data_1R2B
# 
_entry.id   1R2B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1R2B         
RCSB  RCSB020349   
WWPDB D_1000020349 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1R28 'Crystal structure of the B-cell Lymphoma (BCL6) BTB domain to 2.2 Angstrom' unspecified 
PDB 1R29 'Crystal structure of the B-cell Lymphoma (BCL6) BTB domain to 1.3 Angstrom' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R2B 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ahmad, K.F.'  1 
'Melnick, A.'  2 
'Lax, S.A.'    3 
'Bouchard, D.' 4 
'Liu, J.'      5 
'Kiang, C.L.'  6 
'Mayer, S.'    7 
'Licht, J.D.'  8 
'Prive, G.G.'  9 
# 
_citation.id                        primary 
_citation.title                     'Mechanism of SMRT corepressor recruitment by the BCL6 BTB domain.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            12 
_citation.page_first                1551 
_citation.page_last                 1564 
_citation.year                      2003 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14690607 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(03)00454-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ahmad, K.F.'   1  
primary 'Melnick, A.'   2  
primary 'Lax, S.'       3  
primary 'Bouchard, D.'  4  
primary 'Liu, J.'       5  
primary 'Kiang, C.L.'   6  
primary 'Mayer, S.'     7  
primary 'Takahashi, S.' 8  
primary 'Licht, J.D.'   9  
primary 'Prive, G.G.'   10 
# 
_cell.entry_id           1R2B 
_cell.length_a           54.228 
_cell.length_b           38.543 
_cell.length_c           76.659 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.92 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1R2B 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'B-cell lymphoma 6 protein'       14559.823 2   ? 'C8Q, C67R, C84N' 'BCL6 (residues 5-129)'           ? 
2 polymer man 'Nuclear receptor co-repressor 2' 2024.325  2   ? ?                 'SMRT - BBD (residues 1414-1430)' ? 
3 water   nat water                             18.015    130 ? ?                 ?                                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BCL-6, Zinc finger protein 51, LAZ-3 protein, POZ domain, BTB/POZ domain' 
2 
;N-CoR2, Silencing mediator of retinoic acid and thyroid hormone receptor, SMRT, SMRTe, Thyroid-, retinoic-acid-receptor-associated co-repressor, T3 receptor- associating factor, TRAC, CTG repeat protein 26
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEG
FNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE
;
;GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEG
FNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE
;
A,B ? 
2 'polypeptide(L)' no no GSLVATVKEAGRSIHEIPR GSLVATVKEAGRSIHEIPR C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ASP n 
1 5   SER n 
1 6   GLN n 
1 7   ILE n 
1 8   GLN n 
1 9   PHE n 
1 10  THR n 
1 11  ARG n 
1 12  HIS n 
1 13  ALA n 
1 14  SER n 
1 15  ASP n 
1 16  VAL n 
1 17  LEU n 
1 18  LEU n 
1 19  ASN n 
1 20  LEU n 
1 21  ASN n 
1 22  ARG n 
1 23  LEU n 
1 24  ARG n 
1 25  SER n 
1 26  ARG n 
1 27  ASP n 
1 28  ILE n 
1 29  LEU n 
1 30  THR n 
1 31  ASP n 
1 32  VAL n 
1 33  VAL n 
1 34  ILE n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ARG n 
1 39  GLU n 
1 40  GLN n 
1 41  PHE n 
1 42  ARG n 
1 43  ALA n 
1 44  HIS n 
1 45  LYS n 
1 46  THR n 
1 47  VAL n 
1 48  LEU n 
1 49  MET n 
1 50  ALA n 
1 51  CYS n 
1 52  SER n 
1 53  GLY n 
1 54  LEU n 
1 55  PHE n 
1 56  TYR n 
1 57  SER n 
1 58  ILE n 
1 59  PHE n 
1 60  THR n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  LYS n 
1 65  ARG n 
1 66  ASN n 
1 67  LEU n 
1 68  SER n 
1 69  VAL n 
1 70  ILE n 
1 71  ASN n 
1 72  LEU n 
1 73  ASP n 
1 74  PRO n 
1 75  GLU n 
1 76  ILE n 
1 77  ASN n 
1 78  PRO n 
1 79  GLU n 
1 80  GLY n 
1 81  PHE n 
1 82  ASN n 
1 83  ILE n 
1 84  LEU n 
1 85  LEU n 
1 86  ASP n 
1 87  PHE n 
1 88  MET n 
1 89  TYR n 
1 90  THR n 
1 91  SER n 
1 92  ARG n 
1 93  LEU n 
1 94  ASN n 
1 95  LEU n 
1 96  ARG n 
1 97  GLU n 
1 98  GLY n 
1 99  ASN n 
1 100 ILE n 
1 101 MET n 
1 102 ALA n 
1 103 VAL n 
1 104 MET n 
1 105 ALA n 
1 106 THR n 
1 107 ALA n 
1 108 MET n 
1 109 TYR n 
1 110 LEU n 
1 111 GLN n 
1 112 MET n 
1 113 GLU n 
1 114 HIS n 
1 115 VAL n 
1 116 VAL n 
1 117 ASP n 
1 118 THR n 
1 119 CYS n 
1 120 ARG n 
1 121 LYS n 
1 122 PHE n 
1 123 ILE n 
1 124 LYS n 
1 125 ALA n 
1 126 SER n 
1 127 GLU n 
2 1   GLY n 
2 2   SER n 
2 3   LEU n 
2 4   VAL n 
2 5   ALA n 
2 6   THR n 
2 7   VAL n 
2 8   LYS n 
2 9   GLU n 
2 10  ALA n 
2 11  GLY n 
2 12  ARG n 
2 13  SER n 
2 14  ILE n 
2 15  HIS n 
2 16  GLU n 
2 17  ILE n 
2 18  PRO n 
2 19  ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo BCL6             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? 'pET-32(a)' ? ? 
2 1 sample ? ? ? human Homo 'NCOR2 OR CTG26' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? 'pET-32(a)' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP BCL6_HUMAN  P41182 1 5    ? ? 
2 UNP NCOR2_HUMAN Q9Y618 2 1414 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1R2B A 3 ? 127 ? P41182 5    ? 129  ? 5    129  
2 1 1R2B B 3 ? 127 ? P41182 5    ? 129  ? 5    129  
3 2 1R2B C 3 ? 19  ? Q9Y618 1414 ? 1430 ? 1414 1430 
4 2 1R2B D 3 ? 19  ? Q9Y618 1414 ? 1430 ? 1414 1430 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1R2B GLY A 1  ? UNP P41182 ?   ?  'CLONING ARTIFACT' 3    1  
1 1R2B SER A 2  ? UNP P41182 ?   ?  'CLONING ARTIFACT' 4    2  
1 1R2B GLN A 6  ? UNP P41182 CYS 8  ENGINEERED         8    3  
1 1R2B ARG A 65 ? UNP P41182 CYS 67 ENGINEERED         67   4  
1 1R2B ASN A 82 ? UNP P41182 CYS 84 ENGINEERED         84   5  
2 1R2B GLY B 1  ? UNP P41182 ?   ?  'CLONING ARTIFACT' 3    6  
2 1R2B SER B 2  ? UNP P41182 ?   ?  'CLONING ARTIFACT' 4    7  
2 1R2B GLN B 6  ? UNP P41182 CYS 8  ENGINEERED         8    8  
2 1R2B ARG B 65 ? UNP P41182 CYS 67 ENGINEERED         67   9  
2 1R2B ASN B 82 ? UNP P41182 CYS 84 ENGINEERED         84   10 
3 1R2B GLY C 1  ? UNP Q9Y618 ?   ?  'CLONING ARTIFACT' -1   11 
3 1R2B SER C 2  ? UNP Q9Y618 ?   ?  'CLONING ARTIFACT' 0    12 
4 1R2B GLY D 1  ? UNP Q9Y618 ?   ?  'CLONING ARTIFACT' 1412 13 
4 1R2B SER D 2  ? UNP Q9Y618 ?   ?  'CLONING ARTIFACT' 1413 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1R2B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   49.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, sodium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-11-20 
_diffrn_detector.details                'Osmic confocal' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Osmic confocal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1R2B 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             30.0 
_reflns.number_all                   16537 
_reflns.number_obs                   16405 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05 
_reflns.pdbx_netI_over_sigmaI        24.0 
_reflns.B_iso_Wilson_estimate        19.0 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   92.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.256 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1R2B 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             27.08 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     16418 
_refine.ls_number_reflns_obs                     15876 
_refine.ls_number_reflns_R_free                  768 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_all                          0.239 
_refine.ls_R_factor_obs                          0.227 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 37.3735 
_refine.solvent_model_param_ksol                 0.309108 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               37.7 
_refine.aniso_B[1][1]                            0.697 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.445 
_refine.aniso_B[2][2]                            -5.141 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            4.444 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1R2B 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.39 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2275 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               2405 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        27.08 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.01  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.6  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.483 1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.424 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.133 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.087 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.298 
_refine_ls_shell.percent_reflns_obs               89.5 
_refine_ls_shell.R_factor_R_free                  0.399 
_refine_ls_shell.R_factor_R_free_error            0.039 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             104 
_refine_ls_shell.number_reflns_obs                2378 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 water_rep.param   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1R2B 
_struct.title                     'Crystal structure of the BCL6 BTB domain complexed with a SMRT co-repressor peptide' 
_struct.pdbx_descriptor           'B-cell lymphoma 6 protein, Nuclear receptor co-repressor 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R2B 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'BTB domain, HDAC complex, B-cell lymphoma, transcriptional repression, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 11  ? ARG A 26  ? ARG A 13  ARG A 28  1 ? 16 
HELX_P HELX_P2  2  LYS A 45  ? CYS A 51  ? LYS A 47  CYS A 53  1 ? 7  
HELX_P HELX_P3  3  GLY A 53  ? PHE A 59  ? GLY A 55  PHE A 61  1 ? 7  
HELX_P HELX_P4  4  PRO A 78  ? TYR A 89  ? PRO A 80  TYR A 91  1 ? 12 
HELX_P HELX_P5  5  ASN A 99  ? LEU A 110 ? ASN A 101 LEU A 112 1 ? 12 
HELX_P HELX_P6  6  GLU A 113 ? ALA A 125 ? GLU A 115 ALA A 127 1 ? 13 
HELX_P HELX_P7  7  ARG B 11  ? ARG B 26  ? ARG B 13  ARG B 28  1 ? 16 
HELX_P HELX_P8  8  LYS B 45  ? CYS B 51  ? LYS B 47  CYS B 53  1 ? 7  
HELX_P HELX_P9  9  GLY B 53  ? PHE B 59  ? GLY B 55  PHE B 61  1 ? 7  
HELX_P HELX_P10 10 PRO B 78  ? TYR B 89  ? PRO B 80  TYR B 91  1 ? 12 
HELX_P HELX_P11 11 ASN B 99  ? LEU B 110 ? ASN B 101 LEU B 112 1 ? 12 
HELX_P HELX_P12 12 GLU B 113 ? LYS B 124 ? GLU B 115 LYS B 126 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG B 92 ? ARG B 96 ? ARG B 94   ARG B 98   
A 2 ASP A 4  ? PHE A 9  ? ASP A 6    PHE A 11   
A 3 ALA D 5  ? GLU D 9  ? ALA D 1416 GLU D 1420 
B 1 GLU A 39 ? ALA A 43 ? GLU A 41   ALA A 45   
B 2 VAL A 32 ? VAL A 36 ? VAL A 34   VAL A 38   
B 3 VAL A 69 ? ASN A 71 ? VAL A 71   ASN A 73   
C 1 ARG A 92 ? LEU A 95 ? ARG A 94   LEU A 97   
C 2 SER B 5  ? PHE B 9  ? SER B 7    PHE B 11   
C 3 ALA C 5  ? GLU C 9  ? ALA C 1416 GLU C 1420 
D 1 GLU B 39 ? ALA B 43 ? GLU B 41   ALA B 45   
D 2 VAL B 32 ? VAL B 36 ? VAL B 34   VAL B 38   
D 3 VAL B 69 ? ASN B 71 ? VAL B 71   ASN B 73   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU B 95 ? O LEU B 97 N SER A 5  ? N SER A 7    
A 2 3 N GLN A 8  ? N GLN A 10 O VAL D 7  ? O VAL D 1418 
B 1 2 O GLU A 39 ? O GLU A 41 N VAL A 36 ? N VAL A 38   
B 2 3 N VAL A 35 ? N VAL A 37 O ILE A 70 ? O ILE A 72   
C 1 2 N LEU A 95 ? N LEU A 97 O SER B 5  ? O SER B 7    
C 2 3 N GLN B 8  ? N GLN B 10 O GLU C 9  ? O GLU C 1420 
D 1 2 O PHE B 41 ? O PHE B 43 N ILE B 34 ? N ILE B 36   
D 2 3 N VAL B 35 ? N VAL B 37 O ILE B 70 ? O ILE B 72   
# 
_database_PDB_matrix.entry_id          1R2B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1R2B 
_atom_sites.fract_transf_matrix[1][1]   0.018441 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000941 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013062 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 3   ? -13.765 -35.003 43.769 1.00 57.01 ? 5    ALA A N   1 
ATOM   2    C CA  . ALA A 1 3   ? -12.758 -34.145 43.080 1.00 56.77 ? 5    ALA A CA  1 
ATOM   3    C C   . ALA A 1 3   ? -11.985 -33.322 44.097 1.00 56.64 ? 5    ALA A C   1 
ATOM   4    O O   . ALA A 1 3   ? -12.565 -32.523 44.844 1.00 57.37 ? 5    ALA A O   1 
ATOM   5    C CB  . ALA A 1 3   ? -13.444 -33.214 42.075 1.00 56.15 ? 5    ALA A CB  1 
ATOM   6    N N   . ASP A 1 4   ? -10.672 -33.537 44.131 1.00 55.23 ? 6    ASP A N   1 
ATOM   7    C CA  . ASP A 1 4   ? -9.796  -32.813 45.041 1.00 52.73 ? 6    ASP A CA  1 
ATOM   8    C C   . ASP A 1 4   ? -8.872  -31.973 44.178 1.00 50.54 ? 6    ASP A C   1 
ATOM   9    O O   . ASP A 1 4   ? -8.438  -32.407 43.096 1.00 49.82 ? 6    ASP A O   1 
ATOM   10   C CB  . ASP A 1 4   ? -8.978  -33.782 45.904 1.00 53.66 ? 6    ASP A CB  1 
ATOM   11   C CG  . ASP A 1 4   ? -9.839  -34.877 46.529 1.00 54.99 ? 6    ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 4   ? -10.984 -34.575 46.946 1.00 54.99 ? 6    ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 4   ? -9.364  -36.036 46.603 1.00 54.36 ? 6    ASP A OD2 1 
ATOM   14   N N   . SER A 1 5   ? -8.577  -30.766 44.649 1.00 46.82 ? 7    SER A N   1 
ATOM   15   C CA  . SER A 1 5   ? -7.718  -29.865 43.902 1.00 42.37 ? 7    SER A CA  1 
ATOM   16   C C   . SER A 1 5   ? -6.745  -29.157 44.839 1.00 40.23 ? 7    SER A C   1 
ATOM   17   O O   . SER A 1 5   ? -6.956  -29.117 46.060 1.00 38.63 ? 7    SER A O   1 
ATOM   18   C CB  . SER A 1 5   ? -8.582  -28.855 43.137 1.00 41.77 ? 7    SER A CB  1 
ATOM   19   O OG  . SER A 1 5   ? -7.824  -28.172 42.155 1.00 43.92 ? 7    SER A OG  1 
ATOM   20   N N   . GLN A 1 6   ? -5.672  -28.616 44.262 1.00 37.32 ? 8    GLN A N   1 
ATOM   21   C CA  . GLN A 1 6   ? -4.650  -27.914 45.025 1.00 34.33 ? 8    GLN A CA  1 
ATOM   22   C C   . GLN A 1 6   ? -4.179  -26.670 44.296 1.00 33.22 ? 8    GLN A C   1 
ATOM   23   O O   . GLN A 1 6   ? -3.825  -26.725 43.118 1.00 33.24 ? 8    GLN A O   1 
ATOM   24   C CB  . GLN A 1 6   ? -3.455  -28.829 45.284 1.00 34.56 ? 8    GLN A CB  1 
ATOM   25   C CG  . GLN A 1 6   ? -2.261  -28.126 45.934 1.00 33.35 ? 8    GLN A CG  1 
ATOM   26   C CD  . GLN A 1 6   ? -1.077  -29.066 46.152 1.00 34.02 ? 8    GLN A CD  1 
ATOM   27   O OE1 . GLN A 1 6   ? -1.097  -29.906 47.053 1.00 33.57 ? 8    GLN A OE1 1 
ATOM   28   N NE2 . GLN A 1 6   ? -0.048  -28.935 45.317 1.00 30.59 ? 8    GLN A NE2 1 
ATOM   29   N N   . ILE A 1 7   ? -4.181  -25.548 45.010 1.00 30.96 ? 9    ILE A N   1 
ATOM   30   C CA  . ILE A 1 7   ? -3.752  -24.274 44.460 1.00 27.82 ? 9    ILE A CA  1 
ATOM   31   C C   . ILE A 1 7   ? -2.368  -23.962 45.010 1.00 26.78 ? 9    ILE A C   1 
ATOM   32   O O   . ILE A 1 7   ? -2.149  -23.898 46.225 1.00 24.56 ? 9    ILE A O   1 
ATOM   33   C CB  . ILE A 1 7   ? -4.753  -23.152 44.816 1.00 29.38 ? 9    ILE A CB  1 
ATOM   34   C CG1 . ILE A 1 7   ? -6.166  -23.586 44.385 1.00 29.44 ? 9    ILE A CG1 1 
ATOM   35   C CG2 . ILE A 1 7   ? -4.375  -21.835 44.092 1.00 28.58 ? 9    ILE A CG2 1 
ATOM   36   C CD1 . ILE A 1 7   ? -7.204  -22.502 44.493 1.00 29.04 ? 9    ILE A CD1 1 
ATOM   37   N N   . GLN A 1 8   ? -1.428  -23.800 44.093 1.00 24.93 ? 10   GLN A N   1 
ATOM   38   C CA  . GLN A 1 8   ? -0.038  -23.523 44.441 1.00 25.17 ? 10   GLN A CA  1 
ATOM   39   C C   . GLN A 1 8   ? 0.277   -22.055 44.201 1.00 23.28 ? 10   GLN A C   1 
ATOM   40   O O   . GLN A 1 8   ? 0.268   -21.595 43.049 1.00 23.01 ? 10   GLN A O   1 
ATOM   41   C CB  . GLN A 1 8   ? 0.865   -24.431 43.603 1.00 24.65 ? 10   GLN A CB  1 
ATOM   42   C CG  . GLN A 1 8   ? 0.584   -25.894 43.904 1.00 30.39 ? 10   GLN A CG  1 
ATOM   43   C CD  . GLN A 1 8   ? 1.179   -26.884 42.911 1.00 34.56 ? 10   GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 8   ? 1.236   -28.083 43.197 1.00 37.41 ? 10   GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 8   ? 1.607   -26.401 41.739 1.00 34.67 ? 10   GLN A NE2 1 
ATOM   46   N N   . PHE A 1 9   ? 0.532   -21.332 45.296 1.00 20.15 ? 11   PHE A N   1 
ATOM   47   C CA  . PHE A 1 9   ? 0.840   -19.903 45.244 1.00 18.07 ? 11   PHE A CA  1 
ATOM   48   C C   . PHE A 1 9   ? 2.340   -19.726 45.044 1.00 17.60 ? 11   PHE A C   1 
ATOM   49   O O   . PHE A 1 9   ? 3.150   -19.771 45.989 1.00 16.35 ? 11   PHE A O   1 
ATOM   50   C CB  . PHE A 1 9   ? 0.370   -19.209 46.529 1.00 18.67 ? 11   PHE A CB  1 
ATOM   51   C CG  . PHE A 1 9   ? -1.134  -19.170 46.686 1.00 23.30 ? 11   PHE A CG  1 
ATOM   52   C CD1 . PHE A 1 9   ? -1.851  -20.310 47.066 1.00 23.56 ? 11   PHE A CD1 1 
ATOM   53   C CD2 . PHE A 1 9   ? -1.837  -17.980 46.496 1.00 22.56 ? 11   PHE A CD2 1 
ATOM   54   C CE1 . PHE A 1 9   ? -3.254  -20.249 47.263 1.00 26.22 ? 11   PHE A CE1 1 
ATOM   55   C CE2 . PHE A 1 9   ? -3.228  -17.926 46.690 1.00 23.49 ? 11   PHE A CE2 1 
ATOM   56   C CZ  . PHE A 1 9   ? -3.928  -19.057 47.074 1.00 18.56 ? 11   PHE A CZ  1 
ATOM   57   N N   . THR A 1 10  ? 2.703   -19.499 43.793 1.00 16.62 ? 12   THR A N   1 
ATOM   58   C CA  . THR A 1 10  ? 4.094   -19.390 43.426 1.00 19.70 ? 12   THR A CA  1 
ATOM   59   C C   . THR A 1 10  ? 4.920   -18.265 44.074 1.00 18.41 ? 12   THR A C   1 
ATOM   60   O O   . THR A 1 10  ? 6.133   -18.372 44.140 1.00 18.94 ? 12   THR A O   1 
ATOM   61   C CB  . THR A 1 10  ? 4.205   -19.360 41.860 1.00 22.49 ? 12   THR A CB  1 
ATOM   62   O OG1 . THR A 1 10  ? 3.596   -18.170 41.349 1.00 25.12 ? 12   THR A OG1 1 
ATOM   63   C CG2 . THR A 1 10  ? 3.480   -20.588 41.269 1.00 23.15 ? 12   THR A CG2 1 
ATOM   64   N N   . ARG A 1 11  ? 4.287   -17.204 44.571 1.00 18.47 ? 13   ARG A N   1 
ATOM   65   C CA  . ARG A 1 11  ? 5.053   -16.123 45.200 1.00 15.85 ? 13   ARG A CA  1 
ATOM   66   C C   . ARG A 1 11  ? 4.789   -16.016 46.709 1.00 16.18 ? 13   ARG A C   1 
ATOM   67   O O   . ARG A 1 11  ? 5.271   -15.091 47.401 1.00 13.62 ? 13   ARG A O   1 
ATOM   68   C CB  . ARG A 1 11  ? 4.788   -14.774 44.480 1.00 16.78 ? 13   ARG A CB  1 
ATOM   69   C CG  . ARG A 1 11  ? 3.315   -14.333 44.419 1.00 17.37 ? 13   ARG A CG  1 
ATOM   70   C CD  . ARG A 1 11  ? 3.189   -12.889 43.959 1.00 16.41 ? 13   ARG A CD  1 
ATOM   71   N NE  . ARG A 1 11  ? 3.669   -11.941 44.963 1.00 19.34 ? 13   ARG A NE  1 
ATOM   72   C CZ  . ARG A 1 11  ? 3.675   -10.617 44.801 1.00 21.23 ? 13   ARG A CZ  1 
ATOM   73   N NH1 . ARG A 1 11  ? 3.230   -10.087 43.671 1.00 20.75 ? 13   ARG A NH1 1 
ATOM   74   N NH2 . ARG A 1 11  ? 4.108   -9.820  45.773 1.00 17.14 ? 13   ARG A NH2 1 
ATOM   75   N N   . HIS A 1 12  ? 4.063   -17.011 47.223 1.00 16.90 ? 14   HIS A N   1 
ATOM   76   C CA  . HIS A 1 12  ? 3.722   -17.069 48.642 1.00 13.17 ? 14   HIS A CA  1 
ATOM   77   C C   . HIS A 1 12  ? 4.943   -17.052 49.547 1.00 14.78 ? 14   HIS A C   1 
ATOM   78   O O   . HIS A 1 12  ? 5.005   -16.241 50.476 1.00 12.67 ? 14   HIS A O   1 
ATOM   79   C CB  . HIS A 1 12  ? 2.931   -18.336 48.970 1.00 14.99 ? 14   HIS A CB  1 
ATOM   80   C CG  . HIS A 1 12  ? 2.595   -18.460 50.424 1.00 15.41 ? 14   HIS A CG  1 
ATOM   81   N ND1 . HIS A 1 12  ? 1.685   -17.632 51.049 1.00 17.17 ? 14   HIS A ND1 1 
ATOM   82   C CD2 . HIS A 1 12  ? 3.102   -19.261 51.393 1.00 15.16 ? 14   HIS A CD2 1 
ATOM   83   C CE1 . HIS A 1 12  ? 1.650   -17.916 52.341 1.00 18.35 ? 14   HIS A CE1 1 
ATOM   84   N NE2 . HIS A 1 12  ? 2.500   -18.901 52.576 1.00 16.50 ? 14   HIS A NE2 1 
ATOM   85   N N   . ALA A 1 13  ? 5.896   -17.963 49.313 1.00 12.93 ? 15   ALA A N   1 
ATOM   86   C CA  . ALA A 1 13  ? 7.078   -18.011 50.164 1.00 14.19 ? 15   ALA A CA  1 
ATOM   87   C C   . ALA A 1 13  ? 7.772   -16.652 50.112 1.00 15.50 ? 15   ALA A C   1 
ATOM   88   O O   . ALA A 1 13  ? 8.226   -16.138 51.120 1.00 15.73 ? 15   ALA A O   1 
ATOM   89   C CB  . ALA A 1 13  ? 8.036   -19.118 49.711 1.00 15.13 ? 15   ALA A CB  1 
ATOM   90   N N   . SER A 1 14  ? 7.824   -16.055 48.928 1.00 16.16 ? 16   SER A N   1 
ATOM   91   C CA  . SER A 1 14  ? 8.459   -14.756 48.808 1.00 16.36 ? 16   SER A CA  1 
ATOM   92   C C   . SER A 1 14  ? 7.668   -13.668 49.555 1.00 17.43 ? 16   SER A C   1 
ATOM   93   O O   . SER A 1 14  ? 8.270   -12.763 50.158 1.00 18.20 ? 16   SER A O   1 
ATOM   94   C CB  . SER A 1 14  ? 8.616   -14.404 47.331 1.00 19.33 ? 16   SER A CB  1 
ATOM   95   O OG  . SER A 1 14  ? 9.188   -13.128 47.175 1.00 25.23 ? 16   SER A OG  1 
ATOM   96   N N   . ASP A 1 15  ? 6.331   -13.738 49.526 1.00 16.33 ? 17   ASP A N   1 
ATOM   97   C CA  . ASP A 1 15  ? 5.531   -12.741 50.244 1.00 16.05 ? 17   ASP A CA  1 
ATOM   98   C C   . ASP A 1 15  ? 5.682   -12.922 51.739 1.00 15.52 ? 17   ASP A C   1 
ATOM   99   O O   . ASP A 1 15  ? 5.635   -11.947 52.500 1.00 16.91 ? 17   ASP A O   1 
ATOM   100  C CB  . ASP A 1 15  ? 4.031   -12.809 49.877 1.00 15.77 ? 17   ASP A CB  1 
ATOM   101  C CG  . ASP A 1 15  ? 3.777   -12.428 48.439 1.00 14.70 ? 17   ASP A CG  1 
ATOM   102  O OD1 . ASP A 1 15  ? 4.580   -11.630 47.904 1.00 14.56 ? 17   ASP A OD1 1 
ATOM   103  O OD2 . ASP A 1 15  ? 2.787   -12.918 47.857 1.00 13.03 ? 17   ASP A OD2 1 
ATOM   104  N N   . VAL A 1 16  ? 5.827   -14.169 52.167 1.00 14.37 ? 18   VAL A N   1 
ATOM   105  C CA  . VAL A 1 16  ? 6.023   -14.442 53.585 1.00 16.52 ? 18   VAL A CA  1 
ATOM   106  C C   . VAL A 1 16  ? 7.396   -13.876 54.020 1.00 17.14 ? 18   VAL A C   1 
ATOM   107  O O   . VAL A 1 16  ? 7.491   -13.172 55.029 1.00 17.54 ? 18   VAL A O   1 
ATOM   108  C CB  . VAL A 1 16  ? 5.953   -15.984 53.906 1.00 14.02 ? 18   VAL A CB  1 
ATOM   109  C CG1 . VAL A 1 16  ? 6.547   -16.249 55.265 1.00 20.33 ? 18   VAL A CG1 1 
ATOM   110  C CG2 . VAL A 1 16  ? 4.496   -16.468 53.941 1.00 12.93 ? 18   VAL A CG2 1 
ATOM   111  N N   . LEU A 1 17  ? 8.442   -14.144 53.239 1.00 16.15 ? 19   LEU A N   1 
ATOM   112  C CA  . LEU A 1 17  ? 9.767   -13.658 53.590 1.00 15.25 ? 19   LEU A CA  1 
ATOM   113  C C   . LEU A 1 17  ? 9.797   -12.138 53.611 1.00 16.89 ? 19   LEU A C   1 
ATOM   114  O O   . LEU A 1 17  ? 10.441  -11.542 54.474 1.00 17.54 ? 19   LEU A O   1 
ATOM   115  C CB  . LEU A 1 17  ? 10.838  -14.194 52.626 1.00 15.92 ? 19   LEU A CB  1 
ATOM   116  C CG  . LEU A 1 17  ? 12.306  -13.984 53.083 1.00 15.00 ? 19   LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 17  ? 12.564  -14.771 54.357 1.00 12.90 ? 19   LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 17  ? 13.278  -14.456 52.017 1.00 12.56 ? 19   LEU A CD2 1 
ATOM   119  N N   . LEU A 1 18  ? 9.100   -11.495 52.685 1.00 15.74 ? 20   LEU A N   1 
ATOM   120  C CA  . LEU A 1 18  ? 9.082   -10.039 52.701 1.00 17.03 ? 20   LEU A CA  1 
ATOM   121  C C   . LEU A 1 18  ? 8.423   -9.541  53.979 1.00 17.94 ? 20   LEU A C   1 
ATOM   122  O O   . LEU A 1 18  ? 8.919   -8.622  54.625 1.00 19.53 ? 20   LEU A O   1 
ATOM   123  C CB  . LEU A 1 18  ? 8.304   -9.477  51.512 1.00 18.41 ? 20   LEU A CB  1 
ATOM   124  C CG  . LEU A 1 18  ? 8.032   -7.967  51.629 1.00 20.25 ? 20   LEU A CG  1 
ATOM   125  C CD1 . LEU A 1 18  ? 9.370   -7.175  51.673 1.00 14.21 ? 20   LEU A CD1 1 
ATOM   126  C CD2 . LEU A 1 18  ? 7.143   -7.521  50.460 1.00 18.89 ? 20   LEU A CD2 1 
ATOM   127  N N   . ASN A 1 19  ? 7.296   -10.134 54.348 1.00 17.10 ? 21   ASN A N   1 
ATOM   128  C CA  . ASN A 1 19  ? 6.635   -9.691  55.563 1.00 19.85 ? 21   ASN A CA  1 
ATOM   129  C C   . ASN A 1 19  ? 7.463   -9.921  56.812 1.00 20.97 ? 21   ASN A C   1 
ATOM   130  O O   . ASN A 1 19  ? 7.356   -9.156  57.761 1.00 22.14 ? 21   ASN A O   1 
ATOM   131  C CB  . ASN A 1 19  ? 5.263   -10.339 55.709 1.00 18.57 ? 21   ASN A CB  1 
ATOM   132  C CG  . ASN A 1 19  ? 4.228   -9.661  54.823 1.00 21.44 ? 21   ASN A CG  1 
ATOM   133  O OD1 . ASN A 1 19  ? 4.543   -8.664  54.179 1.00 20.37 ? 21   ASN A OD1 1 
ATOM   134  N ND2 . ASN A 1 19  ? 2.996   -10.187 54.790 1.00 20.58 ? 21   ASN A ND2 1 
ATOM   135  N N   . LEU A 1 20  ? 8.292   -10.958 56.806 1.00 20.62 ? 22   LEU A N   1 
ATOM   136  C CA  . LEU A 1 20  ? 9.130   -11.246 57.949 1.00 21.22 ? 22   LEU A CA  1 
ATOM   137  C C   . LEU A 1 20  ? 10.230  -10.190 58.056 1.00 23.84 ? 22   LEU A C   1 
ATOM   138  O O   . LEU A 1 20  ? 10.650  -9.801  59.156 1.00 22.81 ? 22   LEU A O   1 
ATOM   139  C CB  . LEU A 1 20  ? 9.741   -12.634 57.804 1.00 20.20 ? 22   LEU A CB  1 
ATOM   140  C CG  . LEU A 1 20  ? 8.759   -13.783 58.016 1.00 20.63 ? 22   LEU A CG  1 
ATOM   141  C CD1 . LEU A 1 20  ? 9.479   -15.101 57.791 1.00 20.31 ? 22   LEU A CD1 1 
ATOM   142  C CD2 . LEU A 1 20  ? 8.195   -13.729 59.445 1.00 19.60 ? 22   LEU A CD2 1 
ATOM   143  N N   . ASN A 1 21  ? 10.703  -9.730  56.903 1.00 24.76 ? 23   ASN A N   1 
ATOM   144  C CA  . ASN A 1 21  ? 11.743  -8.704  56.879 1.00 24.40 ? 23   ASN A CA  1 
ATOM   145  C C   . ASN A 1 21  ? 11.127  -7.412  57.429 1.00 25.02 ? 23   ASN A C   1 
ATOM   146  O O   . ASN A 1 21  ? 11.738  -6.694  58.215 1.00 24.25 ? 23   ASN A O   1 
ATOM   147  C CB  . ASN A 1 21  ? 12.231  -8.481  55.448 1.00 20.13 ? 23   ASN A CB  1 
ATOM   148  C CG  . ASN A 1 21  ? 13.555  -7.768  55.395 1.00 23.50 ? 23   ASN A CG  1 
ATOM   149  O OD1 . ASN A 1 21  ? 13.847  -7.083  54.415 1.00 26.59 ? 23   ASN A OD1 1 
ATOM   150  N ND2 . ASN A 1 21  ? 14.386  -7.936  56.441 1.00 20.65 ? 23   ASN A ND2 1 
ATOM   151  N N   . ARG A 1 22  ? 9.911   -7.125  56.986 1.00 26.29 ? 24   ARG A N   1 
ATOM   152  C CA  . ARG A 1 22  ? 9.198   -5.953  57.442 1.00 29.67 ? 24   ARG A CA  1 
ATOM   153  C C   . ARG A 1 22  ? 9.103   -6.016  58.958 1.00 30.64 ? 24   ARG A C   1 
ATOM   154  O O   . ARG A 1 22  ? 9.370   -5.028  59.638 1.00 31.62 ? 24   ARG A O   1 
ATOM   155  C CB  . ARG A 1 22  ? 7.797   -5.925  56.830 1.00 30.52 ? 24   ARG A CB  1 
ATOM   156  C CG  . ARG A 1 22  ? 7.827   -5.974  55.314 1.00 31.88 ? 24   ARG A CG  1 
ATOM   157  C CD  . ARG A 1 22  ? 8.286   -4.649  54.701 1.00 33.45 ? 24   ARG A CD  1 
ATOM   158  N NE  . ARG A 1 22  ? 7.180   -4.123  53.918 1.00 36.03 ? 24   ARG A NE  1 
ATOM   159  C CZ  . ARG A 1 22  ? 7.224   -3.787  52.636 1.00 33.41 ? 24   ARG A CZ  1 
ATOM   160  N NH1 . ARG A 1 22  ? 8.341   -3.880  51.931 1.00 32.51 ? 24   ARG A NH1 1 
ATOM   161  N NH2 . ARG A 1 22  ? 6.100   -3.430  52.045 1.00 31.76 ? 24   ARG A NH2 1 
ATOM   162  N N   . LEU A 1 23  ? 8.728   -7.181  59.485 1.00 30.49 ? 25   LEU A N   1 
ATOM   163  C CA  . LEU A 1 23  ? 8.617   -7.344  60.931 1.00 31.00 ? 25   LEU A CA  1 
ATOM   164  C C   . LEU A 1 23  ? 9.967   -7.055  61.593 1.00 30.74 ? 25   LEU A C   1 
ATOM   165  O O   . LEU A 1 23  ? 10.016  -6.460  62.676 1.00 30.38 ? 25   LEU A O   1 
ATOM   166  C CB  . LEU A 1 23  ? 8.148   -8.765  61.286 1.00 29.47 ? 25   LEU A CB  1 
ATOM   167  C CG  . LEU A 1 23  ? 6.700   -9.136  60.927 1.00 30.28 ? 25   LEU A CG  1 
ATOM   168  C CD1 . LEU A 1 23  ? 6.465   -10.595 61.286 1.00 31.39 ? 25   LEU A CD1 1 
ATOM   169  C CD2 . LEU A 1 23  ? 5.698   -8.243  61.658 1.00 28.52 ? 25   LEU A CD2 1 
ATOM   170  N N   . ARG A 1 24  ? 11.054  -7.466  60.940 1.00 29.88 ? 26   ARG A N   1 
ATOM   171  C CA  . ARG A 1 24  ? 12.389  -7.235  61.475 1.00 31.21 ? 26   ARG A CA  1 
ATOM   172  C C   . ARG A 1 24  ? 12.715  -5.744  61.522 1.00 32.57 ? 26   ARG A C   1 
ATOM   173  O O   . ARG A 1 24  ? 13.207  -5.249  62.533 1.00 31.52 ? 26   ARG A O   1 
ATOM   174  C CB  . ARG A 1 24  ? 13.457  -7.959  60.646 1.00 31.02 ? 26   ARG A CB  1 
ATOM   175  C CG  . ARG A 1 24  ? 14.900  -7.688  61.134 1.00 28.88 ? 26   ARG A CG  1 
ATOM   176  C CD  . ARG A 1 24  ? 15.962  -8.525  60.408 1.00 27.57 ? 26   ARG A CD  1 
ATOM   177  N NE  . ARG A 1 24  ? 16.090  -8.261  58.963 1.00 27.04 ? 26   ARG A NE  1 
ATOM   178  C CZ  . ARG A 1 24  ? 17.155  -7.707  58.377 1.00 25.31 ? 26   ARG A CZ  1 
ATOM   179  N NH1 . ARG A 1 24  ? 18.198  -7.327  59.099 1.00 27.29 ? 26   ARG A NH1 1 
ATOM   180  N NH2 . ARG A 1 24  ? 17.219  -7.595  57.057 1.00 24.12 ? 26   ARG A NH2 1 
ATOM   181  N N   . SER A 1 25  ? 12.456  -5.043  60.418 1.00 33.77 ? 27   SER A N   1 
ATOM   182  C CA  . SER A 1 25  ? 12.710  -3.606  60.337 1.00 34.72 ? 27   SER A CA  1 
ATOM   183  C C   . SER A 1 25  ? 11.887  -2.816  61.378 1.00 35.65 ? 27   SER A C   1 
ATOM   184  O O   . SER A 1 25  ? 12.385  -1.853  61.966 1.00 37.02 ? 27   SER A O   1 
ATOM   185  C CB  . SER A 1 25  ? 12.414  -3.093  58.918 1.00 33.72 ? 27   SER A CB  1 
ATOM   186  O OG  . SER A 1 25  ? 11.053  -3.277  58.558 1.00 37.51 ? 27   SER A OG  1 
ATOM   187  N N   . ARG A 1 26  ? 10.637  -3.216  61.605 1.00 34.55 ? 28   ARG A N   1 
ATOM   188  C CA  . ARG A 1 26  ? 9.789   -2.548  62.601 1.00 35.97 ? 28   ARG A CA  1 
ATOM   189  C C   . ARG A 1 26  ? 10.046  -3.142  63.990 1.00 36.44 ? 28   ARG A C   1 
ATOM   190  O O   . ARG A 1 26  ? 9.361   -2.813  64.960 1.00 34.48 ? 28   ARG A O   1 
ATOM   191  C CB  . ARG A 1 26  ? 8.309   -2.700  62.238 1.00 33.90 ? 28   ARG A CB  1 
ATOM   192  C CG  . ARG A 1 26  ? 7.946   -1.959  60.964 1.00 36.62 ? 28   ARG A CG  1 
ATOM   193  C CD  . ARG A 1 26  ? 6.559   -2.319  60.439 1.00 39.29 ? 28   ARG A CD  1 
ATOM   194  N NE  . ARG A 1 26  ? 5.504   -1.893  61.348 1.00 40.55 ? 28   ARG A NE  1 
ATOM   195  C CZ  . ARG A 1 26  ? 4.207   -1.933  61.063 1.00 43.64 ? 28   ARG A CZ  1 
ATOM   196  N NH1 . ARG A 1 26  ? 3.792   -2.386  59.882 1.00 41.30 ? 28   ARG A NH1 1 
ATOM   197  N NH2 . ARG A 1 26  ? 3.323   -1.511  61.962 1.00 44.51 ? 28   ARG A NH2 1 
ATOM   198  N N   . ASP A 1 27  ? 11.041  -4.024  64.059 1.00 37.18 ? 29   ASP A N   1 
ATOM   199  C CA  . ASP A 1 27  ? 11.427  -4.678  65.300 1.00 38.37 ? 29   ASP A CA  1 
ATOM   200  C C   . ASP A 1 27  ? 10.248  -5.381  65.967 1.00 37.71 ? 29   ASP A C   1 
ATOM   201  O O   . ASP A 1 27  ? 10.131  -5.387  67.192 1.00 38.76 ? 29   ASP A O   1 
ATOM   202  C CB  . ASP A 1 27  ? 12.014  -3.643  66.261 1.00 41.36 ? 29   ASP A CB  1 
ATOM   203  C CG  . ASP A 1 27  ? 12.878  -4.268  67.335 1.00 44.22 ? 29   ASP A CG  1 
ATOM   204  O OD1 . ASP A 1 27  ? 13.090  -3.611  68.378 1.00 47.05 ? 29   ASP A OD1 1 
ATOM   205  O OD2 . ASP A 1 27  ? 13.358  -5.408  67.134 1.00 46.20 ? 29   ASP A OD2 1 
ATOM   206  N N   . ILE A 1 28  ? 9.386   -5.992  65.168 1.00 35.58 ? 30   ILE A N   1 
ATOM   207  C CA  . ILE A 1 28  ? 8.222   -6.671  65.710 1.00 34.11 ? 30   ILE A CA  1 
ATOM   208  C C   . ILE A 1 28  ? 8.435   -8.161  65.953 1.00 35.07 ? 30   ILE A C   1 
ATOM   209  O O   . ILE A 1 28  ? 8.853   -8.899  65.054 1.00 35.91 ? 30   ILE A O   1 
ATOM   210  C CB  . ILE A 1 28  ? 6.993   -6.475  64.785 1.00 31.26 ? 30   ILE A CB  1 
ATOM   211  C CG1 . ILE A 1 28  ? 6.626   -4.982  64.747 1.00 29.18 ? 30   ILE A CG1 1 
ATOM   212  C CG2 . ILE A 1 28  ? 5.803   -7.347  65.274 1.00 29.89 ? 30   ILE A CG2 1 
ATOM   213  C CD1 . ILE A 1 28  ? 5.413   -4.639  63.878 1.00 26.03 ? 30   ILE A CD1 1 
ATOM   214  N N   . LEU A 1 29  ? 8.138   -8.589  67.178 1.00 35.07 ? 31   LEU A N   1 
ATOM   215  C CA  . LEU A 1 29  ? 8.264   -9.987  67.591 1.00 35.45 ? 31   LEU A CA  1 
ATOM   216  C C   . LEU A 1 29  ? 9.687   -10.512 67.499 1.00 34.81 ? 31   LEU A C   1 
ATOM   217  O O   . LEU A 1 29  ? 9.910   -11.717 67.571 1.00 33.78 ? 31   LEU A O   1 
ATOM   218  C CB  . LEU A 1 29  ? 7.323   -10.880 66.757 1.00 36.59 ? 31   LEU A CB  1 
ATOM   219  C CG  . LEU A 1 29  ? 5.975   -11.359 67.325 1.00 36.89 ? 31   LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 29  ? 6.214   -12.542 68.244 1.00 38.59 ? 31   LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 29  ? 5.261   -10.238 68.065 1.00 37.07 ? 31   LEU A CD2 1 
ATOM   222  N N   . THR A 1 30  ? 10.646  -9.609  67.314 1.00 36.34 ? 32   THR A N   1 
ATOM   223  C CA  . THR A 1 30  ? 12.050  -10.002 67.253 1.00 37.86 ? 32   THR A CA  1 
ATOM   224  C C   . THR A 1 30  ? 12.396  -10.504 68.656 1.00 39.44 ? 32   THR A C   1 
ATOM   225  O O   . THR A 1 30  ? 12.075  -9.850  69.649 1.00 39.44 ? 32   THR A O   1 
ATOM   226  C CB  . THR A 1 30  ? 12.945  -8.808  66.902 1.00 38.55 ? 32   THR A CB  1 
ATOM   227  O OG1 . THR A 1 30  ? 12.509  -7.659  67.636 1.00 39.17 ? 32   THR A OG1 1 
ATOM   228  C CG2 . THR A 1 30  ? 12.876  -8.506  65.407 1.00 39.67 ? 32   THR A CG2 1 
ATOM   229  N N   . ASP A 1 31  ? 13.063  -11.650 68.741 1.00 39.77 ? 33   ASP A N   1 
ATOM   230  C CA  . ASP A 1 31  ? 13.371  -12.245 70.034 1.00 39.76 ? 33   ASP A CA  1 
ATOM   231  C C   . ASP A 1 31  ? 14.834  -12.476 70.386 1.00 40.40 ? 33   ASP A C   1 
ATOM   232  O O   . ASP A 1 31  ? 15.129  -13.210 71.339 1.00 41.03 ? 33   ASP A O   1 
ATOM   233  C CB  . ASP A 1 31  ? 12.622  -13.574 70.143 1.00 39.28 ? 33   ASP A CB  1 
ATOM   234  C CG  . ASP A 1 31  ? 12.957  -14.527 68.993 1.00 37.41 ? 33   ASP A CG  1 
ATOM   235  O OD1 . ASP A 1 31  ? 12.225  -15.520 68.819 1.00 36.45 ? 33   ASP A OD1 1 
ATOM   236  O OD2 . ASP A 1 31  ? 13.951  -14.283 68.276 1.00 32.24 ? 33   ASP A OD2 1 
ATOM   237  N N   . VAL A 1 32  ? 15.752  -11.868 69.643 1.00 40.20 ? 34   VAL A N   1 
ATOM   238  C CA  . VAL A 1 32  ? 17.168  -12.064 69.929 1.00 40.80 ? 34   VAL A CA  1 
ATOM   239  C C   . VAL A 1 32  ? 18.008  -10.969 69.288 1.00 42.91 ? 34   VAL A C   1 
ATOM   240  O O   . VAL A 1 32  ? 17.613  -10.380 68.285 1.00 42.90 ? 34   VAL A O   1 
ATOM   241  C CB  . VAL A 1 32  ? 17.663  -13.439 69.398 1.00 42.07 ? 34   VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 32  ? 17.819  -13.378 67.873 1.00 40.74 ? 34   VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 32  ? 18.995  -13.838 70.071 1.00 39.75 ? 34   VAL A CG2 1 
ATOM   244  N N   . VAL A 1 33  ? 19.165  -10.690 69.883 1.00 43.66 ? 35   VAL A N   1 
ATOM   245  C CA  . VAL A 1 33  ? 20.072  -9.683  69.353 1.00 43.82 ? 35   VAL A CA  1 
ATOM   246  C C   . VAL A 1 33  ? 21.386  -10.400 69.149 1.00 44.21 ? 35   VAL A C   1 
ATOM   247  O O   . VAL A 1 33  ? 21.812  -11.170 70.009 1.00 45.36 ? 35   VAL A O   1 
ATOM   248  C CB  . VAL A 1 33  ? 20.276  -8.500  70.347 1.00 43.67 ? 35   VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 33  ? 21.075  -7.386  69.689 1.00 41.23 ? 35   VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 33  ? 18.938  -7.977  70.807 1.00 43.70 ? 35   VAL A CG2 1 
ATOM   251  N N   . ILE A 1 34  ? 22.018  -10.166 68.005 1.00 45.76 ? 36   ILE A N   1 
ATOM   252  C CA  . ILE A 1 34  ? 23.294  -10.804 67.701 1.00 46.40 ? 36   ILE A CA  1 
ATOM   253  C C   . ILE A 1 34  ? 24.347  -9.727  67.746 1.00 47.37 ? 36   ILE A C   1 
ATOM   254  O O   . ILE A 1 34  ? 24.228  -8.703  67.070 1.00 47.31 ? 36   ILE A O   1 
ATOM   255  C CB  . ILE A 1 34  ? 23.298  -11.447 66.292 1.00 46.11 ? 36   ILE A CB  1 
ATOM   256  C CG1 . ILE A 1 34  ? 22.209  -12.528 66.201 1.00 46.23 ? 36   ILE A CG1 1 
ATOM   257  C CG2 . ILE A 1 34  ? 24.678  -12.013 65.981 1.00 44.09 ? 36   ILE A CG2 1 
ATOM   258  C CD1 . ILE A 1 34  ? 22.427  -13.728 67.107 1.00 48.17 ? 36   ILE A CD1 1 
ATOM   259  N N   . VAL A 1 35  ? 25.387  -9.967  68.534 1.00 48.81 ? 37   VAL A N   1 
ATOM   260  C CA  . VAL A 1 35  ? 26.444  -8.993  68.684 1.00 49.45 ? 37   VAL A CA  1 
ATOM   261  C C   . VAL A 1 35  ? 27.715  -9.367  67.950 1.00 51.31 ? 37   VAL A C   1 
ATOM   262  O O   . VAL A 1 35  ? 28.310  -10.415 68.191 1.00 52.11 ? 37   VAL A O   1 
ATOM   263  C CB  . VAL A 1 35  ? 26.745  -8.757  70.182 1.00 48.57 ? 37   VAL A CB  1 
ATOM   264  C CG1 . VAL A 1 35  ? 27.806  -7.679  70.350 1.00 46.45 ? 37   VAL A CG1 1 
ATOM   265  C CG2 . VAL A 1 35  ? 25.472  -8.344  70.889 1.00 46.97 ? 37   VAL A CG2 1 
ATOM   266  N N   . VAL A 1 36  ? 28.113  -8.485  67.041 1.00 53.44 ? 38   VAL A N   1 
ATOM   267  C CA  . VAL A 1 36  ? 29.318  -8.646  66.236 1.00 56.12 ? 38   VAL A CA  1 
ATOM   268  C C   . VAL A 1 36  ? 30.142  -7.401  66.553 1.00 57.53 ? 38   VAL A C   1 
ATOM   269  O O   . VAL A 1 36  ? 29.756  -6.279  66.194 1.00 57.35 ? 38   VAL A O   1 
ATOM   270  C CB  . VAL A 1 36  ? 28.967  -8.689  64.728 1.00 56.51 ? 38   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 36  ? 30.180  -9.120  63.914 1.00 56.38 ? 38   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 36  ? 27.795  -9.637  64.502 1.00 56.34 ? 38   VAL A CG2 1 
ATOM   273  N N   . SER A 1 37  ? 31.277  -7.602  67.219 1.00 59.19 ? 39   SER A N   1 
ATOM   274  C CA  . SER A 1 37  ? 32.107  -6.480  67.653 1.00 59.72 ? 39   SER A CA  1 
ATOM   275  C C   . SER A 1 37  ? 31.180  -5.638  68.515 1.00 60.23 ? 39   SER A C   1 
ATOM   276  O O   . SER A 1 37  ? 30.497  -6.172  69.394 1.00 60.14 ? 39   SER A O   1 
ATOM   277  C CB  . SER A 1 37  ? 32.625  -5.662  66.475 1.00 58.98 ? 39   SER A CB  1 
ATOM   278  O OG  . SER A 1 37  ? 33.661  -6.360  65.818 1.00 59.04 ? 39   SER A OG  1 
ATOM   279  N N   . ARG A 1 38  ? 31.116  -4.340  68.264 1.00 61.08 ? 40   ARG A N   1 
ATOM   280  C CA  . ARG A 1 38  ? 30.248  -3.504  69.084 1.00 62.50 ? 40   ARG A CA  1 
ATOM   281  C C   . ARG A 1 38  ? 28.884  -3.253  68.452 1.00 61.74 ? 40   ARG A C   1 
ATOM   282  O O   . ARG A 1 38  ? 28.061  -2.524  69.009 1.00 62.12 ? 40   ARG A O   1 
ATOM   283  C CB  . ARG A 1 38  ? 30.945  -2.179  69.387 1.00 64.66 ? 40   ARG A CB  1 
ATOM   284  C CG  . ARG A 1 38  ? 32.209  -2.337  70.225 1.00 67.79 ? 40   ARG A CG  1 
ATOM   285  C CD  . ARG A 1 38  ? 32.993  -1.043  70.239 1.00 70.27 ? 40   ARG A CD  1 
ATOM   286  N NE  . ARG A 1 38  ? 33.267  -0.596  68.874 1.00 71.69 ? 40   ARG A NE  1 
ATOM   287  C CZ  . ARG A 1 38  ? 33.805  0.579   68.562 1.00 72.25 ? 40   ARG A CZ  1 
ATOM   288  N NH1 . ARG A 1 38  ? 34.131  1.438   69.523 1.00 72.33 ? 40   ARG A NH1 1 
ATOM   289  N NH2 . ARG A 1 38  ? 34.015  0.894   67.288 1.00 71.95 ? 40   ARG A NH2 1 
ATOM   290  N N   . GLU A 1 39  ? 28.641  -3.873  67.298 1.00 60.35 ? 41   GLU A N   1 
ATOM   291  C CA  . GLU A 1 39  ? 27.372  -3.703  66.602 1.00 57.68 ? 41   GLU A CA  1 
ATOM   292  C C   . GLU A 1 39  ? 26.339  -4.776  66.912 1.00 55.07 ? 41   GLU A C   1 
ATOM   293  O O   . GLU A 1 39  ? 26.656  -5.961  67.048 1.00 53.66 ? 41   GLU A O   1 
ATOM   294  C CB  . GLU A 1 39  ? 27.609  -3.611  65.095 1.00 58.54 ? 41   GLU A CB  1 
ATOM   295  C CG  . GLU A 1 39  ? 28.194  -2.275  64.681 1.00 60.51 ? 41   GLU A CG  1 
ATOM   296  C CD  . GLU A 1 39  ? 28.457  -2.182  63.193 1.00 62.83 ? 41   GLU A CD  1 
ATOM   297  O OE1 . GLU A 1 39  ? 27.513  -2.433  62.405 1.00 63.40 ? 41   GLU A OE1 1 
ATOM   298  O OE2 . GLU A 1 39  ? 29.605  -1.853  62.814 1.00 62.59 ? 41   GLU A OE2 1 
ATOM   299  N N   . GLN A 1 40  ? 25.095  -4.328  67.030 1.00 52.16 ? 42   GLN A N   1 
ATOM   300  C CA  . GLN A 1 40  ? 23.974  -5.199  67.331 1.00 51.17 ? 42   GLN A CA  1 
ATOM   301  C C   . GLN A 1 40  ? 23.076  -5.382  66.118 1.00 49.04 ? 42   GLN A C   1 
ATOM   302  O O   . GLN A 1 40  ? 23.034  -4.537  65.227 1.00 48.79 ? 42   GLN A O   1 
ATOM   303  C CB  . GLN A 1 40  ? 23.146  -4.608  68.471 1.00 52.80 ? 42   GLN A CB  1 
ATOM   304  C CG  . GLN A 1 40  ? 23.825  -4.636  69.833 1.00 55.52 ? 42   GLN A CG  1 
ATOM   305  C CD  . GLN A 1 40  ? 23.260  -3.592  70.780 1.00 56.08 ? 42   GLN A CD  1 
ATOM   306  O OE1 . GLN A 1 40  ? 22.049  -3.366  70.820 1.00 55.98 ? 42   GLN A OE1 1 
ATOM   307  N NE2 . GLN A 1 40  ? 24.139  -2.954  71.554 1.00 56.91 ? 42   GLN A NE2 1 
ATOM   308  N N   . PHE A 1 41  ? 22.360  -6.499  66.095 1.00 46.96 ? 43   PHE A N   1 
ATOM   309  C CA  . PHE A 1 41  ? 21.430  -6.796  65.014 1.00 44.03 ? 43   PHE A CA  1 
ATOM   310  C C   . PHE A 1 41  ? 20.253  -7.546  65.615 1.00 42.98 ? 43   PHE A C   1 
ATOM   311  O O   . PHE A 1 41  ? 20.429  -8.627  66.177 1.00 42.94 ? 43   PHE A O   1 
ATOM   312  C CB  . PHE A 1 41  ? 22.078  -7.677  63.947 1.00 42.55 ? 43   PHE A CB  1 
ATOM   313  C CG  . PHE A 1 41  ? 23.340  -7.116  63.364 1.00 41.36 ? 43   PHE A CG  1 
ATOM   314  C CD1 . PHE A 1 41  ? 24.563  -7.302  64.006 1.00 41.60 ? 43   PHE A CD1 1 
ATOM   315  C CD2 . PHE A 1 41  ? 23.317  -6.436  62.151 1.00 39.59 ? 43   PHE A CD2 1 
ATOM   316  C CE1 . PHE A 1 41  ? 25.751  -6.820  63.440 1.00 40.26 ? 43   PHE A CE1 1 
ATOM   317  C CE2 . PHE A 1 41  ? 24.490  -5.951  61.579 1.00 39.21 ? 43   PHE A CE2 1 
ATOM   318  C CZ  . PHE A 1 41  ? 25.711  -6.143  62.222 1.00 40.89 ? 43   PHE A CZ  1 
ATOM   319  N N   . ARG A 1 42  ? 19.061  -6.966  65.507 1.00 42.22 ? 44   ARG A N   1 
ATOM   320  C CA  . ARG A 1 42  ? 17.844  -7.584  66.028 1.00 42.40 ? 44   ARG A CA  1 
ATOM   321  C C   . ARG A 1 42  ? 17.352  -8.602  64.980 1.00 40.99 ? 44   ARG A C   1 
ATOM   322  O O   . ARG A 1 42  ? 17.554  -8.402  63.776 1.00 39.94 ? 44   ARG A O   1 
ATOM   323  C CB  . ARG A 1 42  ? 16.778  -6.507  66.282 1.00 45.29 ? 44   ARG A CB  1 
ATOM   324  C CG  . ARG A 1 42  ? 17.190  -5.395  67.264 1.00 48.58 ? 44   ARG A CG  1 
ATOM   325  C CD  . ARG A 1 42  ? 16.976  -5.798  68.718 1.00 51.16 ? 44   ARG A CD  1 
ATOM   326  N NE  . ARG A 1 42  ? 15.565  -6.047  69.019 1.00 54.33 ? 44   ARG A NE  1 
ATOM   327  C CZ  . ARG A 1 42  ? 15.129  -6.769  70.051 1.00 55.24 ? 44   ARG A CZ  1 
ATOM   328  N NH1 . ARG A 1 42  ? 15.995  -7.326  70.893 1.00 56.48 ? 44   ARG A NH1 1 
ATOM   329  N NH2 . ARG A 1 42  ? 13.826  -6.941  70.242 1.00 55.19 ? 44   ARG A NH2 1 
ATOM   330  N N   . ALA A 1 43  ? 16.706  -9.680  65.427 1.00 38.23 ? 45   ALA A N   1 
ATOM   331  C CA  . ALA A 1 43  ? 16.248  -10.713 64.497 1.00 36.31 ? 45   ALA A CA  1 
ATOM   332  C C   . ALA A 1 43  ? 15.325  -11.745 65.124 1.00 34.88 ? 45   ALA A C   1 
ATOM   333  O O   . ALA A 1 43  ? 15.023  -11.685 66.308 1.00 35.21 ? 45   ALA A O   1 
ATOM   334  C CB  . ALA A 1 43  ? 17.459  -11.417 63.889 1.00 34.56 ? 45   ALA A CB  1 
ATOM   335  N N   . HIS A 1 44  ? 14.870  -12.688 64.305 1.00 33.64 ? 46   HIS A N   1 
ATOM   336  C CA  . HIS A 1 44  ? 13.996  -13.759 64.762 1.00 31.96 ? 46   HIS A CA  1 
ATOM   337  C C   . HIS A 1 44  ? 14.802  -15.043 64.709 1.00 32.59 ? 46   HIS A C   1 
ATOM   338  O O   . HIS A 1 44  ? 15.391  -15.374 63.676 1.00 34.13 ? 46   HIS A O   1 
ATOM   339  C CB  . HIS A 1 44  ? 12.767  -13.881 63.859 1.00 32.70 ? 46   HIS A CB  1 
ATOM   340  C CG  . HIS A 1 44  ? 12.026  -12.594 63.683 1.00 31.72 ? 46   HIS A CG  1 
ATOM   341  N ND1 . HIS A 1 44  ? 12.247  -11.748 62.614 1.00 30.90 ? 46   HIS A ND1 1 
ATOM   342  C CD2 . HIS A 1 44  ? 11.120  -11.975 64.474 1.00 29.22 ? 46   HIS A CD2 1 
ATOM   343  C CE1 . HIS A 1 44  ? 11.508  -10.663 62.756 1.00 29.77 ? 46   HIS A CE1 1 
ATOM   344  N NE2 . HIS A 1 44  ? 10.816  -10.774 63.876 1.00 31.90 ? 46   HIS A NE2 1 
ATOM   345  N N   . LYS A 1 45  ? 14.837  -15.754 65.832 1.00 31.08 ? 47   LYS A N   1 
ATOM   346  C CA  . LYS A 1 45  ? 15.585  -17.001 65.942 1.00 29.85 ? 47   LYS A CA  1 
ATOM   347  C C   . LYS A 1 45  ? 15.160  -17.997 64.885 1.00 25.52 ? 47   LYS A C   1 
ATOM   348  O O   . LYS A 1 45  ? 15.996  -18.621 64.257 1.00 27.51 ? 47   LYS A O   1 
ATOM   349  C CB  . LYS A 1 45  ? 15.396  -17.609 67.349 1.00 33.17 ? 47   LYS A CB  1 
ATOM   350  C CG  . LYS A 1 45  ? 16.041  -16.780 68.470 1.00 35.82 ? 47   LYS A CG  1 
ATOM   351  C CD  . LYS A 1 45  ? 15.593  -17.228 69.850 1.00 38.51 ? 47   LYS A CD  1 
ATOM   352  C CE  . LYS A 1 45  ? 16.340  -16.469 70.947 1.00 38.94 ? 47   LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 45  ? 15.959  -16.936 72.319 1.00 39.31 ? 47   LYS A NZ  1 
ATOM   354  N N   . THR A 1 46  ? 13.861  -18.142 64.689 1.00 24.73 ? 48   THR A N   1 
ATOM   355  C CA  . THR A 1 46  ? 13.348  -19.068 63.684 1.00 26.75 ? 48   THR A CA  1 
ATOM   356  C C   . THR A 1 46  ? 13.948  -18.834 62.289 1.00 25.30 ? 48   THR A C   1 
ATOM   357  O O   . THR A 1 46  ? 14.283  -19.787 61.601 1.00 25.65 ? 48   THR A O   1 
ATOM   358  C CB  . THR A 1 46  ? 11.814  -18.989 63.583 1.00 27.47 ? 48   THR A CB  1 
ATOM   359  O OG1 . THR A 1 46  ? 11.419  -17.625 63.398 1.00 28.93 ? 48   THR A OG1 1 
ATOM   360  C CG2 . THR A 1 46  ? 11.174  -19.547 64.833 1.00 26.87 ? 48   THR A CG2 1 
ATOM   361  N N   . VAL A 1 47  ? 14.091  -17.571 61.884 1.00 24.64 ? 49   VAL A N   1 
ATOM   362  C CA  . VAL A 1 47  ? 14.676  -17.255 60.580 1.00 24.82 ? 49   VAL A CA  1 
ATOM   363  C C   . VAL A 1 47  ? 16.173  -17.574 60.606 1.00 24.82 ? 49   VAL A C   1 
ATOM   364  O O   . VAL A 1 47  ? 16.715  -18.188 59.686 1.00 21.23 ? 49   VAL A O   1 
ATOM   365  C CB  . VAL A 1 47  ? 14.498  -15.749 60.210 1.00 24.95 ? 49   VAL A CB  1 
ATOM   366  C CG1 . VAL A 1 47  ? 15.247  -15.424 58.902 1.00 19.91 ? 49   VAL A CG1 1 
ATOM   367  C CG2 . VAL A 1 47  ? 13.012  -15.420 60.083 1.00 19.80 ? 49   VAL A CG2 1 
ATOM   368  N N   . LEU A 1 48  ? 16.835  -17.134 61.666 1.00 26.61 ? 50   LEU A N   1 
ATOM   369  C CA  . LEU A 1 48  ? 18.259  -17.401 61.823 1.00 28.95 ? 50   LEU A CA  1 
ATOM   370  C C   . LEU A 1 48  ? 18.522  -18.907 61.758 1.00 29.72 ? 50   LEU A C   1 
ATOM   371  O O   . LEU A 1 48  ? 19.453  -19.352 61.089 1.00 30.58 ? 50   LEU A O   1 
ATOM   372  C CB  . LEU A 1 48  ? 18.746  -16.862 63.162 1.00 28.92 ? 50   LEU A CB  1 
ATOM   373  C CG  . LEU A 1 48  ? 18.832  -15.348 63.293 1.00 31.31 ? 50   LEU A CG  1 
ATOM   374  C CD1 . LEU A 1 48  ? 19.540  -15.023 64.603 1.00 31.17 ? 50   LEU A CD1 1 
ATOM   375  C CD2 . LEU A 1 48  ? 19.606  -14.751 62.114 1.00 30.85 ? 50   LEU A CD2 1 
ATOM   376  N N   . MET A 1 49  ? 17.698  -19.681 62.461 1.00 30.99 ? 51   MET A N   1 
ATOM   377  C CA  . MET A 1 49  ? 17.830  -21.134 62.477 1.00 32.88 ? 51   MET A CA  1 
ATOM   378  C C   . MET A 1 49  ? 17.559  -21.749 61.110 1.00 33.05 ? 51   MET A C   1 
ATOM   379  O O   . MET A 1 49  ? 18.235  -22.696 60.697 1.00 35.02 ? 51   MET A O   1 
ATOM   380  C CB  . MET A 1 49  ? 16.845  -21.752 63.461 1.00 34.83 ? 51   MET A CB  1 
ATOM   381  C CG  . MET A 1 49  ? 17.201  -21.603 64.921 1.00 39.69 ? 51   MET A CG  1 
ATOM   382  S SD  . MET A 1 49  ? 15.831  -22.292 65.867 1.00 44.39 ? 51   MET A SD  1 
ATOM   383  C CE  . MET A 1 49  ? 16.057  -24.061 65.529 1.00 42.32 ? 51   MET A CE  1 
ATOM   384  N N   . ALA A 1 50  ? 16.547  -21.235 60.425 1.00 30.24 ? 52   ALA A N   1 
ATOM   385  C CA  . ALA A 1 50  ? 16.203  -21.755 59.118 1.00 29.04 ? 52   ALA A CA  1 
ATOM   386  C C   . ALA A 1 50  ? 17.345  -21.571 58.135 1.00 26.44 ? 52   ALA A C   1 
ATOM   387  O O   . ALA A 1 50  ? 17.533  -22.391 57.233 1.00 25.57 ? 52   ALA A O   1 
ATOM   388  C CB  . ALA A 1 50  ? 14.916  -21.067 58.587 1.00 28.03 ? 52   ALA A CB  1 
ATOM   389  N N   . CYS A 1 51  ? 18.129  -20.517 58.331 1.00 26.19 ? 53   CYS A N   1 
ATOM   390  C CA  . CYS A 1 51  ? 19.231  -20.214 57.408 1.00 26.45 ? 53   CYS A CA  1 
ATOM   391  C C   . CYS A 1 51  ? 20.656  -20.598 57.797 1.00 27.45 ? 53   CYS A C   1 
ATOM   392  O O   . CYS A 1 51  ? 21.502  -20.786 56.922 1.00 27.50 ? 53   CYS A O   1 
ATOM   393  C CB  . CYS A 1 51  ? 19.232  -18.716 57.081 1.00 23.42 ? 53   CYS A CB  1 
ATOM   394  S SG  . CYS A 1 51  ? 17.708  -18.166 56.336 1.00 19.40 ? 53   CYS A SG  1 
ATOM   395  N N   . SER A 1 52  ? 20.936  -20.705 59.088 1.00 27.55 ? 54   SER A N   1 
ATOM   396  C CA  . SER A 1 52  ? 22.297  -21.016 59.515 1.00 29.83 ? 54   SER A CA  1 
ATOM   397  C C   . SER A 1 52  ? 22.406  -22.289 60.354 1.00 29.46 ? 54   SER A C   1 
ATOM   398  O O   . SER A 1 52  ? 21.698  -22.435 61.346 1.00 30.43 ? 54   SER A O   1 
ATOM   399  C CB  . SER A 1 52  ? 22.850  -19.815 60.289 1.00 29.47 ? 54   SER A CB  1 
ATOM   400  O OG  . SER A 1 52  ? 23.957  -20.173 61.100 1.00 33.42 ? 54   SER A OG  1 
ATOM   401  N N   . GLY A 1 53  ? 23.278  -23.206 59.943 1.00 30.32 ? 55   GLY A N   1 
ATOM   402  C CA  . GLY A 1 53  ? 23.474  -24.446 60.689 1.00 31.70 ? 55   GLY A CA  1 
ATOM   403  C C   . GLY A 1 53  ? 23.942  -24.130 62.105 1.00 32.84 ? 55   GLY A C   1 
ATOM   404  O O   . GLY A 1 53  ? 23.593  -24.816 63.077 1.00 30.80 ? 55   GLY A O   1 
ATOM   405  N N   . LEU A 1 54  ? 24.731  -23.065 62.212 1.00 33.17 ? 56   LEU A N   1 
ATOM   406  C CA  . LEU A 1 54  ? 25.233  -22.608 63.485 1.00 35.14 ? 56   LEU A CA  1 
ATOM   407  C C   . LEU A 1 54  ? 24.090  -22.143 64.394 1.00 35.95 ? 56   LEU A C   1 
ATOM   408  O O   . LEU A 1 54  ? 23.868  -22.709 65.467 1.00 36.91 ? 56   LEU A O   1 
ATOM   409  C CB  . LEU A 1 54  ? 26.219  -21.468 63.268 1.00 36.38 ? 56   LEU A CB  1 
ATOM   410  C CG  . LEU A 1 54  ? 26.740  -20.869 64.576 1.00 39.38 ? 56   LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 54  ? 27.119  -22.002 65.535 1.00 39.72 ? 56   LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 54  ? 27.934  -19.956 64.300 1.00 37.71 ? 56   LEU A CD2 1 
ATOM   413  N N   . PHE A 1 55  ? 23.360  -21.112 63.975 1.00 35.03 ? 57   PHE A N   1 
ATOM   414  C CA  . PHE A 1 55  ? 22.262  -20.622 64.800 1.00 32.54 ? 57   PHE A CA  1 
ATOM   415  C C   . PHE A 1 55  ? 21.288  -21.755 65.116 1.00 31.66 ? 57   PHE A C   1 
ATOM   416  O O   . PHE A 1 55  ? 20.591  -21.737 66.135 1.00 28.51 ? 57   PHE A O   1 
ATOM   417  C CB  . PHE A 1 55  ? 21.549  -19.459 64.103 1.00 32.46 ? 57   PHE A CB  1 
ATOM   418  C CG  . PHE A 1 55  ? 22.356  -18.194 64.067 1.00 34.18 ? 57   PHE A CG  1 
ATOM   419  C CD1 . PHE A 1 55  ? 22.507  -17.476 62.880 1.00 33.73 ? 57   PHE A CD1 1 
ATOM   420  C CD2 . PHE A 1 55  ? 22.983  -17.714 65.223 1.00 35.63 ? 57   PHE A CD2 1 
ATOM   421  C CE1 . PHE A 1 55  ? 23.271  -16.298 62.838 1.00 31.86 ? 57   PHE A CE1 1 
ATOM   422  C CE2 . PHE A 1 55  ? 23.750  -16.533 65.195 1.00 32.80 ? 57   PHE A CE2 1 
ATOM   423  C CZ  . PHE A 1 55  ? 23.893  -15.828 64.003 1.00 33.41 ? 57   PHE A CZ  1 
ATOM   424  N N   . TYR A 1 56  ? 21.237  -22.752 64.244 1.00 30.77 ? 58   TYR A N   1 
ATOM   425  C CA  . TYR A 1 56  ? 20.355  -23.878 64.494 1.00 32.14 ? 58   TYR A CA  1 
ATOM   426  C C   . TYR A 1 56  ? 20.850  -24.586 65.769 1.00 33.23 ? 58   TYR A C   1 
ATOM   427  O O   . TYR A 1 56  ? 20.064  -24.925 66.657 1.00 32.33 ? 58   TYR A O   1 
ATOM   428  C CB  . TYR A 1 56  ? 20.365  -24.862 63.315 1.00 33.45 ? 58   TYR A CB  1 
ATOM   429  C CG  . TYR A 1 56  ? 19.455  -26.050 63.558 1.00 34.73 ? 58   TYR A CG  1 
ATOM   430  C CD1 . TYR A 1 56  ? 18.088  -25.985 63.259 1.00 33.21 ? 58   TYR A CD1 1 
ATOM   431  C CD2 . TYR A 1 56  ? 19.946  -27.210 64.182 1.00 34.85 ? 58   TYR A CD2 1 
ATOM   432  C CE1 . TYR A 1 56  ? 17.222  -27.051 63.582 1.00 35.55 ? 58   TYR A CE1 1 
ATOM   433  C CE2 . TYR A 1 56  ? 19.092  -28.276 64.511 1.00 35.85 ? 58   TYR A CE2 1 
ATOM   434  C CZ  . TYR A 1 56  ? 17.739  -28.193 64.209 1.00 36.31 ? 58   TYR A CZ  1 
ATOM   435  O OH  . TYR A 1 56  ? 16.921  -29.256 64.509 1.00 36.81 ? 58   TYR A OH  1 
ATOM   436  N N   . SER A 1 57  ? 22.160  -24.793 65.856 1.00 34.28 ? 59   SER A N   1 
ATOM   437  C CA  . SER A 1 57  ? 22.753  -25.448 67.016 1.00 37.50 ? 59   SER A CA  1 
ATOM   438  C C   . SER A 1 57  ? 22.615  -24.608 68.271 1.00 38.61 ? 59   SER A C   1 
ATOM   439  O O   . SER A 1 57  ? 22.185  -25.097 69.316 1.00 39.91 ? 59   SER A O   1 
ATOM   440  C CB  . SER A 1 57  ? 24.228  -25.742 66.755 1.00 35.96 ? 59   SER A CB  1 
ATOM   441  O OG  . SER A 1 57  ? 24.341  -26.762 65.779 1.00 38.35 ? 59   SER A OG  1 
ATOM   442  N N   . ILE A 1 58  ? 22.974  -23.336 68.156 1.00 40.37 ? 60   ILE A N   1 
ATOM   443  C CA  . ILE A 1 58  ? 22.898  -22.415 69.274 1.00 41.72 ? 60   ILE A CA  1 
ATOM   444  C C   . ILE A 1 58  ? 21.524  -22.386 69.910 1.00 42.48 ? 60   ILE A C   1 
ATOM   445  O O   . ILE A 1 58  ? 21.402  -22.472 71.124 1.00 43.93 ? 60   ILE A O   1 
ATOM   446  C CB  . ILE A 1 58  ? 23.256  -20.993 68.832 1.00 42.39 ? 60   ILE A CB  1 
ATOM   447  C CG1 . ILE A 1 58  ? 24.743  -20.931 68.497 1.00 40.72 ? 60   ILE A CG1 1 
ATOM   448  C CG2 . ILE A 1 58  ? 22.857  -19.983 69.917 1.00 41.28 ? 60   ILE A CG2 1 
ATOM   449  C CD1 . ILE A 1 58  ? 25.164  -19.619 67.882 1.00 42.13 ? 60   ILE A CD1 1 
ATOM   450  N N   . PHE A 1 59  ? 20.486  -22.267 69.091 1.00 43.81 ? 61   PHE A N   1 
ATOM   451  C CA  . PHE A 1 59  ? 19.125  -22.202 69.607 1.00 43.16 ? 61   PHE A CA  1 
ATOM   452  C C   . PHE A 1 59  ? 18.533  -23.575 69.863 1.00 43.92 ? 61   PHE A C   1 
ATOM   453  O O   . PHE A 1 59  ? 17.393  -23.704 70.303 1.00 43.62 ? 61   PHE A O   1 
ATOM   454  C CB  . PHE A 1 59  ? 18.267  -21.379 68.646 1.00 42.89 ? 61   PHE A CB  1 
ATOM   455  C CG  . PHE A 1 59  ? 18.755  -19.966 68.479 1.00 42.11 ? 61   PHE A CG  1 
ATOM   456  C CD1 . PHE A 1 59  ? 18.874  -19.397 67.220 1.00 40.64 ? 61   PHE A CD1 1 
ATOM   457  C CD2 . PHE A 1 59  ? 19.135  -19.214 69.591 1.00 42.69 ? 61   PHE A CD2 1 
ATOM   458  C CE1 . PHE A 1 59  ? 19.370  -18.098 67.068 1.00 41.54 ? 61   PHE A CE1 1 
ATOM   459  C CE2 . PHE A 1 59  ? 19.633  -17.911 69.449 1.00 41.73 ? 61   PHE A CE2 1 
ATOM   460  C CZ  . PHE A 1 59  ? 19.751  -17.356 68.188 1.00 41.23 ? 61   PHE A CZ  1 
ATOM   461  N N   . THR A 1 60  ? 19.324  -24.605 69.587 1.00 46.21 ? 62   THR A N   1 
ATOM   462  C CA  . THR A 1 60  ? 18.916  -25.985 69.829 1.00 48.18 ? 62   THR A CA  1 
ATOM   463  C C   . THR A 1 60  ? 19.537  -26.394 71.165 1.00 49.17 ? 62   THR A C   1 
ATOM   464  O O   . THR A 1 60  ? 19.109  -27.354 71.803 1.00 48.28 ? 62   THR A O   1 
ATOM   465  C CB  . THR A 1 60  ? 19.428  -26.913 68.707 1.00 47.81 ? 62   THR A CB  1 
ATOM   466  O OG1 . THR A 1 60  ? 18.638  -26.699 67.539 1.00 50.25 ? 62   THR A OG1 1 
ATOM   467  C CG2 . THR A 1 60  ? 19.323  -28.374 69.100 1.00 48.98 ? 62   THR A CG2 1 
ATOM   468  N N   . ASP A 1 61  ? 20.546  -25.626 71.569 1.00 51.11 ? 63   ASP A N   1 
ATOM   469  C CA  . ASP A 1 61  ? 21.300  -25.831 72.802 1.00 53.46 ? 63   ASP A CA  1 
ATOM   470  C C   . ASP A 1 61  ? 20.477  -25.392 74.018 1.00 54.80 ? 63   ASP A C   1 
ATOM   471  O O   . ASP A 1 61  ? 20.263  -24.204 74.227 1.00 54.06 ? 63   ASP A O   1 
ATOM   472  C CB  . ASP A 1 61  ? 22.598  -25.019 72.718 1.00 53.92 ? 63   ASP A CB  1 
ATOM   473  C CG  . ASP A 1 61  ? 23.619  -25.420 73.764 1.00 54.38 ? 63   ASP A CG  1 
ATOM   474  O OD1 . ASP A 1 61  ? 23.318  -25.315 74.971 1.00 55.80 ? 63   ASP A OD1 1 
ATOM   475  O OD2 . ASP A 1 61  ? 24.729  -25.834 73.372 1.00 53.24 ? 63   ASP A OD2 1 
ATOM   476  N N   . GLN A 1 62  ? 20.028  -26.357 74.817 1.00 56.85 ? 64   GLN A N   1 
ATOM   477  C CA  . GLN A 1 62  ? 19.216  -26.072 75.995 1.00 59.53 ? 64   GLN A CA  1 
ATOM   478  C C   . GLN A 1 62  ? 19.749  -24.977 76.911 1.00 60.48 ? 64   GLN A C   1 
ATOM   479  O O   . GLN A 1 62  ? 18.964  -24.252 77.533 1.00 61.20 ? 64   GLN A O   1 
ATOM   480  C CB  . GLN A 1 62  ? 19.001  -27.341 76.821 1.00 60.89 ? 64   GLN A CB  1 
ATOM   481  C CG  . GLN A 1 62  ? 20.275  -28.093 77.165 1.00 62.44 ? 64   GLN A CG  1 
ATOM   482  C CD  . GLN A 1 62  ? 20.572  -29.218 76.185 1.00 63.39 ? 64   GLN A CD  1 
ATOM   483  O OE1 . GLN A 1 62  ? 20.805  -28.983 74.991 1.00 63.77 ? 64   GLN A OE1 1 
ATOM   484  N NE2 . GLN A 1 62  ? 20.556  -30.456 76.685 1.00 62.64 ? 64   GLN A NE2 1 
ATOM   485  N N   . LEU A 1 63  ? 21.068  -24.849 77.016 1.00 60.69 ? 65   LEU A N   1 
ATOM   486  C CA  . LEU A 1 63  ? 21.615  -23.811 77.881 1.00 61.38 ? 65   LEU A CA  1 
ATOM   487  C C   . LEU A 1 63  ? 21.835  -22.455 77.204 1.00 60.31 ? 65   LEU A C   1 
ATOM   488  O O   . LEU A 1 63  ? 22.269  -21.505 77.851 1.00 60.21 ? 65   LEU A O   1 
ATOM   489  C CB  . LEU A 1 63  ? 22.907  -24.292 78.564 1.00 62.70 ? 65   LEU A CB  1 
ATOM   490  C CG  . LEU A 1 63  ? 23.917  -25.184 77.840 1.00 64.83 ? 65   LEU A CG  1 
ATOM   491  C CD1 . LEU A 1 63  ? 25.150  -25.345 78.726 1.00 64.93 ? 65   LEU A CD1 1 
ATOM   492  C CD2 . LEU A 1 63  ? 23.301  -26.556 77.533 1.00 65.14 ? 65   LEU A CD2 1 
ATOM   493  N N   . LYS A 1 64  ? 21.517  -22.362 75.913 1.00 59.58 ? 66   LYS A N   1 
ATOM   494  C CA  . LYS A 1 64  ? 21.663  -21.110 75.167 1.00 58.89 ? 66   LYS A CA  1 
ATOM   495  C C   . LYS A 1 64  ? 20.425  -20.809 74.328 1.00 59.22 ? 66   LYS A C   1 
ATOM   496  O O   . LYS A 1 64  ? 20.439  -19.902 73.503 1.00 59.28 ? 66   LYS A O   1 
ATOM   497  C CB  . LYS A 1 64  ? 22.897  -21.160 74.257 1.00 57.68 ? 66   LYS A CB  1 
ATOM   498  C CG  . LYS A 1 64  ? 24.205  -21.233 75.020 1.00 57.49 ? 66   LYS A CG  1 
ATOM   499  C CD  . LYS A 1 64  ? 25.402  -20.922 74.143 1.00 57.95 ? 66   LYS A CD  1 
ATOM   500  C CE  . LYS A 1 64  ? 25.626  -21.975 73.078 1.00 57.50 ? 66   LYS A CE  1 
ATOM   501  N NZ  . LYS A 1 64  ? 26.889  -21.685 72.348 1.00 57.29 ? 66   LYS A NZ  1 
ATOM   502  N N   . ARG A 1 65  ? 19.360  -21.574 74.559 1.00 60.08 ? 67   ARG A N   1 
ATOM   503  C CA  . ARG A 1 65  ? 18.093  -21.434 73.842 1.00 60.29 ? 67   ARG A CA  1 
ATOM   504  C C   . ARG A 1 65  ? 17.263  -20.228 74.271 1.00 60.26 ? 67   ARG A C   1 
ATOM   505  O O   . ARG A 1 65  ? 16.847  -19.430 73.435 1.00 60.96 ? 67   ARG A O   1 
ATOM   506  C CB  . ARG A 1 65  ? 17.241  -22.687 74.031 1.00 61.43 ? 67   ARG A CB  1 
ATOM   507  C CG  . ARG A 1 65  ? 15.847  -22.566 73.431 1.00 64.59 ? 67   ARG A CG  1 
ATOM   508  C CD  . ARG A 1 65  ? 14.828  -23.378 74.223 1.00 66.40 ? 67   ARG A CD  1 
ATOM   509  N NE  . ARG A 1 65  ? 13.523  -23.481 73.565 1.00 68.31 ? 67   ARG A NE  1 
ATOM   510  C CZ  . ARG A 1 65  ? 12.772  -22.448 73.187 1.00 69.02 ? 67   ARG A CZ  1 
ATOM   511  N NH1 . ARG A 1 65  ? 13.189  -21.201 73.389 1.00 68.77 ? 67   ARG A NH1 1 
ATOM   512  N NH2 . ARG A 1 65  ? 11.590  -22.666 72.616 1.00 68.98 ? 67   ARG A NH2 1 
ATOM   513  N N   . ASN A 1 66  ? 16.995  -20.115 75.568 1.00 59.31 ? 68   ASN A N   1 
ATOM   514  C CA  . ASN A 1 66  ? 16.206  -19.005 76.082 1.00 58.54 ? 68   ASN A CA  1 
ATOM   515  C C   . ASN A 1 66  ? 17.065  -17.761 76.250 1.00 58.05 ? 68   ASN A C   1 
ATOM   516  O O   . ASN A 1 66  ? 16.650  -16.774 76.862 1.00 58.07 ? 68   ASN A O   1 
ATOM   517  C CB  . ASN A 1 66  ? 15.571  -19.385 77.414 1.00 59.91 ? 68   ASN A CB  1 
ATOM   518  C CG  . ASN A 1 66  ? 14.661  -20.583 77.291 1.00 61.02 ? 68   ASN A CG  1 
ATOM   519  O OD1 . ASN A 1 66  ? 13.758  -20.606 76.450 1.00 62.37 ? 68   ASN A OD1 1 
ATOM   520  N ND2 . ASN A 1 66  ? 14.891  -21.591 78.125 1.00 60.51 ? 68   ASN A ND2 1 
ATOM   521  N N   . LEU A 1 67  ? 18.269  -17.824 75.696 1.00 56.90 ? 69   LEU A N   1 
ATOM   522  C CA  . LEU A 1 67  ? 19.213  -16.717 75.739 1.00 55.34 ? 69   LEU A CA  1 
ATOM   523  C C   . LEU A 1 67  ? 18.670  -15.627 74.812 1.00 55.02 ? 69   LEU A C   1 
ATOM   524  O O   . LEU A 1 67  ? 18.188  -15.918 73.717 1.00 54.23 ? 69   LEU A O   1 
ATOM   525  C CB  . LEU A 1 67  ? 20.573  -17.208 75.244 1.00 54.49 ? 69   LEU A CB  1 
ATOM   526  C CG  . LEU A 1 67  ? 21.842  -16.681 75.900 1.00 56.04 ? 69   LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 67  ? 21.748  -16.847 77.416 1.00 55.62 ? 69   LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 67  ? 23.046  -17.441 75.345 1.00 55.06 ? 69   LEU A CD2 1 
ATOM   529  N N   . SER A 1 68  ? 18.735  -14.374 75.243 1.00 54.82 ? 70   SER A N   1 
ATOM   530  C CA  . SER A 1 68  ? 18.227  -13.283 74.419 1.00 53.52 ? 70   SER A CA  1 
ATOM   531  C C   . SER A 1 68  ? 19.333  -12.519 73.692 1.00 52.34 ? 70   SER A C   1 
ATOM   532  O O   . SER A 1 68  ? 19.054  -11.649 72.867 1.00 52.61 ? 70   SER A O   1 
ATOM   533  C CB  . SER A 1 68  ? 17.380  -12.322 75.268 1.00 54.24 ? 70   SER A CB  1 
ATOM   534  O OG  . SER A 1 68  ? 18.141  -11.725 76.303 1.00 54.64 ? 70   SER A OG  1 
ATOM   535  N N   . VAL A 1 69  ? 20.587  -12.845 73.986 1.00 50.72 ? 71   VAL A N   1 
ATOM   536  C CA  . VAL A 1 69  ? 21.701  -12.178 73.321 1.00 50.12 ? 71   VAL A CA  1 
ATOM   537  C C   . VAL A 1 69  ? 22.760  -13.206 72.905 1.00 51.07 ? 71   VAL A C   1 
ATOM   538  O O   . VAL A 1 69  ? 22.933  -14.232 73.567 1.00 50.80 ? 71   VAL A O   1 
ATOM   539  C CB  . VAL A 1 69  ? 22.343  -11.096 74.234 1.00 49.93 ? 71   VAL A CB  1 
ATOM   540  C CG1 . VAL A 1 69  ? 23.289  -10.206 73.416 1.00 48.74 ? 71   VAL A CG1 1 
ATOM   541  C CG2 . VAL A 1 69  ? 21.257  -10.244 74.890 1.00 49.22 ? 71   VAL A CG2 1 
ATOM   542  N N   . ILE A 1 70  ? 23.451  -12.936 71.797 1.00 52.15 ? 72   ILE A N   1 
ATOM   543  C CA  . ILE A 1 70  ? 24.476  -13.838 71.282 1.00 53.80 ? 72   ILE A CA  1 
ATOM   544  C C   . ILE A 1 70  ? 25.636  -13.089 70.640 1.00 56.17 ? 72   ILE A C   1 
ATOM   545  O O   . ILE A 1 70  ? 25.444  -12.272 69.741 1.00 56.80 ? 72   ILE A O   1 
ATOM   546  C CB  . ILE A 1 70  ? 23.898  -14.817 70.218 1.00 54.27 ? 72   ILE A CB  1 
ATOM   547  C CG1 . ILE A 1 70  ? 22.888  -15.773 70.862 1.00 54.30 ? 72   ILE A CG1 1 
ATOM   548  C CG2 . ILE A 1 70  ? 25.030  -15.581 69.544 1.00 52.64 ? 72   ILE A CG2 1 
ATOM   549  C CD1 . ILE A 1 70  ? 23.473  -16.666 71.947 1.00 54.88 ? 72   ILE A CD1 1 
ATOM   550  N N   . ASN A 1 71  ? 26.842  -13.390 71.106 1.00 58.59 ? 73   ASN A N   1 
ATOM   551  C CA  . ASN A 1 71  ? 28.057  -12.780 70.590 1.00 61.10 ? 73   ASN A CA  1 
ATOM   552  C C   . ASN A 1 71  ? 28.674  -13.785 69.642 1.00 62.30 ? 73   ASN A C   1 
ATOM   553  O O   . ASN A 1 71  ? 28.327  -14.961 69.672 1.00 63.18 ? 73   ASN A O   1 
ATOM   554  C CB  . ASN A 1 71  ? 29.036  -12.494 71.732 1.00 62.69 ? 73   ASN A CB  1 
ATOM   555  C CG  . ASN A 1 71  ? 28.540  -11.412 72.678 1.00 64.18 ? 73   ASN A CG  1 
ATOM   556  O OD1 . ASN A 1 71  ? 28.672  -10.217 72.399 1.00 65.62 ? 73   ASN A OD1 1 
ATOM   557  N ND2 . ASN A 1 71  ? 27.958  -11.827 73.800 1.00 63.97 ? 73   ASN A ND2 1 
ATOM   558  N N   . LEU A 1 72  ? 29.603  -13.328 68.817 1.00 64.00 ? 74   LEU A N   1 
ATOM   559  C CA  . LEU A 1 72  ? 30.259  -14.202 67.854 1.00 66.25 ? 74   LEU A CA  1 
ATOM   560  C C   . LEU A 1 72  ? 31.760  -13.928 67.904 1.00 68.01 ? 74   LEU A C   1 
ATOM   561  O O   . LEU A 1 72  ? 32.204  -13.069 68.669 1.00 68.60 ? 74   LEU A O   1 
ATOM   562  C CB  . LEU A 1 72  ? 29.736  -13.901 66.444 1.00 65.96 ? 74   LEU A CB  1 
ATOM   563  C CG  . LEU A 1 72  ? 28.225  -13.763 66.207 1.00 65.62 ? 74   LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 72  ? 27.998  -13.147 64.831 1.00 64.66 ? 74   LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 72  ? 27.526  -15.115 66.320 1.00 64.82 ? 74   LEU A CD2 1 
ATOM   566  N N   . ASP A 1 73  ? 32.540  -14.649 67.097 1.00 69.62 ? 75   ASP A N   1 
ATOM   567  C CA  . ASP A 1 73  ? 33.978  -14.415 67.066 1.00 71.09 ? 75   ASP A CA  1 
ATOM   568  C C   . ASP A 1 73  ? 34.164  -12.928 66.826 1.00 71.63 ? 75   ASP A C   1 
ATOM   569  O O   . ASP A 1 73  ? 33.597  -12.364 65.888 1.00 72.51 ? 75   ASP A O   1 
ATOM   570  C CB  . ASP A 1 73  ? 34.656  -15.187 65.930 1.00 72.46 ? 75   ASP A CB  1 
ATOM   571  C CG  . ASP A 1 73  ? 36.156  -14.887 65.835 1.00 72.78 ? 75   ASP A CG  1 
ATOM   572  O OD1 . ASP A 1 73  ? 36.878  -15.125 66.826 1.00 72.85 ? 75   ASP A OD1 1 
ATOM   573  O OD2 . ASP A 1 73  ? 36.615  -14.413 64.773 1.00 72.57 ? 75   ASP A OD2 1 
ATOM   574  N N   . PRO A 1 74  ? 34.964  -12.269 67.674 1.00 71.20 ? 76   PRO A N   1 
ATOM   575  C CA  . PRO A 1 74  ? 35.202  -10.832 67.529 1.00 70.09 ? 76   PRO A CA  1 
ATOM   576  C C   . PRO A 1 74  ? 35.929  -10.504 66.247 1.00 68.35 ? 76   PRO A C   1 
ATOM   577  O O   . PRO A 1 74  ? 36.013  -9.343  65.859 1.00 68.28 ? 76   PRO A O   1 
ATOM   578  C CB  . PRO A 1 74  ? 36.030  -10.496 68.763 1.00 70.84 ? 76   PRO A CB  1 
ATOM   579  C CG  . PRO A 1 74  ? 36.822  -11.753 68.972 1.00 71.58 ? 76   PRO A CG  1 
ATOM   580  C CD  . PRO A 1 74  ? 35.779  -12.831 68.765 1.00 71.46 ? 76   PRO A CD  1 
ATOM   581  N N   . GLU A 1 75  ? 36.451  -11.531 65.588 1.00 66.99 ? 77   GLU A N   1 
ATOM   582  C CA  . GLU A 1 75  ? 37.186  -11.322 64.350 1.00 66.34 ? 77   GLU A CA  1 
ATOM   583  C C   . GLU A 1 75  ? 36.250  -11.367 63.139 1.00 65.63 ? 77   GLU A C   1 
ATOM   584  O O   . GLU A 1 75  ? 36.695  -11.245 61.992 1.00 64.97 ? 77   GLU A O   1 
ATOM   585  C CB  . GLU A 1 75  ? 38.292  -12.371 64.203 1.00 66.53 ? 77   GLU A CB  1 
ATOM   586  C CG  . GLU A 1 75  ? 39.512  -11.873 63.436 1.00 66.58 ? 77   GLU A CG  1 
ATOM   587  C CD  . GLU A 1 75  ? 40.463  -11.077 64.313 1.00 66.64 ? 77   GLU A CD  1 
ATOM   588  O OE1 . GLU A 1 75  ? 41.351  -10.384 63.761 1.00 64.27 ? 77   GLU A OE1 1 
ATOM   589  O OE2 . GLU A 1 75  ? 40.320  -11.158 65.556 1.00 66.62 ? 77   GLU A OE2 1 
ATOM   590  N N   . ILE A 1 76  ? 34.955  -11.549 63.401 1.00 64.29 ? 78   ILE A N   1 
ATOM   591  C CA  . ILE A 1 76  ? 33.948  -11.575 62.338 1.00 63.10 ? 78   ILE A CA  1 
ATOM   592  C C   . ILE A 1 76  ? 33.465  -10.150 62.101 1.00 62.36 ? 78   ILE A C   1 
ATOM   593  O O   . ILE A 1 76  ? 32.733  -9.597  62.923 1.00 62.54 ? 78   ILE A O   1 
ATOM   594  C CB  . ILE A 1 76  ? 32.734  -12.457 62.717 1.00 62.28 ? 78   ILE A CB  1 
ATOM   595  C CG1 . ILE A 1 76  ? 33.073  -13.927 62.489 1.00 60.77 ? 78   ILE A CG1 1 
ATOM   596  C CG2 . ILE A 1 76  ? 31.513  -12.067 61.887 1.00 62.39 ? 78   ILE A CG2 1 
ATOM   597  C CD1 . ILE A 1 76  ? 33.400  -14.234 61.053 1.00 60.39 ? 78   ILE A CD1 1 
ATOM   598  N N   . ASN A 1 77  ? 33.885  -9.556  60.986 1.00 61.75 ? 79   ASN A N   1 
ATOM   599  C CA  . ASN A 1 77  ? 33.494  -8.187  60.659 1.00 61.19 ? 79   ASN A CA  1 
ATOM   600  C C   . ASN A 1 77  ? 31.976  -8.060  60.525 1.00 59.27 ? 79   ASN A C   1 
ATOM   601  O O   . ASN A 1 77  ? 31.307  -8.958  60.014 1.00 58.69 ? 79   ASN A O   1 
ATOM   602  C CB  . ASN A 1 77  ? 34.141  -7.749  59.356 1.00 63.15 ? 79   ASN A CB  1 
ATOM   603  C CG  . ASN A 1 77  ? 33.531  -8.433  58.172 1.00 65.11 ? 79   ASN A CG  1 
ATOM   604  O OD1 . ASN A 1 77  ? 33.418  -9.658  58.151 1.00 67.70 ? 79   ASN A OD1 1 
ATOM   605  N ND2 . ASN A 1 77  ? 33.122  -7.654  57.176 1.00 65.42 ? 79   ASN A ND2 1 
ATOM   606  N N   . PRO A 1 78  ? 31.419  -6.933  60.995 1.00 57.81 ? 80   PRO A N   1 
ATOM   607  C CA  . PRO A 1 78  ? 29.987  -6.617  60.963 1.00 55.69 ? 80   PRO A CA  1 
ATOM   608  C C   . PRO A 1 78  ? 29.361  -6.538  59.569 1.00 53.56 ? 80   PRO A C   1 
ATOM   609  O O   . PRO A 1 78  ? 28.225  -6.973  59.369 1.00 53.28 ? 80   PRO A O   1 
ATOM   610  C CB  . PRO A 1 78  ? 29.920  -5.281  61.693 1.00 56.51 ? 80   PRO A CB  1 
ATOM   611  C CG  . PRO A 1 78  ? 31.031  -5.399  62.687 1.00 57.71 ? 80   PRO A CG  1 
ATOM   612  C CD  . PRO A 1 78  ? 32.137  -5.950  61.825 1.00 57.52 ? 80   PRO A CD  1 
ATOM   613  N N   . GLU A 1 79  ? 30.103  -5.978  58.618 1.00 50.40 ? 81   GLU A N   1 
ATOM   614  C CA  . GLU A 1 79  ? 29.619  -5.824  57.254 1.00 48.29 ? 81   GLU A CA  1 
ATOM   615  C C   . GLU A 1 79  ? 29.251  -7.181  56.656 1.00 46.79 ? 81   GLU A C   1 
ATOM   616  O O   . GLU A 1 79  ? 28.096  -7.418  56.300 1.00 47.33 ? 81   GLU A O   1 
ATOM   617  C CB  . GLU A 1 79  ? 30.688  -5.152  56.392 1.00 47.75 ? 81   GLU A CB  1 
ATOM   618  C CG  . GLU A 1 79  ? 30.184  -4.604  55.060 1.00 48.74 ? 81   GLU A CG  1 
ATOM   619  C CD  . GLU A 1 79  ? 31.313  -4.347  54.068 1.00 50.53 ? 81   GLU A CD  1 
ATOM   620  O OE1 . GLU A 1 79  ? 32.462  -4.140  54.518 1.00 50.23 ? 81   GLU A OE1 1 
ATOM   621  O OE2 . GLU A 1 79  ? 31.056  -4.340  52.839 1.00 51.35 ? 81   GLU A OE2 1 
ATOM   622  N N   . GLY A 1 80  ? 30.242  -8.063  56.554 1.00 44.55 ? 82   GLY A N   1 
ATOM   623  C CA  . GLY A 1 80  ? 30.024  -9.385  56.001 1.00 40.23 ? 82   GLY A CA  1 
ATOM   624  C C   . GLY A 1 80  ? 28.831  -10.058 56.637 1.00 38.99 ? 82   GLY A C   1 
ATOM   625  O O   . GLY A 1 80  ? 28.056  -10.738 55.965 1.00 38.76 ? 82   GLY A O   1 
ATOM   626  N N   . PHE A 1 81  ? 28.677  -9.861  57.943 1.00 36.84 ? 83   PHE A N   1 
ATOM   627  C CA  . PHE A 1 81  ? 27.566  -10.448 58.662 1.00 33.87 ? 83   PHE A CA  1 
ATOM   628  C C   . PHE A 1 81  ? 26.225  -9.809  58.325 1.00 34.14 ? 83   PHE A C   1 
ATOM   629  O O   . PHE A 1 81  ? 25.189  -10.485 58.289 1.00 33.45 ? 83   PHE A O   1 
ATOM   630  C CB  . PHE A 1 81  ? 27.755  -10.319 60.158 1.00 30.63 ? 83   PHE A CB  1 
ATOM   631  C CG  . PHE A 1 81  ? 26.630  -10.917 60.931 1.00 27.25 ? 83   PHE A CG  1 
ATOM   632  C CD1 . PHE A 1 81  ? 26.502  -12.311 61.020 1.00 24.93 ? 83   PHE A CD1 1 
ATOM   633  C CD2 . PHE A 1 81  ? 25.629  -10.100 61.475 1.00 24.65 ? 83   PHE A CD2 1 
ATOM   634  C CE1 . PHE A 1 81  ? 25.383  -12.890 61.634 1.00 20.87 ? 83   PHE A CE1 1 
ATOM   635  C CE2 . PHE A 1 81  ? 24.508  -10.661 62.090 1.00 20.98 ? 83   PHE A CE2 1 
ATOM   636  C CZ  . PHE A 1 81  ? 24.382  -12.059 62.168 1.00 23.67 ? 83   PHE A CZ  1 
ATOM   637  N N   . ASN A 1 82  ? 26.245  -8.496  58.125 1.00 33.02 ? 84   ASN A N   1 
ATOM   638  C CA  . ASN A 1 82  ? 25.037  -7.762  57.818 1.00 30.89 ? 84   ASN A CA  1 
ATOM   639  C C   . ASN A 1 82  ? 24.529  -8.191  56.441 1.00 28.80 ? 84   ASN A C   1 
ATOM   640  O O   . ASN A 1 82  ? 23.329  -8.310  56.209 1.00 28.27 ? 84   ASN A O   1 
ATOM   641  C CB  . ASN A 1 82  ? 25.324  -6.265  57.852 1.00 29.88 ? 84   ASN A CB  1 
ATOM   642  C CG  . ASN A 1 82  ? 24.087  -5.445  57.625 1.00 30.29 ? 84   ASN A CG  1 
ATOM   643  O OD1 . ASN A 1 82  ? 23.116  -5.568  58.365 1.00 29.49 ? 84   ASN A OD1 1 
ATOM   644  N ND2 . ASN A 1 82  ? 24.103  -4.608  56.588 1.00 30.69 ? 84   ASN A ND2 1 
ATOM   645  N N   . ILE A 1 83  ? 25.460  -8.439  55.537 1.00 27.91 ? 85   ILE A N   1 
ATOM   646  C CA  . ILE A 1 83  ? 25.112  -8.873  54.193 1.00 27.39 ? 85   ILE A CA  1 
ATOM   647  C C   . ILE A 1 83  ? 24.424  -10.234 54.247 1.00 27.73 ? 85   ILE A C   1 
ATOM   648  O O   . ILE A 1 83  ? 23.446  -10.477 53.537 1.00 26.46 ? 85   ILE A O   1 
ATOM   649  C CB  . ILE A 1 83  ? 26.364  -8.941  53.331 1.00 26.42 ? 85   ILE A CB  1 
ATOM   650  C CG1 . ILE A 1 83  ? 26.874  -7.510  53.102 1.00 26.59 ? 85   ILE A CG1 1 
ATOM   651  C CG2 . ILE A 1 83  ? 26.080  -9.657  52.009 1.00 24.69 ? 85   ILE A CG2 1 
ATOM   652  C CD1 . ILE A 1 83  ? 28.354  -7.418  52.760 1.00 26.42 ? 85   ILE A CD1 1 
ATOM   653  N N   . LEU A 1 84  ? 24.923  -11.113 55.109 1.00 26.89 ? 86   LEU A N   1 
ATOM   654  C CA  . LEU A 1 84  ? 24.334  -12.436 55.236 1.00 26.18 ? 86   LEU A CA  1 
ATOM   655  C C   . LEU A 1 84  ? 22.951  -12.386 55.877 1.00 25.33 ? 86   LEU A C   1 
ATOM   656  O O   . LEU A 1 84  ? 22.047  -13.107 55.467 1.00 23.47 ? 86   LEU A O   1 
ATOM   657  C CB  . LEU A 1 84  ? 25.279  -13.357 56.020 1.00 25.97 ? 86   LEU A CB  1 
ATOM   658  C CG  . LEU A 1 84  ? 26.436  -13.826 55.131 1.00 25.30 ? 86   LEU A CG  1 
ATOM   659  C CD1 . LEU A 1 84  ? 27.632  -14.275 55.955 1.00 27.17 ? 86   LEU A CD1 1 
ATOM   660  C CD2 . LEU A 1 84  ? 25.941  -14.952 54.242 1.00 25.78 ? 86   LEU A CD2 1 
ATOM   661  N N   . LEU A 1 85  ? 22.788  -11.522 56.872 1.00 24.10 ? 87   LEU A N   1 
ATOM   662  C CA  . LEU A 1 85  ? 21.514  -11.388 57.557 1.00 22.34 ? 87   LEU A CA  1 
ATOM   663  C C   . LEU A 1 85  ? 20.458  -10.856 56.583 1.00 21.64 ? 87   LEU A C   1 
ATOM   664  O O   . LEU A 1 85  ? 19.297  -11.269 56.625 1.00 20.73 ? 87   LEU A O   1 
ATOM   665  C CB  . LEU A 1 85  ? 21.647  -10.426 58.750 1.00 24.12 ? 87   LEU A CB  1 
ATOM   666  C CG  . LEU A 1 85  ? 20.346  -10.106 59.491 1.00 24.32 ? 87   LEU A CG  1 
ATOM   667  C CD1 . LEU A 1 85  ? 19.817  -11.377 60.141 1.00 24.70 ? 87   LEU A CD1 1 
ATOM   668  C CD2 . LEU A 1 85  ? 20.580  -9.006  60.526 1.00 26.30 ? 87   LEU A CD2 1 
ATOM   669  N N   . ASP A 1 86  ? 20.861  -9.920  55.731 1.00 19.45 ? 88   ASP A N   1 
ATOM   670  C CA  . ASP A 1 86  ? 19.946  -9.354  54.756 1.00 19.58 ? 88   ASP A CA  1 
ATOM   671  C C   . ASP A 1 86  ? 19.543  -10.448 53.808 1.00 18.33 ? 88   ASP A C   1 
ATOM   672  O O   . ASP A 1 86  ? 18.372  -10.617 53.530 1.00 19.58 ? 88   ASP A O   1 
ATOM   673  C CB  . ASP A 1 86  ? 20.607  -8.237  53.970 1.00 23.37 ? 88   ASP A CB  1 
ATOM   674  C CG  . ASP A 1 86  ? 20.317  -6.881  54.538 1.00 29.31 ? 88   ASP A CG  1 
ATOM   675  O OD1 . ASP A 1 86  ? 21.059  -5.943  54.175 1.00 34.99 ? 88   ASP A OD1 1 
ATOM   676  O OD2 . ASP A 1 86  ? 19.358  -6.742  55.333 1.00 31.35 ? 88   ASP A OD2 1 
ATOM   677  N N   . PHE A 1 87  ? 20.536  -11.179 53.307 1.00 18.13 ? 89   PHE A N   1 
ATOM   678  C CA  . PHE A 1 87  ? 20.299  -12.304 52.409 1.00 18.15 ? 89   PHE A CA  1 
ATOM   679  C C   . PHE A 1 87  ? 19.240  -13.237 52.974 1.00 17.70 ? 89   PHE A C   1 
ATOM   680  O O   . PHE A 1 87  ? 18.332  -13.661 52.251 1.00 16.25 ? 89   PHE A O   1 
ATOM   681  C CB  . PHE A 1 87  ? 21.563  -13.114 52.220 1.00 17.34 ? 89   PHE A CB  1 
ATOM   682  C CG  . PHE A 1 87  ? 21.306  -14.531 51.859 1.00 16.17 ? 89   PHE A CG  1 
ATOM   683  C CD1 . PHE A 1 87  ? 20.931  -14.877 50.565 1.00 15.37 ? 89   PHE A CD1 1 
ATOM   684  C CD2 . PHE A 1 87  ? 21.396  -15.537 52.825 1.00 16.81 ? 89   PHE A CD2 1 
ATOM   685  C CE1 . PHE A 1 87  ? 20.646  -16.217 50.240 1.00 15.14 ? 89   PHE A CE1 1 
ATOM   686  C CE2 . PHE A 1 87  ? 21.111  -16.881 52.498 1.00 14.02 ? 89   PHE A CE2 1 
ATOM   687  C CZ  . PHE A 1 87  ? 20.738  -17.210 51.203 1.00 13.02 ? 89   PHE A CZ  1 
ATOM   688  N N   . MET A 1 88  ? 19.390  -13.566 54.260 1.00 17.19 ? 90   MET A N   1 
ATOM   689  C CA  . MET A 1 88  ? 18.469  -14.451 54.972 1.00 17.63 ? 90   MET A CA  1 
ATOM   690  C C   . MET A 1 88  ? 17.031  -13.981 54.878 1.00 16.86 ? 90   MET A C   1 
ATOM   691  O O   . MET A 1 88  ? 16.110  -14.779 54.682 1.00 15.24 ? 90   MET A O   1 
ATOM   692  C CB  . MET A 1 88  ? 18.834  -14.519 56.448 1.00 19.57 ? 90   MET A CB  1 
ATOM   693  C CG  . MET A 1 88  ? 20.030  -15.361 56.778 1.00 21.06 ? 90   MET A CG  1 
ATOM   694  S SD  . MET A 1 88  ? 20.167  -15.521 58.590 1.00 24.15 ? 90   MET A SD  1 
ATOM   695  C CE  . MET A 1 88  ? 21.986  -15.653 58.738 1.00 24.87 ? 90   MET A CE  1 
ATOM   696  N N   . TYR A 1 89  ? 16.865  -12.672 55.016 1.00 15.20 ? 91   TYR A N   1 
ATOM   697  C CA  . TYR A 1 89  ? 15.556  -12.045 54.982 1.00 16.57 ? 91   TYR A CA  1 
ATOM   698  C C   . TYR A 1 89  ? 15.105  -11.545 53.597 1.00 15.96 ? 91   TYR A C   1 
ATOM   699  O O   . TYR A 1 89  ? 13.962  -11.122 53.467 1.00 16.28 ? 91   TYR A O   1 
ATOM   700  C CB  . TYR A 1 89  ? 15.512  -10.867 55.990 1.00 15.09 ? 91   TYR A CB  1 
ATOM   701  C CG  . TYR A 1 89  ? 15.230  -11.250 57.425 1.00 17.39 ? 91   TYR A CG  1 
ATOM   702  C CD1 . TYR A 1 89  ? 16.260  -11.626 58.292 1.00 19.75 ? 91   TYR A CD1 1 
ATOM   703  C CD2 . TYR A 1 89  ? 13.926  -11.237 57.927 1.00 20.63 ? 91   TYR A CD2 1 
ATOM   704  C CE1 . TYR A 1 89  ? 15.997  -11.976 59.632 1.00 22.05 ? 91   TYR A CE1 1 
ATOM   705  C CE2 . TYR A 1 89  ? 13.652  -11.588 59.262 1.00 21.80 ? 91   TYR A CE2 1 
ATOM   706  C CZ  . TYR A 1 89  ? 14.698  -11.955 60.115 1.00 23.40 ? 91   TYR A CZ  1 
ATOM   707  O OH  . TYR A 1 89  ? 14.442  -12.300 61.442 1.00 22.57 ? 91   TYR A OH  1 
ATOM   708  N N   . THR A 1 90  ? 15.965  -11.611 52.572 1.00 14.88 ? 92   THR A N   1 
ATOM   709  C CA  . THR A 1 90  ? 15.579  -11.131 51.229 1.00 17.08 ? 92   THR A CA  1 
ATOM   710  C C   . THR A 1 90  ? 15.900  -12.023 49.998 1.00 17.34 ? 92   THR A C   1 
ATOM   711  O O   . THR A 1 90  ? 15.466  -11.697 48.877 1.00 16.75 ? 92   THR A O   1 
ATOM   712  C CB  . THR A 1 90  ? 16.243  -9.751  50.889 1.00 16.60 ? 92   THR A CB  1 
ATOM   713  O OG1 . THR A 1 90  ? 17.631  -9.958  50.626 1.00 16.49 ? 92   THR A OG1 1 
ATOM   714  C CG2 . THR A 1 90  ? 16.105  -8.732  52.037 1.00 20.43 ? 92   THR A CG2 1 
ATOM   715  N N   . SER A 1 91  ? 16.664  -13.100 50.191 1.00 15.82 ? 93   SER A N   1 
ATOM   716  C CA  . SER A 1 91  ? 17.106  -13.983 49.090 1.00 19.18 ? 93   SER A CA  1 
ATOM   717  C C   . SER A 1 91  ? 18.176  -13.281 48.263 1.00 17.43 ? 93   SER A C   1 
ATOM   718  O O   . SER A 1 91  ? 18.646  -13.812 47.250 1.00 15.81 ? 93   SER A O   1 
ATOM   719  C CB  . SER A 1 91  ? 15.965  -14.353 48.112 1.00 18.88 ? 93   SER A CB  1 
ATOM   720  O OG  . SER A 1 91  ? 14.962  -15.082 48.775 1.00 25.07 ? 93   SER A OG  1 
ATOM   721  N N   . ARG A 1 92  ? 18.532  -12.073 48.667 1.00 19.33 ? 94   ARG A N   1 
ATOM   722  C CA  . ARG A 1 92  ? 19.525  -11.327 47.908 1.00 23.12 ? 94   ARG A CA  1 
ATOM   723  C C   . ARG A 1 92  ? 20.843  -11.140 48.663 1.00 22.76 ? 94   ARG A C   1 
ATOM   724  O O   . ARG A 1 92  ? 20.860  -10.741 49.832 1.00 21.09 ? 94   ARG A O   1 
ATOM   725  C CB  . ARG A 1 92  ? 18.938  -9.978  47.475 1.00 24.35 ? 94   ARG A CB  1 
ATOM   726  C CG  . ARG A 1 92  ? 17.814  -10.146 46.484 1.00 28.10 ? 94   ARG A CG  1 
ATOM   727  C CD  . ARG A 1 92  ? 17.102  -8.851  46.159 1.00 33.54 ? 94   ARG A CD  1 
ATOM   728  N NE  . ARG A 1 92  ? 15.985  -9.125  45.253 1.00 39.28 ? 94   ARG A NE  1 
ATOM   729  C CZ  . ARG A 1 92  ? 15.395  -8.225  44.467 1.00 40.95 ? 94   ARG A CZ  1 
ATOM   730  N NH1 . ARG A 1 92  ? 15.805  -6.957  44.455 1.00 41.24 ? 94   ARG A NH1 1 
ATOM   731  N NH2 . ARG A 1 92  ? 14.384  -8.602  43.687 1.00 42.26 ? 94   ARG A NH2 1 
ATOM   732  N N   . LEU A 1 93  ? 21.940  -11.460 47.984 1.00 22.56 ? 95   LEU A N   1 
ATOM   733  C CA  . LEU A 1 93  ? 23.271  -11.345 48.573 1.00 23.52 ? 95   LEU A CA  1 
ATOM   734  C C   . LEU A 1 93  ? 24.019  -10.224 47.860 1.00 24.21 ? 95   LEU A C   1 
ATOM   735  O O   . LEU A 1 93  ? 24.508  -10.392 46.742 1.00 22.28 ? 95   LEU A O   1 
ATOM   736  C CB  . LEU A 1 93  ? 24.024  -12.667 48.414 1.00 25.15 ? 95   LEU A CB  1 
ATOM   737  C CG  . LEU A 1 93  ? 25.316  -12.903 49.209 1.00 26.62 ? 95   LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 93  ? 25.000  -13.215 50.679 1.00 24.81 ? 95   LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 93  ? 26.070  -14.076 48.570 1.00 25.33 ? 95   LEU A CD2 1 
ATOM   740  N N   . ASN A 1 94  ? 24.088  -9.079  48.523 1.00 25.98 ? 96   ASN A N   1 
ATOM   741  C CA  . ASN A 1 94  ? 24.755  -7.912  47.979 1.00 29.96 ? 96   ASN A CA  1 
ATOM   742  C C   . ASN A 1 94  ? 26.244  -7.965  48.214 1.00 31.87 ? 96   ASN A C   1 
ATOM   743  O O   . ASN A 1 94  ? 26.702  -8.034  49.354 1.00 33.37 ? 96   ASN A O   1 
ATOM   744  C CB  . ASN A 1 94  ? 24.158  -6.653  48.588 1.00 27.83 ? 96   ASN A CB  1 
ATOM   745  C CG  . ASN A 1 94  ? 22.706  -6.506  48.233 1.00 29.03 ? 96   ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 94  ? 22.359  -6.526  47.059 1.00 30.88 ? 96   ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 94  ? 21.847  -6.382  49.231 1.00 27.95 ? 96   ASN A ND2 1 
ATOM   748  N N   . LEU A 1 95  ? 26.994  -7.924  47.121 1.00 32.51 ? 97   LEU A N   1 
ATOM   749  C CA  . LEU A 1 95  ? 28.437  -8.004  47.202 1.00 34.41 ? 97   LEU A CA  1 
ATOM   750  C C   . LEU A 1 95  ? 29.165  -6.852  46.533 1.00 37.79 ? 97   LEU A C   1 
ATOM   751  O O   . LEU A 1 95  ? 28.588  -6.036  45.794 1.00 37.51 ? 97   LEU A O   1 
ATOM   752  C CB  . LEU A 1 95  ? 28.915  -9.303  46.556 1.00 32.32 ? 97   LEU A CB  1 
ATOM   753  C CG  . LEU A 1 95  ? 28.381  -10.637 47.089 1.00 30.97 ? 97   LEU A CG  1 
ATOM   754  C CD1 . LEU A 1 95  ? 28.704  -11.740 46.094 1.00 28.34 ? 97   LEU A CD1 1 
ATOM   755  C CD2 . LEU A 1 95  ? 28.965  -10.931 48.466 1.00 29.23 ? 97   LEU A CD2 1 
ATOM   756  N N   . ARG A 1 96  ? 30.457  -6.824  46.831 1.00 40.55 ? 98   ARG A N   1 
ATOM   757  C CA  . ARG A 1 96  ? 31.421  -5.883  46.299 1.00 43.64 ? 98   ARG A CA  1 
ATOM   758  C C   . ARG A 1 96  ? 32.627  -6.776  46.152 1.00 44.57 ? 98   ARG A C   1 
ATOM   759  O O   . ARG A 1 96  ? 32.793  -7.719  46.924 1.00 42.83 ? 98   ARG A O   1 
ATOM   760  C CB  . ARG A 1 96  ? 31.756  -4.780  47.293 1.00 44.36 ? 98   ARG A CB  1 
ATOM   761  C CG  . ARG A 1 96  ? 30.693  -3.764  47.471 1.00 46.80 ? 98   ARG A CG  1 
ATOM   762  C CD  . ARG A 1 96  ? 31.092  -2.820  48.564 1.00 50.86 ? 98   ARG A CD  1 
ATOM   763  N NE  . ARG A 1 96  ? 29.965  -2.011  48.991 1.00 54.17 ? 98   ARG A NE  1 
ATOM   764  C CZ  . ARG A 1 96  ? 29.905  -1.389  50.162 1.00 58.15 ? 98   ARG A CZ  1 
ATOM   765  N NH1 . ARG A 1 96  ? 30.916  -1.487  51.022 1.00 58.90 ? 98   ARG A NH1 1 
ATOM   766  N NH2 . ARG A 1 96  ? 28.828  -0.675  50.478 1.00 60.93 ? 98   ARG A NH2 1 
ATOM   767  N N   . GLU A 1 97  ? 33.451  -6.494  45.155 1.00 47.25 ? 99   GLU A N   1 
ATOM   768  C CA  . GLU A 1 97  ? 34.658  -7.280  44.926 1.00 50.52 ? 99   GLU A CA  1 
ATOM   769  C C   . GLU A 1 97  ? 35.495  -7.247  46.203 1.00 49.04 ? 99   GLU A C   1 
ATOM   770  O O   . GLU A 1 97  ? 36.184  -8.216  46.542 1.00 50.27 ? 99   GLU A O   1 
ATOM   771  C CB  . GLU A 1 97  ? 35.456  -6.659  43.786 1.00 54.75 ? 99   GLU A CB  1 
ATOM   772  C CG  . GLU A 1 97  ? 34.582  -6.140  42.653 1.00 59.66 ? 99   GLU A CG  1 
ATOM   773  C CD  . GLU A 1 97  ? 35.339  -5.209  41.732 1.00 62.85 ? 99   GLU A CD  1 
ATOM   774  O OE1 . GLU A 1 97  ? 35.708  -4.100  42.191 1.00 64.76 ? 99   GLU A OE1 1 
ATOM   775  O OE2 . GLU A 1 97  ? 35.571  -5.589  40.560 1.00 63.08 ? 99   GLU A OE2 1 
ATOM   776  N N   . GLY A 1 98  ? 35.407  -6.123  46.909 1.00 47.11 ? 100  GLY A N   1 
ATOM   777  C CA  . GLY A 1 98  ? 36.158  -5.938  48.134 1.00 44.95 ? 100  GLY A CA  1 
ATOM   778  C C   . GLY A 1 98  ? 35.687  -6.652  49.384 1.00 43.06 ? 100  GLY A C   1 
ATOM   779  O O   . GLY A 1 98  ? 36.441  -6.715  50.357 1.00 44.04 ? 100  GLY A O   1 
ATOM   780  N N   . ASN A 1 99  ? 34.467  -7.192  49.391 1.00 39.77 ? 101  ASN A N   1 
ATOM   781  C CA  . ASN A 1 99  ? 33.987  -7.871  50.597 1.00 35.79 ? 101  ASN A CA  1 
ATOM   782  C C   . ASN A 1 99  ? 33.523  -9.310  50.395 1.00 34.29 ? 101  ASN A C   1 
ATOM   783  O O   . ASN A 1 99  ? 33.087  -9.966  51.340 1.00 32.72 ? 101  ASN A O   1 
ATOM   784  C CB  . ASN A 1 99  ? 32.853  -7.062  51.241 1.00 35.44 ? 101  ASN A CB  1 
ATOM   785  C CG  . ASN A 1 99  ? 31.621  -6.907  50.325 1.00 33.14 ? 101  ASN A CG  1 
ATOM   786  O OD1 . ASN A 1 99  ? 31.209  -7.843  49.644 1.00 30.89 ? 101  ASN A OD1 1 
ATOM   787  N ND2 . ASN A 1 99  ? 31.027  -5.727  50.336 1.00 32.89 ? 101  ASN A ND2 1 
ATOM   788  N N   . ILE A 1 100 ? 33.624  -9.806  49.170 1.00 33.76 ? 102  ILE A N   1 
ATOM   789  C CA  . ILE A 1 100 ? 33.165  -11.148 48.899 1.00 32.82 ? 102  ILE A CA  1 
ATOM   790  C C   . ILE A 1 100 ? 33.884  -12.196 49.727 1.00 34.13 ? 102  ILE A C   1 
ATOM   791  O O   . ILE A 1 100 ? 33.258  -13.156 50.181 1.00 34.02 ? 102  ILE A O   1 
ATOM   792  C CB  . ILE A 1 100 ? 33.281  -11.481 47.406 1.00 32.60 ? 102  ILE A CB  1 
ATOM   793  C CG1 . ILE A 1 100 ? 32.941  -12.964 47.186 1.00 30.53 ? 102  ILE A CG1 1 
ATOM   794  C CG2 . ILE A 1 100 ? 34.666  -11.080 46.888 1.00 34.29 ? 102  ILE A CG2 1 
ATOM   795  C CD1 . ILE A 1 100 ? 32.774  -13.346 45.737 1.00 28.84 ? 102  ILE A CD1 1 
ATOM   796  N N   . MET A 1 101 ? 35.191  -12.017 49.932 1.00 32.82 ? 103  MET A N   1 
ATOM   797  C CA  . MET A 1 101 ? 35.962  -12.968 50.721 1.00 31.47 ? 103  MET A CA  1 
ATOM   798  C C   . MET A 1 101 ? 35.512  -12.952 52.178 1.00 31.09 ? 103  MET A C   1 
ATOM   799  O O   . MET A 1 101 ? 35.346  -14.007 52.806 1.00 31.17 ? 103  MET A O   1 
ATOM   800  C CB  . MET A 1 101 ? 37.461  -12.661 50.611 1.00 32.87 ? 103  MET A CB  1 
ATOM   801  C CG  . MET A 1 101 ? 38.038  -12.904 49.212 1.00 31.31 ? 103  MET A CG  1 
ATOM   802  S SD  . MET A 1 101 ? 37.626  -14.547 48.500 1.00 37.93 ? 103  MET A SD  1 
ATOM   803  C CE  . MET A 1 101 ? 37.808  -14.239 46.813 1.00 31.20 ? 103  MET A CE  1 
ATOM   804  N N   . ALA A 1 102 ? 35.309  -11.757 52.719 1.00 30.00 ? 104  ALA A N   1 
ATOM   805  C CA  . ALA A 1 102 ? 34.838  -11.649 54.090 1.00 30.45 ? 104  ALA A CA  1 
ATOM   806  C C   . ALA A 1 102 ? 33.433  -12.259 54.199 1.00 31.42 ? 104  ALA A C   1 
ATOM   807  O O   . ALA A 1 102 ? 33.056  -12.829 55.240 1.00 29.89 ? 104  ALA A O   1 
ATOM   808  C CB  . ALA A 1 102 ? 34.796  -10.185 54.519 1.00 30.51 ? 104  ALA A CB  1 
ATOM   809  N N   . VAL A 1 103 ? 32.655  -12.131 53.124 1.00 29.36 ? 105  VAL A N   1 
ATOM   810  C CA  . VAL A 1 103 ? 31.297  -12.663 53.129 1.00 28.54 ? 105  VAL A CA  1 
ATOM   811  C C   . VAL A 1 103 ? 31.354  -14.186 53.098 1.00 27.50 ? 105  VAL A C   1 
ATOM   812  O O   . VAL A 1 103 ? 30.682  -14.865 53.868 1.00 23.00 ? 105  VAL A O   1 
ATOM   813  C CB  . VAL A 1 103 ? 30.479  -12.109 51.910 1.00 28.16 ? 105  VAL A CB  1 
ATOM   814  C CG1 . VAL A 1 103 ? 29.172  -12.870 51.735 1.00 27.20 ? 105  VAL A CG1 1 
ATOM   815  C CG2 . VAL A 1 103 ? 30.171  -10.631 52.135 1.00 29.13 ? 105  VAL A CG2 1 
ATOM   816  N N   . MET A 1 104 ? 32.192  -14.707 52.213 1.00 29.65 ? 106  MET A N   1 
ATOM   817  C CA  . MET A 1 104 ? 32.356  -16.131 52.060 1.00 32.57 ? 106  MET A CA  1 
ATOM   818  C C   . MET A 1 104 ? 32.889  -16.732 53.349 1.00 34.27 ? 106  MET A C   1 
ATOM   819  O O   . MET A 1 104 ? 32.466  -17.823 53.763 1.00 35.60 ? 106  MET A O   1 
ATOM   820  C CB  . MET A 1 104 ? 33.311  -16.397 50.901 1.00 36.85 ? 106  MET A CB  1 
ATOM   821  C CG  . MET A 1 104 ? 33.601  -17.861 50.617 1.00 41.79 ? 106  MET A CG  1 
ATOM   822  S SD  . MET A 1 104 ? 34.697  -18.638 51.854 1.00 51.20 ? 106  MET A SD  1 
ATOM   823  C CE  . MET A 1 104 ? 36.338  -18.121 51.249 1.00 46.49 ? 106  MET A CE  1 
ATOM   824  N N   . ALA A 1 105 ? 33.817  -16.022 53.986 1.00 34.48 ? 107  ALA A N   1 
ATOM   825  C CA  . ALA A 1 105 ? 34.401  -16.497 55.236 1.00 34.00 ? 107  ALA A CA  1 
ATOM   826  C C   . ALA A 1 105 ? 33.338  -16.510 56.317 1.00 33.15 ? 107  ALA A C   1 
ATOM   827  O O   . ALA A 1 105 ? 33.232  -17.480 57.069 1.00 32.10 ? 107  ALA A O   1 
ATOM   828  C CB  . ALA A 1 105 ? 35.565  -15.600 55.659 1.00 32.96 ? 107  ALA A CB  1 
ATOM   829  N N   . THR A 1 106 ? 32.546  -15.437 56.388 1.00 32.82 ? 108  THR A N   1 
ATOM   830  C CA  . THR A 1 106 ? 31.480  -15.326 57.394 1.00 31.66 ? 108  THR A CA  1 
ATOM   831  C C   . THR A 1 106 ? 30.392  -16.403 57.254 1.00 32.29 ? 108  THR A C   1 
ATOM   832  O O   . THR A 1 106 ? 29.894  -16.919 58.262 1.00 32.17 ? 108  THR A O   1 
ATOM   833  C CB  . THR A 1 106 ? 30.765  -13.950 57.331 1.00 32.32 ? 108  THR A CB  1 
ATOM   834  O OG1 . THR A 1 106 ? 31.726  -12.887 57.373 1.00 32.32 ? 108  THR A OG1 1 
ATOM   835  C CG2 . THR A 1 106 ? 29.795  -13.799 58.503 1.00 29.79 ? 108  THR A CG2 1 
ATOM   836  N N   . ALA A 1 107 ? 30.012  -16.720 56.015 1.00 31.71 ? 109  ALA A N   1 
ATOM   837  C CA  . ALA A 1 107 ? 28.972  -17.719 55.766 1.00 32.43 ? 109  ALA A CA  1 
ATOM   838  C C   . ALA A 1 107 ? 29.457  -19.087 56.227 1.00 33.91 ? 109  ALA A C   1 
ATOM   839  O O   . ALA A 1 107 ? 28.706  -19.862 56.830 1.00 33.76 ? 109  ALA A O   1 
ATOM   840  C CB  . ALA A 1 107 ? 28.610  -17.763 54.270 1.00 30.94 ? 109  ALA A CB  1 
ATOM   841  N N   . MET A 1 108 ? 30.718  -19.378 55.932 1.00 35.57 ? 110  MET A N   1 
ATOM   842  C CA  . MET A 1 108 ? 31.323  -20.643 56.322 1.00 37.04 ? 110  MET A CA  1 
ATOM   843  C C   . MET A 1 108 ? 31.268  -20.774 57.843 1.00 36.32 ? 110  MET A C   1 
ATOM   844  O O   . MET A 1 108 ? 30.985  -21.849 58.380 1.00 36.31 ? 110  MET A O   1 
ATOM   845  C CB  . MET A 1 108 ? 32.765  -20.689 55.817 1.00 40.96 ? 110  MET A CB  1 
ATOM   846  C CG  . MET A 1 108 ? 33.509  -21.951 56.155 1.00 44.23 ? 110  MET A CG  1 
ATOM   847  S SD  . MET A 1 108 ? 35.103  -21.914 55.341 1.00 51.25 ? 110  MET A SD  1 
ATOM   848  C CE  . MET A 1 108 ? 34.707  -22.865 53.825 1.00 48.23 ? 110  MET A CE  1 
ATOM   849  N N   . TYR A 1 109 ? 31.526  -19.661 58.522 1.00 35.64 ? 111  TYR A N   1 
ATOM   850  C CA  . TYR A 1 109 ? 31.472  -19.578 59.978 1.00 36.34 ? 111  TYR A CA  1 
ATOM   851  C C   . TYR A 1 109 ? 30.039  -19.837 60.463 1.00 34.72 ? 111  TYR A C   1 
ATOM   852  O O   . TYR A 1 109 ? 29.813  -20.531 61.458 1.00 31.95 ? 111  TYR A O   1 
ATOM   853  C CB  . TYR A 1 109 ? 31.906  -18.176 60.414 1.00 40.75 ? 111  TYR A CB  1 
ATOM   854  C CG  . TYR A 1 109 ? 31.734  -17.889 61.889 1.00 46.64 ? 111  TYR A CG  1 
ATOM   855  C CD1 . TYR A 1 109 ? 32.632  -18.399 62.831 1.00 50.49 ? 111  TYR A CD1 1 
ATOM   856  C CD2 . TYR A 1 109 ? 30.678  -17.095 62.346 1.00 49.02 ? 111  TYR A CD2 1 
ATOM   857  C CE1 . TYR A 1 109 ? 32.484  -18.119 64.197 1.00 52.85 ? 111  TYR A CE1 1 
ATOM   858  C CE2 . TYR A 1 109 ? 30.517  -16.813 63.704 1.00 51.76 ? 111  TYR A CE2 1 
ATOM   859  C CZ  . TYR A 1 109 ? 31.428  -17.330 64.622 1.00 52.70 ? 111  TYR A CZ  1 
ATOM   860  O OH  . TYR A 1 109 ? 31.284  -17.058 65.957 1.00 54.93 ? 111  TYR A OH  1 
ATOM   861  N N   . LEU A 1 110 ? 29.069  -19.263 59.752 1.00 33.49 ? 112  LEU A N   1 
ATOM   862  C CA  . LEU A 1 110 ? 27.663  -19.427 60.109 1.00 31.15 ? 112  LEU A CA  1 
ATOM   863  C C   . LEU A 1 110 ? 27.112  -20.759 59.640 1.00 28.56 ? 112  LEU A C   1 
ATOM   864  O O   . LEU A 1 110 ? 25.945  -21.046 59.822 1.00 26.89 ? 112  LEU A O   1 
ATOM   865  C CB  . LEU A 1 110 ? 26.835  -18.293 59.503 1.00 30.88 ? 112  LEU A CB  1 
ATOM   866  C CG  . LEU A 1 110 ? 27.219  -16.910 60.015 1.00 29.58 ? 112  LEU A CG  1 
ATOM   867  C CD1 . LEU A 1 110 ? 26.498  -15.860 59.214 1.00 30.57 ? 112  LEU A CD1 1 
ATOM   868  C CD2 . LEU A 1 110 ? 26.864  -16.794 61.486 1.00 29.42 ? 112  LEU A CD2 1 
ATOM   869  N N   . GLN A 1 111 ? 27.962  -21.573 59.038 1.00 29.15 ? 113  GLN A N   1 
ATOM   870  C CA  . GLN A 1 111 ? 27.542  -22.871 58.533 1.00 31.37 ? 113  GLN A CA  1 
ATOM   871  C C   . GLN A 1 111 ? 26.465  -22.754 57.443 1.00 31.55 ? 113  GLN A C   1 
ATOM   872  O O   . GLN A 1 111 ? 25.427  -23.410 57.492 1.00 34.59 ? 113  GLN A O   1 
ATOM   873  C CB  . GLN A 1 111 ? 27.037  -23.743 59.678 1.00 32.26 ? 113  GLN A CB  1 
ATOM   874  C CG  . GLN A 1 111 ? 28.120  -24.124 60.665 1.00 33.15 ? 113  GLN A CG  1 
ATOM   875  C CD  . GLN A 1 111 ? 27.585  -24.933 61.837 1.00 35.62 ? 113  GLN A CD  1 
ATOM   876  O OE1 . GLN A 1 111 ? 26.796  -25.880 61.663 1.00 36.08 ? 113  GLN A OE1 1 
ATOM   877  N NE2 . GLN A 1 111 ? 28.022  -24.575 63.042 1.00 36.20 ? 113  GLN A NE2 1 
ATOM   878  N N   . MET A 1 112 ? 26.731  -21.905 56.462 1.00 29.73 ? 114  MET A N   1 
ATOM   879  C CA  . MET A 1 112 ? 25.832  -21.696 55.339 1.00 26.61 ? 114  MET A CA  1 
ATOM   880  C C   . MET A 1 112 ? 26.674  -22.141 54.141 1.00 25.60 ? 114  MET A C   1 
ATOM   881  O O   . MET A 1 112 ? 27.253  -21.328 53.409 1.00 25.17 ? 114  MET A O   1 
ATOM   882  C CB  . MET A 1 112 ? 25.456  -20.220 55.287 1.00 24.05 ? 114  MET A CB  1 
ATOM   883  C CG  . MET A 1 112 ? 24.766  -19.754 56.590 1.00 24.55 ? 114  MET A CG  1 
ATOM   884  S SD  . MET A 1 112 ? 24.504  -17.955 56.715 1.00 24.35 ? 114  MET A SD  1 
ATOM   885  C CE  . MET A 1 112 ? 22.972  -17.789 55.720 1.00 29.32 ? 114  MET A CE  1 
ATOM   886  N N   . GLU A 1 113 ? 26.759  -23.458 53.977 1.00 24.74 ? 115  GLU A N   1 
ATOM   887  C CA  . GLU A 1 113 ? 27.568  -24.064 52.926 1.00 26.45 ? 115  GLU A CA  1 
ATOM   888  C C   . GLU A 1 113 ? 27.122  -23.767 51.504 1.00 22.86 ? 115  GLU A C   1 
ATOM   889  O O   . GLU A 1 113 ? 27.945  -23.558 50.621 1.00 21.51 ? 115  GLU A O   1 
ATOM   890  C CB  . GLU A 1 113 ? 27.650  -25.581 53.133 1.00 29.64 ? 115  GLU A CB  1 
ATOM   891  C CG  . GLU A 1 113 ? 28.088  -26.001 54.531 1.00 39.19 ? 115  GLU A CG  1 
ATOM   892  C CD  . GLU A 1 113 ? 29.302  -25.219 55.073 1.00 45.65 ? 115  GLU A CD  1 
ATOM   893  O OE1 . GLU A 1 113 ? 30.163  -24.777 54.256 1.00 47.68 ? 115  GLU A OE1 1 
ATOM   894  O OE2 . GLU A 1 113 ? 29.402  -25.069 56.329 1.00 47.43 ? 115  GLU A OE2 1 
ATOM   895  N N   . HIS A 1 114 ? 25.818  -23.765 51.279 1.00 22.38 ? 116  HIS A N   1 
ATOM   896  C CA  . HIS A 1 114 ? 25.312  -23.457 49.953 1.00 22.82 ? 116  HIS A CA  1 
ATOM   897  C C   . HIS A 1 114 ? 25.717  -22.052 49.538 1.00 20.78 ? 116  HIS A C   1 
ATOM   898  O O   . HIS A 1 114 ? 26.050  -21.824 48.383 1.00 22.93 ? 116  HIS A O   1 
ATOM   899  C CB  . HIS A 1 114 ? 23.789  -23.610 49.903 1.00 22.75 ? 116  HIS A CB  1 
ATOM   900  C CG  . HIS A 1 114 ? 23.326  -25.019 50.091 1.00 22.02 ? 116  HIS A CG  1 
ATOM   901  N ND1 . HIS A 1 114 ? 23.194  -25.601 51.335 1.00 22.54 ? 116  HIS A ND1 1 
ATOM   902  C CD2 . HIS A 1 114 ? 22.972  -25.965 49.192 1.00 21.70 ? 116  HIS A CD2 1 
ATOM   903  C CE1 . HIS A 1 114 ? 22.773  -26.846 51.195 1.00 22.76 ? 116  HIS A CE1 1 
ATOM   904  N NE2 . HIS A 1 114 ? 22.631  -27.092 49.904 1.00 24.91 ? 116  HIS A NE2 1 
ATOM   905  N N   . VAL A 1 115 ? 25.678  -21.103 50.464 1.00 20.25 ? 117  VAL A N   1 
ATOM   906  C CA  . VAL A 1 115 ? 26.093  -19.750 50.118 1.00 21.18 ? 117  VAL A CA  1 
ATOM   907  C C   . VAL A 1 115 ? 27.608  -19.712 49.824 1.00 21.39 ? 117  VAL A C   1 
ATOM   908  O O   . VAL A 1 115 ? 28.050  -19.012 48.905 1.00 19.10 ? 117  VAL A O   1 
ATOM   909  C CB  . VAL A 1 115 ? 25.745  -18.731 51.246 1.00 22.03 ? 117  VAL A CB  1 
ATOM   910  C CG1 . VAL A 1 115 ? 26.391  -17.376 50.947 1.00 21.73 ? 117  VAL A CG1 1 
ATOM   911  C CG2 . VAL A 1 115 ? 24.234  -18.543 51.329 1.00 21.95 ? 117  VAL A CG2 1 
ATOM   912  N N   . VAL A 1 116 ? 28.403  -20.470 50.585 1.00 24.00 ? 118  VAL A N   1 
ATOM   913  C CA  . VAL A 1 116 ? 29.856  -20.497 50.340 1.00 23.78 ? 118  VAL A CA  1 
ATOM   914  C C   . VAL A 1 116 ? 30.075  -21.001 48.917 1.00 25.35 ? 118  VAL A C   1 
ATOM   915  O O   . VAL A 1 116 ? 30.794  -20.383 48.114 1.00 25.53 ? 118  VAL A O   1 
ATOM   916  C CB  . VAL A 1 116 ? 30.608  -21.432 51.349 1.00 23.72 ? 118  VAL A CB  1 
ATOM   917  C CG1 . VAL A 1 116 ? 32.067  -21.664 50.883 1.00 22.20 ? 118  VAL A CG1 1 
ATOM   918  C CG2 . VAL A 1 116 ? 30.607  -20.796 52.752 1.00 18.32 ? 118  VAL A CG2 1 
ATOM   919  N N   . ASP A 1 117 ? 29.410  -22.105 48.590 1.00 27.98 ? 119  ASP A N   1 
ATOM   920  C CA  . ASP A 1 117 ? 29.545  -22.688 47.266 1.00 28.28 ? 119  ASP A CA  1 
ATOM   921  C C   . ASP A 1 117 ? 29.076  -21.781 46.144 1.00 27.43 ? 119  ASP A C   1 
ATOM   922  O O   . ASP A 1 117 ? 29.638  -21.832 45.057 1.00 26.68 ? 119  ASP A O   1 
ATOM   923  C CB  . ASP A 1 117 ? 28.805  -24.017 47.160 1.00 31.35 ? 119  ASP A CB  1 
ATOM   924  C CG  . ASP A 1 117 ? 29.318  -24.854 45.988 1.00 37.60 ? 119  ASP A CG  1 
ATOM   925  O OD1 . ASP A 1 117 ? 30.544  -25.162 45.970 1.00 39.19 ? 119  ASP A OD1 1 
ATOM   926  O OD2 . ASP A 1 117 ? 28.518  -25.190 45.084 1.00 36.40 ? 119  ASP A OD2 1 
ATOM   927  N N   . THR A 1 118 ? 28.053  -20.957 46.390 1.00 26.17 ? 120  THR A N   1 
ATOM   928  C CA  . THR A 1 118 ? 27.555  -20.045 45.348 1.00 25.46 ? 120  THR A CA  1 
ATOM   929  C C   . THR A 1 118 ? 28.596  -18.963 45.076 1.00 24.69 ? 120  THR A C   1 
ATOM   930  O O   . THR A 1 118 ? 28.829  -18.583 43.930 1.00 25.41 ? 120  THR A O   1 
ATOM   931  C CB  . THR A 1 118 ? 26.202  -19.386 45.744 1.00 26.00 ? 120  THR A CB  1 
ATOM   932  O OG1 . THR A 1 118 ? 25.194  -20.400 45.865 1.00 22.07 ? 120  THR A OG1 1 
ATOM   933  C CG2 . THR A 1 118 ? 25.778  -18.354 44.690 1.00 21.71 ? 120  THR A CG2 1 
ATOM   934  N N   . CYS A 1 119 ? 29.203  -18.466 46.145 1.00 25.05 ? 121  CYS A N   1 
ATOM   935  C CA  . CYS A 1 119 ? 30.276  -17.482 46.057 1.00 27.55 ? 121  CYS A CA  1 
ATOM   936  C C   . CYS A 1 119 ? 31.408  -18.053 45.172 1.00 28.67 ? 121  CYS A C   1 
ATOM   937  O O   . CYS A 1 119 ? 31.965  -17.348 44.309 1.00 27.02 ? 121  CYS A O   1 
ATOM   938  C CB  . CYS A 1 119 ? 30.824  -17.178 47.458 1.00 29.70 ? 121  CYS A CB  1 
ATOM   939  S SG  . CYS A 1 119 ? 29.795  -16.089 48.491 1.00 32.06 ? 121  CYS A SG  1 
ATOM   940  N N   . ARG A 1 120 ? 31.728  -19.333 45.392 1.00 28.09 ? 122  ARG A N   1 
ATOM   941  C CA  . ARG A 1 120 ? 32.752  -20.024 44.615 1.00 28.79 ? 122  ARG A CA  1 
ATOM   942  C C   . ARG A 1 120 ? 32.352  -19.992 43.139 1.00 26.67 ? 122  ARG A C   1 
ATOM   943  O O   . ARG A 1 120 ? 33.165  -19.645 42.258 1.00 22.31 ? 122  ARG A O   1 
ATOM   944  C CB  . ARG A 1 120 ? 32.912  -21.486 45.084 1.00 32.25 ? 122  ARG A CB  1 
ATOM   945  C CG  . ARG A 1 120 ? 34.005  -22.243 44.314 1.00 40.96 ? 122  ARG A CG  1 
ATOM   946  C CD  . ARG A 1 120 ? 34.036  -23.769 44.555 1.00 44.96 ? 122  ARG A CD  1 
ATOM   947  N NE  . ARG A 1 120 ? 34.367  -24.152 45.931 1.00 48.31 ? 122  ARG A NE  1 
ATOM   948  C CZ  . ARG A 1 120 ? 35.162  -25.175 46.266 1.00 49.13 ? 122  ARG A CZ  1 
ATOM   949  N NH1 . ARG A 1 120 ? 35.730  -25.935 45.330 1.00 46.82 ? 122  ARG A NH1 1 
ATOM   950  N NH2 . ARG A 1 120 ? 35.386  -25.449 47.551 1.00 50.52 ? 122  ARG A NH2 1 
ATOM   951  N N   . LYS A 1 121 ? 31.091  -20.339 42.873 1.00 26.00 ? 123  LYS A N   1 
ATOM   952  C CA  . LYS A 1 121 ? 30.578  -20.336 41.500 1.00 24.33 ? 123  LYS A CA  1 
ATOM   953  C C   . LYS A 1 121 ? 30.686  -18.940 40.909 1.00 23.61 ? 123  LYS A C   1 
ATOM   954  O O   . LYS A 1 121 ? 30.985  -18.781 39.736 1.00 23.40 ? 123  LYS A O   1 
ATOM   955  C CB  . LYS A 1 121 ? 29.117  -20.804 41.458 1.00 24.69 ? 123  LYS A CB  1 
ATOM   956  C CG  . LYS A 1 121 ? 28.893  -22.215 42.003 1.00 26.23 ? 123  LYS A CG  1 
ATOM   957  C CD  . LYS A 1 121 ? 27.406  -22.568 42.088 1.00 24.31 ? 123  LYS A CD  1 
ATOM   958  C CE  . LYS A 1 121 ? 26.763  -22.593 40.716 1.00 25.04 ? 123  LYS A CE  1 
ATOM   959  N NZ  . LYS A 1 121 ? 25.282  -22.823 40.798 1.00 27.88 ? 123  LYS A NZ  1 
ATOM   960  N N   . PHE A 1 122 ? 30.445  -17.929 41.741 1.00 25.14 ? 124  PHE A N   1 
ATOM   961  C CA  . PHE A 1 122 ? 30.516  -16.527 41.324 1.00 25.01 ? 124  PHE A CA  1 
ATOM   962  C C   . PHE A 1 122 ? 31.967  -16.141 40.961 1.00 25.55 ? 124  PHE A C   1 
ATOM   963  O O   . PHE A 1 122 ? 32.198  -15.471 39.952 1.00 25.35 ? 124  PHE A O   1 
ATOM   964  C CB  . PHE A 1 122 ? 30.004  -15.638 42.464 1.00 23.50 ? 124  PHE A CB  1 
ATOM   965  C CG  . PHE A 1 122 ? 30.033  -14.167 42.152 1.00 25.18 ? 124  PHE A CG  1 
ATOM   966  C CD1 . PHE A 1 122 ? 28.997  -13.566 41.429 1.00 23.96 ? 124  PHE A CD1 1 
ATOM   967  C CD2 . PHE A 1 122 ? 31.094  -13.375 42.582 1.00 25.22 ? 124  PHE A CD2 1 
ATOM   968  C CE1 . PHE A 1 122 ? 29.017  -12.185 41.137 1.00 24.54 ? 124  PHE A CE1 1 
ATOM   969  C CE2 . PHE A 1 122 ? 31.124  -11.988 42.294 1.00 26.74 ? 124  PHE A CE2 1 
ATOM   970  C CZ  . PHE A 1 122 ? 30.087  -11.398 41.573 1.00 25.16 ? 124  PHE A CZ  1 
ATOM   971  N N   . ILE A 1 123 ? 32.920  -16.548 41.807 1.00 27.32 ? 125  ILE A N   1 
ATOM   972  C CA  . ILE A 1 123 ? 34.351  -16.293 41.592 1.00 29.24 ? 125  ILE A CA  1 
ATOM   973  C C   . ILE A 1 123 ? 34.691  -16.895 40.228 1.00 29.50 ? 125  ILE A C   1 
ATOM   974  O O   . ILE A 1 123 ? 35.314  -16.246 39.384 1.00 27.00 ? 125  ILE A O   1 
ATOM   975  C CB  . ILE A 1 123 ? 35.249  -17.032 42.640 1.00 30.06 ? 125  ILE A CB  1 
ATOM   976  C CG1 . ILE A 1 123 ? 35.034  -16.483 44.056 1.00 29.11 ? 125  ILE A CG1 1 
ATOM   977  C CG2 . ILE A 1 123 ? 36.720  -16.934 42.221 1.00 30.25 ? 125  ILE A CG2 1 
ATOM   978  C CD1 . ILE A 1 123 ? 35.494  -15.082 44.266 1.00 31.49 ? 125  ILE A CD1 1 
ATOM   979  N N   . LYS A 1 124 ? 34.245  -18.138 40.039 1.00 31.24 ? 126  LYS A N   1 
ATOM   980  C CA  . LYS A 1 124 ? 34.470  -18.906 38.820 1.00 32.94 ? 126  LYS A CA  1 
ATOM   981  C C   . LYS A 1 124 ? 34.015  -18.230 37.557 1.00 33.37 ? 126  LYS A C   1 
ATOM   982  O O   . LYS A 1 124 ? 34.650  -18.382 36.511 1.00 34.21 ? 126  LYS A O   1 
ATOM   983  C CB  . LYS A 1 124 ? 33.759  -20.262 38.869 1.00 34.12 ? 126  LYS A CB  1 
ATOM   984  C CG  . LYS A 1 124 ? 34.421  -21.318 39.711 1.00 37.27 ? 126  LYS A CG  1 
ATOM   985  C CD  . LYS A 1 124 ? 33.847  -22.691 39.401 1.00 38.44 ? 126  LYS A CD  1 
ATOM   986  C CE  . LYS A 1 124 ? 34.211  -23.116 37.985 1.00 41.23 ? 126  LYS A CE  1 
ATOM   987  N NZ  . LYS A 1 124 ? 33.798  -24.520 37.698 1.00 42.78 ? 126  LYS A NZ  1 
ATOM   988  N N   . ALA A 1 125 ? 32.908  -17.507 37.636 1.00 32.61 ? 127  ALA A N   1 
ATOM   989  C CA  . ALA A 1 125 ? 32.380  -16.854 36.448 1.00 32.88 ? 127  ALA A CA  1 
ATOM   990  C C   . ALA A 1 125 ? 32.793  -15.404 36.296 1.00 32.88 ? 127  ALA A C   1 
ATOM   991  O O   . ALA A 1 125 ? 32.553  -14.816 35.243 1.00 33.47 ? 127  ALA A O   1 
ATOM   992  C CB  . ALA A 1 125 ? 30.843  -16.951 36.431 1.00 32.16 ? 127  ALA A CB  1 
ATOM   993  N N   . SER A 1 126 ? 33.411  -14.828 37.325 1.00 34.55 ? 128  SER A N   1 
ATOM   994  C CA  . SER A 1 126 ? 33.796  -13.417 37.277 1.00 37.21 ? 128  SER A CA  1 
ATOM   995  C C   . SER A 1 126 ? 34.766  -13.041 36.164 1.00 39.96 ? 128  SER A C   1 
ATOM   996  O O   . SER A 1 126 ? 35.562  -13.865 35.719 1.00 39.32 ? 128  SER A O   1 
ATOM   997  C CB  . SER A 1 126 ? 34.357  -12.966 38.625 1.00 37.56 ? 128  SER A CB  1 
ATOM   998  O OG  . SER A 1 126 ? 35.542  -13.659 38.952 1.00 39.99 ? 128  SER A OG  1 
ATOM   999  N N   . GLU A 1 127 ? 34.668  -11.781 35.729 1.00 43.78 ? 129  GLU A N   1 
ATOM   1000 C CA  . GLU A 1 127 ? 35.480  -11.195 34.654 1.00 48.10 ? 129  GLU A CA  1 
ATOM   1001 C C   . GLU A 1 127 ? 34.902  -11.529 33.270 1.00 49.46 ? 129  GLU A C   1 
ATOM   1002 O O   . GLU A 1 127 ? 34.598  -10.597 32.488 1.00 48.95 ? 129  GLU A O   1 
ATOM   1003 C CB  . GLU A 1 127 ? 36.936  -11.676 34.751 1.00 49.97 ? 129  GLU A CB  1 
ATOM   1004 C CG  . GLU A 1 127 ? 37.676  -11.129 35.963 1.00 53.32 ? 129  GLU A CG  1 
ATOM   1005 C CD  . GLU A 1 127 ? 38.422  -12.202 36.764 1.00 56.48 ? 129  GLU A CD  1 
ATOM   1006 O OE1 . GLU A 1 127 ? 39.289  -12.908 36.187 1.00 56.89 ? 129  GLU A OE1 1 
ATOM   1007 O OE2 . GLU A 1 127 ? 38.140  -12.330 37.983 1.00 56.51 ? 129  GLU A OE2 1 
ATOM   1008 O OXT . GLU A 1 127 ? 34.755  -12.736 32.980 1.00 52.62 ? 129  GLU A OXT 1 
ATOM   1009 N N   . ASP B 1 4   ? 30.211  -3.892  42.401 1.00 31.63 ? 6    ASP B N   1 
ATOM   1010 C CA  . ASP B 1 4   ? 28.871  -4.085  43.063 1.00 31.33 ? 6    ASP B CA  1 
ATOM   1011 C C   . ASP B 1 4   ? 28.001  -5.130  42.352 1.00 29.13 ? 6    ASP B C   1 
ATOM   1012 O O   . ASP B 1 4   ? 27.633  -4.975  41.188 1.00 27.61 ? 6    ASP B O   1 
ATOM   1013 C CB  . ASP B 1 4   ? 28.123  -2.755  43.136 1.00 35.58 ? 6    ASP B CB  1 
ATOM   1014 C CG  . ASP B 1 4   ? 28.550  -1.905  44.318 1.00 39.97 ? 6    ASP B CG  1 
ATOM   1015 O OD1 . ASP B 1 4   ? 29.730  -1.992  44.724 1.00 42.94 ? 6    ASP B OD1 1 
ATOM   1016 O OD2 . ASP B 1 4   ? 27.708  -1.135  44.830 1.00 41.39 ? 6    ASP B OD2 1 
ATOM   1017 N N   . SER B 1 5   ? 27.665  -6.188  43.076 1.00 27.34 ? 7    SER B N   1 
ATOM   1018 C CA  . SER B 1 5   ? 26.877  -7.272  42.517 1.00 26.33 ? 7    SER B CA  1 
ATOM   1019 C C   . SER B 1 5   ? 25.816  -7.757  43.484 1.00 24.27 ? 7    SER B C   1 
ATOM   1020 O O   . SER B 1 5   ? 25.857  -7.455  44.664 1.00 24.93 ? 7    SER B O   1 
ATOM   1021 C CB  . SER B 1 5   ? 27.789  -8.452  42.159 1.00 26.16 ? 7    SER B CB  1 
ATOM   1022 O OG  . SER B 1 5   ? 28.817  -8.057  41.272 1.00 30.87 ? 7    SER B OG  1 
ATOM   1023 N N   . GLN B 1 6   ? 24.868  -8.519  42.958 1.00 23.12 ? 8    GLN B N   1 
ATOM   1024 C CA  . GLN B 1 6   ? 23.784  -9.074  43.747 1.00 20.47 ? 8    GLN B CA  1 
ATOM   1025 C C   . GLN B 1 6   ? 23.416  -10.456 43.200 1.00 20.54 ? 8    GLN B C   1 
ATOM   1026 O O   . GLN B 1 6   ? 22.998  -10.601 42.032 1.00 18.74 ? 8    GLN B O   1 
ATOM   1027 C CB  . GLN B 1 6   ? 22.544  -8.169  43.699 1.00 19.46 ? 8    GLN B CB  1 
ATOM   1028 C CG  . GLN B 1 6   ? 21.415  -8.645  44.611 1.00 18.73 ? 8    GLN B CG  1 
ATOM   1029 C CD  . GLN B 1 6   ? 20.144  -7.801  44.499 1.00 19.34 ? 8    GLN B CD  1 
ATOM   1030 O OE1 . GLN B 1 6   ? 19.276  -8.058  43.647 1.00 17.73 ? 8    GLN B OE1 1 
ATOM   1031 N NE2 . GLN B 1 6   ? 20.032  -6.781  45.359 1.00 19.64 ? 8    GLN B NE2 1 
ATOM   1032 N N   . ILE B 1 7   ? 23.618  -11.471 44.038 1.00 19.17 ? 9    ILE B N   1 
ATOM   1033 C CA  . ILE B 1 7   ? 23.256  -12.822 43.672 1.00 17.78 ? 9    ILE B CA  1 
ATOM   1034 C C   . ILE B 1 7   ? 21.842  -12.999 44.226 1.00 17.64 ? 9    ILE B C   1 
ATOM   1035 O O   . ILE B 1 7   ? 21.598  -12.777 45.414 1.00 17.10 ? 9    ILE B O   1 
ATOM   1036 C CB  . ILE B 1 7   ? 24.210  -13.877 44.294 1.00 17.76 ? 9    ILE B CB  1 
ATOM   1037 C CG1 . ILE B 1 7   ? 25.666  -13.551 43.906 1.00 18.20 ? 9    ILE B CG1 1 
ATOM   1038 C CG2 . ILE B 1 7   ? 23.816  -15.293 43.794 1.00 12.96 ? 9    ILE B CG2 1 
ATOM   1039 C CD1 . ILE B 1 7   ? 26.672  -14.648 44.226 1.00 17.68 ? 9    ILE B CD1 1 
ATOM   1040 N N   . GLN B 1 8   ? 20.919  -13.360 43.343 1.00 17.83 ? 10   GLN B N   1 
ATOM   1041 C CA  . GLN B 1 8   ? 19.505  -13.557 43.686 1.00 17.41 ? 10   GLN B CA  1 
ATOM   1042 C C   . GLN B 1 8   ? 19.205  -15.053 43.712 1.00 16.82 ? 10   GLN B C   1 
ATOM   1043 O O   . GLN B 1 8   ? 19.246  -15.718 42.673 1.00 12.89 ? 10   GLN B O   1 
ATOM   1044 C CB  . GLN B 1 8   ? 18.620  -12.855 42.652 1.00 16.04 ? 10   GLN B CB  1 
ATOM   1045 C CG  . GLN B 1 8   ? 18.872  -11.351 42.609 1.00 20.35 ? 10   GLN B CG  1 
ATOM   1046 C CD  . GLN B 1 8   ? 18.264  -10.645 41.409 1.00 21.55 ? 10   GLN B CD  1 
ATOM   1047 O OE1 . GLN B 1 8   ? 18.227  -9.406  41.363 1.00 23.31 ? 10   GLN B OE1 1 
ATOM   1048 N NE2 . GLN B 1 8   ? 17.802  -11.413 40.430 1.00 18.67 ? 10   GLN B NE2 1 
ATOM   1049 N N   . PHE B 1 9   ? 18.914  -15.546 44.918 1.00 15.07 ? 11   PHE B N   1 
ATOM   1050 C CA  . PHE B 1 9   ? 18.621  -16.955 45.170 1.00 15.55 ? 11   PHE B CA  1 
ATOM   1051 C C   . PHE B 1 9   ? 17.149  -17.146 44.936 1.00 14.32 ? 11   PHE B C   1 
ATOM   1052 O O   . PHE B 1 9   ? 16.327  -16.831 45.806 1.00 15.27 ? 11   PHE B O   1 
ATOM   1053 C CB  . PHE B 1 9   ? 19.005  -17.331 46.614 1.00 12.87 ? 11   PHE B CB  1 
ATOM   1054 C CG  . PHE B 1 9   ? 20.490  -17.332 46.857 1.00 16.37 ? 11   PHE B CG  1 
ATOM   1055 C CD1 . PHE B 1 9   ? 21.203  -16.136 46.930 1.00 16.15 ? 11   PHE B CD1 1 
ATOM   1056 C CD2 . PHE B 1 9   ? 21.193  -18.542 46.941 1.00 17.43 ? 11   PHE B CD2 1 
ATOM   1057 C CE1 . PHE B 1 9   ? 22.595  -16.150 47.079 1.00 19.50 ? 11   PHE B CE1 1 
ATOM   1058 C CE2 . PHE B 1 9   ? 22.586  -18.571 47.090 1.00 15.54 ? 11   PHE B CE2 1 
ATOM   1059 C CZ  . PHE B 1 9   ? 23.287  -17.385 47.159 1.00 16.89 ? 11   PHE B CZ  1 
ATOM   1060 N N   . THR B 1 10  ? 16.813  -17.671 43.761 1.00 14.90 ? 12   THR B N   1 
ATOM   1061 C CA  . THR B 1 10  ? 15.406  -17.828 43.392 1.00 16.66 ? 12   THR B CA  1 
ATOM   1062 C C   . THR B 1 10  ? 14.554  -18.816 44.158 1.00 16.32 ? 12   THR B C   1 
ATOM   1063 O O   . THR B 1 10  ? 13.324  -18.741 44.069 1.00 21.23 ? 12   THR B O   1 
ATOM   1064 C CB  . THR B 1 10  ? 15.257  -18.085 41.868 1.00 17.04 ? 12   THR B CB  1 
ATOM   1065 O OG1 . THR B 1 10  ? 16.143  -19.134 41.468 1.00 19.67 ? 12   THR B OG1 1 
ATOM   1066 C CG2 . THR B 1 10  ? 15.611  -16.821 41.091 1.00 18.73 ? 12   THR B CG2 1 
ATOM   1067 N N   . ARG B 1 11  ? 15.161  -19.743 44.893 1.00 15.60 ? 13   ARG B N   1 
ATOM   1068 C CA  . ARG B 1 11  ? 14.368  -20.676 45.699 1.00 15.33 ? 13   ARG B CA  1 
ATOM   1069 C C   . ARG B 1 11  ? 14.592  -20.483 47.203 1.00 14.82 ? 13   ARG B C   1 
ATOM   1070 O O   . ARG B 1 11  ? 14.062  -21.245 48.050 1.00 15.31 ? 13   ARG B O   1 
ATOM   1071 C CB  . ARG B 1 11  ? 14.618  -22.142 45.284 1.00 14.43 ? 13   ARG B CB  1 
ATOM   1072 C CG  . ARG B 1 11  ? 16.066  -22.609 45.292 1.00 16.12 ? 13   ARG B CG  1 
ATOM   1073 C CD  . ARG B 1 11  ? 16.157  -24.121 45.112 1.00 14.72 ? 13   ARG B CD  1 
ATOM   1074 N NE  . ARG B 1 11  ? 15.739  -24.872 46.314 1.00 19.28 ? 13   ARG B NE  1 
ATOM   1075 C CZ  . ARG B 1 11  ? 15.751  -26.202 46.404 1.00 18.52 ? 13   ARG B CZ  1 
ATOM   1076 N NH1 . ARG B 1 11  ? 16.164  -26.936 45.376 1.00 22.40 ? 13   ARG B NH1 1 
ATOM   1077 N NH2 . ARG B 1 11  ? 15.332  -26.808 47.499 1.00 16.46 ? 13   ARG B NH2 1 
ATOM   1078 N N   . HIS B 1 12  ? 15.348  -19.438 47.540 1.00 15.08 ? 14   HIS B N   1 
ATOM   1079 C CA  . HIS B 1 12  ? 15.639  -19.148 48.950 1.00 16.25 ? 14   HIS B CA  1 
ATOM   1080 C C   . HIS B 1 12  ? 14.398  -19.030 49.851 1.00 14.65 ? 14   HIS B C   1 
ATOM   1081 O O   . HIS B 1 12  ? 14.313  -19.683 50.885 1.00 14.99 ? 14   HIS B O   1 
ATOM   1082 C CB  . HIS B 1 12  ? 16.454  -17.870 49.090 1.00 14.91 ? 14   HIS B CB  1 
ATOM   1083 C CG  . HIS B 1 12  ? 16.736  -17.511 50.520 1.00 19.36 ? 14   HIS B CG  1 
ATOM   1084 N ND1 . HIS B 1 12  ? 17.515  -18.298 51.346 1.00 18.41 ? 14   HIS B ND1 1 
ATOM   1085 C CD2 . HIS B 1 12  ? 16.298  -16.482 51.284 1.00 15.60 ? 14   HIS B CD2 1 
ATOM   1086 C CE1 . HIS B 1 12  ? 17.542  -17.770 52.556 1.00 18.67 ? 14   HIS B CE1 1 
ATOM   1087 N NE2 . HIS B 1 12  ? 16.811  -16.667 52.545 1.00 19.88 ? 14   HIS B NE2 1 
ATOM   1088 N N   . ALA B 1 13  ? 13.454  -18.175 49.470 1.00 15.94 ? 15   ALA B N   1 
ATOM   1089 C CA  . ALA B 1 13  ? 12.216  -18.003 50.240 1.00 14.25 ? 15   ALA B CA  1 
ATOM   1090 C C   . ALA B 1 13  ? 11.534  -19.360 50.444 1.00 14.92 ? 15   ALA B C   1 
ATOM   1091 O O   . ALA B 1 13  ? 11.109  -19.699 51.537 1.00 16.63 ? 15   ALA B O   1 
ATOM   1092 C CB  . ALA B 1 13  ? 11.278  -17.046 49.507 1.00 12.75 ? 15   ALA B CB  1 
ATOM   1093 N N   . SER B 1 14  ? 11.446  -20.149 49.387 1.00 15.53 ? 16   SER B N   1 
ATOM   1094 C CA  . SER B 1 14  ? 10.809  -21.447 49.496 1.00 17.18 ? 16   SER B CA  1 
ATOM   1095 C C   . SER B 1 14  ? 11.583  -22.389 50.444 1.00 18.93 ? 16   SER B C   1 
ATOM   1096 O O   . SER B 1 14  ? 10.969  -23.130 51.238 1.00 17.39 ? 16   SER B O   1 
ATOM   1097 C CB  . SER B 1 14  ? 10.667  -22.048 48.096 1.00 18.83 ? 16   SER B CB  1 
ATOM   1098 O OG  . SER B 1 14  ? 10.037  -23.310 48.158 1.00 27.15 ? 16   SER B OG  1 
ATOM   1099 N N   . ASP B 1 15  ? 12.920  -22.380 50.370 1.00 18.44 ? 17   ASP B N   1 
ATOM   1100 C CA  . ASP B 1 15  ? 13.707  -23.216 51.295 1.00 18.40 ? 17   ASP B CA  1 
ATOM   1101 C C   . ASP B 1 15  ? 13.531  -22.703 52.730 1.00 19.31 ? 17   ASP B C   1 
ATOM   1102 O O   . ASP B 1 15  ? 13.483  -23.490 53.691 1.00 19.80 ? 17   ASP B O   1 
ATOM   1103 C CB  . ASP B 1 15  ? 15.206  -23.211 50.949 1.00 17.77 ? 17   ASP B CB  1 
ATOM   1104 C CG  . ASP B 1 15  ? 15.513  -23.866 49.594 1.00 19.33 ? 17   ASP B CG  1 
ATOM   1105 O OD1 . ASP B 1 15  ? 14.721  -24.711 49.114 1.00 17.67 ? 17   ASP B OD1 1 
ATOM   1106 O OD2 . ASP B 1 15  ? 16.565  -23.539 49.019 1.00 20.24 ? 17   ASP B OD2 1 
ATOM   1107 N N   . VAL B 1 16  ? 13.462  -21.385 52.898 1.00 18.87 ? 18   VAL B N   1 
ATOM   1108 C CA  . VAL B 1 16  ? 13.249  -20.855 54.236 1.00 18.60 ? 18   VAL B CA  1 
ATOM   1109 C C   . VAL B 1 16  ? 11.878  -21.347 54.742 1.00 19.67 ? 18   VAL B C   1 
ATOM   1110 O O   . VAL B 1 16  ? 11.780  -21.869 55.848 1.00 20.81 ? 18   VAL B O   1 
ATOM   1111 C CB  . VAL B 1 16  ? 13.247  -19.319 54.251 1.00 19.14 ? 18   VAL B CB  1 
ATOM   1112 C CG1 . VAL B 1 16  ? 12.606  -18.822 55.556 1.00 18.48 ? 18   VAL B CG1 1 
ATOM   1113 C CG2 . VAL B 1 16  ? 14.685  -18.776 54.109 1.00 16.28 ? 18   VAL B CG2 1 
ATOM   1114 N N   . LEU B 1 17  ? 10.831  -21.190 53.928 1.00 17.65 ? 19   LEU B N   1 
ATOM   1115 C CA  . LEU B 1 17  ? 9.494   -21.611 54.328 1.00 20.06 ? 19   LEU B CA  1 
ATOM   1116 C C   . LEU B 1 17  ? 9.409   -23.100 54.679 1.00 22.94 ? 19   LEU B C   1 
ATOM   1117 O O   . LEU B 1 17  ? 8.730   -23.478 55.639 1.00 23.17 ? 19   LEU B O   1 
ATOM   1118 C CB  . LEU B 1 17  ? 8.472   -21.278 53.249 1.00 20.20 ? 19   LEU B CB  1 
ATOM   1119 C CG  . LEU B 1 17  ? 7.025   -21.455 53.703 1.00 21.89 ? 19   LEU B CG  1 
ATOM   1120 C CD1 . LEU B 1 17  ? 6.748   -20.452 54.821 1.00 23.27 ? 19   LEU B CD1 1 
ATOM   1121 C CD2 . LEU B 1 17  ? 6.052   -21.269 52.548 1.00 16.31 ? 19   LEU B CD2 1 
ATOM   1122 N N   . LEU B 1 18  ? 10.098  -23.948 53.920 1.00 22.91 ? 20   LEU B N   1 
ATOM   1123 C CA  . LEU B 1 18  ? 10.076  -25.365 54.224 1.00 24.37 ? 20   LEU B CA  1 
ATOM   1124 C C   . LEU B 1 18  ? 10.720  -25.608 55.591 1.00 25.37 ? 20   LEU B C   1 
ATOM   1125 O O   . LEU B 1 18  ? 10.202  -26.379 56.402 1.00 24.56 ? 20   LEU B O   1 
ATOM   1126 C CB  . LEU B 1 18  ? 10.824  -26.167 53.164 1.00 24.94 ? 20   LEU B CB  1 
ATOM   1127 C CG  . LEU B 1 18  ? 10.959  -27.652 53.505 1.00 26.68 ? 20   LEU B CG  1 
ATOM   1128 C CD1 . LEU B 1 18  ? 9.579   -28.294 53.509 1.00 26.38 ? 20   LEU B CD1 1 
ATOM   1129 C CD2 . LEU B 1 18  ? 11.882  -28.343 52.491 1.00 28.61 ? 20   LEU B CD2 1 
ATOM   1130 N N   . ASN B 1 19  ? 11.849  -24.952 55.845 1.00 24.60 ? 21   ASN B N   1 
ATOM   1131 C CA  . ASN B 1 19  ? 12.523  -25.128 57.120 1.00 25.35 ? 21   ASN B CA  1 
ATOM   1132 C C   . ASN B 1 19  ? 11.658  -24.622 58.269 1.00 26.86 ? 21   ASN B C   1 
ATOM   1133 O O   . ASN B 1 19  ? 11.785  -25.088 59.394 1.00 26.29 ? 21   ASN B O   1 
ATOM   1134 C CB  . ASN B 1 19  ? 13.885  -24.427 57.124 1.00 24.08 ? 21   ASN B CB  1 
ATOM   1135 C CG  . ASN B 1 19  ? 14.975  -25.274 56.478 1.00 25.04 ? 21   ASN B CG  1 
ATOM   1136 O OD1 . ASN B 1 19  ? 14.701  -26.371 55.974 1.00 23.67 ? 21   ASN B OD1 1 
ATOM   1137 N ND2 . ASN B 1 19  ? 16.219  -24.771 56.484 1.00 24.78 ? 21   ASN B ND2 1 
ATOM   1138 N N   . LEU B 1 20  ? 10.771  -23.671 57.998 1.00 26.10 ? 22   LEU B N   1 
ATOM   1139 C CA  . LEU B 1 20  ? 9.926   -23.189 59.068 1.00 25.79 ? 22   LEU B CA  1 
ATOM   1140 C C   . LEU B 1 20  ? 8.853   -24.234 59.333 1.00 26.98 ? 22   LEU B C   1 
ATOM   1141 O O   . LEU B 1 20  ? 8.408   -24.402 60.459 1.00 28.49 ? 22   LEU B O   1 
ATOM   1142 C CB  . LEU B 1 20  ? 9.286   -21.855 58.696 1.00 23.57 ? 22   LEU B CB  1 
ATOM   1143 C CG  . LEU B 1 20  ? 10.228  -20.666 58.570 1.00 22.89 ? 22   LEU B CG  1 
ATOM   1144 C CD1 . LEU B 1 20  ? 9.439   -19.498 58.024 1.00 22.62 ? 22   LEU B CD1 1 
ATOM   1145 C CD2 . LEU B 1 20  ? 10.836  -20.309 59.925 1.00 22.16 ? 22   LEU B CD2 1 
ATOM   1146 N N   . ASN B 1 21  ? 8.427   -24.939 58.297 1.00 26.83 ? 23   ASN B N   1 
ATOM   1147 C CA  . ASN B 1 21  ? 7.410   -25.958 58.490 1.00 27.45 ? 23   ASN B CA  1 
ATOM   1148 C C   . ASN B 1 21  ? 8.023   -27.162 59.192 1.00 28.04 ? 23   ASN B C   1 
ATOM   1149 O O   . ASN B 1 21  ? 7.348   -27.888 59.929 1.00 27.36 ? 23   ASN B O   1 
ATOM   1150 C CB  . ASN B 1 21  ? 6.805   -26.370 57.149 1.00 26.73 ? 23   ASN B CB  1 
ATOM   1151 C CG  . ASN B 1 21  ? 5.499   -27.129 57.313 1.00 25.95 ? 23   ASN B CG  1 
ATOM   1152 O OD1 . ASN B 1 21  ? 4.694   -26.833 58.199 1.00 23.74 ? 23   ASN B OD1 1 
ATOM   1153 N ND2 . ASN B 1 21  ? 5.277   -28.097 56.450 1.00 26.05 ? 23   ASN B ND2 1 
ATOM   1154 N N   . ARG B 1 22  ? 9.302   -27.395 58.944 1.00 28.29 ? 24   ARG B N   1 
ATOM   1155 C CA  . ARG B 1 22  ? 9.973   -28.489 59.621 1.00 31.70 ? 24   ARG B CA  1 
ATOM   1156 C C   . ARG B 1 22  ? 9.933   -28.178 61.133 1.00 33.06 ? 24   ARG B C   1 
ATOM   1157 O O   . ARG B 1 22  ? 9.502   -29.002 61.927 1.00 34.19 ? 24   ARG B O   1 
ATOM   1158 C CB  . ARG B 1 22  ? 11.419  -28.629 59.112 1.00 30.32 ? 24   ARG B CB  1 
ATOM   1159 C CG  . ARG B 1 22  ? 11.506  -29.162 57.686 1.00 29.38 ? 24   ARG B CG  1 
ATOM   1160 C CD  . ARG B 1 22  ? 11.023  -30.604 57.638 1.00 32.12 ? 24   ARG B CD  1 
ATOM   1161 N NE  . ARG B 1 22  ? 10.694  -31.062 56.293 1.00 33.68 ? 24   ARG B NE  1 
ATOM   1162 C CZ  . ARG B 1 22  ? 11.588  -31.420 55.375 1.00 32.19 ? 24   ARG B CZ  1 
ATOM   1163 N NH1 . ARG B 1 22  ? 12.879  -31.375 55.653 1.00 31.96 ? 24   ARG B NH1 1 
ATOM   1164 N NH2 . ARG B 1 22  ? 11.183  -31.828 54.179 1.00 30.89 ? 24   ARG B NH2 1 
ATOM   1165 N N   . LEU B 1 23  ? 10.359  -26.981 61.522 1.00 33.92 ? 25   LEU B N   1 
ATOM   1166 C CA  . LEU B 1 23  ? 10.333  -26.593 62.932 1.00 35.73 ? 25   LEU B CA  1 
ATOM   1167 C C   . LEU B 1 23  ? 8.932   -26.823 63.503 1.00 36.84 ? 25   LEU B C   1 
ATOM   1168 O O   . LEU B 1 23  ? 8.762   -27.368 64.604 1.00 36.32 ? 25   LEU B O   1 
ATOM   1169 C CB  . LEU B 1 23  ? 10.692  -25.115 63.091 1.00 35.66 ? 25   LEU B CB  1 
ATOM   1170 C CG  . LEU B 1 23  ? 12.083  -24.683 62.634 1.00 37.20 ? 25   LEU B CG  1 
ATOM   1171 C CD1 . LEU B 1 23  ? 12.274  -23.197 62.928 1.00 37.70 ? 25   LEU B CD1 1 
ATOM   1172 C CD2 . LEU B 1 23  ? 13.152  -25.525 63.356 1.00 36.69 ? 25   LEU B CD2 1 
ATOM   1173 N N   . ARG B 1 24  ? 7.933   -26.401 62.740 1.00 36.21 ? 26   ARG B N   1 
ATOM   1174 C CA  . ARG B 1 24  ? 6.550   -26.551 63.136 1.00 36.80 ? 26   ARG B CA  1 
ATOM   1175 C C   . ARG B 1 24  ? 6.259   -28.013 63.510 1.00 38.09 ? 26   ARG B C   1 
ATOM   1176 O O   . ARG B 1 24  ? 5.827   -28.306 64.624 1.00 38.25 ? 26   ARG B O   1 
ATOM   1177 C CB  . ARG B 1 24  ? 5.637   -26.114 61.987 1.00 35.67 ? 26   ARG B CB  1 
ATOM   1178 C CG  . ARG B 1 24  ? 4.471   -25.231 62.410 1.00 34.63 ? 26   ARG B CG  1 
ATOM   1179 C CD  . ARG B 1 24  ? 3.136   -25.765 61.918 1.00 33.11 ? 26   ARG B CD  1 
ATOM   1180 N NE  . ARG B 1 24  ? 3.142   -26.134 60.502 1.00 33.21 ? 26   ARG B NE  1 
ATOM   1181 C CZ  . ARG B 1 24  ? 2.077   -26.611 59.863 1.00 34.12 ? 26   ARG B CZ  1 
ATOM   1182 N NH1 . ARG B 1 24  ? 0.929   -26.767 60.512 1.00 34.97 ? 26   ARG B NH1 1 
ATOM   1183 N NH2 . ARG B 1 24  ? 2.154   -26.961 58.587 1.00 33.88 ? 26   ARG B NH2 1 
ATOM   1184 N N   . SER B 1 25  ? 6.503   -28.923 62.571 1.00 39.45 ? 27   SER B N   1 
ATOM   1185 C CA  . SER B 1 25  ? 6.259   -30.344 62.788 1.00 41.27 ? 27   SER B CA  1 
ATOM   1186 C C   . SER B 1 25  ? 7.100   -30.946 63.917 1.00 42.54 ? 27   SER B C   1 
ATOM   1187 O O   . SER B 1 25  ? 6.675   -31.900 64.560 1.00 44.56 ? 27   SER B O   1 
ATOM   1188 C CB  . SER B 1 25  ? 6.526   -31.124 61.511 1.00 38.79 ? 27   SER B CB  1 
ATOM   1189 O OG  . SER B 1 25  ? 7.910   -31.127 61.235 1.00 42.32 ? 27   SER B OG  1 
ATOM   1190 N N   . ARG B 1 26  ? 8.293   -30.411 64.152 1.00 42.81 ? 28   ARG B N   1 
ATOM   1191 C CA  . ARG B 1 26  ? 9.134   -30.927 65.225 1.00 42.40 ? 28   ARG B CA  1 
ATOM   1192 C C   . ARG B 1 26  ? 8.907   -30.071 66.448 1.00 43.34 ? 28   ARG B C   1 
ATOM   1193 O O   . ARG B 1 26  ? 9.681   -30.099 67.399 1.00 42.99 ? 28   ARG B O   1 
ATOM   1194 C CB  . ARG B 1 26  ? 10.607  -30.893 64.824 1.00 42.23 ? 28   ARG B CB  1 
ATOM   1195 C CG  . ARG B 1 26  ? 10.953  -31.898 63.738 1.00 40.42 ? 28   ARG B CG  1 
ATOM   1196 C CD  . ARG B 1 26  ? 12.392  -31.768 63.312 1.00 41.07 ? 28   ARG B CD  1 
ATOM   1197 N NE  . ARG B 1 26  ? 13.304  -31.910 64.440 1.00 41.15 ? 28   ARG B NE  1 
ATOM   1198 C CZ  . ARG B 1 26  ? 14.626  -31.861 64.339 1.00 40.63 ? 28   ARG B CZ  1 
ATOM   1199 N NH1 . ARG B 1 26  ? 15.192  -31.673 63.155 1.00 40.63 ? 28   ARG B NH1 1 
ATOM   1200 N NH2 . ARG B 1 26  ? 15.379  -32.000 65.419 1.00 40.86 ? 28   ARG B NH2 1 
ATOM   1201 N N   . ASP B 1 27  ? 7.830   -29.299 66.392 1.00 44.19 ? 29   ASP B N   1 
ATOM   1202 C CA  . ASP B 1 27  ? 7.431   -28.413 67.474 1.00 45.03 ? 29   ASP B CA  1 
ATOM   1203 C C   . ASP B 1 27  ? 8.594   -27.635 68.071 1.00 42.89 ? 29   ASP B C   1 
ATOM   1204 O O   . ASP B 1 27  ? 8.715   -27.538 69.293 1.00 41.68 ? 29   ASP B O   1 
ATOM   1205 C CB  . ASP B 1 27  ? 6.737   -29.215 68.580 1.00 48.81 ? 29   ASP B CB  1 
ATOM   1206 C CG  . ASP B 1 27  ? 5.878   -28.345 69.467 1.00 52.26 ? 29   ASP B CG  1 
ATOM   1207 O OD1 . ASP B 1 27  ? 5.565   -28.759 70.611 1.00 54.60 ? 29   ASP B OD1 1 
ATOM   1208 O OD2 . ASP B 1 27  ? 5.505   -27.245 69.004 1.00 54.54 ? 29   ASP B OD2 1 
ATOM   1209 N N   . ILE B 1 28  ? 9.438   -27.078 67.208 1.00 41.44 ? 30   ILE B N   1 
ATOM   1210 C CA  . ILE B 1 28  ? 10.590  -26.298 67.651 1.00 40.35 ? 30   ILE B CA  1 
ATOM   1211 C C   . ILE B 1 28  ? 10.336  -24.787 67.564 1.00 40.44 ? 30   ILE B C   1 
ATOM   1212 O O   . ILE B 1 28  ? 9.871   -24.278 66.552 1.00 40.66 ? 30   ILE B O   1 
ATOM   1213 C CB  . ILE B 1 28  ? 11.847  -26.642 66.820 1.00 40.36 ? 30   ILE B CB  1 
ATOM   1214 C CG1 . ILE B 1 28  ? 12.158  -28.141 66.937 1.00 39.82 ? 30   ILE B CG1 1 
ATOM   1215 C CG2 . ILE B 1 28  ? 13.043  -25.799 67.302 1.00 37.79 ? 30   ILE B CG2 1 
ATOM   1216 C CD1 . ILE B 1 28  ? 13.359  -28.594 66.096 1.00 37.39 ? 30   ILE B CD1 1 
ATOM   1217 N N   . LEU B 1 29  ? 10.661  -24.081 68.640 1.00 40.41 ? 31   LEU B N   1 
ATOM   1218 C CA  . LEU B 1 29  ? 10.483  -22.640 68.735 1.00 39.57 ? 31   LEU B CA  1 
ATOM   1219 C C   . LEU B 1 29  ? 9.066   -22.185 68.503 1.00 39.92 ? 31   LEU B C   1 
ATOM   1220 O O   . LEU B 1 29  ? 8.791   -20.993 68.414 1.00 40.53 ? 31   LEU B O   1 
ATOM   1221 C CB  . LEU B 1 29  ? 11.438  -21.912 67.796 1.00 40.53 ? 31   LEU B CB  1 
ATOM   1222 C CG  . LEU B 1 29  ? 12.642  -21.357 68.567 1.00 39.54 ? 31   LEU B CG  1 
ATOM   1223 C CD1 . LEU B 1 29  ? 13.758  -20.961 67.628 1.00 39.81 ? 31   LEU B CD1 1 
ATOM   1224 C CD2 . LEU B 1 29  ? 12.192  -20.161 69.373 1.00 38.18 ? 31   LEU B CD2 1 
ATOM   1225 N N   . THR B 1 30  ? 8.154   -23.137 68.399 1.00 40.44 ? 32   THR B N   1 
ATOM   1226 C CA  . THR B 1 30  ? 6.760   -22.782 68.240 1.00 41.94 ? 32   THR B CA  1 
ATOM   1227 C C   . THR B 1 30  ? 6.501   -21.954 69.495 1.00 42.28 ? 32   THR B C   1 
ATOM   1228 O O   . THR B 1 30  ? 7.058   -22.252 70.551 1.00 44.00 ? 32   THR B O   1 
ATOM   1229 C CB  . THR B 1 30  ? 5.904   -24.042 68.218 1.00 42.96 ? 32   THR B CB  1 
ATOM   1230 O OG1 . THR B 1 30  ? 6.338   -24.917 69.263 1.00 43.53 ? 32   THR B OG1 1 
ATOM   1231 C CG2 . THR B 1 30  ? 6.061   -24.766 66.877 1.00 42.50 ? 32   THR B CG2 1 
ATOM   1232 N N   . ASP B 1 31  ? 5.685   -20.913 69.403 1.00 41.44 ? 33   ASP B N   1 
ATOM   1233 C CA  . ASP B 1 31  ? 5.457   -20.064 70.569 1.00 40.43 ? 33   ASP B CA  1 
ATOM   1234 C C   . ASP B 1 31  ? 4.019   -19.671 70.841 1.00 40.76 ? 33   ASP B C   1 
ATOM   1235 O O   . ASP B 1 31  ? 3.765   -18.632 71.451 1.00 41.75 ? 33   ASP B O   1 
ATOM   1236 C CB  . ASP B 1 31  ? 6.321   -18.802 70.459 1.00 39.82 ? 33   ASP B CB  1 
ATOM   1237 C CG  . ASP B 1 31  ? 6.187   -18.109 69.098 1.00 39.98 ? 33   ASP B CG  1 
ATOM   1238 O OD1 . ASP B 1 31  ? 7.085   -17.314 68.734 1.00 37.81 ? 33   ASP B OD1 1 
ATOM   1239 O OD2 . ASP B 1 31  ? 5.186   -18.357 68.399 1.00 36.42 ? 33   ASP B OD2 1 
ATOM   1240 N N   . VAL B 1 32  ? 3.080   -20.500 70.398 1.00 40.69 ? 34   VAL B N   1 
ATOM   1241 C CA  . VAL B 1 32  ? 1.672   -20.222 70.614 1.00 41.49 ? 34   VAL B CA  1 
ATOM   1242 C C   . VAL B 1 32  ? 0.805   -21.397 70.164 1.00 42.72 ? 34   VAL B C   1 
ATOM   1243 O O   . VAL B 1 32  ? 1.269   -22.263 69.419 1.00 43.28 ? 34   VAL B O   1 
ATOM   1244 C CB  . VAL B 1 32  ? 1.240   -18.937 69.864 1.00 42.98 ? 34   VAL B CB  1 
ATOM   1245 C CG1 . VAL B 1 32  ? 1.458   -19.112 68.362 1.00 40.86 ? 34   VAL B CG1 1 
ATOM   1246 C CG2 . VAL B 1 32  ? -0.238  -18.603 70.182 1.00 41.42 ? 34   VAL B CG2 1 
ATOM   1247 N N   . VAL B 1 33  ? -0.444  -21.425 70.635 1.00 43.49 ? 35   VAL B N   1 
ATOM   1248 C CA  . VAL B 1 33  ? -1.395  -22.479 70.289 1.00 44.39 ? 35   VAL B CA  1 
ATOM   1249 C C   . VAL B 1 33  ? -2.730  -21.875 69.879 1.00 45.66 ? 35   VAL B C   1 
ATOM   1250 O O   . VAL B 1 33  ? -3.353  -21.129 70.641 1.00 47.47 ? 35   VAL B O   1 
ATOM   1251 C CB  . VAL B 1 33  ? -1.645  -23.449 71.489 1.00 45.81 ? 35   VAL B CB  1 
ATOM   1252 C CG1 . VAL B 1 33  ? -2.732  -24.483 71.135 1.00 43.95 ? 35   VAL B CG1 1 
ATOM   1253 C CG2 . VAL B 1 33  ? -0.356  -24.158 71.859 1.00 45.34 ? 35   VAL B CG2 1 
ATOM   1254 N N   . ILE B 1 34  ? -3.179  -22.181 68.670 1.00 46.08 ? 36   ILE B N   1 
ATOM   1255 C CA  . ILE B 1 34  ? -4.454  -21.649 68.235 1.00 46.66 ? 36   ILE B CA  1 
ATOM   1256 C C   . ILE B 1 34  ? -5.492  -22.723 68.489 1.00 48.34 ? 36   ILE B C   1 
ATOM   1257 O O   . ILE B 1 34  ? -5.371  -23.847 67.994 1.00 48.69 ? 36   ILE B O   1 
ATOM   1258 C CB  . ILE B 1 34  ? -4.452  -21.280 66.737 1.00 45.80 ? 36   ILE B CB  1 
ATOM   1259 C CG1 . ILE B 1 34  ? -3.268  -20.356 66.425 1.00 44.56 ? 36   ILE B CG1 1 
ATOM   1260 C CG2 . ILE B 1 34  ? -5.776  -20.625 66.368 1.00 45.52 ? 36   ILE B CG2 1 
ATOM   1261 C CD1 . ILE B 1 34  ? -3.167  -19.122 67.299 1.00 42.63 ? 36   ILE B CD1 1 
ATOM   1262 N N   . VAL B 1 35  ? -6.502  -22.366 69.282 1.00 49.67 ? 37   VAL B N   1 
ATOM   1263 C CA  . VAL B 1 35  ? -7.579  -23.271 69.637 1.00 49.26 ? 37   VAL B CA  1 
ATOM   1264 C C   . VAL B 1 35  ? -8.811  -23.007 68.786 1.00 50.40 ? 37   VAL B C   1 
ATOM   1265 O O   . VAL B 1 35  ? -9.331  -21.888 68.726 1.00 49.93 ? 37   VAL B O   1 
ATOM   1266 C CB  . VAL B 1 35  ? -7.944  -23.124 71.124 1.00 50.02 ? 37   VAL B CB  1 
ATOM   1267 C CG1 . VAL B 1 35  ? -9.107  -24.053 71.477 1.00 50.52 ? 37   VAL B CG1 1 
ATOM   1268 C CG2 . VAL B 1 35  ? -6.727  -23.432 71.983 1.00 49.53 ? 37   VAL B CG2 1 
ATOM   1269 N N   . VAL B 1 36  ? -9.271  -24.053 68.119 1.00 51.19 ? 38   VAL B N   1 
ATOM   1270 C CA  . VAL B 1 36  ? -10.438 -23.955 67.266 1.00 54.01 ? 38   VAL B CA  1 
ATOM   1271 C C   . VAL B 1 36  ? -11.354 -25.105 67.658 1.00 55.77 ? 38   VAL B C   1 
ATOM   1272 O O   . VAL B 1 36  ? -11.261 -26.209 67.116 1.00 56.08 ? 38   VAL B O   1 
ATOM   1273 C CB  . VAL B 1 36  ? -10.016 -24.053 65.788 1.00 53.99 ? 38   VAL B CB  1 
ATOM   1274 C CG1 . VAL B 1 36  ? -11.226 -24.054 64.891 1.00 52.33 ? 38   VAL B CG1 1 
ATOM   1275 C CG2 . VAL B 1 36  ? -9.096  -22.892 65.449 1.00 53.17 ? 38   VAL B CG2 1 
ATOM   1276 N N   . SER B 1 37  ? -12.245 -24.825 68.607 1.00 58.21 ? 39   SER B N   1 
ATOM   1277 C CA  . SER B 1 37  ? -13.155 -25.832 69.146 1.00 59.87 ? 39   SER B CA  1 
ATOM   1278 C C   . SER B 1 37  ? -12.281 -26.787 69.980 1.00 60.56 ? 39   SER B C   1 
ATOM   1279 O O   . SER B 1 37  ? -11.333 -26.348 70.631 1.00 60.17 ? 39   SER B O   1 
ATOM   1280 C CB  . SER B 1 37  ? -13.878 -26.579 68.017 1.00 59.72 ? 39   SER B CB  1 
ATOM   1281 O OG  . SER B 1 37  ? -14.703 -25.694 67.273 1.00 58.85 ? 39   SER B OG  1 
ATOM   1282 N N   . ARG B 1 38  ? -12.575 -28.079 69.962 1.00 62.39 ? 40   ARG B N   1 
ATOM   1283 C CA  . ARG B 1 38  ? -11.779 -29.014 70.751 1.00 65.03 ? 40   ARG B CA  1 
ATOM   1284 C C   . ARG B 1 38  ? -10.331 -29.118 70.273 1.00 65.12 ? 40   ARG B C   1 
ATOM   1285 O O   . ARG B 1 38  ? -9.422  -29.370 71.070 1.00 64.27 ? 40   ARG B O   1 
ATOM   1286 C CB  . ARG B 1 38  ? -12.432 -30.401 70.731 1.00 68.36 ? 40   ARG B CB  1 
ATOM   1287 C CG  . ARG B 1 38  ? -13.837 -30.414 71.329 1.00 71.99 ? 40   ARG B CG  1 
ATOM   1288 C CD  . ARG B 1 38  ? -14.494 -31.779 71.223 1.00 74.65 ? 40   ARG B CD  1 
ATOM   1289 N NE  . ARG B 1 38  ? -14.479 -32.287 69.854 1.00 78.04 ? 40   ARG B NE  1 
ATOM   1290 C CZ  . ARG B 1 38  ? -15.285 -33.247 69.401 1.00 80.02 ? 40   ARG B CZ  1 
ATOM   1291 N NH1 . ARG B 1 38  ? -16.184 -33.806 70.208 1.00 80.11 ? 40   ARG B NH1 1 
ATOM   1292 N NH2 . ARG B 1 38  ? -15.185 -33.657 68.141 1.00 81.39 ? 40   ARG B NH2 1 
ATOM   1293 N N   . GLU B 1 39  ? -10.123 -28.904 68.973 1.00 64.83 ? 41   GLU B N   1 
ATOM   1294 C CA  . GLU B 1 39  ? -8.796  -29.002 68.360 1.00 63.64 ? 41   GLU B CA  1 
ATOM   1295 C C   . GLU B 1 39  ? -7.846  -27.822 68.583 1.00 61.57 ? 41   GLU B C   1 
ATOM   1296 O O   . GLU B 1 39  ? -8.254  -26.656 68.577 1.00 61.26 ? 41   GLU B O   1 
ATOM   1297 C CB  . GLU B 1 39  ? -8.952  -29.269 66.861 1.00 64.90 ? 41   GLU B CB  1 
ATOM   1298 C CG  . GLU B 1 39  ? -9.651  -30.593 66.551 1.00 67.36 ? 41   GLU B CG  1 
ATOM   1299 C CD  . GLU B 1 39  ? -9.800  -30.858 65.055 1.00 69.31 ? 41   GLU B CD  1 
ATOM   1300 O OE1 . GLU B 1 39  ? -8.767  -30.921 64.343 1.00 70.03 ? 41   GLU B OE1 1 
ATOM   1301 O OE2 . GLU B 1 39  ? -10.955 -31.007 64.593 1.00 69.18 ? 41   GLU B OE2 1 
ATOM   1302 N N   . GLN B 1 40  ? -6.571  -28.156 68.781 1.00 59.11 ? 42   GLN B N   1 
ATOM   1303 C CA  . GLN B 1 40  ? -5.504  -27.185 69.013 1.00 55.91 ? 42   GLN B CA  1 
ATOM   1304 C C   . GLN B 1 40  ? -4.431  -27.275 67.922 1.00 53.98 ? 42   GLN B C   1 
ATOM   1305 O O   . GLN B 1 40  ? -4.229  -28.339 67.334 1.00 53.52 ? 42   GLN B O   1 
ATOM   1306 C CB  . GLN B 1 40  ? -4.849  -27.457 70.355 1.00 56.40 ? 42   GLN B CB  1 
ATOM   1307 C CG  . GLN B 1 40  ? -5.772  -27.332 71.539 1.00 57.64 ? 42   GLN B CG  1 
ATOM   1308 C CD  . GLN B 1 40  ? -5.209  -28.029 72.767 1.00 58.56 ? 42   GLN B CD  1 
ATOM   1309 O OE1 . GLN B 1 40  ? -3.985  -28.099 72.952 1.00 57.83 ? 42   GLN B OE1 1 
ATOM   1310 N NE2 . GLN B 1 40  ? -6.099  -28.541 73.620 1.00 58.78 ? 42   GLN B NE2 1 
ATOM   1311 N N   . PHE B 1 41  ? -3.746  -26.162 67.657 1.00 50.82 ? 43   PHE B N   1 
ATOM   1312 C CA  . PHE B 1 41  ? -2.693  -26.140 66.642 1.00 48.17 ? 43   PHE B CA  1 
ATOM   1313 C C   . PHE B 1 41  ? -1.509  -25.317 67.104 1.00 46.89 ? 43   PHE B C   1 
ATOM   1314 O O   . PHE B 1 41  ? -1.665  -24.144 67.429 1.00 46.94 ? 43   PHE B O   1 
ATOM   1315 C CB  . PHE B 1 41  ? -3.188  -25.534 65.326 1.00 45.71 ? 43   PHE B CB  1 
ATOM   1316 C CG  . PHE B 1 41  ? -4.423  -26.179 64.775 1.00 46.05 ? 43   PHE B CG  1 
ATOM   1317 C CD1 . PHE B 1 41  ? -5.687  -25.710 65.133 1.00 44.78 ? 43   PHE B CD1 1 
ATOM   1318 C CD2 . PHE B 1 41  ? -4.328  -27.253 63.892 1.00 45.06 ? 43   PHE B CD2 1 
ATOM   1319 C CE1 . PHE B 1 41  ? -6.841  -26.299 64.618 1.00 44.28 ? 43   PHE B CE1 1 
ATOM   1320 C CE2 . PHE B 1 41  ? -5.475  -27.851 63.371 1.00 45.37 ? 43   PHE B CE2 1 
ATOM   1321 C CZ  . PHE B 1 41  ? -6.740  -27.370 63.736 1.00 45.01 ? 43   PHE B CZ  1 
ATOM   1322 N N   . ARG B 1 42  ? -0.329  -25.924 67.132 1.00 45.82 ? 44   ARG B N   1 
ATOM   1323 C CA  . ARG B 1 42  ? 0.870   -25.199 67.527 1.00 46.02 ? 44   ARG B CA  1 
ATOM   1324 C C   . ARG B 1 42  ? 1.488   -24.546 66.282 1.00 45.91 ? 44   ARG B C   1 
ATOM   1325 O O   . ARG B 1 42  ? 1.512   -25.152 65.200 1.00 45.41 ? 44   ARG B O   1 
ATOM   1326 C CB  . ARG B 1 42  ? 1.860   -26.145 68.212 1.00 47.60 ? 44   ARG B CB  1 
ATOM   1327 C CG  . ARG B 1 42  ? 1.342   -26.642 69.568 1.00 51.54 ? 44   ARG B CG  1 
ATOM   1328 C CD  . ARG B 1 42  ? 2.411   -27.332 70.420 1.00 53.96 ? 44   ARG B CD  1 
ATOM   1329 N NE  . ARG B 1 42  ? 3.584   -26.490 70.689 1.00 57.35 ? 44   ARG B NE  1 
ATOM   1330 C CZ  . ARG B 1 42  ? 3.554   -25.281 71.255 1.00 58.61 ? 44   ARG B CZ  1 
ATOM   1331 N NH1 . ARG B 1 42  ? 2.402   -24.735 71.625 1.00 58.88 ? 44   ARG B NH1 1 
ATOM   1332 N NH2 . ARG B 1 42  ? 4.686   -24.612 71.457 1.00 57.43 ? 44   ARG B NH2 1 
ATOM   1333 N N   . ALA B 1 43  ? 1.969   -23.310 66.439 1.00 43.79 ? 45   ALA B N   1 
ATOM   1334 C CA  . ALA B 1 43  ? 2.552   -22.548 65.333 1.00 42.07 ? 45   ALA B CA  1 
ATOM   1335 C C   . ALA B 1 43  ? 3.486   -21.428 65.801 1.00 41.42 ? 45   ALA B C   1 
ATOM   1336 O O   . ALA B 1 43  ? 3.663   -21.219 67.002 1.00 41.36 ? 45   ALA B O   1 
ATOM   1337 C CB  . ALA B 1 43  ? 1.433   -21.951 64.487 1.00 40.77 ? 45   ALA B CB  1 
ATOM   1338 N N   . HIS B 1 44  ? 4.080   -20.717 64.839 1.00 38.48 ? 46   HIS B N   1 
ATOM   1339 C CA  . HIS B 1 44  ? 4.969   -19.598 65.133 1.00 35.44 ? 46   HIS B CA  1 
ATOM   1340 C C   . HIS B 1 44  ? 4.201   -18.321 64.858 1.00 32.49 ? 46   HIS B C   1 
ATOM   1341 O O   . HIS B 1 44  ? 3.681   -18.132 63.768 1.00 32.46 ? 46   HIS B O   1 
ATOM   1342 C CB  . HIS B 1 44  ? 6.223   -19.622 64.246 1.00 35.52 ? 46   HIS B CB  1 
ATOM   1343 C CG  . HIS B 1 44  ? 7.000   -20.900 64.314 1.00 35.06 ? 46   HIS B CG  1 
ATOM   1344 N ND1 . HIS B 1 44  ? 6.720   -21.987 63.510 1.00 34.70 ? 46   HIS B ND1 1 
ATOM   1345 C CD2 . HIS B 1 44  ? 8.043   -21.269 65.099 1.00 33.33 ? 46   HIS B CD2 1 
ATOM   1346 C CE1 . HIS B 1 44  ? 7.559   -22.968 63.799 1.00 34.11 ? 46   HIS B CE1 1 
ATOM   1347 N NE2 . HIS B 1 44  ? 8.370   -22.558 64.760 1.00 32.31 ? 46   HIS B NE2 1 
ATOM   1348 N N   . LYS B 1 45  ? 4.154   -17.438 65.845 1.00 32.95 ? 47   LYS B N   1 
ATOM   1349 C CA  . LYS B 1 45  ? 3.435   -16.165 65.735 1.00 32.88 ? 47   LYS B CA  1 
ATOM   1350 C C   . LYS B 1 45  ? 3.818   -15.316 64.512 1.00 31.58 ? 47   LYS B C   1 
ATOM   1351 O O   . LYS B 1 45  ? 2.955   -14.734 63.836 1.00 31.89 ? 47   LYS B O   1 
ATOM   1352 C CB  . LYS B 1 45  ? 3.650   -15.343 67.018 1.00 35.57 ? 47   LYS B CB  1 
ATOM   1353 C CG  . LYS B 1 45  ? 2.990   -15.933 68.289 1.00 36.12 ? 47   LYS B CG  1 
ATOM   1354 C CD  . LYS B 1 45  ? 3.275   -15.054 69.519 1.00 38.33 ? 47   LYS B CD  1 
ATOM   1355 C CE  . LYS B 1 45  ? 2.616   -15.596 70.804 1.00 39.66 ? 47   LYS B CE  1 
ATOM   1356 N NZ  . LYS B 1 45  ? 2.847   -14.702 71.985 1.00 39.72 ? 47   LYS B NZ  1 
ATOM   1357 N N   . THR B 1 46  ? 5.110   -15.237 64.236 1.00 29.26 ? 48   THR B N   1 
ATOM   1358 C CA  . THR B 1 46  ? 5.591   -14.459 63.110 1.00 29.07 ? 48   THR B CA  1 
ATOM   1359 C C   . THR B 1 46  ? 5.019   -14.950 61.797 1.00 27.14 ? 48   THR B C   1 
ATOM   1360 O O   . THR B 1 46  ? 4.711   -14.159 60.909 1.00 26.19 ? 48   THR B O   1 
ATOM   1361 C CB  . THR B 1 46  ? 7.095   -14.542 63.005 1.00 30.38 ? 48   THR B CB  1 
ATOM   1362 O OG1 . THR B 1 46  ? 7.483   -15.924 62.993 1.00 30.03 ? 48   THR B OG1 1 
ATOM   1363 C CG2 . THR B 1 46  ? 7.745   -13.804 64.168 1.00 32.67 ? 48   THR B CG2 1 
ATOM   1364 N N   . VAL B 1 47  ? 4.885   -16.263 61.671 1.00 26.76 ? 49   VAL B N   1 
ATOM   1365 C CA  . VAL B 1 47  ? 4.355   -16.838 60.443 1.00 27.90 ? 49   VAL B CA  1 
ATOM   1366 C C   . VAL B 1 47  ? 2.892   -16.476 60.338 1.00 28.04 ? 49   VAL B C   1 
ATOM   1367 O O   . VAL B 1 47  ? 2.419   -16.044 59.293 1.00 27.88 ? 49   VAL B O   1 
ATOM   1368 C CB  . VAL B 1 47  ? 4.526   -18.388 60.412 1.00 28.86 ? 49   VAL B CB  1 
ATOM   1369 C CG1 . VAL B 1 47  ? 3.921   -18.966 59.124 1.00 27.08 ? 49   VAL B CG1 1 
ATOM   1370 C CG2 . VAL B 1 47  ? 6.024   -18.755 60.504 1.00 25.88 ? 49   VAL B CG2 1 
ATOM   1371 N N   . LEU B 1 48  ? 2.180   -16.630 61.445 1.00 28.42 ? 50   LEU B N   1 
ATOM   1372 C CA  . LEU B 1 48  ? 0.766   -16.312 61.465 1.00 28.39 ? 50   LEU B CA  1 
ATOM   1373 C C   . LEU B 1 48  ? 0.590   -14.841 61.128 1.00 27.55 ? 50   LEU B C   1 
ATOM   1374 O O   . LEU B 1 48  ? -0.318  -14.470 60.390 1.00 29.93 ? 50   LEU B O   1 
ATOM   1375 C CB  . LEU B 1 48  ? 0.186   -16.627 62.846 1.00 28.65 ? 50   LEU B CB  1 
ATOM   1376 C CG  . LEU B 1 48  ? 0.337   -18.093 63.259 1.00 29.24 ? 50   LEU B CG  1 
ATOM   1377 C CD1 . LEU B 1 48  ? -0.152  -18.302 64.702 1.00 29.87 ? 50   LEU B CD1 1 
ATOM   1378 C CD2 . LEU B 1 48  ? -0.453  -18.955 62.285 1.00 26.67 ? 50   LEU B CD2 1 
ATOM   1379 N N   . MET B 1 49  ? 1.459   -14.003 61.670 1.00 26.78 ? 51   MET B N   1 
ATOM   1380 C CA  . MET B 1 49  ? 1.392   -12.560 61.405 1.00 27.27 ? 51   MET B CA  1 
ATOM   1381 C C   . MET B 1 49  ? 1.658   -12.212 59.938 1.00 25.39 ? 51   MET B C   1 
ATOM   1382 O O   . MET B 1 49  ? 1.022   -11.328 59.359 1.00 24.16 ? 51   MET B O   1 
ATOM   1383 C CB  . MET B 1 49  ? 2.411   -11.813 62.270 1.00 25.15 ? 51   MET B CB  1 
ATOM   1384 C CG  . MET B 1 49  ? 2.028   -11.737 63.741 1.00 28.24 ? 51   MET B CG  1 
ATOM   1385 S SD  . MET B 1 49  ? 3.246   -10.834 64.754 1.00 29.45 ? 51   MET B SD  1 
ATOM   1386 C CE  . MET B 1 49  ? 2.512   -9.158  64.673 1.00 26.51 ? 51   MET B CE  1 
ATOM   1387 N N   . ALA B 1 50  ? 2.627   -12.895 59.351 1.00 24.44 ? 52   ALA B N   1 
ATOM   1388 C CA  . ALA B 1 50  ? 2.980   -12.628 57.980 1.00 23.37 ? 52   ALA B CA  1 
ATOM   1389 C C   . ALA B 1 50  ? 1.808   -12.890 57.056 1.00 23.20 ? 52   ALA B C   1 
ATOM   1390 O O   . ALA B 1 50  ? 1.581   -12.144 56.103 1.00 20.78 ? 52   ALA B O   1 
ATOM   1391 C CB  . ALA B 1 50  ? 4.172   -13.490 57.576 1.00 21.28 ? 52   ALA B CB  1 
ATOM   1392 N N   . CYS B 1 51  ? 1.058   -13.947 57.358 1.00 22.85 ? 53   CYS B N   1 
ATOM   1393 C CA  . CYS B 1 51  ? -0.054  -14.357 56.516 1.00 23.08 ? 53   CYS B CA  1 
ATOM   1394 C C   . CYS B 1 51  ? -1.441  -13.855 56.859 1.00 24.83 ? 53   CYS B C   1 
ATOM   1395 O O   . CYS B 1 51  ? -2.284  -13.747 55.973 1.00 24.79 ? 53   CYS B O   1 
ATOM   1396 C CB  . CYS B 1 51  ? -0.135  -15.879 56.474 1.00 23.69 ? 53   CYS B CB  1 
ATOM   1397 S SG  . CYS B 1 51  ? 1.400   -16.713 56.078 1.00 18.26 ? 53   CYS B SG  1 
ATOM   1398 N N   . SER B 1 52  ? -1.691  -13.549 58.127 1.00 26.34 ? 54   SER B N   1 
ATOM   1399 C CA  . SER B 1 52  ? -3.041  -13.142 58.524 1.00 27.90 ? 54   SER B CA  1 
ATOM   1400 C C   . SER B 1 52  ? -3.150  -11.787 59.228 1.00 26.93 ? 54   SER B C   1 
ATOM   1401 O O   . SER B 1 52  ? -2.418  -11.497 60.177 1.00 25.38 ? 54   SER B O   1 
ATOM   1402 C CB  . SER B 1 52  ? -3.651  -14.247 59.403 1.00 29.47 ? 54   SER B CB  1 
ATOM   1403 O OG  . SER B 1 52  ? -4.941  -13.890 59.892 1.00 34.46 ? 54   SER B OG  1 
ATOM   1404 N N   . GLY B 1 53  ? -4.074  -10.962 58.739 1.00 27.95 ? 55   GLY B N   1 
ATOM   1405 C CA  . GLY B 1 53  ? -4.294  -9.652  59.329 1.00 28.44 ? 55   GLY B CA  1 
ATOM   1406 C C   . GLY B 1 53  ? -4.757  -9.827  60.766 1.00 30.11 ? 55   GLY B C   1 
ATOM   1407 O O   . GLY B 1 53  ? -4.285  -9.140  61.680 1.00 29.29 ? 55   GLY B O   1 
ATOM   1408 N N   . LEU B 1 54  ? -5.686  -10.759 60.962 1.00 31.34 ? 56   LEU B N   1 
ATOM   1409 C CA  . LEU B 1 54  ? -6.217  -11.053 62.288 1.00 32.91 ? 56   LEU B CA  1 
ATOM   1410 C C   . LEU B 1 54  ? -5.021  -11.294 63.217 1.00 32.53 ? 56   LEU B C   1 
ATOM   1411 O O   . LEU B 1 54  ? -4.784  -10.543 64.174 1.00 31.13 ? 56   LEU B O   1 
ATOM   1412 C CB  . LEU B 1 54  ? -7.099  -12.301 62.229 1.00 35.10 ? 56   LEU B CB  1 
ATOM   1413 C CG  . LEU B 1 54  ? -7.971  -12.597 63.456 1.00 39.73 ? 56   LEU B CG  1 
ATOM   1414 C CD1 . LEU B 1 54  ? -9.060  -11.516 63.588 1.00 39.39 ? 56   LEU B CD1 1 
ATOM   1415 C CD2 . LEU B 1 54  ? -8.626  -13.975 63.306 1.00 40.67 ? 56   LEU B CD2 1 
ATOM   1416 N N   . PHE B 1 55  ? -4.254  -12.334 62.924 1.00 31.01 ? 57   PHE B N   1 
ATOM   1417 C CA  . PHE B 1 55  ? -3.100  -12.627 63.740 1.00 31.73 ? 57   PHE B CA  1 
ATOM   1418 C C   . PHE B 1 55  ? -2.128  -11.452 63.838 1.00 32.40 ? 57   PHE B C   1 
ATOM   1419 O O   . PHE B 1 55  ? -1.487  -11.264 64.881 1.00 31.36 ? 57   PHE B O   1 
ATOM   1420 C CB  . PHE B 1 55  ? -2.402  -13.877 63.222 1.00 33.63 ? 57   PHE B CB  1 
ATOM   1421 C CG  . PHE B 1 55  ? -3.156  -15.136 63.502 1.00 35.16 ? 57   PHE B CG  1 
ATOM   1422 C CD1 . PHE B 1 55  ? -3.333  -16.096 62.509 1.00 35.72 ? 57   PHE B CD1 1 
ATOM   1423 C CD2 . PHE B 1 55  ? -3.703  -15.361 64.764 1.00 37.31 ? 57   PHE B CD2 1 
ATOM   1424 C CE1 . PHE B 1 55  ? -4.048  -17.269 62.761 1.00 36.05 ? 57   PHE B CE1 1 
ATOM   1425 C CE2 . PHE B 1 55  ? -4.422  -16.532 65.036 1.00 38.16 ? 57   PHE B CE2 1 
ATOM   1426 C CZ  . PHE B 1 55  ? -4.595  -17.491 64.026 1.00 37.78 ? 57   PHE B CZ  1 
ATOM   1427 N N   . TYR B 1 56  ? -2.011  -10.662 62.768 1.00 32.58 ? 58   TYR B N   1 
ATOM   1428 C CA  . TYR B 1 56  ? -1.134  -9.507  62.814 1.00 33.95 ? 58   TYR B CA  1 
ATOM   1429 C C   . TYR B 1 56  ? -1.627  -8.607  63.948 1.00 34.67 ? 58   TYR B C   1 
ATOM   1430 O O   . TYR B 1 56  ? -0.841  -8.179  64.781 1.00 33.80 ? 58   TYR B O   1 
ATOM   1431 C CB  . TYR B 1 56  ? -1.165  -8.712  61.507 1.00 34.29 ? 58   TYR B CB  1 
ATOM   1432 C CG  . TYR B 1 56  ? -0.261  -7.496  61.545 1.00 33.89 ? 58   TYR B CG  1 
ATOM   1433 C CD1 . TYR B 1 56  ? 1.121   -7.630  61.430 1.00 35.54 ? 58   TYR B CD1 1 
ATOM   1434 C CD2 . TYR B 1 56  ? -0.780  -6.218  61.735 1.00 34.48 ? 58   TYR B CD2 1 
ATOM   1435 C CE1 . TYR B 1 56  ? 1.974   -6.520  61.504 1.00 34.69 ? 58   TYR B CE1 1 
ATOM   1436 C CE2 . TYR B 1 56  ? 0.058   -5.100  61.814 1.00 34.23 ? 58   TYR B CE2 1 
ATOM   1437 C CZ  . TYR B 1 56  ? 1.435   -5.256  61.696 1.00 36.23 ? 58   TYR B CZ  1 
ATOM   1438 O OH  . TYR B 1 56  ? 2.278   -4.156  61.753 1.00 34.54 ? 58   TYR B OH  1 
ATOM   1439 N N   . SER B 1 57  ? -2.931  -8.330  63.968 1.00 35.69 ? 59   SER B N   1 
ATOM   1440 C CA  . SER B 1 57  ? -3.546  -7.487  65.001 1.00 38.98 ? 59   SER B CA  1 
ATOM   1441 C C   . SER B 1 57  ? -3.478  -8.080  66.418 1.00 38.88 ? 59   SER B C   1 
ATOM   1442 O O   . SER B 1 57  ? -3.222  -7.369  67.386 1.00 38.06 ? 59   SER B O   1 
ATOM   1443 C CB  . SER B 1 57  ? -5.002  -7.211  64.637 1.00 40.57 ? 59   SER B CB  1 
ATOM   1444 O OG  . SER B 1 57  ? -5.081  -6.591  63.361 1.00 44.77 ? 59   SER B OG  1 
ATOM   1445 N N   . ILE B 1 58  ? -3.699  -9.385  66.528 1.00 39.29 ? 60   ILE B N   1 
ATOM   1446 C CA  . ILE B 1 58  ? -3.651  -10.067 67.812 1.00 39.09 ? 60   ILE B CA  1 
ATOM   1447 C C   . ILE B 1 58  ? -2.281  -9.966  68.471 1.00 38.90 ? 60   ILE B C   1 
ATOM   1448 O O   . ILE B 1 58  ? -2.162  -9.520  69.608 1.00 38.71 ? 60   ILE B O   1 
ATOM   1449 C CB  . ILE B 1 58  ? -4.016  -11.560 67.658 1.00 40.10 ? 60   ILE B CB  1 
ATOM   1450 C CG1 . ILE B 1 58  ? -5.467  -11.691 67.196 1.00 39.67 ? 60   ILE B CG1 1 
ATOM   1451 C CG2 . ILE B 1 58  ? -3.814  -12.294 68.975 1.00 39.90 ? 60   ILE B CG2 1 
ATOM   1452 C CD1 . ILE B 1 58  ? -5.889  -13.111 66.900 1.00 38.88 ? 60   ILE B CD1 1 
ATOM   1453 N N   . PHE B 1 59  ? -1.236  -10.373 67.764 1.00 40.07 ? 61   PHE B N   1 
ATOM   1454 C CA  . PHE B 1 59  ? 0.092   -10.324 68.354 1.00 40.26 ? 61   PHE B CA  1 
ATOM   1455 C C   . PHE B 1 59  ? 0.681   -8.938  68.303 1.00 40.36 ? 61   PHE B C   1 
ATOM   1456 O O   . PHE B 1 59  ? 1.822   -8.715  68.709 1.00 39.75 ? 61   PHE B O   1 
ATOM   1457 C CB  . PHE B 1 59  ? 0.994   -11.355 67.678 1.00 42.10 ? 61   PHE B CB  1 
ATOM   1458 C CG  . PHE B 1 59  ? 0.426   -12.738 67.727 1.00 43.77 ? 61   PHE B CG  1 
ATOM   1459 C CD1 . PHE B 1 59  ? 0.068   -13.406 66.559 1.00 45.62 ? 61   PHE B CD1 1 
ATOM   1460 C CD2 . PHE B 1 59  ? 0.141   -13.334 68.950 1.00 44.50 ? 61   PHE B CD2 1 
ATOM   1461 C CE1 . PHE B 1 59  ? -0.577  -14.648 66.609 1.00 45.41 ? 61   PHE B CE1 1 
ATOM   1462 C CE2 . PHE B 1 59  ? -0.501  -14.574 69.013 1.00 45.70 ? 61   PHE B CE2 1 
ATOM   1463 C CZ  . PHE B 1 59  ? -0.863  -15.231 67.839 1.00 46.01 ? 61   PHE B CZ  1 
ATOM   1464 N N   . THR B 1 60  ? -0.118  -7.999  67.811 1.00 42.14 ? 62   THR B N   1 
ATOM   1465 C CA  . THR B 1 60  ? 0.292   -6.601  67.737 1.00 45.39 ? 62   THR B CA  1 
ATOM   1466 C C   . THR B 1 60  ? -0.325  -5.888  68.958 1.00 46.84 ? 62   THR B C   1 
ATOM   1467 O O   . THR B 1 60  ? 0.119   -4.822  69.374 1.00 45.39 ? 62   THR B O   1 
ATOM   1468 C CB  . THR B 1 60  ? -0.203  -5.948  66.432 1.00 44.99 ? 62   THR B CB  1 
ATOM   1469 O OG1 . THR B 1 60  ? 0.641   -4.844  66.104 1.00 49.03 ? 62   THR B OG1 1 
ATOM   1470 C CG2 . THR B 1 60  ? -1.624  -5.440  66.583 1.00 47.43 ? 62   THR B CG2 1 
ATOM   1471 N N   . ASP B 1 61  ? -1.359  -6.517  69.516 1.00 49.37 ? 63   ASP B N   1 
ATOM   1472 C CA  . ASP B 1 61  ? -2.075  -6.031  70.696 1.00 51.41 ? 63   ASP B CA  1 
ATOM   1473 C C   . ASP B 1 61  ? -1.200  -6.282  71.934 1.00 52.47 ? 63   ASP B C   1 
ATOM   1474 O O   . ASP B 1 61  ? -1.029  -7.427  72.348 1.00 52.30 ? 63   ASP B O   1 
ATOM   1475 C CB  . ASP B 1 61  ? -3.386  -6.806  70.835 1.00 51.56 ? 63   ASP B CB  1 
ATOM   1476 C CG  . ASP B 1 61  ? -4.188  -6.388  72.043 1.00 51.93 ? 63   ASP B CG  1 
ATOM   1477 O OD1 . ASP B 1 61  ? -3.582  -6.211  73.122 1.00 50.26 ? 63   ASP B OD1 1 
ATOM   1478 O OD2 . ASP B 1 61  ? -5.427  -6.248  71.910 1.00 50.93 ? 63   ASP B OD2 1 
ATOM   1479 N N   . GLN B 1 62  ? -0.660  -5.214  72.522 1.00 53.27 ? 64   GLN B N   1 
ATOM   1480 C CA  . GLN B 1 62  ? 0.216   -5.326  73.692 1.00 53.53 ? 64   GLN B CA  1 
ATOM   1481 C C   . GLN B 1 62  ? -0.305  -6.294  74.749 1.00 54.91 ? 64   GLN B C   1 
ATOM   1482 O O   . GLN B 1 62  ? 0.478   -6.924  75.464 1.00 56.01 ? 64   GLN B O   1 
ATOM   1483 C CB  . GLN B 1 62  ? 0.420   -3.954  74.339 1.00 53.28 ? 64   GLN B CB  1 
ATOM   1484 C CG  . GLN B 1 62  ? -0.819  -3.408  75.064 1.00 52.11 ? 64   GLN B CG  1 
ATOM   1485 C CD  . GLN B 1 62  ? -0.531  -2.134  75.836 1.00 51.13 ? 64   GLN B CD  1 
ATOM   1486 O OE1 . GLN B 1 62  ? 0.416   -2.075  76.629 1.00 51.46 ? 64   GLN B OE1 1 
ATOM   1487 N NE2 . GLN B 1 62  ? -1.348  -1.107  75.614 1.00 50.47 ? 64   GLN B NE2 1 
ATOM   1488 N N   . LEU B 1 63  ? -1.625  -6.398  74.850 1.00 54.97 ? 65   LEU B N   1 
ATOM   1489 C CA  . LEU B 1 63  ? -2.256  -7.284  75.819 1.00 56.81 ? 65   LEU B CA  1 
ATOM   1490 C C   . LEU B 1 63  ? -2.129  -8.747  75.419 1.00 57.38 ? 65   LEU B C   1 
ATOM   1491 O O   . LEU B 1 63  ? -1.370  -9.511  76.017 1.00 58.08 ? 65   LEU B O   1 
ATOM   1492 C CB  . LEU B 1 63  ? -3.738  -6.922  75.963 1.00 57.61 ? 65   LEU B CB  1 
ATOM   1493 C CG  . LEU B 1 63  ? -4.252  -6.535  77.355 1.00 57.91 ? 65   LEU B CG  1 
ATOM   1494 C CD1 . LEU B 1 63  ? -3.246  -5.624  78.057 1.00 55.88 ? 65   LEU B CD1 1 
ATOM   1495 C CD2 . LEU B 1 63  ? -5.619  -5.853  77.214 1.00 57.41 ? 65   LEU B CD2 1 
ATOM   1496 N N   . LYS B 1 64  ? -2.885  -9.133  74.402 1.00 58.51 ? 66   LYS B N   1 
ATOM   1497 C CA  . LYS B 1 64  ? -2.867  -10.505 73.927 1.00 59.50 ? 66   LYS B CA  1 
ATOM   1498 C C   . LYS B 1 64  ? -1.666  -10.758 73.030 1.00 60.08 ? 66   LYS B C   1 
ATOM   1499 O O   . LYS B 1 64  ? -1.711  -11.587 72.127 1.00 60.53 ? 66   LYS B O   1 
ATOM   1500 C CB  . LYS B 1 64  ? -4.164  -10.807 73.181 1.00 59.19 ? 66   LYS B CB  1 
ATOM   1501 C CG  . LYS B 1 64  ? -4.484  -9.798  72.112 1.00 60.10 ? 66   LYS B CG  1 
ATOM   1502 C CD  . LYS B 1 64  ? -5.730  -10.182 71.357 1.00 59.63 ? 66   LYS B CD  1 
ATOM   1503 C CE  . LYS B 1 64  ? -6.935  -10.162 72.251 1.00 59.23 ? 66   LYS B CE  1 
ATOM   1504 N NZ  . LYS B 1 64  ? -8.163  -10.192 71.424 1.00 60.81 ? 66   LYS B NZ  1 
ATOM   1505 N N   . ARG B 1 65  ? -0.583  -10.045 73.307 1.00 60.78 ? 67   ARG B N   1 
ATOM   1506 C CA  . ARG B 1 65  ? 0.636   -10.164 72.532 1.00 61.05 ? 67   ARG B CA  1 
ATOM   1507 C C   . ARG B 1 65  ? 1.531   -11.291 73.004 1.00 61.10 ? 67   ARG B C   1 
ATOM   1508 O O   . ARG B 1 65  ? 2.175   -11.959 72.197 1.00 61.81 ? 67   ARG B O   1 
ATOM   1509 C CB  . ARG B 1 65  ? 1.419   -8.858  72.601 1.00 62.81 ? 67   ARG B CB  1 
ATOM   1510 C CG  . ARG B 1 65  ? 2.762   -8.920  71.913 1.00 64.95 ? 67   ARG B CG  1 
ATOM   1511 C CD  . ARG B 1 65  ? 3.816   -8.151  72.691 1.00 66.99 ? 67   ARG B CD  1 
ATOM   1512 N NE  . ARG B 1 65  ? 5.156   -8.347  72.136 1.00 69.07 ? 67   ARG B NE  1 
ATOM   1513 C CZ  . ARG B 1 65  ? 5.720   -9.534  71.919 1.00 70.08 ? 67   ARG B CZ  1 
ATOM   1514 N NH1 . ARG B 1 65  ? 5.063   -10.656 72.205 1.00 70.03 ? 67   ARG B NH1 1 
ATOM   1515 N NH2 . ARG B 1 65  ? 6.948   -9.598  71.415 1.00 70.88 ? 67   ARG B NH2 1 
ATOM   1516 N N   . ASN B 1 66  ? 1.581   -11.506 74.311 1.00 61.17 ? 68   ASN B N   1 
ATOM   1517 C CA  . ASN B 1 66  ? 2.452   -12.541 74.850 1.00 60.78 ? 68   ASN B CA  1 
ATOM   1518 C C   . ASN B 1 66  ? 1.764   -13.831 75.258 1.00 60.45 ? 68   ASN B C   1 
ATOM   1519 O O   . ASN B 1 66  ? 2.415   -14.769 75.720 1.00 60.30 ? 68   ASN B O   1 
ATOM   1520 C CB  . ASN B 1 66  ? 3.243   -11.969 76.019 1.00 60.09 ? 68   ASN B CB  1 
ATOM   1521 C CG  . ASN B 1 66  ? 4.148   -10.843 75.592 1.00 60.50 ? 68   ASN B CG  1 
ATOM   1522 O OD1 . ASN B 1 66  ? 5.171   -11.068 74.946 1.00 60.48 ? 68   ASN B OD1 1 
ATOM   1523 N ND2 . ASN B 1 66  ? 3.766   -9.616  75.925 1.00 60.00 ? 68   ASN B ND2 1 
ATOM   1524 N N   . LEU B 1 67  ? 0.450   -13.889 75.087 1.00 59.89 ? 69   LEU B N   1 
ATOM   1525 C CA  . LEU B 1 67  ? -0.272  -15.100 75.442 1.00 59.54 ? 69   LEU B CA  1 
ATOM   1526 C C   . LEU B 1 67  ? 0.281   -16.239 74.595 1.00 59.02 ? 69   LEU B C   1 
ATOM   1527 O O   . LEU B 1 67  ? 0.732   -16.028 73.467 1.00 58.57 ? 69   LEU B O   1 
ATOM   1528 C CB  . LEU B 1 67  ? -1.771  -14.953 75.162 1.00 59.51 ? 69   LEU B CB  1 
ATOM   1529 C CG  . LEU B 1 67  ? -2.374  -13.555 75.029 1.00 58.81 ? 69   LEU B CG  1 
ATOM   1530 C CD1 . LEU B 1 67  ? -3.887  -13.698 75.061 1.00 59.07 ? 69   LEU B CD1 1 
ATOM   1531 C CD2 . LEU B 1 67  ? -1.901  -12.638 76.155 1.00 60.04 ? 69   LEU B CD2 1 
ATOM   1532 N N   . SER B 1 68  ? 0.254   -17.445 75.149 1.00 58.43 ? 70   SER B N   1 
ATOM   1533 C CA  . SER B 1 68  ? 0.737   -18.614 74.436 1.00 58.32 ? 70   SER B CA  1 
ATOM   1534 C C   . SER B 1 68  ? -0.443  -19.453 73.961 1.00 58.01 ? 70   SER B C   1 
ATOM   1535 O O   . SER B 1 68  ? -0.266  -20.597 73.549 1.00 58.00 ? 70   SER B O   1 
ATOM   1536 C CB  . SER B 1 68  ? 1.659   -19.442 75.334 1.00 58.62 ? 70   SER B CB  1 
ATOM   1537 O OG  . SER B 1 68  ? 1.110   -19.614 76.631 1.00 59.05 ? 70   SER B OG  1 
ATOM   1538 N N   . VAL B 1 69  ? -1.639  -18.862 74.016 1.00 57.35 ? 71   VAL B N   1 
ATOM   1539 C CA  . VAL B 1 69  ? -2.877  -19.517 73.595 1.00 56.71 ? 71   VAL B CA  1 
ATOM   1540 C C   . VAL B 1 69  ? -3.922  -18.511 73.105 1.00 56.87 ? 71   VAL B C   1 
ATOM   1541 O O   . VAL B 1 69  ? -4.207  -17.522 73.782 1.00 56.52 ? 71   VAL B O   1 
ATOM   1542 C CB  . VAL B 1 69  ? -3.520  -20.318 74.745 1.00 56.86 ? 71   VAL B CB  1 
ATOM   1543 C CG1 . VAL B 1 69  ? -4.884  -20.870 74.304 1.00 55.60 ? 71   VAL B CG1 1 
ATOM   1544 C CG2 . VAL B 1 69  ? -2.593  -21.440 75.173 1.00 56.22 ? 71   VAL B CG2 1 
ATOM   1545 N N   . ILE B 1 70  ? -4.492  -18.775 71.931 1.00 55.35 ? 72   ILE B N   1 
ATOM   1546 C CA  . ILE B 1 70  ? -5.502  -17.899 71.358 1.00 54.82 ? 72   ILE B CA  1 
ATOM   1547 C C   . ILE B 1 70  ? -6.703  -18.731 70.949 1.00 55.71 ? 72   ILE B C   1 
ATOM   1548 O O   . ILE B 1 70  ? -6.556  -19.779 70.330 1.00 56.41 ? 72   ILE B O   1 
ATOM   1549 C CB  . ILE B 1 70  ? -4.979  -17.151 70.107 1.00 53.08 ? 72   ILE B CB  1 
ATOM   1550 C CG1 . ILE B 1 70  ? -3.924  -16.123 70.509 1.00 51.43 ? 72   ILE B CG1 1 
ATOM   1551 C CG2 . ILE B 1 70  ? -6.143  -16.475 69.382 1.00 51.99 ? 72   ILE B CG2 1 
ATOM   1552 C CD1 . ILE B 1 70  ? -4.458  -14.996 71.361 1.00 50.30 ? 72   ILE B CD1 1 
ATOM   1553 N N   . ASN B 1 71  ? -7.892  -18.250 71.282 1.00 56.12 ? 73   ASN B N   1 
ATOM   1554 C CA  . ASN B 1 71  ? -9.109  -18.968 70.958 1.00 58.11 ? 73   ASN B CA  1 
ATOM   1555 C C   . ASN B 1 71  ? -9.932  -18.252 69.891 1.00 59.71 ? 73   ASN B C   1 
ATOM   1556 O O   . ASN B 1 71  ? -10.106 -17.036 69.936 1.00 60.04 ? 73   ASN B O   1 
ATOM   1557 C CB  . ASN B 1 71  ? -9.940  -19.151 72.230 1.00 57.34 ? 73   ASN B CB  1 
ATOM   1558 C CG  . ASN B 1 71  ? -9.202  -19.942 73.298 1.00 56.27 ? 73   ASN B CG  1 
ATOM   1559 O OD1 . ASN B 1 71  ? -9.065  -21.157 73.193 1.00 55.47 ? 73   ASN B OD1 1 
ATOM   1560 N ND2 . ASN B 1 71  ? -8.717  -19.251 74.325 1.00 55.42 ? 73   ASN B ND2 1 
ATOM   1561 N N   . LEU B 1 72  ? -10.442 -19.015 68.932 1.00 61.07 ? 74   LEU B N   1 
ATOM   1562 C CA  . LEU B 1 72  ? -11.246 -18.443 67.863 1.00 62.54 ? 74   LEU B CA  1 
ATOM   1563 C C   . LEU B 1 72  ? -12.718 -18.823 68.045 1.00 63.66 ? 74   LEU B C   1 
ATOM   1564 O O   . LEU B 1 72  ? -13.044 -19.747 68.798 1.00 63.09 ? 74   LEU B O   1 
ATOM   1565 C CB  . LEU B 1 72  ? -10.746 -18.955 66.506 1.00 62.67 ? 74   LEU B CB  1 
ATOM   1566 C CG  . LEU B 1 72  ? -9.229  -19.038 66.265 1.00 62.49 ? 74   LEU B CG  1 
ATOM   1567 C CD1 . LEU B 1 72  ? -8.980  -19.623 64.887 1.00 61.12 ? 74   LEU B CD1 1 
ATOM   1568 C CD2 . LEU B 1 72  ? -8.582  -17.664 66.392 1.00 61.90 ? 74   LEU B CD2 1 
ATOM   1569 N N   . ASP B 1 73  ? -13.603 -18.101 67.360 1.00 64.42 ? 75   ASP B N   1 
ATOM   1570 C CA  . ASP B 1 73  ? -15.028 -18.387 67.435 1.00 65.42 ? 75   ASP B CA  1 
ATOM   1571 C C   . ASP B 1 73  ? -15.204 -19.898 67.248 1.00 66.44 ? 75   ASP B C   1 
ATOM   1572 O O   . ASP B 1 73  ? -14.619 -20.499 66.347 1.00 67.03 ? 75   ASP B O   1 
ATOM   1573 C CB  . ASP B 1 73  ? -15.774 -17.604 66.348 1.00 64.73 ? 75   ASP B CB  1 
ATOM   1574 C CG  . ASP B 1 73  ? -17.202 -18.075 66.157 1.00 64.67 ? 75   ASP B CG  1 
ATOM   1575 O OD1 . ASP B 1 73  ? -17.423 -19.006 65.355 1.00 62.94 ? 75   ASP B OD1 1 
ATOM   1576 O OD2 . ASP B 1 73  ? -18.104 -17.520 66.817 1.00 64.80 ? 75   ASP B OD2 1 
ATOM   1577 N N   . PRO B 1 74  ? -15.995 -20.535 68.120 1.00 66.77 ? 76   PRO B N   1 
ATOM   1578 C CA  . PRO B 1 74  ? -16.229 -21.980 68.040 1.00 67.11 ? 76   PRO B CA  1 
ATOM   1579 C C   . PRO B 1 74  ? -16.914 -22.469 66.770 1.00 67.38 ? 76   PRO B C   1 
ATOM   1580 O O   . PRO B 1 74  ? -16.951 -23.675 66.511 1.00 67.68 ? 76   PRO B O   1 
ATOM   1581 C CB  . PRO B 1 74  ? -17.055 -22.264 69.290 1.00 67.73 ? 76   PRO B CB  1 
ATOM   1582 C CG  . PRO B 1 74  ? -17.806 -20.978 69.495 1.00 66.85 ? 76   PRO B CG  1 
ATOM   1583 C CD  . PRO B 1 74  ? -16.725 -19.950 69.257 1.00 67.25 ? 76   PRO B CD  1 
ATOM   1584 N N   . GLU B 1 75  ? -17.459 -21.547 65.979 1.00 67.10 ? 77   GLU B N   1 
ATOM   1585 C CA  . GLU B 1 75  ? -18.128 -21.941 64.743 1.00 66.02 ? 77   GLU B CA  1 
ATOM   1586 C C   . GLU B 1 75  ? -17.114 -22.060 63.610 1.00 65.11 ? 77   GLU B C   1 
ATOM   1587 O O   . GLU B 1 75  ? -17.463 -22.454 62.500 1.00 65.49 ? 77   GLU B O   1 
ATOM   1588 C CB  . GLU B 1 75  ? -19.235 -20.943 64.373 1.00 66.94 ? 77   GLU B CB  1 
ATOM   1589 C CG  . GLU B 1 75  ? -20.340 -20.786 65.434 1.00 66.61 ? 77   GLU B CG  1 
ATOM   1590 C CD  . GLU B 1 75  ? -21.039 -22.097 65.785 1.00 67.31 ? 77   GLU B CD  1 
ATOM   1591 O OE1 . GLU B 1 75  ? -21.595 -22.753 64.876 1.00 66.20 ? 77   GLU B OE1 1 
ATOM   1592 O OE2 . GLU B 1 75  ? -21.034 -22.471 66.979 1.00 67.31 ? 77   GLU B OE2 1 
ATOM   1593 N N   . ILE B 1 76  ? -15.860 -21.719 63.906 1.00 63.89 ? 78   ILE B N   1 
ATOM   1594 C CA  . ILE B 1 76  ? -14.758 -21.807 62.942 1.00 62.51 ? 78   ILE B CA  1 
ATOM   1595 C C   . ILE B 1 76  ? -14.363 -23.281 62.857 1.00 62.26 ? 78   ILE B C   1 
ATOM   1596 O O   . ILE B 1 76  ? -13.715 -23.795 63.767 1.00 62.55 ? 78   ILE B O   1 
ATOM   1597 C CB  . ILE B 1 76  ? -13.525 -21.002 63.429 1.00 61.89 ? 78   ILE B CB  1 
ATOM   1598 C CG1 . ILE B 1 76  ? -13.884 -19.522 63.573 1.00 60.20 ? 78   ILE B CG1 1 
ATOM   1599 C CG2 . ILE B 1 76  ? -12.370 -21.174 62.457 1.00 61.74 ? 78   ILE B CG2 1 
ATOM   1600 C CD1 . ILE B 1 76  ? -14.272 -18.863 62.280 1.00 58.86 ? 78   ILE B CD1 1 
ATOM   1601 N N   . ASN B 1 77  ? -14.740 -23.966 61.779 1.00 61.65 ? 79   ASN B N   1 
ATOM   1602 C CA  . ASN B 1 77  ? -14.423 -25.388 61.677 1.00 60.68 ? 79   ASN B CA  1 
ATOM   1603 C C   . ASN B 1 77  ? -12.942 -25.672 61.460 1.00 60.16 ? 79   ASN B C   1 
ATOM   1604 O O   . ASN B 1 77  ? -12.322 -25.166 60.520 1.00 59.73 ? 79   ASN B O   1 
ATOM   1605 C CB  . ASN B 1 77  ? -15.242 -26.056 60.573 1.00 61.65 ? 79   ASN B CB  1 
ATOM   1606 C CG  . ASN B 1 77  ? -14.633 -25.873 59.210 1.00 62.33 ? 79   ASN B CG  1 
ATOM   1607 O OD1 . ASN B 1 77  ? -14.540 -24.757 58.708 1.00 63.70 ? 79   ASN B OD1 1 
ATOM   1608 N ND2 . ASN B 1 77  ? -14.205 -26.974 58.601 1.00 62.79 ? 79   ASN B ND2 1 
ATOM   1609 N N   . PRO B 1 78  ? -12.364 -26.513 62.331 1.00 58.84 ? 80   PRO B N   1 
ATOM   1610 C CA  . PRO B 1 78  ? -10.962 -26.952 62.355 1.00 57.54 ? 80   PRO B CA  1 
ATOM   1611 C C   . PRO B 1 78  ? -10.354 -27.374 61.011 1.00 55.75 ? 80   PRO B C   1 
ATOM   1612 O O   . PRO B 1 78  ? -9.196  -27.069 60.735 1.00 55.39 ? 80   PRO B O   1 
ATOM   1613 C CB  . PRO B 1 78  ? -10.983 -28.109 63.348 1.00 57.66 ? 80   PRO B CB  1 
ATOM   1614 C CG  . PRO B 1 78  ? -12.078 -27.720 64.289 1.00 59.12 ? 80   PRO B CG  1 
ATOM   1615 C CD  . PRO B 1 78  ? -13.148 -27.230 63.352 1.00 58.63 ? 80   PRO B CD  1 
ATOM   1616 N N   . GLU B 1 79  ? -11.121 -28.086 60.187 1.00 53.81 ? 81   GLU B N   1 
ATOM   1617 C CA  . GLU B 1 79  ? -10.598 -28.533 58.902 1.00 52.21 ? 81   GLU B CA  1 
ATOM   1618 C C   . GLU B 1 79  ? -10.284 -27.323 58.027 1.00 50.85 ? 81   GLU B C   1 
ATOM   1619 O O   . GLU B 1 79  ? -9.193  -27.221 57.461 1.00 49.85 ? 81   GLU B O   1 
ATOM   1620 C CB  . GLU B 1 79  ? -11.596 -29.435 58.175 1.00 51.47 ? 81   GLU B CB  1 
ATOM   1621 C CG  . GLU B 1 79  ? -11.022 -30.002 56.891 1.00 51.93 ? 81   GLU B CG  1 
ATOM   1622 C CD  . GLU B 1 79  ? -12.071 -30.528 55.936 1.00 52.86 ? 81   GLU B CD  1 
ATOM   1623 O OE1 . GLU B 1 79  ? -13.083 -29.826 55.716 1.00 52.29 ? 81   GLU B OE1 1 
ATOM   1624 O OE2 . GLU B 1 79  ? -11.868 -31.635 55.384 1.00 53.51 ? 81   GLU B OE2 1 
ATOM   1625 N N   . GLY B 1 80  ? -11.255 -26.416 57.924 1.00 49.34 ? 82   GLY B N   1 
ATOM   1626 C CA  . GLY B 1 80  ? -11.074 -25.213 57.134 1.00 45.71 ? 82   GLY B CA  1 
ATOM   1627 C C   . GLY B 1 80  ? -9.853  -24.449 57.612 1.00 44.11 ? 82   GLY B C   1 
ATOM   1628 O O   . GLY B 1 80  ? -9.064  -23.955 56.804 1.00 44.49 ? 82   GLY B O   1 
ATOM   1629 N N   . PHE B 1 81  ? -9.689  -24.361 58.930 1.00 40.52 ? 83   PHE B N   1 
ATOM   1630 C CA  . PHE B 1 81  ? -8.553  -23.659 59.505 1.00 38.78 ? 83   PHE B CA  1 
ATOM   1631 C C   . PHE B 1 81  ? -7.225  -24.365 59.236 1.00 38.51 ? 83   PHE B C   1 
ATOM   1632 O O   . PHE B 1 81  ? -6.227  -23.723 58.888 1.00 39.18 ? 83   PHE B O   1 
ATOM   1633 C CB  . PHE B 1 81  ? -8.712  -23.511 61.016 1.00 36.96 ? 83   PHE B CB  1 
ATOM   1634 C CG  . PHE B 1 81  ? -7.578  -22.770 61.659 1.00 34.51 ? 83   PHE B CG  1 
ATOM   1635 C CD1 . PHE B 1 81  ? -7.479  -21.382 61.535 1.00 34.27 ? 83   PHE B CD1 1 
ATOM   1636 C CD2 . PHE B 1 81  ? -6.569  -23.459 62.320 1.00 32.88 ? 83   PHE B CD2 1 
ATOM   1637 C CE1 . PHE B 1 81  ? -6.387  -20.694 62.057 1.00 31.17 ? 83   PHE B CE1 1 
ATOM   1638 C CE2 . PHE B 1 81  ? -5.469  -22.780 62.846 1.00 32.09 ? 83   PHE B CE2 1 
ATOM   1639 C CZ  . PHE B 1 81  ? -5.377  -21.395 62.713 1.00 32.44 ? 83   PHE B CZ  1 
ATOM   1640 N N   . ASN B 1 82  ? -7.218  -25.682 59.423 1.00 36.31 ? 84   ASN B N   1 
ATOM   1641 C CA  . ASN B 1 82  ? -6.024  -26.491 59.222 1.00 34.27 ? 84   ASN B CA  1 
ATOM   1642 C C   . ASN B 1 82  ? -5.508  -26.402 57.775 1.00 32.11 ? 84   ASN B C   1 
ATOM   1643 O O   . ASN B 1 82  ? -4.307  -26.362 57.537 1.00 29.57 ? 84   ASN B O   1 
ATOM   1644 C CB  . ASN B 1 82  ? -6.328  -27.936 59.614 1.00 34.21 ? 84   ASN B CB  1 
ATOM   1645 C CG  . ASN B 1 82  ? -5.141  -28.857 59.415 1.00 34.99 ? 84   ASN B CG  1 
ATOM   1646 O OD1 . ASN B 1 82  ? -5.035  -29.567 58.405 1.00 34.10 ? 84   ASN B OD1 1 
ATOM   1647 N ND2 . ASN B 1 82  ? -4.232  -28.845 60.378 1.00 36.06 ? 84   ASN B ND2 1 
ATOM   1648 N N   . ILE B 1 83  ? -6.428  -26.355 56.822 1.00 31.94 ? 85   ILE B N   1 
ATOM   1649 C CA  . ILE B 1 83  ? -6.086  -26.240 55.405 1.00 31.87 ? 85   ILE B CA  1 
ATOM   1650 C C   . ILE B 1 83  ? -5.356  -24.905 55.134 1.00 32.93 ? 85   ILE B C   1 
ATOM   1651 O O   . ILE B 1 83  ? -4.387  -24.857 54.363 1.00 31.11 ? 85   ILE B O   1 
ATOM   1652 C CB  . ILE B 1 83  ? -7.360  -26.338 54.568 1.00 31.26 ? 85   ILE B CB  1 
ATOM   1653 C CG1 . ILE B 1 83  ? -7.815  -27.806 54.523 1.00 31.63 ? 85   ILE B CG1 1 
ATOM   1654 C CG2 . ILE B 1 83  ? -7.148  -25.718 53.195 1.00 30.90 ? 85   ILE B CG2 1 
ATOM   1655 C CD1 . ILE B 1 83  ? -9.205  -28.025 53.874 1.00 31.23 ? 85   ILE B CD1 1 
ATOM   1656 N N   . LEU B 1 84  ? -5.827  -23.838 55.783 1.00 32.80 ? 86   LEU B N   1 
ATOM   1657 C CA  . LEU B 1 84  ? -5.231  -22.502 55.676 1.00 32.37 ? 86   LEU B CA  1 
ATOM   1658 C C   . LEU B 1 84  ? -3.897  -22.428 56.429 1.00 32.02 ? 86   LEU B C   1 
ATOM   1659 O O   . LEU B 1 84  ? -2.971  -21.731 56.019 1.00 31.14 ? 86   LEU B O   1 
ATOM   1660 C CB  . LEU B 1 84  ? -6.166  -21.457 56.273 1.00 31.18 ? 86   LEU B CB  1 
ATOM   1661 C CG  . LEU B 1 84  ? -7.422  -21.116 55.486 1.00 32.43 ? 86   LEU B CG  1 
ATOM   1662 C CD1 . LEU B 1 84  ? -8.359  -20.247 56.338 1.00 30.66 ? 86   LEU B CD1 1 
ATOM   1663 C CD2 . LEU B 1 84  ? -7.008  -20.401 54.203 1.00 33.28 ? 86   LEU B CD2 1 
ATOM   1664 N N   . LEU B 1 85  ? -3.811  -23.135 57.549 1.00 31.10 ? 87   LEU B N   1 
ATOM   1665 C CA  . LEU B 1 85  ? -2.588  -23.132 58.333 1.00 28.29 ? 87   LEU B CA  1 
ATOM   1666 C C   . LEU B 1 85  ? -1.486  -23.806 57.535 1.00 27.90 ? 87   LEU B C   1 
ATOM   1667 O O   . LEU B 1 85  ? -0.340  -23.345 57.536 1.00 28.14 ? 87   LEU B O   1 
ATOM   1668 C CB  . LEU B 1 85  ? -2.803  -23.876 59.639 1.00 29.46 ? 87   LEU B CB  1 
ATOM   1669 C CG  . LEU B 1 85  ? -1.533  -24.140 60.450 1.00 33.64 ? 87   LEU B CG  1 
ATOM   1670 C CD1 . LEU B 1 85  ? -0.903  -22.825 60.911 1.00 32.69 ? 87   LEU B CD1 1 
ATOM   1671 C CD2 . LEU B 1 85  ? -1.889  -25.025 61.646 1.00 34.42 ? 87   LEU B CD2 1 
ATOM   1672 N N   . ASP B 1 86  ? -1.850  -24.908 56.876 1.00 25.12 ? 88   ASP B N   1 
ATOM   1673 C CA  . ASP B 1 86  ? -0.939  -25.678 56.044 1.00 24.50 ? 88   ASP B CA  1 
ATOM   1674 C C   . ASP B 1 86  ? -0.448  -24.784 54.939 1.00 21.32 ? 88   ASP B C   1 
ATOM   1675 O O   . ASP B 1 86  ? 0.747   -24.665 54.713 1.00 21.25 ? 88   ASP B O   1 
ATOM   1676 C CB  . ASP B 1 86  ? -1.645  -26.872 55.409 1.00 26.79 ? 88   ASP B CB  1 
ATOM   1677 C CG  . ASP B 1 86  ? -1.309  -28.167 56.092 1.00 31.85 ? 88   ASP B CG  1 
ATOM   1678 O OD1 . ASP B 1 86  ? -0.183  -28.272 56.621 1.00 32.06 ? 88   ASP B OD1 1 
ATOM   1679 O OD2 . ASP B 1 86  ? -2.169  -29.080 56.085 1.00 35.57 ? 88   ASP B OD2 1 
ATOM   1680 N N   . PHE B 1 87  ? -1.406  -24.187 54.244 1.00 19.64 ? 89   PHE B N   1 
ATOM   1681 C CA  . PHE B 1 87  ? -1.148  -23.256 53.166 1.00 18.44 ? 89   PHE B CA  1 
ATOM   1682 C C   . PHE B 1 87  ? -0.095  -22.227 53.585 1.00 17.29 ? 89   PHE B C   1 
ATOM   1683 O O   . PHE B 1 87  ? 0.838   -21.947 52.828 1.00 14.94 ? 89   PHE B O   1 
ATOM   1684 C CB  . PHE B 1 87  ? -2.440  -22.526 52.799 1.00 18.55 ? 89   PHE B CB  1 
ATOM   1685 C CG  . PHE B 1 87  ? -2.206  -21.175 52.206 1.00 18.85 ? 89   PHE B CG  1 
ATOM   1686 C CD1 . PHE B 1 87  ? -1.787  -21.047 50.898 1.00 16.34 ? 89   PHE B CD1 1 
ATOM   1687 C CD2 . PHE B 1 87  ? -2.319  -20.023 52.994 1.00 18.76 ? 89   PHE B CD2 1 
ATOM   1688 C CE1 . PHE B 1 87  ? -1.474  -19.800 50.379 1.00 18.24 ? 89   PHE B CE1 1 
ATOM   1689 C CE2 . PHE B 1 87  ? -2.006  -18.774 52.476 1.00 18.87 ? 89   PHE B CE2 1 
ATOM   1690 C CZ  . PHE B 1 87  ? -1.581  -18.664 51.164 1.00 16.16 ? 89   PHE B CZ  1 
ATOM   1691 N N   . MET B 1 88  ? -0.273  -21.672 54.786 1.00 15.53 ? 90   MET B N   1 
ATOM   1692 C CA  . MET B 1 88  ? 0.629   -20.669 55.344 1.00 16.27 ? 90   MET B CA  1 
ATOM   1693 C C   . MET B 1 88  ? 2.079   -21.137 55.323 1.00 16.78 ? 90   MET B C   1 
ATOM   1694 O O   . MET B 1 88  ? 2.973   -20.406 54.898 1.00 16.61 ? 90   MET B O   1 
ATOM   1695 C CB  . MET B 1 88  ? 0.256   -20.339 56.797 1.00 18.37 ? 90   MET B CB  1 
ATOM   1696 C CG  . MET B 1 88  ? -1.005  -19.522 56.998 1.00 18.86 ? 90   MET B CG  1 
ATOM   1697 S SD  . MET B 1 88  ? -1.105  -18.894 58.713 1.00 24.63 ? 90   MET B SD  1 
ATOM   1698 C CE  . MET B 1 88  ? -2.806  -18.203 58.688 1.00 22.66 ? 90   MET B CE  1 
ATOM   1699 N N   . TYR B 1 89  ? 2.293   -22.368 55.776 1.00 17.59 ? 91   TYR B N   1 
ATOM   1700 C CA  . TYR B 1 89  ? 3.622   -22.958 55.850 1.00 19.72 ? 91   TYR B CA  1 
ATOM   1701 C C   . TYR B 1 89  ? 4.148   -23.705 54.626 1.00 19.72 ? 91   TYR B C   1 
ATOM   1702 O O   . TYR B 1 89  ? 5.295   -24.154 54.644 1.00 21.17 ? 91   TYR B O   1 
ATOM   1703 C CB  . TYR B 1 89  ? 3.702   -23.909 57.051 1.00 21.36 ? 91   TYR B CB  1 
ATOM   1704 C CG  . TYR B 1 89  ? 3.890   -23.225 58.380 1.00 20.44 ? 91   TYR B CG  1 
ATOM   1705 C CD1 . TYR B 1 89  ? 2.796   -22.725 59.096 1.00 24.18 ? 91   TYR B CD1 1 
ATOM   1706 C CD2 . TYR B 1 89  ? 5.153   -23.103 58.936 1.00 19.38 ? 91   TYR B CD2 1 
ATOM   1707 C CE1 . TYR B 1 89  ? 2.963   -22.119 60.363 1.00 25.08 ? 91   TYR B CE1 1 
ATOM   1708 C CE2 . TYR B 1 89  ? 5.341   -22.502 60.186 1.00 25.19 ? 91   TYR B CE2 1 
ATOM   1709 C CZ  . TYR B 1 89  ? 4.238   -22.017 60.898 1.00 25.92 ? 91   TYR B CZ  1 
ATOM   1710 O OH  . TYR B 1 89  ? 4.425   -21.468 62.147 1.00 29.36 ? 91   TYR B OH  1 
ATOM   1711 N N   . THR B 1 90  ? 3.339   -23.831 53.576 1.00 18.97 ? 92   THR B N   1 
ATOM   1712 C CA  . THR B 1 90  ? 3.750   -24.574 52.380 1.00 19.22 ? 92   THR B CA  1 
ATOM   1713 C C   . THR B 1 90  ? 3.454   -23.916 51.015 1.00 18.69 ? 92   THR B C   1 
ATOM   1714 O O   . THR B 1 90  ? 3.927   -24.413 50.002 1.00 18.76 ? 92   THR B O   1 
ATOM   1715 C CB  . THR B 1 90  ? 3.044   -25.950 52.306 1.00 17.28 ? 92   THR B CB  1 
ATOM   1716 O OG1 . THR B 1 90  ? 1.661   -25.733 52.028 1.00 15.95 ? 92   THR B OG1 1 
ATOM   1717 C CG2 . THR B 1 90  ? 3.169   -26.718 53.607 1.00 17.11 ? 92   THR B CG2 1 
ATOM   1718 N N   . SER B 1 91  ? 2.669   -22.838 50.983 1.00 18.44 ? 93   SER B N   1 
ATOM   1719 C CA  . SER B 1 91  ? 2.275   -22.171 49.716 1.00 21.11 ? 93   SER B CA  1 
ATOM   1720 C C   . SER B 1 91  ? 1.191   -22.964 48.963 1.00 19.96 ? 93   SER B C   1 
ATOM   1721 O O   . SER B 1 91  ? 0.722   -22.539 47.914 1.00 18.35 ? 93   SER B O   1 
ATOM   1722 C CB  . SER B 1 91  ? 3.466   -21.984 48.753 1.00 21.16 ? 93   SER B CB  1 
ATOM   1723 O OG  . SER B 1 91  ? 4.490   -21.204 49.352 1.00 25.51 ? 93   SER B OG  1 
ATOM   1724 N N   . ARG B 1 92  ? 0.809   -24.122 49.494 1.00 21.26 ? 94   ARG B N   1 
ATOM   1725 C CA  . ARG B 1 92  ? -0.201  -24.957 48.851 1.00 22.87 ? 94   ARG B CA  1 
ATOM   1726 C C   . ARG B 1 92  ? -1.499  -24.971 49.639 1.00 21.17 ? 94   ARG B C   1 
ATOM   1727 O O   . ARG B 1 92  ? -1.502  -25.117 50.853 1.00 21.51 ? 94   ARG B O   1 
ATOM   1728 C CB  . ARG B 1 92  ? 0.306   -26.402 48.676 1.00 22.36 ? 94   ARG B CB  1 
ATOM   1729 C CG  . ARG B 1 92  ? 1.450   -26.554 47.708 1.00 25.49 ? 94   ARG B CG  1 
ATOM   1730 C CD  . ARG B 1 92  ? 2.221   -27.823 48.012 1.00 30.58 ? 94   ARG B CD  1 
ATOM   1731 N NE  . ARG B 1 92  ? 3.462   -27.915 47.250 1.00 36.75 ? 94   ARG B NE  1 
ATOM   1732 C CZ  . ARG B 1 92  ? 3.579   -28.474 46.046 1.00 39.30 ? 94   ARG B CZ  1 
ATOM   1733 N NH1 . ARG B 1 92  ? 2.526   -29.010 45.440 1.00 39.00 ? 94   ARG B NH1 1 
ATOM   1734 N NH2 . ARG B 1 92  ? 4.763   -28.492 45.443 1.00 42.11 ? 94   ARG B NH2 1 
ATOM   1735 N N   . LEU B 1 93  ? -2.597  -24.830 48.912 1.00 23.68 ? 95   LEU B N   1 
ATOM   1736 C CA  . LEU B 1 93  ? -3.927  -24.805 49.486 1.00 25.30 ? 95   LEU B CA  1 
ATOM   1737 C C   . LEU B 1 93  ? -4.689  -26.018 48.961 1.00 27.15 ? 95   LEU B C   1 
ATOM   1738 O O   . LEU B 1 93  ? -4.944  -26.122 47.757 1.00 27.57 ? 95   LEU B O   1 
ATOM   1739 C CB  . LEU B 1 93  ? -4.640  -23.505 49.087 1.00 21.35 ? 95   LEU B CB  1 
ATOM   1740 C CG  . LEU B 1 93  ? -6.056  -23.282 49.648 1.00 21.39 ? 95   LEU B CG  1 
ATOM   1741 C CD1 . LEU B 1 93  ? -6.020  -23.091 51.147 1.00 19.92 ? 95   LEU B CD1 1 
ATOM   1742 C CD2 . LEU B 1 93  ? -6.659  -22.058 48.998 1.00 24.05 ? 95   LEU B CD2 1 
ATOM   1743 N N   . ASN B 1 94  ? -5.046  -26.933 49.864 1.00 28.14 ? 96   ASN B N   1 
ATOM   1744 C CA  . ASN B 1 94  ? -5.780  -28.143 49.472 1.00 30.56 ? 96   ASN B CA  1 
ATOM   1745 C C   . ASN B 1 94  ? -7.281  -27.975 49.576 1.00 30.41 ? 96   ASN B C   1 
ATOM   1746 O O   . ASN B 1 94  ? -7.810  -27.763 50.656 1.00 32.78 ? 96   ASN B O   1 
ATOM   1747 C CB  . ASN B 1 94  ? -5.322  -29.321 50.321 1.00 28.88 ? 96   ASN B CB  1 
ATOM   1748 C CG  . ASN B 1 94  ? -3.897  -29.716 50.010 1.00 31.03 ? 96   ASN B CG  1 
ATOM   1749 O OD1 . ASN B 1 94  ? -3.098  -29.987 50.903 1.00 30.55 ? 96   ASN B OD1 1 
ATOM   1750 N ND2 . ASN B 1 94  ? -3.568  -29.743 48.725 1.00 32.61 ? 96   ASN B ND2 1 
ATOM   1751 N N   . LEU B 1 95  ? -7.964  -28.088 48.447 1.00 33.48 ? 97   LEU B N   1 
ATOM   1752 C CA  . LEU B 1 95  ? -9.416  -27.915 48.408 1.00 37.29 ? 97   LEU B CA  1 
ATOM   1753 C C   . LEU B 1 95  ? -10.225 -29.080 47.819 1.00 40.90 ? 97   LEU B C   1 
ATOM   1754 O O   . LEU B 1 95  ? -9.886  -29.657 46.770 1.00 40.89 ? 97   LEU B O   1 
ATOM   1755 C CB  . LEU B 1 95  ? -9.772  -26.659 47.606 1.00 35.94 ? 97   LEU B CB  1 
ATOM   1756 C CG  . LEU B 1 95  ? -9.043  -25.345 47.870 1.00 32.49 ? 97   LEU B CG  1 
ATOM   1757 C CD1 . LEU B 1 95  ? -9.602  -24.304 46.936 1.00 32.05 ? 97   LEU B CD1 1 
ATOM   1758 C CD2 . LEU B 1 95  ? -9.206  -24.909 49.318 1.00 34.40 ? 97   LEU B CD2 1 
ATOM   1759 N N   . ARG B 1 96  ? -11.307 -29.410 48.513 1.00 44.24 ? 98   ARG B N   1 
ATOM   1760 C CA  . ARG B 1 96  ? -12.218 -30.446 48.070 1.00 47.84 ? 98   ARG B CA  1 
ATOM   1761 C C   . ARG B 1 96  ? -13.496 -29.698 47.750 1.00 48.57 ? 98   ARG B C   1 
ATOM   1762 O O   . ARG B 1 96  ? -13.809 -28.689 48.382 1.00 48.45 ? 98   ARG B O   1 
ATOM   1763 C CB  . ARG B 1 96  ? -12.452 -31.482 49.170 1.00 49.65 ? 98   ARG B CB  1 
ATOM   1764 C CG  . ARG B 1 96  ? -11.195 -32.221 49.519 1.00 52.93 ? 98   ARG B CG  1 
ATOM   1765 C CD  . ARG B 1 96  ? -11.441 -33.590 50.096 1.00 56.08 ? 98   ARG B CD  1 
ATOM   1766 N NE  . ARG B 1 96  ? -10.210 -34.373 50.002 1.00 59.98 ? 98   ARG B NE  1 
ATOM   1767 C CZ  . ARG B 1 96  ? -10.035 -35.598 50.491 1.00 61.56 ? 98   ARG B CZ  1 
ATOM   1768 N NH1 . ARG B 1 96  ? -11.022 -36.216 51.134 1.00 62.52 ? 98   ARG B NH1 1 
ATOM   1769 N NH2 . ARG B 1 96  ? -8.867  -36.212 50.324 1.00 61.83 ? 98   ARG B NH2 1 
ATOM   1770 N N   . GLU B 1 97  ? -14.221 -30.181 46.756 1.00 50.11 ? 99   GLU B N   1 
ATOM   1771 C CA  . GLU B 1 97  ? -15.461 -29.539 46.341 1.00 52.10 ? 99   GLU B CA  1 
ATOM   1772 C C   . GLU B 1 97  ? -16.434 -29.317 47.504 1.00 50.71 ? 99   GLU B C   1 
ATOM   1773 O O   . GLU B 1 97  ? -17.347 -28.494 47.413 1.00 50.07 ? 99   GLU B O   1 
ATOM   1774 C CB  . GLU B 1 97  ? -16.127 -30.389 45.259 1.00 54.99 ? 99   GLU B CB  1 
ATOM   1775 C CG  . GLU B 1 97  ? -16.998 -29.610 44.303 1.00 58.97 ? 99   GLU B CG  1 
ATOM   1776 C CD  . GLU B 1 97  ? -17.480 -30.473 43.161 1.00 61.30 ? 99   GLU B CD  1 
ATOM   1777 O OE1 . GLU B 1 97  ? -18.260 -31.419 43.427 1.00 62.38 ? 99   GLU B OE1 1 
ATOM   1778 O OE2 . GLU B 1 97  ? -17.069 -30.211 42.005 1.00 61.94 ? 99   GLU B OE2 1 
ATOM   1779 N N   . GLY B 1 98  ? -16.233 -30.048 48.595 1.00 48.64 ? 100  GLY B N   1 
ATOM   1780 C CA  . GLY B 1 98  ? -17.116 -29.908 49.732 1.00 46.95 ? 100  GLY B CA  1 
ATOM   1781 C C   . GLY B 1 98  ? -16.654 -28.975 50.831 1.00 46.87 ? 100  GLY B C   1 
ATOM   1782 O O   . GLY B 1 98  ? -17.458 -28.593 51.671 1.00 46.95 ? 100  GLY B O   1 
ATOM   1783 N N   . ASN B 1 99  ? -15.376 -28.598 50.849 1.00 46.83 ? 101  ASN B N   1 
ATOM   1784 C CA  . ASN B 1 99  ? -14.890 -27.714 51.905 1.00 45.44 ? 101  ASN B CA  1 
ATOM   1785 C C   . ASN B 1 99  ? -14.405 -26.354 51.419 1.00 44.76 ? 101  ASN B C   1 
ATOM   1786 O O   . ASN B 1 99  ? -13.974 -25.523 52.218 1.00 44.31 ? 101  ASN B O   1 
ATOM   1787 C CB  . ASN B 1 99  ? -13.776 -28.397 52.709 1.00 45.22 ? 101  ASN B CB  1 
ATOM   1788 C CG  . ASN B 1 99  ? -12.623 -28.858 51.840 1.00 46.97 ? 101  ASN B CG  1 
ATOM   1789 O OD1 . ASN B 1 99  ? -12.527 -28.484 50.670 1.00 48.74 ? 101  ASN B OD1 1 
ATOM   1790 N ND2 . ASN B 1 99  ? -11.731 -29.666 52.412 1.00 45.48 ? 101  ASN B ND2 1 
ATOM   1791 N N   . ILE B 1 100 ? -14.495 -26.117 50.116 1.00 43.34 ? 102  ILE B N   1 
ATOM   1792 C CA  . ILE B 1 100 ? -14.036 -24.854 49.568 1.00 43.21 ? 102  ILE B CA  1 
ATOM   1793 C C   . ILE B 1 100 ? -14.770 -23.667 50.211 1.00 43.32 ? 102  ILE B C   1 
ATOM   1794 O O   . ILE B 1 100 ? -14.128 -22.801 50.818 1.00 42.25 ? 102  ILE B O   1 
ATOM   1795 C CB  . ILE B 1 100 ? -14.171 -24.860 48.016 1.00 44.58 ? 102  ILE B CB  1 
ATOM   1796 C CG1 . ILE B 1 100 ? -13.369 -23.707 47.399 1.00 45.82 ? 102  ILE B CG1 1 
ATOM   1797 C CG2 . ILE B 1 100 ? -15.627 -24.861 47.605 1.00 45.09 ? 102  ILE B CG2 1 
ATOM   1798 C CD1 . ILE B 1 100 ? -13.709 -22.332 47.904 1.00 47.89 ? 102  ILE B CD1 1 
ATOM   1799 N N   . MET B 1 101 ? -16.100 -23.629 50.104 1.00 41.73 ? 103  MET B N   1 
ATOM   1800 C CA  . MET B 1 101 ? -16.874 -22.535 50.697 1.00 41.04 ? 103  MET B CA  1 
ATOM   1801 C C   . MET B 1 101 ? -16.493 -22.326 52.150 1.00 39.10 ? 103  MET B C   1 
ATOM   1802 O O   . MET B 1 101 ? -16.353 -21.190 52.613 1.00 38.27 ? 103  MET B O   1 
ATOM   1803 C CB  . MET B 1 101 ? -18.378 -22.809 50.629 1.00 41.90 ? 103  MET B CB  1 
ATOM   1804 C CG  . MET B 1 101 ? -18.958 -22.862 49.231 1.00 42.13 ? 103  MET B CG  1 
ATOM   1805 S SD  . MET B 1 101 ? -18.624 -21.391 48.244 1.00 44.92 ? 103  MET B SD  1 
ATOM   1806 C CE  . MET B 1 101 ? -17.891 -22.144 46.838 1.00 44.57 ? 103  MET B CE  1 
ATOM   1807 N N   . ALA B 1 102 ? -16.330 -23.422 52.878 1.00 38.29 ? 104  ALA B N   1 
ATOM   1808 C CA  . ALA B 1 102 ? -15.954 -23.314 54.280 1.00 38.19 ? 104  ALA B CA  1 
ATOM   1809 C C   . ALA B 1 102 ? -14.619 -22.584 54.397 1.00 38.50 ? 104  ALA B C   1 
ATOM   1810 O O   . ALA B 1 102 ? -14.445 -21.726 55.265 1.00 39.15 ? 104  ALA B O   1 
ATOM   1811 C CB  . ALA B 1 102 ? -15.846 -24.697 54.902 1.00 39.24 ? 104  ALA B CB  1 
ATOM   1812 N N   . VAL B 1 103 ? -13.686 -22.935 53.508 1.00 36.74 ? 105  VAL B N   1 
ATOM   1813 C CA  . VAL B 1 103 ? -12.346 -22.343 53.481 1.00 35.43 ? 105  VAL B CA  1 
ATOM   1814 C C   . VAL B 1 103 ? -12.393 -20.833 53.253 1.00 34.95 ? 105  VAL B C   1 
ATOM   1815 O O   . VAL B 1 103 ? -11.745 -20.072 53.977 1.00 33.67 ? 105  VAL B O   1 
ATOM   1816 C CB  . VAL B 1 103 ? -11.472 -23.012 52.374 1.00 35.32 ? 105  VAL B CB  1 
ATOM   1817 C CG1 . VAL B 1 103 ? -10.127 -22.296 52.244 1.00 33.61 ? 105  VAL B CG1 1 
ATOM   1818 C CG2 . VAL B 1 103 ? -11.255 -24.487 52.709 1.00 31.66 ? 105  VAL B CG2 1 
ATOM   1819 N N   . MET B 1 104 ? -13.166 -20.407 52.255 1.00 35.28 ? 106  MET B N   1 
ATOM   1820 C CA  . MET B 1 104 ? -13.299 -18.988 51.942 1.00 37.67 ? 106  MET B CA  1 
ATOM   1821 C C   . MET B 1 104 ? -13.829 -18.288 53.172 1.00 38.05 ? 106  MET B C   1 
ATOM   1822 O O   . MET B 1 104 ? -13.310 -17.258 53.600 1.00 38.37 ? 106  MET B O   1 
ATOM   1823 C CB  . MET B 1 104 ? -14.273 -18.772 50.784 1.00 41.03 ? 106  MET B CB  1 
ATOM   1824 C CG  . MET B 1 104 ? -13.820 -19.363 49.463 1.00 44.48 ? 106  MET B CG  1 
ATOM   1825 S SD  . MET B 1 104 ? -15.017 -19.106 48.110 1.00 52.70 ? 106  MET B SD  1 
ATOM   1826 C CE  . MET B 1 104 ? -14.369 -17.571 47.292 1.00 50.13 ? 106  MET B CE  1 
ATOM   1827 N N   . ALA B 1 105 ? -14.878 -18.869 53.737 1.00 38.54 ? 107  ALA B N   1 
ATOM   1828 C CA  . ALA B 1 105 ? -15.499 -18.335 54.936 1.00 37.26 ? 107  ALA B CA  1 
ATOM   1829 C C   . ALA B 1 105 ? -14.458 -18.185 56.039 1.00 35.34 ? 107  ALA B C   1 
ATOM   1830 O O   . ALA B 1 105 ? -14.383 -17.149 56.688 1.00 35.64 ? 107  ALA B O   1 
ATOM   1831 C CB  . ALA B 1 105 ? -16.617 -19.267 55.390 1.00 38.61 ? 107  ALA B CB  1 
ATOM   1832 N N   . THR B 1 106 ? -13.648 -19.219 56.247 1.00 35.41 ? 108  THR B N   1 
ATOM   1833 C CA  . THR B 1 106 ? -12.615 -19.187 57.293 1.00 33.44 ? 108  THR B CA  1 
ATOM   1834 C C   . THR B 1 106 ? -11.528 -18.140 57.021 1.00 32.98 ? 108  THR B C   1 
ATOM   1835 O O   . THR B 1 106 ? -11.100 -17.407 57.917 1.00 32.76 ? 108  THR B O   1 
ATOM   1836 C CB  . THR B 1 106 ? -11.926 -20.558 57.428 1.00 34.08 ? 108  THR B CB  1 
ATOM   1837 O OG1 . THR B 1 106 ? -12.905 -21.606 57.303 1.00 32.70 ? 108  THR B OG1 1 
ATOM   1838 C CG2 . THR B 1 106 ? -11.213 -20.669 58.779 1.00 30.52 ? 108  THR B CG2 1 
ATOM   1839 N N   . ALA B 1 107 ? -11.075 -18.075 55.776 1.00 34.24 ? 109  ALA B N   1 
ATOM   1840 C CA  . ALA B 1 107 ? -10.036 -17.122 55.411 1.00 34.68 ? 109  ALA B CA  1 
ATOM   1841 C C   . ALA B 1 107 ? -10.537 -15.694 55.632 1.00 35.03 ? 109  ALA B C   1 
ATOM   1842 O O   . ALA B 1 107 ? -9.756  -14.826 56.049 1.00 33.65 ? 109  ALA B O   1 
ATOM   1843 C CB  . ALA B 1 107 ? -9.603  -17.335 53.938 1.00 33.06 ? 109  ALA B CB  1 
ATOM   1844 N N   . MET B 1 108 ? -11.821 -15.457 55.339 1.00 35.56 ? 110  MET B N   1 
ATOM   1845 C CA  . MET B 1 108 ? -12.437 -14.133 55.527 1.00 36.99 ? 110  MET B CA  1 
ATOM   1846 C C   . MET B 1 108 ? -12.230 -13.740 56.983 1.00 37.59 ? 110  MET B C   1 
ATOM   1847 O O   . MET B 1 108 ? -11.847 -12.607 57.292 1.00 35.56 ? 110  MET B O   1 
ATOM   1848 C CB  . MET B 1 108 ? -13.946 -14.159 55.230 1.00 38.75 ? 110  MET B CB  1 
ATOM   1849 C CG  . MET B 1 108 ? -14.363 -14.002 53.756 1.00 41.76 ? 110  MET B CG  1 
ATOM   1850 S SD  . MET B 1 108 ? -13.801 -12.455 52.904 1.00 45.50 ? 110  MET B SD  1 
ATOM   1851 C CE  . MET B 1 108 ? -14.613 -11.160 53.894 1.00 44.93 ? 110  MET B CE  1 
ATOM   1852 N N   . TYR B 1 109 ? -12.471 -14.701 57.872 1.00 38.36 ? 111  TYR B N   1 
ATOM   1853 C CA  . TYR B 1 109 ? -12.298 -14.490 59.312 1.00 39.46 ? 111  TYR B CA  1 
ATOM   1854 C C   . TYR B 1 109 ? -10.848 -14.139 59.661 1.00 37.66 ? 111  TYR B C   1 
ATOM   1855 O O   . TYR B 1 109 ? -10.578 -13.216 60.430 1.00 38.32 ? 111  TYR B O   1 
ATOM   1856 C CB  . TYR B 1 109 ? -12.715 -15.754 60.073 1.00 41.33 ? 111  TYR B CB  1 
ATOM   1857 C CG  . TYR B 1 109 ? -12.401 -15.714 61.553 1.00 44.36 ? 111  TYR B CG  1 
ATOM   1858 C CD1 . TYR B 1 109 ? -13.032 -14.795 62.401 1.00 46.66 ? 111  TYR B CD1 1 
ATOM   1859 C CD2 . TYR B 1 109 ? -11.469 -16.591 62.108 1.00 45.29 ? 111  TYR B CD2 1 
ATOM   1860 C CE1 . TYR B 1 109 ? -12.743 -14.751 63.765 1.00 46.91 ? 111  TYR B CE1 1 
ATOM   1861 C CE2 . TYR B 1 109 ? -11.169 -16.560 63.470 1.00 47.24 ? 111  TYR B CE2 1 
ATOM   1862 C CZ  . TYR B 1 109 ? -11.811 -15.637 64.295 1.00 48.28 ? 111  TYR B CZ  1 
ATOM   1863 O OH  . TYR B 1 109 ? -11.524 -15.614 65.643 1.00 47.91 ? 111  TYR B OH  1 
ATOM   1864 N N   . LEU B 1 110 ? -9.918  -14.889 59.088 1.00 36.62 ? 112  LEU B N   1 
ATOM   1865 C CA  . LEU B 1 110 ? -8.494  -14.664 59.329 1.00 34.87 ? 112  LEU B CA  1 
ATOM   1866 C C   . LEU B 1 110 ? -7.934  -13.461 58.568 1.00 33.49 ? 112  LEU B C   1 
ATOM   1867 O O   . LEU B 1 110 ? -6.762  -13.117 58.720 1.00 34.71 ? 112  LEU B O   1 
ATOM   1868 C CB  . LEU B 1 110 ? -7.708  -15.919 58.947 1.00 33.48 ? 112  LEU B CB  1 
ATOM   1869 C CG  . LEU B 1 110 ? -8.060  -17.160 59.757 1.00 31.61 ? 112  LEU B CG  1 
ATOM   1870 C CD1 . LEU B 1 110 ? -7.292  -18.339 59.225 1.00 31.76 ? 112  LEU B CD1 1 
ATOM   1871 C CD2 . LEU B 1 110 ? -7.725  -16.924 61.224 1.00 32.25 ? 112  LEU B CD2 1 
ATOM   1872 N N   . GLN B 1 111 ? -8.770  -12.822 57.757 1.00 32.63 ? 113  GLN B N   1 
ATOM   1873 C CA  . GLN B 1 111 ? -8.346  -11.671 56.975 1.00 32.01 ? 113  GLN B CA  1 
ATOM   1874 C C   . GLN B 1 111 ? -7.290  -12.064 55.936 1.00 32.06 ? 113  GLN B C   1 
ATOM   1875 O O   . GLN B 1 111 ? -6.190  -11.508 55.888 1.00 32.38 ? 113  GLN B O   1 
ATOM   1876 C CB  . GLN B 1 111 ? -7.800  -10.581 57.889 1.00 32.53 ? 113  GLN B CB  1 
ATOM   1877 C CG  . GLN B 1 111 ? -8.832  -9.974  58.793 1.00 37.51 ? 113  GLN B CG  1 
ATOM   1878 C CD  . GLN B 1 111 ? -8.243  -8.890  59.661 1.00 40.30 ? 113  GLN B CD  1 
ATOM   1879 O OE1 . GLN B 1 111 ? -7.580  -7.989  59.156 1.00 41.99 ? 113  GLN B OE1 1 
ATOM   1880 N NE2 . GLN B 1 111 ? -8.479  -8.968  60.974 1.00 40.91 ? 113  GLN B NE2 1 
ATOM   1881 N N   . MET B 1 112 ? -7.654  -13.040 55.112 1.00 31.54 ? 114  MET B N   1 
ATOM   1882 C CA  . MET B 1 112 ? -6.810  -13.544 54.040 1.00 29.58 ? 114  MET B CA  1 
ATOM   1883 C C   . MET B 1 112 ? -7.593  -13.328 52.750 1.00 29.15 ? 114  MET B C   1 
ATOM   1884 O O   . MET B 1 112 ? -8.106  -14.268 52.124 1.00 28.51 ? 114  MET B O   1 
ATOM   1885 C CB  . MET B 1 112 ? -6.492  -15.016 54.305 1.00 27.63 ? 114  MET B CB  1 
ATOM   1886 C CG  . MET B 1 112 ? -5.659  -15.168 55.583 1.00 29.35 ? 114  MET B CG  1 
ATOM   1887 S SD  . MET B 1 112 ? -5.313  -16.844 56.164 1.00 29.05 ? 114  MET B SD  1 
ATOM   1888 C CE  . MET B 1 112 ? -3.873  -17.190 55.168 1.00 31.13 ? 114  MET B CE  1 
ATOM   1889 N N   . GLU B 1 113 ? -7.679  -12.049 52.386 1.00 29.24 ? 115  GLU B N   1 
ATOM   1890 C CA  . GLU B 1 113 ? -8.406  -11.583 51.214 1.00 29.45 ? 115  GLU B CA  1 
ATOM   1891 C C   . GLU B 1 113 ? -7.948  -12.171 49.902 1.00 28.30 ? 115  GLU B C   1 
ATOM   1892 O O   . GLU B 1 113 ? -8.778  -12.558 49.063 1.00 28.44 ? 115  GLU B O   1 
ATOM   1893 C CB  . GLU B 1 113 ? -8.322  -10.055 51.112 1.00 33.53 ? 115  GLU B CB  1 
ATOM   1894 C CG  . GLU B 1 113 ? -9.393  -9.267  51.880 1.00 40.91 ? 115  GLU B CG  1 
ATOM   1895 C CD  . GLU B 1 113 ? -9.209  -9.283  53.404 1.00 45.41 ? 115  GLU B CD  1 
ATOM   1896 O OE1 . GLU B 1 113 ? -9.737  -10.198 54.086 1.00 44.97 ? 115  GLU B OE1 1 
ATOM   1897 O OE2 . GLU B 1 113 ? -8.525  -8.365  53.917 1.00 48.01 ? 115  GLU B OE2 1 
ATOM   1898 N N   . HIS B 1 114 ? -6.631  -12.219 49.707 1.00 26.95 ? 116  HIS B N   1 
ATOM   1899 C CA  . HIS B 1 114 ? -6.081  -12.747 48.464 1.00 25.03 ? 116  HIS B CA  1 
ATOM   1900 C C   . HIS B 1 114 ? -6.488  -14.195 48.267 1.00 24.35 ? 116  HIS B C   1 
ATOM   1901 O O   . HIS B 1 114 ? -6.863  -14.571 47.157 1.00 25.71 ? 116  HIS B O   1 
ATOM   1902 C CB  . HIS B 1 114 ? -4.550  -12.610 48.443 1.00 23.55 ? 116  HIS B CB  1 
ATOM   1903 C CG  . HIS B 1 114 ? -4.076  -11.186 48.432 1.00 24.25 ? 116  HIS B CG  1 
ATOM   1904 N ND1 . HIS B 1 114 ? -3.869  -10.459 49.586 1.00 24.23 ? 116  HIS B ND1 1 
ATOM   1905 C CD2 . HIS B 1 114 ? -3.716  -10.375 47.407 1.00 22.89 ? 116  HIS B CD2 1 
ATOM   1906 C CE1 . HIS B 1 114 ? -3.401  -9.264  49.272 1.00 24.37 ? 116  HIS B CE1 1 
ATOM   1907 N NE2 . HIS B 1 114 ? -3.296  -9.187  47.957 1.00 22.27 ? 116  HIS B NE2 1 
ATOM   1908 N N   . VAL B 1 115 ? -6.428  -14.997 49.330 1.00 21.93 ? 117  VAL B N   1 
ATOM   1909 C CA  . VAL B 1 115 ? -6.821  -16.397 49.244 1.00 23.85 ? 117  VAL B CA  1 
ATOM   1910 C C   . VAL B 1 115 ? -8.322  -16.533 48.923 1.00 25.61 ? 117  VAL B C   1 
ATOM   1911 O O   . VAL B 1 115 ? -8.734  -17.411 48.150 1.00 22.50 ? 117  VAL B O   1 
ATOM   1912 C CB  . VAL B 1 115 ? -6.499  -17.155 50.559 1.00 23.90 ? 117  VAL B CB  1 
ATOM   1913 C CG1 . VAL B 1 115 ? -7.170  -18.509 50.556 1.00 25.95 ? 117  VAL B CG1 1 
ATOM   1914 C CG2 . VAL B 1 115 ? -5.001  -17.357 50.685 1.00 25.35 ? 117  VAL B CG2 1 
ATOM   1915 N N   . VAL B 1 116 ? -9.134  -15.668 49.526 1.00 27.21 ? 118  VAL B N   1 
ATOM   1916 C CA  . VAL B 1 116 ? -10.580 -15.678 49.274 1.00 28.65 ? 118  VAL B CA  1 
ATOM   1917 C C   . VAL B 1 116 ? -10.817 -15.344 47.807 1.00 30.62 ? 118  VAL B C   1 
ATOM   1918 O O   . VAL B 1 116 ? -11.609 -15.991 47.120 1.00 30.29 ? 118  VAL B O   1 
ATOM   1919 C CB  . VAL B 1 116 ? -11.296 -14.622 50.157 1.00 27.71 ? 118  VAL B CB  1 
ATOM   1920 C CG1 . VAL B 1 116 ? -12.703 -14.311 49.597 1.00 27.95 ? 118  VAL B CG1 1 
ATOM   1921 C CG2 . VAL B 1 116 ? -11.373 -15.130 51.589 1.00 22.11 ? 118  VAL B CG2 1 
ATOM   1922 N N   . ASP B 1 117 ? -10.102 -14.333 47.324 1.00 33.35 ? 119  ASP B N   1 
ATOM   1923 C CA  . ASP B 1 117 ? -10.240 -13.912 45.942 1.00 35.76 ? 119  ASP B CA  1 
ATOM   1924 C C   . ASP B 1 117 ? -9.780  -14.991 44.955 1.00 35.55 ? 119  ASP B C   1 
ATOM   1925 O O   . ASP B 1 117 ? -10.362 -15.141 43.861 1.00 35.22 ? 119  ASP B O   1 
ATOM   1926 C CB  . ASP B 1 117 ? -9.456  -12.616 45.713 1.00 40.46 ? 119  ASP B CB  1 
ATOM   1927 C CG  . ASP B 1 117 ? -9.807  -11.959 44.396 1.00 44.72 ? 119  ASP B CG  1 
ATOM   1928 O OD1 . ASP B 1 117 ? -11.001 -11.622 44.207 1.00 49.07 ? 119  ASP B OD1 1 
ATOM   1929 O OD2 . ASP B 1 117 ? -8.907  -11.782 43.542 1.00 46.60 ? 119  ASP B OD2 1 
ATOM   1930 N N   . THR B 1 118 ? -8.743  -15.737 45.330 1.00 34.06 ? 120  THR B N   1 
ATOM   1931 C CA  . THR B 1 118 ? -8.228  -16.804 44.468 1.00 34.05 ? 120  THR B CA  1 
ATOM   1932 C C   . THR B 1 118 ? -9.278  -17.908 44.366 1.00 35.30 ? 120  THR B C   1 
ATOM   1933 O O   . THR B 1 118 ? -9.491  -18.492 43.300 1.00 34.12 ? 120  THR B O   1 
ATOM   1934 C CB  . THR B 1 118 ? -6.897  -17.412 45.012 1.00 33.07 ? 120  THR B CB  1 
ATOM   1935 O OG1 . THR B 1 118 ? -5.907  -16.381 45.096 1.00 31.19 ? 120  THR B OG1 1 
ATOM   1936 C CG2 . THR B 1 118 ? -6.369  -18.505 44.064 1.00 30.56 ? 120  THR B CG2 1 
ATOM   1937 N N   . CYS B 1 119 ? -9.926  -18.194 45.485 1.00 36.71 ? 121  CYS B N   1 
ATOM   1938 C CA  . CYS B 1 119 ? -10.974 -19.191 45.495 1.00 39.98 ? 121  CYS B CA  1 
ATOM   1939 C C   . CYS B 1 119 ? -12.131 -18.736 44.599 1.00 42.35 ? 121  CYS B C   1 
ATOM   1940 O O   . CYS B 1 119 ? -12.689 -19.528 43.837 1.00 42.51 ? 121  CYS B O   1 
ATOM   1941 C CB  . CYS B 1 119 ? -11.462 -19.402 46.915 1.00 37.99 ? 121  CYS B CB  1 
ATOM   1942 S SG  . CYS B 1 119 ? -10.247 -20.263 47.902 1.00 42.07 ? 121  CYS B SG  1 
ATOM   1943 N N   . ARG B 1 120 ? -12.490 -17.460 44.690 1.00 44.01 ? 122  ARG B N   1 
ATOM   1944 C CA  . ARG B 1 120 ? -13.570 -16.955 43.857 1.00 46.82 ? 122  ARG B CA  1 
ATOM   1945 C C   . ARG B 1 120 ? -13.190 -17.248 42.408 1.00 47.04 ? 122  ARG B C   1 
ATOM   1946 O O   . ARG B 1 120 ? -13.963 -17.839 41.655 1.00 45.61 ? 122  ARG B O   1 
ATOM   1947 C CB  . ARG B 1 120 ? -13.759 -15.443 44.043 1.00 46.66 ? 122  ARG B CB  1 
ATOM   1948 C CG  . ARG B 1 120 ? -14.968 -14.915 43.290 1.00 50.04 ? 122  ARG B CG  1 
ATOM   1949 C CD  . ARG B 1 120 ? -15.080 -13.395 43.269 1.00 50.91 ? 122  ARG B CD  1 
ATOM   1950 N NE  . ARG B 1 120 ? -15.030 -12.803 44.602 1.00 52.50 ? 122  ARG B NE  1 
ATOM   1951 C CZ  . ARG B 1 120 ? -15.626 -11.661 44.935 1.00 52.48 ? 122  ARG B CZ  1 
ATOM   1952 N NH1 . ARG B 1 120 ? -16.333 -10.990 44.035 1.00 52.01 ? 122  ARG B NH1 1 
ATOM   1953 N NH2 . ARG B 1 120 ? -15.494 -11.176 46.162 1.00 53.70 ? 122  ARG B NH2 1 
ATOM   1954 N N   . LYS B 1 121 ? -11.980 -16.843 42.035 1.00 48.31 ? 123  LYS B N   1 
ATOM   1955 C CA  . LYS B 1 121 ? -11.489 -17.054 40.681 1.00 48.96 ? 123  LYS B CA  1 
ATOM   1956 C C   . LYS B 1 121 ? -11.563 -18.528 40.311 1.00 49.01 ? 123  LYS B C   1 
ATOM   1957 O O   . LYS B 1 121 ? -11.789 -18.887 39.157 1.00 48.74 ? 123  LYS B O   1 
ATOM   1958 C CB  . LYS B 1 121 ? -10.046 -16.548 40.560 1.00 51.03 ? 123  LYS B CB  1 
ATOM   1959 C CG  . LYS B 1 121 ? -9.421  -16.803 39.191 1.00 52.73 ? 123  LYS B CG  1 
ATOM   1960 C CD  . LYS B 1 121 ? -8.328  -15.798 38.850 1.00 54.12 ? 123  LYS B CD  1 
ATOM   1961 C CE  . LYS B 1 121 ? -7.106  -15.933 39.738 1.00 54.43 ? 123  LYS B CE  1 
ATOM   1962 N NZ  . LYS B 1 121 ? -5.950  -15.173 39.172 1.00 54.09 ? 123  LYS B NZ  1 
ATOM   1963 N N   . PHE B 1 122 ? -11.384 -19.380 41.308 1.00 49.92 ? 124  PHE B N   1 
ATOM   1964 C CA  . PHE B 1 122 ? -11.425 -20.816 41.108 1.00 50.97 ? 124  PHE B CA  1 
ATOM   1965 C C   . PHE B 1 122 ? -12.819 -21.297 40.706 1.00 51.95 ? 124  PHE B C   1 
ATOM   1966 O O   . PHE B 1 122 ? -13.002 -22.020 39.716 1.00 51.67 ? 124  PHE B O   1 
ATOM   1967 C CB  . PHE B 1 122 ? -11.010 -21.521 42.394 1.00 51.75 ? 124  PHE B CB  1 
ATOM   1968 C CG  . PHE B 1 122 ? -10.995 -23.006 42.277 1.00 53.57 ? 124  PHE B CG  1 
ATOM   1969 C CD1 . PHE B 1 122 ? -10.062 -23.641 41.452 1.00 54.03 ? 124  PHE B CD1 1 
ATOM   1970 C CD2 . PHE B 1 122 ? -11.935 -23.776 42.954 1.00 53.14 ? 124  PHE B CD2 1 
ATOM   1971 C CE1 . PHE B 1 122 ? -10.069 -25.033 41.301 1.00 54.34 ? 124  PHE B CE1 1 
ATOM   1972 C CE2 . PHE B 1 122 ? -11.952 -25.165 42.811 1.00 54.68 ? 124  PHE B CE2 1 
ATOM   1973 C CZ  . PHE B 1 122 ? -11.018 -25.796 41.982 1.00 54.41 ? 124  PHE B CZ  1 
ATOM   1974 N N   . ILE B 1 123 ? -13.802 -20.904 41.498 1.00 52.52 ? 125  ILE B N   1 
ATOM   1975 C CA  . ILE B 1 123 ? -15.171 -21.296 41.245 1.00 52.70 ? 125  ILE B CA  1 
ATOM   1976 C C   . ILE B 1 123 ? -15.667 -20.862 39.877 1.00 52.68 ? 125  ILE B C   1 
ATOM   1977 O O   . ILE B 1 123 ? -16.479 -21.543 39.271 1.00 52.62 ? 125  ILE B O   1 
ATOM   1978 C CB  . ILE B 1 123 ? -16.087 -20.725 42.317 1.00 51.03 ? 125  ILE B CB  1 
ATOM   1979 C CG1 . ILE B 1 123 ? -15.628 -21.217 43.688 1.00 48.42 ? 125  ILE B CG1 1 
ATOM   1980 C CG2 . ILE B 1 123 ? -17.513 -21.155 42.052 1.00 52.56 ? 125  ILE B CG2 1 
ATOM   1981 C CD1 . ILE B 1 123 ? -16.278 -20.499 44.811 1.00 44.11 ? 125  ILE B CD1 1 
ATOM   1982 N N   . LYS B 1 124 ? -15.176 -19.734 39.387 1.00 54.61 ? 126  LYS B N   1 
ATOM   1983 C CA  . LYS B 1 124 ? -15.606 -19.242 38.084 1.00 57.21 ? 126  LYS B CA  1 
ATOM   1984 C C   . LYS B 1 124 ? -15.232 -20.152 36.925 1.00 59.62 ? 126  LYS B C   1 
ATOM   1985 O O   . LYS B 1 124 ? -15.730 -19.985 35.810 1.00 61.02 ? 126  LYS B O   1 
ATOM   1986 C CB  . LYS B 1 124 ? -15.060 -17.848 37.841 1.00 55.81 ? 126  LYS B CB  1 
ATOM   1987 C CG  . LYS B 1 124 ? -15.619 -16.833 38.796 1.00 56.18 ? 126  LYS B CG  1 
ATOM   1988 C CD  . LYS B 1 124 ? -15.714 -15.489 38.132 1.00 59.31 ? 126  LYS B CD  1 
ATOM   1989 C CE  . LYS B 1 124 ? -16.746 -15.502 37.002 1.00 62.09 ? 126  LYS B CE  1 
ATOM   1990 N NZ  . LYS B 1 124 ? -16.433 -16.458 35.890 1.00 63.34 ? 126  LYS B NZ  1 
ATOM   1991 N N   . ALA B 1 125 ? -14.357 -21.114 37.189 1.00 61.71 ? 127  ALA B N   1 
ATOM   1992 C CA  . ALA B 1 125 ? -13.949 -22.077 36.180 1.00 63.23 ? 127  ALA B CA  1 
ATOM   1993 C C   . ALA B 1 125 ? -14.529 -23.435 36.588 1.00 65.28 ? 127  ALA B C   1 
ATOM   1994 O O   . ALA B 1 125 ? -15.146 -24.129 35.775 1.00 66.11 ? 127  ALA B O   1 
ATOM   1995 C CB  . ALA B 1 125 ? -12.435 -22.143 36.100 1.00 63.96 ? 127  ALA B CB  1 
ATOM   1996 N N   . SER B 1 126 ? -14.345 -23.798 37.858 1.00 66.67 ? 128  SER B N   1 
ATOM   1997 C CA  . SER B 1 126 ? -14.860 -25.063 38.387 1.00 67.56 ? 128  SER B CA  1 
ATOM   1998 C C   . SER B 1 126 ? -16.194 -24.862 39.108 1.00 68.00 ? 128  SER B C   1 
ATOM   1999 O O   . SER B 1 126 ? -17.212 -25.427 38.651 1.00 68.97 ? 128  SER B O   1 
ATOM   2000 C CB  . SER B 1 126 ? -13.853 -25.689 39.360 1.00 68.32 ? 128  SER B CB  1 
ATOM   2001 O OG  . SER B 1 126 ? -12.662 -26.085 38.697 1.00 67.94 ? 128  SER B OG  1 
ATOM   2002 N N   . GLY C 2 1   ? 29.531  5.624   42.619 1.00 22.23 ? -1   GLY C N   1 
ATOM   2003 C CA  . GLY C 2 1   ? 28.695  4.409   42.812 1.00 22.34 ? -1   GLY C CA  1 
ATOM   2004 C C   . GLY C 2 1   ? 28.586  3.646   41.511 1.00 23.19 ? -1   GLY C C   1 
ATOM   2005 O O   . GLY C 2 1   ? 29.190  4.058   40.507 1.00 23.39 ? -1   GLY C O   1 
ATOM   2006 N N   . SER C 2 2   ? 27.803  2.564   41.513 1.00 22.25 ? 0    SER C N   1 
ATOM   2007 C CA  . SER C 2 2   ? 27.656  1.734   40.331 1.00 21.72 ? 0    SER C CA  1 
ATOM   2008 C C   . SER C 2 2   ? 26.306  1.029   40.150 1.00 22.81 ? 0    SER C C   1 
ATOM   2009 O O   . SER C 2 2   ? 25.513  0.860   41.096 1.00 21.04 ? 0    SER C O   1 
ATOM   2010 C CB  . SER C 2 2   ? 28.777  0.695   40.327 1.00 22.56 ? 0    SER C CB  1 
ATOM   2011 O OG  . SER C 2 2   ? 28.692  -0.135  41.464 1.00 25.58 ? 0    SER C OG  1 
ATOM   2012 N N   . LEU C 2 3   ? 26.047  0.630   38.907 1.00 22.89 ? 1414 LEU C N   1 
ATOM   2013 C CA  . LEU C 2 3   ? 24.825  -0.086  38.570 1.00 21.28 ? 1414 LEU C CA  1 
ATOM   2014 C C   . LEU C 2 3   ? 25.114  -1.544  38.873 1.00 21.26 ? 1414 LEU C C   1 
ATOM   2015 O O   . LEU C 2 3   ? 25.976  -2.171  38.247 1.00 21.97 ? 1414 LEU C O   1 
ATOM   2016 C CB  . LEU C 2 3   ? 24.478  0.104   37.102 1.00 21.35 ? 1414 LEU C CB  1 
ATOM   2017 C CG  . LEU C 2 3   ? 24.209  1.573   36.737 1.00 22.99 ? 1414 LEU C CG  1 
ATOM   2018 C CD1 . LEU C 2 3   ? 23.995  1.683   35.226 1.00 23.32 ? 1414 LEU C CD1 1 
ATOM   2019 C CD2 . LEU C 2 3   ? 22.982  2.113   37.514 1.00 21.40 ? 1414 LEU C CD2 1 
ATOM   2020 N N   . VAL C 2 4   ? 24.375  -2.078  39.834 1.00 19.30 ? 1415 VAL C N   1 
ATOM   2021 C CA  . VAL C 2 4   ? 24.568  -3.434  40.284 1.00 19.83 ? 1415 VAL C CA  1 
ATOM   2022 C C   . VAL C 2 4   ? 24.323  -4.535  39.265 1.00 20.33 ? 1415 VAL C C   1 
ATOM   2023 O O   . VAL C 2 4   ? 23.260  -4.611  38.621 1.00 16.89 ? 1415 VAL C O   1 
ATOM   2024 C CB  . VAL C 2 4   ? 23.721  -3.723  41.547 1.00 21.69 ? 1415 VAL C CB  1 
ATOM   2025 C CG1 . VAL C 2 4   ? 24.142  -5.064  42.153 1.00 20.12 ? 1415 VAL C CG1 1 
ATOM   2026 C CG2 . VAL C 2 4   ? 23.898  -2.585  42.564 1.00 20.91 ? 1415 VAL C CG2 1 
ATOM   2027 N N   . ALA C 2 5   ? 25.339  -5.378  39.104 1.00 19.66 ? 1416 ALA C N   1 
ATOM   2028 C CA  . ALA C 2 5   ? 25.210  -6.513  38.197 1.00 22.27 ? 1416 ALA C CA  1 
ATOM   2029 C C   . ALA C 2 5   ? 24.445  -7.589  38.982 1.00 21.44 ? 1416 ALA C C   1 
ATOM   2030 O O   . ALA C 2 5   ? 24.736  -7.835  40.155 1.00 24.10 ? 1416 ALA C O   1 
ATOM   2031 C CB  . ALA C 2 5   ? 26.610  -7.041  37.789 1.00 20.45 ? 1416 ALA C CB  1 
ATOM   2032 N N   . THR C 2 6   ? 23.454  -8.212  38.368 1.00 20.83 ? 1417 THR C N   1 
ATOM   2033 C CA  . THR C 2 6   ? 22.740  -9.264  39.074 1.00 19.49 ? 1417 THR C CA  1 
ATOM   2034 C C   . THR C 2 6   ? 22.891  -10.560 38.291 1.00 18.58 ? 1417 THR C C   1 
ATOM   2035 O O   . THR C 2 6   ? 23.055  -10.563 37.074 1.00 16.24 ? 1417 THR C O   1 
ATOM   2036 C CB  . THR C 2 6   ? 21.218  -8.970  39.222 1.00 19.42 ? 1417 THR C CB  1 
ATOM   2037 O OG1 . THR C 2 6   ? 20.615  -8.952  37.925 1.00 21.31 ? 1417 THR C OG1 1 
ATOM   2038 C CG2 . THR C 2 6   ? 20.968  -7.609  39.898 1.00 19.45 ? 1417 THR C CG2 1 
ATOM   2039 N N   . VAL C 2 7   ? 22.849  -11.668 39.013 1.00 17.80 ? 1418 VAL C N   1 
ATOM   2040 C CA  . VAL C 2 7   ? 22.925  -12.972 38.404 1.00 17.30 ? 1418 VAL C CA  1 
ATOM   2041 C C   . VAL C 2 7   ? 22.081  -13.837 39.320 1.00 18.44 ? 1418 VAL C C   1 
ATOM   2042 O O   . VAL C 2 7   ? 21.945  -13.526 40.503 1.00 14.94 ? 1418 VAL C O   1 
ATOM   2043 C CB  . VAL C 2 7   ? 24.390  -13.470 38.309 1.00 18.00 ? 1418 VAL C CB  1 
ATOM   2044 C CG1 . VAL C 2 7   ? 25.032  -13.562 39.714 1.00 16.09 ? 1418 VAL C CG1 1 
ATOM   2045 C CG2 . VAL C 2 7   ? 24.437  -14.805 37.572 1.00 15.81 ? 1418 VAL C CG2 1 
ATOM   2046 N N   . LYS C 2 8   ? 21.497  -14.910 38.790 1.00 19.54 ? 1419 LYS C N   1 
ATOM   2047 C CA  . LYS C 2 8   ? 20.667  -15.753 39.635 1.00 21.51 ? 1419 LYS C CA  1 
ATOM   2048 C C   . LYS C 2 8   ? 21.303  -17.056 40.054 1.00 21.03 ? 1419 LYS C C   1 
ATOM   2049 O O   . LYS C 2 8   ? 22.128  -17.620 39.333 1.00 21.77 ? 1419 LYS C O   1 
ATOM   2050 C CB  . LYS C 2 8   ? 19.333  -16.057 38.942 1.00 24.75 ? 1419 LYS C CB  1 
ATOM   2051 C CG  . LYS C 2 8   ? 18.423  -14.856 38.780 1.00 27.94 ? 1419 LYS C CG  1 
ATOM   2052 C CD  . LYS C 2 8   ? 17.195  -15.202 37.954 1.00 33.63 ? 1419 LYS C CD  1 
ATOM   2053 C CE  . LYS C 2 8   ? 16.308  -13.973 37.758 1.00 36.87 ? 1419 LYS C CE  1 
ATOM   2054 N NZ  . LYS C 2 8   ? 15.010  -14.293 37.082 1.00 39.35 ? 1419 LYS C NZ  1 
ATOM   2055 N N   . GLU C 2 9   ? 20.922  -17.514 41.243 1.00 19.36 ? 1420 GLU C N   1 
ATOM   2056 C CA  . GLU C 2 9   ? 21.368  -18.798 41.757 1.00 18.46 ? 1420 GLU C CA  1 
ATOM   2057 C C   . GLU C 2 9   ? 20.087  -19.611 41.923 1.00 18.56 ? 1420 GLU C C   1 
ATOM   2058 O O   . GLU C 2 9   ? 19.192  -19.227 42.691 1.00 17.51 ? 1420 GLU C O   1 
ATOM   2059 C CB  . GLU C 2 9   ? 22.089  -18.670 43.104 1.00 17.37 ? 1420 GLU C CB  1 
ATOM   2060 C CG  . GLU C 2 9   ? 22.401  -20.055 43.750 1.00 20.41 ? 1420 GLU C CG  1 
ATOM   2061 C CD  . GLU C 2 9   ? 23.156  -21.037 42.819 1.00 22.95 ? 1420 GLU C CD  1 
ATOM   2062 O OE1 . GLU C 2 9   ? 24.329  -20.806 42.477 1.00 24.46 ? 1420 GLU C OE1 1 
ATOM   2063 O OE2 . GLU C 2 9   ? 22.580  -22.058 42.420 1.00 25.15 ? 1420 GLU C OE2 1 
ATOM   2064 N N   . ALA C 2 10  ? 20.005  -20.733 41.215 1.00 16.67 ? 1421 ALA C N   1 
ATOM   2065 C CA  . ALA C 2 10  ? 18.815  -21.563 41.262 1.00 18.91 ? 1421 ALA C CA  1 
ATOM   2066 C C   . ALA C 2 10  ? 18.859  -22.699 42.261 1.00 18.72 ? 1421 ALA C C   1 
ATOM   2067 O O   . ALA C 2 10  ? 17.836  -23.293 42.555 1.00 20.53 ? 1421 ALA C O   1 
ATOM   2068 C CB  . ALA C 2 10  ? 18.500  -22.130 39.854 1.00 19.34 ? 1421 ALA C CB  1 
ATOM   2069 N N   . GLY C 2 11  ? 20.036  -23.019 42.774 1.00 19.24 ? 1422 GLY C N   1 
ATOM   2070 C CA  . GLY C 2 11  ? 20.119  -24.114 43.722 1.00 19.67 ? 1422 GLY C CA  1 
ATOM   2071 C C   . GLY C 2 11  ? 19.625  -23.798 45.126 1.00 19.29 ? 1422 GLY C C   1 
ATOM   2072 O O   . GLY C 2 11  ? 19.258  -22.664 45.421 1.00 16.37 ? 1422 GLY C O   1 
ATOM   2073 N N   . ARG C 2 12  ? 19.615  -24.825 45.978 1.00 18.98 ? 1423 ARG C N   1 
ATOM   2074 C CA  . ARG C 2 12  ? 19.222  -24.704 47.373 1.00 17.91 ? 1423 ARG C CA  1 
ATOM   2075 C C   . ARG C 2 12  ? 20.135  -23.645 47.994 1.00 20.39 ? 1423 ARG C C   1 
ATOM   2076 O O   . ARG C 2 12  ? 21.363  -23.660 47.799 1.00 18.30 ? 1423 ARG C O   1 
ATOM   2077 C CB  . ARG C 2 12  ? 19.387  -26.057 48.081 1.00 16.45 ? 1423 ARG C CB  1 
ATOM   2078 C CG  . ARG C 2 12  ? 19.403  -26.001 49.613 1.00 16.72 ? 1423 ARG C CG  1 
ATOM   2079 C CD  . ARG C 2 12  ? 19.141  -27.395 50.233 1.00 16.72 ? 1423 ARG C CD  1 
ATOM   2080 N NE  . ARG C 2 12  ? 17.718  -27.763 50.198 1.00 16.50 ? 1423 ARG C NE  1 
ATOM   2081 C CZ  . ARG C 2 12  ? 16.791  -27.237 50.998 1.00 18.53 ? 1423 ARG C CZ  1 
ATOM   2082 N NH1 . ARG C 2 12  ? 17.130  -26.321 51.916 1.00 17.36 ? 1423 ARG C NH1 1 
ATOM   2083 N NH2 . ARG C 2 12  ? 15.515  -27.603 50.870 1.00 19.12 ? 1423 ARG C NH2 1 
ATOM   2084 N N   . SER C 2 13  ? 19.528  -22.729 48.741 1.00 19.28 ? 1424 SER C N   1 
ATOM   2085 C CA  . SER C 2 13  ? 20.265  -21.624 49.345 1.00 20.23 ? 1424 SER C CA  1 
ATOM   2086 C C   . SER C 2 13  ? 20.746  -21.841 50.771 1.00 21.32 ? 1424 SER C C   1 
ATOM   2087 O O   . SER C 2 13  ? 21.635  -21.137 51.247 1.00 23.99 ? 1424 SER C O   1 
ATOM   2088 C CB  . SER C 2 13  ? 19.391  -20.371 49.326 1.00 17.92 ? 1424 SER C CB  1 
ATOM   2089 O OG  . SER C 2 13  ? 18.312  -20.516 50.233 1.00 15.89 ? 1424 SER C OG  1 
ATOM   2090 N N   . ILE C 2 14  ? 20.173  -22.812 51.455 1.00 20.98 ? 1425 ILE C N   1 
ATOM   2091 C CA  . ILE C 2 14  ? 20.525  -23.022 52.851 1.00 20.50 ? 1425 ILE C CA  1 
ATOM   2092 C C   . ILE C 2 14  ? 20.401  -24.488 53.171 1.00 21.40 ? 1425 ILE C C   1 
ATOM   2093 O O   . ILE C 2 14  ? 19.924  -25.261 52.353 1.00 21.80 ? 1425 ILE C O   1 
ATOM   2094 C CB  . ILE C 2 14  ? 19.542  -22.251 53.787 1.00 18.68 ? 1425 ILE C CB  1 
ATOM   2095 C CG1 . ILE C 2 14  ? 18.092  -22.680 53.444 1.00 15.23 ? 1425 ILE C CG1 1 
ATOM   2096 C CG2 . ILE C 2 14  ? 19.782  -20.733 53.669 1.00 13.30 ? 1425 ILE C CG2 1 
ATOM   2097 C CD1 . ILE C 2 14  ? 16.939  -21.880 54.118 1.00 16.68 ? 1425 ILE C CD1 1 
ATOM   2098 N N   . HIS C 2 15  ? 20.813  -24.869 54.370 1.00 23.40 ? 1426 HIS C N   1 
ATOM   2099 C CA  . HIS C 2 15  ? 20.704  -26.262 54.745 1.00 26.10 ? 1426 HIS C CA  1 
ATOM   2100 C C   . HIS C 2 15  ? 19.236  -26.680 54.803 1.00 26.46 ? 1426 HIS C C   1 
ATOM   2101 O O   . HIS C 2 15  ? 18.327  -25.847 54.940 1.00 25.98 ? 1426 HIS C O   1 
ATOM   2102 C CB  . HIS C 2 15  ? 21.362  -26.499 56.108 1.00 28.37 ? 1426 HIS C CB  1 
ATOM   2103 C CG  . HIS C 2 15  ? 20.672  -25.817 57.247 1.00 30.56 ? 1426 HIS C CG  1 
ATOM   2104 N ND1 . HIS C 2 15  ? 20.662  -26.336 58.524 1.00 31.25 ? 1426 HIS C ND1 1 
ATOM   2105 C CD2 . HIS C 2 15  ? 19.975  -24.655 57.309 1.00 32.45 ? 1426 HIS C CD2 1 
ATOM   2106 C CE1 . HIS C 2 15  ? 19.987  -25.525 59.323 1.00 31.14 ? 1426 HIS C CE1 1 
ATOM   2107 N NE2 . HIS C 2 15  ? 19.560  -24.498 58.610 1.00 31.06 ? 1426 HIS C NE2 1 
ATOM   2108 N N   . GLU C 2 16  ? 19.002  -27.977 54.670 1.00 27.73 ? 1427 GLU C N   1 
ATOM   2109 C CA  . GLU C 2 16  ? 17.653  -28.498 54.781 1.00 25.87 ? 1427 GLU C CA  1 
ATOM   2110 C C   . GLU C 2 16  ? 17.519  -29.108 56.180 1.00 26.79 ? 1427 GLU C C   1 
ATOM   2111 O O   . GLU C 2 16  ? 18.234  -30.053 56.524 1.00 27.40 ? 1427 GLU C O   1 
ATOM   2112 C CB  . GLU C 2 16  ? 17.382  -29.583 53.748 1.00 25.60 ? 1427 GLU C CB  1 
ATOM   2113 C CG  . GLU C 2 16  ? 15.917  -29.990 53.761 1.00 26.73 ? 1427 GLU C CG  1 
ATOM   2114 C CD  . GLU C 2 16  ? 15.605  -31.204 52.913 1.00 29.55 ? 1427 GLU C CD  1 
ATOM   2115 O OE1 . GLU C 2 16  ? 16.235  -31.384 51.850 1.00 31.73 ? 1427 GLU C OE1 1 
ATOM   2116 O OE2 . GLU C 2 16  ? 14.697  -31.970 53.307 1.00 32.96 ? 1427 GLU C OE2 1 
ATOM   2117 N N   . ILE C 2 17  ? 16.621  -28.545 56.982 1.00 27.53 ? 1428 ILE C N   1 
ATOM   2118 C CA  . ILE C 2 17  ? 16.351  -29.027 58.330 1.00 28.69 ? 1428 ILE C CA  1 
ATOM   2119 C C   . ILE C 2 17  ? 15.562  -30.321 58.187 1.00 30.84 ? 1428 ILE C C   1 
ATOM   2120 O O   . ILE C 2 17  ? 14.507  -30.347 57.568 1.00 30.90 ? 1428 ILE C O   1 
ATOM   2121 C CB  . ILE C 2 17  ? 15.516  -28.012 59.136 1.00 27.01 ? 1428 ILE C CB  1 
ATOM   2122 C CG1 . ILE C 2 17  ? 16.387  -26.803 59.496 1.00 26.61 ? 1428 ILE C CG1 1 
ATOM   2123 C CG2 . ILE C 2 17  ? 14.916  -28.683 60.376 1.00 28.08 ? 1428 ILE C CG2 1 
ATOM   2124 C CD1 . ILE C 2 17  ? 15.653  -25.680 60.212 1.00 24.12 ? 1428 ILE C CD1 1 
ATOM   2125 N N   . PRO C 2 18  ? 16.056  -31.413 58.784 1.00 33.50 ? 1429 PRO C N   1 
ATOM   2126 C CA  . PRO C 2 18  ? 15.387  -32.714 58.698 1.00 34.59 ? 1429 PRO C CA  1 
ATOM   2127 C C   . PRO C 2 18  ? 14.056  -32.859 59.429 1.00 34.75 ? 1429 PRO C C   1 
ATOM   2128 O O   . PRO C 2 18  ? 13.771  -32.124 60.382 1.00 34.36 ? 1429 PRO C O   1 
ATOM   2129 C CB  . PRO C 2 18  ? 16.453  -33.666 59.222 1.00 34.19 ? 1429 PRO C CB  1 
ATOM   2130 C CG  . PRO C 2 18  ? 17.132  -32.854 60.252 1.00 34.48 ? 1429 PRO C CG  1 
ATOM   2131 C CD  . PRO C 2 18  ? 17.290  -31.513 59.579 1.00 33.99 ? 1429 PRO C CD  1 
ATOM   2132 N N   . ARG C 2 19  ? 13.238  -33.804 58.962 1.00 36.00 ? 1430 ARG C N   1 
ATOM   2133 C CA  . ARG C 2 19  ? 11.943  -34.063 59.599 1.00 39.24 ? 1430 ARG C CA  1 
ATOM   2134 C C   . ARG C 2 19  ? 12.183  -34.642 60.998 1.00 39.51 ? 1430 ARG C C   1 
ATOM   2135 O O   . ARG C 2 19  ? 13.291  -35.178 61.232 1.00 38.29 ? 1430 ARG C O   1 
ATOM   2136 C CB  . ARG C 2 19  ? 11.113  -35.061 58.785 1.00 39.37 ? 1430 ARG C CB  1 
ATOM   2137 C CG  . ARG C 2 19  ? 10.812  -34.612 57.388 1.00 40.51 ? 1430 ARG C CG  1 
ATOM   2138 C CD  . ARG C 2 19  ? 9.933   -35.603 56.664 1.00 41.44 ? 1430 ARG C CD  1 
ATOM   2139 N NE  . ARG C 2 19  ? 9.850   -35.318 55.235 1.00 42.12 ? 1430 ARG C NE  1 
ATOM   2140 C CZ  . ARG C 2 19  ? 10.899  -35.302 54.415 1.00 43.75 ? 1430 ARG C CZ  1 
ATOM   2141 N NH1 . ARG C 2 19  ? 12.115  -35.550 54.884 1.00 43.88 ? 1430 ARG C NH1 1 
ATOM   2142 N NH2 . ARG C 2 19  ? 10.736  -35.054 53.119 1.00 44.63 ? 1430 ARG C NH2 1 
ATOM   2143 O OXT . ARG C 2 19  ? 11.255  -34.561 61.838 1.00 41.80 ? 1430 ARG C OXT 1 
ATOM   2144 N N   . LEU D 2 3   ? -5.163  -38.747 42.703 1.00 50.89 ? 1414 LEU D N   1 
ATOM   2145 C CA  . LEU D 2 3   ? -4.609  -37.627 41.876 1.00 49.45 ? 1414 LEU D CA  1 
ATOM   2146 C C   . LEU D 2 3   ? -5.448  -36.357 42.024 1.00 48.15 ? 1414 LEU D C   1 
ATOM   2147 O O   . LEU D 2 3   ? -6.669  -36.338 41.803 1.00 48.76 ? 1414 LEU D O   1 
ATOM   2148 C CB  . LEU D 2 3   ? -4.561  -38.016 40.396 1.00 50.14 ? 1414 LEU D CB  1 
ATOM   2149 C CG  . LEU D 2 3   ? -3.277  -37.899 39.560 1.00 50.10 ? 1414 LEU D CG  1 
ATOM   2150 C CD1 . LEU D 2 3   ? -3.704  -38.240 38.173 1.00 49.68 ? 1414 LEU D CD1 1 
ATOM   2151 C CD2 . LEU D 2 3   ? -2.621  -36.512 39.564 1.00 50.87 ? 1414 LEU D CD2 1 
ATOM   2152 N N   . VAL D 2 4   ? -4.757  -35.290 42.390 1.00 45.15 ? 1415 VAL D N   1 
ATOM   2153 C CA  . VAL D 2 4   ? -5.363  -33.995 42.590 1.00 41.43 ? 1415 VAL D CA  1 
ATOM   2154 C C   . VAL D 2 4   ? -5.035  -33.114 41.386 1.00 40.83 ? 1415 VAL D C   1 
ATOM   2155 O O   . VAL D 2 4   ? -3.969  -33.251 40.759 1.00 39.05 ? 1415 VAL D O   1 
ATOM   2156 C CB  . VAL D 2 4   ? -4.795  -33.349 43.876 1.00 41.49 ? 1415 VAL D CB  1 
ATOM   2157 C CG1 . VAL D 2 4   ? -5.411  -31.984 44.091 1.00 40.19 ? 1415 VAL D CG1 1 
ATOM   2158 C CG2 . VAL D 2 4   ? -5.047  -34.260 45.069 1.00 38.46 ? 1415 VAL D CG2 1 
ATOM   2159 N N   . ALA D 2 5   ? -5.965  -32.234 41.044 1.00 38.82 ? 1416 ALA D N   1 
ATOM   2160 C CA  . ALA D 2 5   ? -5.742  -31.309 39.946 1.00 39.04 ? 1416 ALA D CA  1 
ATOM   2161 C C   . ALA D 2 5   ? -4.931  -30.184 40.585 1.00 38.04 ? 1416 ALA D C   1 
ATOM   2162 O O   . ALA D 2 5   ? -5.218  -29.751 41.702 1.00 36.24 ? 1416 ALA D O   1 
ATOM   2163 C CB  . ALA D 2 5   ? -7.077  -30.773 39.389 1.00 37.03 ? 1416 ALA D CB  1 
ATOM   2164 N N   . THR D 2 6   ? -3.908  -29.728 39.882 1.00 37.29 ? 1417 THR D N   1 
ATOM   2165 C CA  . THR D 2 6   ? -3.057  -28.674 40.401 1.00 37.64 ? 1417 THR D CA  1 
ATOM   2166 C C   . THR D 2 6   ? -3.367  -27.382 39.679 1.00 37.09 ? 1417 THR D C   1 
ATOM   2167 O O   . THR D 2 6   ? -3.618  -27.364 38.473 1.00 36.28 ? 1417 THR D O   1 
ATOM   2168 C CB  . THR D 2 6   ? -1.551  -29.003 40.188 1.00 37.53 ? 1417 THR D CB  1 
ATOM   2169 O OG1 . THR D 2 6   ? -1.202  -30.192 40.914 1.00 35.21 ? 1417 THR D OG1 1 
ATOM   2170 C CG2 . THR D 2 6   ? -0.691  -27.845 40.662 1.00 39.15 ? 1417 THR D CG2 1 
ATOM   2171 N N   . VAL D 2 7   ? -3.359  -26.288 40.417 1.00 35.86 ? 1418 VAL D N   1 
ATOM   2172 C CA  . VAL D 2 7   ? -3.612  -25.014 39.788 1.00 34.51 ? 1418 VAL D CA  1 
ATOM   2173 C C   . VAL D 2 7   ? -2.644  -24.015 40.401 1.00 31.59 ? 1418 VAL D C   1 
ATOM   2174 O O   . VAL D 2 7   ? -2.451  -23.973 41.608 1.00 29.26 ? 1418 VAL D O   1 
ATOM   2175 C CB  . VAL D 2 7   ? -5.085  -24.568 39.983 1.00 34.96 ? 1418 VAL D CB  1 
ATOM   2176 C CG1 . VAL D 2 7   ? -5.376  -24.364 41.452 1.00 38.74 ? 1418 VAL D CG1 1 
ATOM   2177 C CG2 . VAL D 2 7   ? -5.351  -23.286 39.206 1.00 35.97 ? 1418 VAL D CG2 1 
ATOM   2178 N N   . LYS D 2 8   ? -2.014  -23.230 39.547 1.00 29.90 ? 1419 LYS D N   1 
ATOM   2179 C CA  . LYS D 2 8   ? -1.068  -22.247 40.016 1.00 29.84 ? 1419 LYS D CA  1 
ATOM   2180 C C   . LYS D 2 8   ? -1.630  -20.829 40.104 1.00 28.19 ? 1419 LYS D C   1 
ATOM   2181 O O   . LYS D 2 8   ? -2.431  -20.400 39.274 1.00 25.61 ? 1419 LYS D O   1 
ATOM   2182 C CB  . LYS D 2 8   ? 0.176   -22.270 39.123 1.00 31.02 ? 1419 LYS D CB  1 
ATOM   2183 C CG  . LYS D 2 8   ? 1.010   -23.523 39.333 1.00 33.53 ? 1419 LYS D CG  1 
ATOM   2184 C CD  . LYS D 2 8   ? 2.304   -23.474 38.567 1.00 36.10 ? 1419 LYS D CD  1 
ATOM   2185 C CE  . LYS D 2 8   ? 3.128   -24.719 38.853 1.00 39.80 ? 1419 LYS D CE  1 
ATOM   2186 N NZ  . LYS D 2 8   ? 3.460   -24.860 40.319 1.00 42.98 ? 1419 LYS D NZ  1 
ATOM   2187 N N   . GLU D 2 9   ? -1.201  -20.113 41.136 1.00 27.50 ? 1420 GLU D N   1 
ATOM   2188 C CA  . GLU D 2 9   ? -1.597  -18.731 41.343 1.00 26.12 ? 1420 GLU D CA  1 
ATOM   2189 C C   . GLU D 2 9   ? -0.303  -17.908 41.381 1.00 25.45 ? 1420 GLU D C   1 
ATOM   2190 O O   . GLU D 2 9   ? 0.605   -18.206 42.173 1.00 22.84 ? 1420 GLU D O   1 
ATOM   2191 C CB  . GLU D 2 9   ? -2.369  -18.598 42.668 1.00 28.45 ? 1420 GLU D CB  1 
ATOM   2192 C CG  . GLU D 2 9   ? -2.775  -17.162 43.016 1.00 27.90 ? 1420 GLU D CG  1 
ATOM   2193 C CD  . GLU D 2 9   ? -3.421  -16.433 41.851 1.00 30.28 ? 1420 GLU D CD  1 
ATOM   2194 O OE1 . GLU D 2 9   ? -4.425  -16.950 41.310 1.00 29.28 ? 1420 GLU D OE1 1 
ATOM   2195 O OE2 . GLU D 2 9   ? -2.927  -15.342 41.482 1.00 29.40 ? 1420 GLU D OE2 1 
ATOM   2196 N N   . ALA D 2 10  ? -0.217  -16.891 40.518 1.00 22.92 ? 1421 ALA D N   1 
ATOM   2197 C CA  . ALA D 2 10  ? 0.968   -16.038 40.455 1.00 22.58 ? 1421 ALA D CA  1 
ATOM   2198 C C   . ALA D 2 10  ? 0.813   -14.720 41.218 1.00 22.20 ? 1421 ALA D C   1 
ATOM   2199 O O   . ALA D 2 10  ? 1.796   -14.021 41.421 1.00 22.28 ? 1421 ALA D O   1 
ATOM   2200 C CB  . ALA D 2 10  ? 1.359   -15.744 38.979 1.00 19.64 ? 1421 ALA D CB  1 
ATOM   2201 N N   . GLY D 2 11  ? -0.406  -14.391 41.646 1.00 21.10 ? 1422 GLY D N   1 
ATOM   2202 C CA  . GLY D 2 11  ? -0.641  -13.147 42.367 1.00 19.87 ? 1422 GLY D CA  1 
ATOM   2203 C C   . GLY D 2 11  ? -0.251  -13.179 43.838 1.00 21.03 ? 1422 GLY D C   1 
ATOM   2204 O O   . GLY D 2 11  ? -0.027  -14.261 44.387 1.00 18.41 ? 1422 GLY D O   1 
ATOM   2205 N N   . ARG D 2 12  ? -0.178  -11.998 44.468 1.00 20.07 ? 1423 ARG D N   1 
ATOM   2206 C CA  . ARG D 2 12  ? 0.189   -11.887 45.879 1.00 19.96 ? 1423 ARG D CA  1 
ATOM   2207 C C   . ARG D 2 12  ? -0.692  -12.832 46.684 1.00 21.98 ? 1423 ARG D C   1 
ATOM   2208 O O   . ARG D 2 12  ? -1.905  -12.863 46.506 1.00 20.44 ? 1423 ARG D O   1 
ATOM   2209 C CB  . ARG D 2 12  ? 0.018   -10.443 46.376 1.00 19.14 ? 1423 ARG D CB  1 
ATOM   2210 C CG  . ARG D 2 12  ? -0.049  -10.289 47.914 1.00 18.90 ? 1423 ARG D CG  1 
ATOM   2211 C CD  . ARG D 2 12  ? 0.115   -8.829  48.354 1.00 17.32 ? 1423 ARG D CD  1 
ATOM   2212 N NE  . ARG D 2 12  ? 1.507   -8.381  48.272 1.00 17.82 ? 1423 ARG D NE  1 
ATOM   2213 C CZ  . ARG D 2 12  ? 2.463   -8.718  49.141 1.00 14.86 ? 1423 ARG D CZ  1 
ATOM   2214 N NH1 . ARG D 2 12  ? 2.193   -9.511  50.179 1.00 11.31 ? 1423 ARG D NH1 1 
ATOM   2215 N NH2 . ARG D 2 12  ? 3.700   -8.273  48.970 1.00 14.79 ? 1423 ARG D NH2 1 
ATOM   2216 N N   . SER D 2 13  ? -0.084  -13.585 47.592 1.00 21.39 ? 1424 SER D N   1 
ATOM   2217 C CA  . SER D 2 13  ? -0.832  -14.550 48.367 1.00 21.54 ? 1424 SER D CA  1 
ATOM   2218 C C   . SER D 2 13  ? -1.384  -14.069 49.701 1.00 23.68 ? 1424 SER D C   1 
ATOM   2219 O O   . SER D 2 13  ? -2.298  -14.685 50.244 1.00 25.75 ? 1424 SER D O   1 
ATOM   2220 C CB  . SER D 2 13  ? 0.052   -15.749 48.661 1.00 19.70 ? 1424 SER D CB  1 
ATOM   2221 O OG  . SER D 2 13  ? 0.916   -15.442 49.734 1.00 20.55 ? 1424 SER D OG  1 
ATOM   2222 N N   . ILE D 2 14  ? -0.820  -12.998 50.243 1.00 24.27 ? 1425 ILE D N   1 
ATOM   2223 C CA  . ILE D 2 14  ? -1.222  -12.526 51.568 1.00 21.53 ? 1425 ILE D CA  1 
ATOM   2224 C C   . ILE D 2 14  ? -1.094  -11.014 51.663 1.00 21.80 ? 1425 ILE D C   1 
ATOM   2225 O O   . ILE D 2 14  ? -0.572  -10.371 50.745 1.00 20.71 ? 1425 ILE D O   1 
ATOM   2226 C CB  . ILE D 2 14  ? -0.317  -13.176 52.657 1.00 20.33 ? 1425 ILE D CB  1 
ATOM   2227 C CG1 . ILE D 2 14  ? 1.162   -12.988 52.282 1.00 18.55 ? 1425 ILE D CG1 1 
ATOM   2228 C CG2 . ILE D 2 14  ? -0.624  -14.654 52.784 1.00 18.49 ? 1425 ILE D CG2 1 
ATOM   2229 C CD1 . ILE D 2 14  ? 2.154   -13.834 53.090 1.00 13.91 ? 1425 ILE D CD1 1 
ATOM   2230 N N   . HIS D 2 15  ? -1.571  -10.446 52.770 1.00 21.37 ? 1426 HIS D N   1 
ATOM   2231 C CA  . HIS D 2 15  ? -1.475  -9.008  52.932 1.00 22.78 ? 1426 HIS D CA  1 
ATOM   2232 C C   . HIS D 2 15  ? -0.015  -8.579  52.884 1.00 23.31 ? 1426 HIS D C   1 
ATOM   2233 O O   . HIS D 2 15  ? 0.898   -9.391  53.114 1.00 24.10 ? 1426 HIS D O   1 
ATOM   2234 C CB  . HIS D 2 15  ? -2.097  -8.539  54.265 1.00 21.69 ? 1426 HIS D CB  1 
ATOM   2235 C CG  . HIS D 2 15  ? -1.421  -9.076  55.499 1.00 25.10 ? 1426 HIS D CG  1 
ATOM   2236 N ND1 . HIS D 2 15  ? -1.502  -8.445  56.724 1.00 25.17 ? 1426 HIS D ND1 1 
ATOM   2237 C CD2 . HIS D 2 15  ? -0.711  -10.213 55.715 1.00 25.79 ? 1426 HIS D CD2 1 
ATOM   2238 C CE1 . HIS D 2 15  ? -0.874  -9.165  57.640 1.00 25.68 ? 1426 HIS D CE1 1 
ATOM   2239 N NE2 . HIS D 2 15  ? -0.388  -10.245 57.054 1.00 26.61 ? 1426 HIS D NE2 1 
ATOM   2240 N N   . GLU D 2 16  ? 0.209   -7.315  52.557 1.00 22.88 ? 1427 GLU D N   1 
ATOM   2241 C CA  . GLU D 2 16  ? 1.558   -6.789  52.570 1.00 24.79 ? 1427 GLU D CA  1 
ATOM   2242 C C   . GLU D 2 16  ? 1.685   -5.940  53.837 1.00 26.34 ? 1427 GLU D C   1 
ATOM   2243 O O   . GLU D 2 16  ? 0.922   -4.992  54.049 1.00 25.02 ? 1427 GLU D O   1 
ATOM   2244 C CB  . GLU D 2 16  ? 1.832   -5.908  51.366 1.00 24.79 ? 1427 GLU D CB  1 
ATOM   2245 C CG  . GLU D 2 16  ? 3.252   -5.362  51.365 1.00 25.83 ? 1427 GLU D CG  1 
ATOM   2246 C CD  . GLU D 2 16  ? 3.532   -4.485  50.158 1.00 27.24 ? 1427 GLU D CD  1 
ATOM   2247 O OE1 . GLU D 2 16  ? 2.775   -4.581  49.175 1.00 26.48 ? 1427 GLU D OE1 1 
ATOM   2248 O OE2 . GLU D 2 16  ? 4.514   -3.720  50.184 1.00 26.64 ? 1427 GLU D OE2 1 
ATOM   2249 N N   . ILE D 2 17  ? 2.646   -6.287  54.682 1.00 27.78 ? 1428 ILE D N   1 
ATOM   2250 C CA  . ILE D 2 17  ? 2.864   -5.543  55.916 1.00 28.87 ? 1428 ILE D CA  1 
ATOM   2251 C C   . ILE D 2 17  ? 3.725   -4.354  55.528 1.00 31.04 ? 1428 ILE D C   1 
ATOM   2252 O O   . ILE D 2 17  ? 4.879   -4.515  55.153 1.00 33.42 ? 1428 ILE D O   1 
ATOM   2253 C CB  . ILE D 2 17  ? 3.580   -6.433  56.973 1.00 25.34 ? 1428 ILE D CB  1 
ATOM   2254 C CG1 . ILE D 2 17  ? 2.640   -7.557  57.417 1.00 22.12 ? 1428 ILE D CG1 1 
ATOM   2255 C CG2 . ILE D 2 17  ? 4.035   -5.596  58.181 1.00 24.77 ? 1428 ILE D CG2 1 
ATOM   2256 C CD1 . ILE D 2 17  ? 3.271   -8.549  58.410 1.00 18.01 ? 1428 ILE D CD1 1 
ATOM   2257 N N   . PRO D 2 18  ? 3.173   -3.136  55.600 1.00 34.58 ? 1429 PRO D N   1 
ATOM   2258 C CA  . PRO D 2 18  ? 3.954   -1.946  55.231 1.00 36.02 ? 1429 PRO D CA  1 
ATOM   2259 C C   . PRO D 2 18  ? 5.211   -1.730  56.068 1.00 37.55 ? 1429 PRO D C   1 
ATOM   2260 O O   . PRO D 2 18  ? 5.339   -2.264  57.175 1.00 36.13 ? 1429 PRO D O   1 
ATOM   2261 C CB  . PRO D 2 18  ? 2.954   -0.813  55.411 1.00 36.71 ? 1429 PRO D CB  1 
ATOM   2262 C CG  . PRO D 2 18  ? 2.111   -1.299  56.564 1.00 36.39 ? 1429 PRO D CG  1 
ATOM   2263 C CD  . PRO D 2 18  ? 1.877   -2.753  56.190 1.00 35.10 ? 1429 PRO D CD  1 
ATOM   2264 N N   . ARG D 2 19  ? 6.137   -0.947  55.518 1.00 40.10 ? 1430 ARG D N   1 
ATOM   2265 C CA  . ARG D 2 19  ? 7.391   -0.614  56.192 1.00 43.44 ? 1430 ARG D CA  1 
ATOM   2266 C C   . ARG D 2 19  ? 7.129   0.341   57.363 1.00 43.24 ? 1430 ARG D C   1 
ATOM   2267 O O   . ARG D 2 19  ? 6.102   1.047   57.314 1.00 42.58 ? 1430 ARG D O   1 
ATOM   2268 C CB  . ARG D 2 19  ? 8.357   0.053   55.202 1.00 47.17 ? 1430 ARG D CB  1 
ATOM   2269 C CG  . ARG D 2 19  ? 8.924   -0.885  54.135 1.00 51.72 ? 1430 ARG D CG  1 
ATOM   2270 C CD  . ARG D 2 19  ? 9.958   -1.850  54.736 1.00 56.32 ? 1430 ARG D CD  1 
ATOM   2271 N NE  . ARG D 2 19  ? 10.385  -2.877  53.782 1.00 59.43 ? 1430 ARG D NE  1 
ATOM   2272 C CZ  . ARG D 2 19  ? 11.341  -3.776  54.012 1.00 59.64 ? 1430 ARG D CZ  1 
ATOM   2273 N NH1 . ARG D 2 19  ? 11.989  -3.790  55.169 1.00 58.45 ? 1430 ARG D NH1 1 
ATOM   2274 N NH2 . ARG D 2 19  ? 11.650  -4.665  53.074 1.00 61.18 ? 1430 ARG D NH2 1 
ATOM   2275 O OXT . ARG D 2 19  ? 7.955   0.386   58.304 1.00 43.63 ? 1430 ARG D OXT 1 
HETATM 2276 O O   . HOH E 3 .   ? 4.592   -9.459  51.700 1.00 17.80 ? 130  HOH A O   1 
HETATM 2277 O O   . HOH E 3 .   ? 23.037  -9.190  51.289 1.00 17.40 ? 131  HOH A O   1 
HETATM 2278 O O   . HOH E 3 .   ? 10.921  -11.592 49.804 1.00 15.71 ? 132  HOH A O   1 
HETATM 2279 O O   . HOH E 3 .   ? 5.687   -19.933 47.063 1.00 18.92 ? 133  HOH A O   1 
HETATM 2280 O O   . HOH E 3 .   ? 12.197  -10.011 51.512 1.00 18.57 ? 134  HOH A O   1 
HETATM 2281 O O   . HOH E 3 .   ? 7.670   -17.775 46.533 1.00 14.20 ? 135  HOH A O   1 
HETATM 2282 O O   . HOH E 3 .   ? 22.593  -22.905 55.922 1.00 22.00 ? 136  HOH A O   1 
HETATM 2283 O O   . HOH E 3 .   ? 6.988   -10.576 47.243 1.00 35.01 ? 137  HOH A O   1 
HETATM 2284 O O   . HOH E 3 .   ? 35.539  -16.450 34.917 1.00 37.26 ? 138  HOH A O   1 
HETATM 2285 O O   . HOH E 3 .   ? 30.907  -13.446 38.240 1.00 23.62 ? 139  HOH A O   1 
HETATM 2286 O O   . HOH E 3 .   ? 32.531  -25.101 48.624 1.00 42.05 ? 140  HOH A O   1 
HETATM 2287 O O   . HOH E 3 .   ? 18.768  -18.189 72.484 1.00 44.80 ? 141  HOH A O   1 
HETATM 2288 O O   . HOH E 3 .   ? 16.547  -5.737  54.237 1.00 25.76 ? 142  HOH A O   1 
HETATM 2289 O O   . HOH E 3 .   ? 32.440  -10.619 36.723 1.00 32.37 ? 143  HOH A O   1 
HETATM 2290 O O   . HOH E 3 .   ? 20.298  -5.861  58.130 1.00 41.90 ? 144  HOH A O   1 
HETATM 2291 O O   . HOH E 3 .   ? 12.572  -13.501 48.421 1.00 24.57 ? 145  HOH A O   1 
HETATM 2292 O O   . HOH E 3 .   ? 19.235  -4.614  41.747 1.00 48.42 ? 146  HOH A O   1 
HETATM 2293 O O   . HOH E 3 .   ? 13.528  -13.613 73.406 1.00 36.33 ? 147  HOH A O   1 
HETATM 2294 O O   . HOH E 3 .   ? 25.535  -24.559 44.999 1.00 26.54 ? 148  HOH A O   1 
HETATM 2295 O O   . HOH E 3 .   ? 13.979  -9.493  47.823 1.00 40.68 ? 149  HOH A O   1 
HETATM 2296 O O   . HOH E 3 .   ? 25.353  -25.397 42.322 1.00 23.91 ? 150  HOH A O   1 
HETATM 2297 O O   . HOH E 3 .   ? 14.546  -10.550 41.878 1.00 38.03 ? 151  HOH A O   1 
HETATM 2298 O O   . HOH E 3 .   ? 12.255  -16.645 66.131 1.00 42.10 ? 152  HOH A O   1 
HETATM 2299 O O   . HOH E 3 .   ? 27.234  -1.084  47.975 1.00 45.39 ? 153  HOH A O   1 
HETATM 2300 O O   . HOH E 3 .   ? 7.258   -12.085 44.148 1.00 35.41 ? 154  HOH A O   1 
HETATM 2301 O O   . HOH E 3 .   ? 17.883  -30.980 66.704 1.00 42.29 ? 155  HOH A O   1 
HETATM 2302 O O   . HOH E 3 .   ? 36.955  -9.204  51.446 1.00 49.40 ? 156  HOH A O   1 
HETATM 2303 O O   . HOH E 3 .   ? 28.175  -13.472 37.776 1.00 26.89 ? 157  HOH A O   1 
HETATM 2304 O O   . HOH E 3 .   ? 18.937  -4.605  64.238 1.00 36.13 ? 158  HOH A O   1 
HETATM 2305 O O   . HOH E 3 .   ? 26.522  -27.855 50.155 1.00 37.33 ? 159  HOH A O   1 
HETATM 2306 O O   . HOH E 3 .   ? 9.655   -16.922 61.626 1.00 24.37 ? 160  HOH A O   1 
HETATM 2307 O O   . HOH E 3 .   ? 22.300  -3.958  45.772 1.00 38.69 ? 161  HOH A O   1 
HETATM 2308 O O   . HOH E 3 .   ? 35.813  -12.435 41.668 1.00 36.83 ? 162  HOH A O   1 
HETATM 2309 O O   . HOH E 3 .   ? 36.970  -10.040 48.871 1.00 39.84 ? 163  HOH A O   1 
HETATM 2310 O O   . HOH E 3 .   ? 20.317  -3.530  43.557 1.00 41.94 ? 164  HOH A O   1 
HETATM 2311 O O   . HOH E 3 .   ? 17.869  -6.665  62.259 1.00 32.77 ? 165  HOH A O   1 
HETATM 2312 O O   . HOH E 3 .   ? 16.092  -3.565  55.959 1.00 39.41 ? 166  HOH A O   1 
HETATM 2313 O O   . HOH E 3 .   ? 27.914  -27.759 57.132 1.00 44.27 ? 167  HOH A O   1 
HETATM 2314 O O   . HOH E 3 .   ? 7.159   -6.929  69.404 1.00 33.73 ? 168  HOH A O   1 
HETATM 2315 O O   . HOH E 3 .   ? -9.884  -35.886 43.110 1.00 44.47 ? 169  HOH A O   1 
HETATM 2316 O O   . HOH E 3 .   ? 24.584  -20.397 78.015 1.00 47.72 ? 170  HOH A O   1 
HETATM 2317 O O   . HOH E 3 .   ? 35.362  -1.576  67.155 1.00 42.86 ? 171  HOH A O   1 
HETATM 2318 O O   . HOH E 3 .   ? 14.941  -9.677  72.590 1.00 43.23 ? 172  HOH A O   1 
HETATM 2319 O O   . HOH E 3 .   ? 27.897  -5.544  49.203 1.00 37.57 ? 173  HOH A O   1 
HETATM 2320 O O   . HOH E 3 .   ? 1.979   -30.644 41.920 1.00 37.33 ? 174  HOH A O   1 
HETATM 2321 O O   . HOH E 3 .   ? 5.855   0.032   63.510 1.00 45.77 ? 175  HOH A O   1 
HETATM 2322 O O   . HOH E 3 .   ? 8.624   -16.027 44.367 1.00 36.85 ? 176  HOH A O   1 
HETATM 2323 O O   . HOH E 3 .   ? 31.573  0.856   48.619 1.00 45.57 ? 177  HOH A O   1 
HETATM 2324 O O   . HOH E 3 .   ? 23.915  -24.277 53.319 1.00 26.84 ? 178  HOH A O   1 
HETATM 2325 O O   . HOH E 3 .   ? 27.245  -11.113 38.170 1.00 32.28 ? 179  HOH A O   1 
HETATM 2326 O O   . HOH E 3 .   ? 34.926  -3.025  46.173 1.00 36.77 ? 180  HOH A O   1 
HETATM 2327 O O   . HOH E 3 .   ? 38.361  -15.181 33.627 1.00 29.04 ? 181  HOH A O   1 
HETATM 2328 O O   . HOH E 3 .   ? 14.750  -4.963  57.476 1.00 33.05 ? 182  HOH A O   1 
HETATM 2329 O O   . HOH F 3 .   ? 13.662  -16.883 46.721 1.00 19.34 ? 130  HOH B O   1 
HETATM 2330 O O   . HOH F 3 .   ? -4.662  -11.551 52.014 1.00 25.79 ? 131  HOH B O   1 
HETATM 2331 O O   . HOH F 3 .   ? 14.565  -26.060 53.324 1.00 18.04 ? 132  HOH B O   1 
HETATM 2332 O O   . HOH F 3 .   ? 12.365  -25.169 48.344 1.00 28.35 ? 133  HOH B O   1 
HETATM 2333 O O   . HOH F 3 .   ? -3.468  -12.098 54.545 1.00 24.73 ? 134  HOH B O   1 
HETATM 2334 O O   . HOH F 3 .   ? 8.502   -24.352 50.981 1.00 21.86 ? 135  HOH B O   1 
HETATM 2335 O O   . HOH F 3 .   ? 11.660  -19.018 46.775 1.00 18.53 ? 136  HOH B O   1 
HETATM 2336 O O   . HOH F 3 .   ? 16.933  -26.116 42.676 1.00 19.88 ? 137  HOH B O   1 
HETATM 2337 O O   . HOH F 3 .   ? 16.497  -19.322 38.908 1.00 22.79 ? 138  HOH B O   1 
HETATM 2338 O O   . HOH F 3 .   ? 6.876   -25.428 52.892 1.00 21.92 ? 139  HOH B O   1 
HETATM 2339 O O   . HOH F 3 .   ? -3.653  -26.441 52.407 1.00 18.60 ? 140  HOH B O   1 
HETATM 2340 O O   . HOH F 3 .   ? 8.042   -30.791 56.864 1.00 48.94 ? 141  HOH B O   1 
HETATM 2341 O O   . HOH F 3 .   ? 6.920   -22.667 49.197 1.00 32.47 ? 142  HOH B O   1 
HETATM 2342 O O   . HOH F 3 .   ? 30.994  -7.640  42.747 1.00 40.61 ? 143  HOH B O   1 
HETATM 2343 O O   . HOH F 3 .   ? 31.456  0.891   43.511 1.00 30.10 ? 144  HOH B O   1 
HETATM 2344 O O   . HOH F 3 .   ? -18.276 -27.679 38.408 1.00 34.13 ? 145  HOH B O   1 
HETATM 2345 O O   . HOH F 3 .   ? 2.186   -28.933 56.193 1.00 41.23 ? 146  HOH B O   1 
HETATM 2346 O O   . HOH F 3 .   ? 29.448  -4.150  38.901 1.00 31.95 ? 147  HOH B O   1 
HETATM 2347 O O   . HOH F 3 .   ? -17.954 -21.349 35.912 1.00 44.14 ? 148  HOH B O   1 
HETATM 2348 O O   . HOH F 3 .   ? 11.722  -24.781 45.569 1.00 38.01 ? 149  HOH B O   1 
HETATM 2349 O O   . HOH F 3 .   ? 27.569  1.554   44.426 1.00 45.02 ? 150  HOH B O   1 
HETATM 2350 O O   . HOH F 3 .   ? 6.747   -28.918 54.042 1.00 28.25 ? 151  HOH B O   1 
HETATM 2351 O O   . HOH F 3 .   ? -5.664  -9.826  53.696 1.00 49.46 ? 152  HOH B O   1 
HETATM 2352 O O   . HOH F 3 .   ? -15.402 -31.328 52.428 1.00 42.72 ? 153  HOH B O   1 
HETATM 2353 O O   . HOH F 3 .   ? -2.190  -31.146 58.042 1.00 43.57 ? 154  HOH B O   1 
HETATM 2354 O O   . HOH F 3 .   ? -17.728 -25.862 52.222 1.00 36.80 ? 155  HOH B O   1 
HETATM 2355 O O   . HOH F 3 .   ? 29.479  -9.333  38.671 1.00 31.24 ? 156  HOH B O   1 
HETATM 2356 O O   . HOH F 3 .   ? -16.458 -25.678 64.680 1.00 46.00 ? 157  HOH B O   1 
HETATM 2357 O O   . HOH F 3 .   ? 25.699  -4.541  45.890 1.00 29.71 ? 158  HOH B O   1 
HETATM 2358 O O   . HOH F 3 .   ? 8.185   -25.438 71.371 1.00 41.31 ? 159  HOH B O   1 
HETATM 2359 O O   . HOH F 3 .   ? -4.873  -31.587 47.736 1.00 53.30 ? 160  HOH B O   1 
HETATM 2360 O O   . HOH F 3 .   ? 15.519  -12.814 40.961 1.00 47.66 ? 161  HOH B O   1 
HETATM 2361 O O   . HOH F 3 .   ? -13.824 -29.783 60.902 1.00 38.62 ? 162  HOH B O   1 
HETATM 2362 O O   . HOH F 3 .   ? 12.106  -32.468 51.679 1.00 47.73 ? 163  HOH B O   1 
HETATM 2363 O O   . HOH F 3 .   ? 32.045  -2.308  40.941 1.00 40.30 ? 164  HOH B O   1 
HETATM 2364 O O   . HOH F 3 .   ? -1.434  -2.454  71.495 1.00 37.34 ? 165  HOH B O   1 
HETATM 2365 O O   . HOH F 3 .   ? 8.020   -24.606 47.027 1.00 36.32 ? 166  HOH B O   1 
HETATM 2366 O O   . HOH F 3 .   ? 9.646   -17.721 53.335 1.00 28.64 ? 167  HOH B O   1 
HETATM 2367 O O   . HOH F 3 .   ? -4.411  -6.125  60.505 1.00 35.92 ? 168  HOH B O   1 
HETATM 2368 O O   . HOH F 3 .   ? -17.496 -27.244 35.905 1.00 47.53 ? 169  HOH B O   1 
HETATM 2369 O O   . HOH G 3 .   ? 22.077  -0.677  40.521 1.00 24.42 ? 8    HOH C O   1 
HETATM 2370 O O   . HOH G 3 .   ? 18.172  -20.301 45.044 1.00 14.34 ? 12   HOH C O   1 
HETATM 2371 O O   . HOH G 3 .   ? 20.547  -3.860  38.489 1.00 19.75 ? 14   HOH C O   1 
HETATM 2372 O O   . HOH G 3 .   ? 23.351  -24.297 45.773 1.00 22.95 ? 17   HOH C O   1 
HETATM 2373 O O   . HOH G 3 .   ? 28.794  -2.089  37.661 1.00 24.09 ? 19   HOH C O   1 
HETATM 2374 O O   . HOH G 3 .   ? 23.772  -21.552 52.923 1.00 24.79 ? 20   HOH C O   1 
HETATM 2375 O O   . HOH G 3 .   ? 22.395  -7.251  35.832 1.00 29.20 ? 29   HOH C O   1 
HETATM 2376 O O   . HOH G 3 .   ? 22.924  -24.017 40.806 1.00 32.85 ? 32   HOH C O   1 
HETATM 2377 O O   . HOH G 3 .   ? 20.089  -1.061  38.991 1.00 24.15 ? 39   HOH C O   1 
HETATM 2378 O O   . HOH G 3 .   ? 7.455   -34.350 54.416 1.00 51.07 ? 42   HOH C O   1 
HETATM 2379 O O   . HOH G 3 .   ? 18.094  -1.452  41.151 1.00 30.41 ? 66   HOH C O   1 
HETATM 2380 O O   . HOH G 3 .   ? 16.976  -29.691 48.016 1.00 38.17 ? 67   HOH C O   1 
HETATM 2381 O O   . HOH G 3 .   ? 21.241  -29.609 53.916 1.00 38.11 ? 73   HOH C O   1 
HETATM 2382 O O   . HOH G 3 .   ? 15.104  -22.607 41.751 1.00 36.39 ? 74   HOH C O   1 
HETATM 2383 O O   . HOH G 3 .   ? 14.581  -29.746 49.308 1.00 29.87 ? 91   HOH C O   1 
HETATM 2384 O O   . HOH G 3 .   ? 13.981  -16.791 38.020 1.00 42.34 ? 95   HOH C O   1 
HETATM 2385 O O   . HOH G 3 .   ? 23.634  -27.203 58.477 1.00 33.97 ? 103  HOH C O   1 
HETATM 2386 O O   . HOH G 3 .   ? 22.999  1.851   41.605 1.00 45.10 ? 108  HOH C O   1 
HETATM 2387 O O   . HOH G 3 .   ? 19.043  -31.145 50.832 1.00 36.09 ? 112  HOH C O   1 
HETATM 2388 O O   . HOH G 3 .   ? 25.837  -10.419 35.713 1.00 35.17 ? 115  HOH C O   1 
HETATM 2389 O O   . HOH G 3 .   ? 21.130  -26.428 41.025 1.00 33.12 ? 120  HOH C O   1 
HETATM 2390 O O   . HOH H 3 .   ? 1.367   -16.823 44.463 1.00 23.52 ? 9    HOH D O   1 
HETATM 2391 O O   . HOH H 3 .   ? 2.657   -11.378 40.691 1.00 23.34 ? 21   HOH D O   1 
HETATM 2392 O O   . HOH H 3 .   ? -3.155  -31.327 37.878 1.00 29.75 ? 23   HOH D O   1 
HETATM 2393 O O   . HOH H 3 .   ? -0.596  -9.548  42.777 1.00 31.73 ? 24   HOH D O   1 
HETATM 2394 O O   . HOH H 3 .   ? -4.464  -14.189 51.570 1.00 26.06 ? 31   HOH D O   1 
HETATM 2395 O O   . HOH H 3 .   ? 12.879  -0.410  53.800 1.00 58.14 ? 45   HOH D O   1 
HETATM 2396 O O   . HOH H 3 .   ? -1.682  -5.786  51.741 1.00 33.95 ? 56   HOH D O   1 
HETATM 2397 O O   . HOH H 3 .   ? 4.459   -14.873 40.682 1.00 33.16 ? 78   HOH D O   1 
HETATM 2398 O O   . HOH H 3 .   ? 5.182   -7.132  46.959 1.00 34.44 ? 83   HOH D O   1 
HETATM 2399 O O   . HOH H 3 .   ? 0.026   -5.125  48.054 1.00 37.78 ? 87   HOH D O   1 
HETATM 2400 O O   . HOH H 3 .   ? -3.465  -10.196 43.555 1.00 40.36 ? 90   HOH D O   1 
HETATM 2401 O O   . HOH H 3 .   ? 4.442   1.166   59.212 1.00 40.90 ? 107  HOH D O   1 
HETATM 2402 O O   . HOH H 3 .   ? 11.659  -0.401  56.366 1.00 44.40 ? 119  HOH D O   1 
HETATM 2403 O O   . HOH H 3 .   ? 8.298   3.859   50.738 1.00 42.27 ? 122  HOH D O   1 
HETATM 2404 O O   . HOH H 3 .   ? 1.367   -6.919  45.536 1.00 28.67 ? 125  HOH D O   1 
HETATM 2405 O O   . HOH H 3 .   ? -2.220  -6.233  49.507 1.00 31.43 ? 128  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   3    ?    ?   ?   A . n 
A 1 2   SER 2   4    ?    ?   ?   A . n 
A 1 3   ALA 3   5    5    ALA ALA A . n 
A 1 4   ASP 4   6    6    ASP ASP A . n 
A 1 5   SER 5   7    7    SER SER A . n 
A 1 6   GLN 6   8    8    GLN GLN A . n 
A 1 7   ILE 7   9    9    ILE ILE A . n 
A 1 8   GLN 8   10   10   GLN GLN A . n 
A 1 9   PHE 9   11   11   PHE PHE A . n 
A 1 10  THR 10  12   12   THR THR A . n 
A 1 11  ARG 11  13   13   ARG ARG A . n 
A 1 12  HIS 12  14   14   HIS HIS A . n 
A 1 13  ALA 13  15   15   ALA ALA A . n 
A 1 14  SER 14  16   16   SER SER A . n 
A 1 15  ASP 15  17   17   ASP ASP A . n 
A 1 16  VAL 16  18   18   VAL VAL A . n 
A 1 17  LEU 17  19   19   LEU LEU A . n 
A 1 18  LEU 18  20   20   LEU LEU A . n 
A 1 19  ASN 19  21   21   ASN ASN A . n 
A 1 20  LEU 20  22   22   LEU LEU A . n 
A 1 21  ASN 21  23   23   ASN ASN A . n 
A 1 22  ARG 22  24   24   ARG ARG A . n 
A 1 23  LEU 23  25   25   LEU LEU A . n 
A 1 24  ARG 24  26   26   ARG ARG A . n 
A 1 25  SER 25  27   27   SER SER A . n 
A 1 26  ARG 26  28   28   ARG ARG A . n 
A 1 27  ASP 27  29   29   ASP ASP A . n 
A 1 28  ILE 28  30   30   ILE ILE A . n 
A 1 29  LEU 29  31   31   LEU LEU A . n 
A 1 30  THR 30  32   32   THR THR A . n 
A 1 31  ASP 31  33   33   ASP ASP A . n 
A 1 32  VAL 32  34   34   VAL VAL A . n 
A 1 33  VAL 33  35   35   VAL VAL A . n 
A 1 34  ILE 34  36   36   ILE ILE A . n 
A 1 35  VAL 35  37   37   VAL VAL A . n 
A 1 36  VAL 36  38   38   VAL VAL A . n 
A 1 37  SER 37  39   39   SER SER A . n 
A 1 38  ARG 38  40   40   ARG ARG A . n 
A 1 39  GLU 39  41   41   GLU GLU A . n 
A 1 40  GLN 40  42   42   GLN GLN A . n 
A 1 41  PHE 41  43   43   PHE PHE A . n 
A 1 42  ARG 42  44   44   ARG ARG A . n 
A 1 43  ALA 43  45   45   ALA ALA A . n 
A 1 44  HIS 44  46   46   HIS HIS A . n 
A 1 45  LYS 45  47   47   LYS LYS A . n 
A 1 46  THR 46  48   48   THR THR A . n 
A 1 47  VAL 47  49   49   VAL VAL A . n 
A 1 48  LEU 48  50   50   LEU LEU A . n 
A 1 49  MET 49  51   51   MET MET A . n 
A 1 50  ALA 50  52   52   ALA ALA A . n 
A 1 51  CYS 51  53   53   CYS CYS A . n 
A 1 52  SER 52  54   54   SER SER A . n 
A 1 53  GLY 53  55   55   GLY GLY A . n 
A 1 54  LEU 54  56   56   LEU LEU A . n 
A 1 55  PHE 55  57   57   PHE PHE A . n 
A 1 56  TYR 56  58   58   TYR TYR A . n 
A 1 57  SER 57  59   59   SER SER A . n 
A 1 58  ILE 58  60   60   ILE ILE A . n 
A 1 59  PHE 59  61   61   PHE PHE A . n 
A 1 60  THR 60  62   62   THR THR A . n 
A 1 61  ASP 61  63   63   ASP ASP A . n 
A 1 62  GLN 62  64   64   GLN GLN A . n 
A 1 63  LEU 63  65   65   LEU LEU A . n 
A 1 64  LYS 64  66   66   LYS LYS A . n 
A 1 65  ARG 65  67   67   ARG ARG A . n 
A 1 66  ASN 66  68   68   ASN ASN A . n 
A 1 67  LEU 67  69   69   LEU LEU A . n 
A 1 68  SER 68  70   70   SER SER A . n 
A 1 69  VAL 69  71   71   VAL VAL A . n 
A 1 70  ILE 70  72   72   ILE ILE A . n 
A 1 71  ASN 71  73   73   ASN ASN A . n 
A 1 72  LEU 72  74   74   LEU LEU A . n 
A 1 73  ASP 73  75   75   ASP ASP A . n 
A 1 74  PRO 74  76   76   PRO PRO A . n 
A 1 75  GLU 75  77   77   GLU GLU A . n 
A 1 76  ILE 76  78   78   ILE ILE A . n 
A 1 77  ASN 77  79   79   ASN ASN A . n 
A 1 78  PRO 78  80   80   PRO PRO A . n 
A 1 79  GLU 79  81   81   GLU GLU A . n 
A 1 80  GLY 80  82   82   GLY GLY A . n 
A 1 81  PHE 81  83   83   PHE PHE A . n 
A 1 82  ASN 82  84   84   ASN ASN A . n 
A 1 83  ILE 83  85   85   ILE ILE A . n 
A 1 84  LEU 84  86   86   LEU LEU A . n 
A 1 85  LEU 85  87   87   LEU LEU A . n 
A 1 86  ASP 86  88   88   ASP ASP A . n 
A 1 87  PHE 87  89   89   PHE PHE A . n 
A 1 88  MET 88  90   90   MET MET A . n 
A 1 89  TYR 89  91   91   TYR TYR A . n 
A 1 90  THR 90  92   92   THR THR A . n 
A 1 91  SER 91  93   93   SER SER A . n 
A 1 92  ARG 92  94   94   ARG ARG A . n 
A 1 93  LEU 93  95   95   LEU LEU A . n 
A 1 94  ASN 94  96   96   ASN ASN A . n 
A 1 95  LEU 95  97   97   LEU LEU A . n 
A 1 96  ARG 96  98   98   ARG ARG A . n 
A 1 97  GLU 97  99   99   GLU GLU A . n 
A 1 98  GLY 98  100  100  GLY GLY A . n 
A 1 99  ASN 99  101  101  ASN ASN A . n 
A 1 100 ILE 100 102  102  ILE ILE A . n 
A 1 101 MET 101 103  103  MET MET A . n 
A 1 102 ALA 102 104  104  ALA ALA A . n 
A 1 103 VAL 103 105  105  VAL VAL A . n 
A 1 104 MET 104 106  106  MET MET A . n 
A 1 105 ALA 105 107  107  ALA ALA A . n 
A 1 106 THR 106 108  108  THR THR A . n 
A 1 107 ALA 107 109  109  ALA ALA A . n 
A 1 108 MET 108 110  110  MET MET A . n 
A 1 109 TYR 109 111  111  TYR TYR A . n 
A 1 110 LEU 110 112  112  LEU LEU A . n 
A 1 111 GLN 111 113  113  GLN GLN A . n 
A 1 112 MET 112 114  114  MET MET A . n 
A 1 113 GLU 113 115  115  GLU GLU A . n 
A 1 114 HIS 114 116  116  HIS HIS A . n 
A 1 115 VAL 115 117  117  VAL VAL A . n 
A 1 116 VAL 116 118  118  VAL VAL A . n 
A 1 117 ASP 117 119  119  ASP ASP A . n 
A 1 118 THR 118 120  120  THR THR A . n 
A 1 119 CYS 119 121  121  CYS CYS A . n 
A 1 120 ARG 120 122  122  ARG ARG A . n 
A 1 121 LYS 121 123  123  LYS LYS A . n 
A 1 122 PHE 122 124  124  PHE PHE A . n 
A 1 123 ILE 123 125  125  ILE ILE A . n 
A 1 124 LYS 124 126  126  LYS LYS A . n 
A 1 125 ALA 125 127  127  ALA ALA A . n 
A 1 126 SER 126 128  128  SER SER A . n 
A 1 127 GLU 127 129  129  GLU GLU A . n 
B 1 1   GLY 1   3    ?    ?   ?   B . n 
B 1 2   SER 2   4    ?    ?   ?   B . n 
B 1 3   ALA 3   5    ?    ?   ?   B . n 
B 1 4   ASP 4   6    6    ASP ASP B . n 
B 1 5   SER 5   7    7    SER SER B . n 
B 1 6   GLN 6   8    8    GLN GLN B . n 
B 1 7   ILE 7   9    9    ILE ILE B . n 
B 1 8   GLN 8   10   10   GLN GLN B . n 
B 1 9   PHE 9   11   11   PHE PHE B . n 
B 1 10  THR 10  12   12   THR THR B . n 
B 1 11  ARG 11  13   13   ARG ARG B . n 
B 1 12  HIS 12  14   14   HIS HIS B . n 
B 1 13  ALA 13  15   15   ALA ALA B . n 
B 1 14  SER 14  16   16   SER SER B . n 
B 1 15  ASP 15  17   17   ASP ASP B . n 
B 1 16  VAL 16  18   18   VAL VAL B . n 
B 1 17  LEU 17  19   19   LEU LEU B . n 
B 1 18  LEU 18  20   20   LEU LEU B . n 
B 1 19  ASN 19  21   21   ASN ASN B . n 
B 1 20  LEU 20  22   22   LEU LEU B . n 
B 1 21  ASN 21  23   23   ASN ASN B . n 
B 1 22  ARG 22  24   24   ARG ARG B . n 
B 1 23  LEU 23  25   25   LEU LEU B . n 
B 1 24  ARG 24  26   26   ARG ARG B . n 
B 1 25  SER 25  27   27   SER SER B . n 
B 1 26  ARG 26  28   28   ARG ARG B . n 
B 1 27  ASP 27  29   29   ASP ASP B . n 
B 1 28  ILE 28  30   30   ILE ILE B . n 
B 1 29  LEU 29  31   31   LEU LEU B . n 
B 1 30  THR 30  32   32   THR THR B . n 
B 1 31  ASP 31  33   33   ASP ASP B . n 
B 1 32  VAL 32  34   34   VAL VAL B . n 
B 1 33  VAL 33  35   35   VAL VAL B . n 
B 1 34  ILE 34  36   36   ILE ILE B . n 
B 1 35  VAL 35  37   37   VAL VAL B . n 
B 1 36  VAL 36  38   38   VAL VAL B . n 
B 1 37  SER 37  39   39   SER SER B . n 
B 1 38  ARG 38  40   40   ARG ARG B . n 
B 1 39  GLU 39  41   41   GLU GLU B . n 
B 1 40  GLN 40  42   42   GLN GLN B . n 
B 1 41  PHE 41  43   43   PHE PHE B . n 
B 1 42  ARG 42  44   44   ARG ARG B . n 
B 1 43  ALA 43  45   45   ALA ALA B . n 
B 1 44  HIS 44  46   46   HIS HIS B . n 
B 1 45  LYS 45  47   47   LYS LYS B . n 
B 1 46  THR 46  48   48   THR THR B . n 
B 1 47  VAL 47  49   49   VAL VAL B . n 
B 1 48  LEU 48  50   50   LEU LEU B . n 
B 1 49  MET 49  51   51   MET MET B . n 
B 1 50  ALA 50  52   52   ALA ALA B . n 
B 1 51  CYS 51  53   53   CYS CYS B . n 
B 1 52  SER 52  54   54   SER SER B . n 
B 1 53  GLY 53  55   55   GLY GLY B . n 
B 1 54  LEU 54  56   56   LEU LEU B . n 
B 1 55  PHE 55  57   57   PHE PHE B . n 
B 1 56  TYR 56  58   58   TYR TYR B . n 
B 1 57  SER 57  59   59   SER SER B . n 
B 1 58  ILE 58  60   60   ILE ILE B . n 
B 1 59  PHE 59  61   61   PHE PHE B . n 
B 1 60  THR 60  62   62   THR THR B . n 
B 1 61  ASP 61  63   63   ASP ASP B . n 
B 1 62  GLN 62  64   64   GLN GLN B . n 
B 1 63  LEU 63  65   65   LEU LEU B . n 
B 1 64  LYS 64  66   66   LYS LYS B . n 
B 1 65  ARG 65  67   67   ARG ARG B . n 
B 1 66  ASN 66  68   68   ASN ASN B . n 
B 1 67  LEU 67  69   69   LEU LEU B . n 
B 1 68  SER 68  70   70   SER SER B . n 
B 1 69  VAL 69  71   71   VAL VAL B . n 
B 1 70  ILE 70  72   72   ILE ILE B . n 
B 1 71  ASN 71  73   73   ASN ASN B . n 
B 1 72  LEU 72  74   74   LEU LEU B . n 
B 1 73  ASP 73  75   75   ASP ASP B . n 
B 1 74  PRO 74  76   76   PRO PRO B . n 
B 1 75  GLU 75  77   77   GLU GLU B . n 
B 1 76  ILE 76  78   78   ILE ILE B . n 
B 1 77  ASN 77  79   79   ASN ASN B . n 
B 1 78  PRO 78  80   80   PRO PRO B . n 
B 1 79  GLU 79  81   81   GLU GLU B . n 
B 1 80  GLY 80  82   82   GLY GLY B . n 
B 1 81  PHE 81  83   83   PHE PHE B . n 
B 1 82  ASN 82  84   84   ASN ASN B . n 
B 1 83  ILE 83  85   85   ILE ILE B . n 
B 1 84  LEU 84  86   86   LEU LEU B . n 
B 1 85  LEU 85  87   87   LEU LEU B . n 
B 1 86  ASP 86  88   88   ASP ASP B . n 
B 1 87  PHE 87  89   89   PHE PHE B . n 
B 1 88  MET 88  90   90   MET MET B . n 
B 1 89  TYR 89  91   91   TYR TYR B . n 
B 1 90  THR 90  92   92   THR THR B . n 
B 1 91  SER 91  93   93   SER SER B . n 
B 1 92  ARG 92  94   94   ARG ARG B . n 
B 1 93  LEU 93  95   95   LEU LEU B . n 
B 1 94  ASN 94  96   96   ASN ASN B . n 
B 1 95  LEU 95  97   97   LEU LEU B . n 
B 1 96  ARG 96  98   98   ARG ARG B . n 
B 1 97  GLU 97  99   99   GLU GLU B . n 
B 1 98  GLY 98  100  100  GLY GLY B . n 
B 1 99  ASN 99  101  101  ASN ASN B . n 
B 1 100 ILE 100 102  102  ILE ILE B . n 
B 1 101 MET 101 103  103  MET MET B . n 
B 1 102 ALA 102 104  104  ALA ALA B . n 
B 1 103 VAL 103 105  105  VAL VAL B . n 
B 1 104 MET 104 106  106  MET MET B . n 
B 1 105 ALA 105 107  107  ALA ALA B . n 
B 1 106 THR 106 108  108  THR THR B . n 
B 1 107 ALA 107 109  109  ALA ALA B . n 
B 1 108 MET 108 110  110  MET MET B . n 
B 1 109 TYR 109 111  111  TYR TYR B . n 
B 1 110 LEU 110 112  112  LEU LEU B . n 
B 1 111 GLN 111 113  113  GLN GLN B . n 
B 1 112 MET 112 114  114  MET MET B . n 
B 1 113 GLU 113 115  115  GLU GLU B . n 
B 1 114 HIS 114 116  116  HIS HIS B . n 
B 1 115 VAL 115 117  117  VAL VAL B . n 
B 1 116 VAL 116 118  118  VAL VAL B . n 
B 1 117 ASP 117 119  119  ASP ASP B . n 
B 1 118 THR 118 120  120  THR THR B . n 
B 1 119 CYS 119 121  121  CYS CYS B . n 
B 1 120 ARG 120 122  122  ARG ARG B . n 
B 1 121 LYS 121 123  123  LYS LYS B . n 
B 1 122 PHE 122 124  124  PHE PHE B . n 
B 1 123 ILE 123 125  125  ILE ILE B . n 
B 1 124 LYS 124 126  126  LYS LYS B . n 
B 1 125 ALA 125 127  127  ALA ALA B . n 
B 1 126 SER 126 128  128  SER SER B . n 
B 1 127 GLU 127 129  ?    ?   ?   B . n 
C 2 1   GLY 1   -1   -1   GLY GLY C . n 
C 2 2   SER 2   0    0    SER SER C . n 
C 2 3   LEU 3   1414 1414 LEU LEU C . n 
C 2 4   VAL 4   1415 1415 VAL VAL C . n 
C 2 5   ALA 5   1416 1416 ALA ALA C . n 
C 2 6   THR 6   1417 1417 THR THR C . n 
C 2 7   VAL 7   1418 1418 VAL VAL C . n 
C 2 8   LYS 8   1419 1419 LYS LYS C . n 
C 2 9   GLU 9   1420 1420 GLU GLU C . n 
C 2 10  ALA 10  1421 1421 ALA ALA C . n 
C 2 11  GLY 11  1422 1422 GLY GLY C . n 
C 2 12  ARG 12  1423 1423 ARG ARG C . n 
C 2 13  SER 13  1424 1424 SER SER C . n 
C 2 14  ILE 14  1425 1425 ILE ILE C . n 
C 2 15  HIS 15  1426 1426 HIS HIS C . n 
C 2 16  GLU 16  1427 1427 GLU GLU C . n 
C 2 17  ILE 17  1428 1428 ILE ILE C . n 
C 2 18  PRO 18  1429 1429 PRO PRO C . n 
C 2 19  ARG 19  1430 1430 ARG ARG C . n 
D 2 1   GLY 1   1412 ?    ?   ?   D . n 
D 2 2   SER 2   1413 ?    ?   ?   D . n 
D 2 3   LEU 3   1414 1414 LEU LEU D . n 
D 2 4   VAL 4   1415 1415 VAL VAL D . n 
D 2 5   ALA 5   1416 1416 ALA ALA D . n 
D 2 6   THR 6   1417 1417 THR THR D . n 
D 2 7   VAL 7   1418 1418 VAL VAL D . n 
D 2 8   LYS 8   1419 1419 LYS LYS D . n 
D 2 9   GLU 9   1420 1420 GLU GLU D . n 
D 2 10  ALA 10  1421 1421 ALA ALA D . n 
D 2 11  GLY 11  1422 1422 GLY GLY D . n 
D 2 12  ARG 12  1423 1423 ARG ARG D . n 
D 2 13  SER 13  1424 1424 SER SER D . n 
D 2 14  ILE 14  1425 1425 ILE ILE D . n 
D 2 15  HIS 15  1426 1426 HIS HIS D . n 
D 2 16  GLU 16  1427 1427 GLU GLU D . n 
D 2 17  ILE 17  1428 1428 ILE ILE D . n 
D 2 18  PRO 18  1429 1429 PRO PRO D . n 
D 2 19  ARG 19  1430 1430 ARG ARG D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8310  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  13920 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-23 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 39  ? ? 57.34   -130.24 
2 1 MET A 114 ? ? -117.88 78.26   
3 1 LEU B 31  ? ? 56.95   7.44    
4 1 SER B 39  ? ? 70.54   -142.89 
5 1 LEU B 65  ? ? -73.38  -72.70  
6 1 LYS B 66  ? ? -80.15  30.86   
7 1 SER B 93  ? ? 75.83   -2.77   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 3    ? A GLY 1   
2 1 Y 1 A SER 4    ? A SER 2   
3 1 Y 1 B GLY 3    ? B GLY 1   
4 1 Y 1 B SER 4    ? B SER 2   
5 1 Y 1 B ALA 5    ? B ALA 3   
6 1 Y 1 B GLU 129  ? B GLU 127 
7 1 Y 1 D GLY 1412 ? D GLY 1   
8 1 Y 1 D SER 1413 ? D SER 2   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  130 1   HOH HOH A . 
E 3 HOH 2  131 2   HOH HOH A . 
E 3 HOH 3  132 4   HOH HOH A . 
E 3 HOH 4  133 5   HOH HOH A . 
E 3 HOH 5  134 10  HOH HOH A . 
E 3 HOH 6  135 11  HOH HOH A . 
E 3 HOH 7  136 15  HOH HOH A . 
E 3 HOH 8  137 16  HOH HOH A . 
E 3 HOH 9  138 27  HOH HOH A . 
E 3 HOH 10 139 36  HOH HOH A . 
E 3 HOH 11 140 38  HOH HOH A . 
E 3 HOH 12 141 40  HOH HOH A . 
E 3 HOH 13 142 41  HOH HOH A . 
E 3 HOH 14 143 43  HOH HOH A . 
E 3 HOH 15 144 44  HOH HOH A . 
E 3 HOH 16 145 46  HOH HOH A . 
E 3 HOH 17 146 47  HOH HOH A . 
E 3 HOH 18 147 48  HOH HOH A . 
E 3 HOH 19 148 50  HOH HOH A . 
E 3 HOH 20 149 53  HOH HOH A . 
E 3 HOH 21 150 54  HOH HOH A . 
E 3 HOH 22 151 57  HOH HOH A . 
E 3 HOH 23 152 58  HOH HOH A . 
E 3 HOH 24 153 59  HOH HOH A . 
E 3 HOH 25 154 60  HOH HOH A . 
E 3 HOH 26 155 61  HOH HOH A . 
E 3 HOH 27 156 65  HOH HOH A . 
E 3 HOH 28 157 68  HOH HOH A . 
E 3 HOH 29 158 69  HOH HOH A . 
E 3 HOH 30 159 70  HOH HOH A . 
E 3 HOH 31 160 71  HOH HOH A . 
E 3 HOH 32 161 76  HOH HOH A . 
E 3 HOH 33 162 79  HOH HOH A . 
E 3 HOH 34 163 80  HOH HOH A . 
E 3 HOH 35 164 82  HOH HOH A . 
E 3 HOH 36 165 84  HOH HOH A . 
E 3 HOH 37 166 86  HOH HOH A . 
E 3 HOH 38 167 89  HOH HOH A . 
E 3 HOH 39 168 92  HOH HOH A . 
E 3 HOH 40 169 93  HOH HOH A . 
E 3 HOH 41 170 97  HOH HOH A . 
E 3 HOH 42 171 100 HOH HOH A . 
E 3 HOH 43 172 101 HOH HOH A . 
E 3 HOH 44 173 105 HOH HOH A . 
E 3 HOH 45 174 109 HOH HOH A . 
E 3 HOH 46 175 116 HOH HOH A . 
E 3 HOH 47 176 118 HOH HOH A . 
E 3 HOH 48 177 124 HOH HOH A . 
E 3 HOH 49 178 126 HOH HOH A . 
E 3 HOH 50 179 127 HOH HOH A . 
E 3 HOH 51 180 129 HOH HOH A . 
E 3 HOH 52 181 131 HOH HOH A . 
E 3 HOH 53 182 132 HOH HOH A . 
F 3 HOH 1  130 3   HOH HOH B . 
F 3 HOH 2  131 6   HOH HOH B . 
F 3 HOH 3  132 7   HOH HOH B . 
F 3 HOH 4  133 13  HOH HOH B . 
F 3 HOH 5  134 18  HOH HOH B . 
F 3 HOH 6  135 22  HOH HOH B . 
F 3 HOH 7  136 25  HOH HOH B . 
F 3 HOH 8  137 26  HOH HOH B . 
F 3 HOH 9  138 28  HOH HOH B . 
F 3 HOH 10 139 33  HOH HOH B . 
F 3 HOH 11 140 34  HOH HOH B . 
F 3 HOH 12 141 35  HOH HOH B . 
F 3 HOH 13 142 37  HOH HOH B . 
F 3 HOH 14 143 49  HOH HOH B . 
F 3 HOH 15 144 51  HOH HOH B . 
F 3 HOH 16 145 52  HOH HOH B . 
F 3 HOH 17 146 55  HOH HOH B . 
F 3 HOH 18 147 62  HOH HOH B . 
F 3 HOH 19 148 63  HOH HOH B . 
F 3 HOH 20 149 64  HOH HOH B . 
F 3 HOH 21 150 72  HOH HOH B . 
F 3 HOH 22 151 75  HOH HOH B . 
F 3 HOH 23 152 77  HOH HOH B . 
F 3 HOH 24 153 81  HOH HOH B . 
F 3 HOH 25 154 85  HOH HOH B . 
F 3 HOH 26 155 88  HOH HOH B . 
F 3 HOH 27 156 94  HOH HOH B . 
F 3 HOH 28 157 96  HOH HOH B . 
F 3 HOH 29 158 99  HOH HOH B . 
F 3 HOH 30 159 102 HOH HOH B . 
F 3 HOH 31 160 104 HOH HOH B . 
F 3 HOH 32 161 106 HOH HOH B . 
F 3 HOH 33 162 110 HOH HOH B . 
F 3 HOH 34 163 111 HOH HOH B . 
F 3 HOH 35 164 113 HOH HOH B . 
F 3 HOH 36 165 114 HOH HOH B . 
F 3 HOH 37 166 117 HOH HOH B . 
F 3 HOH 38 167 121 HOH HOH B . 
F 3 HOH 39 168 123 HOH HOH B . 
F 3 HOH 40 169 130 HOH HOH B . 
G 3 HOH 1  8   8   HOH HOH C . 
G 3 HOH 2  12  12  HOH HOH C . 
G 3 HOH 3  14  14  HOH HOH C . 
G 3 HOH 4  17  17  HOH HOH C . 
G 3 HOH 5  19  19  HOH HOH C . 
G 3 HOH 6  20  20  HOH HOH C . 
G 3 HOH 7  29  29  HOH HOH C . 
G 3 HOH 8  32  32  HOH HOH C . 
G 3 HOH 9  39  39  HOH HOH C . 
G 3 HOH 10 42  42  HOH HOH C . 
G 3 HOH 11 66  66  HOH HOH C . 
G 3 HOH 12 67  67  HOH HOH C . 
G 3 HOH 13 73  73  HOH HOH C . 
G 3 HOH 14 74  74  HOH HOH C . 
G 3 HOH 15 91  91  HOH HOH C . 
G 3 HOH 16 95  95  HOH HOH C . 
G 3 HOH 17 103 103 HOH HOH C . 
G 3 HOH 18 108 108 HOH HOH C . 
G 3 HOH 19 112 112 HOH HOH C . 
G 3 HOH 20 115 115 HOH HOH C . 
G 3 HOH 21 120 120 HOH HOH C . 
H 3 HOH 1  9   9   HOH HOH D . 
H 3 HOH 2  21  21  HOH HOH D . 
H 3 HOH 3  23  23  HOH HOH D . 
H 3 HOH 4  24  24  HOH HOH D . 
H 3 HOH 5  31  31  HOH HOH D . 
H 3 HOH 6  45  45  HOH HOH D . 
H 3 HOH 7  56  56  HOH HOH D . 
H 3 HOH 8  78  78  HOH HOH D . 
H 3 HOH 9  83  83  HOH HOH D . 
H 3 HOH 10 87  87  HOH HOH D . 
H 3 HOH 11 90  90  HOH HOH D . 
H 3 HOH 12 107 107 HOH HOH D . 
H 3 HOH 13 119 119 HOH HOH D . 
H 3 HOH 14 122 122 HOH HOH D . 
H 3 HOH 15 125 125 HOH HOH D . 
H 3 HOH 16 128 128 HOH HOH D . 
#