data_1R2Y
# 
_entry.id   1R2Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1R2Y         
NDB   PD0473       
RCSB  RCSB020371   
WWPDB D_1000020371 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1L1T 'Mutm (Fpg) Bound To Abasic-Site Containing DNA'                unspecified 
PDB 1L1Z 'Mutm (Fpg) Covalent-DNA Intermediate'                          unspecified 
PDB 1L2B 'Mutm (Fpg) DNA End-Product Structure'                          unspecified 
PDB 1L2C 'Mutm (Fpg)-DNA Estranged Thymine Mismatch Recognition Complex' unspecified 
PDB 1L2D 'Mutm (Fpg)-DNA Estranged Guanine Mismatch Recognition Complex' unspecified 
PDB 1R2Z 'MutM (Fpg) bound to 5,6-dihydrouracil (DHU) containing DNA'    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R2Y 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fromme, J.C.'  1 
'Verdine, G.L.' 2 
# 
_citation.id                        primary 
_citation.title                     'DNA Lesion Recognition by the Bacterial Repair Enzyme MutM.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                51543 
_citation.page_last                 51548 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14525999 
_citation.pdbx_database_id_DOI      10.1074/jbc.M307768200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fromme, J.C.'  1 
primary 'Verdine, G.L.' 2 
# 
_cell.entry_id           1R2Y 
_cell.length_a           44.290 
_cell.length_b           93.634 
_cell.length_c           102.221 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1R2Y 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3'"     3687.417  1   ? ?   ? ? 
2 polymer     syn "5'-D(*TP*GP*CP*GP*TP*CP*CP*AP*(8OG)P*GP*TP*CP*TP*AP*CP*C)-3'" 3654.379  1   ? ?   ? ? 
3 polymer     man MutM                                                           30738.525 1   ? E3Q ? ? 
4 non-polymer syn 'ZINC ION'                                                     65.409    1   ? ?   ? ? 
5 water       nat water                                                          18.015    135 ? ?   ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        FPG 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DG)(DT)(DA)(DG)(DA)(DC)(DC)(DT)(DG)(DG)(DA)(DC)' GTAGACCTGGAC B ? 
2 polydeoxyribonucleotide no yes '(DG)(DT)(DC)(DC)(DA)(8OG)(DG)(DT)(DC)(DT)(DA)(DC)' GTCCAGGTCTAC C ? 
3 'polypeptide(L)'        no no  
;MPQLPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
;MPQLPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DT  n 
1 3   DA  n 
1 4   DG  n 
1 5   DA  n 
1 6   DC  n 
1 7   DC  n 
1 8   DT  n 
1 9   DG  n 
1 10  DG  n 
1 11  DA  n 
1 12  DC  n 
2 1   DG  n 
2 2   DT  n 
2 3   DC  n 
2 4   DC  n 
2 5   DA  n 
2 6   8OG n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DT  n 
2 11  DA  n 
2 12  DC  n 
3 1   MET n 
3 2   PRO n 
3 3   GLN n 
3 4   LEU n 
3 5   PRO n 
3 6   GLU n 
3 7   VAL n 
3 8   GLU n 
3 9   THR n 
3 10  ILE n 
3 11  ARG n 
3 12  ARG n 
3 13  THR n 
3 14  LEU n 
3 15  LEU n 
3 16  PRO n 
3 17  LEU n 
3 18  ILE n 
3 19  VAL n 
3 20  GLY n 
3 21  LYS n 
3 22  THR n 
3 23  ILE n 
3 24  GLU n 
3 25  ASP n 
3 26  VAL n 
3 27  ARG n 
3 28  ILE n 
3 29  PHE n 
3 30  TRP n 
3 31  PRO n 
3 32  ASN n 
3 33  ILE n 
3 34  ILE n 
3 35  ARG n 
3 36  HIS n 
3 37  PRO n 
3 38  ARG n 
3 39  ASP n 
3 40  SER n 
3 41  GLU n 
3 42  ALA n 
3 43  PHE n 
3 44  ALA n 
3 45  ALA n 
3 46  ARG n 
3 47  MET n 
3 48  ILE n 
3 49  GLY n 
3 50  GLN n 
3 51  THR n 
3 52  VAL n 
3 53  ARG n 
3 54  GLY n 
3 55  LEU n 
3 56  GLU n 
3 57  ARG n 
3 58  ARG n 
3 59  GLY n 
3 60  LYS n 
3 61  PHE n 
3 62  LEU n 
3 63  LYS n 
3 64  PHE n 
3 65  LEU n 
3 66  LEU n 
3 67  ASP n 
3 68  ARG n 
3 69  ASP n 
3 70  ALA n 
3 71  LEU n 
3 72  ILE n 
3 73  SER n 
3 74  HIS n 
3 75  LEU n 
3 76  ARG n 
3 77  MET n 
3 78  GLU n 
3 79  GLY n 
3 80  ARG n 
3 81  TYR n 
3 82  ALA n 
3 83  VAL n 
3 84  ALA n 
3 85  SER n 
3 86  ALA n 
3 87  LEU n 
3 88  GLU n 
3 89  PRO n 
3 90  LEU n 
3 91  GLU n 
3 92  PRO n 
3 93  HIS n 
3 94  THR n 
3 95  HIS n 
3 96  VAL n 
3 97  VAL n 
3 98  PHE n 
3 99  CYS n 
3 100 PHE n 
3 101 THR n 
3 102 ASP n 
3 103 GLY n 
3 104 SER n 
3 105 GLU n 
3 106 LEU n 
3 107 ARG n 
3 108 TYR n 
3 109 ARG n 
3 110 ASP n 
3 111 VAL n 
3 112 ARG n 
3 113 LYS n 
3 114 PHE n 
3 115 GLY n 
3 116 THR n 
3 117 MET n 
3 118 HIS n 
3 119 VAL n 
3 120 TYR n 
3 121 ALA n 
3 122 LYS n 
3 123 GLU n 
3 124 GLU n 
3 125 ALA n 
3 126 ASP n 
3 127 ARG n 
3 128 ARG n 
3 129 PRO n 
3 130 PRO n 
3 131 LEU n 
3 132 ALA n 
3 133 GLU n 
3 134 LEU n 
3 135 GLY n 
3 136 PRO n 
3 137 GLU n 
3 138 PRO n 
3 139 LEU n 
3 140 SER n 
3 141 PRO n 
3 142 ALA n 
3 143 PHE n 
3 144 SER n 
3 145 PRO n 
3 146 ALA n 
3 147 VAL n 
3 148 LEU n 
3 149 ALA n 
3 150 GLU n 
3 151 ARG n 
3 152 ALA n 
3 153 VAL n 
3 154 LYS n 
3 155 THR n 
3 156 LYS n 
3 157 ARG n 
3 158 SER n 
3 159 VAL n 
3 160 LYS n 
3 161 ALA n 
3 162 LEU n 
3 163 LEU n 
3 164 LEU n 
3 165 ASP n 
3 166 GLN n 
3 167 THR n 
3 168 VAL n 
3 169 VAL n 
3 170 ALA n 
3 171 GLY n 
3 172 PHE n 
3 173 GLY n 
3 174 ASN n 
3 175 ILE n 
3 176 TYR n 
3 177 VAL n 
3 178 ASP n 
3 179 GLU n 
3 180 SER n 
3 181 LEU n 
3 182 PHE n 
3 183 ARG n 
3 184 ALA n 
3 185 GLY n 
3 186 ILE n 
3 187 LEU n 
3 188 PRO n 
3 189 GLY n 
3 190 ARG n 
3 191 PRO n 
3 192 ALA n 
3 193 ALA n 
3 194 SER n 
3 195 LEU n 
3 196 SER n 
3 197 SER n 
3 198 LYS n 
3 199 GLU n 
3 200 ILE n 
3 201 GLU n 
3 202 ARG n 
3 203 LEU n 
3 204 HIS n 
3 205 GLU n 
3 206 GLU n 
3 207 MET n 
3 208 VAL n 
3 209 ALA n 
3 210 THR n 
3 211 ILE n 
3 212 GLY n 
3 213 GLU n 
3 214 ALA n 
3 215 VAL n 
3 216 MET n 
3 217 LYS n 
3 218 GLY n 
3 219 GLY n 
3 220 SER n 
3 221 THR n 
3 222 VAL n 
3 223 ARG n 
3 224 THR n 
3 225 TYR n 
3 226 VAL n 
3 227 ASN n 
3 228 THR n 
3 229 GLN n 
3 230 GLY n 
3 231 GLU n 
3 232 ALA n 
3 233 GLY n 
3 234 THR n 
3 235 PHE n 
3 236 GLN n 
3 237 HIS n 
3 238 HIS n 
3 239 LEU n 
3 240 TYR n 
3 241 VAL n 
3 242 TYR n 
3 243 GLY n 
3 244 ARG n 
3 245 GLN n 
3 246 GLY n 
3 247 ASN n 
3 248 PRO n 
3 249 CYS n 
3 250 LYS n 
3 251 ARG n 
3 252 CYS n 
3 253 GLY n 
3 254 THR n 
3 255 PRO n 
3 256 ILE n 
3 257 GLU n 
3 258 LYS n 
3 259 THR n 
3 260 VAL n 
3 261 VAL n 
3 262 ALA n 
3 263 GLY n 
3 264 ARG n 
3 265 GLY n 
3 266 THR n 
3 267 HIS n 
3 268 TYR n 
3 269 CYS n 
3 270 PRO n 
3 271 ARG n 
3 272 CYS n 
3 273 GLN n 
3 274 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 mutm 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP P84131_BACST P84131 3 1 ? ? 
2 PDB 1R2Y         1R2Y   1 ? ? ? 
3 PDB 1R2Y         1R2Y   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1R2Y A 1 ? 274 ? P84131 1  ? 274 ? 1  274 
2 2 1R2Y B 1 ? 12  ? 1R2Y   1  ? 12  ? 1  12  
3 3 1R2Y C 1 ? 12  ? 1R2Y   13 ? 24  ? 13 24  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P' 363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                                                       
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                  ?                                                       
'Zn 2'            65.409  
# 
_exptl.entry_id          1R2Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.density_percent_sol   55.45 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, MAGNESIUM ACETATE, SODIUM CACODYLATE, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000'          ? ? ? 
1 2 1 'MAGNESIUM ACETATE' ? ? ? 
1 3 1 'SODIUM CACODYLATE' ? ? ? 
1 4 1 H2O                 ? ? ? 
1 5 2 'PEG 8000'          ? ? ? 
1 6 2 'MAGNESIUM ACETATE' ? ? ? 
1 7 2 'SODIUM CACODYLATE' ? ? ? 
1 8 2 H2O                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-03-28 
_diffrn_detector.details                Osmic 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1R2Y 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.34 
_reflns.number_obs                   18601 
_reflns.number_all                   18609 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.9 
_reflns.B_iso_Wilson_estimate        24.0 
_reflns.pdbx_redundancy              7.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.34 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.395 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.8 
_reflns_shell.pdbx_redundancy        7.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1810 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1R2Y 
_refine.ls_number_reflns_obs                     17910 
_refine.ls_number_reflns_all                     18598 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               329052.00 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           329052.00 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.34 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.211 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.9 
_refine.ls_number_reflns_R_free                  1233 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.2 
_refine.aniso_B[1][1]                            1.53 
_refine.aniso_B[2][2]                            2.55 
_refine.aniso_B[3][3]                            -4.08 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.351345 
_refine.solvent_model_param_bsol                 33.732 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1L1T 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1R2Y 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.16 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2108 
_refine_hist.pdbx_number_atoms_nucleic_acid   487 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               2731 
_refine_hist.d_res_high                       2.34 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.96  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.19  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.82  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.64  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.62  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.34 
_refine_ls_shell.d_res_low                        2.42 
_refine_ls_shell.number_reflns_R_work             1549 
_refine_ls_shell.R_factor_R_work                  0.217 
_refine_ls_shell.percent_reflns_obs               91.3 
_refine_ls_shell.R_factor_R_free                  0.265 
_refine_ls_shell.R_factor_R_free_error            0.027 
_refine_ls_shell.percent_reflns_R_free            6.1 
_refine_ls_shell.number_reflns_R_free             100 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM         WATER.TOP   'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM   ION.TOP     'X-RAY DIFFRACTION' 
5 OXOG.PARAM        OXOG.TOP    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1R2Y 
_struct.title                     'MutM (Fpg) bound to 8-oxoguanine (oxoG) containing DNA' 
_struct.pdbx_descriptor           'MutM/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R2Y 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'DNA REPAIR, DNA GLYCOSYLASE, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN C 3   ? VAL C 19  ? GLN A 3   VAL A 19  1 ? 17 
HELX_P HELX_P2  2  TRP C 30  ? ASN C 32  ? TRP A 30  ASN A 32  5 ? 3  
HELX_P HELX_P3  3  ASP C 39  ? ILE C 48  ? ASP A 39  ILE A 48  1 ? 10 
HELX_P HELX_P4  4  LYS C 122 ? ASP C 126 ? LYS A 122 ASP A 126 1 ? 5  
HELX_P HELX_P5  5  SER C 144 ? VAL C 153 ? SER A 144 VAL A 153 1 ? 10 
HELX_P HELX_P6  6  SER C 158 ? ASP C 165 ? SER A 158 ASP A 165 1 ? 8  
HELX_P HELX_P7  7  GLY C 173 ? ALA C 184 ? GLY A 173 ALA A 184 1 ? 12 
HELX_P HELX_P8  8  PRO C 191 ? LEU C 195 ? PRO A 191 LEU A 195 5 ? 5  
HELX_P HELX_P9  9  SER C 196 ? LYS C 217 ? SER A 196 LYS A 217 1 ? 22 
HELX_P HELX_P10 10 THR C 234 ? LEU C 239 ? THR A 234 LEU A 239 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B 8OG 6  P     ? ? ? 1_555 B DA  5   "O3'" ? ? C 8OG 18  C DA  17  1_555 ? ? ? ? ? ? ?            1.596 ? 
covale2  covale ? ? B 8OG 6  "O3'" ? ? ? 1_555 B DG  7   P     ? ? C 8OG 18  C DG  19  1_555 ? ? ? ? ? ? ?            1.582 ? 
metalc1  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 252 SG    ? ? A ZN  300 A CYS 252 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc2  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 269 SG    ? ? A ZN  300 A CYS 269 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc3  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 272 SG    ? ? A ZN  300 A CYS 272 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc4  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 249 SG    ? ? A ZN  300 A CYS 249 1_555 ? ? ? ? ? ? ?            2.432 ? 
hydrog1  hydrog ? ? A DG  1  N2    ? ? ? 1_555 B DC  12  O2    ? ? B DG  1   C DC  24  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? A DT  2  N3    ? ? ? 1_555 B DA  11  N1    ? ? B DT  2   C DA  23  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog3  hydrog ? ? A DA  3  N1    ? ? ? 1_555 B DT  10  N3    ? ? B DA  3   C DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  3  N6    ? ? ? 1_555 B DT  10  O4    ? ? B DA  3   C DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  4  N1    ? ? ? 1_555 B DC  9   N3    ? ? B DG  4   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  4  N2    ? ? ? 1_555 B DC  9   O2    ? ? B DG  4   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  4  O6    ? ? ? 1_555 B DC  9   N4    ? ? B DG  4   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  5  N1    ? ? ? 1_555 B DT  8   N3    ? ? B DA  5   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA  5  N6    ? ? ? 1_555 B DT  8   O4    ? ? B DA  5   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  6  N3    ? ? ? 1_555 B DG  7   N1    ? ? B DC  6   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DC  6  N4    ? ? ? 1_555 B DG  7   O6    ? ? B DC  6   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC  6  O2    ? ? ? 1_555 B DG  7   N2    ? ? B DC  6   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  8  N3    ? ? ? 1_555 B DA  5   N1    ? ? B DT  8   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  8  O4    ? ? ? 1_555 B DA  5   N6    ? ? B DT  8   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  9  N1    ? ? ? 1_555 B DC  4   N3    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  9  N2    ? ? ? 1_555 B DC  4   O2    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  9  O6    ? ? ? 1_555 B DC  4   N4    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG  10 N1    ? ? ? 1_555 B DC  3   N3    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  10 N2    ? ? ? 1_555 B DC  3   O2    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG  10 O6    ? ? ? 1_555 B DC  3   N4    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA  11 N1    ? ? ? 1_555 B DT  2   N3    ? ? B DA  11  C DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  11 N6    ? ? ? 1_555 B DT  2   O4    ? ? B DA  11  C DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  12 N3    ? ? ? 1_555 B DG  1   N1    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  12 N4    ? ? ? 1_555 B DG  1   O6    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC  12 O2    ? ? ? 1_555 B DG  1   N2    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 36  C . ? HIS 36  A PRO 37  C ? PRO 37  A 1 -0.59 
2 PRO 129 C . ? PRO 129 A PRO 130 C ? PRO 130 A 1 0.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 23  ? ILE C 28  ? ILE A 23  ILE A 28  
A 2 THR C 94  ? PHE C 100 ? THR A 94  PHE A 100 
A 3 SER C 104 ? ARG C 109 ? SER A 104 ARG A 109 
A 4 ARG C 80  ? SER C 85  ? ARG A 80  SER A 85  
B 1 ILE C 34  ? HIS C 36  ? ILE A 34  HIS A 36  
B 2 THR C 116 ? ALA C 121 ? THR A 116 ALA A 121 
B 3 ASP C 69  ? HIS C 74  ? ASP A 69  HIS A 74  
B 4 PHE C 61  ? LEU C 65  ? PHE A 61  LEU A 65  
B 5 GLY C 54  ? ARG C 58  ? GLY A 54  ARG A 58  
C 1 GLU C 257 ? VAL C 261 ? GLU A 257 VAL A 261 
C 2 ARG C 264 ? TYR C 268 ? ARG A 264 TYR A 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP C 25  ? N ASP A 25  O CYS C 99  ? O CYS A 99  
A 2 3 N PHE C 98  ? N PHE A 98  O LEU C 106 ? O LEU A 106 
A 3 4 O ARG C 107 ? O ARG A 107 N ALA C 82  ? N ALA A 82  
B 1 2 N HIS C 36  ? N HIS A 36  O VAL C 119 ? O VAL A 119 
B 2 3 O HIS C 118 ? O HIS A 118 N ILE C 72  ? N ILE A 72  
B 3 4 O SER C 73  ? O SER A 73  N LEU C 62  ? N LEU A 62  
B 4 5 O LYS C 63  ? O LYS A 63  N GLU C 56  ? N GLU A 56  
C 1 2 N GLU C 257 ? N GLU A 257 O TYR C 268 ? O TYR A 268 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS C 249 ? CYS A 249 . ? 1_555 ? 
2 AC1 4 CYS C 252 ? CYS A 252 . ? 1_555 ? 
3 AC1 4 CYS C 269 ? CYS A 269 . ? 1_555 ? 
4 AC1 4 CYS C 272 ? CYS A 272 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1R2Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1R2Y 
_atom_sites.fract_transf_matrix[1][1]   0.022578 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010680 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009783 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 4.580   46.787 31.132 1.00 108.60 ? 1   DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 3.399   47.344 31.720 1.00 108.98 ? 1   DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 3.693   48.022 33.038 1.00 109.08 ? 1   DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 4.704   49.037 32.829 1.00 109.21 ? 1   DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 2.500   48.743 33.665 1.00 109.14 ? 1   DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 2.559   48.652 35.095 1.00 109.18 ? 1   DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 2.685   50.179 33.211 1.00 108.79 ? 1   DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 4.197   50.318 33.179 1.00 108.79 ? 1   DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 4.691   51.273 32.192 1.00 108.41 ? 1   DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 4.841   51.064 30.842 1.00 108.17 ? 1   DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 5.321   52.101 30.212 1.00 107.75 ? 1   DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 5.496   53.056 31.205 1.00 107.55 ? 1   DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 5.989   54.386 31.126 1.00 107.15 ? 1   DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 6.383   55.005 30.129 1.00 106.46 ? 1   DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 5.997   55.002 32.375 1.00 106.72 ? 1   DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 5.585   54.417 33.548 1.00 106.69 ? 1   DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 5.669   55.178 34.650 1.00 106.40 ? 1   DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 5.123   53.179 33.635 1.00 106.91 ? 1   DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 5.107   52.562 32.434 1.00 107.73 ? 1   DG  B C4    1 
ATOM   20   P  P     . DT  A 1 2   ? 1.278   49.069 35.976 1.00 109.34 ? 2   DT  B P     1 
ATOM   21   O  OP1   . DT  A 1 2   ? 1.538   48.650 37.378 1.00 108.80 ? 2   DT  B OP1   1 
ATOM   22   O  OP2   . DT  A 1 2   ? 0.053   48.590 35.283 1.00 109.27 ? 2   DT  B OP2   1 
ATOM   23   O  "O5'" . DT  A 1 2   ? 1.288   50.663 35.934 1.00 108.55 ? 2   DT  B "O5'" 1 
ATOM   24   C  "C5'" . DT  A 1 2   ? 2.016   51.414 36.905 1.00 106.93 ? 2   DT  B "C5'" 1 
ATOM   25   C  "C4'" . DT  A 1 2   ? 1.623   52.872 36.846 1.00 105.69 ? 2   DT  B "C4'" 1 
ATOM   26   O  "O4'" . DT  A 1 2   ? 2.187   53.503 35.671 1.00 104.87 ? 2   DT  B "O4'" 1 
ATOM   27   C  "C3'" . DT  A 1 2   ? 0.116   53.123 36.781 1.00 105.08 ? 2   DT  B "C3'" 1 
ATOM   28   O  "O3'" . DT  A 1 2   ? -0.217  54.266 37.572 1.00 104.90 ? 2   DT  B "O3'" 1 
ATOM   29   C  "C2'" . DT  A 1 2   ? -0.121  53.423 35.312 1.00 104.53 ? 2   DT  B "C2'" 1 
ATOM   30   C  "C1'" . DT  A 1 2   ? 1.159   54.148 34.939 1.00 103.93 ? 2   DT  B "C1'" 1 
ATOM   31   N  N1    . DT  A 1 2   ? 1.522   54.103 33.509 1.00 103.31 ? 2   DT  B N1    1 
ATOM   32   C  C2    . DT  A 1 2   ? 2.265   55.146 33.007 1.00 103.01 ? 2   DT  B C2    1 
ATOM   33   O  O2    . DT  A 1 2   ? 2.626   56.093 33.687 1.00 102.92 ? 2   DT  B O2    1 
ATOM   34   N  N3    . DT  A 1 2   ? 2.572   55.041 31.672 1.00 102.45 ? 2   DT  B N3    1 
ATOM   35   C  C4    . DT  A 1 2   ? 2.217   54.020 30.810 1.00 102.12 ? 2   DT  B C4    1 
ATOM   36   O  O4    . DT  A 1 2   ? 2.570   54.062 29.634 1.00 100.78 ? 2   DT  B O4    1 
ATOM   37   C  C5    . DT  A 1 2   ? 1.435   52.958 31.404 1.00 102.49 ? 2   DT  B C5    1 
ATOM   38   C  C7    . DT  A 1 2   ? 1.002   51.810 30.548 1.00 102.68 ? 2   DT  B C7    1 
ATOM   39   C  C6    . DT  A 1 2   ? 1.131   53.052 32.706 1.00 103.01 ? 2   DT  B C6    1 
ATOM   40   P  P     . DA  A 1 3   ? -1.325  54.139 38.728 1.00 105.23 ? 3   DA  B P     1 
ATOM   41   O  OP1   . DA  A 1 3   ? -0.876  53.059 39.646 1.00 104.83 ? 3   DA  B OP1   1 
ATOM   42   O  OP2   . DA  A 1 3   ? -2.667  54.054 38.094 1.00 105.03 ? 3   DA  B OP2   1 
ATOM   43   O  "O5'" . DA  A 1 3   ? -1.226  55.527 39.502 1.00 103.50 ? 3   DA  B "O5'" 1 
ATOM   44   C  "C5'" . DA  A 1 3   ? -2.091  56.614 39.177 1.00 100.95 ? 3   DA  B "C5'" 1 
ATOM   45   C  "C4'" . DA  A 1 3   ? -1.278  57.841 38.832 1.00 99.45  ? 3   DA  B "C4'" 1 
ATOM   46   O  "O4'" . DA  A 1 3   ? -0.514  57.585 37.626 1.00 98.76  ? 3   DA  B "O4'" 1 
ATOM   47   C  "C3'" . DA  A 1 3   ? -2.115  59.084 38.539 1.00 98.56  ? 3   DA  B "C3'" 1 
ATOM   48   O  "O3'" . DA  A 1 3   ? -1.459  60.251 39.042 1.00 97.21  ? 3   DA  B "O3'" 1 
ATOM   49   C  "C2'" . DA  A 1 3   ? -2.196  59.113 37.024 1.00 98.02  ? 3   DA  B "C2'" 1 
ATOM   50   C  "C1'" . DA  A 1 3   ? -0.872  58.503 36.600 1.00 97.34  ? 3   DA  B "C1'" 1 
ATOM   51   N  N9    . DA  A 1 3   ? -0.956  57.755 35.345 1.00 96.39  ? 3   DA  B N9    1 
ATOM   52   C  C8    . DA  A 1 3   ? -1.600  56.561 35.128 1.00 95.91  ? 3   DA  B C8    1 
ATOM   53   N  N7    . DA  A 1 3   ? -1.507  56.126 33.894 1.00 95.27  ? 3   DA  B N7    1 
ATOM   54   C  C5    . DA  A 1 3   ? -0.751  57.098 33.253 1.00 94.52  ? 3   DA  B C5    1 
ATOM   55   C  C6    . DA  A 1 3   ? -0.300  57.225 31.926 1.00 93.50  ? 3   DA  B C6    1 
ATOM   56   N  N6    . DA  A 1 3   ? -0.555  56.332 30.967 1.00 92.18  ? 3   DA  B N6    1 
ATOM   57   N  N1    . DA  A 1 3   ? 0.431   58.316 31.614 1.00 93.22  ? 3   DA  B N1    1 
ATOM   58   C  C2    . DA  A 1 3   ? 0.685   59.213 32.575 1.00 94.06  ? 3   DA  B C2    1 
ATOM   59   N  N3    . DA  A 1 3   ? 0.318   59.206 33.856 1.00 94.95  ? 3   DA  B N3    1 
ATOM   60   C  C4    . DA  A 1 3   ? -0.406  58.109 34.135 1.00 95.33  ? 3   DA  B C4    1 
ATOM   61   P  P     . DG  A 1 4   ? -2.207  61.671 38.980 1.00 96.52  ? 4   DG  B P     1 
ATOM   62   O  OP1   . DG  A 1 4   ? -1.467  62.612 39.861 1.00 95.95  ? 4   DG  B OP1   1 
ATOM   63   O  OP2   . DG  A 1 4   ? -3.661  61.450 39.196 1.00 95.87  ? 4   DG  B OP2   1 
ATOM   64   O  "O5'" . DG  A 1 4   ? -1.992  62.131 37.471 1.00 93.89  ? 4   DG  B "O5'" 1 
ATOM   65   C  "C5'" . DG  A 1 4   ? -0.733  62.645 37.038 1.00 89.24  ? 4   DG  B "C5'" 1 
ATOM   66   C  "C4'" . DG  A 1 4   ? -0.906  63.408 35.748 1.00 84.60  ? 4   DG  B "C4'" 1 
ATOM   67   O  "O4'" . DG  A 1 4   ? -1.026  62.489 34.635 1.00 82.57  ? 4   DG  B "O4'" 1 
ATOM   68   C  "C3'" . DG  A 1 4   ? -2.170  64.265 35.729 1.00 82.69  ? 4   DG  B "C3'" 1 
ATOM   69   O  "O3'" . DG  A 1 4   ? -1.919  65.497 35.054 1.00 81.28  ? 4   DG  B "O3'" 1 
ATOM   70   C  "C2'" . DG  A 1 4   ? -3.159  63.407 34.961 1.00 81.11  ? 4   DG  B "C2'" 1 
ATOM   71   C  "C1'" . DG  A 1 4   ? -2.258  62.702 33.961 1.00 79.49  ? 4   DG  B "C1'" 1 
ATOM   72   N  N9    . DG  A 1 4   ? -2.746  61.405 33.498 1.00 75.94  ? 4   DG  B N9    1 
ATOM   73   C  C8    . DG  A 1 4   ? -3.446  60.470 34.223 1.00 74.12  ? 4   DG  B C8    1 
ATOM   74   N  N7    . DG  A 1 4   ? -3.733  59.398 33.535 1.00 72.32  ? 4   DG  B N7    1 
ATOM   75   C  C5    . DG  A 1 4   ? -3.191  59.640 32.279 1.00 71.57  ? 4   DG  B C5    1 
ATOM   76   C  C6    . DG  A 1 4   ? -3.181  58.834 31.109 1.00 70.03  ? 4   DG  B C6    1 
ATOM   77   O  O6    . DG  A 1 4   ? -3.659  57.704 30.945 1.00 69.46  ? 4   DG  B O6    1 
ATOM   78   N  N1    . DG  A 1 4   ? -2.530  59.469 30.057 1.00 68.87  ? 4   DG  B N1    1 
ATOM   79   C  C2    . DG  A 1 4   ? -1.960  60.717 30.119 1.00 69.55  ? 4   DG  B C2    1 
ATOM   80   N  N2    . DG  A 1 4   ? -1.388  61.164 28.993 1.00 68.01  ? 4   DG  B N2    1 
ATOM   81   N  N3    . DG  A 1 4   ? -1.955  61.473 31.204 1.00 70.66  ? 4   DG  B N3    1 
ATOM   82   C  C4    . DG  A 1 4   ? -2.583  60.877 32.238 1.00 72.73  ? 4   DG  B C4    1 
ATOM   83   P  P     . DA  A 1 5   ? -3.052  66.636 35.035 1.00 80.56  ? 5   DA  B P     1 
ATOM   84   O  OP1   . DA  A 1 5   ? -2.403  67.932 35.369 1.00 80.35  ? 5   DA  B OP1   1 
ATOM   85   O  OP2   . DA  A 1 5   ? -4.211  66.165 35.838 1.00 79.69  ? 5   DA  B OP2   1 
ATOM   86   O  "O5'" . DA  A 1 5   ? -3.486  66.678 33.505 1.00 76.63  ? 5   DA  B "O5'" 1 
ATOM   87   C  "C5'" . DA  A 1 5   ? -3.388  65.511 32.695 1.00 68.75  ? 5   DA  B "C5'" 1 
ATOM   88   C  "C4'" . DA  A 1 5   ? -3.322  65.898 31.240 1.00 63.98  ? 5   DA  B "C4'" 1 
ATOM   89   O  "O4'" . DA  A 1 5   ? -3.309  64.693 30.441 1.00 62.20  ? 5   DA  B "O4'" 1 
ATOM   90   C  "C3'" . DA  A 1 5   ? -4.546  66.686 30.795 1.00 61.20  ? 5   DA  B "C3'" 1 
ATOM   91   O  "O3'" . DA  A 1 5   ? -4.191  67.685 29.846 1.00 58.38  ? 5   DA  B "O3'" 1 
ATOM   92   C  "C2'" . DA  A 1 5   ? -5.469  65.635 30.209 1.00 60.30  ? 5   DA  B "C2'" 1 
ATOM   93   C  "C1'" . DA  A 1 5   ? -4.532  64.534 29.734 1.00 59.21  ? 5   DA  B "C1'" 1 
ATOM   94   N  N9    . DA  A 1 5   ? -5.043  63.202 30.051 1.00 55.96  ? 5   DA  B N9    1 
ATOM   95   C  C8    . DA  A 1 5   ? -5.489  62.754 31.270 1.00 54.52  ? 5   DA  B C8    1 
ATOM   96   N  N7    . DA  A 1 5   ? -5.892  61.510 31.260 1.00 53.10  ? 5   DA  B N7    1 
ATOM   97   C  C5    . DA  A 1 5   ? -5.697  61.109 29.946 1.00 52.38  ? 5   DA  B C5    1 
ATOM   98   C  C6    . DA  A 1 5   ? -5.927  59.893 29.288 1.00 51.79  ? 5   DA  B C6    1 
ATOM   99   N  N6    . DA  A 1 5   ? -6.415  58.805 29.889 1.00 51.68  ? 5   DA  B N6    1 
ATOM   100  N  N1    . DA  A 1 5   ? -5.632  59.828 27.973 1.00 52.04  ? 5   DA  B N1    1 
ATOM   101  C  C2    . DA  A 1 5   ? -5.139  60.915 27.372 1.00 51.66  ? 5   DA  B C2    1 
ATOM   102  N  N3    . DA  A 1 5   ? -4.874  62.111 27.884 1.00 51.87  ? 5   DA  B N3    1 
ATOM   103  C  C4    . DA  A 1 5   ? -5.179  62.142 29.190 1.00 52.90  ? 5   DA  B C4    1 
ATOM   104  P  P     . DC  A 1 6   ? -5.184  68.919 29.601 1.00 57.24  ? 6   DC  B P     1 
ATOM   105  O  OP1   . DC  A 1 6   ? -4.429  69.986 28.893 1.00 58.07  ? 6   DC  B OP1   1 
ATOM   106  O  OP2   . DC  A 1 6   ? -5.873  69.226 30.881 1.00 56.71  ? 6   DC  B OP2   1 
ATOM   107  O  "O5'" . DC  A 1 6   ? -6.262  68.318 28.602 1.00 53.96  ? 6   DC  B "O5'" 1 
ATOM   108  C  "C5'" . DC  A 1 6   ? -5.871  67.810 27.330 1.00 49.76  ? 6   DC  B "C5'" 1 
ATOM   109  C  "C4'" . DC  A 1 6   ? -7.085  67.287 26.606 1.00 45.74  ? 6   DC  B "C4'" 1 
ATOM   110  O  "O4'" . DC  A 1 6   ? -7.220  65.855 26.815 1.00 41.74  ? 6   DC  B "O4'" 1 
ATOM   111  C  "C3'" . DC  A 1 6   ? -8.359  67.933 27.151 1.00 44.09  ? 6   DC  B "C3'" 1 
ATOM   112  O  "O3'" . DC  A 1 6   ? -9.154  68.541 26.133 1.00 43.54  ? 6   DC  B "O3'" 1 
ATOM   113  C  "C2'" . DC  A 1 6   ? -9.085  66.797 27.850 1.00 41.86  ? 6   DC  B "C2'" 1 
ATOM   114  C  "C1'" . DC  A 1 6   ? -8.564  65.561 27.140 1.00 40.54  ? 6   DC  B "C1'" 1 
ATOM   115  N  N1    . DC  A 1 6   ? -8.600  64.339 27.969 1.00 38.32  ? 6   DC  B N1    1 
ATOM   116  C  C2    . DC  A 1 6   ? -8.472  63.082 27.352 1.00 36.01  ? 6   DC  B C2    1 
ATOM   117  O  O2    . DC  A 1 6   ? -8.212  63.025 26.145 1.00 37.62  ? 6   DC  B O2    1 
ATOM   118  N  N3    . DC  A 1 6   ? -8.626  61.964 28.095 1.00 34.69  ? 6   DC  B N3    1 
ATOM   119  C  C4    . DC  A 1 6   ? -8.866  62.062 29.405 1.00 35.96  ? 6   DC  B C4    1 
ATOM   120  N  N4    . DC  A 1 6   ? -9.046  60.939 30.093 1.00 35.50  ? 6   DC  B N4    1 
ATOM   121  C  C5    . DC  A 1 6   ? -8.939  63.321 30.067 1.00 37.09  ? 6   DC  B C5    1 
ATOM   122  C  C6    . DC  A 1 6   ? -8.800  64.423 29.319 1.00 38.36  ? 6   DC  B C6    1 
ATOM   123  P  P     . DC  A 1 7   ? -9.990  69.873 26.489 1.00 44.24  ? 7   DC  B P     1 
ATOM   124  O  OP1   . DC  A 1 7   ? -9.846  70.852 25.380 1.00 44.52  ? 7   DC  B OP1   1 
ATOM   125  O  OP2   . DC  A 1 7   ? -9.644  70.276 27.875 1.00 40.36  ? 7   DC  B OP2   1 
ATOM   126  O  "O5'" . DC  A 1 7   ? -11.489 69.355 26.507 1.00 41.36  ? 7   DC  B "O5'" 1 
ATOM   127  C  "C5'" . DC  A 1 7   ? -11.769 68.043 26.952 1.00 36.89  ? 7   DC  B "C5'" 1 
ATOM   128  C  "C4'" . DC  A 1 7   ? -13.248 67.783 26.899 1.00 32.86  ? 7   DC  B "C4'" 1 
ATOM   129  O  "O4'" . DC  A 1 7   ? -13.438 66.430 27.358 1.00 32.98  ? 7   DC  B "O4'" 1 
ATOM   130  C  "C3'" . DC  A 1 7   ? -14.066 68.680 27.822 1.00 31.41  ? 7   DC  B "C3'" 1 
ATOM   131  O  "O3'" . DC  A 1 7   ? -15.271 69.078 27.180 1.00 28.43  ? 7   DC  B "O3'" 1 
ATOM   132  C  "C2'" . DC  A 1 7   ? -14.314 67.826 29.052 1.00 31.96  ? 7   DC  B "C2'" 1 
ATOM   133  C  "C1'" . DC  A 1 7   ? -14.155 66.388 28.572 1.00 32.40  ? 7   DC  B "C1'" 1 
ATOM   134  N  N1    . DC  A 1 7   ? -13.377 65.550 29.495 1.00 33.34  ? 7   DC  B N1    1 
ATOM   135  C  C2    . DC  A 1 7   ? -13.763 64.226 29.696 1.00 33.49  ? 7   DC  B C2    1 
ATOM   136  O  O2    . DC  A 1 7   ? -14.724 63.779 29.053 1.00 34.29  ? 7   DC  B O2    1 
ATOM   137  N  N3    . DC  A 1 7   ? -13.076 63.465 30.578 1.00 32.73  ? 7   DC  B N3    1 
ATOM   138  C  C4    . DC  A 1 7   ? -12.033 63.979 31.235 1.00 33.49  ? 7   DC  B C4    1 
ATOM   139  N  N4    . DC  A 1 7   ? -11.393 63.198 32.105 1.00 33.48  ? 7   DC  B N4    1 
ATOM   140  C  C5    . DC  A 1 7   ? -11.601 65.319 31.030 1.00 31.86  ? 7   DC  B C5    1 
ATOM   141  C  C6    . DC  A 1 7   ? -12.294 66.062 30.159 1.00 33.73  ? 7   DC  B C6    1 
ATOM   142  P  P     . DT  A 1 8   ? -16.263 70.107 27.906 1.00 27.40  ? 8   DT  B P     1 
ATOM   143  O  OP1   . DT  A 1 8   ? -16.777 70.999 26.839 1.00 28.89  ? 8   DT  B OP1   1 
ATOM   144  O  OP2   . DT  A 1 8   ? -15.620 70.691 29.109 1.00 30.02  ? 8   DT  B OP2   1 
ATOM   145  O  "O5'" . DT  A 1 8   ? -17.446 69.158 28.369 1.00 27.47  ? 8   DT  B "O5'" 1 
ATOM   146  C  "C5'" . DT  A 1 8   ? -18.004 68.248 27.434 1.00 28.15  ? 8   DT  B "C5'" 1 
ATOM   147  C  "C4'" . DT  A 1 8   ? -18.932 67.275 28.116 1.00 27.26  ? 8   DT  B "C4'" 1 
ATOM   148  O  "O4'" . DT  A 1 8   ? -18.194 66.164 28.677 1.00 25.76  ? 8   DT  B "O4'" 1 
ATOM   149  C  "C3'" . DT  A 1 8   ? -19.791 67.856 29.238 1.00 27.43  ? 8   DT  B "C3'" 1 
ATOM   150  O  "O3'" . DT  A 1 8   ? -21.160 67.622 28.935 1.00 29.27  ? 8   DT  B "O3'" 1 
ATOM   151  C  "C2'" . DT  A 1 8   ? -19.360 67.074 30.474 1.00 28.24  ? 8   DT  B "C2'" 1 
ATOM   152  C  "C1'" . DT  A 1 8   ? -18.783 65.784 29.903 1.00 26.20  ? 8   DT  B "C1'" 1 
ATOM   153  N  N1    . DT  A 1 8   ? -17.732 65.148 30.744 1.00 26.80  ? 8   DT  B N1    1 
ATOM   154  C  C2    . DT  A 1 8   ? -17.719 63.769 30.870 1.00 26.26  ? 8   DT  B C2    1 
ATOM   155  O  O2    . DT  A 1 8   ? -18.478 63.032 30.269 1.00 29.08  ? 8   DT  B O2    1 
ATOM   156  N  N3    . DT  A 1 8   ? -16.769 63.282 31.733 1.00 25.47  ? 8   DT  B N3    1 
ATOM   157  C  C4    . DT  A 1 8   ? -15.841 64.011 32.449 1.00 26.37  ? 8   DT  B C4    1 
ATOM   158  O  O4    . DT  A 1 8   ? -15.068 63.437 33.208 1.00 27.11  ? 8   DT  B O4    1 
ATOM   159  C  C5    . DT  A 1 8   ? -15.876 65.439 32.231 1.00 26.19  ? 8   DT  B C5    1 
ATOM   160  C  C7    . DT  A 1 8   ? -14.875 66.304 32.932 1.00 24.82  ? 8   DT  B C7    1 
ATOM   161  C  C6    . DT  A 1 8   ? -16.807 65.928 31.403 1.00 24.96  ? 8   DT  B C6    1 
ATOM   162  P  P     . DG  A 1 9   ? -22.306 68.219 29.882 1.00 30.77  ? 9   DG  B P     1 
ATOM   163  O  OP1   . DG  A 1 9   ? -23.232 69.031 29.047 1.00 32.65  ? 9   DG  B OP1   1 
ATOM   164  O  OP2   . DG  A 1 9   ? -21.684 68.819 31.090 1.00 34.51  ? 9   DG  B OP2   1 
ATOM   165  O  "O5'" . DG  A 1 9   ? -23.090 66.904 30.295 1.00 33.27  ? 9   DG  B "O5'" 1 
ATOM   166  C  "C5'" . DG  A 1 9   ? -23.331 65.903 29.315 1.00 35.99  ? 9   DG  B "C5'" 1 
ATOM   167  C  "C4'" . DG  A 1 9   ? -23.620 64.578 29.973 1.00 38.28  ? 9   DG  B "C4'" 1 
ATOM   168  O  "O4'" . DG  A 1 9   ? -22.420 64.048 30.585 1.00 37.90  ? 9   DG  B "O4'" 1 
ATOM   169  C  "C3'" . DG  A 1 9   ? -24.678 64.632 31.072 1.00 40.99  ? 9   DG  B "C3'" 1 
ATOM   170  O  "O3'" . DG  A 1 9   ? -25.555 63.523 30.912 1.00 47.19  ? 9   DG  B "O3'" 1 
ATOM   171  C  "C2'" . DG  A 1 9   ? -23.871 64.517 32.355 1.00 38.80  ? 9   DG  B "C2'" 1 
ATOM   172  C  "C1'" . DG  A 1 9   ? -22.701 63.655 31.918 1.00 37.24  ? 9   DG  B "C1'" 1 
ATOM   173  N  N9    . DG  A 1 9   ? -21.481 63.821 32.702 1.00 32.85  ? 9   DG  B N9    1 
ATOM   174  C  C8    . DG  A 1 9   ? -20.899 65.001 33.098 1.00 33.08  ? 9   DG  B C8    1 
ATOM   175  N  N7    . DG  A 1 9   ? -19.806 64.827 33.795 1.00 31.05  ? 9   DG  B N7    1 
ATOM   176  C  C5    . DG  A 1 9   ? -19.660 63.450 33.864 1.00 31.30  ? 9   DG  B C5    1 
ATOM   177  C  C6    . DG  A 1 9   ? -18.666 62.667 34.495 1.00 31.60  ? 9   DG  B C6    1 
ATOM   178  O  O6    . DG  A 1 9   ? -17.684 63.045 35.147 1.00 33.60  ? 9   DG  B O6    1 
ATOM   179  N  N1    . DG  A 1 9   ? -18.896 61.308 34.316 1.00 31.63  ? 9   DG  B N1    1 
ATOM   180  C  C2    . DG  A 1 9   ? -19.953 60.768 33.625 1.00 32.55  ? 9   DG  B C2    1 
ATOM   181  N  N2    . DG  A 1 9   ? -19.998 59.428 33.573 1.00 33.17  ? 9   DG  B N2    1 
ATOM   182  N  N3    . DG  A 1 9   ? -20.894 61.488 33.032 1.00 32.72  ? 9   DG  B N3    1 
ATOM   183  C  C4    . DG  A 1 9   ? -20.685 62.813 33.192 1.00 33.78  ? 9   DG  B C4    1 
ATOM   184  P  P     . DG  A 1 10  ? -26.748 63.292 31.955 1.00 52.85  ? 10  DG  B P     1 
ATOM   185  O  OP1   . DG  A 1 10  ? -27.984 63.050 31.165 1.00 52.50  ? 10  DG  B OP1   1 
ATOM   186  O  OP2   . DG  A 1 10  ? -26.727 64.367 32.982 1.00 52.62  ? 10  DG  B OP2   1 
ATOM   187  O  "O5'" . DG  A 1 10  ? -26.330 61.926 32.648 1.00 52.92  ? 10  DG  B "O5'" 1 
ATOM   188  C  "C5'" . DG  A 1 10  ? -25.992 60.795 31.857 1.00 54.07  ? 10  DG  B "C5'" 1 
ATOM   189  C  "C4'" . DG  A 1 10  ? -25.668 59.627 32.752 1.00 55.17  ? 10  DG  B "C4'" 1 
ATOM   190  O  "O4'" . DG  A 1 10  ? -24.395 59.848 33.402 1.00 54.72  ? 10  DG  B "O4'" 1 
ATOM   191  C  "C3'" . DG  A 1 10  ? -26.682 59.426 33.875 1.00 56.69  ? 10  DG  B "C3'" 1 
ATOM   192  O  "O3'" . DG  A 1 10  ? -26.833 58.030 34.119 1.00 61.05  ? 10  DG  B "O3'" 1 
ATOM   193  C  "C2'" . DG  A 1 10  ? -26.029 60.114 35.060 1.00 53.63  ? 10  DG  B "C2'" 1 
ATOM   194  C  "C1'" . DG  A 1 10  ? -24.557 59.845 34.811 1.00 51.89  ? 10  DG  B "C1'" 1 
ATOM   195  N  N9    . DG  A 1 10  ? -23.648 60.845 35.358 1.00 48.39  ? 10  DG  B N9    1 
ATOM   196  C  C8    . DG  A 1 10  ? -23.748 62.210 35.243 1.00 48.56  ? 10  DG  B C8    1 
ATOM   197  N  N7    . DG  A 1 10  ? -22.763 62.846 35.820 1.00 48.17  ? 10  DG  B N7    1 
ATOM   198  C  C5    . DG  A 1 10  ? -21.971 61.837 36.354 1.00 46.26  ? 10  DG  B C5    1 
ATOM   199  C  C6    . DG  A 1 10  ? -20.761 61.911 37.093 1.00 45.40  ? 10  DG  B C6    1 
ATOM   200  O  O6    . DG  A 1 10  ? -20.126 62.914 37.435 1.00 45.36  ? 10  DG  B O6    1 
ATOM   201  N  N1    . DG  A 1 10  ? -20.295 60.648 37.438 1.00 45.39  ? 10  DG  B N1    1 
ATOM   202  C  C2    . DG  A 1 10  ? -20.911 59.465 37.116 1.00 45.99  ? 10  DG  B C2    1 
ATOM   203  N  N2    . DG  A 1 10  ? -20.302 58.346 37.542 1.00 46.42  ? 10  DG  B N2    1 
ATOM   204  N  N3    . DG  A 1 10  ? -22.038 59.382 36.428 1.00 45.76  ? 10  DG  B N3    1 
ATOM   205  C  C4    . DG  A 1 10  ? -22.507 60.598 36.081 1.00 46.24  ? 10  DG  B C4    1 
ATOM   206  P  P     . DA  A 1 11  ? -28.052 57.504 35.014 1.00 62.88  ? 11  DA  B P     1 
ATOM   207  O  OP1   . DA  A 1 11  ? -29.124 57.063 34.085 1.00 61.72  ? 11  DA  B OP1   1 
ATOM   208  O  OP2   . DA  A 1 11  ? -28.353 58.526 36.051 1.00 62.07  ? 11  DA  B OP2   1 
ATOM   209  O  "O5'" . DA  A 1 11  ? -27.428 56.222 35.723 1.00 65.08  ? 11  DA  B "O5'" 1 
ATOM   210  C  "C5'" . DA  A 1 11  ? -27.680 55.950 37.097 1.00 68.93  ? 11  DA  B "C5'" 1 
ATOM   211  C  "C4'" . DA  A 1 11  ? -26.424 55.445 37.768 1.00 70.72  ? 11  DA  B "C4'" 1 
ATOM   212  O  "O4'" . DA  A 1 11  ? -25.389 56.457 37.676 1.00 69.18  ? 11  DA  B "O4'" 1 
ATOM   213  C  "C3'" . DA  A 1 11  ? -26.604 55.162 39.260 1.00 72.69  ? 11  DA  B "C3'" 1 
ATOM   214  O  "O3'" . DA  A 1 11  ? -25.867 54.000 39.647 1.00 77.27  ? 11  DA  B "O3'" 1 
ATOM   215  C  "C2'" . DA  A 1 11  ? -26.034 56.398 39.928 1.00 70.48  ? 11  DA  B "C2'" 1 
ATOM   216  C  "C1'" . DA  A 1 11  ? -24.925 56.796 38.976 1.00 67.21  ? 11  DA  B "C1'" 1 
ATOM   217  N  N9    . DA  A 1 11  ? -24.623 58.227 38.994 1.00 63.09  ? 11  DA  B N9    1 
ATOM   218  C  C8    . DA  A 1 11  ? -25.358 59.260 38.469 1.00 61.56  ? 11  DA  B C8    1 
ATOM   219  N  N7    . DA  A 1 11  ? -24.817 60.440 38.655 1.00 60.25  ? 11  DA  B N7    1 
ATOM   220  C  C5    . DA  A 1 11  ? -23.647 60.165 39.349 1.00 59.33  ? 11  DA  B C5    1 
ATOM   221  C  C6    . DA  A 1 11  ? -22.621 60.991 39.844 1.00 58.62  ? 11  DA  B C6    1 
ATOM   222  N  N6    . DA  A 1 11  ? -22.609 62.320 39.712 1.00 57.79  ? 11  DA  B N6    1 
ATOM   223  N  N1    . DA  A 1 11  ? -21.593 60.397 40.489 1.00 57.85  ? 11  DA  B N1    1 
ATOM   224  C  C2    . DA  A 1 11  ? -21.604 59.066 40.622 1.00 57.59  ? 11  DA  B C2    1 
ATOM   225  N  N3    . DA  A 1 11  ? -22.508 58.185 40.202 1.00 59.56  ? 11  DA  B N3    1 
ATOM   226  C  C4    . DA  A 1 11  ? -23.515 58.806 39.564 1.00 60.52  ? 11  DA  B C4    1 
ATOM   227  P  P     . DC  A 1 12  ? -26.188 53.296 41.055 1.00 80.05  ? 12  DC  B P     1 
ATOM   228  O  OP1   . DC  A 1 12  ? -25.606 51.929 41.009 1.00 80.08  ? 12  DC  B OP1   1 
ATOM   229  O  OP2   . DC  A 1 12  ? -27.638 53.470 41.335 1.00 79.03  ? 12  DC  B OP2   1 
ATOM   230  O  "O5'" . DC  A 1 12  ? -25.366 54.162 42.112 1.00 79.86  ? 12  DC  B "O5'" 1 
ATOM   231  C  "C5'" . DC  A 1 12  ? -24.049 53.781 42.506 1.00 80.12  ? 12  DC  B "C5'" 1 
ATOM   232  C  "C4'" . DC  A 1 12  ? -23.673 54.457 43.803 1.00 80.45  ? 12  DC  B "C4'" 1 
ATOM   233  O  "O4'" . DC  A 1 12  ? -23.457 55.871 43.566 1.00 79.99  ? 12  DC  B "O4'" 1 
ATOM   234  C  "C3'" . DC  A 1 12  ? -24.738 54.368 44.900 1.00 80.92  ? 12  DC  B "C3'" 1 
ATOM   235  O  "O3'" . DC  A 1 12  ? -24.164 54.340 46.214 1.00 81.44  ? 12  DC  B "O3'" 1 
ATOM   236  C  "C2'" . DC  A 1 12  ? -25.465 55.695 44.773 1.00 79.98  ? 12  DC  B "C2'" 1 
ATOM   237  C  "C1'" . DC  A 1 12  ? -24.333 56.636 44.382 1.00 79.06  ? 12  DC  B "C1'" 1 
ATOM   238  N  N1    . DC  A 1 12  ? -24.747 57.831 43.622 1.00 77.06  ? 12  DC  B N1    1 
ATOM   239  C  C2    . DC  A 1 12  ? -23.935 58.972 43.664 1.00 75.30  ? 12  DC  B C2    1 
ATOM   240  O  O2    . DC  A 1 12  ? -22.878 58.933 44.311 1.00 74.52  ? 12  DC  B O2    1 
ATOM   241  N  N3    . DC  A 1 12  ? -24.321 60.084 42.998 1.00 73.51  ? 12  DC  B N3    1 
ATOM   242  C  C4    . DC  A 1 12  ? -25.462 60.084 42.307 1.00 73.95  ? 12  DC  B C4    1 
ATOM   243  N  N4    . DC  A 1 12  ? -25.811 61.208 41.676 1.00 73.34  ? 12  DC  B N4    1 
ATOM   244  C  C5    . DC  A 1 12  ? -26.299 58.933 42.233 1.00 74.37  ? 12  DC  B C5    1 
ATOM   245  C  C6    . DC  A 1 12  ? -25.907 57.839 42.898 1.00 75.91  ? 12  DC  B C6    1 
ATOM   246  O  "O5'" . DG  B 2 1   ? -18.201 69.970 46.332 1.00 85.11  ? 13  DG  C "O5'" 1 
ATOM   247  C  "C5'" . DG  B 2 1   ? -19.198 68.949 46.234 1.00 85.34  ? 13  DG  C "C5'" 1 
ATOM   248  C  "C4'" . DG  B 2 1   ? -18.743 67.623 46.799 1.00 85.34  ? 13  DG  C "C4'" 1 
ATOM   249  O  "O4'" . DG  B 2 1   ? -19.812 66.658 46.646 1.00 85.08  ? 13  DG  C "O4'" 1 
ATOM   250  C  "C3'" . DG  B 2 1   ? -17.523 67.011 46.107 1.00 85.00  ? 13  DG  C "C3'" 1 
ATOM   251  O  "O3'" . DG  B 2 1   ? -16.712 66.309 47.058 1.00 85.07  ? 13  DG  C "O3'" 1 
ATOM   252  C  "C2'" . DG  B 2 1   ? -18.136 66.046 45.109 1.00 84.10  ? 13  DG  C "C2'" 1 
ATOM   253  C  "C1'" . DG  B 2 1   ? -19.389 65.574 45.828 1.00 83.63  ? 13  DG  C "C1'" 1 
ATOM   254  N  N9    . DG  B 2 1   ? -20.494 65.236 44.935 1.00 81.95  ? 13  DG  C N9    1 
ATOM   255  C  C8    . DG  B 2 1   ? -21.170 66.087 44.094 1.00 81.30  ? 13  DG  C C8    1 
ATOM   256  N  N7    . DG  B 2 1   ? -22.122 65.497 43.423 1.00 80.33  ? 13  DG  C N7    1 
ATOM   257  C  C5    . DG  B 2 1   ? -22.070 64.175 43.844 1.00 79.91  ? 13  DG  C C5    1 
ATOM   258  C  C6    . DG  B 2 1   ? -22.861 63.059 43.468 1.00 79.18  ? 13  DG  C C6    1 
ATOM   259  O  O6    . DG  B 2 1   ? -23.796 63.013 42.661 1.00 77.81  ? 13  DG  C O6    1 
ATOM   260  N  N1    . DG  B 2 1   ? -22.468 61.905 44.140 1.00 79.49  ? 13  DG  C N1    1 
ATOM   261  C  C2    . DG  B 2 1   ? -21.447 61.832 45.054 1.00 79.85  ? 13  DG  C C2    1 
ATOM   262  N  N2    . DG  B 2 1   ? -21.221 60.626 45.593 1.00 79.52  ? 13  DG  C N2    1 
ATOM   263  N  N3    . DG  B 2 1   ? -20.702 62.866 45.414 1.00 80.19  ? 13  DG  C N3    1 
ATOM   264  C  C4    . DG  B 2 1   ? -21.067 63.997 44.775 1.00 80.78  ? 13  DG  C C4    1 
ATOM   265  P  P     . DT  B 2 2   ? -15.261 65.761 46.622 1.00 85.63  ? 14  DT  C P     1 
ATOM   266  O  OP1   . DT  B 2 2   ? -14.423 65.688 47.846 1.00 85.27  ? 14  DT  C OP1   1 
ATOM   267  O  OP2   . DT  B 2 2   ? -14.782 66.543 45.454 1.00 85.86  ? 14  DT  C OP2   1 
ATOM   268  O  "O5'" . DT  B 2 2   ? -15.549 64.270 46.141 1.00 84.52  ? 14  DT  C "O5'" 1 
ATOM   269  C  "C5'" . DT  B 2 2   ? -15.847 63.245 47.088 1.00 81.60  ? 14  DT  C "C5'" 1 
ATOM   270  C  "C4'" . DT  B 2 2   ? -15.859 61.891 46.417 1.00 79.14  ? 14  DT  C "C4'" 1 
ATOM   271  O  "O4'" . DT  B 2 2   ? -17.040 61.743 45.590 1.00 78.16  ? 14  DT  C "O4'" 1 
ATOM   272  C  "C3'" . DT  B 2 2   ? -14.664 61.608 45.507 1.00 77.98  ? 14  DT  C "C3'" 1 
ATOM   273  O  "O3'" . DT  B 2 2   ? -14.243 60.253 45.682 1.00 76.35  ? 14  DT  C "O3'" 1 
ATOM   274  C  "C2'" . DT  B 2 2   ? -15.228 61.818 44.112 1.00 77.30  ? 14  DT  C "C2'" 1 
ATOM   275  C  "C1'" . DT  B 2 2   ? -16.660 61.348 44.280 1.00 76.61  ? 14  DT  C "C1'" 1 
ATOM   276  N  N1    . DT  B 2 2   ? -17.628 61.931 43.328 1.00 75.12  ? 14  DT  C N1    1 
ATOM   277  C  C2    . DT  B 2 2   ? -18.632 61.117 42.844 1.00 74.37  ? 14  DT  C C2    1 
ATOM   278  O  O2    . DT  B 2 2   ? -18.743 59.940 43.148 1.00 73.44  ? 14  DT  C O2    1 
ATOM   279  N  N3    . DT  B 2 2   ? -19.504 61.736 41.983 1.00 74.08  ? 14  DT  C N3    1 
ATOM   280  C  C4    . DT  B 2 2   ? -19.473 63.052 41.562 1.00 74.11  ? 14  DT  C C4    1 
ATOM   281  O  O4    . DT  B 2 2   ? -20.335 63.469 40.790 1.00 73.59  ? 14  DT  C O4    1 
ATOM   282  C  C5    . DT  B 2 2   ? -18.385 63.844 42.097 1.00 73.62  ? 14  DT  C C5    1 
ATOM   283  C  C7    . DT  B 2 2   ? -18.260 65.276 41.686 1.00 73.62  ? 14  DT  C C7    1 
ATOM   284  C  C6    . DT  B 2 2   ? -17.531 63.252 42.942 1.00 74.30  ? 14  DT  C C6    1 
ATOM   285  P  P     . DC  B 2 3   ? -13.123 59.632 44.711 1.00 76.00  ? 15  DC  C P     1 
ATOM   286  O  OP1   . DC  B 2 3   ? -12.293 58.710 45.530 1.00 75.96  ? 15  DC  C OP1   1 
ATOM   287  O  OP2   . DC  B 2 3   ? -12.470 60.734 43.957 1.00 75.23  ? 15  DC  C OP2   1 
ATOM   288  O  "O5'" . DC  B 2 3   ? -13.974 58.756 43.690 1.00 73.16  ? 15  DC  C "O5'" 1 
ATOM   289  C  "C5'" . DC  B 2 3   ? -14.872 57.758 44.170 1.00 67.85  ? 15  DC  C "C5'" 1 
ATOM   290  C  "C4'" . DC  B 2 3   ? -15.401 56.932 43.022 1.00 64.23  ? 15  DC  C "C4'" 1 
ATOM   291  O  "O4'" . DC  B 2 3   ? -16.394 57.678 42.275 1.00 62.17  ? 15  DC  C "O4'" 1 
ATOM   292  C  "C3'" . DC  B 2 3   ? -14.337 56.501 42.013 1.00 61.82  ? 15  DC  C "C3'" 1 
ATOM   293  O  "O3'" . DC  B 2 3   ? -14.552 55.143 41.627 1.00 59.01  ? 15  DC  C "O3'" 1 
ATOM   294  C  "C2'" . DC  B 2 3   ? -14.555 57.440 40.840 1.00 60.84  ? 15  DC  C "C2'" 1 
ATOM   295  C  "C1'" . DC  B 2 3   ? -16.051 57.699 40.897 1.00 59.63  ? 15  DC  C "C1'" 1 
ATOM   296  N  N1    . DC  B 2 3   ? -16.460 59.003 40.349 1.00 56.67  ? 15  DC  C N1    1 
ATOM   297  C  C2    . DC  B 2 3   ? -17.666 59.091 39.642 1.00 54.88  ? 15  DC  C C2    1 
ATOM   298  O  O2    . DC  B 2 3   ? -18.355 58.071 39.502 1.00 52.91  ? 15  DC  C O2    1 
ATOM   299  N  N3    . DC  B 2 3   ? -18.049 60.285 39.132 1.00 54.15  ? 15  DC  C N3    1 
ATOM   300  C  C4    . DC  B 2 3   ? -17.278 61.363 39.307 1.00 54.83  ? 15  DC  C C4    1 
ATOM   301  N  N4    . DC  B 2 3   ? -17.694 62.522 38.789 1.00 54.65  ? 15  DC  C N4    1 
ATOM   302  C  C5    . DC  B 2 3   ? -16.047 61.300 40.023 1.00 54.78  ? 15  DC  C C5    1 
ATOM   303  C  C6    . DC  B 2 3   ? -15.680 60.113 40.522 1.00 55.60  ? 15  DC  C C6    1 
ATOM   304  P  P     . DC  B 2 4   ? -13.724 54.522 40.402 1.00 57.32  ? 16  DC  C P     1 
ATOM   305  O  OP1   . DC  B 2 4   ? -13.639 53.057 40.628 1.00 58.59  ? 16  DC  C OP1   1 
ATOM   306  O  OP2   . DC  B 2 4   ? -12.483 55.308 40.192 1.00 56.17  ? 16  DC  C OP2   1 
ATOM   307  O  "O5'" . DC  B 2 4   ? -14.693 54.764 39.168 1.00 54.18  ? 16  DC  C "O5'" 1 
ATOM   308  C  "C5'" . DC  B 2 4   ? -15.978 54.156 39.135 1.00 49.11  ? 16  DC  C "C5'" 1 
ATOM   309  C  "C4'" . DC  B 2 4   ? -16.457 54.077 37.709 1.00 45.20  ? 16  DC  C "C4'" 1 
ATOM   310  O  "O4'" . DC  B 2 4   ? -17.062 55.341 37.334 1.00 44.93  ? 16  DC  C "O4'" 1 
ATOM   311  C  "C3'" . DC  B 2 4   ? -15.289 53.845 36.753 1.00 42.60  ? 16  DC  C "C3'" 1 
ATOM   312  O  "O3'" . DC  B 2 4   ? -15.561 52.836 35.794 1.00 36.77  ? 16  DC  C "O3'" 1 
ATOM   313  C  "C2'" . DC  B 2 4   ? -15.093 55.184 36.070 1.00 43.97  ? 16  DC  C "C2'" 1 
ATOM   314  C  "C1'" . DC  B 2 4   ? -16.463 55.837 36.148 1.00 43.49  ? 16  DC  C "C1'" 1 
ATOM   315  N  N1    . DC  B 2 4   ? -16.370 57.304 36.260 1.00 41.47  ? 16  DC  C N1    1 
ATOM   316  C  C2    . DC  B 2 4   ? -17.355 58.101 35.663 1.00 39.85  ? 16  DC  C C2    1 
ATOM   317  O  O2    . DC  B 2 4   ? -18.324 57.554 35.116 1.00 38.19  ? 16  DC  C O2    1 
ATOM   318  N  N3    . DC  B 2 4   ? -17.226 59.447 35.704 1.00 39.18  ? 16  DC  C N3    1 
ATOM   319  C  C4    . DC  B 2 4   ? -16.179 60.001 36.321 1.00 39.44  ? 16  DC  C C4    1 
ATOM   320  N  N4    . DC  B 2 4   ? -16.079 61.334 36.317 1.00 38.20  ? 16  DC  C N4    1 
ATOM   321  C  C5    . DC  B 2 4   ? -15.183 59.214 36.966 1.00 39.98  ? 16  DC  C C5    1 
ATOM   322  C  C6    . DC  B 2 4   ? -15.317 57.884 36.914 1.00 40.18  ? 16  DC  C C6    1 
ATOM   323  P  P     . DA  B 2 5   ? -14.400 52.386 34.784 1.00 33.69  ? 17  DA  C P     1 
ATOM   324  O  OP1   . DA  B 2 5   ? -14.318 50.906 34.820 1.00 34.19  ? 17  DA  C OP1   1 
ATOM   325  O  OP2   . DA  B 2 5   ? -13.185 53.192 35.048 1.00 34.19  ? 17  DA  C OP2   1 
ATOM   326  O  "O5'" . DA  B 2 5   ? -14.978 52.831 33.371 1.00 31.97  ? 17  DA  C "O5'" 1 
ATOM   327  C  "C5'" . DA  B 2 5   ? -16.322 52.532 33.016 1.00 28.85  ? 17  DA  C "C5'" 1 
ATOM   328  C  "C4'" . DA  B 2 5   ? -16.650 53.159 31.685 1.00 30.92  ? 17  DA  C "C4'" 1 
ATOM   329  O  "O4'" . DA  B 2 5   ? -17.024 54.540 31.920 1.00 29.45  ? 17  DA  C "O4'" 1 
ATOM   330  C  "C3'" . DA  B 2 5   ? -15.430 53.179 30.764 1.00 29.48  ? 17  DA  C "C3'" 1 
ATOM   331  O  "O3'" . DA  B 2 5   ? -15.563 52.390 29.595 1.00 26.49  ? 17  DA  C "O3'" 1 
ATOM   332  C  "C2'" . DA  B 2 5   ? -15.191 54.639 30.428 1.00 30.68  ? 17  DA  C "C2'" 1 
ATOM   333  C  "C1'" . DA  B 2 5   ? -16.352 55.415 31.030 1.00 29.28  ? 17  DA  C "C1'" 1 
ATOM   334  N  N9    . DA  B 2 5   ? -15.811 56.529 31.808 1.00 27.90  ? 17  DA  C N9    1 
ATOM   335  C  C8    . DA  B 2 5   ? -14.694 56.481 32.607 1.00 27.13  ? 17  DA  C C8    1 
ATOM   336  N  N7    . DA  B 2 5   ? -14.332 57.645 33.082 1.00 27.62  ? 17  DA  C N7    1 
ATOM   337  C  C5    . DA  B 2 5   ? -15.290 58.517 32.588 1.00 26.65  ? 17  DA  C C5    1 
ATOM   338  C  C6    . DA  B 2 5   ? -15.446 59.907 32.706 1.00 27.42  ? 17  DA  C C6    1 
ATOM   339  N  N6    . DA  B 2 5   ? -14.588 60.694 33.362 1.00 25.58  ? 17  DA  C N6    1 
ATOM   340  N  N1    . DA  B 2 5   ? -16.518 60.472 32.107 1.00 26.54  ? 17  DA  C N1    1 
ATOM   341  C  C2    . DA  B 2 5   ? -17.359 59.682 31.426 1.00 26.72  ? 17  DA  C C2    1 
ATOM   342  N  N3    . DA  B 2 5   ? -17.307 58.366 31.228 1.00 27.93  ? 17  DA  C N3    1 
ATOM   343  C  C4    . DA  B 2 5   ? -16.233 57.837 31.837 1.00 27.10  ? 17  DA  C C4    1 
HETATM 344  P  P     . 8OG B 2 6   ? -14.413 51.307 29.364 1.00 25.02  ? 18  8OG C P     1 
HETATM 345  O  OP1   . 8OG B 2 6   ? -14.773 50.062 30.092 1.00 23.42  ? 18  8OG C OP1   1 
HETATM 346  O  OP2   . 8OG B 2 6   ? -13.107 51.925 29.671 1.00 24.05  ? 18  8OG C OP2   1 
HETATM 347  O  "O5'" . 8OG B 2 6   ? -14.449 51.044 27.800 1.00 26.16  ? 18  8OG C "O5'" 1 
HETATM 348  C  "C5'" . 8OG B 2 6   ? -15.593 50.524 27.140 1.00 21.85  ? 18  8OG C "C5'" 1 
HETATM 349  C  "C4'" . 8OG B 2 6   ? -15.182 50.196 25.727 1.00 21.67  ? 18  8OG C "C4'" 1 
HETATM 350  O  "O4'" . 8OG B 2 6   ? -16.298 49.704 24.956 1.00 21.89  ? 18  8OG C "O4'" 1 
HETATM 351  C  "C3'" . 8OG B 2 6   ? -14.648 51.372 24.924 1.00 21.30  ? 18  8OG C "C3'" 1 
HETATM 352  O  "O3'" . 8OG B 2 6   ? -13.866 50.803 23.886 1.00 23.81  ? 18  8OG C "O3'" 1 
HETATM 353  C  "C2'" . 8OG B 2 6   ? -15.924 51.952 24.336 1.00 19.87  ? 18  8OG C "C2'" 1 
HETATM 354  C  "C1'" . 8OG B 2 6   ? -16.689 50.677 23.983 1.00 21.21  ? 18  8OG C "C1'" 1 
HETATM 355  N  N9    . 8OG B 2 6   ? -18.148 50.656 24.037 1.00 20.66  ? 18  8OG C N9    1 
HETATM 356  C  C8    . 8OG B 2 6   ? -18.952 49.707 23.464 1.00 20.84  ? 18  8OG C C8    1 
HETATM 357  N  N7    . 8OG B 2 6   ? -20.215 49.883 23.667 1.00 19.29  ? 18  8OG C N7    1 
HETATM 358  C  C5    . 8OG B 2 6   ? -20.271 51.032 24.426 1.00 20.35  ? 18  8OG C C5    1 
HETATM 359  C  C6    . 8OG B 2 6   ? -21.394 51.716 24.968 1.00 20.95  ? 18  8OG C C6    1 
HETATM 360  O  O6    . 8OG B 2 6   ? -22.584 51.401 24.866 1.00 20.71  ? 18  8OG C O6    1 
HETATM 361  N  N1    . 8OG B 2 6   ? -21.027 52.867 25.685 1.00 19.38  ? 18  8OG C N1    1 
HETATM 362  C  C2    . 8OG B 2 6   ? -19.714 53.309 25.866 1.00 20.71  ? 18  8OG C C2    1 
HETATM 363  N  N2    . 8OG B 2 6   ? -19.551 54.436 26.573 1.00 20.13  ? 18  8OG C N2    1 
HETATM 364  N  N3    . 8OG B 2 6   ? -18.649 52.662 25.370 1.00 19.35  ? 18  8OG C N3    1 
HETATM 365  C  C4    . 8OG B 2 6   ? -18.998 51.542 24.666 1.00 19.62  ? 18  8OG C C4    1 
HETATM 366  O  O8    . 8OG B 2 6   ? -18.510 48.766 22.821 1.00 24.46  ? 18  8OG C O8    1 
ATOM   367  P  P     . DG  B 2 7   ? -12.288 50.919 23.883 1.00 20.64  ? 19  DG  C P     1 
ATOM   368  O  OP1   . DG  B 2 7   ? -11.782 50.409 22.585 1.00 18.46  ? 19  DG  C OP1   1 
ATOM   369  O  OP2   . DG  B 2 7   ? -11.750 50.354 25.143 1.00 24.81  ? 19  DG  C OP2   1 
ATOM   370  O  "O5'" . DG  B 2 7   ? -12.047 52.491 23.923 1.00 23.18  ? 19  DG  C "O5'" 1 
ATOM   371  C  "C5'" . DG  B 2 7   ? -12.448 53.311 22.830 1.00 22.50  ? 19  DG  C "C5'" 1 
ATOM   372  C  "C4'" . DG  B 2 7   ? -11.275 54.129 22.349 1.00 28.13  ? 19  DG  C "C4'" 1 
ATOM   373  O  "O4'" . DG  B 2 7   ? -11.046 55.250 23.233 1.00 26.13  ? 19  DG  C "O4'" 1 
ATOM   374  C  "C3'" . DG  B 2 7   ? -9.960  53.355 22.297 1.00 28.80  ? 19  DG  C "C3'" 1 
ATOM   375  O  "O3'" . DG  B 2 7   ? -9.227  53.758 21.140 1.00 33.31  ? 19  DG  C "O3'" 1 
ATOM   376  C  "C2'" . DG  B 2 7   ? -9.261  53.773 23.581 1.00 28.69  ? 19  DG  C "C2'" 1 
ATOM   377  C  "C1'" . DG  B 2 7   ? -9.729  55.206 23.753 1.00 27.54  ? 19  DG  C "C1'" 1 
ATOM   378  N  N9    . DG  B 2 7   ? -9.796  55.695 25.126 1.00 30.61  ? 19  DG  C N9    1 
ATOM   379  C  C8    . DG  B 2 7   ? -10.262 55.020 26.231 1.00 32.92  ? 19  DG  C C8    1 
ATOM   380  N  N7    . DG  B 2 7   ? -10.281 55.757 27.310 1.00 32.48  ? 19  DG  C N7    1 
ATOM   381  C  C5    . DG  B 2 7   ? -9.780  56.985 26.896 1.00 31.38  ? 19  DG  C C5    1 
ATOM   382  C  C6    . DG  B 2 7   ? -9.583  58.188 27.618 1.00 30.74  ? 19  DG  C C6    1 
ATOM   383  O  O6    . DG  B 2 7   ? -9.826  58.421 28.803 1.00 30.81  ? 19  DG  C O6    1 
ATOM   384  N  N1    . DG  B 2 7   ? -9.055  59.190 26.810 1.00 28.09  ? 19  DG  C N1    1 
ATOM   385  C  C2    . DG  B 2 7   ? -8.766  59.057 25.478 1.00 27.02  ? 19  DG  C C2    1 
ATOM   386  N  N2    . DG  B 2 7   ? -8.289  60.146 24.864 1.00 26.52  ? 19  DG  C N2    1 
ATOM   387  N  N3    . DG  B 2 7   ? -8.940  57.941 24.794 1.00 28.11  ? 19  DG  C N3    1 
ATOM   388  C  C4    . DG  B 2 7   ? -9.453  56.955 25.558 1.00 30.32  ? 19  DG  C C4    1 
ATOM   389  P  P     . DT  B 2 8   ? -7.901  52.964 20.716 1.00 37.08  ? 20  DT  C P     1 
ATOM   390  O  OP1   . DT  B 2 8   ? -7.262  53.776 19.653 1.00 39.89  ? 20  DT  C OP1   1 
ATOM   391  O  OP2   . DT  B 2 8   ? -8.208  51.539 20.464 1.00 37.76  ? 20  DT  C OP2   1 
ATOM   392  O  "O5'" . DT  B 2 8   ? -6.988  53.060 22.011 1.00 42.12  ? 20  DT  C "O5'" 1 
ATOM   393  C  "C5'" . DT  B 2 8   ? -5.604  53.367 21.897 1.00 50.18  ? 20  DT  C "C5'" 1 
ATOM   394  C  "C4'" . DT  B 2 8   ? -5.423  54.799 21.445 1.00 51.87  ? 20  DT  C "C4'" 1 
ATOM   395  O  "O4'" . DT  B 2 8   ? -6.150  55.699 22.319 1.00 50.89  ? 20  DT  C "O4'" 1 
ATOM   396  C  "C3'" . DT  B 2 8   ? -3.971  55.262 21.476 1.00 54.02  ? 20  DT  C "C3'" 1 
ATOM   397  O  "O3'" . DT  B 2 8   ? -3.717  56.152 20.392 1.00 60.38  ? 20  DT  C "O3'" 1 
ATOM   398  C  "C2'" . DT  B 2 8   ? -3.859  55.974 22.810 1.00 52.34  ? 20  DT  C "C2'" 1 
ATOM   399  C  "C1'" . DT  B 2 8   ? -5.252  56.553 23.015 1.00 48.96  ? 20  DT  C "C1'" 1 
ATOM   400  N  N1    . DT  B 2 8   ? -5.654  56.563 24.430 1.00 45.76  ? 20  DT  C N1    1 
ATOM   401  C  C2    . DT  B 2 8   ? -5.600  57.751 25.124 1.00 44.33  ? 20  DT  C C2    1 
ATOM   402  O  O2    . DT  B 2 8   ? -5.254  58.806 24.619 1.00 44.42  ? 20  DT  C O2    1 
ATOM   403  N  N3    . DT  B 2 8   ? -5.970  57.660 26.441 1.00 41.78  ? 20  DT  C N3    1 
ATOM   404  C  C4    . DT  B 2 8   ? -6.383  56.530 27.116 1.00 41.83  ? 20  DT  C C4    1 
ATOM   405  O  O4    . DT  B 2 8   ? -6.676  56.603 28.309 1.00 41.65  ? 20  DT  C O4    1 
ATOM   406  C  C5    . DT  B 2 8   ? -6.429  55.322 26.324 1.00 42.91  ? 20  DT  C C5    1 
ATOM   407  C  C7    . DT  B 2 8   ? -6.876  54.047 26.966 1.00 42.85  ? 20  DT  C C7    1 
ATOM   408  C  C6    . DT  B 2 8   ? -6.066  55.400 25.038 1.00 43.68  ? 20  DT  C C6    1 
ATOM   409  P  P     . DC  B 2 9   ? -2.207  56.572 20.051 1.00 65.78  ? 21  DC  C P     1 
ATOM   410  O  OP1   . DC  B 2 9   ? -2.218  57.147 18.679 1.00 64.52  ? 21  DC  C OP1   1 
ATOM   411  O  OP2   . DC  B 2 9   ? -1.310  55.427 20.365 1.00 63.21  ? 21  DC  C OP2   1 
ATOM   412  O  "O5'" . DC  B 2 9   ? -1.913  57.746 21.087 1.00 68.44  ? 21  DC  C "O5'" 1 
ATOM   413  C  "C5'" . DC  B 2 9   ? -2.478  59.043 20.897 1.00 72.59  ? 21  DC  C "C5'" 1 
ATOM   414  C  "C4'" . DC  B 2 9   ? -1.866  60.026 21.867 1.00 75.61  ? 21  DC  C "C4'" 1 
ATOM   415  O  "O4'" . DC  B 2 9   ? -2.441  59.855 23.187 1.00 74.93  ? 21  DC  C "O4'" 1 
ATOM   416  C  "C3'" . DC  B 2 9   ? -0.354  59.867 22.034 1.00 78.12  ? 21  DC  C "C3'" 1 
ATOM   417  O  "O3'" . DC  B 2 9   ? 0.282   61.145 22.091 1.00 83.67  ? 21  DC  C "O3'" 1 
ATOM   418  C  "C2'" . DC  B 2 9   ? -0.220  59.152 23.365 1.00 76.81  ? 21  DC  C "C2'" 1 
ATOM   419  C  "C1'" . DC  B 2 9   ? -1.402  59.705 24.139 1.00 74.43  ? 21  DC  C "C1'" 1 
ATOM   420  N  N1    . DC  B 2 9   ? -1.890  58.835 25.221 1.00 72.55  ? 21  DC  C N1    1 
ATOM   421  C  C2    . DC  B 2 9   ? -2.170  59.408 26.466 1.00 72.04  ? 21  DC  C C2    1 
ATOM   422  O  O2    . DC  B 2 9   ? -2.009  60.628 26.612 1.00 71.99  ? 21  DC  C O2    1 
ATOM   423  N  N3    . DC  B 2 9   ? -2.609  58.620 27.475 1.00 71.23  ? 21  DC  C N3    1 
ATOM   424  C  C4    . DC  B 2 9   ? -2.769  57.310 27.274 1.00 71.18  ? 21  DC  C C4    1 
ATOM   425  N  N4    . DC  B 2 9   ? -3.203  56.568 28.299 1.00 70.23  ? 21  DC  C N4    1 
ATOM   426  C  C5    . DC  B 2 9   ? -2.493  56.701 26.013 1.00 70.45  ? 21  DC  C C5    1 
ATOM   427  C  C6    . DC  B 2 9   ? -2.061  57.494 25.025 1.00 71.02  ? 21  DC  C C6    1 
ATOM   428  P  P     . DT  B 2 10  ? 1.886   61.232 22.169 1.00 87.46  ? 22  DT  C P     1 
ATOM   429  O  OP1   . DT  B 2 10  ? 2.311   62.340 21.274 1.00 86.93  ? 22  DT  C OP1   1 
ATOM   430  O  OP2   . DT  B 2 10  ? 2.455   59.871 21.974 1.00 86.70  ? 22  DT  C OP2   1 
ATOM   431  O  "O5'" . DT  B 2 10  ? 2.156   61.669 23.674 1.00 87.77  ? 22  DT  C "O5'" 1 
ATOM   432  C  "C5'" . DT  B 2 10  ? 1.551   62.842 24.207 1.00 90.24  ? 22  DT  C "C5'" 1 
ATOM   433  C  "C4'" . DT  B 2 10  ? 1.908   62.991 25.665 1.00 92.41  ? 22  DT  C "C4'" 1 
ATOM   434  O  "O4'" . DT  B 2 10  ? 1.265   61.945 26.435 1.00 92.00  ? 22  DT  C "O4'" 1 
ATOM   435  C  "C3'" . DT  B 2 10  ? 3.405   62.867 25.953 1.00 93.98  ? 22  DT  C "C3'" 1 
ATOM   436  O  "O3'" . DT  B 2 10  ? 3.771   63.764 27.006 1.00 96.75  ? 22  DT  C "O3'" 1 
ATOM   437  C  "C2'" . DT  B 2 10  ? 3.541   61.431 26.428 1.00 93.10  ? 22  DT  C "C2'" 1 
ATOM   438  C  "C1'" . DT  B 2 10  ? 2.241   61.246 27.187 1.00 91.44  ? 22  DT  C "C1'" 1 
ATOM   439  N  N1    . DT  B 2 10  ? 1.789   59.852 27.340 1.00 90.21  ? 22  DT  C N1    1 
ATOM   440  C  C2    . DT  B 2 10  ? 1.382   59.447 28.591 1.00 89.44  ? 22  DT  C C2    1 
ATOM   441  O  O2    . DT  B 2 10  ? 1.383   60.184 29.562 1.00 89.32  ? 22  DT  C O2    1 
ATOM   442  N  N3    . DT  B 2 10  ? 0.972   58.140 28.665 1.00 88.89  ? 22  DT  C N3    1 
ATOM   443  C  C4    . DT  B 2 10  ? 0.928   57.220 27.637 1.00 89.02  ? 22  DT  C C4    1 
ATOM   444  O  O4    . DT  B 2 10  ? 0.532   56.079 27.855 1.00 88.85  ? 22  DT  C O4    1 
ATOM   445  C  C5    . DT  B 2 10  ? 1.372   57.712 26.349 1.00 89.35  ? 22  DT  C C5    1 
ATOM   446  C  C7    . DT  B 2 10  ? 1.366   56.784 25.176 1.00 89.34  ? 22  DT  C C7    1 
ATOM   447  C  C6    . DT  B 2 10  ? 1.773   58.988 26.267 1.00 89.89  ? 22  DT  C C6    1 
ATOM   448  P  P     . DA  B 2 11  ? 5.067   64.698 26.845 1.00 98.03  ? 23  DA  C P     1 
ATOM   449  O  OP1   . DA  B 2 11  ? 4.622   65.971 26.224 1.00 97.47  ? 23  DA  C OP1   1 
ATOM   450  O  OP2   . DA  B 2 11  ? 6.143   63.903 26.200 1.00 98.42  ? 23  DA  C OP2   1 
ATOM   451  O  "O5'" . DA  B 2 11  ? 5.495   64.995 28.350 1.00 99.31  ? 23  DA  C "O5'" 1 
ATOM   452  C  "C5'" . DA  B 2 11  ? 4.555   65.523 29.283 1.00 102.01 ? 23  DA  C "C5'" 1 
ATOM   453  C  "C4'" . DA  B 2 11  ? 4.662   64.798 30.605 1.00 103.68 ? 23  DA  C "C4'" 1 
ATOM   454  O  "O4'" . DA  B 2 11  ? 4.242   63.421 30.443 1.00 103.93 ? 23  DA  C "O4'" 1 
ATOM   455  C  "C3'" . DA  B 2 11  ? 6.071   64.741 31.198 1.00 104.41 ? 23  DA  C "C3'" 1 
ATOM   456  O  "O3'" . DA  B 2 11  ? 6.001   64.844 32.624 1.00 105.82 ? 23  DA  C "O3'" 1 
ATOM   457  C  "C2'" . DA  B 2 11  ? 6.554   63.357 30.808 1.00 104.12 ? 23  DA  C "C2'" 1 
ATOM   458  C  "C1'" . DA  B 2 11  ? 5.271   62.550 30.889 1.00 103.69 ? 23  DA  C "C1'" 1 
ATOM   459  N  N9    . DA  B 2 11  ? 5.250   61.356 30.045 1.00 103.18 ? 23  DA  C N9    1 
ATOM   460  C  C8    . DA  B 2 11  ? 5.672   61.230 28.745 1.00 102.95 ? 23  DA  C C8    1 
ATOM   461  N  N7    . DA  B 2 11  ? 5.521   60.024 28.254 1.00 102.73 ? 23  DA  C N7    1 
ATOM   462  C  C5    . DA  B 2 11  ? 4.963   59.305 29.302 1.00 102.51 ? 23  DA  C C5    1 
ATOM   463  C  C6    . DA  B 2 11  ? 4.567   57.960 29.424 1.00 102.42 ? 23  DA  C C6    1 
ATOM   464  N  N6    . DA  B 2 11  ? 4.672   57.064 28.440 1.00 102.37 ? 23  DA  C N6    1 
ATOM   465  N  N1    . DA  B 2 11  ? 4.051   57.563 30.608 1.00 102.29 ? 23  DA  C N1    1 
ATOM   466  C  C2    . DA  B 2 11  ? 3.946   58.462 31.595 1.00 102.22 ? 23  DA  C C2    1 
ATOM   467  N  N3    . DA  B 2 11  ? 4.283   59.750 31.602 1.00 102.15 ? 23  DA  C N3    1 
ATOM   468  C  C4    . DA  B 2 11  ? 4.791   60.113 30.412 1.00 102.57 ? 23  DA  C C4    1 
ATOM   469  P  P     . DC  B 2 12  ? 7.314   65.243 33.459 1.00 107.04 ? 24  DC  C P     1 
ATOM   470  O  OP1   . DC  B 2 12  ? 7.009   66.506 34.182 1.00 107.04 ? 24  DC  C OP1   1 
ATOM   471  O  OP2   . DC  B 2 12  ? 8.484   65.181 32.544 1.00 106.96 ? 24  DC  C OP2   1 
ATOM   472  O  "O5'" . DC  B 2 12  ? 7.458   64.076 34.537 1.00 106.19 ? 24  DC  C "O5'" 1 
ATOM   473  C  "C5'" . DC  B 2 12  ? 6.555   63.982 35.639 1.00 105.23 ? 24  DC  C "C5'" 1 
ATOM   474  C  "C4'" . DC  B 2 12  ? 6.862   62.755 36.466 1.00 104.60 ? 24  DC  C "C4'" 1 
ATOM   475  O  "O4'" . DC  B 2 12  ? 6.573   61.566 35.690 1.00 104.38 ? 24  DC  C "O4'" 1 
ATOM   476  C  "C3'" . DC  B 2 12  ? 8.323   62.625 36.901 1.00 104.49 ? 24  DC  C "C3'" 1 
ATOM   477  O  "O3'" . DC  B 2 12  ? 8.415   61.889 38.123 1.00 104.58 ? 24  DC  C "O3'" 1 
ATOM   478  C  "C2'" . DC  B 2 12  ? 8.914   61.733 35.825 1.00 104.14 ? 24  DC  C "C2'" 1 
ATOM   479  C  "C1'" . DC  B 2 12  ? 7.755   60.793 35.525 1.00 104.01 ? 24  DC  C "C1'" 1 
ATOM   480  N  N1    . DC  B 2 12  ? 7.752   60.239 34.158 1.00 103.45 ? 24  DC  C N1    1 
ATOM   481  C  C2    . DC  B 2 12  ? 7.344   58.910 33.966 1.00 103.00 ? 24  DC  C C2    1 
ATOM   482  O  O2    . DC  B 2 12  ? 6.977   58.245 34.948 1.00 103.10 ? 24  DC  C O2    1 
ATOM   483  N  N3    . DC  B 2 12  ? 7.359   58.388 32.718 1.00 102.13 ? 24  DC  C N3    1 
ATOM   484  C  C4    . DC  B 2 12  ? 7.755   59.138 31.686 1.00 101.96 ? 24  DC  C C4    1 
ATOM   485  N  N4    . DC  B 2 12  ? 7.761   58.580 30.473 1.00 101.19 ? 24  DC  C N4    1 
ATOM   486  C  C5    . DC  B 2 12  ? 8.165   60.494 31.851 1.00 102.25 ? 24  DC  C C5    1 
ATOM   487  C  C6    . DC  B 2 12  ? 8.147   60.999 33.092 1.00 102.87 ? 24  DC  C C6    1 
ATOM   488  N  N     . PRO C 3 2   ? -16.579 52.690 21.169 1.00 23.64  ? 2   PRO A N     1 
ATOM   489  C  CA    . PRO C 3 2   ? -16.801 51.760 20.043 1.00 24.00  ? 2   PRO A CA    1 
ATOM   490  C  C     . PRO C 3 2   ? -15.563 50.975 19.621 1.00 23.77  ? 2   PRO A C     1 
ATOM   491  O  O     . PRO C 3 2   ? -14.517 51.545 19.306 1.00 24.18  ? 2   PRO A O     1 
ATOM   492  C  CB    . PRO C 3 2   ? -17.326 52.596 18.887 1.00 23.39  ? 2   PRO A CB    1 
ATOM   493  C  CG    . PRO C 3 2   ? -18.114 53.655 19.644 1.00 23.30  ? 2   PRO A CG    1 
ATOM   494  C  CD    . PRO C 3 2   ? -17.246 53.976 20.889 1.00 25.76  ? 2   PRO A CD    1 
ATOM   495  N  N     . GLN C 3 3   ? -15.694 49.656 19.627 1.00 20.73  ? 3   GLN A N     1 
ATOM   496  C  CA    . GLN C 3 3   ? -14.608 48.778 19.223 1.00 18.94  ? 3   GLN A CA    1 
ATOM   497  C  C     . GLN C 3 3   ? -14.988 48.294 17.826 1.00 18.51  ? 3   GLN A C     1 
ATOM   498  O  O     . GLN C 3 3   ? -15.954 48.790 17.250 1.00 18.34  ? 3   GLN A O     1 
ATOM   499  C  CB    . GLN C 3 3   ? -14.486 47.627 20.225 1.00 16.93  ? 3   GLN A CB    1 
ATOM   500  C  CG    . GLN C 3 3   ? -14.277 48.152 21.655 1.00 18.35  ? 3   GLN A CG    1 
ATOM   501  C  CD    . GLN C 3 3   ? -14.645 47.151 22.736 1.00 19.67  ? 3   GLN A CD    1 
ATOM   502  O  OE1   . GLN C 3 3   ? -13.864 46.255 23.069 1.00 17.43  ? 3   GLN A OE1   1 
ATOM   503  N  NE2   . GLN C 3 3   ? -15.849 47.294 23.284 1.00 18.33  ? 3   GLN A NE2   1 
ATOM   504  N  N     . LEU C 3 4   ? -14.254 47.333 17.281 1.00 17.58  ? 4   LEU A N     1 
ATOM   505  C  CA    . LEU C 3 4   ? -14.545 46.857 15.938 1.00 18.54  ? 4   LEU A CA    1 
ATOM   506  C  C     . LEU C 3 4   ? -16.012 46.520 15.652 1.00 18.16  ? 4   LEU A C     1 
ATOM   507  O  O     . LEU C 3 4   ? -16.561 46.972 14.653 1.00 19.49  ? 4   LEU A O     1 
ATOM   508  C  CB    . LEU C 3 4   ? -13.650 45.658 15.589 1.00 16.78  ? 4   LEU A CB    1 
ATOM   509  C  CG    . LEU C 3 4   ? -13.760 45.097 14.165 1.00 17.74  ? 4   LEU A CG    1 
ATOM   510  C  CD1   . LEU C 3 4   ? -12.473 44.360 13.784 1.00 16.40  ? 4   LEU A CD1   1 
ATOM   511  C  CD2   . LEU C 3 4   ? -14.967 44.171 14.063 1.00 12.71  ? 4   LEU A CD2   1 
ATOM   512  N  N     . PRO C 3 5   ? -16.670 45.737 16.521 1.00 18.37  ? 5   PRO A N     1 
ATOM   513  C  CA    . PRO C 3 5   ? -18.076 45.395 16.258 1.00 19.52  ? 5   PRO A CA    1 
ATOM   514  C  C     . PRO C 3 5   ? -19.025 46.592 16.181 1.00 17.84  ? 5   PRO A C     1 
ATOM   515  O  O     . PRO C 3 5   ? -19.932 46.617 15.351 1.00 17.07  ? 5   PRO A O     1 
ATOM   516  C  CB    . PRO C 3 5   ? -18.431 44.450 17.410 1.00 18.43  ? 5   PRO A CB    1 
ATOM   517  C  CG    . PRO C 3 5   ? -17.112 43.832 17.756 1.00 20.38  ? 5   PRO A CG    1 
ATOM   518  C  CD    . PRO C 3 5   ? -16.183 45.032 17.716 1.00 19.02  ? 5   PRO A CD    1 
ATOM   519  N  N     . GLU C 3 6   ? -18.812 47.572 17.052 1.00 18.27  ? 6   GLU A N     1 
ATOM   520  C  CA    . GLU C 3 6   ? -19.638 48.775 17.075 1.00 18.28  ? 6   GLU A CA    1 
ATOM   521  C  C     . GLU C 3 6   ? -19.354 49.649 15.845 1.00 19.05  ? 6   GLU A C     1 
ATOM   522  O  O     . GLU C 3 6   ? -20.278 50.112 15.170 1.00 19.62  ? 6   GLU A O     1 
ATOM   523  C  CB    . GLU C 3 6   ? -19.374 49.568 18.357 1.00 17.67  ? 6   GLU A CB    1 
ATOM   524  C  CG    . GLU C 3 6   ? -19.868 48.880 19.633 1.00 20.06  ? 6   GLU A CG    1 
ATOM   525  C  CD    . GLU C 3 6   ? -19.085 47.617 19.983 1.00 20.29  ? 6   GLU A CD    1 
ATOM   526  O  OE1   . GLU C 3 6   ? -19.718 46.634 20.412 1.00 20.71  ? 6   GLU A OE1   1 
ATOM   527  O  OE2   . GLU C 3 6   ? -17.841 47.607 19.842 1.00 21.80  ? 6   GLU A OE2   1 
ATOM   528  N  N     . VAL C 3 7   ? -18.078 49.868 15.548 1.00 19.70  ? 7   VAL A N     1 
ATOM   529  C  CA    . VAL C 3 7   ? -17.706 50.676 14.392 1.00 20.27  ? 7   VAL A CA    1 
ATOM   530  C  C     . VAL C 3 7   ? -18.201 50.001 13.111 1.00 21.61  ? 7   VAL A C     1 
ATOM   531  O  O     . VAL C 3 7   ? -18.665 50.674 12.193 1.00 20.82  ? 7   VAL A O     1 
ATOM   532  C  CB    . VAL C 3 7   ? -16.175 50.873 14.315 1.00 21.80  ? 7   VAL A CB    1 
ATOM   533  C  CG1   . VAL C 3 7   ? -15.800 51.666 13.051 1.00 20.29  ? 7   VAL A CG1   1 
ATOM   534  C  CG2   . VAL C 3 7   ? -15.692 51.604 15.565 1.00 19.37  ? 7   VAL A CG2   1 
ATOM   535  N  N     . GLU C 3 8   ? -18.118 48.671 13.063 1.00 22.58  ? 8   GLU A N     1 
ATOM   536  C  CA    . GLU C 3 8   ? -18.567 47.917 11.896 1.00 24.46  ? 8   GLU A CA    1 
ATOM   537  C  C     . GLU C 3 8   ? -20.085 48.016 11.719 1.00 25.45  ? 8   GLU A C     1 
ATOM   538  O  O     . GLU C 3 8   ? -20.578 48.129 10.597 1.00 26.15  ? 8   GLU A O     1 
ATOM   539  C  CB    . GLU C 3 8   ? -18.149 46.445 12.018 1.00 23.98  ? 8   GLU A CB    1 
ATOM   540  C  CG    . GLU C 3 8   ? -18.530 45.562 10.813 1.00 24.21  ? 8   GLU A CG    1 
ATOM   541  C  CD    . GLU C 3 8   ? -18.001 46.093 9.474  1.00 23.32  ? 8   GLU A CD    1 
ATOM   542  O  OE1   . GLU C 3 8   ? -16.876 46.630 9.436  1.00 22.20  ? 8   GLU A OE1   1 
ATOM   543  O  OE2   . GLU C 3 8   ? -18.707 45.961 8.455  1.00 21.09  ? 8   GLU A OE2   1 
ATOM   544  N  N     . THR C 3 9   ? -20.824 47.966 12.825 1.00 25.21  ? 9   THR A N     1 
ATOM   545  C  CA    . THR C 3 9   ? -22.279 48.067 12.766 1.00 24.12  ? 9   THR A CA    1 
ATOM   546  C  C     . THR C 3 9   ? -22.666 49.475 12.310 1.00 23.94  ? 9   THR A C     1 
ATOM   547  O  O     . THR C 3 9   ? -23.625 49.656 11.562 1.00 22.80  ? 9   THR A O     1 
ATOM   548  C  CB    . THR C 3 9   ? -22.925 47.800 14.143 1.00 25.19  ? 9   THR A CB    1 
ATOM   549  O  OG1   . THR C 3 9   ? -22.495 46.525 14.637 1.00 24.67  ? 9   THR A OG1   1 
ATOM   550  C  CG2   . THR C 3 9   ? -24.455 47.808 14.026 1.00 22.42  ? 9   THR A CG2   1 
ATOM   551  N  N     . ILE C 3 10  ? -21.923 50.474 12.775 1.00 23.49  ? 10  ILE A N     1 
ATOM   552  C  CA    . ILE C 3 10  ? -22.189 51.847 12.370 1.00 21.65  ? 10  ILE A CA    1 
ATOM   553  C  C     . ILE C 3 10  ? -21.904 51.972 10.878 1.00 22.26  ? 10  ILE A C     1 
ATOM   554  O  O     . ILE C 3 10  ? -22.663 52.603 10.143 1.00 23.34  ? 10  ILE A O     1 
ATOM   555  C  CB    . ILE C 3 10  ? -21.300 52.851 13.145 1.00 18.07  ? 10  ILE A CB    1 
ATOM   556  C  CG1   . ILE C 3 10  ? -21.846 53.037 14.566 1.00 16.01  ? 10  ILE A CG1   1 
ATOM   557  C  CG2   . ILE C 3 10  ? -21.233 54.182 12.398 1.00 14.70  ? 10  ILE A CG2   1 
ATOM   558  C  CD1   . ILE C 3 10  ? -20.926 53.843 15.487 1.00 14.89  ? 10  ILE A CD1   1 
ATOM   559  N  N     . ARG C 3 11  ? -20.815 51.354 10.432 1.00 23.65  ? 11  ARG A N     1 
ATOM   560  C  CA    . ARG C 3 11  ? -20.432 51.415 9.024  1.00 23.56  ? 11  ARG A CA    1 
ATOM   561  C  C     . ARG C 3 11  ? -21.520 50.857 8.117  1.00 25.36  ? 11  ARG A C     1 
ATOM   562  O  O     . ARG C 3 11  ? -21.901 51.487 7.132  1.00 27.11  ? 11  ARG A O     1 
ATOM   563  C  CB    . ARG C 3 11  ? -19.138 50.635 8.780  1.00 22.88  ? 11  ARG A CB    1 
ATOM   564  C  CG    . ARG C 3 11  ? -18.592 50.805 7.360  1.00 24.05  ? 11  ARG A CG    1 
ATOM   565  C  CD    . ARG C 3 11  ? -17.527 49.790 7.051  1.00 22.97  ? 11  ARG A CD    1 
ATOM   566  N  NE    . ARG C 3 11  ? -18.107 48.462 6.904  1.00 27.17  ? 11  ARG A NE    1 
ATOM   567  C  CZ    . ARG C 3 11  ? -18.848 48.077 5.868  1.00 29.15  ? 11  ARG A CZ    1 
ATOM   568  N  NH1   . ARG C 3 11  ? -19.104 48.918 4.870  1.00 28.93  ? 11  ARG A NH1   1 
ATOM   569  N  NH2   . ARG C 3 11  ? -19.337 46.846 5.833  1.00 32.40  ? 11  ARG A NH2   1 
ATOM   570  N  N     . ARG C 3 12  ? -22.018 49.673 8.453  1.00 25.86  ? 12  ARG A N     1 
ATOM   571  C  CA    . ARG C 3 12  ? -23.052 49.031 7.656  1.00 26.23  ? 12  ARG A CA    1 
ATOM   572  C  C     . ARG C 3 12  ? -24.340 49.837 7.589  1.00 25.77  ? 12  ARG A C     1 
ATOM   573  O  O     . ARG C 3 12  ? -24.935 49.975 6.520  1.00 24.49  ? 12  ARG A O     1 
ATOM   574  C  CB    . ARG C 3 12  ? -23.358 47.640 8.212  1.00 27.60  ? 12  ARG A CB    1 
ATOM   575  C  CG    . ARG C 3 12  ? -22.184 46.679 8.137  1.00 31.82  ? 12  ARG A CG    1 
ATOM   576  C  CD    . ARG C 3 12  ? -22.521 45.321 8.756  1.00 31.76  ? 12  ARG A CD    1 
ATOM   577  N  NE    . ARG C 3 12  ? -21.420 44.368 8.604  1.00 31.69  ? 12  ARG A NE    1 
ATOM   578  C  CZ    . ARG C 3 12  ? -21.491 43.085 8.944  1.00 30.94  ? 12  ARG A CZ    1 
ATOM   579  N  NH1   . ARG C 3 12  ? -22.610 42.594 9.459  1.00 28.72  ? 12  ARG A NH1   1 
ATOM   580  N  NH2   . ARG C 3 12  ? -20.444 42.292 8.766  1.00 29.53  ? 12  ARG A NH2   1 
ATOM   581  N  N     . THR C 3 13  ? -24.760 50.377 8.728  1.00 24.29  ? 13  THR A N     1 
ATOM   582  C  CA    . THR C 3 13  ? -26.001 51.137 8.797  1.00 23.74  ? 13  THR A CA    1 
ATOM   583  C  C     . THR C 3 13  ? -25.908 52.589 8.326  1.00 24.16  ? 13  THR A C     1 
ATOM   584  O  O     . THR C 3 13  ? -26.930 53.221 8.061  1.00 24.62  ? 13  THR A O     1 
ATOM   585  C  CB    . THR C 3 13  ? -26.566 51.116 10.231 1.00 24.54  ? 13  THR A CB    1 
ATOM   586  O  OG1   . THR C 3 13  ? -25.639 51.748 11.125 1.00 24.12  ? 13  THR A OG1   1 
ATOM   587  C  CG2   . THR C 3 13  ? -26.796 49.680 10.682 1.00 21.79  ? 13  THR A CG2   1 
ATOM   588  N  N     . LEU C 3 14  ? -24.691 53.113 8.213  1.00 23.27  ? 14  LEU A N     1 
ATOM   589  C  CA    . LEU C 3 14  ? -24.494 54.494 7.771  1.00 22.64  ? 14  LEU A CA    1 
ATOM   590  C  C     . LEU C 3 14  ? -24.287 54.629 6.262  1.00 21.33  ? 14  LEU A C     1 
ATOM   591  O  O     . LEU C 3 14  ? -24.845 55.524 5.636  1.00 19.56  ? 14  LEU A O     1 
ATOM   592  C  CB    . LEU C 3 14  ? -23.293 55.118 8.502  1.00 21.81  ? 14  LEU A CB    1 
ATOM   593  C  CG    . LEU C 3 14  ? -22.819 56.511 8.056  1.00 20.71  ? 14  LEU A CG    1 
ATOM   594  C  CD1   . LEU C 3 14  ? -23.976 57.493 8.100  1.00 19.29  ? 14  LEU A CD1   1 
ATOM   595  C  CD2   . LEU C 3 14  ? -21.685 56.986 8.967  1.00 17.89  ? 14  LEU A CD2   1 
ATOM   596  N  N     . LEU C 3 15  ? -23.492 53.729 5.692  1.00 20.97  ? 15  LEU A N     1 
ATOM   597  C  CA    . LEU C 3 15  ? -23.161 53.758 4.266  1.00 21.66  ? 15  LEU A CA    1 
ATOM   598  C  C     . LEU C 3 15  ? -24.314 53.979 3.279  1.00 21.24  ? 15  LEU A C     1 
ATOM   599  O  O     . LEU C 3 15  ? -24.215 54.817 2.388  1.00 21.54  ? 15  LEU A O     1 
ATOM   600  C  CB    . LEU C 3 15  ? -22.397 52.483 3.885  1.00 21.67  ? 15  LEU A CB    1 
ATOM   601  C  CG    . LEU C 3 15  ? -22.257 52.164 2.388  1.00 24.49  ? 15  LEU A CG    1 
ATOM   602  C  CD1   . LEU C 3 15  ? -21.457 53.242 1.679  1.00 23.77  ? 15  LEU A CD1   1 
ATOM   603  C  CD2   . LEU C 3 15  ? -21.580 50.811 2.228  1.00 23.75  ? 15  LEU A CD2   1 
ATOM   604  N  N     . PRO C 3 16  ? -25.412 53.226 3.411  1.00 19.92  ? 16  PRO A N     1 
ATOM   605  C  CA    . PRO C 3 16  ? -26.491 53.462 2.444  1.00 19.68  ? 16  PRO A CA    1 
ATOM   606  C  C     . PRO C 3 16  ? -27.170 54.818 2.594  1.00 20.12  ? 16  PRO A C     1 
ATOM   607  O  O     . PRO C 3 16  ? -27.776 55.333 1.653  1.00 19.18  ? 16  PRO A O     1 
ATOM   608  C  CB    . PRO C 3 16  ? -27.440 52.277 2.679  1.00 20.29  ? 16  PRO A CB    1 
ATOM   609  C  CG    . PRO C 3 16  ? -27.181 51.886 4.114  1.00 18.67  ? 16  PRO A CG    1 
ATOM   610  C  CD    . PRO C 3 16  ? -25.688 52.054 4.260  1.00 18.21  ? 16  PRO A CD    1 
ATOM   611  N  N     . LEU C 3 17  ? -27.052 55.405 3.777  1.00 21.14  ? 17  LEU A N     1 
ATOM   612  C  CA    . LEU C 3 17  ? -27.655 56.705 4.037  1.00 20.17  ? 17  LEU A CA    1 
ATOM   613  C  C     . LEU C 3 17  ? -26.850 57.863 3.456  1.00 21.01  ? 17  LEU A C     1 
ATOM   614  O  O     . LEU C 3 17  ? -27.359 58.977 3.345  1.00 21.65  ? 17  LEU A O     1 
ATOM   615  C  CB    . LEU C 3 17  ? -27.823 56.908 5.539  1.00 19.36  ? 17  LEU A CB    1 
ATOM   616  C  CG    . LEU C 3 17  ? -29.085 56.375 6.223  1.00 20.87  ? 17  LEU A CG    1 
ATOM   617  C  CD1   . LEU C 3 17  ? -29.769 55.290 5.403  1.00 20.49  ? 17  LEU A CD1   1 
ATOM   618  C  CD2   . LEU C 3 17  ? -28.690 55.867 7.591  1.00 21.59  ? 17  LEU A CD2   1 
ATOM   619  N  N     . ILE C 3 18  ? -25.601 57.609 3.076  1.00 19.07  ? 18  ILE A N     1 
ATOM   620  C  CA    . ILE C 3 18  ? -24.777 58.679 2.534  1.00 20.27  ? 18  ILE A CA    1 
ATOM   621  C  C     . ILE C 3 18  ? -24.135 58.409 1.179  1.00 19.51  ? 18  ILE A C     1 
ATOM   622  O  O     . ILE C 3 18  ? -23.735 59.349 0.500  1.00 19.19  ? 18  ILE A O     1 
ATOM   623  C  CB    . ILE C 3 18  ? -23.653 59.067 3.521  1.00 21.41  ? 18  ILE A CB    1 
ATOM   624  C  CG1   . ILE C 3 18  ? -22.745 57.858 3.770  1.00 21.83  ? 18  ILE A CG1   1 
ATOM   625  C  CG2   . ILE C 3 18  ? -24.263 59.579 4.821  1.00 19.46  ? 18  ILE A CG2   1 
ATOM   626  C  CD1   . ILE C 3 18  ? -21.584 58.133 4.716  1.00 24.57  ? 18  ILE A CD1   1 
ATOM   627  N  N     . VAL C 3 19  ? -24.032 57.143 0.776  1.00 18.37  ? 19  VAL A N     1 
ATOM   628  C  CA    . VAL C 3 19  ? -23.409 56.839 -0.504 1.00 17.40  ? 19  VAL A CA    1 
ATOM   629  C  C     . VAL C 3 19  ? -24.101 57.616 -1.626 1.00 18.69  ? 19  VAL A C     1 
ATOM   630  O  O     . VAL C 3 19  ? -25.331 57.707 -1.664 1.00 18.28  ? 19  VAL A O     1 
ATOM   631  C  CB    . VAL C 3 19  ? -23.440 55.308 -0.820 1.00 18.67  ? 19  VAL A CB    1 
ATOM   632  C  CG1   . VAL C 3 19  ? -24.863 54.830 -1.078 1.00 15.25  ? 19  VAL A CG1   1 
ATOM   633  C  CG2   . VAL C 3 19  ? -22.551 55.010 -2.019 1.00 16.68  ? 19  VAL A CG2   1 
ATOM   634  N  N     . GLY C 3 20  ? -23.302 58.208 -2.513 1.00 17.57  ? 20  GLY A N     1 
ATOM   635  C  CA    . GLY C 3 20  ? -23.859 58.962 -3.624 1.00 18.56  ? 20  GLY A CA    1 
ATOM   636  C  C     . GLY C 3 20  ? -24.134 60.432 -3.355 1.00 20.64  ? 20  GLY A C     1 
ATOM   637  O  O     . GLY C 3 20  ? -24.389 61.198 -4.286 1.00 20.50  ? 20  GLY A O     1 
ATOM   638  N  N     . LYS C 3 21  ? -24.089 60.841 -2.091 1.00 20.04  ? 21  LYS A N     1 
ATOM   639  C  CA    . LYS C 3 21  ? -24.347 62.240 -1.766 1.00 20.93  ? 21  LYS A CA    1 
ATOM   640  C  C     . LYS C 3 21  ? -23.091 63.102 -1.897 1.00 20.09  ? 21  LYS A C     1 
ATOM   641  O  O     . LYS C 3 21  ? -21.978 62.659 -1.594 1.00 20.76  ? 21  LYS A O     1 
ATOM   642  C  CB    . LYS C 3 21  ? -24.937 62.357 -0.361 1.00 20.65  ? 21  LYS A CB    1 
ATOM   643  C  CG    . LYS C 3 21  ? -26.285 61.679 -0.233 1.00 21.47  ? 21  LYS A CG    1 
ATOM   644  C  CD    . LYS C 3 21  ? -26.924 61.969 1.113  1.00 24.59  ? 21  LYS A CD    1 
ATOM   645  C  CE    . LYS C 3 21  ? -28.260 61.244 1.241  1.00 23.47  ? 21  LYS A CE    1 
ATOM   646  N  NZ    . LYS C 3 21  ? -28.893 61.527 2.552  1.00 25.34  ? 21  LYS A NZ    1 
ATOM   647  N  N     . THR C 3 22  ? -23.291 64.330 -2.361 1.00 18.37  ? 22  THR A N     1 
ATOM   648  C  CA    . THR C 3 22  ? -22.213 65.284 -2.576 1.00 17.65  ? 22  THR A CA    1 
ATOM   649  C  C     . THR C 3 22  ? -22.167 66.320 -1.459 1.00 18.85  ? 22  THR A C     1 
ATOM   650  O  O     . THR C 3 22  ? -23.181 66.949 -1.124 1.00 19.31  ? 22  THR A O     1 
ATOM   651  C  CB    . THR C 3 22  ? -22.393 66.012 -3.926 1.00 18.55  ? 22  THR A CB    1 
ATOM   652  O  OG1   . THR C 3 22  ? -22.541 65.044 -4.977 1.00 17.88  ? 22  THR A OG1   1 
ATOM   653  C  CG2   . THR C 3 22  ? -21.193 66.888 -4.227 1.00 16.10  ? 22  THR A CG2   1 
ATOM   654  N  N     . ILE C 3 23  ? -20.984 66.488 -0.879 1.00 16.96  ? 23  ILE A N     1 
ATOM   655  C  CA    . ILE C 3 23  ? -20.788 67.436 0.203  1.00 16.62  ? 23  ILE A CA    1 
ATOM   656  C  C     . ILE C 3 23  ? -20.900 68.873 -0.298 1.00 18.96  ? 23  ILE A C     1 
ATOM   657  O  O     . ILE C 3 23  ? -20.190 69.277 -1.223 1.00 19.75  ? 23  ILE A O     1 
ATOM   658  C  CB    . ILE C 3 23  ? -19.409 67.234 0.852  1.00 16.90  ? 23  ILE A CB    1 
ATOM   659  C  CG1   . ILE C 3 23  ? -19.360 65.856 1.523  1.00 16.54  ? 23  ILE A CG1   1 
ATOM   660  C  CG2   . ILE C 3 23  ? -19.140 68.346 1.870  1.00 16.71  ? 23  ILE A CG2   1 
ATOM   661  C  CD1   . ILE C 3 23  ? -17.971 65.393 1.886  1.00 14.53  ? 23  ILE A CD1   1 
ATOM   662  N  N     . GLU C 3 24  ? -21.801 69.636 0.312  1.00 20.96  ? 24  GLU A N     1 
ATOM   663  C  CA    . GLU C 3 24  ? -22.004 71.032 -0.052 1.00 22.03  ? 24  GLU A CA    1 
ATOM   664  C  C     . GLU C 3 24  ? -21.284 71.960 0.922  1.00 20.96  ? 24  GLU A C     1 
ATOM   665  O  O     . GLU C 3 24  ? -20.779 72.999 0.524  1.00 23.55  ? 24  GLU A O     1 
ATOM   666  C  CB    . GLU C 3 24  ? -23.498 71.373 -0.088 1.00 22.96  ? 24  GLU A CB    1 
ATOM   667  C  CG    . GLU C 3 24  ? -23.773 72.841 -0.385 1.00 25.68  ? 24  GLU A CG    1 
ATOM   668  C  CD    . GLU C 3 24  ? -25.160 73.088 -0.958 1.00 26.99  ? 24  GLU A CD    1 
ATOM   669  O  OE1   . GLU C 3 24  ? -25.464 72.526 -2.032 1.00 24.73  ? 24  GLU A OE1   1 
ATOM   670  O  OE2   . GLU C 3 24  ? -25.939 73.848 -0.339 1.00 25.51  ? 24  GLU A OE2   1 
ATOM   671  N  N     . ASP C 3 25  ? -21.247 71.590 2.196  1.00 20.94  ? 25  ASP A N     1 
ATOM   672  C  CA    . ASP C 3 25  ? -20.563 72.400 3.198  1.00 19.87  ? 25  ASP A CA    1 
ATOM   673  C  C     . ASP C 3 25  ? -20.187 71.533 4.396  1.00 19.70  ? 25  ASP A C     1 
ATOM   674  O  O     . ASP C 3 25  ? -20.802 70.502 4.640  1.00 20.17  ? 25  ASP A O     1 
ATOM   675  C  CB    . ASP C 3 25  ? -21.459 73.561 3.649  1.00 21.49  ? 25  ASP A CB    1 
ATOM   676  C  CG    . ASP C 3 25  ? -20.698 74.623 4.447  1.00 22.64  ? 25  ASP A CG    1 
ATOM   677  O  OD1   . ASP C 3 25  ? -19.449 74.555 4.510  1.00 21.93  ? 25  ASP A OD1   1 
ATOM   678  O  OD2   . ASP C 3 25  ? -21.349 75.536 5.005  1.00 19.84  ? 25  ASP A OD2   1 
ATOM   679  N  N     . VAL C 3 26  ? -19.158 71.947 5.125  1.00 19.98  ? 26  VAL A N     1 
ATOM   680  C  CA    . VAL C 3 26  ? -18.703 71.230 6.306  1.00 19.77  ? 26  VAL A CA    1 
ATOM   681  C  C     . VAL C 3 26  ? -18.576 72.249 7.425  1.00 21.67  ? 26  VAL A C     1 
ATOM   682  O  O     . VAL C 3 26  ? -17.759 73.167 7.341  1.00 22.97  ? 26  VAL A O     1 
ATOM   683  C  CB    . VAL C 3 26  ? -17.327 70.573 6.091  1.00 19.32  ? 26  VAL A CB    1 
ATOM   684  C  CG1   . VAL C 3 26  ? -16.870 69.902 7.376  1.00 17.01  ? 26  VAL A CG1   1 
ATOM   685  C  CG2   . VAL C 3 26  ? -17.409 69.542 4.979  1.00 19.53  ? 26  VAL A CG2   1 
ATOM   686  N  N     . ARG C 3 27  ? -19.386 72.088 8.466  1.00 20.87  ? 27  ARG A N     1 
ATOM   687  C  CA    . ARG C 3 27  ? -19.370 73.006 9.595  1.00 21.85  ? 27  ARG A CA    1 
ATOM   688  C  C     . ARG C 3 27  ? -18.775 72.340 10.836 1.00 23.64  ? 27  ARG A C     1 
ATOM   689  O  O     . ARG C 3 27  ? -19.152 71.225 11.208 1.00 22.28  ? 27  ARG A O     1 
ATOM   690  C  CB    . ARG C 3 27  ? -20.790 73.508 9.843  1.00 23.58  ? 27  ARG A CB    1 
ATOM   691  C  CG    . ARG C 3 27  ? -21.344 74.244 8.626  1.00 25.79  ? 27  ARG A CG    1 
ATOM   692  C  CD    . ARG C 3 27  ? -22.820 74.552 8.731  1.00 27.56  ? 27  ARG A CD    1 
ATOM   693  N  NE    . ARG C 3 27  ? -23.258 75.370 7.604  1.00 29.23  ? 27  ARG A NE    1 
ATOM   694  C  CZ    . ARG C 3 27  ? -24.461 75.930 7.501  1.00 31.62  ? 27  ARG A CZ    1 
ATOM   695  N  NH1   . ARG C 3 27  ? -25.366 75.764 8.458  1.00 31.00  ? 27  ARG A NH1   1 
ATOM   696  N  NH2   . ARG C 3 27  ? -24.756 76.674 6.444  1.00 33.06  ? 27  ARG A NH2   1 
ATOM   697  N  N     . ILE C 3 28  ? -17.825 73.031 11.457 1.00 23.39  ? 28  ILE A N     1 
ATOM   698  C  CA    . ILE C 3 28  ? -17.123 72.520 12.628 1.00 22.33  ? 28  ILE A CA    1 
ATOM   699  C  C     . ILE C 3 28  ? -17.345 73.426 13.841 1.00 23.03  ? 28  ILE A C     1 
ATOM   700  O  O     . ILE C 3 28  ? -17.080 74.621 13.778 1.00 24.18  ? 28  ILE A O     1 
ATOM   701  C  CB    . ILE C 3 28  ? -15.613 72.420 12.314 1.00 22.26  ? 28  ILE A CB    1 
ATOM   702  C  CG1   . ILE C 3 28  ? -15.422 71.553 11.063 1.00 22.93  ? 28  ILE A CG1   1 
ATOM   703  C  CG2   . ILE C 3 28  ? -14.852 71.827 13.508 1.00 20.18  ? 28  ILE A CG2   1 
ATOM   704  C  CD1   . ILE C 3 28  ? -14.115 71.795 10.316 1.00 24.24  ? 28  ILE A CD1   1 
ATOM   705  N  N     . PHE C 3 29  ? -17.830 72.854 14.941 1.00 21.49  ? 29  PHE A N     1 
ATOM   706  C  CA    . PHE C 3 29  ? -18.089 73.634 16.146 1.00 21.66  ? 29  PHE A CA    1 
ATOM   707  C  C     . PHE C 3 29  ? -17.066 73.375 17.260 1.00 23.48  ? 29  PHE A C     1 
ATOM   708  O  O     . PHE C 3 29  ? -17.085 74.042 18.301 1.00 23.09  ? 29  PHE A O     1 
ATOM   709  C  CB    . PHE C 3 29  ? -19.516 73.363 16.614 1.00 20.49  ? 29  PHE A CB    1 
ATOM   710  C  CG    . PHE C 3 29  ? -20.516 73.426 15.499 1.00 23.14  ? 29  PHE A CG    1 
ATOM   711  C  CD1   . PHE C 3 29  ? -20.745 74.624 14.822 1.00 21.85  ? 29  PHE A CD1   1 
ATOM   712  C  CD2   . PHE C 3 29  ? -21.153 72.270 15.049 1.00 22.44  ? 29  PHE A CD2   1 
ATOM   713  C  CE1   . PHE C 3 29  ? -21.585 74.664 13.714 1.00 22.54  ? 29  PHE A CE1   1 
ATOM   714  C  CE2   . PHE C 3 29  ? -21.998 72.304 13.936 1.00 22.66  ? 29  PHE A CE2   1 
ATOM   715  C  CZ    . PHE C 3 29  ? -22.211 73.501 13.269 1.00 20.52  ? 29  PHE A CZ    1 
ATOM   716  N  N     . TRP C 3 30  ? -16.186 72.400 17.037 1.00 20.98  ? 30  TRP A N     1 
ATOM   717  C  CA    . TRP C 3 30  ? -15.112 72.083 17.975 1.00 22.58  ? 30  TRP A CA    1 
ATOM   718  C  C     . TRP C 3 30  ? -13.902 71.682 17.121 1.00 21.38  ? 30  TRP A C     1 
ATOM   719  O  O     . TRP C 3 30  ? -13.661 70.504 16.882 1.00 21.29  ? 30  TRP A O     1 
ATOM   720  C  CB    . TRP C 3 30  ? -15.510 70.936 18.926 1.00 22.30  ? 30  TRP A CB    1 
ATOM   721  C  CG    . TRP C 3 30  ? -14.572 70.832 20.107 1.00 22.53  ? 30  TRP A CG    1 
ATOM   722  C  CD1   . TRP C 3 30  ? -13.664 69.839 20.357 1.00 24.41  ? 30  TRP A CD1   1 
ATOM   723  C  CD2   . TRP C 3 30  ? -14.367 71.825 21.123 1.00 23.27  ? 30  TRP A CD2   1 
ATOM   724  N  NE1   . TRP C 3 30  ? -12.899 70.159 21.461 1.00 23.32  ? 30  TRP A NE1   1 
ATOM   725  C  CE2   . TRP C 3 30  ? -13.310 71.372 21.948 1.00 24.23  ? 30  TRP A CE2   1 
ATOM   726  C  CE3   . TRP C 3 30  ? -14.970 73.060 21.412 1.00 24.65  ? 30  TRP A CE3   1 
ATOM   727  C  CZ2   . TRP C 3 30  ? -12.842 72.111 23.043 1.00 23.54  ? 30  TRP A CZ2   1 
ATOM   728  C  CZ3   . TRP C 3 30  ? -14.504 73.797 22.503 1.00 24.41  ? 30  TRP A CZ3   1 
ATOM   729  C  CH2   . TRP C 3 30  ? -13.449 73.316 23.303 1.00 24.29  ? 30  TRP A CH2   1 
ATOM   730  N  N     . PRO C 3 31  ? -13.135 72.674 16.640 1.00 22.99  ? 31  PRO A N     1 
ATOM   731  C  CA    . PRO C 3 31  ? -11.942 72.501 15.795 1.00 23.67  ? 31  PRO A CA    1 
ATOM   732  C  C     . PRO C 3 31  ? -10.945 71.424 16.234 1.00 24.31  ? 31  PRO A C     1 
ATOM   733  O  O     . PRO C 3 31  ? -10.358 70.719 15.404 1.00 24.14  ? 31  PRO A O     1 
ATOM   734  C  CB    . PRO C 3 31  ? -11.315 73.897 15.798 1.00 24.10  ? 31  PRO A CB    1 
ATOM   735  C  CG    . PRO C 3 31  ? -12.504 74.792 15.912 1.00 24.77  ? 31  PRO A CG    1 
ATOM   736  C  CD    . PRO C 3 31  ? -13.326 74.097 16.977 1.00 23.20  ? 31  PRO A CD    1 
ATOM   737  N  N     . ASN C 3 32  ? -10.758 71.304 17.538 1.00 23.49  ? 32  ASN A N     1 
ATOM   738  C  CA    . ASN C 3 32  ? -9.832  70.334 18.097 1.00 26.36  ? 32  ASN A CA    1 
ATOM   739  C  C     . ASN C 3 32  ? -10.055 68.911 17.577 1.00 25.05  ? 32  ASN A C     1 
ATOM   740  O  O     . ASN C 3 32  ? -9.126  68.097 17.576 1.00 23.26  ? 32  ASN A O     1 
ATOM   741  C  CB    . ASN C 3 32  ? -9.921  70.378 19.624 1.00 29.99  ? 32  ASN A CB    1 
ATOM   742  C  CG    . ASN C 3 32  ? -9.885  71.812 20.168 1.00 36.94  ? 32  ASN A CG    1 
ATOM   743  O  OD1   . ASN C 3 32  ? -10.736 72.651 19.819 1.00 37.67  ? 32  ASN A OD1   1 
ATOM   744  N  ND2   . ASN C 3 32  ? -8.906  72.097 21.022 1.00 36.53  ? 32  ASN A ND2   1 
ATOM   745  N  N     . ILE C 3 33  ? -11.274 68.605 17.131 1.00 22.87  ? 33  ILE A N     1 
ATOM   746  C  CA    . ILE C 3 33  ? -11.556 67.269 16.610 1.00 21.78  ? 33  ILE A CA    1 
ATOM   747  C  C     . ILE C 3 33  ? -10.800 67.040 15.302 1.00 21.43  ? 33  ILE A C     1 
ATOM   748  O  O     . ILE C 3 33  ? -10.415 65.913 14.993 1.00 21.96  ? 33  ILE A O     1 
ATOM   749  C  CB    . ILE C 3 33  ? -13.074 67.053 16.371 1.00 22.60  ? 33  ILE A CB    1 
ATOM   750  C  CG1   . ILE C 3 33  ? -13.809 67.021 17.712 1.00 21.19  ? 33  ILE A CG1   1 
ATOM   751  C  CG2   . ILE C 3 33  ? -13.311 65.756 15.616 1.00 19.48  ? 33  ILE A CG2   1 
ATOM   752  C  CD1   . ILE C 3 33  ? -15.288 66.834 17.591 1.00 23.21  ? 33  ILE A CD1   1 
ATOM   753  N  N     . ILE C 3 34  ? -10.580 68.121 14.553 1.00 20.15  ? 34  ILE A N     1 
ATOM   754  C  CA    . ILE C 3 34  ? -9.870  68.075 13.273 1.00 20.20  ? 34  ILE A CA    1 
ATOM   755  C  C     . ILE C 3 34  ? -8.351  67.990 13.497 1.00 21.54  ? 34  ILE A C     1 
ATOM   756  O  O     . ILE C 3 34  ? -7.728  68.945 13.973 1.00 20.34  ? 34  ILE A O     1 
ATOM   757  C  CB    . ILE C 3 34  ? -10.169 69.342 12.434 1.00 21.01  ? 34  ILE A CB    1 
ATOM   758  C  CG1   . ILE C 3 34  ? -11.680 69.602 12.382 1.00 21.48  ? 34  ILE A CG1   1 
ATOM   759  C  CG2   . ILE C 3 34  ? -9.585  69.199 11.050 1.00 21.08  ? 34  ILE A CG2   1 
ATOM   760  C  CD1   . ILE C 3 34  ? -12.495 68.482 11.789 1.00 22.67  ? 34  ILE A CD1   1 
ATOM   761  N  N     . ARG C 3 35  ? -7.753  66.856 13.144 1.00 22.28  ? 35  ARG A N     1 
ATOM   762  C  CA    . ARG C 3 35  ? -6.319  66.672 13.337 1.00 23.60  ? 35  ARG A CA    1 
ATOM   763  C  C     . ARG C 3 35  ? -5.506  66.886 12.061 1.00 24.89  ? 35  ARG A C     1 
ATOM   764  O  O     . ARG C 3 35  ? -4.347  67.300 12.118 1.00 25.82  ? 35  ARG A O     1 
ATOM   765  C  CB    . ARG C 3 35  ? -6.043  65.280 13.921 1.00 22.73  ? 35  ARG A CB    1 
ATOM   766  C  CG    . ARG C 3 35  ? -6.781  65.011 15.245 1.00 27.16  ? 35  ARG A CG    1 
ATOM   767  C  CD    . ARG C 3 35  ? -6.479  66.086 16.282 1.00 26.48  ? 35  ARG A CD    1 
ATOM   768  N  NE    . ARG C 3 35  ? -7.239  65.911 17.519 1.00 31.15  ? 35  ARG A NE    1 
ATOM   769  C  CZ    . ARG C 3 35  ? -6.951  65.025 18.473 1.00 31.30  ? 35  ARG A CZ    1 
ATOM   770  N  NH1   . ARG C 3 35  ? -5.906  64.216 18.348 1.00 30.42  ? 35  ARG A NH1   1 
ATOM   771  N  NH2   . ARG C 3 35  ? -7.715  64.946 19.556 1.00 30.69  ? 35  ARG A NH2   1 
ATOM   772  N  N     . HIS C 3 36  ? -6.100  66.600 10.910 1.00 25.47  ? 36  HIS A N     1 
ATOM   773  C  CA    . HIS C 3 36  ? -5.390  66.806 9.659  1.00 26.81  ? 36  HIS A CA    1 
ATOM   774  C  C     . HIS C 3 36  ? -6.304  66.960 8.453  1.00 26.32  ? 36  HIS A C     1 
ATOM   775  O  O     . HIS C 3 36  ? -7.179  66.131 8.217  1.00 26.68  ? 36  HIS A O     1 
ATOM   776  C  CB    . HIS C 3 36  ? -4.391  65.675 9.394  1.00 26.35  ? 36  HIS A CB    1 
ATOM   777  C  CG    . HIS C 3 36  ? -3.550  65.900 8.175  1.00 30.21  ? 36  HIS A CG    1 
ATOM   778  N  ND1   . HIS C 3 36  ? -4.032  65.731 6.894  1.00 31.21  ? 36  HIS A ND1   1 
ATOM   779  C  CD2   . HIS C 3 36  ? -2.280  66.352 8.039  1.00 30.74  ? 36  HIS A CD2   1 
ATOM   780  C  CE1   . HIS C 3 36  ? -3.097  66.069 6.023  1.00 29.91  ? 36  HIS A CE1   1 
ATOM   781  N  NE2   . HIS C 3 36  ? -2.024  66.450 6.693  1.00 29.90  ? 36  HIS A NE2   1 
ATOM   782  N  N     . PRO C 3 37  ? -6.147  68.068 7.711  1.00 26.80  ? 37  PRO A N     1 
ATOM   783  C  CA    . PRO C 3 37  ? -5.155  69.106 8.034  1.00 27.37  ? 37  PRO A CA    1 
ATOM   784  C  C     . PRO C 3 37  ? -5.521  69.820 9.339  1.00 28.31  ? 37  PRO A C     1 
ATOM   785  O  O     . PRO C 3 37  ? -6.698  69.954 9.666  1.00 28.52  ? 37  PRO A O     1 
ATOM   786  C  CB    . PRO C 3 37  ? -5.200  70.032 6.812  1.00 27.03  ? 37  PRO A CB    1 
ATOM   787  C  CG    . PRO C 3 37  ? -6.554  69.761 6.194  1.00 27.56  ? 37  PRO A CG    1 
ATOM   788  C  CD    . PRO C 3 37  ? -6.703  68.273 6.362  1.00 25.58  ? 37  PRO A CD    1 
ATOM   789  N  N     . ARG C 3 38  ? -4.520  70.272 10.088 1.00 30.24  ? 38  ARG A N     1 
ATOM   790  C  CA    . ARG C 3 38  ? -4.784  70.936 11.363 1.00 31.96  ? 38  ARG A CA    1 
ATOM   791  C  C     . ARG C 3 38  ? -5.695  72.155 11.234 1.00 31.09  ? 38  ARG A C     1 
ATOM   792  O  O     . ARG C 3 38  ? -6.554  72.384 12.088 1.00 31.89  ? 38  ARG A O     1 
ATOM   793  C  CB    . ARG C 3 38  ? -3.474  71.336 12.047 1.00 36.03  ? 38  ARG A CB    1 
ATOM   794  C  CG    . ARG C 3 38  ? -3.669  71.752 13.503 1.00 39.66  ? 38  ARG A CG    1 
ATOM   795  C  CD    . ARG C 3 38  ? -4.349  70.638 14.305 1.00 43.67  ? 38  ARG A CD    1 
ATOM   796  N  NE    . ARG C 3 38  ? -4.774  71.078 15.633 1.00 46.15  ? 38  ARG A NE    1 
ATOM   797  C  CZ    . ARG C 3 38  ? -5.321  70.282 16.548 1.00 48.97  ? 38  ARG A CZ    1 
ATOM   798  N  NH1   . ARG C 3 38  ? -5.513  68.995 16.287 1.00 50.37  ? 38  ARG A NH1   1 
ATOM   799  N  NH2   . ARG C 3 38  ? -5.681  70.771 17.727 1.00 50.56  ? 38  ARG A NH2   1 
ATOM   800  N  N     . ASP C 3 39  ? -5.508  72.939 10.177 1.00 29.87  ? 39  ASP A N     1 
ATOM   801  C  CA    . ASP C 3 39  ? -6.353  74.107 9.946  1.00 27.93  ? 39  ASP A CA    1 
ATOM   802  C  C     . ASP C 3 39  ? -7.727  73.578 9.526  1.00 27.65  ? 39  ASP A C     1 
ATOM   803  O  O     . ASP C 3 39  ? -7.900  73.073 8.410  1.00 25.55  ? 39  ASP A O     1 
ATOM   804  C  CB    . ASP C 3 39  ? -5.756  74.981 8.841  1.00 29.21  ? 39  ASP A CB    1 
ATOM   805  C  CG    . ASP C 3 39  ? -6.576  76.232 8.578  1.00 32.21  ? 39  ASP A CG    1 
ATOM   806  O  OD1   . ASP C 3 39  ? -6.136  77.072 7.764  1.00 33.37  ? 39  ASP A OD1   1 
ATOM   807  O  OD2   . ASP C 3 39  ? -7.661  76.378 9.181  1.00 35.35  ? 39  ASP A OD2   1 
ATOM   808  N  N     . SER C 3 40  ? -8.697  73.686 10.430 1.00 27.50  ? 40  SER A N     1 
ATOM   809  C  CA    . SER C 3 40  ? -10.050 73.194 10.177 1.00 26.53  ? 40  SER A CA    1 
ATOM   810  C  C     . SER C 3 40  ? -10.718 73.803 8.946  1.00 25.67  ? 40  SER A C     1 
ATOM   811  O  O     . SER C 3 40  ? -11.585 73.177 8.330  1.00 24.28  ? 40  SER A O     1 
ATOM   812  C  CB    . SER C 3 40  ? -10.933 73.429 11.403 1.00 27.25  ? 40  SER A CB    1 
ATOM   813  O  OG    . SER C 3 40  ? -11.225 74.803 11.560 1.00 32.77  ? 40  SER A OG    1 
ATOM   814  N  N     . GLU C 3 41  ? -10.327 75.019 8.581  1.00 24.73  ? 41  GLU A N     1 
ATOM   815  C  CA    . GLU C 3 41  ? -10.921 75.656 7.409  1.00 24.75  ? 41  GLU A CA    1 
ATOM   816  C  C     . GLU C 3 41  ? -10.463 74.981 6.116  1.00 22.41  ? 41  GLU A C     1 
ATOM   817  O  O     . GLU C 3 41  ? -11.188 74.977 5.127  1.00 21.68  ? 41  GLU A O     1 
ATOM   818  C  CB    . GLU C 3 41  ? -10.577 77.146 7.381  1.00 28.65  ? 41  GLU A CB    1 
ATOM   819  C  CG    . GLU C 3 41  ? -11.092 77.901 8.598  1.00 35.75  ? 41  GLU A CG    1 
ATOM   820  C  CD    . GLU C 3 41  ? -11.036 79.404 8.425  1.00 40.82  ? 41  GLU A CD    1 
ATOM   821  O  OE1   . GLU C 3 41  ? -9.919  79.970 8.370  1.00 43.43  ? 41  GLU A OE1   1 
ATOM   822  O  OE2   . GLU C 3 41  ? -12.121 80.020 8.339  1.00 44.76  ? 41  GLU A OE2   1 
ATOM   823  N  N     . ALA C 3 42  ? -9.258  74.412 6.133  1.00 20.60  ? 42  ALA A N     1 
ATOM   824  C  CA    . ALA C 3 42  ? -8.708  73.718 4.970  1.00 19.64  ? 42  ALA A CA    1 
ATOM   825  C  C     . ALA C 3 42  ? -9.412  72.371 4.878  1.00 18.71  ? 42  ALA A C     1 
ATOM   826  O  O     . ALA C 3 42  ? -9.780  71.906 3.796  1.00 20.59  ? 42  ALA A O     1 
ATOM   827  C  CB    . ALA C 3 42  ? -7.208  73.516 5.142  1.00 18.55  ? 42  ALA A CB    1 
ATOM   828  N  N     . PHE C 3 43  ? -9.589  71.761 6.041  1.00 17.61  ? 43  PHE A N     1 
ATOM   829  C  CA    . PHE C 3 43  ? -10.264 70.480 6.189  1.00 16.78  ? 43  PHE A CA    1 
ATOM   830  C  C     . PHE C 3 43  ? -11.655 70.586 5.561  1.00 15.98  ? 43  PHE A C     1 
ATOM   831  O  O     . PHE C 3 43  ? -12.066 69.750 4.749  1.00 14.97  ? 43  PHE A O     1 
ATOM   832  C  CB    . PHE C 3 43  ? -10.381 70.172 7.684  1.00 18.08  ? 43  PHE A CB    1 
ATOM   833  C  CG    . PHE C 3 43  ? -11.181 68.945 8.005  1.00 19.03  ? 43  PHE A CG    1 
ATOM   834  C  CD1   . PHE C 3 43  ? -10.550 67.728 8.222  1.00 17.26  ? 43  PHE A CD1   1 
ATOM   835  C  CD2   . PHE C 3 43  ? -12.565 69.021 8.152  1.00 19.62  ? 43  PHE A CD2   1 
ATOM   836  C  CE1   . PHE C 3 43  ? -11.281 66.605 8.590  1.00 19.43  ? 43  PHE A CE1   1 
ATOM   837  C  CE2   . PHE C 3 43  ? -13.307 67.903 8.519  1.00 19.87  ? 43  PHE A CE2   1 
ATOM   838  C  CZ    . PHE C 3 43  ? -12.665 66.693 8.740  1.00 18.55  ? 43  PHE A CZ    1 
ATOM   839  N  N     . ALA C 3 44  ? -12.370 71.632 5.946  1.00 13.41  ? 44  ALA A N     1 
ATOM   840  C  CA    . ALA C 3 44  ? -13.716 71.878 5.450  1.00 16.46  ? 44  ALA A CA    1 
ATOM   841  C  C     . ALA C 3 44  ? -13.736 72.185 3.952  1.00 17.31  ? 44  ALA A C     1 
ATOM   842  O  O     . ALA C 3 44  ? -14.482 71.571 3.189  1.00 17.35  ? 44  ALA A O     1 
ATOM   843  C  CB    . ALA C 3 44  ? -14.345 73.046 6.228  1.00 15.56  ? 44  ALA A CB    1 
ATOM   844  N  N     . ALA C 3 45  ? -12.905 73.134 3.534  1.00 16.50  ? 45  ALA A N     1 
ATOM   845  C  CA    . ALA C 3 45  ? -12.860 73.539 2.137  1.00 17.11  ? 45  ALA A CA    1 
ATOM   846  C  C     . ALA C 3 45  ? -12.542 72.415 1.153  1.00 17.59  ? 45  ALA A C     1 
ATOM   847  O  O     . ALA C 3 45  ? -13.207 72.291 0.127  1.00 18.14  ? 45  ALA A O     1 
ATOM   848  C  CB    . ALA C 3 45  ? -11.850 74.691 1.960  1.00 15.62  ? 45  ALA A CB    1 
ATOM   849  N  N     . ARG C 3 46  ? -11.541 71.593 1.465  1.00 16.89  ? 46  ARG A N     1 
ATOM   850  C  CA    . ARG C 3 46  ? -11.138 70.523 0.548  1.00 17.38  ? 46  ARG A CA    1 
ATOM   851  C  C     . ARG C 3 46  ? -12.214 69.489 0.258  1.00 17.66  ? 46  ARG A C     1 
ATOM   852  O  O     . ARG C 3 46  ? -12.227 68.896 -0.812 1.00 18.82  ? 46  ARG A O     1 
ATOM   853  C  CB    . ARG C 3 46  ? -9.880  69.806 1.063  1.00 15.09  ? 46  ARG A CB    1 
ATOM   854  C  CG    . ARG C 3 46  ? -10.122 68.838 2.225  1.00 15.42  ? 46  ARG A CG    1 
ATOM   855  C  CD    . ARG C 3 46  ? -8.809  68.261 2.744  1.00 14.79  ? 46  ARG A CD    1 
ATOM   856  N  NE    . ARG C 3 46  ? -8.207  67.283 1.834  1.00 16.46  ? 46  ARG A NE    1 
ATOM   857  C  CZ    . ARG C 3 46  ? -6.903  67.216 1.567  1.00 17.50  ? 46  ARG A CZ    1 
ATOM   858  N  NH1   . ARG C 3 46  ? -6.070  68.081 2.128  1.00 12.40  ? 46  ARG A NH1   1 
ATOM   859  N  NH2   . ARG C 3 46  ? -6.423  66.262 0.767  1.00 14.58  ? 46  ARG A NH2   1 
ATOM   860  N  N     . MET C 3 47  ? -13.122 69.268 1.199  1.00 18.75  ? 47  MET A N     1 
ATOM   861  C  CA    . MET C 3 47  ? -14.149 68.269 0.973  1.00 20.26  ? 47  MET A CA    1 
ATOM   862  C  C     . MET C 3 47  ? -15.372 68.747 0.211  1.00 19.86  ? 47  MET A C     1 
ATOM   863  O  O     . MET C 3 47  ? -16.094 67.937 -0.361 1.00 17.54  ? 47  MET A O     1 
ATOM   864  C  CB    . MET C 3 47  ? -14.561 67.647 2.298  1.00 21.82  ? 47  MET A CB    1 
ATOM   865  C  CG    . MET C 3 47  ? -13.478 66.749 2.860  1.00 22.95  ? 47  MET A CG    1 
ATOM   866  S  SD    . MET C 3 47  ? -14.079 65.885 4.277  1.00 26.13  ? 47  MET A SD    1 
ATOM   867  C  CE    . MET C 3 47  ? -13.901 67.153 5.489  1.00 21.00  ? 47  MET A CE    1 
ATOM   868  N  N     . ILE C 3 48  ? -15.599 70.057 0.195  1.00 21.30  ? 48  ILE A N     1 
ATOM   869  C  CA    . ILE C 3 48  ? -16.739 70.620 -0.520 1.00 22.28  ? 48  ILE A CA    1 
ATOM   870  C  C     . ILE C 3 48  ? -16.650 70.236 -1.992 1.00 22.35  ? 48  ILE A C     1 
ATOM   871  O  O     . ILE C 3 48  ? -15.609 70.406 -2.621 1.00 22.24  ? 48  ILE A O     1 
ATOM   872  C  CB    . ILE C 3 48  ? -16.773 72.167 -0.381 1.00 24.33  ? 48  ILE A CB    1 
ATOM   873  C  CG1   . ILE C 3 48  ? -17.231 72.542 1.034  1.00 23.63  ? 48  ILE A CG1   1 
ATOM   874  C  CG2   . ILE C 3 48  ? -17.696 72.779 -1.436 1.00 22.26  ? 48  ILE A CG2   1 
ATOM   875  C  CD1   . ILE C 3 48  ? -17.306 74.030 1.289  1.00 22.98  ? 48  ILE A CD1   1 
ATOM   876  N  N     . GLY C 3 49  ? -17.739 69.705 -2.537 1.00 22.24  ? 49  GLY A N     1 
ATOM   877  C  CA    . GLY C 3 49  ? -17.735 69.314 -3.939 1.00 21.70  ? 49  GLY A CA    1 
ATOM   878  C  C     . GLY C 3 49  ? -17.460 67.838 -4.173 1.00 21.50  ? 49  GLY A C     1 
ATOM   879  O  O     . GLY C 3 49  ? -17.763 67.307 -5.243 1.00 21.86  ? 49  GLY A O     1 
ATOM   880  N  N     . GLN C 3 50  ? -16.883 67.171 -3.179 1.00 20.09  ? 50  GLN A N     1 
ATOM   881  C  CA    . GLN C 3 50  ? -16.589 65.750 -3.288 1.00 19.02  ? 50  GLN A CA    1 
ATOM   882  C  C     . GLN C 3 50  ? -17.817 64.908 -2.960 1.00 21.00  ? 50  GLN A C     1 
ATOM   883  O  O     . GLN C 3 50  ? -18.670 65.312 -2.162 1.00 23.25  ? 50  GLN A O     1 
ATOM   884  C  CB    . GLN C 3 50  ? -15.448 65.372 -2.354 1.00 17.54  ? 50  GLN A CB    1 
ATOM   885  C  CG    . GLN C 3 50  ? -14.124 66.017 -2.715 1.00 19.06  ? 50  GLN A CG    1 
ATOM   886  C  CD    . GLN C 3 50  ? -12.960 65.377 -1.993 1.00 18.67  ? 50  GLN A CD    1 
ATOM   887  O  OE1   . GLN C 3 50  ? -12.733 64.169 -2.109 1.00 18.65  ? 50  GLN A OE1   1 
ATOM   888  N  NE2   . GLN C 3 50  ? -12.215 66.179 -1.243 1.00 16.36  ? 50  GLN A NE2   1 
ATOM   889  N  N     . THR C 3 51  ? -17.901 63.734 -3.577 1.00 18.97  ? 51  THR A N     1 
ATOM   890  C  CA    . THR C 3 51  ? -19.025 62.830 -3.364 1.00 20.29  ? 51  THR A CA    1 
ATOM   891  C  C     . THR C 3 51  ? -18.609 61.594 -2.572 1.00 20.57  ? 51  THR A C     1 
ATOM   892  O  O     . THR C 3 51  ? -17.492 61.091 -2.731 1.00 20.94  ? 51  THR A O     1 
ATOM   893  C  CB    . THR C 3 51  ? -19.614 62.380 -4.722 1.00 19.61  ? 51  THR A CB    1 
ATOM   894  O  OG1   . THR C 3 51  ? -20.137 63.520 -5.406 1.00 22.31  ? 51  THR A OG1   1 
ATOM   895  C  CG2   . THR C 3 51  ? -20.720 61.361 -4.529 1.00 20.25  ? 51  THR A CG2   1 
ATOM   896  N  N     . VAL C 3 52  ? -19.503 61.111 -1.714 1.00 21.03  ? 52  VAL A N     1 
ATOM   897  C  CA    . VAL C 3 52  ? -19.223 59.913 -0.927 1.00 19.78  ? 52  VAL A CA    1 
ATOM   898  C  C     . VAL C 3 52  ? -19.377 58.703 -1.860 1.00 21.56  ? 52  VAL A C     1 
ATOM   899  O  O     . VAL C 3 52  ? -20.459 58.466 -2.409 1.00 20.99  ? 52  VAL A O     1 
ATOM   900  C  CB    . VAL C 3 52  ? -20.216 59.763 0.250  1.00 20.79  ? 52  VAL A CB    1 
ATOM   901  C  CG1   . VAL C 3 52  ? -19.805 58.594 1.133  1.00 18.42  ? 52  VAL A CG1   1 
ATOM   902  C  CG2   . VAL C 3 52  ? -20.271 61.050 1.060  1.00 20.50  ? 52  VAL A CG2   1 
ATOM   903  N  N     . ARG C 3 53  ? -18.296 57.952 -2.051 1.00 22.17  ? 53  ARG A N     1 
ATOM   904  C  CA    . ARG C 3 53  ? -18.324 56.776 -2.923 1.00 23.24  ? 53  ARG A CA    1 
ATOM   905  C  C     . ARG C 3 53  ? -18.361 55.484 -2.111 1.00 23.99  ? 53  ARG A C     1 
ATOM   906  O  O     . ARG C 3 53  ? -18.803 54.444 -2.607 1.00 23.57  ? 53  ARG A O     1 
ATOM   907  C  CB    . ARG C 3 53  ? -17.089 56.745 -3.830 1.00 22.23  ? 53  ARG A CB    1 
ATOM   908  C  CG    . ARG C 3 53  ? -16.825 58.018 -4.586 1.00 22.37  ? 53  ARG A CG    1 
ATOM   909  C  CD    . ARG C 3 53  ? -17.915 58.330 -5.585 1.00 25.42  ? 53  ARG A CD    1 
ATOM   910  N  NE    . ARG C 3 53  ? -17.568 59.527 -6.347 1.00 29.57  ? 53  ARG A NE    1 
ATOM   911  C  CZ    . ARG C 3 53  ? -18.357 60.111 -7.241 1.00 28.07  ? 53  ARG A CZ    1 
ATOM   912  N  NH1   . ARG C 3 53  ? -19.560 59.612 -7.507 1.00 26.15  ? 53  ARG A NH1   1 
ATOM   913  N  NH2   . ARG C 3 53  ? -17.945 61.212 -7.853 1.00 27.05  ? 53  ARG A NH2   1 
ATOM   914  N  N     . GLY C 3 54  ? -17.882 55.547 -0.870 1.00 23.55  ? 54  GLY A N     1 
ATOM   915  C  CA    . GLY C 3 54  ? -17.880 54.358 -0.035 1.00 21.77  ? 54  GLY A CA    1 
ATOM   916  C  C     . GLY C 3 54  ? -17.552 54.599 1.427  1.00 21.90  ? 54  GLY A C     1 
ATOM   917  O  O     . GLY C 3 54  ? -17.143 55.691 1.829  1.00 20.15  ? 54  GLY A O     1 
ATOM   918  N  N     . LEU C 3 55  ? -17.737 53.560 2.230  1.00 22.87  ? 55  LEU A N     1 
ATOM   919  C  CA    . LEU C 3 55  ? -17.468 53.642 3.656  1.00 22.57  ? 55  LEU A CA    1 
ATOM   920  C  C     . LEU C 3 55  ? -16.853 52.327 4.104  1.00 23.09  ? 55  LEU A C     1 
ATOM   921  O  O     . LEU C 3 55  ? -17.493 51.275 4.079  1.00 21.27  ? 55  LEU A O     1 
ATOM   922  C  CB    . LEU C 3 55  ? -18.759 53.912 4.430  1.00 21.05  ? 55  LEU A CB    1 
ATOM   923  C  CG    . LEU C 3 55  ? -18.634 54.217 5.928  1.00 23.47  ? 55  LEU A CG    1 
ATOM   924  C  CD1   . LEU C 3 55  ? -17.723 55.413 6.144  1.00 25.50  ? 55  LEU A CD1   1 
ATOM   925  C  CD2   . LEU C 3 55  ? -20.013 54.504 6.507  1.00 23.13  ? 55  LEU A CD2   1 
ATOM   926  N  N     . GLU C 3 56  ? -15.594 52.403 4.510  1.00 23.16  ? 56  GLU A N     1 
ATOM   927  C  CA    . GLU C 3 56  ? -14.870 51.232 4.950  1.00 22.56  ? 56  GLU A CA    1 
ATOM   928  C  C     . GLU C 3 56  ? -14.470 51.367 6.405  1.00 22.04  ? 56  GLU A C     1 
ATOM   929  O  O     . GLU C 3 56  ? -14.622 52.427 7.011  1.00 22.82  ? 56  GLU A O     1 
ATOM   930  C  CB    . GLU C 3 56  ? -13.628 51.039 4.076  1.00 22.04  ? 56  GLU A CB    1 
ATOM   931  C  CG    . GLU C 3 56  ? -13.949 50.660 2.637  1.00 25.63  ? 56  GLU A CG    1 
ATOM   932  C  CD    . GLU C 3 56  ? -12.713 50.593 1.750  1.00 28.42  ? 56  GLU A CD    1 
ATOM   933  O  OE1   . GLU C 3 56  ? -12.846 50.180 0.585  1.00 33.65  ? 56  GLU A OE1   1 
ATOM   934  O  OE2   . GLU C 3 56  ? -11.612 50.957 2.206  1.00 29.20  ? 56  GLU A OE2   1 
ATOM   935  N  N     . ARG C 3 57  ? -13.973 50.275 6.964  1.00 20.45  ? 57  ARG A N     1 
ATOM   936  C  CA    . ARG C 3 57  ? -13.523 50.260 8.341  1.00 21.17  ? 57  ARG A CA    1 
ATOM   937  C  C     . ARG C 3 57  ? -12.148 49.609 8.406  1.00 20.32  ? 57  ARG A C     1 
ATOM   938  O  O     . ARG C 3 57  ? -11.883 48.632 7.713  1.00 20.86  ? 57  ARG A O     1 
ATOM   939  C  CB    . ARG C 3 57  ? -14.487 49.459 9.233  1.00 19.83  ? 57  ARG A CB    1 
ATOM   940  C  CG    . ARG C 3 57  ? -13.980 49.307 10.672 1.00 20.10  ? 57  ARG A CG    1 
ATOM   941  C  CD    . ARG C 3 57  ? -14.732 48.240 11.464 1.00 20.79  ? 57  ARG A CD    1 
ATOM   942  N  NE    . ARG C 3 57  ? -14.554 46.916 10.879 1.00 21.08  ? 57  ARG A NE    1 
ATOM   943  C  CZ    . ARG C 3 57  ? -13.382 46.299 10.759 1.00 22.28  ? 57  ARG A CZ    1 
ATOM   944  N  NH1   . ARG C 3 57  ? -13.322 45.098 10.204 1.00 21.51  ? 57  ARG A NH1   1 
ATOM   945  N  NH2   . ARG C 3 57  ? -12.272 46.877 11.202 1.00 22.98  ? 57  ARG A NH2   1 
ATOM   946  N  N     . ARG C 3 58  ? -11.278 50.170 9.235  1.00 20.37  ? 58  ARG A N     1 
ATOM   947  C  CA    . ARG C 3 58  ? -9.947  49.629 9.452  1.00 20.70  ? 58  ARG A CA    1 
ATOM   948  C  C     . ARG C 3 58  ? -9.769  49.727 10.962 1.00 20.45  ? 58  ARG A C     1 
ATOM   949  O  O     . ARG C 3 58  ? -9.661  50.825 11.507 1.00 21.35  ? 58  ARG A O     1 
ATOM   950  C  CB    . ARG C 3 58  ? -8.882  50.459 8.732  1.00 19.21  ? 58  ARG A CB    1 
ATOM   951  C  CG    . ARG C 3 58  ? -7.455  49.930 8.929  1.00 20.12  ? 58  ARG A CG    1 
ATOM   952  C  CD    . ARG C 3 58  ? -7.183  48.638 8.139  1.00 20.35  ? 58  ARG A CD    1 
ATOM   953  N  NE    . ARG C 3 58  ? -5.793  48.210 8.296  1.00 20.22  ? 58  ARG A NE    1 
ATOM   954  C  CZ    . ARG C 3 58  ? -5.348  47.435 9.285  1.00 25.61  ? 58  ARG A CZ    1 
ATOM   955  N  NH1   . ARG C 3 58  ? -6.184  46.976 10.215 1.00 21.96  ? 58  ARG A NH1   1 
ATOM   956  N  NH2   . ARG C 3 58  ? -4.052  47.144 9.371  1.00 24.17  ? 58  ARG A NH2   1 
ATOM   957  N  N     . GLY C 3 59  ? -9.757  48.580 11.637 1.00 18.84  ? 59  GLY A N     1 
ATOM   958  C  CA    . GLY C 3 59  ? -9.625  48.587 13.079 1.00 17.94  ? 59  GLY A CA    1 
ATOM   959  C  C     . GLY C 3 59  ? -10.856 49.234 13.697 1.00 18.46  ? 59  GLY A C     1 
ATOM   960  O  O     . GLY C 3 59  ? -11.982 48.780 13.477 1.00 16.34  ? 59  GLY A O     1 
ATOM   961  N  N     . LYS C 3 60  ? -10.644 50.303 14.458 1.00 17.08  ? 60  LYS A N     1 
ATOM   962  C  CA    . LYS C 3 60  ? -11.737 51.017 15.105 1.00 17.32  ? 60  LYS A CA    1 
ATOM   963  C  C     . LYS C 3 60  ? -12.010 52.320 14.357 1.00 19.18  ? 60  LYS A C     1 
ATOM   964  O  O     . LYS C 3 60  ? -12.789 53.150 14.814 1.00 19.19  ? 60  LYS A O     1 
ATOM   965  C  CB    . LYS C 3 60  ? -11.373 51.343 16.555 1.00 18.48  ? 60  LYS A CB    1 
ATOM   966  C  CG    . LYS C 3 60  ? -10.999 50.127 17.399 1.00 17.49  ? 60  LYS A CG    1 
ATOM   967  C  CD    . LYS C 3 60  ? -10.605 50.515 18.819 1.00 13.24  ? 60  LYS A CD    1 
ATOM   968  C  CE    . LYS C 3 60  ? -10.280 49.261 19.634 1.00 14.18  ? 60  LYS A CE    1 
ATOM   969  N  NZ    . LYS C 3 60  ? -9.828  49.584 21.006 1.00 15.33  ? 60  LYS A NZ    1 
ATOM   970  N  N     . PHE C 3 61  ? -11.359 52.497 13.209 1.00 18.10  ? 61  PHE A N     1 
ATOM   971  C  CA    . PHE C 3 61  ? -11.531 53.706 12.421 1.00 17.18  ? 61  PHE A CA    1 
ATOM   972  C  C     . PHE C 3 61  ? -12.511 53.537 11.274 1.00 16.95  ? 61  PHE A C     1 
ATOM   973  O  O     . PHE C 3 61  ? -12.575 52.483 10.651 1.00 15.42  ? 61  PHE A O     1 
ATOM   974  C  CB    . PHE C 3 61  ? -10.197 54.166 11.823 1.00 16.26  ? 61  PHE A CB    1 
ATOM   975  C  CG    . PHE C 3 61  ? -9.157  54.538 12.838 1.00 17.34  ? 61  PHE A CG    1 
ATOM   976  C  CD1   . PHE C 3 61  ? -8.390  53.559 13.460 1.00 18.65  ? 61  PHE A CD1   1 
ATOM   977  C  CD2   . PHE C 3 61  ? -8.928  55.876 13.158 1.00 16.91  ? 61  PHE A CD2   1 
ATOM   978  C  CE1   . PHE C 3 61  ? -7.402  53.909 14.386 1.00 17.54  ? 61  PHE A CE1   1 
ATOM   979  C  CE2   . PHE C 3 61  ? -7.946  56.236 14.081 1.00 18.34  ? 61  PHE A CE2   1 
ATOM   980  C  CZ    . PHE C 3 61  ? -7.179  55.251 14.697 1.00 16.80  ? 61  PHE A CZ    1 
ATOM   981  N  N     . LEU C 3 62  ? -13.285 54.584 11.007 1.00 18.38  ? 62  LEU A N     1 
ATOM   982  C  CA    . LEU C 3 62  ? -14.206 54.570 9.883  1.00 19.66  ? 62  LEU A CA    1 
ATOM   983  C  C     . LEU C 3 62  ? -13.421 55.236 8.761  1.00 20.75  ? 62  LEU A C     1 
ATOM   984  O  O     . LEU C 3 62  ? -12.638 56.158 9.003  1.00 21.42  ? 62  LEU A O     1 
ATOM   985  C  CB    . LEU C 3 62  ? -15.470 55.375 10.183 1.00 18.40  ? 62  LEU A CB    1 
ATOM   986  C  CG    . LEU C 3 62  ? -16.560 54.653 10.983 1.00 20.38  ? 62  LEU A CG    1 
ATOM   987  C  CD1   . LEU C 3 62  ? -17.657 55.632 11.391 1.00 18.79  ? 62  LEU A CD1   1 
ATOM   988  C  CD2   . LEU C 3 62  ? -17.130 53.522 10.142 1.00 17.84  ? 62  LEU A CD2   1 
ATOM   989  N  N     . LYS C 3 63  ? -13.613 54.765 7.540  1.00 20.50  ? 63  LYS A N     1 
ATOM   990  C  CA    . LYS C 3 63  ? -12.909 55.343 6.409  1.00 21.27  ? 63  LYS A CA    1 
ATOM   991  C  C     . LYS C 3 63  ? -13.886 55.738 5.305  1.00 20.10  ? 63  LYS A C     1 
ATOM   992  O  O     . LYS C 3 63  ? -14.319 54.897 4.507  1.00 17.59  ? 63  LYS A O     1 
ATOM   993  C  CB    . LYS C 3 63  ? -11.880 54.345 5.878  1.00 22.74  ? 63  LYS A CB    1 
ATOM   994  C  CG    . LYS C 3 63  ? -10.935 54.913 4.842  1.00 27.17  ? 63  LYS A CG    1 
ATOM   995  C  CD    . LYS C 3 63  ? -9.915  53.853 4.451  1.00 31.32  ? 63  LYS A CD    1 
ATOM   996  C  CE    . LYS C 3 63  ? -8.894  54.380 3.474  1.00 31.06  ? 63  LYS A CE    1 
ATOM   997  N  NZ    . LYS C 3 63  ? -8.013  53.281 2.986  1.00 31.73  ? 63  LYS A NZ    1 
ATOM   998  N  N     . PHE C 3 64  ? -14.232 57.023 5.278  1.00 19.19  ? 64  PHE A N     1 
ATOM   999  C  CA    . PHE C 3 64  ? -15.149 57.565 4.281  1.00 19.02  ? 64  PHE A CA    1 
ATOM   1000 C  C     . PHE C 3 64  ? -14.376 57.763 2.999  1.00 18.70  ? 64  PHE A C     1 
ATOM   1001 O  O     . PHE C 3 64  ? -13.387 58.493 2.974  1.00 18.32  ? 64  PHE A O     1 
ATOM   1002 C  CB    . PHE C 3 64  ? -15.706 58.920 4.730  1.00 18.68  ? 64  PHE A CB    1 
ATOM   1003 C  CG    . PHE C 3 64  ? -16.569 58.857 5.960  1.00 19.97  ? 64  PHE A CG    1 
ATOM   1004 C  CD1   . PHE C 3 64  ? -17.959 58.908 5.855  1.00 19.24  ? 64  PHE A CD1   1 
ATOM   1005 C  CD2   . PHE C 3 64  ? -15.995 58.781 7.225  1.00 16.70  ? 64  PHE A CD2   1 
ATOM   1006 C  CE1   . PHE C 3 64  ? -18.763 58.887 6.992  1.00 18.12  ? 64  PHE A CE1   1 
ATOM   1007 C  CE2   . PHE C 3 64  ? -16.788 58.760 8.369  1.00 18.32  ? 64  PHE A CE2   1 
ATOM   1008 C  CZ    . PHE C 3 64  ? -18.178 58.813 8.253  1.00 18.67  ? 64  PHE A CZ    1 
ATOM   1009 N  N     . LEU C 3 65  ? -14.818 57.103 1.935  1.00 19.48  ? 65  LEU A N     1 
ATOM   1010 C  CA    . LEU C 3 65  ? -14.154 57.230 0.646  1.00 20.13  ? 65  LEU A CA    1 
ATOM   1011 C  C     . LEU C 3 65  ? -14.919 58.247 -0.182 1.00 18.90  ? 65  LEU A C     1 
ATOM   1012 O  O     . LEU C 3 65  ? -16.085 58.041 -0.520 1.00 19.81  ? 65  LEU A O     1 
ATOM   1013 C  CB    . LEU C 3 65  ? -14.114 55.872 -0.072 1.00 21.69  ? 65  LEU A CB    1 
ATOM   1014 C  CG    . LEU C 3 65  ? -13.296 54.772 0.620  1.00 21.79  ? 65  LEU A CG    1 
ATOM   1015 C  CD1   . LEU C 3 65  ? -13.441 53.473 -0.139 1.00 24.45  ? 65  LEU A CD1   1 
ATOM   1016 C  CD2   . LEU C 3 65  ? -11.829 55.180 0.695  1.00 21.83  ? 65  LEU A CD2   1 
ATOM   1017 N  N     . LEU C 3 66  ? -14.260 59.356 -0.489 1.00 19.70  ? 66  LEU A N     1 
ATOM   1018 C  CA    . LEU C 3 66  ? -14.866 60.423 -1.272 1.00 19.00  ? 66  LEU A CA    1 
ATOM   1019 C  C     . LEU C 3 66  ? -14.351 60.301 -2.706 1.00 20.45  ? 66  LEU A C     1 
ATOM   1020 O  O     . LEU C 3 66  ? -14.287 59.199 -3.237 1.00 22.10  ? 66  LEU A O     1 
ATOM   1021 C  CB    . LEU C 3 66  ? -14.492 61.775 -0.661 1.00 18.31  ? 66  LEU A CB    1 
ATOM   1022 C  CG    . LEU C 3 66  ? -14.722 61.918 0.852  1.00 19.10  ? 66  LEU A CG    1 
ATOM   1023 C  CD1   . LEU C 3 66  ? -14.359 63.326 1.280  1.00 19.79  ? 66  LEU A CD1   1 
ATOM   1024 C  CD2   . LEU C 3 66  ? -16.170 61.626 1.212  1.00 18.05  ? 66  LEU A CD2   1 
ATOM   1025 N  N     . ASP C 3 67  ? -13.996 61.415 -3.339 1.00 22.60  ? 67  ASP A N     1 
ATOM   1026 C  CA    . ASP C 3 67  ? -13.468 61.366 -4.699 1.00 23.29  ? 67  ASP A CA    1 
ATOM   1027 C  C     . ASP C 3 67  ? -11.957 61.231 -4.627 1.00 23.69  ? 67  ASP A C     1 
ATOM   1028 O  O     . ASP C 3 67  ? -11.402 60.170 -4.890 1.00 25.70  ? 67  ASP A O     1 
ATOM   1029 C  CB    . ASP C 3 67  ? -13.822 62.636 -5.474 1.00 25.98  ? 67  ASP A CB    1 
ATOM   1030 C  CG    . ASP C 3 67  ? -15.286 62.712 -5.822 1.00 26.81  ? 67  ASP A CG    1 
ATOM   1031 O  OD1   . ASP C 3 67  ? -15.806 61.754 -6.430 1.00 31.30  ? 67  ASP A OD1   1 
ATOM   1032 O  OD2   . ASP C 3 67  ? -15.918 63.733 -5.495 1.00 32.79  ? 67  ASP A OD2   1 
ATOM   1033 N  N     . ARG C 3 68  ? -11.296 62.317 -4.258 1.00 23.77  ? 68  ARG A N     1 
ATOM   1034 C  CA    . ARG C 3 68  ? -9.848  62.330 -4.132 1.00 23.96  ? 68  ARG A CA    1 
ATOM   1035 C  C     . ARG C 3 68  ? -9.405  61.947 -2.716 1.00 23.89  ? 68  ARG A C     1 
ATOM   1036 O  O     . ARG C 3 68  ? -8.401  61.252 -2.533 1.00 24.34  ? 68  ARG A O     1 
ATOM   1037 C  CB    . ARG C 3 68  ? -9.321  63.725 -4.479 1.00 24.59  ? 68  ARG A CB    1 
ATOM   1038 C  CG    . ARG C 3 68  ? -7.861  63.962 -4.108 1.00 29.39  ? 68  ARG A CG    1 
ATOM   1039 C  CD    . ARG C 3 68  ? -7.750  65.195 -3.244 1.00 30.76  ? 68  ARG A CD    1 
ATOM   1040 N  NE    . ARG C 3 68  ? -8.326  66.341 -3.931 1.00 38.42  ? 68  ARG A NE    1 
ATOM   1041 C  CZ    . ARG C 3 68  ? -8.956  67.347 -3.331 1.00 40.04  ? 68  ARG A CZ    1 
ATOM   1042 N  NH1   . ARG C 3 68  ? -9.108  67.363 -2.010 1.00 35.61  ? 68  ARG A NH1   1 
ATOM   1043 N  NH2   . ARG C 3 68  ? -9.428  68.344 -4.066 1.00 41.05  ? 68  ARG A NH2   1 
ATOM   1044 N  N     . ASP C 3 69  ? -10.172 62.381 -1.720 1.00 21.88  ? 69  ASP A N     1 
ATOM   1045 C  CA    . ASP C 3 69  ? -9.829  62.123 -0.327 1.00 19.67  ? 69  ASP A CA    1 
ATOM   1046 C  C     . ASP C 3 69  ? -10.538 60.977 0.385  1.00 18.78  ? 69  ASP A C     1 
ATOM   1047 O  O     . ASP C 3 69  ? -11.545 60.443 -0.066 1.00 17.23  ? 69  ASP A O     1 
ATOM   1048 C  CB    . ASP C 3 69  ? -10.054 63.383 0.520  1.00 20.29  ? 69  ASP A CB    1 
ATOM   1049 C  CG    . ASP C 3 69  ? -9.273  64.583 0.021  1.00 19.42  ? 69  ASP A CG    1 
ATOM   1050 O  OD1   . ASP C 3 69  ? -8.116  64.406 -0.407 1.00 20.15  ? 69  ASP A OD1   1 
ATOM   1051 O  OD2   . ASP C 3 69  ? -9.818  65.708 0.083  1.00 17.78  ? 69  ASP A OD2   1 
ATOM   1052 N  N     . ALA C 3 70  ? -9.975  60.627 1.532  1.00 18.14  ? 70  ALA A N     1 
ATOM   1053 C  CA    . ALA C 3 70  ? -10.512 59.604 2.402  1.00 17.62  ? 70  ALA A CA    1 
ATOM   1054 C  C     . ALA C 3 70  ? -10.577 60.317 3.742  1.00 18.15  ? 70  ALA A C     1 
ATOM   1055 O  O     . ALA C 3 70  ? -9.596  60.939 4.157  1.00 18.14  ? 70  ALA A O     1 
ATOM   1056 C  CB    . ALA C 3 70  ? -9.560  58.416 2.484  1.00 17.67  ? 70  ALA A CB    1 
ATOM   1057 N  N     . LEU C 3 71  ? -11.735 60.270 4.392  1.00 18.31  ? 71  LEU A N     1 
ATOM   1058 C  CA    . LEU C 3 71  ? -11.894 60.888 5.702  1.00 17.77  ? 71  LEU A CA    1 
ATOM   1059 C  C     . LEU C 3 71  ? -11.794 59.784 6.745  1.00 18.27  ? 71  LEU A C     1 
ATOM   1060 O  O     . LEU C 3 71  ? -12.665 58.924 6.823  1.00 18.27  ? 71  LEU A O     1 
ATOM   1061 C  CB    . LEU C 3 71  ? -13.253 61.573 5.818  1.00 18.95  ? 71  LEU A CB    1 
ATOM   1062 C  CG    . LEU C 3 71  ? -13.755 61.850 7.242  1.00 20.40  ? 71  LEU A CG    1 
ATOM   1063 C  CD1   . LEU C 3 71  ? -12.847 62.842 7.959  1.00 18.02  ? 71  LEU A CD1   1 
ATOM   1064 C  CD2   . LEU C 3 71  ? -15.174 62.393 7.167  1.00 24.27  ? 71  LEU A CD2   1 
ATOM   1065 N  N     . ILE C 3 72  ? -10.724 59.806 7.533  1.00 18.68  ? 72  ILE A N     1 
ATOM   1066 C  CA    . ILE C 3 72  ? -10.511 58.811 8.576  1.00 17.85  ? 72  ILE A CA    1 
ATOM   1067 C  C     . ILE C 3 72  ? -11.108 59.356 9.866  1.00 19.25  ? 72  ILE A C     1 
ATOM   1068 O  O     . ILE C 3 72  ? -10.700 60.416 10.350 1.00 21.28  ? 72  ILE A O     1 
ATOM   1069 C  CB    . ILE C 3 72  ? -8.996  58.513 8.765  1.00 15.31  ? 72  ILE A CB    1 
ATOM   1070 C  CG1   . ILE C 3 72  ? -8.443  57.784 7.538  1.00 17.68  ? 72  ILE A CG1   1 
ATOM   1071 C  CG2   . ILE C 3 72  ? -8.780  57.605 9.967  1.00 13.97  ? 72  ILE A CG2   1 
ATOM   1072 C  CD1   . ILE C 3 72  ? -8.558  58.543 6.239  1.00 23.15  ? 72  ILE A CD1   1 
ATOM   1073 N  N     . SER C 3 73  ? -12.077 58.633 10.421 1.00 17.81  ? 73  SER A N     1 
ATOM   1074 C  CA    . SER C 3 73  ? -12.747 59.073 11.638 1.00 17.80  ? 73  SER A CA    1 
ATOM   1075 C  C     . SER C 3 73  ? -12.678 58.076 12.792 1.00 19.55  ? 73  SER A C     1 
ATOM   1076 O  O     . SER C 3 73  ? -12.971 56.887 12.631 1.00 19.25  ? 73  SER A O     1 
ATOM   1077 C  CB    . SER C 3 73  ? -14.216 59.389 11.331 1.00 17.33  ? 73  SER A CB    1 
ATOM   1078 O  OG    . SER C 3 73  ? -14.939 59.697 12.511 1.00 18.82  ? 73  SER A OG    1 
ATOM   1079 N  N     . HIS C 3 74  ? -12.287 58.573 13.959 1.00 19.45  ? 74  HIS A N     1 
ATOM   1080 C  CA    . HIS C 3 74  ? -12.198 57.741 15.145 1.00 19.94  ? 74  HIS A CA    1 
ATOM   1081 C  C     . HIS C 3 74  ? -13.203 58.262 16.161 1.00 19.79  ? 74  HIS A C     1 
ATOM   1082 O  O     . HIS C 3 74  ? -13.143 59.417 16.571 1.00 20.57  ? 74  HIS A O     1 
ATOM   1083 C  CB    . HIS C 3 74  ? -10.787 57.777 15.731 1.00 20.44  ? 74  HIS A CB    1 
ATOM   1084 C  CG    . HIS C 3 74  ? -10.528 56.685 16.722 1.00 27.53  ? 74  HIS A CG    1 
ATOM   1085 N  ND1   . HIS C 3 74  ? -9.474  55.805 16.603 1.00 30.44  ? 74  HIS A ND1   1 
ATOM   1086 C  CD2   . HIS C 3 74  ? -11.211 56.304 17.827 1.00 28.48  ? 74  HIS A CD2   1 
ATOM   1087 C  CE1   . HIS C 3 74  ? -9.522  54.928 17.590 1.00 30.29  ? 74  HIS A CE1   1 
ATOM   1088 N  NE2   . HIS C 3 74  ? -10.567 55.208 18.346 1.00 29.12  ? 74  HIS A NE2   1 
ATOM   1089 N  N     . LEU C 3 75  ? -14.129 57.397 16.554 1.00 20.36  ? 75  LEU A N     1 
ATOM   1090 C  CA    . LEU C 3 75  ? -15.178 57.738 17.507 1.00 20.69  ? 75  LEU A CA    1 
ATOM   1091 C  C     . LEU C 3 75  ? -14.720 57.807 18.961 1.00 21.02  ? 75  LEU A C     1 
ATOM   1092 O  O     . LEU C 3 75  ? -15.395 58.408 19.795 1.00 19.41  ? 75  LEU A O     1 
ATOM   1093 C  CB    . LEU C 3 75  ? -16.310 56.712 17.410 1.00 20.03  ? 75  LEU A CB    1 
ATOM   1094 C  CG    . LEU C 3 75  ? -17.388 56.770 16.326 1.00 22.77  ? 75  LEU A CG    1 
ATOM   1095 C  CD1   . LEU C 3 75  ? -16.910 57.459 15.057 1.00 22.15  ? 75  LEU A CD1   1 
ATOM   1096 C  CD2   . LEU C 3 75  ? -17.822 55.341 16.057 1.00 20.20  ? 75  LEU A CD2   1 
ATOM   1097 N  N     . ARG C 3 76  ? -13.585 57.191 19.269 1.00 21.30  ? 76  ARG A N     1 
ATOM   1098 C  CA    . ARG C 3 76  ? -13.088 57.165 20.646 1.00 23.47  ? 76  ARG A CA    1 
ATOM   1099 C  C     . ARG C 3 76  ? -14.163 56.572 21.561 1.00 22.82  ? 76  ARG A C     1 
ATOM   1100 O  O     . ARG C 3 76  ? -14.730 55.527 21.247 1.00 23.90  ? 76  ARG A O     1 
ATOM   1101 C  CB    . ARG C 3 76  ? -12.723 58.567 21.133 1.00 24.22  ? 76  ARG A CB    1 
ATOM   1102 C  CG    . ARG C 3 76  ? -11.985 58.579 22.476 1.00 25.54  ? 76  ARG A CG    1 
ATOM   1103 C  CD    . ARG C 3 76  ? -10.582 58.113 22.290 1.00 31.11  ? 76  ARG A CD    1 
ATOM   1104 N  NE    . ARG C 3 76  ? -10.123 58.477 20.957 1.00 36.21  ? 76  ARG A NE    1 
ATOM   1105 C  CZ    . ARG C 3 76  ? -8.873  58.367 20.536 1.00 40.96  ? 76  ARG A CZ    1 
ATOM   1106 N  NH1   . ARG C 3 76  ? -7.934  57.898 21.349 1.00 42.96  ? 76  ARG A NH1   1 
ATOM   1107 N  NH2   . ARG C 3 76  ? -8.566  58.728 19.295 1.00 44.73  ? 76  ARG A NH2   1 
ATOM   1108 N  N     . MET C 3 77  ? -14.458 57.245 22.673 1.00 23.21  ? 77  MET A N     1 
ATOM   1109 C  CA    . MET C 3 77  ? -15.450 56.758 23.638 1.00 24.96  ? 77  MET A CA    1 
ATOM   1110 C  C     . MET C 3 77  ? -16.917 57.097 23.380 1.00 24.66  ? 77  MET A C     1 
ATOM   1111 O  O     . MET C 3 77  ? -17.789 56.275 23.642 1.00 25.40  ? 77  MET A O     1 
ATOM   1112 C  CB    . MET C 3 77  ? -15.123 57.257 25.053 1.00 24.35  ? 77  MET A CB    1 
ATOM   1113 C  CG    . MET C 3 77  ? -13.840 56.722 25.675 1.00 26.20  ? 77  MET A CG    1 
ATOM   1114 S  SD    . MET C 3 77  ? -13.796 54.934 25.873 1.00 26.50  ? 77  MET A SD    1 
ATOM   1115 C  CE    . MET C 3 77  ? -15.186 54.649 26.944 1.00 24.28  ? 77  MET A CE    1 
ATOM   1116 N  N     . GLU C 3 78  ? -17.194 58.296 22.877 1.00 24.69  ? 78  GLU A N     1 
ATOM   1117 C  CA    . GLU C 3 78  ? -18.578 58.723 22.681 1.00 24.91  ? 78  GLU A CA    1 
ATOM   1118 C  C     . GLU C 3 78  ? -18.993 59.215 21.295 1.00 24.19  ? 78  GLU A C     1 
ATOM   1119 O  O     . GLU C 3 78  ? -20.135 59.638 21.115 1.00 22.41  ? 78  GLU A O     1 
ATOM   1120 C  CB    . GLU C 3 78  ? -18.896 59.831 23.684 1.00 24.97  ? 78  GLU A CB    1 
ATOM   1121 C  CG    . GLU C 3 78  ? -18.603 59.481 25.133 1.00 27.31  ? 78  GLU A CG    1 
ATOM   1122 C  CD    . GLU C 3 78  ? -19.456 58.345 25.637 1.00 27.71  ? 78  GLU A CD    1 
ATOM   1123 O  OE1   . GLU C 3 78  ? -20.648 58.296 25.266 1.00 27.67  ? 78  GLU A OE1   1 
ATOM   1124 O  OE2   . GLU C 3 78  ? -18.942 57.512 26.412 1.00 29.12  ? 78  GLU A OE2   1 
ATOM   1125 N  N     . GLY C 3 79  ? -18.078 59.181 20.333 1.00 23.23  ? 79  GLY A N     1 
ATOM   1126 C  CA    . GLY C 3 79  ? -18.402 59.644 18.994 1.00 23.40  ? 79  GLY A CA    1 
ATOM   1127 C  C     . GLY C 3 79  ? -19.502 58.823 18.344 1.00 23.73  ? 79  GLY A C     1 
ATOM   1128 O  O     . GLY C 3 79  ? -19.427 57.597 18.323 1.00 24.61  ? 79  GLY A O     1 
ATOM   1129 N  N     . ARG C 3 80  ? -20.517 59.504 17.813 1.00 22.11  ? 80  ARG A N     1 
ATOM   1130 C  CA    . ARG C 3 80  ? -21.658 58.864 17.159 1.00 23.74  ? 80  ARG A CA    1 
ATOM   1131 C  C     . ARG C 3 80  ? -22.059 59.641 15.900 1.00 22.86  ? 80  ARG A C     1 
ATOM   1132 O  O     . ARG C 3 80  ? -21.884 60.860 15.824 1.00 22.45  ? 80  ARG A O     1 
ATOM   1133 C  CB    . ARG C 3 80  ? -22.872 58.817 18.111 1.00 26.38  ? 80  ARG A CB    1 
ATOM   1134 C  CG    . ARG C 3 80  ? -22.980 57.584 19.020 1.00 32.88  ? 80  ARG A CG    1 
ATOM   1135 C  CD    . ARG C 3 80  ? -21.679 57.302 19.749 1.00 35.50  ? 80  ARG A CD    1 
ATOM   1136 N  NE    . ARG C 3 80  ? -21.797 56.377 20.874 1.00 37.14  ? 80  ARG A NE    1 
ATOM   1137 C  CZ    . ARG C 3 80  ? -20.747 55.905 21.539 1.00 36.80  ? 80  ARG A CZ    1 
ATOM   1138 N  NH1   . ARG C 3 80  ? -19.529 56.270 21.170 1.00 37.22  ? 80  ARG A NH1   1 
ATOM   1139 N  NH2   . ARG C 3 80  ? -20.905 55.102 22.586 1.00 34.95  ? 80  ARG A NH2   1 
ATOM   1140 N  N     . TYR C 3 81  ? -22.599 58.926 14.919 1.00 19.62  ? 81  TYR A N     1 
ATOM   1141 C  CA    . TYR C 3 81  ? -23.050 59.540 13.679 1.00 18.38  ? 81  TYR A CA    1 
ATOM   1142 C  C     . TYR C 3 81  ? -24.550 59.352 13.510 1.00 19.46  ? 81  TYR A C     1 
ATOM   1143 O  O     . TYR C 3 81  ? -25.159 58.452 14.098 1.00 17.45  ? 81  TYR A O     1 
ATOM   1144 C  CB    . TYR C 3 81  ? -22.344 58.927 12.462 1.00 18.66  ? 81  TYR A CB    1 
ATOM   1145 C  CG    . TYR C 3 81  ? -20.955 59.461 12.200 1.00 16.34  ? 81  TYR A CG    1 
ATOM   1146 C  CD1   . TYR C 3 81  ? -19.819 58.742 12.575 1.00 16.25  ? 81  TYR A CD1   1 
ATOM   1147 C  CD2   . TYR C 3 81  ? -20.778 60.690 11.569 1.00 16.52  ? 81  TYR A CD2   1 
ATOM   1148 C  CE1   . TYR C 3 81  ? -18.528 59.242 12.318 1.00 15.76  ? 81  TYR A CE1   1 
ATOM   1149 C  CE2   . TYR C 3 81  ? -19.506 61.199 11.310 1.00 17.04  ? 81  TYR A CE2   1 
ATOM   1150 C  CZ    . TYR C 3 81  ? -18.389 60.475 11.683 1.00 16.65  ? 81  TYR A CZ    1 
ATOM   1151 O  OH    . TYR C 3 81  ? -17.149 60.999 11.421 1.00 15.01  ? 81  TYR A OH    1 
ATOM   1152 N  N     . ALA C 3 82  ? -25.135 60.223 12.704 1.00 17.37  ? 82  ALA A N     1 
ATOM   1153 C  CA    . ALA C 3 82  ? -26.553 60.176 12.400 1.00 18.98  ? 82  ALA A CA    1 
ATOM   1154 C  C     . ALA C 3 82  ? -26.753 61.028 11.155 1.00 18.90  ? 82  ALA A C     1 
ATOM   1155 O  O     . ALA C 3 82  ? -25.996 61.974 10.910 1.00 16.65  ? 82  ALA A O     1 
ATOM   1156 C  CB    . ALA C 3 82  ? -27.380 60.733 13.570 1.00 15.91  ? 82  ALA A CB    1 
ATOM   1157 N  N     . VAL C 3 83  ? -27.759 60.672 10.365 1.00 19.87  ? 83  VAL A N     1 
ATOM   1158 C  CA    . VAL C 3 83  ? -28.089 61.402 9.153  1.00 18.39  ? 83  VAL A CA    1 
ATOM   1159 C  C     . VAL C 3 83  ? -29.466 62.004 9.372  1.00 20.30  ? 83  VAL A C     1 
ATOM   1160 O  O     . VAL C 3 83  ? -30.369 61.328 9.875  1.00 21.17  ? 83  VAL A O     1 
ATOM   1161 C  CB    . VAL C 3 83  ? -28.135 60.466 7.930  1.00 19.15  ? 83  VAL A CB    1 
ATOM   1162 C  CG1   . VAL C 3 83  ? -28.617 61.233 6.697  1.00 17.35  ? 83  VAL A CG1   1 
ATOM   1163 C  CG2   . VAL C 3 83  ? -26.753 59.879 7.683  1.00 18.50  ? 83  VAL A CG2   1 
ATOM   1164 N  N     . ALA C 3 84  ? -29.628 63.272 9.007  1.00 18.92  ? 84  ALA A N     1 
ATOM   1165 C  CA    . ALA C 3 84  ? -30.908 63.940 9.182  1.00 20.91  ? 84  ALA A CA    1 
ATOM   1166 C  C     . ALA C 3 84  ? -31.054 65.170 8.289  1.00 22.23  ? 84  ALA A C     1 
ATOM   1167 O  O     . ALA C 3 84  ? -30.142 65.530 7.551  1.00 22.61  ? 84  ALA A O     1 
ATOM   1168 C  CB    . ALA C 3 84  ? -31.088 64.332 10.649 1.00 20.73  ? 84  ALA A CB    1 
ATOM   1169 N  N     . SER C 3 85  ? -32.219 65.802 8.367  1.00 24.49  ? 85  SER A N     1 
ATOM   1170 C  CA    . SER C 3 85  ? -32.523 66.994 7.588  1.00 27.31  ? 85  SER A CA    1 
ATOM   1171 C  C     . SER C 3 85  ? -31.777 68.219 8.109  1.00 29.76  ? 85  SER A C     1 
ATOM   1172 O  O     . SER C 3 85  ? -31.809 68.518 9.302  1.00 28.67  ? 85  SER A O     1 
ATOM   1173 C  CB    . SER C 3 85  ? -34.022 67.272 7.630  1.00 25.91  ? 85  SER A CB    1 
ATOM   1174 O  OG    . SER C 3 85  ? -34.295 68.555 7.103  1.00 30.87  ? 85  SER A OG    1 
ATOM   1175 N  N     . ALA C 3 86  ? -31.118 68.932 7.201  1.00 33.31  ? 86  ALA A N     1 
ATOM   1176 C  CA    . ALA C 3 86  ? -30.359 70.127 7.561  1.00 35.98  ? 86  ALA A CA    1 
ATOM   1177 C  C     . ALA C 3 86  ? -31.282 71.268 7.983  1.00 37.24  ? 86  ALA A C     1 
ATOM   1178 O  O     . ALA C 3 86  ? -30.819 72.330 8.400  1.00 38.51  ? 86  ALA A O     1 
ATOM   1179 C  CB    . ALA C 3 86  ? -29.486 70.562 6.385  1.00 33.31  ? 86  ALA A CB    1 
ATOM   1180 N  N     . LEU C 3 87  ? -32.586 71.040 7.882  1.00 38.46  ? 87  LEU A N     1 
ATOM   1181 C  CA    . LEU C 3 87  ? -33.570 72.052 8.245  1.00 40.54  ? 87  LEU A CA    1 
ATOM   1182 C  C     . LEU C 3 87  ? -33.988 71.967 9.711  1.00 40.66  ? 87  LEU A C     1 
ATOM   1183 O  O     . LEU C 3 87  ? -34.614 72.885 10.238 1.00 40.24  ? 87  LEU A O     1 
ATOM   1184 C  CB    . LEU C 3 87  ? -34.808 71.925 7.347  1.00 40.87  ? 87  LEU A CB    1 
ATOM   1185 C  CG    . LEU C 3 87  ? -34.572 72.152 5.851  1.00 41.29  ? 87  LEU A CG    1 
ATOM   1186 C  CD1   . LEU C 3 87  ? -35.829 71.781 5.080  1.00 42.19  ? 87  LEU A CD1   1 
ATOM   1187 C  CD2   . LEU C 3 87  ? -34.177 73.605 5.600  1.00 39.57  ? 87  LEU A CD2   1 
ATOM   1188 N  N     . GLU C 3 88  ? -33.644 70.860 10.358 1.00 40.72  ? 88  GLU A N     1 
ATOM   1189 C  CA    . GLU C 3 88  ? -33.970 70.649 11.767 1.00 42.94  ? 88  GLU A CA    1 
ATOM   1190 C  C     . GLU C 3 88  ? -32.840 71.089 12.696 1.00 41.86  ? 88  GLU A C     1 
ATOM   1191 O  O     . GLU C 3 88  ? -31.668 71.047 12.321 1.00 40.59  ? 88  GLU A O     1 
ATOM   1192 C  CB    . GLU C 3 88  ? -34.244 69.167 12.030 1.00 44.40  ? 88  GLU A CB    1 
ATOM   1193 C  CG    . GLU C 3 88  ? -35.569 68.662 11.535 1.00 49.93  ? 88  GLU A CG    1 
ATOM   1194 C  CD    . GLU C 3 88  ? -35.634 67.149 11.558 1.00 54.61  ? 88  GLU A CD    1 
ATOM   1195 O  OE1   . GLU C 3 88  ? -35.119 66.542 12.528 1.00 54.58  ? 88  GLU A OE1   1 
ATOM   1196 O  OE2   . GLU C 3 88  ? -36.204 66.568 10.606 1.00 57.76  ? 88  GLU A OE2   1 
ATOM   1197 N  N     . PRO C 3 89  ? -33.182 71.523 13.925 1.00 42.14  ? 89  PRO A N     1 
ATOM   1198 C  CA    . PRO C 3 89  ? -32.162 71.953 14.892 1.00 40.80  ? 89  PRO A CA    1 
ATOM   1199 C  C     . PRO C 3 89  ? -31.290 70.751 15.280 1.00 40.04  ? 89  PRO A C     1 
ATOM   1200 O  O     . PRO C 3 89  ? -31.778 69.619 15.363 1.00 41.34  ? 89  PRO A O     1 
ATOM   1201 C  CB    . PRO C 3 89  ? -32.992 72.463 16.069 1.00 41.02  ? 89  PRO A CB    1 
ATOM   1202 C  CG    . PRO C 3 89  ? -34.242 72.976 15.398 1.00 42.53  ? 89  PRO A CG    1 
ATOM   1203 C  CD    . PRO C 3 89  ? -34.533 71.880 14.394 1.00 41.49  ? 89  PRO A CD    1 
ATOM   1204 N  N     . LEU C 3 90  ? -30.008 71.002 15.518 1.00 37.33  ? 90  LEU A N     1 
ATOM   1205 C  CA    . LEU C 3 90  ? -29.065 69.948 15.884 1.00 34.09  ? 90  LEU A CA    1 
ATOM   1206 C  C     . LEU C 3 90  ? -29.287 69.381 17.282 1.00 34.35  ? 90  LEU A C     1 
ATOM   1207 O  O     . LEU C 3 90  ? -29.951 69.992 18.115 1.00 35.47  ? 90  LEU A O     1 
ATOM   1208 C  CB    . LEU C 3 90  ? -27.639 70.487 15.785 1.00 30.30  ? 90  LEU A CB    1 
ATOM   1209 C  CG    . LEU C 3 90  ? -27.279 70.971 14.381 1.00 30.22  ? 90  LEU A CG    1 
ATOM   1210 C  CD1   . LEU C 3 90  ? -26.066 71.869 14.432 1.00 29.93  ? 90  LEU A CD1   1 
ATOM   1211 C  CD2   . LEU C 3 90  ? -27.047 69.766 13.476 1.00 26.16  ? 90  LEU A CD2   1 
ATOM   1212 N  N     . GLU C 3 91  ? -28.738 68.195 17.528 1.00 33.45  ? 91  GLU A N     1 
ATOM   1213 C  CA    . GLU C 3 91  ? -28.840 67.575 18.837 1.00 32.75  ? 91  GLU A CA    1 
ATOM   1214 C  C     . GLU C 3 91  ? -27.673 68.152 19.636 1.00 32.51  ? 91  GLU A C     1 
ATOM   1215 O  O     . GLU C 3 91  ? -26.737 68.710 19.065 1.00 31.60  ? 91  GLU A O     1 
ATOM   1216 C  CB    . GLU C 3 91  ? -28.707 66.054 18.731 1.00 32.37  ? 91  GLU A CB    1 
ATOM   1217 N  N     . PRO C 3 92  ? -27.720 68.046 20.969 1.00 32.30  ? 92  PRO A N     1 
ATOM   1218 C  CA    . PRO C 3 92  ? -26.620 68.589 21.775 1.00 30.26  ? 92  PRO A CA    1 
ATOM   1219 C  C     . PRO C 3 92  ? -25.299 67.844 21.573 1.00 26.94  ? 92  PRO A C     1 
ATOM   1220 O  O     . PRO C 3 92  ? -25.283 66.636 21.349 1.00 25.40  ? 92  PRO A O     1 
ATOM   1221 C  CB    . PRO C 3 92  ? -27.143 68.453 23.207 1.00 31.68  ? 92  PRO A CB    1 
ATOM   1222 C  CG    . PRO C 3 92  ? -28.643 68.522 23.029 1.00 33.26  ? 92  PRO A CG    1 
ATOM   1223 C  CD    . PRO C 3 92  ? -28.852 67.650 21.823 1.00 32.44  ? 92  PRO A CD    1 
ATOM   1224 N  N     . HIS C 3 93  ? -24.194 68.577 21.658 1.00 25.69  ? 93  HIS A N     1 
ATOM   1225 C  CA    . HIS C 3 93  ? -22.861 67.999 21.504 1.00 26.48  ? 93  HIS A CA    1 
ATOM   1226 C  C     . HIS C 3 93  ? -22.523 67.593 20.068 1.00 24.47  ? 93  HIS A C     1 
ATOM   1227 O  O     . HIS C 3 93  ? -21.716 66.695 19.844 1.00 25.36  ? 93  HIS A O     1 
ATOM   1228 C  CB    . HIS C 3 93  ? -22.694 66.802 22.452 1.00 26.90  ? 93  HIS A CB    1 
ATOM   1229 C  CG    . HIS C 3 93  ? -22.927 67.148 23.890 1.00 30.88  ? 93  HIS A CG    1 
ATOM   1230 N  ND1   . HIS C 3 93  ? -22.124 68.032 24.581 1.00 31.14  ? 93  HIS A ND1   1 
ATOM   1231 C  CD2   . HIS C 3 93  ? -23.902 66.774 24.752 1.00 31.29  ? 93  HIS A CD2   1 
ATOM   1232 C  CE1   . HIS C 3 93  ? -22.595 68.188 25.806 1.00 30.58  ? 93  HIS A CE1   1 
ATOM   1233 N  NE2   . HIS C 3 93  ? -23.674 67.437 25.935 1.00 31.26  ? 93  HIS A NE2   1 
ATOM   1234 N  N     . THR C 3 94  ? -23.149 68.257 19.102 1.00 22.94  ? 94  THR A N     1 
ATOM   1235 C  CA    . THR C 3 94  ? -22.881 67.997 17.690 1.00 22.24  ? 94  THR A CA    1 
ATOM   1236 C  C     . THR C 3 94  ? -21.690 68.894 17.354 1.00 22.03  ? 94  THR A C     1 
ATOM   1237 O  O     . THR C 3 94  ? -21.814 70.122 17.340 1.00 22.62  ? 94  THR A O     1 
ATOM   1238 C  CB    . THR C 3 94  ? -24.084 68.383 16.830 1.00 20.45  ? 94  THR A CB    1 
ATOM   1239 O  OG1   . THR C 3 94  ? -25.230 67.679 17.310 1.00 21.27  ? 94  THR A OG1   1 
ATOM   1240 C  CG2   . THR C 3 94  ? -23.845 68.027 15.363 1.00 16.72  ? 94  THR A CG2   1 
ATOM   1241 N  N     . HIS C 3 95  ? -20.539 68.290 17.084 1.00 19.49  ? 95  HIS A N     1 
ATOM   1242 C  CA    . HIS C 3 95  ? -19.349 69.088 16.831 1.00 19.44  ? 95  HIS A CA    1 
ATOM   1243 C  C     . HIS C 3 95  ? -18.917 69.265 15.392 1.00 19.09  ? 95  HIS A C     1 
ATOM   1244 O  O     . HIS C 3 95  ? -18.132 70.163 15.088 1.00 16.77  ? 95  HIS A O     1 
ATOM   1245 C  CB    . HIS C 3 95  ? -18.200 68.540 17.675 1.00 17.86  ? 95  HIS A CB    1 
ATOM   1246 C  CG    . HIS C 3 95  ? -18.519 68.501 19.136 1.00 18.15  ? 95  HIS A CG    1 
ATOM   1247 N  ND1   . HIS C 3 95  ? -19.066 69.578 19.800 1.00 17.19  ? 95  HIS A ND1   1 
ATOM   1248 C  CD2   . HIS C 3 95  ? -18.413 67.509 20.050 1.00 18.88  ? 95  HIS A CD2   1 
ATOM   1249 C  CE1   . HIS C 3 95  ? -19.287 69.250 21.060 1.00 19.25  ? 95  HIS A CE1   1 
ATOM   1250 N  NE2   . HIS C 3 95  ? -18.899 67.999 21.238 1.00 19.80  ? 95  HIS A NE2   1 
ATOM   1251 N  N     . VAL C 3 96  ? -19.426 68.409 14.512 1.00 18.91  ? 96  VAL A N     1 
ATOM   1252 C  CA    . VAL C 3 96  ? -19.110 68.491 13.098 1.00 16.87  ? 96  VAL A CA    1 
ATOM   1253 C  C     . VAL C 3 96  ? -20.342 68.053 12.320 1.00 20.00  ? 96  VAL A C     1 
ATOM   1254 O  O     . VAL C 3 96  ? -21.039 67.115 12.717 1.00 20.09  ? 96  VAL A O     1 
ATOM   1255 C  CB    . VAL C 3 96  ? -17.922 67.575 12.717 1.00 18.01  ? 96  VAL A CB    1 
ATOM   1256 C  CG1   . VAL C 3 96  ? -17.565 67.775 11.242 1.00 15.11  ? 96  VAL A CG1   1 
ATOM   1257 C  CG2   . VAL C 3 96  ? -16.713 67.876 13.600 1.00 11.84  ? 96  VAL A CG2   1 
ATOM   1258 N  N     . VAL C 3 97  ? -20.618 68.752 11.223 1.00 19.18  ? 97  VAL A N     1 
ATOM   1259 C  CA    . VAL C 3 97  ? -21.755 68.440 10.378 1.00 19.06  ? 97  VAL A CA    1 
ATOM   1260 C  C     . VAL C 3 97  ? -21.328 68.538 8.914  1.00 19.65  ? 97  VAL A C     1 
ATOM   1261 O  O     . VAL C 3 97  ? -20.660 69.492 8.510  1.00 17.86  ? 97  VAL A O     1 
ATOM   1262 C  CB    . VAL C 3 97  ? -22.935 69.434 10.610 1.00 23.74  ? 97  VAL A CB    1 
ATOM   1263 C  CG1   . VAL C 3 97  ? -24.172 68.949 9.877  1.00 26.20  ? 97  VAL A CG1   1 
ATOM   1264 C  CG2   . VAL C 3 97  ? -23.233 69.583 12.097 1.00 22.57  ? 97  VAL A CG2   1 
ATOM   1265 N  N     . PHE C 3 98  ? -21.691 67.533 8.127  1.00 19.38  ? 98  PHE A N     1 
ATOM   1266 C  CA    . PHE C 3 98  ? -21.379 67.540 6.704  1.00 19.87  ? 98  PHE A CA    1 
ATOM   1267 C  C     . PHE C 3 98  ? -22.718 67.731 6.000  1.00 19.47  ? 98  PHE A C     1 
ATOM   1268 O  O     . PHE C 3 98  ? -23.599 66.871 6.075  1.00 20.63  ? 98  PHE A O     1 
ATOM   1269 C  CB    . PHE C 3 98  ? -20.739 66.214 6.271  1.00 19.11  ? 98  PHE A CB    1 
ATOM   1270 C  CG    . PHE C 3 98  ? -19.491 65.854 7.035  1.00 18.07  ? 98  PHE A CG    1 
ATOM   1271 C  CD1   . PHE C 3 98  ? -19.572 65.317 8.318  1.00 15.70  ? 98  PHE A CD1   1 
ATOM   1272 C  CD2   . PHE C 3 98  ? -18.235 66.050 6.469  1.00 16.54  ? 98  PHE A CD2   1 
ATOM   1273 C  CE1   . PHE C 3 98  ? -18.420 64.982 9.020  1.00 17.49  ? 98  PHE A CE1   1 
ATOM   1274 C  CE2   . PHE C 3 98  ? -17.078 65.718 7.166  1.00 15.61  ? 98  PHE A CE2   1 
ATOM   1275 C  CZ    . PHE C 3 98  ? -17.166 65.185 8.440  1.00 15.15  ? 98  PHE A CZ    1 
ATOM   1276 N  N     . CYS C 3 99  ? -22.882 68.862 5.327  1.00 20.35  ? 99  CYS A N     1 
ATOM   1277 C  CA    . CYS C 3 99  ? -24.139 69.132 4.648  1.00 21.83  ? 99  CYS A CA    1 
ATOM   1278 C  C     . CYS C 3 99  ? -24.086 68.754 3.175  1.00 19.94  ? 99  CYS A C     1 
ATOM   1279 O  O     . CYS C 3 99  ? -23.209 69.195 2.436  1.00 20.47  ? 99  CYS A O     1 
ATOM   1280 C  CB    . CYS C 3 99  ? -24.528 70.602 4.804  1.00 25.09  ? 99  CYS A CB    1 
ATOM   1281 S  SG    . CYS C 3 99  ? -26.263 70.902 4.340  1.00 39.80  ? 99  CYS A SG    1 
ATOM   1282 N  N     . PHE C 3 100 ? -25.046 67.938 2.759  1.00 18.75  ? 100 PHE A N     1 
ATOM   1283 C  CA    . PHE C 3 100 ? -25.121 67.461 1.388  1.00 15.97  ? 100 PHE A CA    1 
ATOM   1284 C  C     . PHE C 3 100 ? -26.024 68.334 0.522  1.00 16.21  ? 100 PHE A C     1 
ATOM   1285 O  O     . PHE C 3 100 ? -26.887 69.039 1.031  1.00 17.01  ? 100 PHE A O     1 
ATOM   1286 C  CB    . PHE C 3 100 ? -25.620 66.020 1.392  1.00 14.02  ? 100 PHE A CB    1 
ATOM   1287 C  CG    . PHE C 3 100 ? -24.764 65.087 2.201  1.00 12.75  ? 100 PHE A CG    1 
ATOM   1288 C  CD1   . PHE C 3 100 ? -23.443 64.834 1.828  1.00 10.97  ? 100 PHE A CD1   1 
ATOM   1289 C  CD2   . PHE C 3 100 ? -25.281 64.446 3.324  1.00 11.01  ? 100 PHE A CD2   1 
ATOM   1290 C  CE1   . PHE C 3 100 ? -22.649 63.949 2.563  1.00 13.55  ? 100 PHE A CE1   1 
ATOM   1291 C  CE2   . PHE C 3 100 ? -24.503 63.557 4.070  1.00 12.50  ? 100 PHE A CE2   1 
ATOM   1292 C  CZ    . PHE C 3 100 ? -23.179 63.305 3.689  1.00 13.18  ? 100 PHE A CZ    1 
ATOM   1293 N  N     . THR C 3 101 ? -25.824 68.264 -0.790 1.00 15.77  ? 101 THR A N     1 
ATOM   1294 C  CA    . THR C 3 101 ? -26.586 69.060 -1.735 1.00 15.18  ? 101 THR A CA    1 
ATOM   1295 C  C     . THR C 3 101 ? -28.055 68.671 -1.857 1.00 16.95  ? 101 THR A C     1 
ATOM   1296 O  O     . THR C 3 101 ? -28.823 69.351 -2.547 1.00 17.64  ? 101 THR A O     1 
ATOM   1297 C  CB    . THR C 3 101 ? -25.967 68.991 -3.143 1.00 13.91  ? 101 THR A CB    1 
ATOM   1298 O  OG1   . THR C 3 101 ? -26.150 67.675 -3.672 1.00 14.45  ? 101 THR A OG1   1 
ATOM   1299 C  CG2   . THR C 3 101 ? -24.476 69.320 -3.098 1.00 8.39   ? 101 THR A CG2   1 
ATOM   1300 N  N     . ASP C 3 102 ? -28.460 67.588 -1.207 1.00 15.24  ? 102 ASP A N     1 
ATOM   1301 C  CA    . ASP C 3 102 ? -29.859 67.183 -1.295 1.00 15.79  ? 102 ASP A CA    1 
ATOM   1302 C  C     . ASP C 3 102 ? -30.633 67.663 -0.079 1.00 15.37  ? 102 ASP A C     1 
ATOM   1303 O  O     . ASP C 3 102 ? -31.804 67.328 0.094  1.00 16.09  ? 102 ASP A O     1 
ATOM   1304 C  CB    . ASP C 3 102 ? -29.982 65.662 -1.422 1.00 17.06  ? 102 ASP A CB    1 
ATOM   1305 C  CG    . ASP C 3 102 ? -29.571 64.938 -0.157 1.00 18.41  ? 102 ASP A CG    1 
ATOM   1306 O  OD1   . ASP C 3 102 ? -29.201 65.609 0.833  1.00 19.50  ? 102 ASP A OD1   1 
ATOM   1307 O  OD2   . ASP C 3 102 ? -29.618 63.693 -0.155 1.00 21.38  ? 102 ASP A OD2   1 
ATOM   1308 N  N     . GLY C 3 103 ? -29.968 68.440 0.771  1.00 15.43  ? 103 GLY A N     1 
ATOM   1309 C  CA    . GLY C 3 103 ? -30.622 68.974 1.948  1.00 14.45  ? 103 GLY A CA    1 
ATOM   1310 C  C     . GLY C 3 103 ? -30.447 68.147 3.203  1.00 16.16  ? 103 GLY A C     1 
ATOM   1311 O  O     . GLY C 3 103 ? -30.787 68.604 4.300  1.00 15.88  ? 103 GLY A O     1 
ATOM   1312 N  N     . SER C 3 104 ? -29.933 66.929 3.059  1.00 15.20  ? 104 SER A N     1 
ATOM   1313 C  CA    . SER C 3 104 ? -29.722 66.076 4.222  1.00 14.87  ? 104 SER A CA    1 
ATOM   1314 C  C     . SER C 3 104 ? -28.312 66.353 4.719  1.00 16.02  ? 104 SER A C     1 
ATOM   1315 O  O     . SER C 3 104 ? -27.533 67.021 4.036  1.00 15.35  ? 104 SER A O     1 
ATOM   1316 C  CB    . SER C 3 104 ? -29.866 64.598 3.848  1.00 13.77  ? 104 SER A CB    1 
ATOM   1317 O  OG    . SER C 3 104 ? -28.797 64.172 3.015  1.00 16.15  ? 104 SER A OG    1 
ATOM   1318 N  N     . GLU C 3 105 ? -27.986 65.847 5.905  1.00 18.29  ? 105 GLU A N     1 
ATOM   1319 C  CA    . GLU C 3 105 ? -26.663 66.061 6.474  1.00 21.63  ? 105 GLU A CA    1 
ATOM   1320 C  C     . GLU C 3 105 ? -26.195 64.941 7.388  1.00 20.99  ? 105 GLU A C     1 
ATOM   1321 O  O     . GLU C 3 105 ? -27.001 64.236 7.998  1.00 21.86  ? 105 GLU A O     1 
ATOM   1322 C  CB    . GLU C 3 105 ? -26.622 67.389 7.246  1.00 22.61  ? 105 GLU A CB    1 
ATOM   1323 C  CG    . GLU C 3 105 ? -27.748 67.572 8.226  1.00 29.84  ? 105 GLU A CG    1 
ATOM   1324 C  CD    . GLU C 3 105 ? -27.614 68.846 9.052  1.00 34.25  ? 105 GLU A CD    1 
ATOM   1325 O  OE1   . GLU C 3 105 ? -27.301 69.916 8.480  1.00 36.66  ? 105 GLU A OE1   1 
ATOM   1326 O  OE2   . GLU C 3 105 ? -27.834 68.776 10.277 1.00 34.82  ? 105 GLU A OE2   1 
ATOM   1327 N  N     . LEU C 3 106 ? -24.877 64.781 7.456  1.00 19.41  ? 106 LEU A N     1 
ATOM   1328 C  CA    . LEU C 3 106 ? -24.250 63.788 8.311  1.00 18.10  ? 106 LEU A CA    1 
ATOM   1329 C  C     . LEU C 3 106 ? -23.798 64.563 9.533  1.00 18.32  ? 106 LEU A C     1 
ATOM   1330 O  O     . LEU C 3 106 ? -23.041 65.526 9.424  1.00 19.07  ? 106 LEU A O     1 
ATOM   1331 C  CB    . LEU C 3 106 ? -23.036 63.170 7.620  1.00 19.03  ? 106 LEU A CB    1 
ATOM   1332 C  CG    . LEU C 3 106 ? -22.174 62.209 8.449  1.00 22.10  ? 106 LEU A CG    1 
ATOM   1333 C  CD1   . LEU C 3 106 ? -23.016 61.008 8.935  1.00 18.05  ? 106 LEU A CD1   1 
ATOM   1334 C  CD2   . LEU C 3 106 ? -20.997 61.743 7.586  1.00 21.05  ? 106 LEU A CD2   1 
ATOM   1335 N  N     . ARG C 3 107 ? -24.280 64.153 10.694 1.00 19.33  ? 107 ARG A N     1 
ATOM   1336 C  CA    . ARG C 3 107 ? -23.932 64.823 11.933 1.00 19.64  ? 107 ARG A CA    1 
ATOM   1337 C  C     . ARG C 3 107 ? -23.048 63.957 12.812 1.00 19.42  ? 107 ARG A C     1 
ATOM   1338 O  O     . ARG C 3 107 ? -23.297 62.769 12.982 1.00 20.06  ? 107 ARG A O     1 
ATOM   1339 C  CB    . ARG C 3 107 ? -25.202 65.179 12.696 1.00 21.13  ? 107 ARG A CB    1 
ATOM   1340 C  CG    . ARG C 3 107 ? -26.158 66.043 11.904 1.00 21.51  ? 107 ARG A CG    1 
ATOM   1341 C  CD    . ARG C 3 107 ? -27.464 66.141 12.631 1.00 25.36  ? 107 ARG A CD    1 
ATOM   1342 N  NE    . ARG C 3 107 ? -28.432 66.965 11.930 1.00 26.56  ? 107 ARG A NE    1 
ATOM   1343 C  CZ    . ARG C 3 107 ? -29.636 67.236 12.414 1.00 29.90  ? 107 ARG A CZ    1 
ATOM   1344 N  NH1   . ARG C 3 107 ? -29.990 66.734 13.590 1.00 30.80  ? 107 ARG A NH1   1 
ATOM   1345 N  NH2   . ARG C 3 107 ? -30.474 68.016 11.741 1.00 27.55  ? 107 ARG A NH2   1 
ATOM   1346 N  N     . TYR C 3 108 ? -22.005 64.562 13.359 1.00 18.52  ? 108 TYR A N     1 
ATOM   1347 C  CA    . TYR C 3 108 ? -21.112 63.855 14.245 1.00 18.42  ? 108 TYR A CA    1 
ATOM   1348 C  C     . TYR C 3 108 ? -21.276 64.437 15.644 1.00 18.68  ? 108 TYR A C     1 
ATOM   1349 O  O     . TYR C 3 108 ? -21.062 65.627 15.852 1.00 17.79  ? 108 TYR A O     1 
ATOM   1350 C  CB    . TYR C 3 108 ? -19.662 63.996 13.772 1.00 18.05  ? 108 TYR A CB    1 
ATOM   1351 C  CG    . TYR C 3 108 ? -18.670 63.382 14.724 1.00 17.80  ? 108 TYR A CG    1 
ATOM   1352 C  CD1   . TYR C 3 108 ? -17.912 64.180 15.583 1.00 17.52  ? 108 TYR A CD1   1 
ATOM   1353 C  CD2   . TYR C 3 108 ? -18.552 61.996 14.836 1.00 17.74  ? 108 TYR A CD2   1 
ATOM   1354 C  CE1   . TYR C 3 108 ? -17.075 63.618 16.526 1.00 16.14  ? 108 TYR A CE1   1 
ATOM   1355 C  CE2   . TYR C 3 108 ? -17.717 61.424 15.782 1.00 16.98  ? 108 TYR A CE2   1 
ATOM   1356 C  CZ    . TYR C 3 108 ? -16.984 62.239 16.624 1.00 18.07  ? 108 TYR A CZ    1 
ATOM   1357 O  OH    . TYR C 3 108 ? -16.177 61.672 17.584 1.00 20.41  ? 108 TYR A OH    1 
ATOM   1358 N  N     . ARG C 3 109 ? -21.691 63.594 16.585 1.00 18.81  ? 109 ARG A N     1 
ATOM   1359 C  CA    . ARG C 3 109 ? -21.875 63.994 17.975 1.00 22.05  ? 109 ARG A CA    1 
ATOM   1360 C  C     . ARG C 3 109 ? -20.816 63.291 18.823 1.00 22.19  ? 109 ARG A C     1 
ATOM   1361 O  O     . ARG C 3 109 ? -20.489 62.124 18.589 1.00 20.60  ? 109 ARG A O     1 
ATOM   1362 C  CB    . ARG C 3 109 ? -23.265 63.596 18.478 1.00 26.71  ? 109 ARG A CB    1 
ATOM   1363 C  CG    . ARG C 3 109 ? -24.420 64.253 17.739 1.00 37.57  ? 109 ARG A CG    1 
ATOM   1364 C  CD    . ARG C 3 109 ? -25.756 63.885 18.380 1.00 41.96  ? 109 ARG A CD    1 
ATOM   1365 N  NE    . ARG C 3 109 ? -25.796 64.282 19.786 1.00 46.77  ? 109 ARG A NE    1 
ATOM   1366 C  CZ    . ARG C 3 109 ? -26.829 64.081 20.600 1.00 48.44  ? 109 ARG A CZ    1 
ATOM   1367 N  NH1   . ARG C 3 109 ? -27.929 63.484 20.155 1.00 49.38  ? 109 ARG A NH1   1 
ATOM   1368 N  NH2   . ARG C 3 109 ? -26.757 64.472 21.865 1.00 48.83  ? 109 ARG A NH2   1 
ATOM   1369 N  N     . ASP C 3 110 ? -20.294 63.997 19.819 1.00 22.13  ? 110 ASP A N     1 
ATOM   1370 C  CA    . ASP C 3 110 ? -19.259 63.441 20.682 1.00 20.11  ? 110 ASP A CA    1 
ATOM   1371 C  C     . ASP C 3 110 ? -19.213 64.237 21.979 1.00 20.51  ? 110 ASP A C     1 
ATOM   1372 O  O     . ASP C 3 110 ? -18.497 65.224 22.088 1.00 18.59  ? 110 ASP A O     1 
ATOM   1373 C  CB    . ASP C 3 110 ? -17.909 63.512 19.964 1.00 20.72  ? 110 ASP A CB    1 
ATOM   1374 C  CG    . ASP C 3 110 ? -16.829 62.708 20.657 1.00 21.07  ? 110 ASP A CG    1 
ATOM   1375 O  OD1   . ASP C 3 110 ? -15.759 62.516 20.053 1.00 21.93  ? 110 ASP A OD1   1 
ATOM   1376 O  OD2   . ASP C 3 110 ? -17.043 62.270 21.802 1.00 24.75  ? 110 ASP A OD2   1 
ATOM   1377 N  N     . VAL C 3 111 ? -19.994 63.794 22.956 1.00 21.46  ? 111 VAL A N     1 
ATOM   1378 C  CA    . VAL C 3 111 ? -20.079 64.444 24.258 1.00 20.05  ? 111 VAL A CA    1 
ATOM   1379 C  C     . VAL C 3 111 ? -18.725 64.781 24.892 1.00 20.74  ? 111 VAL A C     1 
ATOM   1380 O  O     . VAL C 3 111 ? -18.513 65.896 25.366 1.00 19.11  ? 111 VAL A O     1 
ATOM   1381 C  CB    . VAL C 3 111 ? -20.893 63.557 25.224 1.00 20.53  ? 111 VAL A CB    1 
ATOM   1382 C  CG1   . VAL C 3 111 ? -20.834 64.105 26.642 1.00 20.43  ? 111 VAL A CG1   1 
ATOM   1383 C  CG2   . VAL C 3 111 ? -22.341 63.484 24.743 1.00 22.09  ? 111 VAL A CG2   1 
ATOM   1384 N  N     . ARG C 3 112 ? -17.803 63.829 24.887 1.00 20.71  ? 112 ARG A N     1 
ATOM   1385 C  CA    . ARG C 3 112 ? -16.508 64.061 25.506 1.00 21.23  ? 112 ARG A CA    1 
ATOM   1386 C  C     . ARG C 3 112 ? -15.498 64.773 24.612 1.00 22.36  ? 112 ARG A C     1 
ATOM   1387 O  O     . ARG C 3 112 ? -14.456 65.234 25.090 1.00 21.92  ? 112 ARG A O     1 
ATOM   1388 C  CB    . ARG C 3 112 ? -15.954 62.731 26.029 1.00 20.78  ? 112 ARG A CB    1 
ATOM   1389 C  CG    . ARG C 3 112 ? -16.896 62.092 27.051 1.00 20.75  ? 112 ARG A CG    1 
ATOM   1390 C  CD    . ARG C 3 112 ? -16.333 60.845 27.717 1.00 20.09  ? 112 ARG A CD    1 
ATOM   1391 N  NE    . ARG C 3 112 ? -15.194 61.145 28.576 1.00 20.71  ? 112 ARG A NE    1 
ATOM   1392 C  CZ    . ARG C 3 112 ? -14.467 60.219 29.195 1.00 23.26  ? 112 ARG A CZ    1 
ATOM   1393 N  NH1   . ARG C 3 112 ? -13.442 60.573 29.961 1.00 21.82  ? 112 ARG A NH1   1 
ATOM   1394 N  NH2   . ARG C 3 112 ? -14.768 58.934 29.053 1.00 23.25  ? 112 ARG A NH2   1 
ATOM   1395 N  N     . LYS C 3 113 ? -15.812 64.875 23.322 1.00 21.77  ? 113 LYS A N     1 
ATOM   1396 C  CA    . LYS C 3 113 ? -14.939 65.557 22.365 1.00 21.96  ? 113 LYS A CA    1 
ATOM   1397 C  C     . LYS C 3 113 ? -13.599 64.870 22.153 1.00 21.38  ? 113 LYS A C     1 
ATOM   1398 O  O     . LYS C 3 113 ? -12.623 65.513 21.766 1.00 21.88  ? 113 LYS A O     1 
ATOM   1399 C  CB    . LYS C 3 113 ? -14.687 66.998 22.818 1.00 23.62  ? 113 LYS A CB    1 
ATOM   1400 C  CG    . LYS C 3 113 ? -15.945 67.833 22.962 1.00 25.75  ? 113 LYS A CG    1 
ATOM   1401 C  CD    . LYS C 3 113 ? -15.615 69.216 23.495 1.00 27.84  ? 113 LYS A CD    1 
ATOM   1402 C  CE    . LYS C 3 113 ? -16.857 70.087 23.577 1.00 27.80  ? 113 LYS A CE    1 
ATOM   1403 N  NZ    . LYS C 3 113 ? -16.491 71.444 24.048 1.00 31.50  ? 113 LYS A NZ    1 
ATOM   1404 N  N     . PHE C 3 114 ? -13.552 63.565 22.395 1.00 20.29  ? 114 PHE A N     1 
ATOM   1405 C  CA    . PHE C 3 114 ? -12.314 62.811 22.234 1.00 22.03  ? 114 PHE A CA    1 
ATOM   1406 C  C     . PHE C 3 114 ? -12.041 62.339 20.802 1.00 21.50  ? 114 PHE A C     1 
ATOM   1407 O  O     . PHE C 3 114 ? -10.888 62.120 20.435 1.00 21.65  ? 114 PHE A O     1 
ATOM   1408 C  CB    . PHE C 3 114 ? -12.315 61.590 23.159 1.00 21.88  ? 114 PHE A CB    1 
ATOM   1409 C  CG    . PHE C 3 114 ? -12.191 61.919 24.625 1.00 22.16  ? 114 PHE A CG    1 
ATOM   1410 C  CD1   . PHE C 3 114 ? -12.302 60.908 25.582 1.00 20.58  ? 114 PHE A CD1   1 
ATOM   1411 C  CD2   . PHE C 3 114 ? -11.963 63.224 25.055 1.00 20.97  ? 114 PHE A CD2   1 
ATOM   1412 C  CE1   . PHE C 3 114 ? -12.189 61.196 26.943 1.00 18.32  ? 114 PHE A CE1   1 
ATOM   1413 C  CE2   . PHE C 3 114 ? -11.850 63.516 26.410 1.00 18.21  ? 114 PHE A CE2   1 
ATOM   1414 C  CZ    . PHE C 3 114 ? -11.962 62.503 27.352 1.00 18.86  ? 114 PHE A CZ    1 
ATOM   1415 N  N     . GLY C 3 115 ? -13.096 62.179 20.003 1.00 21.42  ? 115 GLY A N     1 
ATOM   1416 C  CA    . GLY C 3 115 ? -12.934 61.710 18.634 1.00 18.98  ? 115 GLY A CA    1 
ATOM   1417 C  C     . GLY C 3 115 ? -12.008 62.550 17.769 1.00 19.75  ? 115 GLY A C     1 
ATOM   1418 O  O     . GLY C 3 115 ? -11.763 63.710 18.064 1.00 20.78  ? 115 GLY A O     1 
ATOM   1419 N  N     . THR C 3 116 ? -11.495 61.964 16.691 1.00 20.45  ? 116 THR A N     1 
ATOM   1420 C  CA    . THR C 3 116 ? -10.598 62.676 15.783 1.00 20.46  ? 116 THR A CA    1 
ATOM   1421 C  C     . THR C 3 116 ? -10.961 62.431 14.312 1.00 19.44  ? 116 THR A C     1 
ATOM   1422 O  O     . THR C 3 116 ? -11.586 61.422 13.975 1.00 17.69  ? 116 THR A O     1 
ATOM   1423 C  CB    . THR C 3 116 ? -9.133  62.236 15.986 1.00 19.06  ? 116 THR A CB    1 
ATOM   1424 O  OG1   . THR C 3 116 ? -9.034  60.827 15.754 1.00 20.87  ? 116 THR A OG1   1 
ATOM   1425 C  CG2   . THR C 3 116 ? -8.666  62.537 17.399 1.00 20.83  ? 116 THR A CG2   1 
ATOM   1426 N  N     . MET C 3 117 ? -10.556 63.366 13.452 1.00 19.83  ? 117 MET A N     1 
ATOM   1427 C  CA    . MET C 3 117 ? -10.793 63.285 12.008 1.00 19.75  ? 117 MET A CA    1 
ATOM   1428 C  C     . MET C 3 117 ? -9.526  63.659 11.234 1.00 18.77  ? 117 MET A C     1 
ATOM   1429 O  O     . MET C 3 117 ? -8.896  64.677 11.507 1.00 20.43  ? 117 MET A O     1 
ATOM   1430 C  CB    . MET C 3 117 ? -11.940 64.219 11.593 1.00 17.83  ? 117 MET A CB    1 
ATOM   1431 C  CG    . MET C 3 117 ? -13.326 63.698 11.948 1.00 17.32  ? 117 MET A CG    1 
ATOM   1432 S  SD    . MET C 3 117 ? -14.666 64.860 11.562 1.00 16.22  ? 117 MET A SD    1 
ATOM   1433 C  CE    . MET C 3 117 ? -16.061 64.066 12.466 1.00 13.91  ? 117 MET A CE    1 
ATOM   1434 N  N     . HIS C 3 118 ? -9.154  62.819 10.276 1.00 19.92  ? 118 HIS A N     1 
ATOM   1435 C  CA    . HIS C 3 118 ? -7.977  63.046 9.448  1.00 20.26  ? 118 HIS A CA    1 
ATOM   1436 C  C     . HIS C 3 118 ? -8.405  62.912 7.999  1.00 20.39  ? 118 HIS A C     1 
ATOM   1437 O  O     . HIS C 3 118 ? -9.131  61.980 7.657  1.00 20.27  ? 118 HIS A O     1 
ATOM   1438 C  CB    . HIS C 3 118 ? -6.885  61.993 9.698  1.00 22.64  ? 118 HIS A CB    1 
ATOM   1439 C  CG    . HIS C 3 118 ? -6.229  62.080 11.039 1.00 20.07  ? 118 HIS A CG    1 
ATOM   1440 N  ND1   . HIS C 3 118 ? -6.822  61.609 12.191 1.00 24.01  ? 118 HIS A ND1   1 
ATOM   1441 C  CD2   . HIS C 3 118 ? -5.017  62.559 11.407 1.00 20.23  ? 118 HIS A CD2   1 
ATOM   1442 C  CE1   . HIS C 3 118 ? -6.002  61.791 13.211 1.00 22.51  ? 118 HIS A CE1   1 
ATOM   1443 N  NE2   . HIS C 3 118 ? -4.900  62.366 12.762 1.00 23.47  ? 118 HIS A NE2   1 
ATOM   1444 N  N     . VAL C 3 119 ? -7.959  63.838 7.152  1.00 18.97  ? 119 VAL A N     1 
ATOM   1445 C  CA    . VAL C 3 119 ? -8.285  63.784 5.733  1.00 20.00  ? 119 VAL A CA    1 
ATOM   1446 C  C     . VAL C 3 119 ? -7.000  63.785 4.907  1.00 20.28  ? 119 VAL A C     1 
ATOM   1447 O  O     . VAL C 3 119 ? -6.150  64.652 5.066  1.00 20.08  ? 119 VAL A O     1 
ATOM   1448 C  CB    . VAL C 3 119 ? -9.169  64.978 5.295  1.00 21.70  ? 119 VAL A CB    1 
ATOM   1449 C  CG1   . VAL C 3 119 ? -9.324  64.983 3.768  1.00 19.19  ? 119 VAL A CG1   1 
ATOM   1450 C  CG2   . VAL C 3 119 ? -10.542 64.876 5.954  1.00 19.53  ? 119 VAL A CG2   1 
ATOM   1451 N  N     . TYR C 3 120 ? -6.864  62.788 4.043  1.00 19.95  ? 120 TYR A N     1 
ATOM   1452 C  CA    . TYR C 3 120 ? -5.700  62.655 3.172  1.00 21.83  ? 120 TYR A CA    1 
ATOM   1453 C  C     . TYR C 3 120 ? -6.214  62.154 1.833  1.00 22.01  ? 120 TYR A C     1 
ATOM   1454 O  O     . TYR C 3 120 ? -7.367  61.727 1.725  1.00 21.43  ? 120 TYR A O     1 
ATOM   1455 C  CB    . TYR C 3 120 ? -4.720  61.590 3.689  1.00 21.97  ? 120 TYR A CB    1 
ATOM   1456 C  CG    . TYR C 3 120 ? -4.175  61.766 5.087  1.00 24.44  ? 120 TYR A CG    1 
ATOM   1457 C  CD1   . TYR C 3 120 ? -3.204  62.726 5.369  1.00 24.28  ? 120 TYR A CD1   1 
ATOM   1458 C  CD2   . TYR C 3 120 ? -4.576  60.912 6.119  1.00 25.64  ? 120 TYR A CD2   1 
ATOM   1459 C  CE1   . TYR C 3 120 ? -2.636  62.825 6.648  1.00 24.59  ? 120 TYR A CE1   1 
ATOM   1460 C  CE2   . TYR C 3 120 ? -4.019  61.001 7.396  1.00 25.23  ? 120 TYR A CE2   1 
ATOM   1461 C  CZ    . TYR C 3 120 ? -3.049  61.957 7.654  1.00 26.28  ? 120 TYR A CZ    1 
ATOM   1462 O  OH    . TYR C 3 120 ? -2.493  62.038 8.915  1.00 25.42  ? 120 TYR A OH    1 
ATOM   1463 N  N     . ALA C 3 121 ? -5.362  62.206 0.814  1.00 22.87  ? 121 ALA A N     1 
ATOM   1464 C  CA    . ALA C 3 121 ? -5.737  61.674 -0.487 1.00 24.95  ? 121 ALA A CA    1 
ATOM   1465 C  C     . ALA C 3 121 ? -5.849  60.176 -0.210 1.00 24.91  ? 121 ALA A C     1 
ATOM   1466 O  O     . ALA C 3 121 ? -5.145  59.651 0.659  1.00 25.19  ? 121 ALA A O     1 
ATOM   1467 C  CB    . ALA C 3 121 ? -4.642  61.939 -1.518 1.00 25.13  ? 121 ALA A CB    1 
ATOM   1468 N  N     . LYS C 3 122 ? -6.729  59.492 -0.932 1.00 24.80  ? 122 LYS A N     1 
ATOM   1469 C  CA    . LYS C 3 122 ? -6.920  58.063 -0.734 1.00 26.81  ? 122 LYS A CA    1 
ATOM   1470 C  C     . LYS C 3 122 ? -5.639  57.237 -0.724 1.00 28.60  ? 122 LYS A C     1 
ATOM   1471 O  O     . LYS C 3 122 ? -5.549  56.251 0.003  1.00 28.13  ? 122 LYS A O     1 
ATOM   1472 C  CB    . LYS C 3 122 ? -7.862  57.507 -1.802 1.00 28.54  ? 122 LYS A CB    1 
ATOM   1473 C  CG    . LYS C 3 122 ? -9.300  57.975 -1.667 1.00 27.82  ? 122 LYS A CG    1 
ATOM   1474 C  CD    . LYS C 3 122 ? -10.140 57.509 -2.844 1.00 25.73  ? 122 LYS A CD    1 
ATOM   1475 C  CE    . LYS C 3 122 ? -11.550 58.054 -2.736 1.00 24.27  ? 122 LYS A CE    1 
ATOM   1476 N  NZ    . LYS C 3 122 ? -12.389 57.654 -3.885 1.00 25.10  ? 122 LYS A NZ    1 
ATOM   1477 N  N     . GLU C 3 123 ? -4.651  57.632 -1.522 1.00 30.78  ? 123 GLU A N     1 
ATOM   1478 C  CA    . GLU C 3 123 ? -3.398  56.882 -1.602 1.00 33.54  ? 123 GLU A CA    1 
ATOM   1479 C  C     . GLU C 3 123 ? -2.508  57.051 -0.386 1.00 33.85  ? 123 GLU A C     1 
ATOM   1480 O  O     . GLU C 3 123 ? -1.733  56.154 -0.058 1.00 35.25  ? 123 GLU A O     1 
ATOM   1481 C  CB    . GLU C 3 123 ? -2.588  57.297 -2.829 1.00 35.02  ? 123 GLU A CB    1 
ATOM   1482 C  CG    . GLU C 3 123 ? -3.416  57.696 -4.010 1.00 39.49  ? 123 GLU A CG    1 
ATOM   1483 C  CD    . GLU C 3 123 ? -3.812  59.156 -3.973 1.00 38.75  ? 123 GLU A CD    1 
ATOM   1484 O  OE1   . GLU C 3 123 ? -2.928  60.030 -4.129 1.00 38.70  ? 123 GLU A OE1   1 
ATOM   1485 O  OE2   . GLU C 3 123 ? -5.014  59.422 -3.788 1.00 39.48  ? 123 GLU A OE2   1 
ATOM   1486 N  N     . GLU C 3 124 ? -2.605  58.202 0.270  1.00 33.02  ? 124 GLU A N     1 
ATOM   1487 C  CA    . GLU C 3 124 ? -1.777  58.480 1.437  1.00 34.21  ? 124 GLU A CA    1 
ATOM   1488 C  C     . GLU C 3 124 ? -2.351  58.010 2.769  1.00 32.54  ? 124 GLU A C     1 
ATOM   1489 O  O     . GLU C 3 124 ? -1.597  57.738 3.700  1.00 34.38  ? 124 GLU A O     1 
ATOM   1490 C  CB    . GLU C 3 124 ? -1.482  59.979 1.527  1.00 35.44  ? 124 GLU A CB    1 
ATOM   1491 C  CG    . GLU C 3 124 ? -0.745  60.531 0.327  1.00 40.45  ? 124 GLU A CG    1 
ATOM   1492 C  CD    . GLU C 3 124 ? 0.541   59.779 0.038  1.00 43.64  ? 124 GLU A CD    1 
ATOM   1493 O  OE1   . GLU C 3 124 ? 1.448   59.790 0.900  1.00 41.56  ? 124 GLU A OE1   1 
ATOM   1494 O  OE2   . GLU C 3 124 ? 0.638   59.174 -1.056 1.00 45.53  ? 124 GLU A OE2   1 
ATOM   1495 N  N     . ALA C 3 125 ? -3.674  57.908 2.857  1.00 32.07  ? 125 ALA A N     1 
ATOM   1496 C  CA    . ALA C 3 125 ? -4.346  57.505 4.094  1.00 29.42  ? 125 ALA A CA    1 
ATOM   1497 C  C     . ALA C 3 125 ? -3.745  56.301 4.819  1.00 29.91  ? 125 ALA A C     1 
ATOM   1498 O  O     . ALA C 3 125 ? -3.565  56.332 6.033  1.00 29.01  ? 125 ALA A O     1 
ATOM   1499 C  CB    . ALA C 3 125 ? -5.816  57.245 3.820  1.00 27.15  ? 125 ALA A CB    1 
ATOM   1500 N  N     . ASP C 3 126 ? -3.437  55.243 4.081  1.00 29.72  ? 126 ASP A N     1 
ATOM   1501 C  CA    . ASP C 3 126 ? -2.892  54.040 4.686  1.00 31.22  ? 126 ASP A CA    1 
ATOM   1502 C  C     . ASP C 3 126 ? -1.411  54.074 5.048  1.00 33.80  ? 126 ASP A C     1 
ATOM   1503 O  O     . ASP C 3 126 ? -0.938  53.200 5.770  1.00 34.60  ? 126 ASP A O     1 
ATOM   1504 C  CB    . ASP C 3 126 ? -3.178  52.839 3.790  1.00 30.74  ? 126 ASP A CB    1 
ATOM   1505 C  CG    . ASP C 3 126 ? -4.661  52.586 3.628  1.00 32.07  ? 126 ASP A CG    1 
ATOM   1506 O  OD1   . ASP C 3 126 ? -5.418  52.895 4.571  1.00 31.39  ? 126 ASP A OD1   1 
ATOM   1507 O  OD2   . ASP C 3 126 ? -5.074  52.071 2.571  1.00 35.95  ? 126 ASP A OD2   1 
ATOM   1508 N  N     . ARG C 3 127 ? -0.676  55.069 4.561  1.00 34.20  ? 127 ARG A N     1 
ATOM   1509 C  CA    . ARG C 3 127 ? 0.742   55.151 4.884  1.00 36.27  ? 127 ARG A CA    1 
ATOM   1510 C  C     . ARG C 3 127 ? 1.055   56.384 5.714  1.00 36.02  ? 127 ARG A C     1 
ATOM   1511 O  O     . ARG C 3 127 ? 2.161   56.919 5.673  1.00 38.26  ? 127 ARG A O     1 
ATOM   1512 C  CB    . ARG C 3 127 ? 1.584   55.128 3.604  1.00 39.24  ? 127 ARG A CB    1 
ATOM   1513 C  CG    . ARG C 3 127 ? 1.432   56.317 2.676  1.00 45.10  ? 127 ARG A CG    1 
ATOM   1514 C  CD    . ARG C 3 127 ? 1.944   55.939 1.290  1.00 50.52  ? 127 ARG A CD    1 
ATOM   1515 N  NE    . ARG C 3 127 ? 2.320   57.088 0.473  1.00 55.20  ? 127 ARG A NE    1 
ATOM   1516 C  CZ    . ARG C 3 127 ? 2.598   57.013 -0.826 1.00 58.85  ? 127 ARG A CZ    1 
ATOM   1517 N  NH1   . ARG C 3 127 ? 2.941   58.103 -1.502 1.00 60.44  ? 127 ARG A NH1   1 
ATOM   1518 N  NH2   . ARG C 3 127 ? 2.519   55.847 -1.457 1.00 59.95  ? 127 ARG A NH2   1 
ATOM   1519 N  N     . ARG C 3 128 ? 0.059   56.815 6.477  1.00 34.59  ? 128 ARG A N     1 
ATOM   1520 C  CA    . ARG C 3 128 ? 0.165   57.975 7.350  1.00 33.22  ? 128 ARG A CA    1 
ATOM   1521 C  C     . ARG C 3 128 ? -0.627  57.642 8.613  1.00 33.12  ? 128 ARG A C     1 
ATOM   1522 O  O     . ARG C 3 128 ? -1.404  56.686 8.636  1.00 31.24  ? 128 ARG A O     1 
ATOM   1523 C  CB    . ARG C 3 128 ? -0.471  59.212 6.689  1.00 35.50  ? 128 ARG A CB    1 
ATOM   1524 C  CG    . ARG C 3 128 ? 0.158   59.678 5.369  1.00 37.12  ? 128 ARG A CG    1 
ATOM   1525 C  CD    . ARG C 3 128 ? 1.507   60.331 5.604  1.00 40.60  ? 128 ARG A CD    1 
ATOM   1526 N  NE    . ARG C 3 128 ? 1.399   61.520 6.448  1.00 44.98  ? 128 ARG A NE    1 
ATOM   1527 C  CZ    . ARG C 3 128 ? 1.036   62.724 6.011  1.00 46.91  ? 128 ARG A CZ    1 
ATOM   1528 N  NH1   . ARG C 3 128 ? 0.745   62.910 4.728  1.00 48.17  ? 128 ARG A NH1   1 
ATOM   1529 N  NH2   . ARG C 3 128 ? 0.963   63.745 6.856  1.00 46.70  ? 128 ARG A NH2   1 
ATOM   1530 N  N     . PRO C 3 129 ? -0.422  58.408 9.692  1.00 33.07  ? 129 PRO A N     1 
ATOM   1531 C  CA    . PRO C 3 129 ? -1.186  58.111 10.905 1.00 31.34  ? 129 PRO A CA    1 
ATOM   1532 C  C     . PRO C 3 129 ? -2.606  58.612 10.681 1.00 30.96  ? 129 PRO A C     1 
ATOM   1533 O  O     . PRO C 3 129 ? -2.834  59.472 9.836  1.00 30.44  ? 129 PRO A O     1 
ATOM   1534 C  CB    . PRO C 3 129 ? -0.445  58.900 11.982 1.00 33.05  ? 129 PRO A CB    1 
ATOM   1535 C  CG    . PRO C 3 129 ? 0.111   60.074 11.220 1.00 34.09  ? 129 PRO A CG    1 
ATOM   1536 C  CD    . PRO C 3 129 ? 0.616   59.421 9.951  1.00 33.43  ? 129 PRO A CD    1 
ATOM   1537 N  N     . PRO C 3 130 ? -3.583  58.085 11.431 1.00 30.98  ? 130 PRO A N     1 
ATOM   1538 C  CA    . PRO C 3 130 ? -3.445  57.059 12.467 1.00 30.52  ? 130 PRO A CA    1 
ATOM   1539 C  C     . PRO C 3 130 ? -3.520  55.613 11.972 1.00 29.16  ? 130 PRO A C     1 
ATOM   1540 O  O     . PRO C 3 130 ? -3.348  54.684 12.759 1.00 30.31  ? 130 PRO A O     1 
ATOM   1541 C  CB    . PRO C 3 130 ? -4.588  57.392 13.416 1.00 32.02  ? 130 PRO A CB    1 
ATOM   1542 C  CG    . PRO C 3 130 ? -5.656  57.828 12.465 1.00 32.10  ? 130 PRO A CG    1 
ATOM   1543 C  CD    . PRO C 3 130 ? -4.908  58.727 11.507 1.00 30.24  ? 130 PRO A CD    1 
ATOM   1544 N  N     . LEU C 3 131 ? -3.764  55.421 10.680 1.00 27.31  ? 131 LEU A N     1 
ATOM   1545 C  CA    . LEU C 3 131 ? -3.882  54.075 10.121 1.00 27.09  ? 131 LEU A CA    1 
ATOM   1546 C  C     . LEU C 3 131 ? -2.568  53.354 9.844  1.00 27.07  ? 131 LEU A C     1 
ATOM   1547 O  O     . LEU C 3 131 ? -2.518  52.126 9.850  1.00 27.23  ? 131 LEU A O     1 
ATOM   1548 C  CB    . LEU C 3 131 ? -4.702  54.103 8.822  1.00 22.63  ? 131 LEU A CB    1 
ATOM   1549 C  CG    . LEU C 3 131 ? -6.128  54.651 8.920  1.00 27.07  ? 131 LEU A CG    1 
ATOM   1550 C  CD1   . LEU C 3 131 ? -6.849  54.463 7.589  1.00 23.41  ? 131 LEU A CD1   1 
ATOM   1551 C  CD2   . LEU C 3 131 ? -6.877  53.936 10.040 1.00 27.39  ? 131 LEU A CD2   1 
ATOM   1552 N  N     . ALA C 3 132 ? -1.511  54.119 9.602  1.00 29.26  ? 132 ALA A N     1 
ATOM   1553 C  CA    . ALA C 3 132 ? -0.196  53.569 9.275  1.00 31.04  ? 132 ALA A CA    1 
ATOM   1554 C  C     . ALA C 3 132 ? 0.292   52.332 10.044 1.00 31.19  ? 132 ALA A C     1 
ATOM   1555 O  O     . ALA C 3 132 ? 0.595   51.303 9.439  1.00 30.91  ? 132 ALA A O     1 
ATOM   1556 C  CB    . ALA C 3 132 ? 0.860   54.680 9.369  1.00 30.36  ? 132 ALA A CB    1 
ATOM   1557 N  N     . GLU C 3 133 ? 0.365   52.423 11.366 1.00 31.95  ? 133 GLU A N     1 
ATOM   1558 C  CA    . GLU C 3 133 ? 0.876   51.307 12.156 1.00 33.65  ? 133 GLU A CA    1 
ATOM   1559 C  C     . GLU C 3 133 ? -0.136  50.347 12.779 1.00 33.05  ? 133 GLU A C     1 
ATOM   1560 O  O     . GLU C 3 133 ? 0.192   49.636 13.729 1.00 34.08  ? 133 GLU A O     1 
ATOM   1561 C  CB    . GLU C 3 133 ? 1.795   51.848 13.254 1.00 35.04  ? 133 GLU A CB    1 
ATOM   1562 C  CG    . GLU C 3 133 ? 1.104   52.797 14.221 1.00 35.91  ? 133 GLU A CG    1 
ATOM   1563 N  N     . LEU C 3 134 ? -1.354  50.303 12.259 1.00 31.32  ? 134 LEU A N     1 
ATOM   1564 C  CA    . LEU C 3 134 ? -2.344  49.393 12.825 1.00 31.77  ? 134 LEU A CA    1 
ATOM   1565 C  C     . LEU C 3 134 ? -2.040  47.928 12.498 1.00 31.79  ? 134 LEU A C     1 
ATOM   1566 O  O     . LEU C 3 134 ? -1.577  47.605 11.403 1.00 33.43  ? 134 LEU A O     1 
ATOM   1567 C  CB    . LEU C 3 134 ? -3.744  49.749 12.323 1.00 29.93  ? 134 LEU A CB    1 
ATOM   1568 C  CG    . LEU C 3 134 ? -4.286  51.102 12.783 1.00 28.98  ? 134 LEU A CG    1 
ATOM   1569 C  CD1   . LEU C 3 134 ? -5.632  51.352 12.121 1.00 29.66  ? 134 LEU A CD1   1 
ATOM   1570 C  CD2   . LEU C 3 134 ? -4.413  51.127 14.302 1.00 28.75  ? 134 LEU A CD2   1 
ATOM   1571 N  N     . GLY C 3 135 ? -2.299  47.048 13.460 1.00 30.13  ? 135 GLY A N     1 
ATOM   1572 C  CA    . GLY C 3 135 ? -2.066  45.632 13.257 1.00 29.25  ? 135 GLY A CA    1 
ATOM   1573 C  C     . GLY C 3 135 ? -3.086  45.033 12.301 1.00 29.74  ? 135 GLY A C     1 
ATOM   1574 O  O     . GLY C 3 135 ? -3.949  45.738 11.785 1.00 29.78  ? 135 GLY A O     1 
ATOM   1575 N  N     . PRO C 3 136 ? -3.020  43.722 12.050 1.00 29.15  ? 136 PRO A N     1 
ATOM   1576 C  CA    . PRO C 3 136 ? -3.971  43.086 11.134 1.00 28.14  ? 136 PRO A CA    1 
ATOM   1577 C  C     . PRO C 3 136 ? -5.420  42.999 11.617 1.00 27.85  ? 136 PRO A C     1 
ATOM   1578 O  O     . PRO C 3 136 ? -5.718  43.116 12.811 1.00 28.15  ? 136 PRO A O     1 
ATOM   1579 C  CB    . PRO C 3 136 ? -3.349  41.708 10.904 1.00 28.00  ? 136 PRO A CB    1 
ATOM   1580 C  CG    . PRO C 3 136 ? -2.666  41.428 12.219 1.00 30.52  ? 136 PRO A CG    1 
ATOM   1581 C  CD    . PRO C 3 136 ? -2.017  42.755 12.538 1.00 29.42  ? 136 PRO A CD    1 
ATOM   1582 N  N     . GLU C 3 137 ? -6.320  42.799 10.663 1.00 26.44  ? 137 GLU A N     1 
ATOM   1583 C  CA    . GLU C 3 137 ? -7.736  42.662 10.957 1.00 26.85  ? 137 GLU A CA    1 
ATOM   1584 C  C     . GLU C 3 137 ? -7.958  41.284 11.588 1.00 28.86  ? 137 GLU A C     1 
ATOM   1585 O  O     . GLU C 3 137 ? -7.506  40.268 11.054 1.00 26.98  ? 137 GLU A O     1 
ATOM   1586 C  CB    . GLU C 3 137 ? -8.541  42.810 9.669  1.00 23.17  ? 137 GLU A CB    1 
ATOM   1587 C  CG    . GLU C 3 137 ? -8.620  44.247 9.192  1.00 23.19  ? 137 GLU A CG    1 
ATOM   1588 C  CD    . GLU C 3 137 ? -9.466  45.116 10.123 1.00 24.25  ? 137 GLU A CD    1 
ATOM   1589 O  OE1   . GLU C 3 137 ? -9.102  46.292 10.352 1.00 22.97  ? 137 GLU A OE1   1 
ATOM   1590 O  OE2   . GLU C 3 137 ? -10.502 44.623 10.616 1.00 22.40  ? 137 GLU A OE2   1 
ATOM   1591 N  N     . PRO C 3 138 ? -8.649  41.237 12.745 1.00 29.36  ? 138 PRO A N     1 
ATOM   1592 C  CA    . PRO C 3 138 ? -8.921  39.981 13.451 1.00 30.55  ? 138 PRO A CA    1 
ATOM   1593 C  C     . PRO C 3 138 ? -9.710  38.943 12.665 1.00 31.47  ? 138 PRO A C     1 
ATOM   1594 O  O     . PRO C 3 138 ? -9.445  37.748 12.779 1.00 32.48  ? 138 PRO A O     1 
ATOM   1595 C  CB    . PRO C 3 138 ? -9.641  40.443 14.719 1.00 30.42  ? 138 PRO A CB    1 
ATOM   1596 C  CG    . PRO C 3 138 ? -10.300 41.718 14.296 1.00 30.26  ? 138 PRO A CG    1 
ATOM   1597 C  CD    . PRO C 3 138 ? -9.219  42.379 13.479 1.00 28.60  ? 138 PRO A CD    1 
ATOM   1598 N  N     . LEU C 3 139 ? -10.674 39.395 11.870 1.00 32.65  ? 139 LEU A N     1 
ATOM   1599 C  CA    . LEU C 3 139 ? -11.481 38.484 11.071 1.00 33.35  ? 139 LEU A CA    1 
ATOM   1600 C  C     . LEU C 3 139 ? -10.848 38.214 9.703  1.00 34.55  ? 139 LEU A C     1 
ATOM   1601 O  O     . LEU C 3 139 ? -11.540 37.847 8.753  1.00 36.25  ? 139 LEU A O     1 
ATOM   1602 C  CB    . LEU C 3 139 ? -12.893 39.043 10.892 1.00 32.77  ? 139 LEU A CB    1 
ATOM   1603 C  CG    . LEU C 3 139 ? -13.691 39.269 12.179 1.00 34.61  ? 139 LEU A CG    1 
ATOM   1604 C  CD1   . LEU C 3 139 ? -15.044 39.868 11.848 1.00 33.63  ? 139 LEU A CD1   1 
ATOM   1605 C  CD2   . LEU C 3 139 ? -13.862 37.952 12.917 1.00 33.60  ? 139 LEU A CD2   1 
ATOM   1606 N  N     . SER C 3 140 ? -9.533  38.396 9.609  1.00 34.71  ? 140 SER A N     1 
ATOM   1607 C  CA    . SER C 3 140 ? -8.816  38.153 8.361  1.00 35.21  ? 140 SER A CA    1 
ATOM   1608 C  C     . SER C 3 140 ? -7.682  37.151 8.580  1.00 36.16  ? 140 SER A C     1 
ATOM   1609 O  O     . SER C 3 140 ? -7.223  36.953 9.705  1.00 35.96  ? 140 SER A O     1 
ATOM   1610 C  CB    . SER C 3 140 ? -8.224  39.452 7.815  1.00 32.49  ? 140 SER A CB    1 
ATOM   1611 O  OG    . SER C 3 140 ? -7.035  39.790 8.501  1.00 30.83  ? 140 SER A OG    1 
ATOM   1612 N  N     . PRO C 3 141 ? -7.222  36.499 7.499  1.00 37.30  ? 141 PRO A N     1 
ATOM   1613 C  CA    . PRO C 3 141 ? -6.132  35.518 7.580  1.00 36.98  ? 141 PRO A CA    1 
ATOM   1614 C  C     . PRO C 3 141 ? -4.835  36.130 8.111  1.00 36.43  ? 141 PRO A C     1 
ATOM   1615 O  O     . PRO C 3 141 ? -3.971  35.421 8.628  1.00 36.53  ? 141 PRO A O     1 
ATOM   1616 C  CB    . PRO C 3 141 ? -5.989  35.043 6.134  1.00 37.56  ? 141 PRO A CB    1 
ATOM   1617 C  CG    . PRO C 3 141 ? -7.395  35.142 5.612  1.00 37.83  ? 141 PRO A CG    1 
ATOM   1618 C  CD    . PRO C 3 141 ? -7.847  36.482 6.163  1.00 37.01  ? 141 PRO A CD    1 
ATOM   1619 N  N     . ALA C 3 142 ? -4.702  37.447 7.977  1.00 35.16  ? 142 ALA A N     1 
ATOM   1620 C  CA    . ALA C 3 142 ? -3.503  38.142 8.440  1.00 34.84  ? 142 ALA A CA    1 
ATOM   1621 C  C     . ALA C 3 142 ? -3.351  38.052 9.955  1.00 34.72  ? 142 ALA A C     1 
ATOM   1622 O  O     . ALA C 3 142 ? -2.257  38.252 10.489 1.00 34.30  ? 142 ALA A O     1 
ATOM   1623 C  CB    . ALA C 3 142 ? -3.532  39.602 7.996  1.00 32.84  ? 142 ALA A CB    1 
ATOM   1624 N  N     . PHE C 3 143 ? -4.451  37.770 10.650 1.00 34.63  ? 143 PHE A N     1 
ATOM   1625 C  CA    . PHE C 3 143 ? -4.397  37.624 12.099 1.00 34.89  ? 143 PHE A CA    1 
ATOM   1626 C  C     . PHE C 3 143 ? -4.469  36.135 12.409 1.00 34.63  ? 143 PHE A C     1 
ATOM   1627 O  O     . PHE C 3 143 ? -5.479  35.486 12.148 1.00 35.55  ? 143 PHE A O     1 
ATOM   1628 C  CB    . PHE C 3 143 ? -5.560  38.344 12.785 1.00 34.85  ? 143 PHE A CB    1 
ATOM   1629 C  CG    . PHE C 3 143 ? -5.521  38.248 14.289 1.00 32.80  ? 143 PHE A CG    1 
ATOM   1630 C  CD1   . PHE C 3 143 ? -6.628  37.808 15.002 1.00 31.59  ? 143 PHE A CD1   1 
ATOM   1631 C  CD2   . PHE C 3 143 ? -4.366  38.585 14.990 1.00 32.35  ? 143 PHE A CD2   1 
ATOM   1632 C  CE1   . PHE C 3 143 ? -6.587  37.704 16.392 1.00 29.23  ? 143 PHE A CE1   1 
ATOM   1633 C  CE2   . PHE C 3 143 ? -4.318  38.485 16.378 1.00 30.61  ? 143 PHE A CE2   1 
ATOM   1634 C  CZ    . PHE C 3 143 ? -5.435  38.042 17.077 1.00 28.45  ? 143 PHE A CZ    1 
ATOM   1635 N  N     . SER C 3 144 ? -3.392  35.599 12.966 1.00 35.66  ? 144 SER A N     1 
ATOM   1636 C  CA    . SER C 3 144 ? -3.317  34.179 13.290 1.00 34.85  ? 144 SER A CA    1 
ATOM   1637 C  C     . SER C 3 144 ? -2.612  33.993 14.619 1.00 34.84  ? 144 SER A C     1 
ATOM   1638 O  O     . SER C 3 144 ? -2.072  34.945 15.183 1.00 35.51  ? 144 SER A O     1 
ATOM   1639 C  CB    . SER C 3 144 ? -2.519  33.444 12.217 1.00 35.39  ? 144 SER A CB    1 
ATOM   1640 O  OG    . SER C 3 144 ? -1.152  33.839 12.267 1.00 36.41  ? 144 SER A OG    1 
ATOM   1641 N  N     . PRO C 3 145 ? -2.603  32.756 15.138 1.00 34.80  ? 145 PRO A N     1 
ATOM   1642 C  CA    . PRO C 3 145 ? -1.933  32.506 16.413 1.00 35.90  ? 145 PRO A CA    1 
ATOM   1643 C  C     . PRO C 3 145 ? -0.473  32.958 16.332 1.00 37.20  ? 145 PRO A C     1 
ATOM   1644 O  O     . PRO C 3 145 ? 0.062   33.558 17.271 1.00 35.77  ? 145 PRO A O     1 
ATOM   1645 C  CB    . PRO C 3 145 ? -2.068  30.995 16.574 1.00 35.37  ? 145 PRO A CB    1 
ATOM   1646 C  CG    . PRO C 3 145 ? -3.399  30.724 15.938 1.00 35.58  ? 145 PRO A CG    1 
ATOM   1647 C  CD    . PRO C 3 145 ? -3.335  31.559 14.682 1.00 33.84  ? 145 PRO A CD    1 
ATOM   1648 N  N     . ALA C 3 146 ? 0.155   32.671 15.193 1.00 37.89  ? 146 ALA A N     1 
ATOM   1649 C  CA    . ALA C 3 146 ? 1.549   33.036 14.961 1.00 38.86  ? 146 ALA A CA    1 
ATOM   1650 C  C     . ALA C 3 146 ? 1.796   34.515 15.232 1.00 39.01  ? 146 ALA A C     1 
ATOM   1651 O  O     . ALA C 3 146 ? 2.743   34.868 15.929 1.00 40.86  ? 146 ALA A O     1 
ATOM   1652 C  CB    . ALA C 3 146 ? 1.949   32.694 13.525 1.00 40.37  ? 146 ALA A CB    1 
ATOM   1653 N  N     . VAL C 3 147 ? 0.941   35.372 14.678 1.00 39.41  ? 147 VAL A N     1 
ATOM   1654 C  CA    . VAL C 3 147 ? 1.068   36.820 14.854 1.00 38.48  ? 147 VAL A CA    1 
ATOM   1655 C  C     . VAL C 3 147 ? 0.937   37.246 16.311 1.00 38.28  ? 147 VAL A C     1 
ATOM   1656 O  O     . VAL C 3 147 ? 1.590   38.193 16.754 1.00 38.58  ? 147 VAL A O     1 
ATOM   1657 C  CB    . VAL C 3 147 ? 0.004   37.577 14.026 1.00 39.42  ? 147 VAL A CB    1 
ATOM   1658 C  CG1   . VAL C 3 147 ? 0.034   39.067 14.361 1.00 38.33  ? 147 VAL A CG1   1 
ATOM   1659 C  CG2   . VAL C 3 147 ? 0.261   37.363 12.542 1.00 38.98  ? 147 VAL A CG2   1 
ATOM   1660 N  N     . LEU C 3 148 ? 0.083   36.553 17.053 1.00 37.33  ? 148 LEU A N     1 
ATOM   1661 C  CA    . LEU C 3 148 ? -0.111  36.872 18.458 1.00 36.25  ? 148 LEU A CA    1 
ATOM   1662 C  C     . LEU C 3 148 ? 1.120   36.406 19.236 1.00 36.01  ? 148 LEU A C     1 
ATOM   1663 O  O     . LEU C 3 148 ? 1.637   37.126 20.089 1.00 36.24  ? 148 LEU A O     1 
ATOM   1664 C  CB    . LEU C 3 148 ? -1.376  36.180 18.982 1.00 35.03  ? 148 LEU A CB    1 
ATOM   1665 C  CG    . LEU C 3 148 ? -2.008  36.757 20.250 1.00 34.55  ? 148 LEU A CG    1 
ATOM   1666 C  CD1   . LEU C 3 148 ? -2.343  38.228 20.042 1.00 32.32  ? 148 LEU A CD1   1 
ATOM   1667 C  CD2   . LEU C 3 148 ? -3.270  35.975 20.586 1.00 36.64  ? 148 LEU A CD2   1 
ATOM   1668 N  N     . ALA C 3 149 ? 1.589   35.200 18.927 1.00 36.57  ? 149 ALA A N     1 
ATOM   1669 C  CA    . ALA C 3 149 ? 2.765   34.638 19.588 1.00 37.83  ? 149 ALA A CA    1 
ATOM   1670 C  C     . ALA C 3 149 ? 3.983   35.523 19.345 1.00 38.26  ? 149 ALA A C     1 
ATOM   1671 O  O     . ALA C 3 149 ? 4.716   35.859 20.280 1.00 37.80  ? 149 ALA A O     1 
ATOM   1672 C  CB    . ALA C 3 149 ? 3.032   33.231 19.068 1.00 37.39  ? 149 ALA A CB    1 
ATOM   1673 N  N     . GLU C 3 150 ? 4.191   35.901 18.086 1.00 38.52  ? 150 GLU A N     1 
ATOM   1674 C  CA    . GLU C 3 150 ? 5.319   36.750 17.712 1.00 39.25  ? 150 GLU A CA    1 
ATOM   1675 C  C     . GLU C 3 150 ? 5.429   37.967 18.627 1.00 39.81  ? 150 GLU A C     1 
ATOM   1676 O  O     . GLU C 3 150 ? 6.521   38.320 19.074 1.00 39.64  ? 150 GLU A O     1 
ATOM   1677 C  CB    . GLU C 3 150 ? 5.173   37.208 16.257 1.00 39.78  ? 150 GLU A CB    1 
ATOM   1678 N  N     . ARG C 3 151 ? 4.295   38.604 18.906 1.00 40.48  ? 151 ARG A N     1 
ATOM   1679 C  CA    . ARG C 3 151 ? 4.279   39.778 19.773 1.00 41.44  ? 151 ARG A CA    1 
ATOM   1680 C  C     . ARG C 3 151 ? 4.240   39.411 21.259 1.00 41.54  ? 151 ARG A C     1 
ATOM   1681 O  O     . ARG C 3 151 ? 4.817   40.114 22.093 1.00 41.15  ? 151 ARG A O     1 
ATOM   1682 C  CB    . ARG C 3 151 ? 3.088   40.680 19.423 1.00 41.68  ? 151 ARG A CB    1 
ATOM   1683 C  CG    . ARG C 3 151 ? 3.265   41.473 18.129 1.00 41.34  ? 151 ARG A CG    1 
ATOM   1684 C  CD    . ARG C 3 151 ? 4.446   42.431 18.229 1.00 42.26  ? 151 ARG A CD    1 
ATOM   1685 N  NE    . ARG C 3 151 ? 4.235   43.483 19.223 1.00 43.75  ? 151 ARG A NE    1 
ATOM   1686 C  CZ    . ARG C 3 151 ? 3.558   44.608 18.999 1.00 46.43  ? 151 ARG A CZ    1 
ATOM   1687 N  NH1   . ARG C 3 151 ? 3.020   44.845 17.807 1.00 46.70  ? 151 ARG A NH1   1 
ATOM   1688 N  NH2   . ARG C 3 151 ? 3.412   45.499 19.970 1.00 46.67  ? 151 ARG A NH2   1 
ATOM   1689 N  N     . ALA C 3 152 ? 3.565   38.311 21.587 1.00 41.54  ? 152 ALA A N     1 
ATOM   1690 C  CA    . ALA C 3 152 ? 3.464   37.860 22.978 1.00 43.18  ? 152 ALA A CA    1 
ATOM   1691 C  C     . ALA C 3 152 ? 4.821   37.456 23.569 1.00 44.62  ? 152 ALA A C     1 
ATOM   1692 O  O     . ALA C 3 152 ? 5.225   37.961 24.621 1.00 44.50  ? 152 ALA A O     1 
ATOM   1693 C  CB    . ALA C 3 152 ? 2.490   36.689 23.078 1.00 39.70  ? 152 ALA A CB    1 
ATOM   1694 N  N     . VAL C 3 153 ? 5.515   36.547 22.885 1.00 46.46  ? 153 VAL A N     1 
ATOM   1695 C  CA    . VAL C 3 153 ? 6.818   36.054 23.333 1.00 48.95  ? 153 VAL A CA    1 
ATOM   1696 C  C     . VAL C 3 153 ? 7.941   37.055 23.075 1.00 49.44  ? 153 VAL A C     1 
ATOM   1697 O  O     . VAL C 3 153 ? 9.037   36.677 22.665 1.00 50.84  ? 153 VAL A O     1 
ATOM   1698 C  CB    . VAL C 3 153 ? 7.188   34.718 22.624 1.00 49.44  ? 153 VAL A CB    1 
ATOM   1699 C  CG1   . VAL C 3 153 ? 6.036   33.725 22.752 1.00 50.03  ? 153 VAL A CG1   1 
ATOM   1700 C  CG2   . VAL C 3 153 ? 7.524   34.972 21.151 1.00 48.04  ? 153 VAL A CG2   1 
ATOM   1701 N  N     . LYS C 3 154 ? 7.672   38.330 23.320 1.00 49.57  ? 154 LYS A N     1 
ATOM   1702 C  CA    . LYS C 3 154 ? 8.674   39.361 23.093 1.00 49.14  ? 154 LYS A CA    1 
ATOM   1703 C  C     . LYS C 3 154 ? 8.497   40.498 24.088 1.00 49.14  ? 154 LYS A C     1 
ATOM   1704 O  O     . LYS C 3 154 ? 9.260   41.465 24.082 1.00 49.57  ? 154 LYS A O     1 
ATOM   1705 C  CB    . LYS C 3 154 ? 8.555   39.891 21.658 1.00 49.34  ? 154 LYS A CB    1 
ATOM   1706 C  CG    . LYS C 3 154 ? 9.633   40.876 21.249 1.00 50.94  ? 154 LYS A CG    1 
ATOM   1707 N  N     . THR C 3 155 ? 7.486   40.380 24.943 1.00 48.33  ? 155 THR A N     1 
ATOM   1708 C  CA    . THR C 3 155 ? 7.223   41.412 25.938 1.00 47.77  ? 155 THR A CA    1 
ATOM   1709 C  C     . THR C 3 155 ? 6.814   40.829 27.283 1.00 46.80  ? 155 THR A C     1 
ATOM   1710 O  O     . THR C 3 155 ? 6.292   39.717 27.364 1.00 46.50  ? 155 THR A O     1 
ATOM   1711 C  CB    . THR C 3 155 ? 6.113   42.383 25.470 1.00 47.32  ? 155 THR A CB    1 
ATOM   1712 O  OG1   . THR C 3 155 ? 5.895   43.377 26.481 1.00 46.93  ? 155 THR A OG1   1 
ATOM   1713 C  CG2   . THR C 3 155 ? 4.815   41.630 25.211 1.00 45.91  ? 155 THR A CG2   1 
ATOM   1714 N  N     . LYS C 3 156 ? 7.049   41.601 28.336 1.00 46.49  ? 156 LYS A N     1 
ATOM   1715 C  CA    . LYS C 3 156 ? 6.721   41.175 29.686 1.00 45.15  ? 156 LYS A CA    1 
ATOM   1716 C  C     . LYS C 3 156 ? 5.377   41.714 30.165 1.00 43.82  ? 156 LYS A C     1 
ATOM   1717 O  O     . LYS C 3 156 ? 4.789   41.177 31.106 1.00 45.46  ? 156 LYS A O     1 
ATOM   1718 C  CB    . LYS C 3 156 ? 7.831   41.614 30.645 1.00 45.95  ? 156 LYS A CB    1 
ATOM   1719 C  CG    . LYS C 3 156 ? 8.260   43.068 30.474 1.00 44.52  ? 156 LYS A CG    1 
ATOM   1720 N  N     . ARG C 3 157 ? 4.884   42.767 29.520 1.00 40.95  ? 157 ARG A N     1 
ATOM   1721 C  CA    . ARG C 3 157 ? 3.611   43.356 29.927 1.00 38.04  ? 157 ARG A CA    1 
ATOM   1722 C  C     . ARG C 3 157 ? 2.445   42.374 29.908 1.00 34.37  ? 157 ARG A C     1 
ATOM   1723 O  O     . ARG C 3 157 ? 2.498   41.327 29.262 1.00 33.06  ? 157 ARG A O     1 
ATOM   1724 C  CB    . ARG C 3 157 ? 3.267   44.563 29.053 1.00 38.03  ? 157 ARG A CB    1 
ATOM   1725 C  CG    . ARG C 3 157 ? 3.047   44.248 27.592 1.00 38.64  ? 157 ARG A CG    1 
ATOM   1726 C  CD    . ARG C 3 157 ? 2.574   45.503 26.871 1.00 40.39  ? 157 ARG A CD    1 
ATOM   1727 N  NE    . ARG C 3 157 ? 2.601   45.360 25.419 1.00 39.58  ? 157 ARG A NE    1 
ATOM   1728 C  CZ    . ARG C 3 157 ? 2.106   46.256 24.573 1.00 37.81  ? 157 ARG A CZ    1 
ATOM   1729 N  NH1   . ARG C 3 157 ? 2.182   46.037 23.269 1.00 38.82  ? 157 ARG A NH1   1 
ATOM   1730 N  NH2   . ARG C 3 157 ? 1.534   47.364 25.028 1.00 36.58  ? 157 ARG A NH2   1 
ATOM   1731 N  N     . SER C 3 158 ? 1.386   42.735 30.625 1.00 31.99  ? 158 SER A N     1 
ATOM   1732 C  CA    . SER C 3 158 ? 0.191   41.906 30.724 1.00 30.04  ? 158 SER A CA    1 
ATOM   1733 C  C     . SER C 3 158 ? -0.349  41.544 29.354 1.00 28.59  ? 158 SER A C     1 
ATOM   1734 O  O     . SER C 3 158 ? -0.194  42.298 28.390 1.00 28.90  ? 158 SER A O     1 
ATOM   1735 C  CB    . SER C 3 158 ? -0.893  42.638 31.522 1.00 29.67  ? 158 SER A CB    1 
ATOM   1736 O  OG    . SER C 3 158 ? -1.299  43.826 30.864 1.00 31.02  ? 158 SER A OG    1 
ATOM   1737 N  N     . VAL C 3 159 ? -0.978  40.378 29.267 1.00 27.69  ? 159 VAL A N     1 
ATOM   1738 C  CA    . VAL C 3 159 ? -1.558  39.932 28.010 1.00 25.10  ? 159 VAL A CA    1 
ATOM   1739 C  C     . VAL C 3 159 ? -2.697  40.879 27.639 1.00 24.55  ? 159 VAL A C     1 
ATOM   1740 O  O     . VAL C 3 159 ? -3.048  40.996 26.472 1.00 25.84  ? 159 VAL A O     1 
ATOM   1741 C  CB    . VAL C 3 159 ? -2.097  38.495 28.128 1.00 26.50  ? 159 VAL A CB    1 
ATOM   1742 C  CG1   . VAL C 3 159 ? -3.171  38.436 29.211 1.00 25.12  ? 159 VAL A CG1   1 
ATOM   1743 C  CG2   . VAL C 3 159 ? -2.634  38.018 26.779 1.00 23.27  ? 159 VAL A CG2   1 
ATOM   1744 N  N     . LYS C 3 160 ? -3.265  41.566 28.631 1.00 24.25  ? 160 LYS A N     1 
ATOM   1745 C  CA    . LYS C 3 160 ? -4.347  42.508 28.364 1.00 23.32  ? 160 LYS A CA    1 
ATOM   1746 C  C     . LYS C 3 160 ? -3.820  43.754 27.651 1.00 25.21  ? 160 LYS A C     1 
ATOM   1747 O  O     . LYS C 3 160 ? -4.434  44.228 26.689 1.00 24.53  ? 160 LYS A O     1 
ATOM   1748 C  CB    . LYS C 3 160 ? -5.072  42.918 29.653 1.00 21.69  ? 160 LYS A CB    1 
ATOM   1749 C  CG    . LYS C 3 160 ? -6.085  44.050 29.420 1.00 22.14  ? 160 LYS A CG    1 
ATOM   1750 C  CD    . LYS C 3 160 ? -7.181  44.132 30.486 1.00 22.85  ? 160 LYS A CD    1 
ATOM   1751 C  CE    . LYS C 3 160 ? -8.195  45.215 30.124 1.00 22.28  ? 160 LYS A CE    1 
ATOM   1752 N  NZ    . LYS C 3 160 ? -9.405  45.216 30.991 1.00 21.08  ? 160 LYS A NZ    1 
ATOM   1753 N  N     . ALA C 3 161 ? -2.693  44.286 28.126 1.00 26.03  ? 161 ALA A N     1 
ATOM   1754 C  CA    . ALA C 3 161 ? -2.090  45.464 27.497 1.00 27.21  ? 161 ALA A CA    1 
ATOM   1755 C  C     . ALA C 3 161 ? -1.761  45.100 26.060 1.00 26.41  ? 161 ALA A C     1 
ATOM   1756 O  O     . ALA C 3 161 ? -1.943  45.905 25.149 1.00 28.59  ? 161 ALA A O     1 
ATOM   1757 C  CB    . ALA C 3 161 ? -0.825  45.880 28.229 1.00 25.66  ? 161 ALA A CB    1 
ATOM   1758 N  N     . LEU C 3 162 ? -1.291  43.873 25.865 1.00 26.15  ? 162 LEU A N     1 
ATOM   1759 C  CA    . LEU C 3 162 ? -0.950  43.389 24.534 1.00 27.33  ? 162 LEU A CA    1 
ATOM   1760 C  C     . LEU C 3 162 ? -2.160  43.428 23.591 1.00 26.74  ? 162 LEU A C     1 
ATOM   1761 O  O     . LEU C 3 162 ? -2.073  43.948 22.483 1.00 26.71  ? 162 LEU A O     1 
ATOM   1762 C  CB    . LEU C 3 162 ? -0.424  41.953 24.605 1.00 26.79  ? 162 LEU A CB    1 
ATOM   1763 C  CG    . LEU C 3 162 ? -0.033  41.342 23.258 1.00 28.86  ? 162 LEU A CG    1 
ATOM   1764 C  CD1   . LEU C 3 162 ? 1.293   41.936 22.804 1.00 29.76  ? 162 LEU A CD1   1 
ATOM   1765 C  CD2   . LEU C 3 162 ? 0.075   39.832 23.375 1.00 29.33  ? 162 LEU A CD2   1 
ATOM   1766 N  N     . LEU C 3 163 ? -3.283  42.872 24.038 1.00 26.61  ? 163 LEU A N     1 
ATOM   1767 C  CA    . LEU C 3 163 ? -4.499  42.821 23.223 1.00 26.56  ? 163 LEU A CA    1 
ATOM   1768 C  C     . LEU C 3 163 ? -5.142  44.174 22.939 1.00 25.19  ? 163 LEU A C     1 
ATOM   1769 O  O     . LEU C 3 163 ? -5.856  44.329 21.947 1.00 24.97  ? 163 LEU A O     1 
ATOM   1770 C  CB    . LEU C 3 163 ? -5.526  41.894 23.879 1.00 25.63  ? 163 LEU A CB    1 
ATOM   1771 C  CG    . LEU C 3 163 ? -5.483  40.405 23.517 1.00 26.55  ? 163 LEU A CG    1 
ATOM   1772 C  CD1   . LEU C 3 163 ? -4.058  39.932 23.265 1.00 23.02  ? 163 LEU A CD1   1 
ATOM   1773 C  CD2   . LEU C 3 163 ? -6.143  39.621 24.635 1.00 25.03  ? 163 LEU A CD2   1 
ATOM   1774 N  N     . LEU C 3 164 ? -4.891  45.146 23.812 1.00 23.75  ? 164 LEU A N     1 
ATOM   1775 C  CA    . LEU C 3 164 ? -5.443  46.485 23.651 1.00 21.52  ? 164 LEU A CA    1 
ATOM   1776 C  C     . LEU C 3 164 ? -4.565  47.297 22.698 1.00 21.83  ? 164 LEU A C     1 
ATOM   1777 O  O     . LEU C 3 164 ? -4.957  48.374 22.243 1.00 19.65  ? 164 LEU A O     1 
ATOM   1778 C  CB    . LEU C 3 164 ? -5.539  47.193 25.018 1.00 17.90  ? 164 LEU A CB    1 
ATOM   1779 C  CG    . LEU C 3 164 ? -6.601  46.681 26.007 1.00 18.55  ? 164 LEU A CG    1 
ATOM   1780 C  CD1   . LEU C 3 164 ? -6.388  47.280 27.397 1.00 15.39  ? 164 LEU A CD1   1 
ATOM   1781 C  CD2   . LEU C 3 164 ? -7.993  47.041 25.488 1.00 16.45  ? 164 LEU A CD2   1 
ATOM   1782 N  N     . ASP C 3 165 ? -3.384  46.764 22.393 1.00 22.23  ? 165 ASP A N     1 
ATOM   1783 C  CA    . ASP C 3 165 ? -2.435  47.438 21.509 1.00 23.41  ? 165 ASP A CA    1 
ATOM   1784 C  C     . ASP C 3 165 ? -2.873  47.310 20.058 1.00 21.03  ? 165 ASP A C     1 
ATOM   1785 O  O     . ASP C 3 165 ? -2.757  46.242 19.462 1.00 21.58  ? 165 ASP A O     1 
ATOM   1786 C  CB    . ASP C 3 165 ? -1.034  46.837 21.667 1.00 24.83  ? 165 ASP A CB    1 
ATOM   1787 C  CG    . ASP C 3 165 ? 0.053   47.719 21.064 1.00 28.48  ? 165 ASP A CG    1 
ATOM   1788 O  OD1   . ASP C 3 165 ? -0.151  48.252 19.951 1.00 27.73  ? 165 ASP A OD1   1 
ATOM   1789 O  OD2   . ASP C 3 165 ? 1.120   47.873 21.701 1.00 29.10  ? 165 ASP A OD2   1 
ATOM   1790 N  N     . GLN C 3 166 ? -3.359  48.407 19.488 1.00 20.23  ? 166 GLN A N     1 
ATOM   1791 C  CA    . GLN C 3 166 ? -3.823  48.396 18.104 1.00 19.80  ? 166 GLN A CA    1 
ATOM   1792 C  C     . GLN C 3 166 ? -2.761  47.987 17.072 1.00 20.79  ? 166 GLN A C     1 
ATOM   1793 O  O     . GLN C 3 166 ? -3.102  47.655 15.940 1.00 21.17  ? 166 GLN A O     1 
ATOM   1794 C  CB    . GLN C 3 166 ? -4.425  49.759 17.744 1.00 19.76  ? 166 GLN A CB    1 
ATOM   1795 C  CG    . GLN C 3 166 ? -5.608  50.164 18.642 1.00 19.68  ? 166 GLN A CG    1 
ATOM   1796 C  CD    . GLN C 3 166 ? -6.645  49.049 18.774 1.00 22.99  ? 166 GLN A CD    1 
ATOM   1797 O  OE1   . GLN C 3 166 ? -7.310  48.680 17.805 1.00 19.84  ? 166 GLN A OE1   1 
ATOM   1798 N  NE2   . GLN C 3 166 ? -6.774  48.503 19.979 1.00 23.22  ? 166 GLN A NE2   1 
ATOM   1799 N  N     . THR C 3 167 ? -1.484  47.992 17.452 1.00 21.98  ? 167 THR A N     1 
ATOM   1800 C  CA    . THR C 3 167 ? -0.423  47.588 16.517 1.00 23.88  ? 167 THR A CA    1 
ATOM   1801 C  C     . THR C 3 167 ? -0.285  46.063 16.457 1.00 25.05  ? 167 THR A C     1 
ATOM   1802 O  O     . THR C 3 167 ? 0.225   45.517 15.479 1.00 25.82  ? 167 THR A O     1 
ATOM   1803 C  CB    . THR C 3 167 ? 0.962   48.183 16.894 1.00 21.96  ? 167 THR A CB    1 
ATOM   1804 O  OG1   . THR C 3 167 ? 1.418   47.602 18.118 1.00 25.17  ? 167 THR A OG1   1 
ATOM   1805 C  CG2   . THR C 3 167 ? 0.872   49.697 17.065 1.00 20.76  ? 167 THR A CG2   1 
ATOM   1806 N  N     . VAL C 3 168 ? -0.733  45.376 17.505 1.00 25.80  ? 168 VAL A N     1 
ATOM   1807 C  CA    . VAL C 3 168 ? -0.665  43.917 17.542 1.00 26.29  ? 168 VAL A CA    1 
ATOM   1808 C  C     . VAL C 3 168 ? -1.792  43.361 16.687 1.00 26.77  ? 168 VAL A C     1 
ATOM   1809 O  O     . VAL C 3 168 ? -1.574  42.543 15.795 1.00 28.31  ? 168 VAL A O     1 
ATOM   1810 C  CB    . VAL C 3 168 ? -0.826  43.376 18.983 1.00 27.19  ? 168 VAL A CB    1 
ATOM   1811 C  CG1   . VAL C 3 168 ? -0.872  41.858 18.967 1.00 27.52  ? 168 VAL A CG1   1 
ATOM   1812 C  CG2   . VAL C 3 168 ? 0.321   43.855 19.851 1.00 25.66  ? 168 VAL A CG2   1 
ATOM   1813 N  N     . VAL C 3 169 ? -3.005  43.817 16.978 1.00 27.23  ? 169 VAL A N     1 
ATOM   1814 C  CA    . VAL C 3 169 ? -4.204  43.410 16.256 1.00 25.13  ? 169 VAL A CA    1 
ATOM   1815 C  C     . VAL C 3 169 ? -5.143  44.609 16.377 1.00 26.18  ? 169 VAL A C     1 
ATOM   1816 O  O     . VAL C 3 169 ? -5.195  45.253 17.427 1.00 26.55  ? 169 VAL A O     1 
ATOM   1817 C  CB    . VAL C 3 169 ? -4.819  42.128 16.890 1.00 27.17  ? 169 VAL A CB    1 
ATOM   1818 C  CG1   . VAL C 3 169 ? -5.146  42.369 18.359 1.00 26.43  ? 169 VAL A CG1   1 
ATOM   1819 C  CG2   . VAL C 3 169 ? -6.048  41.688 16.116 1.00 24.97  ? 169 VAL A CG2   1 
ATOM   1820 N  N     . ALA C 3 170 ? -5.865  44.929 15.308 1.00 25.78  ? 170 ALA A N     1 
ATOM   1821 C  CA    . ALA C 3 170 ? -6.754  46.093 15.323 1.00 24.42  ? 170 ALA A CA    1 
ATOM   1822 C  C     . ALA C 3 170 ? -8.223  45.811 15.632 1.00 24.24  ? 170 ALA A C     1 
ATOM   1823 O  O     . ALA C 3 170 ? -8.835  44.938 15.021 1.00 23.76  ? 170 ALA A O     1 
ATOM   1824 C  CB    . ALA C 3 170 ? -6.651  46.829 13.983 1.00 21.55  ? 170 ALA A CB    1 
ATOM   1825 N  N     . GLY C 3 171 ? -8.792  46.550 16.582 1.00 22.43  ? 171 GLY A N     1 
ATOM   1826 C  CA    . GLY C 3 171 ? -10.200 46.359 16.871 1.00 21.74  ? 171 GLY A CA    1 
ATOM   1827 C  C     . GLY C 3 171 ? -10.665 45.971 18.257 1.00 21.80  ? 171 GLY A C     1 
ATOM   1828 O  O     . GLY C 3 171 ? -11.835 46.194 18.584 1.00 20.05  ? 171 GLY A O     1 
ATOM   1829 N  N     . PHE C 3 172 ? -9.793  45.388 19.075 1.00 20.11  ? 172 PHE A N     1 
ATOM   1830 C  CA    . PHE C 3 172 ? -10.215 44.995 20.413 1.00 20.45  ? 172 PHE A CA    1 
ATOM   1831 C  C     . PHE C 3 172 ? -10.089 46.113 21.434 1.00 20.24  ? 172 PHE A C     1 
ATOM   1832 O  O     . PHE C 3 172 ? -9.096  46.833 21.456 1.00 19.92  ? 172 PHE A O     1 
ATOM   1833 C  CB    . PHE C 3 172 ? -9.427  43.769 20.892 1.00 22.37  ? 172 PHE A CB    1 
ATOM   1834 C  CG    . PHE C 3 172 ? -9.753  42.515 20.136 1.00 24.58  ? 172 PHE A CG    1 
ATOM   1835 C  CD1   . PHE C 3 172 ? -9.301  42.334 18.830 1.00 21.65  ? 172 PHE A CD1   1 
ATOM   1836 C  CD2   . PHE C 3 172 ? -10.558 41.531 20.712 1.00 23.33  ? 172 PHE A CD2   1 
ATOM   1837 C  CE1   . PHE C 3 172 ? -9.645  41.201 18.114 1.00 21.50  ? 172 PHE A CE1   1 
ATOM   1838 C  CE2   . PHE C 3 172 ? -10.907 40.391 19.995 1.00 21.45  ? 172 PHE A CE2   1 
ATOM   1839 C  CZ    . PHE C 3 172 ? -10.453 40.226 18.698 1.00 21.39  ? 172 PHE A CZ    1 
ATOM   1840 N  N     . GLY C 3 173 ? -11.111 46.245 22.275 1.00 20.79  ? 173 GLY A N     1 
ATOM   1841 C  CA    . GLY C 3 173 ? -11.119 47.263 23.316 1.00 20.45  ? 173 GLY A CA    1 
ATOM   1842 C  C     . GLY C 3 173 ? -11.317 46.636 24.691 1.00 21.52  ? 173 GLY A C     1 
ATOM   1843 O  O     . GLY C 3 173 ? -11.216 45.420 24.848 1.00 20.48  ? 173 GLY A O     1 
ATOM   1844 N  N     . ASN C 3 174 ? -11.630 47.456 25.688 1.00 21.64  ? 174 ASN A N     1 
ATOM   1845 C  CA    . ASN C 3 174 ? -11.803 46.959 27.048 1.00 21.51  ? 174 ASN A CA    1 
ATOM   1846 C  C     . ASN C 3 174 ? -12.806 45.815 27.202 1.00 22.19  ? 174 ASN A C     1 
ATOM   1847 O  O     . ASN C 3 174 ? -12.541 44.839 27.912 1.00 21.13  ? 174 ASN A O     1 
ATOM   1848 C  CB    . ASN C 3 174 ? -12.178 48.113 27.976 1.00 22.81  ? 174 ASN A CB    1 
ATOM   1849 C  CG    . ASN C 3 174 ? -11.602 47.942 29.364 1.00 24.92  ? 174 ASN A CG    1 
ATOM   1850 O  OD1   . ASN C 3 174 ? -10.498 47.416 29.515 1.00 26.04  ? 174 ASN A OD1   1 
ATOM   1851 N  ND2   . ASN C 3 174 ? -12.330 48.396 30.382 1.00 22.24  ? 174 ASN A ND2   1 
ATOM   1852 N  N     . ILE C 3 175 ? -13.953 45.928 26.545 1.00 20.65  ? 175 ILE A N     1 
ATOM   1853 C  CA    . ILE C 3 175 ? -14.963 44.882 26.630 1.00 21.06  ? 175 ILE A CA    1 
ATOM   1854 C  C     . ILE C 3 175 ? -14.500 43.559 26.006 1.00 22.04  ? 175 ILE A C     1 
ATOM   1855 O  O     . ILE C 3 175 ? -14.462 42.517 26.675 1.00 21.91  ? 175 ILE A O     1 
ATOM   1856 C  CB    . ILE C 3 175 ? -16.287 45.306 25.936 1.00 20.34  ? 175 ILE A CB    1 
ATOM   1857 C  CG1   . ILE C 3 175 ? -16.912 46.497 26.667 1.00 21.53  ? 175 ILE A CG1   1 
ATOM   1858 C  CG2   . ILE C 3 175 ? -17.278 44.137 25.925 1.00 19.19  ? 175 ILE A CG2   1 
ATOM   1859 C  CD1   . ILE C 3 175 ? -18.228 46.976 26.038 1.00 23.09  ? 175 ILE A CD1   1 
ATOM   1860 N  N     . TYR C 3 176 ? -14.136 43.600 24.730 1.00 20.43  ? 176 TYR A N     1 
ATOM   1861 C  CA    . TYR C 3 176 ? -13.734 42.386 24.034 1.00 19.85  ? 176 TYR A CA    1 
ATOM   1862 C  C     . TYR C 3 176 ? -12.416 41.753 24.446 1.00 20.41  ? 176 TYR A C     1 
ATOM   1863 O  O     . TYR C 3 176 ? -12.194 40.569 24.186 1.00 22.63  ? 176 TYR A O     1 
ATOM   1864 C  CB    . TYR C 3 176 ? -13.788 42.633 22.533 1.00 18.47  ? 176 TYR A CB    1 
ATOM   1865 C  CG    . TYR C 3 176 ? -15.180 43.024 22.124 1.00 18.31  ? 176 TYR A CG    1 
ATOM   1866 C  CD1   . TYR C 3 176 ? -15.424 44.217 21.453 1.00 20.17  ? 176 TYR A CD1   1 
ATOM   1867 C  CD2   . TYR C 3 176 ? -16.270 42.237 22.484 1.00 17.71  ? 176 TYR A CD2   1 
ATOM   1868 C  CE1   . TYR C 3 176 ? -16.726 44.622 21.156 1.00 20.49  ? 176 TYR A CE1   1 
ATOM   1869 C  CE2   . TYR C 3 176 ? -17.574 42.628 22.192 1.00 19.83  ? 176 TYR A CE2   1 
ATOM   1870 C  CZ    . TYR C 3 176 ? -17.793 43.825 21.530 1.00 19.54  ? 176 TYR A CZ    1 
ATOM   1871 O  OH    . TYR C 3 176 ? -19.076 44.236 21.262 1.00 19.27  ? 176 TYR A OH    1 
ATOM   1872 N  N     . VAL C 3 177 ? -11.539 42.521 25.081 1.00 18.85  ? 177 VAL A N     1 
ATOM   1873 C  CA    . VAL C 3 177 ? -10.291 41.947 25.551 1.00 18.83  ? 177 VAL A CA    1 
ATOM   1874 C  C     . VAL C 3 177 ? -10.623 41.124 26.811 1.00 18.82  ? 177 VAL A C     1 
ATOM   1875 O  O     . VAL C 3 177 ? -10.140 40.005 26.974 1.00 17.89  ? 177 VAL A O     1 
ATOM   1876 C  CB    . VAL C 3 177 ? -9.242  43.043 25.877 1.00 19.00  ? 177 VAL A CB    1 
ATOM   1877 C  CG1   . VAL C 3 177 ? -8.168  42.486 26.809 1.00 18.83  ? 177 VAL A CG1   1 
ATOM   1878 C  CG2   . VAL C 3 177 ? -8.587  43.533 24.581 1.00 15.40  ? 177 VAL A CG2   1 
ATOM   1879 N  N     . ASP C 3 178 ? -11.469 41.672 27.680 1.00 17.67  ? 178 ASP A N     1 
ATOM   1880 C  CA    . ASP C 3 178 ? -11.862 40.973 28.903 1.00 19.23  ? 178 ASP A CA    1 
ATOM   1881 C  C     . ASP C 3 178 ? -12.690 39.727 28.603 1.00 19.26  ? 178 ASP A C     1 
ATOM   1882 O  O     . ASP C 3 178 ? -12.552 38.711 29.279 1.00 19.60  ? 178 ASP A O     1 
ATOM   1883 C  CB    . ASP C 3 178 ? -12.656 41.899 29.826 1.00 17.74  ? 178 ASP A CB    1 
ATOM   1884 C  CG    . ASP C 3 178 ? -11.774 42.896 30.555 1.00 19.40  ? 178 ASP A CG    1 
ATOM   1885 O  OD1   . ASP C 3 178 ? -10.593 43.053 30.163 1.00 19.60  ? 178 ASP A OD1   1 
ATOM   1886 O  OD2   . ASP C 3 178 ? -12.266 43.531 31.515 1.00 18.55  ? 178 ASP A OD2   1 
ATOM   1887 N  N     . GLU C 3 179 ? -13.547 39.806 27.589 1.00 18.74  ? 179 GLU A N     1 
ATOM   1888 C  CA    . GLU C 3 179 ? -14.381 38.670 27.212 1.00 20.09  ? 179 GLU A CA    1 
ATOM   1889 C  C     . GLU C 3 179 ? -13.558 37.549 26.586 1.00 21.69  ? 179 GLU A C     1 
ATOM   1890 O  O     . GLU C 3 179 ? -13.768 36.372 26.887 1.00 23.85  ? 179 GLU A O     1 
ATOM   1891 C  CB    . GLU C 3 179 ? -15.473 39.105 26.234 1.00 16.65  ? 179 GLU A CB    1 
ATOM   1892 C  CG    . GLU C 3 179 ? -16.529 39.982 26.867 1.00 17.28  ? 179 GLU A CG    1 
ATOM   1893 C  CD    . GLU C 3 179 ? -17.359 39.233 27.893 1.00 19.41  ? 179 GLU A CD    1 
ATOM   1894 O  OE1   . GLU C 3 179 ? -17.598 39.786 28.995 1.00 17.33  ? 179 GLU A OE1   1 
ATOM   1895 O  OE2   . GLU C 3 179 ? -17.775 38.092 27.586 1.00 15.89  ? 179 GLU A OE2   1 
ATOM   1896 N  N     . SER C 3 180 ? -12.623 37.916 25.715 1.00 21.32  ? 180 SER A N     1 
ATOM   1897 C  CA    . SER C 3 180 ? -11.783 36.931 25.050 1.00 20.58  ? 180 SER A CA    1 
ATOM   1898 C  C     . SER C 3 180 ? -10.884 36.198 26.044 1.00 20.79  ? 180 SER A C     1 
ATOM   1899 O  O     . SER C 3 180 ? -10.737 34.978 25.977 1.00 21.42  ? 180 SER A O     1 
ATOM   1900 C  CB    . SER C 3 180 ? -10.935 37.610 23.974 1.00 20.38  ? 180 SER A CB    1 
ATOM   1901 O  OG    . SER C 3 180 ? -11.758 38.113 22.928 1.00 23.04  ? 180 SER A OG    1 
ATOM   1902 N  N     . LEU C 3 181 ? -10.280 36.939 26.963 1.00 19.26  ? 181 LEU A N     1 
ATOM   1903 C  CA    . LEU C 3 181 ? -9.416  36.322 27.948 1.00 19.76  ? 181 LEU A CA    1 
ATOM   1904 C  C     . LEU C 3 181 ? -10.245 35.385 28.833 1.00 21.52  ? 181 LEU A C     1 
ATOM   1905 O  O     . LEU C 3 181 ? -9.778  34.313 29.232 1.00 19.06  ? 181 LEU A O     1 
ATOM   1906 C  CB    . LEU C 3 181 ? -8.709  37.401 28.775 1.00 18.18  ? 181 LEU A CB    1 
ATOM   1907 C  CG    . LEU C 3 181 ? -7.642  38.166 27.973 1.00 20.15  ? 181 LEU A CG    1 
ATOM   1908 C  CD1   . LEU C 3 181 ? -7.227  39.442 28.703 1.00 18.45  ? 181 LEU A CD1   1 
ATOM   1909 C  CD2   . LEU C 3 181 ? -6.431  37.248 27.735 1.00 17.06  ? 181 LEU A CD2   1 
ATOM   1910 N  N     . PHE C 3 182 ? -11.484 35.775 29.123 1.00 21.98  ? 182 PHE A N     1 
ATOM   1911 C  CA    . PHE C 3 182 ? -12.334 34.921 29.941 1.00 23.24  ? 182 PHE A CA    1 
ATOM   1912 C  C     . PHE C 3 182 ? -12.623 33.627 29.199 1.00 23.59  ? 182 PHE A C     1 
ATOM   1913 O  O     . PHE C 3 182 ? -12.445 32.532 29.732 1.00 23.86  ? 182 PHE A O     1 
ATOM   1914 C  CB    . PHE C 3 182 ? -13.675 35.581 30.265 1.00 21.95  ? 182 PHE A CB    1 
ATOM   1915 C  CG    . PHE C 3 182 ? -14.646 34.641 30.919 1.00 23.85  ? 182 PHE A CG    1 
ATOM   1916 C  CD1   . PHE C 3 182 ? -14.545 34.350 32.278 1.00 23.28  ? 182 PHE A CD1   1 
ATOM   1917 C  CD2   . PHE C 3 182 ? -15.598 33.965 30.157 1.00 22.82  ? 182 PHE A CD2   1 
ATOM   1918 C  CE1   . PHE C 3 182 ? -15.375 33.391 32.870 1.00 24.56  ? 182 PHE A CE1   1 
ATOM   1919 C  CE2   . PHE C 3 182 ? -16.430 33.007 30.737 1.00 24.15  ? 182 PHE A CE2   1 
ATOM   1920 C  CZ    . PHE C 3 182 ? -16.316 32.719 32.098 1.00 24.76  ? 182 PHE A CZ    1 
ATOM   1921 N  N     . ARG C 3 183 ? -13.091 33.768 27.967 1.00 22.96  ? 183 ARG A N     1 
ATOM   1922 C  CA    . ARG C 3 183 ? -13.432 32.617 27.155 1.00 24.47  ? 183 ARG A CA    1 
ATOM   1923 C  C     . ARG C 3 183 ? -12.246 31.700 26.910 1.00 25.50  ? 183 ARG A C     1 
ATOM   1924 O  O     . ARG C 3 183 ? -12.428 30.496 26.737 1.00 24.38  ? 183 ARG A O     1 
ATOM   1925 C  CB    . ARG C 3 183 ? -14.052 33.091 25.840 1.00 24.67  ? 183 ARG A CB    1 
ATOM   1926 C  CG    . ARG C 3 183 ? -15.400 33.745 26.076 1.00 25.09  ? 183 ARG A CG    1 
ATOM   1927 C  CD    . ARG C 3 183 ? -15.922 34.482 24.874 1.00 27.24  ? 183 ARG A CD    1 
ATOM   1928 N  NE    . ARG C 3 183 ? -16.142 33.619 23.722 1.00 27.87  ? 183 ARG A NE    1 
ATOM   1929 C  CZ    . ARG C 3 183 ? -17.109 33.818 22.833 1.00 28.26  ? 183 ARG A CZ    1 
ATOM   1930 N  NH1   . ARG C 3 183 ? -17.938 34.842 22.985 1.00 26.70  ? 183 ARG A NH1   1 
ATOM   1931 N  NH2   . ARG C 3 183 ? -17.237 33.011 21.786 1.00 27.39  ? 183 ARG A NH2   1 
ATOM   1932 N  N     . ALA C 3 184 ? -11.039 32.269 26.913 1.00 25.19  ? 184 ALA A N     1 
ATOM   1933 C  CA    . ALA C 3 184 ? -9.817  31.493 26.709 1.00 26.41  ? 184 ALA A CA    1 
ATOM   1934 C  C     . ALA C 3 184 ? -9.272  30.968 28.039 1.00 26.27  ? 184 ALA A C     1 
ATOM   1935 O  O     . ALA C 3 184 ? -8.297  30.218 28.062 1.00 24.81  ? 184 ALA A O     1 
ATOM   1936 C  CB    . ALA C 3 184 ? -8.759  32.344 26.018 1.00 24.91  ? 184 ALA A CB    1 
ATOM   1937 N  N     . GLY C 3 185 ? -9.899  31.380 29.140 1.00 26.10  ? 185 GLY A N     1 
ATOM   1938 C  CA    . GLY C 3 185 ? -9.476  30.938 30.460 1.00 25.88  ? 185 GLY A CA    1 
ATOM   1939 C  C     . GLY C 3 185 ? -8.108  31.438 30.884 1.00 27.31  ? 185 GLY A C     1 
ATOM   1940 O  O     . GLY C 3 185 ? -7.348  30.709 31.528 1.00 27.41  ? 185 GLY A O     1 
ATOM   1941 N  N     . ILE C 3 186 ? -7.800  32.686 30.541 1.00 26.66  ? 186 ILE A N     1 
ATOM   1942 C  CA    . ILE C 3 186 ? -6.509  33.296 30.865 1.00 26.17  ? 186 ILE A CA    1 
ATOM   1943 C  C     . ILE C 3 186 ? -6.690  34.587 31.663 1.00 26.03  ? 186 ILE A C     1 
ATOM   1944 O  O     . ILE C 3 186 ? -7.462  35.463 31.267 1.00 26.23  ? 186 ILE A O     1 
ATOM   1945 C  CB    . ILE C 3 186 ? -5.729  33.638 29.575 1.00 27.04  ? 186 ILE A CB    1 
ATOM   1946 C  CG1   . ILE C 3 186 ? -5.606  32.397 28.688 1.00 26.13  ? 186 ILE A CG1   1 
ATOM   1947 C  CG2   . ILE C 3 186 ? -4.363  34.185 29.925 1.00 27.49  ? 186 ILE A CG2   1 
ATOM   1948 C  CD1   . ILE C 3 186 ? -5.104  32.701 27.270 1.00 24.95  ? 186 ILE A CD1   1 
ATOM   1949 N  N     . LEU C 3 187 ? -5.980  34.706 32.783 1.00 25.73  ? 187 LEU A N     1 
ATOM   1950 C  CA    . LEU C 3 187 ? -6.077  35.907 33.607 1.00 27.07  ? 187 LEU A CA    1 
ATOM   1951 C  C     . LEU C 3 187 ? -5.537  37.110 32.839 1.00 27.13  ? 187 LEU A C     1 
ATOM   1952 O  O     . LEU C 3 187 ? -4.501  37.028 32.180 1.00 27.52  ? 187 LEU A O     1 
ATOM   1953 C  CB    . LEU C 3 187 ? -5.300  35.737 34.915 1.00 26.13  ? 187 LEU A CB    1 
ATOM   1954 C  CG    . LEU C 3 187 ? -5.929  34.831 35.978 1.00 27.87  ? 187 LEU A CG    1 
ATOM   1955 C  CD1   . LEU C 3 187 ? -4.976  34.702 37.174 1.00 25.42  ? 187 LEU A CD1   1 
ATOM   1956 C  CD2   . LEU C 3 187 ? -7.269  35.415 36.416 1.00 26.56  ? 187 LEU A CD2   1 
ATOM   1957 N  N     . PRO C 3 188 ? -6.232  38.249 32.923 1.00 26.96  ? 188 PRO A N     1 
ATOM   1958 C  CA    . PRO C 3 188 ? -5.790  39.451 32.212 1.00 29.06  ? 188 PRO A CA    1 
ATOM   1959 C  C     . PRO C 3 188 ? -4.442  40.019 32.658 1.00 29.84  ? 188 PRO A C     1 
ATOM   1960 O  O     . PRO C 3 188 ? -3.676  40.530 31.840 1.00 30.12  ? 188 PRO A O     1 
ATOM   1961 C  CB    . PRO C 3 188 ? -6.950  40.426 32.439 1.00 27.44  ? 188 PRO A CB    1 
ATOM   1962 C  CG    . PRO C 3 188 ? -7.474  40.012 33.783 1.00 24.55  ? 188 PRO A CG    1 
ATOM   1963 C  CD    . PRO C 3 188 ? -7.461  38.511 33.695 1.00 25.09  ? 188 PRO A CD    1 
ATOM   1964 N  N     . GLY C 3 189 ? -4.143  39.904 33.945 1.00 31.23  ? 189 GLY A N     1 
ATOM   1965 C  CA    . GLY C 3 189 ? -2.902  40.450 34.464 1.00 32.30  ? 189 GLY A CA    1 
ATOM   1966 C  C     . GLY C 3 189 ? -1.602  39.703 34.229 1.00 33.87  ? 189 GLY A C     1 
ATOM   1967 O  O     . GLY C 3 189 ? -0.532  40.258 34.483 1.00 35.69  ? 189 GLY A O     1 
ATOM   1968 N  N     . ARG C 3 190 ? -1.651  38.469 33.745 1.00 33.76  ? 190 ARG A N     1 
ATOM   1969 C  CA    . ARG C 3 190 ? -0.398  37.755 33.552 1.00 35.72  ? 190 ARG A CA    1 
ATOM   1970 C  C     . ARG C 3 190 ? 0.401   38.139 32.320 1.00 35.78  ? 190 ARG A C     1 
ATOM   1971 O  O     . ARG C 3 190 ? -0.152  38.538 31.296 1.00 35.75  ? 190 ARG A O     1 
ATOM   1972 C  CB    . ARG C 3 190 ? -0.613  36.236 33.597 1.00 37.55  ? 190 ARG A CB    1 
ATOM   1973 C  CG    . ARG C 3 190 ? -1.785  35.698 32.831 1.00 38.23  ? 190 ARG A CG    1 
ATOM   1974 C  CD    . ARG C 3 190 ? -1.919  34.207 33.124 1.00 39.28  ? 190 ARG A CD    1 
ATOM   1975 N  NE    . ARG C 3 190 ? -0.734  33.476 32.683 1.00 37.69  ? 190 ARG A NE    1 
ATOM   1976 C  CZ    . ARG C 3 190 ? -0.778  32.322 32.029 1.00 37.22  ? 190 ARG A CZ    1 
ATOM   1977 N  NH1   . ARG C 3 190 ? -1.948  31.765 31.751 1.00 37.03  ? 190 ARG A NH1   1 
ATOM   1978 N  NH2   . ARG C 3 190 ? 0.340   31.743 31.616 1.00 38.46  ? 190 ARG A NH2   1 
ATOM   1979 N  N     . PRO C 3 191 ? 1.738   38.046 32.423 1.00 36.52  ? 191 PRO A N     1 
ATOM   1980 C  CA    . PRO C 3 191 ? 2.667   38.376 31.340 1.00 34.81  ? 191 PRO A CA    1 
ATOM   1981 C  C     . PRO C 3 191 ? 2.324   37.655 30.049 1.00 34.46  ? 191 PRO A C     1 
ATOM   1982 O  O     . PRO C 3 191 ? 2.069   36.451 30.052 1.00 35.02  ? 191 PRO A O     1 
ATOM   1983 C  CB    . PRO C 3 191 ? 4.016   37.947 31.911 1.00 34.61  ? 191 PRO A CB    1 
ATOM   1984 C  CG    . PRO C 3 191 ? 3.860   38.256 33.368 1.00 34.59  ? 191 PRO A CG    1 
ATOM   1985 C  CD    . PRO C 3 191 ? 2.477   37.702 33.654 1.00 35.55  ? 191 PRO A CD    1 
ATOM   1986 N  N     . ALA C 3 192 ? 2.309   38.400 28.947 1.00 33.22  ? 192 ALA A N     1 
ATOM   1987 C  CA    . ALA C 3 192 ? 1.999   37.827 27.646 1.00 33.11  ? 192 ALA A CA    1 
ATOM   1988 C  C     . ALA C 3 192 ? 3.041   36.770 27.299 1.00 34.43  ? 192 ALA A C     1 
ATOM   1989 O  O     . ALA C 3 192 ? 2.760   35.822 26.561 1.00 34.40  ? 192 ALA A O     1 
ATOM   1990 C  CB    . ALA C 3 192 ? 1.988   38.921 26.585 1.00 32.82  ? 192 ALA A CB    1 
ATOM   1991 N  N     . ALA C 3 193 ? 4.245   36.943 27.839 1.00 35.70  ? 193 ALA A N     1 
ATOM   1992 C  CA    . ALA C 3 193 ? 5.346   36.015 27.598 1.00 37.61  ? 193 ALA A CA    1 
ATOM   1993 C  C     . ALA C 3 193 ? 5.159   34.700 28.352 1.00 38.34  ? 193 ALA A C     1 
ATOM   1994 O  O     . ALA C 3 193 ? 5.782   33.693 28.014 1.00 40.05  ? 193 ALA A O     1 
ATOM   1995 C  CB    . ALA C 3 193 ? 6.668   36.660 28.002 1.00 37.81  ? 193 ALA A CB    1 
ATOM   1996 N  N     . SER C 3 194 ? 4.306   34.710 29.373 1.00 37.81  ? 194 SER A N     1 
ATOM   1997 C  CA    . SER C 3 194 ? 4.057   33.502 30.151 1.00 37.50  ? 194 SER A CA    1 
ATOM   1998 C  C     . SER C 3 194 ? 3.050   32.590 29.457 1.00 37.40  ? 194 SER A C     1 
ATOM   1999 O  O     . SER C 3 194 ? 2.862   31.451 29.863 1.00 37.73  ? 194 SER A O     1 
ATOM   2000 C  CB    . SER C 3 194 ? 3.532   33.856 31.546 1.00 37.41  ? 194 SER A CB    1 
ATOM   2001 O  OG    . SER C 3 194 ? 2.147   34.147 31.512 1.00 37.26  ? 194 SER A OG    1 
ATOM   2002 N  N     . LEU C 3 195 ? 2.398   33.087 28.411 1.00 37.84  ? 195 LEU A N     1 
ATOM   2003 C  CA    . LEU C 3 195 ? 1.415   32.279 27.700 1.00 38.60  ? 195 LEU A CA    1 
ATOM   2004 C  C     . LEU C 3 195 ? 2.037   31.180 26.855 1.00 38.93  ? 195 LEU A C     1 
ATOM   2005 O  O     . LEU C 3 195 ? 2.940   31.424 26.059 1.00 40.90  ? 195 LEU A O     1 
ATOM   2006 C  CB    . LEU C 3 195 ? 0.519   33.155 26.812 1.00 38.07  ? 195 LEU A CB    1 
ATOM   2007 C  CG    . LEU C 3 195 ? -0.780  33.656 27.457 1.00 38.80  ? 195 LEU A CG    1 
ATOM   2008 C  CD1   . LEU C 3 195 ? -0.470  34.727 28.486 1.00 38.67  ? 195 LEU A CD1   1 
ATOM   2009 C  CD2   . LEU C 3 195 ? -1.713  34.204 26.381 1.00 38.26  ? 195 LEU A CD2   1 
ATOM   2010 N  N     . SER C 3 196 ? 1.535   29.965 27.034 1.00 38.95  ? 196 SER A N     1 
ATOM   2011 C  CA    . SER C 3 196 ? 2.016   28.813 26.290 1.00 38.41  ? 196 SER A CA    1 
ATOM   2012 C  C     . SER C 3 196 ? 1.410   28.830 24.891 1.00 38.41  ? 196 SER A C     1 
ATOM   2013 O  O     . SER C 3 196 ? 0.445   29.550 24.634 1.00 39.38  ? 196 SER A O     1 
ATOM   2014 C  CB    . SER C 3 196 ? 1.605   27.524 26.999 1.00 36.83  ? 196 SER A CB    1 
ATOM   2015 O  OG    . SER C 3 196 ? 0.198   27.368 26.972 1.00 35.29  ? 196 SER A OG    1 
ATOM   2016 N  N     . SER C 3 197 ? 1.976   28.027 23.996 1.00 37.31  ? 197 SER A N     1 
ATOM   2017 C  CA    . SER C 3 197 ? 1.490   27.943 22.626 1.00 36.84  ? 197 SER A CA    1 
ATOM   2018 C  C     . SER C 3 197 ? 0.028   27.515 22.608 1.00 36.02  ? 197 SER A C     1 
ATOM   2019 O  O     . SER C 3 197 ? -0.750  27.966 21.768 1.00 36.81  ? 197 SER A O     1 
ATOM   2020 C  CB    . SER C 3 197 ? 2.331   26.939 21.824 1.00 35.24  ? 197 SER A CB    1 
ATOM   2021 N  N     . LYS C 3 198 ? -0.343  26.644 23.542 1.00 35.24  ? 198 LYS A N     1 
ATOM   2022 C  CA    . LYS C 3 198 ? -1.715  26.155 23.627 1.00 35.01  ? 198 LYS A CA    1 
ATOM   2023 C  C     . LYS C 3 198 ? -2.685  27.274 23.998 1.00 33.96  ? 198 LYS A C     1 
ATOM   2024 O  O     . LYS C 3 198 ? -3.762  27.391 23.417 1.00 34.12  ? 198 LYS A O     1 
ATOM   2025 C  CB    . LYS C 3 198 ? -1.811  25.029 24.660 1.00 34.62  ? 198 LYS A CB    1 
ATOM   2026 C  CG    . LYS C 3 198 ? -3.215  24.469 24.829 1.00 36.44  ? 198 LYS A CG    1 
ATOM   2027 N  N     . GLU C 3 199 ? -2.293  28.088 24.974 1.00 34.12  ? 199 GLU A N     1 
ATOM   2028 C  CA    . GLU C 3 199 ? -3.111  29.203 25.435 1.00 33.54  ? 199 GLU A CA    1 
ATOM   2029 C  C     . GLU C 3 199 ? -3.239  30.258 24.347 1.00 33.88  ? 199 GLU A C     1 
ATOM   2030 O  O     . GLU C 3 199 ? -4.324  30.797 24.114 1.00 32.38  ? 199 GLU A O     1 
ATOM   2031 C  CB    . GLU C 3 199 ? -2.499  29.815 26.703 1.00 32.51  ? 199 GLU A CB    1 
ATOM   2032 C  CG    . GLU C 3 199 ? -2.955  29.127 27.980 1.00 32.77  ? 199 GLU A CG    1 
ATOM   2033 C  CD    . GLU C 3 199 ? -2.156  29.542 29.193 1.00 31.88  ? 199 GLU A CD    1 
ATOM   2034 O  OE1   . GLU C 3 199 ? -2.739  29.575 30.298 1.00 31.54  ? 199 GLU A OE1   1 
ATOM   2035 O  OE2   . GLU C 3 199 ? -0.946  29.820 29.046 1.00 31.71  ? 199 GLU A OE2   1 
ATOM   2036 N  N     . ILE C 3 200 ? -2.126  30.543 23.677 1.00 33.61  ? 200 ILE A N     1 
ATOM   2037 C  CA    . ILE C 3 200 ? -2.116  31.524 22.603 1.00 33.43  ? 200 ILE A CA    1 
ATOM   2038 C  C     . ILE C 3 200 ? -3.073  31.099 21.494 1.00 33.65  ? 200 ILE A C     1 
ATOM   2039 O  O     . ILE C 3 200 ? -3.873  31.901 21.016 1.00 34.66  ? 200 ILE A O     1 
ATOM   2040 C  CB    . ILE C 3 200 ? -0.685  31.703 22.034 1.00 34.09  ? 200 ILE A CB    1 
ATOM   2041 C  CG1   . ILE C 3 200 ? 0.195   32.387 23.083 1.00 33.80  ? 200 ILE A CG1   1 
ATOM   2042 C  CG2   . ILE C 3 200 ? -0.717  32.522 20.754 1.00 31.98  ? 200 ILE A CG2   1 
ATOM   2043 C  CD1   . ILE C 3 200 ? 1.653   32.486 22.704 1.00 38.02  ? 200 ILE A CD1   1 
ATOM   2044 N  N     . GLU C 3 201 ? -3.009  29.835 21.096 1.00 34.32  ? 201 GLU A N     1 
ATOM   2045 C  CA    . GLU C 3 201 ? -3.891  29.343 20.040 1.00 34.91  ? 201 GLU A CA    1 
ATOM   2046 C  C     . GLU C 3 201 ? -5.351  29.432 20.484 1.00 34.25  ? 201 GLU A C     1 
ATOM   2047 O  O     . GLU C 3 201 ? -6.244  29.733 19.686 1.00 34.46  ? 201 GLU A O     1 
ATOM   2048 C  CB    . GLU C 3 201 ? -3.542  27.892 19.684 1.00 34.26  ? 201 GLU A CB    1 
ATOM   2049 N  N     . ARG C 3 202 ? -5.578  29.173 21.766 1.00 33.57  ? 202 ARG A N     1 
ATOM   2050 C  CA    . ARG C 3 202 ? -6.916  29.212 22.348 1.00 33.60  ? 202 ARG A CA    1 
ATOM   2051 C  C     . ARG C 3 202 ? -7.434  30.655 22.426 1.00 31.66  ? 202 ARG A C     1 
ATOM   2052 O  O     . ARG C 3 202 ? -8.598  30.926 22.132 1.00 30.80  ? 202 ARG A O     1 
ATOM   2053 C  CB    . ARG C 3 202 ? -6.876  28.578 23.746 1.00 35.26  ? 202 ARG A CB    1 
ATOM   2054 C  CG    . ARG C 3 202 ? -8.179  28.651 24.526 1.00 38.00  ? 202 ARG A CG    1 
ATOM   2055 C  CD    . ARG C 3 202 ? -9.310  27.888 23.853 1.00 41.97  ? 202 ARG A CD    1 
ATOM   2056 N  NE    . ARG C 3 202 ? -10.526 27.960 24.657 1.00 45.52  ? 202 ARG A NE    1 
ATOM   2057 C  CZ    . ARG C 3 202 ? -10.638 27.445 25.878 1.00 47.71  ? 202 ARG A CZ    1 
ATOM   2058 N  NH1   . ARG C 3 202 ? -9.610  26.810 26.429 1.00 49.19  ? 202 ARG A NH1   1 
ATOM   2059 N  NH2   . ARG C 3 202 ? -11.763 27.589 26.565 1.00 48.53  ? 202 ARG A NH2   1 
ATOM   2060 N  N     . LEU C 3 203 ? -6.558  31.571 22.825 1.00 29.52  ? 203 LEU A N     1 
ATOM   2061 C  CA    . LEU C 3 203 ? -6.907  32.981 22.930 1.00 28.65  ? 203 LEU A CA    1 
ATOM   2062 C  C     . LEU C 3 203 ? -7.255  33.539 21.550 1.00 29.29  ? 203 LEU A C     1 
ATOM   2063 O  O     . LEU C 3 203 ? -8.248  34.249 21.392 1.00 27.04  ? 203 LEU A O     1 
ATOM   2064 C  CB    . LEU C 3 203 ? -5.737  33.760 23.529 1.00 27.13  ? 203 LEU A CB    1 
ATOM   2065 C  CG    . LEU C 3 203 ? -5.851  35.284 23.604 1.00 27.30  ? 203 LEU A CG    1 
ATOM   2066 C  CD1   . LEU C 3 203 ? -7.070  35.702 24.428 1.00 23.44  ? 203 LEU A CD1   1 
ATOM   2067 C  CD2   . LEU C 3 203 ? -4.567  35.829 24.213 1.00 25.37  ? 203 LEU A CD2   1 
ATOM   2068 N  N     . HIS C 3 204 ? -6.435  33.204 20.555 1.00 30.17  ? 204 HIS A N     1 
ATOM   2069 C  CA    . HIS C 3 204 ? -6.659  33.660 19.187 1.00 28.78  ? 204 HIS A CA    1 
ATOM   2070 C  C     . HIS C 3 204 ? -8.031  33.205 18.708 1.00 29.43  ? 204 HIS A C     1 
ATOM   2071 O  O     . HIS C 3 204 ? -8.785  33.973 18.104 1.00 28.80  ? 204 HIS A O     1 
ATOM   2072 C  CB    . HIS C 3 204 ? -5.594  33.091 18.242 1.00 30.01  ? 204 HIS A CB    1 
ATOM   2073 C  CG    . HIS C 3 204 ? -5.945  33.227 16.791 1.00 30.01  ? 204 HIS A CG    1 
ATOM   2074 N  ND1   . HIS C 3 204 ? -5.740  34.391 16.080 1.00 30.33  ? 204 HIS A ND1   1 
ATOM   2075 C  CD2   . HIS C 3 204 ? -6.562  32.372 15.941 1.00 29.69  ? 204 HIS A CD2   1 
ATOM   2076 C  CE1   . HIS C 3 204 ? -6.217  34.248 14.857 1.00 29.17  ? 204 HIS A CE1   1 
ATOM   2077 N  NE2   . HIS C 3 204 ? -6.723  33.033 14.746 1.00 30.84  ? 204 HIS A NE2   1 
ATOM   2078 N  N     . GLU C 3 205 ? -8.348  31.943 18.975 1.00 29.08  ? 205 GLU A N     1 
ATOM   2079 C  CA    . GLU C 3 205 ? -9.625  31.385 18.561 1.00 28.58  ? 205 GLU A CA    1 
ATOM   2080 C  C     . GLU C 3 205 ? -10.803 32.084 19.249 1.00 28.00  ? 205 GLU A C     1 
ATOM   2081 O  O     . GLU C 3 205 ? -11.828 32.321 18.620 1.00 27.50  ? 205 GLU A O     1 
ATOM   2082 C  CB    . GLU C 3 205 ? -9.658  29.881 18.850 1.00 29.67  ? 205 GLU A CB    1 
ATOM   2083 C  CG    . GLU C 3 205 ? -10.916 29.177 18.344 1.00 31.05  ? 205 GLU A CG    1 
ATOM   2084 N  N     . GLU C 3 206 ? -10.661 32.411 20.533 1.00 27.57  ? 206 GLU A N     1 
ATOM   2085 C  CA    . GLU C 3 206 ? -11.737 33.094 21.257 1.00 29.45  ? 206 GLU A CA    1 
ATOM   2086 C  C     . GLU C 3 206 ? -11.850 34.548 20.814 1.00 28.15  ? 206 GLU A C     1 
ATOM   2087 O  O     . GLU C 3 206 ? -12.938 35.126 20.801 1.00 26.42  ? 206 GLU A O     1 
ATOM   2088 C  CB    . GLU C 3 206 ? -11.511 33.049 22.775 1.00 30.68  ? 206 GLU A CB    1 
ATOM   2089 C  CG    . GLU C 3 206 ? -11.735 31.690 23.400 1.00 32.13  ? 206 GLU A CG    1 
ATOM   2090 C  CD    . GLU C 3 206 ? -13.035 31.058 22.960 1.00 33.53  ? 206 GLU A CD    1 
ATOM   2091 O  OE1   . GLU C 3 206 ? -14.071 31.757 22.912 1.00 34.32  ? 206 GLU A OE1   1 
ATOM   2092 O  OE2   . GLU C 3 206 ? -13.023 29.850 22.666 1.00 37.91  ? 206 GLU A OE2   1 
ATOM   2093 N  N     . MET C 3 207 ? -10.716 35.140 20.461 1.00 27.87  ? 207 MET A N     1 
ATOM   2094 C  CA    . MET C 3 207 ? -10.710 36.517 20.003 1.00 27.32  ? 207 MET A CA    1 
ATOM   2095 C  C     . MET C 3 207 ? -11.510 36.625 18.709 1.00 27.91  ? 207 MET A C     1 
ATOM   2096 O  O     . MET C 3 207 ? -12.386 37.480 18.578 1.00 27.65  ? 207 MET A O     1 
ATOM   2097 C  CB    . MET C 3 207 ? -9.275  36.993 19.795 1.00 25.27  ? 207 MET A CB    1 
ATOM   2098 C  CG    . MET C 3 207 ? -8.532  37.222 21.109 1.00 27.12  ? 207 MET A CG    1 
ATOM   2099 S  SD    . MET C 3 207 ? -6.843  37.804 20.875 1.00 27.41  ? 207 MET A SD    1 
ATOM   2100 C  CE    . MET C 3 207 ? -7.160  39.455 20.253 1.00 28.08  ? 207 MET A CE    1 
ATOM   2101 N  N     . VAL C 3 208 ? -11.221 35.736 17.764 1.00 28.41  ? 208 VAL A N     1 
ATOM   2102 C  CA    . VAL C 3 208 ? -11.914 35.734 16.486 1.00 28.21  ? 208 VAL A CA    1 
ATOM   2103 C  C     . VAL C 3 208 ? -13.395 35.439 16.671 1.00 29.23  ? 208 VAL A C     1 
ATOM   2104 O  O     . VAL C 3 208 ? -14.244 36.107 16.082 1.00 30.39  ? 208 VAL A O     1 
ATOM   2105 C  CB    . VAL C 3 208 ? -11.315 34.680 15.525 1.00 29.43  ? 208 VAL A CB    1 
ATOM   2106 C  CG1   . VAL C 3 208 ? -12.188 34.554 14.274 1.00 27.97  ? 208 VAL A CG1   1 
ATOM   2107 C  CG2   . VAL C 3 208 ? -9.903  35.078 15.134 1.00 28.89  ? 208 VAL A CG2   1 
ATOM   2108 N  N     . ALA C 3 209 ? -13.700 34.439 17.493 1.00 28.64  ? 209 ALA A N     1 
ATOM   2109 C  CA    . ALA C 3 209 ? -15.083 34.044 17.747 1.00 28.47  ? 209 ALA A CA    1 
ATOM   2110 C  C     . ALA C 3 209 ? -15.894 35.153 18.418 1.00 28.02  ? 209 ALA A C     1 
ATOM   2111 O  O     . ALA C 3 209 ? -17.019 35.437 18.017 1.00 29.29  ? 209 ALA A O     1 
ATOM   2112 C  CB    . ALA C 3 209 ? -15.114 32.779 18.608 1.00 27.38  ? 209 ALA A CB    1 
ATOM   2113 N  N     . THR C 3 210 ? -15.318 35.770 19.441 1.00 26.46  ? 210 THR A N     1 
ATOM   2114 C  CA    . THR C 3 210 ? -15.983 36.843 20.171 1.00 26.38  ? 210 THR A CA    1 
ATOM   2115 C  C     . THR C 3 210 ? -16.276 38.055 19.279 1.00 26.23  ? 210 THR A C     1 
ATOM   2116 O  O     . THR C 3 210 ? -17.415 38.505 19.176 1.00 27.39  ? 210 THR A O     1 
ATOM   2117 C  CB    . THR C 3 210 ? -15.119 37.289 21.382 1.00 25.35  ? 210 THR A CB    1 
ATOM   2118 O  OG1   . THR C 3 210 ? -15.002 36.200 22.305 1.00 25.92  ? 210 THR A OG1   1 
ATOM   2119 C  CG2   . THR C 3 210 ? -15.739 38.493 22.096 1.00 25.72  ? 210 THR A CG2   1 
ATOM   2120 N  N     . ILE C 3 211 ? -15.245 38.577 18.630 1.00 26.80  ? 211 ILE A N     1 
ATOM   2121 C  CA    . ILE C 3 211 ? -15.419 39.740 17.776 1.00 27.19  ? 211 ILE A CA    1 
ATOM   2122 C  C     . ILE C 3 211 ? -16.400 39.412 16.644 1.00 27.83  ? 211 ILE A C     1 
ATOM   2123 O  O     . ILE C 3 211 ? -17.213 40.248 16.249 1.00 27.12  ? 211 ILE A O     1 
ATOM   2124 C  CB    . ILE C 3 211 ? -14.042 40.219 17.229 1.00 25.64  ? 211 ILE A CB    1 
ATOM   2125 C  CG1   . ILE C 3 211 ? -13.962 41.743 17.289 1.00 27.68  ? 211 ILE A CG1   1 
ATOM   2126 C  CG2   . ILE C 3 211 ? -13.835 39.755 15.812 1.00 26.97  ? 211 ILE A CG2   1 
ATOM   2127 C  CD1   . ILE C 3 211 ? -13.989 42.311 18.694 1.00 23.42  ? 211 ILE A CD1   1 
ATOM   2128 N  N     . GLY C 3 212 ? -16.344 38.180 16.147 1.00 28.61  ? 212 GLY A N     1 
ATOM   2129 C  CA    . GLY C 3 212 ? -17.247 37.780 15.084 1.00 27.65  ? 212 GLY A CA    1 
ATOM   2130 C  C     . GLY C 3 212 ? -18.692 37.737 15.550 1.00 27.83  ? 212 GLY A C     1 
ATOM   2131 O  O     . GLY C 3 212 ? -19.591 38.206 14.851 1.00 29.31  ? 212 GLY A O     1 
ATOM   2132 N  N     . GLU C 3 213 ? -18.922 37.168 16.730 1.00 26.17  ? 213 GLU A N     1 
ATOM   2133 C  CA    . GLU C 3 213 ? -20.269 37.081 17.281 1.00 25.26  ? 213 GLU A CA    1 
ATOM   2134 C  C     . GLU C 3 213 ? -20.815 38.472 17.614 1.00 24.18  ? 213 GLU A C     1 
ATOM   2135 O  O     . GLU C 3 213 ? -21.988 38.756 17.376 1.00 21.68  ? 213 GLU A O     1 
ATOM   2136 C  CB    . GLU C 3 213 ? -20.275 36.209 18.539 1.00 26.15  ? 213 GLU A CB    1 
ATOM   2137 C  CG    . GLU C 3 213 ? -19.883 34.760 18.294 1.00 28.65  ? 213 GLU A CG    1 
ATOM   2138 C  CD    . GLU C 3 213 ? -19.643 33.985 19.590 1.00 31.25  ? 213 GLU A CD    1 
ATOM   2139 O  OE1   . GLU C 3 213 ? -19.152 32.840 19.507 1.00 31.60  ? 213 GLU A OE1   1 
ATOM   2140 O  OE2   . GLU C 3 213 ? -19.946 34.516 20.685 1.00 29.13  ? 213 GLU A OE2   1 
ATOM   2141 N  N     . ALA C 3 214 ? -19.960 39.331 18.171 1.00 23.20  ? 214 ALA A N     1 
ATOM   2142 C  CA    . ALA C 3 214 ? -20.363 40.690 18.524 1.00 22.79  ? 214 ALA A CA    1 
ATOM   2143 C  C     . ALA C 3 214 ? -20.858 41.451 17.293 1.00 22.84  ? 214 ALA A C     1 
ATOM   2144 O  O     . ALA C 3 214 ? -21.815 42.219 17.371 1.00 20.27  ? 214 ALA A O     1 
ATOM   2145 C  CB    . ALA C 3 214 ? -19.199 41.429 19.165 1.00 23.13  ? 214 ALA A CB    1 
ATOM   2146 N  N     . VAL C 3 215 ? -20.203 41.240 16.155 1.00 24.94  ? 215 VAL A N     1 
ATOM   2147 C  CA    . VAL C 3 215 ? -20.607 41.899 14.915 1.00 25.44  ? 215 VAL A CA    1 
ATOM   2148 C  C     . VAL C 3 215 ? -22.039 41.491 14.558 1.00 27.41  ? 215 VAL A C     1 
ATOM   2149 O  O     . VAL C 3 215 ? -22.883 42.336 14.244 1.00 25.93  ? 215 VAL A O     1 
ATOM   2150 C  CB    . VAL C 3 215 ? -19.674 41.505 13.748 1.00 26.32  ? 215 VAL A CB    1 
ATOM   2151 C  CG1   . VAL C 3 215 ? -20.267 41.970 12.414 1.00 24.76  ? 215 VAL A CG1   1 
ATOM   2152 C  CG2   . VAL C 3 215 ? -18.293 42.114 13.960 1.00 24.42  ? 215 VAL A CG2   1 
ATOM   2153 N  N     . MET C 3 216 ? -22.300 40.187 14.616 1.00 28.66  ? 216 MET A N     1 
ATOM   2154 C  CA    . MET C 3 216 ? -23.610 39.637 14.292 1.00 30.34  ? 216 MET A CA    1 
ATOM   2155 C  C     . MET C 3 216 ? -24.706 40.228 15.165 1.00 29.80  ? 216 MET A C     1 
ATOM   2156 O  O     . MET C 3 216 ? -25.819 40.466 14.696 1.00 29.69  ? 216 MET A O     1 
ATOM   2157 C  CB    . MET C 3 216 ? -23.609 38.112 14.467 1.00 35.82  ? 216 MET A CB    1 
ATOM   2158 C  CG    . MET C 3 216 ? -22.580 37.367 13.624 1.00 42.99  ? 216 MET A CG    1 
ATOM   2159 S  SD    . MET C 3 216 ? -22.847 37.563 11.846 1.00 51.99  ? 216 MET A SD    1 
ATOM   2160 C  CE    . MET C 3 216 ? -24.330 36.550 11.625 1.00 49.81  ? 216 MET A CE    1 
ATOM   2161 N  N     . LYS C 3 217 ? -24.392 40.457 16.439 1.00 27.86  ? 217 LYS A N     1 
ATOM   2162 C  CA    . LYS C 3 217 ? -25.367 41.004 17.371 1.00 24.36  ? 217 LYS A CA    1 
ATOM   2163 C  C     . LYS C 3 217 ? -25.434 42.520 17.368 1.00 23.60  ? 217 LYS A C     1 
ATOM   2164 O  O     . LYS C 3 217 ? -26.061 43.116 18.243 1.00 23.19  ? 217 LYS A O     1 
ATOM   2165 C  CB    . LYS C 3 217 ? -25.079 40.505 18.788 1.00 25.80  ? 217 LYS A CB    1 
ATOM   2166 C  CG    . LYS C 3 217 ? -25.358 39.024 18.989 1.00 24.07  ? 217 LYS A CG    1 
ATOM   2167 N  N     . GLY C 3 218 ? -24.788 43.143 16.385 1.00 23.45  ? 218 GLY A N     1 
ATOM   2168 C  CA    . GLY C 3 218 ? -24.804 44.592 16.280 1.00 22.08  ? 218 GLY A CA    1 
ATOM   2169 C  C     . GLY C 3 218 ? -24.034 45.340 17.352 1.00 22.29  ? 218 GLY A C     1 
ATOM   2170 O  O     . GLY C 3 218 ? -24.339 46.496 17.656 1.00 21.84  ? 218 GLY A O     1 
ATOM   2171 N  N     . GLY C 3 219 ? -23.036 44.684 17.932 1.00 21.94  ? 219 GLY A N     1 
ATOM   2172 C  CA    . GLY C 3 219 ? -22.238 45.327 18.958 1.00 21.58  ? 219 GLY A CA    1 
ATOM   2173 C  C     . GLY C 3 219 ? -22.859 45.274 20.341 1.00 22.14  ? 219 GLY A C     1 
ATOM   2174 O  O     . GLY C 3 219 ? -23.975 44.781 20.525 1.00 21.92  ? 219 GLY A O     1 
ATOM   2175 N  N     . SER C 3 220 ? -22.123 45.789 21.317 1.00 20.15  ? 220 SER A N     1 
ATOM   2176 C  CA    . SER C 3 220 ? -22.573 45.809 22.697 1.00 21.16  ? 220 SER A CA    1 
ATOM   2177 C  C     . SER C 3 220 ? -22.957 47.211 23.164 1.00 22.01  ? 220 SER A C     1 
ATOM   2178 O  O     . SER C 3 220 ? -22.166 48.150 23.069 1.00 20.09  ? 220 SER A O     1 
ATOM   2179 C  CB    . SER C 3 220 ? -21.473 45.282 23.620 1.00 20.50  ? 220 SER A CB    1 
ATOM   2180 O  OG    . SER C 3 220 ? -21.090 43.965 23.286 1.00 25.59  ? 220 SER A OG    1 
ATOM   2181 N  N     . THR C 3 221 ? -24.182 47.348 23.658 1.00 23.82  ? 221 THR A N     1 
ATOM   2182 C  CA    . THR C 3 221 ? -24.640 48.619 24.192 1.00 23.96  ? 221 THR A CA    1 
ATOM   2183 C  C     . THR C 3 221 ? -24.605 48.453 25.703 1.00 23.78  ? 221 THR A C     1 
ATOM   2184 O  O     . THR C 3 221 ? -25.461 47.782 26.276 1.00 25.21  ? 221 THR A O     1 
ATOM   2185 C  CB    . THR C 3 221 ? -26.082 48.953 23.754 1.00 25.20  ? 221 THR A CB    1 
ATOM   2186 O  OG1   . THR C 3 221 ? -26.086 49.356 22.379 1.00 21.86  ? 221 THR A OG1   1 
ATOM   2187 C  CG2   . THR C 3 221 ? -26.655 50.075 24.624 1.00 23.83  ? 221 THR A CG2   1 
ATOM   2188 N  N     . VAL C 3 222 ? -23.600 49.040 26.342 1.00 23.88  ? 222 VAL A N     1 
ATOM   2189 C  CA    . VAL C 3 222 ? -23.469 48.945 27.786 1.00 26.14  ? 222 VAL A CA    1 
ATOM   2190 C  C     . VAL C 3 222 ? -23.694 50.305 28.444 1.00 29.49  ? 222 VAL A C     1 
ATOM   2191 O  O     . VAL C 3 222 ? -24.139 50.386 29.590 1.00 31.91  ? 222 VAL A O     1 
ATOM   2192 C  CB    . VAL C 3 222 ? -22.065 48.395 28.198 1.00 26.41  ? 222 VAL A CB    1 
ATOM   2193 C  CG1   . VAL C 3 222 ? -21.914 46.950 27.726 1.00 23.39  ? 222 VAL A CG1   1 
ATOM   2194 C  CG2   . VAL C 3 222 ? -20.955 49.267 27.606 1.00 25.17  ? 222 VAL A CG2   1 
ATOM   2195 N  N     . ARG C 3 223 ? -23.394 51.373 27.716 1.00 30.27  ? 223 ARG A N     1 
ATOM   2196 C  CA    . ARG C 3 223 ? -23.570 52.718 28.240 1.00 31.24  ? 223 ARG A CA    1 
ATOM   2197 C  C     . ARG C 3 223 ? -24.297 53.642 27.266 1.00 31.03  ? 223 ARG A C     1 
ATOM   2198 O  O     . ARG C 3 223 ? -25.435 54.031 27.515 1.00 32.44  ? 223 ARG A O     1 
ATOM   2199 C  CB    . ARG C 3 223 ? -22.217 53.350 28.580 1.00 33.11  ? 223 ARG A CB    1 
ATOM   2200 C  CG    . ARG C 3 223 ? -21.434 52.662 29.682 1.00 37.56  ? 223 ARG A CG    1 
ATOM   2201 C  CD    . ARG C 3 223 ? -20.008 53.206 29.758 1.00 38.50  ? 223 ARG A CD    1 
ATOM   2202 N  NE    . ARG C 3 223 ? -19.957 54.609 30.168 1.00 43.51  ? 223 ARG A NE    1 
ATOM   2203 C  CZ    . ARG C 3 223 ? -20.144 55.039 31.416 1.00 45.24  ? 223 ARG A CZ    1 
ATOM   2204 N  NH1   . ARG C 3 223 ? -20.398 54.174 32.393 1.00 45.05  ? 223 ARG A NH1   1 
ATOM   2205 N  NH2   . ARG C 3 223 ? -20.072 56.336 31.690 1.00 43.99  ? 223 ARG A NH2   1 
ATOM   2206 N  N     . THR C 3 224 ? -23.644 53.973 26.152 1.00 28.60  ? 224 THR A N     1 
ATOM   2207 C  CA    . THR C 3 224 ? -24.212 54.910 25.185 1.00 26.04  ? 224 THR A CA    1 
ATOM   2208 C  C     . THR C 3 224 ? -24.061 54.560 23.703 1.00 26.26  ? 224 THR A C     1 
ATOM   2209 O  O     . THR C 3 224 ? -24.243 55.428 22.846 1.00 25.76  ? 224 THR A O     1 
ATOM   2210 C  CB    . THR C 3 224 ? -23.582 56.300 25.381 1.00 25.15  ? 224 THR A CB    1 
ATOM   2211 O  OG1   . THR C 3 224 ? -22.160 56.189 25.237 1.00 23.06  ? 224 THR A OG1   1 
ATOM   2212 C  CG2   . THR C 3 224 ? -23.886 56.848 26.771 1.00 23.28  ? 224 THR A CG2   1 
ATOM   2213 N  N     . TYR C 3 225 ? -23.719 53.317 23.384 1.00 24.03  ? 225 TYR A N     1 
ATOM   2214 C  CA    . TYR C 3 225 ? -23.560 52.951 21.985 1.00 22.84  ? 225 TYR A CA    1 
ATOM   2215 C  C     . TYR C 3 225 ? -24.862 52.532 21.325 1.00 23.85  ? 225 TYR A C     1 
ATOM   2216 O  O     . TYR C 3 225 ? -25.664 51.803 21.909 1.00 24.27  ? 225 TYR A O     1 
ATOM   2217 C  CB    . TYR C 3 225 ? -22.522 51.833 21.814 1.00 21.18  ? 225 TYR A CB    1 
ATOM   2218 C  CG    . TYR C 3 225 ? -22.674 51.068 20.519 1.00 18.75  ? 225 TYR A CG    1 
ATOM   2219 C  CD1   . TYR C 3 225 ? -23.358 49.856 20.488 1.00 20.33  ? 225 TYR A CD1   1 
ATOM   2220 C  CD2   . TYR C 3 225 ? -22.199 51.592 19.313 1.00 20.12  ? 225 TYR A CD2   1 
ATOM   2221 C  CE1   . TYR C 3 225 ? -23.575 49.179 19.291 1.00 21.72  ? 225 TYR A CE1   1 
ATOM   2222 C  CE2   . TYR C 3 225 ? -22.414 50.927 18.099 1.00 20.12  ? 225 TYR A CE2   1 
ATOM   2223 C  CZ    . TYR C 3 225 ? -23.105 49.721 18.097 1.00 23.17  ? 225 TYR A CZ    1 
ATOM   2224 O  OH    . TYR C 3 225 ? -23.358 49.065 16.911 1.00 23.69  ? 225 TYR A OH    1 
ATOM   2225 N  N     . VAL C 3 226 ? -25.049 53.015 20.099 1.00 22.83  ? 226 VAL A N     1 
ATOM   2226 C  CA    . VAL C 3 226 ? -26.215 52.717 19.277 1.00 22.06  ? 226 VAL A CA    1 
ATOM   2227 C  C     . VAL C 3 226 ? -25.711 52.789 17.835 1.00 23.31  ? 226 VAL A C     1 
ATOM   2228 O  O     . VAL C 3 226 ? -24.709 53.457 17.560 1.00 21.09  ? 226 VAL A O     1 
ATOM   2229 C  CB    . VAL C 3 226 ? -27.364 53.770 19.475 1.00 21.94  ? 226 VAL A CB    1 
ATOM   2230 C  CG1   . VAL C 3 226 ? -27.874 53.738 20.907 1.00 20.19  ? 226 VAL A CG1   1 
ATOM   2231 C  CG2   . VAL C 3 226 ? -26.870 55.168 19.147 1.00 20.01  ? 226 VAL A CG2   1 
ATOM   2232 N  N     . ASN C 3 227 ? -26.377 52.090 16.921 1.00 24.48  ? 227 ASN A N     1 
ATOM   2233 C  CA    . ASN C 3 227 ? -25.968 52.136 15.526 1.00 27.12  ? 227 ASN A CA    1 
ATOM   2234 C  C     . ASN C 3 227 ? -26.472 53.456 14.943 1.00 27.61  ? 227 ASN A C     1 
ATOM   2235 O  O     . ASN C 3 227 ? -27.079 54.261 15.654 1.00 28.35  ? 227 ASN A O     1 
ATOM   2236 C  CB    . ASN C 3 227 ? -26.535 50.946 14.741 1.00 26.02  ? 227 ASN A CB    1 
ATOM   2237 C  CG    . ASN C 3 227 ? -28.039 50.899 14.762 1.00 27.58  ? 227 ASN A CG    1 
ATOM   2238 O  OD1   . ASN C 3 227 ? -28.704 51.936 14.757 1.00 29.69  ? 227 ASN A OD1   1 
ATOM   2239 N  ND2   . ASN C 3 227 ? -28.591 49.695 14.769 1.00 25.72  ? 227 ASN A ND2   1 
ATOM   2240 N  N     . THR C 3 228 ? -26.222 53.678 13.657 1.00 28.88  ? 228 THR A N     1 
ATOM   2241 C  CA    . THR C 3 228 ? -26.631 54.916 12.997 1.00 29.87  ? 228 THR A CA    1 
ATOM   2242 C  C     . THR C 3 228 ? -28.134 55.185 13.086 1.00 31.26  ? 228 THR A C     1 
ATOM   2243 O  O     . THR C 3 228 ? -28.565 56.336 13.058 1.00 31.27  ? 228 THR A O     1 
ATOM   2244 C  CB    . THR C 3 228 ? -26.201 54.918 11.513 1.00 28.48  ? 228 THR A CB    1 
ATOM   2245 O  OG1   . THR C 3 228 ? -24.806 54.599 11.424 1.00 25.20  ? 228 THR A OG1   1 
ATOM   2246 C  CG2   . THR C 3 228 ? -26.426 56.296 10.893 1.00 26.85  ? 228 THR A CG2   1 
ATOM   2247 N  N     . GLN C 3 229 ? -28.926 54.124 13.202 1.00 33.46  ? 229 GLN A N     1 
ATOM   2248 C  CA    . GLN C 3 229 ? -30.377 54.256 13.308 1.00 35.54  ? 229 GLN A CA    1 
ATOM   2249 C  C     . GLN C 3 229 ? -30.775 54.572 14.749 1.00 35.81  ? 229 GLN A C     1 
ATOM   2250 O  O     . GLN C 3 229 ? -31.959 54.660 15.067 1.00 36.08  ? 229 GLN A O     1 
ATOM   2251 C  CB    . GLN C 3 229 ? -31.065 52.958 12.884 1.00 37.57  ? 229 GLN A CB    1 
ATOM   2252 C  CG    . GLN C 3 229 ? -30.447 52.280 11.674 1.00 42.02  ? 229 GLN A CG    1 
ATOM   2253 C  CD    . GLN C 3 229 ? -30.409 53.176 10.460 1.00 43.29  ? 229 GLN A CD    1 
ATOM   2254 O  OE1   . GLN C 3 229 ? -31.439 53.678 10.012 1.00 47.36  ? 229 GLN A OE1   1 
ATOM   2255 N  NE2   . GLN C 3 229 ? -29.217 53.382 9.916  1.00 45.38  ? 229 GLN A NE2   1 
ATOM   2256 N  N     . GLY C 3 230 ? -29.784 54.738 15.619 1.00 35.99  ? 230 GLY A N     1 
ATOM   2257 C  CA    . GLY C 3 230 ? -30.067 55.028 17.014 1.00 35.40  ? 230 GLY A CA    1 
ATOM   2258 C  C     . GLY C 3 230 ? -30.451 53.759 17.750 1.00 35.12  ? 230 GLY A C     1 
ATOM   2259 O  O     . GLY C 3 230 ? -30.910 53.796 18.893 1.00 35.78  ? 230 GLY A O     1 
ATOM   2260 N  N     . GLU C 3 231 ? -30.252 52.625 17.092 1.00 34.40  ? 231 GLU A N     1 
ATOM   2261 C  CA    . GLU C 3 231 ? -30.589 51.335 17.680 1.00 35.83  ? 231 GLU A CA    1 
ATOM   2262 C  C     . GLU C 3 231 ? -29.455 50.717 18.504 1.00 34.78  ? 231 GLU A C     1 
ATOM   2263 O  O     . GLU C 3 231 ? -28.279 50.851 18.171 1.00 34.83  ? 231 GLU A O     1 
ATOM   2264 C  CB    . GLU C 3 231 ? -31.003 50.368 16.576 1.00 37.11  ? 231 GLU A CB    1 
ATOM   2265 C  CG    . GLU C 3 231 ? -32.244 50.798 15.830 1.00 38.67  ? 231 GLU A CG    1 
ATOM   2266 C  CD    . GLU C 3 231 ? -32.514 49.924 14.634 1.00 41.64  ? 231 GLU A CD    1 
ATOM   2267 O  OE1   . GLU C 3 231 ? -33.658 49.946 14.129 1.00 45.83  ? 231 GLU A OE1   1 
ATOM   2268 O  OE2   . GLU C 3 231 ? -31.579 49.219 14.193 1.00 43.00  ? 231 GLU A OE2   1 
ATOM   2269 N  N     . ALA C 3 232 ? -29.827 50.034 19.582 1.00 32.02  ? 232 ALA A N     1 
ATOM   2270 C  CA    . ALA C 3 232 ? -28.859 49.393 20.455 1.00 30.36  ? 232 ALA A CA    1 
ATOM   2271 C  C     . ALA C 3 232 ? -28.447 48.020 19.927 1.00 28.84  ? 232 ALA A C     1 
ATOM   2272 O  O     . ALA C 3 232 ? -29.192 47.376 19.189 1.00 28.71  ? 232 ALA A O     1 
ATOM   2273 C  CB    . ALA C 3 232 ? -29.445 49.256 21.860 1.00 30.32  ? 232 ALA A CB    1 
ATOM   2274 N  N     . GLY C 3 233 ? -27.246 47.587 20.297 1.00 27.36  ? 233 GLY A N     1 
ATOM   2275 C  CA    . GLY C 3 233 ? -26.782 46.278 19.881 1.00 26.06  ? 233 GLY A CA    1 
ATOM   2276 C  C     . GLY C 3 233 ? -27.360 45.310 20.891 1.00 25.18  ? 233 GLY A C     1 
ATOM   2277 O  O     . GLY C 3 233 ? -28.146 45.721 21.742 1.00 25.69  ? 233 GLY A O     1 
ATOM   2278 N  N     . THR C 3 234 ? -26.990 44.039 20.823 1.00 25.59  ? 234 THR A N     1 
ATOM   2279 C  CA    . THR C 3 234 ? -27.526 43.072 21.782 1.00 25.42  ? 234 THR A CA    1 
ATOM   2280 C  C     . THR C 3 234 ? -26.482 42.112 22.336 1.00 24.23  ? 234 THR A C     1 
ATOM   2281 O  O     . THR C 3 234 ? -26.815 41.193 23.080 1.00 25.58  ? 234 THR A O     1 
ATOM   2282 C  CB    . THR C 3 234 ? -28.663 42.232 21.158 1.00 25.92  ? 234 THR A CB    1 
ATOM   2283 O  OG1   . THR C 3 234 ? -28.147 41.456 20.064 1.00 26.12  ? 234 THR A OG1   1 
ATOM   2284 C  CG2   . THR C 3 234 ? -29.781 43.140 20.667 1.00 24.69  ? 234 THR A CG2   1 
ATOM   2285 N  N     . PHE C 3 235 ? -25.220 42.321 21.987 1.00 24.21  ? 235 PHE A N     1 
ATOM   2286 C  CA    . PHE C 3 235 ? -24.180 41.426 22.471 1.00 24.62  ? 235 PHE A CA    1 
ATOM   2287 C  C     . PHE C 3 235 ? -23.945 41.578 23.966 1.00 23.85  ? 235 PHE A C     1 
ATOM   2288 O  O     . PHE C 3 235 ? -23.351 40.696 24.582 1.00 23.32  ? 235 PHE A O     1 
ATOM   2289 C  CB    . PHE C 3 235 ? -22.868 41.648 21.710 1.00 25.48  ? 235 PHE A CB    1 
ATOM   2290 C  CG    . PHE C 3 235 ? -21.843 40.572 21.948 1.00 24.21  ? 235 PHE A CG    1 
ATOM   2291 C  CD1   . PHE C 3 235 ? -20.804 40.767 22.849 1.00 21.84  ? 235 PHE A CD1   1 
ATOM   2292 C  CD2   . PHE C 3 235 ? -21.936 39.349 21.285 1.00 24.00  ? 235 PHE A CD2   1 
ATOM   2293 C  CE1   . PHE C 3 235 ? -19.870 39.758 23.089 1.00 23.82  ? 235 PHE A CE1   1 
ATOM   2294 C  CE2   . PHE C 3 235 ? -21.009 38.332 21.516 1.00 22.50  ? 235 PHE A CE2   1 
ATOM   2295 C  CZ    . PHE C 3 235 ? -19.974 38.537 22.420 1.00 22.65  ? 235 PHE A CZ    1 
ATOM   2296 N  N     . GLN C 3 236 ? -24.418 42.679 24.550 1.00 23.25  ? 236 GLN A N     1 
ATOM   2297 C  CA    . GLN C 3 236 ? -24.239 42.901 25.982 1.00 26.28  ? 236 GLN A CA    1 
ATOM   2298 C  C     . GLN C 3 236 ? -24.933 41.800 26.775 1.00 27.61  ? 236 GLN A C     1 
ATOM   2299 O  O     . GLN C 3 236 ? -24.614 41.566 27.935 1.00 29.80  ? 236 GLN A O     1 
ATOM   2300 C  CB    . GLN C 3 236 ? -24.778 44.274 26.421 1.00 26.29  ? 236 GLN A CB    1 
ATOM   2301 C  CG    . GLN C 3 236 ? -26.272 44.479 26.212 1.00 25.84  ? 236 GLN A CG    1 
ATOM   2302 C  CD    . GLN C 3 236 ? -26.604 44.994 24.825 1.00 26.38  ? 236 GLN A CD    1 
ATOM   2303 O  OE1   . GLN C 3 236 ? -25.777 44.930 23.907 1.00 24.39  ? 236 GLN A OE1   1 
ATOM   2304 N  NE2   . GLN C 3 236 ? -27.822 45.503 24.662 1.00 22.44  ? 236 GLN A NE2   1 
ATOM   2305 N  N     . HIS C 3 237 ? -25.876 41.115 26.141 1.00 28.53  ? 237 HIS A N     1 
ATOM   2306 C  CA    . HIS C 3 237 ? -26.586 40.028 26.800 1.00 29.17  ? 237 HIS A CA    1 
ATOM   2307 C  C     . HIS C 3 237 ? -25.745 38.762 26.742 1.00 29.79  ? 237 HIS A C     1 
ATOM   2308 O  O     . HIS C 3 237 ? -26.075 37.762 27.375 1.00 31.06  ? 237 HIS A O     1 
ATOM   2309 C  CB    . HIS C 3 237 ? -27.931 39.770 26.117 1.00 28.23  ? 237 HIS A CB    1 
ATOM   2310 C  CG    . HIS C 3 237 ? -28.857 40.945 26.153 1.00 30.43  ? 237 HIS A CG    1 
ATOM   2311 N  ND1   . HIS C 3 237 ? -29.186 41.596 27.322 1.00 31.01  ? 237 HIS A ND1   1 
ATOM   2312 C  CD2   . HIS C 3 237 ? -29.519 41.590 25.162 1.00 30.22  ? 237 HIS A CD2   1 
ATOM   2313 C  CE1   . HIS C 3 237 ? -30.011 42.592 27.050 1.00 30.97  ? 237 HIS A CE1   1 
ATOM   2314 N  NE2   . HIS C 3 237 ? -30.229 42.610 25.747 1.00 29.28  ? 237 HIS A NE2   1 
ATOM   2315 N  N     . HIS C 3 238 ? -24.656 38.808 25.984 1.00 28.14  ? 238 HIS A N     1 
ATOM   2316 C  CA    . HIS C 3 238 ? -23.788 37.646 25.842 1.00 29.06  ? 238 HIS A CA    1 
ATOM   2317 C  C     . HIS C 3 238 ? -22.421 37.862 26.481 1.00 27.56  ? 238 HIS A C     1 
ATOM   2318 O  O     . HIS C 3 238 ? -21.452 37.180 26.146 1.00 28.28  ? 238 HIS A O     1 
ATOM   2319 C  CB    . HIS C 3 238 ? -23.624 37.311 24.359 1.00 30.82  ? 238 HIS A CB    1 
ATOM   2320 C  CG    . HIS C 3 238 ? -24.919 37.033 23.663 1.00 34.52  ? 238 HIS A CG    1 
ATOM   2321 N  ND1   . HIS C 3 238 ? -25.542 35.804 23.709 1.00 36.89  ? 238 HIS A ND1   1 
ATOM   2322 C  CD2   . HIS C 3 238 ? -25.727 37.836 22.932 1.00 35.50  ? 238 HIS A CD2   1 
ATOM   2323 C  CE1   . HIS C 3 238 ? -26.676 35.862 23.034 1.00 36.81  ? 238 HIS A CE1   1 
ATOM   2324 N  NE2   . HIS C 3 238 ? -26.812 37.084 22.553 1.00 37.11  ? 238 HIS A NE2   1 
ATOM   2325 N  N     . LEU C 3 239 ? -22.346 38.815 27.402 1.00 24.87  ? 239 LEU A N     1 
ATOM   2326 C  CA    . LEU C 3 239 ? -21.095 39.106 28.082 1.00 24.06  ? 239 LEU A CA    1 
ATOM   2327 C  C     . LEU C 3 239 ? -20.923 38.180 29.276 1.00 22.25  ? 239 LEU A C     1 
ATOM   2328 O  O     . LEU C 3 239 ? -21.857 37.943 30.032 1.00 22.38  ? 239 LEU A O     1 
ATOM   2329 C  CB    . LEU C 3 239 ? -21.070 40.561 28.555 1.00 24.99  ? 239 LEU A CB    1 
ATOM   2330 C  CG    . LEU C 3 239 ? -21.170 41.617 27.452 1.00 26.69  ? 239 LEU A CG    1 
ATOM   2331 C  CD1   . LEU C 3 239 ? -21.218 43.013 28.067 1.00 23.79  ? 239 LEU A CD1   1 
ATOM   2332 C  CD2   . LEU C 3 239 ? -19.982 41.474 26.515 1.00 24.14  ? 239 LEU A CD2   1 
ATOM   2333 N  N     . TYR C 3 240 ? -19.718 37.658 29.440 1.00 21.85  ? 240 TYR A N     1 
ATOM   2334 C  CA    . TYR C 3 240 ? -19.429 36.764 30.547 1.00 22.52  ? 240 TYR A CA    1 
ATOM   2335 C  C     . TYR C 3 240 ? -18.888 37.528 31.753 1.00 22.36  ? 240 TYR A C     1 
ATOM   2336 O  O     . TYR C 3 240 ? -19.258 37.237 32.894 1.00 22.28  ? 240 TYR A O     1 
ATOM   2337 C  CB    . TYR C 3 240 ? -18.404 35.719 30.118 1.00 20.68  ? 240 TYR A CB    1 
ATOM   2338 C  CG    . TYR C 3 240 ? -18.938 34.650 29.202 1.00 20.57  ? 240 TYR A CG    1 
ATOM   2339 C  CD1   . TYR C 3 240 ? -19.680 33.579 29.707 1.00 21.95  ? 240 TYR A CD1   1 
ATOM   2340 C  CD2   . TYR C 3 240 ? -18.665 34.680 27.833 1.00 20.41  ? 240 TYR A CD2   1 
ATOM   2341 C  CE1   . TYR C 3 240 ? -20.129 32.556 28.875 1.00 21.88  ? 240 TYR A CE1   1 
ATOM   2342 C  CE2   . TYR C 3 240 ? -19.111 33.664 26.989 1.00 21.48  ? 240 TYR A CE2   1 
ATOM   2343 C  CZ    . TYR C 3 240 ? -19.840 32.603 27.519 1.00 23.47  ? 240 TYR A CZ    1 
ATOM   2344 O  OH    . TYR C 3 240 ? -20.255 31.582 26.694 1.00 24.33  ? 240 TYR A OH    1 
ATOM   2345 N  N     . VAL C 3 241 ? -18.029 38.514 31.501 1.00 20.59  ? 241 VAL A N     1 
ATOM   2346 C  CA    . VAL C 3 241 ? -17.420 39.262 32.595 1.00 19.64  ? 241 VAL A CA    1 
ATOM   2347 C  C     . VAL C 3 241 ? -17.506 40.789 32.583 1.00 19.69  ? 241 VAL A C     1 
ATOM   2348 O  O     . VAL C 3 241 ? -17.642 41.410 33.638 1.00 20.14  ? 241 VAL A O     1 
ATOM   2349 C  CB    . VAL C 3 241 ? -15.932 38.881 32.728 1.00 19.78  ? 241 VAL A CB    1 
ATOM   2350 C  CG1   . VAL C 3 241 ? -15.806 37.388 32.976 1.00 20.74  ? 241 VAL A CG1   1 
ATOM   2351 C  CG2   . VAL C 3 241 ? -15.178 39.275 31.472 1.00 16.72  ? 241 VAL A CG2   1 
ATOM   2352 N  N     . TYR C 3 242 ? -17.409 41.408 31.414 1.00 20.71  ? 242 TYR A N     1 
ATOM   2353 C  CA    . TYR C 3 242 ? -17.452 42.863 31.373 1.00 19.90  ? 242 TYR A CA    1 
ATOM   2354 C  C     . TYR C 3 242 ? -18.684 43.457 32.042 1.00 21.27  ? 242 TYR A C     1 
ATOM   2355 O  O     . TYR C 3 242 ? -19.822 43.154 31.669 1.00 20.75  ? 242 TYR A O     1 
ATOM   2356 C  CB    . TYR C 3 242 ? -17.382 43.388 29.942 1.00 18.99  ? 242 TYR A CB    1 
ATOM   2357 C  CG    . TYR C 3 242 ? -17.271 44.890 29.931 1.00 17.81  ? 242 TYR A CG    1 
ATOM   2358 C  CD1   . TYR C 3 242 ? -16.036 45.515 30.091 1.00 14.68  ? 242 TYR A CD1   1 
ATOM   2359 C  CD2   . TYR C 3 242 ? -18.414 45.690 29.856 1.00 18.07  ? 242 TYR A CD2   1 
ATOM   2360 C  CE1   . TYR C 3 242 ? -15.937 46.899 30.180 1.00 15.90  ? 242 TYR A CE1   1 
ATOM   2361 C  CE2   . TYR C 3 242 ? -18.328 47.073 29.946 1.00 18.70  ? 242 TYR A CE2   1 
ATOM   2362 C  CZ    . TYR C 3 242 ? -17.088 47.672 30.107 1.00 18.06  ? 242 TYR A CZ    1 
ATOM   2363 O  OH    . TYR C 3 242 ? -17.009 49.041 30.189 1.00 18.81  ? 242 TYR A OH    1 
ATOM   2364 N  N     . GLY C 3 243 ? -18.442 44.319 33.026 1.00 22.00  ? 243 GLY A N     1 
ATOM   2365 C  CA    . GLY C 3 243 ? -19.528 44.965 33.743 1.00 22.53  ? 243 GLY A CA    1 
ATOM   2366 C  C     . GLY C 3 243 ? -20.346 44.055 34.644 1.00 24.03  ? 243 GLY A C     1 
ATOM   2367 O  O     . GLY C 3 243 ? -21.388 44.471 35.157 1.00 23.12  ? 243 GLY A O     1 
ATOM   2368 N  N     . ARG C 3 244 ? -19.883 42.824 34.852 1.00 23.49  ? 244 ARG A N     1 
ATOM   2369 C  CA    . ARG C 3 244 ? -20.619 41.881 35.692 1.00 23.50  ? 244 ARG A CA    1 
ATOM   2370 C  C     . ARG C 3 244 ? -19.992 41.665 37.069 1.00 23.65  ? 244 ARG A C     1 
ATOM   2371 O  O     . ARG C 3 244 ? -20.299 40.683 37.749 1.00 23.51  ? 244 ARG A O     1 
ATOM   2372 C  CB    . ARG C 3 244 ? -20.763 40.537 34.971 1.00 22.45  ? 244 ARG A CB    1 
ATOM   2373 C  CG    . ARG C 3 244 ? -21.384 40.659 33.591 1.00 25.19  ? 244 ARG A CG    1 
ATOM   2374 C  CD    . ARG C 3 244 ? -21.809 39.309 33.034 1.00 25.80  ? 244 ARG A CD    1 
ATOM   2375 N  NE    . ARG C 3 244 ? -22.853 38.696 33.851 1.00 27.07  ? 244 ARG A NE    1 
ATOM   2376 C  CZ    . ARG C 3 244 ? -22.656 37.682 34.690 1.00 28.55  ? 244 ARG A CZ    1 
ATOM   2377 N  NH1   . ARG C 3 244 ? -21.445 37.145 34.832 1.00 27.96  ? 244 ARG A NH1   1 
ATOM   2378 N  NH2   . ARG C 3 244 ? -23.674 37.207 35.394 1.00 26.64  ? 244 ARG A NH2   1 
ATOM   2379 N  N     . GLN C 3 245 ? -19.123 42.583 37.482 1.00 22.43  ? 245 GLN A N     1 
ATOM   2380 C  CA    . GLN C 3 245 ? -18.477 42.471 38.785 1.00 24.91  ? 245 GLN A CA    1 
ATOM   2381 C  C     . GLN C 3 245 ? -19.537 42.325 39.867 1.00 25.77  ? 245 GLN A C     1 
ATOM   2382 O  O     . GLN C 3 245 ? -20.521 43.059 39.880 1.00 24.36  ? 245 GLN A O     1 
ATOM   2383 C  CB    . GLN C 3 245 ? -17.620 43.707 39.084 1.00 25.68  ? 245 GLN A CB    1 
ATOM   2384 C  CG    . GLN C 3 245 ? -18.380 45.025 39.014 1.00 26.52  ? 245 GLN A CG    1 
ATOM   2385 C  CD    . GLN C 3 245 ? -18.364 45.642 37.620 1.00 28.29  ? 245 GLN A CD    1 
ATOM   2386 O  OE1   . GLN C 3 245 ? -18.363 44.934 36.611 1.00 28.88  ? 245 GLN A OE1   1 
ATOM   2387 N  NE2   . GLN C 3 245 ? -18.367 46.968 37.562 1.00 28.38  ? 245 GLN A NE2   1 
ATOM   2388 N  N     . GLY C 3 246 ? -19.332 41.369 40.767 1.00 27.13  ? 246 GLY A N     1 
ATOM   2389 C  CA    . GLY C 3 246 ? -20.283 41.150 41.842 1.00 28.17  ? 246 GLY A CA    1 
ATOM   2390 C  C     . GLY C 3 246 ? -21.359 40.133 41.510 1.00 28.33  ? 246 GLY A C     1 
ATOM   2391 O  O     . GLY C 3 246 ? -22.033 39.627 42.409 1.00 31.14  ? 246 GLY A O     1 
ATOM   2392 N  N     . ASN C 3 247 ? -21.530 39.838 40.223 1.00 26.63  ? 247 ASN A N     1 
ATOM   2393 C  CA    . ASN C 3 247 ? -22.528 38.869 39.783 1.00 25.74  ? 247 ASN A CA    1 
ATOM   2394 C  C     . ASN C 3 247 ? -21.861 37.509 39.619 1.00 25.02  ? 247 ASN A C     1 
ATOM   2395 O  O     . ASN C 3 247 ? -20.652 37.424 39.427 1.00 23.92  ? 247 ASN A O     1 
ATOM   2396 C  CB    . ASN C 3 247 ? -23.154 39.306 38.452 1.00 28.58  ? 247 ASN A CB    1 
ATOM   2397 C  CG    . ASN C 3 247 ? -23.819 40.675 38.537 1.00 31.11  ? 247 ASN A CG    1 
ATOM   2398 O  OD1   . ASN C 3 247 ? -24.542 40.968 39.489 1.00 31.92  ? 247 ASN A OD1   1 
ATOM   2399 N  ND2   . ASN C 3 247 ? -23.581 41.514 37.534 1.00 32.17  ? 247 ASN A ND2   1 
ATOM   2400 N  N     . PRO C 3 248 ? -22.640 36.424 39.702 1.00 24.36  ? 248 PRO A N     1 
ATOM   2401 C  CA    . PRO C 3 248 ? -22.058 35.090 39.557 1.00 24.14  ? 248 PRO A CA    1 
ATOM   2402 C  C     . PRO C 3 248 ? -21.602 34.760 38.140 1.00 24.87  ? 248 PRO A C     1 
ATOM   2403 O  O     . PRO C 3 248 ? -22.269 35.109 37.161 1.00 24.94  ? 248 PRO A O     1 
ATOM   2404 C  CB    . PRO C 3 248 ? -23.176 34.170 40.043 1.00 24.99  ? 248 PRO A CB    1 
ATOM   2405 C  CG    . PRO C 3 248 ? -24.420 34.930 39.704 1.00 26.83  ? 248 PRO A CG    1 
ATOM   2406 C  CD    . PRO C 3 248 ? -24.064 36.347 40.078 1.00 25.89  ? 248 PRO A CD    1 
ATOM   2407 N  N     . CYS C 3 249 ? -20.452 34.101 38.038 1.00 21.80  ? 249 CYS A N     1 
ATOM   2408 C  CA    . CYS C 3 249 ? -19.929 33.703 36.741 1.00 23.49  ? 249 CYS A CA    1 
ATOM   2409 C  C     . CYS C 3 249 ? -20.940 32.794 36.057 1.00 24.08  ? 249 CYS A C     1 
ATOM   2410 O  O     . CYS C 3 249 ? -21.545 31.942 36.702 1.00 25.06  ? 249 CYS A O     1 
ATOM   2411 C  CB    . CYS C 3 249 ? -18.614 32.945 36.895 1.00 20.92  ? 249 CYS A CB    1 
ATOM   2412 S  SG    . CYS C 3 249 ? -18.057 32.210 35.351 1.00 21.95  ? 249 CYS A SG    1 
ATOM   2413 N  N     . LYS C 3 250 ? -21.107 32.959 34.751 1.00 25.09  ? 250 LYS A N     1 
ATOM   2414 C  CA    . LYS C 3 250 ? -22.064 32.147 34.006 1.00 26.31  ? 250 LYS A CA    1 
ATOM   2415 C  C     . LYS C 3 250 ? -21.647 30.691 33.842 1.00 25.80  ? 250 LYS A C     1 
ATOM   2416 O  O     . LYS C 3 250 ? -22.475 29.839 33.529 1.00 26.87  ? 250 LYS A O     1 
ATOM   2417 C  CB    . LYS C 3 250 ? -22.330 32.768 32.631 1.00 24.87  ? 250 LYS A CB    1 
ATOM   2418 C  CG    . LYS C 3 250 ? -23.115 34.074 32.698 1.00 26.48  ? 250 LYS A CG    1 
ATOM   2419 C  CD    . LYS C 3 250 ? -23.438 34.628 31.317 1.00 25.88  ? 250 LYS A CD    1 
ATOM   2420 C  CE    . LYS C 3 250 ? -24.171 35.961 31.437 1.00 28.73  ? 250 LYS A CE    1 
ATOM   2421 N  NZ    . LYS C 3 250 ? -24.504 36.573 30.113 1.00 31.59  ? 250 LYS A NZ    1 
ATOM   2422 N  N     . ARG C 3 251 ? -20.371 30.398 34.055 1.00 25.73  ? 251 ARG A N     1 
ATOM   2423 C  CA    . ARG C 3 251 ? -19.897 29.028 33.912 1.00 25.92  ? 251 ARG A CA    1 
ATOM   2424 C  C     . ARG C 3 251 ? -19.692 28.287 35.236 1.00 25.79  ? 251 ARG A C     1 
ATOM   2425 O  O     . ARG C 3 251 ? -19.994 27.096 35.331 1.00 25.95  ? 251 ARG A O     1 
ATOM   2426 C  CB    . ARG C 3 251 ? -18.595 28.998 33.109 1.00 26.46  ? 251 ARG A CB    1 
ATOM   2427 C  CG    . ARG C 3 251 ? -18.770 29.342 31.639 1.00 28.42  ? 251 ARG A CG    1 
ATOM   2428 N  N     . CYS C 3 252 ? -19.202 28.986 36.257 1.00 23.28  ? 252 CYS A N     1 
ATOM   2429 C  CA    . CYS C 3 252 ? -18.941 28.337 37.538 1.00 21.71  ? 252 CYS A CA    1 
ATOM   2430 C  C     . CYS C 3 252 ? -19.651 28.948 38.743 1.00 20.12  ? 252 CYS A C     1 
ATOM   2431 O  O     . CYS C 3 252 ? -19.590 28.400 39.843 1.00 20.22  ? 252 CYS A O     1 
ATOM   2432 C  CB    . CYS C 3 252 ? -17.438 28.328 37.804 1.00 21.13  ? 252 CYS A CB    1 
ATOM   2433 S  SG    . CYS C 3 252 ? -16.812 29.953 38.246 1.00 21.06  ? 252 CYS A SG    1 
ATOM   2434 N  N     . GLY C 3 253 ? -20.303 30.087 38.548 1.00 19.76  ? 253 GLY A N     1 
ATOM   2435 C  CA    . GLY C 3 253 ? -21.012 30.717 39.650 1.00 18.62  ? 253 GLY A CA    1 
ATOM   2436 C  C     . GLY C 3 253 ? -20.177 31.562 40.601 1.00 18.37  ? 253 GLY A C     1 
ATOM   2437 O  O     . GLY C 3 253 ? -20.721 32.179 41.515 1.00 18.30  ? 253 GLY A O     1 
ATOM   2438 N  N     . THR C 3 254 ? -18.861 31.593 40.405 1.00 18.59  ? 254 THR A N     1 
ATOM   2439 C  CA    . THR C 3 254 ? -17.987 32.393 41.264 1.00 17.33  ? 254 THR A CA    1 
ATOM   2440 C  C     . THR C 3 254 ? -18.206 33.863 40.936 1.00 16.93  ? 254 THR A C     1 
ATOM   2441 O  O     . THR C 3 254 ? -18.242 34.240 39.767 1.00 17.05  ? 254 THR A O     1 
ATOM   2442 C  CB    . THR C 3 254 ? -16.510 32.046 41.022 1.00 17.73  ? 254 THR A CB    1 
ATOM   2443 O  OG1   . THR C 3 254 ? -16.313 30.647 41.247 1.00 17.87  ? 254 THR A OG1   1 
ATOM   2444 C  CG2   . THR C 3 254 ? -15.608 32.839 41.955 1.00 16.15  ? 254 THR A CG2   1 
ATOM   2445 N  N     . PRO C 3 255 ? -18.362 34.716 41.961 1.00 18.57  ? 255 PRO A N     1 
ATOM   2446 C  CA    . PRO C 3 255 ? -18.581 36.145 41.684 1.00 18.09  ? 255 PRO A CA    1 
ATOM   2447 C  C     . PRO C 3 255 ? -17.498 36.737 40.774 1.00 18.73  ? 255 PRO A C     1 
ATOM   2448 O  O     . PRO C 3 255 ? -16.303 36.561 41.021 1.00 17.62  ? 255 PRO A O     1 
ATOM   2449 C  CB    . PRO C 3 255 ? -18.563 36.783 43.082 1.00 17.17  ? 255 PRO A CB    1 
ATOM   2450 C  CG    . PRO C 3 255 ? -19.008 35.646 43.996 1.00 16.60  ? 255 PRO A CG    1 
ATOM   2451 C  CD    . PRO C 3 255 ? -18.244 34.471 43.411 1.00 17.48  ? 255 PRO A CD    1 
ATOM   2452 N  N     . ILE C 3 256 ? -17.917 37.430 39.720 1.00 18.13  ? 256 ILE A N     1 
ATOM   2453 C  CA    . ILE C 3 256 ? -16.965 38.057 38.806 1.00 20.60  ? 256 ILE A CA    1 
ATOM   2454 C  C     . ILE C 3 256 ? -16.274 39.204 39.537 1.00 20.99  ? 256 ILE A C     1 
ATOM   2455 O  O     . ILE C 3 256 ? -16.900 39.928 40.306 1.00 21.75  ? 256 ILE A O     1 
ATOM   2456 C  CB    . ILE C 3 256 ? -17.677 38.605 37.542 1.00 20.07  ? 256 ILE A CB    1 
ATOM   2457 C  CG1   . ILE C 3 256 ? -18.255 37.439 36.737 1.00 18.53  ? 256 ILE A CG1   1 
ATOM   2458 C  CG2   . ILE C 3 256 ? -16.715 39.433 36.703 1.00 20.57  ? 256 ILE A CG2   1 
ATOM   2459 C  CD1   . ILE C 3 256 ? -17.246 36.343 36.410 1.00 15.92  ? 256 ILE A CD1   1 
ATOM   2460 N  N     . GLU C 3 257 ? -14.982 39.372 39.297 1.00 22.97  ? 257 GLU A N     1 
ATOM   2461 C  CA    . GLU C 3 257 ? -14.240 40.428 39.964 1.00 23.38  ? 257 GLU A CA    1 
ATOM   2462 C  C     . GLU C 3 257 ? -13.719 41.528 39.055 1.00 23.64  ? 257 GLU A C     1 
ATOM   2463 O  O     . GLU C 3 257 ? -13.516 41.328 37.855 1.00 24.23  ? 257 GLU A O     1 
ATOM   2464 C  CB    . GLU C 3 257 ? -13.091 39.815 40.759 1.00 23.35  ? 257 GLU A CB    1 
ATOM   2465 C  CG    . GLU C 3 257 ? -13.580 39.040 41.963 1.00 27.67  ? 257 GLU A CG    1 
ATOM   2466 C  CD    . GLU C 3 257 ? -12.471 38.341 42.708 1.00 29.32  ? 257 GLU A CD    1 
ATOM   2467 O  OE1   . GLU C 3 257 ? -12.776 37.647 43.697 1.00 31.83  ? 257 GLU A OE1   1 
ATOM   2468 O  OE2   . GLU C 3 257 ? -11.298 38.479 42.306 1.00 31.72  ? 257 GLU A OE2   1 
ATOM   2469 N  N     . LYS C 3 258 ? -13.508 42.698 39.646 1.00 23.82  ? 258 LYS A N     1 
ATOM   2470 C  CA    . LYS C 3 258 ? -13.003 43.840 38.906 1.00 25.73  ? 258 LYS A CA    1 
ATOM   2471 C  C     . LYS C 3 258 ? -11.808 44.483 39.592 1.00 25.89  ? 258 LYS A C     1 
ATOM   2472 O  O     . LYS C 3 258 ? -11.802 44.675 40.805 1.00 27.43  ? 258 LYS A O     1 
ATOM   2473 C  CB    . LYS C 3 258 ? -14.100 44.894 38.730 1.00 24.06  ? 258 LYS A CB    1 
ATOM   2474 C  CG    . LYS C 3 258 ? -13.631 46.129 37.972 1.00 25.62  ? 258 LYS A CG    1 
ATOM   2475 C  CD    . LYS C 3 258 ? -14.747 47.132 37.773 1.00 25.83  ? 258 LYS A CD    1 
ATOM   2476 C  CE    . LYS C 3 258 ? -14.255 48.309 36.941 1.00 27.02  ? 258 LYS A CE    1 
ATOM   2477 N  NZ    . LYS C 3 258 ? -15.342 49.279 36.667 1.00 26.15  ? 258 LYS A NZ    1 
ATOM   2478 N  N     . THR C 3 259 ? -10.793 44.806 38.804 1.00 28.05  ? 259 THR A N     1 
ATOM   2479 C  CA    . THR C 3 259 ? -9.597  45.468 39.312 1.00 30.62  ? 259 THR A CA    1 
ATOM   2480 C  C     . THR C 3 259 ? -9.101  46.401 38.221 1.00 31.81  ? 259 THR A C     1 
ATOM   2481 O  O     . THR C 3 259 ? -9.842  46.745 37.298 1.00 32.07  ? 259 THR A O     1 
ATOM   2482 C  CB    . THR C 3 259 ? -8.468  44.475 39.643 1.00 30.40  ? 259 THR A CB    1 
ATOM   2483 O  OG1   . THR C 3 259 ? -8.132  43.723 38.471 1.00 30.57  ? 259 THR A OG1   1 
ATOM   2484 C  CG2   . THR C 3 259 ? -8.898  43.533 40.750 1.00 33.31  ? 259 THR A CG2   1 
ATOM   2485 N  N     . VAL C 3 260 ? -7.842  46.806 38.331 1.00 32.95  ? 260 VAL A N     1 
ATOM   2486 C  CA    . VAL C 3 260 ? -7.247  47.687 37.349 1.00 33.14  ? 260 VAL A CA    1 
ATOM   2487 C  C     . VAL C 3 260 ? -6.048  46.982 36.734 1.00 33.76  ? 260 VAL A C     1 
ATOM   2488 O  O     . VAL C 3 260 ? -5.161  46.507 37.445 1.00 35.13  ? 260 VAL A O     1 
ATOM   2489 C  CB    . VAL C 3 260 ? -6.795  49.008 37.998 1.00 33.00  ? 260 VAL A CB    1 
ATOM   2490 C  CG1   . VAL C 3 260 ? -6.270  49.963 36.935 1.00 34.25  ? 260 VAL A CG1   1 
ATOM   2491 C  CG2   . VAL C 3 260 ? -7.962  49.642 38.734 1.00 34.42  ? 260 VAL A CG2   1 
ATOM   2492 N  N     . VAL C 3 261 ? -6.038  46.896 35.410 1.00 33.74  ? 261 VAL A N     1 
ATOM   2493 C  CA    . VAL C 3 261 ? -4.943  46.260 34.683 1.00 33.58  ? 261 VAL A CA    1 
ATOM   2494 C  C     . VAL C 3 261 ? -4.615  47.138 33.481 1.00 34.15  ? 261 VAL A C     1 
ATOM   2495 O  O     . VAL C 3 261 ? -5.484  47.415 32.653 1.00 35.13  ? 261 VAL A O     1 
ATOM   2496 C  CB    . VAL C 3 261 ? -5.336  44.851 34.194 1.00 32.97  ? 261 VAL A CB    1 
ATOM   2497 C  CG1   . VAL C 3 261 ? -4.206  44.254 33.367 1.00 30.65  ? 261 VAL A CG1   1 
ATOM   2498 C  CG2   . VAL C 3 261 ? -5.654  43.958 35.391 1.00 30.63  ? 261 VAL A CG2   1 
ATOM   2499 N  N     . ALA C 3 262 ? -3.363  47.577 33.391 1.00 33.91  ? 262 ALA A N     1 
ATOM   2500 C  CA    . ALA C 3 262 ? -2.938  48.450 32.302 1.00 32.76  ? 262 ALA A CA    1 
ATOM   2501 C  C     . ALA C 3 262 ? -3.743  49.746 32.381 1.00 32.00  ? 262 ALA A C     1 
ATOM   2502 O  O     . ALA C 3 262 ? -4.146  50.302 31.360 1.00 33.94  ? 262 ALA A O     1 
ATOM   2503 C  CB    . ALA C 3 262 ? -3.162  47.764 30.955 1.00 31.69  ? 262 ALA A CB    1 
ATOM   2504 N  N     . GLY C 3 263 ? -3.991  50.202 33.606 1.00 30.08  ? 263 GLY A N     1 
ATOM   2505 C  CA    . GLY C 3 263 ? -4.734  51.432 33.826 1.00 29.44  ? 263 GLY A CA    1 
ATOM   2506 C  C     . GLY C 3 263 ? -6.202  51.404 33.424 1.00 30.06  ? 263 GLY A C     1 
ATOM   2507 O  O     . GLY C 3 263 ? -6.794  52.450 33.156 1.00 29.91  ? 263 GLY A O     1 
ATOM   2508 N  N     . ARG C 3 264 ? -6.809  50.223 33.397 1.00 28.65  ? 264 ARG A N     1 
ATOM   2509 C  CA    . ARG C 3 264 ? -8.204  50.134 32.996 1.00 27.38  ? 264 ARG A CA    1 
ATOM   2510 C  C     . ARG C 3 264 ? -9.045  49.127 33.769 1.00 25.36  ? 264 ARG A C     1 
ATOM   2511 O  O     . ARG C 3 264 ? -8.538  48.103 34.226 1.00 24.48  ? 264 ARG A O     1 
ATOM   2512 C  CB    . ARG C 3 264 ? -8.263  49.823 31.504 1.00 30.17  ? 264 ARG A CB    1 
ATOM   2513 C  CG    . ARG C 3 264 ? -7.346  50.732 30.697 1.00 33.20  ? 264 ARG A CG    1 
ATOM   2514 C  CD    . ARG C 3 264 ? -7.755  50.785 29.257 1.00 34.85  ? 264 ARG A CD    1 
ATOM   2515 N  NE    . ARG C 3 264 ? -9.103  51.319 29.092 1.00 32.40  ? 264 ARG A NE    1 
ATOM   2516 C  CZ    . ARG C 3 264 ? -9.776  51.254 27.952 1.00 30.74  ? 264 ARG A CZ    1 
ATOM   2517 N  NH1   . ARG C 3 264 ? -9.216  50.682 26.895 1.00 32.56  ? 264 ARG A NH1   1 
ATOM   2518 N  NH2   . ARG C 3 264 ? -11.003 51.740 27.868 1.00 27.79  ? 264 ARG A NH2   1 
ATOM   2519 N  N     . GLY C 3 265 ? -10.331 49.440 33.925 1.00 24.60  ? 265 GLY A N     1 
ATOM   2520 C  CA    . GLY C 3 265 ? -11.238 48.541 34.617 1.00 22.64  ? 265 GLY A CA    1 
ATOM   2521 C  C     . GLY C 3 265 ? -11.087 47.175 33.979 1.00 23.55  ? 265 GLY A C     1 
ATOM   2522 O  O     . GLY C 3 265 ? -11.124 47.061 32.753 1.00 23.33  ? 265 GLY A O     1 
ATOM   2523 N  N     . THR C 3 266 ? -10.907 46.142 34.797 1.00 22.69  ? 266 THR A N     1 
ATOM   2524 C  CA    . THR C 3 266 ? -10.709 44.794 34.281 1.00 22.23  ? 266 THR A CA    1 
ATOM   2525 C  C     . THR C 3 266 ? -11.598 43.777 34.988 1.00 22.47  ? 266 THR A C     1 
ATOM   2526 O  O     . THR C 3 266 ? -11.578 43.655 36.211 1.00 24.07  ? 266 THR A O     1 
ATOM   2527 C  CB    . THR C 3 266 ? -9.235  44.393 34.426 1.00 20.72  ? 266 THR A CB    1 
ATOM   2528 O  OG1   . THR C 3 266 ? -8.418  45.384 33.790 1.00 20.78  ? 266 THR A OG1   1 
ATOM   2529 C  CG2   . THR C 3 266 ? -8.973  43.038 33.787 1.00 22.02  ? 266 THR A CG2   1 
ATOM   2530 N  N     . HIS C 3 267 ? -12.371 43.044 34.197 1.00 23.39  ? 267 HIS A N     1 
ATOM   2531 C  CA    . HIS C 3 267 ? -13.303 42.052 34.713 1.00 21.99  ? 267 HIS A CA    1 
ATOM   2532 C  C     . HIS C 3 267 ? -12.818 40.647 34.400 1.00 23.26  ? 267 HIS A C     1 
ATOM   2533 O  O     . HIS C 3 267 ? -12.328 40.384 33.297 1.00 22.61  ? 267 HIS A O     1 
ATOM   2534 C  CB    . HIS C 3 267 ? -14.676 42.297 34.094 1.00 21.64  ? 267 HIS A CB    1 
ATOM   2535 C  CG    . HIS C 3 267 ? -15.104 43.730 34.153 1.00 21.77  ? 267 HIS A CG    1 
ATOM   2536 N  ND1   . HIS C 3 267 ? -14.449 44.727 33.464 1.00 21.79  ? 267 HIS A ND1   1 
ATOM   2537 C  CD2   . HIS C 3 267 ? -16.075 44.344 34.869 1.00 23.84  ? 267 HIS A CD2   1 
ATOM   2538 C  CE1   . HIS C 3 267 ? -14.997 45.894 33.754 1.00 22.50  ? 267 HIS A CE1   1 
ATOM   2539 N  NE2   . HIS C 3 267 ? -15.985 45.690 34.604 1.00 24.04  ? 267 HIS A NE2   1 
ATOM   2540 N  N     . TYR C 3 268 ? -12.957 39.747 35.372 1.00 21.83  ? 268 TYR A N     1 
ATOM   2541 C  CA    . TYR C 3 268 ? -12.511 38.370 35.200 1.00 21.97  ? 268 TYR A CA    1 
ATOM   2542 C  C     . TYR C 3 268 ? -13.079 37.444 36.280 1.00 21.35  ? 268 TYR A C     1 
ATOM   2543 O  O     . TYR C 3 268 ? -13.518 37.895 37.346 1.00 18.42  ? 268 TYR A O     1 
ATOM   2544 C  CB    . TYR C 3 268 ? -10.981 38.321 35.270 1.00 22.10  ? 268 TYR A CB    1 
ATOM   2545 C  CG    . TYR C 3 268 ? -10.447 38.658 36.649 1.00 25.33  ? 268 TYR A CG    1 
ATOM   2546 C  CD1   . TYR C 3 268 ? -10.207 37.655 37.591 1.00 26.52  ? 268 TYR A CD1   1 
ATOM   2547 C  CD2   . TYR C 3 268 ? -10.243 39.985 37.036 1.00 26.58  ? 268 TYR A CD2   1 
ATOM   2548 C  CE1   . TYR C 3 268 ? -9.784  37.964 38.884 1.00 26.79  ? 268 TYR A CE1   1 
ATOM   2549 C  CE2   . TYR C 3 268 ? -9.820  40.306 38.323 1.00 28.64  ? 268 TYR A CE2   1 
ATOM   2550 C  CZ    . TYR C 3 268 ? -9.594  39.288 39.244 1.00 29.80  ? 268 TYR A CZ    1 
ATOM   2551 O  OH    . TYR C 3 268 ? -9.201  39.599 40.526 1.00 32.13  ? 268 TYR A OH    1 
ATOM   2552 N  N     . CYS C 3 269 ? -13.075 36.148 35.987 1.00 20.73  ? 269 CYS A N     1 
ATOM   2553 C  CA    . CYS C 3 269 ? -13.523 35.152 36.944 1.00 21.19  ? 269 CYS A CA    1 
ATOM   2554 C  C     . CYS C 3 269 ? -12.231 34.553 37.486 1.00 21.77  ? 269 CYS A C     1 
ATOM   2555 O  O     . CYS C 3 269 ? -11.416 34.037 36.722 1.00 21.56  ? 269 CYS A O     1 
ATOM   2556 C  CB    . CYS C 3 269 ? -14.344 34.050 36.280 1.00 22.32  ? 269 CYS A CB    1 
ATOM   2557 S  SG    . CYS C 3 269 ? -14.783 32.731 37.465 1.00 22.31  ? 269 CYS A SG    1 
ATOM   2558 N  N     . PRO C 3 270 ? -12.020 34.626 38.808 1.00 21.53  ? 270 PRO A N     1 
ATOM   2559 C  CA    . PRO C 3 270 ? -10.801 34.079 39.415 1.00 21.19  ? 270 PRO A CA    1 
ATOM   2560 C  C     . PRO C 3 270 ? -10.708 32.560 39.366 1.00 22.01  ? 270 PRO A C     1 
ATOM   2561 O  O     . PRO C 3 270 ? -9.649  31.995 39.616 1.00 23.89  ? 270 PRO A O     1 
ATOM   2562 C  CB    . PRO C 3 270 ? -10.856 34.617 40.840 1.00 19.12  ? 270 PRO A CB    1 
ATOM   2563 C  CG    . PRO C 3 270 ? -12.340 34.683 41.105 1.00 20.88  ? 270 PRO A CG    1 
ATOM   2564 C  CD    . PRO C 3 270 ? -12.885 35.255 39.823 1.00 18.74  ? 270 PRO A CD    1 
ATOM   2565 N  N     . ARG C 3 271 ? -11.813 31.894 39.056 1.00 23.05  ? 271 ARG A N     1 
ATOM   2566 C  CA    . ARG C 3 271 ? -11.784 30.443 38.975 1.00 23.16  ? 271 ARG A CA    1 
ATOM   2567 C  C     . ARG C 3 271 ? -11.535 29.987 37.545 1.00 22.40  ? 271 ARG A C     1 
ATOM   2568 O  O     . ARG C 3 271 ? -10.600 29.232 37.290 1.00 22.53  ? 271 ARG A O     1 
ATOM   2569 C  CB    . ARG C 3 271 ? -13.090 29.818 39.478 1.00 22.76  ? 271 ARG A CB    1 
ATOM   2570 C  CG    . ARG C 3 271 ? -13.108 28.296 39.274 1.00 25.46  ? 271 ARG A CG    1 
ATOM   2571 C  CD    . ARG C 3 271 ? -14.354 27.606 39.837 1.00 25.28  ? 271 ARG A CD    1 
ATOM   2572 N  NE    . ARG C 3 271 ? -14.271 26.162 39.636 1.00 25.89  ? 271 ARG A NE    1 
ATOM   2573 C  CZ    . ARG C 3 271 ? -15.106 25.270 40.162 1.00 28.40  ? 271 ARG A CZ    1 
ATOM   2574 N  NH1   . ARG C 3 271 ? -14.931 23.979 39.911 1.00 27.62  ? 271 ARG A NH1   1 
ATOM   2575 N  NH2   . ARG C 3 271 ? -16.111 25.659 40.939 1.00 26.33  ? 271 ARG A NH2   1 
ATOM   2576 N  N     . CYS C 3 272 ? -12.370 30.459 36.623 1.00 21.64  ? 272 CYS A N     1 
ATOM   2577 C  CA    . CYS C 3 272 ? -12.272 30.096 35.213 1.00 22.04  ? 272 CYS A CA    1 
ATOM   2578 C  C     . CYS C 3 272 ? -10.987 30.553 34.542 1.00 23.21  ? 272 CYS A C     1 
ATOM   2579 O  O     . CYS C 3 272 ? -10.466 29.876 33.659 1.00 22.53  ? 272 CYS A O     1 
ATOM   2580 C  CB    . CYS C 3 272 ? -13.453 30.673 34.431 1.00 20.23  ? 272 CYS A CB    1 
ATOM   2581 S  SG    . CYS C 3 272 ? -15.027 29.867 34.732 1.00 19.61  ? 272 CYS A SG    1 
ATOM   2582 N  N     . GLN C 3 273 ? -10.482 31.708 34.950 1.00 23.58  ? 273 GLN A N     1 
ATOM   2583 C  CA    . GLN C 3 273 ? -9.273  32.234 34.341 1.00 26.27  ? 273 GLN A CA    1 
ATOM   2584 C  C     . GLN C 3 273 ? -8.044  32.001 35.207 1.00 27.84  ? 273 GLN A C     1 
ATOM   2585 O  O     . GLN C 3 273 ? -8.039  32.319 36.396 1.00 27.61  ? 273 GLN A O     1 
ATOM   2586 C  CB    . GLN C 3 273 ? -9.450  33.725 34.056 1.00 22.96  ? 273 GLN A CB    1 
ATOM   2587 C  CG    . GLN C 3 273 ? -10.525 34.009 33.021 1.00 24.38  ? 273 GLN A CG    1 
ATOM   2588 C  CD    . GLN C 3 273 ? -10.857 35.483 32.918 1.00 24.49  ? 273 GLN A CD    1 
ATOM   2589 O  OE1   . GLN C 3 273 ? -11.803 35.964 33.548 1.00 21.81  ? 273 GLN A OE1   1 
ATOM   2590 N  NE2   . GLN C 3 273 ? -10.066 36.215 32.134 1.00 23.09  ? 273 GLN A NE2   1 
ATOM   2591 N  N     . ARG C 3 274 ? -7.010  31.434 34.592 1.00 28.75  ? 274 ARG A N     1 
ATOM   2592 C  CA    . ARG C 3 274 ? -5.758  31.150 35.280 1.00 31.45  ? 274 ARG A CA    1 
ATOM   2593 C  C     . ARG C 3 274 ? -4.592  31.703 34.464 1.00 32.45  ? 274 ARG A C     1 
ATOM   2594 O  O     . ARG C 3 274 ? -3.486  31.852 34.983 1.00 35.41  ? 274 ARG A O     1 
ATOM   2595 C  CB    . ARG C 3 274 ? -5.585  29.640 35.471 1.00 28.97  ? 274 ARG A CB    1 
HETATM 2596 ZN ZN    . ZN  D 4 .   ? -16.086 31.187 36.342 1.00 24.16  ? 300 ZN  A ZN    1 
HETATM 2597 O  O     . HOH E 5 .   ? -10.230 69.576 23.368 1.00 37.55  ? 63  HOH B O     1 
HETATM 2598 O  O     . HOH E 5 .   ? -8.714  63.684 23.174 1.00 45.23  ? 68  HOH B O     1 
HETATM 2599 O  O     . HOH E 5 .   ? -22.289 56.664 34.687 1.00 43.76  ? 76  HOH B O     1 
HETATM 2600 O  O     . HOH E 5 .   ? -5.310  55.183 31.664 1.00 52.94  ? 122 HOH B O     1 
HETATM 2601 O  O     . HOH E 5 .   ? -21.630 60.717 28.918 1.00 41.54  ? 134 HOH B O     1 
HETATM 2602 O  O     . HOH F 5 .   ? -14.254 49.109 32.772 1.00 27.47  ? 25  HOH C O     1 
HETATM 2603 O  O     . HOH F 5 .   ? -11.023 51.514 31.813 1.00 28.64  ? 26  HOH C O     1 
HETATM 2604 O  O     . HOH F 5 .   ? -11.053 51.748 36.760 1.00 33.52  ? 27  HOH C O     1 
HETATM 2605 O  O     . HOH F 5 .   ? -24.346 66.453 45.705 1.00 49.58  ? 28  HOH C O     1 
HETATM 2606 O  O     . HOH F 5 .   ? -7.748  52.494 17.662 1.00 39.41  ? 29  HOH C O     1 
HETATM 2607 O  O     . HOH F 5 .   ? -6.984  50.389 22.650 1.00 34.42  ? 30  HOH C O     1 
HETATM 2608 O  O     . HOH F 5 .   ? -9.067  55.104 30.484 1.00 39.20  ? 31  HOH C O     1 
HETATM 2609 O  O     . HOH F 5 .   ? -4.442  57.450 17.557 1.00 52.44  ? 32  HOH C O     1 
HETATM 2610 O  O     . HOH F 5 .   ? -12.192 57.534 29.867 1.00 36.74  ? 33  HOH C O     1 
HETATM 2611 O  O     . HOH G 5 .   ? -11.086 38.833 31.454 1.00 14.91  ? 301 HOH A O     1 
HETATM 2612 O  O     . HOH G 5 .   ? -19.268 34.304 33.469 1.00 15.95  ? 302 HOH A O     1 
HETATM 2613 O  O     . HOH G 5 .   ? -14.589 61.378 14.541 1.00 22.01  ? 303 HOH A O     1 
HETATM 2614 O  O     . HOH G 5 .   ? -26.243 65.179 -2.198 1.00 21.41  ? 304 HOH A O     1 
HETATM 2615 O  O     . HOH G 5 .   ? -19.541 68.120 23.912 1.00 24.19  ? 305 HOH A O     1 
HETATM 2616 O  O     . HOH G 5 .   ? -14.841 36.172 43.248 1.00 20.18  ? 306 HOH A O     1 
HETATM 2617 O  O     . HOH G 5 .   ? -29.516 58.533 11.353 1.00 20.97  ? 307 HOH A O     1 
HETATM 2618 O  O     . HOH G 5 .   ? -10.354 65.484 19.628 1.00 17.31  ? 308 HOH A O     1 
HETATM 2619 O  O     . HOH G 5 .   ? -8.937  60.144 12.919 1.00 25.89  ? 309 HOH A O     1 
HETATM 2620 O  O     . HOH G 5 .   ? -11.220 42.134 11.007 1.00 19.56  ? 310 HOH A O     1 
HETATM 2621 O  O     . HOH G 5 .   ? -13.113 53.963 19.169 1.00 17.39  ? 311 HOH A O     1 
HETATM 2622 O  O     . HOH G 5 .   ? -11.506 35.891 44.783 1.00 26.64  ? 312 HOH A O     1 
HETATM 2623 O  O     . HOH G 5 .   ? -30.999 62.467 -2.247 1.00 29.17  ? 313 HOH A O     1 
HETATM 2624 O  O     . HOH G 5 .   ? -33.013 65.564 1.839  1.00 20.94  ? 314 HOH A O     1 
HETATM 2625 O  O     . HOH G 5 .   ? -27.433 57.627 0.247  1.00 18.23  ? 315 HOH A O     1 
HETATM 2626 O  O     . HOH G 5 .   ? -17.168 57.651 28.267 1.00 15.93  ? 316 HOH A O     1 
HETATM 2627 O  O     . HOH G 5 .   ? -23.435 72.283 17.645 1.00 34.70  ? 317 HOH A O     1 
HETATM 2628 O  O     . HOH G 5 .   ? -34.514 64.482 10.254 1.00 37.42  ? 318 HOH A O     1 
HETATM 2629 O  O     . HOH G 5 .   ? -7.910  50.489 15.874 1.00 26.59  ? 319 HOH A O     1 
HETATM 2630 O  O     . HOH G 5 .   ? -6.814  60.565 -4.788 1.00 11.58  ? 320 HOH A O     1 
HETATM 2631 O  O     . HOH G 5 .   ? -18.507 36.974 25.060 1.00 27.09  ? 321 HOH A O     1 
HETATM 2632 O  O     . HOH G 5 .   ? -24.403 63.437 -5.592 1.00 27.39  ? 322 HOH A O     1 
HETATM 2633 O  O     . HOH G 5 .   ? -21.848 61.426 22.348 1.00 24.54  ? 323 HOH A O     1 
HETATM 2634 O  O     . HOH G 5 .   ? -27.037 58.032 16.329 1.00 24.03  ? 324 HOH A O     1 
HETATM 2635 O  O     . HOH G 5 .   ? -13.088 55.149 -3.702 1.00 24.31  ? 325 HOH A O     1 
HETATM 2636 O  O     . HOH G 5 .   ? -23.119 44.627 12.752 1.00 19.58  ? 326 HOH A O     1 
HETATM 2637 O  O     . HOH G 5 .   ? -8.632  59.842 -6.641 1.00 15.24  ? 327 HOH A O     1 
HETATM 2638 O  O     . HOH G 5 .   ? -2.768  63.721 0.849  1.00 29.03  ? 328 HOH A O     1 
HETATM 2639 O  O     . HOH G 5 .   ? -4.460  76.049 5.980  1.00 25.74  ? 329 HOH A O     1 
HETATM 2640 O  O     . HOH G 5 .   ? -17.190 75.920 10.444 1.00 31.35  ? 330 HOH A O     1 
HETATM 2641 O  O     . HOH G 5 .   ? -13.915 54.633 16.821 1.00 22.18  ? 331 HOH A O     1 
HETATM 2642 O  O     . HOH G 5 .   ? -12.930 31.344 16.291 1.00 39.64  ? 332 HOH A O     1 
HETATM 2643 O  O     . HOH G 5 .   ? -7.022  45.113 19.313 1.00 24.32  ? 333 HOH A O     1 
HETATM 2644 O  O     . HOH G 5 .   ? -21.860 44.540 37.906 1.00 26.24  ? 334 HOH A O     1 
HETATM 2645 O  O     . HOH G 5 .   ? -15.281 60.183 21.908 1.00 31.68  ? 335 HOH A O     1 
HETATM 2646 O  O     . HOH G 5 .   ? -0.346  26.176 19.204 1.00 37.38  ? 336 HOH A O     1 
HETATM 2647 O  O     . HOH G 5 .   ? -24.417 48.431 4.193  1.00 23.19  ? 337 HOH A O     1 
HETATM 2648 O  O     . HOH G 5 .   ? -4.336  57.530 8.347  1.00 23.33  ? 338 HOH A O     1 
HETATM 2649 O  O     . HOH G 5 .   ? -22.354 43.564 31.892 1.00 40.81  ? 339 HOH A O     1 
HETATM 2650 O  O     . HOH G 5 .   ? -34.731 75.618 9.046  1.00 38.12  ? 340 HOH A O     1 
HETATM 2651 O  O     . HOH G 5 .   ? -19.753 72.568 19.997 1.00 24.53  ? 341 HOH A O     1 
HETATM 2652 O  O     . HOH G 5 .   ? -0.648  30.635 12.860 1.00 31.72  ? 342 HOH A O     1 
HETATM 2653 O  O     . HOH G 5 .   ? -13.577 74.595 -1.599 1.00 33.27  ? 343 HOH A O     1 
HETATM 2654 O  O     . HOH G 5 .   ? 1.536   46.359 13.260 1.00 36.21  ? 344 HOH A O     1 
HETATM 2655 O  O     . HOH G 5 .   ? -8.149  74.921 13.156 1.00 30.54  ? 345 HOH A O     1 
HETATM 2656 O  O     . HOH G 5 .   ? -33.413 70.613 3.416  1.00 28.93  ? 346 HOH A O     1 
HETATM 2657 O  O     . HOH G 5 .   ? -14.746 29.911 43.275 1.00 26.23  ? 347 HOH A O     1 
HETATM 2658 O  O     . HOH G 5 .   ? -20.963 75.001 -1.219 1.00 29.91  ? 348 HOH A O     1 
HETATM 2659 O  O     . HOH G 5 .   ? -24.103 71.276 22.745 1.00 43.38  ? 349 HOH A O     1 
HETATM 2660 O  O     . HOH G 5 .   ? -23.402 76.864 3.017  1.00 46.92  ? 350 HOH A O     1 
HETATM 2661 O  O     . HOH G 5 .   ? -1.636  69.969 8.799  1.00 34.74  ? 351 HOH A O     1 
HETATM 2662 O  O     . HOH G 5 .   ? -31.717 61.763 4.002  1.00 41.90  ? 352 HOH A O     1 
HETATM 2663 O  O     . HOH G 5 .   ? -2.646  49.734 36.098 1.00 42.66  ? 353 HOH A O     1 
HETATM 2664 O  O     . HOH G 5 .   ? -13.530 39.117 46.262 1.00 32.21  ? 354 HOH A O     1 
HETATM 2665 O  O     . HOH G 5 .   ? -17.966 51.026 0.709  1.00 28.00  ? 355 HOH A O     1 
HETATM 2666 O  O     . HOH G 5 .   ? -18.110 64.781 -6.772 1.00 34.57  ? 356 HOH A O     1 
HETATM 2667 O  O     . HOH G 5 .   ? -13.173 71.272 -2.488 1.00 24.92  ? 357 HOH A O     1 
HETATM 2668 O  O     . HOH G 5 .   ? 3.401   49.209 20.676 1.00 39.41  ? 358 HOH A O     1 
HETATM 2669 O  O     . HOH G 5 .   ? -14.427 47.944 5.463  1.00 30.46  ? 359 HOH A O     1 
HETATM 2670 O  O     . HOH G 5 .   ? -8.731  50.572 24.417 1.00 35.96  ? 360 HOH A O     1 
HETATM 2671 O  O     . HOH G 5 .   ? -14.772 76.751 19.916 1.00 49.01  ? 361 HOH A O     1 
HETATM 2672 O  O     . HOH G 5 .   ? -28.854 54.127 -0.505 1.00 34.26  ? 362 HOH A O     1 
HETATM 2673 O  O     . HOH G 5 .   ? -17.513 47.991 34.677 1.00 23.17  ? 363 HOH A O     1 
HETATM 2674 O  O     . HOH G 5 .   ? -26.077 60.344 16.992 1.00 23.11  ? 364 HOH A O     1 
HETATM 2675 O  O     . HOH G 5 .   ? -18.945 73.038 22.809 1.00 37.29  ? 365 HOH A O     1 
HETATM 2676 O  O     . HOH G 5 .   ? -9.870  61.939 -7.801 1.00 23.48  ? 366 HOH A O     1 
HETATM 2677 O  O     . HOH G 5 .   ? -28.057 63.399 -3.499 1.00 29.76  ? 367 HOH A O     1 
HETATM 2678 O  O     . HOH G 5 .   ? -22.657 59.881 24.614 1.00 23.88  ? 368 HOH A O     1 
HETATM 2679 O  O     . HOH G 5 .   ? -25.017 62.518 15.515 1.00 32.24  ? 369 HOH A O     1 
HETATM 2680 O  O     . HOH G 5 .   ? -16.215 36.802 45.847 1.00 32.81  ? 370 HOH A O     1 
HETATM 2681 O  O     . HOH G 5 .   ? -29.075 55.142 -2.990 1.00 41.24  ? 371 HOH A O     1 
HETATM 2682 O  O     . HOH G 5 .   ? -10.244 66.017 23.216 1.00 38.42  ? 372 HOH A O     1 
HETATM 2683 O  O     . HOH G 5 .   ? -14.678 29.404 26.346 1.00 43.17  ? 373 HOH A O     1 
HETATM 2684 O  O     . HOH G 5 .   ? -8.149  72.285 14.379 1.00 35.77  ? 374 HOH A O     1 
HETATM 2685 O  O     . HOH G 5 .   ? -19.783 51.574 -1.844 1.00 39.30  ? 375 HOH A O     1 
HETATM 2686 O  O     . HOH G 5 .   ? -28.951 38.429 21.736 1.00 33.27  ? 376 HOH A O     1 
HETATM 2687 O  O     . HOH G 5 .   ? -13.273 76.656 5.016  1.00 34.10  ? 377 HOH A O     1 
HETATM 2688 O  O     . HOH G 5 .   ? -20.674 38.634 45.139 1.00 38.68  ? 378 HOH A O     1 
HETATM 2689 O  O     . HOH G 5 .   ? -25.923 48.974 2.224  1.00 46.37  ? 379 HOH A O     1 
HETATM 2690 O  O     . HOH G 5 .   ? -37.428 76.008 9.568  1.00 43.12  ? 380 HOH A O     1 
HETATM 2691 O  O     . HOH G 5 .   ? -2.085  48.551 25.572 1.00 36.62  ? 381 HOH A O     1 
HETATM 2692 O  O     . HOH G 5 .   ? -22.546 35.008 21.657 1.00 41.36  ? 382 HOH A O     1 
HETATM 2693 O  O     . HOH G 5 .   ? -13.047 27.828 31.584 1.00 44.91  ? 383 HOH A O     1 
HETATM 2694 O  O     . HOH G 5 .   ? 0.301   50.785 20.975 1.00 33.53  ? 384 HOH A O     1 
HETATM 2695 O  O     . HOH G 5 .   ? -19.310 38.391 11.985 1.00 33.60  ? 385 HOH A O     1 
HETATM 2696 O  O     . HOH G 5 .   ? -27.185 57.386 -3.766 1.00 40.40  ? 386 HOH A O     1 
HETATM 2697 O  O     . HOH G 5 .   ? -9.838  50.737 4.198  1.00 33.44  ? 387 HOH A O     1 
HETATM 2698 O  O     . HOH G 5 .   ? 2.926   62.437 9.124  1.00 35.32  ? 388 HOH A O     1 
HETATM 2699 O  O     . HOH G 5 .   ? -4.016  54.910 16.048 1.00 42.63  ? 389 HOH A O     1 
HETATM 2700 O  O     . HOH G 5 .   ? -24.682 39.412 29.749 1.00 39.24  ? 390 HOH A O     1 
HETATM 2701 O  O     . HOH G 5 .   ? -20.809 35.105 24.482 1.00 37.89  ? 391 HOH A O     1 
HETATM 2702 O  O     . HOH G 5 .   ? 0.364   44.825 10.754 1.00 47.38  ? 392 HOH A O     1 
HETATM 2703 O  O     . HOH G 5 .   ? -32.874 54.406 7.963  1.00 51.57  ? 393 HOH A O     1 
HETATM 2704 O  O     . HOH G 5 .   ? -24.787 70.836 19.388 1.00 29.60  ? 394 HOH A O     1 
HETATM 2705 O  O     . HOH G 5 .   ? -5.847  32.683 10.962 1.00 51.35  ? 395 HOH A O     1 
HETATM 2706 O  O     . HOH G 5 .   ? -5.582  51.156 27.581 1.00 40.83  ? 396 HOH A O     1 
HETATM 2707 O  O     . HOH G 5 .   ? -11.036 67.983 21.657 1.00 58.53  ? 397 HOH A O     1 
HETATM 2708 O  O     . HOH G 5 .   ? -13.241 42.271 8.549  1.00 38.04  ? 398 HOH A O     1 
HETATM 2709 O  O     . HOH G 5 .   ? -16.232 42.971 8.962  1.00 41.42  ? 399 HOH A O     1 
HETATM 2710 O  O     . HOH G 5 .   ? -34.329 67.717 4.337  1.00 41.95  ? 400 HOH A O     1 
HETATM 2711 O  O     . HOH G 5 .   ? -32.137 63.022 1.561  1.00 33.24  ? 401 HOH A O     1 
HETATM 2712 O  O     . HOH G 5 .   ? -7.459  55.145 1.230  1.00 45.41  ? 402 HOH A O     1 
HETATM 2713 O  O     . HOH G 5 .   ? -3.617  54.757 1.166  1.00 39.49  ? 403 HOH A O     1 
HETATM 2714 O  O     . HOH G 5 .   ? -17.852 39.233 45.718 1.00 33.91  ? 404 HOH A O     1 
HETATM 2715 O  O     . HOH G 5 .   ? -27.490 78.036 6.071  1.00 30.19  ? 405 HOH A O     1 
HETATM 2716 O  O     . HOH G 5 .   ? -22.043 73.326 19.656 1.00 32.96  ? 406 HOH A O     1 
HETATM 2717 O  O     . HOH G 5 .   ? -25.943 72.368 2.422  1.00 11.41  ? 407 HOH A O     1 
HETATM 2718 O  O     . HOH G 5 .   ? -25.886 71.552 7.119  1.00 28.09  ? 408 HOH A O     1 
HETATM 2719 O  O     . HOH G 5 .   ? -29.064 64.019 15.932 1.00 43.47  ? 409 HOH A O     1 
HETATM 2720 O  O     . HOH G 5 .   ? -15.563 46.014 7.184  1.00 30.90  ? 410 HOH A O     1 
HETATM 2721 O  O     . HOH G 5 .   ? -18.557 48.539 1.590  1.00 41.35  ? 411 HOH A O     1 
HETATM 2722 O  O     . HOH G 5 .   ? -22.964 50.936 -1.442 1.00 32.78  ? 412 HOH A O     1 
HETATM 2723 O  O     . HOH G 5 .   ? -29.171 52.468 7.331  1.00 47.24  ? 413 HOH A O     1 
HETATM 2724 O  O     . HOH G 5 .   ? -25.060 60.382 -7.131 1.00 48.19  ? 414 HOH A O     1 
HETATM 2725 O  O     . HOH G 5 .   ? -14.189 76.604 10.187 1.00 49.83  ? 415 HOH A O     1 
HETATM 2726 O  O     . HOH G 5 .   ? -15.158 76.111 3.075  1.00 23.86  ? 416 HOH A O     1 
HETATM 2727 O  O     . HOH G 5 .   ? -25.765 67.013 -6.052 1.00 28.65  ? 417 HOH A O     1 
HETATM 2728 O  O     . HOH G 5 .   ? -20.992 71.185 -3.904 1.00 41.52  ? 418 HOH A O     1 
HETATM 2729 O  O     . HOH G 5 .   ? -8.946  53.696 -1.242 1.00 36.29  ? 419 HOH A O     1 
HETATM 2730 O  O     . HOH G 5 .   ? -12.355 62.227 -8.527 1.00 41.07  ? 420 HOH A O     1 
HETATM 2731 O  O     . HOH G 5 .   ? 0.851   61.261 2.701  1.00 50.48  ? 421 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  GUA B . n 
A 1 2   DT  2   2   2   DT  THY B . n 
A 1 3   DA  3   3   3   DA  ADE B . n 
A 1 4   DG  4   4   4   DG  GUA B . n 
A 1 5   DA  5   5   5   DA  ADE B . n 
A 1 6   DC  6   6   6   DC  CYT B . n 
A 1 7   DC  7   7   7   DC  CYT B . n 
A 1 8   DT  8   8   8   DT  THY B . n 
A 1 9   DG  9   9   9   DG  GUA B . n 
A 1 10  DG  10  10  10  DG  GUA B . n 
A 1 11  DA  11  11  11  DA  ADE B . n 
A 1 12  DC  12  12  12  DC  CYT B . n 
B 2 1   DG  1   13  13  DG  GUA C . n 
B 2 2   DT  2   14  14  DT  THY C . n 
B 2 3   DC  3   15  15  DC  CYT C . n 
B 2 4   DC  4   16  16  DC  CYT C . n 
B 2 5   DA  5   17  17  DA  ADE C . n 
B 2 6   8OG 6   18  18  8OG 8OG C . n 
B 2 7   DG  7   19  19  DG  GUA C . n 
B 2 8   DT  8   20  20  DT  THY C . n 
B 2 9   DC  9   21  21  DC  CYT C . n 
B 2 10  DT  10  22  22  DT  THY C . n 
B 2 11  DA  11  23  23  DA  ADE C . n 
B 2 12  DC  12  24  24  DC  CYT C . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   PRO 2   2   2   PRO PRO A . n 
C 3 3   GLN 3   3   3   GLN GLN A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   PRO 5   5   5   PRO PRO A . n 
C 3 6   GLU 6   6   6   GLU GLU A . n 
C 3 7   VAL 7   7   7   VAL VAL A . n 
C 3 8   GLU 8   8   8   GLU GLU A . n 
C 3 9   THR 9   9   9   THR THR A . n 
C 3 10  ILE 10  10  10  ILE ILE A . n 
C 3 11  ARG 11  11  11  ARG ARG A . n 
C 3 12  ARG 12  12  12  ARG ARG A . n 
C 3 13  THR 13  13  13  THR THR A . n 
C 3 14  LEU 14  14  14  LEU LEU A . n 
C 3 15  LEU 15  15  15  LEU LEU A . n 
C 3 16  PRO 16  16  16  PRO PRO A . n 
C 3 17  LEU 17  17  17  LEU LEU A . n 
C 3 18  ILE 18  18  18  ILE ILE A . n 
C 3 19  VAL 19  19  19  VAL VAL A . n 
C 3 20  GLY 20  20  20  GLY GLY A . n 
C 3 21  LYS 21  21  21  LYS LYS A . n 
C 3 22  THR 22  22  22  THR THR A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  GLU 24  24  24  GLU GLU A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  VAL 26  26  26  VAL VAL A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  ILE 28  28  28  ILE ILE A . n 
C 3 29  PHE 29  29  29  PHE PHE A . n 
C 3 30  TRP 30  30  30  TRP TRP A . n 
C 3 31  PRO 31  31  31  PRO PRO A . n 
C 3 32  ASN 32  32  32  ASN ASN A . n 
C 3 33  ILE 33  33  33  ILE ILE A . n 
C 3 34  ILE 34  34  34  ILE ILE A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  HIS 36  36  36  HIS HIS A . n 
C 3 37  PRO 37  37  37  PRO PRO A . n 
C 3 38  ARG 38  38  38  ARG ARG A . n 
C 3 39  ASP 39  39  39  ASP ASP A . n 
C 3 40  SER 40  40  40  SER SER A . n 
C 3 41  GLU 41  41  41  GLU GLU A . n 
C 3 42  ALA 42  42  42  ALA ALA A . n 
C 3 43  PHE 43  43  43  PHE PHE A . n 
C 3 44  ALA 44  44  44  ALA ALA A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  ARG 46  46  46  ARG ARG A . n 
C 3 47  MET 47  47  47  MET MET A . n 
C 3 48  ILE 48  48  48  ILE ILE A . n 
C 3 49  GLY 49  49  49  GLY GLY A . n 
C 3 50  GLN 50  50  50  GLN GLN A . n 
C 3 51  THR 51  51  51  THR THR A . n 
C 3 52  VAL 52  52  52  VAL VAL A . n 
C 3 53  ARG 53  53  53  ARG ARG A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  GLU 56  56  56  GLU GLU A . n 
C 3 57  ARG 57  57  57  ARG ARG A . n 
C 3 58  ARG 58  58  58  ARG ARG A . n 
C 3 59  GLY 59  59  59  GLY GLY A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  PHE 61  61  61  PHE PHE A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  PHE 64  64  64  PHE PHE A . n 
C 3 65  LEU 65  65  65  LEU LEU A . n 
C 3 66  LEU 66  66  66  LEU LEU A . n 
C 3 67  ASP 67  67  67  ASP ASP A . n 
C 3 68  ARG 68  68  68  ARG ARG A . n 
C 3 69  ASP 69  69  69  ASP ASP A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  ILE 72  72  72  ILE ILE A . n 
C 3 73  SER 73  73  73  SER SER A . n 
C 3 74  HIS 74  74  74  HIS HIS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  ARG 76  76  76  ARG ARG A . n 
C 3 77  MET 77  77  77  MET MET A . n 
C 3 78  GLU 78  78  78  GLU GLU A . n 
C 3 79  GLY 79  79  79  GLY GLY A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  TYR 81  81  81  TYR TYR A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  VAL 83  83  83  VAL VAL A . n 
C 3 84  ALA 84  84  84  ALA ALA A . n 
C 3 85  SER 85  85  85  SER SER A . n 
C 3 86  ALA 86  86  86  ALA ALA A . n 
C 3 87  LEU 87  87  87  LEU LEU A . n 
C 3 88  GLU 88  88  88  GLU GLU A . n 
C 3 89  PRO 89  89  89  PRO PRO A . n 
C 3 90  LEU 90  90  90  LEU LEU A . n 
C 3 91  GLU 91  91  91  GLU GLU A . n 
C 3 92  PRO 92  92  92  PRO PRO A . n 
C 3 93  HIS 93  93  93  HIS HIS A . n 
C 3 94  THR 94  94  94  THR THR A . n 
C 3 95  HIS 95  95  95  HIS HIS A . n 
C 3 96  VAL 96  96  96  VAL VAL A . n 
C 3 97  VAL 97  97  97  VAL VAL A . n 
C 3 98  PHE 98  98  98  PHE PHE A . n 
C 3 99  CYS 99  99  99  CYS CYS A . n 
C 3 100 PHE 100 100 100 PHE PHE A . n 
C 3 101 THR 101 101 101 THR THR A . n 
C 3 102 ASP 102 102 102 ASP ASP A . n 
C 3 103 GLY 103 103 103 GLY GLY A . n 
C 3 104 SER 104 104 104 SER SER A . n 
C 3 105 GLU 105 105 105 GLU GLU A . n 
C 3 106 LEU 106 106 106 LEU LEU A . n 
C 3 107 ARG 107 107 107 ARG ARG A . n 
C 3 108 TYR 108 108 108 TYR TYR A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 ASP 110 110 110 ASP ASP A . n 
C 3 111 VAL 111 111 111 VAL VAL A . n 
C 3 112 ARG 112 112 112 ARG ARG A . n 
C 3 113 LYS 113 113 113 LYS LYS A . n 
C 3 114 PHE 114 114 114 PHE PHE A . n 
C 3 115 GLY 115 115 115 GLY GLY A . n 
C 3 116 THR 116 116 116 THR THR A . n 
C 3 117 MET 117 117 117 MET MET A . n 
C 3 118 HIS 118 118 118 HIS HIS A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 TYR 120 120 120 TYR TYR A . n 
C 3 121 ALA 121 121 121 ALA ALA A . n 
C 3 122 LYS 122 122 122 LYS LYS A . n 
C 3 123 GLU 123 123 123 GLU GLU A . n 
C 3 124 GLU 124 124 124 GLU GLU A . n 
C 3 125 ALA 125 125 125 ALA ALA A . n 
C 3 126 ASP 126 126 126 ASP ASP A . n 
C 3 127 ARG 127 127 127 ARG ARG A . n 
C 3 128 ARG 128 128 128 ARG ARG A . n 
C 3 129 PRO 129 129 129 PRO PRO A . n 
C 3 130 PRO 130 130 130 PRO PRO A . n 
C 3 131 LEU 131 131 131 LEU LEU A . n 
C 3 132 ALA 132 132 132 ALA ALA A . n 
C 3 133 GLU 133 133 133 GLU GLU A . n 
C 3 134 LEU 134 134 134 LEU LEU A . n 
C 3 135 GLY 135 135 135 GLY GLY A . n 
C 3 136 PRO 136 136 136 PRO PRO A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 PRO 138 138 138 PRO PRO A . n 
C 3 139 LEU 139 139 139 LEU LEU A . n 
C 3 140 SER 140 140 140 SER SER A . n 
C 3 141 PRO 141 141 141 PRO PRO A . n 
C 3 142 ALA 142 142 142 ALA ALA A . n 
C 3 143 PHE 143 143 143 PHE PHE A . n 
C 3 144 SER 144 144 144 SER SER A . n 
C 3 145 PRO 145 145 145 PRO PRO A . n 
C 3 146 ALA 146 146 146 ALA ALA A . n 
C 3 147 VAL 147 147 147 VAL VAL A . n 
C 3 148 LEU 148 148 148 LEU LEU A . n 
C 3 149 ALA 149 149 149 ALA ALA A . n 
C 3 150 GLU 150 150 150 GLU GLU A . n 
C 3 151 ARG 151 151 151 ARG ARG A . n 
C 3 152 ALA 152 152 152 ALA ALA A . n 
C 3 153 VAL 153 153 153 VAL VAL A . n 
C 3 154 LYS 154 154 154 LYS LYS A . n 
C 3 155 THR 155 155 155 THR THR A . n 
C 3 156 LYS 156 156 156 LYS LYS A . n 
C 3 157 ARG 157 157 157 ARG ARG A . n 
C 3 158 SER 158 158 158 SER SER A . n 
C 3 159 VAL 159 159 159 VAL VAL A . n 
C 3 160 LYS 160 160 160 LYS LYS A . n 
C 3 161 ALA 161 161 161 ALA ALA A . n 
C 3 162 LEU 162 162 162 LEU LEU A . n 
C 3 163 LEU 163 163 163 LEU LEU A . n 
C 3 164 LEU 164 164 164 LEU LEU A . n 
C 3 165 ASP 165 165 165 ASP ASP A . n 
C 3 166 GLN 166 166 166 GLN GLN A . n 
C 3 167 THR 167 167 167 THR THR A . n 
C 3 168 VAL 168 168 168 VAL VAL A . n 
C 3 169 VAL 169 169 169 VAL VAL A . n 
C 3 170 ALA 170 170 170 ALA ALA A . n 
C 3 171 GLY 171 171 171 GLY GLY A . n 
C 3 172 PHE 172 172 172 PHE PHE A . n 
C 3 173 GLY 173 173 173 GLY GLY A . n 
C 3 174 ASN 174 174 174 ASN ASN A . n 
C 3 175 ILE 175 175 175 ILE ILE A . n 
C 3 176 TYR 176 176 176 TYR TYR A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 ASP 178 178 178 ASP ASP A . n 
C 3 179 GLU 179 179 179 GLU GLU A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 LEU 181 181 181 LEU LEU A . n 
C 3 182 PHE 182 182 182 PHE PHE A . n 
C 3 183 ARG 183 183 183 ARG ARG A . n 
C 3 184 ALA 184 184 184 ALA ALA A . n 
C 3 185 GLY 185 185 185 GLY GLY A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 LEU 187 187 187 LEU LEU A . n 
C 3 188 PRO 188 188 188 PRO PRO A . n 
C 3 189 GLY 189 189 189 GLY GLY A . n 
C 3 190 ARG 190 190 190 ARG ARG A . n 
C 3 191 PRO 191 191 191 PRO PRO A . n 
C 3 192 ALA 192 192 192 ALA ALA A . n 
C 3 193 ALA 193 193 193 ALA ALA A . n 
C 3 194 SER 194 194 194 SER SER A . n 
C 3 195 LEU 195 195 195 LEU LEU A . n 
C 3 196 SER 196 196 196 SER SER A . n 
C 3 197 SER 197 197 197 SER SER A . n 
C 3 198 LYS 198 198 198 LYS LYS A . n 
C 3 199 GLU 199 199 199 GLU GLU A . n 
C 3 200 ILE 200 200 200 ILE ILE A . n 
C 3 201 GLU 201 201 201 GLU GLU A . n 
C 3 202 ARG 202 202 202 ARG ARG A . n 
C 3 203 LEU 203 203 203 LEU LEU A . n 
C 3 204 HIS 204 204 204 HIS HIS A . n 
C 3 205 GLU 205 205 205 GLU GLU A . n 
C 3 206 GLU 206 206 206 GLU GLU A . n 
C 3 207 MET 207 207 207 MET MET A . n 
C 3 208 VAL 208 208 208 VAL VAL A . n 
C 3 209 ALA 209 209 209 ALA ALA A . n 
C 3 210 THR 210 210 210 THR THR A . n 
C 3 211 ILE 211 211 211 ILE ILE A . n 
C 3 212 GLY 212 212 212 GLY GLY A . n 
C 3 213 GLU 213 213 213 GLU GLU A . n 
C 3 214 ALA 214 214 214 ALA ALA A . n 
C 3 215 VAL 215 215 215 VAL VAL A . n 
C 3 216 MET 216 216 216 MET MET A . n 
C 3 217 LYS 217 217 217 LYS LYS A . n 
C 3 218 GLY 218 218 218 GLY GLY A . n 
C 3 219 GLY 219 219 219 GLY GLY A . n 
C 3 220 SER 220 220 220 SER SER A . n 
C 3 221 THR 221 221 221 THR THR A . n 
C 3 222 VAL 222 222 222 VAL VAL A . n 
C 3 223 ARG 223 223 223 ARG ARG A . n 
C 3 224 THR 224 224 224 THR THR A . n 
C 3 225 TYR 225 225 225 TYR TYR A . n 
C 3 226 VAL 226 226 226 VAL VAL A . n 
C 3 227 ASN 227 227 227 ASN ASN A . n 
C 3 228 THR 228 228 228 THR THR A . n 
C 3 229 GLN 229 229 229 GLN GLN A . n 
C 3 230 GLY 230 230 230 GLY GLY A . n 
C 3 231 GLU 231 231 231 GLU GLU A . n 
C 3 232 ALA 232 232 232 ALA ALA A . n 
C 3 233 GLY 233 233 233 GLY GLY A . n 
C 3 234 THR 234 234 234 THR THR A . n 
C 3 235 PHE 235 235 235 PHE PHE A . n 
C 3 236 GLN 236 236 236 GLN GLN A . n 
C 3 237 HIS 237 237 237 HIS HIS A . n 
C 3 238 HIS 238 238 238 HIS HIS A . n 
C 3 239 LEU 239 239 239 LEU LEU A . n 
C 3 240 TYR 240 240 240 TYR TYR A . n 
C 3 241 VAL 241 241 241 VAL VAL A . n 
C 3 242 TYR 242 242 242 TYR TYR A . n 
C 3 243 GLY 243 243 243 GLY GLY A . n 
C 3 244 ARG 244 244 244 ARG ARG A . n 
C 3 245 GLN 245 245 245 GLN GLN A . n 
C 3 246 GLY 246 246 246 GLY GLY A . n 
C 3 247 ASN 247 247 247 ASN ASN A . n 
C 3 248 PRO 248 248 248 PRO PRO A . n 
C 3 249 CYS 249 249 249 CYS CYS A . n 
C 3 250 LYS 250 250 250 LYS LYS A . n 
C 3 251 ARG 251 251 251 ARG ARG A . n 
C 3 252 CYS 252 252 252 CYS CYS A . n 
C 3 253 GLY 253 253 253 GLY GLY A . n 
C 3 254 THR 254 254 254 THR THR A . n 
C 3 255 PRO 255 255 255 PRO PRO A . n 
C 3 256 ILE 256 256 256 ILE ILE A . n 
C 3 257 GLU 257 257 257 GLU GLU A . n 
C 3 258 LYS 258 258 258 LYS LYS A . n 
C 3 259 THR 259 259 259 THR THR A . n 
C 3 260 VAL 260 260 260 VAL VAL A . n 
C 3 261 VAL 261 261 261 VAL VAL A . n 
C 3 262 ALA 262 262 262 ALA ALA A . n 
C 3 263 GLY 263 263 263 GLY GLY A . n 
C 3 264 ARG 264 264 264 ARG ARG A . n 
C 3 265 GLY 265 265 265 GLY GLY A . n 
C 3 266 THR 266 266 266 THR THR A . n 
C 3 267 HIS 267 267 267 HIS HIS A . n 
C 3 268 TYR 268 268 268 TYR TYR A . n 
C 3 269 CYS 269 269 269 CYS CYS A . n 
C 3 270 PRO 270 270 270 PRO PRO A . n 
C 3 271 ARG 271 271 271 ARG ARG A . n 
C 3 272 CYS 272 272 272 CYS CYS A . n 
C 3 273 GLN 273 273 273 GLN GLN A . n 
C 3 274 ARG 274 274 274 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   300 300 ZN  ZN  A . 
E 5 HOH 1   63  63  HOH HOH B . 
E 5 HOH 2   68  68  HOH HOH B . 
E 5 HOH 3   76  76  HOH HOH B . 
E 5 HOH 4   122 122 HOH HOH B . 
E 5 HOH 5   134 134 HOH HOH B . 
F 5 HOH 1   25  15  HOH HOH C . 
F 5 HOH 2   26  38  HOH HOH C . 
F 5 HOH 3   27  45  HOH HOH C . 
F 5 HOH 4   28  48  HOH HOH C . 
F 5 HOH 5   29  103 HOH HOH C . 
F 5 HOH 6   30  104 HOH HOH C . 
F 5 HOH 7   31  106 HOH HOH C . 
F 5 HOH 8   32  107 HOH HOH C . 
F 5 HOH 9   33  121 HOH HOH C . 
G 5 HOH 1   301 1   HOH HOH A . 
G 5 HOH 2   302 2   HOH HOH A . 
G 5 HOH 3   303 3   HOH HOH A . 
G 5 HOH 4   304 4   HOH HOH A . 
G 5 HOH 5   305 5   HOH HOH A . 
G 5 HOH 6   306 6   HOH HOH A . 
G 5 HOH 7   307 7   HOH HOH A . 
G 5 HOH 8   308 8   HOH HOH A . 
G 5 HOH 9   309 9   HOH HOH A . 
G 5 HOH 10  310 10  HOH HOH A . 
G 5 HOH 11  311 11  HOH HOH A . 
G 5 HOH 12  312 12  HOH HOH A . 
G 5 HOH 13  313 13  HOH HOH A . 
G 5 HOH 14  314 14  HOH HOH A . 
G 5 HOH 15  315 16  HOH HOH A . 
G 5 HOH 16  316 17  HOH HOH A . 
G 5 HOH 17  317 18  HOH HOH A . 
G 5 HOH 18  318 19  HOH HOH A . 
G 5 HOH 19  319 20  HOH HOH A . 
G 5 HOH 20  320 21  HOH HOH A . 
G 5 HOH 21  321 22  HOH HOH A . 
G 5 HOH 22  322 23  HOH HOH A . 
G 5 HOH 23  323 24  HOH HOH A . 
G 5 HOH 24  324 25  HOH HOH A . 
G 5 HOH 25  325 26  HOH HOH A . 
G 5 HOH 26  326 27  HOH HOH A . 
G 5 HOH 27  327 28  HOH HOH A . 
G 5 HOH 28  328 29  HOH HOH A . 
G 5 HOH 29  329 30  HOH HOH A . 
G 5 HOH 30  330 31  HOH HOH A . 
G 5 HOH 31  331 32  HOH HOH A . 
G 5 HOH 32  332 33  HOH HOH A . 
G 5 HOH 33  333 34  HOH HOH A . 
G 5 HOH 34  334 35  HOH HOH A . 
G 5 HOH 35  335 36  HOH HOH A . 
G 5 HOH 36  336 37  HOH HOH A . 
G 5 HOH 37  337 39  HOH HOH A . 
G 5 HOH 38  338 40  HOH HOH A . 
G 5 HOH 39  339 41  HOH HOH A . 
G 5 HOH 40  340 42  HOH HOH A . 
G 5 HOH 41  341 43  HOH HOH A . 
G 5 HOH 42  342 44  HOH HOH A . 
G 5 HOH 43  343 46  HOH HOH A . 
G 5 HOH 44  344 47  HOH HOH A . 
G 5 HOH 45  345 49  HOH HOH A . 
G 5 HOH 46  346 50  HOH HOH A . 
G 5 HOH 47  347 51  HOH HOH A . 
G 5 HOH 48  348 52  HOH HOH A . 
G 5 HOH 49  349 53  HOH HOH A . 
G 5 HOH 50  350 54  HOH HOH A . 
G 5 HOH 51  351 55  HOH HOH A . 
G 5 HOH 52  352 56  HOH HOH A . 
G 5 HOH 53  353 57  HOH HOH A . 
G 5 HOH 54  354 58  HOH HOH A . 
G 5 HOH 55  355 59  HOH HOH A . 
G 5 HOH 56  356 60  HOH HOH A . 
G 5 HOH 57  357 61  HOH HOH A . 
G 5 HOH 58  358 62  HOH HOH A . 
G 5 HOH 59  359 64  HOH HOH A . 
G 5 HOH 60  360 65  HOH HOH A . 
G 5 HOH 61  361 66  HOH HOH A . 
G 5 HOH 62  362 67  HOH HOH A . 
G 5 HOH 63  363 69  HOH HOH A . 
G 5 HOH 64  364 70  HOH HOH A . 
G 5 HOH 65  365 71  HOH HOH A . 
G 5 HOH 66  366 72  HOH HOH A . 
G 5 HOH 67  367 73  HOH HOH A . 
G 5 HOH 68  368 74  HOH HOH A . 
G 5 HOH 69  369 75  HOH HOH A . 
G 5 HOH 70  370 77  HOH HOH A . 
G 5 HOH 71  371 78  HOH HOH A . 
G 5 HOH 72  372 79  HOH HOH A . 
G 5 HOH 73  373 80  HOH HOH A . 
G 5 HOH 74  374 81  HOH HOH A . 
G 5 HOH 75  375 82  HOH HOH A . 
G 5 HOH 76  376 83  HOH HOH A . 
G 5 HOH 77  377 84  HOH HOH A . 
G 5 HOH 78  378 85  HOH HOH A . 
G 5 HOH 79  379 86  HOH HOH A . 
G 5 HOH 80  380 87  HOH HOH A . 
G 5 HOH 81  381 88  HOH HOH A . 
G 5 HOH 82  382 89  HOH HOH A . 
G 5 HOH 83  383 90  HOH HOH A . 
G 5 HOH 84  384 91  HOH HOH A . 
G 5 HOH 85  385 92  HOH HOH A . 
G 5 HOH 86  386 93  HOH HOH A . 
G 5 HOH 87  387 94  HOH HOH A . 
G 5 HOH 88  388 95  HOH HOH A . 
G 5 HOH 89  389 96  HOH HOH A . 
G 5 HOH 90  390 97  HOH HOH A . 
G 5 HOH 91  391 98  HOH HOH A . 
G 5 HOH 92  392 99  HOH HOH A . 
G 5 HOH 93  393 100 HOH HOH A . 
G 5 HOH 94  394 101 HOH HOH A . 
G 5 HOH 95  395 102 HOH HOH A . 
G 5 HOH 96  396 105 HOH HOH A . 
G 5 HOH 97  397 108 HOH HOH A . 
G 5 HOH 98  398 109 HOH HOH A . 
G 5 HOH 99  399 110 HOH HOH A . 
G 5 HOH 100 400 111 HOH HOH A . 
G 5 HOH 101 401 112 HOH HOH A . 
G 5 HOH 102 402 113 HOH HOH A . 
G 5 HOH 103 403 114 HOH HOH A . 
G 5 HOH 104 404 115 HOH HOH A . 
G 5 HOH 105 405 116 HOH HOH A . 
G 5 HOH 106 406 117 HOH HOH A . 
G 5 HOH 107 407 118 HOH HOH A . 
G 5 HOH 108 408 119 HOH HOH A . 
G 5 HOH 109 409 120 HOH HOH A . 
G 5 HOH 110 410 123 HOH HOH A . 
G 5 HOH 111 411 124 HOH HOH A . 
G 5 HOH 112 412 125 HOH HOH A . 
G 5 HOH 113 413 126 HOH HOH A . 
G 5 HOH 114 414 127 HOH HOH A . 
G 5 HOH 115 415 128 HOH HOH A . 
G 5 HOH 116 416 129 HOH HOH A . 
G 5 HOH 117 417 130 HOH HOH A . 
G 5 HOH 118 418 131 HOH HOH A . 
G 5 HOH 119 419 132 HOH HOH A . 
G 5 HOH 120 420 133 HOH HOH A . 
G 5 HOH 121 421 135 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    8OG 
_pdbx_struct_mod_residue.label_seq_id     6 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     8OG 
_pdbx_struct_mod_residue.auth_seq_id      18 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 269 ? A CYS 269 ? 1_555 97.4  ? 
2 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 272 ? A CYS 272 ? 1_555 113.3 ? 
3 SG ? C CYS 269 ? A CYS 269 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 272 ? A CYS 272 ? 1_555 117.2 ? 
4 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 107.3 ? 
5 SG ? C CYS 269 ? A CYS 269 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 112.0 ? 
6 SG ? C CYS 272 ? A CYS 272 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 108.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-14 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The sequence of this protein is not available in any reference sequence database. 
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 66  ? ? -101.11 -137.07 
2 1 ASP A 67  ? ? -90.38  -73.23  
3 1 ARG A 76  ? ? 55.93   -130.88 
4 1 ASP A 110 ? ? -160.12 90.23   
5 1 VAL A 153 ? ? -76.46  41.27   
6 1 LYS A 154 ? ? -148.32 -1.27   
7 1 ARG A 223 ? ? -132.11 -68.24  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     17 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.061 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 91  ? CG  ? C GLU 91  CG  
2  1 Y 1 A GLU 91  ? CD  ? C GLU 91  CD  
3  1 Y 1 A GLU 91  ? OE1 ? C GLU 91  OE1 
4  1 Y 1 A GLU 91  ? OE2 ? C GLU 91  OE2 
5  1 Y 1 A GLU 133 ? CD  ? C GLU 133 CD  
6  1 Y 1 A GLU 133 ? OE1 ? C GLU 133 OE1 
7  1 Y 1 A GLU 133 ? OE2 ? C GLU 133 OE2 
8  1 Y 1 A GLU 150 ? CG  ? C GLU 150 CG  
9  1 Y 1 A GLU 150 ? CD  ? C GLU 150 CD  
10 1 Y 1 A GLU 150 ? OE1 ? C GLU 150 OE1 
11 1 Y 1 A GLU 150 ? OE2 ? C GLU 150 OE2 
12 1 Y 1 A LYS 154 ? CD  ? C LYS 154 CD  
13 1 Y 1 A LYS 154 ? CE  ? C LYS 154 CE  
14 1 Y 1 A LYS 154 ? NZ  ? C LYS 154 NZ  
15 1 Y 1 A LYS 156 ? CD  ? C LYS 156 CD  
16 1 Y 1 A LYS 156 ? CE  ? C LYS 156 CE  
17 1 Y 1 A LYS 156 ? NZ  ? C LYS 156 NZ  
18 1 Y 1 A SER 197 ? OG  ? C SER 197 OG  
19 1 Y 1 A LYS 198 ? CD  ? C LYS 198 CD  
20 1 Y 1 A LYS 198 ? CE  ? C LYS 198 CE  
21 1 Y 1 A LYS 198 ? NZ  ? C LYS 198 NZ  
22 1 Y 1 A GLU 201 ? CG  ? C GLU 201 CG  
23 1 Y 1 A GLU 201 ? CD  ? C GLU 201 CD  
24 1 Y 1 A GLU 201 ? OE1 ? C GLU 201 OE1 
25 1 Y 1 A GLU 201 ? OE2 ? C GLU 201 OE2 
26 1 Y 1 A GLU 205 ? CD  ? C GLU 205 CD  
27 1 Y 1 A GLU 205 ? OE1 ? C GLU 205 OE1 
28 1 Y 1 A GLU 205 ? OE2 ? C GLU 205 OE2 
29 1 Y 1 A LYS 217 ? CD  ? C LYS 217 CD  
30 1 Y 1 A LYS 217 ? CE  ? C LYS 217 CE  
31 1 Y 1 A LYS 217 ? NZ  ? C LYS 217 NZ  
32 1 Y 1 A ARG 251 ? CD  ? C ARG 251 CD  
33 1 Y 1 A ARG 251 ? NE  ? C ARG 251 NE  
34 1 Y 1 A ARG 251 ? CZ  ? C ARG 251 CZ  
35 1 Y 1 A ARG 251 ? NH1 ? C ARG 251 NH1 
36 1 Y 1 A ARG 251 ? NH2 ? C ARG 251 NH2 
37 1 Y 1 A ARG 274 ? CG  ? C ARG 274 CG  
38 1 Y 1 A ARG 274 ? CD  ? C ARG 274 CD  
39 1 Y 1 A ARG 274 ? NE  ? C ARG 274 NE  
40 1 Y 1 A ARG 274 ? CZ  ? C ARG 274 CZ  
41 1 Y 1 A ARG 274 ? NH1 ? C ARG 274 NH1 
42 1 Y 1 A ARG 274 ? NH2 ? C ARG 274 NH2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    C 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1R2Y 'b-form double helix'  
1R2Y 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 12 1_555 -0.303 0.681  0.251  1.506   1.631   4.611  1  B_DG1:DC24_C  B 1  ? C 24 ? ?  ? 
1 A DT 2  1_555 B DA 11 1_555 0.013  0.352  0.020  11.477  -10.598 16.240 2  B_DT2:DA23_C  B 2  ? C 23 ? ?  1 
1 A DA 3  1_555 B DT 10 1_555 -1.056 -0.190 0.114  7.428   -11.223 5.903  3  B_DA3:DT22_C  B 3  ? C 22 ? 20 1 
1 A DG 4  1_555 B DC 9  1_555 0.055  -0.259 -0.465 -3.796  -14.819 6.707  4  B_DG4:DC21_C  B 4  ? C 21 ? 19 1 
1 A DA 5  1_555 B DT 8  1_555 0.158  -0.284 -0.215 -5.643  -2.505  -0.719 5  B_DA5:DT20_C  B 5  ? C 20 ? 20 1 
1 A DC 6  1_555 B DG 7  1_555 -0.073 0.053  -0.518 15.067  8.672   -5.203 6  B_DC6:DG19_C  B 6  ? C 19 ? 19 1 
1 A DT 8  1_555 B DA 5  1_555 -0.226 -0.113 0.006  -14.700 -3.011  -3.694 7  B_DT8:DA17_C  B 8  ? C 17 ? 20 1 
1 A DG 9  1_555 B DC 4  1_555 0.173  -0.203 -0.254 0.535   -2.332  -5.724 8  B_DG9:DC16_C  B 9  ? C 16 ? 19 1 
1 A DG 10 1_555 B DC 3  1_555 0.154  -0.168 -0.169 -0.028  -9.957  -0.308 9  B_DG10:DC15_C B 10 ? C 15 ? 19 1 
1 A DA 11 1_555 B DT 2  1_555 0.455  -0.100 -0.227 1.741   -12.256 -4.948 10 B_DA11:DT14_C B 11 ? C 14 ? 20 1 
1 A DC 12 1_555 B DG 1  1_555 1.039  -0.466 -0.377 9.470   -6.340  1.516  11 B_DC12:DG13_C B 12 ? C 13 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 12 1_555 A DT 2  1_555 B DA 11 1_555 0.960  0.196  3.003 4.316  7.279  37.431 -0.558 -0.954 3.074 11.168 
-6.622 38.342 1 BB_DG1DT2:DA23DC24_CC   B 1  ? C 24 ? B 2  ? C 23 ? 
1 A DT 2  1_555 B DA 11 1_555 A DA 3  1_555 B DT 10 1_555 -0.501 1.536  3.384 -1.341 -2.873 39.567 2.604  0.578  3.283 -4.236 
1.977  39.689 2 BB_DT2DA3:DT22DA23_CC   B 2  ? C 23 ? B 3  ? C 22 ? 
1 A DA 3  1_555 B DT 10 1_555 A DG 4  1_555 B DC 9  1_555 -0.123 -0.081 3.716 3.063  6.142  41.023 -0.852 0.541  3.649 8.691  
-4.333 41.569 3 BB_DA3DG4:DC21DT22_CC   B 3  ? C 22 ? B 4  ? C 21 ? 
1 A DG 4  1_555 B DC 9  1_555 A DA 5  1_555 B DT 8  1_555 -0.043 -0.838 3.289 -1.041 3.820  34.145 -2.011 -0.088 3.179 6.478  
1.766  34.367 4 BB_DG4DA5:DT20DC21_CC   B 4  ? C 21 ? B 5  ? C 20 ? 
1 A DA 5  1_555 B DT 8  1_555 A DC 6  1_555 B DG 7  1_555 0.272  -0.076 2.909 3.628  4.642  20.714 -1.872 0.577  2.829 12.586 
-9.836 21.527 5 BB_DA5DC6:DG19DT20_CC   B 5  ? C 20 ? B 6  ? C 19 ? 
1 A DT 8  1_555 B DA 5  1_555 A DG 9  1_555 B DC 4  1_555 -0.120 0.396  3.161 0.469  5.071  31.831 -0.168 0.297  3.183 9.173  
-0.848 32.226 6 BB_DT8DG9:DC16DA17_CC   B 8  ? C 17 ? B 9  ? C 16 ? 
1 A DG 9  1_555 B DC 4  1_555 A DG 10 1_555 B DC 3  1_555 -0.174 -0.423 3.305 -2.006 6.911  34.002 -1.765 -0.015 3.166 11.656 
3.383  34.733 7 BB_DG9DG10:DC15DC16_CC  B 9  ? C 16 ? B 10 ? C 15 ? 
1 A DG 10 1_555 B DC 3  1_555 A DA 11 1_555 B DT 2  1_555 -0.642 -0.016 3.218 -2.029 3.450  37.884 -0.457 0.730  3.233 5.295  
3.115  38.087 8 BB_DG10DA11:DT14DC15_CC B 10 ? C 15 ? B 11 ? C 14 ? 
1 A DA 11 1_555 B DT 2  1_555 A DC 12 1_555 B DG 1  1_555 0.268  -0.026 3.229 1.456  5.738  40.010 -0.674 -0.226 3.203 8.331  
-2.114 40.428 9 BB_DA11DC12:DG13DT14_CC B 11 ? C 14 ? B 12 ? C 13 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#