data_1QYO
# 
_entry.id   1QYO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1QYO         pdb_00001qyo 10.2210/pdb1qyo/pdb 
RCSB  RCSB020230   ?            ?                   
WWPDB D_1000020230 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QXT 'Precyclization intermediate cyrstal structure of R96A GFP variant'    unspecified 
PDB 1QY3 'Precylization intermediate crystal structure (B) of R96A GFP variant' unspecified 
PDB 1QYF 'Mature crystal structure of R96A GFP variant'                         unspecified 
PDB 1QYQ .                                                                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QYO 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barondeau, D.P.' 1 
'Putnam, C.D.'    2 
'Kassmann, C.J.'  3 
'Tainer, J.A.'    4 
'Getzoff, E.D.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Mechanism and energetics of green fluorescent protein chromophore synthesis revealed by trapped intermediate structures.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            100 
_citation.page_first                12111 
_citation.page_last                 12116 
_citation.year                      2003 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14523232 
_citation.pdbx_database_id_DOI      10.1073/pnas.2133463100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Barondeau, D.P.' 1 ? 
primary 'Putnam, C.D.'    2 ? 
primary 'Kassmann, C.J.'  3 ? 
primary 'Tainer, J.A.'    4 ? 
primary 'Getzoff, E.D.'   5 ? 
# 
_cell.entry_id           1QYO 
_cell.length_a           50.937 
_cell.length_b           62.858 
_cell.length_c           71.781 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QYO 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'green-fluorescent protein' 26633.918 1   ? 'F99S, M153T, V163A, F64L, S65G, Y66G' ? ? 
2 water   nat water                       18.015    293 ? ?                                      ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGGGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGGGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LYS n 
1 4   GLY n 
1 5   GLU n 
1 6   GLU n 
1 7   LEU n 
1 8   PHE n 
1 9   THR n 
1 10  GLY n 
1 11  VAL n 
1 12  VAL n 
1 13  PRO n 
1 14  ILE n 
1 15  LEU n 
1 16  VAL n 
1 17  GLU n 
1 18  LEU n 
1 19  ASP n 
1 20  GLY n 
1 21  ASP n 
1 22  VAL n 
1 23  ASN n 
1 24  GLY n 
1 25  HIS n 
1 26  LYS n 
1 27  PHE n 
1 28  SER n 
1 29  VAL n 
1 30  SER n 
1 31  GLY n 
1 32  GLU n 
1 33  GLY n 
1 34  GLU n 
1 35  GLY n 
1 36  ASP n 
1 37  ALA n 
1 38  THR n 
1 39  TYR n 
1 40  GLY n 
1 41  LYS n 
1 42  LEU n 
1 43  THR n 
1 44  LEU n 
1 45  LYS n 
1 46  PHE n 
1 47  ILE n 
1 48  CYS n 
1 49  THR n 
1 50  THR n 
1 51  GLY n 
1 52  LYS n 
1 53  LEU n 
1 54  PRO n 
1 55  VAL n 
1 56  PRO n 
1 57  TRP n 
1 58  PRO n 
1 59  THR n 
1 60  LEU n 
1 61  VAL n 
1 62  THR n 
1 63  THR n 
1 64  LEU n 
1 65  GLY n 
1 66  GLY n 
1 67  GLY n 
1 68  VAL n 
1 69  GLN n 
1 70  CYS n 
1 71  PHE n 
1 72  SER n 
1 73  ARG n 
1 74  TYR n 
1 75  PRO n 
1 76  ASP n 
1 77  HIS n 
1 78  MET n 
1 79  LYS n 
1 80  GLN n 
1 81  HIS n 
1 82  ASP n 
1 83  PHE n 
1 84  PHE n 
1 85  LYS n 
1 86  SER n 
1 87  ALA n 
1 88  MET n 
1 89  PRO n 
1 90  GLU n 
1 91  GLY n 
1 92  TYR n 
1 93  VAL n 
1 94  GLN n 
1 95  GLU n 
1 96  ARG n 
1 97  THR n 
1 98  ILE n 
1 99  SER n 
1 100 PHE n 
1 101 LYS n 
1 102 ASP n 
1 103 ASP n 
1 104 GLY n 
1 105 ASN n 
1 106 TYR n 
1 107 LYS n 
1 108 THR n 
1 109 ARG n 
1 110 ALA n 
1 111 GLU n 
1 112 VAL n 
1 113 LYS n 
1 114 PHE n 
1 115 GLU n 
1 116 GLY n 
1 117 ASP n 
1 118 THR n 
1 119 LEU n 
1 120 VAL n 
1 121 ASN n 
1 122 ARG n 
1 123 ILE n 
1 124 GLU n 
1 125 LEU n 
1 126 LYS n 
1 127 GLY n 
1 128 ILE n 
1 129 ASP n 
1 130 PHE n 
1 131 LYS n 
1 132 GLU n 
1 133 ASP n 
1 134 GLY n 
1 135 ASN n 
1 136 ILE n 
1 137 LEU n 
1 138 GLY n 
1 139 HIS n 
1 140 LYS n 
1 141 LEU n 
1 142 GLU n 
1 143 TYR n 
1 144 ASN n 
1 145 TYR n 
1 146 ASN n 
1 147 SER n 
1 148 HIS n 
1 149 ASN n 
1 150 VAL n 
1 151 TYR n 
1 152 ILE n 
1 153 THR n 
1 154 ALA n 
1 155 ASP n 
1 156 LYS n 
1 157 GLN n 
1 158 LYS n 
1 159 ASN n 
1 160 GLY n 
1 161 ILE n 
1 162 LYS n 
1 163 ALA n 
1 164 ASN n 
1 165 PHE n 
1 166 LYS n 
1 167 ILE n 
1 168 ARG n 
1 169 HIS n 
1 170 ASN n 
1 171 ILE n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 SER n 
1 176 VAL n 
1 177 GLN n 
1 178 LEU n 
1 179 ALA n 
1 180 ASP n 
1 181 HIS n 
1 182 TYR n 
1 183 GLN n 
1 184 GLN n 
1 185 ASN n 
1 186 THR n 
1 187 PRO n 
1 188 ILE n 
1 189 GLY n 
1 190 ASP n 
1 191 GLY n 
1 192 PRO n 
1 193 VAL n 
1 194 LEU n 
1 195 LEU n 
1 196 PRO n 
1 197 ASP n 
1 198 ASN n 
1 199 HIS n 
1 200 TYR n 
1 201 LEU n 
1 202 SER n 
1 203 THR n 
1 204 GLN n 
1 205 SER n 
1 206 ALA n 
1 207 LEU n 
1 208 SER n 
1 209 LYS n 
1 210 ASP n 
1 211 PRO n 
1 212 ASN n 
1 213 GLU n 
1 214 LYS n 
1 215 ARG n 
1 216 ASP n 
1 217 HIS n 
1 218 MET n 
1 219 VAL n 
1 220 LEU n 
1 221 LEU n 
1 222 GLU n 
1 223 PHE n 
1 224 VAL n 
1 225 THR n 
1 226 ALA n 
1 227 ALA n 
1 228 GLY n 
1 229 ILE n 
1 230 THR n 
1 231 HIS n 
1 232 GLY n 
1 233 MET n 
1 234 ASP n 
1 235 GLU n 
1 236 LEU n 
1 237 TYR n 
1 238 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aequorea 
_entity_src_gen.pdbx_gene_src_gene                 GFP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aequorea victoria' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6100 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GFP_AEQVI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
_struct_ref.pdbx_align_begin           0 
_struct_ref.pdbx_db_accession          P42212 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QYO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 238 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P42212 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  238 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       238 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QYO LEU A 64  ? UNP P42212 PHE 64  'engineered mutation' 64  1 
1 1QYO GLY A 65  ? UNP P42212 SER 65  'engineered mutation' 65  2 
1 1QYO GLY A 66  ? UNP P42212 TYR 66  'engineered mutation' 66  3 
1 1QYO SER A 99  ? UNP P42212 PHE 99  'engineered mutation' 99  4 
1 1QYO THR A 153 ? UNP P42212 MET 153 'engineered mutation' 153 5 
1 1QYO ALA A 163 ? UNP P42212 VAL 163 'engineered mutation' 163 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QYO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.81 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG 4000, Magnesium Chloride, Hepes, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-11-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54179 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54179 
# 
_reflns.entry_id                     1QYO 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   21270 
_reflns.number_all                   21947 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.072 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        13.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   85.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.366 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QYO 
_refine.ls_number_reflns_obs                     20447 
_refine.ls_number_reflns_all                     21947 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               493845.43 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.pdbx_data_cutoff_high_rms_absF           493845.43 
_refine.ls_d_res_low                             17.44 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    93.8 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  994 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               17.4 
_refine.aniso_B[1][1]                            -5.18 
_refine.aniso_B[2][2]                            -0.81 
_refine.aniso_B[3][3]                            6.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35782 
_refine.solvent_model_param_bsol                 20.5896 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ema 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QYO 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.15 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1857 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             293 
_refine_hist.number_atoms_total               2150 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        17.44 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      28.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.33  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.11  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.60  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.89  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.86  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             2772 
_refine_ls_shell.R_factor_R_work                  0.289 
_refine_ls_shell.percent_reflns_obs               81.9 
_refine_ls_shell.R_factor_R_free                  0.341 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN.GFP.PARAM PROTEIN.GFP.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QYO 
_struct.title                     'Anaerobic precylization intermediate crystal structure for S65G Y66G GFP variant' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QYO 
_struct_keywords.pdbx_keywords   'LUMINESCENT PROTEIN' 
_struct_keywords.text            'beta barrel, chromophore, trapped intermediate, LUMINESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 3   ? THR A 9   ? LYS A 3   THR A 9   5 ? 7 
HELX_P HELX_P2 2 ALA A 37  ? TYR A 39  ? ALA A 37  TYR A 39  5 ? 3 
HELX_P HELX_P3 3 PRO A 56  ? THR A 59  ? PRO A 56  THR A 59  5 ? 4 
HELX_P HELX_P4 4 LEU A 60  ? GLY A 65  ? LEU A 60  GLY A 65  1 ? 6 
HELX_P HELX_P5 5 VAL A 68  ? SER A 72  ? VAL A 68  SER A 72  5 ? 5 
HELX_P HELX_P6 6 PRO A 75  ? HIS A 81  ? PRO A 75  HIS A 81  5 ? 7 
HELX_P HELX_P7 7 ASP A 82  ? ALA A 87  ? ASP A 82  ALA A 87  1 ? 6 
HELX_P HELX_P8 8 GLY A 232 ? TYR A 237 ? GLY A 232 TYR A 237 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           88 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            88 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    89 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     89 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.31 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   12 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 12  ? VAL A 22  ? VAL A 12  VAL A 22  
A 2  HIS A 25  ? ASP A 36  ? HIS A 25  ASP A 36  
A 3  LYS A 41  ? CYS A 48  ? LYS A 41  CYS A 48  
A 4  HIS A 217 ? ALA A 227 ? HIS A 217 ALA A 227 
A 5  HIS A 199 ? SER A 208 ? HIS A 199 SER A 208 
A 6  HIS A 148 ? ASP A 155 ? HIS A 148 ASP A 155 
A 7  GLY A 160 ? ASN A 170 ? GLY A 160 ASN A 170 
A 8  VAL A 176 ? PRO A 187 ? VAL A 176 PRO A 187 
A 9  TYR A 92  ? PHE A 100 ? TYR A 92  PHE A 100 
A 10 ASN A 105 ? GLU A 115 ? ASN A 105 GLU A 115 
A 11 THR A 118 ? ILE A 128 ? THR A 118 ILE A 128 
A 12 VAL A 12  ? VAL A 22  ? VAL A 12  VAL A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 16  ? N VAL A 16  O GLY A 31  ? O GLY A 31  
A 2  3  N SER A 30  ? N SER A 30  O ILE A 47  ? O ILE A 47  
A 3  4  N LEU A 44  ? N LEU A 44  O LEU A 220 ? O LEU A 220 
A 4  5  O THR A 225 ? O THR A 225 N SER A 202 ? N SER A 202 
A 5  6  O THR A 203 ? O THR A 203 N HIS A 148 ? N HIS A 148 
A 6  7  N THR A 153 ? N THR A 153 O LYS A 162 ? O LYS A 162 
A 7  8  N PHE A 165 ? N PHE A 165 O HIS A 181 ? O HIS A 181 
A 8  9  O GLN A 184 ? O GLN A 184 N GLU A 95  ? N GLU A 95  
A 9  10 N GLN A 94  ? N GLN A 94  O ALA A 110 ? O ALA A 110 
A 10 11 N GLU A 115 ? N GLU A 115 O THR A 118 ? O THR A 118 
A 11 12 O GLY A 127 ? O GLY A 127 N ASP A 21  ? N ASP A 21  
# 
_database_PDB_matrix.entry_id          1QYO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QYO 
_atom_sites.fract_transf_matrix[1][1]   0.019632 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015909 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013931 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 2   ? 30.091 21.023  19.228 1.00 30.44 ? 2    SER A N   1 
ATOM   2    C CA  . SER A 1 2   ? 28.649 21.101  18.846 1.00 29.77 ? 2    SER A CA  1 
ATOM   3    C C   . SER A 1 2   ? 27.871 22.106  19.699 1.00 30.46 ? 2    SER A C   1 
ATOM   4    O O   . SER A 1 2   ? 28.420 22.700  20.628 1.00 32.02 ? 2    SER A O   1 
ATOM   5    C CB  . SER A 1 2   ? 28.002 19.718  18.969 1.00 29.13 ? 2    SER A CB  1 
ATOM   6    O OG  . SER A 1 2   ? 27.947 19.275  20.320 1.00 25.39 ? 2    SER A OG  1 
ATOM   7    N N   . LYS A 1 3   ? 26.587 22.276  19.375 1.00 30.19 ? 3    LYS A N   1 
ATOM   8    C CA  . LYS A 1 3   ? 25.681 23.175  20.097 1.00 29.42 ? 3    LYS A CA  1 
ATOM   9    C C   . LYS A 1 3   ? 25.272 22.506  21.417 1.00 27.13 ? 3    LYS A C   1 
ATOM   10   O O   . LYS A 1 3   ? 25.111 23.173  22.443 1.00 28.04 ? 3    LYS A O   1 
ATOM   11   C CB  . LYS A 1 3   ? 24.436 23.459  19.236 1.00 31.58 ? 3    LYS A CB  1 
ATOM   12   C CG  . LYS A 1 3   ? 23.455 24.495  19.802 1.00 34.99 ? 3    LYS A CG  1 
ATOM   13   C CD  . LYS A 1 3   ? 22.241 24.674  18.889 1.00 36.81 ? 3    LYS A CD  1 
ATOM   14   C CE  . LYS A 1 3   ? 21.268 25.722  19.431 1.00 38.55 ? 3    LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 3   ? 21.835 27.107  19.473 1.00 38.40 ? 3    LYS A NZ  1 
ATOM   16   N N   . GLY A 1 4   ? 25.162 21.178  21.380 1.00 25.00 ? 4    GLY A N   1 
ATOM   17   C CA  . GLY A 1 4   ? 24.778 20.402  22.547 1.00 21.19 ? 4    GLY A CA  1 
ATOM   18   C C   . GLY A 1 4   ? 25.770 20.366  23.700 1.00 20.40 ? 4    GLY A C   1 
ATOM   19   O O   . GLY A 1 4   ? 25.350 20.244  24.852 1.00 18.09 ? 4    GLY A O   1 
ATOM   20   N N   . GLU A 1 5   ? 27.067 20.509  23.405 1.00 19.41 ? 5    GLU A N   1 
ATOM   21   C CA  . GLU A 1 5   ? 28.110 20.486  24.443 1.00 20.78 ? 5    GLU A CA  1 
ATOM   22   C C   . GLU A 1 5   ? 28.075 21.669  25.415 1.00 19.66 ? 5    GLU A C   1 
ATOM   23   O O   . GLU A 1 5   ? 28.557 21.561  26.546 1.00 18.87 ? 5    GLU A O   1 
ATOM   24   C CB  . GLU A 1 5   ? 29.519 20.315  23.837 1.00 22.38 ? 5    GLU A CB  1 
ATOM   25   C CG  . GLU A 1 5   ? 30.090 21.514  23.091 1.00 29.44 ? 5    GLU A CG  1 
ATOM   26   C CD  . GLU A 1 5   ? 31.579 21.384  22.829 1.00 32.41 ? 5    GLU A CD  1 
ATOM   27   O OE1 . GLU A 1 5   ? 32.365 21.520  23.793 1.00 34.39 ? 5    GLU A OE1 1 
ATOM   28   O OE2 . GLU A 1 5   ? 31.964 21.155  21.663 1.00 34.17 ? 5    GLU A OE2 1 
ATOM   29   N N   . GLU A 1 6   ? 27.444 22.761  24.978 1.00 19.14 ? 6    GLU A N   1 
ATOM   30   C CA  . GLU A 1 6   ? 27.297 23.994  25.759 1.00 19.56 ? 6    GLU A CA  1 
ATOM   31   C C   . GLU A 1 6   ? 26.405 23.807  26.992 1.00 17.72 ? 6    GLU A C   1 
ATOM   32   O O   . GLU A 1 6   ? 26.524 24.545  27.972 1.00 19.25 ? 6    GLU A O   1 
ATOM   33   C CB  . GLU A 1 6   ? 26.720 25.105  24.875 1.00 23.43 ? 6    GLU A CB  1 
ATOM   34   C CG  . GLU A 1 6   ? 27.600 25.499  23.680 1.00 29.06 ? 6    GLU A CG  1 
ATOM   35   C CD  . GLU A 1 6   ? 26.872 26.345  22.632 1.00 33.16 ? 6    GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 6   ? 25.686 26.702  22.831 1.00 34.92 ? 6    GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 6   ? 27.494 26.646  21.589 1.00 35.30 ? 6    GLU A OE2 1 
ATOM   38   N N   . LEU A 1 7   ? 25.552 22.784  26.945 1.00 15.26 ? 7    LEU A N   1 
ATOM   39   C CA  . LEU A 1 7   ? 24.628 22.454  28.032 1.00 14.63 ? 7    LEU A CA  1 
ATOM   40   C C   . LEU A 1 7   ? 25.297 21.649  29.149 1.00 12.71 ? 7    LEU A C   1 
ATOM   41   O O   . LEU A 1 7   ? 24.679 21.381  30.182 1.00 12.69 ? 7    LEU A O   1 
ATOM   42   C CB  . LEU A 1 7   ? 23.441 21.652  27.475 1.00 15.08 ? 7    LEU A CB  1 
ATOM   43   C CG  . LEU A 1 7   ? 22.628 22.243  26.317 1.00 14.70 ? 7    LEU A CG  1 
ATOM   44   C CD1 . LEU A 1 7   ? 21.709 21.173  25.755 1.00 14.87 ? 7    LEU A CD1 1 
ATOM   45   C CD2 . LEU A 1 7   ? 21.826 23.457  26.776 1.00 16.44 ? 7    LEU A CD2 1 
ATOM   46   N N   . PHE A 1 8   ? 26.564 21.289  28.936 1.00 11.96 ? 8    PHE A N   1 
ATOM   47   C CA  . PHE A 1 8   ? 27.335 20.474  29.877 1.00 13.08 ? 8    PHE A CA  1 
ATOM   48   C C   . PHE A 1 8   ? 28.572 21.133  30.484 1.00 13.82 ? 8    PHE A C   1 
ATOM   49   O O   . PHE A 1 8   ? 29.389 20.454  31.118 1.00 14.23 ? 8    PHE A O   1 
ATOM   50   C CB  . PHE A 1 8   ? 27.746 19.165  29.192 1.00 11.72 ? 8    PHE A CB  1 
ATOM   51   C CG  . PHE A 1 8   ? 26.592 18.267  28.852 1.00 12.99 ? 8    PHE A CG  1 
ATOM   52   C CD1 . PHE A 1 8   ? 25.912 18.409  27.628 1.00 12.41 ? 8    PHE A CD1 1 
ATOM   53   C CD2 . PHE A 1 8   ? 26.158 17.289  29.765 1.00 12.29 ? 8    PHE A CD2 1 
ATOM   54   C CE1 . PHE A 1 8   ? 24.808 17.589  27.311 1.00 13.67 ? 8    PHE A CE1 1 
ATOM   55   C CE2 . PHE A 1 8   ? 25.051 16.452  29.466 1.00 12.80 ? 8    PHE A CE2 1 
ATOM   56   C CZ  . PHE A 1 8   ? 24.374 16.603  28.235 1.00 13.04 ? 8    PHE A CZ  1 
ATOM   57   N N   . THR A 1 9   ? 28.692 22.452  30.328 1.00 12.52 ? 9    THR A N   1 
ATOM   58   C CA  . THR A 1 9   ? 29.840 23.206  30.854 1.00 14.57 ? 9    THR A CA  1 
ATOM   59   C C   . THR A 1 9   ? 29.891 23.304  32.383 1.00 15.26 ? 9    THR A C   1 
ATOM   60   O O   . THR A 1 9   ? 30.953 23.559  32.954 1.00 14.50 ? 9    THR A O   1 
ATOM   61   C CB  . THR A 1 9   ? 29.922 24.625  30.236 1.00 14.60 ? 9    THR A CB  1 
ATOM   62   O OG1 . THR A 1 9   ? 28.666 25.296  30.389 1.00 15.30 ? 9    THR A OG1 1 
ATOM   63   C CG2 . THR A 1 9   ? 30.277 24.539  28.754 1.00 17.37 ? 9    THR A CG2 1 
ATOM   64   N N   . GLY A 1 10  ? 28.749 23.059  33.028 1.00 15.59 ? 10   GLY A N   1 
ATOM   65   C CA  . GLY A 1 10  ? 28.671 23.109  34.480 1.00 15.65 ? 10   GLY A CA  1 
ATOM   66   C C   . GLY A 1 10  ? 28.025 21.874  35.084 1.00 14.71 ? 10   GLY A C   1 
ATOM   67   O O   . GLY A 1 10  ? 27.947 20.824  34.442 1.00 15.38 ? 10   GLY A O   1 
ATOM   68   N N   . VAL A 1 11  ? 27.572 22.007  36.331 1.00 14.11 ? 11   VAL A N   1 
ATOM   69   C CA  . VAL A 1 11  ? 26.912 20.924  37.069 1.00 14.89 ? 11   VAL A CA  1 
ATOM   70   C C   . VAL A 1 11  ? 25.454 20.819  36.604 1.00 14.19 ? 11   VAL A C   1 
ATOM   71   O O   . VAL A 1 11  ? 24.700 21.790  36.673 1.00 14.33 ? 11   VAL A O   1 
ATOM   72   C CB  . VAL A 1 11  ? 26.973 21.173  38.608 1.00 15.18 ? 11   VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 11  ? 26.265 20.065  39.369 1.00 17.68 ? 11   VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 11  ? 28.420 21.261  39.075 1.00 15.18 ? 11   VAL A CG2 1 
ATOM   75   N N   . VAL A 1 12  ? 25.081 19.631  36.129 1.00 13.87 ? 12   VAL A N   1 
ATOM   76   C CA  . VAL A 1 12  ? 23.731 19.368  35.624 1.00 12.85 ? 12   VAL A CA  1 
ATOM   77   C C   . VAL A 1 12  ? 23.015 18.305  36.475 1.00 11.84 ? 12   VAL A C   1 
ATOM   78   O O   . VAL A 1 12  ? 23.571 17.226  36.708 1.00 10.30 ? 12   VAL A O   1 
ATOM   79   C CB  . VAL A 1 12  ? 23.784 18.877  34.129 1.00 14.36 ? 12   VAL A CB  1 
ATOM   80   C CG1 . VAL A 1 12  ? 22.386 18.527  33.597 1.00 14.43 ? 12   VAL A CG1 1 
ATOM   81   C CG2 . VAL A 1 12  ? 24.442 19.916  33.233 1.00 11.22 ? 12   VAL A CG2 1 
ATOM   82   N N   . PRO A 1 13  ? 21.796 18.610  36.984 1.00 11.88 ? 13   PRO A N   1 
ATOM   83   C CA  . PRO A 1 13  ? 21.060 17.623  37.792 1.00 11.33 ? 13   PRO A CA  1 
ATOM   84   C C   . PRO A 1 13  ? 20.579 16.450  36.927 1.00 11.39 ? 13   PRO A C   1 
ATOM   85   O O   . PRO A 1 13  ? 20.279 16.628  35.744 1.00 11.50 ? 13   PRO A O   1 
ATOM   86   C CB  . PRO A 1 13  ? 19.900 18.440  38.383 1.00 12.30 ? 13   PRO A CB  1 
ATOM   87   C CG  . PRO A 1 13  ? 19.753 19.599  37.457 1.00 15.00 ? 13   PRO A CG  1 
ATOM   88   C CD  . PRO A 1 13  ? 21.163 19.940  37.090 1.00 13.47 ? 13   PRO A CD  1 
ATOM   89   N N   . ILE A 1 14  ? 20.618 15.244  37.495 1.00 9.97  ? 14   ILE A N   1 
ATOM   90   C CA  . ILE A 1 14  ? 20.219 14.024  36.788 1.00 10.32 ? 14   ILE A CA  1 
ATOM   91   C C   . ILE A 1 14  ? 19.108 13.283  37.518 1.00 10.98 ? 14   ILE A C   1 
ATOM   92   O O   . ILE A 1 14  ? 19.078 13.239  38.747 1.00 11.42 ? 14   ILE A O   1 
ATOM   93   C CB  . ILE A 1 14  ? 21.419 13.012  36.638 1.00 12.01 ? 14   ILE A CB  1 
ATOM   94   C CG1 . ILE A 1 14  ? 22.625 13.670  35.976 1.00 9.82  ? 14   ILE A CG1 1 
ATOM   95   C CG2 . ILE A 1 14  ? 21.016 11.765  35.804 1.00 11.49 ? 14   ILE A CG2 1 
ATOM   96   C CD1 . ILE A 1 14  ? 23.881 12.851  36.100 1.00 9.57  ? 14   ILE A CD1 1 
ATOM   97   N N   . LEU A 1 15  ? 18.191 12.716  36.735 1.00 11.53 ? 15   LEU A N   1 
ATOM   98   C CA  . LEU A 1 15  ? 17.094 11.900  37.248 1.00 10.84 ? 15   LEU A CA  1 
ATOM   99   C C   . LEU A 1 15  ? 17.107 10.606  36.456 1.00 11.03 ? 15   LEU A C   1 
ATOM   100  O O   . LEU A 1 15  ? 17.185 10.627  35.227 1.00 11.90 ? 15   LEU A O   1 
ATOM   101  C CB  . LEU A 1 15  ? 15.735 12.578  37.073 1.00 10.52 ? 15   LEU A CB  1 
ATOM   102  C CG  . LEU A 1 15  ? 15.432 13.811  37.921 1.00 11.15 ? 15   LEU A CG  1 
ATOM   103  C CD1 . LEU A 1 15  ? 14.135 14.402  37.453 1.00 9.01  ? 15   LEU A CD1 1 
ATOM   104  C CD2 . LEU A 1 15  ? 15.414 13.471  39.405 1.00 9.56  ? 15   LEU A CD2 1 
ATOM   105  N N   . VAL A 1 16  ? 17.116 9.483   37.168 1.00 9.99  ? 16   VAL A N   1 
ATOM   106  C CA  . VAL A 1 16  ? 17.112 8.170   36.526 1.00 10.39 ? 16   VAL A CA  1 
ATOM   107  C C   . VAL A 1 16  ? 15.901 7.392   37.025 1.00 10.12 ? 16   VAL A C   1 
ATOM   108  O O   . VAL A 1 16  ? 15.636 7.351   38.229 1.00 10.91 ? 16   VAL A O   1 
ATOM   109  C CB  . VAL A 1 16  ? 18.415 7.360   36.821 1.00 8.85  ? 16   VAL A CB  1 
ATOM   110  C CG1 . VAL A 1 16  ? 18.400 6.032   36.083 1.00 12.02 ? 16   VAL A CG1 1 
ATOM   111  C CG2 . VAL A 1 16  ? 19.655 8.138   36.415 1.00 9.63  ? 16   VAL A CG2 1 
ATOM   112  N N   . GLU A 1 17  ? 15.148 6.817   36.088 1.00 10.07 ? 17   GLU A N   1 
ATOM   113  C CA  . GLU A 1 17  ? 13.964 6.018   36.403 1.00 11.29 ? 17   GLU A CA  1 
ATOM   114  C C   . GLU A 1 17  ? 13.984 4.726   35.602 1.00 11.67 ? 17   GLU A C   1 
ATOM   115  O O   . GLU A 1 17  ? 13.983 4.750   34.369 1.00 11.13 ? 17   GLU A O   1 
ATOM   116  C CB  . GLU A 1 17  ? 12.662 6.781   36.110 1.00 12.06 ? 17   GLU A CB  1 
ATOM   117  C CG  . GLU A 1 17  ? 12.360 7.956   37.039 1.00 15.98 ? 17   GLU A CG  1 
ATOM   118  C CD  . GLU A 1 17  ? 12.161 7.561   38.502 1.00 18.47 ? 17   GLU A CD  1 
ATOM   119  O OE1 . GLU A 1 17  ? 12.725 8.253   39.371 1.00 19.76 ? 17   GLU A OE1 1 
ATOM   120  O OE2 . GLU A 1 17  ? 11.426 6.590   38.788 1.00 20.98 ? 17   GLU A OE2 1 
ATOM   121  N N   . LEU A 1 18  ? 14.010 3.603   36.314 1.00 11.26 ? 18   LEU A N   1 
ATOM   122  C CA  . LEU A 1 18  ? 14.032 2.289   35.685 1.00 11.52 ? 18   LEU A CA  1 
ATOM   123  C C   . LEU A 1 18  ? 12.808 1.461   36.051 1.00 13.08 ? 18   LEU A C   1 
ATOM   124  O O   . LEU A 1 18  ? 12.421 1.395   37.213 1.00 12.00 ? 18   LEU A O   1 
ATOM   125  C CB  . LEU A 1 18  ? 15.327 1.536   36.054 1.00 11.39 ? 18   LEU A CB  1 
ATOM   126  C CG  . LEU A 1 18  ? 15.644 0.136   35.494 1.00 12.31 ? 18   LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 18  ? 17.134 -0.014  35.277 1.00 10.77 ? 18   LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 18  ? 15.152 -0.954  36.430 1.00 14.47 ? 18   LEU A CD2 1 
ATOM   129  N N   . ASP A 1 19  ? 12.248 0.805   35.037 1.00 12.98 ? 19   ASP A N   1 
ATOM   130  C CA  . ASP A 1 19  ? 11.100 -0.086  35.175 1.00 15.70 ? 19   ASP A CA  1 
ATOM   131  C C   . ASP A 1 19  ? 11.667 -1.424  34.694 1.00 14.59 ? 19   ASP A C   1 
ATOM   132  O O   . ASP A 1 19  ? 12.128 -1.521  33.554 1.00 12.80 ? 19   ASP A O   1 
ATOM   133  C CB  . ASP A 1 19  ? 9.968  0.369   34.248 1.00 20.92 ? 19   ASP A CB  1 
ATOM   134  C CG  . ASP A 1 19  ? 8.598  0.163   34.855 1.00 28.09 ? 19   ASP A CG  1 
ATOM   135  O OD1 . ASP A 1 19  ? 8.211  -1.004  35.082 1.00 30.25 ? 19   ASP A OD1 1 
ATOM   136  O OD2 . ASP A 1 19  ? 7.906  1.176   35.102 1.00 30.85 ? 19   ASP A OD2 1 
ATOM   137  N N   . GLY A 1 20  ? 11.676 -2.431  35.566 1.00 13.36 ? 20   GLY A N   1 
ATOM   138  C CA  . GLY A 1 20  ? 12.237 -3.715  35.181 1.00 13.76 ? 20   GLY A CA  1 
ATOM   139  C C   . GLY A 1 20  ? 11.461 -4.975  35.491 1.00 13.71 ? 20   GLY A C   1 
ATOM   140  O O   . GLY A 1 20  ? 10.579 -4.982  36.346 1.00 14.98 ? 20   GLY A O   1 
ATOM   141  N N   . ASP A 1 21  ? 11.811 -6.036  34.763 1.00 11.92 ? 21   ASP A N   1 
ATOM   142  C CA  . ASP A 1 21  ? 11.229 -7.368  34.905 1.00 12.28 ? 21   ASP A CA  1 
ATOM   143  C C   . ASP A 1 21  ? 12.346 -8.350  34.565 1.00 11.92 ? 21   ASP A C   1 
ATOM   144  O O   . ASP A 1 21  ? 12.826 -8.382  33.435 1.00 12.04 ? 21   ASP A O   1 
ATOM   145  C CB  . ASP A 1 21  ? 10.024 -7.572  33.951 1.00 12.94 ? 21   ASP A CB  1 
ATOM   146  C CG  . ASP A 1 21  ? 9.381  -8.978  34.063 1.00 14.82 ? 21   ASP A CG  1 
ATOM   147  O OD1 . ASP A 1 21  ? 10.100 -9.995  34.191 1.00 14.03 ? 21   ASP A OD1 1 
ATOM   148  O OD2 . ASP A 1 21  ? 8.139  -9.072  33.988 1.00 17.78 ? 21   ASP A OD2 1 
ATOM   149  N N   . VAL A 1 22  ? 12.768 -9.126  35.561 1.00 10.72 ? 22   VAL A N   1 
ATOM   150  C CA  . VAL A 1 22  ? 13.794 -10.153 35.384 1.00 10.37 ? 22   VAL A CA  1 
ATOM   151  C C   . VAL A 1 22  ? 13.170 -11.452 35.882 1.00 11.36 ? 22   VAL A C   1 
ATOM   152  O O   . VAL A 1 22  ? 12.927 -11.593 37.080 1.00 14.13 ? 22   VAL A O   1 
ATOM   153  C CB  . VAL A 1 22  ? 15.101 -9.843  36.185 1.00 10.67 ? 22   VAL A CB  1 
ATOM   154  C CG1 . VAL A 1 22  ? 16.091 -11.006 36.093 1.00 11.00 ? 22   VAL A CG1 1 
ATOM   155  C CG2 . VAL A 1 22  ? 15.769 -8.602  35.645 1.00 8.86  ? 22   VAL A CG2 1 
ATOM   156  N N   . ASN A 1 23  ? 12.889 -12.378 34.957 1.00 13.13 ? 23   ASN A N   1 
ATOM   157  C CA  . ASN A 1 23  ? 12.283 -13.691 35.263 1.00 14.07 ? 23   ASN A CA  1 
ATOM   158  C C   . ASN A 1 23  ? 10.927 -13.633 35.991 1.00 16.02 ? 23   ASN A C   1 
ATOM   159  O O   . ASN A 1 23  ? 10.586 -14.537 36.768 1.00 16.90 ? 23   ASN A O   1 
ATOM   160  C CB  . ASN A 1 23  ? 13.262 -14.576 36.057 1.00 13.36 ? 23   ASN A CB  1 
ATOM   161  C CG  . ASN A 1 23  ? 14.171 -15.397 35.173 1.00 13.48 ? 23   ASN A CG  1 
ATOM   162  O OD1 . ASN A 1 23  ? 14.537 -14.993 34.067 1.00 15.11 ? 23   ASN A OD1 1 
ATOM   163  N ND2 . ASN A 1 23  ? 14.564 -16.559 35.673 1.00 14.09 ? 23   ASN A ND2 1 
ATOM   164  N N   . GLY A 1 24  ? 10.175 -12.557 35.750 1.00 15.75 ? 24   GLY A N   1 
ATOM   165  C CA  . GLY A 1 24  ? 8.876  -12.385 36.383 1.00 16.20 ? 24   GLY A CA  1 
ATOM   166  C C   . GLY A 1 24  ? 8.921  -11.506 37.620 1.00 17.61 ? 24   GLY A C   1 
ATOM   167  O O   . GLY A 1 24  ? 7.872  -11.161 38.170 1.00 20.94 ? 24   GLY A O   1 
ATOM   168  N N   . HIS A 1 25  ? 10.133 -11.178 38.075 1.00 16.14 ? 25   HIS A N   1 
ATOM   169  C CA  . HIS A 1 25  ? 10.341 -10.317 39.243 1.00 16.17 ? 25   HIS A CA  1 
ATOM   170  C C   . HIS A 1 25  ? 10.272 -8.861  38.781 1.00 16.34 ? 25   HIS A C   1 
ATOM   171  O O   . HIS A 1 25  ? 11.179 -8.375  38.099 1.00 14.84 ? 25   HIS A O   1 
ATOM   172  C CB  . HIS A 1 25  ? 11.711 -10.567 39.877 1.00 16.35 ? 25   HIS A CB  1 
ATOM   173  C CG  . HIS A 1 25  ? 11.882 -11.929 40.470 1.00 19.26 ? 25   HIS A CG  1 
ATOM   174  N ND1 . HIS A 1 25  ? 11.306 -12.298 41.667 1.00 22.38 ? 25   HIS A ND1 1 
ATOM   175  C CD2 . HIS A 1 25  ? 12.600 -12.999 40.053 1.00 20.58 ? 25   HIS A CD2 1 
ATOM   176  C CE1 . HIS A 1 25  ? 11.665 -13.535 41.962 1.00 22.08 ? 25   HIS A CE1 1 
ATOM   177  N NE2 . HIS A 1 25  ? 12.450 -13.983 40.999 1.00 21.19 ? 25   HIS A NE2 1 
ATOM   178  N N   . LYS A 1 26  ? 9.187  -8.182  39.145 1.00 14.45 ? 26   LYS A N   1 
ATOM   179  C CA  . LYS A 1 26  ? 8.974  -6.788  38.769 1.00 16.60 ? 26   LYS A CA  1 
ATOM   180  C C   . LYS A 1 26  ? 9.544  -5.825  39.799 1.00 16.25 ? 26   LYS A C   1 
ATOM   181  O O   . LYS A 1 26  ? 9.297  -5.966  41.004 1.00 15.93 ? 26   LYS A O   1 
ATOM   182  C CB  . LYS A 1 26  ? 7.486  -6.512  38.523 1.00 19.05 ? 26   LYS A CB  1 
ATOM   183  C CG  . LYS A 1 26  ? 6.919  -7.318  37.364 1.00 24.12 ? 26   LYS A CG  1 
ATOM   184  C CD  . LYS A 1 26  ? 5.491  -6.939  37.028 1.00 29.13 ? 26   LYS A CD  1 
ATOM   185  C CE  . LYS A 1 26  ? 4.956  -7.792  35.880 1.00 31.46 ? 26   LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 26  ? 5.754  -7.642  34.623 1.00 34.28 ? 26   LYS A NZ  1 
ATOM   187  N N   . PHE A 1 27  ? 10.347 -4.880  39.312 1.00 13.84 ? 27   PHE A N   1 
ATOM   188  C CA  . PHE A 1 27  ? 10.987 -3.885  40.167 1.00 13.72 ? 27   PHE A CA  1 
ATOM   189  C C   . PHE A 1 27  ? 11.152 -2.514  39.518 1.00 13.17 ? 27   PHE A C   1 
ATOM   190  O O   . PHE A 1 27  ? 11.164 -2.391  38.294 1.00 11.46 ? 27   PHE A O   1 
ATOM   191  C CB  . PHE A 1 27  ? 12.351 -4.394  40.677 1.00 13.16 ? 27   PHE A CB  1 
ATOM   192  C CG  . PHE A 1 27  ? 13.391 -4.607  39.592 1.00 14.15 ? 27   PHE A CG  1 
ATOM   193  C CD1 . PHE A 1 27  ? 13.328 -5.727  38.744 1.00 14.02 ? 27   PHE A CD1 1 
ATOM   194  C CD2 . PHE A 1 27  ? 14.461 -3.703  39.438 1.00 13.46 ? 27   PHE A CD2 1 
ATOM   195  C CE1 . PHE A 1 27  ? 14.322 -5.951  37.755 1.00 13.65 ? 27   PHE A CE1 1 
ATOM   196  C CE2 . PHE A 1 27  ? 15.464 -3.914  38.453 1.00 13.32 ? 27   PHE A CE2 1 
ATOM   197  C CZ  . PHE A 1 27  ? 15.392 -5.042  37.610 1.00 13.08 ? 27   PHE A CZ  1 
ATOM   198  N N   . SER A 1 28  ? 11.343 -1.505  40.364 1.00 13.88 ? 28   SER A N   1 
ATOM   199  C CA  . SER A 1 28  ? 11.544 -0.130  39.921 1.00 13.21 ? 28   SER A CA  1 
ATOM   200  C C   . SER A 1 28  ? 12.688 0.509   40.692 1.00 13.23 ? 28   SER A C   1 
ATOM   201  O O   . SER A 1 28  ? 12.862 0.248   41.886 1.00 12.89 ? 28   SER A O   1 
ATOM   202  C CB  . SER A 1 28  ? 10.269 0.700   40.108 1.00 14.83 ? 28   SER A CB  1 
ATOM   203  O OG  . SER A 1 28  ? 9.203  0.184   39.334 1.00 13.96 ? 28   SER A OG  1 
ATOM   204  N N   . VAL A 1 29  ? 13.505 1.288   39.984 1.00 11.77 ? 29   VAL A N   1 
ATOM   205  C CA  . VAL A 1 29  ? 14.641 1.992   40.583 1.00 12.34 ? 29   VAL A CA  1 
ATOM   206  C C   . VAL A 1 29  ? 14.530 3.479   40.262 1.00 12.40 ? 29   VAL A C   1 
ATOM   207  O O   . VAL A 1 29  ? 14.242 3.858   39.125 1.00 11.40 ? 29   VAL A O   1 
ATOM   208  C CB  . VAL A 1 29  ? 16.025 1.442   40.078 1.00 11.38 ? 29   VAL A CB  1 
ATOM   209  C CG1 . VAL A 1 29  ? 17.185 2.246   40.666 1.00 10.43 ? 29   VAL A CG1 1 
ATOM   210  C CG2 . VAL A 1 29  ? 16.199 -0.021  40.465 1.00 11.87 ? 29   VAL A CG2 1 
ATOM   211  N N   . SER A 1 30  ? 14.733 4.303   41.287 1.00 11.84 ? 30   SER A N   1 
ATOM   212  C CA  . SER A 1 30  ? 14.701 5.756   41.153 1.00 14.54 ? 30   SER A CA  1 
ATOM   213  C C   . SER A 1 30  ? 16.059 6.300   41.558 1.00 13.20 ? 30   SER A C   1 
ATOM   214  O O   . SER A 1 30  ? 16.571 5.973   42.632 1.00 15.13 ? 30   SER A O   1 
ATOM   215  C CB  . SER A 1 30  ? 13.610 6.376   42.027 1.00 14.34 ? 30   SER A CB  1 
ATOM   216  O OG  . SER A 1 30  ? 12.321 6.079   41.519 1.00 18.84 ? 30   SER A OG  1 
ATOM   217  N N   . GLY A 1 31  ? 16.637 7.124   40.690 1.00 13.07 ? 31   GLY A N   1 
ATOM   218  C CA  . GLY A 1 31  ? 17.941 7.696   40.963 1.00 11.05 ? 31   GLY A CA  1 
ATOM   219  C C   . GLY A 1 31  ? 18.004 9.200   40.874 1.00 12.70 ? 31   GLY A C   1 
ATOM   220  O O   . GLY A 1 31  ? 17.330 9.816   40.046 1.00 12.17 ? 31   GLY A O   1 
ATOM   221  N N   . GLU A 1 32  ? 18.797 9.788   41.768 1.00 12.61 ? 32   GLU A N   1 
ATOM   222  C CA  . GLU A 1 32  ? 18.993 11.233  41.838 1.00 12.96 ? 32   GLU A CA  1 
ATOM   223  C C   . GLU A 1 32  ? 20.464 11.562  42.048 1.00 13.08 ? 32   GLU A C   1 
ATOM   224  O O   . GLU A 1 32  ? 21.188 10.838  42.736 1.00 13.42 ? 32   GLU A O   1 
ATOM   225  C CB  . GLU A 1 32  ? 18.198 11.842  42.997 1.00 12.71 ? 32   GLU A CB  1 
ATOM   226  C CG  . GLU A 1 32  ? 16.690 11.904  42.799 1.00 12.11 ? 32   GLU A CG  1 
ATOM   227  C CD  . GLU A 1 32  ? 15.987 12.578  43.952 1.00 12.89 ? 32   GLU A CD  1 
ATOM   228  O OE1 . GLU A 1 32  ? 16.558 13.535  44.517 1.00 13.41 ? 32   GLU A OE1 1 
ATOM   229  O OE2 . GLU A 1 32  ? 14.864 12.154  44.293 1.00 12.68 ? 32   GLU A OE2 1 
ATOM   230  N N   . GLY A 1 33  ? 20.883 12.681  41.471 1.00 13.38 ? 33   GLY A N   1 
ATOM   231  C CA  . GLY A 1 33  ? 22.253 13.121  41.608 1.00 11.28 ? 33   GLY A CA  1 
ATOM   232  C C   . GLY A 1 33  ? 22.613 14.179  40.593 1.00 11.36 ? 33   GLY A C   1 
ATOM   233  O O   . GLY A 1 33  ? 21.739 14.882  40.078 1.00 9.43  ? 33   GLY A O   1 
ATOM   234  N N   . GLU A 1 34  ? 23.908 14.277  40.303 1.00 12.22 ? 34   GLU A N   1 
ATOM   235  C CA  . GLU A 1 34  ? 24.420 15.266  39.360 1.00 13.23 ? 34   GLU A CA  1 
ATOM   236  C C   . GLU A 1 34  ? 25.618 14.788  38.554 1.00 12.65 ? 34   GLU A C   1 
ATOM   237  O O   . GLU A 1 34  ? 26.246 13.774  38.875 1.00 12.00 ? 34   GLU A O   1 
ATOM   238  C CB  . GLU A 1 34  ? 24.749 16.584  40.082 1.00 14.50 ? 34   GLU A CB  1 
ATOM   239  C CG  . GLU A 1 34  ? 25.613 16.443  41.329 1.00 18.85 ? 34   GLU A CG  1 
ATOM   240  C CD  . GLU A 1 34  ? 25.796 17.747  42.079 1.00 18.64 ? 34   GLU A CD  1 
ATOM   241  O OE1 . GLU A 1 34  ? 26.959 18.103  42.353 1.00 19.83 ? 34   GLU A OE1 1 
ATOM   242  O OE2 . GLU A 1 34  ? 24.788 18.423  42.384 1.00 21.02 ? 34   GLU A OE2 1 
ATOM   243  N N   . GLY A 1 35  ? 25.884 15.510  37.471 1.00 11.66 ? 35   GLY A N   1 
ATOM   244  C CA  . GLY A 1 35  ? 26.997 15.192  36.605 1.00 10.91 ? 35   GLY A CA  1 
ATOM   245  C C   . GLY A 1 35  ? 27.739 16.450  36.210 1.00 11.61 ? 35   GLY A C   1 
ATOM   246  O O   . GLY A 1 35  ? 27.125 17.491  35.955 1.00 10.73 ? 35   GLY A O   1 
ATOM   247  N N   . ASP A 1 36  ? 29.063 16.341  36.152 1.00 11.53 ? 36   ASP A N   1 
ATOM   248  C CA  . ASP A 1 36  ? 29.934 17.449  35.794 1.00 12.41 ? 36   ASP A CA  1 
ATOM   249  C C   . ASP A 1 36  ? 30.881 16.888  34.737 1.00 11.70 ? 36   ASP A C   1 
ATOM   250  O O   . ASP A 1 36  ? 31.928 16.316  35.060 1.00 12.19 ? 36   ASP A O   1 
ATOM   251  C CB  . ASP A 1 36  ? 30.701 17.933  37.037 1.00 14.33 ? 36   ASP A CB  1 
ATOM   252  C CG  . ASP A 1 36  ? 31.156 19.387  36.937 1.00 15.85 ? 36   ASP A CG  1 
ATOM   253  O OD1 . ASP A 1 36  ? 31.495 19.961  37.993 1.00 19.90 ? 36   ASP A OD1 1 
ATOM   254  O OD2 . ASP A 1 36  ? 31.193 19.960  35.827 1.00 16.89 ? 36   ASP A OD2 1 
ATOM   255  N N   . ALA A 1 37  ? 30.474 17.040  33.475 1.00 10.63 ? 37   ALA A N   1 
ATOM   256  C CA  . ALA A 1 37  ? 31.212 16.552  32.307 1.00 11.75 ? 37   ALA A CA  1 
ATOM   257  C C   . ALA A 1 37  ? 32.636 17.074  32.161 1.00 11.96 ? 37   ALA A C   1 
ATOM   258  O O   . ALA A 1 37  ? 33.496 16.389  31.608 1.00 9.81  ? 37   ALA A O   1 
ATOM   259  C CB  . ALA A 1 37  ? 30.426 16.823  31.049 1.00 15.67 ? 37   ALA A CB  1 
ATOM   260  N N   . THR A 1 38  ? 32.889 18.256  32.719 1.00 11.89 ? 38   THR A N   1 
ATOM   261  C CA  . THR A 1 38  ? 34.210 18.885  32.698 1.00 12.73 ? 38   THR A CA  1 
ATOM   262  C C   . THR A 1 38  ? 35.246 17.981  33.398 1.00 13.36 ? 38   THR A C   1 
ATOM   263  O O   . THR A 1 38  ? 36.425 17.982  33.043 1.00 14.31 ? 38   THR A O   1 
ATOM   264  C CB  . THR A 1 38  ? 34.147 20.276  33.387 1.00 15.05 ? 38   THR A CB  1 
ATOM   265  O OG1 . THR A 1 38  ? 33.188 21.100  32.713 1.00 14.71 ? 38   THR A OG1 1 
ATOM   266  C CG2 . THR A 1 38  ? 35.486 20.975  33.346 1.00 15.70 ? 38   THR A CG2 1 
ATOM   267  N N   . TYR A 1 39  ? 34.772 17.177  34.353 1.00 11.85 ? 39   TYR A N   1 
ATOM   268  C CA  . TYR A 1 39  ? 35.626 16.259  35.107 1.00 13.36 ? 39   TYR A CA  1 
ATOM   269  C C   . TYR A 1 39  ? 35.206 14.806  34.884 1.00 12.59 ? 39   TYR A C   1 
ATOM   270  O O   . TYR A 1 39  ? 35.738 13.900  35.533 1.00 13.07 ? 39   TYR A O   1 
ATOM   271  C CB  . TYR A 1 39  ? 35.573 16.602  36.609 1.00 12.63 ? 39   TYR A CB  1 
ATOM   272  C CG  . TYR A 1 39  ? 35.779 18.069  36.894 1.00 13.93 ? 39   TYR A CG  1 
ATOM   273  C CD1 . TYR A 1 39  ? 37.042 18.672  36.719 1.00 13.76 ? 39   TYR A CD1 1 
ATOM   274  C CD2 . TYR A 1 39  ? 34.691 18.888  37.248 1.00 15.09 ? 39   TYR A CD2 1 
ATOM   275  C CE1 . TYR A 1 39  ? 37.214 20.069  36.879 1.00 16.16 ? 39   TYR A CE1 1 
ATOM   276  C CE2 . TYR A 1 39  ? 34.850 20.292  37.416 1.00 16.24 ? 39   TYR A CE2 1 
ATOM   277  C CZ  . TYR A 1 39  ? 36.114 20.866  37.226 1.00 16.56 ? 39   TYR A CZ  1 
ATOM   278  O OH  . TYR A 1 39  ? 36.275 22.217  37.367 1.00 17.77 ? 39   TYR A OH  1 
ATOM   279  N N   . GLY A 1 40  ? 34.237 14.602  33.980 1.00 12.01 ? 40   GLY A N   1 
ATOM   280  C CA  . GLY A 1 40  ? 33.707 13.274  33.666 1.00 12.25 ? 40   GLY A CA  1 
ATOM   281  C C   . GLY A 1 40  ? 33.145 12.565  34.884 1.00 11.87 ? 40   GLY A C   1 
ATOM   282  O O   . GLY A 1 40  ? 33.123 11.335  34.949 1.00 12.55 ? 40   GLY A O   1 
ATOM   283  N N   . LYS A 1 41  ? 32.655 13.373  35.820 1.00 11.74 ? 41   LYS A N   1 
ATOM   284  C CA  . LYS A 1 41  ? 32.139 12.927  37.108 1.00 12.09 ? 41   LYS A CA  1 
ATOM   285  C C   . LYS A 1 41  ? 30.626 12.771  37.208 1.00 12.23 ? 41   LYS A C   1 
ATOM   286  O O   . LYS A 1 41  ? 29.873 13.684  36.876 1.00 12.25 ? 41   LYS A O   1 
ATOM   287  C CB  . LYS A 1 41  ? 32.628 13.912  38.180 1.00 10.71 ? 41   LYS A CB  1 
ATOM   288  C CG  . LYS A 1 41  ? 32.362 13.538  39.635 1.00 11.46 ? 41   LYS A CG  1 
ATOM   289  C CD  . LYS A 1 41  ? 32.976 14.585  40.547 1.00 11.10 ? 41   LYS A CD  1 
ATOM   290  C CE  . LYS A 1 41  ? 32.856 14.210  42.006 1.00 13.02 ? 41   LYS A CE  1 
ATOM   291  N NZ  . LYS A 1 41  ? 33.504 15.229  42.871 1.00 11.67 ? 41   LYS A NZ  1 
ATOM   292  N N   . LEU A 1 42  ? 30.218 11.609  37.715 1.00 11.53 ? 42   LEU A N   1 
ATOM   293  C CA  . LEU A 1 42  ? 28.821 11.256  37.952 1.00 13.05 ? 42   LEU A CA  1 
ATOM   294  C C   . LEU A 1 42  ? 28.702 10.898  39.426 1.00 13.01 ? 42   LEU A C   1 
ATOM   295  O O   . LEU A 1 42  ? 29.472 10.074  39.926 1.00 10.89 ? 42   LEU A O   1 
ATOM   296  C CB  . LEU A 1 42  ? 28.412 10.026  37.129 1.00 14.31 ? 42   LEU A CB  1 
ATOM   297  C CG  . LEU A 1 42  ? 28.145 10.171  35.636 1.00 16.49 ? 42   LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 42  ? 28.040 8.813   34.960 1.00 17.86 ? 42   LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 42  ? 26.878 10.946  35.462 1.00 16.45 ? 42   LEU A CD2 1 
ATOM   300  N N   . THR A 1 43  ? 27.773 11.554  40.120 1.00 12.36 ? 43   THR A N   1 
ATOM   301  C CA  . THR A 1 43  ? 27.511 11.301  41.537 1.00 13.13 ? 43   THR A CA  1 
ATOM   302  C C   . THR A 1 43  ? 26.018 10.994  41.618 1.00 13.28 ? 43   THR A C   1 
ATOM   303  O O   . THR A 1 43  ? 25.186 11.888  41.451 1.00 12.93 ? 43   THR A O   1 
ATOM   304  C CB  . THR A 1 43  ? 27.883 12.518  42.427 1.00 13.90 ? 43   THR A CB  1 
ATOM   305  O OG1 . THR A 1 43  ? 27.262 13.708  41.934 1.00 17.10 ? 43   THR A OG1 1 
ATOM   306  C CG2 . THR A 1 43  ? 29.388 12.707  42.480 1.00 13.89 ? 43   THR A CG2 1 
ATOM   307  N N   . LEU A 1 44  ? 25.681 9.713   41.788 1.00 12.06 ? 44   LEU A N   1 
ATOM   308  C CA  . LEU A 1 44  ? 24.281 9.275   41.810 1.00 12.64 ? 44   LEU A CA  1 
ATOM   309  C C   . LEU A 1 44  ? 23.898 8.294   42.921 1.00 12.26 ? 44   LEU A C   1 
ATOM   310  O O   . LEU A 1 44  ? 24.688 7.426   43.292 1.00 12.85 ? 44   LEU A O   1 
ATOM   311  C CB  . LEU A 1 44  ? 23.935 8.648   40.448 1.00 13.59 ? 44   LEU A CB  1 
ATOM   312  C CG  . LEU A 1 44  ? 23.898 9.478   39.153 1.00 13.72 ? 44   LEU A CG  1 
ATOM   313  C CD1 . LEU A 1 44  ? 24.138 8.616   37.918 1.00 14.66 ? 44   LEU A CD1 1 
ATOM   314  C CD2 . LEU A 1 44  ? 22.585 10.211  39.066 1.00 14.80 ? 44   LEU A CD2 1 
ATOM   315  N N   . LYS A 1 45  ? 22.685 8.454   43.452 1.00 10.79 ? 45   LYS A N   1 
ATOM   316  C CA  . LYS A 1 45  ? 22.147 7.576   44.498 1.00 11.84 ? 45   LYS A CA  1 
ATOM   317  C C   . LYS A 1 45  ? 20.854 6.946   43.974 1.00 11.57 ? 45   LYS A C   1 
ATOM   318  O O   . LYS A 1 45  ? 19.892 7.649   43.656 1.00 10.97 ? 45   LYS A O   1 
ATOM   319  C CB  . LYS A 1 45  ? 21.878 8.337   45.810 1.00 12.22 ? 45   LYS A CB  1 
ATOM   320  C CG  . LYS A 1 45  ? 21.337 7.442   46.935 1.00 12.03 ? 45   LYS A CG  1 
ATOM   321  C CD  . LYS A 1 45  ? 20.922 8.221   48.171 1.00 14.03 ? 45   LYS A CD  1 
ATOM   322  C CE  . LYS A 1 45  ? 20.199 7.311   49.151 1.00 11.53 ? 45   LYS A CE  1 
ATOM   323  N NZ  . LYS A 1 45  ? 19.784 8.035   50.385 1.00 14.36 ? 45   LYS A NZ  1 
ATOM   324  N N   . PHE A 1 46  ? 20.849 5.617   43.896 1.00 11.79 ? 46   PHE A N   1 
ATOM   325  C CA  . PHE A 1 46  ? 19.706 4.855   43.398 1.00 11.07 ? 46   PHE A CA  1 
ATOM   326  C C   . PHE A 1 46  ? 18.985 4.124   44.517 1.00 11.70 ? 46   PHE A C   1 
ATOM   327  O O   . PHE A 1 46  ? 19.624 3.584   45.408 1.00 10.78 ? 46   PHE A O   1 
ATOM   328  C CB  . PHE A 1 46  ? 20.168 3.839   42.352 1.00 11.73 ? 46   PHE A CB  1 
ATOM   329  C CG  . PHE A 1 46  ? 20.946 4.443   41.224 1.00 10.76 ? 46   PHE A CG  1 
ATOM   330  C CD1 . PHE A 1 46  ? 22.348 4.412   41.237 1.00 11.26 ? 46   PHE A CD1 1 
ATOM   331  C CD2 . PHE A 1 46  ? 20.289 5.065   40.149 1.00 9.10  ? 46   PHE A CD2 1 
ATOM   332  C CE1 . PHE A 1 46  ? 23.099 4.995   40.190 1.00 11.85 ? 46   PHE A CE1 1 
ATOM   333  C CE2 . PHE A 1 46  ? 21.023 5.659   39.092 1.00 8.58  ? 46   PHE A CE2 1 
ATOM   334  C CZ  . PHE A 1 46  ? 22.431 5.622   39.113 1.00 9.04  ? 46   PHE A CZ  1 
ATOM   335  N N   . ILE A 1 47  ? 17.655 4.118   44.464 1.00 10.79 ? 47   ILE A N   1 
ATOM   336  C CA  . ILE A 1 47  ? 16.819 3.450   45.467 1.00 12.72 ? 47   ILE A CA  1 
ATOM   337  C C   . ILE A 1 47  ? 15.833 2.507   44.773 1.00 13.82 ? 47   ILE A C   1 
ATOM   338  O O   . ILE A 1 47  ? 15.224 2.878   43.762 1.00 13.28 ? 47   ILE A O   1 
ATOM   339  C CB  . ILE A 1 47  ? 15.999 4.502   46.315 1.00 14.69 ? 47   ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 47  ? 16.939 5.409   47.115 1.00 15.03 ? 47   ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 47  ? 15.043 3.808   47.301 1.00 15.59 ? 47   ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 47  ? 16.380 6.792   47.377 1.00 18.22 ? 47   ILE A CD1 1 
ATOM   343  N N   . CYS A 1 48  ? 15.686 1.292   45.310 1.00 12.94 ? 48   CYS A N   1 
ATOM   344  C CA  . CYS A 1 48  ? 14.711 0.340   44.776 1.00 14.12 ? 48   CYS A CA  1 
ATOM   345  C C   . CYS A 1 48  ? 13.410 0.683   45.505 1.00 15.55 ? 48   CYS A C   1 
ATOM   346  O O   . CYS A 1 48  ? 13.266 0.418   46.705 1.00 16.94 ? 48   CYS A O   1 
ATOM   347  C CB  . CYS A 1 48  ? 15.107 -1.114  45.045 1.00 13.98 ? 48   CYS A CB  1 
ATOM   348  S SG  . CYS A 1 48  ? 13.897 -2.298  44.382 1.00 13.84 ? 48   CYS A SG  1 
ATOM   349  N N   . THR A 1 49  ? 12.490 1.309   44.775 1.00 14.30 ? 49   THR A N   1 
ATOM   350  C CA  . THR A 1 49  ? 11.207 1.758   45.322 1.00 16.25 ? 49   THR A CA  1 
ATOM   351  C C   . THR A 1 49  ? 10.133 0.690   45.539 1.00 17.10 ? 49   THR A C   1 
ATOM   352  O O   . THR A 1 49  ? 9.132  0.944   46.216 1.00 18.94 ? 49   THR A O   1 
ATOM   353  C CB  . THR A 1 49  ? 10.619 2.890   44.456 1.00 16.28 ? 49   THR A CB  1 
ATOM   354  O OG1 . THR A 1 49  ? 10.482 2.434   43.105 1.00 16.27 ? 49   THR A OG1 1 
ATOM   355  C CG2 . THR A 1 49  ? 11.528 4.113   44.485 1.00 16.23 ? 49   THR A CG2 1 
ATOM   356  N N   . THR A 1 50  ? 10.350 -0.497  44.975 1.00 16.38 ? 50   THR A N   1 
ATOM   357  C CA  . THR A 1 50  ? 9.406  -1.612  45.088 1.00 17.57 ? 50   THR A CA  1 
ATOM   358  C C   . THR A 1 50  ? 9.718  -2.594  46.223 1.00 17.91 ? 50   THR A C   1 
ATOM   359  O O   . THR A 1 50  ? 8.944  -3.523  46.479 1.00 19.15 ? 50   THR A O   1 
ATOM   360  C CB  . THR A 1 50  ? 9.327  -2.387  43.761 1.00 18.17 ? 50   THR A CB  1 
ATOM   361  O OG1 . THR A 1 50  ? 10.650 -2.573  43.247 1.00 15.24 ? 50   THR A OG1 1 
ATOM   362  C CG2 . THR A 1 50  ? 8.485  -1.636  42.744 1.00 16.54 ? 50   THR A CG2 1 
ATOM   363  N N   . GLY A 1 51  ? 10.847 -2.377  46.898 1.00 18.20 ? 51   GLY A N   1 
ATOM   364  C CA  . GLY A 1 51  ? 11.260 -3.239  47.995 1.00 19.14 ? 51   GLY A CA  1 
ATOM   365  C C   . GLY A 1 51  ? 12.700 -3.673  47.812 1.00 18.69 ? 51   GLY A C   1 
ATOM   366  O O   . GLY A 1 51  ? 13.573 -2.834  47.592 1.00 20.36 ? 51   GLY A O   1 
ATOM   367  N N   . LYS A 1 52  ? 12.952 -4.977  47.916 1.00 18.68 ? 52   LYS A N   1 
ATOM   368  C CA  . LYS A 1 52  ? 14.299 -5.520  47.735 1.00 18.48 ? 52   LYS A CA  1 
ATOM   369  C C   . LYS A 1 52  ? 14.555 -5.743  46.248 1.00 16.38 ? 52   LYS A C   1 
ATOM   370  O O   . LYS A 1 52  ? 13.654 -6.173  45.520 1.00 15.12 ? 52   LYS A O   1 
ATOM   371  C CB  . LYS A 1 52  ? 14.474 -6.842  48.502 1.00 21.85 ? 52   LYS A CB  1 
ATOM   372  C CG  . LYS A 1 52  ? 14.452 -6.719  50.038 1.00 26.64 ? 52   LYS A CG  1 
ATOM   373  C CD  . LYS A 1 52  ? 15.682 -5.991  50.618 1.00 30.99 ? 52   LYS A CD  1 
ATOM   374  C CE  . LYS A 1 52  ? 16.933 -6.874  50.640 1.00 33.54 ? 52   LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 52  ? 18.131 -6.138  51.138 1.00 35.68 ? 52   LYS A NZ  1 
ATOM   376  N N   . LEU A 1 53  ? 15.760 -5.394  45.795 1.00 14.26 ? 53   LEU A N   1 
ATOM   377  C CA  . LEU A 1 53  ? 16.153 -5.567  44.392 1.00 13.85 ? 53   LEU A CA  1 
ATOM   378  C C   . LEU A 1 53  ? 16.388 -7.068  44.143 1.00 11.92 ? 53   LEU A C   1 
ATOM   379  O O   . LEU A 1 53  ? 17.164 -7.696  44.860 1.00 13.48 ? 53   LEU A O   1 
ATOM   380  C CB  . LEU A 1 53  ? 17.425 -4.759  44.078 1.00 12.82 ? 53   LEU A CB  1 
ATOM   381  C CG  . LEU A 1 53  ? 17.658 -4.452  42.596 1.00 13.68 ? 53   LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 53  ? 16.777 -3.312  42.152 1.00 13.29 ? 53   LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 53  ? 19.092 -4.105  42.345 1.00 11.98 ? 53   LEU A CD2 1 
ATOM   384  N N   . PRO A 1 54  ? 15.677 -7.666  43.162 1.00 13.63 ? 54   PRO A N   1 
ATOM   385  C CA  . PRO A 1 54  ? 15.804 -9.093  42.832 1.00 13.16 ? 54   PRO A CA  1 
ATOM   386  C C   . PRO A 1 54  ? 17.063 -9.531  42.087 1.00 12.68 ? 54   PRO A C   1 
ATOM   387  O O   . PRO A 1 54  ? 17.246 -10.722 41.821 1.00 12.90 ? 54   PRO A O   1 
ATOM   388  C CB  . PRO A 1 54  ? 14.549 -9.355  42.017 1.00 11.69 ? 54   PRO A CB  1 
ATOM   389  C CG  . PRO A 1 54  ? 14.353 -8.081  41.305 1.00 13.74 ? 54   PRO A CG  1 
ATOM   390  C CD  . PRO A 1 54  ? 14.567 -7.070  42.390 1.00 13.38 ? 54   PRO A CD  1 
ATOM   391  N N   . VAL A 1 55  ? 17.895 -8.553  41.729 1.00 11.32 ? 55   VAL A N   1 
ATOM   392  C CA  . VAL A 1 55  ? 19.165 -8.771  41.029 1.00 11.73 ? 55   VAL A CA  1 
ATOM   393  C C   . VAL A 1 55  ? 20.254 -7.998  41.802 1.00 12.80 ? 55   VAL A C   1 
ATOM   394  O O   . VAL A 1 55  ? 19.921 -7.093  42.565 1.00 13.33 ? 55   VAL A O   1 
ATOM   395  C CB  . VAL A 1 55  ? 19.095 -8.276  39.532 1.00 13.72 ? 55   VAL A CB  1 
ATOM   396  C CG1 . VAL A 1 55  ? 18.170 -9.160  38.726 1.00 11.16 ? 55   VAL A CG1 1 
ATOM   397  C CG2 . VAL A 1 55  ? 18.670 -6.815  39.435 1.00 14.85 ? 55   VAL A CG2 1 
ATOM   398  N N   . PRO A 1 56  ? 21.551 -8.377  41.671 1.00 12.01 ? 56   PRO A N   1 
ATOM   399  C CA  . PRO A 1 56  ? 22.582 -7.630  42.404 1.00 11.63 ? 56   PRO A CA  1 
ATOM   400  C C   . PRO A 1 56  ? 22.765 -6.228  41.827 1.00 11.80 ? 56   PRO A C   1 
ATOM   401  O O   . PRO A 1 56  ? 22.727 -6.049  40.600 1.00 11.53 ? 56   PRO A O   1 
ATOM   402  C CB  . PRO A 1 56  ? 23.844 -8.469  42.170 1.00 11.57 ? 56   PRO A CB  1 
ATOM   403  C CG  . PRO A 1 56  ? 23.324 -9.832  41.982 1.00 11.99 ? 56   PRO A CG  1 
ATOM   404  C CD  . PRO A 1 56  ? 22.152 -9.585  41.082 1.00 12.73 ? 56   PRO A CD  1 
ATOM   405  N N   . TRP A 1 57  ? 22.988 -5.248  42.708 1.00 9.91  ? 57   TRP A N   1 
ATOM   406  C CA  . TRP A 1 57  ? 23.213 -3.859  42.290 1.00 10.48 ? 57   TRP A CA  1 
ATOM   407  C C   . TRP A 1 57  ? 24.316 -3.677  41.229 1.00 10.86 ? 57   TRP A C   1 
ATOM   408  O O   . TRP A 1 57  ? 24.112 -2.896  40.291 1.00 9.68  ? 57   TRP A O   1 
ATOM   409  C CB  . TRP A 1 57  ? 23.442 -2.927  43.493 1.00 11.28 ? 57   TRP A CB  1 
ATOM   410  C CG  . TRP A 1 57  ? 22.188 -2.528  44.215 1.00 12.79 ? 57   TRP A CG  1 
ATOM   411  C CD1 . TRP A 1 57  ? 21.782 -2.956  45.454 1.00 12.27 ? 57   TRP A CD1 1 
ATOM   412  C CD2 . TRP A 1 57  ? 21.177 -1.619  43.752 1.00 13.14 ? 57   TRP A CD2 1 
ATOM   413  N NE1 . TRP A 1 57  ? 20.582 -2.375  45.788 1.00 11.59 ? 57   TRP A NE1 1 
ATOM   414  C CE2 . TRP A 1 57  ? 20.183 -1.551  44.767 1.00 12.62 ? 57   TRP A CE2 1 
ATOM   415  C CE3 . TRP A 1 57  ? 21.005 -0.853  42.573 1.00 12.16 ? 57   TRP A CE3 1 
ATOM   416  C CZ2 . TRP A 1 57  ? 19.025 -0.742  44.644 1.00 12.58 ? 57   TRP A CZ2 1 
ATOM   417  C CZ3 . TRP A 1 57  ? 19.849 -0.042  42.446 1.00 12.67 ? 57   TRP A CZ3 1 
ATOM   418  C CH2 . TRP A 1 57  ? 18.876 0.001   43.484 1.00 13.98 ? 57   TRP A CH2 1 
ATOM   419  N N   . PRO A 1 58  ? 25.468 -4.413  41.329 1.00 10.32 ? 58   PRO A N   1 
ATOM   420  C CA  . PRO A 1 58  ? 26.502 -4.236  40.301 1.00 10.00 ? 58   PRO A CA  1 
ATOM   421  C C   . PRO A 1 58  ? 26.071 -4.518  38.857 1.00 9.52  ? 58   PRO A C   1 
ATOM   422  O O   . PRO A 1 58  ? 26.580 -3.876  37.936 1.00 9.63  ? 58   PRO A O   1 
ATOM   423  C CB  . PRO A 1 58  ? 27.589 -5.210  40.745 1.00 10.89 ? 58   PRO A CB  1 
ATOM   424  C CG  . PRO A 1 58  ? 27.513 -5.123  42.198 1.00 11.28 ? 58   PRO A CG  1 
ATOM   425  C CD  . PRO A 1 58  ? 26.041 -5.205  42.445 1.00 9.81  ? 58   PRO A CD  1 
ATOM   426  N N   . THR A 1 59  ? 25.100 -5.424  38.675 1.00 9.88  ? 59   THR A N   1 
ATOM   427  C CA  . THR A 1 59  ? 24.597 -5.793  37.341 1.00 9.28  ? 59   THR A CA  1 
ATOM   428  C C   . THR A 1 59  ? 23.822 -4.674  36.644 1.00 10.67 ? 59   THR A C   1 
ATOM   429  O O   . THR A 1 59  ? 23.622 -4.719  35.424 1.00 9.54  ? 59   THR A O   1 
ATOM   430  C CB  . THR A 1 59  ? 23.687 -7.065  37.357 1.00 9.26  ? 59   THR A CB  1 
ATOM   431  O OG1 . THR A 1 59  ? 22.443 -6.785  38.013 1.00 11.99 ? 59   THR A OG1 1 
ATOM   432  C CG2 . THR A 1 59  ? 24.370 -8.225  38.036 1.00 10.77 ? 59   THR A CG2 1 
ATOM   433  N N   . LEU A 1 60  ? 23.390 -3.687  37.431 1.00 9.15  ? 60   LEU A N   1 
ATOM   434  C CA  . LEU A 1 60  ? 22.627 -2.553  36.922 1.00 10.50 ? 60   LEU A CA  1 
ATOM   435  C C   . LEU A 1 60  ? 23.414 -1.259  36.726 1.00 9.95  ? 60   LEU A C   1 
ATOM   436  O O   . LEU A 1 60  ? 22.870 -0.299  36.195 1.00 10.58 ? 60   LEU A O   1 
ATOM   437  C CB  . LEU A 1 60  ? 21.414 -2.272  37.823 1.00 8.94  ? 60   LEU A CB  1 
ATOM   438  C CG  . LEU A 1 60  ? 20.323 -3.322  38.051 1.00 10.70 ? 60   LEU A CG  1 
ATOM   439  C CD1 . LEU A 1 60  ? 19.174 -2.683  38.812 1.00 11.11 ? 60   LEU A CD1 1 
ATOM   440  C CD2 . LEU A 1 60  ? 19.813 -3.897  36.735 1.00 9.09  ? 60   LEU A CD2 1 
ATOM   441  N N   . VAL A 1 61  ? 24.695 -1.243  37.103 1.00 11.50 ? 61   VAL A N   1 
ATOM   442  C CA  . VAL A 1 61  ? 25.538 -0.038  36.985 1.00 10.21 ? 61   VAL A CA  1 
ATOM   443  C C   . VAL A 1 61  ? 25.639 0.551   35.573 1.00 10.23 ? 61   VAL A C   1 
ATOM   444  O O   . VAL A 1 61  ? 25.442 1.756   35.398 1.00 10.36 ? 61   VAL A O   1 
ATOM   445  C CB  . VAL A 1 61  ? 26.952 -0.276  37.591 1.00 10.40 ? 61   VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 61  ? 27.880 0.942   37.406 1.00 11.62 ? 61   VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 61  ? 26.824 -0.590  39.069 1.00 11.13 ? 61   VAL A CG2 1 
ATOM   448  N N   . THR A 1 62  ? 25.891 -0.297  34.575 1.00 9.68  ? 62   THR A N   1 
ATOM   449  C CA  . THR A 1 62  ? 25.999 0.168   33.188 1.00 9.87  ? 62   THR A CA  1 
ATOM   450  C C   . THR A 1 62  ? 24.683 0.704   32.626 1.00 10.82 ? 62   THR A C   1 
ATOM   451  O O   . THR A 1 62  ? 24.688 1.544   31.733 1.00 12.68 ? 62   THR A O   1 
ATOM   452  C CB  . THR A 1 62  ? 26.542 -0.919  32.245 1.00 9.44  ? 62   THR A CB  1 
ATOM   453  O OG1 . THR A 1 62  ? 25.770 -2.118  32.382 1.00 10.77 ? 62   THR A OG1 1 
ATOM   454  C CG2 . THR A 1 62  ? 27.994 -1.204  32.560 1.00 9.17  ? 62   THR A CG2 1 
ATOM   455  N N   . THR A 1 63  ? 23.564 0.235   33.172 1.00 10.30 ? 63   THR A N   1 
ATOM   456  C CA  . THR A 1 63  ? 22.244 0.684   32.733 1.00 10.51 ? 63   THR A CA  1 
ATOM   457  C C   . THR A 1 63  ? 21.870 1.995   33.444 1.00 11.79 ? 63   THR A C   1 
ATOM   458  O O   . THR A 1 63  ? 21.361 2.932   32.822 1.00 11.69 ? 63   THR A O   1 
ATOM   459  C CB  . THR A 1 63  ? 21.182 -0.420  33.005 1.00 10.65 ? 63   THR A CB  1 
ATOM   460  O OG1 . THR A 1 63  ? 21.520 -1.588  32.253 1.00 11.41 ? 63   THR A OG1 1 
ATOM   461  C CG2 . THR A 1 63  ? 19.786 0.022   32.597 1.00 10.24 ? 63   THR A CG2 1 
ATOM   462  N N   . LEU A 1 64  ? 22.177 2.052   34.736 1.00 12.94 ? 64   LEU A N   1 
ATOM   463  C CA  . LEU A 1 64  ? 21.869 3.201   35.582 1.00 13.54 ? 64   LEU A CA  1 
ATOM   464  C C   . LEU A 1 64  ? 22.835 4.382   35.470 1.00 16.15 ? 64   LEU A C   1 
ATOM   465  O O   . LEU A 1 64  ? 22.396 5.528   35.324 1.00 17.10 ? 64   LEU A O   1 
ATOM   466  C CB  . LEU A 1 64  ? 21.751 2.734   37.030 1.00 13.55 ? 64   LEU A CB  1 
ATOM   467  C CG  . LEU A 1 64  ? 20.570 1.831   37.407 1.00 13.55 ? 64   LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 64  ? 20.747 1.346   38.835 1.00 11.49 ? 64   LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 64  ? 19.250 2.560   37.253 1.00 10.92 ? 64   LEU A CD2 1 
ATOM   470  N N   . GLY A 1 65  ? 24.134 4.095   35.561 1.00 14.79 ? 65   GLY A N   1 
ATOM   471  C CA  . GLY A 1 65  ? 25.162 5.121   35.458 1.00 14.65 ? 65   GLY A CA  1 
ATOM   472  C C   . GLY A 1 65  ? 25.700 5.250   34.044 1.00 15.16 ? 65   GLY A C   1 
ATOM   473  O O   . GLY A 1 65  ? 25.886 6.363   33.551 1.00 15.38 ? 65   GLY A O   1 
ATOM   474  N N   . GLY A 1 66  ? 25.894 4.112   33.374 1.00 13.24 ? 66   GLY A N   1 
ATOM   475  C CA  . GLY A 1 66  ? 26.396 4.104   32.003 1.00 12.65 ? 66   GLY A CA  1 
ATOM   476  C C   . GLY A 1 66  ? 25.314 4.415   30.981 1.00 13.15 ? 66   GLY A C   1 
ATOM   477  O O   . GLY A 1 66  ? 25.502 4.219   29.777 1.00 12.65 ? 66   GLY A O   1 
ATOM   478  N N   . GLY A 1 67  ? 24.155 4.840   31.483 1.00 12.27 ? 67   GLY A N   1 
ATOM   479  C CA  . GLY A 1 67  ? 23.041 5.214   30.635 1.00 13.50 ? 67   GLY A CA  1 
ATOM   480  C C   . GLY A 1 67  ? 23.123 6.689   30.285 1.00 13.59 ? 67   GLY A C   1 
ATOM   481  O O   . GLY A 1 67  ? 22.484 7.149   29.339 1.00 15.63 ? 67   GLY A O   1 
ATOM   482  N N   . VAL A 1 68  ? 23.937 7.422   31.044 1.00 12.41 ? 68   VAL A N   1 
ATOM   483  C CA  . VAL A 1 68  ? 24.127 8.861   30.855 1.00 12.09 ? 68   VAL A CA  1 
ATOM   484  C C   . VAL A 1 68  ? 25.574 9.202   30.464 1.00 11.89 ? 68   VAL A C   1 
ATOM   485  O O   . VAL A 1 68  ? 26.228 10.057  31.078 1.00 10.79 ? 68   VAL A O   1 
ATOM   486  C CB  . VAL A 1 68  ? 23.666 9.661   32.124 1.00 12.33 ? 68   VAL A CB  1 
ATOM   487  C CG1 . VAL A 1 68  ? 22.176 9.515   32.320 1.00 11.16 ? 68   VAL A CG1 1 
ATOM   488  C CG2 . VAL A 1 68  ? 24.375 9.168   33.384 1.00 11.86 ? 68   VAL A CG2 1 
ATOM   489  N N   . GLN A 1 69  ? 26.045 8.562   29.392 1.00 10.83 ? 69   GLN A N   1 
ATOM   490  C CA  . GLN A 1 69  ? 27.409 8.753   28.890 1.00 11.35 ? 69   GLN A CA  1 
ATOM   491  C C   . GLN A 1 69  ? 27.692 10.138  28.302 1.00 10.33 ? 69   GLN A C   1 
ATOM   492  O O   . GLN A 1 69  ? 28.816 10.436  27.897 1.00 11.31 ? 69   GLN A O   1 
ATOM   493  C CB  . GLN A 1 69  ? 27.793 7.632   27.929 1.00 11.94 ? 69   GLN A CB  1 
ATOM   494  C CG  . GLN A 1 69  ? 27.947 6.284   28.625 1.00 13.14 ? 69   GLN A CG  1 
ATOM   495  C CD  . GLN A 1 69  ? 28.019 5.107   27.669 1.00 12.67 ? 69   GLN A CD  1 
ATOM   496  O OE1 . GLN A 1 69  ? 27.266 5.027   26.698 1.00 13.67 ? 69   GLN A OE1 1 
ATOM   497  N NE2 . GLN A 1 69  ? 28.911 4.167   27.962 1.00 13.44 ? 69   GLN A NE2 1 
ATOM   498  N N   . CYS A 1 70  ? 26.677 11.003  28.348 1.00 9.93  ? 70   CYS A N   1 
ATOM   499  C CA  . CYS A 1 70  ? 26.789 12.391  27.905 1.00 10.23 ? 70   CYS A CA  1 
ATOM   500  C C   . CYS A 1 70  ? 27.615 13.198  28.906 1.00 10.57 ? 70   CYS A C   1 
ATOM   501  O O   . CYS A 1 70  ? 28.013 14.328  28.630 1.00 11.34 ? 70   CYS A O   1 
ATOM   502  C CB  . CYS A 1 70  ? 25.404 13.006  27.681 1.00 10.52 ? 70   CYS A CB  1 
ATOM   503  S SG  . CYS A 1 70  ? 24.214 12.684  28.990 1.00 12.73 ? 70   CYS A SG  1 
ATOM   504  N N   . PHE A 1 71  ? 27.917 12.570  30.044 1.00 10.27 ? 71   PHE A N   1 
ATOM   505  C CA  . PHE A 1 71  ? 28.721 13.181  31.094 1.00 10.68 ? 71   PHE A CA  1 
ATOM   506  C C   . PHE A 1 71  ? 30.174 12.750  31.075 1.00 10.99 ? 71   PHE A C   1 
ATOM   507  O O   . PHE A 1 71  ? 30.930 13.034  32.007 1.00 11.33 ? 71   PHE A O   1 
ATOM   508  C CB  . PHE A 1 71  ? 28.104 12.936  32.463 1.00 10.67 ? 71   PHE A CB  1 
ATOM   509  C CG  . PHE A 1 71  ? 26.862 13.717  32.684 1.00 11.91 ? 71   PHE A CG  1 
ATOM   510  C CD1 . PHE A 1 71  ? 26.928 15.102  32.915 1.00 9.68  ? 71   PHE A CD1 1 
ATOM   511  C CD2 . PHE A 1 71  ? 25.611 13.097  32.590 1.00 12.90 ? 71   PHE A CD2 1 
ATOM   512  C CE1 . PHE A 1 71  ? 25.753 15.862  33.047 1.00 11.37 ? 71   PHE A CE1 1 
ATOM   513  C CE2 . PHE A 1 71  ? 24.433 13.840  32.716 1.00 12.56 ? 71   PHE A CE2 1 
ATOM   514  C CZ  . PHE A 1 71  ? 24.497 15.230  32.946 1.00 13.11 ? 71   PHE A CZ  1 
ATOM   515  N N   . SER A 1 72  ? 30.564 12.083  29.991 1.00 11.63 ? 72   SER A N   1 
ATOM   516  C CA  . SER A 1 72  ? 31.940 11.635  29.802 1.00 12.11 ? 72   SER A CA  1 
ATOM   517  C C   . SER A 1 72  ? 32.802 12.848  29.485 1.00 12.05 ? 72   SER A C   1 
ATOM   518  O O   . SER A 1 72  ? 32.322 13.813  28.876 1.00 11.84 ? 72   SER A O   1 
ATOM   519  C CB  . SER A 1 72  ? 32.036 10.650  28.632 1.00 12.09 ? 72   SER A CB  1 
ATOM   520  O OG  . SER A 1 72  ? 31.238 9.501   28.847 1.00 12.76 ? 72   SER A OG  1 
ATOM   521  N N   . ARG A 1 73  ? 34.042 12.833  29.963 1.00 11.91 ? 73   ARG A N   1 
ATOM   522  C CA  . ARG A 1 73  ? 34.945 13.931  29.670 1.00 11.33 ? 73   ARG A CA  1 
ATOM   523  C C   . ARG A 1 73  ? 35.638 13.641  28.361 1.00 10.35 ? 73   ARG A C   1 
ATOM   524  O O   . ARG A 1 73  ? 36.389 12.668  28.242 1.00 10.66 ? 73   ARG A O   1 
ATOM   525  C CB  . ARG A 1 73  ? 36.003 14.137  30.754 1.00 9.66  ? 73   ARG A CB  1 
ATOM   526  C CG  . ARG A 1 73  ? 36.869 15.366  30.489 1.00 12.23 ? 73   ARG A CG  1 
ATOM   527  C CD  . ARG A 1 73  ? 37.969 15.536  31.509 1.00 13.09 ? 73   ARG A CD  1 
ATOM   528  N NE  . ARG A 1 73  ? 39.089 14.599  31.388 1.00 14.16 ? 73   ARG A NE  1 
ATOM   529  C CZ  . ARG A 1 73  ? 40.112 14.728  30.542 1.00 12.49 ? 73   ARG A CZ  1 
ATOM   530  N NH1 . ARG A 1 73  ? 40.176 15.754  29.702 1.00 12.38 ? 73   ARG A NH1 1 
ATOM   531  N NH2 . ARG A 1 73  ? 41.116 13.862  30.591 1.00 13.39 ? 73   ARG A NH2 1 
ATOM   532  N N   . TYR A 1 74  ? 35.330 14.467  27.371 1.00 10.52 ? 74   TYR A N   1 
ATOM   533  C CA  . TYR A 1 74  ? 35.962 14.349  26.074 1.00 11.87 ? 74   TYR A CA  1 
ATOM   534  C C   . TYR A 1 74  ? 37.015 15.432  26.054 1.00 11.52 ? 74   TYR A C   1 
ATOM   535  O O   . TYR A 1 74  ? 36.681 16.615  26.176 1.00 12.83 ? 74   TYR A O   1 
ATOM   536  C CB  . TYR A 1 74  ? 34.960 14.550  24.939 1.00 11.36 ? 74   TYR A CB  1 
ATOM   537  C CG  . TYR A 1 74  ? 34.323 13.264  24.486 1.00 11.05 ? 74   TYR A CG  1 
ATOM   538  C CD1 . TYR A 1 74  ? 33.308 12.649  25.252 1.00 11.10 ? 74   TYR A CD1 1 
ATOM   539  C CD2 . TYR A 1 74  ? 34.735 12.639  23.292 1.00 9.37  ? 74   TYR A CD2 1 
ATOM   540  C CE1 . TYR A 1 74  ? 32.709 11.431  24.837 1.00 11.16 ? 74   TYR A CE1 1 
ATOM   541  C CE2 . TYR A 1 74  ? 34.147 11.414  22.864 1.00 10.10 ? 74   TYR A CE2 1 
ATOM   542  C CZ  . TYR A 1 74  ? 33.134 10.822  23.647 1.00 10.72 ? 74   TYR A CZ  1 
ATOM   543  O OH  . TYR A 1 74  ? 32.556 9.640   23.255 1.00 9.30  ? 74   TYR A OH  1 
ATOM   544  N N   . PRO A 1 75  ? 38.311 15.043  25.999 1.00 11.87 ? 75   PRO A N   1 
ATOM   545  C CA  . PRO A 1 75  ? 39.410 16.016  25.967 1.00 10.80 ? 75   PRO A CA  1 
ATOM   546  C C   . PRO A 1 75  ? 39.216 16.965  24.783 1.00 12.63 ? 75   PRO A C   1 
ATOM   547  O O   . PRO A 1 75  ? 38.585 16.583  23.792 1.00 11.38 ? 75   PRO A O   1 
ATOM   548  C CB  . PRO A 1 75  ? 40.634 15.131  25.764 1.00 12.02 ? 75   PRO A CB  1 
ATOM   549  C CG  . PRO A 1 75  ? 40.264 13.864  26.462 1.00 11.39 ? 75   PRO A CG  1 
ATOM   550  C CD  . PRO A 1 75  ? 38.844 13.665  26.002 1.00 11.20 ? 75   PRO A CD  1 
ATOM   551  N N   . ASP A 1 76  ? 39.700 18.200  24.908 1.00 13.08 ? 76   ASP A N   1 
ATOM   552  C CA  . ASP A 1 76  ? 39.554 19.207  23.851 1.00 13.29 ? 76   ASP A CA  1 
ATOM   553  C C   . ASP A 1 76  ? 39.889 18.740  22.428 1.00 13.22 ? 76   ASP A C   1 
ATOM   554  O O   . ASP A 1 76  ? 39.116 19.002  21.502 1.00 15.95 ? 76   ASP A O   1 
ATOM   555  C CB  . ASP A 1 76  ? 40.334 20.482  24.189 1.00 14.68 ? 76   ASP A CB  1 
ATOM   556  C CG  . ASP A 1 76  ? 40.091 21.590  23.180 1.00 15.49 ? 76   ASP A CG  1 
ATOM   557  O OD1 . ASP A 1 76  ? 38.995 22.187  23.199 1.00 14.85 ? 76   ASP A OD1 1 
ATOM   558  O OD2 . ASP A 1 76  ? 40.979 21.819  22.336 1.00 18.27 ? 76   ASP A OD2 1 
ATOM   559  N N   . HIS A 1 77  ? 40.987 17.994  22.279 1.00 14.49 ? 77   HIS A N   1 
ATOM   560  C CA  . HIS A 1 77  ? 41.414 17.485  20.972 1.00 14.55 ? 77   HIS A CA  1 
ATOM   561  C C   . HIS A 1 77  ? 40.470 16.422  20.379 1.00 14.61 ? 77   HIS A C   1 
ATOM   562  O O   . HIS A 1 77  ? 40.544 16.110  19.191 1.00 15.64 ? 77   HIS A O   1 
ATOM   563  C CB  . HIS A 1 77  ? 42.868 16.967  21.039 1.00 15.52 ? 77   HIS A CB  1 
ATOM   564  C CG  . HIS A 1 77  ? 43.042 15.684  21.798 1.00 15.56 ? 77   HIS A CG  1 
ATOM   565  N ND1 . HIS A 1 77  ? 43.219 15.639  23.164 1.00 18.27 ? 77   HIS A ND1 1 
ATOM   566  C CD2 . HIS A 1 77  ? 43.094 14.399  21.372 1.00 16.56 ? 77   HIS A CD2 1 
ATOM   567  C CE1 . HIS A 1 77  ? 43.373 14.384  23.545 1.00 17.65 ? 77   HIS A CE1 1 
ATOM   568  N NE2 . HIS A 1 77  ? 43.300 13.612  22.478 1.00 17.08 ? 77   HIS A NE2 1 
ATOM   569  N N   . MET A 1 78  ? 39.594 15.888  21.230 1.00 13.80 ? 78   MET A N   1 
ATOM   570  C CA  . MET A 1 78  ? 38.633 14.843  20.868 1.00 15.77 ? 78   MET A CA  1 
ATOM   571  C C   . MET A 1 78  ? 37.166 15.267  20.854 1.00 14.45 ? 78   MET A C   1 
ATOM   572  O O   . MET A 1 78  ? 36.294 14.420  20.638 1.00 14.92 ? 78   MET A O   1 
ATOM   573  C CB  . MET A 1 78  ? 38.740 13.688  21.864 1.00 17.03 ? 78   MET A CB  1 
ATOM   574  C CG  . MET A 1 78  ? 39.878 12.751  21.655 1.00 19.14 ? 78   MET A CG  1 
ATOM   575  S SD  . MET A 1 78  ? 39.767 11.445  22.861 1.00 15.98 ? 78   MET A SD  1 
ATOM   576  C CE  . MET A 1 78  ? 38.492 10.447  22.126 1.00 16.78 ? 78   MET A CE  1 
ATOM   577  N N   . LYS A 1 79  ? 36.893 16.551  21.085 1.00 14.74 ? 79   LYS A N   1 
ATOM   578  C CA  . LYS A 1 79  ? 35.522 17.071  21.142 1.00 15.98 ? 79   LYS A CA  1 
ATOM   579  C C   . LYS A 1 79  ? 34.618 16.890  19.925 1.00 15.83 ? 79   LYS A C   1 
ATOM   580  O O   . LYS A 1 79  ? 33.395 16.823  20.072 1.00 15.28 ? 79   LYS A O   1 
ATOM   581  C CB  . LYS A 1 79  ? 35.510 18.524  21.618 1.00 18.41 ? 79   LYS A CB  1 
ATOM   582  C CG  . LYS A 1 79  ? 35.588 18.638  23.134 1.00 22.62 ? 79   LYS A CG  1 
ATOM   583  C CD  . LYS A 1 79  ? 35.446 20.070  23.601 1.00 27.16 ? 79   LYS A CD  1 
ATOM   584  C CE  . LYS A 1 79  ? 35.426 20.148  25.118 1.00 30.17 ? 79   LYS A CE  1 
ATOM   585  N NZ  . LYS A 1 79  ? 35.168 21.536  25.588 1.00 33.27 ? 79   LYS A NZ  1 
ATOM   586  N N   . GLN A 1 80  ? 35.222 16.720  18.747 1.00 14.74 ? 80   GLN A N   1 
ATOM   587  C CA  . GLN A 1 80  ? 34.469 16.512  17.506 1.00 14.76 ? 80   GLN A CA  1 
ATOM   588  C C   . GLN A 1 80  ? 33.947 15.066  17.406 1.00 13.98 ? 80   GLN A C   1 
ATOM   589  O O   . GLN A 1 80  ? 33.213 14.718  16.479 1.00 13.64 ? 80   GLN A O   1 
ATOM   590  C CB  . GLN A 1 80  ? 35.314 16.902  16.270 1.00 15.44 ? 80   GLN A CB  1 
ATOM   591  C CG  . GLN A 1 80  ? 36.533 16.012  15.945 1.00 18.83 ? 80   GLN A CG  1 
ATOM   592  C CD  . GLN A 1 80  ? 37.849 16.480  16.562 1.00 21.33 ? 80   GLN A CD  1 
ATOM   593  O OE1 . GLN A 1 80  ? 38.877 16.522  15.882 1.00 22.67 ? 80   GLN A OE1 1 
ATOM   594  N NE2 . GLN A 1 80  ? 37.832 16.800  17.851 1.00 17.97 ? 80   GLN A NE2 1 
ATOM   595  N N   . HIS A 1 81  ? 34.294 14.256  18.407 1.00 12.91 ? 81   HIS A N   1 
ATOM   596  C CA  . HIS A 1 81  ? 33.902 12.852  18.474 1.00 12.03 ? 81   HIS A CA  1 
ATOM   597  C C   . HIS A 1 81  ? 32.839 12.559  19.541 1.00 11.99 ? 81   HIS A C   1 
ATOM   598  O O   . HIS A 1 81  ? 32.492 11.398  19.779 1.00 11.63 ? 81   HIS A O   1 
ATOM   599  C CB  . HIS A 1 81  ? 35.142 11.977  18.711 1.00 14.57 ? 81   HIS A CB  1 
ATOM   600  C CG  . HIS A 1 81  ? 36.202 12.150  17.671 1.00 16.54 ? 81   HIS A CG  1 
ATOM   601  N ND1 . HIS A 1 81  ? 36.060 11.689  16.380 1.00 17.58 ? 81   HIS A ND1 1 
ATOM   602  C CD2 . HIS A 1 81  ? 37.397 12.783  17.716 1.00 17.44 ? 81   HIS A CD2 1 
ATOM   603  C CE1 . HIS A 1 81  ? 37.121 12.039  15.674 1.00 19.52 ? 81   HIS A CE1 1 
ATOM   604  N NE2 . HIS A 1 81  ? 37.947 12.702  16.462 1.00 19.10 ? 81   HIS A NE2 1 
ATOM   605  N N   . ASP A 1 82  ? 32.305 13.615  20.149 1.00 11.12 ? 82   ASP A N   1 
ATOM   606  C CA  . ASP A 1 82  ? 31.294 13.486  21.196 1.00 11.96 ? 82   ASP A CA  1 
ATOM   607  C C   . ASP A 1 82  ? 29.869 13.447  20.647 1.00 12.59 ? 82   ASP A C   1 
ATOM   608  O O   . ASP A 1 82  ? 29.204 14.484  20.547 1.00 14.82 ? 82   ASP A O   1 
ATOM   609  C CB  . ASP A 1 82  ? 31.454 14.626  22.215 1.00 10.69 ? 82   ASP A CB  1 
ATOM   610  C CG  . ASP A 1 82  ? 30.744 14.354  23.547 1.00 12.19 ? 82   ASP A CG  1 
ATOM   611  O OD1 . ASP A 1 82  ? 29.830 13.499  23.631 1.00 11.53 ? 82   ASP A OD1 1 
ATOM   612  O OD2 . ASP A 1 82  ? 31.130 14.999  24.538 1.00 11.14 ? 82   ASP A OD2 1 
ATOM   613  N N   . PHE A 1 83  ? 29.390 12.234  20.359 1.00 13.58 ? 83   PHE A N   1 
ATOM   614  C CA  . PHE A 1 83  ? 28.038 12.017  19.846 1.00 12.47 ? 83   PHE A CA  1 
ATOM   615  C C   . PHE A 1 83  ? 27.000 12.371  20.907 1.00 12.79 ? 83   PHE A C   1 
ATOM   616  O O   . PHE A 1 83  ? 26.000 13.031  20.618 1.00 12.96 ? 83   PHE A O   1 
ATOM   617  C CB  . PHE A 1 83  ? 27.839 10.538  19.418 1.00 12.00 ? 83   PHE A CB  1 
ATOM   618  C CG  . PHE A 1 83  ? 26.376 10.138  19.217 1.00 13.46 ? 83   PHE A CG  1 
ATOM   619  C CD1 . PHE A 1 83  ? 25.676 10.529  18.056 1.00 13.74 ? 83   PHE A CD1 1 
ATOM   620  C CD2 . PHE A 1 83  ? 25.665 9.460   20.242 1.00 13.13 ? 83   PHE A CD2 1 
ATOM   621  C CE1 . PHE A 1 83  ? 24.283 10.264  17.918 1.00 12.84 ? 83   PHE A CE1 1 
ATOM   622  C CE2 . PHE A 1 83  ? 24.279 9.192   20.120 1.00 14.00 ? 83   PHE A CE2 1 
ATOM   623  C CZ  . PHE A 1 83  ? 23.584 9.596   18.957 1.00 15.65 ? 83   PHE A CZ  1 
ATOM   624  N N   . PHE A 1 84  ? 27.215 11.809  22.093 1.00 12.34 ? 84   PHE A N   1 
ATOM   625  C CA  . PHE A 1 84  ? 26.337 11.941  23.246 1.00 12.17 ? 84   PHE A CA  1 
ATOM   626  C C   . PHE A 1 84  ? 25.794 13.334  23.533 1.00 12.16 ? 84   PHE A C   1 
ATOM   627  O O   . PHE A 1 84  ? 24.576 13.526  23.582 1.00 12.29 ? 84   PHE A O   1 
ATOM   628  C CB  . PHE A 1 84  ? 27.035 11.390  24.480 1.00 11.36 ? 84   PHE A CB  1 
ATOM   629  C CG  . PHE A 1 84  ? 27.495 9.972   24.348 1.00 10.37 ? 84   PHE A CG  1 
ATOM   630  C CD1 . PHE A 1 84  ? 26.569 8.909   24.321 1.00 10.18 ? 84   PHE A CD1 1 
ATOM   631  C CD2 . PHE A 1 84  ? 28.871 9.685   24.297 1.00 10.03 ? 84   PHE A CD2 1 
ATOM   632  C CE1 . PHE A 1 84  ? 27.005 7.562   24.250 1.00 11.37 ? 84   PHE A CE1 1 
ATOM   633  C CE2 . PHE A 1 84  ? 29.334 8.349   24.226 1.00 12.90 ? 84   PHE A CE2 1 
ATOM   634  C CZ  . PHE A 1 84  ? 28.398 7.281   24.205 1.00 12.77 ? 84   PHE A CZ  1 
ATOM   635  N N   . LYS A 1 85  ? 26.702 14.304  23.657 1.00 12.23 ? 85   LYS A N   1 
ATOM   636  C CA  . LYS A 1 85  ? 26.330 15.690  23.920 1.00 12.15 ? 85   LYS A CA  1 
ATOM   637  C C   . LYS A 1 85  ? 25.708 16.376  22.709 1.00 13.22 ? 85   LYS A C   1 
ATOM   638  O O   . LYS A 1 85  ? 24.811 17.198  22.867 1.00 12.12 ? 85   LYS A O   1 
ATOM   639  C CB  . LYS A 1 85  ? 27.537 16.501  24.383 1.00 10.70 ? 85   LYS A CB  1 
ATOM   640  C CG  . LYS A 1 85  ? 28.099 16.102  25.737 1.00 11.47 ? 85   LYS A CG  1 
ATOM   641  C CD  . LYS A 1 85  ? 29.245 17.031  26.120 1.00 11.30 ? 85   LYS A CD  1 
ATOM   642  C CE  . LYS A 1 85  ? 29.987 16.559  27.356 1.00 13.31 ? 85   LYS A CE  1 
ATOM   643  N NZ  . LYS A 1 85  ? 30.564 15.196  27.209 1.00 12.29 ? 85   LYS A NZ  1 
ATOM   644  N N   . SER A 1 86  ? 26.140 15.987  21.508 1.00 13.01 ? 86   SER A N   1 
ATOM   645  C CA  . SER A 1 86  ? 25.641 16.582  20.264 1.00 13.41 ? 86   SER A CA  1 
ATOM   646  C C   . SER A 1 86  ? 24.165 16.329  19.960 1.00 13.67 ? 86   SER A C   1 
ATOM   647  O O   . SER A 1 86  ? 23.545 17.106  19.237 1.00 12.69 ? 86   SER A O   1 
ATOM   648  C CB  . SER A 1 86  ? 26.494 16.146  19.073 1.00 13.05 ? 86   SER A CB  1 
ATOM   649  O OG  . SER A 1 86  ? 26.221 14.818  18.672 1.00 11.28 ? 86   SER A OG  1 
ATOM   650  N N   . ALA A 1 87  ? 23.626 15.239  20.511 1.00 13.13 ? 87   ALA A N   1 
ATOM   651  C CA  . ALA A 1 87  ? 22.220 14.861  20.326 1.00 14.55 ? 87   ALA A CA  1 
ATOM   652  C C   . ALA A 1 87  ? 21.294 15.620  21.277 1.00 13.84 ? 87   ALA A C   1 
ATOM   653  O O   . ALA A 1 87  ? 20.069 15.589  21.126 1.00 15.03 ? 87   ALA A O   1 
ATOM   654  C CB  . ALA A 1 87  ? 22.050 13.350  20.513 1.00 12.24 ? 87   ALA A CB  1 
ATOM   655  N N   . MET A 1 88  ? 21.896 16.327  22.232 1.00 14.57 ? 88   MET A N   1 
ATOM   656  C CA  . MET A 1 88  ? 21.165 17.102  23.233 1.00 14.43 ? 88   MET A CA  1 
ATOM   657  C C   . MET A 1 88  ? 20.787 18.492  22.685 1.00 14.24 ? 88   MET A C   1 
ATOM   658  O O   . MET A 1 88  ? 21.524 19.029  21.852 1.00 15.26 ? 88   MET A O   1 
ATOM   659  C CB  . MET A 1 88  ? 22.006 17.198  24.514 1.00 14.41 ? 88   MET A CB  1 
ATOM   660  C CG  . MET A 1 88  ? 22.239 15.851  25.187 1.00 12.71 ? 88   MET A CG  1 
ATOM   661  S SD  . MET A 1 88  ? 20.713 15.043  25.703 1.00 12.46 ? 88   MET A SD  1 
ATOM   662  C CE  . MET A 1 88  ? 21.300 13.474  26.079 1.00 13.08 ? 88   MET A CE  1 
ATOM   663  N N   . PRO A 1 89  ? 19.668 19.108  23.159 1.00 13.85 ? 89   PRO A N   1 
ATOM   664  C CA  . PRO A 1 89  ? 18.652 18.725  24.162 1.00 13.91 ? 89   PRO A CA  1 
ATOM   665  C C   . PRO A 1 89  ? 17.622 17.639  23.831 1.00 13.69 ? 89   PRO A C   1 
ATOM   666  O O   . PRO A 1 89  ? 17.106 16.995  24.743 1.00 12.50 ? 89   PRO A O   1 
ATOM   667  C CB  . PRO A 1 89  ? 17.982 20.057  24.487 1.00 13.90 ? 89   PRO A CB  1 
ATOM   668  C CG  . PRO A 1 89  ? 18.010 20.766  23.177 1.00 14.22 ? 89   PRO A CG  1 
ATOM   669  C CD  . PRO A 1 89  ? 19.403 20.482  22.674 1.00 12.93 ? 89   PRO A CD  1 
ATOM   670  N N   . GLU A 1 90  ? 17.389 17.401  22.537 1.00 14.35 ? 90   GLU A N   1 
ATOM   671  C CA  . GLU A 1 90  ? 16.416 16.406  22.053 1.00 15.56 ? 90   GLU A CA  1 
ATOM   672  C C   . GLU A 1 90  ? 16.696 14.991  22.564 1.00 14.04 ? 90   GLU A C   1 
ATOM   673  O O   . GLU A 1 90  ? 15.766 14.220  22.832 1.00 13.12 ? 90   GLU A O   1 
ATOM   674  C CB  . GLU A 1 90  ? 16.357 16.406  20.521 1.00 18.52 ? 90   GLU A CB  1 
ATOM   675  C CG  . GLU A 1 90  ? 15.853 17.712  19.875 1.00 23.15 ? 90   GLU A CG  1 
ATOM   676  C CD  . GLU A 1 90  ? 16.878 18.849  19.874 1.00 27.16 ? 90   GLU A CD  1 
ATOM   677  O OE1 . GLU A 1 90  ? 18.105 18.583  19.830 1.00 26.50 ? 90   GLU A OE1 1 
ATOM   678  O OE2 . GLU A 1 90  ? 16.447 20.022  19.916 1.00 30.93 ? 90   GLU A OE2 1 
ATOM   679  N N   . GLY A 1 91  ? 17.984 14.679  22.696 1.00 11.92 ? 91   GLY A N   1 
ATOM   680  C CA  . GLY A 1 91  ? 18.418 13.400  23.219 1.00 11.34 ? 91   GLY A CA  1 
ATOM   681  C C   . GLY A 1 91  ? 18.630 12.218  22.306 1.00 11.98 ? 91   GLY A C   1 
ATOM   682  O O   . GLY A 1 91  ? 18.622 12.341  21.078 1.00 11.18 ? 91   GLY A O   1 
ATOM   683  N N   . TYR A 1 92  ? 18.833 11.062  22.936 1.00 10.26 ? 92   TYR A N   1 
ATOM   684  C CA  . TYR A 1 92  ? 19.064 9.812   22.223 1.00 11.69 ? 92   TYR A CA  1 
ATOM   685  C C   . TYR A 1 92  ? 18.403 8.607   22.870 1.00 12.75 ? 92   TYR A C   1 
ATOM   686  O O   . TYR A 1 92  ? 18.108 8.612   24.072 1.00 13.54 ? 92   TYR A O   1 
ATOM   687  C CB  . TYR A 1 92  ? 20.578 9.548   22.018 1.00 11.59 ? 92   TYR A CB  1 
ATOM   688  C CG  . TYR A 1 92  ? 21.449 9.546   23.273 1.00 12.99 ? 92   TYR A CG  1 
ATOM   689  C CD1 . TYR A 1 92  ? 21.537 8.405   24.105 1.00 10.91 ? 92   TYR A CD1 1 
ATOM   690  C CD2 . TYR A 1 92  ? 22.194 10.686  23.634 1.00 12.04 ? 92   TYR A CD2 1 
ATOM   691  C CE1 . TYR A 1 92  ? 22.348 8.401   25.275 1.00 11.76 ? 92   TYR A CE1 1 
ATOM   692  C CE2 . TYR A 1 92  ? 23.008 10.691  24.804 1.00 12.97 ? 92   TYR A CE2 1 
ATOM   693  C CZ  . TYR A 1 92  ? 23.074 9.551   25.614 1.00 12.52 ? 92   TYR A CZ  1 
ATOM   694  O OH  . TYR A 1 92  ? 23.836 9.574   26.756 1.00 14.01 ? 92   TYR A OH  1 
ATOM   695  N N   . VAL A 1 93  ? 18.164 7.588   22.047 1.00 12.26 ? 93   VAL A N   1 
ATOM   696  C CA  . VAL A 1 93  ? 17.602 6.319   22.496 1.00 13.58 ? 93   VAL A CA  1 
ATOM   697  C C   . VAL A 1 93  ? 18.819 5.395   22.613 1.00 14.02 ? 93   VAL A C   1 
ATOM   698  O O   . VAL A 1 93  ? 19.593 5.266   21.663 1.00 14.71 ? 93   VAL A O   1 
ATOM   699  C CB  . VAL A 1 93  ? 16.592 5.710   21.469 1.00 12.42 ? 93   VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 93  ? 16.067 4.349   21.958 1.00 12.54 ? 93   VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 93  ? 15.425 6.649   21.243 1.00 12.94 ? 93   VAL A CG2 1 
ATOM   702  N N   . GLN A 1 94  ? 19.013 4.812   23.793 1.00 13.07 ? 94   GLN A N   1 
ATOM   703  C CA  . GLN A 1 94  ? 20.124 3.896   24.025 1.00 13.30 ? 94   GLN A CA  1 
ATOM   704  C C   . GLN A 1 94  ? 19.563 2.504   24.283 1.00 12.88 ? 94   GLN A C   1 
ATOM   705  O O   . GLN A 1 94  ? 18.722 2.321   25.167 1.00 12.96 ? 94   GLN A O   1 
ATOM   706  C CB  . GLN A 1 94  ? 20.989 4.360   25.204 1.00 14.47 ? 94   GLN A CB  1 
ATOM   707  C CG  . GLN A 1 94  ? 22.205 3.471   25.471 1.00 14.04 ? 94   GLN A CG  1 
ATOM   708  C CD  . GLN A 1 94  ? 23.161 4.071   26.472 1.00 16.32 ? 94   GLN A CD  1 
ATOM   709  O OE1 . GLN A 1 94  ? 23.794 5.093   26.206 1.00 16.98 ? 94   GLN A OE1 1 
ATOM   710  N NE2 . GLN A 1 94  ? 23.285 3.432   27.628 1.00 14.90 ? 94   GLN A NE2 1 
ATOM   711  N N   . GLU A 1 95  ? 19.995 1.546   23.464 1.00 12.57 ? 95   GLU A N   1 
ATOM   712  C CA  . GLU A 1 95  ? 19.565 0.155   23.578 1.00 13.36 ? 95   GLU A CA  1 
ATOM   713  C C   . GLU A 1 95  ? 20.759 -0.743  23.833 1.00 12.89 ? 95   GLU A C   1 
ATOM   714  O O   . GLU A 1 95  ? 21.829 -0.534  23.259 1.00 12.04 ? 95   GLU A O   1 
ATOM   715  C CB  . GLU A 1 95  ? 18.844 -0.313  22.308 1.00 16.52 ? 95   GLU A CB  1 
ATOM   716  C CG  . GLU A 1 95  ? 17.506 0.372   22.051 1.00 22.42 ? 95   GLU A CG  1 
ATOM   717  C CD  . GLU A 1 95  ? 16.825 -0.110  20.788 1.00 26.89 ? 95   GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 95  ? 15.686 -0.610  20.889 1.00 30.02 ? 95   GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 95  ? 17.422 0.018   19.696 1.00 31.43 ? 95   GLU A OE2 1 
ATOM   720  N N   . ARG A 1 96  ? 20.589 -1.697  24.749 1.00 11.23 ? 96   ARG A N   1 
ATOM   721  C CA  . ARG A 1 96  ? 21.641 -2.654  25.083 1.00 11.90 ? 96   ARG A CA  1 
ATOM   722  C C   . ARG A 1 96  ? 21.131 -4.078  25.223 1.00 12.47 ? 96   ARG A C   1 
ATOM   723  O O   . ARG A 1 96  ? 19.953 -4.312  25.502 1.00 11.39 ? 96   ARG A O   1 
ATOM   724  C CB  . ARG A 1 96  ? 22.353 -2.309  26.403 1.00 11.40 ? 96   ARG A CB  1 
ATOM   725  C CG  . ARG A 1 96  ? 23.248 -1.089  26.401 1.00 10.46 ? 96   ARG A CG  1 
ATOM   726  C CD  . ARG A 1 96  ? 24.492 -1.342  27.230 1.00 11.83 ? 96   ARG A CD  1 
ATOM   727  N NE  . ARG A 1 96  ? 25.339 -0.155  27.350 1.00 12.64 ? 96   ARG A NE  1 
ATOM   728  C CZ  . ARG A 1 96  ? 25.269 0.720   28.351 1.00 13.12 ? 96   ARG A CZ  1 
ATOM   729  N NH1 . ARG A 1 96  ? 24.386 0.554   29.328 1.00 14.23 ? 96   ARG A NH1 1 
ATOM   730  N NH2 . ARG A 1 96  ? 26.094 1.760   28.380 1.00 12.66 ? 96   ARG A NH2 1 
ATOM   731  N N   . THR A 1 97  ? 22.035 -5.012  24.949 1.00 11.44 ? 97   THR A N   1 
ATOM   732  C CA  . THR A 1 97  ? 21.806 -6.438  25.116 1.00 10.14 ? 97   THR A CA  1 
ATOM   733  C C   . THR A 1 97  ? 23.003 -6.811  25.978 1.00 8.90  ? 97   THR A C   1 
ATOM   734  O O   . THR A 1 97  ? 24.161 -6.658  25.566 1.00 9.94  ? 97   THR A O   1 
ATOM   735  C CB  . THR A 1 97  ? 21.785 -7.235  23.781 1.00 11.23 ? 97   THR A CB  1 
ATOM   736  O OG1 . THR A 1 97  ? 20.609 -6.883  23.043 1.00 10.47 ? 97   THR A OG1 1 
ATOM   737  C CG2 . THR A 1 97  ? 21.743 -8.750  24.048 1.00 11.78 ? 97   THR A CG2 1 
ATOM   738  N N   . ILE A 1 98  ? 22.705 -7.137  27.229 1.00 8.93  ? 98   ILE A N   1 
ATOM   739  C CA  . ILE A 1 98  ? 23.717 -7.519  28.209 1.00 9.12  ? 98   ILE A CA  1 
ATOM   740  C C   . ILE A 1 98  ? 23.626 -9.030  28.401 1.00 9.64  ? 98   ILE A C   1 
ATOM   741  O O   . ILE A 1 98  ? 22.688 -9.528  29.014 1.00 10.49 ? 98   ILE A O   1 
ATOM   742  C CB  . ILE A 1 98  ? 23.509 -6.771  29.560 1.00 9.72  ? 98   ILE A CB  1 
ATOM   743  C CG1 . ILE A 1 98  ? 23.509 -5.249  29.332 1.00 10.40 ? 98   ILE A CG1 1 
ATOM   744  C CG2 . ILE A 1 98  ? 24.581 -7.187  30.556 1.00 9.16  ? 98   ILE A CG2 1 
ATOM   745  C CD1 . ILE A 1 98  ? 23.074 -4.402  30.527 1.00 10.34 ? 98   ILE A CD1 1 
ATOM   746  N N   . SER A 1 99  ? 24.625 -9.744  27.892 1.00 11.08 ? 99   SER A N   1 
ATOM   747  C CA  . SER A 1 99  ? 24.656 -11.199 27.975 1.00 11.53 ? 99   SER A CA  1 
ATOM   748  C C   . SER A 1 99  ? 25.582 -11.725 29.062 1.00 11.77 ? 99   SER A C   1 
ATOM   749  O O   . SER A 1 99  ? 26.799 -11.564 28.982 1.00 10.12 ? 99   SER A O   1 
ATOM   750  C CB  . SER A 1 99  ? 25.058 -11.785 26.621 1.00 12.48 ? 99   SER A CB  1 
ATOM   751  O OG  . SER A 1 99  ? 24.213 -11.311 25.585 1.00 12.61 ? 99   SER A OG  1 
ATOM   752  N N   . PHE A 1 100 ? 24.993 -12.339 30.088 1.00 10.47 ? 100  PHE A N   1 
ATOM   753  C CA  . PHE A 1 100 ? 25.766 -12.911 31.184 1.00 10.99 ? 100  PHE A CA  1 
ATOM   754  C C   . PHE A 1 100 ? 26.174 -14.323 30.798 1.00 11.79 ? 100  PHE A C   1 
ATOM   755  O O   . PHE A 1 100 ? 25.313 -15.150 30.479 1.00 12.20 ? 100  PHE A O   1 
ATOM   756  C CB  . PHE A 1 100 ? 24.958 -12.920 32.485 1.00 11.83 ? 100  PHE A CB  1 
ATOM   757  C CG  . PHE A 1 100 ? 24.625 -11.551 32.996 1.00 12.10 ? 100  PHE A CG  1 
ATOM   758  C CD1 . PHE A 1 100 ? 25.481 -10.899 33.907 1.00 11.54 ? 100  PHE A CD1 1 
ATOM   759  C CD2 . PHE A 1 100 ? 23.466 -10.889 32.554 1.00 11.51 ? 100  PHE A CD2 1 
ATOM   760  C CE1 . PHE A 1 100 ? 25.186 -9.589  34.373 1.00 11.32 ? 100  PHE A CE1 1 
ATOM   761  C CE2 . PHE A 1 100 ? 23.154 -9.586  33.005 1.00 12.47 ? 100  PHE A CE2 1 
ATOM   762  C CZ  . PHE A 1 100 ? 24.017 -8.933  33.917 1.00 11.95 ? 100  PHE A CZ  1 
ATOM   763  N N   . LYS A 1 101 ? 27.487 -14.572 30.792 1.00 11.81 ? 101  LYS A N   1 
ATOM   764  C CA  . LYS A 1 101 ? 28.067 -15.876 30.435 1.00 13.05 ? 101  LYS A CA  1 
ATOM   765  C C   . LYS A 1 101 ? 27.492 -16.992 31.301 1.00 13.79 ? 101  LYS A C   1 
ATOM   766  O O   . LYS A 1 101 ? 27.477 -16.889 32.536 1.00 12.55 ? 101  LYS A O   1 
ATOM   767  C CB  . LYS A 1 101 ? 29.602 -15.848 30.555 1.00 14.02 ? 101  LYS A CB  1 
ATOM   768  C CG  . LYS A 1 101 ? 30.309 -17.137 30.102 1.00 16.39 ? 101  LYS A CG  1 
ATOM   769  C CD  . LYS A 1 101 ? 31.801 -17.110 30.410 1.00 20.33 ? 101  LYS A CD  1 
ATOM   770  C CE  . LYS A 1 101 ? 32.443 -18.464 30.146 1.00 22.43 ? 101  LYS A CE  1 
ATOM   771  N NZ  . LYS A 1 101 ? 33.903 -18.448 30.428 1.00 22.85 ? 101  LYS A NZ  1 
ATOM   772  N N   . ASP A 1 102 ? 26.972 -18.018 30.617 1.00 13.64 ? 102  ASP A N   1 
ATOM   773  C CA  . ASP A 1 102 ? 26.346 -19.206 31.210 1.00 15.83 ? 102  ASP A CA  1 
ATOM   774  C C   . ASP A 1 102 ? 25.091 -18.896 32.037 1.00 15.71 ? 102  ASP A C   1 
ATOM   775  O O   . ASP A 1 102 ? 24.712 -19.655 32.930 1.00 16.39 ? 102  ASP A O   1 
ATOM   776  C CB  . ASP A 1 102 ? 27.367 -20.048 32.007 1.00 18.37 ? 102  ASP A CB  1 
ATOM   777  C CG  . ASP A 1 102 ? 28.398 -20.731 31.111 1.00 21.23 ? 102  ASP A CG  1 
ATOM   778  O OD1 . ASP A 1 102 ? 28.026 -21.223 30.022 1.00 25.93 ? 102  ASP A OD1 1 
ATOM   779  O OD2 . ASP A 1 102 ? 29.584 -20.784 31.501 1.00 24.50 ? 102  ASP A OD2 1 
ATOM   780  N N   . ASP A 1 103 ? 24.454 -17.768 31.722 1.00 13.83 ? 103  ASP A N   1 
ATOM   781  C CA  . ASP A 1 103 ? 23.235 -17.338 32.403 1.00 12.95 ? 103  ASP A CA  1 
ATOM   782  C C   . ASP A 1 103 ? 22.345 -16.566 31.415 1.00 12.84 ? 103  ASP A C   1 
ATOM   783  O O   . ASP A 1 103 ? 22.530 -16.674 30.197 1.00 10.27 ? 103  ASP A O   1 
ATOM   784  C CB  . ASP A 1 103 ? 23.583 -16.499 33.649 1.00 12.31 ? 103  ASP A CB  1 
ATOM   785  C CG  . ASP A 1 103 ? 22.610 -16.720 34.805 1.00 14.53 ? 103  ASP A CG  1 
ATOM   786  O OD1 . ASP A 1 103 ? 21.414 -16.971 34.556 1.00 15.50 ? 103  ASP A OD1 1 
ATOM   787  O OD2 . ASP A 1 103 ? 23.039 -16.629 35.972 1.00 12.49 ? 103  ASP A OD2 1 
ATOM   788  N N   . GLY A 1 104 ? 21.379 -15.807 31.935 1.00 11.49 ? 104  GLY A N   1 
ATOM   789  C CA  . GLY A 1 104 ? 20.466 -15.056 31.086 1.00 11.08 ? 104  GLY A CA  1 
ATOM   790  C C   . GLY A 1 104 ? 20.960 -13.738 30.532 1.00 10.69 ? 104  GLY A C   1 
ATOM   791  O O   . GLY A 1 104 ? 22.150 -13.431 30.602 1.00 10.88 ? 104  GLY A O   1 
ATOM   792  N N   . ASN A 1 105 ? 20.025 -12.943 30.011 1.00 10.92 ? 105  ASN A N   1 
ATOM   793  C CA  . ASN A 1 105 ? 20.359 -11.648 29.422 1.00 10.59 ? 105  ASN A CA  1 
ATOM   794  C C   . ASN A 1 105 ? 19.397 -10.515 29.757 1.00 10.75 ? 105  ASN A C   1 
ATOM   795  O O   . ASN A 1 105 ? 18.227 -10.756 30.059 1.00 10.73 ? 105  ASN A O   1 
ATOM   796  C CB  . ASN A 1 105 ? 20.497 -11.769 27.887 1.00 11.05 ? 105  ASN A CB  1 
ATOM   797  C CG  . ASN A 1 105 ? 19.193 -12.177 27.198 1.00 11.75 ? 105  ASN A CG  1 
ATOM   798  O OD1 . ASN A 1 105 ? 18.372 -11.327 26.840 1.00 12.53 ? 105  ASN A OD1 1 
ATOM   799  N ND2 . ASN A 1 105 ? 19.003 -13.477 27.015 1.00 11.39 ? 105  ASN A ND2 1 
ATOM   800  N N   . TYR A 1 106 ? 19.916 -9.286  29.714 1.00 11.25 ? 106  TYR A N   1 
ATOM   801  C CA  . TYR A 1 106 ? 19.119 -8.083  29.930 1.00 10.79 ? 106  TYR A CA  1 
ATOM   802  C C   . TYR A 1 106 ? 19.008 -7.393  28.582 1.00 11.42 ? 106  TYR A C   1 
ATOM   803  O O   . TYR A 1 106 ? 19.985 -7.325  27.832 1.00 11.56 ? 106  TYR A O   1 
ATOM   804  C CB  . TYR A 1 106 ? 19.801 -7.052  30.842 1.00 9.59  ? 106  TYR A CB  1 
ATOM   805  C CG  . TYR A 1 106 ? 19.951 -7.344  32.314 1.00 11.31 ? 106  TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 106 ? 19.176 -8.326  32.968 1.00 9.21  ? 106  TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 106 ? 20.883 -6.612  33.077 1.00 10.08 ? 106  TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 106 ? 19.334 -8.574  34.357 1.00 9.85  ? 106  TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 106 ? 21.047 -6.850  34.462 1.00 11.70 ? 106  TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 106 ? 20.272 -7.834  35.090 1.00 12.05 ? 106  TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 106 ? 20.454 -8.093  36.423 1.00 10.19 ? 106  TYR A OH  1 
ATOM   812  N N   . LYS A 1 107 ? 17.810 -6.914  28.275 1.00 11.06 ? 107  LYS A N   1 
ATOM   813  C CA  . LYS A 1 107 ? 17.565 -6.141  27.067 1.00 13.40 ? 107  LYS A CA  1 
ATOM   814  C C   . LYS A 1 107 ? 17.038 -4.830  27.623 1.00 12.90 ? 107  LYS A C   1 
ATOM   815  O O   . LYS A 1 107 ? 16.056 -4.818  28.371 1.00 11.81 ? 107  LYS A O   1 
ATOM   816  C CB  . LYS A 1 107 ? 16.546 -6.803  26.142 1.00 14.51 ? 107  LYS A CB  1 
ATOM   817  C CG  . LYS A 1 107 ? 17.175 -7.757  25.137 1.00 19.74 ? 107  LYS A CG  1 
ATOM   818  C CD  . LYS A 1 107 ? 16.198 -8.102  24.025 1.00 22.75 ? 107  LYS A CD  1 
ATOM   819  C CE  . LYS A 1 107 ? 16.920 -8.690  22.819 1.00 26.53 ? 107  LYS A CE  1 
ATOM   820  N NZ  . LYS A 1 107 ? 15.985 -8.900  21.670 1.00 29.19 ? 107  LYS A NZ  1 
ATOM   821  N N   . THR A 1 108 ? 17.768 -3.750  27.354 1.00 12.70 ? 108  THR A N   1 
ATOM   822  C CA  . THR A 1 108 ? 17.399 -2.429  27.851 1.00 12.67 ? 108  THR A CA  1 
ATOM   823  C C   . THR A 1 108 ? 17.115 -1.417  26.749 1.00 12.76 ? 108  THR A C   1 
ATOM   824  O O   . THR A 1 108 ? 17.710 -1.471  25.677 1.00 12.38 ? 108  THR A O   1 
ATOM   825  C CB  . THR A 1 108 ? 18.507 -1.818  28.780 1.00 13.28 ? 108  THR A CB  1 
ATOM   826  O OG1 . THR A 1 108 ? 19.705 -1.593  28.032 1.00 15.70 ? 108  THR A OG1 1 
ATOM   827  C CG2 . THR A 1 108 ? 18.839 -2.733  29.935 1.00 14.13 ? 108  THR A CG2 1 
ATOM   828  N N   . ARG A 1 109 ? 16.161 -0.530  27.016 1.00 12.85 ? 109  ARG A N   1 
ATOM   829  C CA  . ARG A 1 109 ? 15.813 0.553   26.103 1.00 13.07 ? 109  ARG A CA  1 
ATOM   830  C C   . ARG A 1 109 ? 15.685 1.771   27.001 1.00 14.66 ? 109  ARG A C   1 
ATOM   831  O O   . ARG A 1 109 ? 14.940 1.755   27.987 1.00 14.19 ? 109  ARG A O   1 
ATOM   832  C CB  . ARG A 1 109 ? 14.506 0.309   25.342 1.00 13.57 ? 109  ARG A CB  1 
ATOM   833  C CG  . ARG A 1 109 ? 14.281 1.352   24.241 1.00 15.71 ? 109  ARG A CG  1 
ATOM   834  C CD  . ARG A 1 109 ? 12.930 1.229   23.555 1.00 18.76 ? 109  ARG A CD  1 
ATOM   835  N NE  . ARG A 1 109 ? 12.748 2.273   22.542 1.00 19.26 ? 109  ARG A NE  1 
ATOM   836  C CZ  . ARG A 1 109 ? 12.335 3.517   22.788 1.00 20.76 ? 109  ARG A CZ  1 
ATOM   837  N NH1 . ARG A 1 109 ? 12.046 3.907   24.026 1.00 20.31 ? 109  ARG A NH1 1 
ATOM   838  N NH2 . ARG A 1 109 ? 12.228 4.386   21.789 1.00 20.45 ? 109  ARG A NH2 1 
ATOM   839  N N   . ALA A 1 110 ? 16.449 2.805   26.672 1.00 13.94 ? 110  ALA A N   1 
ATOM   840  C CA  . ALA A 1 110 ? 16.452 4.029   27.449 1.00 13.29 ? 110  ALA A CA  1 
ATOM   841  C C   . ALA A 1 110 ? 16.367 5.265   26.581 1.00 13.76 ? 110  ALA A C   1 
ATOM   842  O O   . ALA A 1 110 ? 16.929 5.299   25.491 1.00 14.56 ? 110  ALA A O   1 
ATOM   843  C CB  . ALA A 1 110 ? 17.699 4.088   28.319 1.00 12.53 ? 110  ALA A CB  1 
ATOM   844  N N   . GLU A 1 111 ? 15.593 6.242   27.043 1.00 14.05 ? 111  GLU A N   1 
ATOM   845  C CA  . GLU A 1 111 ? 15.448 7.523   26.360 1.00 15.39 ? 111  GLU A CA  1 
ATOM   846  C C   . GLU A 1 111 ? 16.129 8.528   27.272 1.00 14.01 ? 111  GLU A C   1 
ATOM   847  O O   . GLU A 1 111 ? 15.739 8.701   28.429 1.00 12.74 ? 111  GLU A O   1 
ATOM   848  C CB  . GLU A 1 111 ? 13.977 7.884   26.127 1.00 19.45 ? 111  GLU A CB  1 
ATOM   849  C CG  . GLU A 1 111 ? 13.398 7.264   24.857 1.00 25.74 ? 111  GLU A CG  1 
ATOM   850  C CD  . GLU A 1 111 ? 11.947 7.643   24.612 1.00 29.09 ? 111  GLU A CD  1 
ATOM   851  O OE1 . GLU A 1 111 ? 11.642 8.855   24.542 1.00 29.87 ? 111  GLU A OE1 1 
ATOM   852  O OE2 . GLU A 1 111 ? 11.113 6.722   24.479 1.00 30.80 ? 111  GLU A OE2 1 
ATOM   853  N N   . VAL A 1 112 ? 17.226 9.088   26.773 1.00 12.51 ? 112  VAL A N   1 
ATOM   854  C CA  . VAL A 1 112 ? 18.036 10.051  27.512 1.00 12.37 ? 112  VAL A CA  1 
ATOM   855  C C   . VAL A 1 112 ? 17.903 11.420  26.858 1.00 13.25 ? 112  VAL A C   1 
ATOM   856  O O   . VAL A 1 112 ? 18.319 11.608  25.717 1.00 12.83 ? 112  VAL A O   1 
ATOM   857  C CB  . VAL A 1 112 ? 19.530 9.608   27.542 1.00 12.15 ? 112  VAL A CB  1 
ATOM   858  C CG1 . VAL A 1 112 ? 20.345 10.469  28.489 1.00 12.47 ? 112  VAL A CG1 1 
ATOM   859  C CG2 . VAL A 1 112 ? 19.646 8.140   27.942 1.00 12.05 ? 112  VAL A CG2 1 
ATOM   860  N N   . LYS A 1 113 ? 17.329 12.369  27.595 1.00 13.81 ? 113  LYS A N   1 
ATOM   861  C CA  . LYS A 1 113 ? 17.109 13.724  27.089 1.00 13.56 ? 113  LYS A CA  1 
ATOM   862  C C   . LYS A 1 113 ? 16.976 14.745  28.208 1.00 13.43 ? 113  LYS A C   1 
ATOM   863  O O   . LYS A 1 113 ? 16.877 14.386  29.381 1.00 12.87 ? 113  LYS A O   1 
ATOM   864  C CB  . LYS A 1 113 ? 15.836 13.769  26.214 1.00 15.27 ? 113  LYS A CB  1 
ATOM   865  C CG  . LYS A 1 113 ? 14.502 13.513  26.947 1.00 17.17 ? 113  LYS A CG  1 
ATOM   866  C CD  . LYS A 1 113 ? 13.282 13.624  26.017 1.00 20.09 ? 113  LYS A CD  1 
ATOM   867  C CE  . LYS A 1 113 ? 13.105 15.025  25.418 1.00 23.59 ? 113  LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 113 ? 12.826 16.083  26.428 1.00 25.28 ? 113  LYS A NZ  1 
ATOM   869  N N   . PHE A 1 114 ? 16.938 16.018  27.822 1.00 12.23 ? 114  PHE A N   1 
ATOM   870  C CA  . PHE A 1 114 ? 16.766 17.106  28.772 1.00 13.61 ? 114  PHE A CA  1 
ATOM   871  C C   . PHE A 1 114 ? 15.298 17.411  29.002 1.00 14.34 ? 114  PHE A C   1 
ATOM   872  O O   . PHE A 1 114 ? 14.511 17.476  28.054 1.00 13.32 ? 114  PHE A O   1 
ATOM   873  C CB  . PHE A 1 114 ? 17.445 18.386  28.279 1.00 12.63 ? 114  PHE A CB  1 
ATOM   874  C CG  . PHE A 1 114 ? 18.848 18.553  28.768 1.00 13.41 ? 114  PHE A CG  1 
ATOM   875  C CD1 . PHE A 1 114 ? 19.097 19.072  30.050 1.00 13.30 ? 114  PHE A CD1 1 
ATOM   876  C CD2 . PHE A 1 114 ? 19.933 18.199  27.952 1.00 12.72 ? 114  PHE A CD2 1 
ATOM   877  C CE1 . PHE A 1 114 ? 20.423 19.239  30.525 1.00 12.66 ? 114  PHE A CE1 1 
ATOM   878  C CE2 . PHE A 1 114 ? 21.265 18.358  28.405 1.00 10.79 ? 114  PHE A CE2 1 
ATOM   879  C CZ  . PHE A 1 114 ? 21.515 18.878  29.695 1.00 11.59 ? 114  PHE A CZ  1 
ATOM   880  N N   . GLU A 1 115 ? 14.931 17.501  30.277 1.00 14.14 ? 115  GLU A N   1 
ATOM   881  C CA  . GLU A 1 115 ? 13.582 17.875  30.693 1.00 14.11 ? 115  GLU A CA  1 
ATOM   882  C C   . GLU A 1 115 ? 13.872 19.137  31.487 1.00 14.36 ? 115  GLU A C   1 
ATOM   883  O O   . GLU A 1 115 ? 14.182 19.089  32.683 1.00 13.51 ? 115  GLU A O   1 
ATOM   884  C CB  . GLU A 1 115 ? 12.916 16.799  31.563 1.00 13.69 ? 115  GLU A CB  1 
ATOM   885  C CG  . GLU A 1 115 ? 12.506 15.515  30.830 1.00 14.05 ? 115  GLU A CG  1 
ATOM   886  C CD  . GLU A 1 115 ? 11.434 15.692  29.753 1.00 15.79 ? 115  GLU A CD  1 
ATOM   887  O OE1 . GLU A 1 115 ? 10.693 16.705  29.745 1.00 13.94 ? 115  GLU A OE1 1 
ATOM   888  O OE2 . GLU A 1 115 ? 11.326 14.783  28.907 1.00 18.38 ? 115  GLU A OE2 1 
ATOM   889  N N   . GLY A 1 116 ? 13.845 20.262  30.771 1.00 15.81 ? 116  GLY A N   1 
ATOM   890  C CA  . GLY A 1 116 ? 14.177 21.549  31.357 1.00 16.39 ? 116  GLY A CA  1 
ATOM   891  C C   . GLY A 1 116 ? 15.696 21.593  31.391 1.00 16.59 ? 116  GLY A C   1 
ATOM   892  O O   . GLY A 1 116 ? 16.343 21.297  30.385 1.00 16.33 ? 116  GLY A O   1 
ATOM   893  N N   . ASP A 1 117 ? 16.260 21.872  32.563 1.00 17.78 ? 117  ASP A N   1 
ATOM   894  C CA  . ASP A 1 117 ? 17.712 21.923  32.727 1.00 17.40 ? 117  ASP A CA  1 
ATOM   895  C C   . ASP A 1 117 ? 18.236 20.645  33.392 1.00 17.04 ? 117  ASP A C   1 
ATOM   896  O O   . ASP A 1 117 ? 19.416 20.547  33.749 1.00 15.56 ? 117  ASP A O   1 
ATOM   897  C CB  . ASP A 1 117 ? 18.114 23.171  33.527 1.00 21.05 ? 117  ASP A CB  1 
ATOM   898  C CG  . ASP A 1 117 ? 17.746 24.472  32.817 1.00 24.25 ? 117  ASP A CG  1 
ATOM   899  O OD1 . ASP A 1 117 ? 17.958 24.579  31.587 1.00 24.05 ? 117  ASP A OD1 1 
ATOM   900  O OD2 . ASP A 1 117 ? 17.242 25.390  33.496 1.00 27.37 ? 117  ASP A OD2 1 
ATOM   901  N N   . THR A 1 118 ? 17.354 19.650  33.490 1.00 14.25 ? 118  THR A N   1 
ATOM   902  C CA  . THR A 1 118 ? 17.663 18.363  34.100 1.00 14.17 ? 118  THR A CA  1 
ATOM   903  C C   . THR A 1 118 ? 17.797 17.260  33.050 1.00 13.29 ? 118  THR A C   1 
ATOM   904  O O   . THR A 1 118 ? 16.945 17.125  32.169 1.00 11.91 ? 118  THR A O   1 
ATOM   905  C CB  . THR A 1 118 ? 16.569 17.979  35.136 1.00 15.32 ? 118  THR A CB  1 
ATOM   906  O OG1 . THR A 1 118 ? 16.467 19.018  36.111 1.00 15.11 ? 118  THR A OG1 1 
ATOM   907  C CG2 . THR A 1 118 ? 16.903 16.681  35.856 1.00 14.04 ? 118  THR A CG2 1 
ATOM   908  N N   . LEU A 1 119 ? 18.871 16.477  33.161 1.00 12.07 ? 119  LEU A N   1 
ATOM   909  C CA  . LEU A 1 119 ? 19.116 15.365  32.250 1.00 10.68 ? 119  LEU A CA  1 
ATOM   910  C C   . LEU A 1 119 ? 18.408 14.136  32.814 1.00 11.73 ? 119  LEU A C   1 
ATOM   911  O O   . LEU A 1 119 ? 18.674 13.714  33.941 1.00 11.71 ? 119  LEU A O   1 
ATOM   912  C CB  . LEU A 1 119 ? 20.625 15.125  32.078 1.00 10.21 ? 119  LEU A CB  1 
ATOM   913  C CG  . LEU A 1 119 ? 21.178 14.271  30.918 1.00 10.44 ? 119  LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 119 ? 21.094 12.792  31.233 1.00 10.52 ? 119  LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 119 ? 20.525 14.596  29.598 1.00 9.44  ? 119  LEU A CD2 1 
ATOM   916  N N   . VAL A 1 120 ? 17.511 13.568  32.011 1.00 11.20 ? 120  VAL A N   1 
ATOM   917  C CA  . VAL A 1 120 ? 16.718 12.410  32.413 1.00 11.81 ? 120  VAL A CA  1 
ATOM   918  C C   . VAL A 1 120 ? 17.070 11.144  31.627 1.00 12.72 ? 120  VAL A C   1 
ATOM   919  O O   . VAL A 1 120 ? 17.334 11.203  30.431 1.00 12.60 ? 120  VAL A O   1 
ATOM   920  C CB  . VAL A 1 120 ? 15.191 12.745  32.292 1.00 12.19 ? 120  VAL A CB  1 
ATOM   921  C CG1 . VAL A 1 120 ? 14.325 11.523  32.514 1.00 12.30 ? 120  VAL A CG1 1 
ATOM   922  C CG2 . VAL A 1 120 ? 14.810 13.814  33.312 1.00 11.35 ? 120  VAL A CG2 1 
ATOM   923  N N   . ASN A 1 121 ? 17.046 10.014  32.332 1.00 12.60 ? 121  ASN A N   1 
ATOM   924  C CA  . ASN A 1 121 ? 17.323 8.691   31.780 1.00 13.73 ? 121  ASN A CA  1 
ATOM   925  C C   . ASN A 1 121 ? 16.149 7.784   32.194 1.00 13.73 ? 121  ASN A C   1 
ATOM   926  O O   . ASN A 1 121 ? 16.087 7.328   33.340 1.00 15.02 ? 121  ASN A O   1 
ATOM   927  C CB  . ASN A 1 121 ? 18.664 8.165   32.346 1.00 13.71 ? 121  ASN A CB  1 
ATOM   928  C CG  . ASN A 1 121 ? 19.093 6.806   31.765 1.00 16.93 ? 121  ASN A CG  1 
ATOM   929  O OD1 . ASN A 1 121 ? 19.954 6.127   32.333 1.00 19.88 ? 121  ASN A OD1 1 
ATOM   930  N ND2 . ASN A 1 121 ? 18.497 6.408   30.648 1.00 16.46 ? 121  ASN A ND2 1 
ATOM   931  N N   . ARG A 1 122 ? 15.207 7.572   31.268 1.00 13.78 ? 122  ARG A N   1 
ATOM   932  C CA  . ARG A 1 122 ? 14.031 6.713   31.489 1.00 14.14 ? 122  ARG A CA  1 
ATOM   933  C C   . ARG A 1 122 ? 14.327 5.348   30.875 1.00 13.93 ? 122  ARG A C   1 
ATOM   934  O O   . ARG A 1 122 ? 14.432 5.229   29.654 1.00 13.02 ? 122  ARG A O   1 
ATOM   935  C CB  . ARG A 1 122 ? 12.778 7.296   30.824 1.00 15.56 ? 122  ARG A CB  1 
ATOM   936  C CG  . ARG A 1 122 ? 12.262 8.589   31.420 1.00 22.86 ? 122  ARG A CG  1 
ATOM   937  C CD  . ARG A 1 122 ? 10.924 8.994   30.810 1.00 25.86 ? 122  ARG A CD  1 
ATOM   938  N NE  . ARG A 1 122 ? 9.832  8.113   31.230 1.00 32.49 ? 122  ARG A NE  1 
ATOM   939  C CZ  . ARG A 1 122 ? 8.967  7.523   30.404 1.00 34.49 ? 122  ARG A CZ  1 
ATOM   940  N NH1 . ARG A 1 122 ? 9.050  7.708   29.090 1.00 36.40 ? 122  ARG A NH1 1 
ATOM   941  N NH2 . ARG A 1 122 ? 8.019  6.735   30.896 1.00 35.62 ? 122  ARG A NH2 1 
ATOM   942  N N   . ILE A 1 123 ? 14.448 4.324   31.721 1.00 12.52 ? 123  ILE A N   1 
ATOM   943  C CA  . ILE A 1 123 ? 14.788 2.972   31.265 1.00 13.31 ? 123  ILE A CA  1 
ATOM   944  C C   . ILE A 1 123 ? 13.733 1.886   31.480 1.00 13.79 ? 123  ILE A C   1 
ATOM   945  O O   . ILE A 1 123 ? 13.023 1.877   32.483 1.00 13.70 ? 123  ILE A O   1 
ATOM   946  C CB  . ILE A 1 123 ? 16.100 2.437   31.954 1.00 12.37 ? 123  ILE A CB  1 
ATOM   947  C CG1 . ILE A 1 123 ? 17.128 3.552   32.166 1.00 11.58 ? 123  ILE A CG1 1 
ATOM   948  C CG2 . ILE A 1 123 ? 16.730 1.331   31.110 1.00 14.03 ? 123  ILE A CG2 1 
ATOM   949  C CD1 . ILE A 1 123 ? 17.952 3.392   33.421 1.00 13.97 ? 123  ILE A CD1 1 
ATOM   950  N N   . GLU A 1 124 ? 13.687 0.961   30.519 1.00 14.14 ? 124  GLU A N   1 
ATOM   951  C CA  . GLU A 1 124 ? 12.834 -0.224  30.546 1.00 14.95 ? 124  GLU A CA  1 
ATOM   952  C C   . GLU A 1 124 ? 13.834 -1.378  30.426 1.00 13.92 ? 124  GLU A C   1 
ATOM   953  O O   . GLU A 1 124 ? 14.617 -1.420  29.472 1.00 12.96 ? 124  GLU A O   1 
ATOM   954  C CB  . GLU A 1 124 ? 11.858 -0.263  29.365 1.00 17.66 ? 124  GLU A CB  1 
ATOM   955  C CG  . GLU A 1 124 ? 10.633 0.634   29.497 1.00 23.47 ? 124  GLU A CG  1 
ATOM   956  C CD  . GLU A 1 124 ? 9.685  0.489   28.318 1.00 26.74 ? 124  GLU A CD  1 
ATOM   957  O OE1 . GLU A 1 124 ? 8.647  -0.190  28.465 1.00 27.79 ? 124  GLU A OE1 1 
ATOM   958  O OE2 . GLU A 1 124 ? 9.985  1.044   27.239 1.00 28.98 ? 124  GLU A OE2 1 
ATOM   959  N N   . LEU A 1 125 ? 13.867 -2.252  31.432 1.00 12.55 ? 125  LEU A N   1 
ATOM   960  C CA  . LEU A 1 125 ? 14.773 -3.403  31.441 1.00 11.72 ? 125  LEU A CA  1 
ATOM   961  C C   . LEU A 1 125 ? 13.972 -4.701  31.441 1.00 11.32 ? 125  LEU A C   1 
ATOM   962  O O   . LEU A 1 125 ? 13.051 -4.875  32.238 1.00 10.49 ? 125  LEU A O   1 
ATOM   963  C CB  . LEU A 1 125 ? 15.731 -3.346  32.653 1.00 9.99  ? 125  LEU A CB  1 
ATOM   964  C CG  . LEU A 1 125 ? 16.838 -4.404  32.847 1.00 10.99 ? 125  LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 125 ? 18.073 -3.770  33.466 1.00 11.79 ? 125  LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 125 ? 16.367 -5.567  33.706 1.00 8.90  ? 125  LEU A CD2 1 
ATOM   967  N N   . LYS A 1 126 ? 14.378 -5.623  30.574 1.00 9.94  ? 126  LYS A N   1 
ATOM   968  C CA  . LYS A 1 126 ? 13.736 -6.926  30.442 1.00 12.01 ? 126  LYS A CA  1 
ATOM   969  C C   . LYS A 1 126 ? 14.827 -7.986  30.566 1.00 11.57 ? 126  LYS A C   1 
ATOM   970  O O   . LYS A 1 126 ? 15.752 -8.020  29.755 1.00 10.85 ? 126  LYS A O   1 
ATOM   971  C CB  . LYS A 1 126 ? 13.026 -7.020  29.079 1.00 13.30 ? 126  LYS A CB  1 
ATOM   972  C CG  . LYS A 1 126 ? 12.313 -8.342  28.764 1.00 18.16 ? 126  LYS A CG  1 
ATOM   973  C CD  . LYS A 1 126 ? 11.081 -8.569  29.612 1.00 19.14 ? 126  LYS A CD  1 
ATOM   974  C CE  . LYS A 1 126 ? 10.342 -9.815  29.143 1.00 19.42 ? 126  LYS A CE  1 
ATOM   975  N NZ  . LYS A 1 126 ? 9.271  -10.184 30.092 1.00 21.34 ? 126  LYS A NZ  1 
ATOM   976  N N   . GLY A 1 127 ? 14.706 -8.830  31.591 1.00 9.16  ? 127  GLY A N   1 
ATOM   977  C CA  . GLY A 1 127 ? 15.674 -9.890  31.828 1.00 9.96  ? 127  GLY A CA  1 
ATOM   978  C C   . GLY A 1 127 ? 15.043 -11.254 31.655 1.00 10.57 ? 127  GLY A C   1 
ATOM   979  O O   . GLY A 1 127 ? 14.012 -11.547 32.267 1.00 9.71  ? 127  GLY A O   1 
ATOM   980  N N   . ILE A 1 128 ? 15.643 -12.083 30.800 1.00 10.92 ? 128  ILE A N   1 
ATOM   981  C CA  . ILE A 1 128 ? 15.113 -13.420 30.523 1.00 11.03 ? 128  ILE A CA  1 
ATOM   982  C C   . ILE A 1 128 ? 16.149 -14.532 30.650 1.00 11.44 ? 128  ILE A C   1 
ATOM   983  O O   . ILE A 1 128 ? 17.351 -14.272 30.616 1.00 11.06 ? 128  ILE A O   1 
ATOM   984  C CB  . ILE A 1 128 ? 14.453 -13.497 29.096 1.00 12.45 ? 128  ILE A CB  1 
ATOM   985  C CG1 . ILE A 1 128 ? 15.468 -13.189 27.983 1.00 12.97 ? 128  ILE A CG1 1 
ATOM   986  C CG2 . ILE A 1 128 ? 13.227 -12.568 29.017 1.00 10.52 ? 128  ILE A CG2 1 
ATOM   987  C CD1 . ILE A 1 128 ? 14.968 -13.493 26.564 1.00 13.11 ? 128  ILE A CD1 1 
ATOM   988  N N   . ASP A 1 129 ? 15.658 -15.767 30.792 1.00 11.48 ? 129  ASP A N   1 
ATOM   989  C CA  . ASP A 1 129 ? 16.470 -16.991 30.890 1.00 12.58 ? 129  ASP A CA  1 
ATOM   990  C C   . ASP A 1 129 ? 17.532 -17.084 31.982 1.00 12.94 ? 129  ASP A C   1 
ATOM   991  O O   . ASP A 1 129 ? 18.598 -17.694 31.795 1.00 11.54 ? 129  ASP A O   1 
ATOM   992  C CB  . ASP A 1 129 ? 17.067 -17.345 29.517 1.00 14.04 ? 129  ASP A CB  1 
ATOM   993  C CG  . ASP A 1 129 ? 16.018 -17.837 28.548 1.00 14.30 ? 129  ASP A CG  1 
ATOM   994  O OD1 . ASP A 1 129 ? 15.413 -18.889 28.832 1.00 18.88 ? 129  ASP A OD1 1 
ATOM   995  O OD2 . ASP A 1 129 ? 15.787 -17.166 27.523 1.00 14.94 ? 129  ASP A OD2 1 
ATOM   996  N N   . PHE A 1 130 ? 17.238 -16.475 33.125 1.00 13.01 ? 130  PHE A N   1 
ATOM   997  C CA  . PHE A 1 130 ? 18.150 -16.505 34.254 1.00 12.86 ? 130  PHE A CA  1 
ATOM   998  C C   . PHE A 1 130 ? 17.960 -17.748 35.105 1.00 13.33 ? 130  PHE A C   1 
ATOM   999  O O   . PHE A 1 130 ? 16.832 -18.196 35.318 1.00 14.25 ? 130  PHE A O   1 
ATOM   1000 C CB  . PHE A 1 130 ? 17.997 -15.253 35.104 1.00 12.92 ? 130  PHE A CB  1 
ATOM   1001 C CG  . PHE A 1 130 ? 18.691 -14.064 34.541 1.00 11.97 ? 130  PHE A CG  1 
ATOM   1002 C CD1 . PHE A 1 130 ? 17.994 -13.144 33.746 1.00 10.92 ? 130  PHE A CD1 1 
ATOM   1003 C CD2 . PHE A 1 130 ? 20.065 -13.869 34.777 1.00 10.92 ? 130  PHE A CD2 1 
ATOM   1004 C CE1 . PHE A 1 130 ? 18.657 -12.035 33.182 1.00 9.54  ? 130  PHE A CE1 1 
ATOM   1005 C CE2 . PHE A 1 130 ? 20.746 -12.767 34.221 1.00 11.30 ? 130  PHE A CE2 1 
ATOM   1006 C CZ  . PHE A 1 130 ? 20.040 -11.849 33.422 1.00 10.51 ? 130  PHE A CZ  1 
ATOM   1007 N N   . LYS A 1 131 ? 19.079 -18.316 35.550 1.00 13.99 ? 131  LYS A N   1 
ATOM   1008 C CA  . LYS A 1 131 ? 19.083 -19.513 36.384 1.00 15.32 ? 131  LYS A CA  1 
ATOM   1009 C C   . LYS A 1 131 ? 18.645 -19.151 37.800 1.00 17.30 ? 131  LYS A C   1 
ATOM   1010 O O   . LYS A 1 131 ? 19.097 -18.140 38.357 1.00 14.76 ? 131  LYS A O   1 
ATOM   1011 C CB  . LYS A 1 131 ? 20.477 -20.145 36.397 1.00 17.66 ? 131  LYS A CB  1 
ATOM   1012 C CG  . LYS A 1 131 ? 20.902 -20.754 35.069 1.00 19.35 ? 131  LYS A CG  1 
ATOM   1013 C CD  . LYS A 1 131 ? 22.338 -21.241 35.123 1.00 22.71 ? 131  LYS A CD  1 
ATOM   1014 C CE  . LYS A 1 131 ? 22.698 -22.020 33.867 1.00 26.08 ? 131  LYS A CE  1 
ATOM   1015 N NZ  . LYS A 1 131 ? 24.150 -22.364 33.836 1.00 28.28 ? 131  LYS A NZ  1 
ATOM   1016 N N   . GLU A 1 132 ? 17.748 -19.974 38.350 1.00 17.82 ? 132  GLU A N   1 
ATOM   1017 C CA  . GLU A 1 132 ? 17.172 -19.816 39.694 1.00 20.19 ? 132  GLU A CA  1 
ATOM   1018 C C   . GLU A 1 132 ? 18.225 -19.531 40.769 1.00 20.27 ? 132  GLU A C   1 
ATOM   1019 O O   . GLU A 1 132 ? 18.059 -18.610 41.579 1.00 21.12 ? 132  GLU A O   1 
ATOM   1020 C CB  . GLU A 1 132 ? 16.376 -21.078 40.058 1.00 21.10 ? 132  GLU A CB  1 
ATOM   1021 C CG  . GLU A 1 132 ? 15.474 -20.955 41.289 1.00 27.15 ? 132  GLU A CG  1 
ATOM   1022 C CD  . GLU A 1 132 ? 14.767 -22.258 41.664 1.00 30.27 ? 132  GLU A CD  1 
ATOM   1023 O OE1 . GLU A 1 132 ? 14.684 -23.188 40.827 1.00 31.50 ? 132  GLU A OE1 1 
ATOM   1024 O OE2 . GLU A 1 132 ? 14.285 -22.346 42.814 1.00 32.93 ? 132  GLU A OE2 1 
ATOM   1025 N N   . ASP A 1 133 ? 19.306 -20.311 40.748 1.00 19.97 ? 133  ASP A N   1 
ATOM   1026 C CA  . ASP A 1 133 ? 20.400 -20.144 41.698 1.00 20.65 ? 133  ASP A CA  1 
ATOM   1027 C C   . ASP A 1 133 ? 21.722 -19.857 40.972 1.00 19.20 ? 133  ASP A C   1 
ATOM   1028 O O   . ASP A 1 133 ? 22.780 -20.397 41.313 1.00 19.40 ? 133  ASP A O   1 
ATOM   1029 C CB  . ASP A 1 133 ? 20.507 -21.356 42.639 1.00 23.91 ? 133  ASP A CB  1 
ATOM   1030 C CG  . ASP A 1 133 ? 21.253 -21.031 43.932 1.00 25.96 ? 133  ASP A CG  1 
ATOM   1031 O OD1 . ASP A 1 133 ? 22.299 -21.662 44.192 1.00 28.16 ? 133  ASP A OD1 1 
ATOM   1032 O OD2 . ASP A 1 133 ? 20.805 -20.124 44.668 1.00 28.91 ? 133  ASP A OD2 1 
ATOM   1033 N N   . GLY A 1 134 ? 21.641 -19.002 39.951 1.00 17.05 ? 134  GLY A N   1 
ATOM   1034 C CA  . GLY A 1 134 ? 22.824 -18.599 39.206 1.00 15.16 ? 134  GLY A CA  1 
ATOM   1035 C C   . GLY A 1 134 ? 23.491 -17.465 39.968 1.00 14.36 ? 134  GLY A C   1 
ATOM   1036 O O   . GLY A 1 134 ? 23.050 -17.126 41.067 1.00 14.45 ? 134  GLY A O   1 
ATOM   1037 N N   . ASN A 1 135 ? 24.521 -16.853 39.389 1.00 13.02 ? 135  ASN A N   1 
ATOM   1038 C CA  . ASN A 1 135 ? 25.235 -15.754 40.047 1.00 12.53 ? 135  ASN A CA  1 
ATOM   1039 C C   . ASN A 1 135 ? 24.409 -14.484 40.229 1.00 12.33 ? 135  ASN A C   1 
ATOM   1040 O O   . ASN A 1 135 ? 24.623 -13.724 41.176 1.00 11.45 ? 135  ASN A O   1 
ATOM   1041 C CB  . ASN A 1 135 ? 26.530 -15.435 39.306 1.00 13.13 ? 135  ASN A CB  1 
ATOM   1042 C CG  . ASN A 1 135 ? 27.544 -16.554 39.404 1.00 13.52 ? 135  ASN A CG  1 
ATOM   1043 O OD1 . ASN A 1 135 ? 27.725 -17.157 40.466 1.00 14.62 ? 135  ASN A OD1 1 
ATOM   1044 N ND2 . ASN A 1 135 ? 28.218 -16.834 38.298 1.00 11.97 ? 135  ASN A ND2 1 
ATOM   1045 N N   . ILE A 1 136 ? 23.425 -14.310 39.350 1.00 11.97 ? 136  ILE A N   1 
ATOM   1046 C CA  . ILE A 1 136 ? 22.544 -13.152 39.373 1.00 12.02 ? 136  ILE A CA  1 
ATOM   1047 C C   . ILE A 1 136 ? 21.354 -13.342 40.324 1.00 12.51 ? 136  ILE A C   1 
ATOM   1048 O O   . ILE A 1 136 ? 21.259 -12.632 41.328 1.00 12.49 ? 136  ILE A O   1 
ATOM   1049 C CB  . ILE A 1 136 ? 22.106 -12.749 37.923 1.00 12.27 ? 136  ILE A CB  1 
ATOM   1050 C CG1 . ILE A 1 136 ? 23.316 -12.247 37.121 1.00 12.12 ? 136  ILE A CG1 1 
ATOM   1051 C CG2 . ILE A 1 136 ? 21.054 -11.635 37.929 1.00 13.16 ? 136  ILE A CG2 1 
ATOM   1052 C CD1 . ILE A 1 136 ? 24.166 -13.343 36.481 1.00 15.35 ? 136  ILE A CD1 1 
ATOM   1053 N N   . LEU A 1 137 ? 20.482 -14.317 40.052 1.00 12.13 ? 137  LEU A N   1 
ATOM   1054 C CA  . LEU A 1 137 ? 19.312 -14.538 40.918 1.00 12.86 ? 137  LEU A CA  1 
ATOM   1055 C C   . LEU A 1 137 ? 19.633 -15.153 42.277 1.00 13.94 ? 137  LEU A C   1 
ATOM   1056 O O   . LEU A 1 137 ? 18.833 -15.060 43.210 1.00 14.22 ? 137  LEU A O   1 
ATOM   1057 C CB  . LEU A 1 137 ? 18.217 -15.333 40.203 1.00 12.88 ? 137  LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 137 ? 17.542 -14.666 38.994 1.00 12.73 ? 137  LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 137 ? 16.398 -15.554 38.529 1.00 11.79 ? 137  LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 137 ? 17.020 -13.266 39.314 1.00 11.77 ? 137  LEU A CD2 1 
ATOM   1061 N N   . GLY A 1 138 ? 20.832 -15.721 42.389 1.00 14.48 ? 138  GLY A N   1 
ATOM   1062 C CA  . GLY A 1 138 ? 21.280 -16.313 43.638 1.00 14.35 ? 138  GLY A CA  1 
ATOM   1063 C C   . GLY A 1 138 ? 22.091 -15.327 44.463 1.00 14.30 ? 138  GLY A C   1 
ATOM   1064 O O   . GLY A 1 138 ? 22.595 -15.690 45.527 1.00 14.47 ? 138  GLY A O   1 
ATOM   1065 N N   . HIS A 1 139 ? 22.231 -14.092 43.956 1.00 12.43 ? 139  HIS A N   1 
ATOM   1066 C CA  . HIS A 1 139 ? 22.967 -12.989 44.607 1.00 12.10 ? 139  HIS A CA  1 
ATOM   1067 C C   . HIS A 1 139 ? 24.370 -13.393 45.073 1.00 12.91 ? 139  HIS A C   1 
ATOM   1068 O O   . HIS A 1 139 ? 24.701 -13.315 46.262 1.00 11.74 ? 139  HIS A O   1 
ATOM   1069 C CB  . HIS A 1 139 ? 22.150 -12.403 45.775 1.00 12.76 ? 139  HIS A CB  1 
ATOM   1070 C CG  . HIS A 1 139 ? 20.862 -11.766 45.356 1.00 13.60 ? 139  HIS A CG  1 
ATOM   1071 N ND1 . HIS A 1 139 ? 20.763 -10.427 45.047 1.00 14.24 ? 139  HIS A ND1 1 
ATOM   1072 C CD2 . HIS A 1 139 ? 19.616 -12.278 45.217 1.00 13.77 ? 139  HIS A CD2 1 
ATOM   1073 C CE1 . HIS A 1 139 ? 19.511 -10.140 44.741 1.00 13.88 ? 139  HIS A CE1 1 
ATOM   1074 N NE2 . HIS A 1 139 ? 18.794 -11.246 44.835 1.00 15.14 ? 139  HIS A NE2 1 
ATOM   1075 N N   . LYS A 1 140 ? 25.170 -13.870 44.120 1.00 11.26 ? 140  LYS A N   1 
ATOM   1076 C CA  . LYS A 1 140 ? 26.521 -14.342 44.404 1.00 13.40 ? 140  LYS A CA  1 
ATOM   1077 C C   . LYS A 1 140 ? 27.607 -13.367 43.959 1.00 11.73 ? 140  LYS A C   1 
ATOM   1078 O O   . LYS A 1 140 ? 28.791 -13.695 43.985 1.00 12.26 ? 140  LYS A O   1 
ATOM   1079 C CB  . LYS A 1 140 ? 26.744 -15.725 43.767 1.00 12.83 ? 140  LYS A CB  1 
ATOM   1080 C CG  . LYS A 1 140 ? 25.720 -16.779 44.175 1.00 14.86 ? 140  LYS A CG  1 
ATOM   1081 C CD  . LYS A 1 140 ? 25.967 -18.106 43.485 1.00 15.08 ? 140  LYS A CD  1 
ATOM   1082 C CE  . LYS A 1 140 ? 24.855 -19.090 43.798 1.00 16.26 ? 140  LYS A CE  1 
ATOM   1083 N NZ  . LYS A 1 140 ? 25.077 -20.403 43.127 1.00 17.35 ? 140  LYS A NZ  1 
ATOM   1084 N N   . LEU A 1 141 ? 27.195 -12.162 43.569 1.00 11.77 ? 141  LEU A N   1 
ATOM   1085 C CA  . LEU A 1 141 ? 28.126 -11.137 43.113 1.00 11.00 ? 141  LEU A CA  1 
ATOM   1086 C C   . LEU A 1 141 ? 28.487 -10.151 44.208 1.00 11.26 ? 141  LEU A C   1 
ATOM   1087 O O   . LEU A 1 141 ? 27.617 -9.674  44.945 1.00 11.58 ? 141  LEU A O   1 
ATOM   1088 C CB  . LEU A 1 141 ? 27.564 -10.402 41.891 1.00 11.88 ? 141  LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 141 ? 27.218 -11.286 40.687 1.00 12.90 ? 141  LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 141 ? 26.743 -10.436 39.550 1.00 14.49 ? 141  LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 141 ? 28.425 -12.103 40.253 1.00 14.63 ? 141  LEU A CD2 1 
ATOM   1092 N N   . GLU A 1 142 ? 29.785 -9.865  44.313 1.00 9.57  ? 142  GLU A N   1 
ATOM   1093 C CA  . GLU A 1 142 ? 30.316 -8.938  45.311 1.00 10.22 ? 142  GLU A CA  1 
ATOM   1094 C C   . GLU A 1 142 ? 29.911 -7.503  45.032 1.00 10.81 ? 142  GLU A C   1 
ATOM   1095 O O   . GLU A 1 142 ? 29.644 -7.137  43.884 1.00 11.33 ? 142  GLU A O   1 
ATOM   1096 C CB  . GLU A 1 142 ? 31.839 -9.027  45.375 1.00 9.56  ? 142  GLU A CB  1 
ATOM   1097 C CG  . GLU A 1 142 ? 32.352 -10.346 45.921 1.00 11.28 ? 142  GLU A CG  1 
ATOM   1098 C CD  . GLU A 1 142 ? 33.873 -10.448 45.972 1.00 12.75 ? 142  GLU A CD  1 
ATOM   1099 O OE1 . GLU A 1 142 ? 34.568 -9.521  45.507 1.00 12.46 ? 142  GLU A OE1 1 
ATOM   1100 O OE2 . GLU A 1 142 ? 34.375 -11.475 46.479 1.00 12.73 ? 142  GLU A OE2 1 
ATOM   1101 N N   . TYR A 1 143 ? 29.866 -6.702  46.092 1.00 11.51 ? 143  TYR A N   1 
ATOM   1102 C CA  . TYR A 1 143 ? 29.491 -5.301  45.981 1.00 12.43 ? 143  TYR A CA  1 
ATOM   1103 C C   . TYR A 1 143 ? 30.722 -4.434  45.671 1.00 12.33 ? 143  TYR A C   1 
ATOM   1104 O O   . TYR A 1 143 ? 31.218 -3.677  46.509 1.00 11.86 ? 143  TYR A O   1 
ATOM   1105 C CB  . TYR A 1 143 ? 28.758 -4.848  47.253 1.00 12.91 ? 143  TYR A CB  1 
ATOM   1106 C CG  . TYR A 1 143 ? 28.020 -3.536  47.100 1.00 13.44 ? 143  TYR A CG  1 
ATOM   1107 C CD1 . TYR A 1 143 ? 26.900 -3.428  46.247 1.00 13.61 ? 143  TYR A CD1 1 
ATOM   1108 C CD2 . TYR A 1 143 ? 28.450 -2.384  47.789 1.00 14.78 ? 143  TYR A CD2 1 
ATOM   1109 C CE1 . TYR A 1 143 ? 26.220 -2.193  46.081 1.00 13.14 ? 143  TYR A CE1 1 
ATOM   1110 C CE2 . TYR A 1 143 ? 27.781 -1.148  47.632 1.00 12.22 ? 143  TYR A CE2 1 
ATOM   1111 C CZ  . TYR A 1 143 ? 26.672 -1.064  46.778 1.00 12.07 ? 143  TYR A CZ  1 
ATOM   1112 O OH  . TYR A 1 143 ? 26.023 0.131   46.633 1.00 12.84 ? 143  TYR A OH  1 
ATOM   1113 N N   . ASN A 1 144 ? 31.229 -4.606  44.453 1.00 12.45 ? 144  ASN A N   1 
ATOM   1114 C CA  . ASN A 1 144 ? 32.383 -3.865  43.958 1.00 11.36 ? 144  ASN A CA  1 
ATOM   1115 C C   . ASN A 1 144 ? 32.303 -3.769  42.442 1.00 12.11 ? 144  ASN A C   1 
ATOM   1116 O O   . ASN A 1 144 ? 31.326 -4.222  41.835 1.00 9.72  ? 144  ASN A O   1 
ATOM   1117 C CB  . ASN A 1 144 ? 33.726 -4.483  44.418 1.00 12.97 ? 144  ASN A CB  1 
ATOM   1118 C CG  . ASN A 1 144 ? 33.791 -5.998  44.246 1.00 13.63 ? 144  ASN A CG  1 
ATOM   1119 O OD1 . ASN A 1 144 ? 33.339 -6.556  43.240 1.00 11.80 ? 144  ASN A OD1 1 
ATOM   1120 N ND2 . ASN A 1 144 ? 34.365 -6.672  45.241 1.00 12.66 ? 144  ASN A ND2 1 
ATOM   1121 N N   . TYR A 1 145 ? 33.344 -3.211  41.833 1.00 12.25 ? 145  TYR A N   1 
ATOM   1122 C CA  . TYR A 1 145 ? 33.358 -3.035  40.393 1.00 13.94 ? 145  TYR A CA  1 
ATOM   1123 C C   . TYR A 1 145 ? 34.761 -2.893  39.852 1.00 13.76 ? 145  TYR A C   1 
ATOM   1124 O O   . TYR A 1 145 ? 35.645 -2.341  40.508 1.00 17.54 ? 145  TYR A O   1 
ATOM   1125 C CB  . TYR A 1 145 ? 32.545 -1.791  40.019 1.00 13.64 ? 145  TYR A CB  1 
ATOM   1126 C CG  . TYR A 1 145 ? 31.728 -1.954  38.768 1.00 15.28 ? 145  TYR A CG  1 
ATOM   1127 C CD1 . TYR A 1 145 ? 32.198 -1.469  37.532 1.00 14.27 ? 145  TYR A CD1 1 
ATOM   1128 C CD2 . TYR A 1 145 ? 30.474 -2.595  38.805 1.00 14.67 ? 145  TYR A CD2 1 
ATOM   1129 C CE1 . TYR A 1 145 ? 31.437 -1.612  36.353 1.00 15.03 ? 145  TYR A CE1 1 
ATOM   1130 C CE2 . TYR A 1 145 ? 29.706 -2.752  37.630 1.00 14.00 ? 145  TYR A CE2 1 
ATOM   1131 C CZ  . TYR A 1 145 ? 30.195 -2.252  36.413 1.00 13.81 ? 145  TYR A CZ  1 
ATOM   1132 O OH  . TYR A 1 145 ? 29.435 -2.361  35.281 1.00 16.80 ? 145  TYR A OH  1 
ATOM   1133 N N   . ASN A 1 146 ? 34.946 -3.402  38.639 1.00 14.20 ? 146  ASN A N   1 
ATOM   1134 C CA  . ASN A 1 146 ? 36.224 -3.329  37.954 1.00 13.96 ? 146  ASN A CA  1 
ATOM   1135 C C   . ASN A 1 146 ? 36.118 -2.313  36.832 1.00 14.78 ? 146  ASN A C   1 
ATOM   1136 O O   . ASN A 1 146 ? 35.074 -2.198  36.181 1.00 14.51 ? 146  ASN A O   1 
ATOM   1137 C CB  . ASN A 1 146 ? 36.615 -4.696  37.393 1.00 13.76 ? 146  ASN A CB  1 
ATOM   1138 C CG  . ASN A 1 146 ? 36.905 -5.705  38.481 1.00 15.49 ? 146  ASN A CG  1 
ATOM   1139 O OD1 . ASN A 1 146 ? 37.795 -5.502  39.309 1.00 17.50 ? 146  ASN A OD1 1 
ATOM   1140 N ND2 . ASN A 1 146 ? 36.145 -6.794  38.496 1.00 17.30 ? 146  ASN A ND2 1 
ATOM   1141 N N   . SER A 1 147 ? 37.202 -1.568  36.624 1.00 15.38 ? 147  SER A N   1 
ATOM   1142 C CA  . SER A 1 147 ? 37.270 -0.557  35.574 1.00 15.53 ? 147  SER A CA  1 
ATOM   1143 C C   . SER A 1 147 ? 37.255 -1.226  34.193 1.00 14.59 ? 147  SER A C   1 
ATOM   1144 O O   . SER A 1 147 ? 37.768 -2.340  34.030 1.00 14.52 ? 147  SER A O   1 
ATOM   1145 C CB  . SER A 1 147 ? 38.526 0.303   35.748 1.00 17.97 ? 147  SER A CB  1 
ATOM   1146 O OG  . SER A 1 147 ? 39.708 -0.472  35.622 1.00 23.20 ? 147  SER A OG  1 
ATOM   1147 N N   . HIS A 1 148 ? 36.646 -0.553  33.219 1.00 13.35 ? 148  HIS A N   1 
ATOM   1148 C CA  . HIS A 1 148 ? 36.533 -1.087  31.863 1.00 12.03 ? 148  HIS A CA  1 
ATOM   1149 C C   . HIS A 1 148 ? 36.583 0.005   30.797 1.00 11.50 ? 148  HIS A C   1 
ATOM   1150 O O   . HIS A 1 148 ? 36.469 1.196   31.103 1.00 12.14 ? 148  HIS A O   1 
ATOM   1151 C CB  . HIS A 1 148 ? 35.214 -1.872  31.726 1.00 12.55 ? 148  HIS A CB  1 
ATOM   1152 C CG  . HIS A 1 148 ? 33.984 -1.026  31.880 1.00 13.42 ? 148  HIS A CG  1 
ATOM   1153 N ND1 . HIS A 1 148 ? 33.478 -0.666  33.111 1.00 14.46 ? 148  HIS A ND1 1 
ATOM   1154 C CD2 . HIS A 1 148 ? 33.152 -0.482  30.959 1.00 13.36 ? 148  HIS A CD2 1 
ATOM   1155 C CE1 . HIS A 1 148 ? 32.386 0.057   32.942 1.00 12.10 ? 148  HIS A CE1 1 
ATOM   1156 N NE2 . HIS A 1 148 ? 32.167 0.185   31.646 1.00 13.00 ? 148  HIS A NE2 1 
ATOM   1157 N N   . ASN A 1 149 ? 36.674 -0.428  29.542 1.00 10.89 ? 149  ASN A N   1 
ATOM   1158 C CA  . ASN A 1 149 ? 36.701 0.480   28.401 1.00 11.65 ? 149  ASN A CA  1 
ATOM   1159 C C   . ASN A 1 149 ? 35.493 0.218   27.503 1.00 11.93 ? 149  ASN A C   1 
ATOM   1160 O O   . ASN A 1 149 ? 35.226 -0.926  27.140 1.00 13.33 ? 149  ASN A O   1 
ATOM   1161 C CB  . ASN A 1 149 ? 37.992 0.302   27.594 1.00 12.46 ? 149  ASN A CB  1 
ATOM   1162 C CG  . ASN A 1 149 ? 39.240 0.720   28.359 1.00 14.98 ? 149  ASN A CG  1 
ATOM   1163 O OD1 . ASN A 1 149 ? 39.225 1.686   29.121 1.00 14.51 ? 149  ASN A OD1 1 
ATOM   1164 N ND2 . ASN A 1 149 ? 40.337 0.004   28.132 1.00 18.31 ? 149  ASN A ND2 1 
ATOM   1165 N N   . VAL A 1 150 ? 34.753 1.279   27.180 1.00 10.42 ? 150  VAL A N   1 
ATOM   1166 C CA  . VAL A 1 150 ? 33.578 1.197   26.304 1.00 11.31 ? 150  VAL A CA  1 
ATOM   1167 C C   . VAL A 1 150 ? 34.047 1.546   24.887 1.00 10.98 ? 150  VAL A C   1 
ATOM   1168 O O   . VAL A 1 150 ? 34.250 2.717   24.583 1.00 11.31 ? 150  VAL A O   1 
ATOM   1169 C CB  . VAL A 1 150 ? 32.450 2.185   26.772 1.00 11.77 ? 150  VAL A CB  1 
ATOM   1170 C CG1 . VAL A 1 150 ? 31.252 2.171   25.816 1.00 12.83 ? 150  VAL A CG1 1 
ATOM   1171 C CG2 . VAL A 1 150 ? 31.995 1.846   28.187 1.00 11.10 ? 150  VAL A CG2 1 
ATOM   1172 N N   . TYR A 1 151 ? 34.192 0.537   24.025 1.00 11.16 ? 151  TYR A N   1 
ATOM   1173 C CA  . TYR A 1 151 ? 34.661 0.750   22.649 1.00 12.68 ? 151  TYR A CA  1 
ATOM   1174 C C   . TYR A 1 151 ? 33.551 1.207   21.712 1.00 12.63 ? 151  TYR A C   1 
ATOM   1175 O O   . TYR A 1 151 ? 32.621 0.459   21.434 1.00 13.09 ? 151  TYR A O   1 
ATOM   1176 C CB  . TYR A 1 151 ? 35.356 -0.507  22.109 1.00 12.45 ? 151  TYR A CB  1 
ATOM   1177 C CG  . TYR A 1 151 ? 36.567 -0.906  22.920 1.00 14.64 ? 151  TYR A CG  1 
ATOM   1178 C CD1 . TYR A 1 151 ? 37.810 -0.266  22.724 1.00 14.44 ? 151  TYR A CD1 1 
ATOM   1179 C CD2 . TYR A 1 151 ? 36.471 -1.890  23.929 1.00 12.16 ? 151  TYR A CD2 1 
ATOM   1180 C CE1 . TYR A 1 151 ? 38.938 -0.591  23.525 1.00 15.76 ? 151  TYR A CE1 1 
ATOM   1181 C CE2 . TYR A 1 151 ? 37.591 -2.227  24.735 1.00 14.58 ? 151  TYR A CE2 1 
ATOM   1182 C CZ  . TYR A 1 151 ? 38.816 -1.568  24.526 1.00 15.40 ? 151  TYR A CZ  1 
ATOM   1183 O OH  . TYR A 1 151 ? 39.891 -1.857  25.329 1.00 18.98 ? 151  TYR A OH  1 
ATOM   1184 N N   . ILE A 1 152 ? 33.676 2.444   21.236 1.00 11.21 ? 152  ILE A N   1 
ATOM   1185 C CA  . ILE A 1 152 ? 32.689 3.078   20.358 1.00 12.57 ? 152  ILE A CA  1 
ATOM   1186 C C   . ILE A 1 152 ? 33.088 3.106   18.879 1.00 12.66 ? 152  ILE A C   1 
ATOM   1187 O O   . ILE A 1 152 ? 34.245 3.336   18.540 1.00 13.68 ? 152  ILE A O   1 
ATOM   1188 C CB  . ILE A 1 152 ? 32.397 4.538   20.848 1.00 12.33 ? 152  ILE A CB  1 
ATOM   1189 C CG1 . ILE A 1 152 ? 31.855 4.507   22.284 1.00 12.91 ? 152  ILE A CG1 1 
ATOM   1190 C CG2 . ILE A 1 152 ? 31.411 5.274   19.907 1.00 12.58 ? 152  ILE A CG2 1 
ATOM   1191 C CD1 . ILE A 1 152 ? 31.674 5.867   22.900 1.00 12.80 ? 152  ILE A CD1 1 
ATOM   1192 N N   . THR A 1 153 ? 32.098 2.864   18.019 1.00 13.83 ? 153  THR A N   1 
ATOM   1193 C CA  . THR A 1 153 ? 32.252 2.889   16.561 1.00 15.19 ? 153  THR A CA  1 
ATOM   1194 C C   . THR A 1 153 ? 31.042 3.649   16.018 1.00 15.41 ? 153  THR A C   1 
ATOM   1195 O O   . THR A 1 153 ? 29.986 3.660   16.655 1.00 14.54 ? 153  THR A O   1 
ATOM   1196 C CB  . THR A 1 153 ? 32.261 1.459   15.929 1.00 16.14 ? 153  THR A CB  1 
ATOM   1197 O OG1 . THR A 1 153 ? 31.182 0.682   16.462 1.00 20.15 ? 153  THR A OG1 1 
ATOM   1198 C CG2 . THR A 1 153 ? 33.580 0.740   16.180 1.00 16.88 ? 153  THR A CG2 1 
ATOM   1199 N N   . ALA A 1 154 ? 31.189 4.276   14.850 1.00 15.92 ? 154  ALA A N   1 
ATOM   1200 C CA  . ALA A 1 154 ? 30.085 5.016   14.234 1.00 18.21 ? 154  ALA A CA  1 
ATOM   1201 C C   . ALA A 1 154 ? 29.124 4.091   13.493 1.00 19.97 ? 154  ALA A C   1 
ATOM   1202 O O   . ALA A 1 154 ? 29.499 2.996   13.058 1.00 19.63 ? 154  ALA A O   1 
ATOM   1203 C CB  . ALA A 1 154 ? 30.616 6.081   13.280 1.00 18.62 ? 154  ALA A CB  1 
ATOM   1204 N N   . ASP A 1 155 ? 27.873 4.534   13.412 1.00 21.70 ? 155  ASP A N   1 
ATOM   1205 C CA  . ASP A 1 155 ? 26.802 3.832   12.717 1.00 24.71 ? 155  ASP A CA  1 
ATOM   1206 C C   . ASP A 1 155 ? 26.145 4.949   11.894 1.00 24.32 ? 155  ASP A C   1 
ATOM   1207 O O   . ASP A 1 155 ? 25.148 5.553   12.304 1.00 24.85 ? 155  ASP A O   1 
ATOM   1208 C CB  . ASP A 1 155 ? 25.828 3.201   13.736 1.00 25.58 ? 155  ASP A CB  1 
ATOM   1209 C CG  . ASP A 1 155 ? 24.731 2.352   13.086 1.00 27.63 ? 155  ASP A CG  1 
ATOM   1210 O OD1 . ASP A 1 155 ? 24.771 2.106   11.860 1.00 27.31 ? 155  ASP A OD1 1 
ATOM   1211 O OD2 . ASP A 1 155 ? 23.817 1.927   13.827 1.00 27.56 ? 155  ASP A OD2 1 
ATOM   1212 N N   . LYS A 1 156 ? 26.769 5.246   10.754 1.00 26.32 ? 156  LYS A N   1 
ATOM   1213 C CA  . LYS A 1 156 ? 26.334 6.299   9.829  1.00 29.51 ? 156  LYS A CA  1 
ATOM   1214 C C   . LYS A 1 156 ? 24.937 6.118   9.238  1.00 30.13 ? 156  LYS A C   1 
ATOM   1215 O O   . LYS A 1 156 ? 24.238 7.107   8.983  1.00 28.89 ? 156  LYS A O   1 
ATOM   1216 C CB  . LYS A 1 156 ? 27.360 6.470   8.702  1.00 31.15 ? 156  LYS A CB  1 
ATOM   1217 C CG  . LYS A 1 156 ? 28.669 7.110   9.147  1.00 33.61 ? 156  LYS A CG  1 
ATOM   1218 C CD  . LYS A 1 156 ? 29.641 7.265   7.983  1.00 35.25 ? 156  LYS A CD  1 
ATOM   1219 C CE  . LYS A 1 156 ? 30.881 8.061   8.386  1.00 36.96 ? 156  LYS A CE  1 
ATOM   1220 N NZ  . LYS A 1 156 ? 31.690 7.394   9.451  1.00 38.48 ? 156  LYS A NZ  1 
ATOM   1221 N N   . GLN A 1 157 ? 24.531 4.856   9.067  1.00 31.69 ? 157  GLN A N   1 
ATOM   1222 C CA  . GLN A 1 157 ? 23.220 4.484   8.517  1.00 33.00 ? 157  GLN A CA  1 
ATOM   1223 C C   . GLN A 1 157 ? 22.068 4.944   9.405  1.00 32.67 ? 157  GLN A C   1 
ATOM   1224 O O   . GLN A 1 157 ? 21.082 5.501   8.914  1.00 33.00 ? 157  GLN A O   1 
ATOM   1225 C CB  . GLN A 1 157 ? 23.129 2.966   8.328  1.00 35.36 ? 157  GLN A CB  1 
ATOM   1226 C CG  . GLN A 1 157 ? 24.057 2.396   7.262  1.00 39.03 ? 157  GLN A CG  1 
ATOM   1227 C CD  . GLN A 1 157 ? 23.999 0.879   7.191  1.00 40.56 ? 157  GLN A CD  1 
ATOM   1228 O OE1 . GLN A 1 157 ? 24.498 0.183   8.078  1.00 41.05 ? 157  GLN A OE1 1 
ATOM   1229 N NE2 . GLN A 1 157 ? 23.383 0.359   6.134  1.00 40.88 ? 157  GLN A NE2 1 
ATOM   1230 N N   . LYS A 1 158 ? 22.227 4.734   10.713 1.00 30.88 ? 158  LYS A N   1 
ATOM   1231 C CA  . LYS A 1 158 ? 21.224 5.111   11.705 1.00 29.95 ? 158  LYS A CA  1 
ATOM   1232 C C   . LYS A 1 158 ? 21.509 6.455   12.381 1.00 28.20 ? 158  LYS A C   1 
ATOM   1233 O O   . LYS A 1 158 ? 20.848 6.816   13.364 1.00 26.78 ? 158  LYS A O   1 
ATOM   1234 C CB  . LYS A 1 158 ? 21.054 3.988   12.740 1.00 32.53 ? 158  LYS A CB  1 
ATOM   1235 C CG  . LYS A 1 158 ? 20.374 2.742   12.172 1.00 34.45 ? 158  LYS A CG  1 
ATOM   1236 C CD  . LYS A 1 158 ? 20.187 1.646   13.212 1.00 36.97 ? 158  LYS A CD  1 
ATOM   1237 C CE  . LYS A 1 158 ? 19.496 0.432   12.592 1.00 37.57 ? 158  LYS A CE  1 
ATOM   1238 N NZ  . LYS A 1 158 ? 19.315 -0.685  13.563 1.00 37.76 ? 158  LYS A NZ  1 
ATOM   1239 N N   . ASN A 1 159 ? 22.485 7.193   11.831 1.00 25.57 ? 159  ASN A N   1 
ATOM   1240 C CA  . ASN A 1 159 ? 22.909 8.524   12.305 1.00 24.10 ? 159  ASN A CA  1 
ATOM   1241 C C   . ASN A 1 159 ? 23.356 8.517   13.785 1.00 21.36 ? 159  ASN A C   1 
ATOM   1242 O O   . ASN A 1 159 ? 23.251 9.521   14.491 1.00 21.99 ? 159  ASN A O   1 
ATOM   1243 C CB  . ASN A 1 159 ? 21.777 9.555   12.038 1.00 25.07 ? 159  ASN A CB  1 
ATOM   1244 C CG  . ASN A 1 159 ? 22.233 11.009  12.144 1.00 25.09 ? 159  ASN A CG  1 
ATOM   1245 O OD1 . ASN A 1 159 ? 21.458 11.872  12.554 1.00 28.19 ? 159  ASN A OD1 1 
ATOM   1246 N ND2 . ASN A 1 159 ? 23.484 11.283  11.781 1.00 23.65 ? 159  ASN A ND2 1 
ATOM   1247 N N   . GLY A 1 160 ? 23.898 7.385   14.226 1.00 19.76 ? 160  GLY A N   1 
ATOM   1248 C CA  . GLY A 1 160 ? 24.327 7.263   15.606 1.00 17.54 ? 160  GLY A CA  1 
ATOM   1249 C C   . GLY A 1 160 ? 25.603 6.486   15.818 1.00 17.00 ? 160  GLY A C   1 
ATOM   1250 O O   . GLY A 1 160 ? 26.529 6.572   15.010 1.00 15.74 ? 160  GLY A O   1 
ATOM   1251 N N   . ILE A 1 161 ? 25.672 5.779   16.949 1.00 14.10 ? 161  ILE A N   1 
ATOM   1252 C CA  . ILE A 1 161 ? 26.841 4.981   17.309 1.00 12.98 ? 161  ILE A CA  1 
ATOM   1253 C C   . ILE A 1 161 ? 26.505 3.572   17.794 1.00 13.14 ? 161  ILE A C   1 
ATOM   1254 O O   . ILE A 1 161 ? 25.348 3.244   18.072 1.00 14.55 ? 161  ILE A O   1 
ATOM   1255 C CB  . ILE A 1 161 ? 27.707 5.654   18.427 1.00 11.27 ? 161  ILE A CB  1 
ATOM   1256 C CG1 . ILE A 1 161 ? 26.900 5.860   19.707 1.00 9.53  ? 161  ILE A CG1 1 
ATOM   1257 C CG2 . ILE A 1 161 ? 28.268 6.965   17.963 1.00 12.64 ? 161  ILE A CG2 1 
ATOM   1258 C CD1 . ILE A 1 161 ? 27.735 5.989   20.945 1.00 9.03  ? 161  ILE A CD1 1 
ATOM   1259 N N   . LYS A 1 162 ? 27.552 2.758   17.884 1.00 14.71 ? 162  LYS A N   1 
ATOM   1260 C CA  . LYS A 1 162 ? 27.491 1.389   18.381 1.00 15.17 ? 162  LYS A CA  1 
ATOM   1261 C C   . LYS A 1 162 ? 28.629 1.265   19.386 1.00 14.63 ? 162  LYS A C   1 
ATOM   1262 O O   . LYS A 1 162 ? 29.639 1.968   19.278 1.00 14.40 ? 162  LYS A O   1 
ATOM   1263 C CB  . LYS A 1 162 ? 27.693 0.367   17.255 1.00 17.64 ? 162  LYS A CB  1 
ATOM   1264 C CG  . LYS A 1 162 ? 26.455 0.085   16.420 1.00 19.29 ? 162  LYS A CG  1 
ATOM   1265 C CD  . LYS A 1 162 ? 26.786 -0.832  15.261 1.00 22.50 ? 162  LYS A CD  1 
ATOM   1266 C CE  . LYS A 1 162 ? 25.549 -1.146  14.441 1.00 25.16 ? 162  LYS A CE  1 
ATOM   1267 N NZ  . LYS A 1 162 ? 25.907 -1.862  13.185 1.00 26.50 ? 162  LYS A NZ  1 
ATOM   1268 N N   . ALA A 1 163 ? 28.442 0.419   20.393 1.00 12.54 ? 163  ALA A N   1 
ATOM   1269 C CA  . ALA A 1 163 ? 29.476 0.191   21.395 1.00 11.77 ? 163  ALA A CA  1 
ATOM   1270 C C   . ALA A 1 163 ? 29.525 -1.267  21.824 1.00 11.47 ? 163  ALA A C   1 
ATOM   1271 O O   . ALA A 1 163 ? 28.501 -1.952  21.842 1.00 11.16 ? 163  ALA A O   1 
ATOM   1272 C CB  . ALA A 1 163 ? 29.296 1.112   22.607 1.00 11.13 ? 163  ALA A CB  1 
ATOM   1273 N N   . ASN A 1 164 ? 30.741 -1.753  22.076 1.00 11.67 ? 164  ASN A N   1 
ATOM   1274 C CA  . ASN A 1 164 ? 30.982 -3.129  22.513 1.00 12.91 ? 164  ASN A CA  1 
ATOM   1275 C C   . ASN A 1 164 ? 31.967 -3.126  23.666 1.00 12.57 ? 164  ASN A C   1 
ATOM   1276 O O   . ASN A 1 164 ? 33.003 -2.456  23.601 1.00 12.33 ? 164  ASN A O   1 
ATOM   1277 C CB  . ASN A 1 164 ? 31.555 -3.994  21.381 1.00 14.20 ? 164  ASN A CB  1 
ATOM   1278 C CG  . ASN A 1 164 ? 30.547 -4.272  20.286 1.00 18.67 ? 164  ASN A CG  1 
ATOM   1279 O OD1 . ASN A 1 164 ? 30.450 -3.519  19.314 1.00 20.91 ? 164  ASN A OD1 1 
ATOM   1280 N ND2 . ASN A 1 164 ? 29.775 -5.343  20.445 1.00 18.32 ? 164  ASN A ND2 1 
ATOM   1281 N N   . PHE A 1 165 ? 31.599 -3.813  24.747 1.00 11.21 ? 165  PHE A N   1 
ATOM   1282 C CA  . PHE A 1 165 ? 32.452 -3.928  25.928 1.00 11.53 ? 165  PHE A CA  1 
ATOM   1283 C C   . PHE A 1 165 ? 32.151 -5.123  26.814 1.00 11.17 ? 165  PHE A C   1 
ATOM   1284 O O   . PHE A 1 165 ? 31.101 -5.757  26.693 1.00 11.88 ? 165  PHE A O   1 
ATOM   1285 C CB  . PHE A 1 165 ? 32.530 -2.618  26.751 1.00 10.46 ? 165  PHE A CB  1 
ATOM   1286 C CG  . PHE A 1 165 ? 31.203 -2.070  27.239 1.00 10.93 ? 165  PHE A CG  1 
ATOM   1287 C CD1 . PHE A 1 165 ? 30.886 -2.118  28.608 1.00 11.61 ? 165  PHE A CD1 1 
ATOM   1288 C CD2 . PHE A 1 165 ? 30.326 -1.392  26.365 1.00 11.37 ? 165  PHE A CD2 1 
ATOM   1289 C CE1 . PHE A 1 165 ? 29.716 -1.485  29.116 1.00 10.11 ? 165  PHE A CE1 1 
ATOM   1290 C CE2 . PHE A 1 165 ? 29.144 -0.750  26.854 1.00 10.48 ? 165  PHE A CE2 1 
ATOM   1291 C CZ  . PHE A 1 165 ? 28.843 -0.797  28.236 1.00 11.03 ? 165  PHE A CZ  1 
ATOM   1292 N N   . LYS A 1 166 ? 33.122 -5.458  27.661 1.00 12.28 ? 166  LYS A N   1 
ATOM   1293 C CA  . LYS A 1 166 ? 33.021 -6.582  28.584 1.00 13.64 ? 166  LYS A CA  1 
ATOM   1294 C C   . LYS A 1 166 ? 33.125 -6.135  30.041 1.00 13.44 ? 166  LYS A C   1 
ATOM   1295 O O   . LYS A 1 166 ? 34.055 -5.412  30.419 1.00 12.87 ? 166  LYS A O   1 
ATOM   1296 C CB  . LYS A 1 166 ? 34.121 -7.612  28.290 1.00 16.27 ? 166  LYS A CB  1 
ATOM   1297 C CG  . LYS A 1 166 ? 34.002 -8.304  26.938 1.00 19.99 ? 166  LYS A CG  1 
ATOM   1298 C CD  . LYS A 1 166 ? 35.211 -9.172  26.641 1.00 22.92 ? 166  LYS A CD  1 
ATOM   1299 C CE  . LYS A 1 166 ? 35.077 -9.867  25.289 1.00 24.49 ? 166  LYS A CE  1 
ATOM   1300 N NZ  . LYS A 1 166 ? 34.030 -10.934 25.302 1.00 27.99 ? 166  LYS A NZ  1 
ATOM   1301 N N   . ILE A 1 167 ? 32.128 -6.525  30.833 1.00 12.09 ? 167  ILE A N   1 
ATOM   1302 C CA  . ILE A 1 167 ? 32.101 -6.221  32.262 1.00 12.22 ? 167  ILE A CA  1 
ATOM   1303 C C   . ILE A 1 167 ? 32.433 -7.502  33.006 1.00 12.00 ? 167  ILE A C   1 
ATOM   1304 O O   . ILE A 1 167 ? 31.889 -8.567  32.714 1.00 11.81 ? 167  ILE A O   1 
ATOM   1305 C CB  . ILE A 1 167 ? 30.722 -5.688  32.737 1.00 11.80 ? 167  ILE A CB  1 
ATOM   1306 C CG1 . ILE A 1 167 ? 30.411 -4.354  32.060 1.00 11.63 ? 167  ILE A CG1 1 
ATOM   1307 C CG2 . ILE A 1 167 ? 30.686 -5.518  34.272 1.00 12.45 ? 167  ILE A CG2 1 
ATOM   1308 C CD1 . ILE A 1 167 ? 31.298 -3.227  32.448 1.00 13.62 ? 167  ILE A CD1 1 
ATOM   1309 N N   . ARG A 1 168 ? 33.348 -7.376  33.958 1.00 11.68 ? 168  ARG A N   1 
ATOM   1310 C CA  . ARG A 1 168 ? 33.795 -8.491  34.773 1.00 12.48 ? 168  ARG A CA  1 
ATOM   1311 C C   . ARG A 1 168 ? 33.296 -8.278  36.205 1.00 13.22 ? 168  ARG A C   1 
ATOM   1312 O O   . ARG A 1 168 ? 33.762 -7.376  36.907 1.00 13.75 ? 168  ARG A O   1 
ATOM   1313 C CB  . ARG A 1 168 ? 35.328 -8.583  34.706 1.00 14.56 ? 168  ARG A CB  1 
ATOM   1314 C CG  . ARG A 1 168 ? 35.863 -8.757  33.275 1.00 16.37 ? 168  ARG A CG  1 
ATOM   1315 C CD  . ARG A 1 168 ? 37.385 -8.682  33.182 1.00 18.80 ? 168  ARG A CD  1 
ATOM   1316 N NE  . ARG A 1 168 ? 38.040 -9.820  33.824 1.00 19.02 ? 168  ARG A NE  1 
ATOM   1317 C CZ  . ARG A 1 168 ? 38.186 -11.028 33.281 1.00 21.83 ? 168  ARG A CZ  1 
ATOM   1318 N NH1 . ARG A 1 168 ? 37.725 -11.290 32.061 1.00 21.58 ? 168  ARG A NH1 1 
ATOM   1319 N NH2 . ARG A 1 168 ? 38.796 -11.984 33.971 1.00 23.44 ? 168  ARG A NH2 1 
ATOM   1320 N N   . HIS A 1 169 ? 32.268 -9.040  36.583 1.00 12.68 ? 169  HIS A N   1 
ATOM   1321 C CA  . HIS A 1 169 ? 31.681 -8.968  37.927 1.00 11.98 ? 169  HIS A CA  1 
ATOM   1322 C C   . HIS A 1 169 ? 32.353 -9.998  38.830 1.00 12.04 ? 169  HIS A C   1 
ATOM   1323 O O   . HIS A 1 169 ? 32.342 -11.194 38.523 1.00 13.34 ? 169  HIS A O   1 
ATOM   1324 C CB  . HIS A 1 169 ? 30.180 -9.284  37.902 1.00 10.64 ? 169  HIS A CB  1 
ATOM   1325 C CG  . HIS A 1 169 ? 29.342 -8.266  37.194 1.00 12.23 ? 169  HIS A CG  1 
ATOM   1326 N ND1 . HIS A 1 169 ? 29.280 -6.947  37.587 1.00 10.83 ? 169  HIS A ND1 1 
ATOM   1327 C CD2 . HIS A 1 169 ? 28.490 -8.389  36.148 1.00 11.94 ? 169  HIS A CD2 1 
ATOM   1328 C CE1 . HIS A 1 169 ? 28.424 -6.302  36.815 1.00 10.95 ? 169  HIS A CE1 1 
ATOM   1329 N NE2 . HIS A 1 169 ? 27.930 -7.153  35.935 1.00 11.17 ? 169  HIS A NE2 1 
ATOM   1330 N N   . ASN A 1 170 ? 32.911 -9.539  39.950 1.00 11.92 ? 170  ASN A N   1 
ATOM   1331 C CA  . ASN A 1 170 ? 33.567 -10.426 40.913 1.00 12.01 ? 170  ASN A CA  1 
ATOM   1332 C C   . ASN A 1 170 ? 32.544 -11.296 41.650 1.00 11.98 ? 170  ASN A C   1 
ATOM   1333 O O   . ASN A 1 170 ? 31.552 -10.781 42.173 1.00 11.65 ? 170  ASN A O   1 
ATOM   1334 C CB  . ASN A 1 170 ? 34.360 -9.615  41.953 1.00 12.06 ? 170  ASN A CB  1 
ATOM   1335 C CG  . ASN A 1 170 ? 35.570 -8.897  41.363 1.00 12.93 ? 170  ASN A CG  1 
ATOM   1336 O OD1 . ASN A 1 170 ? 36.009 -9.185  40.252 1.00 14.28 ? 170  ASN A OD1 1 
ATOM   1337 N ND2 . ASN A 1 170 ? 36.119 -7.959  42.125 1.00 13.81 ? 170  ASN A ND2 1 
ATOM   1338 N N   . ILE A 1 171 ? 32.750 -12.615 41.625 1.00 11.42 ? 171  ILE A N   1 
ATOM   1339 C CA  . ILE A 1 171 ? 31.863 -13.547 42.338 1.00 12.37 ? 171  ILE A CA  1 
ATOM   1340 C C   . ILE A 1 171 ? 32.491 -13.752 43.726 1.00 11.75 ? 171  ILE A C   1 
ATOM   1341 O O   . ILE A 1 171 ? 33.715 -13.686 43.871 1.00 11.37 ? 171  ILE A O   1 
ATOM   1342 C CB  . ILE A 1 171 ? 31.711 -14.926 41.605 1.00 12.25 ? 171  ILE A CB  1 
ATOM   1343 C CG1 . ILE A 1 171 ? 31.241 -14.719 40.160 1.00 12.78 ? 171  ILE A CG1 1 
ATOM   1344 C CG2 . ILE A 1 171 ? 30.686 -15.824 42.329 1.00 13.09 ? 171  ILE A CG2 1 
ATOM   1345 C CD1 . ILE A 1 171 ? 31.288 -15.984 39.284 1.00 11.76 ? 171  ILE A CD1 1 
ATOM   1346 N N   . GLU A 1 172 ? 31.641 -14.005 44.723 1.00 13.17 ? 172  GLU A N   1 
ATOM   1347 C CA  . GLU A 1 172 ? 32.033 -14.219 46.127 1.00 14.60 ? 172  GLU A CA  1 
ATOM   1348 C C   . GLU A 1 172 ? 33.104 -15.278 46.441 1.00 14.48 ? 172  GLU A C   1 
ATOM   1349 O O   . GLU A 1 172 ? 33.728 -15.223 47.504 1.00 12.46 ? 172  GLU A O   1 
ATOM   1350 C CB  . GLU A 1 172 ? 30.784 -14.485 46.976 1.00 16.05 ? 172  GLU A CB  1 
ATOM   1351 C CG  . GLU A 1 172 ? 29.985 -15.723 46.550 1.00 18.85 ? 172  GLU A CG  1 
ATOM   1352 C CD  . GLU A 1 172 ? 28.645 -15.863 47.257 1.00 22.13 ? 172  GLU A CD  1 
ATOM   1353 O OE1 . GLU A 1 172 ? 28.210 -14.917 47.953 1.00 22.82 ? 172  GLU A OE1 1 
ATOM   1354 O OE2 . GLU A 1 172 ? 28.008 -16.924 47.083 1.00 23.85 ? 172  GLU A OE2 1 
ATOM   1355 N N   . ASP A 1 173 ? 33.301 -16.229 45.525 1.00 14.16 ? 173  ASP A N   1 
ATOM   1356 C CA  . ASP A 1 173 ? 34.293 -17.298 45.701 1.00 14.22 ? 173  ASP A CA  1 
ATOM   1357 C C   . ASP A 1 173 ? 35.660 -16.996 45.066 1.00 15.28 ? 173  ASP A C   1 
ATOM   1358 O O   . ASP A 1 173 ? 36.569 -17.832 45.101 1.00 17.05 ? 173  ASP A O   1 
ATOM   1359 C CB  . ASP A 1 173 ? 33.737 -18.644 45.190 1.00 13.29 ? 173  ASP A CB  1 
ATOM   1360 C CG  . ASP A 1 173 ? 33.377 -18.631 43.700 1.00 13.03 ? 173  ASP A CG  1 
ATOM   1361 O OD1 . ASP A 1 173 ? 33.453 -17.571 43.047 1.00 13.34 ? 173  ASP A OD1 1 
ATOM   1362 O OD2 . ASP A 1 173 ? 33.019 -19.705 43.175 1.00 13.45 ? 173  ASP A OD2 1 
ATOM   1363 N N   . GLY A 1 174 ? 35.778 -15.808 44.471 1.00 14.17 ? 174  GLY A N   1 
ATOM   1364 C CA  . GLY A 1 174 ? 37.011 -15.395 43.822 1.00 12.38 ? 174  GLY A CA  1 
ATOM   1365 C C   . GLY A 1 174 ? 36.982 -15.528 42.309 1.00 12.58 ? 174  GLY A C   1 
ATOM   1366 O O   . GLY A 1 174 ? 37.966 -15.199 41.641 1.00 12.00 ? 174  GLY A O   1 
ATOM   1367 N N   . SER A 1 175 ? 35.879 -16.053 41.774 1.00 12.24 ? 175  SER A N   1 
ATOM   1368 C CA  . SER A 1 175 ? 35.712 -16.229 40.332 1.00 12.41 ? 175  SER A CA  1 
ATOM   1369 C C   . SER A 1 175 ? 35.173 -14.948 39.676 1.00 12.28 ? 175  SER A C   1 
ATOM   1370 O O   . SER A 1 175 ? 34.999 -13.927 40.349 1.00 11.04 ? 175  SER A O   1 
ATOM   1371 C CB  . SER A 1 175 ? 34.800 -17.426 40.051 1.00 13.21 ? 175  SER A CB  1 
ATOM   1372 O OG  . SER A 1 175 ? 34.832 -17.780 38.681 1.00 15.10 ? 175  SER A OG  1 
ATOM   1373 N N   . VAL A 1 176 ? 34.945 -14.998 38.362 1.00 10.39 ? 176  VAL A N   1 
ATOM   1374 C CA  . VAL A 1 176 ? 34.458 -13.848 37.591 1.00 12.79 ? 176  VAL A CA  1 
ATOM   1375 C C   . VAL A 1 176 ? 33.236 -14.208 36.734 1.00 11.99 ? 176  VAL A C   1 
ATOM   1376 O O   . VAL A 1 176 ? 33.207 -15.259 36.091 1.00 12.77 ? 176  VAL A O   1 
ATOM   1377 C CB  . VAL A 1 176 ? 35.609 -13.264 36.675 1.00 14.03 ? 176  VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 176 ? 35.077 -12.257 35.657 1.00 15.80 ? 176  VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 176 ? 36.669 -12.569 37.525 1.00 16.68 ? 176  VAL A CG2 1 
ATOM   1380 N N   . GLN A 1 177 ? 32.222 -13.343 36.782 1.00 13.07 ? 177  GLN A N   1 
ATOM   1381 C CA  . GLN A 1 177 ? 31.001 -13.488 35.987 1.00 11.11 ? 177  GLN A CA  1 
ATOM   1382 C C   . GLN A 1 177 ? 31.103 -12.452 34.872 1.00 11.42 ? 177  GLN A C   1 
ATOM   1383 O O   . GLN A 1 177 ? 31.078 -11.244 35.125 1.00 9.96  ? 177  GLN A O   1 
ATOM   1384 C CB  . GLN A 1 177 ? 29.743 -13.241 36.841 1.00 11.98 ? 177  GLN A CB  1 
ATOM   1385 C CG  . GLN A 1 177 ? 28.404 -13.105 36.074 1.00 11.91 ? 177  GLN A CG  1 
ATOM   1386 C CD  . GLN A 1 177 ? 27.982 -14.382 35.373 1.00 12.66 ? 177  GLN A CD  1 
ATOM   1387 O OE1 . GLN A 1 177 ? 27.598 -15.356 36.017 1.00 13.43 ? 177  GLN A OE1 1 
ATOM   1388 N NE2 . GLN A 1 177 ? 28.051 -14.382 34.046 1.00 10.39 ? 177  GLN A NE2 1 
ATOM   1389 N N   . LEU A 1 178 ? 31.234 -12.941 33.643 1.00 10.40 ? 178  LEU A N   1 
ATOM   1390 C CA  . LEU A 1 178 ? 31.340 -12.081 32.472 1.00 11.37 ? 178  LEU A CA  1 
ATOM   1391 C C   . LEU A 1 178 ? 29.966 -11.576 32.024 1.00 11.28 ? 178  LEU A C   1 
ATOM   1392 O O   . LEU A 1 178 ? 28.980 -12.311 32.069 1.00 10.87 ? 178  LEU A O   1 
ATOM   1393 C CB  . LEU A 1 178 ? 32.043 -12.842 31.332 1.00 14.67 ? 178  LEU A CB  1 
ATOM   1394 C CG  . LEU A 1 178 ? 32.335 -12.186 29.973 1.00 19.07 ? 178  LEU A CG  1 
ATOM   1395 C CD1 . LEU A 1 178 ? 33.256 -10.975 30.117 1.00 19.68 ? 178  LEU A CD1 1 
ATOM   1396 C CD2 . LEU A 1 178 ? 32.960 -13.220 29.052 1.00 20.67 ? 178  LEU A CD2 1 
ATOM   1397 N N   . ALA A 1 179 ? 29.914 -10.295 31.662 1.00 10.20 ? 179  ALA A N   1 
ATOM   1398 C CA  . ALA A 1 179 ? 28.696 -9.661  31.175 1.00 11.08 ? 179  ALA A CA  1 
ATOM   1399 C C   . ALA A 1 179 ? 29.052 -8.895  29.905 1.00 12.13 ? 179  ALA A C   1 
ATOM   1400 O O   . ALA A 1 179 ? 29.599 -7.788  29.962 1.00 11.87 ? 179  ALA A O   1 
ATOM   1401 C CB  . ALA A 1 179 ? 28.102 -8.726  32.232 1.00 10.82 ? 179  ALA A CB  1 
ATOM   1402 N N   . ASP A 1 180 ? 28.800 -9.533  28.761 1.00 11.29 ? 180  ASP A N   1 
ATOM   1403 C CA  . ASP A 1 180 ? 29.068 -8.946  27.450 1.00 12.46 ? 180  ASP A CA  1 
ATOM   1404 C C   . ASP A 1 180 ? 28.023 -7.890  27.113 1.00 11.62 ? 180  ASP A C   1 
ATOM   1405 O O   . ASP A 1 180 ? 26.825 -8.134  27.237 1.00 11.48 ? 180  ASP A O   1 
ATOM   1406 C CB  . ASP A 1 180 ? 29.084 -10.033 26.371 1.00 15.89 ? 180  ASP A CB  1 
ATOM   1407 C CG  . ASP A 1 180 ? 30.394 -10.812 26.337 1.00 20.29 ? 180  ASP A CG  1 
ATOM   1408 O OD1 . ASP A 1 180 ? 30.410 -11.990 26.758 1.00 21.75 ? 180  ASP A OD1 1 
ATOM   1409 O OD2 . ASP A 1 180 ? 31.405 -10.252 25.860 1.00 22.88 ? 180  ASP A OD2 1 
ATOM   1410 N N   . HIS A 1 181 ? 28.487 -6.705  26.730 1.00 11.75 ? 181  HIS A N   1 
ATOM   1411 C CA  . HIS A 1 181 ? 27.596 -5.599  26.390 1.00 11.76 ? 181  HIS A CA  1 
ATOM   1412 C C   . HIS A 1 181 ? 27.661 -5.188  24.927 1.00 12.55 ? 181  HIS A C   1 
ATOM   1413 O O   . HIS A 1 181 ? 28.746 -4.979  24.381 1.00 11.64 ? 181  HIS A O   1 
ATOM   1414 C CB  . HIS A 1 181 ? 27.936 -4.360  27.219 1.00 11.38 ? 181  HIS A CB  1 
ATOM   1415 C CG  . HIS A 1 181 ? 27.534 -4.445  28.659 1.00 11.83 ? 181  HIS A CG  1 
ATOM   1416 N ND1 . HIS A 1 181 ? 27.923 -5.473  29.487 1.00 12.11 ? 181  HIS A ND1 1 
ATOM   1417 C CD2 . HIS A 1 181 ? 26.785 -3.612  29.419 1.00 10.26 ? 181  HIS A CD2 1 
ATOM   1418 C CE1 . HIS A 1 181 ? 27.426 -5.272  30.694 1.00 11.33 ? 181  HIS A CE1 1 
ATOM   1419 N NE2 . HIS A 1 181 ? 26.733 -4.150  30.681 1.00 9.48  ? 181  HIS A NE2 1 
ATOM   1420 N N   . TYR A 1 182 ? 26.488 -5.098  24.305 1.00 12.50 ? 182  TYR A N   1 
ATOM   1421 C CA  . TYR A 1 182 ? 26.353 -4.629  22.930 1.00 14.08 ? 182  TYR A CA  1 
ATOM   1422 C C   . TYR A 1 182 ? 25.431 -3.425  23.085 1.00 13.00 ? 182  TYR A C   1 
ATOM   1423 O O   . TYR A 1 182 ? 24.358 -3.544  23.665 1.00 12.98 ? 182  TYR A O   1 
ATOM   1424 C CB  . TYR A 1 182 ? 25.734 -5.681  21.997 1.00 17.56 ? 182  TYR A CB  1 
ATOM   1425 C CG  . TYR A 1 182 ? 25.562 -5.201  20.556 1.00 20.99 ? 182  TYR A CG  1 
ATOM   1426 C CD1 . TYR A 1 182 ? 26.600 -4.507  19.886 1.00 22.86 ? 182  TYR A CD1 1 
ATOM   1427 C CD2 . TYR A 1 182 ? 24.352 -5.411  19.862 1.00 23.90 ? 182  TYR A CD2 1 
ATOM   1428 C CE1 . TYR A 1 182 ? 26.436 -4.029  18.562 1.00 25.31 ? 182  TYR A CE1 1 
ATOM   1429 C CE2 . TYR A 1 182 ? 24.179 -4.939  18.522 1.00 27.27 ? 182  TYR A CE2 1 
ATOM   1430 C CZ  . TYR A 1 182 ? 25.231 -4.251  17.888 1.00 26.66 ? 182  TYR A CZ  1 
ATOM   1431 O OH  . TYR A 1 182 ? 25.098 -3.804  16.591 1.00 29.80 ? 182  TYR A OH  1 
ATOM   1432 N N   . GLN A 1 183 ? 25.853 -2.286  22.544 1.00 12.79 ? 183  GLN A N   1 
ATOM   1433 C CA  . GLN A 1 183 ? 25.105 -1.034  22.669 1.00 13.12 ? 183  GLN A CA  1 
ATOM   1434 C C   . GLN A 1 183 ? 24.856 -0.331  21.340 1.00 13.53 ? 183  GLN A C   1 
ATOM   1435 O O   . GLN A 1 183 ? 25.694 -0.382  20.444 1.00 11.66 ? 183  GLN A O   1 
ATOM   1436 C CB  . GLN A 1 183 ? 25.886 -0.111  23.618 1.00 12.97 ? 183  GLN A CB  1 
ATOM   1437 C CG  . GLN A 1 183 ? 25.278 1.252   23.933 1.00 11.39 ? 183  GLN A CG  1 
ATOM   1438 C CD  . GLN A 1 183 ? 26.169 2.101   24.818 1.00 12.15 ? 183  GLN A CD  1 
ATOM   1439 O OE1 . GLN A 1 183 ? 26.957 1.584   25.617 1.00 11.55 ? 183  GLN A OE1 1 
ATOM   1440 N NE2 . GLN A 1 183 ? 26.045 3.418   24.686 1.00 13.91 ? 183  GLN A NE2 1 
ATOM   1441 N N   . GLN A 1 184 ? 23.684 0.298   21.226 1.00 14.29 ? 184  GLN A N   1 
ATOM   1442 C CA  . GLN A 1 184 ? 23.278 1.068   20.044 1.00 15.95 ? 184  GLN A CA  1 
ATOM   1443 C C   . GLN A 1 184 ? 22.626 2.368   20.513 1.00 15.30 ? 184  GLN A C   1 
ATOM   1444 O O   . GLN A 1 184 ? 21.810 2.352   21.441 1.00 13.62 ? 184  GLN A O   1 
ATOM   1445 C CB  . GLN A 1 184 ? 22.256 0.300   19.189 1.00 19.90 ? 184  GLN A CB  1 
ATOM   1446 C CG  . GLN A 1 184 ? 22.800 -0.880  18.389 1.00 27.15 ? 184  GLN A CG  1 
ATOM   1447 C CD  . GLN A 1 184 ? 21.741 -1.551  17.520 1.00 30.42 ? 184  GLN A CD  1 
ATOM   1448 O OE1 . GLN A 1 184 ? 20.554 -1.584  17.865 1.00 33.73 ? 184  GLN A OE1 1 
ATOM   1449 N NE2 . GLN A 1 184 ? 22.170 -2.093  16.383 1.00 33.36 ? 184  GLN A NE2 1 
ATOM   1450 N N   . ASN A 1 185 ? 23.034 3.491   19.917 1.00 13.96 ? 185  ASN A N   1 
ATOM   1451 C CA  . ASN A 1 185 ? 22.471 4.808   20.234 1.00 13.25 ? 185  ASN A CA  1 
ATOM   1452 C C   . ASN A 1 185 ? 22.050 5.507   18.949 1.00 13.72 ? 185  ASN A C   1 
ATOM   1453 O O   . ASN A 1 185 ? 22.800 5.529   17.971 1.00 13.30 ? 185  ASN A O   1 
ATOM   1454 C CB  . ASN A 1 185 ? 23.460 5.723   20.971 1.00 12.90 ? 185  ASN A CB  1 
ATOM   1455 C CG  . ASN A 1 185 ? 23.860 5.203   22.336 1.00 13.90 ? 185  ASN A CG  1 
ATOM   1456 O OD1 . ASN A 1 185 ? 24.526 4.176   22.449 1.00 11.57 ? 185  ASN A OD1 1 
ATOM   1457 N ND2 . ASN A 1 185 ? 23.496 5.941   23.379 1.00 13.08 ? 185  ASN A ND2 1 
ATOM   1458 N N   . THR A 1 186 ? 20.848 6.073   18.963 1.00 13.53 ? 186  THR A N   1 
ATOM   1459 C CA  . THR A 1 186 ? 20.303 6.791   17.811 1.00 16.16 ? 186  THR A CA  1 
ATOM   1460 C C   . THR A 1 186 ? 19.644 8.089   18.315 1.00 13.87 ? 186  THR A C   1 
ATOM   1461 O O   . THR A 1 186 ? 18.988 8.076   19.358 1.00 14.16 ? 186  THR A O   1 
ATOM   1462 C CB  . THR A 1 186 ? 19.310 5.881   16.981 1.00 18.83 ? 186  THR A CB  1 
ATOM   1463 O OG1 . THR A 1 186 ? 18.760 6.628   15.886 1.00 22.69 ? 186  THR A OG1 1 
ATOM   1464 C CG2 . THR A 1 186 ? 18.186 5.331   17.838 1.00 21.07 ? 186  THR A CG2 1 
ATOM   1465 N N   . PRO A 1 187 ? 19.840 9.230   17.608 1.00 13.91 ? 187  PRO A N   1 
ATOM   1466 C CA  . PRO A 1 187 ? 19.231 10.490  18.059 1.00 13.17 ? 187  PRO A CA  1 
ATOM   1467 C C   . PRO A 1 187 ? 17.707 10.554  17.917 1.00 14.10 ? 187  PRO A C   1 
ATOM   1468 O O   . PRO A 1 187 ? 17.131 9.910   17.034 1.00 13.90 ? 187  PRO A O   1 
ATOM   1469 C CB  . PRO A 1 187 ? 19.936 11.537  17.192 1.00 13.55 ? 187  PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 187 ? 20.210 10.805  15.923 1.00 16.37 ? 187  PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 187 ? 20.688 9.466   16.422 1.00 14.53 ? 187  PRO A CD  1 
ATOM   1472 N N   . ILE A 1 188 ? 17.066 11.283  18.831 1.00 13.01 ? 188  ILE A N   1 
ATOM   1473 C CA  . ILE A 1 188 ? 15.612 11.462  18.818 1.00 14.57 ? 188  ILE A CA  1 
ATOM   1474 C C   . ILE A 1 188 ? 15.267 12.599  17.848 1.00 15.51 ? 188  ILE A C   1 
ATOM   1475 O O   . ILE A 1 188 ? 14.301 12.498  17.085 1.00 16.09 ? 188  ILE A O   1 
ATOM   1476 C CB  . ILE A 1 188 ? 15.052 11.731  20.258 1.00 13.71 ? 188  ILE A CB  1 
ATOM   1477 C CG1 . ILE A 1 188 ? 15.291 10.493  21.136 1.00 12.88 ? 188  ILE A CG1 1 
ATOM   1478 C CG2 . ILE A 1 188 ? 13.529 12.021  20.220 1.00 15.46 ? 188  ILE A CG2 1 
ATOM   1479 C CD1 . ILE A 1 188 ? 14.996 10.669  22.629 1.00 12.96 ? 188  ILE A CD1 1 
ATOM   1480 N N   . GLY A 1 189 ? 16.098 13.642  17.855 1.00 17.94 ? 189  GLY A N   1 
ATOM   1481 C CA  . GLY A 1 189 ? 15.906 14.788  16.974 1.00 20.32 ? 189  GLY A CA  1 
ATOM   1482 C C   . GLY A 1 189 ? 16.472 14.573  15.580 1.00 22.81 ? 189  GLY A C   1 
ATOM   1483 O O   . GLY A 1 189 ? 17.181 13.592  15.337 1.00 21.03 ? 189  GLY A O   1 
ATOM   1484 N N   . ASP A 1 190 ? 16.145 15.490  14.670 1.00 25.39 ? 190  ASP A N   1 
ATOM   1485 C CA  . ASP A 1 190 ? 16.596 15.427  13.277 1.00 28.67 ? 190  ASP A CA  1 
ATOM   1486 C C   . ASP A 1 190 ? 17.793 16.334  12.983 1.00 29.03 ? 190  ASP A C   1 
ATOM   1487 O O   . ASP A 1 190 ? 18.278 16.388  11.845 1.00 31.07 ? 190  ASP A O   1 
ATOM   1488 C CB  . ASP A 1 190 ? 15.428 15.729  12.315 1.00 32.11 ? 190  ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 190 ? 14.644 16.983  12.698 1.00 34.89 ? 190  ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 190 ? 15.180 18.103  12.548 1.00 37.23 ? 190  ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 190 ? 13.488 16.840  13.148 1.00 37.52 ? 190  ASP A OD2 1 
ATOM   1492 N N   . GLY A 1 191 ? 18.269 17.022  14.023 1.00 27.66 ? 191  GLY A N   1 
ATOM   1493 C CA  . GLY A 1 191 ? 19.406 17.923  13.908 1.00 24.75 ? 191  GLY A CA  1 
ATOM   1494 C C   . GLY A 1 191 ? 20.728 17.200  13.694 1.00 22.57 ? 191  GLY A C   1 
ATOM   1495 O O   . GLY A 1 191 ? 20.807 15.995  13.954 1.00 23.62 ? 191  GLY A O   1 
ATOM   1496 N N   . PRO A 1 192 ? 21.786 17.898  13.233 1.00 21.13 ? 192  PRO A N   1 
ATOM   1497 C CA  . PRO A 1 192 ? 23.086 17.257  13.000 1.00 18.89 ? 192  PRO A CA  1 
ATOM   1498 C C   . PRO A 1 192 ? 23.818 16.819  14.272 1.00 17.66 ? 192  PRO A C   1 
ATOM   1499 O O   . PRO A 1 192 ? 23.832 17.535  15.278 1.00 16.56 ? 192  PRO A O   1 
ATOM   1500 C CB  . PRO A 1 192 ? 23.856 18.327  12.233 1.00 18.56 ? 192  PRO A CB  1 
ATOM   1501 C CG  . PRO A 1 192 ? 23.336 19.601  12.808 1.00 19.34 ? 192  PRO A CG  1 
ATOM   1502 C CD  . PRO A 1 192 ? 21.849 19.339  12.910 1.00 20.44 ? 192  PRO A CD  1 
ATOM   1503 N N   . VAL A 1 193 ? 24.328 15.593  14.238 1.00 14.96 ? 193  VAL A N   1 
ATOM   1504 C CA  . VAL A 1 193 ? 25.072 15.027  15.356 1.00 15.46 ? 193  VAL A CA  1 
ATOM   1505 C C   . VAL A 1 193 ? 26.498 14.729  14.903 1.00 14.50 ? 193  VAL A C   1 
ATOM   1506 O O   . VAL A 1 193 ? 26.786 14.710  13.701 1.00 16.45 ? 193  VAL A O   1 
ATOM   1507 C CB  . VAL A 1 193 ? 24.408 13.721  15.924 1.00 14.54 ? 193  VAL A CB  1 
ATOM   1508 C CG1 . VAL A 1 193 ? 23.037 14.021  16.519 1.00 13.49 ? 193  VAL A CG1 1 
ATOM   1509 C CG2 . VAL A 1 193 ? 24.307 12.632  14.859 1.00 14.87 ? 193  VAL A CG2 1 
ATOM   1510 N N   . LEU A 1 194 ? 27.381 14.493  15.869 1.00 14.44 ? 194  LEU A N   1 
ATOM   1511 C CA  . LEU A 1 194 ? 28.771 14.171  15.580 1.00 14.74 ? 194  LEU A CA  1 
ATOM   1512 C C   . LEU A 1 194 ? 28.933 12.655  15.481 1.00 15.62 ? 194  LEU A C   1 
ATOM   1513 O O   . LEU A 1 194 ? 28.518 11.923  16.382 1.00 14.76 ? 194  LEU A O   1 
ATOM   1514 C CB  . LEU A 1 194 ? 29.693 14.752  16.665 1.00 13.91 ? 194  LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 194 ? 29.742 16.285  16.799 1.00 12.15 ? 194  LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 194 ? 30.465 16.668  18.071 1.00 12.61 ? 194  LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 194 ? 30.395 16.936  15.582 1.00 12.70 ? 194  LEU A CD2 1 
ATOM   1518 N N   . LEU A 1 195 ? 29.428 12.194  14.331 1.00 15.67 ? 195  LEU A N   1 
ATOM   1519 C CA  . LEU A 1 195 ? 29.681 10.773  14.076 1.00 17.28 ? 195  LEU A CA  1 
ATOM   1520 C C   . LEU A 1 195 ? 31.174 10.568  14.344 1.00 16.70 ? 195  LEU A C   1 
ATOM   1521 O O   . LEU A 1 195 ? 32.024 10.987  13.550 1.00 17.47 ? 195  LEU A O   1 
ATOM   1522 C CB  . LEU A 1 195 ? 29.321 10.385  12.630 1.00 20.43 ? 195  LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 195 ? 27.860 10.305  12.149 1.00 22.92 ? 195  LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 195 ? 27.014 9.503   13.134 1.00 23.45 ? 195  LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 195 ? 27.270 11.691  11.947 1.00 26.66 ? 195  LEU A CD2 1 
ATOM   1526 N N   . PRO A 1 196 ? 31.513 9.905   15.465 1.00 16.19 ? 196  PRO A N   1 
ATOM   1527 C CA  . PRO A 1 196 ? 32.907 9.668   15.835 1.00 14.80 ? 196  PRO A CA  1 
ATOM   1528 C C   . PRO A 1 196 ? 33.710 8.611   15.117 1.00 13.75 ? 196  PRO A C   1 
ATOM   1529 O O   . PRO A 1 196 ? 33.164 7.694   14.504 1.00 13.07 ? 196  PRO A O   1 
ATOM   1530 C CB  . PRO A 1 196 ? 32.788 9.292   17.303 1.00 16.17 ? 196  PRO A CB  1 
ATOM   1531 C CG  . PRO A 1 196 ? 31.546 8.506   17.346 1.00 16.20 ? 196  PRO A CG  1 
ATOM   1532 C CD  . PRO A 1 196 ? 30.613 9.342   16.494 1.00 15.94 ? 196  PRO A CD  1 
ATOM   1533 N N   . ASP A 1 197 ? 35.028 8.754   15.251 1.00 14.17 ? 197  ASP A N   1 
ATOM   1534 C CA  . ASP A 1 197 ? 35.994 7.786   14.744 1.00 15.05 ? 197  ASP A CA  1 
ATOM   1535 C C   . ASP A 1 197 ? 36.071 6.810   15.917 1.00 13.69 ? 197  ASP A C   1 
ATOM   1536 O O   . ASP A 1 197 ? 35.587 7.122   17.017 1.00 15.10 ? 197  ASP A O   1 
ATOM   1537 C CB  . ASP A 1 197 ? 37.386 8.412   14.566 1.00 14.44 ? 197  ASP A CB  1 
ATOM   1538 C CG  . ASP A 1 197 ? 37.492 9.309   13.348 1.00 16.98 ? 197  ASP A CG  1 
ATOM   1539 O OD1 . ASP A 1 197 ? 36.624 9.250   12.453 1.00 16.83 ? 197  ASP A OD1 1 
ATOM   1540 O OD2 . ASP A 1 197 ? 38.478 10.076  13.292 1.00 18.16 ? 197  ASP A OD2 1 
ATOM   1541 N N   . ASN A 1 198 ? 36.703 5.661   15.701 1.00 13.55 ? 198  ASN A N   1 
ATOM   1542 C CA  . ASN A 1 198 ? 36.850 4.651   16.745 1.00 13.79 ? 198  ASN A CA  1 
ATOM   1543 C C   . ASN A 1 198 ? 37.639 5.172   17.947 1.00 13.53 ? 198  ASN A C   1 
ATOM   1544 O O   . ASN A 1 198 ? 38.723 5.745   17.792 1.00 13.82 ? 198  ASN A O   1 
ATOM   1545 C CB  . ASN A 1 198 ? 37.518 3.392   16.184 1.00 15.16 ? 198  ASN A CB  1 
ATOM   1546 C CG  . ASN A 1 198 ? 36.626 2.624   15.220 1.00 16.02 ? 198  ASN A CG  1 
ATOM   1547 O OD1 . ASN A 1 198 ? 35.545 3.079   14.834 1.00 15.12 ? 198  ASN A OD1 1 
ATOM   1548 N ND2 . ASN A 1 198 ? 37.076 1.436   14.835 1.00 17.92 ? 198  ASN A ND2 1 
ATOM   1549 N N   . HIS A 1 199 ? 37.026 5.057   19.125 1.00 12.02 ? 199  HIS A N   1 
ATOM   1550 C CA  . HIS A 1 199 ? 37.625 5.483   20.390 1.00 10.95 ? 199  HIS A CA  1 
ATOM   1551 C C   . HIS A 1 199 ? 36.969 4.732   21.547 1.00 11.65 ? 199  HIS A C   1 
ATOM   1552 O O   . HIS A 1 199 ? 36.051 3.939   21.334 1.00 11.25 ? 199  HIS A O   1 
ATOM   1553 C CB  . HIS A 1 199 ? 37.504 7.011   20.587 1.00 11.69 ? 199  HIS A CB  1 
ATOM   1554 C CG  . HIS A 1 199 ? 36.115 7.499   20.881 1.00 11.42 ? 199  HIS A CG  1 
ATOM   1555 N ND1 . HIS A 1 199 ? 35.135 7.589   19.916 1.00 13.00 ? 199  HIS A ND1 1 
ATOM   1556 C CD2 . HIS A 1 199 ? 35.547 7.926   22.034 1.00 11.00 ? 199  HIS A CD2 1 
ATOM   1557 C CE1 . HIS A 1 199 ? 34.024 8.050   20.464 1.00 11.95 ? 199  HIS A CE1 1 
ATOM   1558 N NE2 . HIS A 1 199 ? 34.247 8.261   21.747 1.00 11.03 ? 199  HIS A NE2 1 
ATOM   1559 N N   . TYR A 1 200 ? 37.423 5.010   22.768 1.00 11.73 ? 200  TYR A N   1 
ATOM   1560 C CA  . TYR A 1 200 ? 36.854 4.367   23.941 1.00 11.87 ? 200  TYR A CA  1 
ATOM   1561 C C   . TYR A 1 200 ? 36.607 5.296   25.115 1.00 12.10 ? 200  TYR A C   1 
ATOM   1562 O O   . TYR A 1 200 ? 37.169 6.389   25.183 1.00 11.55 ? 200  TYR A O   1 
ATOM   1563 C CB  . TYR A 1 200 ? 37.687 3.142   24.383 1.00 13.90 ? 200  TYR A CB  1 
ATOM   1564 C CG  . TYR A 1 200 ? 39.107 3.403   24.859 1.00 14.81 ? 200  TYR A CG  1 
ATOM   1565 C CD1 . TYR A 1 200 ? 39.380 3.671   26.221 1.00 14.50 ? 200  TYR A CD1 1 
ATOM   1566 C CD2 . TYR A 1 200 ? 40.194 3.340   23.963 1.00 15.90 ? 200  TYR A CD2 1 
ATOM   1567 C CE1 . TYR A 1 200 ? 40.705 3.874   26.686 1.00 16.46 ? 200  TYR A CE1 1 
ATOM   1568 C CE2 . TYR A 1 200 ? 41.532 3.538   24.419 1.00 16.87 ? 200  TYR A CE2 1 
ATOM   1569 C CZ  . TYR A 1 200 ? 41.772 3.807   25.781 1.00 17.36 ? 200  TYR A CZ  1 
ATOM   1570 O OH  . TYR A 1 200 ? 43.054 4.015   26.234 1.00 18.89 ? 200  TYR A OH  1 
ATOM   1571 N N   . LEU A 1 201 ? 35.755 4.844   26.032 1.00 10.97 ? 201  LEU A N   1 
ATOM   1572 C CA  . LEU A 1 201 ? 35.460 5.590   27.248 1.00 11.58 ? 201  LEU A CA  1 
ATOM   1573 C C   . LEU A 1 201 ? 36.026 4.782   28.410 1.00 11.45 ? 201  LEU A C   1 
ATOM   1574 O O   . LEU A 1 201 ? 35.583 3.655   28.658 1.00 12.03 ? 201  LEU A O   1 
ATOM   1575 C CB  . LEU A 1 201 ? 33.951 5.780   27.442 1.00 10.43 ? 201  LEU A CB  1 
ATOM   1576 C CG  . LEU A 1 201 ? 33.071 6.477   26.406 1.00 9.54  ? 201  LEU A CG  1 
ATOM   1577 C CD1 . LEU A 1 201 ? 31.630 6.460   26.885 1.00 12.02 ? 201  LEU A CD1 1 
ATOM   1578 C CD2 . LEU A 1 201 ? 33.534 7.897   26.161 1.00 11.78 ? 201  LEU A CD2 1 
ATOM   1579 N N   . SER A 1 202 ? 37.052 5.327   29.068 1.00 11.27 ? 202  SER A N   1 
ATOM   1580 C CA  . SER A 1 202 ? 37.681 4.684   30.227 1.00 11.42 ? 202  SER A CA  1 
ATOM   1581 C C   . SER A 1 202 ? 36.730 4.968   31.382 1.00 11.18 ? 202  SER A C   1 
ATOM   1582 O O   . SER A 1 202 ? 36.574 6.116   31.798 1.00 10.44 ? 202  SER A O   1 
ATOM   1583 C CB  . SER A 1 202 ? 39.068 5.283   30.499 1.00 12.69 ? 202  SER A CB  1 
ATOM   1584 O OG  . SER A 1 202 ? 39.673 4.682   31.628 1.00 14.14 ? 202  SER A OG  1 
ATOM   1585 N N   . THR A 1 203 ? 36.071 3.914   31.856 1.00 11.05 ? 203  THR A N   1 
ATOM   1586 C CA  . THR A 1 203 ? 35.067 4.021   32.907 1.00 11.71 ? 203  THR A CA  1 
ATOM   1587 C C   . THR A 1 203 ? 35.486 3.360   34.222 1.00 13.31 ? 203  THR A C   1 
ATOM   1588 O O   . THR A 1 203 ? 35.851 2.183   34.254 1.00 12.79 ? 203  THR A O   1 
ATOM   1589 C CB  . THR A 1 203 ? 33.736 3.405   32.401 1.00 12.24 ? 203  THR A CB  1 
ATOM   1590 O OG1 . THR A 1 203 ? 33.446 3.899   31.088 1.00 13.27 ? 203  THR A OG1 1 
ATOM   1591 C CG2 . THR A 1 203 ? 32.569 3.737   33.323 1.00 12.94 ? 203  THR A CG2 1 
ATOM   1592 N N   . GLN A 1 204 ? 35.434 4.143   35.297 1.00 12.03 ? 204  GLN A N   1 
ATOM   1593 C CA  . GLN A 1 204 ? 35.784 3.685   36.642 1.00 15.09 ? 204  GLN A CA  1 
ATOM   1594 C C   . GLN A 1 204 ? 34.581 3.922   37.548 1.00 14.63 ? 204  GLN A C   1 
ATOM   1595 O O   . GLN A 1 204 ? 34.143 5.061   37.708 1.00 14.49 ? 204  GLN A O   1 
ATOM   1596 C CB  . GLN A 1 204 ? 36.997 4.461   37.171 1.00 17.81 ? 204  GLN A CB  1 
ATOM   1597 C CG  . GLN A 1 204 ? 38.267 4.289   36.342 1.00 24.29 ? 204  GLN A CG  1 
ATOM   1598 C CD  . GLN A 1 204 ? 39.314 5.334   36.643 1.00 28.38 ? 204  GLN A CD  1 
ATOM   1599 O OE1 . GLN A 1 204 ? 40.336 5.041   37.264 1.00 31.61 ? 204  GLN A OE1 1 
ATOM   1600 N NE2 . GLN A 1 204 ? 39.072 6.563   36.194 1.00 29.41 ? 204  GLN A NE2 1 
ATOM   1601 N N   . SER A 1 205 ? 34.045 2.846   38.121 1.00 14.55 ? 205  SER A N   1 
ATOM   1602 C CA  . SER A 1 205 ? 32.882 2.931   39.005 1.00 14.96 ? 205  SER A CA  1 
ATOM   1603 C C   . SER A 1 205 ? 33.226 2.539   40.439 1.00 14.94 ? 205  SER A C   1 
ATOM   1604 O O   . SER A 1 205 ? 33.953 1.568   40.668 1.00 15.75 ? 205  SER A O   1 
ATOM   1605 C CB  . SER A 1 205 ? 31.755 2.032   38.494 1.00 14.76 ? 205  SER A CB  1 
ATOM   1606 O OG  . SER A 1 205 ? 31.532 2.198   37.104 1.00 13.55 ? 205  SER A OG  1 
ATOM   1607 N N   . ALA A 1 206 ? 32.685 3.295   41.392 1.00 12.39 ? 206  ALA A N   1 
ATOM   1608 C CA  . ALA A 1 206 ? 32.896 3.052   42.820 1.00 12.71 ? 206  ALA A CA  1 
ATOM   1609 C C   . ALA A 1 206 ? 31.523 2.955   43.473 1.00 11.78 ? 206  ALA A C   1 
ATOM   1610 O O   . ALA A 1 206 ? 30.710 3.880   43.364 1.00 10.36 ? 206  ALA A O   1 
ATOM   1611 C CB  . ALA A 1 206 ? 33.709 4.192   43.446 1.00 13.48 ? 206  ALA A CB  1 
ATOM   1612 N N   . LEU A 1 207 ? 31.258 1.816   44.114 1.00 10.57 ? 207  LEU A N   1 
ATOM   1613 C CA  . LEU A 1 207 ? 29.971 1.572   44.770 1.00 11.26 ? 207  LEU A CA  1 
ATOM   1614 C C   . LEU A 1 207 ? 30.075 1.628   46.288 1.00 10.75 ? 207  LEU A C   1 
ATOM   1615 O O   . LEU A 1 207 ? 31.031 1.112   46.873 1.00 12.45 ? 207  LEU A O   1 
ATOM   1616 C CB  . LEU A 1 207 ? 29.394 0.211   44.352 1.00 12.10 ? 207  LEU A CB  1 
ATOM   1617 C CG  . LEU A 1 207 ? 29.499 -0.324  42.919 1.00 14.29 ? 207  LEU A CG  1 
ATOM   1618 C CD1 . LEU A 1 207 ? 28.699 -1.596  42.818 1.00 10.74 ? 207  LEU A CD1 1 
ATOM   1619 C CD2 . LEU A 1 207 ? 28.997 0.666   41.904 1.00 14.78 ? 207  LEU A CD2 1 
ATOM   1620 N N   . SER A 1 208 ? 29.075 2.246   46.917 1.00 11.86 ? 208  SER A N   1 
ATOM   1621 C CA  . SER A 1 208 ? 29.027 2.384   48.373 1.00 12.63 ? 208  SER A CA  1 
ATOM   1622 C C   . SER A 1 208 ? 27.592 2.427   48.889 1.00 13.75 ? 208  SER A C   1 
ATOM   1623 O O   . SER A 1 208 ? 26.633 2.326   48.113 1.00 12.34 ? 208  SER A O   1 
ATOM   1624 C CB  . SER A 1 208 ? 29.798 3.637   48.822 1.00 14.07 ? 208  SER A CB  1 
ATOM   1625 O OG  . SER A 1 208 ? 29.327 4.798   48.161 1.00 13.03 ? 208  SER A OG  1 
ATOM   1626 N N   . LYS A 1 209 ? 27.455 2.535   50.208 1.00 13.67 ? 209  LYS A N   1 
ATOM   1627 C CA  . LYS A 1 209 ? 26.150 2.604   50.858 1.00 14.02 ? 209  LYS A CA  1 
ATOM   1628 C C   . LYS A 1 209 ? 26.043 3.901   51.652 1.00 14.26 ? 209  LYS A C   1 
ATOM   1629 O O   . LYS A 1 209 ? 27.053 4.457   52.089 1.00 15.20 ? 209  LYS A O   1 
ATOM   1630 C CB  . LYS A 1 209 ? 25.943 1.416   51.819 1.00 13.40 ? 209  LYS A CB  1 
ATOM   1631 C CG  . LYS A 1 209 ? 25.903 0.013   51.189 1.00 13.15 ? 209  LYS A CG  1 
ATOM   1632 C CD  . LYS A 1 209 ? 24.732 -0.182  50.228 1.00 11.79 ? 209  LYS A CD  1 
ATOM   1633 C CE  . LYS A 1 209 ? 24.595 -1.646  49.820 1.00 10.68 ? 209  LYS A CE  1 
ATOM   1634 N NZ  . LYS A 1 209 ? 23.646 -1.834  48.676 1.00 9.11  ? 209  LYS A NZ  1 
ATOM   1635 N N   . ASP A 1 210 ? 24.815 4.395   51.787 1.00 14.53 ? 210  ASP A N   1 
ATOM   1636 C CA  . ASP A 1 210 ? 24.512 5.597   52.566 1.00 16.59 ? 210  ASP A CA  1 
ATOM   1637 C C   . ASP A 1 210 ? 24.182 5.011   53.954 1.00 17.32 ? 210  ASP A C   1 
ATOM   1638 O O   . ASP A 1 210 ? 23.219 4.251   54.086 1.00 16.52 ? 210  ASP A O   1 
ATOM   1639 C CB  . ASP A 1 210 ? 23.308 6.334   51.936 1.00 18.06 ? 210  ASP A CB  1 
ATOM   1640 C CG  . ASP A 1 210 ? 22.819 7.548   52.751 1.00 18.59 ? 210  ASP A CG  1 
ATOM   1641 O OD1 . ASP A 1 210 ? 23.369 7.869   53.828 1.00 16.82 ? 210  ASP A OD1 1 
ATOM   1642 O OD2 . ASP A 1 210 ? 21.849 8.188   52.292 1.00 18.67 ? 210  ASP A OD2 1 
ATOM   1643 N N   . PRO A 1 211 ? 25.004 5.323   54.989 1.00 19.37 ? 211  PRO A N   1 
ATOM   1644 C CA  . PRO A 1 211 ? 24.793 4.816   56.356 1.00 19.83 ? 211  PRO A CA  1 
ATOM   1645 C C   . PRO A 1 211 ? 23.452 5.167   57.018 1.00 21.38 ? 211  PRO A C   1 
ATOM   1646 O O   . PRO A 1 211 ? 23.015 4.476   57.944 1.00 22.46 ? 211  PRO A O   1 
ATOM   1647 C CB  . PRO A 1 211 ? 25.985 5.395   57.124 1.00 20.09 ? 211  PRO A CB  1 
ATOM   1648 C CG  . PRO A 1 211 ? 26.296 6.665   56.380 1.00 21.04 ? 211  PRO A CG  1 
ATOM   1649 C CD  . PRO A 1 211 ? 26.189 6.206   54.950 1.00 19.10 ? 211  PRO A CD  1 
ATOM   1650 N N   . ASN A 1 212 ? 22.796 6.209   56.503 1.00 21.37 ? 212  ASN A N   1 
ATOM   1651 C CA  . ASN A 1 212 ? 21.506 6.674   57.014 1.00 23.11 ? 212  ASN A CA  1 
ATOM   1652 C C   . ASN A 1 212 ? 20.299 6.166   56.217 1.00 22.38 ? 212  ASN A C   1 
ATOM   1653 O O   . ASN A 1 212 ? 19.149 6.463   56.565 1.00 23.81 ? 212  ASN A O   1 
ATOM   1654 C CB  . ASN A 1 212 ? 21.488 8.207   57.076 1.00 25.57 ? 212  ASN A CB  1 
ATOM   1655 C CG  . ASN A 1 212 ? 22.484 8.765   58.083 1.00 27.81 ? 212  ASN A CG  1 
ATOM   1656 O OD1 . ASN A 1 212 ? 22.441 8.430   59.268 1.00 30.30 ? 212  ASN A OD1 1 
ATOM   1657 N ND2 . ASN A 1 212 ? 23.387 9.618   57.612 1.00 29.11 ? 212  ASN A ND2 1 
ATOM   1658 N N   . GLU A 1 213 ? 20.562 5.380   55.172 1.00 20.48 ? 213  GLU A N   1 
ATOM   1659 C CA  . GLU A 1 213 ? 19.506 4.831   54.322 1.00 18.22 ? 213  GLU A CA  1 
ATOM   1660 C C   . GLU A 1 213 ? 19.132 3.382   54.663 1.00 18.38 ? 213  GLU A C   1 
ATOM   1661 O O   . GLU A 1 213 ? 19.972 2.476   54.606 1.00 18.11 ? 213  GLU A O   1 
ATOM   1662 C CB  . GLU A 1 213 ? 19.897 4.964   52.842 1.00 17.18 ? 213  GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 213 ? 18.849 4.518   51.823 1.00 16.65 ? 213  GLU A CG  1 
ATOM   1664 C CD  . GLU A 1 213 ? 17.586 5.331   51.882 1.00 16.75 ? 213  GLU A CD  1 
ATOM   1665 O OE1 . GLU A 1 213 ? 17.624 6.519   51.502 1.00 19.45 ? 213  GLU A OE1 1 
ATOM   1666 O OE2 . GLU A 1 213 ? 16.563 4.778   52.327 1.00 17.66 ? 213  GLU A OE2 1 
ATOM   1667 N N   . LYS A 1 214 ? 17.843 3.182   54.940 1.00 16.26 ? 214  LYS A N   1 
ATOM   1668 C CA  . LYS A 1 214 ? 17.280 1.880   55.305 1.00 17.65 ? 214  LYS A CA  1 
ATOM   1669 C C   . LYS A 1 214 ? 16.708 1.083   54.126 1.00 15.74 ? 214  LYS A C   1 
ATOM   1670 O O   . LYS A 1 214 ? 16.550 -0.136  54.216 1.00 13.76 ? 214  LYS A O   1 
ATOM   1671 C CB  . LYS A 1 214 ? 16.214 2.064   56.392 1.00 21.38 ? 214  LYS A CB  1 
ATOM   1672 C CG  . LYS A 1 214 ? 16.760 2.652   57.696 1.00 25.96 ? 214  LYS A CG  1 
ATOM   1673 C CD  . LYS A 1 214 ? 15.655 3.278   58.529 1.00 31.43 ? 214  LYS A CD  1 
ATOM   1674 C CE  . LYS A 1 214 ? 16.215 3.953   59.772 1.00 33.60 ? 214  LYS A CE  1 
ATOM   1675 N NZ  . LYS A 1 214 ? 15.159 4.695   60.514 1.00 36.23 ? 214  LYS A NZ  1 
ATOM   1676 N N   . ARG A 1 215 ? 16.399 1.771   53.025 1.00 15.45 ? 215  ARG A N   1 
ATOM   1677 C CA  . ARG A 1 215 ? 15.868 1.119   51.818 1.00 13.94 ? 215  ARG A CA  1 
ATOM   1678 C C   . ARG A 1 215 ? 17.027 0.510   51.016 1.00 14.56 ? 215  ARG A C   1 
ATOM   1679 O O   . ARG A 1 215 ? 18.185 0.913   51.196 1.00 13.96 ? 215  ARG A O   1 
ATOM   1680 C CB  . ARG A 1 215 ? 15.108 2.129   50.948 1.00 16.06 ? 215  ARG A CB  1 
ATOM   1681 C CG  . ARG A 1 215 ? 13.812 2.659   51.568 1.00 16.00 ? 215  ARG A CG  1 
ATOM   1682 C CD  . ARG A 1 215 ? 13.305 3.917   50.853 1.00 16.54 ? 215  ARG A CD  1 
ATOM   1683 N NE  . ARG A 1 215 ? 14.212 5.054   51.036 1.00 16.17 ? 215  ARG A NE  1 
ATOM   1684 C CZ  . ARG A 1 215 ? 14.107 6.236   50.428 1.00 17.50 ? 215  ARG A CZ  1 
ATOM   1685 N NH1 . ARG A 1 215 ? 13.126 6.485   49.566 1.00 17.33 ? 215  ARG A NH1 1 
ATOM   1686 N NH2 . ARG A 1 215 ? 15.001 7.178   50.681 1.00 19.28 ? 215  ARG A NH2 1 
ATOM   1687 N N   . ASP A 1 216 ? 16.718 -0.478  50.170 1.00 13.36 ? 216  ASP A N   1 
ATOM   1688 C CA  . ASP A 1 216 ? 17.720 -1.143  49.322 1.00 13.27 ? 216  ASP A CA  1 
ATOM   1689 C C   . ASP A 1 216 ? 18.193 -0.089  48.316 1.00 12.12 ? 216  ASP A C   1 
ATOM   1690 O O   . ASP A 1 216 ? 17.393 0.443   47.540 1.00 11.79 ? 216  ASP A O   1 
ATOM   1691 C CB  . ASP A 1 216 ? 17.100 -2.354  48.615 1.00 14.03 ? 216  ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 216 ? 18.136 -3.384  48.165 1.00 14.05 ? 216  ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 216 ? 19.359 -3.133  48.270 1.00 14.46 ? 216  ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 216 ? 17.715 -4.462  47.702 1.00 14.71 ? 216  ASP A OD2 1 
ATOM   1695 N N   . HIS A 1 217 ? 19.482 0.241   48.389 1.00 11.22 ? 217  HIS A N   1 
ATOM   1696 C CA  . HIS A 1 217 ? 20.058 1.297   47.563 1.00 11.51 ? 217  HIS A CA  1 
ATOM   1697 C C   . HIS A 1 217 ? 21.490 1.065   47.066 1.00 10.78 ? 217  HIS A C   1 
ATOM   1698 O O   . HIS A 1 217 ? 22.140 0.092   47.441 1.00 12.94 ? 217  HIS A O   1 
ATOM   1699 C CB  . HIS A 1 217 ? 20.016 2.619   48.358 1.00 9.96  ? 217  HIS A CB  1 
ATOM   1700 C CG  . HIS A 1 217 ? 20.976 2.663   49.507 1.00 10.67 ? 217  HIS A CG  1 
ATOM   1701 N ND1 . HIS A 1 217 ? 20.823 1.881   50.631 1.00 11.34 ? 217  HIS A ND1 1 
ATOM   1702 C CD2 . HIS A 1 217 ? 22.129 3.351   49.679 1.00 11.06 ? 217  HIS A CD2 1 
ATOM   1703 C CE1 . HIS A 1 217 ? 21.845 2.080   51.444 1.00 12.00 ? 217  HIS A CE1 1 
ATOM   1704 N NE2 . HIS A 1 217 ? 22.651 2.967   50.890 1.00 10.93 ? 217  HIS A NE2 1 
ATOM   1705 N N   . MET A 1 218 ? 21.976 2.026   46.279 1.00 10.65 ? 218  MET A N   1 
ATOM   1706 C CA  . MET A 1 218 ? 23.335 2.030   45.744 1.00 11.59 ? 218  MET A CA  1 
ATOM   1707 C C   . MET A 1 218 ? 23.787 3.457   45.501 1.00 11.66 ? 218  MET A C   1 
ATOM   1708 O O   . MET A 1 218 ? 23.114 4.227   44.808 1.00 12.32 ? 218  MET A O   1 
ATOM   1709 C CB  . MET A 1 218 ? 23.463 1.224   44.438 1.00 10.87 ? 218  MET A CB  1 
ATOM   1710 C CG  . MET A 1 218 ? 24.860 1.274   43.775 1.00 11.66 ? 218  MET A CG  1 
ATOM   1711 S SD  . MET A 1 218 ? 25.076 0.281   42.269 1.00 11.96 ? 218  MET A SD  1 
ATOM   1712 C CE  . MET A 1 218 ? 24.048 1.156   41.118 1.00 11.08 ? 218  MET A CE  1 
ATOM   1713 N N   . VAL A 1 219 ? 24.934 3.792   46.087 1.00 12.16 ? 219  VAL A N   1 
ATOM   1714 C CA  . VAL A 1 219 ? 25.551 5.104   45.929 1.00 12.52 ? 219  VAL A CA  1 
ATOM   1715 C C   . VAL A 1 219 ? 26.671 4.859   44.910 1.00 12.36 ? 219  VAL A C   1 
ATOM   1716 O O   . VAL A 1 219 ? 27.505 3.967   45.096 1.00 11.62 ? 219  VAL A O   1 
ATOM   1717 C CB  . VAL A 1 219 ? 26.101 5.636   47.286 1.00 13.43 ? 219  VAL A CB  1 
ATOM   1718 C CG1 . VAL A 1 219 ? 26.848 6.948   47.107 1.00 11.67 ? 219  VAL A CG1 1 
ATOM   1719 C CG2 . VAL A 1 219 ? 24.959 5.833   48.274 1.00 13.05 ? 219  VAL A CG2 1 
ATOM   1720 N N   . LEU A 1 220 ? 26.625 5.601   43.808 1.00 11.08 ? 220  LEU A N   1 
ATOM   1721 C CA  . LEU A 1 220 ? 27.601 5.466   42.730 1.00 11.87 ? 220  LEU A CA  1 
ATOM   1722 C C   . LEU A 1 220 ? 28.404 6.724   42.428 1.00 10.47 ? 220  LEU A C   1 
ATOM   1723 O O   . LEU A 1 220 ? 27.847 7.814   42.252 1.00 11.35 ? 220  LEU A O   1 
ATOM   1724 C CB  . LEU A 1 220 ? 26.899 4.985   41.444 1.00 11.12 ? 220  LEU A CB  1 
ATOM   1725 C CG  . LEU A 1 220 ? 27.626 4.914   40.087 1.00 13.65 ? 220  LEU A CG  1 
ATOM   1726 C CD1 . LEU A 1 220 ? 28.733 3.874   40.103 1.00 11.53 ? 220  LEU A CD1 1 
ATOM   1727 C CD2 . LEU A 1 220 ? 26.642 4.596   38.988 1.00 12.95 ? 220  LEU A CD2 1 
ATOM   1728 N N   . LEU A 1 221 ? 29.720 6.535   42.354 1.00 11.11 ? 221  LEU A N   1 
ATOM   1729 C CA  . LEU A 1 221 ? 30.668 7.583   41.989 1.00 11.33 ? 221  LEU A CA  1 
ATOM   1730 C C   . LEU A 1 221 ? 31.317 6.992   40.740 1.00 11.24 ? 221  LEU A C   1 
ATOM   1731 O O   . LEU A 1 221 ? 31.972 5.947   40.807 1.00 11.14 ? 221  LEU A O   1 
ATOM   1732 C CB  . LEU A 1 221 ? 31.720 7.829   43.085 1.00 12.44 ? 221  LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 221 ? 32.877 8.791   42.740 1.00 14.49 ? 221  LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 221 ? 32.376 10.209  42.465 1.00 13.86 ? 221  LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 221 ? 33.907 8.800   43.857 1.00 15.93 ? 221  LEU A CD2 1 
ATOM   1736 N N   . GLU A 1 222 ? 31.091 7.641   39.601 1.00 11.13 ? 222  GLU A N   1 
ATOM   1737 C CA  . GLU A 1 222 ? 31.625 7.161   38.338 1.00 11.76 ? 222  GLU A CA  1 
ATOM   1738 C C   . GLU A 1 222 ? 32.400 8.219   37.567 1.00 12.42 ? 222  GLU A C   1 
ATOM   1739 O O   . GLU A 1 222 ? 31.966 9.366   37.451 1.00 14.21 ? 222  GLU A O   1 
ATOM   1740 C CB  . GLU A 1 222 ? 30.489 6.580   37.484 1.00 15.41 ? 222  GLU A CB  1 
ATOM   1741 C CG  . GLU A 1 222 ? 30.942 5.671   36.356 1.00 17.58 ? 222  GLU A CG  1 
ATOM   1742 C CD  . GLU A 1 222 ? 29.808 4.874   35.756 1.00 20.70 ? 222  GLU A CD  1 
ATOM   1743 O OE1 . GLU A 1 222 ? 29.291 3.968   36.440 1.00 25.74 ? 222  GLU A OE1 1 
ATOM   1744 O OE2 . GLU A 1 222 ? 29.439 5.141   34.597 1.00 25.48 ? 222  GLU A OE2 1 
ATOM   1745 N N   . PHE A 1 223 ? 33.577 7.817   37.090 1.00 11.99 ? 223  PHE A N   1 
ATOM   1746 C CA  . PHE A 1 223 ? 34.464 8.666   36.301 1.00 12.92 ? 223  PHE A CA  1 
ATOM   1747 C C   . PHE A 1 223 ? 34.602 8.080   34.912 1.00 11.84 ? 223  PHE A C   1 
ATOM   1748 O O   . PHE A 1 223 ? 34.939 6.905   34.757 1.00 11.97 ? 223  PHE A O   1 
ATOM   1749 C CB  . PHE A 1 223 ? 35.835 8.799   36.963 1.00 12.26 ? 223  PHE A CB  1 
ATOM   1750 C CG  . PHE A 1 223 ? 35.843 9.734   38.131 1.00 14.46 ? 223  PHE A CG  1 
ATOM   1751 C CD1 . PHE A 1 223 ? 35.789 9.236   39.446 1.00 12.31 ? 223  PHE A CD1 1 
ATOM   1752 C CD2 . PHE A 1 223 ? 35.852 11.128  37.925 1.00 14.76 ? 223  PHE A CD2 1 
ATOM   1753 C CE1 . PHE A 1 223 ? 35.736 10.118  40.552 1.00 14.94 ? 223  PHE A CE1 1 
ATOM   1754 C CE2 . PHE A 1 223 ? 35.798 12.022  39.015 1.00 14.81 ? 223  PHE A CE2 1 
ATOM   1755 C CZ  . PHE A 1 223 ? 35.737 11.516  40.338 1.00 13.39 ? 223  PHE A CZ  1 
ATOM   1756 N N   . VAL A 1 224 ? 34.234 8.873   33.909 1.00 13.06 ? 224  VAL A N   1 
ATOM   1757 C CA  . VAL A 1 224 ? 34.296 8.434   32.514 1.00 12.66 ? 224  VAL A CA  1 
ATOM   1758 C C   . VAL A 1 224 ? 35.111 9.438   31.688 1.00 12.17 ? 224  VAL A C   1 
ATOM   1759 O O   . VAL A 1 224 ? 34.796 10.630  31.642 1.00 13.27 ? 224  VAL A O   1 
ATOM   1760 C CB  . VAL A 1 224 ? 32.874 8.236   31.890 1.00 14.82 ? 224  VAL A CB  1 
ATOM   1761 C CG1 . VAL A 1 224 ? 32.965 7.362   30.660 1.00 15.37 ? 224  VAL A CG1 1 
ATOM   1762 C CG2 . VAL A 1 224 ? 31.894 7.604   32.878 1.00 14.94 ? 224  VAL A CG2 1 
ATOM   1763 N N   . THR A 1 225 ? 36.155 8.935   31.032 1.00 12.32 ? 225  THR A N   1 
ATOM   1764 C CA  . THR A 1 225 ? 37.052 9.760   30.223 1.00 10.80 ? 225  THR A CA  1 
ATOM   1765 C C   . THR A 1 225 ? 37.263 9.142   28.844 1.00 10.58 ? 225  THR A C   1 
ATOM   1766 O O   . THR A 1 225 ? 37.593 7.965   28.733 1.00 11.87 ? 225  THR A O   1 
ATOM   1767 C CB  . THR A 1 225 ? 38.439 9.899   30.924 1.00 11.70 ? 225  THR A CB  1 
ATOM   1768 O OG1 . THR A 1 225 ? 38.249 10.323  32.279 1.00 14.19 ? 225  THR A OG1 1 
ATOM   1769 C CG2 . THR A 1 225 ? 39.334 10.914  30.199 1.00 9.91  ? 225  THR A CG2 1 
ATOM   1770 N N   . ALA A 1 226 ? 37.099 9.953   27.802 1.00 12.17 ? 226  ALA A N   1 
ATOM   1771 C CA  . ALA A 1 226 ? 37.301 9.495   26.428 1.00 11.47 ? 226  ALA A CA  1 
ATOM   1772 C C   . ALA A 1 226 ? 38.787 9.472   26.093 1.00 11.67 ? 226  ALA A C   1 
ATOM   1773 O O   . ALA A 1 226 ? 39.537 10.343  26.538 1.00 11.65 ? 226  ALA A O   1 
ATOM   1774 C CB  . ALA A 1 226 ? 36.573 10.382  25.467 1.00 11.93 ? 226  ALA A CB  1 
ATOM   1775 N N   . ALA A 1 227 ? 39.197 8.453   25.339 1.00 10.73 ? 227  ALA A N   1 
ATOM   1776 C CA  . ALA A 1 227 ? 40.590 8.261   24.921 1.00 12.40 ? 227  ALA A CA  1 
ATOM   1777 C C   . ALA A 1 227 ? 40.635 7.366   23.679 1.00 13.55 ? 227  ALA A C   1 
ATOM   1778 O O   . ALA A 1 227 ? 39.591 6.943   23.177 1.00 11.52 ? 227  ALA A O   1 
ATOM   1779 C CB  . ALA A 1 227 ? 41.395 7.620   26.055 1.00 11.64 ? 227  ALA A CB  1 
ATOM   1780 N N   . GLY A 1 228 ? 41.844 7.106   23.179 1.00 15.24 ? 228  GLY A N   1 
ATOM   1781 C CA  . GLY A 1 228 ? 42.014 6.243   22.019 1.00 17.63 ? 228  GLY A CA  1 
ATOM   1782 C C   . GLY A 1 228 ? 42.216 6.904   20.675 1.00 19.69 ? 228  GLY A C   1 
ATOM   1783 O O   . GLY A 1 228 ? 42.309 6.210   19.662 1.00 21.35 ? 228  GLY A O   1 
ATOM   1784 N N   . ILE A 1 229 ? 42.222 8.234   20.647 1.00 21.97 ? 229  ILE A N   1 
ATOM   1785 C CA  . ILE A 1 229 ? 42.433 8.968   19.403 1.00 25.01 ? 229  ILE A CA  1 
ATOM   1786 C C   . ILE A 1 229 ? 43.752 9.727   19.451 1.00 27.73 ? 229  ILE A C   1 
ATOM   1787 O O   . ILE A 1 229 ? 44.041 10.446  20.415 1.00 26.30 ? 229  ILE A O   1 
ATOM   1788 C CB  . ILE A 1 229 ? 41.189 9.841   19.022 1.00 23.65 ? 229  ILE A CB  1 
ATOM   1789 C CG1 . ILE A 1 229 ? 40.186 8.940   18.289 1.00 24.57 ? 229  ILE A CG1 1 
ATOM   1790 C CG2 . ILE A 1 229 ? 41.563 11.051  18.127 1.00 26.32 ? 229  ILE A CG2 1 
ATOM   1791 C CD1 . ILE A 1 229 ? 38.843 9.522   18.060 1.00 20.87 ? 229  ILE A CD1 1 
ATOM   1792 N N   . THR A 1 230 ? 44.544 9.524   18.397 1.00 31.64 ? 230  THR A N   1 
ATOM   1793 C CA  . THR A 1 230 ? 45.864 10.131  18.234 1.00 36.11 ? 230  THR A CA  1 
ATOM   1794 C C   . THR A 1 230 ? 45.849 11.649  18.085 1.00 36.44 ? 230  THR A C   1 
ATOM   1795 O O   . THR A 1 230 ? 44.955 12.223  17.450 1.00 36.39 ? 230  THR A O   1 
ATOM   1796 C CB  . THR A 1 230 ? 46.626 9.523   17.024 1.00 37.91 ? 230  THR A CB  1 
ATOM   1797 O OG1 . THR A 1 230 ? 45.860 9.705   15.826 1.00 40.58 ? 230  THR A OG1 1 
ATOM   1798 C CG2 . THR A 1 230 ? 46.880 8.034   17.239 1.00 40.11 ? 230  THR A CG2 1 
ATOM   1799 N N   . HIS A 1 231 ? 46.846 12.278  18.699 1.00 36.95 ? 231  HIS A N   1 
ATOM   1800 C CA  . HIS A 1 231 ? 47.022 13.727  18.670 1.00 37.48 ? 231  HIS A CA  1 
ATOM   1801 C C   . HIS A 1 231 ? 48.499 14.072  18.526 1.00 37.17 ? 231  HIS A C   1 
ATOM   1802 O O   . HIS A 1 231 ? 49.365 13.218  18.747 1.00 37.58 ? 231  HIS A O   1 
ATOM   1803 C CB  . HIS A 1 231 ? 46.442 14.379  19.939 1.00 37.05 ? 231  HIS A CB  1 
ATOM   1804 C CG  . HIS A 1 231 ? 46.946 13.791  21.226 1.00 38.09 ? 231  HIS A CG  1 
ATOM   1805 N ND1 . HIS A 1 231 ? 48.030 14.304  21.905 1.00 37.54 ? 231  HIS A ND1 1 
ATOM   1806 C CD2 . HIS A 1 231 ? 46.501 12.747  21.966 1.00 39.04 ? 231  HIS A CD2 1 
ATOM   1807 C CE1 . HIS A 1 231 ? 48.230 13.605  23.008 1.00 38.37 ? 231  HIS A CE1 1 
ATOM   1808 N NE2 . HIS A 1 231 ? 47.316 12.653  23.069 1.00 39.00 ? 231  HIS A NE2 1 
ATOM   1809 N N   . GLY A 1 232 ? 48.770 15.317  18.138 1.00 37.48 ? 232  GLY A N   1 
ATOM   1810 C CA  . GLY A 1 232 ? 50.137 15.784  17.979 1.00 38.25 ? 232  GLY A CA  1 
ATOM   1811 C C   . GLY A 1 232 ? 50.495 16.801  19.048 1.00 38.73 ? 232  GLY A C   1 
ATOM   1812 O O   . GLY A 1 232 ? 51.350 17.661  18.824 1.00 39.49 ? 232  GLY A O   1 
ATOM   1813 N N   . MET A 1 233 ? 49.860 16.676  20.217 1.00 39.13 ? 233  MET A N   1 
ATOM   1814 C CA  . MET A 1 233 ? 50.068 17.579  21.357 1.00 39.84 ? 233  MET A CA  1 
ATOM   1815 C C   . MET A 1 233 ? 51.429 17.457  22.047 1.00 38.79 ? 233  MET A C   1 
ATOM   1816 O O   . MET A 1 233 ? 51.894 18.420  22.653 1.00 38.05 ? 233  MET A O   1 
ATOM   1817 C CB  . MET A 1 233 ? 48.951 17.406  22.398 1.00 41.73 ? 233  MET A CB  1 
ATOM   1818 C CG  . MET A 1 233 ? 47.536 17.751  21.922 1.00 43.85 ? 233  MET A CG  1 
ATOM   1819 S SD  . MET A 1 233 ? 47.145 19.517  21.912 1.00 46.49 ? 233  MET A SD  1 
ATOM   1820 C CE  . MET A 1 233 ? 47.081 19.860  20.146 1.00 47.48 ? 233  MET A CE  1 
ATOM   1821 N N   . ASP A 1 234 ? 52.068 16.290  21.932 1.00 38.14 ? 234  ASP A N   1 
ATOM   1822 C CA  . ASP A 1 234 ? 53.378 16.044  22.545 1.00 37.31 ? 234  ASP A CA  1 
ATOM   1823 C C   . ASP A 1 234 ? 54.537 16.764  21.851 1.00 36.74 ? 234  ASP A C   1 
ATOM   1824 O O   . ASP A 1 234 ? 55.583 17.003  22.465 1.00 36.39 ? 234  ASP A O   1 
ATOM   1825 C CB  . ASP A 1 234 ? 53.658 14.539  22.638 1.00 38.65 ? 234  ASP A CB  1 
ATOM   1826 C CG  . ASP A 1 234 ? 53.000 13.896  23.851 1.00 40.42 ? 234  ASP A CG  1 
ATOM   1827 O OD1 . ASP A 1 234 ? 51.754 13.806  23.888 1.00 40.45 ? 234  ASP A OD1 1 
ATOM   1828 O OD2 . ASP A 1 234 ? 53.734 13.484  24.775 1.00 42.93 ? 234  ASP A OD2 1 
ATOM   1829 N N   . GLU A 1 235 ? 54.309 17.167  20.599 1.00 36.10 ? 235  GLU A N   1 
ATOM   1830 C CA  . GLU A 1 235 ? 55.296 17.880  19.782 1.00 35.99 ? 235  GLU A CA  1 
ATOM   1831 C C   . GLU A 1 235 ? 55.468 19.338  20.241 1.00 34.26 ? 235  GLU A C   1 
ATOM   1832 O O   . GLU A 1 235 ? 56.511 19.955  20.004 1.00 35.17 ? 235  GLU A O   1 
ATOM   1833 C CB  . GLU A 1 235 ? 54.872 17.842  18.310 1.00 38.04 ? 235  GLU A CB  1 
ATOM   1834 C CG  . GLU A 1 235 ? 56.011 18.027  17.316 1.00 41.42 ? 235  GLU A CG  1 
ATOM   1835 C CD  . GLU A 1 235 ? 55.527 18.135  15.885 1.00 43.42 ? 235  GLU A CD  1 
ATOM   1836 O OE1 . GLU A 1 235 ? 55.685 19.224  15.289 1.00 44.20 ? 235  GLU A OE1 1 
ATOM   1837 O OE2 . GLU A 1 235 ? 54.994 17.135  15.357 1.00 44.81 ? 235  GLU A OE2 1 
ATOM   1838 N N   . LEU A 1 236 ? 54.453 19.855  20.938 1.00 32.63 ? 236  LEU A N   1 
ATOM   1839 C CA  . LEU A 1 236 ? 54.442 21.227  21.460 1.00 31.78 ? 236  LEU A CA  1 
ATOM   1840 C C   . LEU A 1 236 ? 55.376 21.408  22.657 1.00 31.63 ? 236  LEU A C   1 
ATOM   1841 O O   . LEU A 1 236 ? 55.660 22.533  23.073 1.00 31.77 ? 236  LEU A O   1 
ATOM   1842 C CB  . LEU A 1 236 ? 53.016 21.625  21.875 1.00 30.91 ? 236  LEU A CB  1 
ATOM   1843 C CG  . LEU A 1 236 ? 51.858 21.525  20.875 1.00 30.10 ? 236  LEU A CG  1 
ATOM   1844 C CD1 . LEU A 1 236 ? 50.556 21.892  21.575 1.00 29.51 ? 236  LEU A CD1 1 
ATOM   1845 C CD2 . LEU A 1 236 ? 52.094 22.425  19.674 1.00 29.97 ? 236  LEU A CD2 1 
ATOM   1846 N N   . TYR A 1 237 ? 55.835 20.284  23.210 1.00 31.44 ? 237  TYR A N   1 
ATOM   1847 C CA  . TYR A 1 237 ? 56.720 20.271  24.373 1.00 31.86 ? 237  TYR A CA  1 
ATOM   1848 C C   . TYR A 1 237 ? 58.052 19.587  24.061 1.00 32.87 ? 237  TYR A C   1 
ATOM   1849 O O   . TYR A 1 237 ? 58.031 18.467  23.501 1.00 33.69 ? 237  TYR A O   1 
ATOM   1850 C CB  . TYR A 1 237 ? 56.022 19.565  25.546 1.00 29.77 ? 237  TYR A CB  1 
ATOM   1851 C CG  . TYR A 1 237 ? 54.597 20.032  25.791 1.00 27.02 ? 237  TYR A CG  1 
ATOM   1852 C CD1 . TYR A 1 237 ? 53.498 19.253  25.367 1.00 25.95 ? 237  TYR A CD1 1 
ATOM   1853 C CD2 . TYR A 1 237 ? 54.334 21.268  26.426 1.00 26.88 ? 237  TYR A CD2 1 
ATOM   1854 C CE1 . TYR A 1 237 ? 52.154 19.696  25.566 1.00 25.79 ? 237  TYR A CE1 1 
ATOM   1855 C CE2 . TYR A 1 237 ? 52.996 21.719  26.635 1.00 25.27 ? 237  TYR A CE2 1 
ATOM   1856 C CZ  . TYR A 1 237 ? 51.916 20.928  26.199 1.00 26.41 ? 237  TYR A CZ  1 
ATOM   1857 O OH  . TYR A 1 237 ? 50.623 21.364  26.387 1.00 24.95 ? 237  TYR A OH  1 
HETATM 1858 O O   . HOH B 2 .   ? 30.485 5.298   45.815 1.00 9.72  ? 1001 HOH A O   1 
HETATM 1859 O O   . HOH B 2 .   ? 26.469 -5.632  33.907 1.00 7.50  ? 1002 HOH A O   1 
HETATM 1860 O O   . HOH B 2 .   ? 17.504 13.469  47.119 1.00 12.34 ? 1003 HOH A O   1 
HETATM 1861 O O   . HOH B 2 .   ? 29.770 12.628  26.321 1.00 7.25  ? 1004 HOH A O   1 
HETATM 1862 O O   . HOH B 2 .   ? 30.335 -8.263  41.382 1.00 9.94  ? 1005 HOH A O   1 
HETATM 1863 O O   . HOH B 2 .   ? 38.460 17.964  28.982 1.00 14.81 ? 1006 HOH A O   1 
HETATM 1864 O O   . HOH B 2 .   ? 36.397 -12.361 42.136 1.00 14.77 ? 1007 HOH A O   1 
HETATM 1865 O O   . HOH B 2 .   ? 35.570 -3.766  27.412 1.00 14.22 ? 1008 HOH A O   1 
HETATM 1866 O O   . HOH B 2 .   ? 30.904 9.494   20.942 1.00 11.40 ? 1009 HOH A O   1 
HETATM 1867 O O   . HOH B 2 .   ? 30.614 4.211   30.327 1.00 11.29 ? 1010 HOH A O   1 
HETATM 1868 O O   . HOH B 2 .   ? 12.481 20.401  28.218 1.00 16.86 ? 1011 HOH A O   1 
HETATM 1869 O O   . HOH B 2 .   ? 24.193 19.764  18.968 1.00 23.55 ? 1012 HOH A O   1 
HETATM 1870 O O   . HOH B 2 .   ? 18.679 14.322  18.852 1.00 16.21 ? 1013 HOH A O   1 
HETATM 1871 O O   . HOH B 2 .   ? 23.710 -14.600 28.160 1.00 15.35 ? 1014 HOH A O   1 
HETATM 1872 O O   . HOH B 2 .   ? 25.862 22.958  32.230 1.00 16.30 ? 1015 HOH A O   1 
HETATM 1873 O O   . HOH B 2 .   ? 30.268 -7.804  48.582 1.00 25.11 ? 1016 HOH A O   1 
HETATM 1874 O O   . HOH B 2 .   ? 29.160 17.184  21.515 1.00 15.20 ? 1017 HOH A O   1 
HETATM 1875 O O   . HOH B 2 .   ? 16.036 -9.853  27.784 1.00 14.74 ? 1018 HOH A O   1 
HETATM 1876 O O   . HOH B 2 .   ? 21.033 -16.168 37.900 1.00 15.74 ? 1019 HOH A O   1 
HETATM 1877 O O   . HOH B 2 .   ? 7.435  -11.706 33.205 1.00 21.27 ? 1020 HOH A O   1 
HETATM 1878 O O   . HOH B 2 .   ? 42.095 10.913  26.992 1.00 13.43 ? 1021 HOH A O   1 
HETATM 1879 O O   . HOH B 2 .   ? 38.811 12.656  33.445 1.00 17.33 ? 1022 HOH A O   1 
HETATM 1880 O O   . HOH B 2 .   ? 21.140 -1.762  49.960 1.00 13.44 ? 1023 HOH A O   1 
HETATM 1881 O O   . HOH B 2 .   ? 28.106 18.426  32.864 1.00 11.36 ? 1024 HOH A O   1 
HETATM 1882 O O   . HOH B 2 .   ? 22.946 -8.875  45.718 1.00 11.93 ? 1025 HOH A O   1 
HETATM 1883 O O   . HOH B 2 .   ? 27.748 24.455  37.650 1.00 22.20 ? 1026 HOH A O   1 
HETATM 1884 O O   . HOH B 2 .   ? 7.978  -2.354  39.080 1.00 20.49 ? 1027 HOH A O   1 
HETATM 1885 O O   . HOH B 2 .   ? 14.884 -17.732 23.352 1.00 20.73 ? 1028 HOH A O   1 
HETATM 1886 O O   . HOH B 2 .   ? 38.884 -14.280 39.252 1.00 21.15 ? 1029 HOH A O   1 
HETATM 1887 O O   . HOH B 2 .   ? 18.222 9.052   45.480 1.00 17.65 ? 1030 HOH A O   1 
HETATM 1888 O O   . HOH B 2 .   ? 26.799 -3.203  35.327 1.00 8.26  ? 1031 HOH A O   1 
HETATM 1889 O O   . HOH B 2 .   ? 26.527 -6.959  45.512 1.00 17.41 ? 1032 HOH A O   1 
HETATM 1890 O O   . HOH B 2 .   ? 22.150 22.653  31.095 1.00 19.67 ? 1033 HOH A O   1 
HETATM 1891 O O   . HOH B 2 .   ? 24.759 14.200  43.905 1.00 17.77 ? 1034 HOH A O   1 
HETATM 1892 O O   . HOH B 2 .   ? 14.377 10.217  40.019 1.00 21.52 ? 1035 HOH A O   1 
HETATM 1893 O O   . HOH B 2 .   ? 33.828 0.795   35.811 1.00 14.06 ? 1036 HOH A O   1 
HETATM 1894 O O   . HOH B 2 .   ? 24.011 -4.571  47.879 1.00 17.12 ? 1037 HOH A O   1 
HETATM 1895 O O   . HOH B 2 .   ? 25.294 -17.650 36.792 1.00 16.79 ? 1038 HOH A O   1 
HETATM 1896 O O   . HOH B 2 .   ? 28.734 2.389   33.532 1.00 16.75 ? 1039 HOH A O   1 
HETATM 1897 O O   . HOH B 2 .   ? 32.689 -4.814  37.369 1.00 11.95 ? 1040 HOH A O   1 
HETATM 1898 O O   . HOH B 2 .   ? 32.992 -0.376  44.472 1.00 13.64 ? 1041 HOH A O   1 
HETATM 1899 O O   . HOH B 2 .   ? 18.244 10.157  49.500 1.00 15.82 ? 1042 HOH A O   1 
HETATM 1900 O O   . HOH B 2 .   ? 14.807 -20.189 35.519 1.00 25.42 ? 1043 HOH A O   1 
HETATM 1901 O O   . HOH B 2 .   ? 13.837 -3.090  50.956 1.00 36.53 ? 1044 HOH A O   1 
HETATM 1902 O O   . HOH B 2 .   ? 33.412 16.684  27.591 1.00 15.75 ? 1045 HOH A O   1 
HETATM 1903 O O   . HOH B 2 .   ? 38.309 -9.240  38.913 1.00 20.92 ? 1046 HOH A O   1 
HETATM 1904 O O   . HOH B 2 .   ? 40.760 1.950   31.345 1.00 30.12 ? 1047 HOH A O   1 
HETATM 1905 O O   . HOH B 2 .   ? 20.047 -22.506 39.060 1.00 25.29 ? 1048 HOH A O   1 
HETATM 1906 O O   . HOH B 2 .   ? 13.430 -17.010 38.674 1.00 21.44 ? 1049 HOH A O   1 
HETATM 1907 O O   . HOH B 2 .   ? 36.712 -5.367  30.863 1.00 16.30 ? 1051 HOH A O   1 
HETATM 1908 O O   . HOH B 2 .   ? 42.389 -0.656  24.292 1.00 28.73 ? 1052 HOH A O   1 
HETATM 1909 O O   . HOH B 2 .   ? 37.803 7.787   33.603 1.00 20.17 ? 1053 HOH A O   1 
HETATM 1910 O O   . HOH B 2 .   ? 30.381 14.071  12.369 1.00 26.24 ? 1054 HOH A O   1 
HETATM 1911 O O   . HOH B 2 .   ? 32.860 -1.421  47.030 1.00 26.49 ? 1055 HOH A O   1 
HETATM 1912 O O   . HOH B 2 .   ? 16.217 5.384   55.635 1.00 21.57 ? 1056 HOH A O   1 
HETATM 1913 O O   . HOH B 2 .   ? 16.497 -12.905 43.301 1.00 23.80 ? 1057 HOH A O   1 
HETATM 1914 O O   . HOH B 2 .   ? 19.999 -4.301  21.872 1.00 38.20 ? 1058 HOH A O   1 
HETATM 1915 O O   . HOH B 2 .   ? 35.005 5.942   40.646 1.00 18.42 ? 1059 HOH A O   1 
HETATM 1916 O O   . HOH B 2 .   ? 36.032 -5.498  25.259 1.00 23.43 ? 1060 HOH A O   1 
HETATM 1917 O O   . HOH B 2 .   ? 22.577 -18.225 46.652 1.00 36.62 ? 1061 HOH A O   1 
HETATM 1918 O O   . HOH B 2 .   ? 38.225 16.769  12.514 1.00 37.90 ? 1062 HOH A O   1 
HETATM 1919 O O   . HOH B 2 .   ? 31.060 26.208  34.785 1.00 33.90 ? 1063 HOH A O   1 
HETATM 1920 O O   . HOH B 2 .   ? 33.525 -12.004 49.136 1.00 26.16 ? 1064 HOH A O   1 
HETATM 1921 O O   . HOH B 2 .   ? 34.483 -4.829  34.354 1.00 11.09 ? 1065 HOH A O   1 
HETATM 1922 O O   . HOH B 2 .   ? 31.812 22.633  35.790 1.00 20.17 ? 1066 HOH A O   1 
HETATM 1923 O O   . HOH B 2 .   ? 29.234 -19.221 41.233 1.00 20.01 ? 1067 HOH A O   1 
HETATM 1924 O O   . HOH B 2 .   ? 9.696  8.476   42.749 1.00 33.82 ? 1068 HOH A O   1 
HETATM 1925 O O   . HOH B 2 .   ? 20.434 -19.388 30.561 1.00 29.13 ? 1069 HOH A O   1 
HETATM 1926 O O   . HOH B 2 .   ? 29.423 9.302   31.701 1.00 22.09 ? 1070 HOH A O   1 
HETATM 1927 O O   . HOH B 2 .   ? 28.056 -3.555  51.031 1.00 33.57 ? 1071 HOH A O   1 
HETATM 1928 O O   . HOH B 2 .   ? 17.555 -15.722 26.074 1.00 16.47 ? 1072 HOH A O   1 
HETATM 1929 O O   . HOH B 2 .   ? 11.198 4.321   28.371 1.00 34.49 ? 1073 HOH A O   1 
HETATM 1930 O O   . HOH B 2 .   ? 30.715 20.335  14.657 1.00 30.75 ? 1074 HOH A O   1 
HETATM 1931 O O   . HOH B 2 .   ? 31.068 18.792  40.608 1.00 24.65 ? 1075 HOH A O   1 
HETATM 1932 O O   . HOH B 2 .   ? 11.526 -5.037  44.174 1.00 16.33 ? 1076 HOH A O   1 
HETATM 1933 O O   . HOH B 2 .   ? 29.020 14.842  39.904 1.00 22.45 ? 1077 HOH A O   1 
HETATM 1934 O O   . HOH B 2 .   ? 26.261 -17.954 27.690 1.00 32.02 ? 1078 HOH A O   1 
HETATM 1935 O O   . HOH B 2 .   ? 16.230 23.723  41.835 1.00 32.88 ? 1079 HOH A O   1 
HETATM 1936 O O   . HOH B 2 .   ? 31.860 -15.691 33.523 1.00 19.99 ? 1080 HOH A O   1 
HETATM 1937 O O   . HOH B 2 .   ? 16.528 21.705  36.424 1.00 34.51 ? 1081 HOH A O   1 
HETATM 1938 O O   . HOH B 2 .   ? 29.496 -0.502  50.493 1.00 25.28 ? 1082 HOH A O   1 
HETATM 1939 O O   . HOH B 2 .   ? 23.631 -14.950 48.536 1.00 37.93 ? 1083 HOH A O   1 
HETATM 1940 O O   . HOH B 2 .   ? 38.838 1.924   20.198 1.00 26.58 ? 1084 HOH A O   1 
HETATM 1941 O O   . HOH B 2 .   ? 40.085 -7.743  40.221 1.00 33.03 ? 1085 HOH A O   1 
HETATM 1942 O O   . HOH B 2 .   ? 25.379 25.107  30.467 1.00 29.42 ? 1086 HOH A O   1 
HETATM 1943 O O   . HOH B 2 .   ? 24.819 23.683  34.590 1.00 19.30 ? 1087 HOH A O   1 
HETATM 1944 O O   . HOH B 2 .   ? 30.804 20.261  33.460 1.00 19.25 ? 1088 HOH A O   1 
HETATM 1945 O O   . HOH B 2 .   ? 22.510 19.460  40.567 1.00 20.36 ? 1089 HOH A O   1 
HETATM 1946 O O   . HOH B 2 .   ? 8.280  -3.433  36.608 1.00 16.06 ? 1090 HOH A O   1 
HETATM 1947 O O   . HOH B 2 .   ? 11.291 -11.198 31.954 1.00 12.33 ? 1091 HOH A O   1 
HETATM 1948 O O   . HOH B 2 .   ? 11.218 4.013   38.420 1.00 23.54 ? 1092 HOH A O   1 
HETATM 1949 O O   . HOH B 2 .   ? 15.984 8.383   44.337 1.00 18.06 ? 1093 HOH A O   1 
HETATM 1950 O O   . HOH B 2 .   ? 13.887 9.840   43.270 1.00 18.49 ? 1094 HOH A O   1 
HETATM 1951 O O   . HOH B 2 .   ? 17.401 15.698  43.079 1.00 12.19 ? 1095 HOH A O   1 
HETATM 1952 O O   . HOH B 2 .   ? 18.899 11.278  47.163 1.00 19.57 ? 1096 HOH A O   1 
HETATM 1953 O O   . HOH B 2 .   ? 30.453 24.540  37.645 1.00 35.98 ? 1097 HOH A O   1 
HETATM 1954 O O   . HOH B 2 .   ? 30.805 10.693  33.627 1.00 17.74 ? 1098 HOH A O   1 
HETATM 1955 O O   . HOH B 2 .   ? 13.918 -0.737  49.239 1.00 18.74 ? 1099 HOH A O   1 
HETATM 1956 O O   . HOH B 2 .   ? 25.033 -10.393 44.708 1.00 10.65 ? 1100 HOH A O   1 
HETATM 1957 O O   . HOH B 2 .   ? 24.134 -5.898  45.462 1.00 17.70 ? 1101 HOH A O   1 
HETATM 1958 O O   . HOH B 2 .   ? 30.686 -6.074  39.845 1.00 12.54 ? 1102 HOH A O   1 
HETATM 1959 O O   . HOH B 2 .   ? 23.478 -2.741  33.655 1.00 10.10 ? 1103 HOH A O   1 
HETATM 1960 O O   . HOH B 2 .   ? 29.318 5.581   32.026 1.00 24.57 ? 1104 HOH A O   1 
HETATM 1961 O O   . HOH B 2 .   ? 29.786 1.766   31.091 1.00 15.91 ? 1105 HOH A O   1 
HETATM 1962 O O   . HOH B 2 .   ? 30.111 0.897   34.997 1.00 24.08 ? 1106 HOH A O   1 
HETATM 1963 O O   . HOH B 2 .   ? 20.545 5.248   28.821 1.00 32.74 ? 1107 HOH A O   1 
HETATM 1964 O O   . HOH B 2 .   ? 24.505 7.157   27.533 1.00 24.44 ? 1108 HOH A O   1 
HETATM 1965 O O   . HOH B 2 .   ? 32.598 17.199  24.406 1.00 18.22 ? 1109 HOH A O   1 
HETATM 1966 O O   . HOH B 2 .   ? 32.847 14.886  13.914 1.00 25.09 ? 1110 HOH A O   1 
HETATM 1967 O O   . HOH B 2 .   ? 21.941 -0.928  29.575 1.00 13.94 ? 1111 HOH A O   1 
HETATM 1968 O O   . HOH B 2 .   ? 25.445 -8.963  24.571 1.00 11.87 ? 1112 HOH A O   1 
HETATM 1969 O O   . HOH B 2 .   ? 25.479 -21.904 28.479 1.00 42.06 ? 1113 HOH A O   1 
HETATM 1970 O O   . HOH B 2 .   ? 21.250 -15.299 27.485 1.00 16.33 ? 1114 HOH A O   1 
HETATM 1971 O O   . HOH B 2 .   ? 13.861 -9.810  26.013 1.00 12.69 ? 1115 HOH A O   1 
HETATM 1972 O O   . HOH B 2 .   ? 12.105 2.705   26.715 1.00 20.76 ? 1116 HOH A O   1 
HETATM 1973 O O   . HOH B 2 .   ? 16.081 21.587  27.845 1.00 18.62 ? 1117 HOH A O   1 
HETATM 1974 O O   . HOH B 2 .   ? 12.860 18.200  35.752 1.00 24.84 ? 1118 HOH A O   1 
HETATM 1975 O O   . HOH B 2 .   ? 26.133 -20.327 40.488 1.00 27.74 ? 1119 HOH A O   1 
HETATM 1976 O O   . HOH B 2 .   ? 33.550 -6.742  40.375 1.00 11.39 ? 1120 HOH A O   1 
HETATM 1977 O O   . HOH B 2 .   ? 35.671 -1.997  43.446 1.00 37.98 ? 1121 HOH A O   1 
HETATM 1978 O O   . HOH B 2 .   ? 37.136 -4.888  33.385 1.00 15.24 ? 1122 HOH A O   1 
HETATM 1979 O O   . HOH B 2 .   ? 35.635 0.567   38.644 1.00 24.27 ? 1123 HOH A O   1 
HETATM 1980 O O   . HOH B 2 .   ? 37.532 -3.247  29.238 1.00 15.27 ? 1124 HOH A O   1 
HETATM 1981 O O   . HOH B 2 .   ? 36.377 1.386   18.965 1.00 16.08 ? 1125 HOH A O   1 
HETATM 1982 O O   . HOH B 2 .   ? 33.741 5.141   13.968 1.00 13.09 ? 1126 HOH A O   1 
HETATM 1983 O O   . HOH B 2 .   ? 31.727 -19.709 40.904 1.00 20.66 ? 1127 HOH A O   1 
HETATM 1984 O O   . HOH B 2 .   ? 28.592 -13.443 27.962 1.00 28.61 ? 1128 HOH A O   1 
HETATM 1985 O O   . HOH B 2 .   ? 37.489 4.912   12.997 1.00 21.25 ? 1129 HOH A O   1 
HETATM 1986 O O   . HOH B 2 .   ? 40.535 6.145   15.958 1.00 28.86 ? 1130 HOH A O   1 
HETATM 1987 O O   . HOH B 2 .   ? 31.623 18.264  21.475 1.00 19.04 ? 1131 HOH A O   1 
HETATM 1988 O O   . HOH B 2 .   ? 22.931 24.669  23.114 1.00 25.73 ? 1132 HOH A O   1 
HETATM 1989 O O   . HOH B 2 .   ? 29.902 26.957  26.093 1.00 32.07 ? 1133 HOH A O   1 
HETATM 1990 O O   . HOH B 2 .   ? 16.008 19.103  38.816 1.00 24.49 ? 1134 HOH A O   1 
HETATM 1991 O O   . HOH B 2 .   ? 11.331 9.794   41.448 1.00 18.53 ? 1135 HOH A O   1 
HETATM 1992 O O   . HOH B 2 .   ? 9.308  -14.688 39.199 1.00 27.77 ? 1136 HOH A O   1 
HETATM 1993 O O   . HOH B 2 .   ? 5.079  -11.190 37.870 1.00 33.85 ? 1137 HOH A O   1 
HETATM 1994 O O   . HOH B 2 .   ? 5.057  -13.929 36.852 1.00 35.12 ? 1138 HOH A O   1 
HETATM 1995 O O   . HOH B 2 .   ? 4.965  -12.797 34.443 1.00 27.10 ? 1139 HOH A O   1 
HETATM 1996 O O   . HOH B 2 .   ? 7.573  -9.349  41.402 1.00 22.79 ? 1140 HOH A O   1 
HETATM 1997 O O   . HOH B 2 .   ? 28.411 20.121  43.394 1.00 35.82 ? 1142 HOH A O   1 
HETATM 1998 O O   . HOH B 2 .   ? 37.645 19.351  31.016 1.00 24.09 ? 1143 HOH A O   1 
HETATM 1999 O O   . HOH B 2 .   ? 33.079 17.759  41.923 1.00 27.70 ? 1144 HOH A O   1 
HETATM 2000 O O   . HOH B 2 .   ? 12.832 -8.938  45.225 1.00 26.23 ? 1145 HOH A O   1 
HETATM 2001 O O   . HOH B 2 .   ? 21.109 -6.288  45.366 1.00 28.48 ? 1146 HOH A O   1 
HETATM 2002 O O   . HOH B 2 .   ? 39.031 19.187  18.334 1.00 32.63 ? 1147 HOH A O   1 
HETATM 2003 O O   . HOH B 2 .   ? 26.290 18.531  16.156 1.00 18.14 ? 1148 HOH A O   1 
HETATM 2004 O O   . HOH B 2 .   ? 19.295 2.949   19.580 1.00 25.68 ? 1149 HOH A O   1 
HETATM 2005 O O   . HOH B 2 .   ? 19.788 0.958   27.333 1.00 16.31 ? 1150 HOH A O   1 
HETATM 2006 O O   . HOH B 2 .   ? 17.112 -3.466  23.671 1.00 24.92 ? 1151 HOH A O   1 
HETATM 2007 O O   . HOH B 2 .   ? 22.375 -12.893 24.416 1.00 27.15 ? 1152 HOH A O   1 
HETATM 2008 O O   . HOH B 2 .   ? 13.643 1.591   19.897 1.00 33.37 ? 1153 HOH A O   1 
HETATM 2009 O O   . HOH B 2 .   ? 10.242 18.968  28.143 1.00 24.16 ? 1154 HOH A O   1 
HETATM 2010 O O   . HOH B 2 .   ? 9.840  14.210  26.834 1.00 27.23 ? 1155 HOH A O   1 
HETATM 2011 O O   . HOH B 2 .   ? 15.283 24.971  30.522 1.00 37.69 ? 1156 HOH A O   1 
HETATM 2012 O O   . HOH B 2 .   ? 14.594 -11.251 23.654 1.00 33.86 ? 1158 HOH A O   1 
HETATM 2013 O O   . HOH B 2 .   ? 11.562 -10.994 25.917 1.00 21.67 ? 1159 HOH A O   1 
HETATM 2014 O O   . HOH B 2 .   ? 13.033 -7.401  25.278 1.00 15.90 ? 1160 HOH A O   1 
HETATM 2015 O O   . HOH B 2 .   ? 12.253 23.269  28.198 1.00 25.61 ? 1161 HOH A O   1 
HETATM 2016 O O   . HOH B 2 .   ? 16.352 -20.606 31.071 1.00 24.00 ? 1162 HOH A O   1 
HETATM 2017 O O   . HOH B 2 .   ? 16.720 -22.144 36.661 1.00 22.76 ? 1163 HOH A O   1 
HETATM 2018 O O   . HOH B 2 .   ? 15.539 -24.000 37.983 1.00 24.66 ? 1164 HOH A O   1 
HETATM 2019 O O   . HOH B 2 .   ? 13.404 -25.423 36.701 1.00 21.65 ? 1165 HOH A O   1 
HETATM 2020 O O   . HOH B 2 .   ? 13.151 -22.929 35.454 1.00 25.15 ? 1166 HOH A O   1 
HETATM 2021 O O   . HOH B 2 .   ? 12.026 -23.904 42.384 1.00 19.07 ? 1167 HOH A O   1 
HETATM 2022 O O   . HOH B 2 .   ? 29.590 -19.350 44.324 1.00 27.75 ? 1168 HOH A O   1 
HETATM 2023 O O   . HOH B 2 .   ? 36.276 -12.502 44.883 1.00 18.23 ? 1169 HOH A O   1 
HETATM 2024 O O   . HOH B 2 .   ? 37.413 -11.900 47.418 1.00 27.06 ? 1170 HOH A O   1 
HETATM 2025 O O   . HOH B 2 .   ? 37.145 -9.674  45.128 1.00 15.54 ? 1171 HOH A O   1 
HETATM 2026 O O   . HOH B 2 .   ? 38.687 -11.527 43.601 1.00 14.30 ? 1172 HOH A O   1 
HETATM 2027 O O   . HOH B 2 .   ? 39.792 -10.582 46.195 1.00 14.39 ? 1173 HOH A O   1 
HETATM 2028 O O   . HOH B 2 .   ? 39.117 -13.528 45.778 1.00 16.56 ? 1174 HOH A O   1 
HETATM 2029 O O   . HOH B 2 .   ? 38.462 -6.468  41.684 1.00 25.13 ? 1175 HOH A O   1 
HETATM 2030 O O   . HOH B 2 .   ? 39.342 -1.791  38.453 1.00 27.63 ? 1176 HOH A O   1 
HETATM 2031 O O   . HOH B 2 .   ? 43.139 0.871   28.977 1.00 40.72 ? 1177 HOH A O   1 
HETATM 2032 O O   . HOH B 2 .   ? 18.313 4.864   6.499  1.00 36.11 ? 1178 HOH A O   1 
HETATM 2033 O O   . HOH B 2 .   ? 19.352 3.301   4.773  1.00 31.60 ? 1179 HOH A O   1 
HETATM 2034 O O   . HOH B 2 .   ? 21.890 6.474   4.347  1.00 36.68 ? 1180 HOH A O   1 
HETATM 2035 O O   . HOH B 2 .   ? 32.640 -1.152  19.144 1.00 34.43 ? 1181 HOH A O   1 
HETATM 2036 O O   . HOH B 2 .   ? 28.140 -12.111 47.869 1.00 34.98 ? 1182 HOH A O   1 
HETATM 2037 O O   . HOH B 2 .   ? 30.325 -10.453 48.875 1.00 24.12 ? 1183 HOH A O   1 
HETATM 2038 O O   . HOH B 2 .   ? 25.808 -11.081 47.930 1.00 30.59 ? 1184 HOH A O   1 
HETATM 2039 O O   . HOH B 2 .   ? 32.375 -21.950 44.389 1.00 32.89 ? 1185 HOH A O   1 
HETATM 2040 O O   . HOH B 2 .   ? 12.880 10.122  16.668 1.00 43.01 ? 1186 HOH A O   1 
HETATM 2041 O O   . HOH B 2 .   ? 39.425 0.681   16.310 1.00 29.24 ? 1187 HOH A O   1 
HETATM 2042 O O   . HOH B 2 .   ? 29.726 2.073   52.052 1.00 21.84 ? 1188 HOH A O   1 
HETATM 2043 O O   . HOH B 2 .   ? 19.864 9.699   53.615 1.00 24.61 ? 1189 HOH A O   1 
HETATM 2044 O O   . HOH B 2 .   ? 23.604 10.287  54.864 1.00 31.30 ? 1190 HOH A O   1 
HETATM 2045 O O   . HOH B 2 .   ? 21.252 -5.436  48.533 1.00 28.16 ? 1191 HOH A O   1 
HETATM 2046 O O   . HOH B 2 .   ? 18.690 -6.983  47.368 1.00 34.03 ? 1192 HOH A O   1 
HETATM 2047 O O   . HOH B 2 .   ? 44.362 7.807   24.325 1.00 28.33 ? 1193 HOH A O   1 
HETATM 2048 O O   . HOH B 2 .   ? 23.671 -18.321 28.354 1.00 18.64 ? 1194 HOH A O   1 
HETATM 2049 O O   . HOH B 2 .   ? 39.780 9.065   37.109 1.00 28.53 ? 1195 HOH A O   1 
HETATM 2050 O O   . HOH B 2 .   ? 14.459 -19.925 32.780 1.00 24.16 ? 1196 HOH A O   1 
HETATM 2051 O O   . HOH B 2 .   ? 12.065 12.090  29.643 1.00 28.21 ? 1197 HOH A O   1 
HETATM 2052 O O   . HOH B 2 .   ? 25.752 -15.661 26.652 1.00 23.21 ? 1198 HOH A O   1 
HETATM 2053 O O   . HOH B 2 .   ? 29.034 3.506   9.700  1.00 35.09 ? 1199 HOH A O   1 
HETATM 2054 O O   . HOH B 2 .   ? 34.155 23.769  36.888 1.00 28.65 ? 1200 HOH A O   1 
HETATM 2055 O O   . HOH B 2 .   ? 35.314 5.986   46.080 1.00 28.58 ? 1201 HOH A O   1 
HETATM 2056 O O   . HOH B 2 .   ? 39.781 14.489  12.648 1.00 32.34 ? 1202 HOH A O   1 
HETATM 2057 O O   . HOH B 2 .   ? 43.368 13.073  27.862 1.00 41.98 ? 1204 HOH A O   1 
HETATM 2058 O O   . HOH B 2 .   ? 18.391 11.407  52.059 1.00 33.80 ? 1205 HOH A O   1 
HETATM 2059 O O   . HOH B 2 .   ? 21.561 22.243  33.767 1.00 26.87 ? 1206 HOH A O   1 
HETATM 2060 O O   . HOH B 2 .   ? 14.523 19.908  26.406 1.00 24.29 ? 1207 HOH A O   1 
HETATM 2061 O O   . HOH B 2 .   ? 25.916 -5.099  49.652 1.00 30.69 ? 1208 HOH A O   1 
HETATM 2062 O O   . HOH B 2 .   ? 34.217 -6.202  23.518 1.00 33.73 ? 1209 HOH A O   1 
HETATM 2063 O O   . HOH B 2 .   ? 22.857 1.696   54.844 1.00 30.96 ? 1210 HOH A O   1 
HETATM 2064 O O   . HOH B 2 .   ? 12.880 15.752  19.417 1.00 35.51 ? 1211 HOH A O   1 
HETATM 2065 O O   . HOH B 2 .   ? 37.467 21.662  20.440 1.00 37.41 ? 1212 HOH A O   1 
HETATM 2066 O O   . HOH B 2 .   ? 32.218 -4.522  49.266 1.00 41.81 ? 1213 HOH A O   1 
HETATM 2067 O O   . HOH B 2 .   ? 32.577 5.533   49.725 1.00 41.14 ? 1214 HOH A O   1 
HETATM 2068 O O   . HOH B 2 .   ? 27.703 19.903  14.356 1.00 32.64 ? 1215 HOH A O   1 
HETATM 2069 O O   . HOH B 2 .   ? 18.974 15.308  40.727 1.00 33.07 ? 1216 HOH A O   1 
HETATM 2070 O O   . HOH B 2 .   ? 12.644 -15.488 45.264 1.00 36.35 ? 1217 HOH A O   1 
HETATM 2071 O O   . HOH B 2 .   ? 11.032 4.689   48.430 1.00 25.45 ? 1218 HOH A O   1 
HETATM 2072 O O   . HOH B 2 .   ? 16.518 7.700   54.011 1.00 33.54 ? 1219 HOH A O   1 
HETATM 2073 O O   . HOH B 2 .   ? 36.029 -1.120  18.258 1.00 40.07 ? 1221 HOH A O   1 
HETATM 2074 O O   . HOH B 2 .   ? 32.270 19.991  29.384 1.00 33.62 ? 1222 HOH A O   1 
HETATM 2075 O O   . HOH B 2 .   ? 17.303 25.248  36.674 1.00 39.31 ? 1223 HOH A O   1 
HETATM 2076 O O   . HOH B 2 .   ? 11.036 -7.778  42.531 1.00 30.07 ? 1224 HOH A O   1 
HETATM 2077 O O   . HOH B 2 .   ? 33.687 2.071   46.859 1.00 29.96 ? 1225 HOH A O   1 
HETATM 2078 O O   . HOH B 2 .   ? 13.244 7.995   18.250 1.00 36.77 ? 1226 HOH A O   1 
HETATM 2079 O O   . HOH B 2 .   ? 12.345 22.865  24.812 1.00 39.70 ? 1227 HOH A O   1 
HETATM 2080 O O   . HOH B 2 .   ? 56.379 15.940  24.790 1.00 24.46 ? 1228 HOH A O   1 
HETATM 2081 O O   . HOH B 2 .   ? 22.219 19.471  16.347 1.00 34.92 ? 1229 HOH A O   1 
HETATM 2082 O O   . HOH B 2 .   ? 22.652 -22.789 38.969 1.00 38.07 ? 1230 HOH A O   1 
HETATM 2083 O O   . HOH B 2 .   ? 19.486 22.991  29.799 1.00 33.15 ? 1231 HOH A O   1 
HETATM 2084 O O   . HOH B 2 .   ? 10.687 3.950   40.934 1.00 34.99 ? 1232 HOH A O   1 
HETATM 2085 O O   . HOH B 2 .   ? 27.684 7.328   31.969 1.00 26.26 ? 1233 HOH A O   1 
HETATM 2086 O O   . HOH B 2 .   ? 21.882 21.050  20.046 1.00 23.58 ? 1234 HOH A O   1 
HETATM 2087 O O   . HOH B 2 .   ? 13.020 14.815  22.275 1.00 24.72 ? 1235 HOH A O   1 
HETATM 2088 O O   . HOH B 2 .   ? 34.848 19.179  40.552 1.00 30.09 ? 1236 HOH A O   1 
HETATM 2089 O O   . HOH B 2 .   ? 11.003 -21.556 41.639 1.00 25.45 ? 1237 HOH A O   1 
HETATM 2090 O O   . HOH B 2 .   ? 33.089 4.707   47.042 1.00 25.56 ? 1238 HOH A O   1 
HETATM 2091 O O   . HOH B 2 .   ? 51.331 13.565  20.425 1.00 27.55 ? 1239 HOH A O   1 
HETATM 2092 O O   . HOH B 2 .   ? 24.497 14.094  11.671 1.00 25.44 ? 1240 HOH A O   1 
HETATM 2093 O O   . HOH B 2 .   ? 19.319 16.173  17.009 1.00 33.74 ? 1241 HOH A O   1 
HETATM 2094 O O   . HOH B 2 .   ? 14.271 -27.946 36.062 1.00 29.86 ? 1242 HOH A O   1 
HETATM 2095 O O   . HOH B 2 .   ? 29.276 5.979   52.529 1.00 34.86 ? 1243 HOH A O   1 
HETATM 2096 O O   . HOH B 2 .   ? 15.785 7.618   17.783 1.00 30.57 ? 1244 HOH A O   1 
HETATM 2097 O O   . HOH B 2 .   ? 18.442 -18.565 44.320 1.00 33.62 ? 1245 HOH A O   1 
HETATM 2098 O O   . HOH B 2 .   ? 20.961 14.449  10.945 1.00 26.76 ? 1246 HOH A O   1 
HETATM 2099 O O   . HOH B 2 .   ? 21.565 3.969   3.475  1.00 39.02 ? 1247 HOH A O   1 
HETATM 2100 O O   . HOH B 2 .   ? 14.769 24.029  27.437 1.00 33.24 ? 1248 HOH A O   1 
HETATM 2101 O O   . HOH B 2 .   ? 25.845 1.436   55.684 1.00 26.99 ? 1249 HOH A O   1 
HETATM 2102 O O   . HOH B 2 .   ? 41.033 3.077   16.688 1.00 33.54 ? 1250 HOH A O   1 
HETATM 2103 O O   . HOH B 2 .   ? 19.787 13.519  53.588 1.00 31.74 ? 1252 HOH A O   1 
HETATM 2104 O O   . HOH B 2 .   ? 10.942 -6.829  48.836 1.00 31.83 ? 1253 HOH A O   1 
HETATM 2105 O O   . HOH B 2 .   ? 40.474 6.817   33.416 1.00 37.43 ? 1254 HOH A O   1 
HETATM 2106 O O   . HOH B 2 .   ? 20.350 17.441  41.742 1.00 35.43 ? 1255 HOH A O   1 
HETATM 2107 O O   . HOH B 2 .   ? 27.971 26.988  28.181 1.00 34.15 ? 1256 HOH A O   1 
HETATM 2108 O O   . HOH B 2 .   ? 30.568 16.317  43.649 1.00 32.99 ? 1257 HOH A O   1 
HETATM 2109 O O   . HOH B 2 .   ? 33.282 19.670  15.804 1.00 41.38 ? 1258 HOH A O   1 
HETATM 2110 O O   . HOH B 2 .   ? 31.321 -22.954 41.032 1.00 34.90 ? 1259 HOH A O   1 
HETATM 2111 O O   . HOH B 2 .   ? 43.693 10.833  24.488 1.00 38.19 ? 1260 HOH A O   1 
HETATM 2112 O O   . HOH B 2 .   ? 17.045 21.525  39.415 1.00 37.68 ? 1261 HOH A O   1 
HETATM 2113 O O   . HOH B 2 .   ? 37.826 -13.260 30.036 1.00 38.69 ? 1262 HOH A O   1 
HETATM 2114 O O   . HOH B 2 .   ? 3.401  -10.412 33.967 1.00 33.74 ? 1263 HOH A O   1 
HETATM 2115 O O   . HOH B 2 .   ? 41.685 17.496  17.106 1.00 37.78 ? 1264 HOH A O   1 
HETATM 2116 O O   . HOH B 2 .   ? 14.160 19.184  23.878 1.00 41.05 ? 1266 HOH A O   1 
HETATM 2117 O O   . HOH B 2 .   ? 14.343 11.907  14.291 1.00 45.22 ? 1267 HOH A O   1 
HETATM 2118 O O   . HOH B 2 .   ? 20.631 0.992   5.704  1.00 36.49 ? 1268 HOH A O   1 
HETATM 2119 O O   . HOH B 2 .   ? 35.740 -12.992 26.503 1.00 31.71 ? 1269 HOH A O   1 
HETATM 2120 O O   . HOH B 2 .   ? 59.115 17.103  21.275 1.00 40.19 ? 1270 HOH A O   1 
HETATM 2121 O O   . HOH B 2 .   ? 5.278  -0.824  34.700 1.00 36.48 ? 1271 HOH A O   1 
HETATM 2122 O O   . HOH B 2 .   ? 19.518 13.374  13.706 1.00 35.87 ? 1272 HOH A O   1 
HETATM 2123 O O   . HOH B 2 .   ? 36.261 -1.943  15.481 1.00 41.00 ? 1273 HOH A O   1 
HETATM 2124 O O   . HOH B 2 .   ? 41.431 20.793  18.790 1.00 42.14 ? 1275 HOH A O   1 
HETATM 2125 O O   . HOH B 2 .   ? 33.194 14.713  45.614 1.00 33.22 ? 1276 HOH A O   1 
HETATM 2126 O O   . HOH B 2 .   ? 28.015 2.957   54.766 1.00 39.90 ? 1277 HOH A O   1 
HETATM 2127 O O   . HOH B 2 .   ? 24.289 6.407   5.827  1.00 38.53 ? 1278 HOH A O   1 
HETATM 2128 O O   . HOH B 2 .   ? 33.293 4.795   11.343 1.00 33.28 ? 1279 HOH A O   1 
HETATM 2129 O O   . HOH B 2 .   ? 20.890 26.034  28.888 1.00 39.64 ? 1280 HOH A O   1 
HETATM 2130 O O   . HOH B 2 .   ? 10.745 -0.995  25.546 1.00 38.63 ? 1281 HOH A O   1 
HETATM 2131 O O   . HOH B 2 .   ? 27.088 -21.341 45.237 1.00 37.71 ? 1282 HOH A O   1 
HETATM 2132 O O   . HOH B 2 .   ? 34.852 23.338  23.110 1.00 35.18 ? 1283 HOH A O   1 
HETATM 2133 O O   . HOH B 2 .   ? 34.496 -16.695 28.157 1.00 38.60 ? 1284 HOH A O   1 
HETATM 2134 O O   . HOH B 2 .   ? 29.063 17.357  40.486 1.00 37.21 ? 1285 HOH A O   1 
HETATM 2135 O O   . HOH B 2 .   ? 20.359 3.130   30.302 1.00 24.77 ? 1286 HOH A O   1 
HETATM 2136 O O   . HOH B 2 .   ? 11.697 10.702  26.458 1.00 45.88 ? 1287 HOH A O   1 
HETATM 2137 O O   . HOH B 2 .   ? 15.366 -15.172 43.273 1.00 39.74 ? 1288 HOH A O   1 
HETATM 2138 O O   . HOH B 2 .   ? 35.483 0.297   42.343 1.00 30.47 ? 1289 HOH A O   1 
HETATM 2139 O O   . HOH B 2 .   ? 40.173 2.082   38.246 1.00 38.52 ? 1290 HOH A O   1 
HETATM 2140 O O   . HOH B 2 .   ? 39.826 -3.606  27.781 1.00 40.01 ? 1291 HOH A O   1 
HETATM 2141 O O   . HOH B 2 .   ? 29.711 6.706   50.087 1.00 34.43 ? 1292 HOH A O   1 
HETATM 2142 O O   . HOH B 2 .   ? 48.548 10.296  20.431 1.00 36.70 ? 1293 HOH A O   1 
HETATM 2143 O O   . HOH B 2 .   ? 43.293 14.430  17.706 1.00 34.89 ? 1294 HOH A O   1 
HETATM 2144 O O   . HOH B 2 .   ? 16.309 -15.518 23.620 1.00 30.95 ? 1295 HOH A O   1 
HETATM 2145 O O   . HOH B 2 .   ? 27.503 -19.992 26.766 1.00 31.09 ? 1296 HOH A O   1 
HETATM 2146 O O   . HOH B 2 .   ? 20.904 17.646  18.426 1.00 36.94 ? 1297 HOH A O   1 
HETATM 2147 O O   . HOH B 2 .   ? 18.359 22.631  27.227 1.00 40.26 ? 1298 HOH A O   1 
HETATM 2148 O O   . HOH B 2 .   ? 27.179 -17.923 35.043 1.00 35.09 ? 1299 HOH A O   1 
HETATM 2149 O O   . HOH B 2 .   ? 17.278 -11.709 24.248 1.00 39.56 ? 1300 HOH A O   1 
HETATM 2150 O O   . HOH B 2 .   ? 26.465 2.344   9.439  1.00 43.12 ? 1301 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  TRP 57  57  57  TRP TRP A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  CYS 70  70  70  CYS CYS A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  GLN 94  94  94  GLN GLN A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 TYR 106 106 106 TYR TYR A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 HIS 148 148 148 HIS HIS A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 HIS 169 169 169 HIS HIS A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 ASN 198 198 198 ASN ASN A . n 
A 1 199 HIS 199 199 199 HIS HIS A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 ARG 215 215 215 ARG ARG A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 HIS 217 217 217 HIS HIS A . n 
A 1 218 MET 218 218 218 MET MET A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 PHE 223 223 223 PHE PHE A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 ALA 227 227 227 ALA ALA A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 ILE 229 229 229 ILE ILE A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 HIS 231 231 231 HIS HIS A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 MET 233 233 233 MET MET A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 LYS 238 238 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1018 1018 HOH HOH A . 
B 2 HOH 19  1019 1019 HOH HOH A . 
B 2 HOH 20  1020 1020 HOH HOH A . 
B 2 HOH 21  1021 1021 HOH HOH A . 
B 2 HOH 22  1022 1022 HOH HOH A . 
B 2 HOH 23  1023 1023 HOH HOH A . 
B 2 HOH 24  1024 1024 HOH HOH A . 
B 2 HOH 25  1025 1025 HOH HOH A . 
B 2 HOH 26  1026 1026 HOH HOH A . 
B 2 HOH 27  1027 1027 HOH HOH A . 
B 2 HOH 28  1028 1028 HOH HOH A . 
B 2 HOH 29  1029 1029 HOH HOH A . 
B 2 HOH 30  1030 1030 HOH HOH A . 
B 2 HOH 31  1031 1031 HOH HOH A . 
B 2 HOH 32  1032 1032 HOH HOH A . 
B 2 HOH 33  1033 1033 HOH HOH A . 
B 2 HOH 34  1034 1034 HOH HOH A . 
B 2 HOH 35  1035 1035 HOH HOH A . 
B 2 HOH 36  1036 1036 HOH HOH A . 
B 2 HOH 37  1037 1037 HOH HOH A . 
B 2 HOH 38  1038 1038 HOH HOH A . 
B 2 HOH 39  1039 1039 HOH HOH A . 
B 2 HOH 40  1040 1040 HOH HOH A . 
B 2 HOH 41  1041 1041 HOH HOH A . 
B 2 HOH 42  1042 1042 HOH HOH A . 
B 2 HOH 43  1043 1043 HOH HOH A . 
B 2 HOH 44  1044 1044 HOH HOH A . 
B 2 HOH 45  1045 1045 HOH HOH A . 
B 2 HOH 46  1046 1046 HOH HOH A . 
B 2 HOH 47  1047 1047 HOH HOH A . 
B 2 HOH 48  1048 1048 HOH HOH A . 
B 2 HOH 49  1049 1049 HOH HOH A . 
B 2 HOH 50  1051 1051 HOH HOH A . 
B 2 HOH 51  1052 1052 HOH HOH A . 
B 2 HOH 52  1053 1053 HOH HOH A . 
B 2 HOH 53  1054 1054 HOH HOH A . 
B 2 HOH 54  1055 1055 HOH HOH A . 
B 2 HOH 55  1056 1056 HOH HOH A . 
B 2 HOH 56  1057 1057 HOH HOH A . 
B 2 HOH 57  1058 1058 HOH HOH A . 
B 2 HOH 58  1059 1059 HOH HOH A . 
B 2 HOH 59  1060 1060 HOH HOH A . 
B 2 HOH 60  1061 1061 HOH HOH A . 
B 2 HOH 61  1062 1062 HOH HOH A . 
B 2 HOH 62  1063 1063 HOH HOH A . 
B 2 HOH 63  1064 1064 HOH HOH A . 
B 2 HOH 64  1065 1065 HOH HOH A . 
B 2 HOH 65  1066 1066 HOH HOH A . 
B 2 HOH 66  1067 1067 HOH HOH A . 
B 2 HOH 67  1068 1068 HOH HOH A . 
B 2 HOH 68  1069 1069 HOH HOH A . 
B 2 HOH 69  1070 1070 HOH HOH A . 
B 2 HOH 70  1071 1071 HOH HOH A . 
B 2 HOH 71  1072 1072 HOH HOH A . 
B 2 HOH 72  1073 1073 HOH HOH A . 
B 2 HOH 73  1074 1074 HOH HOH A . 
B 2 HOH 74  1075 1075 HOH HOH A . 
B 2 HOH 75  1076 1076 HOH HOH A . 
B 2 HOH 76  1077 1077 HOH HOH A . 
B 2 HOH 77  1078 1078 HOH HOH A . 
B 2 HOH 78  1079 1079 HOH HOH A . 
B 2 HOH 79  1080 1080 HOH HOH A . 
B 2 HOH 80  1081 1081 HOH HOH A . 
B 2 HOH 81  1082 1082 HOH HOH A . 
B 2 HOH 82  1083 1083 HOH HOH A . 
B 2 HOH 83  1084 1084 HOH HOH A . 
B 2 HOH 84  1085 1085 HOH HOH A . 
B 2 HOH 85  1086 1086 HOH HOH A . 
B 2 HOH 86  1087 1087 HOH HOH A . 
B 2 HOH 87  1088 1088 HOH HOH A . 
B 2 HOH 88  1089 1089 HOH HOH A . 
B 2 HOH 89  1090 1090 HOH HOH A . 
B 2 HOH 90  1091 1091 HOH HOH A . 
B 2 HOH 91  1092 1092 HOH HOH A . 
B 2 HOH 92  1093 1093 HOH HOH A . 
B 2 HOH 93  1094 1094 HOH HOH A . 
B 2 HOH 94  1095 1095 HOH HOH A . 
B 2 HOH 95  1096 1096 HOH HOH A . 
B 2 HOH 96  1097 1097 HOH HOH A . 
B 2 HOH 97  1098 1098 HOH HOH A . 
B 2 HOH 98  1099 1099 HOH HOH A . 
B 2 HOH 99  1100 1100 HOH HOH A . 
B 2 HOH 100 1101 1101 HOH HOH A . 
B 2 HOH 101 1102 1102 HOH HOH A . 
B 2 HOH 102 1103 1103 HOH HOH A . 
B 2 HOH 103 1104 1104 HOH HOH A . 
B 2 HOH 104 1105 1105 HOH HOH A . 
B 2 HOH 105 1106 1106 HOH HOH A . 
B 2 HOH 106 1107 1107 HOH HOH A . 
B 2 HOH 107 1108 1108 HOH HOH A . 
B 2 HOH 108 1109 1109 HOH HOH A . 
B 2 HOH 109 1110 1110 HOH HOH A . 
B 2 HOH 110 1111 1111 HOH HOH A . 
B 2 HOH 111 1112 1112 HOH HOH A . 
B 2 HOH 112 1113 1113 HOH HOH A . 
B 2 HOH 113 1114 1114 HOH HOH A . 
B 2 HOH 114 1115 1115 HOH HOH A . 
B 2 HOH 115 1116 1116 HOH HOH A . 
B 2 HOH 116 1117 1117 HOH HOH A . 
B 2 HOH 117 1118 1118 HOH HOH A . 
B 2 HOH 118 1119 1119 HOH HOH A . 
B 2 HOH 119 1120 1120 HOH HOH A . 
B 2 HOH 120 1121 1121 HOH HOH A . 
B 2 HOH 121 1122 1122 HOH HOH A . 
B 2 HOH 122 1123 1123 HOH HOH A . 
B 2 HOH 123 1124 1124 HOH HOH A . 
B 2 HOH 124 1125 1125 HOH HOH A . 
B 2 HOH 125 1126 1126 HOH HOH A . 
B 2 HOH 126 1127 1127 HOH HOH A . 
B 2 HOH 127 1128 1128 HOH HOH A . 
B 2 HOH 128 1129 1129 HOH HOH A . 
B 2 HOH 129 1130 1130 HOH HOH A . 
B 2 HOH 130 1131 1131 HOH HOH A . 
B 2 HOH 131 1132 1132 HOH HOH A . 
B 2 HOH 132 1133 1133 HOH HOH A . 
B 2 HOH 133 1134 1134 HOH HOH A . 
B 2 HOH 134 1135 1135 HOH HOH A . 
B 2 HOH 135 1136 1136 HOH HOH A . 
B 2 HOH 136 1137 1137 HOH HOH A . 
B 2 HOH 137 1138 1138 HOH HOH A . 
B 2 HOH 138 1139 1139 HOH HOH A . 
B 2 HOH 139 1140 1140 HOH HOH A . 
B 2 HOH 140 1142 1142 HOH HOH A . 
B 2 HOH 141 1143 1143 HOH HOH A . 
B 2 HOH 142 1144 1144 HOH HOH A . 
B 2 HOH 143 1145 1145 HOH HOH A . 
B 2 HOH 144 1146 1146 HOH HOH A . 
B 2 HOH 145 1147 1147 HOH HOH A . 
B 2 HOH 146 1148 1148 HOH HOH A . 
B 2 HOH 147 1149 1149 HOH HOH A . 
B 2 HOH 148 1150 1150 HOH HOH A . 
B 2 HOH 149 1151 1151 HOH HOH A . 
B 2 HOH 150 1152 1152 HOH HOH A . 
B 2 HOH 151 1153 1153 HOH HOH A . 
B 2 HOH 152 1154 1154 HOH HOH A . 
B 2 HOH 153 1155 1155 HOH HOH A . 
B 2 HOH 154 1156 1156 HOH HOH A . 
B 2 HOH 155 1158 1158 HOH HOH A . 
B 2 HOH 156 1159 1159 HOH HOH A . 
B 2 HOH 157 1160 1160 HOH HOH A . 
B 2 HOH 158 1161 1161 HOH HOH A . 
B 2 HOH 159 1162 1162 HOH HOH A . 
B 2 HOH 160 1163 1163 HOH HOH A . 
B 2 HOH 161 1164 1164 HOH HOH A . 
B 2 HOH 162 1165 1165 HOH HOH A . 
B 2 HOH 163 1166 1166 HOH HOH A . 
B 2 HOH 164 1167 1167 HOH HOH A . 
B 2 HOH 165 1168 1168 HOH HOH A . 
B 2 HOH 166 1169 1169 HOH HOH A . 
B 2 HOH 167 1170 1170 HOH HOH A . 
B 2 HOH 168 1171 1171 HOH HOH A . 
B 2 HOH 169 1172 1172 HOH HOH A . 
B 2 HOH 170 1173 1173 HOH HOH A . 
B 2 HOH 171 1174 1174 HOH HOH A . 
B 2 HOH 172 1175 1175 HOH HOH A . 
B 2 HOH 173 1176 1176 HOH HOH A . 
B 2 HOH 174 1177 1177 HOH HOH A . 
B 2 HOH 175 1178 1178 HOH HOH A . 
B 2 HOH 176 1179 1179 HOH HOH A . 
B 2 HOH 177 1180 1180 HOH HOH A . 
B 2 HOH 178 1181 1181 HOH HOH A . 
B 2 HOH 179 1182 1182 HOH HOH A . 
B 2 HOH 180 1183 1183 HOH HOH A . 
B 2 HOH 181 1184 1184 HOH HOH A . 
B 2 HOH 182 1185 1185 HOH HOH A . 
B 2 HOH 183 1186 1186 HOH HOH A . 
B 2 HOH 184 1187 1187 HOH HOH A . 
B 2 HOH 185 1188 1188 HOH HOH A . 
B 2 HOH 186 1189 1189 HOH HOH A . 
B 2 HOH 187 1190 1190 HOH HOH A . 
B 2 HOH 188 1191 1191 HOH HOH A . 
B 2 HOH 189 1192 1192 HOH HOH A . 
B 2 HOH 190 1193 1193 HOH HOH A . 
B 2 HOH 191 1194 1194 HOH HOH A . 
B 2 HOH 192 1195 1195 HOH HOH A . 
B 2 HOH 193 1196 1196 HOH HOH A . 
B 2 HOH 194 1197 1197 HOH HOH A . 
B 2 HOH 195 1198 1198 HOH HOH A . 
B 2 HOH 196 1199 1199 HOH HOH A . 
B 2 HOH 197 1200 1200 HOH HOH A . 
B 2 HOH 198 1201 1201 HOH HOH A . 
B 2 HOH 199 1202 1202 HOH HOH A . 
B 2 HOH 200 1204 1204 HOH HOH A . 
B 2 HOH 201 1205 1205 HOH HOH A . 
B 2 HOH 202 1206 1206 HOH HOH A . 
B 2 HOH 203 1207 1207 HOH HOH A . 
B 2 HOH 204 1208 1208 HOH HOH A . 
B 2 HOH 205 1209 1209 HOH HOH A . 
B 2 HOH 206 1210 1210 HOH HOH A . 
B 2 HOH 207 1211 1211 HOH HOH A . 
B 2 HOH 208 1212 1212 HOH HOH A . 
B 2 HOH 209 1213 1213 HOH HOH A . 
B 2 HOH 210 1214 1214 HOH HOH A . 
B 2 HOH 211 1215 1215 HOH HOH A . 
B 2 HOH 212 1216 1216 HOH HOH A . 
B 2 HOH 213 1217 1217 HOH HOH A . 
B 2 HOH 214 1218 1218 HOH HOH A . 
B 2 HOH 215 1219 1219 HOH HOH A . 
B 2 HOH 216 1221 1221 HOH HOH A . 
B 2 HOH 217 1222 1222 HOH HOH A . 
B 2 HOH 218 1223 1223 HOH HOH A . 
B 2 HOH 219 1224 1224 HOH HOH A . 
B 2 HOH 220 1225 1225 HOH HOH A . 
B 2 HOH 221 1226 1226 HOH HOH A . 
B 2 HOH 222 1227 1227 HOH HOH A . 
B 2 HOH 223 1228 1228 HOH HOH A . 
B 2 HOH 224 1229 1229 HOH HOH A . 
B 2 HOH 225 1230 1230 HOH HOH A . 
B 2 HOH 226 1231 1231 HOH HOH A . 
B 2 HOH 227 1232 1232 HOH HOH A . 
B 2 HOH 228 1233 1233 HOH HOH A . 
B 2 HOH 229 1234 1234 HOH HOH A . 
B 2 HOH 230 1235 1235 HOH HOH A . 
B 2 HOH 231 1236 1236 HOH HOH A . 
B 2 HOH 232 1237 1237 HOH HOH A . 
B 2 HOH 233 1238 1238 HOH HOH A . 
B 2 HOH 234 1239 1239 HOH HOH A . 
B 2 HOH 235 1240 1240 HOH HOH A . 
B 2 HOH 236 1241 1241 HOH HOH A . 
B 2 HOH 237 1242 1242 HOH HOH A . 
B 2 HOH 238 1243 1243 HOH HOH A . 
B 2 HOH 239 1244 1244 HOH HOH A . 
B 2 HOH 240 1245 1245 HOH HOH A . 
B 2 HOH 241 1246 1246 HOH HOH A . 
B 2 HOH 242 1247 1247 HOH HOH A . 
B 2 HOH 243 1248 1248 HOH HOH A . 
B 2 HOH 244 1249 1249 HOH HOH A . 
B 2 HOH 245 1250 1250 HOH HOH A . 
B 2 HOH 246 1252 1252 HOH HOH A . 
B 2 HOH 247 1253 1253 HOH HOH A . 
B 2 HOH 248 1254 1254 HOH HOH A . 
B 2 HOH 249 1255 1255 HOH HOH A . 
B 2 HOH 250 1256 1256 HOH HOH A . 
B 2 HOH 251 1257 1257 HOH HOH A . 
B 2 HOH 252 1258 1258 HOH HOH A . 
B 2 HOH 253 1259 1259 HOH HOH A . 
B 2 HOH 254 1260 1260 HOH HOH A . 
B 2 HOH 255 1261 1261 HOH HOH A . 
B 2 HOH 256 1262 1262 HOH HOH A . 
B 2 HOH 257 1263 1263 HOH HOH A . 
B 2 HOH 258 1264 1264 HOH HOH A . 
B 2 HOH 259 1266 1266 HOH HOH A . 
B 2 HOH 260 1267 1267 HOH HOH A . 
B 2 HOH 261 1268 1268 HOH HOH A . 
B 2 HOH 262 1269 1269 HOH HOH A . 
B 2 HOH 263 1270 1270 HOH HOH A . 
B 2 HOH 264 1271 1271 HOH HOH A . 
B 2 HOH 265 1272 1272 HOH HOH A . 
B 2 HOH 266 1273 1273 HOH HOH A . 
B 2 HOH 267 1275 1275 HOH HOH A . 
B 2 HOH 268 1276 1276 HOH HOH A . 
B 2 HOH 269 1277 1277 HOH HOH A . 
B 2 HOH 270 1278 1278 HOH HOH A . 
B 2 HOH 271 1279 1279 HOH HOH A . 
B 2 HOH 272 1280 1280 HOH HOH A . 
B 2 HOH 273 1281 1281 HOH HOH A . 
B 2 HOH 274 1282 1282 HOH HOH A . 
B 2 HOH 275 1283 1283 HOH HOH A . 
B 2 HOH 276 1284 1284 HOH HOH A . 
B 2 HOH 277 1285 1285 HOH HOH A . 
B 2 HOH 278 1286 1286 HOH HOH A . 
B 2 HOH 279 1287 1287 HOH HOH A . 
B 2 HOH 280 1288 1288 HOH HOH A . 
B 2 HOH 281 1289 1289 HOH HOH A . 
B 2 HOH 282 1290 1290 HOH HOH A . 
B 2 HOH 283 1291 1291 HOH HOH A . 
B 2 HOH 284 1292 1292 HOH HOH A . 
B 2 HOH 285 1293 1293 HOH HOH A . 
B 2 HOH 286 1294 1294 HOH HOH A . 
B 2 HOH 287 1295 1295 HOH HOH A . 
B 2 HOH 288 1296 1296 HOH HOH A . 
B 2 HOH 289 1297 1297 HOH HOH A . 
B 2 HOH 290 1298 1298 HOH HOH A . 
B 2 HOH 291 1299 1299 HOH HOH A . 
B 2 HOH 292 1300 1300 HOH HOH A . 
B 2 HOH 293 1301 1301 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-30 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 68 ? ? -116.63 54.83 
2 1 GLN A 69 ? ? -67.81  1.49  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A LYS 238 ? A LYS 238 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#