  29.529 1.00 12.31 ? 73   ARG A CA  1 
ATOM   527  C  C   . ARG A 1 72  ? 35.848 13.663  28.214 1.00 11.77 ? 73   ARG A C   1 
ATOM   528  O  O   . ARG A 1 72  ? 36.663 12.752  28.132 1.00 13.78 ? 73   ARG A O   1 
ATOM   529  C  CB  . ARG A 1 72  ? 36.246 14.211  30.612 1.00 13.33 ? 73   ARG A CB  1 
ATOM   530  C  CG  . ARG A 1 72  ? 37.086 15.435  30.268 1.00 16.75 ? 73   ARG A CG  1 
ATOM   531  C  CD  . ARG A 1 72  ? 38.139 15.699  31.319 1.00 17.55 ? 73   ARG A CD  1 
ATOM   532  N  NE  . ARG A 1 72  ? 39.280 14.805  31.276 1.00 18.49 ? 73   ARG A NE  1 
ATOM   533  C  CZ  . ARG A 1 72  ? 40.301 14.878  30.435 1.00 17.64 ? 73   ARG A CZ  1 
ATOM   534  N  NH1 . ARG A 1 72  ? 40.369 15.808  29.497 1.00 18.77 ? 73   ARG A NH1 1 
ATOM   535  N  NH2 . ARG A 1 72  ? 41.298 14.006  30.508 1.00 19.83 ? 73   ARG A NH2 1 
ATOM   536  N  N   . TYR A 1 73  ? 35.531 14.435  27.193 1.00 12.37 ? 74   TYR A N   1 
ATOM   537  C  CA  . TYR A 1 73  ? 36.233 14.402  25.912 1.00 11.48 ? 74   TYR A CA  1 
ATOM   538  C  C   . TYR A 1 73  ? 37.316 15.474  25.945 1.00 12.11 ? 74   TYR A C   1 
ATOM   539  O  O   . TYR A 1 73  ? 37.012 16.652  26.061 1.00 14.56 ? 74   TYR A O   1 
ATOM   540  C  CB  . TYR A 1 73  ? 35.275 14.601  24.728 1.00 13.42 ? 74   TYR A CB  1 
ATOM   541  C  CG  . TYR A 1 73  ? 34.621 13.302  24.302 1.00 13.17 ? 74   TYR A CG  1 
ATOM   542  C  CD1 . TYR A 1 73  ? 33.620 12.705  25.076 1.00 12.73 ? 74   TYR A CD1 1 
ATOM   543  C  CD2 . TYR A 1 73  ? 35.026 12.637  23.158 1.00 14.31 ? 74   TYR A CD2 1 
ATOM   544  C  CE1 . TYR A 1 73  ? 33.038 11.506  24.679 1.00 10.99 ? 74   TYR A CE1 1 
ATOM   545  C  CE2 . TYR A 1 73  ? 34.446 11.432  22.753 1.00 12.95 ? 74   TYR A CE2 1 
ATOM   546  C  CZ  . TYR A 1 73  ? 33.453 10.868  23.525 1.00 11.75 ? 74   TYR A CZ  1 
ATOM   547  O  OH  . TYR A 1 73  ? 32.886 9.685   23.129 1.00 12.23 ? 74   TYR A OH  1 
ATOM   548  N  N   . PRO A 1 74  ? 38.565 15.065  25.860 1.00 11.30 ? 75   PRO A N   1 
ATOM   549  C  CA  . PRO A 1 74  ? 39.639 16.049  25.728 1.00 11.32 ? 75   PRO A CA  1 
ATOM   550  C  C   . PRO A 1 74  ? 39.350 17.010  24.573 1.00 10.80 ? 75   PRO A C   1 
ATOM   551  O  O   . PRO A 1 74  ? 38.725 16.609  23.604 1.00 12.72 ? 75   PRO A O   1 
ATOM   552  C  CB  . PRO A 1 74  ? 40.848 15.195  25.394 1.00 12.32 ? 75   PRO A CB  1 
ATOM   553  C  CG  . PRO A 1 74  ? 40.555 13.853  26.025 1.00 13.16 ? 75   PRO A CG  1 
ATOM   554  C  CD  . PRO A 1 74  ? 39.068 13.682  25.884 1.00 12.69 ? 75   PRO A CD  1 
ATOM   555  N  N   . ASP A 1 75  ? 39.801 18.261  24.696 1.00 12.93 ? 76   ASP A N   1 
ATOM   556  C  CA  . ASP A 1 75  ? 39.591 19.255  23.647 1.00 11.73 ? 76   ASP A CA  1 
ATOM   557  C  C   . ASP A 1 75  ? 39.969 18.723  22.269 1.00 12.85 ? 76   ASP A C   1 
ATOM   558  O  O   . ASP A 1 75  ? 39.227 18.928  21.309 1.00 13.78 ? 76   ASP A O   1 
ATOM   559  C  CB  . ASP A 1 75  ? 40.389 20.524  23.938 1.00 14.16 ? 76   ASP A CB  1 
ATOM   560  C  CG  . ASP A 1 75  ? 40.099 21.574  22.876 1.00 13.62 ? 76   ASP A CG  1 
ATOM   561  O  OD1 . ASP A 1 75  ? 39.069 22.259  23.003 1.00 16.99 ? 76   ASP A OD1 1 
ATOM   562  O  OD2 . ASP A 1 75  ? 40.901 21.695  21.929 1.00 18.52 ? 76   ASP A OD2 1 
ATOM   563  N  N   . HIS A 1 76  ? 41.106 18.022  22.185 1.00 12.17 ? 77   HIS A N   1 
ATOM   564  C  CA  . HIS A 1 76  ? 41.566 17.561  20.885 1.00 13.62 ? 77   HIS A CA  1 
ATOM   565  C  C   . HIS A 1 76  ? 40.702 16.432  20.324 1.00 13.66 ? 77   HIS A C   1 
ATOM   566  O  O   . HIS A 1 76  ? 40.868 16.075  19.161 1.00 15.78 ? 77   HIS A O   1 
ATOM   567  C  CB  . HIS A 1 76  ? 43.056 17.174  20.950 1.00 16.25 ? 77   HIS A CB  1 
ATOM   568  C  CG  . HIS A 1 76  ? 43.315 15.836  21.531 1.00 16.86 ? 77   HIS A CG  1 
ATOM   569  N  ND1 . HIS A 1 76  ? 43.405 15.680  22.888 1.00 17.67 ? 77   HIS A ND1 1 
ATOM   570  C  CD2 . HIS A 1 76  ? 43.480 14.613  20.982 1.00 18.75 ? 77   HIS A CD2 1 
ATOM   571  C  CE1 . HIS A 1 76  ? 43.625 14.408  23.170 1.00 19.55 ? 77   HIS A CE1 1 
ATOM   572  N  NE2 . HIS A 1 76  ? 43.680 13.744  22.025 1.00 20.56 ? 77   HIS A NE2 1 
ATOM   573  N  N   . MET A 1 77  ? 39.793 15.873  21.084 1.00 11.96 ? 78   MET A N   1 
ATOM   574  C  CA  . MET A 1 77  ? 38.832 14.877  20.629 1.00 14.04 ? 78   MET A CA  1 
ATOM   575  C  C   . MET A 1 77  ? 37.415 15.405  20.580 1.00 13.48 ? 78   MET A C   1 
ATOM   576  O  O   . MET A 1 77  ? 36.460 14.640  20.407 1.00 14.72 ? 78   MET A O   1 
ATOM   577  C  CB  . MET A 1 77  ? 38.826 13.684  21.614 1.00 14.15 ? 78   MET A CB  1 
ATOM   578  C  CG  . MET A 1 77  ? 40.104 12.886  21.580 1.00 14.35 ? 78   MET A CG  1 
ATOM   579  S  SD  . MET A 1 77  ? 40.120 11.496  22.715 1.00 15.21 ? 78   MET A SD  1 
ATOM   580  C  CE  . MET A 1 77  ? 38.816 10.467  22.033 1.00 12.86 ? 78   MET A CE  1 
ATOM   581  N  N   . LYS A 1 78  ? 37.227 16.715  20.746 1.00 13.93 ? 79   LYS A N   1 
ATOM   582  C  CA  . LYS A 1 78  ? 35.846 17.226  20.857 1.00 16.32 ? 79   LYS A CA  1 
ATOM   583  C  C   . LYS A 1 78  ? 34.925 16.895  19.713 1.00 15.55 ? 79   LYS A C   1 
ATOM   584  O  O   . LYS A 1 78  ? 33.670 16.821  19.834 1.00 16.37 ? 79   LYS A O   1 
ATOM   585  C  CB  . LYS A 1 78  ? 35.932 18.746  21.085 1.00 20.97 ? 79   LYS A CB  1 
ATOM   586  C  CG  . LYS A 1 78  ? 36.345 19.579  19.865 1.00 26.42 ? 79   LYS A CG  1 
ATOM   587  C  CD  . LYS A 1 78  ? 36.799 20.953  20.347 1.00 34.28 ? 79   LYS A CD  1 
ATOM   588  C  CE  . LYS A 1 78  ? 37.825 21.632  19.492 1.00 35.49 ? 79   LYS A CE  1 
ATOM   589  N  NZ  . LYS A 1 78  ? 39.215 21.103  19.556 1.00 36.79 ? 79   LYS A NZ  1 
ATOM   590  N  N   . GLN A 1 79  ? 35.290 16.636  18.494 1.00 14.72 ? 80   GLN A N   1 
ATOM   591  C  CA  . GLN A 1 79  ? 34.659 16.345  17.234 1.00 17.87 ? 80   GLN A CA  1 
ATOM   592  C  C   . GLN A 1 79  ? 34.197 14.879  17.203 1.00 14.09 ? 80   GLN A C   1 
ATOM   593  O  O   . GLN A 1 79  ? 33.524 14.481  16.254 1.00 14.92 ? 80   GLN A O   1 
ATOM   594  C  CB  . GLN A 1 79  ? 35.571 16.632  16.028 1.00 17.05 ? 80   GLN A CB  1 
ATOM   595  C  CG  . GLN A 1 79  ? 36.753 15.684  15.947 1.00 21.46 ? 80   GLN A CG  1 
ATOM   596  C  CD  . GLN A 1 79  ? 38.131 16.158  16.294 1.00 19.86 ? 80   GLN A CD  1 
ATOM   597  O  OE1 . GLN A 1 79  ? 39.015 16.039  15.405 1.00 35.56 ? 80   GLN A OE1 1 
ATOM   598  N  NE2 . GLN A 1 79  ? 38.607 16.672  17.388 1.00 21.45 ? 80   GLN A NE2 1 
ATOM   599  N  N   . HIS A 1 80  ? 34.580 14.147  18.248 1.00 12.24 ? 81   HIS A N   1 
ATOM   600  C  CA  . HIS A 1 80  ? 34.189 12.746  18.348 1.00 13.51 ? 81   HIS A CA  1 
ATOM   601  C  C   . HIS A 1 80  ? 33.138 12.493  19.413 1.00 14.80 ? 81   HIS A C   1 
ATOM   602  O  O   . HIS A 1 80  ? 32.846 11.328  19.666 1.00 15.67 ? 81   HIS A O   1 
ATOM   603  C  CB  . HIS A 1 80  ? 35.441 11.909  18.638 1.00 13.19 ? 81   HIS A CB  1 
ATOM   604  C  CG  . HIS A 1 80  ? 36.461 12.064  17.556 1.00 14.02 ? 81   HIS A CG  1 
ATOM   605  N  ND1 . HIS A 1 80  ? 36.387 11.518  16.288 1.00 15.87 ? 81   HIS A ND1 1 
ATOM   606  C  CD2 . HIS A 1 80  ? 37.631 12.749  17.618 1.00 16.57 ? 81   HIS A CD2 1 
ATOM   607  C  CE1 . HIS A 1 80  ? 37.472 11.869  15.612 1.00 18.68 ? 81   HIS A CE1 1 
ATOM   608  N  NE2 . HIS A 1 80  ? 38.232 12.605  16.391 1.00 19.26 ? 81   HIS A NE2 1 
ATOM   609  N  N   . ASP A 1 81  ? 32.565 13.540  20.000 1.00 14.45 ? 82   ASP A N   1 
ATOM   610  C  CA  . ASP A 1 81  ? 31.584 13.384  21.103 1.00 12.80 ? 82   ASP A CA  1 
ATOM   611  C  C   . ASP A 1 81  ? 30.159 13.389  20.579 1.00 14.60 ? 82   ASP A C   1 
ATOM   612  O  O   . ASP A 1 81  ? 29.463 14.390  20.557 1.00 14.58 ? 82   ASP A O   1 
ATOM   613  C  CB  . ASP A 1 81  ? 31.828 14.485  22.136 1.00 13.76 ? 82   ASP A CB  1 
ATOM   614  C  CG  . ASP A 1 81  ? 30.989 14.325  23.391 1.00 17.22 ? 82   ASP A CG  1 
ATOM   615  O  OD1 . ASP A 1 81  ? 30.097 13.433  23.400 1.00 15.62 ? 82   ASP A OD1 1 
ATOM   616  O  OD2 . ASP A 1 81  ? 31.262 15.110  24.338 1.00 13.95 ? 82   ASP A OD2 1 
ATOM   617  N  N   . PHE A 1 82  ? 29.730 12.207  20.138 1.00 13.85 ? 83   PHE A N   1 
ATOM   618  C  CA  . PHE A 1 82  ? 28.375 11.990  19.634 1.00 11.60 ? 83   PHE A CA  1 
ATOM   619  C  C   . PHE A 1 82  ? 27.347 12.369  20.691 1.00 11.79 ? 83   PHE A C   1 
ATOM   620  O  O   . PHE A 1 82  ? 26.329 12.996  20.419 1.00 13.01 ? 83   PHE A O   1 
ATOM   621  C  CB  . PHE A 1 82  ? 28.181 10.511  19.269 1.00 11.28 ? 83   PHE A CB  1 
ATOM   622  C  CG  . PHE A 1 82  ? 26.725 10.103  19.119 1.00 13.59 ? 83   PHE A CG  1 
ATOM   623  C  CD1 . PHE A 1 82  ? 26.118 10.383  17.884 1.00 14.82 ? 83   PHE A CD1 1 
ATOM   624  C  CD2 . PHE A 1 82  ? 26.014 9.460   20.124 1.00 13.41 ? 83   PHE A CD2 1 
ATOM   625  C  CE1 . PHE A 1 82  ? 24.789 10.037  17.731 1.00 15.96 ? 83   PHE A CE1 1 
ATOM   626  C  CE2 . PHE A 1 82  ? 24.688 9.175   19.980 1.00 13.86 ? 83   PHE A CE2 1 
ATOM   627  C  CZ  . PHE A 1 82  ? 24.079 9.458   18.775 1.00 15.77 ? 83   PHE A CZ  1 
ATOM   628  N  N   . PHE A 1 83  ? 27.597 11.880  21.912 1.00 12.82 ? 84   PHE A N   1 
ATOM   629  C  CA  . PHE A 1 83  ? 26.587 11.878  22.956 1.00 12.84 ? 84   PHE A CA  1 
ATOM   630  C  C   . PHE A 1 83  ? 26.102 13.291  23.251 1.00 13.44 ? 84   PHE A C   1 
ATOM   631  O  O   . PHE A 1 83  ? 24.916 13.580  23.319 1.00 14.46 ? 84   PHE A O   1 
ATOM   632  C  CB  . PHE A 1 83  ? 27.133 11.280  24.254 1.00 13.50 ? 84   PHE A CB  1 
ATOM   633  C  CG  . PHE A 1 83  ? 27.737 9.901   24.028 1.00 12.97 ? 84   PHE A CG  1 
ATOM   634  C  CD1 . PHE A 1 83  ? 26.875 8.830   23.938 1.00 13.40 ? 84   PHE A CD1 1 
ATOM   635  C  CD2 . PHE A 1 83  ? 29.107 9.740   23.935 1.00 12.55 ? 84   PHE A CD2 1 
ATOM   636  C  CE1 . PHE A 1 83  ? 27.380 7.552   23.757 1.00 17.22 ? 84   PHE A CE1 1 
ATOM   637  C  CE2 . PHE A 1 83  ? 29.650 8.472   23.752 1.00 15.55 ? 84   PHE A CE2 1 
ATOM   638  C  CZ  . PHE A 1 83  ? 28.769 7.376   23.684 1.00 16.82 ? 84   PHE A CZ  1 
ATOM   639  N  N   . LYS A 1 84  ? 27.034 14.238  23.441 1.00 12.08 ? 85   LYS A N   1 
ATOM   640  C  CA  . LYS A 1 84  ? 26.581 15.614  23.673 1.00 11.54 ? 85   LYS A CA  1 
ATOM   641  C  C   . LYS A 1 84  ? 25.986 16.259  22.437 1.00 11.72 ? 85   LYS A C   1 
ATOM   642  O  O   . LYS A 1 84  ? 25.079 17.108  22.544 1.00 15.00 ? 85   LYS A O   1 
ATOM   643  C  CB  . LYS A 1 84  ? 27.752 16.486  24.138 1.00 12.97 ? 85   LYS A CB  1 
ATOM   644  C  CG  . LYS A 1 84  ? 28.270 16.116  25.505 1.00 11.95 ? 85   LYS A CG  1 
ATOM   645  C  CD  . LYS A 1 84  ? 29.364 17.025  26.005 1.00 12.44 ? 85   LYS A CD  1 
ATOM   646  C  CE  . LYS A 1 84  ? 30.058 16.505  27.262 1.00 14.12 ? 85   LYS A CE  1 
ATOM   647  N  NZ  . LYS A 1 84  ? 30.743 15.189  27.030 1.00 16.38 ? 85   LYS A NZ  1 
ATOM   648  N  N   . SER A 1 85  ? 26.474 15.863  21.264 1.00 12.42 ? 86   SER A N   1 
ATOM   649  C  CA  . SER A 1 85  ? 26.011 16.462  20.020 1.00 13.00 ? 86   SER A CA  1 
ATOM   650  C  C   . SER A 1 85  ? 24.538 16.162  19.796 1.00 14.02 ? 86   SER A C   1 
ATOM   651  O  O   . SER A 1 85  ? 23.913 16.949  19.088 1.00 16.32 ? 86   SER A O   1 
ATOM   652  C  CB  . SER A 1 85  ? 26.844 16.012  18.815 1.00 13.59 ? 86   SER A CB  1 
ATOM   653  O  OG  . SER A 1 85  ? 26.508 14.737  18.342 1.00 15.31 ? 86   SER A OG  1 
ATOM   654  N  N   . ALA A 1 86  ? 24.040 15.086  20.371 1.00 13.02 ? 87   ALA A N   1 
ATOM   655  C  CA  . ALA A 1 86  ? 22.636 14.760  20.139 1.00 13.46 ? 87   ALA A CA  1 
ATOM   656  C  C   . ALA A 1 86  ? 21.694 15.541  21.039 1.00 15.03 ? 87   ALA A C   1 
ATOM   657  O  O   . ALA A 1 86  ? 20.476 15.461  20.864 1.00 16.21 ? 87   ALA A O   1 
ATOM   658  C  CB  . ALA A 1 86  ? 22.403 13.273  20.353 1.00 14.63 ? 87   ALA A CB  1 
ATOM   659  N  N   . MET A 1 87  ? 22.216 16.278  22.007 1.00 13.64 ? 88   MET A N   1 
ATOM   660  C  CA  . MET A 1 87  ? 21.385 16.995  22.967 1.00 12.88 ? 88   MET A CA  1 
ATOM   661  C  C   . MET A 1 87  ? 20.979 18.356  22.432 1.00 13.81 ? 88   MET A C   1 
ATOM   662  O  O   . MET A 1 87  ? 21.698 18.944  21.607 1.00 14.95 ? 88   MET A O   1 
ATOM   663  C  CB  . MET A 1 87  ? 22.159 17.158  24.272 1.00 13.70 ? 88   MET A CB  1 
ATOM   664  C  CG  . MET A 1 87  ? 22.558 15.869  24.960 1.00 13.60 ? 88   MET A CG  1 
ATOM   665  S  SD  . MET A 1 87  ? 21.076 14.909  25.348 1.00 14.90 ? 88   MET A SD  1 
ATOM   666  C  CE  . MET A 1 87  ? 21.815 13.287  25.604 1.00 13.57 ? 88   MET A CE  1 
ATOM   667  N  N   . PRO A 1 88  ? 19.851 18.915  22.859 1.00 14.02 ? 89   PRO A N   1 
ATOM   668  C  CA  . PRO A 1 88  ? 18.988 18.391  23.909 1.00 13.31 ? 89   PRO A CA  1 
ATOM   669  C  C   . PRO A 1 88  ? 17.960 17.350  23.517 1.00 14.06 ? 89   PRO A C   1 
ATOM   670  O  O   . PRO A 1 88  ? 17.356 16.738  24.403 1.00 14.97 ? 89   PRO A O   1 
ATOM   671  C  CB  . PRO A 1 88  ? 18.263 19.684  24.375 1.00 16.03 ? 89   PRO A CB  1 
ATOM   672  C  CG  . PRO A 1 88  ? 18.143 20.532  23.155 1.00 17.05 ? 89   PRO A CG  1 
ATOM   673  C  CD  . PRO A 1 88  ? 19.363 20.205  22.333 1.00 15.60 ? 89   PRO A CD  1 
ATOM   674  N  N   . GLU A 1 89  ? 17.746 17.141  22.223 1.00 14.89 ? 90   GLU A N   1 
ATOM   675  C  CA  . GLU A 1 89  ? 16.672 16.238  21.788 1.00 15.26 ? 90   GLU A CA  1 
ATOM   676  C  C   . GLU A 1 89  ? 16.946 14.802  22.213 1.00 15.60 ? 90   GLU A C   1 
ATOM   677  O  O   . GLU A 1 89  ? 16.043 14.019  22.507 1.00 17.10 ? 90   GLU A O   1 
ATOM   678  C  CB  . GLU A 1 89  ? 16.464 16.326  20.280 1.00 19.92 ? 90   GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 89  ? 15.962 17.704  19.851 1.00 26.17 ? 90   GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 89  ? 17.085 18.728  19.781 1.00 29.12 ? 90   GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 89  ? 16.793 19.948  19.663 1.00 36.77 ? 90   GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 89  ? 18.275 18.322  19.865 1.00 28.17 ? 90   GLU A OE2 1 
ATOM   683  N  N   . GLY A 1 90  ? 18.220 14.442  22.247 1.00 14.62 ? 91   GLY A N   1 
ATOM   684  C  CA  . GLY A 1 90  ? 18.636 13.204  22.877 1.00 14.84 ? 91   GLY A CA  1 
ATOM   685  C  C   . GLY A 1 90  ? 18.887 12.041  21.945 1.00 14.64 ? 91   GLY A C   1 
ATOM   686  O  O   . GLY A 1 90  ? 18.984 12.166  20.712 1.00 15.61 ? 91   GLY A O   1 
ATOM   687  N  N   . TYR A 1 91  ? 19.011 10.864  22.574 1.00 15.02 ? 92   TYR A N   1 
ATOM   688  C  CA  . TYR A 1 91  ? 19.226 9.666   21.779 1.00 15.00 ? 92   TYR A CA  1 
ATOM   689  C  C   . TYR A 1 91  ? 18.530 8.496   22.449 1.00 14.54 ? 92   TYR A C   1 
ATOM   690  O  O   . TYR A 1 91  ? 18.253 8.549   23.640 1.00 14.62 ? 92   TYR A O   1 
ATOM   691  C  CB  . TYR A 1 91  ? 20.714 9.392   21.605 1.00 15.63 ? 92   TYR A CB  1 
ATOM   692  C  CG  . TYR A 1 91  ? 21.601 9.387   22.823 1.00 15.91 ? 92   TYR A CG  1 
ATOM   693  C  CD1 . TYR A 1 91  ? 21.669 8.306   23.686 1.00 18.05 ? 92   TYR A CD1 1 
ATOM   694  C  CD2 . TYR A 1 91  ? 22.412 10.455  23.143 1.00 18.76 ? 92   TYR A CD2 1 
ATOM   695  C  CE1 . TYR A 1 91  ? 22.479 8.283   24.801 1.00 18.62 ? 92   TYR A CE1 1 
ATOM   696  C  CE2 . TYR A 1 91  ? 23.222 10.453  24.250 1.00 18.85 ? 92   TYR A CE2 1 
ATOM   697  C  CZ  . TYR A 1 91  ? 23.268 9.370   25.094 1.00 20.75 ? 92   TYR A CZ  1 
ATOM   698  O  OH  . TYR A 1 91  ? 24.092 9.380   26.207 1.00 22.45 ? 92   TYR A OH  1 
ATOM   699  N  N   . VAL A 1 92  ? 18.288 7.473   21.641 1.00 15.57 ? 93   VAL A N   1 
ATOM   700  C  CA  . VAL A 1 92  ? 17.868 6.158   22.107 1.00 16.41 ? 93   VAL A CA  1 
ATOM   701  C  C   . VAL A 1 92  ? 19.081 5.239   22.254 1.00 16.29 ? 93   VAL A C   1 
ATOM   702  O  O   . VAL A 1 92  ? 19.910 5.209   21.333 1.00 18.49 ? 93   VAL A O   1 
ATOM   703  C  CB  . VAL A 1 92  ? 16.893 5.512   21.118 1.00 18.22 ? 93   VAL A CB  1 
ATOM   704  C  CG1 . VAL A 1 92  ? 16.465 4.140   21.607 1.00 21.05 ? 93   VAL A CG1 1 
ATOM   705  C  CG2 . VAL A 1 92  ? 15.679 6.380   20.877 1.00 20.41 ? 93   VAL A CG2 1 
ATOM   706  N  N   . GLN A 1 93  ? 19.162 4.552   23.385 1.00 17.72 ? 94   GLN A N   1 
ATOM   707  C  CA  . GLN A 1 93  ? 20.323 3.673   23.635 1.00 17.91 ? 94   GLN A CA  1 
ATOM   708  C  C   . GLN A 1 93  ? 19.725 2.278   23.883 1.00 18.69 ? 94   GLN A C   1 
ATOM   709  O  O   . GLN A 1 93  ? 18.878 2.121   24.756 1.00 23.50 ? 94   GLN A O   1 
ATOM   710  C  CB  . GLN A 1 93  ? 21.241 4.113   24.757 1.00 20.38 ? 94   GLN A CB  1 
ATOM   711  C  CG  . GLN A 1 93  ? 22.398 3.224   25.164 1.00 22.71 ? 94   GLN A CG  1 
ATOM   712  C  CD  . GLN A 1 93  ? 23.478 3.893   25.992 1.00 26.38 ? 94   GLN A CD  1 
ATOM   713  O  OE1 . GLN A 1 93  ? 23.940 5.025   25.808 1.00 22.50 ? 94   GLN A OE1 1 
ATOM   714  N  NE2 . GLN A 1 93  ? 23.984 3.206   27.021 1.00 22.55 ? 94   GLN A NE2 1 
ATOM   715  N  N   . GLU A 1 94  ? 20.176 1.339   23.056 1.00 16.38 ? 95   GLU A N   1 
ATOM   716  C  CA  . GLU A 1 94  ? 19.712 -0.026  23.101 1.00 15.29 ? 95   GLU A CA  1 
ATOM   717  C  C   . GLU A 1 94  ? 20.897 -0.914  23.399 1.00 14.74 ? 95   GLU A C   1 
ATOM   718  O  O   . GLU A 1 94  ? 21.957 -0.697  22.808 1.00 18.57 ? 95   GLU A O   1 
ATOM   719  C  CB  . GLU A 1 94  ? 19.080 -0.446  21.771 1.00 19.39 ? 95   GLU A CB  1 
ATOM   720  C  CG  . GLU A 1 94  ? 17.778 0.326   21.500 1.00 29.46 ? 95   GLU A CG  1 
ATOM   721  C  CD  . GLU A 1 94  ? 17.516 0.259   19.998 1.00 38.72 ? 95   GLU A CD  1 
ATOM   722  O  OE1 . GLU A 1 94  ? 17.437 -0.897  19.525 1.00 54.11 ? 95   GLU A OE1 1 
ATOM   723  O  OE2 . GLU A 1 94  ? 17.433 1.331   19.362 1.00 47.91 ? 95   GLU A OE2 1 
ATOM   724  N  N   . ALA A 1 95  ? 20.718 -1.889  24.282 1.00 13.76 ? 96   ALA A N   1 
ATOM   725  C  CA  . ALA A 1 95  ? 21.812 -2.808  24.527 1.00 12.92 ? 96   ALA A CA  1 
ATOM   726  C  C   . ALA A 1 95  ? 21.330 -4.222  24.767 1.00 12.43 ? 96   ALA A C   1 
ATOM   727  O  O   . ALA A 1 95  ? 20.214 -4.411  25.236 1.00 14.76 ? 96   ALA A O   1 
ATOM   728  C  CB  . ALA A 1 95  ? 22.641 -2.435  25.759 1.00 14.40 ? 96   ALA A CB  1 
ATOM   729  N  N   . THR A 1 96  ? 22.239 -5.138  24.456 1.00 13.72 ? 97   THR A N   1 
ATOM   730  C  CA  . THR A 1 96  ? 22.103 -6.517  24.821 1.00 13.73 ? 97   THR A CA  1 
ATOM   731  C  C   . THR A 1 96  ? 23.314 -6.876  25.682 1.00 13.07 ? 97   THR A C   1 
ATOM   732  O  O   . THR A 1 96  ? 24.422 -6.658  25.213 1.00 15.03 ? 97   THR A O   1 
ATOM   733  C  CB  . THR A 1 96  ? 22.117 -7.444  23.595 1.00 15.89 ? 97   THR A CB  1 
ATOM   734  O  OG1 . THR A 1 96  ? 20.967 -7.097  22.806 1.00 16.52 ? 97   THR A OG1 1 
ATOM   735  C  CG2 . THR A 1 96  ? 22.028 -8.895  24.045 1.00 17.34 ? 97   THR A CG2 1 
ATOM   736  N  N   . ILE A 1 97  ? 23.057 -7.341  26.886 1.00 13.37 ? 98   ILE A N   1 
ATOM   737  C  CA  . ILE A 1 97  ? 24.058 -7.705  27.878 1.00 13.32 ? 98   ILE A CA  1 
ATOM   738  C  C   . ILE A 1 97  ? 23.933 -9.205  28.091 1.00 13.37 ? 98   ILE A C   1 
ATOM   739  O  O   . ILE A 1 97  ? 22.908 -9.684  28.624 1.00 15.21 ? 98   ILE A O   1 
ATOM   740  C  CB  . ILE A 1 97  ? 23.899 -6.957  29.208 1.00 13.72 ? 98   ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 97  ? 23.916 -5.446  28.975 1.00 16.70 ? 98   ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 97  ? 24.943 -7.372  30.239 1.00 15.91 ? 98   ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 97  ? 23.440 -4.672  30.177 1.00 20.90 ? 98   ILE A CD1 1 
ATOM   744  N  N   . SER A 1 98  ? 24.950 -9.905  27.611 1.00 13.35 ? 99   SER A N   1 
ATOM   745  C  CA  . SER A 1 98  ? 24.978 -11.364 27.631 1.00 13.09 ? 99   SER A CA  1 
ATOM   746  C  C   . SER A 1 98  ? 25.879 -11.849 28.760 1.00 12.09 ? 99   SER A C   1 
ATOM   747  O  O   . SER A 1 98  ? 27.080 -11.691 28.693 1.00 13.46 ? 99   SER A O   1 
ATOM   748  C  CB  . SER A 1 98  ? 25.481 -11.881 26.293 1.00 14.87 ? 99   SER A CB  1 
ATOM   749  O  OG  . SER A 1 98  ? 24.725 -11.354 25.194 1.00 17.96 ? 99   SER A OG  1 
ATOM   750  N  N   . PHE A 1 99  ? 25.293 -12.436 29.801 1.00 13.01 ? 100  PHE A N   1 
ATOM   751  C  CA  . PHE A 1 99  ? 26.058 -12.971 30.920 1.00 13.06 ? 100  PHE A CA  1 
ATOM   752  C  C   . PHE A 1 99  ? 26.541 -14.363 30.528 1.00 14.74 ? 100  PHE A C   1 
ATOM   753  O  O   . PHE A 1 99  ? 25.702 -15.216 30.220 1.00 15.38 ? 100  PHE A O   1 
ATOM   754  C  CB  . PHE A 1 99  ? 25.249 -13.028 32.210 1.00 12.91 ? 100  PHE A CB  1 
ATOM   755  C  CG  . PHE A 1 99  ? 24.913 -11.613 32.699 1.00 11.71 ? 100  PHE A CG  1 
ATOM   756  C  CD1 . PHE A 1 99  ? 23.760 -10.986 32.292 1.00 12.69 ? 100  PHE A CD1 1 
ATOM   757  C  CD2 . PHE A 1 99  ? 25.764 -10.944 33.557 1.00 12.03 ? 100  PHE A CD2 1 
ATOM   758  C  CE1 . PHE A 1 99  ? 23.437 -9.709  32.728 1.00 13.54 ? 100  PHE A CE1 1 
ATOM   759  C  CE2 . PHE A 1 99  ? 25.452 -9.672  33.965 1.00 14.15 ? 100  PHE A CE2 1 
ATOM   760  C  CZ  . PHE A 1 99  ? 24.299 -9.027  33.557 1.00 15.68 ? 100  PHE A CZ  1 
ATOM   761  N  N   . LYS A 1 100 ? 27.847 -14.567 30.545 1.00 14.91 ? 101  LYS A N   1 
ATOM   762  C  CA  . LYS A 1 100 ? 28.431 -15.847 30.131 1.00 15.38 ? 101  LYS A CA  1 
ATOM   763  C  C   . LYS A 1 100 ? 27.829 -16.979 30.948 1.00 15.56 ? 101  LYS A C   1 
ATOM   764  O  O   . LYS A 1 100 ? 27.771 -16.854 32.179 1.00 16.20 ? 101  LYS A O   1 
ATOM   765  C  CB  . LYS A 1 100 ? 29.957 -15.801 30.270 1.00 19.22 ? 101  LYS A CB  1 
ATOM   766  C  CG  . LYS A 1 100 ? 30.678 -17.109 29.994 1.00 21.83 ? 101  LYS A CG  1 
ATOM   767  C  CD  . LYS A 1 100 ? 32.195 -16.992 29.948 1.00 23.68 ? 101  LYS A CD  1 
ATOM   768  C  CE  . LYS A 1 100 ? 32.806 -18.373 29.693 1.00 29.20 ? 101  LYS A CE  1 
ATOM   769  N  NZ  . LYS A 1 100 ? 34.295 -18.405 29.876 1.00 37.21 ? 101  LYS A NZ  1 
ATOM   770  N  N   . ASP A 1 101 ? 27.395 -18.051 30.290 1.00 18.18 ? 102  ASP A N   1 
ATOM   771  C  CA  . ASP A 1 101 ? 26.825 -19.232 30.903 1.00 18.96 ? 102  ASP A CA  1 
ATOM   772  C  C   . ASP A 1 101 ? 25.553 -18.901 31.681 1.00 18.52 ? 102  ASP A C   1 
ATOM   773  O  O   . ASP A 1 101 ? 25.204 -19.618 32.612 1.00 17.71 ? 102  ASP A O   1 
ATOM   774  C  CB  . ASP A 1 101 ? 27.783 -19.881 31.909 1.00 25.02 ? 102  ASP A CB  1 
ATOM   775  C  CG  . ASP A 1 101 ? 29.053 -20.387 31.290 1.00 31.23 ? 102  ASP A CG  1 
ATOM   776  O  OD1 . ASP A 1 101 ? 29.052 -20.705 30.084 1.00 36.99 ? 102  ASP A OD1 1 
ATOM   777  O  OD2 . ASP A 1 101 ? 30.065 -20.466 32.012 1.00 51.94 ? 102  ASP A OD2 1 
ATOM   778  N  N   . ASP A 1 102 ? 24.892 -17.810 31.329 1.00 15.91 ? 103  ASP A N   1 
ATOM   779  C  CA  . ASP A 1 102 ? 23.688 -17.441 32.100 1.00 15.19 ? 103  ASP A CA  1 
ATOM   780  C  C   . ASP A 1 102 ? 22.756 -16.635 31.209 1.00 15.91 ? 103  ASP A C   1 
ATOM   781  O  O   . ASP A 1 102 ? 22.867 -16.723 29.983 1.00 15.91 ? 103  ASP A O   1 
ATOM   782  C  CB  . ASP A 1 102 ? 24.075 -16.715 33.384 1.00 16.57 ? 103  ASP A CB  1 
ATOM   783  C  CG  . ASP A 1 102 ? 23.121 -16.885 34.540 1.00 16.73 ? 103  ASP A CG  1 
ATOM   784  O  OD1 . ASP A 1 102 ? 21.934 -17.127 34.229 1.00 16.63 ? 103  ASP A OD1 1 
ATOM   785  O  OD2 . ASP A 1 102 ? 23.525 -16.780 35.715 1.00 18.54 ? 103  ASP A OD2 1 
ATOM   786  N  N   . GLY A 1 103 ? 21.830 -15.878 31.788 1.00 14.01 ? 104  GLY A N   1 
ATOM   787  C  CA  . GLY A 1 103 ? 20.857 -15.166 30.974 1.00 14.43 ? 104  GLY A CA  1 
ATOM   788  C  C   . GLY A 1 103 ? 21.343 -13.881 30.333 1.00 12.24 ? 104  GLY A C   1 
ATOM   789  O  O   . GLY A 1 103 ? 22.524 -13.558 30.289 1.00 14.11 ? 104  GLY A O   1 
ATOM   790  N  N   . ASN A 1 104 ? 20.397 -13.110 29.801 1.00 13.01 ? 105  ASN A N   1 
ATOM   791  C  CA  . ASN A 1 104 ? 20.713 -11.869 29.146 1.00 12.08 ? 105  ASN A CA  1 
ATOM   792  C  C   . ASN A 1 104 ? 19.712 -10.783 29.515 1.00 13.79 ? 105  ASN A C   1 
ATOM   793  O  O   . ASN A 1 104 ? 18.546 -11.050 29.776 1.00 12.76 ? 105  ASN A O   1 
ATOM   794  C  CB  . ASN A 1 104 ? 20.743 -12.003 27.610 1.00 14.23 ? 105  ASN A CB  1 
ATOM   795  C  CG  . ASN A 1 104 ? 19.426 -12.420 26.998 1.00 14.19 ? 105  ASN A CG  1 
ATOM   796  O  OD1 . ASN A 1 104 ? 18.559 -11.632 26.620 1.00 15.87 ? 105  ASN A OD1 1 
ATOM   797  N  ND2 . ASN A 1 104 ? 19.282 -13.739 26.864 1.00 16.64 ? 105  ASN A ND2 1 
ATOM   798  N  N   . TYR A 1 105 ? 20.216 -9.555  29.515 1.00 12.42 ? 106  TYR A N   1 
ATOM   799  C  CA  . TYR A 1 105 ? 19.394 -8.369  29.571 1.00 12.16 ? 106  TYR A CA  1 
ATOM   800  C  C   . TYR A 1 105 ? 19.282 -7.723  28.194 1.00 12.00 ? 106  TYR A C   1 
ATOM   801  O  O   . TYR A 1 105 ? 20.278 -7.637  27.480 1.00 14.33 ? 106  TYR A O   1 
ATOM   802  C  CB  . TYR A 1 105 ? 19.959 -7.295  30.514 1.00 12.26 ? 106  TYR A CB  1 
ATOM   803  C  CG  . TYR A 1 105 ? 20.101 -7.620  31.976 1.00 11.24 ? 106  TYR A CG  1 
ATOM   804  C  CD1 . TYR A 1 105 ? 19.429 -8.636  32.636 1.00 13.25 ? 106  TYR A CD1 1 
ATOM   805  C  CD2 . TYR A 1 105 ? 20.957 -6.852  32.764 1.00 12.83 ? 106  TYR A CD2 1 
ATOM   806  C  CE1 . TYR A 1 105 ? 19.596 -8.884  33.987 1.00 12.44 ? 106  TYR A CE1 1 
ATOM   807  C  CE2 . TYR A 1 105 ? 21.144 -7.075  34.125 1.00 12.30 ? 106  TYR A CE2 1 
ATOM   808  C  CZ  . TYR A 1 105 ? 20.450 -8.108  34.736 1.00 11.25 ? 106  TYR A CZ  1 
ATOM   809  O  OH  . TYR A 1 105 ? 20.616 -8.356  36.074 1.00 13.60 ? 106  TYR A OH  1 
ATOM   810  N  N   . LYS A 1 106 ? 18.094 -7.244  27.874 1.00 13.12 ? 107  LYS A N   1 
ATOM   811  C  CA  . LYS A 1 106 ? 17.927 -6.361  26.718 1.00 14.07 ? 107  LYS A CA  1 
ATOM   812  C  C   . LYS A 1 106 ? 17.329 -5.067  27.259 1.00 13.55 ? 107  LYS A C   1 
ATOM   813  O  O   . LYS A 1 106 ? 16.372 -5.115  28.043 1.00 15.43 ? 107  LYS A O   1 
ATOM   814  C  CB  . LYS A 1 106 ? 17.058 -7.041  25.671 1.00 16.66 ? 107  LYS A CB  1 
ATOM   815  C  CG  . LYS A 1 106 ? 17.782 -8.198  24.979 1.00 24.50 ? 107  LYS A CG  1 
ATOM   816  C  CD  . LYS A 1 106 ? 17.233 -8.300  23.568 1.00 31.97 ? 107  LYS A CD  1 
ATOM   817  C  CE  . LYS A 1 106 ? 17.932 -9.383  22.770 1.00 34.03 ? 107  LYS A CE  1 
ATOM   818  N  NZ  . LYS A 1 106 ? 18.920 -8.835  21.792 1.00 37.64 ? 107  LYS A NZ  1 
ATOM   819  N  N   . THR A 1 107 ? 17.900 -3.934  26.879 1.00 12.79 ? 108  THR A N   1 
ATOM   820  C  CA  . THR A 1 107 ? 17.467 -2.673  27.415 1.00 12.72 ? 108  THR A CA  1 
ATOM   821  C  C   . THR A 1 107 ? 17.198 -1.702  26.274 1.00 13.47 ? 108  THR A C   1 
ATOM   822  O  O   . THR A 1 107 ? 17.801 -1.811  25.187 1.00 15.20 ? 108  THR A O   1 
ATOM   823  C  CB  . THR A 1 107 ? 18.541 -2.067  28.331 1.00 13.64 ? 108  THR A CB  1 
ATOM   824  O  OG1 . THR A 1 107 ? 19.730 -1.775  27.584 1.00 14.57 ? 108  THR A OG1 1 
ATOM   825  C  CG2 . THR A 1 107 ? 18.917 -3.054  29.432 1.00 19.71 ? 108  THR A CG2 1 
ATOM   826  N  N   . ARG A 1 108 ? 16.304 -0.781  26.570 1.00 14.34 ? 109  ARG A N   1 
ATOM   827  C  CA  . ARG A 1 108 ? 15.986 0.332   25.675 1.00 14.44 ? 109  ARG A CA  1 
ATOM   828  C  C   . ARG A 1 108 ? 15.842 1.570   26.556 1.00 13.10 ? 109  ARG A C   1 
ATOM   829  O  O   . ARG A 1 108 ? 15.114 1.516   27.554 1.00 15.55 ? 109  ARG A O   1 
ATOM   830  C  CB  . ARG A 1 108 ? 14.715 0.126   24.867 1.00 17.16 ? 109  ARG A CB  1 
ATOM   831  C  CG  . ARG A 1 108 ? 14.475 1.250   23.855 1.00 19.51 ? 109  ARG A CG  1 
ATOM   832  C  CD  . ARG A 1 108 ? 13.123 1.050   23.178 1.00 18.71 ? 109  ARG A CD  1 
ATOM   833  N  NE  . ARG A 1 108 ? 12.982 2.016   22.092 1.00 22.97 ? 109  ARG A NE  1 
ATOM   834  C  CZ  . ARG A 1 108 ? 12.630 3.283   22.218 1.00 22.97 ? 109  ARG A CZ  1 
ATOM   835  N  NH1 . ARG A 1 108 ? 12.355 3.814   23.408 1.00 25.65 ? 109  ARG A NH1 1 
ATOM   836  N  NH2 . ARG A 1 108 ? 12.535 4.077   21.155 1.00 27.60 ? 109  ARG A NH2 1 
ATOM   837  N  N   . ALA A 1 109 ? 16.560 2.624   26.198 1.00 14.40 ? 110  ALA A N   1 
ATOM   838  C  CA  . ALA A 1 109 ? 16.536 3.826   26.992 1.00 14.24 ? 110  ALA A CA  1 
ATOM   839  C  C   . ALA A 1 109 ? 16.426 5.047   26.089 1.00 14.59 ? 110  ALA A C   1 
ATOM   840  O  O   . ALA A 1 109 ? 16.866 5.019   24.941 1.00 16.28 ? 110  ALA A O   1 
ATOM   841  C  CB  . ALA A 1 109 ? 17.820 4.008   27.811 1.00 17.56 ? 110  ALA A CB  1 
ATOM   842  N  N   . GLU A 1 110 ? 15.845 6.073   26.666 1.00 14.15 ? 111  GLU A N   1 
ATOM   843  C  CA  . GLU A 1 110 ? 15.838 7.382   26.057 1.00 13.65 ? 111  GLU A CA  1 
ATOM   844  C  C   . GLU A 1 110 ? 16.574 8.354   26.953 1.00 13.64 ? 111  GLU A C   1 
ATOM   845  O  O   . GLU A 1 110 ? 16.193 8.420   28.119 1.00 14.56 ? 111  GLU A O   1 
ATOM   846  C  CB  . GLU A 1 110 ? 14.403 7.918   25.839 1.00 19.81 ? 111  GLU A CB  1 
ATOM   847  C  CG  . GLU A 1 110 ? 13.841 7.293   24.588 1.00 26.81 ? 111  GLU A CG  1 
ATOM   848  C  CD  . GLU A 1 110 ? 12.451 7.695   24.178 1.00 33.02 ? 111  GLU A CD  1 
ATOM   849  O  OE1 . GLU A 1 110 ? 12.056 8.873   24.290 1.00 45.48 ? 111  GLU A OE1 1 
ATOM   850  O  OE2 . GLU A 1 110 ? 11.796 6.719   23.718 1.00 36.63 ? 111  GLU A OE2 1 
ATOM   851  N  N   . VAL A 1 111 ? 17.556 9.052   26.416 1.00 13.48 ? 112  VAL A N   1 
ATOM   852  C  CA  . VAL A 1 111 ? 18.347 9.990   27.167 1.00 13.61 ? 112  VAL A CA  1 
ATOM   853  C  C   . VAL A 1 111 ? 18.180 11.330  26.482 1.00 13.05 ? 112  VAL A C   1 
ATOM   854  O  O   . VAL A 1 111 ? 18.517 11.479  25.310 1.00 16.11 ? 112  VAL A O   1 
ATOM   855  C  CB  . VAL A 1 111 ? 19.832 9.584   27.187 1.00 14.72 ? 112  VAL A CB  1 
ATOM   856  C  CG1 . VAL A 1 111 ? 20.574 10.537  28.096 1.00 18.12 ? 112  VAL A CG1 1 
ATOM   857  C  CG2 . VAL A 1 111 ? 19.973 8.121   27.612 1.00 19.87 ? 112  VAL A CG2 1 
ATOM   858  N  N   . LYS A 1 112 ? 17.593 12.251  27.233 1.00 12.79 ? 113  LYS A N   1 
ATOM   859  C  CA  . LYS A 1 112 ? 17.326 13.579  26.727 1.00 13.34 ? 113  LYS A CA  1 
ATOM   860  C  C   . LYS A 1 112 ? 17.217 14.593  27.855 1.00 12.09 ? 113  LYS A C   1 
ATOM   861  O  O   . LYS A 1 112 ? 17.094 14.257  29.021 1.00 12.83 ? 113  LYS A O   1 
ATOM   862  C  CB  . LYS A 1 112 ? 16.032 13.525  25.906 1.00 15.77 ? 113  LYS A CB  1 
ATOM   863  C  CG  . LYS A 1 112 ? 14.755 13.403  26.731 1.00 17.17 ? 113  LYS A CG  1 
ATOM   864  C  CD  . LYS A 1 112 ? 13.550 13.140  25.822 1.00 30.83 ? 113  LYS A CD  1 
ATOM   865  C  CE  . LYS A 1 112 ? 12.573 12.148  26.410 1.00 39.53 ? 113  LYS A CE  1 
ATOM   866  N  NZ  . LYS A 1 112 ? 12.147 11.069  25.478 1.00 59.89 ? 113  LYS A NZ  1 
ATOM   867  N  N   . PHE A 1 113 ? 17.252 15.878  27.505 1.00 13.90 ? 114  PHE A N   1 
ATOM   868  C  CA  . PHE A 1 113 ? 16.960 16.904  28.496 1.00 15.29 ? 114  PHE A CA  1 
ATOM   869  C  C   . PHE A 1 113 ? 15.451 17.064  28.709 1.00 14.63 ? 114  PHE A C   1 
ATOM   870  O  O   . PHE A 1 113 ? 14.680 17.089  27.736 1.00 17.32 ? 114  PHE A O   1 
ATOM   871  C  CB  . PHE A 1 113 ? 17.573 18.240  28.070 1.00 14.95 ? 114  PHE A CB  1 
ATOM   872  C  CG  . PHE A 1 113 ? 19.022 18.384  28.526 1.00 13.23 ? 114  PHE A CG  1 
ATOM   873  C  CD1 . PHE A 1 113 ? 20.039 17.929  27.709 1.00 16.54 ? 114  PHE A CD1 1 
ATOM   874  C  CD2 . PHE A 1 113 ? 19.383 18.957  29.728 1.00 15.16 ? 114  PHE A CD2 1 
ATOM   875  C  CE1 . PHE A 1 113 ? 21.334 18.061  28.131 1.00 16.46 ? 114  PHE A CE1 1 
ATOM   876  C  CE2 . PHE A 1 113 ? 20.703 19.067  30.163 1.00 16.18 ? 114  PHE A CE2 1 
ATOM   877  C  CZ  . PHE A 1 113 ? 21.675 18.607  29.343 1.00 14.04 ? 114  PHE A CZ  1 
ATOM   878  N  N   . GLU A 1 114 ? 15.053 17.185  29.962 1.00 14.80 ? 115  GLU A N   1 
ATOM   879  C  CA  . GLU A 1 114 ? 13.724 17.661  30.344 1.00 14.76 ? 115  GLU A CA  1 
ATOM   880  C  C   . GLU A 1 114 ? 13.955 18.959  31.124 1.00 15.86 ? 115  GLU A C   1 
ATOM   881  O  O   . GLU A 1 114 ? 14.367 18.945  32.290 1.00 17.38 ? 115  GLU A O   1 
ATOM   882  C  CB  . GLU A 1 114 ? 12.957 16.648  31.157 1.00 16.88 ? 115  GLU A CB  1 
ATOM   883  C  CG  . GLU A 1 114 ? 12.686 15.325  30.477 1.00 16.09 ? 115  GLU A CG  1 
ATOM   884  C  CD  . GLU A 1 114 ? 11.618 15.440  29.412 1.00 16.13 ? 115  GLU A CD  1 
ATOM   885  O  OE1 . GLU A 1 114 ? 10.933 16.473  29.296 1.00 16.18 ? 115  GLU A OE1 1 
ATOM   886  O  OE2 . GLU A 1 114 ? 11.470 14.444  28.684 1.00 23.22 ? 115  GLU A OE2 1 
ATOM   887  N  N   . GLY A 1 115 ? 13.716 20.086  30.454 1.00 16.58 ? 116  GLY A N   1 
ATOM   888  C  CA  . GLY A 1 115 ? 14.153 21.371  30.986 1.00 18.72 ? 116  GLY A CA  1 
ATOM   889  C  C   . GLY A 1 115 ? 15.661 21.368  31.158 1.00 19.37 ? 116  GLY A C   1 
ATOM   890  O  O   . GLY A 1 115 ? 16.380 21.032  30.192 1.00 23.84 ? 116  GLY A O   1 
ATOM   891  N  N   . ASP A 1 116 ? 16.171 21.699  32.336 1.00 20.46 ? 117  ASP A N   1 
ATOM   892  C  CA  . ASP A 1 116 ? 17.648 21.733  32.447 1.00 20.26 ? 117  ASP A CA  1 
ATOM   893  C  C   . ASP A 1 116 ? 18.214 20.455  33.049 1.00 19.31 ? 117  ASP A C   1 
ATOM   894  O  O   . ASP A 1 116 ? 19.384 20.419  33.417 1.00 18.28 ? 117  ASP A O   1 
ATOM   895  C  CB  . ASP A 1 116 ? 18.056 22.951  33.264 1.00 25.20 ? 117  ASP A CB  1 
ATOM   896  C  CG  . ASP A 1 116 ? 17.762 24.254  32.520 1.00 27.90 ? 117  ASP A CG  1 
ATOM   897  O  OD1 . ASP A 1 116 ? 17.965 24.346  31.287 1.00 32.02 ? 117  ASP A OD1 1 
ATOM   898  O  OD2 . ASP A 1 116 ? 17.295 25.231  33.144 1.00 35.61 ? 117  ASP A OD2 1 
ATOM   899  N  N   . THR A 1 117 ? 17.373 19.423  33.138 1.00 17.39 ? 118  THR A N   1 
ATOM   900  C  CA  . THR A 1 117 ? 17.756 18.143  33.743 1.00 16.28 ? 118  THR A CA  1 
ATOM   901  C  C   . THR A 1 117 ? 17.987 17.069  32.693 1.00 13.40 ? 118  THR A C   1 
ATOM   902  O  O   . THR A 1 117 ? 17.203 16.914  31.759 1.00 15.00 ? 118  THR A O   1 
ATOM   903  C  CB  . THR A 1 117 ? 16.645 17.698  34.717 1.00 14.95 ? 118  THR A CB  1 
ATOM   904  O  OG1 . THR A 1 117 ? 16.516 18.657  35.780 1.00 18.69 ? 118  THR A OG1 1 
ATOM   905  C  CG2 . THR A 1 117 ? 16.967 16.354  35.365 1.00 13.95 ? 118  THR A CG2 1 
ATOM   906  N  N   . LEU A 1 118 ? 19.090 16.322  32.835 1.00 12.53 ? 119  LEU A N   1 
ATOM   907  C  CA  . LEU A 1 118 ? 19.337 15.187  31.963 1.00 11.56 ? 119  LEU A CA  1 
ATOM   908  C  C   . LEU A 1 118 ? 18.626 13.956  32.516 1.00 10.44 ? 119  LEU A C   1 
ATOM   909  O  O   . LEU A 1 118 ? 18.884 13.550  33.646 1.00 11.48 ? 119  LEU A O   1 
ATOM   910  C  CB  . LEU A 1 118 ? 20.842 14.968  31.894 1.00 13.22 ? 119  LEU A CB  1 
ATOM   911  C  CG  . LEU A 1 118 ? 21.446 14.038  30.854 1.00 14.26 ? 119  LEU A CG  1 
ATOM   912  C  CD1 . LEU A 1 118 ? 21.306 12.554  31.240 1.00 14.83 ? 119  LEU A CD1 1 
ATOM   913  C  CD2 . LEU A 1 118 ? 20.824 14.322  29.492 1.00 15.21 ? 119  LEU A CD2 1 
ATOM   914  N  N   . VAL A 1 119 ? 17.762 13.370  31.702 1.00 11.04 ? 120  VAL A N   1 
ATOM   915  C  CA  . VAL A 1 119 ? 16.925 12.237  32.100 1.00 11.72 ? 120  VAL A CA  1 
ATOM   916  C  C   . VAL A 1 119 ? 17.260 10.996  31.285 1.00 11.50 ? 120  VAL A C   1 
ATOM   917  O  O   . VAL A 1 119 ? 17.397 11.071  30.046 1.00 12.90 ? 120  VAL A O   1 
ATOM   918  C  CB  . VAL A 1 119 ? 15.430 12.606  31.944 1.00 13.74 ? 120  VAL A CB  1 
ATOM   919  C  CG1 . VAL A 1 119 ? 14.562 11.425  32.333 1.00 22.50 ? 120  VAL A CG1 1 
ATOM   920  C  CG2 . VAL A 1 119 ? 15.079 13.829  32.778 1.00 14.14 ? 120  VAL A CG2 1 
ATOM   921  N  N   . ASN A 1 120 ? 17.419 9.879   32.008 1.00 12.83 ? 121  ASN A N   1 
ATOM   922  C  CA  . ASN A 1 120 ? 17.634 8.578   31.418 1.00 13.74 ? 121  ASN A CA  1 
ATOM   923  C  C   . ASN A 1 120 ? 16.464 7.703   31.858 1.00 15.16 ? 121  ASN A C   1 
ATOM   924  O  O   . ASN A 1 120 ? 16.408 7.337   33.029 1.00 14.70 ? 121  ASN A O   1 
ATOM   925  C  CB  . ASN A 1 120 ? 18.978 8.034   31.880 1.00 15.47 ? 121  ASN A CB  1 
ATOM   926  C  CG  . ASN A 1 120 ? 19.371 6.721   31.253 1.00 15.50 ? 121  ASN A CG  1 
ATOM   927  O  OD1 . ASN A 1 120 ? 18.823 6.334   30.214 1.00 17.47 ? 121  ASN A OD1 1 
ATOM   928  N  ND2 . ASN A 1 120 ? 20.320 6.026   31.883 1.00 18.49 ? 121  ASN A ND2 1 
ATOM   929  N  N   . ARG A 1 121 ? 15.590 7.421   30.922 1.00 14.32 ? 122  ARG A N   1 
ATOM   930  C  CA  . ARG A 1 121 ? 14.420 6.570   31.055 1.00 14.31 ? 122  ARG A CA  1 
ATOM   931  C  C   . ARG A 1 121 ? 14.616 5.194   30.416 1.00 13.13 ? 122  ARG A C   1 
ATOM   932  O  O   . ARG A 1 121 ? 14.833 5.103   29.205 1.00 14.30 ? 122  ARG A O   1 
ATOM   933  C  CB  . ARG A 1 121 ? 13.225 7.270   30.403 1.00 20.39 ? 122  ARG A CB  1 
ATOM   934  C  CG  . ARG A 1 121 ? 12.462 8.285   31.179 1.00 27.53 ? 122  ARG A CG  1 
ATOM   935  C  CD  . ARG A 1 121 ? 11.081 8.564   30.601 1.00 30.97 ? 122  ARG A CD  1 
ATOM   936  N  NE  . ARG A 1 121 ? 10.189 7.405   30.674 1.00 40.69 ? 122  ARG A NE  1 
ATOM   937  C  CZ  . ARG A 1 121 ? 8.871  7.390   30.763 1.00 44.91 ? 122  ARG A CZ  1 
ATOM   938  N  NH1 . ARG A 1 121 ? 8.173  8.524   30.800 1.00 55.87 ? 122  ARG A NH1 1 
ATOM   939  N  NH2 . ARG A 1 121 ? 8.204  6.237   30.822 1.00 57.16 ? 122  ARG A NH2 1 
ATOM   940  N  N   . ILE A 1 122 ? 14.540 4.127   31.206 1.00 12.81 ? 123  ILE A N   1 
ATOM   941  C  CA  . ILE A 1 122 ? 14.937 2.822   30.742 1.00 11.72 ? 123  ILE A CA  1 
ATOM   942  C  C   . ILE A 1 122 ? 13.918 1.701   30.959 1.00 11.19 ? 123  ILE A C   1 
ATOM   943  O  O   . ILE A 1 122 ? 13.280 1.634   32.002 1.00 13.55 ? 123  ILE A O   1 
ATOM   944  C  CB  . ILE A 1 122 ? 16.205 2.388   31.512 1.00 12.55 ? 123  ILE A CB  1 
ATOM   945  C  CG1 . ILE A 1 122 ? 17.285 3.471   31.556 1.00 14.55 ? 123  ILE A CG1 1 
ATOM   946  C  CG2 . ILE A 1 122 ? 16.708 1.065   30.970 1.00 17.62 ? 123  ILE A CG2 1 
ATOM   947  C  CD1 . ILE A 1 122 ? 17.985 3.524   32.903 1.00 14.80 ? 123  ILE A CD1 1 
ATOM   948  N  N   . GLU A 1 123 ? 13.814 0.801   29.984 1.00 12.61 ? 124  GLU A N   1 
ATOM   949  C  CA  . GLU A 1 123 ? 13.132 -0.465  30.186 1.00 12.91 ? 124  GLU A CA  1 
ATOM   950  C  C   . GLU A 1 123 ? 14.173 -1.579  30.043 1.00 12.71 ? 124  GLU A C   1 
ATOM   951  O  O   . GLU A 1 123 ? 14.932 -1.546  29.077 1.00 13.21 ? 124  GLU A O   1 
ATOM   952  C  CB  . GLU A 1 123 ? 11.991 -0.631  29.172 1.00 17.10 ? 124  GLU A CB  1 
ATOM   953  C  CG  . GLU A 1 123 ? 10.830 0.342   29.370 1.00 23.17 ? 124  GLU A CG  1 
ATOM   954  C  CD  . GLU A 1 123 ? 9.879  0.437   28.202 1.00 34.21 ? 124  GLU A CD  1 
ATOM   955  O  OE1 . GLU A 1 123 ? 8.649  0.450   28.417 1.00 44.13 ? 124  GLU A OE1 1 
ATOM   956  O  OE2 . GLU A 1 123 ? 10.308 0.510   27.024 1.00 42.12 ? 124  GLU A OE2 1 
ATOM   957  N  N   . LEU A 1 124 ? 14.177 -2.505  30.980 1.00 12.59 ? 125  LEU A N   1 
ATOM   958  C  CA  . LEU A 1 124 ? 15.108 -3.639  30.977 1.00 12.93 ? 125  LEU A CA  1 
ATOM   959  C  C   . LEU A 1 124 ? 14.321 -4.942  30.998 1.00 12.38 ? 125  LEU A C   1 
ATOM   960  O  O   . LEU A 1 124 ? 13.441 -5.105  31.850 1.00 13.37 ? 125  LEU A O   1 
ATOM   961  C  CB  . LEU A 1 124 ? 16.028 -3.584  32.185 1.00 14.05 ? 125  LEU A CB  1 
ATOM   962  C  CG  . LEU A 1 124 ? 17.042 -4.710  32.381 1.00 15.79 ? 125  LEU A CG  1 
ATOM   963  C  CD1 . LEU A 1 124 ? 18.317 -4.182  33.034 1.00 16.74 ? 125  LEU A CD1 1 
ATOM   964  C  CD2 . LEU A 1 124 ? 16.509 -5.852  33.244 1.00 15.24 ? 125  LEU A CD2 1 
ATOM   965  N  N   . LYS A 1 125 ? 14.642 -5.894  30.143 1.00 13.28 ? 126  LYS A N   1 
ATOM   966  C  CA  . LYS A 1 125 ? 14.006 -7.200  30.191 1.00 12.79 ? 126  LYS A CA  1 
ATOM   967  C  C   . LYS A 1 125 ? 15.087 -8.258  30.309 1.00 12.61 ? 126  LYS A C   1 
ATOM   968  O  O   . LYS A 1 125 ? 15.966 -8.264  29.433 1.00 13.19 ? 126  LYS A O   1 
ATOM   969  C  CB  . LYS A 1 125 ? 13.165 -7.425  28.924 1.00 13.38 ? 126  LYS A CB  1 
ATOM   970  C  CG  . LYS A 1 125 ? 12.418 -8.739  28.972 1.00 21.89 ? 126  LYS A CG  1 
ATOM   971  C  CD  . LYS A 1 125 ? 11.145 -8.922  28.233 1.00 27.75 ? 126  LYS A CD  1 
ATOM   972  C  CE  . LYS A 1 125 ? 10.328 -10.123 28.687 1.00 28.73 ? 126  LYS A CE  1 
ATOM   973  N  NZ  . LYS A 1 125 ? 9.728  -9.905  30.036 1.00 48.88 ? 126  LYS A NZ  1 
ATOM   974  N  N   . GLY A 1 126 ? 15.027 -9.104  31.326 1.00 11.73 ? 127  GLY A N   1 
ATOM   975  C  CA  . GLY A 1 126 ? 16.043 -10.146 31.469 1.00 11.01 ? 127  GLY A CA  1 
ATOM   976  C  C   . GLY A 1 126 ? 15.397 -11.503 31.332 1.00 13.34 ? 127  GLY A C   1 
ATOM   977  O  O   . GLY A 1 126 ? 14.313 -11.703 31.913 1.00 13.94 ? 127  GLY A O   1 
ATOM   978  N  N   . ILE A 1 127 ? 16.001 -12.432 30.596 1.00 12.65 ? 128  ILE A N   1 
ATOM   979  C  CA  . ILE A 1 127 ? 15.462 -13.769 30.462 1.00 12.61 ? 128  ILE A CA  1 
ATOM   980  C  C   . ILE A 1 127 ? 16.528 -14.850 30.535 1.00 12.86 ? 128  ILE A C   1 
ATOM   981  O  O   . ILE A 1 127 ? 17.703 -14.557 30.324 1.00 13.04 ? 128  ILE A O   1 
ATOM   982  C  CB  . ILE A 1 127 ? 14.732 -13.891 29.096 1.00 12.89 ? 128  ILE A CB  1 
ATOM   983  C  CG1 . ILE A 1 127 ? 15.685 -13.704 27.912 1.00 14.13 ? 128  ILE A CG1 1 
ATOM   984  C  CG2 . ILE A 1 127 ? 13.553 -12.956 29.030 1.00 15.81 ? 128  ILE A CG2 1 
ATOM   985  C  CD1 . ILE A 1 127 ? 15.038 -14.005 26.568 1.00 16.78 ? 128  ILE A CD1 1 
ATOM   986  N  N   . ASP A 1 128 ? 16.105 -16.058 30.826 1.00 13.92 ? 129  ASP A N   1 
ATOM   987  C  CA  . ASP A 1 128 ? 16.853 -17.285 30.841 1.00 15.18 ? 129  ASP A CA  1 
ATOM   988  C  C   . ASP A 1 128 ? 17.993 -17.260 31.843 1.00 13.71 ? 129  ASP A C   1 
ATOM   989  O  O   . ASP A 1 128 ? 19.042 -17.893 31.691 1.00 16.13 ? 129  ASP A O   1 
ATOM   990  C  CB  . ASP A 1 128 ? 17.327 -17.572 29.410 1.00 15.95 ? 129  ASP A CB  1 
ATOM   991  C  CG  . ASP A 1 128 ? 16.139 -18.054 28.580 1.00 15.60 ? 129  ASP A CG  1 
ATOM   992  O  OD1 . ASP A 1 128 ? 15.400 -18.885 29.163 1.00 20.65 ? 129  ASP A OD1 1 
ATOM   993  O  OD2 . ASP A 1 128 ? 15.954 -17.615 27.434 1.00 19.38 ? 129  ASP A OD2 1 
ATOM   994  N  N   . PHE A 1 129 ? 17.772 -16.539 32.949 1.00 14.82 ? 130  PHE A N   1 
ATOM   995  C  CA  . PHE A 1 129 ? 18.719 -16.640 34.043 1.00 15.05 ? 130  PHE A CA  1 
ATOM   996  C  C   . PHE A 1 129 ? 18.568 -17.935 34.829 1.00 15.39 ? 130  PHE A C   1 
ATOM   997  O  O   . PHE A 1 129 ? 17.467 -18.439 35.014 1.00 16.15 ? 130  PHE A O   1 
ATOM   998  C  CB  . PHE A 1 129 ? 18.554 -15.419 34.974 1.00 15.37 ? 130  PHE A CB  1 
ATOM   999  C  CG  . PHE A 1 129 ? 19.173 -14.193 34.286 1.00 14.38 ? 130  PHE A CG  1 
ATOM   1000 C  CD1 . PHE A 1 129 ? 18.423 -13.346 33.499 1.00 13.41 ? 130  PHE A CD1 1 
ATOM   1001 C  CD2 . PHE A 1 129 ? 20.525 -13.928 34.404 1.00 15.95 ? 130  PHE A CD2 1 
ATOM   1002 C  CE1 . PHE A 1 129 ? 19.016 -12.275 32.857 1.00 12.77 ? 130  PHE A CE1 1 
ATOM   1003 C  CE2 . PHE A 1 129 ? 21.119 -12.843 33.779 1.00 14.94 ? 130  PHE A CE2 1 
ATOM   1004 C  CZ  . PHE A 1 129 ? 20.364 -12.017 32.996 1.00 13.58 ? 130  PHE A CZ  1 
ATOM   1005 N  N   . LYS A 1 130 ? 19.686 -18.459 35.295 1.00 16.60 ? 131  LYS A N   1 
ATOM   1006 C  CA  . LYS A 1 130 ? 19.745 -19.660 36.141 1.00 18.58 ? 131  LYS A CA  1 
ATOM   1007 C  C   . LYS A 1 130 ? 19.442 -19.331 37.599 1.00 19.97 ? 131  LYS A C   1 
ATOM   1008 O  O   . LYS A 1 130 ? 19.969 -18.385 38.193 1.00 21.32 ? 131  LYS A O   1 
ATOM   1009 C  CB  . LYS A 1 130 ? 21.133 -20.330 36.072 1.00 21.49 ? 131  LYS A CB  1 
ATOM   1010 C  CG  . LYS A 1 130 ? 21.422 -20.896 34.701 1.00 26.83 ? 131  LYS A CG  1 
ATOM   1011 C  CD  . LYS A 1 130 ? 22.839 -21.370 34.456 1.00 31.14 ? 131  LYS A CD  1 
ATOM   1012 C  CE  . LYS A 1 130 ? 22.962 -21.673 32.957 1.00 39.97 ? 131  LYS A CE  1 
ATOM   1013 N  NZ  . LYS A 1 130 ? 24.299 -22.176 32.555 1.00 49.37 ? 131  LYS A NZ  1 
ATOM   1014 N  N   . GLU A 1 131 ? 18.560 -20.121 38.204 1.00 21.56 ? 132  GLU A N   1 
ATOM   1015 C  CA  . GLU A 1 131 ? 18.100 -19.777 39.539 1.00 26.93 ? 132  GLU A CA  1 
ATOM   1016 C  C   . GLU A 1 131 ? 19.241 -19.735 40.536 1.00 26.22 ? 132  GLU A C   1 
ATOM   1017 O  O   . GLU A 1 131 ? 19.144 -18.945 41.470 1.00 34.16 ? 132  GLU A O   1 
ATOM   1018 C  CB  . GLU A 1 131 ? 17.040 -20.766 40.034 1.00 37.10 ? 132  GLU A CB  1 
ATOM   1019 C  CG  . GLU A 1 131 ? 15.656 -20.398 39.525 1.00 50.68 ? 132  GLU A CG  1 
ATOM   1020 C  CD  . GLU A 1 131 ? 14.982 -21.523 38.759 1.00 66.73 ? 132  GLU A CD  1 
ATOM   1021 O  OE1 . GLU A 1 131 ? 13.740 -21.497 38.589 1.00 86.27 ? 132  GLU A OE1 1 
ATOM   1022 O  OE2 . GLU A 1 131 ? 15.696 -22.443 38.291 1.00 94.97 ? 132  GLU A OE2 1 
ATOM   1023 N  N   . ASP A 1 132 ? 20.265 -20.536 40.365 1.00 28.91 ? 133  ASP A N   1 
ATOM   1024 C  CA  . ASP A 1 132 ? 21.370 -20.550 41.322 1.00 32.91 ? 133  ASP A CA  1 
ATOM   1025 C  C   . ASP A 1 132 ? 22.662 -20.122 40.637 1.00 25.62 ? 133  ASP A C   1 
ATOM   1026 O  O   . ASP A 1 132 ? 23.752 -20.503 41.022 1.00 27.04 ? 133  ASP A O   1 
ATOM   1027 C  CB  . ASP A 1 132 ? 21.499 -21.922 41.975 1.00 40.80 ? 133  ASP A CB  1 
ATOM   1028 C  CG  . ASP A 1 132 ? 22.235 -22.984 41.184 1.00 56.27 ? 133  ASP A CG  1 
ATOM   1029 O  OD1 . ASP A 1 132 ? 22.385 -22.820 39.945 1.00 72.81 ? 133  ASP A OD1 1 
ATOM   1030 O  OD2 . ASP A 1 132 ? 22.674 -24.008 41.785 1.00 78.58 ? 133  ASP A OD2 1 
ATOM   1031 N  N   . GLY A 1 133 ? 22.507 -19.316 39.597 1.00 20.80 ? 134  GLY A N   1 
ATOM   1032 C  CA  . GLY A 1 133 ? 23.618 -18.707 38.879 1.00 18.43 ? 134  GLY A CA  1 
ATOM   1033 C  C   . GLY A 1 133 ? 24.077 -17.495 39.662 1.00 15.97 ? 134  GLY A C   1 
ATOM   1034 O  O   . GLY A 1 133 ? 23.537 -17.170 40.718 1.00 16.58 ? 134  GLY A O   1 
ATOM   1035 N  N   . ASN A 1 134 ? 25.084 -16.824 39.137 1.00 14.15 ? 135  ASN A N   1 
ATOM   1036 C  CA  . ASN A 1 134 ? 25.668 -15.730 39.918 1.00 14.98 ? 135  ASN A CA  1 
ATOM   1037 C  C   . ASN A 1 134 ? 24.758 -14.528 40.059 1.00 14.79 ? 135  ASN A C   1 
ATOM   1038 O  O   . ASN A 1 134 ? 24.924 -13.746 40.992 1.00 12.67 ? 135  ASN A O   1 
ATOM   1039 C  CB  . ASN A 1 134 ? 26.967 -15.286 39.258 1.00 14.96 ? 135  ASN A CB  1 
ATOM   1040 C  CG  . ASN A 1 134 ? 28.059 -16.331 39.370 1.00 15.39 ? 135  ASN A CG  1 
ATOM   1041 O  OD1 . ASN A 1 134 ? 28.228 -16.938 40.433 1.00 18.43 ? 135  ASN A OD1 1 
ATOM   1042 N  ND2 . ASN A 1 134 ? 28.800 -16.534 38.279 1.00 15.63 ? 135  ASN A ND2 1 
ATOM   1043 N  N   . ILE A 1 135 ? 23.836 -14.353 39.128 1.00 13.52 ? 136  ILE A N   1 
ATOM   1044 C  CA  . ILE A 1 135 ? 22.938 -13.194 39.183 1.00 13.96 ? 136  ILE A CA  1 
ATOM   1045 C  C   . ILE A 1 135 ? 21.754 -13.454 40.097 1.00 13.18 ? 136  ILE A C   1 
ATOM   1046 O  O   . ILE A 1 135 ? 21.579 -12.785 41.111 1.00 14.17 ? 136  ILE A O   1 
ATOM   1047 C  CB  . ILE A 1 135 ? 22.509 -12.841 37.748 1.00 14.63 ? 136  ILE A CB  1 
ATOM   1048 C  CG1 . ILE A 1 135 ? 23.667 -12.350 36.875 1.00 14.82 ? 136  ILE A CG1 1 
ATOM   1049 C  CG2 . ILE A 1 135 ? 21.392 -11.821 37.724 1.00 14.42 ? 136  ILE A CG2 1 
ATOM   1050 C  CD1 . ILE A 1 135 ? 24.435 -13.455 36.181 1.00 19.74 ? 136  ILE A CD1 1 
ATOM   1051 N  N   . LEU A 1 136 ? 20.916 -14.467 39.780 1.00 14.19 ? 137  LEU A N   1 
ATOM   1052 C  CA  . LEU A 1 136 ? 19.761 -14.697 40.654 1.00 15.59 ? 137  LEU A CA  1 
ATOM   1053 C  C   . LEU A 1 136 ? 20.179 -15.300 41.993 1.00 16.01 ? 137  LEU A C   1 
ATOM   1054 O  O   . LEU A 1 136 ? 19.400 -15.231 42.952 1.00 15.54 ? 137  LEU A O   1 
ATOM   1055 C  CB  . LEU A 1 136 ? 18.731 -15.581 39.962 1.00 16.96 ? 137  LEU A CB  1 
ATOM   1056 C  CG  . LEU A 1 136 ? 18.002 -14.991 38.756 1.00 19.77 ? 137  LEU A CG  1 
ATOM   1057 C  CD1 . LEU A 1 136 ? 17.042 -16.025 38.187 1.00 21.89 ? 137  LEU A CD1 1 
ATOM   1058 C  CD2 . LEU A 1 136 ? 17.286 -13.691 39.118 1.00 22.22 ? 137  LEU A CD2 1 
ATOM   1059 N  N   . GLY A 1 137 ? 21.372 -15.871 42.078 1.00 16.78 ? 138  GLY A N   1 
ATOM   1060 C  CA  . GLY A 1 137 ? 21.886 -16.418 43.332 1.00 16.25 ? 138  GLY A CA  1 
ATOM   1061 C  C   . GLY A 1 137 ? 22.593 -15.350 44.145 1.00 13.79 ? 138  GLY A C   1 
ATOM   1062 O  O   . GLY A 1 137 ? 23.059 -15.604 45.248 1.00 14.96 ? 138  GLY A O   1 
ATOM   1063 N  N   . HIS A 1 138 ? 22.683 -14.132 43.613 1.00 14.43 ? 139  HIS A N   1 
ATOM   1064 C  CA  . HIS A 1 138 ? 23.324 -13.008 44.292 1.00 14.16 ? 139  HIS A CA  1 
ATOM   1065 C  C   . HIS A 1 138 ? 24.714 -13.348 44.835 1.00 14.63 ? 139  HIS A C   1 
ATOM   1066 O  O   . HIS A 1 138 ? 25.003 -13.252 46.031 1.00 14.65 ? 139  HIS A O   1 
ATOM   1067 C  CB  . HIS A 1 138 ? 22.431 -12.513 45.438 1.00 15.14 ? 139  HIS A CB  1 
ATOM   1068 C  CG  . HIS A 1 138 ? 21.180 -11.848 44.982 1.00 17.16 ? 139  HIS A CG  1 
ATOM   1069 N  ND1 . HIS A 1 138 ? 21.096 -10.490 44.840 1.00 16.83 ? 139  HIS A ND1 1 
ATOM   1070 C  CD2 . HIS A 1 138 ? 19.963 -12.344 44.624 1.00 18.53 ? 139  HIS A CD2 1 
ATOM   1071 C  CE1 . HIS A 1 138 ? 19.887 -10.164 44.421 1.00 18.53 ? 139  HIS A CE1 1 
ATOM   1072 N  NE2 . HIS A 1 138 ? 19.193 -11.275 44.280 1.00 18.46 ? 139  HIS A NE2 1 
ATOM   1073 N  N   . LYS A 1 139 ? 25.590 -13.751 43.943 1.00 12.80 ? 140  LYS A N   1 
ATOM   1074 C  CA  . LYS A 1 139 ? 26.940 -14.191 44.240 1.00 14.12 ? 140  LYS A CA  1 
ATOM   1075 C  C   . LYS A 1 139 ? 27.986 -13.170 43.818 1.00 15.06 ? 140  LYS A C   1 
ATOM   1076 O  O   . LYS A 1 139 ? 29.186 -13.444 43.922 1.00 15.70 ? 140  LYS A O   1 
ATOM   1077 C  CB  . LYS A 1 139 ? 27.247 -15.545 43.543 1.00 16.10 ? 140  LYS A CB  1 
ATOM   1078 C  CG  . LYS A 1 139 ? 26.165 -16.584 43.835 1.00 16.23 ? 140  LYS A CG  1 
ATOM   1079 C  CD  . LYS A 1 139 ? 26.508 -17.963 43.334 1.00 18.25 ? 140  LYS A CD  1 
ATOM   1080 C  CE  . LYS A 1 139 ? 25.314 -18.908 43.414 1.00 22.43 ? 140  LYS A CE  1 
ATOM   1081 N  NZ  . LYS A 1 139 ? 25.702 -20.332 43.192 1.00 27.77 ? 140  LYS A NZ  1 
ATOM   1082 N  N   . LEU A 1 140 ? 27.520 -12.020 43.355 1.00 13.41 ? 141  LEU A N   1 
ATOM   1083 C  CA  . LEU A 1 140 ? 28.451 -10.970 42.922 1.00 12.58 ? 141  LEU A CA  1 
ATOM   1084 C  C   . LEU A 1 140 ? 28.846 -10.004 44.012 1.00 14.68 ? 141  LEU A C   1 
ATOM   1085 O  O   . LEU A 1 140 ? 28.020 -9.556  44.794 1.00 14.10 ? 141  LEU A O   1 
ATOM   1086 C  CB  . LEU A 1 140 ? 27.784 -10.303 41.694 1.00 15.76 ? 141  LEU A CB  1 
ATOM   1087 C  CG  . LEU A 1 140 ? 27.497 -11.357 40.601 1.00 18.29 ? 141  LEU A CG  1 
ATOM   1088 C  CD1 . LEU A 1 140 ? 26.899 -10.718 39.377 1.00 22.95 ? 141  LEU A CD1 1 
ATOM   1089 C  CD2 . LEU A 1 140 ? 28.739 -12.125 40.152 1.00 25.64 ? 141  LEU A CD2 1 
ATOM   1090 N  N   . GLU A 1 141 ? 30.152 -9.694  44.061 1.00 12.95 ? 142  GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 141 ? 30.628 -8.757  45.065 1.00 13.09 ? 142  GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 141 ? 30.101 -7.350  44.763 1.00 12.13 ? 142  GLU A C   1 
ATOM   1093 O  O   . GLU A 1 141 ? 29.798 -7.031  43.617 1.00 12.87 ? 142  GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 141 ? 32.158 -8.690  45.136 1.00 14.82 ? 142  GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 141 ? 32.748 -10.021 45.581 1.00 15.60 ? 142  GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 141 ? 34.253 -10.033 45.552 1.00 15.78 ? 142  GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 141 ? 34.877 -9.131  44.939 1.00 17.37 ? 142  GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 141 ? 34.809 -10.972 46.164 1.00 16.86 ? 142  GLU A OE2 1 
ATOM   1099 N  N   . TYR A 1 142 ? 30.006 -6.545  45.807 1.00 12.28 ? 143  TYR A N   1 
ATOM   1100 C  CA  . TYR A 1 142 ? 29.509 -5.177  45.684 1.00 12.07 ? 143  TYR A CA  1 
ATOM   1101 C  C   . TYR A 1 142 ? 30.670 -4.236  45.362 1.00 12.33 ? 143  TYR A C   1 
ATOM   1102 O  O   . TYR A 1 142 ? 31.169 -3.476  46.189 1.00 14.77 ? 143  TYR A O   1 
ATOM   1103 C  CB  . TYR A 1 142 ? 28.817 -4.723  46.957 1.00 12.17 ? 143  TYR A CB  1 
ATOM   1104 C  CG  . TYR A 1 142 ? 28.051 -3.419  46.850 1.00 11.55 ? 143  TYR A CG  1 
ATOM   1105 C  CD1 . TYR A 1 142 ? 26.910 -3.339  46.078 1.00 11.09 ? 143  TYR A CD1 1 
ATOM   1106 C  CD2 . TYR A 1 142 ? 28.484 -2.277  47.516 1.00 11.44 ? 143  TYR A CD2 1 
ATOM   1107 C  CE1 . TYR A 1 142 ? 26.182 -2.164  45.954 1.00 11.91 ? 143  TYR A CE1 1 
ATOM   1108 C  CE2 . TYR A 1 142 ? 27.757 -1.093  47.408 1.00 12.00 ? 143  TYR A CE2 1 
ATOM   1109 C  CZ  . TYR A 1 142 ? 26.632 -1.043  46.631 1.00 11.73 ? 143  TYR A CZ  1 
ATOM   1110 O  OH  . TYR A 1 142 ? 25.909 0.139   46.526 1.00 14.63 ? 143  TYR A OH  1 
ATOM   1111 N  N   . ASN A 1 143 ? 31.120 -4.371  44.106 1.00 12.84 ? 144  ASN A N   1 
ATOM   1112 C  CA  . ASN A 1 143 ? 32.242 -3.599  43.591 1.00 12.23 ? 144  ASN A CA  1 
ATOM   1113 C  C   . ASN A 1 143 ? 32.193 -3.607  42.069 1.00 12.73 ? 144  ASN A C   1 
ATOM   1114 O  O   . ASN A 1 143 ? 31.303 -4.213  41.484 1.00 13.70 ? 144  ASN A O   1 
ATOM   1115 C  CB  . ASN A 1 143 ? 33.555 -4.114  44.152 1.00 14.43 ? 144  ASN A CB  1 
ATOM   1116 C  CG  . ASN A 1 143 ? 33.844 -5.576  43.873 1.00 13.31 ? 144  ASN A CG  1 
ATOM   1117 O  OD1 . ASN A 1 143 ? 33.560 -6.079  42.796 1.00 15.87 ? 144  ASN A OD1 1 
ATOM   1118 N  ND2 . ASN A 1 143 ? 34.400 -6.249  44.863 1.00 15.03 ? 144  ASN A ND2 1 
ATOM   1119 N  N   . TYR A 1 144 ? 33.088 -2.878  41.427 1.00 15.71 ? 145  TYR A N   1 
ATOM   1120 C  CA  . TYR A 1 144 ? 33.048 -2.636  39.993 1.00 14.31 ? 145  TYR A CA  1 
ATOM   1121 C  C   . TYR A 1 144 ? 34.436 -2.318  39.463 1.00 14.48 ? 145  TYR A C   1 
ATOM   1122 O  O   . TYR A 1 144 ? 35.138 -1.410  39.930 1.00 17.58 ? 145  TYR A O   1 
ATOM   1123 C  CB  . TYR A 1 144 ? 32.044 -1.497  39.737 1.00 15.02 ? 145  TYR A CB  1 
ATOM   1124 C  CG  . TYR A 1 144 ? 31.400 -1.659  38.380 1.00 13.75 ? 145  TYR A CG  1 
ATOM   1125 C  CD1 . TYR A 1 144 ? 30.288 -2.462  38.320 1.00 16.23 ? 145  TYR A CD1 1 
ATOM   1126 C  CD2 . TYR A 1 144 ? 31.880 -1.067  37.224 1.00 16.71 ? 145  TYR A CD2 1 
ATOM   1127 C  CE1 . TYR A 1 144 ? 29.652 -2.662  37.118 1.00 19.55 ? 145  TYR A CE1 1 
ATOM   1128 C  CE2 . TYR A 1 144 ? 31.239 -1.264  36.001 1.00 19.44 ? 145  TYR A CE2 1 
ATOM   1129 C  CZ  . TYR A 1 144 ? 30.131 -2.066  35.982 1.00 18.78 ? 145  TYR A CZ  1 
ATOM   1130 O  OH  . TYR A 1 144 ? 29.457 -2.300  34.809 1.00 23.18 ? 145  TYR A OH  1 
ATOM   1131 N  N   . ASN A 1 145 ? 34.867 -3.115  38.497 1.00 14.36 ? 146  ASN A N   1 
ATOM   1132 C  CA  . ASN A 1 145 ? 36.181 -2.981  37.892 1.00 14.67 ? 146  ASN A CA  1 
ATOM   1133 C  C   . ASN A 1 145 ? 36.178 -1.845  36.873 1.00 13.68 ? 146  ASN A C   1 
ATOM   1134 O  O   . ASN A 1 145 ? 35.151 -1.408  36.346 1.00 17.37 ? 146  ASN A O   1 
ATOM   1135 C  CB  . ASN A 1 145 ? 36.581 -4.299  37.237 1.00 17.49 ? 146  ASN A CB  1 
ATOM   1136 C  CG  . ASN A 1 145 ? 36.818 -5.377  38.272 1.00 18.32 ? 146  ASN A CG  1 
ATOM   1137 O  OD1 . ASN A 1 145 ? 37.551 -5.166  39.235 1.00 23.00 ? 146  ASN A OD1 1 
ATOM   1138 N  ND2 . ASN A 1 145 ? 36.210 -6.548  38.099 1.00 19.42 ? 146  ASN A ND2 1 
ATOM   1139 N  N   . SER A 1 146 ? 37.368 -1.354  36.586 1.00 16.53 ? 147  SER A N   1 
ATOM   1140 C  CA  . SER A 1 146 ? 37.563 -0.351  35.556 1.00 16.62 ? 147  SER A CA  1 
ATOM   1141 C  C   . SER A 1 146 ? 37.602 -0.997  34.178 1.00 15.58 ? 147  SER A C   1 
ATOM   1142 O  O   . SER A 1 146 ? 38.161 -2.081  34.013 1.00 19.92 ? 147  SER A O   1 
ATOM   1143 C  CB  . SER A 1 146 ? 38.846 0.429   35.847 1.00 19.19 ? 147  SER A CB  1 
ATOM   1144 O  OG  . SER A 1 146 ? 38.820 0.934   37.184 1.00 23.51 ? 147  SER A OG  1 
ATOM   1145 N  N   . HIS A 1 147 ? 37.003 -0.322  33.202 1.00 15.55 ? 148  HIS A N   1 
ATOM   1146 C  CA  . HIS A 1 147 ? 36.804 -0.891  31.881 1.00 19.14 ? 148  HIS A CA  1 
ATOM   1147 C  C   . HIS A 1 147 ? 36.929 0.149   30.777 1.00 18.80 ? 148  HIS A C   1 
ATOM   1148 O  O   . HIS A 1 147 ? 36.746 1.343   31.066 1.00 20.15 ? 148  HIS A O   1 
ATOM   1149 C  CB  . HIS A 1 147 ? 35.395 -1.476  31.700 1.00 23.57 ? 148  HIS A CB  1 
ATOM   1150 C  CG  . HIS A 1 147 ? 35.010 -2.539  32.645 1.00 25.84 ? 148  HIS A CG  1 
ATOM   1151 N  ND1 . HIS A 1 147 ? 34.323 -2.286  33.812 1.00 30.09 ? 148  HIS A ND1 1 
ATOM   1152 C  CD2 . HIS A 1 147 ? 35.177 -3.896  32.571 1.00 23.83 ? 148  HIS A CD2 1 
ATOM   1153 C  CE1 . HIS A 1 147 ? 34.103 -3.445  34.439 1.00 29.36 ? 148  HIS A CE1 1 
ATOM   1154 N  NE2 . HIS A 1 147 ? 34.613 -4.432  33.707 1.00 27.16 ? 148  HIS A NE2 1 
ATOM   1155 N  N   . ASN A 1 148 ? 37.201 -0.295  29.565 1.00 17.50 ? 149  ASN A N   1 
ATOM   1156 C  CA  . ASN A 1 148 ? 37.118 0.561   28.395 1.00 17.42 ? 149  ASN A CA  1 
ATOM   1157 C  C   . ASN A 1 148 ? 35.908 0.237   27.538 1.00 18.23 ? 149  ASN A C   1 
ATOM   1158 O  O   . ASN A 1 148 ? 35.690 -0.949  27.260 1.00 25.57 ? 149  ASN A O   1 
ATOM   1159 C  CB  . ASN A 1 148 ? 38.296 0.384   27.456 1.00 20.43 ? 149  ASN A CB  1 
ATOM   1160 C  CG  . ASN A 1 148 ? 39.603 0.782   28.106 1.00 23.87 ? 149  ASN A CG  1 
ATOM   1161 O  OD1 . ASN A 1 148 ? 39.636 1.654   28.974 1.00 22.68 ? 149  ASN A OD1 1 
ATOM   1162 N  ND2 . ASN A 1 148 ? 40.634 0.102   27.645 1.00 29.43 ? 149  ASN A ND2 1 
ATOM   1163 N  N   . VAL A 1 149 ? 35.196 1.247   27.137 1.00 15.39 ? 150  VAL A N   1 
ATOM   1164 C  CA  . VAL A 1 149 ? 34.002 1.136   26.292 1.00 14.69 ? 150  VAL A CA  1 
ATOM   1165 C  C   . VAL A 1 149 ? 34.419 1.512   24.888 1.00 16.25 ? 150  VAL A C   1 
ATOM   1166 O  O   . VAL A 1 149 ? 34.770 2.684   24.726 1.00 15.28 ? 150  VAL A O   1 
ATOM   1167 C  CB  . VAL A 1 149 ? 32.881 2.096   26.746 1.00 15.14 ? 150  VAL A CB  1 
ATOM   1168 C  CG1 . VAL A 1 149 ? 31.737 2.123   25.749 1.00 16.84 ? 150  VAL A CG1 1 
ATOM   1169 C  CG2 . VAL A 1 149 ? 32.481 1.695   28.170 1.00 20.21 ? 150  VAL A CG2 1 
ATOM   1170 N  N   . TYR A 1 150 ? 34.428 0.579   23.974 1.00 15.51 ? 151  TYR A N   1 
ATOM   1171 C  CA  . TYR A 1 150 ? 34.931 0.834   22.636 1.00 14.34 ? 151  TYR A CA  1 
ATOM   1172 C  C   . TYR A 1 150 ? 33.774 1.319   21.770 1.00 14.64 ? 151  TYR A C   1 
ATOM   1173 O  O   . TYR A 1 150 ? 32.754 0.621   21.650 1.00 17.58 ? 151  TYR A O   1 
ATOM   1174 C  CB  . TYR A 1 150 ? 35.628 -0.406  22.023 1.00 18.61 ? 151  TYR A CB  1 
ATOM   1175 C  CG  . TYR A 1 150 ? 36.802 -0.839  22.895 1.00 19.70 ? 151  TYR A CG  1 
ATOM   1176 C  CD1 . TYR A 1 150 ? 38.023 -0.191  22.753 1.00 21.63 ? 151  TYR A CD1 1 
ATOM   1177 C  CD2 . TYR A 1 150 ? 36.697 -1.850  23.846 1.00 21.83 ? 151  TYR A CD2 1 
ATOM   1178 C  CE1 . TYR A 1 150 ? 39.130 -0.516  23.503 1.00 23.94 ? 151  TYR A CE1 1 
ATOM   1179 C  CE2 . TYR A 1 150 ? 37.813 -2.176  24.604 1.00 22.79 ? 151  TYR A CE2 1 
ATOM   1180 C  CZ  . TYR A 1 150 ? 39.011 -1.521  24.436 1.00 25.49 ? 151  TYR A CZ  1 
ATOM   1181 O  OH  . TYR A 1 150 ? 40.116 -1.850  25.198 1.00 27.09 ? 151  TYR A OH  1 
ATOM   1182 N  N   . ILE A 1 151 ? 33.970 2.489   21.179 1.00 13.44 ? 152  ILE A N   1 
ATOM   1183 C  CA  . ILE A 1 151 ? 32.996 3.194   20.364 1.00 15.83 ? 152  ILE A CA  1 
ATOM   1184 C  C   . ILE A 1 151 ? 33.412 3.224   18.889 1.00 15.02 ? 152  ILE A C   1 
ATOM   1185 O  O   . ILE A 1 151 ? 34.589 3.469   18.567 1.00 15.48 ? 152  ILE A O   1 
ATOM   1186 C  CB  . ILE A 1 151 ? 32.899 4.640   20.845 1.00 14.88 ? 152  ILE A CB  1 
ATOM   1187 C  CG1 . ILE A 1 151 ? 32.553 4.774   22.328 1.00 19.36 ? 152  ILE A CG1 1 
ATOM   1188 C  CG2 . ILE A 1 151 ? 31.928 5.431   19.981 1.00 16.12 ? 152  ILE A CG2 1 
ATOM   1189 C  CD1 . ILE A 1 151 ? 31.457 3.847   22.782 1.00 38.00 ? 152  ILE A CD1 1 
ATOM   1190 N  N   . THR A 1 152 ? 32.456 2.969   18.009 1.00 15.94 ? 153  THR A N   1 
ATOM   1191 C  CA  . THR A 1 152 ? 32.635 3.030   16.578 1.00 16.00 ? 153  THR A CA  1 
ATOM   1192 C  C   . THR A 1 152 ? 31.385 3.682   15.983 1.00 15.58 ? 153  THR A C   1 
ATOM   1193 O  O   . THR A 1 152 ? 30.265 3.632   16.492 1.00 18.14 ? 153  THR A O   1 
ATOM   1194 C  CB  . THR A 1 152 ? 32.859 1.679   15.889 1.00 19.78 ? 153  THR A CB  1 
ATOM   1195 O  OG1 . THR A 1 152 ? 31.715 0.844   16.197 1.00 25.38 ? 153  THR A OG1 1 
ATOM   1196 C  CG2 . THR A 1 152 ? 34.070 0.889   16.359 1.00 31.92 ? 153  THR A CG2 1 
ATOM   1197 N  N   . ALA A 1 153 ? 31.587 4.334   14.841 1.00 16.11 ? 154  ALA A N   1 
ATOM   1198 C  CA  . ALA A 1 153 ? 30.436 4.967   14.211 1.00 17.07 ? 154  ALA A CA  1 
ATOM   1199 C  C   . ALA A 1 153 ? 29.623 3.929   13.442 1.00 18.10 ? 154  ALA A C   1 
ATOM   1200 O  O   . ALA A 1 153 ? 30.134 2.953   12.924 1.00 22.94 ? 154  ALA A O   1 
ATOM   1201 C  CB  . ALA A 1 153 ? 30.823 6.077   13.240 1.00 22.08 ? 154  ALA A CB  1 
ATOM   1202 N  N   . ASP A 1 154 ? 28.352 4.231   13.382 1.00 19.59 ? 155  ASP A N   1 
ATOM   1203 C  CA  . ASP A 1 154 ? 27.308 3.559   12.636 1.00 22.96 ? 155  ASP A CA  1 
ATOM   1204 C  C   . ASP A 1 154 ? 26.645 4.590   11.712 1.00 23.44 ? 155  ASP A C   1 
ATOM   1205 O  O   . ASP A 1 154 ? 25.632 5.214   12.008 1.00 23.34 ? 155  ASP A O   1 
ATOM   1206 C  CB  . ASP A 1 154 ? 26.316 2.954   13.621 1.00 27.90 ? 155  ASP A CB  1 
ATOM   1207 C  CG  . ASP A 1 154 ? 25.216 2.175   12.925 1.00 39.72 ? 155  ASP A CG  1 
ATOM   1208 O  OD1 . ASP A 1 154 ? 24.446 1.517   13.671 1.00 46.26 ? 155  ASP A OD1 1 
ATOM   1209 O  OD2 . ASP A 1 154 ? 25.148 2.232   11.673 1.00 45.16 ? 155  ASP A OD2 1 
ATOM   1210 N  N   . LYS A 1 155 ? 27.267 4.756   10.558 1.00 28.19 ? 156  LYS A N   1 
ATOM   1211 C  CA  . LYS A 1 155 ? 26.953 5.857   9.660  1.00 30.89 ? 156  LYS A CA  1 
ATOM   1212 C  C   . LYS A 1 155 ? 25.556 5.663   9.100  1.00 34.17 ? 156  LYS A C   1 
ATOM   1213 O  O   . LYS A 1 155 ? 24.836 6.623   8.919  1.00 32.51 ? 156  LYS A O   1 
ATOM   1214 C  CB  . LYS A 1 155 ? 28.025 5.969   8.576  1.00 42.27 ? 156  LYS A CB  1 
ATOM   1215 C  CG  . LYS A 1 155 ? 28.946 7.161   8.701  1.00 51.73 ? 156  LYS A CG  1 
ATOM   1216 C  CD  . LYS A 1 155 ? 30.378 6.949   9.150  1.00 59.95 ? 156  LYS A CD  1 
ATOM   1217 C  CE  . LYS A 1 155 ? 31.172 8.251   9.120  1.00 63.45 ? 156  LYS A CE  1 
ATOM   1218 N  NZ  . LYS A 1 155 ? 32.464 8.225   9.868  1.00 65.35 ? 156  LYS A NZ  1 
ATOM   1219 N  N   . GLN A 1 156 ? 25.213 4.407   8.875  1.00 35.91 ? 157  GLN A N   1 
ATOM   1220 C  CA  . GLN A 1 156 ? 23.876 4.109   8.379  1.00 43.18 ? 157  GLN A CA  1 
ATOM   1221 C  C   . GLN A 1 156 ? 22.777 4.460   9.367  1.00 36.92 ? 157  GLN A C   1 
ATOM   1222 O  O   . GLN A 1 156 ? 21.608 4.714   8.999  1.00 43.93 ? 157  GLN A O   1 
ATOM   1223 C  CB  . GLN A 1 156 ? 23.844 2.619   8.018  1.00 55.39 ? 157  GLN A CB  1 
ATOM   1224 C  CG  . GLN A 1 156 ? 25.040 2.182   7.176  1.00 70.79 ? 157  GLN A CG  1 
ATOM   1225 C  CD  . GLN A 1 156 ? 25.841 1.054   7.812  1.00 80.70 ? 157  GLN A CD  1 
ATOM   1226 O  OE1 . GLN A 1 156 ? 25.706 0.781   9.011  1.00 98.58 ? 157  GLN A OE1 1 
ATOM   1227 N  NE2 . GLN A 1 156 ? 26.690 0.390   7.022  1.00 86.58 ? 157  GLN A NE2 1 
ATOM   1228 N  N   . LYS A 1 157 ? 23.048 4.502   10.676 1.00 36.44 ? 158  LYS A N   1 
ATOM   1229 C  CA  . LYS A 1 157 ? 21.969 4.920   11.584 1.00 34.17 ? 158  LYS A CA  1 
ATOM   1230 C  C   . LYS A 1 157 ? 22.226 6.317   12.136 1.00 29.01 ? 158  LYS A C   1 
ATOM   1231 O  O   . LYS A 1 157 ? 21.566 6.785   13.065 1.00 30.02 ? 158  LYS A O   1 
ATOM   1232 C  CB  . LYS A 1 157 ? 21.781 3.902   12.717 1.00 37.15 ? 158  LYS A CB  1 
ATOM   1233 C  CG  . LYS A 1 157 ? 21.141 2.596   12.273 1.00 49.70 ? 158  LYS A CG  1 
ATOM   1234 C  CD  . LYS A 1 157 ? 21.366 1.519   13.317 1.00 58.19 ? 158  LYS A CD  1 
ATOM   1235 C  CE  . LYS A 1 157 ? 21.661 0.152   12.710 1.00 63.52 ? 158  LYS A CE  1 
ATOM   1236 N  NZ  . LYS A 1 157 ? 20.581 -0.844  12.978 1.00 67.29 ? 158  LYS A NZ  1 
ATOM   1237 N  N   . ASN A 1 158 ? 23.194 7.011   11.565 1.00 24.49 ? 159  ASN A N   1 
ATOM   1238 C  CA  . ASN A 1 158 ? 23.600 8.310   12.073 1.00 24.36 ? 159  ASN A CA  1 
ATOM   1239 C  C   . ASN A 1 158 ? 23.855 8.318   13.568 1.00 20.25 ? 159  ASN A C   1 
ATOM   1240 O  O   . ASN A 1 158 ? 23.447 9.179   14.337 1.00 20.15 ? 159  ASN A O   1 
ATOM   1241 C  CB  . ASN A 1 158 ? 22.510 9.329   11.765 1.00 29.77 ? 159  ASN A CB  1 
ATOM   1242 C  CG  . ASN A 1 158 ? 23.156 10.680  11.552 1.00 33.59 ? 159  ASN A CG  1 
ATOM   1243 O  OD1 . ASN A 1 158 ? 22.765 11.580  12.284 1.00 45.92 ? 159  ASN A OD1 1 
ATOM   1244 N  ND2 . ASN A 1 158 ? 24.075 10.761  10.600 1.00 46.64 ? 159  ASN A ND2 1 
ATOM   1245 N  N   . GLY A 1 159 ? 24.576 7.267   13.948 1.00 17.85 ? 160  GLY A N   1 
ATOM   1246 C  CA  . GLY A 1 159 ? 24.800 7.095   15.371 1.00 17.50 ? 160  GLY A CA  1 
ATOM   1247 C  C   . GLY A 1 159 ? 26.074 6.335   15.639 1.00 17.70 ? 160  GLY A C   1 
ATOM   1248 O  O   . GLY A 1 159 ? 27.038 6.370   14.871 1.00 18.51 ? 160  GLY A O   1 
ATOM   1249 N  N   . ILE A 1 160 ? 26.053 5.654   16.789 1.00 16.59 ? 161  ILE A N   1 
ATOM   1250 C  CA  . ILE A 1 160 ? 27.229 4.906   17.184 1.00 14.99 ? 161  ILE A CA  1 
ATOM   1251 C  C   . ILE A 1 160 ? 26.880 3.517   17.729 1.00 14.34 ? 161  ILE A C   1 
ATOM   1252 O  O   . ILE A 1 160 ? 25.726 3.223   18.041 1.00 15.32 ? 161  ILE A O   1 
ATOM   1253 C  CB  . ILE A 1 160 ? 28.071 5.687   18.220 1.00 14.35 ? 161  ILE A CB  1 
ATOM   1254 C  CG1 . ILE A 1 160 ? 27.325 5.926   19.525 1.00 15.59 ? 161  ILE A CG1 1 
ATOM   1255 C  CG2 . ILE A 1 160 ? 28.605 6.985   17.660 1.00 20.08 ? 161  ILE A CG2 1 
ATOM   1256 C  CD1 . ILE A 1 160 ? 28.271 6.184   20.657 1.00 22.73 ? 161  ILE A CD1 1 
ATOM   1257 N  N   . LYS A 1 161 ? 27.919 2.681   17.805 1.00 14.61 ? 162  LYS A N   1 
ATOM   1258 C  CA  . LYS A 1 161 ? 27.879 1.401   18.476 1.00 14.97 ? 162  LYS A CA  1 
ATOM   1259 C  C   . LYS A 1 161 ? 28.960 1.375   19.542 1.00 16.86 ? 162  LYS A C   1 
ATOM   1260 O  O   . LYS A 1 161 ? 30.011 2.028   19.409 1.00 16.97 ? 162  LYS A O   1 
ATOM   1261 C  CB  . LYS A 1 161 ? 28.070 0.256   17.473 1.00 19.59 ? 162  LYS A CB  1 
ATOM   1262 C  CG  . LYS A 1 161 ? 26.882 0.031   16.548 1.00 26.42 ? 162  LYS A CG  1 
ATOM   1263 C  CD  . LYS A 1 161 ? 27.183 -1.009  15.482 1.00 34.85 ? 162  LYS A CD  1 
ATOM   1264 C  CE  . LYS A 1 161 ? 25.960 -1.284  14.626 1.00 38.40 ? 162  LYS A CE  1 
ATOM   1265 N  NZ  . LYS A 1 161 ? 26.273 -1.950  13.332 1.00 48.32 ? 162  LYS A NZ  1 
ATOM   1266 N  N   . ALA A 1 162 ? 28.712 0.620   20.597 1.00 16.05 ? 163  ALA A N   1 
ATOM   1267 C  CA  . ALA A 1 162 ? 29.712 0.435   21.642 1.00 16.11 ? 163  ALA A CA  1 
ATOM   1268 C  C   . ALA A 1 162 ? 29.760 -1.049  21.958 1.00 16.87 ? 163  ALA A C   1 
ATOM   1269 O  O   . ALA A 1 162 ? 28.746 -1.745  22.005 1.00 16.12 ? 163  ALA A O   1 
ATOM   1270 C  CB  . ALA A 1 162 ? 29.427 1.252   22.885 1.00 17.60 ? 163  ALA A CB  1 
ATOM   1271 N  N   . ASN A 1 163 ? 30.962 -1.540  22.175 1.00 18.04 ? 164  ASN A N   1 
ATOM   1272 C  CA  . ASN A 1 163 ? 31.154 -2.939  22.532 1.00 18.47 ? 164  ASN A CA  1 
ATOM   1273 C  C   . ASN A 1 163 ? 32.160 -2.992  23.686 1.00 19.64 ? 164  ASN A C   1 
ATOM   1274 O  O   . ASN A 1 163 ? 33.181 -2.294  23.709 1.00 18.85 ? 164  ASN A O   1 
ATOM   1275 C  CB  . ASN A 1 163 ? 31.672 -3.778  21.378 1.00 27.34 ? 164  ASN A CB  1 
ATOM   1276 C  CG  . ASN A 1 163 ? 30.666 -4.156  20.328 1.00 36.21 ? 164  ASN A CG  1 
ATOM   1277 O  OD1 . ASN A 1 163 ? 30.417 -3.340  19.429 1.00 50.06 ? 164  ASN A OD1 1 
ATOM   1278 N  ND2 . ASN A 1 163 ? 30.074 -5.347  20.385 1.00 48.41 ? 164  ASN A ND2 1 
ATOM   1279 N  N   . PHE A 1 164 ? 31.874 -3.829  24.659 1.00 17.58 ? 165  PHE A N   1 
ATOM   1280 C  CA  . PHE A 1 164 ? 32.818 -4.046  25.743 1.00 15.25 ? 165  PHE A CA  1 
ATOM   1281 C  C   . PHE A 1 164 ? 32.427 -5.297  26.550 1.00 15.91 ? 165  PHE A C   1 
ATOM   1282 O  O   . PHE A 1 164 ? 31.291 -5.733  26.395 1.00 17.10 ? 165  PHE A O   1 
ATOM   1283 C  CB  . PHE A 1 164 ? 32.936 -2.816  26.647 1.00 16.77 ? 165  PHE A CB  1 
ATOM   1284 C  CG  . PHE A 1 164 ? 31.624 -2.277  27.181 1.00 17.34 ? 165  PHE A CG  1 
ATOM   1285 C  CD1 . PHE A 1 164 ? 30.767 -1.570  26.374 1.00 19.55 ? 165  PHE A CD1 1 
ATOM   1286 C  CD2 . PHE A 1 164 ? 31.272 -2.489  28.498 1.00 20.05 ? 165  PHE A CD2 1 
ATOM   1287 C  CE1 . PHE A 1 164 ? 29.580 -1.060  26.880 1.00 18.12 ? 165  PHE A CE1 1 
ATOM   1288 C  CE2 . PHE A 1 164 ? 30.112 -1.991  29.042 1.00 20.24 ? 165  PHE A CE2 1 
ATOM   1289 C  CZ  . PHE A 1 164 ? 29.270 -1.266  28.219 1.00 21.00 ? 165  PHE A CZ  1 
ATOM   1290 N  N   . LYS A 1 165 ? 33.387 -5.744  27.351 1.00 15.74 ? 166  LYS A N   1 
ATOM   1291 C  CA  . LYS A 1 165 ? 33.202 -6.850  28.277 1.00 16.65 ? 166  LYS A CA  1 
ATOM   1292 C  C   . LYS A 1 165 ? 33.326 -6.371  29.711 1.00 15.82 ? 166  LYS A C   1 
ATOM   1293 O  O   . LYS A 1 165 ? 34.332 -5.800  30.130 1.00 18.68 ? 166  LYS A O   1 
ATOM   1294 C  CB  . LYS A 1 165 ? 34.190 -7.968  27.972 1.00 24.86 ? 166  LYS A CB  1 
ATOM   1295 C  CG  . LYS A 1 165 ? 33.762 -8.675  26.675 1.00 33.26 ? 166  LYS A CG  1 
ATOM   1296 C  CD  . LYS A 1 165 ? 34.784 -9.669  26.177 1.00 40.96 ? 166  LYS A CD  1 
ATOM   1297 C  CE  . LYS A 1 165 ? 34.279 -10.363 24.912 1.00 47.79 ? 166  LYS A CE  1 
ATOM   1298 N  NZ  . LYS A 1 165 ? 33.684 -11.697 25.202 1.00 57.41 ? 166  LYS A NZ  1 
ATOM   1299 N  N   . ILE A 1 166 ? 32.249 -6.601  30.461 1.00 19.06 ? 167  ILE A N   1 
ATOM   1300 C  CA  . ILE A 1 166 ? 32.354 -6.283  31.883 1.00 18.28 ? 167  ILE A CA  1 
ATOM   1301 C  C   . ILE A 1 166 ? 32.797 -7.533  32.638 1.00 16.79 ? 167  ILE A C   1 
ATOM   1302 O  O   . ILE A 1 166 ? 32.337 -8.639  32.377 1.00 18.24 ? 167  ILE A O   1 
ATOM   1303 C  CB  . ILE A 1 166 ? 31.025 -5.721  32.413 1.00 19.54 ? 167  ILE A CB  1 
ATOM   1304 C  CG1 . ILE A 1 166 ? 30.645 -4.390  31.760 1.00 20.15 ? 167  ILE A CG1 1 
ATOM   1305 C  CG2 . ILE A 1 166 ? 31.011 -5.578  33.938 1.00 19.41 ? 167  ILE A CG2 1 
ATOM   1306 C  CD1 . ILE A 1 166 ? 31.535 -3.211  32.145 1.00 18.93 ? 167  ILE A CD1 1 
ATOM   1307 N  N   . ARG A 1 167 ? 33.694 -7.360  33.588 1.00 18.70 ? 168  ARG A N   1 
ATOM   1308 C  CA  . ARG A 1 167 ? 34.144 -8.443  34.462 1.00 18.79 ? 168  ARG A CA  1 
ATOM   1309 C  C   . ARG A 1 167 ? 33.578 -8.213  35.858 1.00 17.27 ? 168  ARG A C   1 
ATOM   1310 O  O   . ARG A 1 167 ? 33.980 -7.296  36.578 1.00 23.20 ? 168  ARG A O   1 
ATOM   1311 C  CB  . ARG A 1 167 ? 35.664 -8.540  34.417 1.00 24.93 ? 168  ARG A CB  1 
ATOM   1312 C  CG  . ARG A 1 167 ? 36.275 -8.957  33.095 1.00 28.03 ? 168  ARG A CG  1 
ATOM   1313 C  CD  . ARG A 1 167 ? 36.377 -7.871  32.035 1.00 38.18 ? 168  ARG A CD  1 
ATOM   1314 N  NE  . ARG A 1 167 ? 37.442 -8.127  31.052 1.00 41.50 ? 168  ARG A NE  1 
ATOM   1315 C  CZ  . ARG A 1 167 ? 37.578 -7.443  29.912 1.00 39.61 ? 168  ARG A CZ  1 
ATOM   1316 N  NH1 . ARG A 1 167 ? 38.556 -7.711  29.053 1.00 39.34 ? 168  ARG A NH1 1 
ATOM   1317 N  NH2 . ARG A 1 167 ? 36.718 -6.474  29.622 1.00 45.47 ? 168  ARG A NH2 1 
ATOM   1318 N  N   . HIS A 1 168 ? 32.590 -9.015  36.239 1.00 15.11 ? 169  HIS A N   1 
ATOM   1319 C  CA  . HIS A 1 168 ? 31.997 -8.902  37.553 1.00 15.39 ? 169  HIS A CA  1 
ATOM   1320 C  C   . HIS A 1 168 ? 32.681 -9.885  38.509 1.00 15.05 ? 169  HIS A C   1 
ATOM   1321 O  O   . HIS A 1 168 ? 32.718 -11.102 38.279 1.00 17.17 ? 169  HIS A O   1 
ATOM   1322 C  CB  . HIS A 1 168 ? 30.507 -9.239  37.552 1.00 14.92 ? 169  HIS A CB  1 
ATOM   1323 C  CG  . HIS A 1 168 ? 29.576 -8.314  36.852 1.00 13.73 ? 169  HIS A CG  1 
ATOM   1324 N  ND1 . HIS A 1 168 ? 29.393 -6.987  37.188 1.00 14.67 ? 169  HIS A ND1 1 
ATOM   1325 C  CD2 . HIS A 1 168 ? 28.743 -8.567  35.812 1.00 17.08 ? 169  HIS A CD2 1 
ATOM   1326 C  CE1 . HIS A 1 168 ? 28.477 -6.485  36.350 1.00 15.50 ? 169  HIS A CE1 1 
ATOM   1327 N  NE2 . HIS A 1 168 ? 28.060 -7.415  35.498 1.00 16.45 ? 169  HIS A NE2 1 
ATOM   1328 N  N   . ASN A 1 169 ? 33.210 -9.356  39.613 1.00 14.69 ? 170  ASN A N   1 
ATOM   1329 C  CA  . ASN A 1 169 ? 33.832 -10.226 40.603 1.00 15.03 ? 170  ASN A CA  1 
ATOM   1330 C  C   . ASN A 1 169 ? 32.804 -11.061 41.359 1.00 16.68 ? 170  ASN A C   1 
ATOM   1331 O  O   . ASN A 1 169 ? 31.851 -10.495 41.897 1.00 18.86 ? 170  ASN A O   1 
ATOM   1332 C  CB  . ASN A 1 169 ? 34.574 -9.374  41.635 1.00 16.13 ? 170  ASN A CB  1 
ATOM   1333 C  CG  . ASN A 1 169 ? 35.588 -8.455  40.989 1.00 19.88 ? 170  ASN A CG  1 
ATOM   1334 O  OD1 . ASN A 1 169 ? 36.170 -8.842  39.965 1.00 17.19 ? 170  ASN A OD1 1 
ATOM   1335 N  ND2 . ASN A 1 169 ? 35.760 -7.285  41.581 1.00 26.00 ? 170  ASN A ND2 1 
ATOM   1336 N  N   . ILE A 1 170 ? 33.022 -12.368 41.405 1.00 16.64 ? 171  ILE A N   1 
ATOM   1337 C  CA  . ILE A 1 170 ? 32.251 -13.322 42.181 1.00 15.43 ? 171  ILE A CA  1 
ATOM   1338 C  C   . ILE A 1 170 ? 32.872 -13.509 43.562 1.00 16.23 ? 171  ILE A C   1 
ATOM   1339 O  O   . ILE A 1 170 ? 34.088 -13.417 43.745 1.00 16.79 ? 171  ILE A O   1 
ATOM   1340 C  CB  . ILE A 1 170 ? 32.125 -14.646 41.414 1.00 18.25 ? 171  ILE A CB  1 
ATOM   1341 C  CG1 . ILE A 1 170 ? 31.600 -14.472 39.982 1.00 21.99 ? 171  ILE A CG1 1 
ATOM   1342 C  CG2 . ILE A 1 170 ? 31.272 -15.661 42.173 1.00 22.18 ? 171  ILE A CG2 1 
ATOM   1343 C  CD1 . ILE A 1 170 ? 31.635 -15.811 39.222 1.00 26.43 ? 171  ILE A CD1 1 
ATOM   1344 N  N   . GLU A 1 171 ? 31.996 -13.786 44.544 1.00 16.01 ? 172  GLU A N   1 
ATOM   1345 C  CA  . GLU A 1 171 ? 32.419 -13.829 45.940 1.00 17.00 ? 172  GLU A CA  1 
ATOM   1346 C  C   . GLU A 1 171 ? 33.446 -14.927 46.177 1.00 17.10 ? 172  GLU A C   1 
ATOM   1347 O  O   . GLU A 1 171 ? 34.084 -14.890 47.235 1.00 18.23 ? 172  GLU A O   1 
ATOM   1348 C  CB  . GLU A 1 171 ? 31.227 -14.045 46.888 1.00 21.06 ? 172  GLU A CB  1 
ATOM   1349 C  CG  . GLU A 1 171 ? 30.622 -15.422 46.603 1.00 25.62 ? 172  GLU A CG  1 
ATOM   1350 C  CD  . GLU A 1 171 ? 29.212 -15.606 47.096 1.00 32.38 ? 172  GLU A CD  1 
ATOM   1351 O  OE1 . GLU A 1 171 ? 28.636 -16.668 46.776 1.00 40.22 ? 172  GLU A OE1 1 
ATOM   1352 O  OE2 . GLU A 1 171 ? 28.718 -14.695 47.796 1.00 36.61 ? 172  GLU A OE2 1 
ATOM   1353 N  N   . ASP A 1 172 ? 33.619 -15.864 45.252 1.00 17.50 ? 173  ASP A N   1 
ATOM   1354 C  CA  . ASP A 1 172 ? 34.608 -16.926 45.438 1.00 19.65 ? 173  ASP A CA  1 
ATOM   1355 C  C   . ASP A 1 172 ? 35.944 -16.669 44.739 1.00 21.31 ? 173  ASP A C   1 
ATOM   1356 O  O   . ASP A 1 172 ? 36.791 -17.581 44.697 1.00 20.10 ? 173  ASP A O   1 
ATOM   1357 C  CB  . ASP A 1 172 ? 34.045 -18.286 44.962 1.00 19.02 ? 173  ASP A CB  1 
ATOM   1358 C  CG  . ASP A 1 172 ? 33.810 -18.351 43.463 1.00 19.26 ? 173  ASP A CG  1 
ATOM   1359 O  OD1 . ASP A 1 172 ? 33.977 -17.307 42.804 1.00 19.74 ? 173  ASP A OD1 1 
ATOM   1360 O  OD2 . ASP A 1 172 ? 33.480 -19.449 42.948 1.00 20.68 ? 173  ASP A OD2 1 
ATOM   1361 N  N   . GLY A 1 173 ? 36.176 -15.477 44.198 1.00 20.09 ? 174  GLY A N   1 
ATOM   1362 C  CA  . GLY A 1 173 ? 37.414 -15.156 43.497 1.00 17.89 ? 174  GLY A CA  1 
ATOM   1363 C  C   . GLY A 1 173 ? 37.341 -15.330 41.995 1.00 19.38 ? 174  GLY A C   1 
ATOM   1364 O  O   . GLY A 1 173 ? 38.271 -14.936 41.268 1.00 19.92 ? 174  GLY A O   1 
ATOM   1365 N  N   . SER A 1 174 ? 36.240 -15.914 41.512 1.00 17.26 ? 175  SER A N   1 
ATOM   1366 C  CA  . SER A 1 174 ? 36.089 -16.038 40.078 1.00 18.14 ? 175  SER A CA  1 
ATOM   1367 C  C   . SER A 1 174 ? 35.492 -14.779 39.457 1.00 15.59 ? 175  SER A C   1 
ATOM   1368 O  O   . SER A 1 174 ? 35.298 -13.753 40.112 1.00 15.32 ? 175  SER A O   1 
ATOM   1369 C  CB  . SER A 1 174 ? 35.233 -17.284 39.814 1.00 18.71 ? 175  SER A CB  1 
ATOM   1370 O  OG  . SER A 1 174 ? 35.425 -17.684 38.469 1.00 23.99 ? 175  SER A OG  1 
ATOM   1371 N  N   . VAL A 1 175 ? 35.223 -14.867 38.154 1.00 16.60 ? 176  VAL A N   1 
ATOM   1372 C  CA  . VAL A 1 175 ? 34.689 -13.725 37.400 1.00 16.09 ? 176  VAL A CA  1 
ATOM   1373 C  C   . VAL A 1 175 ? 33.466 -14.162 36.615 1.00 17.63 ? 176  VAL A C   1 
ATOM   1374 O  O   . VAL A 1 175 ? 33.453 -15.250 36.017 1.00 19.97 ? 176  VAL A O   1 
ATOM   1375 C  CB  . VAL A 1 175 ? 35.803 -13.152 36.503 1.00 25.53 ? 176  VAL A CB  1 
ATOM   1376 C  CG1 . VAL A 1 175 ? 35.275 -12.190 35.453 1.00 25.61 ? 176  VAL A CG1 1 
ATOM   1377 C  CG2 . VAL A 1 175 ? 36.829 -12.415 37.360 1.00 24.22 ? 176  VAL A CG2 1 
ATOM   1378 N  N   . GLN A 1 176 ? 32.447 -13.330 36.633 1.00 14.78 ? 177  GLN A N   1 
ATOM   1379 C  CA  . GLN A 1 176 ? 31.294 -13.445 35.760 1.00 15.34 ? 177  GLN A CA  1 
ATOM   1380 C  C   . GLN A 1 176 ? 31.420 -12.424 34.631 1.00 13.92 ? 177  GLN A C   1 
ATOM   1381 O  O   . GLN A 1 176 ? 31.316 -11.209 34.856 1.00 15.42 ? 177  GLN A O   1 
ATOM   1382 C  CB  . GLN A 1 176 ? 30.019 -13.180 36.556 1.00 15.20 ? 177  GLN A CB  1 
ATOM   1383 C  CG  . GLN A 1 176 ? 28.762 -13.129 35.682 1.00 16.02 ? 177  GLN A CG  1 
ATOM   1384 C  CD  . GLN A 1 176 ? 28.392 -14.470 35.071 1.00 15.77 ? 177  GLN A CD  1 
ATOM   1385 O  OE1 . GLN A 1 176 ? 28.057 -15.412 35.795 1.00 17.78 ? 177  GLN A OE1 1 
ATOM   1386 N  NE2 . GLN A 1 176 ? 28.453 -14.539 33.741 1.00 17.57 ? 177  GLN A NE2 1 
ATOM   1387 N  N   . LEU A 1 177 ? 31.636 -12.895 33.422 1.00 16.92 ? 178  LEU A N   1 
ATOM   1388 C  CA  . LEU A 1 177 ? 31.692 -12.110 32.212 1.00 18.52 ? 178  LEU A CA  1 
ATOM   1389 C  C   . LEU A 1 177 ? 30.308 -11.655 31.749 1.00 17.35 ? 178  LEU A C   1 
ATOM   1390 O  O   . LEU A 1 177 ? 29.379 -12.440 31.790 1.00 17.82 ? 178  LEU A O   1 
ATOM   1391 C  CB  . LEU A 1 177 ? 32.342 -12.897 31.065 1.00 28.03 ? 178  LEU A CB  1 
ATOM   1392 C  CG  . LEU A 1 177 ? 33.732 -12.532 30.585 1.00 34.90 ? 178  LEU A CG  1 
ATOM   1393 C  CD1 . LEU A 1 177 ? 34.106 -13.404 29.381 1.00 42.99 ? 178  LEU A CD1 1 
ATOM   1394 C  CD2 . LEU A 1 177 ? 33.880 -11.061 30.209 1.00 47.76 ? 178  LEU A CD2 1 
ATOM   1395 N  N   . ALA A 1 178 ? 30.234 -10.403 31.309 1.00 18.83 ? 179  ALA A N   1 
ATOM   1396 C  CA  . ALA A 1 178 ? 29.072 -9.817  30.692 1.00 19.56 ? 179  ALA A CA  1 
ATOM   1397 C  C   . ALA A 1 178 ? 29.458 -9.006  29.449 1.00 22.88 ? 179  ALA A C   1 
ATOM   1398 O  O   . ALA A 1 178 ? 29.996 -7.882  29.498 1.00 25.47 ? 179  ALA A O   1 
ATOM   1399 C  CB  . ALA A 1 178 ? 28.267 -8.954  31.662 1.00 20.96 ? 179  ALA A CB  1 
ATOM   1400 N  N   . ASP A 1 179 ? 29.126 -9.629  28.302 1.00 17.00 ? 180  ASP A N   1 
ATOM   1401 C  CA  . ASP A 1 179 ? 29.359 -8.944  27.036 1.00 16.26 ? 180  ASP A CA  1 
ATOM   1402 C  C   . ASP A 1 179 ? 28.278 -7.910  26.764 1.00 14.94 ? 180  ASP A C   1 
ATOM   1403 O  O   . ASP A 1 179 ? 27.082 -8.235  26.822 1.00 16.69 ? 180  ASP A O   1 
ATOM   1404 C  CB  . ASP A 1 179 ? 29.333 -9.892  25.839 1.00 19.83 ? 180  ASP A CB  1 
ATOM   1405 C  CG  . ASP A 1 179 ? 29.464 -9.068  24.555 1.00 25.98 ? 180  ASP A CG  1 
ATOM   1406 O  OD1 . ASP A 1 179 ? 30.625 -8.674  24.251 1.00 41.73 ? 180  ASP A OD1 1 
ATOM   1407 O  OD2 . ASP A 1 179 ? 28.440 -8.811  23.875 1.00 35.86 ? 180  ASP A OD2 1 
ATOM   1408 N  N   . HIS A 1 180 ? 28.720 -6.706  26.449 1.00 16.75 ? 181  HIS A N   1 
ATOM   1409 C  CA  . HIS A 1 180 ? 27.818 -5.625  26.118 1.00 17.32 ? 181  HIS A CA  1 
ATOM   1410 C  C   . HIS A 1 180 ? 27.899 -5.165  24.664 1.00 17.83 ? 181  HIS A C   1 
ATOM   1411 O  O   . HIS A 1 180 ? 28.987 -4.810  24.205 1.00 21.10 ? 181  HIS A O   1 
ATOM   1412 C  CB  . HIS A 1 180 ? 28.137 -4.383  26.957 1.00 19.58 ? 181  HIS A CB  1 
ATOM   1413 C  CG  . HIS A 1 180 ? 27.790 -4.546  28.393 1.00 21.03 ? 181  HIS A CG  1 
ATOM   1414 N  ND1 . HIS A 1 180 ? 28.319 -5.513  29.218 1.00 22.41 ? 181  HIS A ND1 1 
ATOM   1415 C  CD2 . HIS A 1 180 ? 26.913 -3.800  29.126 1.00 19.37 ? 181  HIS A CD2 1 
ATOM   1416 C  CE1 . HIS A 1 180 ? 27.778 -5.361  30.429 1.00 23.20 ? 181  HIS A CE1 1 
ATOM   1417 N  NE2 . HIS A 1 180 ? 26.937 -4.340  30.396 1.00 22.53 ? 181  HIS A NE2 1 
ATOM   1418 N  N   . TYR A 1 181 ? 26.748 -5.134  24.006 1.00 16.31 ? 182  TYR A N   1 
ATOM   1419 C  CA  . TYR A 1 181 ? 26.613 -4.617  22.655 1.00 16.67 ? 182  TYR A CA  1 
ATOM   1420 C  C   . TYR A 1 181 ? 25.526 -3.535  22.672 1.00 16.82 ? 182  TYR A C   1 
ATOM   1421 O  O   . TYR A 1 181 ? 24.372 -3.847  22.994 1.00 17.39 ? 182  TYR A O   1 
ATOM   1422 C  CB  . TYR A 1 181 ? 26.228 -5.670  21.623 1.00 17.73 ? 182  TYR A CB  1 
ATOM   1423 C  CG  . TYR A 1 181 ? 26.196 -5.123  20.213 1.00 24.19 ? 182  TYR A CG  1 
ATOM   1424 C  CD1 . TYR A 1 181 ? 27.256 -4.352  19.713 1.00 37.22 ? 182  TYR A CD1 1 
ATOM   1425 C  CD2 . TYR A 1 181 ? 25.126 -5.365  19.384 1.00 27.38 ? 182  TYR A CD2 1 
ATOM   1426 C  CE1 . TYR A 1 181 ? 27.212 -3.856  18.420 1.00 43.31 ? 182  TYR A CE1 1 
ATOM   1427 C  CE2 . TYR A 1 181 ? 25.073 -4.880  18.097 1.00 34.01 ? 182  TYR A CE2 1 
ATOM   1428 C  CZ  . TYR A 1 181 ? 26.116 -4.126  17.620 1.00 42.42 ? 182  TYR A CZ  1 
ATOM   1429 O  OH  . TYR A 1 181 ? 26.051 -3.644  16.324 1.00 53.15 ? 182  TYR A OH  1 
ATOM   1430 N  N   . GLN A 1 182 ? 25.942 -2.312  22.344 1.00 14.58 ? 183  GLN A N   1 
ATOM   1431 C  CA  . GLN A 1 182 ? 25.066 -1.155  22.477 1.00 15.36 ? 183  GLN A CA  1 
ATOM   1432 C  C   . GLN A 1 182 ? 24.987 -0.387  21.174 1.00 12.66 ? 183  GLN A C   1 
ATOM   1433 O  O   . GLN A 1 182 ? 25.991 -0.313  20.441 1.00 14.40 ? 183  GLN A O   1 
ATOM   1434 C  CB  . GLN A 1 182 ? 25.681 -0.345  23.608 1.00 17.48 ? 183  GLN A CB  1 
ATOM   1435 C  CG  . GLN A 1 182 ? 25.246 1.040   23.848 1.00 21.19 ? 183  GLN A CG  1 
ATOM   1436 C  CD  . GLN A 1 182 ? 26.195 1.815   24.757 1.00 22.41 ? 183  GLN A CD  1 
ATOM   1437 O  OE1 . GLN A 1 182 ? 26.790 1.278   25.686 1.00 23.79 ? 183  GLN A OE1 1 
ATOM   1438 N  NE2 . GLN A 1 182 ? 26.287 3.098   24.429 1.00 23.99 ? 183  GLN A NE2 1 
ATOM   1439 N  N   . GLN A 1 183 ? 23.819 0.179   20.943 1.00 13.71 ? 184  GLN A N   1 
ATOM   1440 C  CA  . GLN A 1 183 ? 23.640 1.016   19.760 1.00 14.00 ? 184  GLN A CA  1 
ATOM   1441 C  C   . GLN A 1 183 ? 22.933 2.302   20.179 1.00 13.88 ? 184  GLN A C   1 
ATOM   1442 O  O   . GLN A 1 183 ? 21.980 2.234   20.955 1.00 16.51 ? 184  GLN A O   1 
ATOM   1443 C  CB  . GLN A 1 183 ? 22.850 0.271   18.700 1.00 21.18 ? 184  GLN A CB  1 
ATOM   1444 C  CG  . GLN A 1 183 ? 22.777 0.918   17.324 1.00 39.86 ? 184  GLN A CG  1 
ATOM   1445 C  CD  . GLN A 1 183 ? 22.231 -0.103  16.331 1.00 54.53 ? 184  GLN A CD  1 
ATOM   1446 O  OE1 . GLN A 1 183 ? 21.173 0.108   15.728 1.00 77.99 ? 184  GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A 1 183 ? 22.977 -1.203  16.201 1.00 70.23 ? 184  GLN A NE2 1 
ATOM   1448 N  N   . ASN A 1 184 ? 23.374 3.453   19.699 1.00 13.98 ? 185  ASN A N   1 
ATOM   1449 C  CA  . ASN A 1 184 ? 22.699 4.720   19.988 1.00 13.98 ? 185  ASN A CA  1 
ATOM   1450 C  C   . ASN A 1 184 ? 22.331 5.421   18.696 1.00 13.76 ? 185  ASN A C   1 
ATOM   1451 O  O   . ASN A 1 184 ? 23.136 5.460   17.758 1.00 15.41 ? 185  ASN A O   1 
ATOM   1452 C  CB  . ASN A 1 184 ? 23.630 5.632   20.756 1.00 15.15 ? 185  ASN A CB  1 
ATOM   1453 C  CG  . ASN A 1 184 ? 24.110 5.098   22.061 1.00 15.58 ? 185  ASN A CG  1 
ATOM   1454 O  OD1 . ASN A 1 184 ? 24.715 4.040   22.143 1.00 25.11 ? 185  ASN A OD1 1 
ATOM   1455 N  ND2 . ASN A 1 184 ? 23.931 5.854   23.118 1.00 18.52 ? 185  ASN A ND2 1 
ATOM   1456 N  N   . THR A 1 185 ? 21.147 5.982   18.680 1.00 14.62 ? 186  THR A N   1 
ATOM   1457 C  CA  . THR A 1 185 ? 20.551 6.651   17.530 1.00 15.59 ? 186  THR A CA  1 
ATOM   1458 C  C   . THR A 1 185 ? 19.913 7.955   17.953 1.00 15.35 ? 186  THR A C   1 
ATOM   1459 O  O   . THR A 1 185 ? 19.171 8.004   18.947 1.00 18.44 ? 186  THR A O   1 
ATOM   1460 C  CB  . THR A 1 185 ? 19.478 5.702   16.926 1.00 23.38 ? 186  THR A CB  1 
ATOM   1461 O  OG1 . THR A 1 185 ? 20.078 4.452   16.562 1.00 35.50 ? 186  THR A OG1 1 
ATOM   1462 C  CG2 . THR A 1 185 ? 18.921 6.263   15.637 1.00 36.42 ? 186  THR A CG2 1 
ATOM   1463 N  N   . PRO A 1 186 ? 20.183 9.060   17.261 1.00 14.48 ? 187  PRO A N   1 
ATOM   1464 C  CA  . PRO A 1 186 ? 19.614 10.323  17.721 1.00 15.49 ? 187  PRO A CA  1 
ATOM   1465 C  C   . PRO A 1 186 ? 18.094 10.334  17.559 1.00 15.97 ? 187  PRO A C   1 
ATOM   1466 O  O   . PRO A 1 186 ? 17.540 9.726   16.651 1.00 18.90 ? 187  PRO A O   1 
ATOM   1467 C  CB  . PRO A 1 186 ? 20.234 11.355  16.794 1.00 16.98 ? 187  PRO A CB  1 
ATOM   1468 C  CG  . PRO A 1 186 ? 21.013 10.655  15.760 1.00 19.84 ? 187  PRO A CG  1 
ATOM   1469 C  CD  . PRO A 1 186 ? 21.038 9.198   16.070 1.00 15.56 ? 187  PRO A CD  1 
ATOM   1470 N  N   . ILE A 1 187 ? 17.477 11.083  18.460 1.00 15.63 ? 188  ILE A N   1 
ATOM   1471 C  CA  . ILE A 1 187 ? 16.045 11.316  18.428 1.00 16.20 ? 188  ILE A CA  1 
ATOM   1472 C  C   . ILE A 1 187 ? 15.681 12.499  17.537 1.00 17.73 ? 188  ILE A C   1 
ATOM   1473 O  O   . ILE A 1 187 ? 14.670 12.430  16.824 1.00 21.40 ? 188  ILE A O   1 
ATOM   1474 C  CB  . ILE A 1 187 ? 15.552 11.536  19.872 1.00 17.16 ? 188  ILE A CB  1 
ATOM   1475 C  CG1 . ILE A 1 187 ? 15.736 10.260  20.692 1.00 18.30 ? 188  ILE A CG1 1 
ATOM   1476 C  CG2 . ILE A 1 187 ? 14.131 12.060  19.887 1.00 23.66 ? 188  ILE A CG2 1 
ATOM   1477 C  CD1 . ILE A 1 187 ? 15.495 10.384  22.167 1.00 22.36 ? 188  ILE A CD1 1 
ATOM   1478 N  N   . GLY A 1 188 ? 16.490 13.552  17.568 1.00 17.86 ? 189  GLY A N   1 
ATOM   1479 C  CA  . GLY A 1 188 ? 16.235 14.711  16.741 1.00 21.71 ? 189  GLY A CA  1 
ATOM   1480 C  C   . GLY A 1 188 ? 16.670 14.579  15.291 1.00 24.59 ? 189  GLY A C   1 
ATOM   1481 O  O   . GLY A 1 188 ? 17.233 13.560  14.901 1.00 24.46 ? 189  GLY A O   1 
ATOM   1482 N  N   . ASP A 1 189 ? 16.434 15.604  14.471 1.00 28.13 ? 190  ASP A N   1 
ATOM   1483 C  CA  . ASP A 1 189 ? 16.768 15.719  13.067 1.00 34.05 ? 190  ASP A CA  1 
ATOM   1484 C  C   . ASP A 1 189 ? 18.037 16.503  12.776 1.00 36.07 ? 190  ASP A C   1 
ATOM   1485 O  O   . ASP A 1 189 ? 18.494 16.575  11.636 1.00 36.04 ? 190  ASP A O   1 
ATOM   1486 C  CB  . ASP A 1 189 ? 15.637 16.445  12.308 1.00 41.25 ? 190  ASP A CB  1 
ATOM   1487 C  CG  . ASP A 1 189 ? 14.703 15.399  11.738 1.00 48.05 ? 190  ASP A CG  1 
ATOM   1488 O  OD1 . ASP A 1 189 ? 15.023 14.897  10.636 1.00 71.94 ? 190  ASP A OD1 1 
ATOM   1489 O  OD2 . ASP A 1 189 ? 13.681 15.099  12.396 1.00 59.90 ? 190  ASP A OD2 1 
ATOM   1490 N  N   . GLY A 1 190 ? 18.602 17.123  13.811 1.00 30.68 ? 191  GLY A N   1 
ATOM   1491 C  CA  . GLY A 1 190 ? 19.817 17.902  13.566 1.00 29.79 ? 191  GLY A CA  1 
ATOM   1492 C  C   . GLY A 1 190 ? 21.022 17.016  13.415 1.00 26.11 ? 191  GLY A C   1 
ATOM   1493 O  O   . GLY A 1 190 ? 21.051 15.804  13.646 1.00 21.91 ? 191  GLY A O   1 
ATOM   1494 N  N   . PRO A 1 191 ? 22.107 17.650  13.015 1.00 21.33 ? 192  PRO A N   1 
ATOM   1495 C  CA  . PRO A 1 191 ? 23.310 16.851  12.800 1.00 18.12 ? 192  PRO A CA  1 
ATOM   1496 C  C   . PRO A 1 191 ? 23.965 16.478  14.130 1.00 16.91 ? 192  PRO A C   1 
ATOM   1497 O  O   . PRO A 1 191 ? 23.866 17.217  15.110 1.00 18.22 ? 192  PRO A O   1 
ATOM   1498 C  CB  . PRO A 1 191 ? 24.225 17.816  12.052 1.00 19.22 ? 192  PRO A CB  1 
ATOM   1499 C  CG  . PRO A 1 191 ? 23.772 19.151  12.504 1.00 21.67 ? 192  PRO A CG  1 
ATOM   1500 C  CD  . PRO A 1 191 ? 22.299 19.076  12.790 1.00 22.53 ? 192  PRO A CD  1 
ATOM   1501 N  N   . VAL A 1 192 ? 24.646 15.353  14.141 1.00 15.66 ? 193  VAL A N   1 
ATOM   1502 C  CA  . VAL A 1 192 ? 25.370 14.802  15.269 1.00 14.84 ? 193  VAL A CA  1 
ATOM   1503 C  C   . VAL A 1 192 ? 26.801 14.569  14.810 1.00 14.84 ? 193  VAL A C   1 
ATOM   1504 O  O   . VAL A 1 192 ? 27.081 14.570  13.599 1.00 14.87 ? 193  VAL A O   1 
ATOM   1505 C  CB  . VAL A 1 192 ? 24.738 13.498  15.790 1.00 13.85 ? 193  VAL A CB  1 
ATOM   1506 C  CG1 . VAL A 1 192 ? 23.302 13.710  16.274 1.00 16.26 ? 193  VAL A CG1 1 
ATOM   1507 C  CG2 . VAL A 1 192 ? 24.788 12.406  14.717 1.00 18.45 ? 193  VAL A CG2 1 
ATOM   1508 N  N   . LEU A 1 193 ? 27.665 14.387  15.781 1.00 13.30 ? 194  LEU A N   1 
ATOM   1509 C  CA  . LEU A 1 193 ? 29.062 14.055  15.495 1.00 13.72 ? 194  LEU A CA  1 
ATOM   1510 C  C   . LEU A 1 193 ? 29.200 12.544  15.389 1.00 14.47 ? 194  LEU A C   1 
ATOM   1511 O  O   . LEU A 1 193 ? 28.776 11.812  16.277 1.00 17.37 ? 194  LEU A O   1 
ATOM   1512 C  CB  . LEU A 1 193 ? 30.001 14.590  16.566 1.00 14.88 ? 194  LEU A CB  1 
ATOM   1513 C  CG  . LEU A 1 193 ? 29.947 16.103  16.754 1.00 13.83 ? 194  LEU A CG  1 
ATOM   1514 C  CD1 . LEU A 1 193 ? 30.746 16.489  17.969 1.00 17.71 ? 194  LEU A CD1 1 
ATOM   1515 C  CD2 . LEU A 1 193 ? 30.461 16.800  15.512 1.00 19.42 ? 194  LEU A CD2 1 
ATOM   1516 N  N   . LEU A 1 194 ? 29.799 12.098  14.288 1.00 15.14 ? 195  LEU A N   1 
ATOM   1517 C  CA  . LEU A 1 194 ? 30.087 10.690  14.087 1.00 15.06 ? 195  LEU A CA  1 
ATOM   1518 C  C   . LEU A 1 194 ? 31.583 10.477  14.275 1.00 15.26 ? 195  LEU A C   1 
ATOM   1519 O  O   . LEU A 1 194 ? 32.403 11.005  13.514 1.00 20.18 ? 195  LEU A O   1 
ATOM   1520 C  CB  . LEU A 1 194 ? 29.629 10.223  12.709 1.00 16.02 ? 195  LEU A CB  1 
ATOM   1521 C  CG  . LEU A 1 194 ? 28.139 10.449  12.437 1.00 17.80 ? 195  LEU A CG  1 
ATOM   1522 C  CD1 . LEU A 1 194 ? 27.843 10.100  11.003 1.00 23.26 ? 195  LEU A CD1 1 
ATOM   1523 C  CD2 . LEU A 1 194 ? 27.320 9.633   13.404 1.00 20.81 ? 195  LEU A CD2 1 
ATOM   1524 N  N   . PRO A 1 195 ? 31.922 9.746   15.323 1.00 14.59 ? 196  PRO A N   1 
ATOM   1525 C  CA  . PRO A 1 195 ? 33.320 9.691   15.732 1.00 13.06 ? 196  PRO A CA  1 
ATOM   1526 C  C   . PRO A 1 195 ? 34.181 8.678   15.004 1.00 14.70 ? 196  PRO A C   1 
ATOM   1527 O  O   . PRO A 1 195 ? 33.711 7.696   14.451 1.00 15.19 ? 196  PRO A O   1 
ATOM   1528 C  CB  . PRO A 1 195 ? 33.197 9.175   17.176 1.00 15.17 ? 196  PRO A CB  1 
ATOM   1529 C  CG  . PRO A 1 195 ? 31.997 8.248   17.116 1.00 16.06 ? 196  PRO A CG  1 
ATOM   1530 C  CD  . PRO A 1 195 ? 31.021 8.956   16.188 1.00 14.54 ? 196  PRO A CD  1 
ATOM   1531 N  N   . ASP A 1 196 ? 35.485 8.941   15.067 1.00 14.20 ? 197  ASP A N   1 
ATOM   1532 C  CA  . ASP A 1 196 ? 36.437 7.900   14.733 1.00 12.63 ? 197  ASP A CA  1 
ATOM   1533 C  C   . ASP A 1 196 ? 36.459 6.909   15.905 1.00 15.15 ? 197  ASP A C   1 
ATOM   1534 O  O   . ASP A 1 196 ? 35.994 7.204   17.003 1.00 15.62 ? 197  ASP A O   1 
ATOM   1535 C  CB  . ASP A 1 196 ? 37.839 8.416   14.479 1.00 15.98 ? 197  ASP A CB  1 
ATOM   1536 C  CG  . ASP A 1 196 ? 37.997 9.204   13.198 1.00 17.09 ? 197  ASP A CG  1 
ATOM   1537 O  OD1 . ASP A 1 196 ? 38.976 9.979   13.105 1.00 22.60 ? 197  ASP A OD1 1 
ATOM   1538 O  OD2 . ASP A 1 196 ? 37.181 9.062   12.266 1.00 21.03 ? 197  ASP A OD2 1 
ATOM   1539 N  N   . ASN A 1 197 ? 36.999 5.726   15.666 1.00 14.64 ? 198  ASN A N   1 
ATOM   1540 C  CA  . ASN A 1 197 ? 37.125 4.713   16.704 1.00 15.23 ? 198  ASN A CA  1 
ATOM   1541 C  C   . ASN A 1 197 ? 37.923 5.286   17.878 1.00 15.11 ? 198  ASN A C   1 
ATOM   1542 O  O   . ASN A 1 197 ? 38.991 5.884   17.724 1.00 15.91 ? 198  ASN A O   1 
ATOM   1543 C  CB  . ASN A 1 197 ? 37.832 3.464   16.187 1.00 14.86 ? 198  ASN A CB  1 
ATOM   1544 C  CG  . ASN A 1 197 ? 37.010 2.725   15.156 1.00 17.26 ? 198  ASN A CG  1 
ATOM   1545 O  OD1 . ASN A 1 197 ? 35.889 3.080   14.827 1.00 18.39 ? 198  ASN A OD1 1 
ATOM   1546 N  ND2 . ASN A 1 197 ? 37.622 1.648   14.668 1.00 25.13 ? 198  ASN A ND2 1 
ATOM   1547 N  N   . HIS A 1 198 ? 37.359 5.049   19.054 1.00 14.33 ? 199  HIS A N   1 
ATOM   1548 C  CA  . HIS A 1 198 ? 37.987 5.464   20.300 1.00 13.08 ? 199  HIS A CA  1 
ATOM   1549 C  C   . HIS A 1 198 ? 37.367 4.677   21.447 1.00 14.36 ? 199  HIS A C   1 
ATOM   1550 O  O   . HIS A 1 198 ? 36.533 3.803   21.235 1.00 14.84 ? 199  HIS A O   1 
ATOM   1551 C  CB  . HIS A 1 198 ? 37.849 6.964   20.491 1.00 13.98 ? 199  HIS A CB  1 
ATOM   1552 C  CG  . HIS A 1 198 ? 36.476 7.468   20.773 1.00 13.18 ? 199  HIS A CG  1 
ATOM   1553 N  ND1 . HIS A 1 198 ? 35.520 7.613   19.791 1.00 14.34 ? 199  HIS A ND1 1 
ATOM   1554 C  CD2 . HIS A 1 198 ? 35.882 7.869   21.918 1.00 13.63 ? 199  HIS A CD2 1 
ATOM   1555 C  CE1 . HIS A 1 198 ? 34.403 8.082   20.318 1.00 13.36 ? 199  HIS A CE1 1 
ATOM   1556 N  NE2 . HIS A 1 198 ? 34.595 8.253   21.608 1.00 12.50 ? 199  HIS A NE2 1 
ATOM   1557 N  N   . TYR A 1 199 ? 37.772 5.009   22.666 1.00 14.83 ? 200  TYR A N   1 
ATOM   1558 C  CA  . TYR A 1 199 ? 37.135 4.354   23.805 1.00 14.70 ? 200  TYR A CA  1 
ATOM   1559 C  C   . TYR A 1 199 ? 36.934 5.322   24.960 1.00 13.88 ? 200  TYR A C   1 
ATOM   1560 O  O   . TYR A 1 199 ? 37.544 6.394   25.035 1.00 13.60 ? 200  TYR A O   1 
ATOM   1561 C  CB  . TYR A 1 199 ? 37.957 3.172   24.290 1.00 15.85 ? 200  TYR A CB  1 
ATOM   1562 C  CG  . TYR A 1 199 ? 39.348 3.459   24.770 1.00 17.08 ? 200  TYR A CG  1 
ATOM   1563 C  CD1 . TYR A 1 199 ? 39.554 3.606   26.133 1.00 17.91 ? 200  TYR A CD1 1 
ATOM   1564 C  CD2 . TYR A 1 199 ? 40.405 3.570   23.881 1.00 20.04 ? 200  TYR A CD2 1 
ATOM   1565 C  CE1 . TYR A 1 199 ? 40.833 3.872   26.595 1.00 18.93 ? 200  TYR A CE1 1 
ATOM   1566 C  CE2 . TYR A 1 199 ? 41.684 3.834   24.349 1.00 19.22 ? 200  TYR A CE2 1 
ATOM   1567 C  CZ  . TYR A 1 199 ? 41.875 3.978   25.704 1.00 20.43 ? 200  TYR A CZ  1 
ATOM   1568 O  OH  . TYR A 1 199 ? 43.145 4.243   26.191 1.00 23.98 ? 200  TYR A OH  1 
ATOM   1569 N  N   . LEU A 1 200 ? 36.074 4.894   25.865 1.00 14.50 ? 201  LEU A N   1 
ATOM   1570 C  CA  . LEU A 1 200 ? 35.817 5.562   27.125 1.00 13.96 ? 201  LEU A CA  1 
ATOM   1571 C  C   . LEU A 1 200 ? 36.449 4.704   28.225 1.00 16.55 ? 201  LEU A C   1 
ATOM   1572 O  O   . LEU A 1 200 ? 36.143 3.537   28.346 1.00 15.29 ? 201  LEU A O   1 
ATOM   1573 C  CB  . LEU A 1 200 ? 34.320 5.776   27.360 1.00 12.85 ? 201  LEU A CB  1 
ATOM   1574 C  CG  . LEU A 1 200 ? 33.506 6.454   26.258 1.00 13.78 ? 201  LEU A CG  1 
ATOM   1575 C  CD1 . LEU A 1 200 ? 32.023 6.498   26.615 1.00 17.04 ? 201  LEU A CD1 1 
ATOM   1576 C  CD2 . LEU A 1 200 ? 34.001 7.870   25.948 1.00 16.40 ? 201  LEU A CD2 1 
ATOM   1577 N  N   . SER A 1 201 ? 37.337 5.344   28.961 1.00 13.00 ? 202  SER A N   1 
ATOM   1578 C  CA  . SER A 1 201 ? 37.952 4.745   30.140 1.00 13.97 ? 202  SER A CA  1 
ATOM   1579 C  C   . SER A 1 201 ? 37.102 5.071   31.365 1.00 15.24 ? 202  SER A C   1 
ATOM   1580 O  O   . SER A 1 201 ? 36.943 6.252   31.661 1.00 14.42 ? 202  SER A O   1 
ATOM   1581 C  CB  . SER A 1 201 ? 39.378 5.298   30.270 1.00 17.22 ? 202  SER A CB  1 
ATOM   1582 O  OG  . SER A 1 201 ? 39.997 4.858   31.468 1.00 19.48 ? 202  SER A OG  1 
ATOM   1583 N  N   . THR A 1 202 ? 36.576 4.035   32.032 1.00 15.11 ? 203  THR A N   1 
ATOM   1584 C  CA  . THR A 1 202 ? 35.644 4.231   33.137 1.00 16.10 ? 203  THR A CA  1 
ATOM   1585 C  C   . THR A 1 202 ? 36.224 3.638   34.418 1.00 17.33 ? 203  THR A C   1 
ATOM   1586 O  O   . THR A 1 202 ? 36.902 2.618   34.452 1.00 20.25 ? 203  THR A O   1 
ATOM   1587 C  CB  . THR A 1 202 ? 34.292 3.559   32.871 1.00 20.33 ? 203  THR A CB  1 
ATOM   1588 O  OG1 . THR A 1 202 ? 34.462 2.128   32.981 1.00 28.44 ? 203  THR A OG1 1 
ATOM   1589 C  CG2 . THR A 1 202 ? 33.847 3.887   31.470 1.00 18.49 ? 203  THR A CG2 1 
ATOM   1590 N  N   . GLN A 1 203 ? 35.919 4.324   35.502 1.00 15.26 ? 204  GLN A N   1 
ATOM   1591 C  CA  . GLN A 1 203 ? 36.206 3.869   36.845 1.00 14.77 ? 204  GLN A CA  1 
ATOM   1592 C  C   . GLN A 1 203 ? 34.969 4.152   37.693 1.00 15.90 ? 204  GLN A C   1 
ATOM   1593 O  O   . GLN A 1 203 ? 34.412 5.236   37.571 1.00 16.55 ? 204  GLN A O   1 
ATOM   1594 C  CB  . GLN A 1 203 ? 37.447 4.578   37.375 1.00 20.50 ? 204  GLN A CB  1 
ATOM   1595 C  CG  . GLN A 1 203 ? 38.717 4.232   36.630 1.00 26.19 ? 204  GLN A CG  1 
ATOM   1596 C  CD  . GLN A 1 203 ? 39.064 4.995   35.385 1.00 36.06 ? 204  GLN A CD  1 
ATOM   1597 O  OE1 . GLN A 1 203 ? 39.589 4.413   34.418 1.00 40.63 ? 204  GLN A OE1 1 
ATOM   1598 N  NE2 . GLN A 1 203 ? 38.808 6.305   35.319 1.00 40.34 ? 204  GLN A NE2 1 
ATOM   1599 N  N   . SER A 1 204 ? 34.561 3.215   38.534 1.00 17.09 ? 205  SER A N   1 
ATOM   1600 C  CA  . SER A 1 204 ? 33.333 3.292   39.295 1.00 16.61 ? 205  SER A CA  1 
ATOM   1601 C  C   . SER A 1 204 ? 33.556 2.753   40.707 1.00 18.25 ? 205  SER A C   1 
ATOM   1602 O  O   . SER A 1 204 ? 34.216 1.710   40.886 1.00 19.46 ? 205  SER A O   1 
ATOM   1603 C  CB  . SER A 1 204 ? 32.214 2.468   38.667 1.00 21.49 ? 205  SER A CB  1 
ATOM   1604 O  OG  . SER A 1 204 ? 32.061 2.725   37.273 1.00 22.98 ? 205  SER A OG  1 
ATOM   1605 N  N   . ALA A 1 205 ? 32.984 3.485   41.647 1.00 14.97 ? 206  ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 205 ? 33.014 3.097   43.058 1.00 14.01 ? 206  ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 205 ? 31.596 3.030   43.612 1.00 13.34 ? 206  ALA A C   1 
ATOM   1608 O  O   . ALA A 1 205 ? 30.842 3.994   43.490 1.00 13.22 ? 206  ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 205 ? 33.842 4.062   43.904 1.00 18.80 ? 206  ALA A CB  1 
ATOM   1610 N  N   . LEU A 1 206 ? 31.281 1.899   44.191 1.00 12.44 ? 207  LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 206 ? 29.960 1.645   44.733 1.00 12.18 ? 207  LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 206 ? 30.009 1.762   46.252 1.00 13.65 ? 207  LEU A C   1 
ATOM   1613 O  O   . LEU A 1 206 ? 30.926 1.271   46.901 1.00 16.20 ? 207  LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 206 ? 29.434 0.270   44.343 1.00 12.64 ? 207  LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 206 ? 29.548 -0.206  42.892 1.00 14.44 ? 207  LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 206 ? 28.729 -1.481  42.670 1.00 17.09 ? 207  LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 206 ? 29.125 0.837   41.881 1.00 19.51 ? 207  LEU A CD2 1 
ATOM   1618 N  N   . SER A 1 207 ? 28.975 2.372   46.813 1.00 11.89 ? 208  SER A N   1 
ATOM   1619 C  CA  . SER A 1 207 ? 28.916 2.502   48.273 1.00 11.53 ? 208  SER A CA  1 
ATOM   1620 C  C   . SER A 1 207 ? 27.476 2.483   48.758 1.00 12.79 ? 208  SER A C   1 
ATOM   1621 O  O   . SER A 1 207 ? 26.570 2.357   47.952 1.00 12.32 ? 208  SER A O   1 
ATOM   1622 C  CB  . SER A 1 207 ? 29.656 3.761   48.697 1.00 13.39 ? 208  SER A CB  1 
ATOM   1623 O  OG  . SER A 1 207 ? 29.056 4.930   48.172 1.00 13.40 ? 208  SER A OG  1 
ATOM   1624 N  N   . LYS A 1 208 ? 27.313 2.598   50.073 1.00 14.35 ? 209  LYS A N   1 
ATOM   1625 C  CA  . LYS A 1 208 ? 25.989 2.708   50.681 1.00 15.36 ? 209  LYS A CA  1 
ATOM   1626 C  C   . LYS A 1 208 ? 25.865 3.995   51.485 1.00 16.84 ? 209  LYS A C   1 
ATOM   1627 O  O   . LYS A 1 208 ? 26.868 4.513   51.995 1.00 22.35 ? 209  LYS A O   1 
ATOM   1628 C  CB  . LYS A 1 208 ? 25.713 1.514   51.592 1.00 15.80 ? 209  LYS A CB  1 
ATOM   1629 C  CG  . LYS A 1 208 ? 25.800 0.173   50.891 1.00 15.79 ? 209  LYS A CG  1 
ATOM   1630 C  CD  . LYS A 1 208 ? 24.609 -0.113  49.985 1.00 16.91 ? 209  LYS A CD  1 
ATOM   1631 C  CE  . LYS A 1 208 ? 24.731 -1.552  49.489 1.00 16.75 ? 209  LYS A CE  1 
ATOM   1632 N  NZ  . LYS A 1 208 ? 23.668 -1.846  48.459 1.00 14.22 ? 209  LYS A NZ  1 
ATOM   1633 N  N   . ASP A 1 209 ? 24.644 4.489   51.597 1.00 16.35 ? 210  ASP A N   1 
ATOM   1634 C  CA  . ASP A 1 209 ? 24.322 5.623   52.479 1.00 17.94 ? 210  ASP A CA  1 
ATOM   1635 C  C   . ASP A 1 209 ? 23.990 5.022   53.833 1.00 19.26 ? 210  ASP A C   1 
ATOM   1636 O  O   . ASP A 1 209 ? 23.063 4.223   53.979 1.00 19.66 ? 210  ASP A O   1 
ATOM   1637 C  CB  . ASP A 1 209 ? 23.200 6.425   51.872 1.00 19.19 ? 210  ASP A CB  1 
ATOM   1638 C  CG  . ASP A 1 209 ? 22.488 7.444   52.719 1.00 22.16 ? 210  ASP A CG  1 
ATOM   1639 O  OD1 . ASP A 1 209 ? 22.853 7.572   53.909 1.00 24.70 ? 210  ASP A OD1 1 
ATOM   1640 O  OD2 . ASP A 1 209 ? 21.554 8.112   52.153 1.00 25.66 ? 210  ASP A OD2 1 
ATOM   1641 N  N   . PRO A 1 210 ? 24.735 5.340   54.873 1.00 24.29 ? 211  PRO A N   1 
ATOM   1642 C  CA  . PRO A 1 210 ? 24.564 4.601   56.126 1.00 25.33 ? 211  PRO A CA  1 
ATOM   1643 C  C   . PRO A 1 210 ? 23.226 4.936   56.763 1.00 26.50 ? 211  PRO A C   1 
ATOM   1644 O  O   . PRO A 1 210 ? 22.843 4.269   57.719 1.00 30.42 ? 211  PRO A O   1 
ATOM   1645 C  CB  . PRO A 1 210 ? 25.695 5.138   56.992 1.00 29.48 ? 211  PRO A CB  1 
ATOM   1646 C  CG  . PRO A 1 210 ? 25.939 6.524   56.465 1.00 32.84 ? 211  PRO A CG  1 
ATOM   1647 C  CD  . PRO A 1 210 ? 25.750 6.392   54.967 1.00 29.23 ? 211  PRO A CD  1 
ATOM   1648 N  N   . ASN A 1 211 ? 22.498 5.937   56.267 1.00 26.55 ? 212  ASN A N   1 
ATOM   1649 C  CA  . ASN A 1 211 ? 21.212 6.204   56.934 1.00 27.62 ? 212  ASN A CA  1 
ATOM   1650 C  C   . ASN A 1 211 ? 20.038 5.599   56.179 1.00 26.82 ? 212  ASN A C   1 
ATOM   1651 O  O   . ASN A 1 211 ? 18.874 5.716   56.574 1.00 34.40 ? 212  ASN A O   1 
ATOM   1652 C  CB  . ASN A 1 211 ? 21.038 7.714   57.113 1.00 30.11 ? 212  ASN A CB  1 
ATOM   1653 C  CG  . ASN A 1 211 ? 22.037 8.279   58.109 1.00 35.44 ? 212  ASN A CG  1 
ATOM   1654 O  OD1 . ASN A 1 211 ? 22.330 7.670   59.138 1.00 37.60 ? 212  ASN A OD1 1 
ATOM   1655 N  ND2 . ASN A 1 211 ? 22.585 9.455   57.815 1.00 45.24 ? 212  ASN A ND2 1 
ATOM   1656 N  N   . GLU A 1 212 ? 20.322 4.934   55.055 1.00 19.77 ? 213  GLU A N   1 
ATOM   1657 C  CA  . GLU A 1 212 ? 19.264 4.443   54.185 1.00 15.75 ? 213  GLU A CA  1 
ATOM   1658 C  C   . GLU A 1 212 ? 18.911 2.988   54.448 1.00 15.06 ? 213  GLU A C   1 
ATOM   1659 O  O   . GLU A 1 212 ? 19.753 2.086   54.387 1.00 18.32 ? 213  GLU A O   1 
ATOM   1660 C  CB  . GLU A 1 212 ? 19.733 4.633   52.736 1.00 15.24 ? 213  GLU A CB  1 
ATOM   1661 C  CG  . GLU A 1 212 ? 18.791 4.185   51.640 1.00 16.52 ? 213  GLU A CG  1 
ATOM   1662 C  CD  . GLU A 1 212 ? 17.507 4.980   51.711 1.00 18.44 ? 213  GLU A CD  1 
ATOM   1663 O  OE1 . GLU A 1 212 ? 17.523 6.188   51.352 1.00 17.79 ? 213  GLU A OE1 1 
ATOM   1664 O  OE2 . GLU A 1 212 ? 16.515 4.387   52.172 1.00 15.62 ? 213  GLU A OE2 1 
ATOM   1665 N  N   . LYS A 1 213 ? 17.625 2.737   54.707 1.00 15.56 ? 214  LYS A N   1 
ATOM   1666 C  CA  . LYS A 1 213 ? 17.182 1.358   54.906 1.00 15.14 ? 214  LYS A CA  1 
ATOM   1667 C  C   . LYS A 1 213 ? 16.632 0.758   53.634 1.00 15.36 ? 214  LYS A C   1 
ATOM   1668 O  O   . LYS A 1 213 ? 16.501 -0.475  53.547 1.00 19.74 ? 214  LYS A O   1 
ATOM   1669 C  CB  . LYS A 1 213 ? 16.130 1.290   56.011 1.00 17.94 ? 214  LYS A CB  1 
ATOM   1670 C  CG  . LYS A 1 213 ? 16.739 1.681   57.352 1.00 24.80 ? 214  LYS A CG  1 
ATOM   1671 C  CD  . LYS A 1 213 ? 15.593 2.072   58.279 1.00 37.13 ? 214  LYS A CD  1 
ATOM   1672 C  CE  . LYS A 1 213 ? 16.038 2.220   59.723 1.00 42.99 ? 214  LYS A CE  1 
ATOM   1673 N  NZ  . LYS A 1 213 ? 15.465 1.112   60.563 1.00 56.93 ? 214  LYS A NZ  1 
ATOM   1674 N  N   . ARG A 1 214 ? 16.278 1.557   52.636 1.00 16.18 ? 215  ARG A N   1 
ATOM   1675 C  CA  . ARG A 1 214 ? 15.843 0.934   51.393 1.00 14.28 ? 215  ARG A CA  1 
ATOM   1676 C  C   . ARG A 1 214 ? 17.005 0.291   50.667 1.00 14.07 ? 215  ARG A C   1 
ATOM   1677 O  O   . ARG A 1 214 ? 18.165 0.637   50.882 1.00 14.06 ? 215  ARG A O   1 
ATOM   1678 C  CB  . ARG A 1 214 ? 15.198 1.992   50.481 1.00 12.66 ? 215  ARG A CB  1 
ATOM   1679 C  CG  . ARG A 1 214 ? 13.904 2.504   51.104 1.00 14.63 ? 215  ARG A CG  1 
ATOM   1680 C  CD  . ARG A 1 214 ? 13.374 3.732   50.397 1.00 14.68 ? 215  ARG A CD  1 
ATOM   1681 N  NE  . ARG A 1 214 ? 14.270 4.871   50.635 1.00 14.94 ? 215  ARG A NE  1 
ATOM   1682 C  CZ  . ARG A 1 214 ? 14.093 6.088   50.134 1.00 13.77 ? 215  ARG A CZ  1 
ATOM   1683 N  NH1 . ARG A 1 214 ? 13.044 6.340   49.351 1.00 15.86 ? 215  ARG A NH1 1 
ATOM   1684 N  NH2 . ARG A 1 214 ? 14.955 7.044   50.411 1.00 17.11 ? 215  ARG A NH2 1 
ATOM   1685 N  N   . ASP A 1 215 ? 16.688 -0.644  49.781 1.00 13.12 ? 216  ASP A N   1 
ATOM   1686 C  CA  . ASP A 1 215 ? 17.724 -1.223  48.925 1.00 11.54 ? 216  ASP A CA  1 
ATOM   1687 C  C   . ASP A 1 215 ? 18.205 -0.167  47.936 1.00 11.32 ? 216  ASP A C   1 
ATOM   1688 O  O   . ASP A 1 215 ? 17.365 0.425   47.242 1.00 12.06 ? 216  ASP A O   1 
ATOM   1689 C  CB  . ASP A 1 215 ? 17.159 -2.470  48.268 1.00 12.93 ? 216  ASP A CB  1 
ATOM   1690 C  CG  . ASP A 1 215 ? 18.166 -3.477  47.757 1.00 15.89 ? 216  ASP A CG  1 
ATOM   1691 O  OD1 . ASP A 1 215 ? 19.387 -3.232  47.869 1.00 13.59 ? 216  ASP A OD1 1 
ATOM   1692 O  OD2 . ASP A 1 215 ? 17.736 -4.522  47.220 1.00 19.72 ? 216  ASP A OD2 1 
ATOM   1693 N  N   . HIS A 1 216 ? 19.536 0.075   47.904 1.00 12.13 ? 217  HIS A N   1 
ATOM   1694 C  CA  . HIS A 1 216 ? 20.020 1.227   47.149 1.00 10.91 ? 217  HIS A CA  1 
ATOM   1695 C  C   . HIS A 1 216 ? 21.484 1.076   46.767 1.00 11.92 ? 217  HIS A C   1 
ATOM   1696 O  O   . HIS A 1 216 ? 22.154 0.171   47.277 1.00 10.98 ? 217  HIS A O   1 
ATOM   1697 C  CB  . HIS A 1 216 ? 19.841 2.518   47.964 1.00 11.32 ? 217  HIS A CB  1 
ATOM   1698 C  CG  . HIS A 1 216 ? 20.825 2.573   49.098 1.00 11.94 ? 217  HIS A CG  1 
ATOM   1699 N  ND1 . HIS A 1 216 ? 20.678 1.826   50.245 1.00 14.19 ? 217  HIS A ND1 1 
ATOM   1700 C  CD2 . HIS A 1 216 ? 21.959 3.268   49.256 1.00 13.51 ? 217  HIS A CD2 1 
ATOM   1701 C  CE1 . HIS A 1 216 ? 21.699 2.075   51.063 1.00 13.71 ? 217  HIS A CE1 1 
ATOM   1702 N  NE2 . HIS A 1 216 ? 22.504 2.956   50.488 1.00 13.34 ? 217  HIS A NE2 1 
ATOM   1703 N  N   . MET A 1 217 ? 21.919 1.984   45.919 1.00 10.93 ? 218  MET A N   1 
ATOM   1704 C  CA  . MET A 1 217 ? 23.303 2.024   45.483 1.00 10.96 ? 218  MET A CA  1 
ATOM   1705 C  C   . MET A 1 217 ? 23.750 3.484   45.308 1.00 10.25 ? 218  MET A C   1 
ATOM   1706 O  O   . MET A 1 217 ? 23.082 4.229   44.590 1.00 11.66 ? 218  MET A O   1 
ATOM   1707 C  CB  . MET A 1 217 ? 23.515 1.273   44.171 1.00 11.55 ? 218  MET A CB  1 
ATOM   1708 C  CG  . MET A 1 217 ? 24.874 1.468   43.511 1.00 13.29 ? 218  MET A CG  1 
ATOM   1709 S  SD  . MET A 1 217 ? 25.209 0.400   42.104 1.00 12.79 ? 218  MET A SD  1 
ATOM   1710 C  CE  . MET A 1 217 ? 24.187 1.218   40.859 1.00 13.63 ? 218  MET A CE  1 
ATOM   1711 N  N   . VAL A 1 218 ? 24.857 3.812   45.960 1.00 10.96 ? 219  VAL A N   1 
ATOM   1712 C  CA  . VAL A 1 218 ? 25.544 5.076   45.741 1.00 10.58 ? 219  VAL A CA  1 
ATOM   1713 C  C   . VAL A 1 218 ? 26.713 4.807   44.798 1.00 11.27 ? 219  VAL A C   1 
ATOM   1714 O  O   . VAL A 1 218 ? 27.516 3.903   44.999 1.00 13.36 ? 219  VAL A O   1 
ATOM   1715 C  CB  . VAL A 1 218 ? 25.992 5.735   47.040 1.00 12.26 ? 219  VAL A CB  1 
ATOM   1716 C  CG1 . VAL A 1 218 ? 26.697 7.067   46.826 1.00 14.55 ? 219  VAL A CG1 1 
ATOM   1717 C  CG2 . VAL A 1 218 ? 24.796 5.953   47.964 1.00 16.69 ? 219  VAL A CG2 1 
ATOM   1718 N  N   . LEU A 1 219 ? 26.790 5.612   43.746 1.00 11.17 ? 220  LEU A N   1 
ATOM   1719 C  CA  . LEU A 1 219 ? 27.796 5.469   42.691 1.00 11.81 ? 220  LEU A CA  1 
ATOM   1720 C  C   . LEU A 1 219 ? 28.561 6.752   42.461 1.00 12.41 ? 220  LEU A C   1 
ATOM   1721 O  O   . LEU A 1 219 ? 27.982 7.843   42.352 1.00 12.60 ? 220  LEU A O   1 
ATOM   1722 C  CB  . LEU A 1 219 ? 27.059 5.065   41.417 1.00 14.50 ? 220  LEU A CB  1 
ATOM   1723 C  CG  . LEU A 1 219 ? 27.812 4.875   40.127 1.00 17.38 ? 220  LEU A CG  1 
ATOM   1724 C  CD1 . LEU A 1 219 ? 28.814 3.725   40.264 1.00 21.51 ? 220  LEU A CD1 1 
ATOM   1725 C  CD2 . LEU A 1 219 ? 26.840 4.616   38.976 1.00 27.00 ? 220  LEU A CD2 1 
ATOM   1726 N  N   . LEU A 1 220 ? 29.863 6.631   42.349 1.00 12.18 ? 221  LEU A N   1 
ATOM   1727 C  CA  . LEU A 1 220 ? 30.787 7.688   41.946 1.00 12.94 ? 221  LEU A CA  1 
ATOM   1728 C  C   . LEU A 1 220 ? 31.483 7.152   40.705 1.00 12.91 ? 221  LEU A C   1 
ATOM   1729 O  O   . LEU A 1 220 ? 32.020 6.048   40.820 1.00 14.36 ? 221  LEU A O   1 
ATOM   1730 C  CB  . LEU A 1 220 ? 31.782 8.018   43.053 1.00 14.62 ? 221  LEU A CB  1 
ATOM   1731 C  CG  . LEU A 1 220 ? 32.989 8.871   42.671 1.00 15.81 ? 221  LEU A CG  1 
ATOM   1732 C  CD1 . LEU A 1 220 ? 32.499 10.254  42.261 1.00 19.06 ? 221  LEU A CD1 1 
ATOM   1733 C  CD2 . LEU A 1 220 ? 33.982 8.944   43.812 1.00 20.62 ? 221  LEU A CD2 1 
ATOM   1734 N  N   . GLU A 1 221 ? 31.453 7.865   39.593 1.00 12.97 ? 222  GLU A N   1 
ATOM   1735 C  CA  . GLU A 1 221 ? 32.029 7.318   38.363 1.00 12.73 ? 222  GLU A CA  1 
ATOM   1736 C  C   . GLU A 1 221 ? 32.804 8.412   37.658 1.00 12.60 ? 222  GLU A C   1 
ATOM   1737 O  O   . GLU A 1 221 ? 32.385 9.574   37.721 1.00 14.47 ? 222  GLU A O   1 
ATOM   1738 C  CB  . GLU A 1 221 ? 30.915 6.735   37.488 1.00 17.74 ? 222  GLU A CB  1 
ATOM   1739 C  CG  . GLU A 1 221 ? 31.422 5.918   36.305 1.00 23.79 ? 222  GLU A CG  1 
ATOM   1740 C  CD  . GLU A 1 221 ? 30.276 5.069   35.794 1.00 32.68 ? 222  GLU A CD  1 
ATOM   1741 O  OE1 . GLU A 1 221 ? 30.138 3.903   36.201 1.00 37.32 ? 222  GLU A OE1 1 
ATOM   1742 O  OE2 . GLU A 1 221 ? 29.517 5.655   35.005 1.00 34.58 ? 222  GLU A OE2 1 
ATOM   1743 N  N   . PHE A 1 222 ? 33.910 7.997   37.058 1.00 12.28 ? 223  PHE A N   1 
ATOM   1744 C  CA  . PHE A 1 222 ? 34.704 8.878   36.210 1.00 13.28 ? 223  PHE A CA  1 
ATOM   1745 C  C   . PHE A 1 222 ? 34.789 8.252   34.827 1.00 14.65 ? 223  PHE A C   1 
ATOM   1746 O  O   . PHE A 1 222 ? 35.050 7.053   34.752 1.00 15.96 ? 223  PHE A O   1 
ATOM   1747 C  CB  . PHE A 1 222 ? 36.114 9.113   36.744 1.00 13.30 ? 223  PHE A CB  1 
ATOM   1748 C  CG  . PHE A 1 222 ? 36.127 9.924   38.019 1.00 14.00 ? 223  PHE A CG  1 
ATOM   1749 C  CD1 . PHE A 1 222 ? 36.182 9.319   39.257 1.00 16.47 ? 223  PHE A CD1 1 
ATOM   1750 C  CD2 . PHE A 1 222 ? 36.047 11.307  37.938 1.00 18.19 ? 223  PHE A CD2 1 
ATOM   1751 C  CE1 . PHE A 1 222 ? 36.151 10.092  40.409 1.00 17.91 ? 223  PHE A CE1 1 
ATOM   1752 C  CE2 . PHE A 1 222 ? 36.039 12.055  39.090 1.00 17.65 ? 223  PHE A CE2 1 
ATOM   1753 C  CZ  . PHE A 1 222 ? 36.088 11.459  40.332 1.00 18.39 ? 223  PHE A CZ  1 
ATOM   1754 N  N   . VAL A 1 223 ? 34.559 9.024   33.791 1.00 14.38 ? 224  VAL A N   1 
ATOM   1755 C  CA  . VAL A 1 223 ? 34.573 8.536   32.405 1.00 14.58 ? 224  VAL A CA  1 
ATOM   1756 C  C   . VAL A 1 223 ? 35.348 9.536   31.549 1.00 15.01 ? 224  VAL A C   1 
ATOM   1757 O  O   . VAL A 1 223 ? 35.042 10.732  31.500 1.00 15.29 ? 224  VAL A O   1 
ATOM   1758 C  CB  . VAL A 1 223 ? 33.160 8.299   31.861 1.00 16.60 ? 224  VAL A CB  1 
ATOM   1759 C  CG1 . VAL A 1 223 ? 33.198 7.700   30.480 1.00 19.83 ? 224  VAL A CG1 1 
ATOM   1760 C  CG2 . VAL A 1 223 ? 32.367 7.386   32.783 1.00 22.60 ? 224  VAL A CG2 1 
ATOM   1761 N  N   . THR A 1 224 ? 36.391 9.006   30.894 1.00 14.63 ? 225  THR A N   1 
ATOM   1762 C  CA  . THR A 1 224 ? 37.270 9.849   30.104 1.00 12.66 ? 225  THR A CA  1 
ATOM   1763 C  C   . THR A 1 224 ? 37.453 9.266   28.711 1.00 12.79 ? 225  THR A C   1 
ATOM   1764 O  O   . THR A 1 224 ? 37.818 8.089   28.634 1.00 13.65 ? 225  THR A O   1 
ATOM   1765 C  CB  . THR A 1 224 ? 38.652 9.941   30.777 1.00 14.66 ? 225  THR A CB  1 
ATOM   1766 O  OG1 . THR A 1 224 ? 38.468 10.391  32.130 1.00 19.35 ? 225  THR A OG1 1 
ATOM   1767 C  CG2 . THR A 1 224 ? 39.525 10.924  30.013 1.00 16.92 ? 225  THR A CG2 1 
ATOM   1768 N  N   . ALA A 1 225 ? 37.238 10.043  27.658 1.00 12.23 ? 226  ALA A N   1 
ATOM   1769 C  CA  . ALA A 1 225 ? 37.500 9.554   26.311 1.00 10.40 ? 226  ALA A CA  1 
ATOM   1770 C  C   . ALA A 1 225 ? 38.984 9.554   25.992 1.00 12.13 ? 226  ALA A C   1 
ATOM   1771 O  O   . ALA A 1 225 ? 39.751 10.399  26.451 1.00 12.21 ? 226  ALA A O   1 
ATOM   1772 C  CB  . ALA A 1 225 ? 36.759 10.427  25.331 1.00 12.91 ? 226  ALA A CB  1 
ATOM   1773 N  N   . ALA A 1 226 ? 39.375 8.559   25.206 1.00 11.72 ? 227  ALA A N   1 
ATOM   1774 C  CA  . ALA A 1 226 ? 40.783 8.355   24.898 1.00 13.49 ? 227  ALA A CA  1 
ATOM   1775 C  C   . ALA A 1 226 ? 40.928 7.527   23.618 1.00 14.42 ? 227  ALA A C   1 
ATOM   1776 O  O   . ALA A 1 226 ? 39.931 7.091   23.040 1.00 14.73 ? 227  ALA A O   1 
ATOM   1777 C  CB  . ALA A 1 226 ? 41.477 7.645   26.047 1.00 17.85 ? 227  ALA A CB  1 
ATOM   1778 N  N   . GLY A 1 227 ? 42.193 7.340   23.223 1.00 17.00 ? 228  GLY A N   1 
ATOM   1779 C  CA  . GLY A 1 227 ? 42.537 6.478   22.126 1.00 18.35 ? 228  GLY A CA  1 
ATOM   1780 C  C   . GLY A 1 227 ? 42.749 7.236   20.828 1.00 19.47 ? 228  GLY A C   1 
ATOM   1781 O  O   . GLY A 1 227 ? 42.975 6.613   19.786 1.00 26.16 ? 228  GLY A O   1 
ATOM   1782 N  N   . ILE A 1 228 ? 42.665 8.554   20.919 1.00 19.52 ? 229  ILE A N   1 
ATOM   1783 C  CA  . ILE A 1 228 ? 42.885 9.438   19.781 1.00 21.71 ? 229  ILE A CA  1 
ATOM   1784 C  C   . ILE A 1 228 ? 43.827 10.543  20.211 1.00 25.37 ? 229  ILE A C   1 
ATOM   1785 O  O   . ILE A 1 228 ? 43.696 10.927  21.395 1.00 22.61 ? 229  ILE A O   1 
ATOM   1786 C  CB  . ILE A 1 228 ? 41.561 10.021  19.271 1.00 22.61 ? 229  ILE A CB  1 
ATOM   1787 C  CG1 . ILE A 1 228 ? 40.742 8.991   18.506 1.00 22.16 ? 229  ILE A CG1 1 
ATOM   1788 C  CG2 . ILE A 1 228 ? 41.781 11.296  18.458 1.00 29.48 ? 229  ILE A CG2 1 
ATOM   1789 C  CD1 . ILE A 1 228 ? 39.458 9.506   17.929 1.00 23.42 ? 229  ILE A CD1 1 
ATOM   1790 O  OXT . ILE A 1 228 ? 44.640 10.985  19.379 1.00 27.67 ? 229  ILE A OXT 1 
HETATM 1791 MG MG  . MG  B 2 .   ? 38.410 -11.147 44.808 1.00 18.99 ? 301  MG  A MG  1 
HETATM 1792 C  C1  . EDO C 3 .   ? 37.634 -11.444 40.979 1.00 23.35 ? 303  EDO A C1  1 
HETATM 1793 O  O1  . EDO C 3 .   ? 36.551 -12.082 41.592 1.00 19.17 ? 303  EDO A O1  1 
HETATM 1794 C  C2  . EDO C 3 .   ? 38.364 -10.504 41.955 1.00 21.41 ? 303  EDO A C2  1 
HETATM 1795 O  O2  . EDO C 3 .   ? 39.106 -11.201 42.952 1.00 17.71 ? 303  EDO A O2  1 
HETATM 1796 O  O   . HOH D 4 .   ? 25.868 22.901  32.070 1.00 22.64 ? 1001 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? 22.335 22.565  30.907 1.00 28.02 ? 1002 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? 21.477 21.993  33.413 1.00 21.63 ? 1003 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? 28.277 18.609  32.615 1.00 16.22 ? 1004 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? 29.481 17.132  21.301 1.00 18.60 ? 1005 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? 32.737 17.229  24.125 1.00 18.68 ? 1006 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? 14.404 9.975   39.733 1.00 24.86 ? 1007 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? 11.272 3.886   37.929 1.00 28.66 ? 1008 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? 11.385 9.515   40.885 1.00 24.33 ? 1009 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? 13.985 9.777   42.736 1.00 24.07 ? 1010 HOH A O   1 
HETATM 1806 O  O   . HOH D 4 .   ? 8.654  -3.472  35.978 1.00 25.23 ? 1011 HOH A O   1 
HETATM 1807 O  O   . HOH D 4 .   ? 7.973  -2.468  38.537 1.00 27.64 ? 1012 HOH A O   1 
HETATM 1808 O  O   . HOH D 4 .   ? 11.580 -11.397 31.959 1.00 19.57 ? 1013 HOH A O   1 
HETATM 1809 O  O   . HOH D 4 .   ? 7.580  -11.616 32.647 1.00 26.41 ? 1014 HOH A O   1 
HETATM 1810 O  O   . HOH D 4 .   ? 13.567 -16.672 31.956 1.00 22.83 ? 1015 HOH A O   1 
HETATM 1811 O  O   . HOH D 4 .   ? 9.331  -14.872 38.568 1.00 31.37 ? 1016 HOH A O   1 
HETATM 1812 O  O   . HOH D 4 .   ? 11.567 -5.142  43.744 1.00 21.90 ? 1017 HOH A O   1 
HETATM 1813 O  O   . HOH D 4 .   ? 15.828 8.073   43.967 1.00 25.96 ? 1018 HOH A O   1 
HETATM 1814 O  O   . HOH D 4 .   ? 18.189 9.116   45.023 1.00 21.51 ? 1019 HOH A O   1 
HETATM 1815 O  O   . HOH D 4 .   ? 18.862 10.917  46.823 1.00 19.17 ? 1020 HOH A O   1 
HETATM 1816 O  O   . HOH D 4 .   ? 17.318 13.311  46.585 1.00 16.46 ? 1021 HOH A O   1 
HETATM 1817 O  O   . HOH D 4 .   ? 17.466 15.505  42.627 1.00 19.95 ? 1022 HOH A O   1 
HETATM 1818 O  O   . HOH D 4 .   ? 18.852 15.283  40.338 1.00 32.16 ? 1023 HOH A O   1 
HETATM 1819 O  O   . HOH D 4 .   ? 29.247 17.384  40.403 1.00 34.66 ? 1024 HOH A O   1 
HETATM 1820 O  O   . HOH D 4 .   ? 30.946 20.295  33.412 1.00 26.36 ? 1025 HOH A O   1 
HETATM 1821 O  O   . HOH D 4 .   ? 33.593 16.684  27.460 1.00 23.18 ? 1026 HOH A O   1 
HETATM 1822 O  O   . HOH D 4 .   ? 38.721 17.875  28.778 1.00 19.16 ? 1027 HOH A O   1 
HETATM 1823 O  O   . HOH D 4 .   ? 39.090 12.765  33.256 1.00 21.66 ? 1028 HOH A O   1 
HETATM 1824 O  O   . HOH D 4 .   ? 33.490 17.729  41.464 1.00 33.09 ? 1029 HOH A O   1 
HETATM 1825 O  O   . HOH D 4 .   ? 35.745 19.710  41.220 1.00 37.93 ? 1030 HOH A O   1 
HETATM 1826 O  O   . HOH D 4 .   ? 17.780 9.975   49.141 1.00 20.51 ? 1031 HOH A O   1 
HETATM 1827 O  O   . HOH D 4 .   ? 10.841 4.617   47.961 1.00 27.09 ? 1032 HOH A O   1 
HETATM 1828 O  O   . HOH D 4 .   ? 13.943 -0.968  48.974 1.00 22.97 ? 1033 HOH A O   1 
HETATM 1829 O  O   . HOH D 4 .   ? 24.160 -6.049  45.138 1.00 12.07 ? 1034 HOH A O   1 
HETATM 1830 O  O   . HOH D 4 .   ? 26.692 -7.127  45.290 1.00 24.36 ? 1035 HOH A O   1 
HETATM 1831 O  O   . HOH D 4 .   ? 23.867 -4.579  47.649 1.00 17.44 ? 1036 HOH A O   1 
HETATM 1832 O  O   . HOH D 4 .   ? 23.197 -8.875  45.513 1.00 16.81 ? 1037 HOH A O   1 
HETATM 1833 O  O   . HOH D 4 .   ? 25.355 -10.402 44.480 1.00 14.45 ? 1038 HOH A O   1 
HETATM 1834 O  O   . HOH D 4 .   ? 21.126 -1.879  49.681 1.00 14.01 ? 1039 HOH A O   1 
HETATM 1835 O  O   . HOH D 4 .   ? 26.813 -3.386  34.894 1.00 13.50 ? 1040 HOH A O   1 
HETATM 1836 O  O   . HOH D 4 .   ? 26.684 -5.884  33.416 1.00 16.82 ? 1041 HOH A O   1 
HETATM 1837 O  O   . HOH D 4 .   ? 23.596 -2.953  33.273 1.00 15.53 ? 1042 HOH A O   1 
HETATM 1838 O  O   . HOH D 4 .   ? 30.832 -5.914  39.323 1.00 16.55 ? 1043 HOH A O   1 
HETATM 1839 O  O   . HOH D 4 .   ? 30.633 -7.956  41.159 1.00 16.68 ? 1044 HOH A O   1 
HETATM 1840 O  O   . HOH D 4 .   ? 33.578 -6.451  39.981 1.00 18.55 ? 1045 HOH A O   1 
HETATM 1841 O  O   . HOH D 4 .   ? 32.900 -4.887  37.230 1.00 21.40 ? 1046 HOH A O   1 
HETATM 1842 O  O   . HOH D 4 .   ? 21.977 -1.249  29.256 1.00 37.58 ? 1047 HOH A O   1 
HETATM 1843 O  O   . HOH D 4 .   ? 20.709 2.282   29.180 1.00 24.03 ? 1048 HOH A O   1 
HETATM 1844 O  O   . HOH D 4 .   ? 19.588 0.825   27.036 1.00 27.26 ? 1049 HOH A O   1 
HETATM 1845 O  O   . HOH D 4 .   ? 20.913 5.030   28.686 1.00 18.65 ? 1050 HOH A O   1 
HETATM 1846 O  O   . HOH D 4 .   ? 33.957 1.233   35.939 1.00 22.27 ? 1051 HOH A O   1 
HETATM 1847 O  O   . HOH D 4 .   ? 30.109 12.724  26.128 1.00 14.59 ? 1052 HOH A O   1 
HETATM 1848 O  O   . HOH D 4 .   ? 41.682 12.356  32.980 1.00 29.71 ? 1053 HOH A O   1 
HETATM 1849 O  O   . HOH D 4 .   ? 38.017 7.891   33.556 1.00 24.72 ? 1054 HOH A O   1 
HETATM 1850 O  O   . HOH D 4 .   ? 31.154 9.454   20.801 1.00 15.79 ? 1055 HOH A O   1 
HETATM 1851 O  O   . HOH D 4 .   ? 42.465 10.972  26.753 1.00 20.66 ? 1056 HOH A O   1 
HETATM 1852 O  O   . HOH D 4 .   ? 33.140 14.423  13.868 1.00 38.17 ? 1057 HOH A O   1 
HETATM 1853 O  O   . HOH D 4 .   ? 30.896 14.070  12.254 1.00 20.53 ? 1058 HOH A O   1 
HETATM 1854 O  O   . HOH D 4 .   ? 28.983 16.156  11.875 1.00 32.17 ? 1059 HOH A O   1 
HETATM 1855 O  O   . HOH D 4 .   ? 19.048 14.325  18.441 1.00 20.77 ? 1060 HOH A O   1 
HETATM 1856 O  O   . HOH D 4 .   ? 16.455 21.720  27.186 1.00 28.75 ? 1061 HOH A O   1 
HETATM 1857 O  O   . HOH D 4 .   ? 12.657 20.334  27.699 1.00 23.97 ? 1062 HOH A O   1 
HETATM 1858 O  O   . HOH D 4 .   ? 19.476 2.943   19.250 1.00 24.24 ? 1063 HOH A O   1 
HETATM 1859 O  O   . HOH D 4 .   ? 25.720 -8.948  24.210 1.00 16.20 ? 1064 HOH A O   1 
HETATM 1860 O  O   . HOH D 4 .   ? 24.251 -14.794 27.773 1.00 19.70 ? 1065 HOH A O   1 
HETATM 1861 O  O   . HOH D 4 .   ? 23.840 -18.712 28.144 1.00 30.38 ? 1066 HOH A O   1 
HETATM 1862 O  O   . HOH D 4 .   ? 21.584 -15.693 27.529 1.00 19.94 ? 1067 HOH A O   1 
HETATM 1863 O  O   . HOH D 4 .   ? 29.113 -13.572 27.524 1.00 32.81 ? 1068 HOH A O   1 
HETATM 1864 O  O   . HOH D 4 .   ? 25.949 -17.287 36.533 1.00 19.30 ? 1069 HOH A O   1 
HETATM 1865 O  O   . HOH D 4 .   ? 16.257 -10.324 27.387 1.00 14.66 ? 1070 HOH A O   1 
HETATM 1866 O  O   . HOH D 4 .   ? 14.123 -10.096 25.695 1.00 18.98 ? 1071 HOH A O   1 
HETATM 1867 O  O   . HOH D 4 .   ? 14.776 -11.537 23.468 1.00 29.57 ? 1072 HOH A O   1 
HETATM 1868 O  O   . HOH D 4 .   ? 11.599 -11.192 26.050 1.00 26.80 ? 1073 HOH A O   1 
HETATM 1869 O  O   . HOH D 4 .   ? 17.480 -12.706 24.072 1.00 35.26 ? 1074 HOH A O   1 
HETATM 1870 O  O   . HOH D 4 .   ? 13.448 14.726  22.342 1.00 23.18 ? 1075 HOH A O   1 
HETATM 1871 O  O   . HOH D 4 .   ? 12.163 11.973  29.257 1.00 30.62 ? 1076 HOH A O   1 
HETATM 1872 O  O   . HOH D 4 .   ? 17.701 -16.093 25.955 1.00 19.51 ? 1077 HOH A O   1 
HETATM 1873 O  O   . HOH D 4 .   ? 21.683 -16.328 37.588 1.00 14.85 ? 1078 HOH A O   1 
HETATM 1874 O  O   . HOH D 4 .   ? 29.728 -19.022 41.265 1.00 28.47 ? 1079 HOH A O   1 
HETATM 1875 O  O   . HOH D 4 .   ? 32.141 -19.869 40.836 1.00 21.67 ? 1080 HOH A O   1 
HETATM 1876 O  O   . HOH D 4 .   ? 30.928 -7.395  48.446 1.00 26.92 ? 1081 HOH A O   1 
HETATM 1877 O  O   . HOH D 4 .   ? 36.428 0.899   38.909 1.00 16.30 ? 1082 HOH A O   1 
HETATM 1878 O  O   . HOH D 4 .   ? 38.086 -3.134  29.431 1.00 25.25 ? 1083 HOH A O   1 
HETATM 1879 O  O   . HOH D 4 .   ? 34.226 5.029   13.905 1.00 16.28 ? 1084 HOH A O   1 
HETATM 1880 O  O   . HOH D 4 .   ? 36.517 1.479   18.866 1.00 22.45 ? 1085 HOH A O   1 
HETATM 1881 O  O   . HOH D 4 .   ? 38.163 5.087   12.988 1.00 25.68 ? 1086 HOH A O   1 
HETATM 1882 O  O   . HOH D 4 .   ? 30.422 5.471   45.866 1.00 16.85 ? 1087 HOH A O   1 
HETATM 1883 O  O   . HOH D 4 .   ? 22.872 1.689   54.384 1.00 30.65 ? 1088 HOH A O   1 
HETATM 1884 O  O   . HOH D 4 .   ? 15.770 4.889   55.472 1.00 28.28 ? 1089 HOH A O   1 
HETATM 1885 O  O   . HOH D 4 .   ? 44.872 7.935   24.375 1.00 36.66 ? 1090 HOH A O   1 
HETATM 1886 O  O   . HOH D 4 .   ? 40.802 6.002   15.940 1.00 25.07 ? 1091 HOH A O   1 
HETATM 1887 O  O   . HOH D 4 .   ? 33.243 -0.194  44.389 1.00 19.59 ? 1092 HOH A O   1 
HETATM 1888 O  O   . HOH D 4 .   ? 29.618 2.234   51.772 1.00 21.73 ? 1093 HOH A O   1 
HETATM 1889 O  O   . HOH D 4 .   ? 13.287 -7.741  24.786 1.00 25.28 ? 1094 HOH A O   1 
HETATM 1890 O  O   . HOH D 4 .   ? 25.053 23.647  34.416 1.00 30.85 ? 1095 HOH A O   1 
HETATM 1891 O  O   . HOH D 4 .   ? 16.983 -13.237 42.968 1.00 35.55 ? 1096 HOH A O   1 
HETATM 1892 O  O   . HOH D 4 .   ? 21.107 -5.336  47.516 1.00 27.21 ? 1097 HOH A O   1 
HETATM 1893 O  O   . HOH D 4 .   ? 18.900 -7.235  47.216 1.00 34.92 ? 1098 HOH A O   1 
HETATM 1894 O  O   . HOH D 4 .   ? 12.119 2.667   26.424 1.00 32.23 ? 1099 HOH A O   1 
HETATM 1895 O  O   . HOH D 4 .   ? 38.684 -9.196  38.520 1.00 26.24 ? 1100 HOH A O   1 
HETATM 1896 O  O   . HOH D 4 .   ? 23.185 -17.987 46.327 1.00 36.90 ? 1101 HOH A O   1 
HETATM 1897 O  O   . HOH D 4 .   ? 39.490 -2.543  38.590 1.00 39.23 ? 1102 HOH A O   1 
HETATM 1898 O  O   . HOH D 4 .   ? 27.727 24.538  37.662 1.00 31.16 ? 1103 HOH A O   1 
HETATM 1899 O  O   . HOH D 4 .   ? 28.194 6.676   50.167 1.00 30.51 ? 1104 HOH A O   1 
HETATM 1900 O  O   . HOH D 4 .   ? 31.294 18.919  40.078 1.00 33.59 ? 1105 HOH A O   1 
HETATM 1901 O  O   . HOH D 4 .   ? 32.508 -1.323  46.844 1.00 35.87 ? 1106 HOH A O   1 
HETATM 1902 O  O   . HOH D 4 .   ? 19.674 13.481  13.402 1.00 31.84 ? 1107 HOH A O   1 
HETATM 1903 O  O   . HOH D 4 .   ? 19.931 -17.595 25.924 1.00 27.49 ? 1108 HOH A O   1 
HETATM 1904 O  O   . HOH D 4 .   ? 23.601 -9.179  48.209 1.00 34.71 ? 1109 HOH A O   1 
HETATM 1905 O  O   . HOH D 4 .   ? 37.913 19.318  30.863 1.00 28.26 ? 1110 HOH A O   1 
HETATM 1906 O  O   . HOH D 4 .   ? 32.004 18.164  21.457 1.00 18.23 ? 1111 HOH A O   1 
HETATM 1907 O  O   . HOH D 4 .   ? 32.313 -15.694 33.274 1.00 23.64 ? 1112 HOH A O   1 
HETATM 1908 O  O   . HOH D 4 .   ? 28.185 19.184  20.285 1.00 23.68 ? 1113 HOH A O   1 
HETATM 1909 O  O   . HOH D 4 .   ? 14.484 -19.569 32.970 1.00 35.33 ? 1114 HOH A O   1 
HETATM 1910 O  O   . HOH D 4 .   ? 17.303 -3.820  23.124 1.00 33.36 ? 1115 HOH A O   1 
HETATM 1911 O  O   . HOH D 4 .   ? 35.085 -0.054  42.564 1.00 34.25 ? 1116 HOH A O   1 
HETATM 1912 O  O   . HOH D 4 .   ? 39.355 19.088  17.972 1.00 33.60 ? 1117 HOH A O   1 
HETATM 1913 O  O   . HOH D 4 .   ? 23.113 10.138  54.817 1.00 32.00 ? 1118 HOH A O   1 
HETATM 1914 O  O   . HOH D 4 .   ? 15.217 -20.117 35.290 1.00 44.21 ? 1119 HOH A O   1 
HETATM 1915 O  O   . HOH D 4 .   ? 23.592 -11.785 21.137 1.00 39.56 ? 1120 HOH A O   1 
HETATM 1916 O  O   . HOH D 4 .   ? 10.087 14.160  26.498 1.00 35.55 ? 1121 HOH A O   1 
HETATM 1917 O  O   . HOH D 4 .   ? 20.126 -10.810 20.708 1.00 42.92 ? 1122 HOH A O   1 
HETATM 1918 O  O   . HOH D 4 .   ? 43.868 13.442  26.409 1.00 30.34 ? 1123 HOH A O   1 
HETATM 1919 O  O   . HOH D 4 .   ? 26.874 -20.282 40.549 1.00 46.26 ? 1124 HOH A O   1 
HETATM 1920 O  O   . HOH D 4 .   ? 41.366 2.634   30.695 1.00 33.15 ? 1125 HOH A O   1 
HETATM 1921 O  O   . HOH D 4 .   ? 21.396 17.680  17.915 1.00 45.61 ? 1126 HOH A O   1 
HETATM 1922 O  O   . HOH D 4 .   ? 38.302 -4.746  33.331 1.00 41.21 ? 1127 HOH A O   1 
HETATM 1923 O  O   . HOH D 4 .   ? 32.908 5.704   47.042 1.00 36.77 ? 1128 HOH A O   1 
HETATM 1924 O  O   . HOH D 4 .   ? 12.885 17.533  35.617 1.00 32.58 ? 1129 HOH A O   1 
HETATM 1925 O  O   . HOH D 4 .   ? 10.834 3.662   40.560 1.00 36.42 ? 1130 HOH A O   1 
HETATM 1926 O  O   . HOH D 4 .   ? 43.701 10.344  24.115 1.00 41.64 ? 1131 HOH A O   1 
HETATM 1927 O  O   . HOH D 4 .   ? 40.169 -3.422  27.065 1.00 36.72 ? 1132 HOH A O   1 
HETATM 1928 O  O   . HOH D 4 .   ? 22.678 19.398  15.950 1.00 40.44 ? 1133 HOH A O   1 
HETATM 1929 O  O   . HOH D 4 .   ? 41.017 13.183  15.205 1.00 35.35 ? 1134 HOH A O   1 
HETATM 1930 O  O   . HOH D 4 .   ? 14.615 17.513  15.585 1.00 33.29 ? 1135 HOH A O   1 
HETATM 1931 O  O   . HOH D 4 .   ? 36.181 -4.293  27.219 1.00 50.82 ? 1136 HOH A O   1 
HETATM 1932 O  O   . HOH D 4 .   ? 27.478 27.095  27.551 1.00 44.31 ? 1137 HOH A O   1 
HETATM 1933 O  O   . HOH D 4 .   ? 14.583 17.255  25.033 1.00 40.84 ? 1138 HOH A O   1 
HETATM 1934 O  O   . HOH D 4 .   ? 30.841 -17.575 33.625 1.00 40.73 ? 1139 HOH A O   1 
HETATM 1935 O  O   . HOH D 4 .   ? 38.571 -7.019  44.398 1.00 38.37 ? 1140 HOH A O   1 
HETATM 1936 O  O   . HOH D 4 .   ? 12.871 -8.891  44.939 1.00 38.00 ? 1141 HOH A O   1 
HETATM 1937 O  O   . HOH D 4 .   ? 29.374 5.612   32.104 1.00 36.23 ? 1142 HOH A O   1 
HETATM 1938 O  O   . HOH D 4 .   ? 20.835 -4.528  21.209 1.00 37.41 ? 1143 HOH A O   1 
HETATM 1939 O  O   . HOH D 4 .   ? 22.532 -12.770 24.015 1.00 35.45 ? 1144 HOH A O   1 
HETATM 1940 O  O   . HOH D 4 .   ? 24.873 13.953  11.318 1.00 30.00 ? 1145 HOH A O   1 
HETATM 1941 O  O   . HOH D 4 .   ? 10.599 18.570  27.230 1.00 33.77 ? 1146 HOH A O   1 
HETATM 1942 O  O   . HOH D 4 .   ? 7.385  -9.377  40.479 1.00 35.03 ? 1147 HOH A O   1 
HETATM 1943 O  O   . HOH D 4 .   ? 32.224 -0.572  18.839 1.00 38.26 ? 1148 HOH A O   1 
HETATM 1944 O  O   . HOH D 4 .   ? 36.966 -2.533  42.524 1.00 38.42 ? 1149 HOH A O   1 
HETATM 1945 O  O   . HOH D 4 .   ? 13.316 -17.526 37.840 1.00 33.84 ? 1150 HOH A O   1 
HETATM 1946 O  O   . HOH D 4 .   ? 20.956 -19.788 30.129 1.00 36.38 ? 1151 HOH A O   1 
HETATM 1947 O  O   . HOH D 4 .   ? 34.644 23.691  36.848 1.00 32.18 ? 1152 HOH A O   1 
HETATM 1948 O  O   . HOH D 4 .   ? 34.283 -12.190 48.531 1.00 31.91 ? 1153 HOH A O   1 
HETATM 1949 O  O   . HOH D 4 .   ? 26.879 -20.137 35.404 1.00 40.71 ? 1154 HOH A O   1 
HETATM 1950 O  O   . HOH D 4 .   ? 34.874 -16.502 27.230 1.00 51.76 ? 1155 HOH A O   1 
HETATM 1951 O  O   . HOH D 4 .   ? 24.792 6.750   27.356 1.00 39.24 ? 1156 HOH A O   1 
HETATM 1952 O  O   . HOH D 4 .   ? 34.816 15.414  11.897 1.00 33.67 ? 1157 HOH A O   1 
HETATM 1953 O  O   . HOH D 4 .   ? 29.719 -0.454  50.601 1.00 28.67 ? 1158 HOH A O   1 
HETATM 1954 O  O   . HOH D 4 .   ? 38.739 -8.828  35.949 1.00 47.04 ? 1159 HOH A O   1 
HETATM 1955 O  O   . HOH D 4 .   ? 25.580 25.139  30.189 1.00 41.19 ? 1160 HOH A O   1 
HETATM 1956 O  O   . HOH D 4 .   ? 10.995 -8.168  41.989 1.00 39.00 ? 1161 HOH A O   1 
HETATM 1957 O  O   . HOH D 4 .   ? 27.777 -18.218 27.672 1.00 39.73 ? 1162 HOH A O   1 
HETATM 1958 O  O   . HOH D 4 .   ? 10.606 -7.066  47.375 1.00 40.26 ? 1163 HOH A O   1 
HETATM 1959 O  O   . HOH D 4 .   ? 40.734 -13.266 47.753 1.00 29.57 ? 1164 HOH A O   1 
HETATM 1960 O  O   . HOH D 4 .   ? 42.861 -10.959 45.479 1.00 42.68 ? 1165 HOH A O   1 
HETATM 1961 O  O   . HOH D 4 .   ? 14.007 10.305  28.475 1.00 31.13 ? 1166 HOH A O   1 
HETATM 1962 O  O   . HOH D 4 .   ? 19.256 16.469  17.022 1.00 41.23 ? 1167 HOH A O   1 
HETATM 1963 O  O   . HOH D 4 .   ? 30.900 -18.764 37.428 1.00 36.08 ? 1168 HOH A O   1 
HETATM 1964 O  O   . HOH D 4 .   ? 24.522 -21.277 28.727 1.00 35.29 ? 1169 HOH A O   1 
HETATM 1965 O  O   . HOH D 4 .   ? 9.778  -11.076 42.486 1.00 51.36 ? 1170 HOH A O   1 
HETATM 1966 O  O   . HOH D 4 .   ? 28.961 -12.083 48.475 1.00 41.04 ? 1171 HOH A O   1 
HETATM 1967 O  O   . HOH D 4 .   ? 7.576  -7.622  30.550 1.00 53.16 ? 1172 HOH A O   1 
HETATM 1968 O  O   . HOH D 4 .   ? 12.282 22.717  27.457 1.00 34.11 ? 1173 HOH A O   1 
HETATM 1969 O  O   . HOH D 4 .   ? 26.317 -15.791 26.777 1.00 39.60 ? 1174 HOH A O   1 
HETATM 1970 O  O   . HOH D 4 .   ? 24.961 -9.107  21.470 1.00 26.71 ? 1175 HOH A O   1 
HETATM 1971 O  O   . HOH D 4 .   ? 30.938 4.538   29.878 1.00 38.17 ? 1176 HOH A O   1 
HETATM 1972 O  O   . HOH D 4 .   ? 42.811 0.230   24.989 1.00 55.50 ? 1177 HOH A O   1 
HETATM 1973 O  O   . HOH D 4 .   ? 28.269 -9.024  20.678 1.00 45.41 ? 1178 HOH A O   1 
HETATM 1974 O  O   . HOH D 4 .   ? 18.211 21.749  19.491 1.00 48.14 ? 1179 HOH A O   1 
HETATM 1975 O  O   . HOH D 4 .   ? 16.651 10.442  14.095 1.00 48.86 ? 1180 HOH A O   1 
HETATM 1976 O  O   . HOH D 4 .   ? 39.519 14.210  12.917 1.00 41.57 ? 1181 HOH A O   1 
HETATM 1977 O  O   . HOH D 4 .   ? 28.188 3.236   54.569 1.00 40.08 ? 1182 HOH A O   1 
HETATM 1978 O  O   . HOH D 4 .   ? 16.148 -2.478  56.039 1.00 55.35 ? 1183 HOH A O   1 
HETATM 1979 O  O   . HOH D 4 .   ? 27.867 20.244  43.158 1.00 48.81 ? 1184 HOH A O   1 
HETATM 1980 O  O   . HOH D 4 .   ? 31.996 20.110  29.442 1.00 37.41 ? 1185 HOH A O   1 
HETATM 1981 O  O   . HOH D 4 .   ? 29.649 0.155   14.030 1.00 45.64 ? 1186 HOH A O   1 
HETATM 1982 O  O   . HOH D 4 .   ? 14.781 20.295  25.907 1.00 39.01 ? 1188 HOH A O   1 
HETATM 1983 O  O   . HOH D 4 .   ? 24.889 -12.550 19.279 1.00 36.67 ? 1189 HOH A O   1 
HETATM 1984 O  O   . HOH D 4 .   ? 10.781 3.999   32.558 1.00 36.14 ? 1190 HOH A O   1 
HETATM 1985 O  O   . HOH D 4 .   ? 21.324 -19.744 44.408 1.00 47.30 ? 1191 HOH A O   1 
HETATM 1986 O  O   . HOH D 4 .   ? 30.167 -18.373 44.941 1.00 43.19 ? 1192 HOH A O   1 
HETATM 1987 O  O   . HOH D 4 .   ? 20.211 -2.901  51.989 1.00 52.98 ? 1193 HOH A O   1 
HETATM 1988 O  O   . HOH D 4 .   ? 31.035 -9.944  48.322 1.00 46.86 ? 1194 HOH A O   1 
HETATM 1989 O  O   . HOH D 4 .   ? 43.422 4.143   33.616 1.00 52.06 ? 1196 HOH A O   1 
HETATM 1990 O  O   . HOH D 4 .   ? 30.854 -17.329 25.413 1.00 43.31 ? 1197 HOH A O   1 
HETATM 1991 O  O   . HOH D 4 .   ? 32.412 -21.496 43.952 1.00 50.73 ? 1198 HOH A O   1 
HETATM 1992 O  O   . HOH D 4 .   ? 41.174 7.720   12.913 1.00 44.04 ? 1199 HOH A O   1 
HETATM 1993 O  O   . HOH D 4 .   ? 25.255 9.215   8.120  1.00 63.11 ? 1201 HOH A O   1 
HETATM 1994 O  O   . HOH D 4 .   ? 13.879 19.730  34.585 1.00 34.04 ? 1202 HOH A O   1 
HETATM 1995 O  O   . HOH D 4 .   ? 41.061 10.938  14.716 1.00 39.18 ? 1203 HOH A O   1 
HETATM 1996 O  O   . HOH D 4 .   ? 22.680 1.138   27.512 1.00 46.25 ? 1204 HOH A O   1 
HETATM 1997 O  O   . HOH D 4 .   ? 29.816 3.289   9.938  1.00 44.64 ? 1205 HOH A O   1 
HETATM 1998 O  O   . HOH D 4 .   ? 25.641 -5.057  49.495 1.00 43.49 ? 1206 HOH A O   1 
HETATM 1999 O  O   . HOH D 4 .   ? 14.354 22.136  34.395 1.00 45.48 ? 1207 HOH A O   1 
HETATM 2000 O  O   . HOH D 4 .   ? 30.540 20.970  42.061 1.00 44.94 ? 1208 HOH A O   1 
HETATM 2001 O  O   . HOH D 4 .   ? 31.153 15.997  43.896 1.00 55.98 ? 1209 HOH A O   1 
HETATM 2002 O  O   . HOH D 4 .   ? 38.674 -6.341  40.952 1.00 49.79 ? 1210 HOH A O   1 
HETATM 2003 O  O   . HOH D 4 .   ? 41.020 2.016   38.149 1.00 40.16 ? 1211 HOH A O   1 
HETATM 2004 O  O   . HOH D 4 .   ? 8.852  -6.707  44.789 1.00 50.51 ? 1212 HOH A O   1 
HETATM 2005 O  O   . HOH D 4 .   ? 9.407  6.040   37.049 1.00 41.73 ? 1213 HOH A O   1 
HETATM 2006 O  O   . HOH D 4 .   ? 13.835 -16.886 40.127 1.00 51.89 ? 1214 HOH A O   1 
HETATM 2007 O  O   . HOH D 4 .   ? 6.464  0.395   39.843 1.00 49.17 ? 1215 HOH A O   1 
HETATM 2008 O  O   . HOH D 4 .   ? 26.053 8.319   50.850 1.00 43.72 ? 1217 HOH A O   1 
HETATM 2009 O  O   . HOH D 4 .   ? 35.224 6.280   46.317 1.00 41.44 ? 1218 HOH A O   1 
HETATM 2010 O  O   . HOH D 4 .   ? 36.958 -2.336  45.263 1.00 41.23 ? 1219 HOH A O   1 
HETATM 2011 O  O   . HOH D 4 .   ? 33.797 22.293  29.800 1.00 56.43 ? 1220 HOH A O   1 
HETATM 2012 O  O   . HOH D 4 .   ? 42.961 10.017  31.481 1.00 44.19 ? 1221 HOH A O   1 
HETATM 2013 O  O   . HOH D 4 .   ? 34.059 6.335   10.200 1.00 43.80 ? 1222 HOH A O   1 
HETATM 2014 O  O   . HOH D 4 .   ? 20.251 16.392  41.779 1.00 46.48 ? 1224 HOH A O   1 
HETATM 2015 O  O   . HOH D 4 .   ? 29.596 15.127  40.496 1.00 34.22 ? 1225 HOH A O   1 
HETATM 2016 O  O   . HOH D 4 .   ? 31.101 -12.332 26.982 1.00 41.38 ? 1226 HOH A O   1 
HETATM 2017 O  O   . HOH D 4 .   ? 39.005 -6.358  34.808 1.00 44.81 ? 1227 HOH A O   1 
HETATM 2018 O  O   . HOH D 4 .   ? 8.211  18.235  25.476 1.00 54.60 ? 1228 HOH A O   1 
HETATM 2019 O  O   . HOH D 4 .   ? 31.583 -0.405  49.265 1.00 32.48 ? 1229 HOH A O   1 
HETATM 2020 O  O   . HOH D 4 .   ? 12.846 15.661  19.150 1.00 35.14 ? 1231 HOH A O   1 
HETATM 2021 O  O   . HOH D 4 .   ? 13.579 -3.001  51.136 1.00 42.00 ? 1232 HOH A O   1 
HETATM 2022 O  O   . HOH D 4 .   ? 29.167 -15.413 26.139 1.00 39.32 ? 1233 HOH A O   1 
HETATM 2023 O  O   . HOH D 4 .   ? 20.978 11.739  47.198 1.00 41.48 ? 1234 HOH A O   1 
HETATM 2024 O  O   . HOH D 4 .   ? 41.483 2.875   35.497 1.00 41.24 ? 1235 HOH A O   1 
HETATM 2025 O  O   . HOH D 4 .   ? 42.596 7.695   29.678 1.00 48.65 ? 1236 HOH A O   1 
HETATM 2026 O  O   . HOH D 4 .   ? 24.544 -4.506  51.436 1.00 50.67 ? 1237 HOH A O   1 
HETATM 2027 O  O   . HOH D 4 .   ? 42.742 7.681   31.971 1.00 68.66 ? 1238 HOH A O   1 
HETATM 2028 O  O   . HOH D 4 .   ? 43.891 4.259   28.364 1.00 51.13 ? 1239 HOH A O   1 
HETATM 2029 O  O   . HOH D 4 .   ? 22.602 19.867  40.360 1.00 41.67 ? 1240 HOH A O   1 
HETATM 2030 O  O   . HOH D 4 .   ? 31.081 20.438  27.265 1.00 30.66 ? 1241 HOH A O   1 
HETATM 2031 O  O   . HOH D 4 .   ? 32.547 19.197  26.003 1.00 36.27 ? 1242 HOH A O   1 
HETATM 2032 O  O   . HOH D 4 .   ? 7.283  -5.603  41.735 1.00 61.04 ? 1243 HOH A O   1 
HETATM 2033 O  O   . HOH D 4 .   ? 18.570 -11.284 18.335 1.00 59.15 ? 1244 HOH A O   1 
HETATM 2034 O  O   . HOH D 4 .   ? 26.453 -11.019 47.969 1.00 39.25 ? 1245 HOH A O   1 
HETATM 2035 O  O   . HOH D 4 .   ? 26.262 -18.194 47.929 1.00 52.78 ? 1246 HOH A O   1 
HETATM 2036 O  O   . HOH D 4 .   ? 32.095 22.729  35.731 1.00 29.91 ? 1247 HOH A O   1 
HETATM 2037 O  O   . HOH D 4 .   ? 20.536 12.024  56.231 1.00 79.78 ? 1248 HOH A O   1 
HETATM 2038 O  O   . HOH D 4 .   ? 30.657 24.977  36.626 1.00 50.36 ? 1249 HOH A O   1 
HETATM 2039 O  O   . HOH D 4 .   ? 25.728 -1.135  27.978 1.00 59.20 ? 1250 HOH A O   1 
HETATM 2040 O  O   . HOH D 4 .   ? 27.460 6.940   31.583 1.00 29.41 ? 1251 HOH A O   1 
HETATM 2041 O  O   . HOH D 4 .   ? 20.415 15.016  44.810 1.00 43.53 ? 1253 HOH A O   1 
HETATM 2042 O  O   . HOH D 4 .   ? 42.627 7.877   15.343 1.00 79.64 ? 1256 HOH A O   1 
HETATM 2043 O  O   . HOH D 4 .   ? 19.225 27.562  32.689 1.00 50.64 ? 1257 HOH A O   1 
HETATM 2044 O  O   . HOH D 4 .   ? 23.954 21.389  38.910 1.00 74.38 ? 1258 HOH A O   1 
HETATM 2045 O  O   . HOH D 4 .   ? 23.100 13.657  55.940 1.00 65.86 ? 1259 HOH A O   1 
HETATM 2046 O  O   . HOH D 4 .   ? 13.732 1.951   19.259 1.00 47.19 ? 1261 HOH A O   1 
HETATM 2047 O  O   . HOH D 4 .   ? 40.930 -0.703  32.516 1.00 55.76 ? 1262 HOH A O   1 
HETATM 2048 O  O   . HOH D 4 .   ? 34.452 23.707  22.088 1.00 48.45 ? 1263 HOH A O   1 
HETATM 2049 O  O   . HOH D 4 .   ? 40.356 -3.397  30.969 1.00 59.32 ? 1265 HOH A O   1 
HETATM 2050 O  O   . HOH D 4 .   ? 12.935 3.780   55.116 1.00 64.02 ? 1266 HOH A O   1 
HETATM 2051 O  O   . HOH D 4 .   ? 33.396 3.133   47.773 1.00 54.27 ? 1268 HOH A O   1 
HETATM 2052 O  O   . HOH D 4 .   ? 40.194 1.044   15.856 1.00 48.40 ? 1269 HOH A O   1 
HETATM 2053 O  O   . HOH D 4 .   ? 13.302 13.300  15.196 1.00 66.34 ? 1270 HOH A O   1 
HETATM 2054 O  O   . HOH D 4 .   ? 7.656  2.576   29.613 1.00 52.45 ? 1271 HOH A O   1 
HETATM 2055 O  O   . HOH D 4 .   ? 22.312 23.054  35.346 1.00 67.78 ? 1272 HOH A O   1 
HETATM 2056 O  O   . HOH D 4 .   ? 19.810 -15.907 46.483 1.00 48.83 ? 1273 HOH A O   1 
HETATM 2057 O  O   . HOH D 4 .   ? 43.585 1.605   29.271 1.00 40.72 ? 1275 HOH A O   1 
HETATM 2058 O  O   . HOH D 4 .   ? 36.750 8.927   46.662 1.00 80.50 ? 1276 HOH A O   1 
HETATM 2059 O  O   . HOH D 4 .   ? 23.710 -15.629 48.377 1.00 68.42 ? 1278 HOH A O   1 
HETATM 2060 O  O   . HOH D 4 .   ? 9.482  4.431   50.739 1.00 61.27 ? 1279 HOH A O   1 
HETATM 2061 O  O   . HOH D 4 .   ? 36.191 18.537  28.101 1.00 71.46 ? 1280 HOH A O   1 
HETATM 2062 O  O   . HOH D 4 .   ? 36.405 -4.594  46.977 1.00 80.32 ? 1281 HOH A O   1 
HETATM 2063 O  O   . HOH D 4 .   ? 41.943 3.267   16.857 1.00 52.30 ? 1282 HOH A O   1 
HETATM 2064 O  O   . HOH D 4 .   ? 21.184 -18.412 48.599 1.00 74.16 ? 1283 HOH A O   1 
HETATM 2065 O  O   . HOH D 4 .   ? 33.818 18.233  29.137 1.00 46.30 ? 1284 HOH A O   1 
HETATM 2066 O  O   . HOH D 4 .   ? 36.709 -12.036 44.223 1.00 18.59 ? 1285 HOH A O   1 
HETATM 2067 O  O   . HOH D 4 .   ? 39.561 -12.895 45.029 1.00 18.69 ? 1286 HOH A O   1 
HETATM 2068 O  O   . HOH D 4 .   ? 40.031 -9.968  45.560 1.00 15.16 ? 1287 HOH A O   1 
HETATM 2069 O  O   . HOH D 4 .   ? 37.498 -9.333  44.578 1.00 18.54 ? 1288 HOH A O   1 
HETATM 2070 O  O   . HOH D 4 .   ? 37.595 -11.279 46.689 1.00 21.30 ? 1289 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . LYS A 4   ? 0.7142 0.4476 0.4494 0.1137  0.0829  0.2312  3    LYS A N   
2    C  CA  . LYS A 4   ? 0.4976 0.4115 0.4780 -0.0265 -0.0126 0.1108  3    LYS A CA  
3    C  C   . LYS A 4   ? 0.4067 0.3788 0.4511 -0.0984 -0.0006 0.0499  3    LYS A C   
4    O  O   . LYS A 4   ? 0.3419 0.3236 0.4621 0.0287  -0.0319 0.0514  3    LYS A O   
5    C  CB  . LYS A 4   ? 0.5501 0.4636 0.6069 -0.0309 -0.1044 0.1160  3    LYS A CB  
6    C  CG  . LYS A 4   ? 0.5391 0.5473 0.8616 0.0513  -0.0786 0.0649  3    LYS A CG  
7    C  CD  . LYS A 4   ? 0.7073 0.6093 0.9040 0.1214  -0.0486 0.1512  3    LYS A CD  
8    C  CE  . LYS A 4   ? 0.7678 0.6248 0.9038 0.1791  0.0361  0.1760  3    LYS A CE  
9    N  NZ  . LYS A 4   ? 0.8166 0.5571 0.5238 0.1050  0.0152  0.0784  3    LYS A NZ  
10   N  N   . GLY A 5   ? 0.3938 0.3738 0.4009 -0.0734 -0.1103 0.0551  4    GLY A N   
11   C  CA  . GLY A 5   ? 0.2567 0.3243 0.3994 -0.0859 -0.0181 -0.0096 4    GLY A CA  
12   C  C   . GLY A 5   ? 0.2250 0.1520 0.3465 -0.0453 0.0238  0.0439  4    GLY A C   
13   O  O   . GLY A 5   ? 0.1890 0.1788 0.3604 0.0186  0.0473  0.0127  4    GLY A O   
14   N  N   . GLU A 6   ? 0.2285 0.1833 0.2772 -0.0011 0.0250  0.0718  5    GLU A N   
15   C  CA  . GLU A 6   ? 0.2483 0.2057 0.3449 0.0418  -0.0209 0.0322  5    GLU A CA  
16   C  C   . GLU A 6   ? 0.2369 0.1749 0.3211 -0.0004 -0.0076 0.0615  5    GLU A C   
17   O  O   . GLU A 6   ? 0.2203 0.1897 0.3301 0.0276  -0.0116 0.0493  5    GLU A O   
18   C  CB  . GLU A 6   ? 0.2378 0.2492 0.4233 0.0407  -0.0138 -0.0023 5    GLU A CB  
19   C  CG  . GLU A 6   ? 0.3781 0.4002 0.6663 -0.0517 0.0569  0.1674  5    GLU A CG  
20   C  CD  . GLU A 6   ? 0.5414 0.6422 0.7351 -0.0077 0.1635  0.2621  5    GLU A CD  
21   O  OE1 . GLU A 6   ? 0.8614 1.2325 0.7858 0.0269  0.1460  0.4931  5    GLU A OE1 
22   O  OE2 . GLU A 6   ? 0.6540 0.6619 1.0421 0.1181  0.3684  0.2654  5    GLU A OE2 
23   N  N   . GLU A 7   ? 0.3267 0.1469 0.3002 -0.0134 0.0027  0.0837  6    GLU A N   
24   C  CA  . GLU A 7   ? 0.2982 0.1242 0.3985 -0.0647 0.0104  0.0563  6    GLU A CA  
25   C  C   . GLU A 7   ? 0.1877 0.1745 0.3839 -0.0120 -0.0130 0.0155  6    GLU A C   
26   O  O   . GLU A 7   ? 0.2954 0.2095 0.4305 -0.0646 0.0033  -0.0254 6    GLU A O   
27   C  CB  . GLU A 7   ? 0.3262 0.1512 0.5224 -0.0102 0.0478  0.1117  6    GLU A CB  
28   C  CG  . GLU A 7   ? 0.5192 0.2670 0.4598 0.0239  0.0518  0.1535  6    GLU A CG  
29   C  CD  . GLU A 7   ? 0.6042 0.3585 0.5209 0.1078  0.0233  0.1681  6    GLU A CD  
30   O  OE1 . GLU A 7   ? 0.6947 0.3528 0.4389 0.1459  0.0061  0.1564  6    GLU A OE1 
31   O  OE2 . GLU A 7   ? 0.6747 0.6620 0.6749 0.2694  0.0781  0.2512  6    GLU A OE2 
32   N  N   . LEU A 8   ? 0.1666 0.1636 0.3007 0.0029  0.0016  0.0215  7    LEU A N   
33   C  CA  . LEU A 8   ? 0.1308 0.1856 0.2763 0.0248  -0.0136 -0.0215 7    LEU A CA  
34   C  C   . LEU A 8   ? 0.1614 0.1532 0.2826 0.0218  -0.0031 0.0004  7    LEU A C   
35   O  O   . LEU A 8   ? 0.1703 0.1804 0.3059 0.0173  0.0124  0.0187  7    LEU A O   
36   C  CB  . LEU A 8   ? 0.1739 0.1673 0.2464 -0.0088 0.0095  -0.0151 7    LEU A CB  
37   C  CG  . LEU A 8   ? 0.1744 0.2064 0.2813 0.0032  -0.0328 -0.0426 7    LEU A CG  
38   C  CD1 . LEU A 8   ? 0.1934 0.2505 0.3489 -0.0663 -0.0432 0.0215  7    LEU A CD1 
39   C  CD2 . LEU A 8   ? 0.2947 0.2514 0.3559 0.0922  -0.0231 -0.0272 7    LEU A CD2 
40   N  N   . PHE A 9   ? 0.1480 0.1984 0.2651 0.0114  -0.0182 0.0325  8    PHE A N   
41   C  CA  . PHE A 9   ? 0.1503 0.1471 0.2064 -0.0042 -0.0143 -0.0085 8    PHE A CA  
42   C  C   . PHE A 9   ? 0.1379 0.1372 0.2205 -0.0025 0.0017  -0.0208 8    PHE A C   
43   O  O   . PHE A 9   ? 0.1940 0.1696 0.3454 0.0047  -0.0877 -0.0237 8    PHE A O   
44   C  CB  . PHE A 9   ? 0.1655 0.1281 0.1952 -0.0282 0.0025  0.0037  8    PHE A CB  
45   C  CG  . PHE A 9   ? 0.1349 0.1227 0.1742 0.0009  -0.0131 0.0241  8    PHE A CG  
46   C  CD1 . PHE A 9   ? 0.1570 0.1561 0.1692 0.0152  -0.0182 0.0242  8    PHE A CD1 
47   C  CD2 . PHE A 9   ? 0.1369 0.1755 0.1847 -0.0395 -0.0310 0.0473  8    PHE A CD2 
48   C  CE1 . PHE A 9   ? 0.1770 0.1807 0.1730 0.0047  -0.0300 0.0005  8    PHE A CE1 
49   C  CE2 . PHE A 9   ? 0.1449 0.1759 0.2046 -0.0396 -0.0326 0.0345  8    PHE A CE2 
50   C  CZ  . PHE A 9   ? 0.1651 0.1647 0.2130 -0.0217 -0.0506 0.0054  8    PHE A CZ  
51   N  N   . THR A 10  ? 0.1811 0.1448 0.2574 -0.0270 0.0117  0.0019  9    THR A N   
52   C  CA  . THR A 10  ? 0.2013 0.1538 0.2827 -0.0539 0.0020  0.0215  9    THR A CA  
53   C  C   . THR A 10  ? 0.1951 0.2021 0.2849 -0.0250 -0.0260 0.0034  9    THR A C   
54   O  O   . THR A 10  ? 0.2478 0.2607 0.3370 -0.0862 -0.0399 -0.0240 9    THR A O   
55   C  CB  . THR A 10  ? 0.3417 0.1612 0.3509 -0.0909 0.0007  0.0373  9    THR A CB  
56   O  OG1 . THR A 10  ? 0.3687 0.1789 0.4557 -0.0200 -0.0459 0.1049  9    THR A OG1 
57   C  CG2 . THR A 10  ? 0.3853 0.3565 0.3374 -0.0902 -0.0461 0.1379  9    THR A CG2 
58   N  N   . GLY A 11  ? 0.2132 0.1678 0.2356 -0.0292 -0.0344 0.0114  10   GLY A N   
59   C  CA  . GLY A 11  ? 0.2924 0.1749 0.2325 -0.0840 -0.0482 0.0383  10   GLY A CA  
60   C  C   . GLY A 11  ? 0.2250 0.1440 0.2763 -0.0488 -0.0013 0.0144  10   GLY A C   
61   O  O   . GLY A 11  ? 0.2193 0.1326 0.3652 0.0046  0.0316  -0.0146 10   GLY A O   
62   N  N   . VAL A 12  ? 0.2191 0.1827 0.2608 -0.0559 -0.0215 0.0412  11   VAL A N   
63   C  CA  . VAL A 12  ? 0.1879 0.1389 0.2755 -0.0295 0.0117  -0.0015 11   VAL A CA  
64   C  C   . VAL A 12  ? 0.1747 0.1390 0.2768 -0.0079 0.0255  -0.0252 11   VAL A C   
65   O  O   . VAL A 12  ? 0.2202 0.1252 0.3063 -0.0062 -0.0466 -0.0549 11   VAL A O   
66   C  CB  . VAL A 12  ? 0.1999 0.2061 0.2660 -0.0378 0.0194  0.0297  11   VAL A CB  
67   C  CG1 . VAL A 12  ? 0.3053 0.1678 0.3075 -0.0584 0.0255  0.0327  11   VAL A CG1 
68   C  CG2 . VAL A 12  ? 0.2295 0.1571 0.3152 0.0104  -0.0279 -0.0149 11   VAL A CG2 
69   N  N   . VAL A 13  ? 0.1330 0.1211 0.2540 0.0142  0.0162  -0.0081 12   VAL A N   
70   C  CA  . VAL A 13  ? 0.1482 0.1090 0.2454 0.0126  0.0004  0.0274  12   VAL A CA  
71   C  C   . VAL A 13  ? 0.1484 0.0935 0.2240 0.0101  -0.0057 0.0145  12   VAL A C   
72   O  O   . VAL A 13  ? 0.1747 0.0835 0.2493 0.0187  -0.0209 0.0062  12   VAL A O   
73   C  CB  . VAL A 13  ? 0.1310 0.1595 0.2328 0.0144  -0.0017 0.0397  12   VAL A CB  
74   C  CG1 . VAL A 13  ? 0.1496 0.2163 0.2364 -0.0057 -0.0056 0.0296  12   VAL A CG1 
75   C  CG2 . VAL A 13  ? 0.2246 0.1286 0.2728 -0.0121 0.0763  -0.0087 12   VAL A CG2 
76   N  N   . PRO A 14  ? 0.1954 0.0734 0.2242 0.0260  0.0407  0.0001  13   PRO A N   
77   C  CA  . PRO A 14  ? 0.1504 0.1013 0.2130 0.0035  0.0016  0.0042  13   PRO A CA  
78   C  C   . PRO A 14  ? 0.1504 0.0966 0.1831 0.0096  -0.0001 0.0203  13   PRO A C   
79   O  O   . PRO A 14  ? 0.1528 0.1152 0.1898 0.0077  -0.0026 0.0281  13   PRO A O   
80   C  CB  . PRO A 14  ? 0.2138 0.1495 0.2510 0.0374  0.0630  -0.0001 13   PRO A CB  
81   C  CG  . PRO A 14  ? 0.1827 0.1373 0.3854 0.0418  0.0518  0.0217  13   PRO A CG  
82   C  CD  . PRO A 14  ? 0.1844 0.0999 0.2833 0.0378  0.0198  0.0165  13   PRO A CD  
83   N  N   . ILE A 15  ? 0.1428 0.0935 0.1788 0.0084  0.0069  0.0142  14   ILE A N   
84   C  CA  . ILE A 15  ? 0.1125 0.0965 0.1940 0.0159  0.0028  0.0056  14   ILE A CA  
85   C  C   . ILE A 15  ? 0.1212 0.0874 0.1867 0.0141  0.0170  -0.0329 14   ILE A C   
86   O  O   . ILE A 15  ? 0.1592 0.1323 0.1907 -0.0044 0.0222  -0.0019 14   ILE A O   
87   C  CB  . ILE A 15  ? 0.1068 0.1228 0.2218 0.0188  -0.0041 -0.0251 14   ILE A CB  
88   C  CG1 . ILE A 15  ? 0.0985 0.1119 0.1881 0.0155  -0.0211 -0.0326 14   ILE A CG1 
89   C  CG2 . ILE A 15  ? 0.1337 0.0943 0.2792 0.0166  -0.0105 -0.0113 14   ILE A CG2 
90   C  CD1 . ILE A 15  ? 0.1156 0.1809 0.2053 0.0483  0.0079  0.0061  14   ILE A CD1 
91   N  N   . LEU A 16  ? 0.1412 0.0946 0.2343 -0.0116 0.0056  -0.0445 15   LEU A N   
92   C  CA  . LEU A 16  ? 0.1174 0.0921 0.1992 0.0138  -0.0128 0.0115  15   LEU A CA  
93   C  C   . LEU A 16  ? 0.0727 0.0932 0.1747 -0.0238 0.0321  0.0172  15   LEU A C   
94   O  O   . LEU A 16  ? 0.1623 0.1291 0.1686 0.0012  -0.0011 0.0251  15   LEU A O   
95   C  CB  . LEU A 16  ? 0.1317 0.1197 0.2270 0.0410  0.0148  0.0443  15   LEU A CB  
96   C  CG  . LEU A 16  ? 0.1360 0.1301 0.3115 0.0303  0.0225  0.0035  15   LEU A CG  
97   C  CD1 . LEU A 16  ? 0.2434 0.1672 0.3053 0.1142  -0.0520 -0.0368 15   LEU A CD1 
98   C  CD2 . LEU A 16  ? 0.1505 0.2240 0.2963 0.0882  -0.0437 -0.0590 15   LEU A CD2 
99   N  N   . VAL A 17  ? 0.1265 0.0912 0.1973 0.0044  0.0214  0.0294  16   VAL A N   
100  C  CA  . VAL A 17  ? 0.1027 0.0888 0.1976 -0.0050 -0.0081 0.0285  16   VAL A CA  
101  C  C   . VAL A 17  ? 0.0826 0.1102 0.1845 0.0089  -0.0224 0.0421  16   VAL A C   
102  O  O   . VAL A 17  ? 0.1419 0.1148 0.1913 -0.0074 0.0148  0.0114  16   VAL A O   
103  C  CB  . VAL A 17  ? 0.0840 0.1103 0.1955 0.0026  0.0251  0.0176  16   VAL A CB  
104  C  CG1 . VAL A 17  ? 0.0976 0.1296 0.3681 0.0075  0.0328  -0.0411 16   VAL A CG1 
105  C  CG2 . VAL A 17  ? 0.1087 0.1279 0.2956 -0.0117 0.0573  0.0425  16   VAL A CG2 
106  N  N   . GLU A 18  ? 0.0998 0.1183 0.2121 -0.0100 -0.0298 0.0257  17   GLU A N   
107  C  CA  . GLU A 18  ? 0.1092 0.1066 0.1876 -0.0044 -0.0173 0.0175  17   GLU A CA  
108  C  C   . GLU A 18  ? 0.1161 0.1084 0.1932 0.0021  -0.0123 0.0112  17   GLU A C   
109  O  O   . GLU A 18  ? 0.1652 0.1165 0.1932 -0.0094 0.0198  0.0110  17   GLU A O   
110  C  CB  . GLU A 18  ? 0.1002 0.1082 0.2888 0.0030  0.0172  0.0131  17   GLU A CB  
111  C  CG  . GLU A 18  ? 0.2020 0.1491 0.3050 0.0376  0.0134  -0.0141 17   GLU A CG  
112  C  CD  . GLU A 18  ? 0.1949 0.2267 0.2808 0.0095  -0.0290 -0.0221 17   GLU A CD  
113  O  OE1 . GLU A 18  ? 0.2478 0.2683 0.3249 0.0603  -0.0866 -0.0631 17   GLU A OE1 
114  O  OE2 . GLU A 18  ? 0.2680 0.2592 0.2887 -0.0077 -0.0065 0.0220  17   GLU A OE2 
115  N  N   . LEU A 19  ? 0.1615 0.0991 0.1839 0.0178  0.0124  -0.0001 18   LEU A N   
116  C  CA  . LEU A 19  ? 0.0922 0.1101 0.1983 0.0255  0.0146  -0.0159 18   LEU A CA  
117  C  C   . LEU A 19  ? 0.1249 0.1296 0.1991 -0.0030 0.0173  -0.0112 18   LEU A C   
118  O  O   . LEU A 19  ? 0.1414 0.1785 0.1953 -0.0388 0.0062  -0.0051 18   LEU A O   
119  C  CB  . LEU A 19  ? 0.1182 0.1174 0.2218 0.0274  -0.0319 0.0066  18   LEU A CB  
120  C  CG  . LEU A 19  ? 0.1316 0.0926 0.2888 0.0414  -0.0460 0.0299  18   LEU A CG  
121  C  CD1 . LEU A 19  ? 0.1474 0.1655 0.6842 0.0568  -0.0093 -0.0978 18   LEU A CD1 
122  C  CD2 . LEU A 19  ? 0.3588 0.1610 0.4220 -0.0325 -0.0718 0.1212  18   LEU A CD2 
123  N  N   . ASP A 20  ? 0.1425 0.1098 0.1889 -0.0050 0.0104  0.0072  19   ASP A N   
124  C  CA  . ASP A 20  ? 0.1558 0.1385 0.2282 -0.0261 0.0086  -0.0113 19   ASP A CA  
125  C  C   . ASP A 20  ? 0.1872 0.1241 0.1852 -0.0402 0.0133  -0.0099 19   ASP A C   
126  O  O   . ASP A 20  ? 0.1577 0.1436 0.1823 -0.0342 0.0053  0.0073  19   ASP A O   
127  C  CB  . ASP A 20  ? 0.1385 0.2495 0.2828 -0.0237 0.0085  -0.0071 19   ASP A CB  
128  C  CG  . ASP A 20  ? 0.1952 0.2812 0.3380 0.0487  0.0123  0.0091  19   ASP A CG  
129  O  OD1 . ASP A 20  ? 0.3707 0.4021 0.5202 0.1671  -0.1848 -0.1053 19   ASP A OD1 
130  O  OD2 . ASP A 20  ? 0.2560 0.2469 0.3501 0.0498  0.0230  -0.0307 19   ASP A OD2 
131  N  N   . GLY A 21  ? 0.1387 0.1459 0.1765 -0.0220 0.0254  0.0003  20   GLY A N   
132  C  CA  . GLY A 21  ? 0.1501 0.1389 0.2094 -0.0247 0.0178  0.0045  20   GLY A CA  
133  C  C   . GLY A 21  ? 0.1497 0.1457 0.2066 -0.0341 0.0104  0.0008  20   GLY A C   
134  O  O   . GLY A 21  ? 0.1808 0.1558 0.2331 -0.0500 0.0404  -0.0150 20   GLY A O   
135  N  N   . ASP A 22  ? 0.1798 0.1336 0.1978 -0.0374 0.0380  0.0210  21   ASP A N   
136  C  CA  . ASP A 22  ? 0.1769 0.1343 0.2356 -0.0372 0.0090  0.0130  21   ASP A CA  
137  C  C   . ASP A 22  ? 0.1934 0.1345 0.2263 -0.0303 -0.0010 -0.0039 21   ASP A C   
138  O  O   . ASP A 22  ? 0.1925 0.1762 0.2296 -0.0138 0.0073  0.0118  21   ASP A O   
139  C  CB  . ASP A 22  ? 0.1973 0.1856 0.3101 -0.0484 -0.0356 0.0369  21   ASP A CB  
140  C  CG  . ASP A 22  ? 0.2279 0.1853 0.3622 -0.0567 -0.0492 -0.0173 21   ASP A CG  
141  O  OD1 . ASP A 22  ? 0.2134 0.1838 0.3590 -0.0643 0.0008  0.0239  21   ASP A OD1 
142  O  OD2 . ASP A 22  ? 0.2201 0.1972 0.4855 -0.0381 -0.0543 -0.0933 21   ASP A OD2 
143  N  N   . VAL A 23  ? 0.1660 0.1557 0.2169 -0.0289 -0.0137 -0.0130 22   VAL A N   
144  C  CA  . VAL A 23  ? 0.1385 0.1348 0.2044 -0.0555 -0.0123 -0.0103 22   VAL A CA  
145  C  C   . VAL A 23  ? 0.1466 0.1452 0.2010 -0.0500 0.0340  -0.0232 22   VAL A C   
146  O  O   . VAL A 23  ? 0.1865 0.1824 0.2116 -0.0289 0.0292  0.0213  22   VAL A O   
147  C  CB  . VAL A 23  ? 0.1689 0.1376 0.2046 -0.0483 -0.0387 -0.0041 22   VAL A CB  
148  C  CG1 . VAL A 23  ? 0.1515 0.2088 0.2576 -0.0123 0.0290  0.0897  22   VAL A CG1 
149  C  CG2 . VAL A 23  ? 0.1662 0.1548 0.2682 -0.0803 -0.0470 -0.0012 22   VAL A CG2 
150  N  N   . ASN A 24  ? 0.1544 0.1296 0.2631 -0.0306 -0.0016 -0.0524 23   ASN A N   
151  C  CA  . ASN A 24  ? 0.2094 0.1331 0.2945 -0.0379 -0.0091 -0.0143 23   ASN A CA  
152  C  C   . ASN A 24  ? 0.1870 0.1854 0.3620 -0.0457 -0.0024 0.0465  23   ASN A C   
153  O  O   . ASN A 24  ? 0.2494 0.1771 0.4656 -0.0396 0.0563  0.0771  23   ASN A O   
154  C  CB  . ASN A 24  ? 0.1798 0.1885 0.2544 -0.0533 -0.0028 0.0124  23   ASN A CB  
155  C  CG  . ASN A 24  ? 0.2283 0.1641 0.2576 -0.0155 0.0057  0.0326  23   ASN A CG  
156  O  OD1 . ASN A 24  ? 0.2812 0.1962 0.2820 -0.0015 0.0567  0.0274  23   ASN A OD1 
157  N  ND2 . ASN A 24  ? 0.1989 0.1837 0.3615 -0.0304 -0.0574 0.0677  23   ASN A ND2 
158  N  N   . GLY A 25  ? 0.1599 0.1779 0.3541 -0.0590 -0.0127 0.0344  24   GLY A N   
159  C  CA  . GLY A 25  ? 0.1407 0.2092 0.4013 -0.0728 -0.0206 0.0145  24   GLY A CA  
160  C  C   . GLY A 25  ? 0.1765 0.2070 0.4068 -0.0403 0.0087  0.0083  24   GLY A C   
161  O  O   . GLY A 25  ? 0.2092 0.2230 0.5427 -0.0469 0.0796  -0.0071 24   GLY A O   
162  N  N   . HIS A 26  ? 0.2066 0.1452 0.3097 -0.0606 0.0031  0.0545  25   HIS A N   
163  C  CA  . HIS A 26  ? 0.2477 0.1811 0.3288 -0.0367 0.0200  0.0239  25   HIS A CA  
164  C  C   . HIS A 26  ? 0.2183 0.1703 0.3046 -0.0351 0.1047  0.0048  25   HIS A C   
165  O  O   . HIS A 26  ? 0.1860 0.1971 0.2934 -0.0324 0.0903  -0.0140 25   HIS A O   
166  C  CB  . HIS A 26  ? 0.2449 0.1900 0.3111 -0.0298 0.0160  -0.0416 25   HIS A CB  
167  C  CG  . HIS A 26  ? 0.2783 0.2723 0.3520 0.0363  0.0437  0.0455  25   HIS A CG  
168  N  ND1 . HIS A 26  ? 0.4388 0.2994 0.3721 0.0439  0.1168  0.0437  25   HIS A ND1 
169  C  CD2 . HIS A 26  ? 0.2539 0.2362 0.4449 0.0097  0.0853  0.0719  25   HIS A CD2 
170  C  CE1 . HIS A 26  ? 0.4254 0.3121 0.3843 0.0386  0.1019  0.0749  25   HIS A CE1 
171  N  NE2 . HIS A 26  ? 0.3253 0.2851 0.4109 0.0374  0.0759  0.0972  25   HIS A NE2 
172  N  N   . LYS A 27  ? 0.1961 0.1508 0.3019 -0.0697 0.1040  -0.0291 26   LYS A N   
173  C  CA  . LYS A 27  ? 0.1836 0.1561 0.3027 -0.0519 0.0619  -0.0437 26   LYS A CA  
174  C  C   . LYS A 27  ? 0.1874 0.1328 0.2602 -0.0559 0.0267  0.0120  26   LYS A C   
175  O  O   . LYS A 27  ? 0.2783 0.2077 0.2617 -0.0497 0.0177  0.0389  26   LYS A O   
176  C  CB  . LYS A 27  ? 0.2218 0.2672 0.4005 -0.0419 -0.0423 -0.0483 26   LYS A CB  
177  C  CG  . LYS A 27  ? 0.2717 0.3974 0.4619 -0.0442 -0.0449 -0.1469 26   LYS A CG  
178  C  CD  . LYS A 27  ? 0.4766 0.6077 0.5014 -0.0433 -0.2106 -0.0807 26   LYS A CD  
179  C  CE  . LYS A 27  ? 0.5564 0.7667 0.5260 -0.1070 -0.3081 -0.1247 26   LYS A CE  
180  N  NZ  . LYS A 27  ? 0.4567 1.1081 0.6306 -0.0291 -0.2149 -0.2089 26   LYS A NZ  
181  N  N   . PHE A 28  ? 0.1530 0.1321 0.3097 -0.0473 0.0588  -0.0043 27   PHE A N   
182  C  CA  . PHE A 28  ? 0.1356 0.1210 0.2776 -0.0324 0.0382  0.0190  27   PHE A CA  
183  C  C   . PHE A 28  ? 0.1013 0.1109 0.2568 -0.0162 0.0211  0.0171  27   PHE A C   
184  O  O   . PHE A 28  ? 0.1624 0.1341 0.2541 -0.0173 0.0043  0.0136  27   PHE A O   
185  C  CB  . PHE A 28  ? 0.1808 0.1496 0.2145 0.0188  0.0368  0.0311  27   PHE A CB  
186  C  CG  . PHE A 28  ? 0.1421 0.1560 0.2162 -0.0090 0.0193  -0.0056 27   PHE A CG  
187  C  CD1 . PHE A 28  ? 0.2390 0.1994 0.2277 -0.0623 0.0642  -0.0414 27   PHE A CD1 
188  C  CD2 . PHE A 28  ? 0.1391 0.1591 0.2135 -0.0063 0.0004  0.0101  27   PHE A CD2 
189  C  CE1 . PHE A 28  ? 0.1864 0.1992 0.2200 -0.0135 0.0231  -0.0364 27   PHE A CE1 
190  C  CE2 . PHE A 28  ? 0.1218 0.1922 0.2441 -0.0152 0.0093  0.0043  27   PHE A CE2 
191  C  CZ  . PHE A 28  ? 0.1289 0.1969 0.2229 0.0226  0.0070  0.0132  27   PHE A CZ  
192  N  N   . SER A 29  ? 0.1333 0.1138 0.2659 0.0046  0.0321  0.0038  28   SER A N   
193  C  CA  . SER A 29  ? 0.1278 0.1063 0.2435 -0.0005 0.0548  -0.0088 28   SER A CA  
194  C  C   . SER A 29  ? 0.1305 0.1319 0.2452 -0.0125 0.0417  0.0176  28   SER A C   
195  O  O   . SER A 29  ? 0.1681 0.1359 0.2376 -0.0365 0.0476  0.0115  28   SER A O   
196  C  CB  . SER A 29  ? 0.1537 0.1353 0.2878 0.0382  0.0184  -0.0378 28   SER A CB  
197  O  OG  . SER A 29  ? 0.1758 0.2194 0.3237 0.0118  -0.0288 0.0116  28   SER A OG  
198  N  N   . VAL A 30  ? 0.1141 0.1276 0.2343 -0.0016 0.0403  0.0152  29   VAL A N   
199  C  CA  . VAL A 30  ? 0.1145 0.1327 0.2394 -0.0044 0.0230  0.0320  29   VAL A CA  
200  C  C   . VAL A 30  ? 0.1084 0.1271 0.1932 0.0026  0.0114  0.0177  29   VAL A C   
201  O  O   . VAL A 30  ? 0.1889 0.1360 0.1937 -0.0013 -0.0225 0.0042  29   VAL A O   
202  C  CB  . VAL A 30  ? 0.1162 0.1176 0.2052 0.0000  0.0014  0.0051  29   VAL A CB  
203  C  CG1 . VAL A 30  ? 0.1185 0.1165 0.1766 -0.0051 -0.0067 0.0320  29   VAL A CG1 
204  C  CG2 . VAL A 30  ? 0.1693 0.1019 0.2955 -0.0036 0.0030  -0.0055 29   VAL A CG2 
205  N  N   . SER A 31  ? 0.1376 0.1398 0.1672 -0.0068 0.0186  0.0272  30   SER A N   
206  C  CA  . SER A 31  ? 0.1866 0.1332 0.1654 -0.0094 0.0317  0.0111  30   SER A CA  
207  C  C   . SER A 31  ? 0.1708 0.0763 0.2215 0.0292  0.0168  0.0101  30   SER A C   
208  O  O   . SER A 31  ? 0.1969 0.1461 0.2310 -0.0382 -0.0041 0.0447  30   SER A O   
209  C  CB  . SER A 31  ? 0.1819 0.1808 0.2723 0.0349  0.0654  0.0310  30   SER A CB  
210  O  OG  . SER A 31  ? 0.2010 0.3212 0.4311 0.0479  0.0138  -0.0075 30   SER A OG  
211  N  N   . GLY A 32  ? 0.1481 0.1117 0.2036 0.0145  -0.0016 0.0136  31   GLY A N   
212  C  CA  . GLY A 32  ? 0.1537 0.1132 0.2203 0.0158  -0.0116 0.0005  31   GLY A CA  
213  C  C   . GLY A 32  ? 0.1613 0.1153 0.2079 0.0087  0.0102  0.0117  31   GLY A C   
214  O  O   . GLY A 32  ? 0.1601 0.1079 0.2044 0.0087  0.0104  0.0048  31   GLY A O   
215  N  N   . GLU A 33  ? 0.1417 0.0977 0.2168 0.0120  0.0046  0.0269  32   GLU A N   
216  C  CA  . GLU A 33  ? 0.1146 0.0946 0.2172 0.0302  0.0205  0.0112  32   GLU A CA  
217  C  C   . GLU A 33  ? 0.1132 0.0956 0.2549 0.0325  0.0276  0.0027  32   GLU A C   
218  O  O   . GLU A 33  ? 0.1102 0.1328 0.2470 0.0125  0.0166  0.0204  32   GLU A O   
219  C  CB  . GLU A 33  ? 0.1348 0.1413 0.2683 0.0126  0.0582  -0.0123 32   GLU A CB  
220  C  CG  . GLU A 33  ? 0.1362 0.2001 0.2691 0.0029  0.0753  -0.0228 32   GLU A CG  
221  C  CD  . GLU A 33  ? 0.1655 0.1669 0.2982 0.0169  0.0875  -0.0266 32   GLU A CD  
222  O  OE1 . GLU A 33  ? 0.1633 0.2111 0.2997 0.0267  0.0126  -0.0479 32   GLU A OE1 
223  O  OE2 . GLU A 33  ? 0.1440 0.1947 0.2442 0.0339  0.0685  0.0005  32   GLU A OE2 
224  N  N   . GLY A 34  ? 0.1299 0.1329 0.2141 0.0047  0.0160  0.0074  33   GLY A N   
225  C  CA  . GLY A 34  ? 0.1266 0.1578 0.2515 0.0029  0.0096  0.0435  33   GLY A CA  
226  C  C   . GLY A 34  ? 0.1282 0.1252 0.1932 -0.0032 -0.0084 0.0101  33   GLY A C   
227  O  O   . GLY A 34  ? 0.1348 0.1652 0.2554 0.0182  0.0054  0.0448  33   GLY A O   
228  N  N   . GLU A 35  ? 0.1269 0.1478 0.2082 0.0052  -0.0153 0.0462  34   GLU A N   
229  C  CA  . GLU A 35  ? 0.1398 0.1271 0.2489 0.0080  0.0217  0.0397  34   GLU A CA  
230  C  C   . GLU A 35  ? 0.1146 0.1268 0.2006 0.0012  -0.0215 0.0150  34   GLU A C   
231  O  O   . GLU A 35  ? 0.1502 0.1375 0.2291 0.0227  -0.0148 0.0345  34   GLU A O   
232  C  CB  . GLU A 35  ? 0.2971 0.1530 0.2355 -0.0190 0.1001  0.0124  34   GLU A CB  
233  C  CG  . GLU A 35  ? 0.4730 0.2746 0.3384 -0.1306 -0.0431 -0.0191 34   GLU A CG  
234  C  CD  . GLU A 35  ? 0.4658 0.3313 0.4877 -0.0431 -0.0510 -0.1337 34   GLU A CD  
235  O  OE1 . GLU A 35  ? 0.5012 0.3775 0.5138 0.0323  -0.1597 -0.2528 34   GLU A OE1 
236  O  OE2 . GLU A 35  ? 0.4408 0.4649 0.6210 -0.1161 0.1716  -0.1641 34   GLU A OE2 
237  N  N   . GLY A 36  ? 0.1264 0.1119 0.2088 0.0349  0.0011  0.0120  35   GLY A N   
238  C  CA  . GLY A 36  ? 0.1470 0.0962 0.2655 -0.0043 0.0426  -0.0183 35   GLY A CA  
239  C  C   . GLY A 36  ? 0.1297 0.0971 0.2545 -0.0025 -0.0082 0.0036  35   GLY A C   
240  O  O   . GLY A 36  ? 0.1474 0.1134 0.2545 0.0146  0.0175  0.0154  35   GLY A O   
241  N  N   . ASP A 37  ? 0.1253 0.1329 0.2649 -0.0012 -0.0042 0.0397  36   ASP A N   
242  C  CA  . ASP A 37  ? 0.1233 0.1591 0.2441 -0.0067 -0.0183 0.0626  36   ASP A CA  
243  C  C   . ASP A 37  ? 0.1600 0.1452 0.2401 -0.0229 -0.0021 0.0484  36   ASP A C   
244  O  O   . ASP A 37  ? 0.1565 0.1518 0.1911 -0.0100 -0.0035 -0.0063 36   ASP A O   
245  C  CB  . ASP A 37  ? 0.1206 0.2302 0.2861 -0.0199 0.0007  -0.0193 36   ASP A CB  
246  C  CG  . ASP A 37  ? 0.2472 0.2079 0.4069 -0.0289 -0.0315 -0.0396 36   ASP A CG  
247  O  OD1 . ASP A 37  ? 0.2211 0.3246 0.5163 -0.0479 0.0783  0.0970  36   ASP A OD1 
248  O  OD2 . ASP A 37  ? 0.2984 0.3749 0.5486 -0.0720 -0.0557 -0.1939 36   ASP A OD2 
249  N  N   . ALA A 38  ? 0.1616 0.1306 0.2502 -0.0138 -0.0194 0.0389  37   ALA A N   
250  C  CA  . ALA A 38  ? 0.1591 0.1149 0.2368 -0.0367 -0.0308 0.0287  37   ALA A CA  
251  C  C   . ALA A 38  ? 0.1418 0.1398 0.2825 -0.0268 -0.0225 -0.0432 37   ALA A C   
252  O  O   . ALA A 38  ? 0.1649 0.1655 0.2310 -0.0147 -0.0261 -0.0489 37   ALA A O   
253  C  CB  . ALA A 38  ? 0.1569 0.1960 0.2503 -0.0306 -0.0419 0.0349  37   ALA A CB  
254  N  N   . THR A 39  ? 0.1407 0.1159 0.2844 -0.0280 -0.0068 -0.0175 38   THR A N   
255  C  CA  . THR A 39  ? 0.1516 0.1305 0.1955 -0.0421 -0.0011 -0.0040 38   THR A CA  
256  C  C   . THR A 39  ? 0.1388 0.1338 0.2073 -0.0524 -0.0028 0.0026  38   THR A C   
257  O  O   . THR A 39  ? 0.1374 0.1710 0.2636 -0.0524 0.0046  0.0203  38   THR A O   
258  C  CB  . THR A 39  ? 0.2066 0.1164 0.2526 -0.0559 0.0014  -0.0045 38   THR A CB  
259  O  OG1 . THR A 39  ? 0.2283 0.1225 0.4557 -0.0255 -0.0410 0.0173  38   THR A OG1 
260  C  CG2 . THR A 39  ? 0.2282 0.1133 0.2562 -0.0831 -0.0116 0.0328  38   THR A CG2 
261  N  N   . TYR A 40  ? 0.1653 0.1702 0.1942 -0.0362 0.0047  0.0171  39   TYR A N   
262  C  CA  . TYR A 40  ? 0.1205 0.1959 0.2028 -0.0623 -0.0101 0.0317  39   TYR A CA  
263  C  C   . TYR A 40  ? 0.0842 0.1815 0.1948 -0.0412 0.0041  0.0459  39   TYR A C   
264  O  O   . TYR A 40  ? 0.1400 0.2094 0.2909 0.0114  -0.0466 0.0472  39   TYR A O   
265  C  CB  . TYR A 40  ? 0.1534 0.1895 0.1997 -0.0508 0.0083  0.0386  39   TYR A CB  
266  C  CG  . TYR A 40  ? 0.1915 0.2084 0.2655 -0.0767 -0.0301 0.0020  39   TYR A CG  
267  C  CD1 . TYR A 40  ? 0.2014 0.2500 0.3042 -0.1008 -0.0879 0.0345  39   TYR A CD1 
268  C  CD2 . TYR A 40  ? 0.2408 0.1885 0.2575 -0.0655 0.0266  0.0047  39   TYR A CD2 
269  C  CE1 . TYR A 40  ? 0.2765 0.2577 0.2981 -0.1368 -0.0653 0.0189  39   TYR A CE1 
270  C  CE2 . TYR A 40  ? 0.3138 0.2050 0.2722 -0.0892 0.0303  -0.0332 39   TYR A CE2 
271  C  CZ  . TYR A 40  ? 0.3254 0.2594 0.3366 -0.1255 -0.0614 -0.0716 39   TYR A CZ  
272  O  OH  . TYR A 40  ? 0.4258 0.2607 0.2997 -0.1560 -0.0150 -0.0561 39   TYR A OH  
273  N  N   . GLY A 41  ? 0.1314 0.1513 0.1983 -0.0157 -0.0176 0.0110  40   GLY A N   
274  C  CA  . GLY A 41  ? 0.1354 0.1516 0.2037 -0.0009 -0.0046 -0.0131 40   GLY A CA  
275  C  C   . GLY A 41  ? 0.1474 0.1374 0.2154 -0.0238 0.0026  -0.0189 40   GLY A C   
276  O  O   . GLY A 41  ? 0.1575 0.1455 0.2633 0.0141  0.0514  -0.0072 40   GLY A O   
277  N  N   . LYS A 42  ? 0.1432 0.1125 0.1986 -0.0167 -0.0016 0.0070  41   LYS A N   
278  C  CA  . LYS A 42  ? 0.0879 0.1467 0.1920 -0.0212 -0.0247 0.0223  41   LYS A CA  
279  C  C   . LYS A 42  ? 0.0911 0.0824 0.2479 -0.0084 -0.0173 0.0336  41   LYS A C   
280  O  O   . LYS A 42  ? 0.1171 0.1205 0.2496 0.0194  -0.0069 0.0617  41   LYS A O   
281  C  CB  . LYS A 42  ? 0.1180 0.1822 0.1960 -0.0449 -0.0097 0.0064  41   LYS A CB  
282  C  CG  . LYS A 42  ? 0.1576 0.1684 0.1932 -0.0420 0.0094  -0.0069 41   LYS A CG  
283  C  CD  . LYS A 42  ? 0.1414 0.2062 0.2042 -0.0630 0.0043  -0.0171 41   LYS A CD  
284  C  CE  . LYS A 42  ? 0.1783 0.2465 0.2061 -0.0099 -0.0209 -0.0194 41   LYS A CE  
285  N  NZ  . LYS A 42  ? 0.2198 0.2687 0.1822 -0.0449 0.0352  -0.0458 41   LYS A NZ  
286  N  N   . LEU A 43  ? 0.1129 0.1028 0.2080 0.0062  0.0227  0.0432  42   LEU A N   
287  C  CA  . LEU A 43  ? 0.1120 0.1228 0.2121 -0.0275 -0.0026 0.0306  42   LEU A CA  
288  C  C   . LEU A 43  ? 0.0790 0.1595 0.2225 -0.0081 0.0106  0.0515  42   LEU A C   
289  O  O   . LEU A 43  ? 0.1307 0.1427 0.2072 0.0306  0.0148  0.0243  42   LEU A O   
290  C  CB  . LEU A 43  ? 0.1550 0.2067 0.3180 -0.0207 -0.0395 -0.0618 42   LEU A CB  
291  C  CG  . LEU A 43  ? 0.2076 0.2192 0.3165 -0.0133 -0.0671 -0.0795 42   LEU A CG  
292  C  CD1 . LEU A 43  ? 0.4437 0.2361 0.3900 0.0671  -0.1343 -0.1247 42   LEU A CD1 
293  C  CD2 . LEU A 43  ? 0.2903 0.2190 0.3511 0.0322  -0.0325 -0.0062 42   LEU A CD2 
294  N  N   . THR A 44  ? 0.1169 0.1367 0.2288 0.0176  0.0139  0.0366  43   THR A N   
295  C  CA  . THR A 44  ? 0.1069 0.2003 0.2072 -0.0002 0.0009  0.0187  43   THR A CA  
296  C  C   . THR A 44  ? 0.1094 0.1364 0.2523 0.0196  0.0199  0.0403  43   THR A C   
297  O  O   . THR A 44  ? 0.1162 0.1376 0.2672 0.0273  0.0369  0.0444  43   THR A O   
298  C  CB  . THR A 44  ? 0.1495 0.2364 0.2625 0.0124  -0.0004 -0.0369 43   THR A CB  
299  O  OG1 . THR A 44  ? 0.2944 0.2269 0.4981 0.0530  -0.0375 -0.0524 43   THR A OG1 
300  C  CG2 . THR A 44  ? 0.1638 0.1826 0.2745 -0.0622 0.0253  -0.0160 43   THR A CG2 
301  N  N   . LEU A 45  ? 0.1212 0.1345 0.2262 0.0173  0.0161  0.0287  44   LEU A N   
302  C  CA  . LEU A 45  ? 0.1213 0.1405 0.1730 0.0101  0.0005  0.0330  44   LEU A CA  
303  C  C   . LEU A 45  ? 0.1241 0.1220 0.1452 -0.0001 -0.0134 0.0097  44   LEU A C   
304  O  O   . LEU A 45  ? 0.1321 0.1736 0.2238 0.0132  0.0057  0.0804  44   LEU A O   
305  C  CB  . LEU A 45  ? 0.2201 0.1932 0.1494 -0.0333 -0.0017 0.0473  44   LEU A CB  
306  C  CG  . LEU A 45  ? 0.2663 0.2117 0.1737 0.0461  0.0203  0.0766  44   LEU A CG  
307  C  CD1 . LEU A 45  ? 0.3530 0.4137 0.2504 0.0602  0.2029  0.0672  44   LEU A CD1 
308  C  CD2 . LEU A 45  ? 0.2888 0.2606 0.2619 0.0766  0.0070  0.1044  44   LEU A CD2 
309  N  N   . LYS A 46  ? 0.1321 0.0942 0.2234 -0.0015 0.0142  0.0407  45   LYS A N   
310  C  CA  . LYS A 46  ? 0.1389 0.1149 0.1695 -0.0145 -0.0090 0.0270  45   LYS A CA  
311  C  C   . LYS A 46  ? 0.1038 0.0942 0.1240 0.0125  0.0142  0.0333  45   LYS A C   
312  O  O   . LYS A 46  ? 0.1567 0.1110 0.2082 0.0424  -0.0301 0.0218  45   LYS A O   
313  C  CB  . LYS A 46  ? 0.1422 0.1130 0.1879 -0.0170 -0.0135 0.0035  45   LYS A CB  
314  C  CG  . LYS A 46  ? 0.1780 0.1462 0.1626 -0.0095 -0.0060 0.0142  45   LYS A CG  
315  C  CD  . LYS A 46  ? 0.1714 0.2116 0.2103 -0.0328 0.0285  -0.0330 45   LYS A CD  
316  C  CE  . LYS A 46  ? 0.2207 0.1871 0.1866 0.0286  0.0383  0.0105  45   LYS A CE  
317  N  NZ  . LYS A 46  ? 0.1850 0.1615 0.2094 0.0173  0.0287  -0.0110 45   LYS A NZ  
318  N  N   . PHE A 47  ? 0.1129 0.0906 0.2147 0.0158  -0.0038 0.0084  46   PHE A N   
319  C  CA  . PHE A 47  ? 0.1046 0.1057 0.1880 0.0075  -0.0007 0.0243  46   PHE A CA  
320  C  C   . PHE A 47  ? 0.1093 0.1381 0.1845 0.0058  -0.0033 0.0361  46   PHE A C   
321  O  O   . PHE A 47  ? 0.1351 0.1214 0.1904 0.0083  -0.0162 0.0322  46   PHE A O   
322  C  CB  . PHE A 47  ? 0.1454 0.0991 0.1894 -0.0017 0.0037  0.0179  46   PHE A CB  
323  C  CG  . PHE A 47  ? 0.1248 0.1278 0.1880 0.0081  0.0046  0.0219  46   PHE A CG  
324  C  CD1 . PHE A 47  ? 0.1219 0.1657 0.1793 0.0104  -0.0017 0.0033  46   PHE A CD1 
325  C  CD2 . PHE A 47  ? 0.1142 0.1636 0.1716 0.0214  0.0102  0.0104  46   PHE A CD2 
326  C  CE1 . PHE A 47  ? 0.1265 0.1799 0.1720 0.0179  0.0301  -0.0284 46   PHE A CE1 
327  C  CE2 . PHE A 47  ? 0.1473 0.1559 0.1747 0.0148  0.0155  0.0153  46   PHE A CE2 
328  C  CZ  . PHE A 47  ? 0.1527 0.1597 0.1869 -0.0077 0.0292  0.0090  46   PHE A CZ  
329  N  N   . ILE A 48  ? 0.1077 0.1116 0.1730 0.0238  0.0138  0.0047  47   ILE A N   
330  C  CA  . ILE A 48  ? 0.1215 0.1337 0.1977 0.0002  0.0294  -0.0035 47   ILE A CA  
331  C  C   . ILE A 48  ? 0.1607 0.1267 0.1947 -0.0090 0.0004  0.0122  47   ILE A C   
332  O  O   . ILE A 48  ? 0.1614 0.1376 0.1863 0.0025  0.0135  0.0109  47   ILE A O   
333  C  CB  . ILE A 48  ? 0.1563 0.1517 0.1625 0.0160  0.0352  0.0065  47   ILE A CB  
334  C  CG1 . ILE A 48  ? 0.1412 0.1860 0.1974 0.0359  0.0341  -0.0398 47   ILE A CG1 
335  C  CG2 . ILE A 48  ? 0.2319 0.1973 0.2295 -0.0146 0.1070  -0.0151 47   ILE A CG2 
336  C  CD1 . ILE A 48  ? 0.2269 0.2121 0.3108 0.0410  0.0758  -0.0945 47   ILE A CD1 
337  N  N   . CYS A 49  ? 0.1264 0.1439 0.2043 -0.0146 -0.0082 0.0257  48   CYS A N   
338  C  CA  . CYS A 49  ? 0.1271 0.1354 0.2063 -0.0063 0.0150  -0.0001 48   CYS A CA  
339  C  C   . CYS A 49  ? 0.1239 0.1495 0.1969 -0.0108 0.0185  0.0355  48   CYS A C   
340  O  O   . CYS A 49  ? 0.1370 0.1808 0.1903 0.0036  0.0108  0.0198  48   CYS A O   
341  C  CB  . CYS A 49  ? 0.1593 0.1395 0.1791 -0.0032 0.0023  0.0044  48   CYS A CB  
342  S  SG  . CYS A 49  ? 0.1596 0.1468 0.2835 -0.0266 0.0074  0.0084  48   CYS A SG  
343  N  N   . THR A 50  ? 0.1473 0.1964 0.1809 0.0367  0.0138  0.0025  49   THR A N   
344  C  CA  . THR A 50  ? 0.1754 0.1851 0.2034 0.0535  0.0343  0.0065  49   THR A CA  
345  C  C   . THR A 50  ? 0.1252 0.2050 0.2143 0.0672  0.0057  0.0188  49   THR A C   
346  O  O   . THR A 50  ? 0.1415 0.3108 0.3232 0.0418  0.0482  -0.0660 49   THR A O   
347  C  CB  . THR A 50  ? 0.1781 0.1981 0.2488 0.0487  -0.0069 0.0155  49   THR A CB  
348  O  OG1 . THR A 50  ? 0.1973 0.1996 0.2509 0.0474  -0.0231 0.0218  49   THR A OG1 
349  C  CG2 . THR A 50  ? 0.2135 0.1753 0.2996 0.0435  -0.0339 0.0308  49   THR A CG2 
350  N  N   . THR A 51  ? 0.1600 0.2000 0.2211 0.0316  0.0273  0.0088  50   THR A N   
351  C  CA  . THR A 51  ? 0.1771 0.2413 0.3054 0.0001  0.0272  0.0044  50   THR A CA  
352  C  C   . THR A 51  ? 0.2163 0.2634 0.2972 -0.0620 0.0366  0.0312  50   THR A C   
353  O  O   . THR A 51  ? 0.2728 0.3746 0.2589 -0.1420 0.0447  0.0151  50   THR A O   
354  C  CB  . THR A 51  ? 0.1501 0.2640 0.3030 -0.0308 0.0212  0.0028  50   THR A CB  
355  O  OG1 . THR A 51  ? 0.1724 0.1948 0.3868 0.0015  0.0284  -0.0220 50   THR A OG1 
356  C  CG2 . THR A 51  ? 0.1411 0.3255 0.2552 0.0399  0.1066  0.0164  50   THR A CG2 
357  N  N   . GLY A 52  ? 0.1756 0.2154 0.2977 -0.0276 0.0741  0.0786  51   GLY A N   
358  C  CA  . GLY A 52  ? 0.2305 0.1907 0.2641 0.0349  0.1117  0.0465  51   GLY A CA  
359  C  C   . GLY A 52  ? 0.2067 0.1877 0.2624 0.0070  0.0653  0.0173  51   GLY A C   
360  O  O   . GLY A 52  ? 0.2213 0.2059 0.3003 -0.0236 0.0243  0.0263  51   GLY A O   
361  N  N   . LYS A 53  ? 0.1709 0.1909 0.2363 0.0049  0.0324  0.0223  52   LYS A N   
362  C  CA  . LYS A 53  ? 0.1925 0.2186 0.2926 0.0235  0.0412  -0.0103 52   LYS A CA  
363  C  C   . LYS A 53  ? 0.1633 0.1768 0.2906 0.0256  0.0362  0.0024  52   LYS A C   
364  O  O   . LYS A 53  ? 0.1739 0.2212 0.2999 -0.0018 0.0495  -0.0244 52   LYS A O   
365  C  CB  . LYS A 53  ? 0.3222 0.3207 0.3376 0.1154  0.0097  0.1009  52   LYS A CB  
366  C  CG  . LYS A 53  ? 0.4680 0.5127 0.3583 0.0532  -0.0455 0.1053  52   LYS A CG  
367  C  CD  . LYS A 53  ? 0.4934 0.6998 0.5308 0.0180  -0.1632 0.1115  52   LYS A CD  
368  C  CE  . LYS A 53  ? 0.5228 0.7500 0.6035 -0.0559 -0.1748 0.0496  52   LYS A CE  
369  N  NZ  . LYS A 53  ? 0.5089 0.8313 0.7505 -0.2053 0.1155  0.0068  52   LYS A NZ  
370  N  N   . LEU A 54  ? 0.1841 0.1662 0.2804 -0.0033 0.0173  0.0419  53   LEU A N   
371  C  CA  . LEU A 54  ? 0.1378 0.1831 0.2798 0.0078  0.0113  0.0495  53   LEU A CA  
372  C  C   . LEU A 54  ? 0.1454 0.1800 0.2752 0.0035  0.0335  0.0450  53   LEU A C   
373  O  O   . LEU A 54  ? 0.2076 0.1708 0.2778 0.0062  0.0073  0.0395  53   LEU A O   
374  C  CB  . LEU A 54  ? 0.1128 0.1841 0.2436 0.0090  -0.0010 -0.0337 53   LEU A CB  
375  C  CG  . LEU A 54  ? 0.1218 0.1735 0.2712 0.0006  0.0124  0.0149  53   LEU A CG  
376  C  CD1 . LEU A 54  ? 0.1208 0.1151 0.2859 -0.0085 0.0274  0.0082  53   LEU A CD1 
377  C  CD2 . LEU A 54  ? 0.1342 0.1455 0.3253 -0.0153 -0.0028 0.0304  53   LEU A CD2 
378  N  N   . PRO A 55  ? 0.1908 0.1737 0.2471 0.0048  0.0344  0.0641  54   PRO A N   
379  C  CA  . PRO A 55  ? 0.1937 0.1861 0.2357 0.0096  0.0259  0.0454  54   PRO A CA  
380  C  C   . PRO A 55  ? 0.2024 0.1849 0.2351 -0.0216 0.0373  0.0081  54   PRO A C   
381  O  O   . PRO A 55  ? 0.1838 0.1854 0.3302 -0.0183 0.0631  0.0104  54   PRO A O   
382  C  CB  . PRO A 55  ? 0.2089 0.2150 0.2983 -0.0248 -0.0063 0.0690  54   PRO A CB  
383  C  CG  . PRO A 55  ? 0.1758 0.2193 0.3045 -0.0104 -0.0032 0.0725  54   PRO A CG  
384  C  CD  . PRO A 55  ? 0.2027 0.2088 0.3015 0.0197  -0.0032 0.0618  54   PRO A CD  
385  N  N   . VAL A 56  ? 0.1499 0.1761 0.2132 -0.0062 -0.0184 0.0135  55   VAL A N   
386  C  CA  . VAL A 56  ? 0.1531 0.1695 0.2182 -0.0042 -0.0127 0.0097  55   VAL A CA  
387  C  C   . VAL A 56  ? 0.1366 0.1603 0.1759 0.0189  -0.0009 0.0060  55   VAL A C   
388  O  O   . VAL A 56  ? 0.1286 0.1466 0.2154 -0.0035 0.0386  0.0044  55   VAL A O   
389  C  CB  . VAL A 56  ? 0.1605 0.1365 0.2052 -0.0039 -0.0204 -0.0276 55   VAL A CB  
390  C  CG1 . VAL A 56  ? 0.1708 0.1400 0.2574 0.0000  -0.0291 -0.0590 55   VAL A CG1 
391  C  CG2 . VAL A 56  ? 0.2063 0.1297 0.2009 -0.0131 -0.0436 -0.0219 55   VAL A CG2 
392  N  N   . PRO A 57  ? 0.1310 0.1497 0.2132 0.0020  0.0255  -0.0068 56   PRO A N   
393  C  CA  . PRO A 57  ? 0.1403 0.1291 0.2018 0.0301  -0.0202 0.0050  56   PRO A CA  
394  C  C   . PRO A 57  ? 0.1523 0.1258 0.1982 0.0215  -0.0009 -0.0016 56   PRO A C   
395  O  O   . PRO A 57  ? 0.1572 0.1507 0.1949 -0.0147 -0.0135 0.0032  56   PRO A O   
396  C  CB  . PRO A 57  ? 0.1432 0.1237 0.2238 0.0202  -0.0102 -0.0136 56   PRO A CB  
397  C  CG  . PRO A 57  ? 0.1812 0.1265 0.2413 0.0186  -0.0428 -0.0298 56   PRO A CG  
398  C  CD  . PRO A 57  ? 0.1371 0.1335 0.2406 0.0135  -0.0091 -0.0066 56   PRO A CD  
399  N  N   . TRP A 58  ? 0.1488 0.1412 0.1987 -0.0075 0.0158  -0.0076 57   TRP A N   
400  C  CA  . TRP A 58  ? 0.1379 0.1365 0.1654 -0.0098 0.0067  -0.0217 57   TRP A CA  
401  C  C   . TRP A 58  ? 0.1391 0.1362 0.1490 0.0100  0.0030  -0.0148 57   TRP A C   
402  O  O   . TRP A 58  ? 0.1450 0.1177 0.1634 -0.0042 -0.0015 -0.0163 57   TRP A O   
403  C  CB  . TRP A 58  ? 0.1412 0.1487 0.1468 0.0155  0.0015  -0.0180 57   TRP A CB  
404  C  CG  . TRP A 58  ? 0.1415 0.1161 0.1826 0.0155  0.0245  -0.0038 57   TRP A CG  
405  C  CD1 . TRP A 58  ? 0.1505 0.1340 0.1995 0.0455  0.0366  0.0221  57   TRP A CD1 
406  C  CD2 . TRP A 58  ? 0.1135 0.1672 0.1771 0.0035  0.0085  0.0192  57   TRP A CD2 
407  N  NE1 . TRP A 58  ? 0.1212 0.1505 0.1774 0.0272  0.0169  0.0191  57   TRP A NE1 
408  C  CE2 . TRP A 58  ? 0.1071 0.1232 0.1528 0.0024  -0.0109 -0.0126 57   TRP A CE2 
409  C  CE3 . TRP A 58  ? 0.1408 0.1633 0.1478 0.0273  0.0047  -0.0120 57   TRP A CE3 
410  C  CZ2 . TRP A 58  ? 0.1039 0.0997 0.2078 -0.0085 -0.0044 0.0057  57   TRP A CZ2 
411  C  CZ3 . TRP A 58  ? 0.1247 0.1242 0.2175 0.0032  0.0150  0.0093  57   TRP A CZ3 
412  C  CH2 . TRP A 58  ? 0.1052 0.1381 0.2398 0.0111  0.0208  0.0412  57   TRP A CH2 
413  N  N   . PRO A 59  ? 0.1543 0.1313 0.1834 0.0245  0.0186  -0.0049 58   PRO A N   
414  C  CA  . PRO A 59  ? 0.1427 0.1280 0.1777 0.0208  0.0044  -0.0101 58   PRO A CA  
415  C  C   . PRO A 59  ? 0.1407 0.1296 0.1736 0.0034  -0.0017 0.0075  58   PRO A C   
416  O  O   . PRO A 59  ? 0.1382 0.1329 0.1776 -0.0270 0.0070  -0.0181 58   PRO A O   
417  C  CB  . PRO A 59  ? 0.1333 0.1376 0.1830 0.0110  -0.0030 0.0005  58   PRO A CB  
418  C  CG  . PRO A 59  ? 0.1551 0.1894 0.1836 -0.0091 -0.0037 0.0256  58   PRO A CG  
419  C  CD  . PRO A 59  ? 0.1534 0.1292 0.1841 0.0264  0.0099  -0.0099 58   PRO A CD  
420  N  N   . THR A 60  ? 0.1227 0.1439 0.1737 -0.0015 0.0109  0.0129  59   THR A N   
421  C  CA  . THR A 60  ? 0.1296 0.1402 0.1897 -0.0071 -0.0006 0.0046  59   THR A CA  
422  C  C   . THR A 60  ? 0.1530 0.1156 0.1805 -0.0109 -0.0155 -0.0122 59   THR A C   
423  O  O   . THR A 60  ? 0.1502 0.1309 0.1818 -0.0083 -0.0142 -0.0141 59   THR A O   
424  C  CB  . THR A 60  ? 0.1636 0.1349 0.1502 -0.0160 0.0317  0.0154  59   THR A CB  
425  O  OG1 . THR A 60  ? 0.1549 0.1878 0.1674 -0.0412 0.0305  -0.0220 59   THR A OG1 
426  C  CG2 . THR A 60  ? 0.2280 0.1504 0.1942 -0.0142 -0.0239 0.0235  59   THR A CG2 
427  N  N   . LEU A 61  ? 0.1527 0.1346 0.1955 -0.0076 0.0164  -0.0197 60   LEU A N   
428  C  CA  . LEU A 61  ? 0.1338 0.1421 0.1929 0.0022  0.0472  -0.0092 60   LEU A CA  
429  C  C   . LEU A 61  ? 0.1257 0.1256 0.1535 0.0037  0.0122  -0.0376 60   LEU A C   
430  O  O   . LEU A 61  ? 0.1016 0.1263 0.2370 0.0142  0.0319  -0.0198 60   LEU A O   
431  C  CB  . LEU A 61  ? 0.1770 0.1591 0.1919 0.0029  0.0652  -0.0262 60   LEU A CB  
432  C  CG  . LEU A 61  ? 0.1655 0.1998 0.1765 -0.0051 0.0704  -0.0001 60   LEU A CG  
433  C  CD1 . LEU A 61  ? 0.1378 0.2212 0.2005 0.0271  0.0381  -0.0106 60   LEU A CD1 
434  C  CD2 . LEU A 61  ? 0.1341 0.2287 0.2205 0.0004  0.0480  -0.0339 60   LEU A CD2 
435  N  N   . VAL A 62  ? 0.1374 0.1518 0.1433 0.0019  -0.0047 -0.0346 61   VAL A N   
436  C  CA  . VAL A 62  ? 0.0994 0.1687 0.2192 0.0054  0.0109  -0.0139 61   VAL A CA  
437  C  C   . VAL A 62  ? 0.1017 0.1757 0.2137 -0.0317 0.0140  -0.0190 61   VAL A C   
438  O  O   . VAL A 62  ? 0.1452 0.1940 0.1926 0.0117  0.0083  -0.0168 61   VAL A O   
439  C  CB  . VAL A 62  ? 0.0915 0.1669 0.2511 0.0215  0.0235  0.0206  61   VAL A CB  
440  C  CG1 . VAL A 62  ? 0.1184 0.2162 0.1923 -0.0294 0.0330  -0.0121 61   VAL A CG1 
441  C  CG2 . VAL A 62  ? 0.1259 0.1902 0.2520 -0.0434 -0.0120 0.0651  61   VAL A CG2 
442  N  N   . THR A 63  ? 0.1274 0.1779 0.2251 -0.0161 0.0244  -0.0181 62   THR A N   
443  C  CA  . THR A 63  ? 0.1217 0.2366 0.2199 0.0162  0.0364  -0.0192 62   THR A CA  
444  C  C   . THR A 63  ? 0.1402 0.2556 0.2336 0.0206  0.0196  -0.0071 62   THR A C   
445  O  O   . THR A 63  ? 0.1781 0.2615 0.3006 0.0275  0.0210  0.0327  62   THR A O   
446  C  CB  . THR A 63  ? 0.1453 0.2506 0.2319 0.0158  0.0129  -0.0527 62   THR A CB  
447  O  OG1 . THR A 63  ? 0.1861 0.2521 0.2500 0.0025  -0.0147 -0.0371 62   THR A OG1 
448  C  CG2 . THR A 63  ? 0.1411 0.1864 0.3318 0.0304  0.0341  0.0082  62   THR A CG2 
449  N  N   . THR A 64  ? 0.1276 0.2255 0.2339 0.0182  -0.0041 -0.0182 63   THR A N   
450  C  CA  . THR A 64  ? 0.1363 0.2080 0.1988 0.0071  -0.0225 -0.0266 63   THR A CA  
451  C  C   . THR A 64  ? 0.1267 0.1823 0.1941 -0.0087 0.0108  -0.0028 63   THR A C   
452  O  O   . THR A 64  ? 0.1918 0.2225 0.1901 0.0281  0.0284  0.0203  63   THR A O   
453  C  CB  . THR A 64  ? 0.1217 0.1542 0.2240 0.0460  0.0070  -0.0361 63   THR A CB  
454  O  OG1 . THR A 64  ? 0.1366 0.2230 0.2806 0.0296  -0.0051 -0.1234 63   THR A OG1 
455  C  CG2 . THR A 64  ? 0.1227 0.1811 0.4093 0.0307  -0.0404 -0.0578 63   THR A CG2 
456  N  N   . LEU A 65  ? 0.1024 0.1757 0.2026 0.0041  -0.0019 -0.0145 64   LEU A N   
457  C  CA  . LEU A 65  ? 0.1420 0.1683 0.2321 0.0015  -0.0147 -0.0265 64   LEU A CA  
458  C  C   . LEU A 65  ? 0.1288 0.1731 0.2497 0.0016  -0.0481 -0.0031 64   LEU A C   
459  O  O   . LEU A 65  ? 0.1578 0.1719 0.3502 -0.0024 0.0407  -0.0391 64   LEU A O   
460  C  CB  . LEU A 65  ? 0.1122 0.1572 0.2289 -0.0140 -0.0190 -0.0517 64   LEU A CB  
461  C  CG  . LEU A 65  ? 0.1111 0.1232 0.2282 0.0224  0.0053  -0.0505 64   LEU A CG  
462  C  CD1 . LEU A 65  ? 0.1510 0.2322 0.2334 0.0400  0.0111  -0.0183 64   LEU A CD1 
463  C  CD2 . LEU A 65  ? 0.1125 0.1660 0.2755 0.0326  0.0250  -0.0120 64   LEU A CD2 
464  N  N1  . CRO A 66  ? 0.1515 0.1661 0.2323 0.0187  -0.0168 0.0452  66   CRO A N1  
465  C  CA1 . CRO A 66  ? 0.1534 0.1940 0.2848 -0.0173 -0.0128 0.0012  66   CRO A CA1 
466  C  CB1 . CRO A 66  ? 0.1914 0.2183 0.2947 -0.0050 -0.0525 0.0194  66   CRO A CB1 
467  C  CG1 . CRO A 66  ? 0.1979 0.3396 0.3633 0.0070  -0.0787 -0.1037 66   CRO A CG1 
468  O  OG1 . CRO A 66  ? 0.2297 0.1823 0.3301 -0.0147 -0.0630 0.0298  66   CRO A OG1 
469  C  C1  . CRO A 66  ? 0.1442 0.2113 0.2990 -0.0131 0.0071  0.0054  66   CRO A C1  
470  N  N2  . CRO A 66  ? 0.1864 0.3113 0.3457 0.0497  -0.0488 -0.0856 66   CRO A N2  
471  N  N3  . CRO A 66  ? 0.1885 0.3000 0.2842 0.0448  0.0142  0.0340  66   CRO A N3  
472  C  C2  . CRO A 66  ? 0.2320 0.2046 0.2947 0.0227  0.0092  0.0106  66   CRO A C2  
473  O  O2  . CRO A 66  ? 0.2750 0.2390 0.2938 -0.0255 0.0171  0.0006  66   CRO A O2  
474  C  CA2 . CRO A 66  ? 0.1975 0.2344 0.3358 0.0268  0.0011  -0.0309 66   CRO A CA2 
475  C  CA3 . CRO A 66  ? 0.1691 0.1942 0.3862 -0.0317 -0.0593 -0.0303 66   CRO A CA3 
476  C  C3  . CRO A 66  ? 0.2089 0.2271 0.3740 -0.0167 -0.0599 0.0216  66   CRO A C3  
477  O  O3  . CRO A 66  ? 0.1664 0.3222 0.2500 0.0142  0.0289  0.0348  66   CRO A O3  
478  C  CB2 . CRO A 66  ? 0.2884 0.3143 0.3481 0.1175  -0.0295 -0.0549 66   CRO A CB2 
479  C  CG2 . CRO A 66  ? 0.2554 0.2770 0.4089 0.0653  -0.0337 0.0009  66   CRO A CG2 
480  C  CD1 . CRO A 66  ? 0.2337 0.3181 0.4010 0.0454  -0.0362 0.0325  66   CRO A CD1 
481  C  CD2 . CRO A 66  ? 0.2259 0.3138 0.4422 0.0781  -0.0506 -0.0139 66   CRO A CD2 
482  C  CE1 . CRO A 66  ? 0.2715 0.4179 0.4426 0.0878  -0.0445 0.0663  66   CRO A CE1 
483  C  CE2 . CRO A 66  ? 0.2284 0.3469 0.4879 0.0722  -0.0645 0.0162  66   CRO A CE2 
484  C  CZ  . CRO A 66  ? 0.2255 0.4226 0.4757 0.0825  -0.0600 0.0496  66   CRO A CZ  
485  O  OH  . CRO A 66  ? 0.2392 0.4083 0.5024 0.0704  -0.0424 0.1541  66   CRO A OH  
486  N  N   . VAL A 67  ? 0.2199 0.1831 0.2615 -0.0245 0.0340  -0.0160 68   VAL A N   
487  C  CA  . VAL A 67  ? 0.1098 0.2042 0.2317 0.0283  0.0022  0.0364  68   VAL A CA  
488  C  C   . VAL A 67  ? 0.1281 0.1858 0.2543 0.0039  0.0119  -0.0133 68   VAL A C   
489  O  O   . VAL A 67  ? 0.1666 0.1605 0.2127 -0.0160 0.0255  0.0188  68   VAL A O   
490  C  CB  . VAL A 67  ? 0.1189 0.1532 0.2725 -0.0223 0.0206  0.0151  68   VAL A CB  
491  C  CG1 . VAL A 67  ? 0.1377 0.2542 0.4168 0.0136  0.1121  0.0986  68   VAL A CG1 
492  C  CG2 . VAL A 67  ? 0.2570 0.2127 0.2460 -0.0083 -0.0079 0.0055  68   VAL A CG2 
493  N  N   . GLN A 68  ? 0.1350 0.1450 0.2355 -0.0004 0.0246  0.0117  69   GLN A N   
494  C  CA  . GLN A 68  ? 0.1177 0.1360 0.2384 0.0043  0.0034  0.0070  69   GLN A CA  
495  C  C   . GLN A 68  ? 0.1269 0.1498 0.1571 0.0073  0.0188  0.0039  69   GLN A C   
496  O  O   . GLN A 68  ? 0.1511 0.1816 0.1685 -0.0122 0.0544  -0.0130 69   GLN A O   
497  C  CB  . GLN A 68  ? 0.1877 0.1431 0.2192 -0.0136 0.0603  0.0219  69   GLN A CB  
498  C  CG  . GLN A 68  ? 0.2364 0.1167 0.2657 -0.0336 0.1146  0.0308  69   GLN A CG  
499  C  CD  . GLN A 68  ? 0.4009 0.1629 0.3239 0.0360  0.1073  -0.0250 69   GLN A CD  
500  O  OE1 . GLN A 68  ? 0.4406 0.2449 0.3972 0.0038  0.0380  -0.1175 69   GLN A OE1 
501  N  NE2 . GLN A 68  ? 0.9203 0.3111 0.3188 0.3282  0.0813  -0.0268 69   GLN A NE2 
502  N  N   . CYS A 69  ? 0.1378 0.1408 0.1790 0.0031  -0.0202 0.0133  70   CYS A N   
503  C  CA  . CYS A 69  ? 0.1357 0.1417 0.1876 -0.0045 -0.0107 0.0106  70   CYS A CA  
504  C  C   . CYS A 69  ? 0.1237 0.1355 0.1930 -0.0009 -0.0023 0.0080  70   CYS A C   
505  O  O   . CYS A 69  ? 0.1447 0.1310 0.2279 -0.0085 0.0119  0.0007  70   CYS A O   
506  C  CB  . CYS A 69  ? 0.1478 0.1262 0.2046 -0.0016 -0.0252 0.0130  70   CYS A CB  
507  S  SG  . CYS A 69  ? 0.1534 0.2102 0.3419 0.0250  0.0428  0.0680  70   CYS A SG  
508  N  N   . PHE A 70  ? 0.1182 0.1520 0.1711 -0.0143 0.0140  -0.0109 71   PHE A N   
509  C  CA  . PHE A 70  ? 0.1071 0.1565 0.1919 -0.0029 0.0012  -0.0127 71   PHE A CA  
510  C  C   . PHE A 70  ? 0.1167 0.1095 0.2104 0.0078  -0.0049 0.0134  71   PHE A C   
511  O  O   . PHE A 70  ? 0.1062 0.1425 0.2526 -0.0144 -0.0101 -0.0069 71   PHE A O   
512  C  CB  . PHE A 70  ? 0.1230 0.1580 0.1753 0.0216  -0.0184 -0.0060 71   PHE A CB  
513  C  CG  . PHE A 70  ? 0.1137 0.1135 0.1940 -0.0149 0.0045  -0.0258 71   PHE A CG  
514  C  CD1 . PHE A 70  ? 0.1177 0.1153 0.2067 -0.0320 0.0478  -0.0363 71   PHE A CD1 
515  C  CD2 . PHE A 70  ? 0.1147 0.0964 0.2073 -0.0104 -0.0149 -0.0237 71   PHE A CD2 
516  C  CE1 . PHE A 70  ? 0.1360 0.1183 0.1917 -0.0058 0.0000  -0.0308 71   PHE A CE1 
517  C  CE2 . PHE A 70  ? 0.1165 0.1127 0.2380 -0.0040 0.0022  -0.0078 71   PHE A CE2 
518  C  CZ  . PHE A 70  ? 0.1193 0.1021 0.2004 0.0130  -0.0149 0.0204  71   PHE A CZ  
519  N  N   . SER A 71  ? 0.0951 0.1107 0.2779 -0.0237 0.0163  -0.0280 72   SER A N   
520  C  CA  . SER A 71  ? 0.0962 0.1548 0.2342 -0.0292 0.0230  -0.0114 72   SER A CA  
521  C  C   . SER A 71  ? 0.0879 0.1430 0.2048 -0.0121 0.0180  0.0044  72   SER A C   
522  O  O   . SER A 71  ? 0.1425 0.1808 0.2682 0.0002  -0.0056 0.0441  72   SER A O   
523  C  CB  . SER A 71  ? 0.1534 0.1740 0.2847 -0.0174 0.0438  -0.0534 72   SER A CB  
524  O  OG  . SER A 71  ? 0.1767 0.1560 0.3417 -0.0137 -0.0577 -0.0324 72   SER A OG  
525  N  N   . ARG A 72  ? 0.0932 0.1404 0.2398 -0.0281 0.0091  0.0165  73   ARG A N   
526  C  CA  . ARG A 72  ? 0.1422 0.1415 0.1841 -0.0623 -0.0109 -0.0013 73   ARG A CA  
527  C  C   . ARG A 72  ? 0.1172 0.1391 0.1909 -0.0294 -0.0059 0.0192  73   ARG A C   
528  O  O   . ARG A 72  ? 0.1495 0.1290 0.2451 -0.0205 -0.0034 0.0228  73   ARG A O   
529  C  CB  . ARG A 72  ? 0.1309 0.1602 0.2153 -0.0293 -0.0199 -0.0316 73   ARG A CB  
530  C  CG  . ARG A 72  ? 0.1739 0.1581 0.3044 -0.0643 -0.0379 -0.0694 73   ARG A CG  
531  C  CD  . ARG A 72  ? 0.1168 0.2029 0.3472 -0.0439 -0.0598 0.0118  73   ARG A CD  
532  N  NE  . ARG A 72  ? 0.1855 0.1880 0.3288 -0.0104 -0.0071 -0.0066 73   ARG A NE  
533  C  CZ  . ARG A 72  ? 0.1899 0.1730 0.3075 -0.0328 -0.0149 -0.0621 73   ARG A CZ  
534  N  NH1 . ARG A 72  ? 0.1402 0.2362 0.3369 -0.0313 0.0016  -0.0190 73   ARG A NH1 
535  N  NH2 . ARG A 72  ? 0.2290 0.1869 0.3375 -0.0012 0.0184  -0.0627 73   ARG A NH2 
536  N  N   . TYR A 73  ? 0.1106 0.1744 0.1852 0.0010  -0.0035 0.0138  74   TYR A N   
537  C  CA  . TYR A 73  ? 0.1072 0.1324 0.1968 -0.0243 0.0086  0.0203  74   TYR A CA  
538  C  C   . TYR A 73  ? 0.1312 0.1157 0.2132 -0.0237 -0.0009 0.0039  74   TYR A C   
539  O  O   . TYR A 73  ? 0.1550 0.1241 0.2742 -0.0190 0.0134  -0.0216 74   TYR A O   
540  C  CB  . TYR A 73  ? 0.1627 0.1602 0.1870 -0.0623 -0.0089 0.0417  74   TYR A CB  
541  C  CG  . TYR A 73  ? 0.1517 0.1646 0.1842 -0.0546 0.0024  0.0205  74   TYR A CG  
542  C  CD1 . TYR A 73  ? 0.0996 0.1803 0.2036 -0.0528 0.0032  -0.0138 74   TYR A CD1 
543  C  CD2 . TYR A 73  ? 0.1740 0.1863 0.1836 -0.0560 0.0202  0.0222  74   TYR A CD2 
544  C  CE1 . TYR A 73  ? 0.1339 0.1138 0.1697 -0.0158 -0.0005 0.0272  74   TYR A CE1 
545  C  CE2 . TYR A 73  ? 0.1218 0.1326 0.2377 0.0085  0.0391  0.0100  74   TYR A CE2 
546  C  CZ  . TYR A 73  ? 0.1229 0.1465 0.1772 -0.0159 0.0009  0.0137  74   TYR A CZ  
547  O  OH  . TYR A 73  ? 0.1233 0.1591 0.1823 -0.0189 0.0088  -0.0062 74   TYR A OH  
548  N  N   . PRO A 74  ? 0.1204 0.1025 0.2065 -0.0417 -0.0051 0.0047  75   PRO A N   
549  C  CA  . PRO A 74  ? 0.1371 0.1146 0.1786 -0.0497 0.0095  -0.0061 75   PRO A CA  
550  C  C   . PRO A 74  ? 0.1165 0.1204 0.1732 -0.0471 0.0165  -0.0033 75   PRO A C   
551  O  O   . PRO A 74  ? 0.1282 0.1449 0.2100 -0.0492 -0.0207 0.0073  75   PRO A O   
552  C  CB  . PRO A 74  ? 0.1284 0.1445 0.1953 -0.0362 0.0103  0.0106  75   PRO A CB  
553  C  CG  . PRO A 74  ? 0.1206 0.1582 0.2213 -0.0192 0.0249  0.0362  75   PRO A CG  
554  C  CD  . PRO A 74  ? 0.1282 0.1105 0.2433 -0.0313 -0.0120 0.0133  75   PRO A CD  
555  N  N   . ASP A 75  ? 0.1515 0.1209 0.2189 -0.0472 -0.0167 0.0145  76   ASP A N   
556  C  CA  . ASP A 75  ? 0.0977 0.1184 0.2298 -0.0387 -0.0023 0.0134  76   ASP A CA  
557  C  C   . ASP A 75  ? 0.1428 0.1222 0.2234 -0.0212 0.0019  0.0211  76   ASP A C   
558  O  O   . ASP A 75  ? 0.1447 0.1510 0.2278 -0.0097 0.0006  0.0153  76   ASP A O   
559  C  CB  . ASP A 75  ? 0.1638 0.1208 0.2533 -0.0638 -0.0195 0.0204  76   ASP A CB  
560  C  CG  . ASP A 75  ? 0.1359 0.1323 0.2492 -0.0320 0.0340  0.0299  76   ASP A CG  
561  O  OD1 . ASP A 75  ? 0.1439 0.1587 0.3429 -0.0112 -0.0044 0.0022  76   ASP A OD1 
562  O  OD2 . ASP A 75  ? 0.2160 0.1964 0.2914 -0.0899 0.0899  0.0229  76   ASP A OD2 
563  N  N   . HIS A 76  ? 0.1212 0.1273 0.2138 -0.0405 0.0092  0.0156  77   HIS A N   
564  C  CA  . HIS A 76  ? 0.1588 0.1429 0.2159 -0.0290 0.0229  0.0208  77   HIS A CA  
565  C  C   . HIS A 76  ? 0.1617 0.1620 0.1953 -0.0282 0.0192  0.0027  77   HIS A C   
566  O  O   . HIS A 76  ? 0.2012 0.2327 0.1655 -0.0431 -0.0009 0.0254  77   HIS A O   
567  C  CB  . HIS A 76  ? 0.1438 0.1990 0.2747 -0.0471 0.0590  0.0156  77   HIS A CB  
568  C  CG  . HIS A 76  ? 0.1273 0.2035 0.3098 -0.0105 -0.0077 -0.0033 77   HIS A CG  
569  N  ND1 . HIS A 76  ? 0.1620 0.1992 0.3102 0.0264  0.0613  0.0267  77   HIS A ND1 
570  C  CD2 . HIS A 76  ? 0.1618 0.2096 0.3411 -0.0057 0.0203  -0.0075 77   HIS A CD2 
571  C  CE1 . HIS A 76  ? 0.1860 0.2093 0.3477 0.0705  0.0037  0.0080  77   HIS A CE1 
572  N  NE2 . HIS A 76  ? 0.2142 0.2009 0.3660 0.0040  -0.0439 -0.0128 77   HIS A NE2 
573  N  N   . MET A 77  ? 0.1140 0.1563 0.1842 -0.0162 0.0018  -0.0158 78   MET A N   
574  C  CA  . MET A 77  ? 0.1561 0.1614 0.2159 -0.0398 -0.0310 0.0102  78   MET A CA  
575  C  C   . MET A 77  ? 0.1396 0.1668 0.2059 -0.0539 -0.0234 0.0348  78   MET A C   
576  O  O   . MET A 77  ? 0.1559 0.2018 0.2017 -0.0730 -0.0036 0.0174  78   MET A O   
577  C  CB  . MET A 77  ? 0.1643 0.1555 0.2179 -0.0010 0.0287  0.0073  78   MET A CB  
578  C  CG  . MET A 77  ? 0.1696 0.1405 0.2353 -0.0011 0.0354  -0.0170 78   MET A CG  
579  S  SD  . MET A 77  ? 0.1576 0.1770 0.2432 -0.0083 -0.0096 0.0085  78   MET A SD  
580  C  CE  . MET A 77  ? 0.1840 0.1700 0.1348 -0.0238 0.0206  0.0086  78   MET A CE  
581  N  N   . LYS A 78  ? 0.1577 0.1883 0.1832 -0.0301 -0.0122 -0.0132 79   LYS A N   
582  C  CA  . LYS A 78  ? 0.1698 0.2285 0.2219 -0.0146 -0.0009 -0.0308 79   LYS A CA  
583  C  C   . LYS A 78  ? 0.1541 0.2295 0.2071 -0.0120 -0.0051 0.0056  79   LYS A C   
584  O  O   . LYS A 78  ? 0.1428 0.1836 0.2957 0.0031  -0.0023 0.0242  79   LYS A O   
585  C  CB  . LYS A 78  ? 0.2088 0.2223 0.3658 0.0038  -0.0391 -0.0503 79   LYS A CB  
586  C  CG  . LYS A 78  ? 0.3307 0.2254 0.4478 0.0446  -0.1040 0.0684  79   LYS A CG  
587  C  CD  . LYS A 78  ? 0.5400 0.2377 0.5250 -0.0242 -0.1146 0.0760  79   LYS A CD  
588  C  CE  . LYS A 78  ? 0.5703 0.2654 0.5129 -0.0599 -0.1727 0.1529  79   LYS A CE  
589  N  NZ  . LYS A 78  ? 0.5828 0.3826 0.4327 -0.0084 -0.0701 0.1523  79   LYS A NZ  
590  N  N   . GLN A 79  ? 0.2087 0.1571 0.1934 -0.0407 0.0017  0.0332  80   GLN A N   
591  C  CA  . GLN A 79  ? 0.2721 0.1989 0.2079 -0.0502 -0.0179 0.0113  80   GLN A CA  
592  C  C   . GLN A 79  ? 0.1581 0.1782 0.1989 -0.0001 -0.0182 0.0002  80   GLN A C   
593  O  O   . GLN A 79  ? 0.1649 0.2160 0.1859 -0.0311 -0.0280 0.0261  80   GLN A O   
594  C  CB  . GLN A 79  ? 0.2352 0.2322 0.1803 -0.0602 -0.0584 0.0354  80   GLN A CB  
595  C  CG  . GLN A 79  ? 0.2074 0.3269 0.2812 -0.0532 -0.0658 -0.0790 80   GLN A CG  
596  C  CD  . GLN A 79  ? 0.2118 0.3078 0.2349 -0.1059 -0.0478 -0.0044 80   GLN A CD  
597  O  OE1 . GLN A 79  ? 0.3167 0.6496 0.3847 -0.2003 0.0874  -0.0845 80   GLN A OE1 
598  N  NE2 . GLN A 79  ? 0.3088 0.2313 0.2750 -0.0331 -0.1710 0.0239  80   GLN A NE2 
599  N  N   . HIS A 80  ? 0.1203 0.1653 0.1796 -0.0210 -0.0298 -0.0243 81   HIS A N   
600  C  CA  . HIS A 80  ? 0.1397 0.1707 0.2029 -0.0170 -0.0148 -0.0057 81   HIS A CA  
601  C  C   . HIS A 80  ? 0.1470 0.1767 0.2388 0.0046  0.0063  0.0230  81   HIS A C   
602  O  O   . HIS A 80  ? 0.2153 0.1729 0.2072 -0.0163 -0.0087 0.0205  81   HIS A O   
603  C  CB  . HIS A 80  ? 0.1347 0.1600 0.2066 -0.0179 -0.0015 -0.0176 81   HIS A CB  
604  C  CG  . HIS A 80  ? 0.1445 0.1623 0.2260 -0.0343 0.0063  -0.0046 81   HIS A CG  
605  N  ND1 . HIS A 80  ? 0.1696 0.1930 0.2405 -0.0340 0.0466  -0.0328 81   HIS A ND1 
606  C  CD2 . HIS A 80  ? 0.1272 0.2188 0.2836 -0.0382 0.0059  -0.0089 81   HIS A CD2 
607  C  CE1 . HIS A 80  ? 0.1620 0.2208 0.3269 -0.0197 0.0941  -0.0789 81   HIS A CE1 
608  N  NE2 . HIS A 80  ? 0.1657 0.2372 0.3290 -0.0464 0.0618  -0.0305 81   HIS A NE2 
609  N  N   . ASP A 81  ? 0.1509 0.1821 0.2162 -0.0056 0.0112  0.0177  82   ASP A N   
610  C  CA  . ASP A 81  ? 0.1207 0.1500 0.2157 -0.0459 -0.0040 0.0151  82   ASP A CA  
611  C  C   . ASP A 81  ? 0.1257 0.1590 0.2702 -0.0138 -0.0270 -0.0207 82   ASP A C   
612  O  O   . ASP A 81  ? 0.1482 0.1520 0.2538 -0.0071 0.0382  0.0558  82   ASP A O   
613  C  CB  . ASP A 81  ? 0.1522 0.1788 0.1917 -0.0144 -0.0290 0.0098  82   ASP A CB  
614  C  CG  . ASP A 81  ? 0.1986 0.2251 0.2307 -0.0357 0.0161  -0.0109 82   ASP A CG  
615  O  OD1 . ASP A 81  ? 0.1707 0.1875 0.2354 -0.0032 0.0195  0.0000  82   ASP A OD1 
616  O  OD2 . ASP A 81  ? 0.1493 0.1781 0.2026 0.0245  -0.0128 0.0196  82   ASP A OD2 
617  N  N   . PHE A 82  ? 0.1199 0.1728 0.2335 -0.0081 -0.0341 -0.0185 83   PHE A N   
618  C  CA  . PHE A 82  ? 0.1315 0.1451 0.1641 0.0026  -0.0411 -0.0132 83   PHE A CA  
619  C  C   . PHE A 82  ? 0.1263 0.1336 0.1882 -0.0014 -0.0257 0.0027  83   PHE A C   
620  O  O   . PHE A 82  ? 0.1186 0.1594 0.2163 -0.0022 -0.0262 0.0230  83   PHE A O   
621  C  CB  . PHE A 82  ? 0.1361 0.1400 0.1525 -0.0270 0.0138  0.0135  83   PHE A CB  
622  C  CG  . PHE A 82  ? 0.1357 0.1400 0.2406 -0.0188 -0.0131 0.0283  83   PHE A CG  
623  C  CD1 . PHE A 82  ? 0.1591 0.1668 0.2372 -0.0301 -0.0321 0.0015  83   PHE A CD1 
624  C  CD2 . PHE A 82  ? 0.1242 0.1243 0.2609 -0.0320 -0.0005 0.0203  83   PHE A CD2 
625  C  CE1 . PHE A 82  ? 0.1763 0.2092 0.2209 -0.0667 -0.0297 -0.0151 83   PHE A CE1 
626  C  CE2 . PHE A 82  ? 0.1286 0.1613 0.2367 -0.0233 -0.0072 -0.0016 83   PHE A CE2 
627  C  CZ  . PHE A 82  ? 0.1643 0.1708 0.2638 -0.0245 -0.0300 0.0349  83   PHE A CZ  
628  N  N   . PHE A 83  ? 0.1220 0.1697 0.1956 0.0082  -0.0059 0.0296  84   PHE A N   
629  C  CA  . PHE A 83  ? 0.1228 0.1340 0.2312 -0.0183 0.0125  0.0390  84   PHE A CA  
630  C  C   . PHE A 83  ? 0.1300 0.1452 0.2356 -0.0093 0.0155  0.0237  84   PHE A C   
631  O  O   . PHE A 83  ? 0.1295 0.1809 0.2389 0.0002  0.0110  0.0040  84   PHE A O   
632  C  CB  . PHE A 83  ? 0.1535 0.1435 0.2160 -0.0120 0.0274  0.0364  84   PHE A CB  
633  C  CG  . PHE A 83  ? 0.1419 0.1437 0.2071 -0.0105 0.0175  0.0427  84   PHE A CG  
634  C  CD1 . PHE A 83  ? 0.1196 0.1468 0.2427 -0.0087 0.0470  0.0219  84   PHE A CD1 
635  C  CD2 . PHE A 83  ? 0.1383 0.1299 0.2086 -0.0272 0.0182  0.0069  84   PHE A CD2 
636  C  CE1 . PHE A 83  ? 0.1560 0.1695 0.3286 -0.0087 0.0539  -0.0707 84   PHE A CE1 
637  C  CE2 . PHE A 83  ? 0.1519 0.1645 0.2743 0.0003  -0.0603 -0.0830 84   PHE A CE2 
638  C  CZ  . PHE A 83  ? 0.1580 0.1254 0.3557 0.0138  0.0069  -0.0162 84   PHE A CZ  
639  N  N   . LYS A 84  ? 0.1422 0.1397 0.1770 -0.0153 0.0178  0.0212  85   LYS A N   
640  C  CA  . LYS A 84  ? 0.1260 0.1583 0.1543 0.0038  0.0161  -0.0103 85   LYS A CA  
641  C  C   . LYS A 84  ? 0.1284 0.1449 0.1719 0.0015  0.0011  -0.0046 85   LYS A C   
642  O  O   . LYS A 84  ? 0.1823 0.1602 0.2273 0.0334  0.0101  0.0102  85   LYS A O   
643  C  CB  . LYS A 84  ? 0.1442 0.1386 0.2101 0.0150  -0.0261 -0.0054 85   LYS A CB  
644  C  CG  . LYS A 84  ? 0.1325 0.1237 0.1979 -0.0100 -0.0085 -0.0008 85   LYS A CG  
645  C  CD  . LYS A 84  ? 0.1618 0.1074 0.2033 -0.0206 -0.0239 0.0108  85   LYS A CD  
646  C  CE  . LYS A 84  ? 0.1427 0.1542 0.2395 -0.0127 -0.0398 0.0308  85   LYS A CE  
647  N  NZ  . LYS A 84  ? 0.1489 0.1610 0.3127 0.0030  -0.0027 0.0672  85   LYS A NZ  
648  N  N   . SER A 85  ? 0.1471 0.1609 0.1641 -0.0037 0.0050  0.0133  86   SER A N   
649  C  CA  . SER A 85  ? 0.1670 0.1538 0.1731 -0.0349 0.0098  0.0328  86   SER A CA  
650  C  C   . SER A 85  ? 0.1614 0.1775 0.1939 -0.0147 -0.0147 0.0418  86   SER A C   
651  O  O   . SER A 85  ? 0.2048 0.1861 0.2292 0.0080  -0.0163 0.0522  86   SER A O   
652  C  CB  . SER A 85  ? 0.1819 0.1694 0.1652 -0.0113 -0.0022 0.0177  86   SER A CB  
653  O  OG  . SER A 85  ? 0.1585 0.1631 0.2603 0.0056  0.0004  -0.0039 86   SER A OG  
654  N  N   . ALA A 86  ? 0.1240 0.1561 0.2148 -0.0128 -0.0271 0.0254  87   ALA A N   
655  C  CA  . ALA A 86  ? 0.1208 0.1734 0.2171 -0.0016 -0.0333 0.0034  87   ALA A CA  
656  C  C   . ALA A 86  ? 0.1397 0.2254 0.2058 0.0051  -0.0145 0.0012  87   ALA A C   
657  O  O   . ALA A 86  ? 0.1382 0.2316 0.2461 -0.0142 0.0028  -0.0347 87   ALA A O   
658  C  CB  . ALA A 86  ? 0.1527 0.1921 0.2111 -0.0412 0.0221  0.0207  87   ALA A CB  
659  N  N   . MET A 87  ? 0.1302 0.1856 0.2026 0.0450  -0.0401 0.0217  88   MET A N   
660  C  CA  . MET A 87  ? 0.1457 0.1334 0.2102 0.0017  -0.0118 0.0278  88   MET A CA  
661  C  C   . MET A 87  ? 0.1636 0.1268 0.2343 -0.0001 -0.0058 0.0295  88   MET A C   
662  O  O   . MET A 87  ? 0.1763 0.1719 0.2196 0.0193  -0.0063 0.0590  88   MET A O   
663  C  CB  . MET A 87  ? 0.1532 0.1509 0.2163 -0.0114 -0.0172 0.0155  88   MET A CB  
664  C  CG  . MET A 87  ? 0.1269 0.1791 0.2106 -0.0002 -0.0149 0.0365  88   MET A CG  
665  S  SD  . MET A 87  ? 0.1433 0.1830 0.2401 -0.0029 -0.0050 0.0485  88   MET A SD  
666  C  CE  . MET A 87  ? 0.1536 0.1604 0.2014 -0.0049 0.0149  -0.0114 88   MET A CE  
667  N  N   . PRO A 88  ? 0.1427 0.1536 0.2364 0.0106  -0.0289 0.0441  89   PRO A N   
668  C  CA  . PRO A 88  ? 0.1565 0.1432 0.2060 0.0242  -0.0225 0.0201  89   PRO A CA  
669  C  C   . PRO A 88  ? 0.1070 0.1846 0.2425 0.0196  0.0003  -0.0004 89   PRO A C   
670  O  O   . PRO A 88  ? 0.1270 0.1850 0.2568 0.0219  0.0097  0.0073  89   PRO A O   
671  C  CB  . PRO A 88  ? 0.1902 0.1361 0.2826 0.0485  -0.0044 0.0494  89   PRO A CB  
672  C  CG  . PRO A 88  ? 0.1678 0.1895 0.2906 0.0508  -0.0416 0.0683  89   PRO A CG  
673  C  CD  . PRO A 88  ? 0.1391 0.1728 0.2808 0.0046  -0.0451 0.0749  89   PRO A CD  
674  N  N   . GLU A 89  ? 0.1336 0.1827 0.2495 -0.0023 -0.0089 -0.0096 90   GLU A N   
675  C  CA  . GLU A 89  ? 0.1365 0.1906 0.2527 -0.0154 -0.0262 0.0327  90   GLU A CA  
676  C  C   . GLU A 89  ? 0.1499 0.1840 0.2589 -0.0127 -0.0025 0.0218  90   GLU A C   
677  O  O   . GLU A 89  ? 0.1485 0.1812 0.3198 -0.0074 0.0091  0.0263  90   GLU A O   
678  C  CB  . GLU A 89  ? 0.2320 0.2617 0.2632 -0.0222 -0.0814 0.0358  90   GLU A CB  
679  C  CG  . GLU A 89  ? 0.3027 0.3385 0.3533 0.0425  -0.0743 0.1229  90   GLU A CG  
680  C  CD  . GLU A 89  ? 0.3850 0.2475 0.4740 0.0312  -0.1304 0.1120  90   GLU A CD  
681  O  OE1 . GLU A 89  ? 0.5889 0.2485 0.5599 0.1002  0.0315  0.0305  90   GLU A OE1 
682  O  OE2 . GLU A 89  ? 0.3380 0.2961 0.4364 -0.0120 -0.0465 0.1380  90   GLU A OE2 
683  N  N   . GLY A 90  ? 0.1512 0.1267 0.2777 -0.0156 0.0109  -0.0124 91   GLY A N   
684  C  CA  . GLY A 90  ? 0.1438 0.1332 0.2869 -0.0276 0.0090  0.0020  91   GLY A CA  
685  C  C   . GLY A 90  ? 0.1537 0.1410 0.2615 0.0248  0.0033  0.0181  91   GLY A C   
686  O  O   . GLY A 90  ? 0.1745 0.1572 0.2613 0.0088  0.0017  0.0267  91   GLY A O   
687  N  N   . TYR A 91  ? 0.1646 0.1499 0.2562 0.0481  0.0158  0.0204  92   TYR A N   
688  C  CA  . TYR A 91  ? 0.1789 0.1393 0.2518 0.0313  0.0697  0.0339  92   TYR A CA  
689  C  C   . TYR A 91  ? 0.1804 0.1671 0.2048 -0.0001 0.0666  0.0109  92   TYR A C   
690  O  O   . TYR A 91  ? 0.2096 0.1609 0.1850 0.0159  0.0249  0.0240  92   TYR A O   
691  C  CB  . TYR A 91  ? 0.1811 0.1400 0.2727 0.0220  0.0886  0.0373  92   TYR A CB  
692  C  CG  . TYR A 91  ? 0.1687 0.1379 0.2978 0.0308  0.0761  0.0294  92   TYR A CG  
693  C  CD1 . TYR A 91  ? 0.1983 0.1964 0.2910 0.0097  0.0704  0.0646  92   TYR A CD1 
694  C  CD2 . TYR A 91  ? 0.2027 0.2047 0.3054 -0.0312 0.0886  0.0279  92   TYR A CD2 
695  C  CE1 . TYR A 91  ? 0.2161 0.1842 0.3071 0.0333  0.0519  0.0364  92   TYR A CE1 
696  C  CE2 . TYR A 91  ? 0.1740 0.1797 0.3626 0.0218  0.0609  0.0084  92   TYR A CE2 
697  C  CZ  . TYR A 91  ? 0.1955 0.2300 0.3628 -0.0008 0.0555  0.0442  92   TYR A CZ  
698  O  OH  . TYR A 91  ? 0.2187 0.2206 0.4138 0.0096  0.0138  0.0382  92   TYR A OH  
699  N  N   . VAL A 92  ? 0.2345 0.1681 0.1889 -0.0139 0.0610  0.0198  93   VAL A N   
700  C  CA  . VAL A 92  ? 0.2447 0.1563 0.2226 -0.0014 0.0285  0.0333  93   VAL A CA  
701  C  C   . VAL A 92  ? 0.2288 0.1818 0.2082 -0.0027 -0.0011 0.0111  93   VAL A C   
702  O  O   . VAL A 92  ? 0.2992 0.1723 0.2310 0.0480  0.0434  0.0291  93   VAL A O   
703  C  CB  . VAL A 92  ? 0.1958 0.2200 0.2763 -0.0460 0.0082  0.0776  93   VAL A CB  
704  C  CG1 . VAL A 92  ? 0.2899 0.2090 0.3009 -0.0557 -0.0739 0.0999  93   VAL A CG1 
705  C  CG2 . VAL A 92  ? 0.2915 0.2119 0.2722 0.0196  -0.0219 0.0354  93   VAL A CG2 
706  N  N   . GLN A 93  ? 0.2748 0.1830 0.2154 0.0321  0.0202  0.0191  94   GLN A N   
707  C  CA  . GLN A 93  ? 0.2634 0.1630 0.2542 0.0155  0.0204  0.0361  94   GLN A CA  
708  C  C   . GLN A 93  ? 0.2923 0.1729 0.2448 0.0060  0.0851  0.0406  94   GLN A C   
709  O  O   . GLN A 93  ? 0.3104 0.2077 0.3749 0.0554  0.1720  0.0518  94   GLN A O   
710  C  CB  . GLN A 93  ? 0.2917 0.2130 0.2697 0.0140  -0.0074 0.0508  94   GLN A CB  
711  C  CG  . GLN A 93  ? 0.2631 0.2828 0.3169 0.0226  -0.0135 0.0399  94   GLN A CG  
712  C  CD  . GLN A 93  ? 0.3083 0.2805 0.4136 0.0192  -0.0627 0.0139  94   GLN A CD  
713  O  OE1 . GLN A 93  ? 0.3619 0.2483 0.2449 0.0429  -0.0274 -0.0335 94   GLN A OE1 
714  N  NE2 . GLN A 93  ? 0.2331 0.1745 0.4491 0.0103  -0.0816 -0.0219 94   GLN A NE2 
715  N  N   . GLU A 94  ? 0.2436 0.1598 0.2188 -0.0056 0.0700  0.0545  95   GLU A N   
716  C  CA  . GLU A 94  ? 0.1559 0.1735 0.2517 -0.0116 0.0424  0.0326  95   GLU A CA  
717  C  C   . GLU A 94  ? 0.1743 0.1618 0.2239 0.0004  0.0419  0.0097  95   GLU A C   
718  O  O   . GLU A 94  ? 0.1809 0.1623 0.3626 0.0134  0.0782  0.0958  95   GLU A O   
719  C  CB  . GLU A 94  ? 0.1906 0.2536 0.2926 0.0113  -0.0023 0.0078  95   GLU A CB  
720  C  CG  . GLU A 94  ? 0.2657 0.4080 0.4456 0.0958  -0.0935 -0.0173 95   GLU A CG  
721  C  CD  . GLU A 94  ? 0.5057 0.4752 0.4903 0.0744  -0.2514 0.0038  95   GLU A CD  
722  O  OE1 . GLU A 94  ? 0.9447 0.5480 0.5633 -0.1424 -0.3211 -0.0716 95   GLU A OE1 
723  O  OE2 . GLU A 94  ? 0.6865 0.5817 0.5520 -0.1276 -0.1849 0.1495  95   GLU A OE2 
724  N  N   . ALA A 95  ? 0.1386 0.1594 0.2249 0.0052  0.0612  0.0063  96   ALA A N   
725  C  CA  . ALA A 95  ? 0.1449 0.1309 0.2150 -0.0002 0.0165  -0.0396 96   ALA A CA  
726  C  C   . ALA A 95  ? 0.1389 0.1428 0.1907 0.0009  0.0312  -0.0267 96   ALA A C   
727  O  O   . ALA A 95  ? 0.1294 0.1655 0.2658 0.0262  0.0328  0.0361  96   ALA A O   
728  C  CB  . ALA A 95  ? 0.1653 0.1733 0.2086 -0.0154 0.0237  -0.0457 96   ALA A CB  
729  N  N   . THR A 96  ? 0.1436 0.1305 0.2472 0.0104  0.0534  0.0095  97   THR A N   
730  C  CA  . THR A 96  ? 0.1299 0.1321 0.2597 -0.0249 0.0132  0.0113  97   THR A CA  
731  C  C   . THR A 96  ? 0.1259 0.1123 0.2584 -0.0465 0.0156  0.0240  97   THR A C   
732  O  O   . THR A 96  ? 0.1209 0.1522 0.2979 0.0008  0.0418  0.0427  97   THR A O   
733  C  CB  . THR A 96  ? 0.2215 0.1290 0.2532 -0.0215 -0.0121 0.0149  97   THR A CB  
734  O  OG1 . THR A 96  ? 0.1992 0.1685 0.2600 -0.0278 -0.0053 0.0015  97   THR A OG1 
735  C  CG2 . THR A 96  ? 0.2233 0.1290 0.3064 -0.0447 -0.0011 0.0108  97   THR A CG2 
736  N  N   . ILE A 97  ? 0.1466 0.1042 0.2572 -0.0345 0.0215  0.0199  98   ILE A N   
737  C  CA  . ILE A 97  ? 0.1285 0.1297 0.2478 -0.0152 0.0310  0.0137  98   ILE A CA  
738  C  C   . ILE A 97  ? 0.1477 0.1275 0.2327 -0.0131 0.0087  0.0079  98   ILE A C   
739  O  O   . ILE A 97  ? 0.1808 0.1245 0.2726 -0.0083 0.0448  0.0316  98   ILE A O   
740  C  CB  . ILE A 97  ? 0.1475 0.1199 0.2540 -0.0643 0.0396  0.0080  98   ILE A CB  
741  C  CG1 . ILE A 97  ? 0.1727 0.1161 0.3455 -0.0475 0.0489  -0.0003 98   ILE A CG1 
742  C  CG2 . ILE A 97  ? 0.1862 0.1455 0.2730 -0.0634 0.0026  -0.0097 98   ILE A CG2 
743  C  CD1 . ILE A 97  ? 0.3470 0.1119 0.3353 -0.0425 0.0913  0.0139  98   ILE A CD1 
744  N  N   . SER A 98  ? 0.1502 0.1221 0.2351 -0.0204 0.0080  -0.0024 99   SER A N   
745  C  CA  . SER A 98  ? 0.1446 0.1150 0.2378 -0.0334 0.0309  -0.0058 99   SER A CA  
746  C  C   . SER A 98  ? 0.1372 0.0853 0.2367 -0.0226 0.0312  -0.0274 99   SER A C   
747  O  O   . SER A 98  ? 0.1360 0.1405 0.2350 -0.0103 0.0469  -0.0052 99   SER A O   
748  C  CB  . SER A 98  ? 0.1732 0.1507 0.2412 -0.0437 0.0205  -0.0331 99   SER A CB  
749  O  OG  . SER A 98  ? 0.2292 0.2072 0.2462 -0.0233 -0.0126 -0.0535 99   SER A OG  
750  N  N   . PHE A 99  ? 0.1260 0.1617 0.2066 0.0028  0.0430  -0.0315 100  PHE A N   
751  C  CA  . PHE A 99  ? 0.1387 0.1319 0.2258 0.0000  0.0271  -0.0309 100  PHE A CA  
752  C  C   . PHE A 99  ? 0.1609 0.1277 0.2715 -0.0018 0.0397  -0.0373 100  PHE A C   
753  O  O   . PHE A 99  ? 0.1770 0.1305 0.2769 -0.0090 0.0338  -0.0270 100  PHE A O   
754  C  CB  . PHE A 99  ? 0.1503 0.1259 0.2143 -0.0017 0.0158  -0.0185 100  PHE A CB  
755  C  CG  . PHE A 99  ? 0.1107 0.1374 0.1968 -0.0045 0.0149  -0.0236 100  PHE A CG  
756  C  CD1 . PHE A 99  ? 0.1211 0.1457 0.2153 0.0022  0.0042  -0.0180 100  PHE A CD1 
757  C  CD2 . PHE A 99  ? 0.1336 0.1369 0.1868 -0.0166 0.0058  -0.0126 100  PHE A CD2 
758  C  CE1 . PHE A 99  ? 0.1056 0.1535 0.2552 0.0021  -0.0026 -0.0374 100  PHE A CE1 
759  C  CE2 . PHE A 99  ? 0.1255 0.1912 0.2211 0.0162  -0.0070 -0.0766 100  PHE A CE2 
760  C  CZ  . PHE A 99  ? 0.1232 0.2131 0.2594 0.0274  -0.0111 -0.0921 100  PHE A CZ  
761  N  N   . LYS A 100 ? 0.1641 0.1428 0.2596 0.0102  0.0484  -0.0345 101  LYS A N   
762  C  CA  . LYS A 100 ? 0.1753 0.1470 0.2618 0.0154  0.0285  -0.0456 101  LYS A CA  
763  C  C   . LYS A 100 ? 0.1933 0.1468 0.2512 0.0205  0.0027  -0.0287 101  LYS A C   
764  O  O   . LYS A 100 ? 0.2102 0.1504 0.2550 0.0471  0.0184  -0.0330 101  LYS A O   
765  C  CB  . LYS A 100 ? 0.1691 0.2114 0.3498 0.0212  0.0605  -0.1080 101  LYS A CB  
766  C  CG  . LYS A 100 ? 0.1799 0.2144 0.4350 0.0293  0.0940  -0.0949 101  LYS A CG  
767  C  CD  . LYS A 100 ? 0.1789 0.2830 0.4378 0.0359  0.1073  -0.0883 101  LYS A CD  
768  C  CE  . LYS A 100 ? 0.2344 0.3604 0.5146 0.1305  0.0526  -0.1176 101  LYS A CE  
769  N  NZ  . LYS A 100 ? 0.2328 0.4797 0.7014 0.1393  0.0557  -0.0873 101  LYS A NZ  
770  N  N   . ASP A 101 ? 0.2614 0.1571 0.2722 -0.0133 0.0180  -0.0380 102  ASP A N   
771  C  CA  . ASP A 101 ? 0.2614 0.1481 0.3110 0.0066  0.0244  -0.0193 102  ASP A CA  
772  C  C   . ASP A 101 ? 0.2874 0.1673 0.2490 0.0225  0.0282  0.0106  102  ASP A C   
773  O  O   . ASP A 101 ? 0.2945 0.1309 0.2476 -0.0185 -0.0037 -0.0004 102  ASP A O   
774  C  CB  . ASP A 101 ? 0.3031 0.1513 0.4961 0.0142  -0.0506 0.0389  102  ASP A CB  
775  C  CG  . ASP A 101 ? 0.2920 0.3682 0.5263 0.0655  -0.1007 -0.0548 102  ASP A CG  
776  O  OD1 . ASP A 101 ? 0.4378 0.4348 0.5327 0.0430  -0.0265 -0.0762 102  ASP A OD1 
777  O  OD2 . ASP A 101 ? 0.3410 0.9053 0.7272 0.1563  -0.2031 -0.0961 102  ASP A OD2 
778  N  N   . ASP A 102 ? 0.2309 0.1479 0.2256 -0.0088 0.0112  0.0007  103  ASP A N   
779  C  CA  . ASP A 102 ? 0.1608 0.1590 0.2574 -0.0551 -0.0139 -0.0186 103  ASP A CA  
780  C  C   . ASP A 102 ? 0.2020 0.1506 0.2520 -0.0323 0.0245  0.0147  103  ASP A C   
781  O  O   . ASP A 102 ? 0.2188 0.1330 0.2527 0.0107  -0.0134 -0.0385 103  ASP A O   
782  C  CB  . ASP A 102 ? 0.1847 0.1723 0.2727 -0.0425 0.0100  -0.0545 103  ASP A CB  
783  C  CG  . ASP A 102 ? 0.1843 0.1952 0.2563 0.0014  -0.0054 -0.0062 103  ASP A CG  
784  O  OD1 . ASP A 102 ? 0.1838 0.1836 0.2644 -0.0200 0.0139  -0.0302 103  ASP A OD1 
785  O  OD2 . ASP A 102 ? 0.2447 0.2001 0.2595 -0.0312 -0.0200 -0.0157 103  ASP A OD2 
786  N  N   . GLY A 103 ? 0.2284 0.0848 0.2194 -0.0410 -0.0101 -0.0164 104  GLY A N   
787  C  CA  . GLY A 103 ? 0.1948 0.1433 0.2102 -0.0418 0.0197  0.0177  104  GLY A CA  
788  C  C   . GLY A 103 ? 0.1505 0.1356 0.1788 -0.0159 0.0434  0.0053  104  GLY A C   
789  O  O   . GLY A 103 ? 0.1523 0.1338 0.2500 -0.0174 0.0419  0.0061  104  GLY A O   
790  N  N   . ASN A 104 ? 0.1729 0.1248 0.1966 -0.0340 -0.0125 -0.0106 105  ASN A N   
791  C  CA  . ASN A 104 ? 0.1463 0.1205 0.1921 -0.0181 0.0132  -0.0109 105  ASN A CA  
792  C  C   . ASN A 104 ? 0.1330 0.1223 0.2688 -0.0299 0.0362  -0.0162 105  ASN A C   
793  O  O   . ASN A 104 ? 0.1395 0.1207 0.2248 -0.0363 0.0283  -0.0168 105  ASN A O   
794  C  CB  . ASN A 104 ? 0.1786 0.1729 0.1891 -0.0447 0.0002  -0.0140 105  ASN A CB  
795  C  CG  . ASN A 104 ? 0.1666 0.1770 0.1954 -0.0476 0.0136  -0.0189 105  ASN A CG  
796  O  OD1 . ASN A 104 ? 0.1849 0.2174 0.2006 -0.0274 -0.0094 -0.0222 105  ASN A OD1 
797  N  ND2 . ASN A 104 ? 0.2120 0.1853 0.2350 -0.0577 0.0087  -0.0384 105  ASN A ND2 
798  N  N   . TYR A 105 ? 0.1307 0.1238 0.2174 -0.0264 0.0580  -0.0328 106  TYR A N   
799  C  CA  . TYR A 105 ? 0.1584 0.1261 0.1776 -0.0164 0.0250  -0.0520 106  TYR A CA  
800  C  C   . TYR A 105 ? 0.1337 0.1376 0.1846 -0.0329 0.0193  -0.0444 106  TYR A C   
801  O  O   . TYR A 105 ? 0.1592 0.1549 0.2305 -0.0033 0.0528  0.0034  106  TYR A O   
802  C  CB  . TYR A 105 ? 0.1624 0.1250 0.1786 -0.0487 0.0349  -0.0404 106  TYR A CB  
803  C  CG  . TYR A 105 ? 0.1289 0.1315 0.1669 -0.0400 0.0606  -0.0591 106  TYR A CG  
804  C  CD1 . TYR A 105 ? 0.1615 0.1359 0.2059 -0.0600 -0.0032 -0.0048 106  TYR A CD1 
805  C  CD2 . TYR A 105 ? 0.1512 0.1261 0.2102 -0.0524 -0.0080 -0.0059 106  TYR A CD2 
806  C  CE1 . TYR A 105 ? 0.1264 0.1316 0.2149 -0.0334 -0.0151 0.0106  106  TYR A CE1 
807  C  CE2 . TYR A 105 ? 0.1101 0.1387 0.2185 -0.0295 -0.0202 0.0000  106  TYR A CE2 
808  C  CZ  . TYR A 105 ? 0.1107 0.1123 0.2044 -0.0054 0.0004  -0.0074 106  TYR A CZ  
809  O  OH  . TYR A 105 ? 0.1378 0.1694 0.2093 -0.0200 -0.0148 0.0018  106  TYR A OH  
810  N  N   . LYS A 106 ? 0.1298 0.1222 0.2465 -0.0505 0.0218  0.0101  107  LYS A N   
811  C  CA  . LYS A 106 ? 0.1787 0.1293 0.2265 -0.0218 0.0200  -0.0085 107  LYS A CA  
812  C  C   . LYS A 106 ? 0.1613 0.1399 0.2135 -0.0124 0.0143  -0.0063 107  LYS A C   
813  O  O   . LYS A 106 ? 0.1172 0.1637 0.3054 -0.0248 0.0237  -0.0189 107  LYS A O   
814  C  CB  . LYS A 106 ? 0.2506 0.1171 0.2653 -0.0353 -0.0266 -0.0015 107  LYS A CB  
815  C  CG  . LYS A 106 ? 0.3476 0.1800 0.4033 -0.0462 0.0084  -0.1172 107  LYS A CG  
816  C  CD  . LYS A 106 ? 0.5303 0.3276 0.3569 0.0032  0.0349  -0.1299 107  LYS A CD  
817  C  CE  . LYS A 106 ? 0.5548 0.3412 0.3970 -0.0274 0.1171  -0.1367 107  LYS A CE  
818  N  NZ  . LYS A 106 ? 0.4478 0.4545 0.5279 -0.1074 0.1155  -0.1565 107  LYS A NZ  
819  N  N   . THR A 107 ? 0.1318 0.1323 0.2218 -0.0079 0.0085  -0.0214 108  THR A N   
820  C  CA  . THR A 107 ? 0.1505 0.1353 0.1974 0.0050  0.0153  -0.0105 108  THR A CA  
821  C  C   . THR A 107 ? 0.1643 0.1481 0.1993 -0.0029 0.0164  -0.0005 108  THR A C   
822  O  O   . THR A 107 ? 0.2114 0.1634 0.2027 -0.0218 0.0347  -0.0129 108  THR A O   
823  C  CB  . THR A 107 ? 0.1758 0.1656 0.1770 -0.0028 0.0213  -0.0332 108  THR A CB  
824  O  OG1 . THR A 107 ? 0.1567 0.1636 0.2334 -0.0044 0.0248  -0.0267 108  THR A OG1 
825  C  CG2 . THR A 107 ? 0.2415 0.2955 0.2119 -0.0198 -0.0214 0.0376  108  THR A CG2 
826  N  N   . ARG A 108 ? 0.1799 0.1386 0.2264 0.0030  0.0386  0.0328  109  ARG A N   
827  C  CA  . ARG A 108 ? 0.1899 0.1581 0.2006 0.0009  0.0229  0.0318  109  ARG A CA  
828  C  C   . ARG A 108 ? 0.1237 0.1497 0.2244 0.0242  0.0278  0.0329  109  ARG A C   
829  O  O   . ARG A 108 ? 0.1769 0.1848 0.2292 -0.0333 0.0482  0.0085  109  ARG A O   
830  C  CB  . ARG A 108 ? 0.2057 0.2385 0.2077 0.0232  0.0090  -0.0047 109  ARG A CB  
831  C  CG  . ARG A 108 ? 0.2201 0.2662 0.2552 0.0216  -0.0360 0.0221  109  ARG A CG  
832  C  CD  . ARG A 108 ? 0.2103 0.2753 0.2253 0.0081  -0.0147 -0.0021 109  ARG A CD  
833  N  NE  . ARG A 108 ? 0.2770 0.3484 0.2471 0.0744  -0.0391 0.0291  109  ARG A NE  
834  C  CZ  . ARG A 108 ? 0.2918 0.2999 0.2810 -0.0054 -0.0601 0.0389  109  ARG A CZ  
835  N  NH1 . ARG A 108 ? 0.2641 0.3480 0.3625 -0.0033 -0.0246 -0.0416 109  ARG A NH1 
836  N  NH2 . ARG A 108 ? 0.2899 0.3617 0.3970 -0.0847 -0.0821 0.1440  109  ARG A NH2 
837  N  N   . ALA A 109 ? 0.1714 0.1579 0.2179 0.0018  0.0478  0.0262  110  ALA A N   
838  C  CA  . ALA A 109 ? 0.1719 0.1641 0.2049 0.0017  0.0425  0.0250  110  ALA A CA  
839  C  C   . ALA A 109 ? 0.1700 0.1621 0.2222 -0.0019 0.0295  0.0331  110  ALA A C   
840  O  O   . ALA A 109 ? 0.2318 0.1650 0.2218 0.0062  0.0431  0.0381  110  ALA A O   
841  C  CB  . ALA A 109 ? 0.2427 0.2552 0.1693 -0.0496 0.0070  0.0642  110  ALA A CB  
842  N  N   . GLU A 110 ? 0.1852 0.1610 0.1914 -0.0063 0.0025  0.0244  111  GLU A N   
843  C  CA  . GLU A 110 ? 0.1717 0.1689 0.1783 0.0102  0.0263  0.0307  111  GLU A CA  
844  C  C   . GLU A 110 ? 0.1869 0.1492 0.1820 0.0135  0.0226  0.0290  111  GLU A C   
845  O  O   . GLU A 110 ? 0.2055 0.1661 0.1814 -0.0047 0.0273  0.0321  111  GLU A O   
846  C  CB  . GLU A 110 ? 0.1787 0.2438 0.3302 0.0125  -0.0217 0.0869  111  GLU A CB  
847  C  CG  . GLU A 110 ? 0.2544 0.3891 0.3752 0.0429  -0.1045 0.0541  111  GLU A CG  
848  C  CD  . GLU A 110 ? 0.2845 0.3953 0.5750 0.0635  -0.1865 -0.0010 111  GLU A CD  
849  O  OE1 . GLU A 110 ? 0.3112 0.3267 1.0902 0.0277  -0.1516 0.1614  111  GLU A OE1 
850  O  OE2 . GLU A 110 ? 0.3136 0.4303 0.6480 -0.0336 -0.1833 0.0665  111  GLU A OE2 
851  N  N   . VAL A 111 ? 0.1667 0.1581 0.1875 0.0254  0.0395  0.0005  112  VAL A N   
852  C  CA  . VAL A 111 ? 0.1880 0.1244 0.2046 0.0222  0.0354  0.0155  112  VAL A CA  
853  C  C   . VAL A 111 ? 0.1868 0.1456 0.1635 0.0443  0.0315  0.0133  112  VAL A C   
854  O  O   . VAL A 111 ? 0.2657 0.1795 0.1670 0.0324  0.0484  0.0141  112  VAL A O   
855  C  CB  . VAL A 111 ? 0.1820 0.1001 0.2772 0.0078  0.0083  0.0416  112  VAL A CB  
856  C  CG1 . VAL A 111 ? 0.2275 0.1849 0.2760 -0.0396 0.0041  0.0268  112  VAL A CG1 
857  C  CG2 . VAL A 111 ? 0.2593 0.1157 0.3799 0.0462  0.0643  0.0691  112  VAL A CG2 
858  N  N   . LYS A 112 ? 0.1579 0.1249 0.2032 0.0161  0.0537  0.0068  113  LYS A N   
859  C  CA  . LYS A 112 ? 0.1727 0.1360 0.1983 0.0286  0.0038  0.0077  113  LYS A CA  
860  C  C   . LYS A 112 ? 0.1531 0.1228 0.1835 0.0205  -0.0022 0.0172  113  LYS A C   
861  O  O   . LYS A 112 ? 0.1577 0.1487 0.1812 0.0129  -0.0290 0.0225  113  LYS A O   
862  C  CB  . LYS A 112 ? 0.2081 0.2042 0.1870 -0.0216 -0.0197 0.0206  113  LYS A CB  
863  C  CG  . LYS A 112 ? 0.1743 0.1610 0.3171 -0.0020 -0.0006 0.0333  113  LYS A CG  
864  C  CD  . LYS A 112 ? 0.1973 0.4821 0.4918 0.0067  -0.0831 -0.0202 113  LYS A CD  
865  C  CE  . LYS A 112 ? 0.3074 0.5621 0.6324 -0.1814 -0.1617 -0.0622 113  LYS A CE  
866  N  NZ  . LYS A 112 ? 0.5466 0.7725 0.9562 -0.2274 -0.3583 -0.2480 113  LYS A NZ  
867  N  N   . PHE A 113 ? 0.1969 0.1250 0.2063 0.0389  0.0007  0.0208  114  PHE A N   
868  C  CA  . PHE A 113 ? 0.1598 0.1364 0.2848 0.0180  0.0013  -0.0237 114  PHE A CA  
869  C  C   . PHE A 113 ? 0.1577 0.1361 0.2622 0.0400  -0.0041 0.0228  114  PHE A C   
870  O  O   . PHE A 113 ? 0.1774 0.2199 0.2610 0.0416  -0.0111 0.0215  114  PHE A O   
871  C  CB  . PHE A 113 ? 0.1544 0.1384 0.2752 0.0228  -0.0228 0.0003  114  PHE A CB  
872  C  CG  . PHE A 113 ? 0.1493 0.1204 0.2328 0.0343  -0.0151 0.0469  114  PHE A CG  
873  C  CD1 . PHE A 113 ? 0.1599 0.2143 0.2542 0.0195  0.0047  0.0130  114  PHE A CD1 
874  C  CD2 . PHE A 113 ? 0.1451 0.1612 0.2697 0.0477  -0.0280 0.0013  114  PHE A CD2 
875  C  CE1 . PHE A 113 ? 0.1531 0.2138 0.2584 0.0114  0.0155  0.0050  114  PHE A CE1 
876  C  CE2 . PHE A 113 ? 0.1432 0.2119 0.2596 0.0712  -0.0258 -0.0027 114  PHE A CE2 
877  C  CZ  . PHE A 113 ? 0.1484 0.1489 0.2362 0.0201  0.0110  0.0460  114  PHE A CZ  
878  N  N   . GLU A 114 ? 0.1617 0.1352 0.2654 0.0438  -0.0119 -0.0286 115  GLU A N   
879  C  CA  . GLU A 114 ? 0.1696 0.1378 0.2533 0.0559  -0.0122 -0.0048 115  GLU A CA  
880  C  C   . GLU A 114 ? 0.1990 0.1519 0.2517 0.0567  0.0121  -0.0216 115  GLU A C   
881  O  O   . GLU A 114 ? 0.2286 0.1505 0.2813 0.0845  -0.0354 -0.0341 115  GLU A O   
882  C  CB  . GLU A 114 ? 0.1682 0.1794 0.2939 0.0299  -0.0126 0.0124  115  GLU A CB  
883  C  CG  . GLU A 114 ? 0.2042 0.1539 0.2532 0.0388  -0.0051 0.0410  115  GLU A CG  
884  C  CD  . GLU A 114 ? 0.1823 0.1828 0.2479 0.0042  0.0045  0.0384  115  GLU A CD  
885  O  OE1 . GLU A 114 ? 0.1418 0.2186 0.2544 0.0205  -0.0181 0.0135  115  GLU A OE1 
886  O  OE2 . GLU A 114 ? 0.2645 0.2123 0.4056 0.0200  -0.0880 -0.0279 115  GLU A OE2 
887  N  N   . GLY A 115 ? 0.2332 0.1379 0.2588 0.0202  -0.0328 -0.0288 116  GLY A N   
888  C  CA  . GLY A 115 ? 0.2066 0.1491 0.3555 0.0294  -0.0917 -0.0470 116  GLY A CA  
889  C  C   . GLY A 115 ? 0.2052 0.1538 0.3768 0.0347  -0.0805 0.0082  116  GLY A C   
890  O  O   . GLY A 115 ? 0.2280 0.2487 0.4289 0.0553  -0.0568 -0.0338 116  GLY A O   
891  N  N   . ASP A 116 ? 0.1989 0.1565 0.4219 0.0354  -0.1115 -0.0294 117  ASP A N   
892  C  CA  . ASP A 116 ? 0.2014 0.1298 0.4387 0.0257  -0.0937 -0.0020 117  ASP A CA  
893  C  C   . ASP A 116 ? 0.1811 0.1609 0.3916 0.0230  -0.0691 0.0295  117  ASP A C   
894  O  O   . ASP A 116 ? 0.1902 0.2050 0.2993 0.0368  -0.0727 -0.0130 117  ASP A O   
895  C  CB  . ASP A 116 ? 0.2782 0.1662 0.5131 -0.0310 -0.1389 -0.0184 117  ASP A CB  
896  C  CG  . ASP A 116 ? 0.3210 0.1332 0.6059 -0.0349 -0.0459 0.0027  117  ASP A CG  
897  O  OD1 . ASP A 116 ? 0.3898 0.1755 0.6512 0.0475  0.0622  0.0928  117  ASP A OD1 
898  O  OD2 . ASP A 116 ? 0.4408 0.2222 0.6900 0.0809  -0.0290 -0.0201 117  ASP A OD2 
899  N  N   . THR A 117 ? 0.2032 0.1399 0.3177 0.0270  -0.0403 -0.0128 118  THR A N   
900  C  CA  . THR A 117 ? 0.2160 0.1436 0.2591 0.0337  -0.0012 -0.0136 118  THR A CA  
901  C  C   . THR A 117 ? 0.1410 0.1379 0.2302 0.0220  -0.0084 0.0063  118  THR A C   
902  O  O   . THR A 117 ? 0.1766 0.1319 0.2612 0.0337  -0.0441 0.0071  118  THR A O   
903  C  CB  . THR A 117 ? 0.1567 0.1501 0.2613 0.0582  -0.0114 -0.0368 118  THR A CB  
904  O  OG1 . THR A 117 ? 0.2458 0.1748 0.2894 0.0016  0.0195  -0.0652 118  THR A OG1 
905  C  CG2 . THR A 117 ? 0.1306 0.1715 0.2279 0.0323  -0.0134 -0.0154 118  THR A CG2 
906  N  N   . LEU A 118 ? 0.1348 0.1145 0.2268 0.0069  -0.0072 0.0249  119  LEU A N   
907  C  CA  . LEU A 118 ? 0.1138 0.1162 0.2092 0.0067  -0.0001 0.0330  119  LEU A CA  
908  C  C   . LEU A 118 ? 0.1079 0.1274 0.1612 -0.0058 0.0127  0.0080  119  LEU A C   
909  O  O   . LEU A 118 ? 0.1285 0.1343 0.1733 -0.0060 -0.0039 0.0198  119  LEU A O   
910  C  CB  . LEU A 118 ? 0.1121 0.1577 0.2324 -0.0062 0.0268  0.0371  119  LEU A CB  
911  C  CG  . LEU A 118 ? 0.1257 0.1559 0.2604 0.0025  0.0309  0.0261  119  LEU A CG  
912  C  CD1 . LEU A 118 ? 0.1518 0.1606 0.2512 -0.0145 0.0740  0.0274  119  LEU A CD1 
913  C  CD2 . LEU A 118 ? 0.1776 0.1483 0.2520 0.0013  0.0169  0.0035  119  LEU A CD2 
914  N  N   . VAL A 119 ? 0.1087 0.1245 0.1865 0.0069  -0.0121 0.0184  120  VAL A N   
915  C  CA  . VAL A 119 ? 0.1207 0.1298 0.1948 -0.0084 0.0079  -0.0212 120  VAL A CA  
916  C  C   . VAL A 119 ? 0.1697 0.1268 0.1404 0.0097  -0.0036 0.0022  120  VAL A C   
917  O  O   . VAL A 119 ? 0.2234 0.1236 0.1430 -0.0177 0.0092  0.0165  120  VAL A O   
918  C  CB  . VAL A 119 ? 0.1130 0.1750 0.2339 -0.0108 0.0189  -0.0274 120  VAL A CB  
919  C  CG1 . VAL A 119 ? 0.1499 0.2053 0.4998 -0.0753 -0.0325 -0.0151 120  VAL A CG1 
920  C  CG2 . VAL A 119 ? 0.1428 0.1665 0.2281 0.0376  -0.0256 -0.0133 120  VAL A CG2 
921  N  N   . ASN A 120 ? 0.2266 0.1253 0.1356 0.0023  0.0277  0.0102  121  ASN A N   
922  C  CA  . ASN A 120 ? 0.2261 0.1289 0.1672 0.0085  0.0299  0.0061  121  ASN A CA  
923  C  C   . ASN A 120 ? 0.2468 0.1508 0.1782 -0.0265 0.0424  -0.0239 121  ASN A C   
924  O  O   . ASN A 120 ? 0.2113 0.1585 0.1890 -0.0284 0.0226  0.0008  121  ASN A O   
925  C  CB  . ASN A 120 ? 0.2314 0.1637 0.1927 0.0283  0.0328  0.0090  121  ASN A CB  
926  C  CG  . ASN A 120 ? 0.2256 0.1792 0.1842 0.0338  0.0445  0.0041  121  ASN A CG  
927  O  OD1 . ASN A 120 ? 0.2190 0.1772 0.2675 0.0284  -0.0040 -0.0310 121  ASN A OD1 
928  N  ND2 . ASN A 120 ? 0.1837 0.2022 0.3166 0.0419  -0.0226 -0.0727 121  ASN A ND2 
929  N  N   . ARG A 121 ? 0.2493 0.1172 0.1776 -0.0111 0.0303  0.0154  122  ARG A N   
930  C  CA  . ARG A 121 ? 0.1956 0.1294 0.2188 0.0207  0.0263  -0.0043 122  ARG A CA  
931  C  C   . ARG A 121 ? 0.1527 0.1286 0.2175 0.0056  0.0332  -0.0088 122  ARG A C   
932  O  O   . ARG A 121 ? 0.1685 0.1527 0.2219 -0.0037 0.0477  -0.0130 122  ARG A O   
933  C  CB  . ARG A 121 ? 0.2251 0.2270 0.3225 0.1036  0.0416  0.0246  122  ARG A CB  
934  C  CG  . ARG A 121 ? 0.3129 0.3276 0.4055 0.1664  0.0334  -0.0484 122  ARG A CG  
935  C  CD  . ARG A 121 ? 0.2481 0.3480 0.5805 0.1556  0.0737  0.0028  122  ARG A CD  
936  N  NE  . ARG A 121 ? 0.4329 0.4003 0.7128 0.0393  -0.0880 0.0012  122  ARG A NE  
937  C  CZ  . ARG A 121 ? 0.4155 0.4423 0.8484 -0.0682 -0.2182 -0.0269 122  ARG A CZ  
938  N  NH1 . ARG A 121 ? 0.3880 0.6397 1.0950 0.0858  -0.2828 -0.0504 122  ARG A NH1 
939  N  NH2 . ARG A 121 ? 0.7618 0.6270 0.7829 -0.3176 -0.2806 0.1393  122  ARG A NH2 
940  N  N   . ILE A 122 ? 0.1341 0.1269 0.2259 -0.0221 0.0180  -0.0105 123  ILE A N   
941  C  CA  . ILE A 122 ? 0.1230 0.1247 0.1975 -0.0172 0.0007  0.0035  123  ILE A CA  
942  C  C   . ILE A 122 ? 0.1082 0.1215 0.1956 -0.0075 0.0028  0.0088  123  ILE A C   
943  O  O   . ILE A 122 ? 0.1468 0.1775 0.1904 -0.0185 0.0115  0.0301  123  ILE A O   
944  C  CB  . ILE A 122 ? 0.1129 0.1555 0.2086 -0.0302 -0.0013 0.0281  123  ILE A CB  
945  C  CG1 . ILE A 122 ? 0.1449 0.1730 0.2350 -0.0553 -0.0206 0.0440  123  ILE A CG1 
946  C  CG2 . ILE A 122 ? 0.1493 0.1680 0.3521 0.0114  -0.0728 -0.0108 123  ILE A CG2 
947  C  CD1 . ILE A 122 ? 0.1609 0.1583 0.2430 -0.0027 -0.0332 -0.0180 123  ILE A CD1 
948  N  N   . GLU A 123 ? 0.1556 0.1214 0.2020 -0.0294 -0.0165 0.0090  124  GLU A N   
949  C  CA  . GLU A 123 ? 0.1026 0.1212 0.2669 -0.0180 0.0235  0.0041  124  GLU A CA  
950  C  C   . GLU A 123 ? 0.1237 0.1253 0.2338 -0.0104 0.0334  0.0080  124  GLU A C   
951  O  O   . GLU A 123 ? 0.1472 0.1477 0.2071 0.0031  0.0273  -0.0042 124  GLU A O   
952  C  CB  . GLU A 123 ? 0.1468 0.1369 0.3662 -0.0170 -0.0405 -0.0295 124  GLU A CB  
953  C  CG  . GLU A 123 ? 0.1947 0.2646 0.4212 0.0718  -0.0958 -0.0676 124  GLU A CG  
954  C  CD  . GLU A 123 ? 0.2509 0.5630 0.4859 0.0850  -0.1452 0.0499  124  GLU A CD  
955  O  OE1 . GLU A 123 ? 0.2338 0.8491 0.5940 -0.0818 -0.1841 0.0591  124  GLU A OE1 
956  O  OE2 . GLU A 123 ? 0.3443 0.8056 0.4504 -0.0617 -0.1762 -0.0099 124  GLU A OE2 
957  N  N   . LEU A 124 ? 0.1177 0.1355 0.2253 -0.0190 0.0060  0.0114  125  LEU A N   
958  C  CA  . LEU A 124 ? 0.1188 0.1404 0.2321 -0.0182 0.0168  0.0258  125  LEU A CA  
959  C  C   . LEU A 124 ? 0.1441 0.1347 0.1917 -0.0194 0.0105  0.0312  125  LEU A C   
960  O  O   . LEU A 124 ? 0.1806 0.1288 0.1985 -0.0511 0.0301  0.0035  125  LEU A O   
961  C  CB  . LEU A 124 ? 0.1065 0.1661 0.2611 -0.0225 0.0007  0.0286  125  LEU A CB  
962  C  CG  . LEU A 124 ? 0.1800 0.1438 0.2762 -0.0074 -0.0452 0.0098  125  LEU A CG  
963  C  CD1 . LEU A 124 ? 0.1437 0.1580 0.3342 0.0102  -0.0440 0.0124  125  LEU A CD1 
964  C  CD2 . LEU A 124 ? 0.1699 0.1596 0.2498 -0.0067 -0.0481 0.0057  125  LEU A CD2 
965  N  N   . LYS A 125 ? 0.1588 0.1368 0.2089 -0.0156 0.0266  0.0266  126  LYS A N   
966  C  CA  . LYS A 125 ? 0.1309 0.1374 0.2177 -0.0139 0.0286  0.0237  126  LYS A CA  
967  C  C   . LYS A 125 ? 0.1416 0.1388 0.1988 -0.0069 0.0185  -0.0023 126  LYS A C   
968  O  O   . LYS A 125 ? 0.1334 0.1435 0.2244 -0.0338 0.0279  -0.0317 126  LYS A O   
969  C  CB  . LYS A 125 ? 0.1729 0.1092 0.2260 0.0128  0.0103  0.0108  126  LYS A CB  
970  C  CG  . LYS A 125 ? 0.3043 0.1642 0.3631 -0.0777 -0.0849 0.0305  126  LYS A CG  
971  C  CD  . LYS A 125 ? 0.2777 0.2228 0.5539 -0.0545 -0.1116 -0.0190 126  LYS A CD  
972  C  CE  . LYS A 125 ? 0.3509 0.1609 0.5797 -0.0947 -0.1139 -0.1222 126  LYS A CE  
973  N  NZ  . LYS A 125 ? 0.5740 0.7038 0.5794 -0.1335 0.0229  0.0480  126  LYS A NZ  
974  N  N   . GLY A 126 ? 0.1382 0.1334 0.1740 -0.0123 -0.0213 -0.0167 127  GLY A N   
975  C  CA  . GLY A 126 ? 0.1052 0.1424 0.1707 -0.0258 -0.0071 -0.0070 127  GLY A CA  
976  C  C   . GLY A 126 ? 0.1383 0.1297 0.2388 -0.0285 0.0251  -0.0061 127  GLY A C   
977  O  O   . GLY A 126 ? 0.1462 0.1453 0.2380 -0.0380 0.0324  -0.0201 127  GLY A O   
978  N  N   . ILE A 127 ? 0.1299 0.1442 0.2066 -0.0640 0.0293  -0.0185 128  ILE A N   
979  C  CA  . ILE A 127 ? 0.1487 0.1381 0.1923 -0.0562 0.0140  -0.0167 128  ILE A CA  
980  C  C   . ILE A 127 ? 0.1630 0.1504 0.1754 -0.0430 0.0100  -0.0208 128  ILE A C   
981  O  O   . ILE A 127 ? 0.1674 0.1351 0.1931 -0.0327 0.0250  -0.0190 128  ILE A O   
982  C  CB  . ILE A 127 ? 0.1750 0.1193 0.1956 -0.0265 0.0046  -0.0299 128  ILE A CB  
983  C  CG1 . ILE A 127 ? 0.2065 0.1403 0.1903 -0.0166 0.0206  -0.0486 128  ILE A CG1 
984  C  CG2 . ILE A 127 ? 0.1848 0.1883 0.2274 0.0093  -0.0119 -0.0684 128  ILE A CG2 
985  C  CD1 . ILE A 127 ? 0.1836 0.2503 0.2038 -0.0274 0.0232  -0.0765 128  ILE A CD1 
986  N  N   . ASP A 128 ? 0.1427 0.1490 0.2371 -0.0458 -0.0290 -0.0099 129  ASP A N   
987  C  CA  . ASP A 128 ? 0.1609 0.1454 0.2704 -0.0405 -0.0317 -0.0405 129  ASP A CA  
988  C  C   . ASP A 128 ? 0.1569 0.1277 0.2363 -0.0427 -0.0141 0.0118  129  ASP A C   
989  O  O   . ASP A 128 ? 0.1605 0.1435 0.3088 -0.0359 -0.0305 -0.0265 129  ASP A O   
990  C  CB  . ASP A 128 ? 0.2165 0.1375 0.2521 -0.0102 -0.0405 -0.0109 129  ASP A CB  
991  C  CG  . ASP A 128 ? 0.1948 0.1604 0.2373 -0.0246 -0.0099 -0.0250 129  ASP A CG  
992  O  OD1 . ASP A 128 ? 0.2381 0.1966 0.3499 -0.0537 -0.0055 0.0259  129  ASP A OD1 
993  O  OD2 . ASP A 128 ? 0.2677 0.2156 0.2531 -0.0520 -0.0568 -0.0062 129  ASP A OD2 
994  N  N   . PHE A 129 ? 0.1633 0.1489 0.2509 -0.0493 -0.0279 -0.0143 130  PHE A N   
995  C  CA  . PHE A 129 ? 0.1801 0.1530 0.2389 -0.0228 -0.0247 0.0024  130  PHE A CA  
996  C  C   . PHE A 129 ? 0.1844 0.1390 0.2614 0.0050  0.0228  -0.0015 130  PHE A C   
997  O  O   . PHE A 129 ? 0.1941 0.1954 0.2241 -0.0136 0.0125  0.0280  130  PHE A O   
998  C  CB  . PHE A 129 ? 0.2367 0.1389 0.2085 -0.0355 -0.0356 0.0179  130  PHE A CB  
999  C  CG  . PHE A 129 ? 0.1948 0.1538 0.1976 -0.0320 -0.0118 0.0140  130  PHE A CG  
1000 C  CD1 . PHE A 129 ? 0.2121 0.1051 0.1925 -0.0316 -0.0168 -0.0115 130  PHE A CD1 
1001 C  CD2 . PHE A 129 ? 0.2014 0.1817 0.2231 -0.0361 -0.0248 -0.0106 130  PHE A CD2 
1002 C  CE1 . PHE A 129 ? 0.1689 0.1504 0.1659 -0.0427 -0.0318 0.0027  130  PHE A CE1 
1003 C  CE2 . PHE A 129 ? 0.1450 0.1622 0.2604 -0.0103 -0.0130 -0.0122 130  PHE A CE2 
1004 C  CZ  . PHE A 129 ? 0.1395 0.1258 0.2509 0.0145  0.0146  -0.0369 130  PHE A CZ  
1005 N  N   . LYS A 130 ? 0.2062 0.1521 0.2725 -0.0087 -0.0192 0.0094  131  LYS A N   
1006 C  CA  . LYS A 130 ? 0.2367 0.1369 0.3322 -0.0308 -0.0453 0.0241  131  LYS A CA  
1007 C  C   . LYS A 130 ? 0.2674 0.1798 0.3116 -0.0738 -0.0367 0.0607  131  LYS A C   
1008 O  O   . LYS A 130 ? 0.2716 0.2090 0.3295 -0.0800 0.0221  -0.0019 131  LYS A O   
1009 C  CB  . LYS A 130 ? 0.2443 0.1189 0.4534 -0.0261 -0.0378 0.0459  131  LYS A CB  
1010 C  CG  . LYS A 130 ? 0.2990 0.1765 0.5440 0.0066  0.0070  -0.0486 131  LYS A CG  
1011 C  CD  . LYS A 130 ? 0.2924 0.2503 0.6404 -0.0242 0.0972  0.0417  131  LYS A CD  
1012 C  CE  . LYS A 130 ? 0.4455 0.3670 0.7061 -0.1004 0.2089  -0.0897 131  LYS A CE  
1013 N  NZ  . LYS A 130 ? 0.6016 0.3373 0.9371 0.0099  0.3983  0.0325  131  LYS A NZ  
1014 N  N   . GLU A 131 ? 0.1903 0.2407 0.3883 -0.0681 -0.0316 0.0709  132  GLU A N   
1015 C  CA  . GLU A 131 ? 0.3100 0.3063 0.4068 -0.1153 0.0363  0.0702  132  GLU A CA  
1016 C  C   . GLU A 131 ? 0.3635 0.2738 0.3589 -0.1095 0.0264  0.0292  132  GLU A C   
1017 O  O   . GLU A 131 ? 0.5265 0.4134 0.3580 -0.1911 0.1155  -0.0284 132  GLU A O   
1018 C  CB  . GLU A 131 ? 0.3503 0.4930 0.5664 -0.2097 0.1139  0.0589  132  GLU A CB  
1019 C  CG  . GLU A 131 ? 0.3781 0.7255 0.8220 -0.2971 -0.0542 0.0695  132  GLU A CG  
1020 C  CD  . GLU A 131 ? 0.5902 0.8829 1.0623 -0.2632 -0.1699 -0.1421 132  GLU A CD  
1021 O  OE1 . GLU A 131 ? 0.6278 1.2002 1.4497 -0.4133 -0.3635 -0.1606 132  GLU A OE1 
1022 O  OE2 . GLU A 131 ? 1.1255 1.0809 1.4019 0.0094  -0.2427 -0.3927 132  GLU A OE2 
1023 N  N   . ASP A 132 ? 0.3372 0.2675 0.4939 -0.1130 0.0011  0.0914  133  ASP A N   
1024 C  CA  . ASP A 132 ? 0.3956 0.3377 0.5173 -0.1429 -0.0403 0.1855  133  ASP A CA  
1025 C  C   . ASP A 132 ? 0.3369 0.2475 0.3890 -0.0669 -0.0535 0.0621  133  ASP A C   
1026 O  O   . ASP A 132 ? 0.3717 0.2650 0.3908 -0.0818 -0.1127 0.0639  133  ASP A O   
1027 C  CB  . ASP A 132 ? 0.4557 0.3701 0.7243 -0.0766 -0.0147 0.2634  133  ASP A CB  
1028 C  CG  . ASP A 132 ? 0.7546 0.4358 0.9477 0.0450  0.0293  0.1780  133  ASP A CG  
1029 O  OD1 . ASP A 132 ? 1.1901 0.6536 0.9227 0.0801  0.1298  0.0296  133  ASP A OD1 
1030 O  OD2 . ASP A 132 ? 0.9699 0.6463 1.3695 0.3180  0.0483  0.3205  133  ASP A OD2 
1031 N  N   . GLY A 133 ? 0.2565 0.2056 0.3284 -0.0616 -0.0338 0.0106  134  GLY A N   
1032 C  CA  . GLY A 133 ? 0.1926 0.1875 0.3200 -0.0104 -0.0303 -0.0195 134  GLY A CA  
1033 C  C   . GLY A 133 ? 0.1657 0.1720 0.2692 -0.0037 -0.0116 0.0030  134  GLY A C   
1034 O  O   . GLY A 133 ? 0.1840 0.1726 0.2734 -0.0070 0.0082  0.0172  134  GLY A O   
1035 N  N   . ASN A 134 ? 0.1394 0.1446 0.2535 0.0282  -0.0194 0.0170  135  ASN A N   
1036 C  CA  . ASN A 134 ? 0.1558 0.1664 0.2470 0.0021  0.0229  -0.0047 135  ASN A CA  
1037 C  C   . ASN A 134 ? 0.1147 0.1784 0.2689 -0.0062 0.0083  -0.0341 135  ASN A C   
1038 O  O   . ASN A 134 ? 0.1422 0.1495 0.1895 -0.0017 0.0107  0.0242  135  ASN A O   
1039 C  CB  . ASN A 134 ? 0.1292 0.1919 0.2474 0.0124  0.0139  -0.0052 135  ASN A CB  
1040 C  CG  . ASN A 134 ? 0.1519 0.1593 0.2735 0.0076  0.0154  -0.0021 135  ASN A CG  
1041 O  OD1 . ASN A 134 ? 0.1976 0.2001 0.3026 0.0246  0.0102  0.0299  135  ASN A OD1 
1042 N  ND2 . ASN A 134 ? 0.1119 0.1960 0.2860 0.0012  0.0052  -0.0322 135  ASN A ND2 
1043 N  N   . ILE A 135 ? 0.1494 0.1352 0.2290 -0.0089 0.0139  -0.0349 136  ILE A N   
1044 C  CA  . ILE A 135 ? 0.1743 0.1213 0.2349 -0.0027 0.0141  -0.0025 136  ILE A CA  
1045 C  C   . ILE A 135 ? 0.1321 0.1513 0.2173 0.0098  -0.0149 -0.0254 136  ILE A C   
1046 O  O   . ILE A 135 ? 0.1991 0.1467 0.1928 -0.0106 -0.0031 -0.0075 136  ILE A O   
1047 C  CB  . ILE A 135 ? 0.2063 0.1226 0.2272 -0.0170 -0.0013 -0.0240 136  ILE A CB  
1048 C  CG1 . ILE A 135 ? 0.2010 0.1505 0.2115 -0.0400 -0.0319 0.0026  136  ILE A CG1 
1049 C  CG2 . ILE A 135 ? 0.2387 0.1165 0.1927 0.0009  -0.0261 -0.0414 136  ILE A CG2 
1050 C  CD1 . ILE A 135 ? 0.2647 0.2043 0.2812 -0.0185 0.0695  0.0107  136  ILE A CD1 
1051 N  N   . LEU A 136 ? 0.1463 0.2006 0.1921 -0.0227 -0.0100 -0.0253 137  LEU A N   
1052 C  CA  . LEU A 136 ? 0.1619 0.2093 0.2211 -0.0112 0.0085  0.0073  137  LEU A CA  
1053 C  C   . LEU A 136 ? 0.1813 0.1856 0.2416 -0.0107 0.0074  0.0292  137  LEU A C   
1054 O  O   . LEU A 136 ? 0.1742 0.2011 0.2153 -0.0505 -0.0160 0.0028  137  LEU A O   
1055 C  CB  . LEU A 136 ? 0.1666 0.2146 0.2633 -0.0378 -0.0026 0.0400  137  LEU A CB  
1056 C  CG  . LEU A 136 ? 0.2261 0.2896 0.2356 -0.0659 -0.0272 0.0392  137  LEU A CG  
1057 C  CD1 . LEU A 136 ? 0.2213 0.3647 0.2457 -0.0996 -0.0005 0.0050  137  LEU A CD1 
1058 C  CD2 . LEU A 136 ? 0.2570 0.2888 0.2983 -0.0146 -0.0941 0.0780  137  LEU A CD2 
1059 N  N   . GLY A 137 ? 0.2002 0.1720 0.2652 0.0063  -0.0369 -0.0358 138  GLY A N   
1060 C  CA  . GLY A 137 ? 0.1545 0.1802 0.2829 -0.0343 -0.0111 0.0233  138  GLY A CA  
1061 C  C   . GLY A 137 ? 0.1606 0.1736 0.1899 -0.0158 0.0140  0.0304  138  GLY A C   
1062 O  O   . GLY A 137 ? 0.1855 0.1928 0.1901 0.0289  0.0185  0.0356  138  GLY A O   
1063 N  N   . HIS A 138 ? 0.1945 0.1623 0.1914 -0.0089 -0.0261 0.0189  139  HIS A N   
1064 C  CA  . HIS A 138 ? 0.1509 0.1671 0.2202 0.0120  -0.0093 -0.0176 139  HIS A CA  
1065 C  C   . HIS A 138 ? 0.1606 0.1851 0.2103 0.0140  -0.0111 -0.0044 139  HIS A C   
1066 O  O   . HIS A 138 ? 0.1754 0.1826 0.1985 0.0270  -0.0025 0.0353  139  HIS A O   
1067 C  CB  . HIS A 138 ? 0.1652 0.1835 0.2267 0.0035  0.0139  -0.0016 139  HIS A CB  
1068 C  CG  . HIS A 138 ? 0.1702 0.1874 0.2944 0.0221  0.0050  -0.0444 139  HIS A CG  
1069 N  ND1 . HIS A 138 ? 0.1935 0.1942 0.2516 0.0129  -0.0324 -0.0034 139  HIS A ND1 
1070 C  CD2 . HIS A 138 ? 0.1669 0.1955 0.3417 0.0249  -0.0067 -0.0306 139  HIS A CD2 
1071 C  CE1 . HIS A 138 ? 0.1827 0.2062 0.3151 -0.0124 -0.0370 0.0381  139  HIS A CE1 
1072 N  NE2 . HIS A 138 ? 0.1926 0.1876 0.3212 0.0044  -0.0307 0.0067  139  HIS A NE2 
1073 N  N   . LYS A 139 ? 0.1526 0.1196 0.2143 0.0174  -0.0156 -0.0051 140  LYS A N   
1074 C  CA  . LYS A 139 ? 0.1648 0.1171 0.2548 0.0260  -0.0216 0.0197  140  LYS A CA  
1075 C  C   . LYS A 139 ? 0.1510 0.1522 0.2689 0.0249  0.0292  -0.0004 140  LYS A C   
1076 O  O   . LYS A 139 ? 0.1567 0.1791 0.2606 0.0401  0.0173  -0.0383 140  LYS A O   
1077 C  CB  . LYS A 139 ? 0.1899 0.1397 0.2823 0.0395  0.0344  0.0030  140  LYS A CB  
1078 C  CG  . LYS A 139 ? 0.2181 0.1336 0.2650 0.0131  0.0036  -0.0263 140  LYS A CG  
1079 C  CD  . LYS A 139 ? 0.2028 0.1379 0.3526 0.0445  0.0120  -0.0139 140  LYS A CD  
1080 C  CE  . LYS A 139 ? 0.3164 0.1388 0.3969 -0.0279 0.0554  -0.0210 140  LYS A CE  
1081 N  NZ  . LYS A 139 ? 0.3523 0.1599 0.5431 -0.0049 0.0287  -0.0626 140  LYS A NZ  
1082 N  N   . LEU A 140 ? 0.1230 0.1179 0.2686 -0.0036 0.0357  -0.0200 141  LEU A N   
1083 C  CA  . LEU A 140 ? 0.1003 0.1595 0.2180 -0.0050 0.0481  -0.0198 141  LEU A CA  
1084 C  C   . LEU A 140 ? 0.1439 0.1394 0.2743 -0.0054 0.0073  -0.0314 141  LEU A C   
1085 O  O   . LEU A 140 ? 0.1486 0.1609 0.2262 -0.0069 -0.0121 -0.0461 141  LEU A O   
1086 C  CB  . LEU A 140 ? 0.1352 0.2008 0.2629 -0.0249 0.0111  0.0199  141  LEU A CB  
1087 C  CG  . LEU A 140 ? 0.1537 0.2769 0.2643 0.0180  -0.0260 -0.0189 141  LEU A CG  
1088 C  CD1 . LEU A 140 ? 0.2286 0.4514 0.1921 0.0922  0.0589  0.0123  141  LEU A CD1 
1089 C  CD2 . LEU A 140 ? 0.3375 0.1997 0.4372 0.1063  0.0963  0.0397  141  LEU A CD2 
1090 N  N   . GLU A 141 ? 0.1321 0.0877 0.2724 0.0330  -0.0269 0.0103  142  GLU A N   
1091 C  CA  . GLU A 141 ? 0.1176 0.0971 0.2827 0.0228  -0.0115 -0.0010 142  GLU A CA  
1092 C  C   . GLU A 141 ? 0.1433 0.1053 0.2121 0.0341  -0.0047 0.0008  142  GLU A C   
1093 O  O   . GLU A 141 ? 0.1532 0.1253 0.2104 -0.0003 -0.0091 0.0080  142  GLU A O   
1094 C  CB  . GLU A 141 ? 0.1168 0.1412 0.3052 0.0281  -0.0182 -0.0121 142  GLU A CB  
1095 C  CG  . GLU A 141 ? 0.1368 0.1581 0.2978 0.0541  -0.0279 -0.0214 142  GLU A CG  
1096 C  CD  . GLU A 141 ? 0.1335 0.2037 0.2624 0.0405  -0.0506 0.0326  142  GLU A CD  
1097 O  OE1 . GLU A 141 ? 0.1548 0.1824 0.3228 0.0570  -0.0107 0.0330  142  GLU A OE1 
1098 O  OE2 . GLU A 141 ? 0.1500 0.1924 0.2981 0.0748  0.0029  0.0351  142  GLU A OE2 
1099 N  N   . TYR A 142 ? 0.1442 0.1010 0.2215 0.0191  -0.0221 -0.0107 143  TYR A N   
1100 C  CA  . TYR A 142 ? 0.1579 0.1174 0.1835 0.0476  -0.0071 0.0131  143  TYR A CA  
1101 C  C   . TYR A 142 ? 0.1697 0.0933 0.2057 0.0477  -0.0073 0.0115  143  TYR A C   
1102 O  O   . TYR A 142 ? 0.1888 0.1442 0.2282 0.0336  -0.0158 -0.0224 143  TYR A O   
1103 C  CB  . TYR A 142 ? 0.1402 0.1276 0.1947 0.0226  -0.0218 -0.0240 143  TYR A CB  
1104 C  CG  . TYR A 142 ? 0.1597 0.1198 0.1592 0.0248  -0.0134 -0.0129 143  TYR A CG  
1105 C  CD1 . TYR A 142 ? 0.1283 0.0974 0.1955 0.0026  -0.0053 -0.0045 143  TYR A CD1 
1106 C  CD2 . TYR A 142 ? 0.1765 0.1174 0.1409 0.0285  -0.0353 0.0007  143  TYR A CD2 
1107 C  CE1 . TYR A 142 ? 0.1648 0.1123 0.1755 0.0228  -0.0174 -0.0018 143  TYR A CE1 
1108 C  CE2 . TYR A 142 ? 0.1469 0.1016 0.2073 0.0108  -0.0220 0.0155  143  TYR A CE2 
1109 C  CZ  . TYR A 142 ? 0.1623 0.1071 0.1763 0.0358  -0.0205 -0.0068 143  TYR A CZ  
1110 O  OH  . TYR A 142 ? 0.1796 0.1330 0.2433 0.0596  -0.0497 -0.0327 143  TYR A OH  
1111 N  N   . ASN A 143 ? 0.1590 0.1247 0.2040 0.0009  -0.0123 0.0112  144  ASN A N   
1112 C  CA  . ASN A 143 ? 0.1428 0.1051 0.2170 -0.0010 -0.0233 0.0016  144  ASN A CA  
1113 C  C   . ASN A 143 ? 0.1562 0.1109 0.2165 0.0128  0.0048  0.0011  144  ASN A C   
1114 O  O   . ASN A 143 ? 0.1577 0.1698 0.1932 0.0198  -0.0158 0.0070  144  ASN A O   
1115 C  CB  . ASN A 143 ? 0.1506 0.1477 0.2501 0.0218  -0.0227 -0.0114 144  ASN A CB  
1116 C  CG  . ASN A 143 ? 0.1565 0.1469 0.2022 0.0344  -0.0129 -0.0030 144  ASN A CG  
1117 O  OD1 . ASN A 143 ? 0.2117 0.1599 0.2314 0.0394  -0.0625 -0.0143 144  ASN A OD1 
1118 N  ND2 . ASN A 143 ? 0.1839 0.1710 0.2163 0.0185  -0.0350 0.0138  144  ASN A ND2 
1119 N  N   . TYR A 144 ? 0.1937 0.1526 0.2508 0.0030  0.0106  0.0412  145  TYR A N   
1120 C  CA  . TYR A 144 ? 0.1786 0.1211 0.2440 0.0180  0.0211  0.0223  145  TYR A CA  
1121 C  C   . TYR A 144 ? 0.1831 0.1344 0.2324 -0.0064 0.0157  -0.0149 145  TYR A C   
1122 O  O   . TYR A 144 ? 0.2323 0.1631 0.2725 -0.0398 0.0256  -0.0382 145  TYR A O   
1123 C  CB  . TYR A 144 ? 0.2033 0.1206 0.2469 0.0260  0.0049  0.0113  145  TYR A CB  
1124 C  CG  . TYR A 144 ? 0.1595 0.1092 0.2538 0.0253  0.0142  -0.0087 145  TYR A CG  
1125 C  CD1 . TYR A 144 ? 0.1273 0.1600 0.3292 0.0313  0.0206  -0.0164 145  TYR A CD1 
1126 C  CD2 . TYR A 144 ? 0.1566 0.2478 0.2305 0.0189  0.0324  -0.0142 145  TYR A CD2 
1127 C  CE1 . TYR A 144 ? 0.1725 0.1940 0.3764 -0.0007 -0.0396 0.0006  145  TYR A CE1 
1128 C  CE2 . TYR A 144 ? 0.1941 0.2973 0.2471 0.0046  0.0079  -0.0180 145  TYR A CE2 
1129 C  CZ  . TYR A 144 ? 0.1425 0.2480 0.3230 0.0598  -0.0116 -0.0366 145  TYR A CZ  
1130 O  OH  . TYR A 144 ? 0.2373 0.2892 0.3545 0.0391  -0.0509 -0.0778 145  TYR A OH  
1131 N  N   . ASN A 145 ? 0.1734 0.1419 0.2304 -0.0021 0.0106  -0.0150 146  ASN A N   
1132 C  CA  . ASN A 145 ? 0.1533 0.1819 0.2222 0.0190  -0.0105 -0.0123 146  ASN A CA  
1133 C  C   . ASN A 145 ? 0.1588 0.1683 0.1926 0.0259  0.0181  -0.0280 146  ASN A C   
1134 O  O   . ASN A 145 ? 0.1666 0.2248 0.2684 -0.0084 -0.0206 0.0426  146  ASN A O   
1135 C  CB  . ASN A 145 ? 0.1636 0.1770 0.3242 0.0399  0.0184  -0.0123 146  ASN A CB  
1136 C  CG  . ASN A 145 ? 0.2255 0.1733 0.2974 0.0228  -0.0210 -0.0306 146  ASN A CG  
1137 O  OD1 . ASN A 145 ? 0.3266 0.1897 0.3575 0.0346  -0.0964 -0.0572 146  ASN A OD1 
1138 N  ND2 . ASN A 145 ? 0.1928 0.2373 0.3077 -0.0477 -0.0134 0.0277  146  ASN A ND2 
1139 N  N   . SER A 146 ? 0.1584 0.1495 0.3202 0.0229  -0.0033 0.0006  147  SER A N   
1140 C  CA  . SER A 146 ? 0.1245 0.1923 0.3146 0.0097  0.0070  0.0170  147  SER A CA  
1141 C  C   . SER A 146 ? 0.1178 0.1465 0.3276 0.0301  0.0012  0.0087  147  SER A C   
1142 O  O   . SER A 146 ? 0.1912 0.1377 0.4279 0.0481  -0.0184 0.0015  147  SER A O   
1143 C  CB  . SER A 146 ? 0.1527 0.2570 0.3195 -0.0271 -0.0320 0.0270  147  SER A CB  
1144 O  OG  . SER A 146 ? 0.3256 0.2209 0.3469 -0.0129 -0.0591 -0.0014 147  SER A OG  
1145 N  N   . HIS A 147 ? 0.1549 0.1265 0.3096 0.0271  0.0107  0.0012  148  HIS A N   
1146 C  CA  . HIS A 147 ? 0.2228 0.1971 0.3074 0.0238  0.0039  -0.0126 148  HIS A CA  
1147 C  C   . HIS A 147 ? 0.2323 0.1776 0.3045 -0.0053 -0.0097 -0.0221 148  HIS A C   
1148 O  O   . HIS A 147 ? 0.2656 0.1826 0.3174 -0.0053 0.0311  -0.0304 148  HIS A O   
1149 C  CB  . HIS A 147 ? 0.3166 0.2035 0.3756 -0.1008 0.0809  -0.1554 148  HIS A CB  
1150 C  CG  . HIS A 147 ? 0.3332 0.2732 0.3753 -0.0865 0.0566  -0.1023 148  HIS A CG  
1151 N  ND1 . HIS A 147 ? 0.4306 0.3209 0.3920 -0.1200 0.1055  -0.1158 148  HIS A ND1 
1152 C  CD2 . HIS A 147 ? 0.2786 0.2921 0.3348 0.0357  -0.0093 -0.0006 148  HIS A CD2 
1153 C  CE1 . HIS A 147 ? 0.3779 0.3272 0.4105 -0.1592 0.0851  -0.1148 148  HIS A CE1 
1154 N  NE2 . HIS A 147 ? 0.2894 0.3291 0.4134 -0.0667 0.0709  -0.0406 148  HIS A NE2 
1155 N  N   . ASN A 148 ? 0.2355 0.1398 0.2897 -0.0115 -0.0472 -0.0168 149  ASN A N   
1156 C  CA  . ASN A 148 ? 0.2122 0.1357 0.3138 0.0212  -0.0324 0.0053  149  ASN A CA  
1157 C  C   . ASN A 148 ? 0.2484 0.1178 0.3264 -0.0206 -0.0560 0.0426  149  ASN A C   
1158 O  O   . ASN A 148 ? 0.4117 0.1277 0.4322 0.0196  -0.1768 -0.0097 149  ASN A O   
1159 C  CB  . ASN A 148 ? 0.2494 0.1970 0.3298 0.0103  -0.0026 0.0000  149  ASN A CB  
1160 C  CG  . ASN A 148 ? 0.2287 0.2445 0.4336 -0.0333 0.0190  -0.0152 149  ASN A CG  
1161 O  OD1 . ASN A 148 ? 0.1957 0.3490 0.3170 -0.0047 -0.0106 -0.0085 149  ASN A OD1 
1162 N  ND2 . ASN A 148 ? 0.2524 0.2873 0.5785 0.0224  -0.0276 -0.0847 149  ASN A ND2 
1163 N  N   . VAL A 149 ? 0.1645 0.1207 0.2996 -0.0303 -0.0082 0.0416  150  VAL A N   
1164 C  CA  . VAL A 149 ? 0.1506 0.1367 0.2710 -0.0356 0.0157  0.0250  150  VAL A CA  
1165 C  C   . VAL A 149 ? 0.2005 0.1484 0.2687 0.0011  0.0263  0.0305  150  VAL A C   
1166 O  O   . VAL A 149 ? 0.1964 0.1582 0.2259 -0.0083 0.0133  0.0357  150  VAL A O   
1167 C  CB  . VAL A 149 ? 0.1501 0.1505 0.2748 -0.0279 0.0157  0.0310  150  VAL A CB  
1168 C  CG1 . VAL A 149 ? 0.1427 0.1579 0.3391 -0.0339 -0.0129 -0.0433 150  VAL A CG1 
1169 C  CG2 . VAL A 149 ? 0.2179 0.2617 0.2883 -0.0867 0.0697  0.0029  150  VAL A CG2 
1170 N  N   . TYR A 150 ? 0.1715 0.1521 0.2659 -0.0049 -0.0039 0.0304  151  TYR A N   
1171 C  CA  . TYR A 150 ? 0.1622 0.1144 0.2683 -0.0380 -0.0013 0.0068  151  TYR A CA  
1172 C  C   . TYR A 150 ? 0.1658 0.1535 0.2371 -0.0355 0.0031  0.0020  151  TYR A C   
1173 O  O   . TYR A 150 ? 0.1923 0.1929 0.2828 -0.0700 -0.0381 0.0528  151  TYR A O   
1174 C  CB  . TYR A 150 ? 0.2287 0.1692 0.3092 0.0088  -0.0007 -0.0217 151  TYR A CB  
1175 C  CG  . TYR A 150 ? 0.2061 0.2031 0.3392 0.0317  0.0136  -0.0075 151  TYR A CG  
1176 C  CD1 . TYR A 150 ? 0.1996 0.2424 0.3799 0.0369  0.0249  0.0155  151  TYR A CD1 
1177 C  CD2 . TYR A 150 ? 0.2031 0.2434 0.3828 0.0467  0.0141  0.0381  151  TYR A CD2 
1178 C  CE1 . TYR A 150 ? 0.1973 0.2712 0.4411 0.0402  0.0039  0.0243  151  TYR A CE1 
1179 C  CE2 . TYR A 150 ? 0.1866 0.2615 0.4180 0.0963  0.0399  0.0431  151  TYR A CE2 
1180 C  CZ  . TYR A 150 ? 0.2040 0.2677 0.4967 0.0645  -0.0176 0.0532  151  TYR A CZ  
1181 O  OH  . TYR A 150 ? 0.2479 0.3565 0.4251 0.0482  -0.0510 0.0132  151  TYR A OH  
1182 N  N   . ILE A 151 ? 0.1535 0.1487 0.2086 -0.0363 -0.0087 -0.0103 152  ILE A N   
1183 C  CA  . ILE A 151 ? 0.1625 0.2173 0.2216 0.0073  0.0169  0.0227  152  ILE A CA  
1184 C  C   . ILE A 151 ? 0.1696 0.1872 0.2138 -0.0228 0.0120  0.0131  152  ILE A C   
1185 O  O   . ILE A 151 ? 0.1719 0.2134 0.2029 -0.0426 0.0057  0.0039  152  ILE A O   
1186 C  CB  . ILE A 151 ? 0.1452 0.2281 0.1921 0.0313  -0.0194 0.0131  152  ILE A CB  
1187 C  CG1 . ILE A 151 ? 0.2780 0.2785 0.1789 0.0196  -0.0143 0.0233  152  ILE A CG1 
1188 C  CG2 . ILE A 151 ? 0.1631 0.2236 0.2259 -0.0124 -0.0336 0.0731  152  ILE A CG2 
1189 C  CD1 . ILE A 151 ? 0.3677 0.7661 0.3098 -0.1737 0.0306  0.1648  152  ILE A CD1 
1190 N  N   . THR A 152 ? 0.1631 0.2169 0.2255 -0.0484 0.0101  0.0411  153  THR A N   
1191 C  CA  . THR A 152 ? 0.1992 0.1911 0.2176 -0.0090 0.0053  -0.0275 153  THR A CA  
1192 C  C   . THR A 152 ? 0.1752 0.2259 0.1910 -0.0387 0.0077  -0.0140 153  THR A C   
1193 O  O   . THR A 152 ? 0.1836 0.2744 0.2311 -0.0246 0.0256  0.0128  153  THR A O   
1194 C  CB  . THR A 152 ? 0.2077 0.1789 0.3648 -0.0655 -0.0660 -0.0869 153  THR A CB  
1195 O  OG1 . THR A 152 ? 0.2329 0.2336 0.4977 -0.0818 -0.0796 0.0353  153  THR A OG1 
1196 C  CG2 . THR A 152 ? 0.2232 0.2526 0.7371 0.0369  -0.0452 -0.1279 153  THR A CG2 
1197 N  N   . ALA A 153 ? 0.1936 0.1827 0.2357 -0.0191 0.0269  0.0079  154  ALA A N   
1198 C  CA  . ALA A 153 ? 0.2109 0.2108 0.2269 -0.0167 0.0041  -0.0016 154  ALA A CA  
1199 C  C   . ALA A 153 ? 0.1926 0.2312 0.2640 -0.0457 0.0277  -0.0118 154  ALA A C   
1200 O  O   . ALA A 153 ? 0.2531 0.2064 0.4121 -0.0059 -0.0650 -0.0509 154  ALA A O   
1201 C  CB  . ALA A 153 ? 0.3378 0.1868 0.3142 -0.0429 -0.0491 0.0401  154  ALA A CB  
1202 N  N   . ASP A 154 ? 0.2015 0.2782 0.2645 -0.0340 0.0099  0.0021  155  ASP A N   
1203 C  CA  . ASP A 154 ? 0.2150 0.2676 0.3897 -0.0207 -0.0322 -0.0350 155  ASP A CA  
1204 C  C   . ASP A 154 ? 0.2553 0.2903 0.3451 -0.0455 -0.0653 -0.0402 155  ASP A C   
1205 O  O   . ASP A 154 ? 0.2864 0.2779 0.3226 -0.0105 -0.0841 -0.0169 155  ASP A O   
1206 C  CB  . ASP A 154 ? 0.3217 0.2257 0.5127 -0.1158 -0.0078 0.0071  155  ASP A CB  
1207 C  CG  . ASP A 154 ? 0.3673 0.3787 0.7631 -0.1886 -0.0618 -0.0455 155  ASP A CG  
1208 O  OD1 . ASP A 154 ? 0.3648 0.3875 1.0053 -0.1993 -0.0696 0.0966  155  ASP A OD1 
1209 O  OD2 . ASP A 154 ? 0.4437 0.4977 0.7746 -0.2334 -0.1917 -0.0878 155  ASP A OD2 
1210 N  N   . LYS A 155 ? 0.3560 0.3589 0.3563 -0.0311 -0.0237 -0.0371 156  LYS A N   
1211 C  CA  . LYS A 155 ? 0.3640 0.4712 0.3384 0.0378  0.0013  0.0088  156  LYS A CA  
1212 C  C   . LYS A 155 ? 0.4024 0.4999 0.3961 0.0359  -0.0498 -0.0362 156  LYS A C   
1213 O  O   . LYS A 155 ? 0.3127 0.4732 0.4492 -0.0232 -0.0018 0.0351  156  LYS A O   
1214 C  CB  . LYS A 155 ? 0.5071 0.6053 0.4938 -0.0622 0.1414  0.0511  156  LYS A CB  
1215 C  CG  . LYS A 155 ? 0.5417 0.7672 0.6567 -0.1658 0.1623  -0.0662 156  LYS A CG  
1216 C  CD  . LYS A 155 ? 0.5756 0.9319 0.7705 -0.1584 0.0825  -0.0927 156  LYS A CD  
1217 C  CE  . LYS A 155 ? 0.5653 1.0372 0.8083 -0.2398 0.1339  -0.1130 156  LYS A CE  
1218 N  NZ  . LYS A 155 ? 0.6631 1.1246 0.6955 -0.2651 0.0842  -0.1342 156  LYS A NZ  
1219 N  N   . GLN A 156 ? 0.3848 0.5141 0.4655 0.0819  -0.0229 -0.1634 157  GLN A N   
1220 C  CA  . GLN A 156 ? 0.4315 0.6170 0.5922 0.0467  -0.0836 -0.2296 157  GLN A CA  
1221 C  C   . GLN A 156 ? 0.3298 0.5535 0.5194 -0.0451 -0.1472 -0.2331 157  GLN A C   
1222 O  O   . GLN A 156 ? 0.3659 0.7687 0.5346 0.0322  -0.1463 -0.1395 157  GLN A O   
1223 C  CB  . GLN A 156 ? 0.5767 0.6942 0.8336 0.0424  -0.1188 -0.4179 157  GLN A CB  
1224 C  CG  . GLN A 156 ? 0.7466 0.8768 1.0663 0.2114  -0.0049 -0.4662 157  GLN A CG  
1225 C  CD  . GLN A 156 ? 0.8692 0.9846 1.2123 0.3290  0.0198  -0.4043 157  GLN A CD  
1226 O  OE1 . GLN A 156 ? 1.1675 1.2909 1.2872 0.4448  0.0325  -0.1933 157  GLN A OE1 
1227 N  NE2 . GLN A 156 ? 0.8817 0.9176 1.4902 0.2835  0.0420  -0.5742 157  GLN A NE2 
1228 N  N   . LYS A 157 ? 0.3840 0.4935 0.5070 -0.0513 -0.1378 -0.1035 158  LYS A N   
1229 C  CA  . LYS A 157 ? 0.3709 0.4839 0.4434 -0.1102 -0.1046 -0.0080 158  LYS A CA  
1230 C  C   . LYS A 157 ? 0.2935 0.4493 0.3595 -0.0669 -0.0429 0.0258  158  LYS A C   
1231 O  O   . LYS A 157 ? 0.2289 0.4860 0.4257 -0.0627 -0.0086 0.0340  158  LYS A O   
1232 C  CB  . LYS A 157 ? 0.4646 0.4507 0.4962 -0.1553 -0.2115 0.0210  158  LYS A CB  
1233 C  CG  . LYS A 157 ? 0.7467 0.5055 0.6360 -0.2712 -0.2176 -0.0137 158  LYS A CG  
1234 C  CD  . LYS A 157 ? 0.9654 0.4938 0.7519 -0.3187 -0.1996 0.0550  158  LYS A CD  
1235 C  CE  . LYS A 157 ? 1.0849 0.4693 0.8592 -0.3463 -0.1422 0.0508  158  LYS A CE  
1236 N  NZ  . LYS A 157 ? 1.2031 0.4369 0.9169 -0.3372 0.0511  0.1001  158  LYS A NZ  
1237 N  N   . ASN A 158 ? 0.2145 0.4198 0.2961 -0.0130 -0.0672 0.0196  159  ASN A N   
1238 C  CA  . ASN A 158 ? 0.2898 0.3762 0.2597 -0.0093 -0.0408 0.0597  159  ASN A CA  
1239 C  C   . ASN A 158 ? 0.2259 0.2945 0.2490 0.0160  0.0000  0.0511  159  ASN A C   
1240 O  O   . ASN A 158 ? 0.1905 0.2756 0.2996 0.0082  -0.0002 0.0381  159  ASN A O   
1241 C  CB  . ASN A 158 ? 0.4015 0.4301 0.2996 0.0542  -0.0838 0.0860  159  ASN A CB  
1242 C  CG  . ASN A 158 ? 0.5582 0.4132 0.3047 0.0289  -0.1758 0.1120  159  ASN A CG  
1243 O  OD1 . ASN A 158 ? 0.8948 0.4814 0.3686 -0.0195 -0.1318 -0.0018 159  ASN A OD1 
1244 N  ND2 . ASN A 158 ? 0.6520 0.4097 0.7104 -0.0412 0.0691  0.1254  159  ASN A ND2 
1245 N  N   . GLY A 159 ? 0.1857 0.2413 0.2513 -0.0266 -0.0099 0.0279  160  GLY A N   
1246 C  CA  . GLY A 159 ? 0.1906 0.2224 0.2520 -0.0333 0.0097  0.0556  160  GLY A CA  
1247 C  C   . GLY A 159 ? 0.2148 0.2060 0.2519 -0.0186 -0.0112 0.0260  160  GLY A C   
1248 O  O   . GLY A 159 ? 0.2296 0.2004 0.2734 0.0281  0.0094  0.0668  160  GLY A O   
1249 N  N   . ILE A 160 ? 0.2080 0.2053 0.2173 0.0092  -0.0019 -0.0056 161  ILE A N   
1250 C  CA  . ILE A 160 ? 0.1783 0.1849 0.2061 -0.0044 0.0282  0.0014  161  ILE A CA  
1251 C  C   . ILE A 160 ? 0.1432 0.1842 0.2175 -0.0251 0.0067  -0.0069 161  ILE A C   
1252 O  O   . ILE A 160 ? 0.1351 0.2368 0.2101 -0.0336 -0.0130 0.0021  161  ILE A O   
1253 C  CB  . ILE A 160 ? 0.1803 0.1367 0.2281 -0.0051 0.0142  0.0205  161  ILE A CB  
1254 C  CG1 . ILE A 160 ? 0.1895 0.1662 0.2364 -0.0023 0.0098  -0.0287 161  ILE A CG1 
1255 C  CG2 . ILE A 160 ? 0.1669 0.1591 0.4368 -0.0204 0.0790  0.0430  161  ILE A CG2 
1256 C  CD1 . ILE A 160 ? 0.3121 0.2659 0.2857 0.0009  -0.0518 -0.1038 161  ILE A CD1 
1257 N  N   . LYS A 161 ? 0.1467 0.1674 0.2409 -0.0298 0.0055  -0.0039 162  LYS A N   
1258 C  CA  . LYS A 161 ? 0.1390 0.1937 0.2361 -0.0082 0.0660  0.0209  162  LYS A CA  
1259 C  C   . LYS A 161 ? 0.1662 0.1798 0.2945 -0.0173 0.0215  0.0437  162  LYS A C   
1260 O  O   . LYS A 161 ? 0.1915 0.1993 0.2542 -0.0438 0.0191  0.0541  162  LYS A O   
1261 C  CB  . LYS A 161 ? 0.2843 0.1672 0.2929 0.0006  0.0420  0.0069  162  LYS A CB  
1262 C  CG  . LYS A 161 ? 0.4207 0.2800 0.3031 -0.0336 -0.0386 -0.0182 162  LYS A CG  
1263 C  CD  . LYS A 161 ? 0.5964 0.3684 0.3593 0.0118  -0.0597 -0.0892 162  LYS A CD  
1264 C  CE  . LYS A 161 ? 0.6645 0.4149 0.3796 -0.0145 -0.1022 -0.1277 162  LYS A CE  
1265 N  NZ  . LYS A 161 ? 0.9411 0.5346 0.3602 0.0534  -0.1298 -0.1475 162  LYS A NZ  
1266 N  N   . ALA A 162 ? 0.1067 0.1922 0.3109 -0.0578 -0.0153 0.0519  163  ALA A N   
1267 C  CA  . ALA A 162 ? 0.1193 0.1807 0.3119 -0.0074 -0.0137 0.0295  163  ALA A CA  
1268 C  C   . ALA A 162 ? 0.1173 0.1708 0.3527 -0.0320 -0.0601 0.0147  163  ALA A C   
1269 O  O   . ALA A 162 ? 0.1336 0.2187 0.2602 -0.0585 -0.0451 0.0301  163  ALA A O   
1270 C  CB  . ALA A 162 ? 0.1492 0.1899 0.3295 -0.0480 -0.0102 -0.0007 163  ALA A CB  
1271 N  N   . ASN A 163 ? 0.1254 0.1723 0.3877 -0.0182 -0.0419 0.0339  164  ASN A N   
1272 C  CA  . ASN A 163 ? 0.1848 0.1823 0.3345 0.0038  -0.0242 0.0413  164  ASN A CA  
1273 C  C   . ASN A 163 ? 0.1998 0.1993 0.3471 -0.0405 -0.0396 0.0696  164  ASN A C   
1274 O  O   . ASN A 163 ? 0.1732 0.2145 0.3283 -0.0290 0.0039  0.0359  164  ASN A O   
1275 C  CB  . ASN A 163 ? 0.3559 0.2897 0.3931 0.1205  -0.0628 -0.0388 164  ASN A CB  
1276 C  CG  . ASN A 163 ? 0.4983 0.4729 0.4045 0.0393  -0.0976 -0.0927 164  ASN A CG  
1277 O  OD1 . ASN A 163 ? 0.6153 0.8855 0.4010 0.0472  -0.1498 0.0753  164  ASN A OD1 
1278 N  ND2 . ASN A 163 ? 0.4639 0.6222 0.7532 -0.1133 0.0144  -0.1953 164  ASN A ND2 
1279 N  N   . PHE A 164 ? 0.1744 0.1923 0.3014 -0.0257 -0.0050 0.0284  165  PHE A N   
1280 C  CA  . PHE A 164 ? 0.1633 0.1537 0.2624 0.0045  0.0263  0.0028  165  PHE A CA  
1281 C  C   . PHE A 164 ? 0.1764 0.1308 0.2974 -0.0204 -0.0093 0.0012  165  PHE A C   
1282 O  O   . PHE A 164 ? 0.1659 0.1843 0.2995 -0.0195 -0.0193 0.0301  165  PHE A O   
1283 C  CB  . PHE A 164 ? 0.1831 0.1415 0.3126 -0.0540 0.0368  0.0004  165  PHE A CB  
1284 C  CG  . PHE A 164 ? 0.2220 0.1367 0.3000 -0.0199 0.0394  -0.0316 165  PHE A CG  
1285 C  CD1 . PHE A 164 ? 0.2164 0.2167 0.3098 0.0020  0.0485  -0.0149 165  PHE A CD1 
1286 C  CD2 . PHE A 164 ? 0.2291 0.2222 0.3104 -0.0114 0.0472  -0.0105 165  PHE A CD2 
1287 C  CE1 . PHE A 164 ? 0.2133 0.1153 0.3599 -0.0275 0.0775  0.0055  165  PHE A CE1 
1288 C  CE2 . PHE A 164 ? 0.2283 0.2061 0.3346 -0.0338 0.0721  -0.0055 165  PHE A CE2 
1289 C  CZ  . PHE A 164 ? 0.2028 0.2259 0.3693 -0.0257 0.0914  0.0223  165  PHE A CZ  
1290 N  N   . LYS A 165 ? 0.1409 0.1888 0.2684 -0.0467 0.0171  0.0377  166  LYS A N   
1291 C  CA  . LYS A 165 ? 0.1430 0.2060 0.2838 -0.0461 0.0149  0.0532  166  LYS A CA  
1292 C  C   . LYS A 165 ? 0.1647 0.1528 0.2838 -0.0092 0.0006  0.0639  166  LYS A C   
1293 O  O   . LYS A 165 ? 0.1767 0.2376 0.2956 -0.0265 0.0052  0.0199  166  LYS A O   
1294 C  CB  . LYS A 165 ? 0.3877 0.2116 0.3454 0.0504  0.0589  0.0360  166  LYS A CB  
1295 C  CG  . LYS A 165 ? 0.5939 0.2798 0.3900 0.0345  0.0337  -0.0217 166  LYS A CG  
1296 C  CD  . LYS A 165 ? 0.6663 0.3990 0.4908 0.0177  0.1780  -0.1168 166  LYS A CD  
1297 C  CE  . LYS A 165 ? 0.8025 0.4942 0.5191 -0.0193 0.1752  -0.1723 166  LYS A CE  
1298 N  NZ  . LYS A 165 ? 1.0118 0.6158 0.5536 -0.2200 0.2837  -0.2529 166  LYS A NZ  
1299 N  N   . ILE A 166 ? 0.2244 0.2002 0.2995 -0.0626 0.0457  0.0173  167  ILE A N   
1300 C  CA  . ILE A 166 ? 0.1663 0.2188 0.3094 -0.0249 0.0220  0.0034  167  ILE A CA  
1301 C  C   . ILE A 166 ? 0.1423 0.2113 0.2842 0.0103  0.0118  -0.0405 167  ILE A C   
1302 O  O   . ILE A 166 ? 0.1772 0.2120 0.3036 0.0004  -0.0365 -0.0099 167  ILE A O   
1303 C  CB  . ILE A 166 ? 0.2062 0.2346 0.3017 0.0421  0.0127  0.0313  167  ILE A CB  
1304 C  CG1 . ILE A 166 ? 0.1620 0.2415 0.3620 -0.0221 -0.0735 0.0609  167  ILE A CG1 
1305 C  CG2 . ILE A 166 ? 0.2781 0.1559 0.3035 0.0325  0.0247  0.0056  167  ILE A CG2 
1306 C  CD1 . ILE A 166 ? 0.2026 0.2531 0.2634 -0.0264 -0.0340 0.0027  167  ILE A CD1 
1307 N  N   . ARG A 167 ? 0.1893 0.2665 0.2545 -0.0315 0.0081  -0.0280 168  ARG A N   
1308 C  CA  . ARG A 167 ? 0.1602 0.2837 0.2701 -0.0431 -0.0085 -0.0156 168  ARG A CA  
1309 C  C   . ARG A 167 ? 0.1419 0.2507 0.2637 -0.0164 -0.0226 -0.0129 168  ARG A C   
1310 O  O   . ARG A 167 ? 0.1861 0.3834 0.3122 -0.1056 0.0102  -0.0834 168  ARG A O   
1311 C  CB  . ARG A 167 ? 0.1653 0.4687 0.3130 0.0051  0.0106  0.0005  168  ARG A CB  
1312 C  CG  . ARG A 167 ? 0.2202 0.5345 0.3103 0.0240  0.0450  0.0317  168  ARG A CG  
1313 C  CD  . ARG A 167 ? 0.4631 0.5835 0.4038 -0.1054 0.1074  0.0854  168  ARG A CD  
1314 N  NE  . ARG A 167 ? 0.4498 0.6459 0.4810 -0.0760 0.1456  0.1603  168  ARG A NE  
1315 C  CZ  . ARG A 167 ? 0.3957 0.6187 0.4908 0.0597  0.1670  0.1707  168  ARG A CZ  
1316 N  NH1 . ARG A 167 ? 0.3353 0.7631 0.3963 0.0276  0.0875  0.0902  168  ARG A NH1 
1317 N  NH2 . ARG A 167 ? 0.4590 0.5482 0.7203 0.0649  0.1142  0.1271  168  ARG A NH2 
1318 N  N   . HIS A 168 ? 0.1581 0.1635 0.2525 0.0243  -0.0077 -0.0033 169  HIS A N   
1319 C  CA  . HIS A 168 ? 0.1419 0.1968 0.2462 0.0105  -0.0232 -0.0103 169  HIS A CA  
1320 C  C   . HIS A 168 ? 0.1596 0.1916 0.2205 0.0550  -0.0014 -0.0418 169  HIS A C   
1321 O  O   . HIS A 168 ? 0.2011 0.1788 0.2726 0.0117  -0.0459 -0.0272 169  HIS A O   
1322 C  CB  . HIS A 168 ? 0.1371 0.1409 0.2890 0.0302  -0.0022 -0.0618 169  HIS A CB  
1323 C  CG  . HIS A 168 ? 0.1163 0.1559 0.2494 0.0208  0.0246  -0.0405 169  HIS A CG  
1324 N  ND1 . HIS A 168 ? 0.1597 0.1559 0.2419 0.0388  0.0071  -0.0350 169  HIS A ND1 
1325 C  CD2 . HIS A 168 ? 0.2064 0.1810 0.2615 0.0238  -0.0211 -0.0472 169  HIS A CD2 
1326 C  CE1 . HIS A 168 ? 0.1871 0.1677 0.2340 0.0333  0.0052  -0.0124 169  HIS A CE1 
1327 N  NE2 . HIS A 168 ? 0.1799 0.1888 0.2562 0.0119  -0.0105 -0.0170 169  HIS A NE2 
1328 N  N   . ASN A 169 ? 0.1788 0.1862 0.1931 0.0702  0.0137  -0.0391 170  ASN A N   
1329 C  CA  . ASN A 169 ? 0.2020 0.1781 0.1909 0.0293  0.0186  -0.0089 170  ASN A CA  
1330 C  C   . ASN A 169 ? 0.2007 0.1543 0.2786 0.0306  0.0589  -0.0312 170  ASN A C   
1331 O  O   . ASN A 169 ? 0.1412 0.1543 0.4212 0.0042  0.0499  -0.0703 170  ASN A O   
1332 C  CB  . ASN A 169 ? 0.1907 0.1892 0.2331 0.0293  -0.0180 -0.0055 170  ASN A CB  
1333 C  CG  . ASN A 169 ? 0.2996 0.1648 0.2909 -0.0133 0.0194  -0.0140 170  ASN A CG  
1334 O  OD1 . ASN A 169 ? 0.1970 0.1656 0.2906 -0.0062 -0.0028 0.0045  170  ASN A OD1 
1335 N  ND2 . ASN A 169 ? 0.4831 0.2012 0.3036 -0.0643 0.0023  -0.0410 170  ASN A ND2 
1336 N  N   . ILE A 170 ? 0.1491 0.1643 0.3186 0.0461  0.0229  0.0018  171  ILE A N   
1337 C  CA  . ILE A 170 ? 0.1609 0.1425 0.2831 0.0477  0.0256  -0.0290 171  ILE A CA  
1338 C  C   . ILE A 170 ? 0.1621 0.1602 0.2944 0.0297  0.0120  -0.0205 171  ILE A C   
1339 O  O   . ILE A 170 ? 0.1605 0.1483 0.3291 0.0274  0.0054  -0.0250 171  ILE A O   
1340 C  CB  . ILE A 170 ? 0.1738 0.1948 0.3246 0.0017  0.0708  -0.0857 171  ILE A CB  
1341 C  CG1 . ILE A 170 ? 0.2588 0.2257 0.3510 0.0226  0.0133  -0.1125 171  ILE A CG1 
1342 C  CG2 . ILE A 170 ? 0.2335 0.2167 0.3926 -0.0562 0.1134  -0.1179 171  ILE A CG2 
1343 C  CD1 . ILE A 170 ? 0.3701 0.1964 0.4378 0.0982  -0.1900 -0.1108 171  ILE A CD1 
1344 N  N   . GLU A 171 ? 0.1758 0.1408 0.2918 -0.0068 -0.0005 -0.0048 172  GLU A N   
1345 C  CA  . GLU A 171 ? 0.2073 0.1477 0.2908 0.0261  0.0003  -0.0042 172  GLU A CA  
1346 C  C   . GLU A 171 ? 0.1914 0.1424 0.3160 0.0137  -0.0284 -0.0257 172  GLU A C   
1347 O  O   . GLU A 171 ? 0.2352 0.2178 0.2397 0.0528  0.0177  0.0088  172  GLU A O   
1348 C  CB  . GLU A 171 ? 0.2235 0.2808 0.2959 0.0537  0.0167  0.0160  172  GLU A CB  
1349 C  CG  . GLU A 171 ? 0.2637 0.3204 0.3894 -0.0439 0.0264  0.1015  172  GLU A CG  
1350 C  CD  . GLU A 171 ? 0.2618 0.4771 0.4912 -0.0244 0.0406  0.1815  172  GLU A CD  
1351 O  OE1 . GLU A 171 ? 0.3054 0.5277 0.6949 -0.1284 0.0916  0.2054  172  GLU A OE1 
1352 O  OE2 . GLU A 171 ? 0.3257 0.5329 0.5323 0.0705  0.1239  0.2269  172  GLU A OE2 
1353 N  N   . ASP A 172 ? 0.1921 0.2003 0.2724 0.0507  0.0175  -0.0170 173  ASP A N   
1354 C  CA  . ASP A 172 ? 0.1818 0.1938 0.3712 0.0481  0.0314  -0.0140 173  ASP A CA  
1355 C  C   . ASP A 172 ? 0.1715 0.2075 0.4307 0.0414  0.0237  0.0416  173  ASP A C   
1356 O  O   . ASP A 172 ? 0.1696 0.1906 0.4035 0.0310  0.0441  0.0211  173  ASP A O   
1357 C  CB  . ASP A 172 ? 0.1730 0.1905 0.3592 0.0414  0.0133  0.0190  173  ASP A CB  
1358 C  CG  . ASP A 172 ? 0.1954 0.1749 0.3615 0.0267  0.0103  0.0149  173  ASP A CG  
1359 O  OD1 . ASP A 172 ? 0.2032 0.1899 0.3569 0.0251  0.0340  0.0246  173  ASP A OD1 
1360 O  OD2 . ASP A 172 ? 0.2007 0.1821 0.4028 0.0356  0.0236  -0.0191 173  ASP A OD2 
1361 N  N   . GLY A 173 ? 0.2313 0.1785 0.3535 0.0306  0.0219  -0.0065 174  GLY A N   
1362 C  CA  . GLY A 173 ? 0.1827 0.1691 0.3279 0.0701  -0.0255 0.0591  174  GLY A CA  
1363 C  C   . GLY A 173 ? 0.1766 0.2370 0.3229 0.0717  -0.0265 0.0742  174  GLY A C   
1364 O  O   . GLY A 173 ? 0.2193 0.2026 0.3348 0.0185  -0.0177 0.0593  174  GLY A O   
1365 N  N   . SER A 174 ? 0.1942 0.1692 0.2922 0.0566  0.0319  0.0204  175  SER A N   
1366 C  CA  . SER A 174 ? 0.2396 0.1461 0.3037 0.0350  0.0110  0.0287  175  SER A CA  
1367 C  C   . SER A 174 ? 0.2064 0.1258 0.2602 0.0353  0.0165  -0.0137 175  SER A C   
1368 O  O   . SER A 174 ? 0.1614 0.1405 0.2801 0.0180  0.0245  -0.0348 175  SER A O   
1369 C  CB  . SER A 174 ? 0.2856 0.1428 0.2823 0.0109  0.0360  0.0420  175  SER A CB  
1370 O  OG  . SER A 174 ? 0.3356 0.2653 0.3106 0.0717  -0.0172 -0.0421 175  SER A OG  
1371 N  N   . VAL A 175 ? 0.1948 0.1650 0.2709 0.0630  -0.0110 -0.0320 176  VAL A N   
1372 C  CA  . VAL A 175 ? 0.1957 0.1543 0.2612 0.0350  -0.0292 -0.0365 176  VAL A CA  
1373 C  C   . VAL A 175 ? 0.1984 0.1924 0.2789 0.0605  -0.0371 -0.0698 176  VAL A C   
1374 O  O   . VAL A 175 ? 0.1809 0.2173 0.3605 0.0633  -0.0632 -0.1153 176  VAL A O   
1375 C  CB  . VAL A 175 ? 0.2929 0.2907 0.3865 -0.0624 -0.0013 0.0478  176  VAL A CB  
1376 C  CG1 . VAL A 175 ? 0.3001 0.4332 0.2398 -0.0052 0.0463  0.0255  176  VAL A CG1 
1377 C  CG2 . VAL A 175 ? 0.2060 0.2633 0.4508 -0.0045 -0.0369 0.0757  176  VAL A CG2 
1378 N  N   . GLN A 176 ? 0.1718 0.1790 0.2106 0.0430  0.0165  -0.0172 177  GLN A N   
1379 C  CA  . GLN A 176 ? 0.1635 0.1450 0.2742 0.0203  -0.0005 -0.0189 177  GLN A CA  
1380 C  C   . GLN A 176 ? 0.1136 0.1747 0.2406 0.0214  -0.0122 -0.0239 177  GLN A C   
1381 O  O   . GLN A 176 ? 0.1904 0.1642 0.2313 0.0057  0.0147  -0.0039 177  GLN A O   
1382 C  CB  . GLN A 176 ? 0.1720 0.1655 0.2400 0.0157  0.0003  -0.0105 177  GLN A CB  
1383 C  CG  . GLN A 176 ? 0.1619 0.1671 0.2798 0.0033  -0.0034 -0.0549 177  GLN A CG  
1384 C  CD  . GLN A 176 ? 0.1724 0.1496 0.2772 0.0202  0.0193  -0.0559 177  GLN A CD  
1385 O  OE1 . GLN A 176 ? 0.2143 0.1912 0.2701 -0.0453 -0.0127 -0.0467 177  GLN A OE1 
1386 N  NE2 . GLN A 176 ? 0.2213 0.1684 0.2780 -0.0274 0.0262  -0.0561 177  GLN A NE2 
1387 N  N   . LEU A 177 ? 0.1487 0.2196 0.2744 -0.0057 0.0514  -0.0499 178  LEU A N   
1388 C  CA  . LEU A 177 ? 0.2134 0.2568 0.2334 0.0281  0.0272  -0.0705 178  LEU A CA  
1389 C  C   . LEU A 177 ? 0.1734 0.2102 0.2755 -0.0248 0.0455  -0.0314 178  LEU A C   
1390 O  O   . LEU A 177 ? 0.2145 0.2154 0.2473 -0.0449 0.0611  0.0017  178  LEU A O   
1391 C  CB  . LEU A 177 ? 0.3392 0.4186 0.3074 0.1091  0.1297  -0.0918 178  LEU A CB  
1392 C  CG  . LEU A 177 ? 0.5089 0.3671 0.4502 0.0209  0.3052  -0.0407 178  LEU A CG  
1393 C  CD1 . LEU A 177 ? 0.5950 0.4981 0.5405 0.1592  0.3661  -0.0885 178  LEU A CD1 
1394 C  CD2 . LEU A 177 ? 0.8643 0.3860 0.5643 0.0552  0.3623  0.0338  178  LEU A CD2 
1395 N  N   . ALA A 178 ? 0.1607 0.2172 0.3377 -0.0668 -0.0217 -0.0107 179  ALA A N   
1396 C  CA  . ALA A 178 ? 0.2214 0.2359 0.2859 -0.0686 -0.0678 -0.0066 179  ALA A CA  
1397 C  C   . ALA A 178 ? 0.3101 0.2655 0.2938 -0.0969 -0.0389 -0.0030 179  ALA A C   
1398 O  O   . ALA A 178 ? 0.4324 0.2630 0.2724 -0.1247 -0.0479 -0.0037 179  ALA A O   
1399 C  CB  . ALA A 178 ? 0.2195 0.2233 0.3537 -0.0164 -0.0053 0.0632  179  ALA A CB  
1400 N  N   . ASP A 179 ? 0.1917 0.1625 0.2916 -0.0187 0.0264  -0.0146 180  ASP A N   
1401 C  CA  . ASP A 179 ? 0.1680 0.1656 0.2843 -0.0154 0.0179  -0.0237 180  ASP A CA  
1402 C  C   . ASP A 179 ? 0.1467 0.1445 0.2765 -0.0400 0.0143  -0.0284 180  ASP A C   
1403 O  O   . ASP A 179 ? 0.1513 0.1488 0.3340 -0.0433 0.0258  0.0236  180  ASP A O   
1404 C  CB  . ASP A 179 ? 0.1953 0.2491 0.3090 0.0222  0.0452  -0.0768 180  ASP A CB  
1405 C  CG  . ASP A 179 ? 0.2875 0.4095 0.2900 -0.1077 0.0302  -0.0517 180  ASP A CG  
1406 O  OD1 . ASP A 179 ? 0.3992 0.8607 0.3255 -0.3042 0.1213  -0.0979 180  ASP A OD1 
1407 O  OD2 . ASP A 179 ? 0.4608 0.4616 0.4403 -0.1370 -0.1355 0.0721  180  ASP A OD2 
1408 N  N   . HIS A 180 ? 0.1436 0.1672 0.3256 -0.0465 0.0045  0.0186  181  HIS A N   
1409 C  CA  . HIS A 180 ? 0.1555 0.1814 0.3210 -0.0278 0.0265  0.0302  181  HIS A CA  
1410 C  C   . HIS A 180 ? 0.1476 0.2027 0.3272 -0.0266 0.0406  0.0452  181  HIS A C   
1411 O  O   . HIS A 180 ? 0.1482 0.2588 0.3945 -0.0131 0.0651  0.0785  181  HIS A O   
1412 C  CB  . HIS A 180 ? 0.1265 0.2307 0.3868 0.0230  0.0213  -0.0463 181  HIS A CB  
1413 C  CG  . HIS A 180 ? 0.1644 0.2405 0.3943 -0.0217 0.0446  -0.0602 181  HIS A CG  
1414 N  ND1 . HIS A 180 ? 0.2383 0.2379 0.3754 -0.0162 0.0619  -0.0484 181  HIS A ND1 
1415 C  CD2 . HIS A 180 ? 0.1409 0.1871 0.4080 -0.0837 0.0490  -0.0934 181  HIS A CD2 
1416 C  CE1 . HIS A 180 ? 0.2597 0.2639 0.3577 -0.0145 0.0310  -0.1001 181  HIS A CE1 
1417 N  NE2 . HIS A 180 ? 0.1907 0.2911 0.3741 -0.0267 0.0144  -0.1088 181  HIS A NE2 
1418 N  N   . TYR A 181 ? 0.1549 0.1545 0.3104 0.0042  0.0401  0.0163  182  TYR A N   
1419 C  CA  . TYR A 181 ? 0.1632 0.1592 0.3111 -0.0117 0.0452  0.0216  182  TYR A CA  
1420 C  C   . TYR A 181 ? 0.1885 0.1698 0.2807 0.0035  0.0821  0.0608  182  TYR A C   
1421 O  O   . TYR A 181 ? 0.1754 0.1462 0.3392 0.0122  0.0644  0.0891  182  TYR A O   
1422 C  CB  . TYR A 181 ? 0.1725 0.1794 0.3218 -0.0100 0.0163  0.0133  182  TYR A CB  
1423 C  CG  . TYR A 181 ? 0.3070 0.2828 0.3292 -0.1478 -0.0272 0.0408  182  TYR A CG  
1424 C  CD1 . TYR A 181 ? 0.4294 0.6011 0.3836 -0.3070 -0.0299 0.1367  182  TYR A CD1 
1425 C  CD2 . TYR A 181 ? 0.3162 0.3511 0.3730 -0.1099 -0.0701 0.0801  182  TYR A CD2 
1426 C  CE1 . TYR A 181 ? 0.5140 0.6908 0.4406 -0.2661 -0.0112 0.2288  182  TYR A CE1 
1427 C  CE2 . TYR A 181 ? 0.4089 0.4969 0.3864 -0.0691 -0.0843 0.1215  182  TYR A CE2 
1428 C  CZ  . TYR A 181 ? 0.5312 0.6642 0.4162 -0.1501 -0.0528 0.2304  182  TYR A CZ  
1429 O  OH  . TYR A 181 ? 0.7444 0.8718 0.4033 -0.1308 -0.0222 0.2590  182  TYR A OH  
1430 N  N   . GLN A 182 ? 0.1736 0.1590 0.2214 -0.0210 0.0266  0.0264  183  GLN A N   
1431 C  CA  . GLN A 182 ? 0.2073 0.1581 0.2182 -0.0142 0.0236  0.0218  183  GLN A CA  
1432 C  C   . GLN A 182 ? 0.1404 0.1220 0.2187 -0.0450 0.0243  0.0107  183  GLN A C   
1433 O  O   . GLN A 182 ? 0.1615 0.1515 0.2341 -0.0422 0.0481  -0.0099 183  GLN A O   
1434 C  CB  . GLN A 182 ? 0.2678 0.1868 0.2094 -0.0213 0.0253  0.0068  183  GLN A CB  
1435 C  CG  . GLN A 182 ? 0.3072 0.2208 0.2770 0.0278  -0.0420 -0.0480 183  GLN A CG  
1436 C  CD  . GLN A 182 ? 0.3264 0.1651 0.3601 0.0502  -0.1274 -0.0102 183  GLN A CD  
1437 O  OE1 . GLN A 182 ? 0.4691 0.1645 0.2702 0.0617  -0.1111 -0.0277 183  GLN A OE1 
1438 N  NE2 . GLN A 182 ? 0.4299 0.1657 0.3159 0.0472  -0.1160 -0.0100 183  GLN A NE2 
1439 N  N   . GLN A 183 ? 0.1525 0.1001 0.2683 -0.0312 0.0236  0.0156  184  GLN A N   
1440 C  CA  . GLN A 183 ? 0.1700 0.1484 0.2136 0.0019  0.0137  -0.0173 184  GLN A CA  
1441 C  C   . GLN A 183 ? 0.2023 0.1430 0.1821 0.0215  0.0259  0.0112  184  GLN A C   
1442 O  O   . GLN A 183 ? 0.2240 0.1551 0.2482 -0.0021 0.0654  -0.0236 184  GLN A O   
1443 C  CB  . GLN A 183 ? 0.2945 0.2600 0.2502 -0.0511 0.0065  -0.0886 184  GLN A CB  
1444 C  CG  . GLN A 183 ? 0.6121 0.6541 0.2484 -0.0635 -0.1107 -0.0141 184  GLN A CG  
1445 C  CD  . GLN A 183 ? 0.7410 0.9149 0.4159 0.0217  -0.3731 -0.1492 184  GLN A CD  
1446 O  OE1 . GLN A 183 ? 0.8327 1.3429 0.7877 -0.0390 -0.5752 -0.0211 184  GLN A OE1 
1447 N  NE2 . GLN A 183 ? 0.9793 1.0043 0.6848 0.1096  -0.3497 -0.4474 184  GLN A NE2 
1448 N  N   . ASN A 184 ? 0.1953 0.1543 0.1815 0.0115  -0.0106 0.0233  185  ASN A N   
1449 C  CA  . ASN A 184 ? 0.1911 0.1337 0.2066 -0.0091 0.0000  0.0184  185  ASN A CA  
1450 C  C   . ASN A 184 ? 0.1854 0.1445 0.1931 0.0419  0.0265  0.0026  185  ASN A C   
1451 O  O   . ASN A 184 ? 0.1836 0.1885 0.2133 0.0244  0.0375  0.0193  185  ASN A O   
1452 C  CB  . ASN A 184 ? 0.1663 0.1786 0.2306 -0.0131 0.0082  -0.0054 185  ASN A CB  
1453 C  CG  . ASN A 184 ? 0.1840 0.1890 0.2188 0.0341  0.0023  -0.0340 185  ASN A CG  
1454 O  OD1 . ASN A 184 ? 0.4328 0.1952 0.3261 0.1019  -0.1045 -0.0524 185  ASN A OD1 
1455 N  ND2 . ASN A 184 ? 0.1707 0.2919 0.2411 0.0352  0.0141  -0.0807 185  ASN A ND2 
1456 N  N   . THR A 185 ? 0.1596 0.1928 0.2031 0.0275  0.0085  -0.0057 186  THR A N   
1457 C  CA  . THR A 185 ? 0.1708 0.1935 0.2281 0.0315  0.0181  0.0296  186  THR A CA  
1458 C  C   . THR A 185 ? 0.1973 0.1775 0.2084 0.0120  0.0300  0.0344  186  THR A C   
1459 O  O   . THR A 185 ? 0.2564 0.1928 0.2513 0.0524  0.0777  0.0542  186  THR A O   
1460 C  CB  . THR A 185 ? 0.3425 0.2251 0.3207 0.0301  -0.1382 -0.0221 186  THR A CB  
1461 O  OG1 . THR A 185 ? 0.5250 0.2627 0.5610 0.0568  -0.1124 -0.1238 186  THR A OG1 
1462 C  CG2 . THR A 185 ? 0.3357 0.6827 0.3654 0.1086  -0.1669 0.0607  186  THR A CG2 
1463 N  N   . PRO A 186 ? 0.1732 0.1718 0.2051 -0.0208 -0.0007 0.0229  187  PRO A N   
1464 C  CA  . PRO A 186 ? 0.1760 0.1857 0.2269 0.0210  0.0167  0.0567  187  PRO A CA  
1465 C  C   . PRO A 186 ? 0.1826 0.1877 0.2367 -0.0038 -0.0020 0.0322  187  PRO A C   
1466 O  O   . PRO A 186 ? 0.2387 0.2396 0.2399 -0.0563 0.0042  0.0250  187  PRO A O   
1467 C  CB  . PRO A 186 ? 0.2052 0.1791 0.2608 0.0145  0.0415  0.0544  187  PRO A CB  
1468 C  CG  . PRO A 186 ? 0.2778 0.1891 0.2870 0.0266  0.0930  0.0664  187  PRO A CG  
1469 C  CD  . PRO A 186 ? 0.1717 0.1896 0.2299 0.0353  0.0195  0.0686  187  PRO A CD  
1470 N  N   . ILE A 187 ? 0.1551 0.1748 0.2642 -0.0141 0.0163  0.0346  188  ILE A N   
1471 C  CA  . ILE A 187 ? 0.1507 0.2059 0.2589 -0.0315 0.0045  0.0326  188  ILE A CA  
1472 C  C   . ILE A 187 ? 0.1704 0.2176 0.2856 -0.0078 -0.0163 0.0372  188  ILE A C   
1473 O  O   . ILE A 187 ? 0.2556 0.3200 0.2376 -0.0407 -0.0632 0.0330  188  ILE A O   
1474 C  CB  . ILE A 187 ? 0.1765 0.2024 0.2731 0.0326  0.0143  0.0151  188  ILE A CB  
1475 C  CG1 . ILE A 187 ? 0.2373 0.2196 0.2385 -0.0246 -0.0199 0.0253  188  ILE A CG1 
1476 C  CG2 . ILE A 187 ? 0.1790 0.1999 0.5202 0.0278  0.0754  -0.0086 188  ILE A CG2 
1477 C  CD1 . ILE A 187 ? 0.2776 0.3276 0.2443 0.0288  -0.0070 0.0182  188  ILE A CD1 
1478 N  N   . GLY A 188 ? 0.1625 0.1944 0.3218 0.0071  0.0083  0.0461  189  GLY A N   
1479 C  CA  . GLY A 188 ? 0.2209 0.2378 0.3661 -0.0005 -0.0057 0.0921  189  GLY A CA  
1480 C  C   . GLY A 188 ? 0.2825 0.2951 0.3569 -0.0241 -0.0069 0.1051  189  GLY A C   
1481 O  O   . GLY A 188 ? 0.3222 0.3154 0.2918 -0.0300 -0.0510 0.0464  189  GLY A O   
1482 N  N   . ASP A 189 ? 0.3116 0.3663 0.3908 -0.0176 -0.0316 0.1550  190  ASP A N   
1483 C  CA  . ASP A 189 ? 0.4065 0.5026 0.3848 -0.0866 -0.0498 0.1841  190  ASP A CA  
1484 C  C   . ASP A 189 ? 0.3913 0.5462 0.4329 -0.0702 0.0478  0.1201  190  ASP A C   
1485 O  O   . ASP A 189 ? 0.3532 0.5779 0.4383 0.0753  0.0518  0.1717  190  ASP A O   
1486 C  CB  . ASP A 189 ? 0.4624 0.6958 0.4092 -0.0588 -0.1349 0.1881  190  ASP A CB  
1487 C  CG  . ASP A 189 ? 0.5081 0.7806 0.5370 -0.0736 -0.1684 0.0923  190  ASP A CG  
1488 O  OD1 . ASP A 189 ? 0.9821 0.9197 0.8315 -0.2395 0.0733  -0.1971 190  ASP A OD1 
1489 O  OD2 . ASP A 189 ? 0.7610 0.6035 0.9113 -0.2403 0.0783  0.0523  190  ASP A OD2 
1490 N  N   . GLY A 190 ? 0.2616 0.4244 0.4795 0.0045  0.0420  0.1157  191  GLY A N   
1491 C  CA  . GLY A 190 ? 0.2559 0.3889 0.4872 0.0367  0.0668  0.1697  191  GLY A CA  
1492 C  C   . GLY A 190 ? 0.2668 0.3136 0.4116 0.0043  0.0680  0.1167  191  GLY A C   
1493 O  O   . GLY A 190 ? 0.2368 0.3122 0.2833 -0.0310 0.0028  0.1074  191  GLY A O   
1494 N  N   . PRO A 191 ? 0.2336 0.2640 0.3128 0.0110  0.0070  0.1189  192  PRO A N   
1495 C  CA  . PRO A 191 ? 0.2516 0.2199 0.2171 -0.0003 0.0120  0.0731  192  PRO A CA  
1496 C  C   . PRO A 191 ? 0.2150 0.2252 0.2025 0.0079  0.0295  0.0612  192  PRO A C   
1497 O  O   . PRO A 191 ? 0.2248 0.2413 0.2261 0.0274  0.0154  0.0398  192  PRO A O   
1498 C  CB  . PRO A 191 ? 0.2598 0.2474 0.2231 -0.0097 0.0156  0.0836  192  PRO A CB  
1499 C  CG  . PRO A 191 ? 0.2718 0.2240 0.3276 -0.0071 -0.0054 0.0955  192  PRO A CG  
1500 C  CD  . PRO A 191 ? 0.2636 0.2491 0.3432 0.0343  -0.0135 0.1014  192  PRO A CD  
1501 N  N   . VAL A 192 ? 0.1816 0.2113 0.2022 -0.0188 -0.0050 0.0322  193  VAL A N   
1502 C  CA  . VAL A 192 ? 0.1728 0.1955 0.1957 -0.0082 0.0109  0.0278  193  VAL A CA  
1503 C  C   . VAL A 192 ? 0.1649 0.2346 0.1643 -0.0269 0.0010  0.0010  193  VAL A C   
1504 O  O   . VAL A 192 ? 0.1701 0.2364 0.1583 -0.0155 -0.0100 0.0345  193  VAL A O   
1505 C  CB  . VAL A 192 ? 0.1442 0.1624 0.2197 0.0113  0.0103  0.0113  193  VAL A CB  
1506 C  CG1 . VAL A 192 ? 0.1351 0.2054 0.2773 -0.0090 0.0104  -0.0089 193  VAL A CG1 
1507 C  CG2 . VAL A 192 ? 0.2496 0.2096 0.2419 0.0048  0.0188  -0.0235 193  VAL A CG2 
1508 N  N   . LEU A 193 ? 0.1592 0.2147 0.1315 -0.0295 0.0197  -0.0123 194  LEU A N   
1509 C  CA  . LEU A 193 ? 0.1623 0.2013 0.1579 -0.0151 0.0218  0.0425  194  LEU A CA  
1510 C  C   . LEU A 193 ? 0.1379 0.2029 0.2090 -0.0326 0.0385  0.0342  194  LEU A C   
1511 O  O   . LEU A 193 ? 0.2308 0.1956 0.2334 -0.0447 0.0597  0.0419  194  LEU A O   
1512 C  CB  . LEU A 193 ? 0.1492 0.2161 0.2002 0.0041  0.0130  0.0056  194  LEU A CB  
1513 C  CG  . LEU A 193 ? 0.1277 0.2184 0.1794 0.0279  0.0219  -0.0034 194  LEU A CG  
1514 C  CD1 . LEU A 193 ? 0.1836 0.2439 0.2452 -0.0373 -0.0319 0.0032  194  LEU A CD1 
1515 C  CD2 . LEU A 193 ? 0.2062 0.2801 0.2516 -0.0120 0.0177  0.0763  194  LEU A CD2 
1516 N  N   . LEU A 194 ? 0.1791 0.2146 0.1816 0.0051  0.0075  0.0310  195  LEU A N   
1517 C  CA  . LEU A 194 ? 0.1697 0.2058 0.1968 -0.0089 -0.0020 0.0306  195  LEU A CA  
1518 C  C   . LEU A 194 ? 0.1655 0.2243 0.1901 0.0026  0.0218  0.0260  195  LEU A C   
1519 O  O   . LEU A 194 ? 0.1969 0.2796 0.2903 0.0009  0.0597  0.0942  195  LEU A O   
1520 C  CB  . LEU A 194 ? 0.1767 0.2387 0.1934 0.0156  0.0129  0.0108  195  LEU A CB  
1521 C  CG  . LEU A 194 ? 0.1619 0.3031 0.2115 -0.0179 0.0042  -0.0496 195  LEU A CG  
1522 C  CD1 . LEU A 194 ? 0.2463 0.3835 0.2540 -0.0048 -0.0409 -0.1164 195  LEU A CD1 
1523 C  CD2 . LEU A 194 ? 0.1809 0.2996 0.3101 -0.0951 -0.0473 0.0022  195  LEU A CD2 
1524 N  N   . PRO A 195 ? 0.1566 0.1657 0.2320 -0.0107 0.0036  0.0314  196  PRO A N   
1525 C  CA  . PRO A 195 ? 0.1580 0.1280 0.2101 -0.0210 -0.0021 -0.0106 196  PRO A CA  
1526 C  C   . PRO A 195 ? 0.1725 0.1875 0.1986 0.0077  -0.0165 -0.0303 196  PRO A C   
1527 O  O   . PRO A 195 ? 0.1786 0.1979 0.2005 0.0075  0.0098  -0.0496 196  PRO A O   
1528 C  CB  . PRO A 195 ? 0.1821 0.2070 0.1873 -0.0513 -0.0127 -0.0267 196  PRO A CB  
1529 C  CG  . PRO A 195 ? 0.1816 0.2412 0.1875 -0.0627 -0.0348 0.0364  196  PRO A CG  
1530 C  CD  . PRO A 195 ? 0.1631 0.1721 0.2174 -0.0305 -0.0082 0.0216  196  PRO A CD  
1531 N  N   . ASP A 196 ? 0.1742 0.1790 0.1863 -0.0020 0.0149  0.0011  197  ASP A N   
1532 C  CA  . ASP A 196 ? 0.1585 0.1600 0.1614 -0.0275 -0.0030 -0.0412 197  ASP A CA  
1533 C  C   . ASP A 196 ? 0.1844 0.1919 0.1994 0.0178  0.0082  -0.0064 197  ASP A C   
1534 O  O   . ASP A 196 ? 0.2321 0.1693 0.1922 0.0199  0.0194  0.0117  197  ASP A O   
1535 C  CB  . ASP A 196 ? 0.1530 0.2517 0.2024 -0.0337 0.0062  -0.0342 197  ASP A CB  
1536 C  CG  . ASP A 196 ? 0.1767 0.2562 0.2162 -0.0645 0.0200  -0.0259 197  ASP A CG  
1537 O  OD1 . ASP A 196 ? 0.2216 0.3260 0.3112 -0.1170 0.0115  0.0032  197  ASP A OD1 
1538 O  OD2 . ASP A 196 ? 0.2371 0.3318 0.2301 -0.0944 -0.0202 0.0198  197  ASP A OD2 
1539 N  N   . ASN A 197 ? 0.1383 0.1928 0.2250 0.0066  0.0146  -0.0053 198  ASN A N   
1540 C  CA  . ASN A 197 ? 0.1910 0.1691 0.2184 -0.0052 0.0190  -0.0160 198  ASN A CA  
1541 C  C   . ASN A 197 ? 0.1788 0.1810 0.2142 -0.0201 0.0194  0.0009  198  ASN A C   
1542 O  O   . ASN A 197 ? 0.2006 0.1876 0.2163 -0.0385 0.0464  -0.0187 198  ASN A O   
1543 C  CB  . ASN A 197 ? 0.1684 0.1787 0.2175 -0.0026 0.0305  -0.0005 198  ASN A CB  
1544 C  CG  . ASN A 197 ? 0.2271 0.2014 0.2274 0.0389  0.0099  -0.0470 198  ASN A CG  
1545 O  OD1 . ASN A 197 ? 0.1891 0.2316 0.2780 0.0024  0.0052  -0.0834 198  ASN A OD1 
1546 N  ND2 . ASN A 197 ? 0.3698 0.2665 0.3184 0.1259  -0.0270 -0.1059 198  ASN A ND2 
1547 N  N   . HIS A 198 ? 0.1472 0.1789 0.2184 -0.0177 0.0282  -0.0209 199  HIS A N   
1548 C  CA  . HIS A 198 ? 0.1462 0.1324 0.2184 -0.0053 0.0178  -0.0046 199  HIS A CA  
1549 C  C   . HIS A 198 ? 0.1654 0.1551 0.2252 -0.0358 0.0074  0.0059  199  HIS A C   
1550 O  O   . HIS A 198 ? 0.1648 0.1413 0.2578 -0.0275 0.0031  -0.0021 199  HIS A O   
1551 C  CB  . HIS A 198 ? 0.1448 0.1324 0.2539 -0.0124 0.0194  -0.0033 199  HIS A CB  
1552 C  CG  . HIS A 198 ? 0.1523 0.1279 0.2207 -0.0014 0.0124  0.0103  199  HIS A CG  
1553 N  ND1 . HIS A 198 ? 0.1421 0.1795 0.2233 -0.0267 0.0055  -0.0177 199  HIS A ND1 
1554 C  CD2 . HIS A 198 ? 0.1474 0.1449 0.2256 0.0051  -0.0045 -0.0201 199  HIS A CD2 
1555 C  CE1 . HIS A 198 ? 0.1591 0.1329 0.2158 0.0009  -0.0021 -0.0020 199  HIS A CE1 
1556 N  NE2 . HIS A 198 ? 0.1391 0.1325 0.2034 -0.0091 0.0069  0.0300  199  HIS A NE2 
1557 N  N   . TYR A 199 ? 0.1859 0.1580 0.2194 -0.0398 0.0357  -0.0232 200  TYR A N   
1558 C  CA  . TYR A 199 ? 0.2080 0.1282 0.2225 -0.0219 0.0339  -0.0126 200  TYR A CA  
1559 C  C   . TYR A 199 ? 0.1721 0.1295 0.2259 -0.0432 0.0400  -0.0156 200  TYR A C   
1560 O  O   . TYR A 199 ? 0.1301 0.1252 0.2614 -0.0190 0.0202  -0.0197 200  TYR A O   
1561 C  CB  . TYR A 199 ? 0.2071 0.1398 0.2555 -0.0171 -0.0076 -0.0277 200  TYR A CB  
1562 C  CG  . TYR A 199 ? 0.2126 0.1562 0.2801 -0.0341 -0.0082 -0.0294 200  TYR A CG  
1563 C  CD1 . TYR A 199 ? 0.2365 0.1482 0.2959 0.0119  -0.0456 -0.0563 200  TYR A CD1 
1564 C  CD2 . TYR A 199 ? 0.2102 0.2125 0.3387 -0.0045 0.0112  0.0619  200  TYR A CD2 
1565 C  CE1 . TYR A 199 ? 0.2075 0.1989 0.3130 0.0576  -0.0485 -0.0229 200  TYR A CE1 
1566 C  CE2 . TYR A 199 ? 0.2035 0.1675 0.3595 0.0227  0.0141  0.0390  200  TYR A CE2 
1567 C  CZ  . TYR A 199 ? 0.2484 0.1558 0.3721 0.0068  -0.0122 0.0098  200  TYR A CZ  
1568 O  OH  . TYR A 199 ? 0.2518 0.2681 0.3911 -0.0379 -0.0019 0.0094  200  TYR A OH  
1569 N  N   . LEU A 200 ? 0.1745 0.1427 0.2337 0.0019  0.0505  0.0207  201  LEU A N   
1570 C  CA  . LEU A 200 ? 0.1593 0.1795 0.1917 -0.0283 0.0085  0.0303  201  LEU A CA  
1571 C  C   . LEU A 200 ? 0.1919 0.1728 0.2640 -0.0384 -0.0379 0.0505  201  LEU A C   
1572 O  O   . LEU A 200 ? 0.2186 0.1546 0.2078 -0.0198 -0.0140 0.0088  201  LEU A O   
1573 C  CB  . LEU A 200 ? 0.1640 0.1197 0.2046 -0.0178 0.0164  -0.0212 201  LEU A CB  
1574 C  CG  . LEU A 200 ? 0.1602 0.1273 0.2361 -0.0355 -0.0064 -0.0014 201  LEU A CG  
1575 C  CD1 . LEU A 200 ? 0.1586 0.1668 0.3220 -0.0421 -0.0068 0.0554  201  LEU A CD1 
1576 C  CD2 . LEU A 200 ? 0.1511 0.1546 0.3174 -0.0542 -0.0444 0.0390  201  LEU A CD2 
1577 N  N   . SER A 201 ? 0.1034 0.1518 0.2386 -0.0029 0.0055  0.0366  202  SER A N   
1578 C  CA  . SER A 201 ? 0.1662 0.1375 0.2273 -0.0134 0.0014  0.0342  202  SER A CA  
1579 C  C   . SER A 201 ? 0.2004 0.1424 0.2361 -0.0056 0.0148  0.0323  202  SER A C   
1580 O  O   . SER A 201 ? 0.1603 0.1520 0.2354 -0.0183 -0.0096 0.0073  202  SER A O   
1581 C  CB  . SER A 201 ? 0.1466 0.2506 0.2571 -0.0084 -0.0381 0.0041  202  SER A CB  
1582 O  OG  . SER A 201 ? 0.1721 0.2894 0.2786 -0.0111 -0.0131 0.0799  202  SER A OG  
1583 N  N   . THR A 202 ? 0.1862 0.1498 0.2382 0.0182  0.0186  0.0493  203  THR A N   
1584 C  CA  . THR A 202 ? 0.1894 0.1952 0.2269 -0.0036 0.0147  0.0277  203  THR A CA  
1585 C  C   . THR A 202 ? 0.2644 0.1661 0.2279 0.0334  0.0235  0.0251  203  THR A C   
1586 O  O   . THR A 202 ? 0.3526 0.1868 0.2299 0.0798  0.0416  0.0253  203  THR A O   
1587 C  CB  . THR A 202 ? 0.2268 0.2320 0.3135 -0.0722 0.0175  0.1147  203  THR A CB  
1588 O  OG1 . THR A 202 ? 0.3721 0.2229 0.4855 -0.0806 0.0873  0.0649  203  THR A OG1 
1589 C  CG2 . THR A 202 ? 0.1939 0.2737 0.2350 -0.0777 0.0316  -0.0443 203  THR A CG2 
1590 N  N   . GLN A 203 ? 0.1886 0.1584 0.2328 0.0271  0.0064  0.0189  204  GLN A N   
1591 C  CA  . GLN A 203 ? 0.1717 0.1600 0.2293 0.0520  0.0130  0.0075  204  GLN A CA  
1592 C  C   . GLN A 203 ? 0.2111 0.1113 0.2816 0.0320  0.0649  0.0192  204  GLN A C   
1593 O  O   . GLN A 203 ? 0.1992 0.1529 0.2767 0.0648  0.0701  0.0640  204  GLN A O   
1594 C  CB  . GLN A 203 ? 0.1787 0.2991 0.3013 0.0351  -0.0219 -0.0405 204  GLN A CB  
1595 C  CG  . GLN A 203 ? 0.2101 0.3591 0.4258 -0.0532 0.0801  -0.0741 204  GLN A CG  
1596 C  CD  . GLN A 203 ? 0.3743 0.4063 0.5896 -0.0387 0.1966  0.0393  204  GLN A CD  
1597 O  OE1 . GLN A 203 ? 0.5294 0.5053 0.5090 -0.0392 0.2200  0.0654  204  GLN A OE1 
1598 N  NE2 . GLN A 203 ? 0.4627 0.4292 0.6408 0.0163  -0.0633 0.0569  204  GLN A NE2 
1599 N  N   . SER A 204 ? 0.2305 0.1252 0.2936 0.0454  0.0570  0.0443  205  SER A N   
1600 C  CA  . SER A 204 ? 0.2261 0.1305 0.2744 0.0167  0.0570  0.0299  205  SER A CA  
1601 C  C   . SER A 204 ? 0.2029 0.2228 0.2677 0.0908  0.0419  0.0250  205  SER A C   
1602 O  O   . SER A 204 ? 0.2732 0.1904 0.2756 0.0964  0.0821  0.0309  205  SER A O   
1603 C  CB  . SER A 204 ? 0.2587 0.2533 0.3046 -0.0233 0.0068  0.0346  205  SER A CB  
1604 O  OG  . SER A 204 ? 0.3145 0.2791 0.2797 0.0131  0.0381  -0.0089 205  SER A OG  
1605 N  N   . ALA A 205 ? 0.1462 0.1586 0.2638 0.0661  0.0200  0.0375  206  ALA A N   
1606 C  CA  . ALA A 205 ? 0.1364 0.1431 0.2527 0.0186  0.0050  0.0121  206  ALA A CA  
1607 C  C   . ALA A 205 ? 0.1266 0.1447 0.2354 0.0087  -0.0133 0.0255  206  ALA A C   
1608 O  O   . ALA A 205 ? 0.1435 0.1449 0.2138 0.0213  0.0215  0.0281  206  ALA A O   
1609 C  CB  . ALA A 205 ? 0.1475 0.2443 0.3225 -0.0413 0.0116  -0.0295 206  ALA A CB  
1610 N  N   . LEU A 206 ? 0.1374 0.1334 0.2018 0.0185  -0.0086 0.0110  207  LEU A N   
1611 C  CA  . LEU A 206 ? 0.1530 0.1418 0.1680 -0.0005 -0.0067 -0.0007 207  LEU A CA  
1612 C  C   . LEU A 206 ? 0.1538 0.1976 0.1674 0.0065  -0.0281 -0.0084 207  LEU A C   
1613 O  O   . LEU A 206 ? 0.1619 0.2533 0.2004 0.0211  -0.0351 0.0107  207  LEU A O   
1614 C  CB  . LEU A 206 ? 0.1458 0.1335 0.2010 0.0094  0.0399  -0.0291 207  LEU A CB  
1615 C  CG  . LEU A 206 ? 0.1934 0.1578 0.1976 0.0041  0.0005  -0.0296 207  LEU A CG  
1616 C  CD1 . LEU A 206 ? 0.2639 0.1531 0.2323 -0.0054 -0.0390 -0.0280 207  LEU A CD1 
1617 C  CD2 . LEU A 206 ? 0.2392 0.2414 0.2608 -0.1052 -0.0883 0.0567  207  LEU A CD2 
1618 N  N   . SER A 207 ? 0.1561 0.1503 0.1452 -0.0098 -0.0221 0.0143  208  SER A N   
1619 C  CA  . SER A 207 ? 0.1461 0.1477 0.1444 0.0215  -0.0416 0.0136  208  SER A CA  
1620 C  C   . SER A 207 ? 0.1643 0.1506 0.1710 0.0135  -0.0069 -0.0007 208  SER A C   
1621 O  O   . SER A 207 ? 0.1340 0.1646 0.1693 0.0208  0.0117  -0.0265 208  SER A O   
1622 C  CB  . SER A 207 ? 0.1708 0.1619 0.1759 0.0029  -0.0387 -0.0028 208  SER A CB  
1623 O  OG  . SER A 207 ? 0.1925 0.1499 0.1667 -0.0013 -0.0443 -0.0098 208  SER A OG  
1624 N  N   . LYS A 208 ? 0.1843 0.1903 0.1706 -0.0005 -0.0056 0.0053  209  LYS A N   
1625 C  CA  . LYS A 208 ? 0.1968 0.1988 0.1881 0.0084  0.0136  -0.0254 209  LYS A CA  
1626 C  C   . LYS A 208 ? 0.2030 0.2167 0.2202 0.0184  -0.0314 -0.0493 209  LYS A C   
1627 O  O   . LYS A 208 ? 0.2120 0.3524 0.2848 -0.0136 -0.0068 -0.1444 209  LYS A O   
1628 C  CB  . LYS A 208 ? 0.1837 0.2172 0.1994 0.0225  0.0498  -0.0197 209  LYS A CB  
1629 C  CG  . LYS A 208 ? 0.1841 0.1966 0.2193 0.0325  0.0021  -0.0063 209  LYS A CG  
1630 C  CD  . LYS A 208 ? 0.1762 0.2239 0.2423 0.0100  0.0035  -0.0033 209  LYS A CD  
1631 C  CE  . LYS A 208 ? 0.1504 0.2643 0.2216 0.0373  0.0124  -0.0509 209  LYS A CE  
1632 N  NZ  . LYS A 208 ? 0.1403 0.1793 0.2205 0.0387  -0.0020 0.0275  209  LYS A NZ  
1633 N  N   . ASP A 209 ? 0.1965 0.1945 0.2303 -0.0057 0.0423  -0.0360 210  ASP A N   
1634 C  CA  . ASP A 209 ? 0.2263 0.2043 0.2509 -0.0013 -0.0028 -0.0652 210  ASP A CA  
1635 C  C   . ASP A 209 ? 0.2292 0.2751 0.2277 0.0075  0.0103  -0.0819 210  ASP A C   
1636 O  O   . ASP A 209 ? 0.1988 0.3126 0.2356 0.0174  0.0226  -0.0393 210  ASP A O   
1637 C  CB  . ASP A 209 ? 0.2236 0.2072 0.2982 0.0137  0.0153  -0.0564 210  ASP A CB  
1638 C  CG  . ASP A 209 ? 0.2756 0.2179 0.3484 0.0256  0.0342  -0.0737 210  ASP A CG  
1639 O  OD1 . ASP A 209 ? 0.2784 0.3036 0.3563 -0.0578 0.0485  -0.1420 210  ASP A OD1 
1640 O  OD2 . ASP A 209 ? 0.2523 0.1960 0.5266 0.0239  0.0038  -0.0735 210  ASP A OD2 
1641 N  N   . PRO A 210 ? 0.2705 0.3964 0.2559 -0.0038 -0.0356 -0.0704 211  PRO A N   
1642 C  CA  . PRO A 210 ? 0.2947 0.4090 0.2588 0.0460  -0.0391 -0.0567 211  PRO A CA  
1643 C  C   . PRO A 210 ? 0.3361 0.3886 0.2821 0.0375  0.0130  -0.0520 211  PRO A C   
1644 O  O   . PRO A 210 ? 0.4435 0.4387 0.2738 -0.0084 0.0360  -0.0573 211  PRO A O   
1645 C  CB  . PRO A 210 ? 0.3542 0.4714 0.2945 0.0399  -0.0941 -0.0489 211  PRO A CB  
1646 C  CG  . PRO A 210 ? 0.4964 0.4716 0.2797 -0.0518 -0.1060 -0.0890 211  PRO A CG  
1647 C  CD  . PRO A 210 ? 0.3937 0.4359 0.2812 -0.0762 -0.1160 -0.0706 211  PRO A CD  
1648 N  N   . ASN A 211 ? 0.2874 0.3971 0.3244 0.0361  -0.0251 -0.0848 212  ASN A N   
1649 C  CA  . ASN A 211 ? 0.3215 0.4321 0.2960 0.0339  -0.0111 -0.1503 212  ASN A CA  
1650 C  C   . ASN A 211 ? 0.2902 0.4303 0.2986 0.0091  0.0304  -0.1379 212  ASN A C   
1651 O  O   . ASN A 211 ? 0.2870 0.6832 0.3370 0.0735  0.0132  -0.2027 212  ASN A O   
1652 C  CB  . ASN A 211 ? 0.3481 0.4333 0.3628 0.0201  0.0110  -0.1734 212  ASN A CB  
1653 C  CG  . ASN A 211 ? 0.4386 0.4839 0.4240 -0.0307 -0.0308 -0.1938 212  ASN A CG  
1654 O  OD1 . ASN A 211 ? 0.3797 0.6565 0.3926 -0.0208 -0.0243 -0.1727 212  ASN A OD1 
1655 N  ND2 . ASN A 211 ? 0.5287 0.6421 0.5480 -0.2025 0.0189  -0.1627 212  ASN A ND2 
1656 N  N   . GLU A 212 ? 0.2619 0.2382 0.2512 0.0166  0.0032  -0.0500 213  GLU A N   
1657 C  CA  . GLU A 212 ? 0.1819 0.2073 0.2091 0.0196  0.0406  0.0075  213  GLU A CA  
1658 C  C   . GLU A 212 ? 0.1683 0.2174 0.1863 0.0243  0.0070  0.0471  213  GLU A C   
1659 O  O   . GLU A 212 ? 0.1702 0.2092 0.3168 0.0197  0.0128  0.0093  213  GLU A O   
1660 C  CB  . GLU A 212 ? 0.1942 0.1679 0.2168 0.0132  0.0466  0.0163  213  GLU A CB  
1661 C  CG  . GLU A 212 ? 0.2025 0.2225 0.2026 0.0242  0.0174  0.0676  213  GLU A CG  
1662 C  CD  . GLU A 212 ? 0.2127 0.2337 0.2541 0.0327  0.0266  0.0812  213  GLU A CD  
1663 O  OE1 . GLU A 212 ? 0.1621 0.2091 0.3048 0.0195  0.0604  0.0375  213  GLU A OE1 
1664 O  OE2 . GLU A 212 ? 0.2014 0.1583 0.2337 0.0333  0.0123  0.0279  213  GLU A OE2 
1665 N  N   . LYS A 213 ? 0.1889 0.1910 0.2114 0.0261  0.0591  -0.0011 214  LYS A N   
1666 C  CA  . LYS A 213 ? 0.1502 0.1838 0.2412 0.0487  0.0336  0.0288  214  LYS A CA  
1667 C  C   . LYS A 213 ? 0.1796 0.1570 0.2469 0.0273  0.0335  0.0327  214  LYS A C   
1668 O  O   . LYS A 213 ? 0.3346 0.1581 0.2573 0.0296  0.0417  0.0307  214  LYS A O   
1669 C  CB  . LYS A 213 ? 0.2062 0.2216 0.2539 0.0205  0.0628  0.0366  214  LYS A CB  
1670 C  CG  . LYS A 213 ? 0.3242 0.4046 0.2136 -0.0067 0.0395  0.0909  214  LYS A CG  
1671 C  CD  . LYS A 213 ? 0.5094 0.6438 0.2577 0.1237  0.0958  -0.0177 214  LYS A CD  
1672 C  CE  . LYS A 213 ? 0.6158 0.7820 0.2357 0.2069  0.0799  0.0614  214  LYS A CE  
1673 N  NZ  . LYS A 213 ? 0.7675 0.9553 0.4401 0.1435  0.0070  0.2727  214  LYS A NZ  
1674 N  N   . ARG A 214 ? 0.2249 0.1660 0.2239 0.0258  0.0385  0.0266  215  ARG A N   
1675 C  CA  . ARG A 214 ? 0.1569 0.1289 0.2569 0.0397  0.0173  0.0240  215  ARG A CA  
1676 C  C   . ARG A 214 ? 0.1479 0.1264 0.2604 0.0233  0.0133  0.0042  215  ARG A C   
1677 O  O   . ARG A 214 ? 0.1554 0.1648 0.2138 -0.0043 0.0265  0.0088  215  ARG A O   
1678 C  CB  . ARG A 214 ? 0.1459 0.0881 0.2472 0.0010  0.0445  0.0455  215  ARG A CB  
1679 C  CG  . ARG A 214 ? 0.1640 0.1491 0.2428 0.0483  0.0256  0.0397  215  ARG A CG  
1680 C  CD  . ARG A 214 ? 0.1965 0.1267 0.2347 0.0520  0.0218  0.0171  215  ARG A CD  
1681 N  NE  . ARG A 214 ? 0.1902 0.1289 0.2485 0.0569  0.0290  -0.0023 215  ARG A NE  
1682 C  CZ  . ARG A 214 ? 0.1872 0.1329 0.2030 0.0294  0.0310  -0.0060 215  ARG A CZ  
1683 N  NH1 . ARG A 214 ? 0.1989 0.1620 0.2416 0.0533  0.0224  0.0202  215  ARG A NH1 
1684 N  NH2 . ARG A 214 ? 0.1829 0.1772 0.2899 -0.0156 0.0786  -0.0087 215  ARG A NH2 
1685 N  N   . ASP A 215 ? 0.1399 0.1476 0.2111 0.0048  0.0223  0.0213  216  ASP A N   
1686 C  CA  . ASP A 215 ? 0.1046 0.1094 0.2247 0.0090  0.0060  0.0274  216  ASP A CA  
1687 C  C   . ASP A 215 ? 0.1194 0.1394 0.1713 -0.0093 -0.0090 0.0164  216  ASP A C   
1688 O  O   . ASP A 215 ? 0.1230 0.1231 0.2120 0.0061  -0.0021 0.0257  216  ASP A O   
1689 C  CB  . ASP A 215 ? 0.1256 0.1191 0.2466 0.0109  -0.0082 0.0140  216  ASP A CB  
1690 C  CG  . ASP A 215 ? 0.1621 0.1832 0.2584 0.0239  0.0246  -0.0387 216  ASP A CG  
1691 O  OD1 . ASP A 215 ? 0.1549 0.1802 0.1812 0.0287  0.0466  0.0222  216  ASP A OD1 
1692 O  OD2 . ASP A 215 ? 0.1999 0.1981 0.3514 0.0342  0.0127  -0.0815 216  ASP A OD2 
1693 N  N   . HIS A 216 ? 0.1144 0.1038 0.2425 0.0079  0.0105  0.0311  217  HIS A N   
1694 C  CA  . HIS A 216 ? 0.1149 0.1034 0.1960 0.0096  0.0161  0.0104  217  HIS A CA  
1695 C  C   . HIS A 216 ? 0.1286 0.1356 0.1887 0.0408  0.0305  0.0515  217  HIS A C   
1696 O  O   . HIS A 216 ? 0.1416 0.0964 0.1791 0.0263  -0.0121 0.0115  217  HIS A O   
1697 C  CB  . HIS A 216 ? 0.1304 0.1066 0.1930 0.0010  0.0262  0.0092  217  HIS A CB  
1698 C  CG  . HIS A 216 ? 0.1588 0.1045 0.1905 0.0333  0.0139  0.0003  217  HIS A CG  
1699 N  ND1 . HIS A 216 ? 0.2096 0.1365 0.1932 0.0171  0.0125  0.0103  217  HIS A ND1 
1700 C  CD2 . HIS A 216 ? 0.1843 0.1578 0.1711 0.0044  -0.0208 0.0174  217  HIS A CD2 
1701 C  CE1 . HIS A 216 ? 0.1992 0.1502 0.1714 0.0312  0.0288  0.0076  217  HIS A CE1 
1702 N  NE2 . HIS A 216 ? 0.1609 0.1850 0.1611 0.0400  0.0148  0.0294  217  HIS A NE2 
1703 N  N   . MET A 217 ? 0.1256 0.1270 0.1628 0.0110  0.0083  0.0323  218  MET A N   
1704 C  CA  . MET A 217 ? 0.1203 0.1209 0.1752 -0.0063 0.0042  0.0072  218  MET A CA  
1705 C  C   . MET A 217 ? 0.1060 0.1026 0.1808 0.0235  0.0153  -0.0033 218  MET A C   
1706 O  O   . MET A 217 ? 0.1054 0.1238 0.2140 0.0310  0.0093  0.0115  218  MET A O   
1707 C  CB  . MET A 217 ? 0.1168 0.1125 0.2093 0.0085  0.0035  -0.0171 218  MET A CB  
1708 C  CG  . MET A 217 ? 0.1448 0.1407 0.2194 0.0134  0.0322  -0.0069 218  MET A CG  
1709 S  SD  . MET A 217 ? 0.1286 0.1480 0.2096 0.0115  0.0115  -0.0068 218  MET A SD  
1710 C  CE  . MET A 217 ? 0.1237 0.1430 0.2511 0.0323  -0.0185 -0.0328 218  MET A CE  
1711 N  N   . VAL A 218 ? 0.1156 0.1067 0.1944 0.0011  0.0031  0.0235  219  VAL A N   
1712 C  CA  . VAL A 218 ? 0.1362 0.1093 0.1565 0.0009  -0.0201 0.0489  219  VAL A CA  
1713 C  C   . VAL A 218 ? 0.1065 0.1176 0.2040 -0.0093 -0.0157 0.0433  219  VAL A C   
1714 O  O   . VAL A 218 ? 0.1496 0.1507 0.2074 0.0282  -0.0280 0.0395  219  VAL A O   
1715 C  CB  . VAL A 218 ? 0.1305 0.1542 0.1811 -0.0249 -0.0368 0.0369  219  VAL A CB  
1716 C  CG1 . VAL A 218 ? 0.1646 0.1090 0.2792 0.0031  0.0299  -0.0260 219  VAL A CG1 
1717 C  CG2 . VAL A 218 ? 0.2477 0.1959 0.1907 -0.0183 0.0434  0.0208  219  VAL A CG2 
1718 N  N   . LEU A 219 ? 0.1034 0.1127 0.2083 0.0080  0.0155  0.0387  220  LEU A N   
1719 C  CA  . LEU A 219 ? 0.1069 0.1111 0.2306 0.0240  0.0278  0.0365  220  LEU A CA  
1720 C  C   . LEU A 219 ? 0.1276 0.1147 0.2294 0.0127  0.0642  0.0091  220  LEU A C   
1721 O  O   . LEU A 219 ? 0.1243 0.1121 0.2425 -0.0020 0.0443  0.0277  220  LEU A O   
1722 C  CB  . LEU A 219 ? 0.1870 0.1150 0.2488 0.0388  0.0246  -0.0352 220  LEU A CB  
1723 C  CG  . LEU A 219 ? 0.1766 0.2195 0.2643 0.0514  0.0249  -0.0551 220  LEU A CG  
1724 C  CD1 . LEU A 219 ? 0.2197 0.2967 0.3008 0.1179  0.0567  -0.0301 220  LEU A CD1 
1725 C  CD2 . LEU A 219 ? 0.2828 0.4528 0.2904 0.1577  -0.0419 -0.1533 220  LEU A CD2 
1726 N  N   . LEU A 220 ? 0.1265 0.1097 0.2266 0.0017  0.0425  -0.0146 221  LEU A N   
1727 C  CA  . LEU A 220 ? 0.1226 0.1528 0.2162 -0.0167 0.0073  0.0157  221  LEU A CA  
1728 C  C   . LEU A 220 ? 0.1226 0.1398 0.2280 0.0002  0.0269  0.0388  221  LEU A C   
1729 O  O   . LEU A 220 ? 0.1724 0.1305 0.2427 0.0012  0.0460  0.0537  221  LEU A O   
1730 C  CB  . LEU A 220 ? 0.1358 0.1673 0.2526 -0.0062 -0.0245 0.0184  221  LEU A CB  
1731 C  CG  . LEU A 220 ? 0.1841 0.1598 0.2567 -0.0451 -0.0596 0.0384  221  LEU A CG  
1732 C  CD1 . LEU A 220 ? 0.1811 0.1508 0.3922 -0.0102 -0.0333 0.0198  221  LEU A CD1 
1733 C  CD2 . LEU A 220 ? 0.1798 0.3234 0.2805 -0.0597 -0.0716 0.0285  221  LEU A CD2 
1734 N  N   . GLU A 221 ? 0.1122 0.1470 0.2336 0.0179  0.0271  0.0459  222  GLU A N   
1735 C  CA  . GLU A 221 ? 0.1212 0.1493 0.2133 0.0394  -0.0031 0.0446  222  GLU A CA  
1736 C  C   . GLU A 221 ? 0.1434 0.1442 0.1911 0.0412  0.0181  0.0335  222  GLU A C   
1737 O  O   . GLU A 221 ? 0.1577 0.1417 0.2505 0.0353  0.0476  0.0223  222  GLU A O   
1738 C  CB  . GLU A 221 ? 0.2091 0.2097 0.2553 -0.0187 -0.0514 0.0507  222  GLU A CB  
1739 C  CG  . GLU A 221 ? 0.3329 0.3069 0.2639 0.0188  -0.0966 -0.0125 222  GLU A CG  
1740 C  CD  . GLU A 221 ? 0.5109 0.3278 0.4031 -0.0653 -0.1900 -0.0323 222  GLU A CD  
1741 O  OE1 . GLU A 221 ? 0.4616 0.3235 0.6330 -0.0329 -0.1355 0.0050  222  GLU A OE1 
1742 O  OE2 . GLU A 221 ? 0.3269 0.3140 0.6730 -0.0504 -0.2170 -0.0204 222  GLU A OE2 
1743 N  N   . PHE A 222 ? 0.1239 0.1152 0.2273 0.0272  0.0042  0.0178  223  PHE A N   
1744 C  CA  . PHE A 222 ? 0.1228 0.1483 0.2333 0.0229  0.0243  0.0067  223  PHE A CA  
1745 C  C   . PHE A 222 ? 0.1857 0.1431 0.2278 0.0413  0.0199  0.0133  223  PHE A C   
1746 O  O   . PHE A 222 ? 0.2324 0.1512 0.2228 0.0725  0.0558  0.0226  223  PHE A O   
1747 C  CB  . PHE A 222 ? 0.0907 0.1748 0.2397 0.0535  0.0463  0.0002  223  PHE A CB  
1748 C  CG  . PHE A 222 ? 0.1108 0.1552 0.2659 0.0172  0.0210  -0.0090 223  PHE A CG  
1749 C  CD1 . PHE A 222 ? 0.1814 0.1944 0.2500 0.0017  -0.0549 -0.0202 223  PHE A CD1 
1750 C  CD2 . PHE A 222 ? 0.1906 0.1473 0.3533 -0.0270 -0.0319 -0.0159 223  PHE A CD2 
1751 C  CE1 . PHE A 222 ? 0.2084 0.1999 0.2720 -0.0039 -0.0461 -0.0374 223  PHE A CE1 
1752 C  CE2 . PHE A 222 ? 0.1389 0.1566 0.3751 0.0048  -0.0609 -0.0382 223  PHE A CE2 
1753 C  CZ  . PHE A 222 ? 0.1475 0.1932 0.3582 -0.0183 -0.0694 -0.0466 223  PHE A CZ  
1754 N  N   . VAL A 223 ? 0.2034 0.1123 0.2305 0.0113  0.0607  0.0209  224  VAL A N   
1755 C  CA  . VAL A 223 ? 0.1938 0.1375 0.2225 0.0439  0.0632  0.0296  224  VAL A CA  
1756 C  C   . VAL A 223 ? 0.1891 0.1637 0.2174 0.0224  0.0325  0.0459  224  VAL A C   
1757 O  O   . VAL A 223 ? 0.2158 0.1476 0.2174 0.0082  0.0205  0.0322  224  VAL A O   
1758 C  CB  . VAL A 223 ? 0.2056 0.2005 0.2245 -0.0005 0.0652  0.0114  224  VAL A CB  
1759 C  CG1 . VAL A 223 ? 0.2799 0.1979 0.2757 -0.0032 0.0523  -0.0442 224  VAL A CG1 
1760 C  CG2 . VAL A 223 ? 0.2562 0.2933 0.3091 -0.0550 0.0367  0.0945  224  VAL A CG2 
1761 N  N   . THR A 224 ? 0.1769 0.1521 0.2270 -0.0072 0.0377  0.0342  225  THR A N   
1762 C  CA  . THR A 224 ? 0.1580 0.1310 0.1921 -0.0048 0.0007  0.0375  225  THR A CA  
1763 C  C   . THR A 224 ? 0.1484 0.1363 0.2014 -0.0317 0.0030  0.0227  225  THR A C   
1764 O  O   . THR A 224 ? 0.1563 0.1602 0.2020 0.0106  -0.0158 0.0154  225  THR A O   
1765 C  CB  . THR A 224 ? 0.1725 0.1712 0.2133 -0.0146 -0.0114 0.0004  225  THR A CB  
1766 O  OG1 . THR A 224 ? 0.2828 0.2416 0.2109 0.0004  -0.0354 -0.0190 225  THR A OG1 
1767 C  CG2 . THR A 224 ? 0.1399 0.2057 0.2974 -0.0093 -0.0237 0.0507  225  THR A CG2 
1768 N  N   . ALA A 225 ? 0.1306 0.1462 0.1879 -0.0141 -0.0188 0.0069  226  ALA A N   
1769 C  CA  . ALA A 225 ? 0.1117 0.0887 0.1949 -0.0324 -0.0236 -0.0004 226  ALA A CA  
1770 C  C   . ALA A 225 ? 0.1194 0.1228 0.2186 -0.0336 -0.0093 -0.0053 226  ALA A C   
1771 O  O   . ALA A 225 ? 0.1062 0.1425 0.2153 -0.0377 -0.0049 -0.0064 226  ALA A O   
1772 C  CB  . ALA A 225 ? 0.1510 0.1468 0.1925 -0.0030 -0.0112 0.0271  226  ALA A CB  
1773 N  N   . ALA A 226 ? 0.1260 0.1427 0.1767 -0.0480 0.0184  0.0044  227  ALA A N   
1774 C  CA  . ALA A 226 ? 0.1310 0.1592 0.2223 -0.0347 0.0293  0.0147  227  ALA A CA  
1775 C  C   . ALA A 226 ? 0.1367 0.1757 0.2355 0.0285  0.0052  0.0004  227  ALA A C   
1776 O  O   . ALA A 226 ? 0.1516 0.1903 0.2177 -0.0022 0.0104  0.0051  227  ALA A O   
1777 C  CB  . ALA A 226 ? 0.1806 0.2685 0.2290 0.0424  0.0102  -0.0004 227  ALA A CB  
1778 N  N   . GLY A 227 ? 0.1434 0.2341 0.2685 0.0164  0.0261  -0.0156 228  GLY A N   
1779 C  CA  . GLY A 227 ? 0.1388 0.2664 0.2919 0.0028  0.0436  -0.0406 228  GLY A CA  
1780 C  C   . GLY A 227 ? 0.1996 0.2614 0.2787 -0.0274 0.0525  -0.0616 228  GLY A C   
1781 O  O   . GLY A 227 ? 0.3734 0.2878 0.3328 -0.0184 0.1819  -0.0781 228  GLY A O   
1782 N  N   . ILE A 228 ? 0.2263 0.2640 0.2514 0.0010  0.0175  -0.0523 229  ILE A N   
1783 C  CA  . ILE A 228 ? 0.2792 0.2842 0.2616 -0.0341 -0.0093 -0.0367 229  ILE A CA  
1784 C  C   . ILE A 228 ? 0.3208 0.3073 0.3360 -0.0693 -0.0117 -0.0282 229  ILE A C   
1785 O  O   . ILE A 228 ? 0.2689 0.2474 0.3427 -0.0338 -0.0568 -0.0361 229  ILE A O   
1786 C  CB  . ILE A 228 ? 0.2797 0.2589 0.3205 -0.0323 0.0170  0.0233  229  ILE A CB  
1787 C  CG1 . ILE A 228 ? 0.2030 0.3411 0.2979 -0.0530 0.0313  0.0244  229  ILE A CG1 
1788 C  CG2 . ILE A 228 ? 0.3541 0.3729 0.3928 -0.1184 -0.0628 0.1262  229  ILE A CG2 
1789 C  CD1 . ILE A 228 ? 0.2717 0.3592 0.2589 -0.0255 0.0180  0.0979  229  ILE A CD1 
1790 O  OXT . ILE A 228 ? 0.2532 0.4138 0.3841 -0.0738 -0.0190 -0.0071 229  ILE A OXT 
1791 MG MG  . MG  B .   ? 0.1796 0.2387 0.3033 0.0255  -0.0156 -0.0514 301  MG  A MG  
1792 C  C1  . EDO C .   ? 0.2866 0.3428 0.2579 -0.0697 -0.0447 -0.0879 303  EDO A C1  
1793 O  O1  . EDO C .   ? 0.2181 0.2063 0.3040 0.0408  -0.0353 -0.0575 303  EDO A O1  
1794 C  C2  . EDO C .   ? 0.2877 0.2247 0.3011 0.0126  -0.1127 -0.0650 303  EDO A C2  
1795 O  O2  . EDO C .   ? 0.2106 0.1902 0.2719 0.0299  -0.0409 -0.0589 303  EDO A O2  
1796 O  O   . HOH D .   ? 0.2109 0.2856 0.3636 -0.0352 -0.0346 0.0742  1001 HOH A O   
1797 O  O   . HOH D .   ? 0.2994 0.3190 0.4462 0.0298  0.0448  -0.0103 1002 HOH A O   
1798 O  O   . HOH D .   ? 0.1963 0.2170 0.4086 0.0197  0.0023  -0.0257 1003 HOH A O   
1799 O  O   . HOH D .   ? 0.1527 0.1764 0.2871 0.0042  -0.0586 -0.0051 1004 HOH A O   
1800 O  O   . HOH D .   ? 0.1992 0.2420 0.2655 0.0215  0.0246  -0.0107 1005 HOH A O   
1801 O  O   . HOH D .   ? 0.1536 0.2142 0.3420 0.0106  0.0115  -0.0177 1006 HOH A O   
1802 O  O   . HOH D .   ? 0.2310 0.2591 0.4546 0.0368  0.0583  0.0237  1007 HOH A O   
1803 O  O   . HOH D .   ? 0.3585 0.3011 0.4293 -0.0048 0.0087  0.1557  1008 HOH A O   
1804 O  O   . HOH D .   ? 0.2797 0.3339 0.3107 0.0425  0.0074  -0.0021 1009 HOH A O   
1805 O  O   . HOH D .   ? 0.2216 0.2727 0.4201 -0.0022 -0.0092 -0.0569 1010 HOH A O   
1806 O  O   . HOH D .   ? 0.2931 0.2960 0.3694 -0.0092 0.0055  0.0179  1011 HOH A O   
1807 O  O   . HOH D .   ? 0.3569 0.3118 0.3814 0.0291  0.0926  0.0065  1012 HOH A O   
1808 O  O   . HOH D .   ? 0.1779 0.2455 0.3203 -0.0595 0.0344  -0.0539 1013 HOH A O   
1809 O  O   . HOH D .   ? 0.3285 0.2668 0.4080 -0.0900 -0.0760 -0.0950 1014 HOH A O   
1810 O  O   . HOH D .   ? 0.1926 0.2763 0.3986 -0.0431 0.0193  -0.0016 1015 HOH A O   
1811 O  O   . HOH D .   ? 0.3498 0.4565 0.3857 -0.0609 -0.0041 0.1266  1016 HOH A O   
1812 O  O   . HOH D .   ? 0.2245 0.3386 0.2689 -0.0172 0.0121  -0.0145 1017 HOH A O   
1813 O  O   . HOH D .   ? 0.2514 0.3867 0.3483 -0.0286 -0.0003 -0.0012 1018 HOH A O   
1814 O  O   . HOH D .   ? 0.2047 0.2333 0.3795 0.0635  -0.0109 -0.0015 1019 HOH A O   
1815 O  O   . HOH D .   ? 0.1822 0.2427 0.3036 0.0467  0.0400  0.0416  1020 HOH A O   
1816 O  O   . HOH D .   ? 0.1484 0.2139 0.2631 0.0301  0.0108  -0.0015 1021 HOH A O   
1817 O  O   . HOH D .   ? 0.2107 0.2311 0.3161 0.0880  -0.0219 -0.0208 1022 HOH A O   
1818 O  O   . HOH D .   ? 0.3251 0.4526 0.4442 0.0626  0.0780  0.0552  1023 HOH A O   
1819 O  O   . HOH D .   ? 0.3977 0.4863 0.4329 0.0439  -0.0511 0.0535  1024 HOH A O   
1820 O  O   . HOH D .   ? 0.2693 0.2400 0.4921 -0.0494 0.0103  -0.1147 1025 HOH A O   
1821 O  O   . HOH D .   ? 0.1916 0.2308 0.4585 0.0306  0.0382  -0.0317 1026 HOH A O   
1822 O  O   . HOH D .   ? 0.1960 0.1997 0.3323 -0.0125 0.0328  0.0333  1027 HOH A O   
1823 O  O   . HOH D .   ? 0.3146 0.2532 0.2553 0.0332  -0.0683 0.0242  1028 HOH A O   
1824 O  O   . HOH D .   ? 0.4321 0.3598 0.4655 0.0338  -0.1684 -0.0909 1029 HOH A O   
1825 O  O   . HOH D .   ? 0.4114 0.5763 0.4533 0.1097  -0.0442 0.1617  1030 HOH A O   
1826 O  O   . HOH D .   ? 0.2088 0.2267 0.3439 0.0493  0.0364  0.0511  1031 HOH A O   
1827 O  O   . HOH D .   ? 0.2967 0.3156 0.4169 -0.0774 -0.0201 0.0982  1032 HOH A O   
1828 O  O   . HOH D .   ? 0.1978 0.2946 0.3804 0.0128  -0.0229 -0.0789 1033 HOH A O   
1829 O  O   . HOH D .   ? 0.1682 0.0986 0.1917 0.0041  0.0160  0.0121  1034 HOH A O   
1830 O  O   . HOH D .   ? 0.2092 0.2756 0.4409 0.0324  0.0414  -0.1242 1035 HOH A O   
1831 O  O   . HOH D .   ? 0.2494 0.1691 0.2440 -0.0107 0.0563  0.0430  1036 HOH A O   
1832 O  O   . HOH D .   ? 0.1865 0.1441 0.3082 0.0206  0.0252  -0.0243 1037 HOH A O   
1833 O  O   . HOH D .   ? 0.1595 0.1271 0.2625 0.0254  0.0174  -0.0187 1038 HOH A O   
1834 O  O   . HOH D .   ? 0.1748 0.1764 0.1810 0.0290  0.0249  0.0258  1039 HOH A O   
1835 O  O   . HOH D .   ? 0.1206 0.1509 0.2412 0.0163  -0.0219 0.0019  1040 HOH A O   
1836 O  O   . HOH D .   ? 0.2401 0.1849 0.2141 0.0157  0.0054  0.0153  1041 HOH A O   
1837 O  O   . HOH D .   ? 0.1917 0.1926 0.2058 0.0170  0.0347  -0.0285 1042 HOH A O   
1838 O  O   . HOH D .   ? 0.1938 0.1600 0.2750 0.0280  0.0290  0.0021  1043 HOH A O   
1839 O  O   . HOH D .   ? 0.2090 0.1814 0.2435 0.0366  0.0439  0.0048  1044 HOH A O   
1840 O  O   . HOH D .   ? 0.2408 0.1749 0.2891 -0.0163 0.0159  -0.0402 1045 HOH A O   
1841 O  O   . HOH D .   ? 0.2021 0.2853 0.3259 -0.0831 0.0506  -0.0970 1046 HOH A O   
1842 O  O   . HOH D .   ? 0.5594 0.3969 0.4715 -0.0142 -0.0087 0.1031  1047 HOH A O   
1843 O  O   . HOH D .   ? 0.2562 0.3101 0.3466 0.0158  -0.0014 0.0668  1048 HOH A O   
1844 O  O   . HOH D .   ? 0.3176 0.2100 0.5083 0.0183  0.0006  0.0820  1049 HOH A O   
1845 O  O   . HOH D .   ? 0.1612 0.2690 0.2782 0.0091  -0.0267 0.0606  1050 HOH A O   
1846 O  O   . HOH D .   ? 0.2400 0.2132 0.3930 -0.0011 0.0162  0.0324  1051 HOH A O   
1847 O  O   . HOH D .   ? 0.1674 0.1330 0.2541 -0.0013 0.0104  0.0065  1052 HOH A O   
1848 O  O   . HOH D .   ? 0.4033 0.3099 0.4159 -0.0376 -0.0107 0.0799  1053 HOH A O   
1849 O  O   . HOH D .   ? 0.2842 0.2933 0.3617 -0.0148 0.0345  -0.0032 1054 HOH A O   
1850 O  O   . HOH D .   ? 0.1501 0.1613 0.2888 0.0060  0.0249  -0.0148 1055 HOH A O   
1851 O  O   . HOH D .   ? 0.1566 0.2126 0.4156 0.0032  0.0147  -0.0480 1056 HOH A O   
1852 O  O   . HOH D .   ? 0.3569 0.6564 0.4368 -0.0735 0.0042  -0.0920 1057 HOH A O   
1853 O  O   . HOH D .   ? 0.2729 0.2064 0.3008 -0.0128 0.0241  0.0009  1058 HOH A O   
1854 O  O   . HOH D .   ? 0.3479 0.3991 0.4753 0.1140  -0.0561 -0.0831 1059 HOH A O   
1855 O  O   . HOH D .   ? 0.3131 0.2245 0.2517 0.0213  -0.1056 -0.0162 1060 HOH A O   
1856 O  O   . HOH D .   ? 0.4150 0.2951 0.3822 0.0664  -0.0307 0.0217  1061 HOH A O   
1857 O  O   . HOH D .   ? 0.2802 0.3509 0.2798 0.0176  -0.0018 -0.0136 1062 HOH A O   
1858 O  O   . HOH D .   ? 0.2715 0.2619 0.3875 -0.0218 -0.0241 0.0439  1063 HOH A O   
1859 O  O   . HOH D .   ? 0.1828 0.1736 0.2589 -0.0015 0.0199  -0.0390 1064 HOH A O   
1860 O  O   . HOH D .   ? 0.2744 0.2026 0.2716 -0.0168 0.0575  -0.0046 1065 HOH A O   
1861 O  O   . HOH D .   ? 0.4186 0.3393 0.3963 0.1378  -0.0715 -0.0997 1066 HOH A O   
1862 O  O   . HOH D .   ? 0.2000 0.2109 0.3467 0.0037  -0.0232 -0.0674 1067 HOH A O   
1863 O  O   . HOH D .   ? 0.4080 0.3309 0.5075 0.1031  0.1260  -0.0123 1068 HOH A O   
1864 O  O   . HOH D .   ? 0.2121 0.2389 0.2823 0.0569  -0.0105 -0.0193 1069 HOH A O   
1865 O  O   . HOH D .   ? 0.2118 0.1430 0.2022 -0.0139 0.0021  -0.0385 1070 HOH A O   
1866 O  O   . HOH D .   ? 0.1838 0.1827 0.3545 -0.0337 -0.0036 -0.0071 1071 HOH A O   
1867 O  O   . HOH D .   ? 0.3749 0.4335 0.3153 0.0286  0.0216  -0.0260 1072 HOH A O   
1868 O  O   . HOH D .   ? 0.2394 0.2396 0.5393 -0.0458 -0.0645 0.0719  1073 HOH A O   
1869 O  O   . HOH D .   ? 0.4317 0.3997 0.5082 -0.0383 0.0696  0.1373  1074 HOH A O   
1870 O  O   . HOH D .   ? 0.2026 0.2734 0.4049 0.0380  0.0373  0.0020  1075 HOH A O   
1871 O  O   . HOH D .   ? 0.4497 0.2808 0.4329 0.0759  -0.0788 -0.0499 1076 HOH A O   
1872 O  O   . HOH D .   ? 0.2647 0.2130 0.2636 -0.0870 0.0275  -0.0391 1077 HOH A O   
1873 O  O   . HOH D .   ? 0.1760 0.1400 0.2483 -0.0201 -0.0052 0.0017  1078 HOH A O   
1874 O  O   . HOH D .   ? 0.2899 0.2436 0.5482 0.0197  0.0342  0.0369  1079 HOH A O   
1875 O  O   . HOH D .   ? 0.2565 0.2211 0.3457 0.0350  -0.0357 0.0013  1080 HOH A O   
1876 O  O   . HOH D .   ? 0.4436 0.2810 0.2983 0.1066  0.0027  0.0444  1081 HOH A O   
1877 O  O   . HOH D .   ? 0.2277 0.1865 0.2053 0.0563  0.0381  0.0081  1082 HOH A O   
1878 O  O   . HOH D .   ? 0.4120 0.2304 0.3170 0.0544  0.1023  -0.0578 1083 HOH A O   
1879 O  O   . HOH D .   ? 0.1828 0.2099 0.2260 -0.0230 0.0414  -0.0217 1084 HOH A O   
1880 O  O   . HOH D .   ? 0.3211 0.2485 0.2834 0.0632  0.0906  0.0973  1085 HOH A O   
1881 O  O   . HOH D .   ? 0.2824 0.3429 0.3506 0.0644  0.1262  0.0480  1086 HOH A O   
1882 O  O   . HOH D .   ? 0.2622 0.1769 0.2011 0.0009  0.0233  -0.0276 1087 HOH A O   
1883 O  O   . HOH D .   ? 0.4401 0.3631 0.3615 -0.0656 -0.0158 0.0122  1088 HOH A O   
1884 O  O   . HOH D .   ? 0.3626 0.2777 0.4344 0.0747  0.0825  -0.0497 1089 HOH A O   
1885 O  O   . HOH D .   ? 0.3365 0.5645 0.4920 -0.1233 -0.0852 0.0571  1090 HOH A O   
1886 O  O   . HOH D .   ? 0.2619 0.3830 0.3077 -0.0231 0.0612  -0.0323 1091 HOH A O   
1887 O  O   . HOH D .   ? 0.1804 0.1593 0.4046 0.0580  0.0697  0.0492  1092 HOH A O   
1888 O  O   . HOH D .   ? 0.2927 0.3331 0.1998 0.0518  -0.0399 0.0083  1093 HOH A O   
1889 O  O   . HOH D .   ? 0.3138 0.2949 0.3520 -0.0139 -0.0253 0.0329  1094 HOH A O   
1890 O  O   . HOH D .   ? 0.5117 0.2185 0.4420 0.0327  0.0192  -0.0313 1095 HOH A O   
1891 O  O   . HOH D .   ? 0.4833 0.3769 0.4907 -0.1026 -0.0267 0.0537  1096 HOH A O   
1892 O  O   . HOH D .   ? 0.3009 0.3336 0.3993 0.1370  0.1158  0.0810  1097 HOH A O   
1893 O  O   . HOH D .   ? 0.4911 0.3274 0.5084 0.0372  0.0481  -0.0363 1098 HOH A O   
1894 O  O   . HOH D .   ? 0.3305 0.5076 0.3866 0.1197  0.0536  0.0667  1099 HOH A O   
1895 O  O   . HOH D .   ? 0.3140 0.2938 0.3893 0.0302  0.0355  0.0017  1100 HOH A O   
1896 O  O   . HOH D .   ? 0.5814 0.3010 0.5197 -0.0044 0.0063  -0.0569 1101 HOH A O   
1897 O  O   . HOH D .   ? 0.3993 0.5260 0.5653 0.0915  -0.0241 0.0060  1102 HOH A O   
1898 O  O   . HOH D .   ? 0.4956 0.2654 0.4228 -0.0842 -0.0656 0.0276  1103 HOH A O   
1899 O  O   . HOH D .   ? 0.4112 0.3255 0.4225 0.0330  -0.0955 -0.0885 1104 HOH A O   
1900 O  O   . HOH D .   ? 0.4791 0.4099 0.3874 -0.0254 -0.0858 0.0062  1105 HOH A O   
1901 O  O   . HOH D .   ? 0.4658 0.3946 0.5025 0.0642  0.0860  -0.0006 1106 HOH A O   
1902 O  O   . HOH D .   ? 0.4118 0.3100 0.4881 0.0626  -0.0183 -0.0090 1107 HOH A O   
1903 O  O   . HOH D .   ? 0.2903 0.3172 0.4370 0.0356  0.0790  -0.0914 1108 HOH A O   
1904 O  O   . HOH D .   ? 0.4203 0.5015 0.3970 0.0388  -0.0771 -0.0676 1109 HOH A O   
1905 O  O   . HOH D .   ? 0.4016 0.4091 0.2631 0.0436  0.0860  0.0996  1110 HOH A O   
1906 O  O   . HOH D .   ? 0.2183 0.2007 0.2736 -0.0364 0.0147  -0.0190 1111 HOH A O   
1907 O  O   . HOH D .   ? 0.3643 0.2289 0.3048 0.0317  0.0830  -0.0446 1112 HOH A O   
1908 O  O   . HOH D .   ? 0.1908 0.2468 0.4621 0.0502  -0.0186 -0.0432 1113 HOH A O   
1909 O  O   . HOH D .   ? 0.4297 0.4681 0.4448 0.0472  0.1323  0.0220  1114 HOH A O   
1910 O  O   . HOH D .   ? 0.4131 0.3974 0.4569 -0.0494 0.1017  0.0262  1115 HOH A O   
1911 O  O   . HOH D .   ? 0.5097 0.3948 0.3968 0.2296  -0.0566 0.0632  1116 HOH A O   
1912 O  O   . HOH D .   ? 0.3633 0.3766 0.5369 -0.0687 -0.0661 0.0921  1117 HOH A O   
1913 O  O   . HOH D .   ? 0.5047 0.3772 0.3340 -0.0087 -0.0632 0.0251  1118 HOH A O   
1914 O  O   . HOH D .   ? 0.7087 0.4336 0.5375 -0.0904 -0.0741 0.0352  1119 HOH A O   
1915 O  O   . HOH D .   ? 0.4928 0.4945 0.5157 -0.0673 -0.1351 -0.0809 1120 HOH A O   
1916 O  O   . HOH D .   ? 0.3378 0.5415 0.4714 0.1217  -0.0753 0.0021  1121 HOH A O   
1917 O  O   . HOH D .   ? 0.7021 0.3477 0.5811 -0.0368 -0.0471 -0.1928 1122 HOH A O   
1918 O  O   . HOH D .   ? 0.2875 0.4037 0.4615 0.0138  0.0670  -0.0064 1123 HOH A O   
1919 O  O   . HOH D .   ? 0.6016 0.5153 0.6410 -0.1027 0.1209  -0.0470 1124 HOH A O   
1920 O  O   . HOH D .   ? 0.4033 0.3960 0.4604 0.0072  -0.0762 -0.0802 1125 HOH A O   
1921 O  O   . HOH D .   ? 0.4344 0.6091 0.6893 -0.0106 -0.0022 0.1016  1126 HOH A O   
1922 O  O   . HOH D .   ? 0.5923 0.3258 0.6477 0.1337  -0.0457 -0.0305 1127 HOH A O   
1923 O  O   . HOH D .   ? 0.3472 0.5641 0.4860 -0.0761 -0.0840 -0.1050 1128 HOH A O   
1924 O  O   . HOH D .   ? 0.2175 0.4597 0.5610 -0.0168 0.0364  -0.1194 1129 HOH A O   
1925 O  O   . HOH D .   ? 0.6493 0.3155 0.4191 -0.1478 0.1048  -0.0670 1130 HOH A O   
1926 O  O   . HOH D .   ? 0.4451 0.5790 0.5580 -0.0809 -0.0430 0.0316  1131 HOH A O   
1927 O  O   . HOH D .   ? 0.3711 0.4547 0.5693 0.0000  0.0208  0.0797  1132 HOH A O   
1928 O  O   . HOH D .   ? 0.5842 0.4897 0.4626 0.1928  -0.0485 0.0809  1133 HOH A O   
1929 O  O   . HOH D .   ? 0.3456 0.5445 0.4531 -0.1469 0.0554  0.0901  1134 HOH A O   
1930 O  O   . HOH D .   ? 0.4405 0.3876 0.4367 0.0508  0.1085  0.1330  1135 HOH A O   
1931 O  O   . HOH D .   ? 0.4517 0.7911 0.6880 -0.1940 0.0148  0.2790  1136 HOH A O   
1932 O  O   . HOH D .   ? 0.5720 0.4961 0.6155 -0.0342 0.0001  0.0226  1137 HOH A O   
1933 O  O   . HOH D .   ? 0.5107 0.5247 0.5162 0.0249  0.0069  -0.0818 1138 HOH A O   
1934 O  O   . HOH D .   ? 0.4897 0.4297 0.6282 0.0793  0.0266  0.0292  1139 HOH A O   
1935 O  O   . HOH D .   ? 0.3977 0.4057 0.6547 0.0262  -0.0256 0.0089  1140 HOH A O   
1936 O  O   . HOH D .   ? 0.5935 0.4147 0.4356 -0.2082 0.1034  -0.1117 1141 HOH A O   
1937 O  O   . HOH D .   ? 0.5027 0.3996 0.4741 0.0393  -0.0115 -0.0981 1142 HOH A O   
1938 O  O   . HOH D .   ? 0.5634 0.3983 0.4598 0.1561  -0.1400 -0.0837 1143 HOH A O   
1939 O  O   . HOH D .   ? 0.4658 0.3128 0.5685 -0.0462 -0.1682 -0.0635 1144 HOH A O   
1940 O  O   . HOH D .   ? 0.5570 0.3356 0.2474 -0.0245 -0.1255 0.0035  1145 HOH A O   
1941 O  O   . HOH D .   ? 0.4022 0.4790 0.4019 -0.1308 0.0826  -0.0815 1146 HOH A O   
1942 O  O   . HOH D .   ? 0.4284 0.3133 0.5892 -0.0366 0.2082  0.0956  1147 HOH A O   
1943 O  O   . HOH D .   ? 0.4296 0.5085 0.5157 0.0560  0.1706  0.1020  1148 HOH A O   
1944 O  O   . HOH D .   ? 0.5257 0.4810 0.4530 -0.0028 -0.1005 0.0985  1149 HOH A O   
1945 O  O   . HOH D .   ? 0.5179 0.3973 0.3708 0.1022  -0.0683 0.1600  1150 HOH A O   
1946 O  O   . HOH D .   ? 0.4093 0.3868 0.5860 -0.0680 -0.0546 -0.0477 1151 HOH A O   
1947 O  O   . HOH D .   ? 0.4131 0.2561 0.5535 -0.0427 0.0918  -0.1337 1152 HOH A O   
1948 O  O   . HOH D .   ? 0.3791 0.4273 0.4060 -0.1052 -0.0490 0.0785  1153 HOH A O   
1949 O  O   . HOH D .   ? 0.4902 0.5370 0.5195 -0.1072 -0.0062 0.0997  1154 HOH A O   
1950 O  O   . HOH D .   ? 0.6038 0.7617 0.6013 0.0607  0.2170  0.0395  1155 HOH A O   
1951 O  O   . HOH D .   ? 0.4061 0.4607 0.6243 -0.0173 -0.0867 -0.1274 1156 HOH A O   
1952 O  O   . HOH D .   ? 0.4056 0.4629 0.4107 -0.1124 0.0937  0.0283  1157 HOH A O   
1953 O  O   . HOH D .   ? 0.3862 0.3335 0.3697 -0.0359 -0.0539 -0.0158 1158 HOH A O   
1954 O  O   . HOH D .   ? 0.6215 0.5483 0.6176 0.1238  0.1248  0.0992  1159 HOH A O   
1955 O  O   . HOH D .   ? 0.5561 0.4056 0.6032 0.0110  0.0221  0.0872  1160 HOH A O   
1956 O  O   . HOH D .   ? 0.4263 0.5864 0.4694 0.0481  0.0541  0.0034  1161 HOH A O   
1957 O  O   . HOH D .   ? 0.6383 0.3899 0.4813 -0.0122 0.1013  -0.0662 1162 HOH A O   
1958 O  O   . HOH D .   ? 0.4571 0.3683 0.7042 -0.0902 0.0748  -0.0307 1163 HOH A O   
1959 O  O   . HOH D .   ? 0.4595 0.3909 0.2732 0.0437  -0.0387 0.0750  1164 HOH A O   
1960 O  O   . HOH D .   ? 0.4369 0.4975 0.6872 0.0009  -0.0105 -0.1562 1165 HOH A O   
1961 O  O   . HOH D .   ? 0.4976 0.2561 0.4290 0.1269  0.0800  0.0866  1166 HOH A O   
1962 O  O   . HOH D .   ? 0.6579 0.4474 0.4611 -0.2059 0.0272  0.0848  1167 HOH A O   
1963 O  O   . HOH D .   ? 0.3398 0.5116 0.5197 0.1434  0.0627  0.0025  1168 HOH A O   
1964 O  O   . HOH D .   ? 0.4729 0.3574 0.5107 -0.0630 0.1353  0.0002  1169 HOH A O   
1965 O  O   . HOH D .   ? 0.6027 0.7047 0.6442 -0.0483 0.0254  -0.0191 1170 HOH A O   
1966 O  O   . HOH D .   ? 0.5722 0.5204 0.4666 -0.1508 0.1659  -0.0911 1171 HOH A O   
1967 O  O   . HOH D .   ? 0.6549 0.6170 0.7479 0.1936  -0.0278 0.0993  1172 HOH A O   
1968 O  O   . HOH D .   ? 0.3993 0.3606 0.5362 0.0437  0.0851  0.0491  1173 HOH A O   
1969 O  O   . HOH D .   ? 0.5021 0.5462 0.4565 0.0822  0.0622  0.0864  1174 HOH A O   
1970 O  O   . HOH D .   ? 0.3285 0.3812 0.3051 -0.0163 0.0669  -0.1107 1175 HOH A O   
1971 O  O   . HOH D .   ? 0.4968 0.3225 0.6310 -0.0836 0.0446  0.0369  1176 HOH A O   
1972 O  O   . HOH D .   ? 0.6751 0.7391 0.6946 0.1143  0.0447  0.1096  1177 HOH A O   
1973 O  O   . HOH D .   ? 0.5629 0.6006 0.5621 0.0194  0.1861  0.0600  1178 HOH A O   
1974 O  O   . HOH D .   ? 0.7256 0.5742 0.5292 -0.0040 -0.1001 0.1903  1179 HOH A O   
1975 O  O   . HOH D .   ? 0.6141 0.6616 0.5807 -0.0028 0.0241  0.0028  1180 HOH A O   
1976 O  O   . HOH D .   ? 0.6524 0.4202 0.5070 0.0271  -0.0432 -0.1515 1181 HOH A O   
1977 O  O   . HOH D .   ? 0.5010 0.5445 0.4772 0.0667  -0.0296 -0.0350 1182 HOH A O   
1978 O  O   . HOH D .   ? 0.7282 0.7090 0.6659 -0.0848 -0.0844 0.0198  1183 HOH A O   
1979 O  O   . HOH D .   ? 0.6127 0.6826 0.5595 -0.0813 0.0050  -0.0095 1184 HOH A O   
1980 O  O   . HOH D .   ? 0.4259 0.4273 0.5684 0.1207  0.0210  0.1420  1185 HOH A O   
1981 O  O   . HOH D .   ? 0.5101 0.5866 0.6374 0.1179  -0.0285 -0.0442 1186 HOH A O   
1982 O  O   . HOH D .   ? 0.4677 0.5774 0.4372 0.0396  0.0020  -0.0152 1188 HOH A O   
1983 O  O   . HOH D .   ? 0.6024 0.3722 0.4188 -0.0395 -0.0022 -0.0818 1189 HOH A O   
1984 O  O   . HOH D .   ? 0.3417 0.4578 0.5737 0.0414  -0.0508 0.1111  1190 HOH A O   
1985 O  O   . HOH D .   ? 0.6135 0.5719 0.6117 -0.0838 0.0428  0.1168  1191 HOH A O   
1986 O  O   . HOH D .   ? 0.4319 0.6221 0.5870 0.0425  -0.0305 0.1103  1192 HOH A O   
1987 O  O   . HOH D .   ? 0.7175 0.6995 0.5960 0.0887  -0.0759 0.0602  1193 HOH A O   
1988 O  O   . HOH D .   ? 0.6566 0.5103 0.6137 0.1768  0.0390  0.0953  1194 HOH A O   
1989 O  O   . HOH D .   ? 0.6806 0.5492 0.7484 -0.0418 0.0303  0.0780  1196 HOH A O   
1990 O  O   . HOH D .   ? 0.5774 0.3906 0.6774 -0.1025 0.0403  -0.0312 1197 HOH A O   
1991 O  O   . HOH D .   ? 0.5465 0.5845 0.7965 0.0659  -0.0771 -0.0156 1198 HOH A O   
1992 O  O   . HOH D .   ? 0.3867 0.7068 0.5800 0.1235  0.0755  -0.0915 1199 HOH A O   
1993 O  O   . HOH D .   ? 0.7457 0.7818 0.8704 -0.0337 0.0065  0.0232  1201 HOH A O   
1994 O  O   . HOH D .   ? 0.2788 0.5105 0.5041 0.0022  -0.1320 -0.0211 1202 HOH A O   
1995 O  O   . HOH D .   ? 0.5236 0.6224 0.3427 -0.1285 -0.0713 -0.0187 1203 HOH A O   
1996 O  O   . HOH D .   ? 0.5816 0.4372 0.7386 -0.0697 0.1321  -0.0250 1204 HOH A O   
1997 O  O   . HOH D .   ? 0.5178 0.5642 0.6143 0.0790  0.0187  0.0106  1205 HOH A O   
1998 O  O   . HOH D .   ? 0.5744 0.5099 0.5679 0.0388  -0.0037 -0.0559 1206 HOH A O   
1999 O  O   . HOH D .   ? 0.5937 0.5180 0.6163 -0.1199 -0.0362 -0.0078 1207 HOH A O   
2000 O  O   . HOH D .   ? 0.5426 0.5742 0.5906 0.1223  -0.2130 -0.0442 1208 HOH A O   
2001 O  O   . HOH D .   ? 0.7335 0.6819 0.7117 0.0500  -0.0119 -0.1249 1209 HOH A O   
2002 O  O   . HOH D .   ? 0.6184 0.6451 0.6284 -0.2459 -0.1864 -0.0087 1210 HOH A O   
2003 O  O   . HOH D .   ? 0.3856 0.4881 0.6522 -0.0706 0.0816  -0.0481 1211 HOH A O   
2004 O  O   . HOH D .   ? 0.7191 0.5192 0.6808 0.0860  -0.0151 -0.0269 1212 HOH A O   
2005 O  O   . HOH D .   ? 0.5933 0.4069 0.5854 0.0883  0.0717  -0.0576 1213 HOH A O   
2006 O  O   . HOH D .   ? 0.6364 0.6444 0.6907 -0.0114 0.1466  -0.0266 1214 HOH A O   
2007 O  O   . HOH D .   ? 0.5573 0.6288 0.6820 0.1369  -0.1409 0.0606  1215 HOH A O   
2008 O  O   . HOH D .   ? 0.6821 0.5460 0.4332 -0.0481 -0.0777 0.0126  1217 HOH A O   
2009 O  O   . HOH D .   ? 0.4952 0.5795 0.4999 -0.0035 -0.0879 -0.0406 1218 HOH A O   
2010 O  O   . HOH D .   ? 0.4317 0.4869 0.6481 0.0406  -0.1231 -0.0205 1219 HOH A O   
2011 O  O   . HOH D .   ? 0.6708 0.7406 0.7326 0.1123  -0.0674 0.0552  1220 HOH A O   
2012 O  O   . HOH D .   ? 0.4986 0.6225 0.5577 0.0905  -0.2155 -0.0237 1221 HOH A O   
2013 O  O   . HOH D .   ? 0.4591 0.7093 0.4959 0.0909  0.0828  -0.0055 1222 HOH A O   
2014 O  O   . HOH D .   ? 0.6022 0.6498 0.5139 0.0381  0.0107  -0.1360 1224 HOH A O   
2015 O  O   . HOH D .   ? 0.3103 0.3494 0.6404 0.0452  0.1303  -0.0982 1225 HOH A O   
2016 O  O   . HOH D .   ? 0.4270 0.6045 0.5407 -0.1228 0.0435  -0.0393 1226 HOH A O   
2017 O  O   . HOH D .   ? 0.5135 0.6175 0.5717 -0.0282 -0.0214 0.0092  1227 HOH A O   
2018 O  O   . HOH D .   ? 0.6379 0.7806 0.6560 0.1920  0.0168  -0.0878 1228 HOH A O   
2019 O  O   . HOH D .   ? 0.4143 0.4814 0.3384 0.0038  0.0331  -0.0759 1229 HOH A O   
2020 O  O   . HOH D .   ? 0.3220 0.5107 0.5024 0.0638  -0.0911 -0.0007 1231 HOH A O   
2021 O  O   . HOH D .   ? 0.5552 0.5084 0.5321 -0.0030 -0.0702 0.1297  1232 HOH A O   
2022 O  O   . HOH D .   ? 0.5339 0.4908 0.4691 -0.0073 -0.0883 0.0576  1233 HOH A O   
2023 O  O   . HOH D .   ? 0.5040 0.5372 0.5349 0.0055  -0.0831 0.1186  1234 HOH A O   
2024 O  O   . HOH D .   ? 0.4260 0.6148 0.5261 -0.0635 -0.1074 -0.0016 1235 HOH A O   
2025 O  O   . HOH D .   ? 0.5273 0.7602 0.5610 -0.0430 -0.1339 -0.0621 1236 HOH A O   
2026 O  O   . HOH D .   ? 0.6806 0.6185 0.6260 -0.0897 -0.0545 0.0994  1237 HOH A O   
2027 O  O   . HOH D .   ? 0.9043 0.8027 0.9018 -0.0270 0.0102  0.0079  1238 HOH A O   
2028 O  O   . HOH D .   ? 0.5744 0.6976 0.6709 -0.0619 -0.2466 0.0209  1239 HOH A O   
2029 O  O   . HOH D .   ? 0.5693 0.5598 0.4541 0.1726  0.0395  -0.0057 1240 HOH A O   
2030 O  O   . HOH D .   ? 0.3492 0.4010 0.4146 -0.0223 0.0721  -0.0159 1241 HOH A O   
2031 O  O   . HOH D .   ? 0.4072 0.5056 0.4654 -0.0150 0.0196  -0.0378 1242 HOH A O   
2032 O  O   . HOH D .   ? 0.7038 0.8435 0.7718 -0.0346 0.1353  -0.1545 1243 HOH A O   
2033 O  O   . HOH D .   ? 0.8371 0.6163 0.7940 0.0532  -0.1474 -0.0901 1244 HOH A O   
2034 O  O   . HOH D .   ? 0.3911 0.4335 0.6668 0.0138  0.0590  0.0652  1245 HOH A O   
2035 O  O   . HOH D .   ? 0.7551 0.6117 0.6385 -0.0871 0.0191  0.0760  1246 HOH A O   
2036 O  O   . HOH D .   ? 0.3252 0.3327 0.4785 -0.0350 -0.0058 0.0175  1247 HOH A O   
2037 O  O   . HOH D .   ? 1.0171 0.9457 1.0686 0.0236  -0.0583 -0.0081 1248 HOH A O   
2038 O  O   . HOH D .   ? 0.4981 0.6622 0.7533 -0.1331 -0.0534 -0.1574 1249 HOH A O   
2039 O  O   . HOH D .   ? 0.7860 0.7504 0.7128 -0.1710 -0.2569 0.0102  1250 HOH A O   
2040 O  O   . HOH D .   ? 0.3688 0.2799 0.4688 -0.0174 -0.0064 0.0117  1251 HOH A O   
2041 O  O   . HOH D .   ? 0.6681 0.4286 0.5570 -0.1133 -0.0853 0.0346  1253 HOH A O   
2042 O  O   . HOH D .   ? 1.0365 0.9540 1.0355 -0.0094 -0.0153 -0.1614 1256 HOH A O   
2043 O  O   . HOH D .   ? 0.7072 0.5177 0.6990 -0.0333 0.0212  0.0455  1257 HOH A O   
2044 O  O   . HOH D .   ? 0.8954 0.9827 0.9479 -0.1212 0.0871  0.0302  1258 HOH A O   
2045 O  O   . HOH D .   ? 0.8432 0.8568 0.8022 -0.1295 0.0443  0.1015  1259 HOH A O   
2046 O  O   . HOH D .   ? 0.5154 0.6504 0.6273 0.1147  0.2133  -0.0999 1261 HOH A O   
2047 O  O   . HOH D .   ? 0.6426 0.8233 0.6529 -0.1499 -0.1558 -0.0116 1262 HOH A O   
2048 O  O   . HOH D .   ? 0.6472 0.6328 0.5608 -0.0787 0.0153  -0.1160 1263 HOH A O   
2049 O  O   . HOH D .   ? 0.7001 0.7524 0.8012 -0.0492 0.0519  -0.0352 1265 HOH A O   
2050 O  O   . HOH D .   ? 0.8040 0.8027 0.8258 -0.0129 0.0975  -0.0580 1266 HOH A O   
2051 O  O   . HOH D .   ? 0.5676 0.7791 0.7153 0.1332  0.0626  0.0804  1268 HOH A O   
2052 O  O   . HOH D .   ? 0.5316 0.5752 0.7320 0.2760  -0.1109 -0.1091 1269 HOH A O   
2053 O  O   . HOH D .   ? 0.7919 0.8555 0.8731 -0.1636 0.0247  -0.0078 1270 HOH A O   
2054 O  O   . HOH D .   ? 0.6812 0.7113 0.6004 -0.0746 -0.0866 0.0058  1271 HOH A O   
2055 O  O   . HOH D .   ? 0.9596 0.7743 0.8413 -0.1007 -0.0477 -0.0599 1272 HOH A O   
2056 O  O   . HOH D .   ? 0.7096 0.5046 0.6411 -0.0387 0.2490  0.0465  1273 HOH A O   
2057 O  O   . HOH D .   ? 0.3750 0.6412 0.5310 -0.0156 -0.0353 0.0775  1275 HOH A O   
2058 O  O   . HOH D .   ? 1.0333 1.0435 0.9820 -0.0609 -0.0046 0.0617  1276 HOH A O   
2059 O  O   . HOH D .   ? 0.8155 1.0191 0.7649 0.0324  0.0325  -0.0010 1278 HOH A O   
2060 O  O   . HOH D .   ? 0.7473 0.7297 0.8510 0.0142  0.0956  0.0659  1279 HOH A O   
2061 O  O   . HOH D .   ? 0.9000 0.8879 0.9272 -0.1119 0.0179  0.0251  1280 HOH A O   
2062 O  O   . HOH D .   ? 1.0411 0.9975 1.0133 -0.0422 0.0088  0.0266  1281 HOH A O   
2063 O  O   . HOH D .   ? 0.6768 0.5408 0.7694 0.0435  -0.0311 -0.0730 1282 HOH A O   
2064 O  O   . HOH D .   ? 0.9672 0.9413 0.9093 0.0785  0.0320  -0.0005 1283 HOH A O   
2065 O  O   . HOH D .   ? 0.5360 0.6073 0.6159 -0.0259 -0.1357 -0.0543 1284 HOH A O   
2066 O  O   . HOH D .   ? 0.1838 0.2010 0.3217 0.0434  -0.0382 -0.0643 1285 HOH A O   
2067 O  O   . HOH D .   ? 0.1793 0.2180 0.3128 0.0064  -0.0572 -0.0207 1286 HOH A O   
2068 O  O   . HOH D .   ? 0.1662 0.2031 0.2067 0.0298  -0.0174 0.0011  1287 HOH A O   
2069 O  O   . HOH D .   ? 0.1218 0.2272 0.3557 0.0166  -0.0317 -0.0917 1288 HOH A O   
2070 O  O   . HOH D .   ? 0.2363 0.2559 0.3169 -0.0836 0.0190  -0.0949 1289 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   ?   ?   ?   A . n 
A 1 3   SER 3   2   ?   ?   ?   A . n 
A 1 4   LYS 4   3   3   LYS LYS A . n 
A 1 5   GLY 5   4   4   GLY GLY A . n 
A 1 6   GLU 6   5   5   GLU GLU A . n 
A 1 7   GLU 7   6   6   GLU GLU A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   PHE 9   8   8   PHE PHE A . n 
A 1 10  THR 10  9   9   THR THR A . n 
A 1 11  GLY 11  10  10  GLY GLY A . n 
A 1 12  VAL 12  11  11  VAL VAL A . n 
A 1 13  VAL 13  12  12  VAL VAL A . n 
A 1 14  PRO 14  13  13  PRO PRO A . n 
A 1 15  ILE 15  14  14  ILE ILE A . n 
A 1 16  LEU 16  15  15  LEU LEU A . n 
A 1 17  VAL 17  16  16  VAL VAL A . n 
A 1 18  GLU 18  17  17  GLU GLU A . n 
A 1 19  LEU 19  18  18  LEU LEU A . n 
A 1 20  ASP 20  19  19  ASP ASP A . n 
A 1 21  GLY 21  20  20  GLY GLY A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  VAL 23  22  22  VAL VAL A . n 
A 1 24  ASN 24  23  23  ASN ASN A . n 
A 1 25  GLY 25  24  24  GLY GLY A . n 
A 1 26  HIS 26  25  25  HIS HIS A . n 
A 1 27  LYS 27  26  26  LYS LYS A . n 
A 1 28  PHE 28  27  27  PHE PHE A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  GLY 32  31  31  GLY GLY A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  GLY 34  33  33  GLY GLY A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  GLY 36  35  35  GLY GLY A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  THR 39  38  38  THR THR A . n 
A 1 40  TYR 40  39  39  TYR TYR A . n 
A 1 41  GLY 41  40  40  GLY GLY A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  THR 44  43  43  THR THR A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  LYS 46  45  45  LYS LYS A . n 
A 1 47  PHE 47  46  46  PHE PHE A . n 
A 1 48  ILE 48  47  47  ILE ILE A . n 
A 1 49  CYS 49  48  48  CYS CYS A . n 
A 1 50  THR 50  49  49  THR THR A . n 
A 1 51  THR 51  50  50  THR THR A . n 
A 1 52  GLY 52  51  51  GLY GLY A . n 
A 1 53  LYS 53  52  52  LYS LYS A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  VAL 56  55  55  VAL VAL A . n 
A 1 57  PRO 57  56  56  PRO PRO A . n 
A 1 58  TRP 58  57  57  TRP TRP A . n 
A 1 59  PRO 59  58  58  PRO PRO A . n 
A 1 60  THR 60  59  59  THR THR A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  VAL 62  61  61  VAL VAL A . n 
A 1 63  THR 63  62  62  THR THR A . n 
A 1 64  THR 64  63  63  THR THR A . n 
A 1 65  LEU 65  64  64  LEU LEU A . n 
A 1 66  CRO 66  66  66  CRO CRO A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  GLN 68  69  69  GLN GLN A . n 
A 1 69  CYS 69  70  70  CYS CYS A . n 
A 1 70  PHE 70  71  71  PHE PHE A . n 
A 1 71  SER 71  72  72  SER SER A . n 
A 1 72  ARG 72  73  73  ARG ARG A . n 
A 1 73  TYR 73  74  74  TYR TYR A . n 
A 1 74  PRO 74  75  75  PRO PRO A . n 
A 1 75  ASP 75  76  76  ASP ASP A . n 
A 1 76  HIS 76  77  77  HIS HIS A . n 
A 1 77  MET 77  78  78  MET MET A . n 
A 1 78  LYS 78  79  79  LYS LYS A . n 
A 1 79  GLN 79  80  80  GLN GLN A . n 
A 1 80  HIS 80  81  81  HIS HIS A . n 
A 1 81  ASP 81  82  82  ASP ASP A . n 
A 1 82  PHE 82  83  83  PHE PHE A . n 
A 1 83  PHE 83  84  84  PHE PHE A . n 
A 1 84  LYS 84  85  85  LYS LYS A . n 
A 1 85  SER 85  86  86  SER SER A . n 
A 1 86  ALA 86  87  87  ALA ALA A . n 
A 1 87  MET 87  88  88  MET MET A . n 
A 1 88  PRO 88  89  89  PRO PRO A . n 
A 1 89  GLU 89  90  90  GLU GLU A . n 
A 1 90  GLY 90  91  91  GLY GLY A . n 
A 1 91  TYR 91  92  92  TYR TYR A . n 
A 1 92  VAL 92  93  93  VAL VAL A . n 
A 1 93  GLN 93  94  94  GLN GLN A . n 
A 1 94  GLU 94  95  95  GLU GLU A . n 
A 1 95  ALA 95  96  96  ALA ALA A . n 
A 1 96  THR 96  97  97  THR THR A . n 
A 1 97  ILE 97  98  98  ILE ILE A . n 
A 1 98  SER 98  99  99  SER SER A . n 
A 1 99  PHE 99  100 100 PHE PHE A . n 
A 1 100 LYS 100 101 101 LYS LYS A . n 
A 1 101 ASP 101 102 102 ASP ASP A . n 
A 1 102 ASP 102 103 103 ASP ASP A . n 
A 1 103 GLY 103 104 104 GLY GLY A . n 
A 1 104 ASN 104 105 105 ASN ASN A . n 
A 1 105 TYR 105 106 106 TYR TYR A . n 
A 1 106 LYS 106 107 107 LYS LYS A . n 
A 1 107 THR 107 108 108 THR THR A . n 
A 1 108 ARG 108 109 109 ARG ARG A . n 
A 1 109 ALA 109 110 110 ALA ALA A . n 
A 1 110 GLU 110 111 111 GLU GLU A . n 
A 1 111 VAL 111 112 112 VAL VAL A . n 
A 1 112 LYS 112 113 113 LYS LYS A . n 
A 1 113 PHE 113 114 114 PHE PHE A . n 
A 1 114 GLU 114 115 115 GLU GLU A . n 
A 1 115 GLY 115 116 116 GLY GLY A . n 
A 1 116 ASP 116 117 117 ASP ASP A . n 
A 1 117 THR 117 118 118 THR THR A . n 
A 1 118 LEU 118 119 119 LEU LEU A . n 
A 1 119 VAL 119 120 120 VAL VAL A . n 
A 1 120 ASN 120 121 121 ASN ASN A . n 
A 1 121 ARG 121 122 122 ARG ARG A . n 
A 1 122 ILE 122 123 123 ILE ILE A . n 
A 1 123 GLU 123 124 124 GLU GLU A . n 
A 1 124 LEU 124 125 125 LEU LEU A . n 
A 1 125 LYS 125 126 126 LYS LYS A . n 
A 1 126 GLY 126 127 127 GLY GLY A . n 
A 1 127 ILE 127 128 128 ILE ILE A . n 
A 1 128 ASP 128 129 129 ASP ASP A . n 
A 1 129 PHE 129 130 130 PHE PHE A . n 
A 1 130 LYS 130 131 131 LYS LYS A . n 
A 1 131 GLU 131 132 132 GLU GLU A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 GLY 133 134 134 GLY GLY A . n 
A 1 134 ASN 134 135 135 ASN ASN A . n 
A 1 135 ILE 135 136 136 ILE ILE A . n 
A 1 136 LEU 136 137 137 LEU LEU A . n 
A 1 137 GLY 137 138 138 GLY GLY A . n 
A 1 138 HIS 138 139 139 HIS HIS A . n 
A 1 139 LYS 139 140 140 LYS LYS A . n 
A 1 140 LEU 140 141 141 LEU LEU A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 TYR 142 143 143 TYR TYR A . n 
A 1 143 ASN 143 144 144 ASN ASN A . n 
A 1 144 TYR 144 145 145 TYR TYR A . n 
A 1 145 ASN 145 146 146 ASN ASN A . n 
A 1 146 SER 146 147 147 SER SER A . n 
A 1 147 HIS 147 148 148 HIS HIS A . n 
A 1 148 ASN 148 149 149 ASN ASN A . n 
A 1 149 VAL 149 150 150 VAL VAL A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ILE 151 152 152 ILE ILE A . n 
A 1 152 THR 152 153 153 THR THR A . n 
A 1 153 ALA 153 154 154 ALA ALA A . n 
A 1 154 ASP 154 155 155 ASP ASP A . n 
A 1 155 LYS 155 156 156 LYS LYS A . n 
A 1 156 GLN 156 157 157 GLN GLN A . n 
A 1 157 LYS 157 158 158 LYS LYS A . n 
A 1 158 ASN 158 159 159 ASN ASN A . n 
A 1 159 GLY 159 160 160 GLY GLY A . n 
A 1 160 ILE 160 161 161 ILE ILE A . n 
A 1 161 LYS 161 162 162 LYS LYS A . n 
A 1 162 ALA 162 163 163 ALA ALA A . n 
A 1 163 ASN 163 164 164 ASN ASN A . n 
A 1 164 PHE 164 165 165 PHE PHE A . n 
A 1 165 LYS 165 166 166 LYS LYS A . n 
A 1 166 ILE 166 167 167 ILE ILE A . n 
A 1 167 ARG 167 168 168 ARG ARG A . n 
A 1 168 HIS 168 169 169 HIS HIS A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 ILE 170 171 171 ILE ILE A . n 
A 1 171 GLU 171 172 172 GLU GLU A . n 
A 1 172 ASP 172 173 173 ASP ASP A . n 
A 1 173 GLY 173 174 174 GLY GLY A . n 
A 1 174 SER 174 175 175 SER SER A . n 
A 1 175 VAL 175 176 176 VAL VAL A . n 
A 1 176 GLN 176 177 177 GLN GLN A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 ASP 179 180 180 ASP ASP A . n 
A 1 180 HIS 180 181 181 HIS HIS A . n 
A 1 181 TYR 181 182 182 TYR TYR A . n 
A 1 182 GLN 182 183 183 GLN GLN A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 ASN 184 185 185 ASN ASN A . n 
A 1 185 THR 185 186 186 THR THR A . n 
A 1 186 PRO 186 187 187 PRO PRO A . n 
A 1 187 ILE 187 188 188 ILE ILE A . n 
A 1 188 GLY 188 189 189 GLY GLY A . n 
A 1 189 ASP 189 190 190 ASP ASP A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 PRO 191 192 192 PRO PRO A . n 
A 1 192 VAL 192 193 193 VAL VAL A . n 
A 1 193 LEU 193 194 194 LEU LEU A . n 
A 1 194 LEU 194 195 195 LEU LEU A . n 
A 1 195 PRO 195 196 196 PRO PRO A . n 
A 1 196 ASP 196 197 197 ASP ASP A . n 
A 1 197 ASN 197 198 198 ASN ASN A . n 
A 1 198 HIS 198 199 199 HIS HIS A . n 
A 1 199 TYR 199 200 200 TYR TYR A . n 
A 1 200 LEU 200 201 201 LEU LEU A . n 
A 1 201 SER 201 202 202 SER SER A . n 
A 1 202 THR 202 203 203 THR THR A . n 
A 1 203 GLN 203 204 204 GLN GLN A . n 
A 1 204 SER 204 205 205 SER SER A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 LEU 206 207 207 LEU LEU A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 LYS 208 209 209 LYS LYS A . n 
A 1 209 ASP 209 210 210 ASP ASP A . n 
A 1 210 PRO 210 211 211 PRO PRO A . n 
A 1 211 ASN 211 212 212 ASN ASN A . n 
A 1 212 GLU 212 213 213 GLU GLU A . n 
A 1 213 LYS 213 214 214 LYS LYS A . n 
A 1 214 ARG 214 215 215 ARG ARG A . n 
A 1 215 ASP 215 216 216 ASP ASP A . n 
A 1 216 HIS 216 217 217 HIS HIS A . n 
A 1 217 MET 217 218 218 MET MET A . n 
A 1 218 VAL 218 219 219 VAL VAL A . n 
A 1 219 LEU 219 220 220 LEU LEU A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 GLU 221 222 222 GLU GLU A . n 
A 1 222 PHE 222 223 223 PHE PHE A . n 
A 1 223 VAL 223 224 224 VAL VAL A . n 
A 1 224 THR 224 225 225 THR THR A . n 
A 1 225 ALA 225 226 226 ALA ALA A . n 
A 1 226 ALA 226 227 227 ALA ALA A . n 
A 1 227 GLY 227 228 228 GLY GLY A . n 
A 1 228 ILE 228 229 229 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   301  301  MG  MO5 A . 
C 3 EDO 1   303  303  EDO EGL A . 
D 4 HOH 1   1001 1001 HOH HOH A . 
D 4 HOH 2   1002 1002 HOH HOH A . 
D 4 HOH 3   1003 1003 HOH HOH A . 
D 4 HOH 4   1004 1004 HOH HOH A . 
D 4 HOH 5   1005 1005 HOH HOH A . 
D 4 HOH 6   1006 1006 HOH HOH A . 
D 4 HOH 7   1007 1007 HOH HOH A . 
D 4 HOH 8   1008 1008 HOH HOH A . 
D 4 HOH 9   1009 1009 HOH HOH A . 
D 4 HOH 10  1010 1010 HOH HOH A . 
D 4 HOH 11  1011 1011 HOH HOH A . 
D 4 HOH 12  1012 1012 HOH HOH A . 
D 4 HOH 13  1013 1013 HOH HOH A . 
D 4 HOH 14  1014 1014 HOH HOH A . 
D 4 HOH 15  1015 1015 HOH HOH A . 
D 4 HOH 16  1016 1016 HOH HOH A . 
D 4 HOH 17  1017 1017 HOH HOH A . 
D 4 HOH 18  1018 1018 HOH HOH A . 
D 4 HOH 19  1019 1019 HOH HOH A . 
D 4 HOH 20  1020 1020 HOH HOH A . 
D 4 HOH 21  1021 1021 HOH HOH A . 
D 4 HOH 22  1022 1022 HOH HOH A . 
D 4 HOH 23  1023 1023 HOH HOH A . 
D 4 HOH 24  1024 1024 HOH HOH A . 
D 4 HOH 25  1025 1025 HOH HOH A . 
D 4 HOH 26  1026 1026 HOH HOH A . 
D 4 HOH 27  1027 1027 HOH HOH A . 
D 4 HOH 28  1028 1028 HOH HOH A . 
D 4 HOH 29  1029 1029 HOH HOH A . 
D 4 HOH 30  1030 1030 HOH HOH A . 
D 4 HOH 31  1031 1031 HOH HOH A . 
D 4 HOH 32  1032 1032 HOH HOH A . 
D 4 HOH 33  1033 1033 HOH HOH A . 
D 4 HOH 34  1034 1034 HOH HOH A . 
D 4 HOH 35  1035 1035 HOH HOH A . 
D 4 HOH 36  1036 1036 HOH HOH A . 
D 4 HOH 37  1037 1037 HOH HOH A . 
D 4 HOH 38  1038 1038 HOH HOH A . 
D 4 HOH 39  1039 1039 HOH HOH A . 
D 4 HOH 40  1040 1040 HOH HOH A . 
D 4 HOH 41  1041 1041 HOH HOH A . 
D 4 HOH 42  1042 1042 HOH HOH A . 
D 4 HOH 43  1043 1043 HOH HOH A . 
D 4 HOH 44  1044 1044 HOH HOH A . 
D 4 HOH 45  1045 1045 HOH HOH A . 
D 4 HOH 46  1046 1046 HOH HOH A . 
D 4 HOH 47  1047 1047 HOH HOH A . 
D 4 HOH 48  1048 1048 HOH HOH A . 
D 4 HOH 49  1049 1049 HOH HOH A . 
D 4 HOH 50  1050 1050 HOH HOH A . 
D 4 HOH 51  1051 1051 HOH HOH A . 
D 4 HOH 52  1052 1052 HOH HOH A . 
D 4 HOH 53  1053 1053 HOH HOH A . 
D 4 HOH 54  1054 1054 HOH HOH A . 
D 4 HOH 55  1055 1055 HOH HOH A . 
D 4 HOH 56  1056 1056 HOH HOH A . 
D 4 HOH 57  1057 1057 HOH HOH A . 
D 4 HOH 58  1058 1058 HOH HOH A . 
D 4 HOH 59  1059 1059 HOH HOH A . 
D 4 HOH 60  1060 1060 HOH HOH A . 
D 4 HOH 61  1061 1061 HOH HOH A . 
D 4 HOH 62  1062 1062 HOH HOH A . 
D 4 HOH 63  1063 1063 HOH HOH A . 
D 4 HOH 64  1064 1064 HOH HOH A . 
D 4 HOH 65  1065 1065 HOH HOH A . 
D 4 HOH 66  1066 1066 HOH HOH A . 
D 4 HOH 67  1067 1067 HOH HOH A . 
D 4 HOH 68  1068 1068 HOH HOH A . 
D 4 HOH 69  1069 1069 HOH HOH A . 
D 4 HOH 70  1070 1070 HOH HOH A . 
D 4 HOH 71  1071 1071 HOH HOH A . 
D 4 HOH 72  1072 1072 HOH HOH A . 
D 4 HOH 73  1073 1073 HOH HOH A . 
D 4 HOH 74  1074 1074 HOH HOH A . 
D 4 HOH 75  1075 1075 HOH HOH A . 
D 4 HOH 76  1076 1076 HOH HOH A . 
D 4 HOH 77  1077 1077 HOH HOH A . 
D 4 HOH 78  1078 1078 HOH HOH A . 
D 4 HOH 79  1079 1079 HOH HOH A . 
D 4 HOH 80  1080 1080 HOH HOH A . 
D 4 HOH 81  1081 1081 HOH HOH A . 
D 4 HOH 82  1082 1082 HOH HOH A . 
D 4 HOH 83  1083 1083 HOH HOH A . 
D 4 HOH 84  1084 1084 HOH HOH A . 
D 4 HOH 85  1085 1085 HOH HOH A . 
D 4 HOH 86  1086 1086 HOH HOH A . 
D 4 HOH 87  1087 1087 HOH HOH A . 
D 4 HOH 88  1088 1088 HOH HOH A . 
D 4 HOH 89  1089 1089 HOH HOH A . 
D 4 HOH 90  1090 1090 HOH HOH A . 
D 4 HOH 91  1091 1091 HOH HOH A . 
D 4 HOH 92  1092 1092 HOH HOH A . 
D 4 HOH 93  1093 1093 HOH HOH A . 
D 4 HOH 94  1094 1094 HOH HOH A . 
D 4 HOH 95  1095 1095 HOH HOH A . 
D 4 HOH 96  1096 1096 HOH HOH A . 
D 4 HOH 97  1097 1097 HOH HOH A . 
D 4 HOH 98  1098 1098 HOH HOH A . 
D 4 HOH 99  1099 1099 HOH HOH A . 
D 4 HOH 100 1100 1100 HOH HOH A . 
D 4 HOH 101 1101 1101 HOH HOH A . 
D 4 HOH 102 1102 1102 HOH HOH A . 
D 4 HOH 103 1103 1103 HOH HOH A . 
D 4 HOH 104 1104 1104 HOH HOH A . 
D 4 HOH 105 1105 1105 HOH HOH A . 
D 4 HOH 106 1106 1106 HOH HOH A . 
D 4 HOH 107 1107 1107 HOH HOH A . 
D 4 HOH 108 1108 1108 HOH HOH A . 
D 4 HOH 109 1109 1109 HOH HOH A . 
D 4 HOH 110 1110 1110 HOH HOH A . 
D 4 HOH 111 1111 1111 HOH HOH A . 
D 4 HOH 112 1112 1112 HOH HOH A . 
D 4 HOH 113 1113 1113 HOH HOH A . 
D 4 HOH 114 1114 1114 HOH HOH A . 
D 4 HOH 115 1115 1115 HOH HOH A . 
D 4 HOH 116 1116 1116 HOH HOH A . 
D 4 HOH 117 1117 1117 HOH HOH A . 
D 4 HOH 118 1118 1118 HOH HOH A . 
D 4 HOH 119 1119 1119 HOH HOH A . 
D 4 HOH 120 1120 1120 HOH HOH A . 
D 4 HOH 121 1121 1121 HOH HOH A . 
D 4 HOH 122 1122 1122 HOH HOH A . 
D 4 HOH 123 1123 1123 HOH HOH A . 
D 4 HOH 124 1124 1124 HOH HOH A . 
D 4 HOH 125 1125 1125 HOH HOH A . 
D 4 HOH 126 1126 1126 HOH HOH A . 
D 4 HOH 127 1127 1127 HOH HOH A . 
D 4 HOH 128 1128 1128 HOH HOH A . 
D 4 HOH 129 1129 1129 HOH HOH A . 
D 4 HOH 130 1130 1130 HOH HOH A . 
D 4 HOH 131 1131 1131 HOH HOH A . 
D 4 HOH 132 1132 1132 HOH HOH A . 
D 4 HOH 133 1133 1133 HOH HOH A . 
D 4 HOH 134 1134 1134 HOH HOH A . 
D 4 HOH 135 1135 1135 HOH HOH A . 
D 4 HOH 136 1136 1136 HOH HOH A . 
D 4 HOH 137 1137 1137 HOH HOH A . 
D 4 HOH 138 1138 1138 HOH HOH A . 
D 4 HOH 139 1139 1139 HOH HOH A . 
D 4 HOH 140 1140 1140 HOH HOH A . 
D 4 HOH 141 1141 1141 HOH HOH A . 
D 4 HOH 142 1142 1142 HOH HOH A . 
D 4 HOH 143 1143 1143 HOH HOH A . 
D 4 HOH 144 1144 1144 HOH HOH A . 
D 4 HOH 145 1145 1145 HOH HOH A . 
D 4 HOH 146 1146 1146 HOH HOH A . 
D 4 HOH 147 1147 1147 HOH HOH A . 
D 4 HOH 148 1148 1148 HOH HOH A . 
D 4 HOH 149 1149 1149 HOH HOH A . 
D 4 HOH 150 1150 1150 HOH HOH A . 
D 4 HOH 151 1151 1151 HOH HOH A . 
D 4 HOH 152 1152 1152 HOH HOH A . 
D 4 HOH 153 1153 1153 HOH HOH A . 
D 4 HOH 154 1154 1154 HOH HOH A . 
D 4 HOH 155 1155 1155 HOH HOH A . 
D 4 HOH 156 1156 1156 HOH HOH A . 
D 4 HOH 157 1157 1157 HOH HOH A . 
D 4 HOH 158 1158 1158 HOH HOH A . 
D 4 HOH 159 1159 1159 HOH HOH A . 
D 4 HOH 160 1160 1160 HOH HOH A . 
D 4 HOH 161 1161 1161 HOH HOH A . 
D 4 HOH 162 1162 1162 HOH HOH A . 
D 4 HOH 163 1163 1163 HOH HOH A . 
D 4 HOH 164 1164 1164 HOH HOH A . 
D 4 HOH 165 1165 1165 HOH HOH A . 
D 4 HOH 166 1166 1166 HOH HOH A . 
D 4 HOH 167 1167 1167 HOH HOH A . 
D 4 HOH 168 1168 1168 HOH HOH A . 
D 4 HOH 169 1169 1169 HOH HOH A . 
D 4 HOH 170 1170 1170 HOH HOH A . 
D 4 HOH 171 1171 1171 HOH HOH A . 
D 4 HOH 172 1172 1172 HOH HOH A . 
D 4 HOH 173 1173 1173 HOH HOH A . 
D 4 HOH 174 1174 1174 HOH HOH A . 
D 4 HOH 175 1175 1175 HOH HOH A . 
D 4 HOH 176 1176 1176 HOH HOH A . 
D 4 HOH 177 1177 1177 HOH HOH A . 
D 4 HOH 178 1178 1178 HOH HOH A . 
D 4 HOH 179 1179 1179 HOH HOH A . 
D 4 HOH 180 1180 1180 HOH HOH A . 
D 4 HOH 181 1181 1181 HOH HOH A . 
D 4 HOH 182 1182 1182 HOH HOH A . 
D 4 HOH 183 1183 1183 HOH HOH A . 
D 4 HOH 184 1184 1184 HOH HOH A . 
D 4 HOH 185 1185 1185 HOH HOH A . 
D 4 HOH 186 1186 1186 HOH HOH A . 
D 4 HOH 187 1188 1188 HOH HOH A . 
D 4 HOH 188 1189 1189 HOH HOH A . 
D 4 HOH 189 1190 1190 HOH HOH A . 
D 4 HOH 190 1191 1191 HOH HOH A . 
D 4 HOH 191 1192 1192 HOH HOH A . 
D 4 HOH 192 1193 1193 HOH HOH A . 
D 4 HOH 193 1194 1194 HOH HOH A . 
D 4 HOH 194 1196 1196 HOH HOH A . 
D 4 HOH 195 1197 1197 HOH HOH A . 
D 4 HOH 196 1198 1198 HOH HOH A . 
D 4 HOH 197 1199 1199 HOH HOH A . 
D 4 HOH 198 1201 1201 HOH HOH A . 
D 4 HOH 199 1202 1202 HOH HOH A . 
D 4 HOH 200 1203 1203 HOH HOH A . 
D 4 HOH 201 1204 1204 HOH HOH A . 
D 4 HOH 202 1205 1205 HOH HOH A . 
D 4 HOH 203 1206 1206 HOH HOH A . 
D 4 HOH 204 1207 1207 HOH HOH A . 
D 4 HOH 205 1208 1208 HOH HOH A . 
D 4 HOH 206 1209 1209 HOH HOH A . 
D 4 HOH 207 1210 1210 HOH HOH A . 
D 4 HOH 208 1211 1211 HOH HOH A . 
D 4 HOH 209 1212 1212 HOH HOH A . 
D 4 HOH 210 1213 1213 HOH HOH A . 
D 4 HOH 211 1214 1214 HOH HOH A . 
D 4 HOH 212 1215 1215 HOH HOH A . 
D 4 HOH 213 1217 1217 HOH HOH A . 
D 4 HOH 214 1218 1218 HOH HOH A . 
D 4 HOH 215 1219 1219 HOH HOH A . 
D 4 HOH 216 1220 1220 HOH HOH A . 
D 4 HOH 217 1221 1221 HOH HOH A . 
D 4 HOH 218 1222 1222 HOH HOH A . 
D 4 HOH 219 1224 1224 HOH HOH A . 
D 4 HOH 220 1225 1225 HOH HOH A . 
D 4 HOH 221 1226 1226 HOH HOH A . 
D 4 HOH 222 1227 1227 HOH HOH A . 
D 4 HOH 223 1228 1228 HOH HOH A . 
D 4 HOH 224 1229 1229 HOH HOH A . 
D 4 HOH 225 1231 1231 HOH HOH A . 
D 4 HOH 226 1232 1232 HOH HOH A . 
D 4 HOH 227 1233 1233 HOH HOH A . 
D 4 HOH 228 1234 1234 HOH HOH A . 
D 4 HOH 229 1235 1235 HOH HOH A . 
D 4 HOH 230 1236 1236 HOH HOH A . 
D 4 HOH 231 1237 1237 HOH HOH A . 
D 4 HOH 232 1238 1238 HOH HOH A . 
D 4 HOH 233 1239 1239 HOH HOH A . 
D 4 HOH 234 1240 1240 HOH HOH A . 
D 4 HOH 235 1241 1241 HOH HOH A . 
D 4 HOH 236 1242 1242 HOH HOH A . 
D 4 HOH 237 1243 1243 HOH HOH A . 
D 4 HOH 238 1244 1244 HOH HOH A . 
D 4 HOH 239 1245 1245 HOH HOH A . 
D 4 HOH 240 1246 1246 HOH HOH A . 
D 4 HOH 241 1247 1247 HOH HOH A . 
D 4 HOH 242 1248 1248 HOH HOH A . 
D 4 HOH 243 1249 1249 HOH HOH A . 
D 4 HOH 244 1250 1250 HOH HOH A . 
D 4 HOH 245 1251 1251 HOH HOH A . 
D 4 HOH 246 1253 1253 HOH HOH A . 
D 4 HOH 247 1256 1256 HOH HOH A . 
D 4 HOH 248 1257 1257 HOH HOH A . 
D 4 HOH 249 1258 1258 HOH HOH A . 
D 4 HOH 250 1259 1259 HOH HOH A . 
D 4 HOH 251 1261 1261 HOH HOH A . 
D 4 HOH 252 1262 1262 HOH HOH A . 
D 4 HOH 253 1263 1263 HOH HOH A . 
D 4 HOH 254 1265 1265 HOH HOH A . 
D 4 HOH 255 1266 1266 HOH HOH A . 
D 4 HOH 256 1268 1268 HOH HOH A . 
D 4 HOH 257 1269 1269 HOH HOH A . 
D 4 HOH 258 1270 1270 HOH HOH A . 
D 4 HOH 259 1271 1271 HOH HOH A . 
D 4 HOH 260 1272 1272 HOH HOH A . 
D 4 HOH 261 1273 1273 HOH HOH A . 
D 4 HOH 262 1275 1275 HOH HOH A . 
D 4 HOH 263 1276 1276 HOH HOH A . 
D 4 HOH 264 1278 1278 HOH HOH A . 
D 4 HOH 265 1279 1279 HOH HOH A . 
D 4 HOH 266 1280 1280 HOH HOH A . 
D 4 HOH 267 1281 1281 HOH HOH A . 
D 4 HOH 268 1282 1282 HOH HOH A . 
D 4 HOH 269 1283 1283 HOH HOH A . 
D 4 HOH 270 1284 1284 HOH HOH A . 
D 4 HOH 271 1285 301  HOH MO5 A . 
D 4 HOH 272 1286 301  HOH MO5 A . 
D 4 HOH 273 1287 301  HOH MO5 A . 
D 4 HOH 274 1288 301  HOH MO5 A . 
D 4 HOH 275 1289 301  HOH MO5 A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CRO 66 A CRO 66 ? GLY ? 
2 A CRO 66 A CRO 66 ? TYR ? 
3 A CRO 66 A CRO 66 ? GLY ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? D HOH . ? A HOH 1285 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1286 ? 1_555 97.3  ? 
2  O ? D HOH . ? A HOH 1285 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1288 ? 1_555 89.0  ? 
3  O ? D HOH . ? A HOH 1286 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1288 ? 1_555 173.4 ? 
4  O ? D HOH . ? A HOH 1285 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1289 ? 1_555 84.4  ? 
5  O ? D HOH . ? A HOH 1286 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1289 ? 1_555 93.9  ? 
6  O ? D HOH . ? A HOH 1288 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1289 ? 1_555 89.0  ? 
7  O ? D HOH . ? A HOH 1285 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1287 ? 1_555 171.2 ? 
8  O ? D HOH . ? A HOH 1286 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1287 ? 1_555 90.4  ? 
9  O ? D HOH . ? A HOH 1288 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1287 ? 1_555 83.6  ? 
10 O ? D HOH . ? A HOH 1289 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O  ? D HOH . ? A HOH 1287 ? 1_555 90.8  ? 
11 O ? D HOH . ? A HOH 1285 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? C EDO . ? A EDO 303  ? 1_555 90.7  ? 
12 O ? D HOH . ? A HOH 1286 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? C EDO . ? A EDO 303  ? 1_555 83.3  ? 
13 O ? D HOH . ? A HOH 1288 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? C EDO . ? A EDO 303  ? 1_555 94.3  ? 
14 O ? D HOH . ? A HOH 1289 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? C EDO . ? A EDO 303  ? 1_555 174.0 ? 
15 O ? D HOH . ? A HOH 1287 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? C EDO . ? A EDO 303  ? 1_555 94.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-30 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELX     'model building' . ? 1 
SHELXL-97 refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
AMoRE     phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  A LYS 79  ? ? C  A LYS 79  ? ? N   A GLN 80  ? ? 110.95 122.70 -11.75 1.60 Y 
2 1 C  A LYS 79  ? ? N  A GLN 80  ? ? CA  A GLN 80  ? ? 137.65 121.70 15.95  2.50 Y 
3 1 CB A PHE 83  ? ? CG A PHE 83  ? ? CD1 A PHE 83  ? ? 116.58 120.80 -4.22  0.70 N 
4 1 CB A TYR 106 ? ? CG A TYR 106 ? ? CD1 A TYR 106 ? ? 125.14 121.00 4.14   0.60 N 
5 1 CB A TYR 145 ? ? CG A TYR 145 ? ? CD1 A TYR 145 ? ? 116.57 121.00 -4.43  0.60 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 0 ? A MET 1 
2 1 Y 1 A ALA 1 ? A ALA 2 
3 1 Y 1 A SER 2 ? A SER 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 1,2-ETHANEDIOL  EDO 
4 water           HOH 
#