data_1R49
# 
_entry.id   1R49 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1R49         pdb_00001r49 10.2210/pdb1r49/pdb 
NDB   PD0477       ?            ?                   
RCSB  RCSB020417   ?            ?                   
WWPDB D_1000020417 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1A36 'Human DNA Topoisomerase I (70 Kda) In Non-Covalent Complex With A 22 Base Pair DNA Duplex' unspecified 
PDB 1EJ9 'Crystal Structure Of Human Topoisomerase I DNA Complex' unspecified 
PDB 1K4S 'Human DNA Topoisomerase I In Covalent Complex With A 22 Base Pair DNA Duplex' unspecified 
PDB 1K4T 
'Human DNA Topoisomerase I (70 Kda) In Complex With The Poison Topotecan and Covalent Complex With A 22 Base Pair DNA Duplex'    
unspecified 
PDB 1LPQ 'Human DNA Topoisomerase I (70 Kda) In Non-Covalent Complex With A 22 Base Pair DNA Duplex Containing An 8-Oxog Lesion' 
unspecified 
PDB 1TMC 
'The three-dimensional structure of a class I major histocompatibility complex molecule missing the 3 domain of the heavy chain' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R49 
_pdbx_database_status.recvd_initial_deposition_date   2003-10-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Interthal, H.'  1 
'Quigley, P.M.'  2 
'Hol, W.G.'      3 
'Champoux, J.J.' 4 
# 
_citation.id                        primary 
_citation.title                     'The role of lysine 532 in the catalytic mechanism of human topoisomerase I.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                2984 
_citation.page_last                 2992 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14594810 
_citation.pdbx_database_id_DOI      10.1074/jbc.M309959200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Interthal, H.'  1 ? 
primary 'Quigley, P.M.'  2 ? 
primary 'Hol, W.G.'      3 ? 
primary 'Champoux, J.J.' 4 ? 
# 
_cell.entry_id           1R49 
_cell.length_a           56.944 
_cell.length_b           118.638 
_cell.length_c           71.651 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.33 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1R49 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*TP*AP*GP*AP*AP*AP*AP*AP*TP*TP*TP*TP*T)-3'"  6790.468  1  ?        ?              ? 
? 
2 polymer syn "5'-D(P*AP*AP*AP*AP*AP*TP*TP*TP*TP*TP*CP*TP*AP*AP*GP*TP*CP*TP*TP*TP*TP*T)-3'" 6705.373  1  ?        ?              ? 
? 
3 polymer man 'DNA topoisomerase I'                                                         70180.055 1  5.99.1.2 'K532R, Y723F' 
Topo70 ? 
4 water   nat water                                                                         18.015    29 ?        ?              ? 
? 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        5.99.1.2 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DA)(DA)(DA)(DA)(DG)(DA)(DC)(DT)(DT)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(DT)(DT)(DT)
(DT)(DT)
;
AAAAAGACTTAGAAAAATTTTT B ? 
2 polydeoxyribonucleotide no no 
;(DA)(DA)(DA)(DA)(DA)(DT)(DT)(DT)(DT)(DT)(DC)(DT)(DA)(DA)(DG)(DT)(DC)(DT)(DT)(DT)
(DT)(DT)
;
AAAAATTTTTCTAAGTCTTTTT C ? 
3 'polypeptide(L)'        no no 
;KKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKA
EEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEK
LLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWL
VSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEK
EEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGRDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGIL
NKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDA
KKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWC
KKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
;KKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKA
EEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEK
LLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWL
VSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEK
EEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGRDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGIL
NKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDA
KKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWC
KKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DC  n 
1 9   DT  n 
1 10  DT  n 
1 11  DA  n 
1 12  DG  n 
1 13  DA  n 
1 14  DA  n 
1 15  DA  n 
1 16  DA  n 
1 17  DA  n 
1 18  DT  n 
1 19  DT  n 
1 20  DT  n 
1 21  DT  n 
1 22  DT  n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   DT  n 
2 8   DT  n 
2 9   DT  n 
2 10  DT  n 
2 11  DC  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DC  n 
2 18  DT  n 
2 19  DT  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
3 1   LYS n 
3 2   LYS n 
3 3   PRO n 
3 4   LYS n 
3 5   ASN n 
3 6   LYS n 
3 7   ASP n 
3 8   LYS n 
3 9   ASP n 
3 10  LYS n 
3 11  LYS n 
3 12  VAL n 
3 13  PRO n 
3 14  GLU n 
3 15  PRO n 
3 16  ASP n 
3 17  ASN n 
3 18  LYS n 
3 19  LYS n 
3 20  LYS n 
3 21  LYS n 
3 22  PRO n 
3 23  LYS n 
3 24  LYS n 
3 25  GLU n 
3 26  GLU n 
3 27  GLU n 
3 28  GLN n 
3 29  LYS n 
3 30  TRP n 
3 31  LYS n 
3 32  TRP n 
3 33  TRP n 
3 34  GLU n 
3 35  GLU n 
3 36  GLU n 
3 37  ARG n 
3 38  TYR n 
3 39  PRO n 
3 40  GLU n 
3 41  GLY n 
3 42  ILE n 
3 43  LYS n 
3 44  TRP n 
3 45  LYS n 
3 46  PHE n 
3 47  LEU n 
3 48  GLU n 
3 49  HIS n 
3 50  LYS n 
3 51  GLY n 
3 52  PRO n 
3 53  VAL n 
3 54  PHE n 
3 55  ALA n 
3 56  PRO n 
3 57  PRO n 
3 58  TYR n 
3 59  GLU n 
3 60  PRO n 
3 61  LEU n 
3 62  PRO n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  LYS n 
3 67  PHE n 
3 68  TYR n 
3 69  TYR n 
3 70  ASP n 
3 71  GLY n 
3 72  LYS n 
3 73  VAL n 
3 74  MET n 
3 75  LYS n 
3 76  LEU n 
3 77  SER n 
3 78  PRO n 
3 79  LYS n 
3 80  ALA n 
3 81  GLU n 
3 82  GLU n 
3 83  VAL n 
3 84  ALA n 
3 85  THR n 
3 86  PHE n 
3 87  PHE n 
3 88  ALA n 
3 89  LYS n 
3 90  MET n 
3 91  LEU n 
3 92  ASP n 
3 93  HIS n 
3 94  GLU n 
3 95  TYR n 
3 96  THR n 
3 97  THR n 
3 98  LYS n 
3 99  GLU n 
3 100 ILE n 
3 101 PHE n 
3 102 ARG n 
3 103 LYS n 
3 104 ASN n 
3 105 PHE n 
3 106 PHE n 
3 107 LYS n 
3 108 ASP n 
3 109 TRP n 
3 110 ARG n 
3 111 LYS n 
3 112 GLU n 
3 113 MET n 
3 114 THR n 
3 115 ASN n 
3 116 GLU n 
3 117 GLU n 
3 118 LYS n 
3 119 ASN n 
3 120 ILE n 
3 121 ILE n 
3 122 THR n 
3 123 ASN n 
3 124 LEU n 
3 125 SER n 
3 126 LYS n 
3 127 CYS n 
3 128 ASP n 
3 129 PHE n 
3 130 THR n 
3 131 GLN n 
3 132 MET n 
3 133 SER n 
3 134 GLN n 
3 135 TYR n 
3 136 PHE n 
3 137 LYS n 
3 138 ALA n 
3 139 GLN n 
3 140 THR n 
3 141 GLU n 
3 142 ALA n 
3 143 ARG n 
3 144 LYS n 
3 145 GLN n 
3 146 MET n 
3 147 SER n 
3 148 LYS n 
3 149 GLU n 
3 150 GLU n 
3 151 LYS n 
3 152 LEU n 
3 153 LYS n 
3 154 ILE n 
3 155 LYS n 
3 156 GLU n 
3 157 GLU n 
3 158 ASN n 
3 159 GLU n 
3 160 LYS n 
3 161 LEU n 
3 162 LEU n 
3 163 LYS n 
3 164 GLU n 
3 165 TYR n 
3 166 GLY n 
3 167 PHE n 
3 168 CYS n 
3 169 ILE n 
3 170 MET n 
3 171 ASP n 
3 172 ASN n 
3 173 HIS n 
3 174 LYS n 
3 175 GLU n 
3 176 ARG n 
3 177 ILE n 
3 178 ALA n 
3 179 ASN n 
3 180 PHE n 
3 181 LYS n 
3 182 ILE n 
3 183 GLU n 
3 184 PRO n 
3 185 PRO n 
3 186 GLY n 
3 187 LEU n 
3 188 PHE n 
3 189 ARG n 
3 190 GLY n 
3 191 ARG n 
3 192 GLY n 
3 193 ASN n 
3 194 HIS n 
3 195 PRO n 
3 196 LYS n 
3 197 MET n 
3 198 GLY n 
3 199 MET n 
3 200 LEU n 
3 201 LYS n 
3 202 ARG n 
3 203 ARG n 
3 204 ILE n 
3 205 MET n 
3 206 PRO n 
3 207 GLU n 
3 208 ASP n 
3 209 ILE n 
3 210 ILE n 
3 211 ILE n 
3 212 ASN n 
3 213 CYS n 
3 214 SER n 
3 215 LYS n 
3 216 ASP n 
3 217 ALA n 
3 218 LYS n 
3 219 VAL n 
3 220 PRO n 
3 221 SER n 
3 222 PRO n 
3 223 PRO n 
3 224 PRO n 
3 225 GLY n 
3 226 HIS n 
3 227 LYS n 
3 228 TRP n 
3 229 LYS n 
3 230 GLU n 
3 231 VAL n 
3 232 ARG n 
3 233 HIS n 
3 234 ASP n 
3 235 ASN n 
3 236 LYS n 
3 237 VAL n 
3 238 THR n 
3 239 TRP n 
3 240 LEU n 
3 241 VAL n 
3 242 SER n 
3 243 TRP n 
3 244 THR n 
3 245 GLU n 
3 246 ASN n 
3 247 ILE n 
3 248 GLN n 
3 249 GLY n 
3 250 SER n 
3 251 ILE n 
3 252 LYS n 
3 253 TYR n 
3 254 ILE n 
3 255 MET n 
3 256 LEU n 
3 257 ASN n 
3 258 PRO n 
3 259 SER n 
3 260 SER n 
3 261 ARG n 
3 262 ILE n 
3 263 LYS n 
3 264 GLY n 
3 265 GLU n 
3 266 LYS n 
3 267 ASP n 
3 268 TRP n 
3 269 GLN n 
3 270 LYS n 
3 271 TYR n 
3 272 GLU n 
3 273 THR n 
3 274 ALA n 
3 275 ARG n 
3 276 ARG n 
3 277 LEU n 
3 278 LYS n 
3 279 LYS n 
3 280 CYS n 
3 281 VAL n 
3 282 ASP n 
3 283 LYS n 
3 284 ILE n 
3 285 ARG n 
3 286 ASN n 
3 287 GLN n 
3 288 TYR n 
3 289 ARG n 
3 290 GLU n 
3 291 ASP n 
3 292 TRP n 
3 293 LYS n 
3 294 SER n 
3 295 LYS n 
3 296 GLU n 
3 297 MET n 
3 298 LYS n 
3 299 VAL n 
3 300 ARG n 
3 301 GLN n 
3 302 ARG n 
3 303 ALA n 
3 304 VAL n 
3 305 ALA n 
3 306 LEU n 
3 307 TYR n 
3 308 PHE n 
3 309 ILE n 
3 310 ASP n 
3 311 LYS n 
3 312 LEU n 
3 313 ALA n 
3 314 LEU n 
3 315 ARG n 
3 316 ALA n 
3 317 GLY n 
3 318 ASN n 
3 319 GLU n 
3 320 LYS n 
3 321 GLU n 
3 322 GLU n 
3 323 GLY n 
3 324 GLU n 
3 325 THR n 
3 326 ALA n 
3 327 ASP n 
3 328 THR n 
3 329 VAL n 
3 330 GLY n 
3 331 CYS n 
3 332 CYS n 
3 333 SER n 
3 334 LEU n 
3 335 ARG n 
3 336 VAL n 
3 337 GLU n 
3 338 HIS n 
3 339 ILE n 
3 340 ASN n 
3 341 LEU n 
3 342 HIS n 
3 343 PRO n 
3 344 GLU n 
3 345 LEU n 
3 346 ASP n 
3 347 GLY n 
3 348 GLN n 
3 349 GLU n 
3 350 TYR n 
3 351 VAL n 
3 352 VAL n 
3 353 GLU n 
3 354 PHE n 
3 355 ASP n 
3 356 PHE n 
3 357 LEU n 
3 358 GLY n 
3 359 ARG n 
3 360 ASP n 
3 361 SER n 
3 362 ILE n 
3 363 ARG n 
3 364 TYR n 
3 365 TYR n 
3 366 ASN n 
3 367 LYS n 
3 368 VAL n 
3 369 PRO n 
3 370 VAL n 
3 371 GLU n 
3 372 LYS n 
3 373 ARG n 
3 374 VAL n 
3 375 PHE n 
3 376 LYS n 
3 377 ASN n 
3 378 LEU n 
3 379 GLN n 
3 380 LEU n 
3 381 PHE n 
3 382 MET n 
3 383 GLU n 
3 384 ASN n 
3 385 LYS n 
3 386 GLN n 
3 387 PRO n 
3 388 GLU n 
3 389 ASP n 
3 390 ASP n 
3 391 LEU n 
3 392 PHE n 
3 393 ASP n 
3 394 ARG n 
3 395 LEU n 
3 396 ASN n 
3 397 THR n 
3 398 GLY n 
3 399 ILE n 
3 400 LEU n 
3 401 ASN n 
3 402 LYS n 
3 403 HIS n 
3 404 LEU n 
3 405 GLN n 
3 406 ASP n 
3 407 LEU n 
3 408 MET n 
3 409 GLU n 
3 410 GLY n 
3 411 LEU n 
3 412 THR n 
3 413 ALA n 
3 414 LYS n 
3 415 VAL n 
3 416 PHE n 
3 417 ARG n 
3 418 THR n 
3 419 TYR n 
3 420 ASN n 
3 421 ALA n 
3 422 SER n 
3 423 ILE n 
3 424 THR n 
3 425 LEU n 
3 426 GLN n 
3 427 GLN n 
3 428 GLN n 
3 429 LEU n 
3 430 LYS n 
3 431 GLU n 
3 432 LEU n 
3 433 THR n 
3 434 ALA n 
3 435 PRO n 
3 436 ASP n 
3 437 GLU n 
3 438 ASN n 
3 439 ILE n 
3 440 PRO n 
3 441 ALA n 
3 442 LYS n 
3 443 ILE n 
3 444 LEU n 
3 445 SER n 
3 446 TYR n 
3 447 ASN n 
3 448 ARG n 
3 449 ALA n 
3 450 ASN n 
3 451 ARG n 
3 452 ALA n 
3 453 VAL n 
3 454 ALA n 
3 455 ILE n 
3 456 LEU n 
3 457 CYS n 
3 458 ASN n 
3 459 HIS n 
3 460 GLN n 
3 461 ARG n 
3 462 ALA n 
3 463 PRO n 
3 464 PRO n 
3 465 LYS n 
3 466 THR n 
3 467 PHE n 
3 468 GLU n 
3 469 LYS n 
3 470 SER n 
3 471 MET n 
3 472 MET n 
3 473 ASN n 
3 474 LEU n 
3 475 GLN n 
3 476 THR n 
3 477 LYS n 
3 478 ILE n 
3 479 ASP n 
3 480 ALA n 
3 481 LYS n 
3 482 LYS n 
3 483 GLU n 
3 484 GLN n 
3 485 LEU n 
3 486 ALA n 
3 487 ASP n 
3 488 ALA n 
3 489 ARG n 
3 490 ARG n 
3 491 ASP n 
3 492 LEU n 
3 493 LYS n 
3 494 SER n 
3 495 ALA n 
3 496 LYS n 
3 497 ALA n 
3 498 ASP n 
3 499 ALA n 
3 500 LYS n 
3 501 VAL n 
3 502 MET n 
3 503 LYS n 
3 504 ASP n 
3 505 ALA n 
3 506 LYS n 
3 507 THR n 
3 508 LYS n 
3 509 LYS n 
3 510 VAL n 
3 511 VAL n 
3 512 GLU n 
3 513 SER n 
3 514 LYS n 
3 515 LYS n 
3 516 LYS n 
3 517 ALA n 
3 518 VAL n 
3 519 GLN n 
3 520 ARG n 
3 521 LEU n 
3 522 GLU n 
3 523 GLU n 
3 524 GLN n 
3 525 LEU n 
3 526 MET n 
3 527 LYS n 
3 528 LEU n 
3 529 GLU n 
3 530 VAL n 
3 531 GLN n 
3 532 ALA n 
3 533 THR n 
3 534 ASP n 
3 535 ARG n 
3 536 GLU n 
3 537 GLU n 
3 538 ASN n 
3 539 LYS n 
3 540 GLN n 
3 541 ILE n 
3 542 ALA n 
3 543 LEU n 
3 544 GLY n 
3 545 THR n 
3 546 SER n 
3 547 LYS n 
3 548 LEU n 
3 549 ASN n 
3 550 PHE n 
3 551 LEU n 
3 552 ASP n 
3 553 PRO n 
3 554 ARG n 
3 555 ILE n 
3 556 THR n 
3 557 VAL n 
3 558 ALA n 
3 559 TRP n 
3 560 CYS n 
3 561 LYS n 
3 562 LYS n 
3 563 TRP n 
3 564 GLY n 
3 565 VAL n 
3 566 PRO n 
3 567 ILE n 
3 568 GLU n 
3 569 LYS n 
3 570 ILE n 
3 571 TYR n 
3 572 ASN n 
3 573 LYS n 
3 574 THR n 
3 575 GLN n 
3 576 ARG n 
3 577 GLU n 
3 578 LYS n 
3 579 PHE n 
3 580 ALA n 
3 581 TRP n 
3 582 ALA n 
3 583 ILE n 
3 584 ASP n 
3 585 MET n 
3 586 ALA n 
3 587 ASP n 
3 588 GLU n 
3 589 ASP n 
3 590 TYR n 
3 591 GLU n 
3 592 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TOP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TOP1_HUMAN P11387 3 
;KKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKA
EEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEK
LLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWL
VSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEK
EEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGIL
NKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDA
KKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWC
KKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
174 ? 
2 PDB 1R49       1R49   1 ? ?   ? 
3 PDB 1R49       1R49   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1R49 A 1 ? 592 ? P11387 174 ? 765 ? 174 765 
2 2 1R49 B 1 ? 22  ? 1R49   1   ? 22  ? 1   22  
3 3 1R49 C 1 ? 22  ? 1R49   101 ? 122 ? 101 122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1R49 ARG A 359 ? UNP P11387 LYS 532 'engineered mutation' 532 1 
1 1R49 PHE A 550 ? UNP P11387 TYR 723 'engineered mutation' 723 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1R49 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.80 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.85 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350 MME, Magnesium chloride, MES, TCEP, pH 7.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 3350'           ? ? ? 
1 2 1 MME                  ? ? ? 
1 3 1 'Magnesium chloride' ? ? ? 
1 4 1 MES                  ? ? ? 
1 5 1 TCEP                 ? ? ? 
1 6 1 H2O                  ? ? ? 
1 7 2 'PEG 3350'           ? ? ? 
1 8 2 'Magnesium chloride' ? ? ? 
1 9 2 H2O                  ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1R49 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            3.13 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   ? 
_reflns.number_obs                   15514 
_reflns.percent_possible_obs         93.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.13 
_reflns_shell.d_res_low              3.26 
_reflns_shell.percent_possible_all   64.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.28 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1R49 
_refine.ls_number_reflns_obs                     14675 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.67 
_refine.ls_d_res_high                            3.13 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.28009 
_refine.ls_R_factor_all                          0.28009 
_refine.ls_R_factor_R_work                       0.27681 
_refine.ls_R_factor_R_free                       0.33917 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  821 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.887 
_refine.correlation_coeff_Fo_to_Fc_free          0.841 
_refine.B_iso_mean                               65.598 
_refine.aniso_B[1][1]                            -0.23 
_refine.aniso_B[2][2]                            -0.37 
_refine.aniso_B[3][3]                            0.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.04 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.656 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4527 
_refine_hist.pdbx_number_atoms_nucleic_acid   897 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             29 
_refine_hist.number_atoms_total               5453 
_refine_hist.d_res_high                       3.13 
_refine_hist.d_res_low                        47.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.004  0.021  ? 5560 'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      0.763  2.162  ? 7645 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.590  5.000  ? 540  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.060  0.200  ? 774  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.002  0.020  ? 3872 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.223  0.300  ? 2682 'X-RAY DIFFRACTION' ? 
r_nbd_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.216  0.500  ? 285  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.235  0.300  ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.267  0.500  ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              5.686  3.500  ? 2725 'X-RAY DIFFRACTION' ? 
r_mcangle_it             9.138  6.000  ? 4394 'X-RAY DIFFRACTION' ? 
r_scbond_it              14.551 8.800  ? 2835 'X-RAY DIFFRACTION' ? 
r_scangle_it             19.426 12.500 ? 3251 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.130 
_refine_ls_shell.d_res_low                        3.211 
_refine_ls_shell.number_reflns_R_work             621 
_refine_ls_shell.R_factor_R_work                  0.357 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.536 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             28 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1R49 
_struct.title                     'Human topoisomerase I (Topo70) double mutant K532R/Y723F' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R49 
_struct_keywords.pdbx_keywords   Isomerase/DNA 
_struct_keywords.text            'Protein, DNA, topoisomerase I, Isomerase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER C 77  ? MET C 90  ? SER A 250 MET A 263 1 ? 14 
HELX_P HELX_P2  2  GLU C 94  ? THR C 97  ? GLU A 267 THR A 270 5 ? 4  
HELX_P HELX_P3  3  LYS C 98  ? GLU C 112 ? LYS A 271 GLU A 285 1 ? 15 
HELX_P HELX_P4  4  THR C 114 ? ILE C 121 ? THR A 287 ILE A 294 1 ? 8  
HELX_P HELX_P5  5  PHE C 129 ? GLN C 145 ? PHE A 302 GLN A 318 1 ? 17 
HELX_P HELX_P6  6  SER C 147 ? GLY C 166 ? SER A 320 GLY A 339 1 ? 20 
HELX_P HELX_P7  7  SER C 260 ? ARG C 289 ? SER A 433 ARG A 462 1 ? 30 
HELX_P HELX_P8  8  GLU C 290 ? SER C 294 ? GLU A 463 SER A 467 5 ? 5  
HELX_P HELX_P9  9  GLU C 296 ? LEU C 312 ? GLU A 469 LEU A 485 1 ? 17 
HELX_P HELX_P10 10 ARG C 335 ? GLU C 337 ? ARG A 508 GLU A 510 5 ? 3  
HELX_P HELX_P11 11 GLU C 371 ? PHE C 381 ? GLU A 544 PHE A 554 1 ? 11 
HELX_P HELX_P12 12 ASN C 396 ? MET C 408 ? ASN A 569 MET A 581 1 ? 13 
HELX_P HELX_P13 13 LYS C 414 ? GLU C 431 ? LYS A 587 GLU A 604 1 ? 18 
HELX_P HELX_P14 14 ASN C 438 ? ALA C 454 ? ASN A 611 ALA A 627 1 ? 17 
HELX_P HELX_P15 15 LEU C 474 ? ASP C 487 ? LEU A 647 ASP A 660 1 ? 14 
HELX_P HELX_P16 16 ALA C 488 ? MET C 502 ? ALA A 661 MET A 675 1 ? 15 
HELX_P HELX_P17 17 ALA C 505 ? ASN C 538 ? ALA A 678 ASN A 711 1 ? 34 
HELX_P HELX_P18 18 ASP C 552 ? TRP C 563 ? ASP A 725 TRP A 736 1 ? 12 
HELX_P HELX_P19 19 PRO C 566 ? ILE C 570 ? PRO A 739 ILE A 743 5 ? 5  
HELX_P HELX_P20 20 ASN C 572 ? PHE C 579 ? ASN A 745 PHE A 752 1 ? 8  
HELX_P HELX_P21 21 PHE C 579 ? MET C 585 ? PHE A 752 MET A 758 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 21 O4 ? ? B DA 1  C DT 121 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 20 O4 ? ? B DA 2  C DT 120 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog3  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 21 N3 ? ? B DA 2  C DT 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 21 O4 ? ? B DA 2  C DT 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 20 N3 ? ? B DA 3  C DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 20 O4 ? ? B DA 3  C DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 19 N3 ? ? B DA 4  C DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 19 O4 ? ? B DA 4  C DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 18 N3 ? ? B DA 5  C DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 18 O4 ? ? B DA 5  C DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 17 N3 ? ? B DG 6  C DC 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 17 O2 ? ? B DG 6  C DC 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 17 N4 ? ? B DG 6  C DC 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 16 N3 ? ? B DA 7  C DT 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 16 O4 ? ? B DA 7  C DT 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG 15 N1 ? ? B DC 8  C DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG 15 O6 ? ? B DC 8  C DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG 15 N2 ? ? B DC 8  C DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 14 N1 ? ? B DT 9  C DA 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 14 N6 ? ? B DT 9  C DA 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 13 N1 ? ? B DT 10 C DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 13 N6 ? ? B DT 10 C DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 12 N3 ? ? B DA 11 C DT 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 12 O4 ? ? B DA 11 C DT 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 11 N3 ? ? B DG 12 C DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 11 O2 ? ? B DG 12 C DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 11 N4 ? ? B DG 12 C DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 10 N3 ? ? B DA 13 C DT 110 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog29 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 9  N3 ? ? B DA 14 C DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 9  O4 ? ? B DA 14 C DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 8  N3 ? ? B DA 15 C DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 8  O4 ? ? B DA 15 C DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 7  N3 ? ? B DA 16 C DT 107 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog34 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 17 C DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 17 C DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 5  N1 ? ? B DT 18 C DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DT 18 O4 ? ? ? 1_555 B DA 5  N6 ? ? B DT 18 C DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DT 19 N3 ? ? ? 1_555 B DA 4  N1 ? ? B DT 19 C DA 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DT 19 O4 ? ? ? 1_555 B DA 4  N6 ? ? B DT 19 C DA 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DT 20 N3 ? ? ? 1_555 B DA 3  N1 ? ? B DT 20 C DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? A DT 20 O4 ? ? ? 1_555 B DA 3  N6 ? ? B DT 20 C DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? A DT 21 N3 ? ? ? 1_555 B DA 2  N1 ? ? B DT 21 C DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? A DT 21 O4 ? ? ? 1_555 B DA 2  N6 ? ? B DT 21 C DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? A DT 22 N3 ? ? ? 1_555 B DA 1  N1 ? ? B DT 22 C DA 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? A DT 22 O4 ? ? ? 1_555 B DA 1  N6 ? ? B DT 22 C DA 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 31  C . ? LYS 204 A TRP 32  C ? TRP 205 A 1 -4.46 
2 GLN 348 C . ? GLN 521 A GLU 349 C ? GLU 522 A 1 8.04  
3 MET 471 C . ? MET 644 A MET 472 C ? MET 645 A 1 -0.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 47  ? GLU C 48  ? LEU A 220 GLU A 221 
A 2 PHE C 167 ? MET C 170 ? PHE A 340 MET A 343 
A 3 HIS C 173 ? ARG C 176 ? HIS A 346 ARG A 349 
B 1 LYS C 72  ? MET C 74  ? LYS A 245 MET A 247 
B 2 PHE C 67  ? TYR C 69  ? PHE A 240 TYR A 242 
B 3 CYS C 127 ? ASP C 128 ? CYS A 300 ASP A 301 
C 1 GLY C 186 ? LEU C 187 ? GLY A 359 LEU A 360 
C 2 LEU C 200 ? LYS C 201 ? LEU A 373 LYS A 374 
D 1 GLU C 230 ? ARG C 232 ? GLU A 403 ARG A 405 
D 2 ILE C 210 ? ASN C 212 ? ILE A 383 ASN A 385 
D 3 VAL C 241 ? THR C 244 ? VAL A 414 THR A 417 
D 4 ILE C 251 ? ILE C 254 ? ILE A 424 ILE A 427 
E 1 ILE C 339 ? HIS C 342 ? ILE A 512 HIS A 515 
E 2 VAL C 351 ? LEU C 357 ? VAL A 524 LEU A 530 
E 3 ARG C 363 ? PRO C 369 ? ARG A 536 PRO A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 48  ? N GLU A 221 O ILE C 169 ? O ILE A 342 
A 2 3 N MET C 170 ? N MET A 343 O HIS C 173 ? O HIS A 346 
B 1 2 O LYS C 72  ? O LYS A 245 N TYR C 69  ? N TYR A 242 
B 2 3 N TYR C 68  ? N TYR A 241 O ASP C 128 ? O ASP A 301 
C 1 2 N GLY C 186 ? N GLY A 359 O LYS C 201 ? O LYS A 374 
D 1 2 O ARG C 232 ? O ARG A 405 N ILE C 211 ? N ILE A 384 
D 2 3 N ILE C 210 ? N ILE A 383 O SER C 242 ? O SER A 415 
D 3 4 N TRP C 243 ? N TRP A 416 O LYS C 252 ? O LYS A 425 
E 1 2 N ASN C 340 ? N ASN A 513 O GLU C 353 ? O GLU A 526 
E 2 3 N PHE C 354 ? N PHE A 527 O ASN C 366 ? O ASN A 539 
# 
_database_PDB_matrix.entry_id          1R49 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1R49 
_atom_sites.fract_transf_matrix[1][1]   0.017561 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002570 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008429 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014105 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? -1.755  3.944   38.104  1.00 140.62 ? 1   DA  B "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? -1.163  4.085   36.811  1.00 137.31 ? 1   DA  B "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 0.132   3.295   36.725  1.00 127.53 ? 1   DA  B "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? -0.162  1.878   36.737  1.00 110.91 ? 1   DA  B "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 0.968   3.505   35.470  1.00 125.69 ? 1   DA  B "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 2.339   3.224   35.789  1.00 126.51 ? 1   DA  B "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 0.329   2.503   34.510  1.00 111.03 ? 1   DA  B "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 0.050   1.331   35.448  1.00 101.90 ? 1   DA  B "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? -1.136  0.543   35.130  1.00 83.69  ? 1   DA  B N9    1 
ATOM   10   C C8    . DA  A 1 1   ? -2.396  1.008   34.868  1.00 70.04  ? 1   DA  B C8    1 
ATOM   11   N N7    . DA  A 1 1   ? -3.270  0.058   34.627  1.00 60.48  ? 1   DA  B N7    1 
ATOM   12   C C5    . DA  A 1 1   ? -2.530  -1.110  34.745  1.00 75.75  ? 1   DA  B C5    1 
ATOM   13   C C6    . DA  A 1 1   ? -2.873  -2.472  34.606  1.00 71.51  ? 1   DA  B C6    1 
ATOM   14   N N6    . DA  A 1 1   ? -4.110  -2.883  34.303  1.00 45.25  ? 1   DA  B N6    1 
ATOM   15   N N1    . DA  A 1 1   ? -1.894  -3.389  34.791  1.00 55.13  ? 1   DA  B N1    1 
ATOM   16   C C2    . DA  A 1 1   ? -0.656  -2.967  35.091  1.00 31.17  ? 1   DA  B C2    1 
ATOM   17   N N3    . DA  A 1 1   ? -0.213  -1.718  35.244  1.00 52.16  ? 1   DA  B N3    1 
ATOM   18   C C4    . DA  A 1 1   ? -1.210  -0.830  35.058  1.00 74.90  ? 1   DA  B C4    1 
ATOM   19   P P     . DA  A 1 2   ? 3.449   2.808   34.697  1.00 117.40 ? 2   DA  B P     1 
ATOM   20   O OP1   . DA  A 1 2   ? 4.787   3.073   35.274  1.00 88.81  ? 2   DA  B OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? 3.081   3.406   33.394  1.00 128.97 ? 2   DA  B OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? 3.256   1.224   34.591  1.00 129.83 ? 2   DA  B "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? 4.253   0.358   35.117  1.00 133.81 ? 2   DA  B "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? 4.560   -0.772  34.149  1.00 131.06 ? 2   DA  B "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? 3.342   -1.503  33.847  1.00 122.77 ? 2   DA  B "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? 5.148   -0.347  32.806  1.00 118.25 ? 2   DA  B "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? 6.156   -1.288  32.462  1.00 108.41 ? 2   DA  B "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? 3.942   -0.405  31.871  1.00 96.07  ? 2   DA  B "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? 3.191   -1.599  32.447  1.00 90.43  ? 2   DA  B "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? 1.763   -1.607  32.159  1.00 75.93  ? 2   DA  B N9    1 
ATOM   31   C C8    . DA  A 1 2   ? 0.950   -0.528  31.951  1.00 74.35  ? 2   DA  B C8    1 
ATOM   32   N N7    . DA  A 1 2   ? -0.302  -0.848  31.716  1.00 67.72  ? 2   DA  B N7    1 
ATOM   33   C C5    . DA  A 1 2   ? -0.310  -2.233  31.776  1.00 55.98  ? 2   DA  B C5    1 
ATOM   34   C C6    . DA  A 1 2   ? -1.335  -3.188  31.616  1.00 53.95  ? 2   DA  B C6    1 
ATOM   35   N N6    . DA  A 1 2   ? -2.605  -2.861  31.350  1.00 46.34  ? 2   DA  B N6    1 
ATOM   36   N N1    . DA  A 1 2   ? -1.004  -4.492  31.740  1.00 41.53  ? 2   DA  B N1    1 
ATOM   37   C C2    . DA  A 1 2   ? 0.270   -4.810  32.007  1.00 66.56  ? 2   DA  B C2    1 
ATOM   38   N N3    . DA  A 1 2   ? 1.318   -4.005  32.180  1.00 73.12  ? 2   DA  B N3    1 
ATOM   39   C C4    . DA  A 1 2   ? 0.957   -2.717  32.051  1.00 72.44  ? 2   DA  B C4    1 
ATOM   40   P P     . DA  A 1 3   ? 7.063   -1.171  31.148  1.00 115.55 ? 3   DA  B P     1 
ATOM   41   O OP1   . DA  A 1 3   ? 8.193   -0.262  31.439  1.00 103.72 ? 3   DA  B OP1   1 
ATOM   42   O OP2   . DA  A 1 3   ? 6.197   -0.925  29.971  1.00 116.84 ? 3   DA  B OP2   1 
ATOM   43   O "O5'" . DA  A 1 3   ? 7.615   -2.669  31.049  1.00 117.20 ? 3   DA  B "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3   ? 6.961   -3.690  31.803  1.00 109.49 ? 3   DA  B "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3   ? 6.311   -4.713  30.886  1.00 97.20  ? 3   DA  B "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3   ? 4.879   -4.481  30.767  1.00 81.24  ? 3   DA  B "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3   ? 6.843   -4.736  29.457  1.00 72.89  ? 3   DA  B "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3   ? 6.997   -6.093  29.085  1.00 75.01  ? 3   DA  B "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3   ? 5.726   -4.057  28.670  1.00 44.49  ? 3   DA  B "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3   ? 4.535   -4.653  29.407  1.00 33.16  ? 3   DA  B "C1'" 1 
ATOM   51   N N9    . DA  A 1 3   ? 3.256   -4.004  29.152  1.00 35.48  ? 3   DA  B N9    1 
ATOM   52   C C8    . DA  A 1 3   ? 3.010   -2.662  29.065  1.00 28.59  ? 3   DA  B C8    1 
ATOM   53   N N7    . DA  A 1 3   ? 1.749   -2.373  28.830  1.00 38.65  ? 3   DA  B N7    1 
ATOM   54   C C5    . DA  A 1 3   ? 1.122   -3.609  28.758  1.00 44.66  ? 3   DA  B C5    1 
ATOM   55   C C6    . DA  A 1 3   ? -0.222  -3.990  28.529  1.00 47.01  ? 3   DA  B C6    1 
ATOM   56   N N6    . DA  A 1 3   ? -1.213  -3.112  28.325  1.00 42.38  ? 3   DA  B N6    1 
ATOM   57   N N1    . DA  A 1 3   ? -0.511  -5.313  28.521  1.00 22.90  ? 3   DA  B N1    1 
ATOM   58   C C2    . DA  A 1 3   ? 0.489   -6.183  28.728  1.00 40.88  ? 3   DA  B C2    1 
ATOM   59   N N3    . DA  A 1 3   ? 1.787   -5.945  28.949  1.00 26.20  ? 3   DA  B N3    1 
ATOM   60   C C4    . DA  A 1 3   ? 2.040   -4.625  28.954  1.00 44.25  ? 3   DA  B C4    1 
ATOM   61   P P     . DA  A 1 4   ? 7.942   -6.502  27.869  1.00 99.62  ? 4   DA  B P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 9.313   -6.044  28.186  1.00 108.14 ? 4   DA  B OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 7.278   -6.055  26.623  1.00 108.27 ? 4   DA  B OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 7.897   -8.102  27.916  1.00 89.43  ? 4   DA  B "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 6.813   -8.766  28.566  1.00 90.48  ? 4   DA  B "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 5.757   -9.230  27.573  1.00 93.09  ? 4   DA  B "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 4.670   -8.275  27.507  1.00 83.89  ? 4   DA  B "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 6.240   -9.456  26.140  1.00 81.70  ? 4   DA  B "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 6.113   -10.853 25.836  1.00 81.60  ? 4   DA  B "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 5.356   -8.540  25.287  1.00 59.70  ? 4   DA  B "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 4.157   -8.267  26.191  1.00 63.09  ? 4   DA  B "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 3.523   -6.967  25.981  1.00 51.85  ? 4   DA  B N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 4.145   -5.748  25.962  1.00 51.88  ? 4   DA  B C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 3.333   -4.736  25.762  1.00 34.88  ? 4   DA  B N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 2.087   -5.332  25.641  1.00 21.17  ? 4   DA  B C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 0.803   -4.797  25.415  1.00 35.71  ? 4   DA  B C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 0.584   -3.487  25.267  1.00 42.69  ? 4   DA  B N6    1 
ATOM   78   N N1    . DA  A 1 4   ? -0.241  -5.656  25.349  1.00 18.32  ? 4   DA  B N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 0.002   -6.967  25.497  1.00 28.92  ? 4   DA  B C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 1.167   -7.590  25.711  1.00 29.86  ? 4   DA  B N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 2.183   -6.707  25.775  1.00 37.94  ? 4   DA  B C4    1 
ATOM   82   P P     . DA  A 1 5   ? 5.831   -11.413 24.361  1.00 104.59 ? 5   DA  B P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 6.182   -12.851 24.347  1.00 93.70  ? 5   DA  B OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 6.456   -10.498 23.379  1.00 89.53  ? 5   DA  B OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 4.241   -11.294 24.232  1.00 105.79 ? 5   DA  B "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 3.404   -12.176 24.976  1.00 91.78  ? 5   DA  B "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 1.987   -12.186 24.428  1.00 76.09  ? 5   DA  B "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 1.457   -10.836 24.361  1.00 72.44  ? 5   DA  B "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 1.823   -12.760 23.026  1.00 62.57  ? 5   DA  B "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 0.561   -13.426 22.958  1.00 58.30  ? 5   DA  B "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 1.885   -11.506 22.149  1.00 38.00  ? 5   DA  B "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 1.122   -10.511 23.022  1.00 38.43  ? 5   DA  B "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 1.470   -9.106  22.819  1.00 10.85  ? 5   DA  B N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 2.722   -8.556  22.867  1.00 38.95  ? 5   DA  B C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 2.740   -7.258  22.660  1.00 50.17  ? 5   DA  B N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 1.406   -6.933  22.463  1.00 20.66  ? 5   DA  B C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 0.756   -5.710  22.197  1.00 38.85  ? 5   DA  B C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 1.404   -4.542  22.081  1.00 9.05   ? 5   DA  B N6    1 
ATOM   99   N N1    . DA  A 1 5   ? -0.592  -5.735  22.054  1.00 47.89  ? 5   DA  B N1    1 
ATOM   100  C C2    . DA  A 1 5   ? -1.243  -6.901  22.179  1.00 11.40  ? 5   DA  B C2    1 
ATOM   101  N N3    . DA  A 1 5   ? -0.737  -8.110  22.429  1.00 24.44  ? 5   DA  B N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 0.605   -8.060  22.559  1.00 25.62  ? 5   DA  B C4    1 
ATOM   103  P P     . DG  A 1 6   ? 0.131   -14.308 21.692  1.00 65.71  ? 6   DG  B P     1 
ATOM   104  O OP1   . DG  A 1 6   ? -0.473  -15.555 22.203  1.00 33.29  ? 6   DG  B OP1   1 
ATOM   105  O OP2   . DG  A 1 6   ? 1.259   -14.364 20.734  1.00 68.42  ? 6   DG  B OP2   1 
ATOM   106  O "O5'" . DG  A 1 6   ? -1.046  -13.440 21.050  1.00 72.58  ? 6   DG  B "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 6   ? -1.848  -12.621 21.892  1.00 66.46  ? 6   DG  B "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 6   ? -2.704  -11.668 21.077  1.00 66.26  ? 6   DG  B "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 6   ? -2.059  -10.368 20.996  1.00 66.21  ? 6   DG  B "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 6   ? -2.988  -12.099 19.641  1.00 45.21  ? 6   DG  B "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 6   ? -4.369  -11.853 19.356  1.00 45.61  ? 6   DG  B "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 6   ? -2.027  -11.216 18.841  1.00 33.90  ? 6   DG  B "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 6   ? -2.054  -9.929  19.653  1.00 26.28  ? 6   DG  B "C1'" 1 
ATOM   114  N N9    . DG  A 1 6   ? -0.897  -9.051  19.488  1.00 34.99  ? 6   DG  B N9    1 
ATOM   115  C C8    . DG  A 1 6   ? 0.429   -9.405  19.544  1.00 38.32  ? 6   DG  B C8    1 
ATOM   116  N N7    . DG  A 1 6   ? 1.244   -8.398  19.376  1.00 16.12  ? 6   DG  B N7    1 
ATOM   117  C C5    . DG  A 1 6   ? 0.410   -7.302  19.199  1.00 21.08  ? 6   DG  B C5    1 
ATOM   118  C C6    . DG  A 1 6   ? 0.727   -5.938  18.968  1.00 35.98  ? 6   DG  B C6    1 
ATOM   119  O O6    . DG  A 1 6   ? 1.850   -5.409  18.875  1.00 12.41  ? 6   DG  B O6    1 
ATOM   120  N N1    . DG  A 1 6   ? -0.425  -5.159  18.843  1.00 11.77  ? 6   DG  B N1    1 
ATOM   121  C C2    . DG  A 1 6   ? -1.714  -5.645  18.933  1.00 40.51  ? 6   DG  B C2    1 
ATOM   122  N N2    . DG  A 1 6   ? -2.715  -4.759  18.793  1.00 35.31  ? 6   DG  B N2    1 
ATOM   123  N N3    . DG  A 1 6   ? -2.015  -6.920  19.144  1.00 35.54  ? 6   DG  B N3    1 
ATOM   124  C C4    . DG  A 1 6   ? -0.910  -7.690  19.265  1.00 25.28  ? 6   DG  B C4    1 
ATOM   125  P P     . DA  A 1 7   ? -5.070  -12.331 17.996  1.00 61.36  ? 7   DA  B P     1 
ATOM   126  O OP1   . DA  A 1 7   ? -6.335  -13.025 18.321  1.00 63.22  ? 7   DA  B OP1   1 
ATOM   127  O OP2   . DA  A 1 7   ? -4.044  -13.011 17.173  1.00 48.54  ? 7   DA  B OP2   1 
ATOM   128  O "O5'" . DA  A 1 7   ? -5.463  -10.945 17.308  1.00 63.75  ? 7   DA  B "O5'" 1 
ATOM   129  C "C5'" . DA  A 1 7   ? -5.841  -9.850  18.132  1.00 49.89  ? 7   DA  B "C5'" 1 
ATOM   130  C "C4'" . DA  A 1 7   ? -6.212  -8.622  17.312  1.00 66.60  ? 7   DA  B "C4'" 1 
ATOM   131  O "O4'" . DA  A 1 7   ? -5.076  -7.723  17.237  1.00 75.14  ? 7   DA  B "O4'" 1 
ATOM   132  C "C3'" . DA  A 1 7   ? -6.647  -8.859  15.869  1.00 38.74  ? 7   DA  B "C3'" 1 
ATOM   133  O "O3'" . DA  A 1 7   ? -7.753  -7.992  15.608  1.00 39.94  ? 7   DA  B "O3'" 1 
ATOM   134  C "C2'" . DA  A 1 7   ? -5.392  -8.531  15.054  1.00 86.46  ? 7   DA  B "C2'" 1 
ATOM   135  C "C1'" . DA  A 1 7   ? -4.747  -7.434  15.890  1.00 38.44  ? 7   DA  B "C1'" 1 
ATOM   136  N N9    . DA  A 1 7   ? -3.287  -7.353  15.848  1.00 37.75  ? 7   DA  B N9    1 
ATOM   137  C C8    . DA  A 1 7   ? -2.399  -8.390  15.945  1.00 23.62  ? 7   DA  B C8    1 
ATOM   138  N N7    . DA  A 1 7   ? -1.138  -8.023  15.900  1.00 7.64   ? 7   DA  B N7    1 
ATOM   139  C C5    . DA  A 1 7   ? -1.203  -6.645  15.774  1.00 4.55   ? 7   DA  B C5    1 
ATOM   140  C C6    . DA  A 1 7   ? -0.202  -5.656  15.671  1.00 16.45  ? 7   DA  B C6    1 
ATOM   141  N N6    . DA  A 1 7   ? 1.103   -5.947  15.685  1.00 10.65  ? 7   DA  B N6    1 
ATOM   142  N N1    . DA  A 1 7   ? -0.593  -4.366  15.553  1.00 16.70  ? 7   DA  B N1    1 
ATOM   143  C C2    . DA  A 1 7   ? -1.910  -4.097  15.542  1.00 25.46  ? 7   DA  B C2    1 
ATOM   144  N N3    . DA  A 1 7   ? -2.944  -4.941  15.628  1.00 13.40  ? 7   DA  B N3    1 
ATOM   145  C C4    . DA  A 1 7   ? -2.519  -6.212  15.744  1.00 15.39  ? 7   DA  B C4    1 
ATOM   146  P P     . DC  A 1 8   ? -8.513  -7.940  14.198  1.00 57.44  ? 8   DC  B P     1 
ATOM   147  O OP1   . DC  A 1 8   ? -9.934  -7.626  14.444  1.00 42.44  ? 8   DC  B OP1   1 
ATOM   148  O OP2   . DC  A 1 8   ? -8.187  -9.164  13.429  1.00 67.91  ? 8   DC  B OP2   1 
ATOM   149  O "O5'" . DC  A 1 8   ? -7.832  -6.668  13.498  1.00 58.92  ? 8   DC  B "O5'" 1 
ATOM   150  C "C5'" . DC  A 1 8   ? -7.535  -5.524  14.305  1.00 63.72  ? 8   DC  B "C5'" 1 
ATOM   151  C "C4'" . DC  A 1 8   ? -7.024  -4.343  13.490  1.00 55.94  ? 8   DC  B "C4'" 1 
ATOM   152  O "O4'" . DC  A 1 8   ? -5.579  -4.244  13.616  1.00 58.16  ? 8   DC  B "O4'" 1 
ATOM   153  C "C3'" . DC  A 1 8   ? -7.301  -4.382  11.995  1.00 51.47  ? 8   DC  B "C3'" 1 
ATOM   154  O "O3'" . DC  A 1 8   ? -7.409  -3.042  11.516  1.00 74.34  ? 8   DC  B "O3'" 1 
ATOM   155  C "C2'" . DC  A 1 8   ? -6.035  -5.056  11.487  1.00 46.51  ? 8   DC  B "C2'" 1 
ATOM   156  C "C1'" . DC  A 1 8   ? -5.005  -4.303  12.325  1.00 29.65  ? 8   DC  B "C1'" 1 
ATOM   157  N N1    . DC  A 1 8   ? -3.668  -4.976  12.395  1.00 28.51  ? 8   DC  B N1    1 
ATOM   158  C C2    . DC  A 1 8   ? -2.494  -4.213  12.333  1.00 21.57  ? 8   DC  B C2    1 
ATOM   159  O O2    . DC  A 1 8   ? -2.581  -2.982  12.229  1.00 9.01   ? 8   DC  B O2    1 
ATOM   160  N N3    . DC  A 1 8   ? -1.294  -4.849  12.398  1.00 2.40   ? 8   DC  B N3    1 
ATOM   161  C C4    . DC  A 1 8   ? -1.251  -6.174  12.510  1.00 15.43  ? 8   DC  B C4    1 
ATOM   162  N N4    . DC  A 1 8   ? -0.050  -6.756  12.566  1.00 14.38  ? 8   DC  B N4    1 
ATOM   163  C C5    . DC  A 1 8   ? -2.435  -6.963  12.563  1.00 9.03   ? 8   DC  B C5    1 
ATOM   164  C C6    . DC  A 1 8   ? -3.606  -6.333  12.504  1.00 22.41  ? 8   DC  B C6    1 
ATOM   165  P P     . DT  A 1 9   ? -7.760  -2.708  9.987   1.00 89.13  ? 9   DT  B P     1 
ATOM   166  O OP1   . DT  A 1 9   ? -9.167  -2.245  9.940   1.00 42.95  ? 9   DT  B OP1   1 
ATOM   167  O OP2   . DT  A 1 9   ? -7.341  -3.843  9.129   1.00 64.10  ? 9   DT  B OP2   1 
ATOM   168  O "O5'" . DT  A 1 9   ? -6.793  -1.468  9.662   1.00 80.29  ? 9   DT  B "O5'" 1 
ATOM   169  C "C5'" . DT  A 1 9   ? -6.243  -0.665  10.710  1.00 60.13  ? 9   DT  B "C5'" 1 
ATOM   170  C "C4'" . DT  A 1 9   ? -5.102  0.230   10.235  1.00 55.58  ? 9   DT  B "C4'" 1 
ATOM   171  O "O4'" . DT  A 1 9   ? -3.811  -0.432  10.355  1.00 49.29  ? 9   DT  B "O4'" 1 
ATOM   172  C "C3'" . DT  A 1 9   ? -5.144  0.730   8.799   1.00 45.65  ? 9   DT  B "C3'" 1 
ATOM   173  O "O3'" . DT  A 1 9   ? -4.486  1.996   8.765   1.00 42.95  ? 9   DT  B "O3'" 1 
ATOM   174  C "C2'" . DT  A 1 9   ? -4.354  -0.352  8.065   1.00 33.90  ? 9   DT  B "C2'" 1 
ATOM   175  C "C1'" . DT  A 1 9   ? -3.240  -0.635  9.070   1.00 25.12  ? 9   DT  B "C1'" 1 
ATOM   176  N N1    . DT  A 1 9   ? -2.694  -2.031  9.044   1.00 35.14  ? 9   DT  B N1    1 
ATOM   177  C C2    . DT  A 1 9   ? -1.330  -2.203  8.998   1.00 11.13  ? 9   DT  B C2    1 
ATOM   178  O O2    . DT  A 1 9   ? -0.544  -1.271  8.963   1.00 23.36  ? 9   DT  B O2    1 
ATOM   179  N N3    . DT  A 1 9   ? -0.915  -3.513  8.994   1.00 18.57  ? 9   DT  B N3    1 
ATOM   180  C C4    . DT  A 1 9   ? -1.705  -4.649  9.035   1.00 28.41  ? 9   DT  B C4    1 
ATOM   181  O O4    . DT  A 1 9   ? -1.230  -5.786  9.029   1.00 7.99   ? 9   DT  B O4    1 
ATOM   182  C C5    . DT  A 1 9   ? -3.120  -4.387  9.081   1.00 9.06   ? 9   DT  B C5    1 
ATOM   183  C C7    . DT  A 1 9   ? -4.090  -5.395  9.122   1.00 9.15   ? 9   DT  B C7    1 
ATOM   184  C C6    . DT  A 1 9   ? -3.548  -3.118  9.085   1.00 26.88  ? 9   DT  B C6    1 
ATOM   185  P P     . DT  A 1 10  ? -4.484  2.905   7.448   1.00 37.31  ? 10  DT  B P     1 
ATOM   186  O OP1   . DT  A 1 10  ? -4.814  4.291   7.851   1.00 10.87  ? 10  DT  B OP1   1 
ATOM   187  O OP2   . DT  A 1 10  ? -5.289  2.207   6.418   1.00 39.31  ? 10  DT  B OP2   1 
ATOM   188  O "O5'" . DT  A 1 10  ? -2.947  2.875   7.000   1.00 29.34  ? 10  DT  B "O5'" 1 
ATOM   189  C "C5'" . DT  A 1 10  ? -1.952  2.668   8.002   1.00 33.15  ? 10  DT  B "C5'" 1 
ATOM   190  C "C4'" . DT  A 1 10  ? -0.552  2.989   7.514   1.00 31.43  ? 10  DT  B "C4'" 1 
ATOM   191  O "O4'" . DT  A 1 10  ? 0.227   1.768   7.459   1.00 48.87  ? 10  DT  B "O4'" 1 
ATOM   192  C "C3'" . DT  A 1 10  ? -0.436  3.606   6.128   1.00 26.70  ? 10  DT  B "C3'" 1 
ATOM   193  O "O3'" . DT  A 1 10  ? 0.730   4.422   6.084   1.00 52.59  ? 10  DT  B "O3'" 1 
ATOM   194  C "C2'" . DT  A 1 10  ? -0.300  2.376   5.244   1.00 6.79   ? 10  DT  B "C2'" 1 
ATOM   195  C "C1'" . DT  A 1 10  ? 0.510   1.426   6.113   1.00 19.80  ? 10  DT  B "C1'" 1 
ATOM   196  N N1    . DT  A 1 10  ? 0.150   -0.002  5.926   1.00 18.92  ? 10  DT  B N1    1 
ATOM   197  C C2    . DT  A 1 10  ? 1.158   -0.937  5.803   1.00 23.66  ? 10  DT  B C2    1 
ATOM   198  O O2    . DT  A 1 10  ? 2.339   -0.640  5.834   1.00 8.47   ? 10  DT  B O2    1 
ATOM   199  N N3    . DT  A 1 10  ? 0.731   -2.236  5.642   1.00 16.13  ? 10  DT  B N3    1 
ATOM   200  C C4    . DT  A 1 10  ? -0.582  -2.672  5.593   1.00 13.73  ? 10  DT  B C4    1 
ATOM   201  O O4    . DT  A 1 10  ? -0.878  -3.848  5.447   1.00 21.53  ? 10  DT  B O4    1 
ATOM   202  C C5    . DT  A 1 10  ? -1.577  -1.639  5.728   1.00 9.53   ? 10  DT  B C5    1 
ATOM   203  C C7    . DT  A 1 10  ? -2.954  -1.888  5.703   1.00 9.62   ? 10  DT  B C7    1 
ATOM   204  C C6    . DT  A 1 10  ? -1.182  -0.368  5.887   1.00 11.35  ? 10  DT  B C6    1 
ATOM   205  P P     . DA  A 1 11  ? 1.266   5.074   4.722   1.00 58.28  ? 11  DA  B P     1 
ATOM   206  O OP1   . DA  A 1 11  ? 2.161   6.193   5.097   1.00 34.64  ? 11  DA  B OP1   1 
ATOM   207  O OP2   . DA  A 1 11  ? 0.107   5.313   3.831   1.00 37.53  ? 11  DA  B OP2   1 
ATOM   208  O "O5'" . DA  A 1 11  ? 2.162   3.913   4.083   1.00 24.56  ? 11  DA  B "O5'" 1 
ATOM   209  C "C5'" . DA  A 1 11  ? 3.299   3.457   4.799   1.00 29.36  ? 11  DA  B "C5'" 1 
ATOM   210  C "C4'" . DA  A 1 11  ? 4.232   2.675   3.895   1.00 43.70  ? 11  DA  B "C4'" 1 
ATOM   211  O "O4'" . DA  A 1 11  ? 3.809   1.290   3.825   1.00 52.19  ? 11  DA  B "O4'" 1 
ATOM   212  C "C3'" . DA  A 1 11  ? 4.309   3.165   2.456   1.00 39.03  ? 11  DA  B "C3'" 1 
ATOM   213  O "O3'" . DA  A 1 11  ? 5.642   2.982   1.997   1.00 45.22  ? 11  DA  B "O3'" 1 
ATOM   214  C "C2'" . DA  A 1 11  ? 3.318   2.251   1.742   1.00 45.40  ? 11  DA  B "C2'" 1 
ATOM   215  C "C1'" . DA  A 1 11  ? 3.555   0.936   2.480   1.00 26.59  ? 11  DA  B "C1'" 1 
ATOM   216  N N9    . DA  A 1 11  ? 2.417   0.019   2.471   1.00 23.28  ? 11  DA  B N9    1 
ATOM   217  C C8    . DA  A 1 11  ? 1.088   0.348   2.454   1.00 30.70  ? 11  DA  B C8    1 
ATOM   218  N N7    . DA  A 1 11  ? 0.281   -0.690  2.457   1.00 37.35  ? 11  DA  B N7    1 
ATOM   219  C C5    . DA  A 1 11  ? 1.142   -1.778  2.480   1.00 29.83  ? 11  DA  B C5    1 
ATOM   220  C C6    . DA  A 1 11  ? 0.912   -3.169  2.494   1.00 27.86  ? 11  DA  B C6    1 
ATOM   221  N N6    . DA  A 1 11  ? -0.309  -3.709  2.490   1.00 26.38  ? 11  DA  B N6    1 
ATOM   222  N N1    . DA  A 1 11  ? 1.987   -3.984  2.512   1.00 18.24  ? 11  DA  B N1    1 
ATOM   223  C C2    . DA  A 1 11  ? 3.210   -3.434  2.520   1.00 30.29  ? 11  DA  B C2    1 
ATOM   224  N N3    . DA  A 1 11  ? 3.556   -2.145  2.509   1.00 24.46  ? 11  DA  B N3    1 
ATOM   225  C C4    . DA  A 1 11  ? 2.463   -1.360  2.489   1.00 34.69  ? 11  DA  B C4    1 
ATOM   226  P P     . DG  A 1 12  ? 6.333   4.054   1.031   1.00 68.47  ? 12  DG  B P     1 
ATOM   227  O OP1   . DG  A 1 12  ? 6.593   5.290   1.807   1.00 57.23  ? 12  DG  B OP1   1 
ATOM   228  O OP2   . DG  A 1 12  ? 5.530   4.106   -0.214  1.00 67.80  ? 12  DG  B OP2   1 
ATOM   229  O "O5'" . DG  A 1 12  ? 7.733   3.353   0.712   1.00 50.68  ? 12  DG  B "O5'" 1 
ATOM   230  C "C5'" . DG  A 1 12  ? 8.340   2.561   1.726   1.00 63.56  ? 12  DG  B "C5'" 1 
ATOM   231  C "C4'" . DG  A 1 12  ? 8.915   1.273   1.159   1.00 67.39  ? 12  DG  B "C4'" 1 
ATOM   232  O "O4'" . DG  A 1 12  ? 7.892   0.243   1.101   1.00 53.30  ? 12  DG  B "O4'" 1 
ATOM   233  C "C3'" . DG  A 1 12  ? 9.463   1.366   -0.256  1.00 72.54  ? 12  DG  B "C3'" 1 
ATOM   234  O "O3'" . DG  A 1 12  ? 10.507  0.410   -0.353  1.00 69.60  ? 12  DG  B "O3'" 1 
ATOM   235  C "C2'" . DG  A 1 12  ? 8.241   0.981   -1.085  1.00 67.55  ? 12  DG  B "C2'" 1 
ATOM   236  C "C1'" . DG  A 1 12  ? 7.720   -0.180  -0.239  1.00 41.62  ? 12  DG  B "C1'" 1 
ATOM   237  N N9    . DG  A 1 12  ? 6.304   -0.499  -0.410  1.00 41.25  ? 12  DG  B N9    1 
ATOM   238  C C8    . DG  A 1 12  ? 5.266   0.388   -0.552  1.00 37.82  ? 12  DG  B C8    1 
ATOM   239  N N7    . DG  A 1 12  ? 4.101   -0.189  -0.676  1.00 29.71  ? 12  DG  B N7    1 
ATOM   240  C C5    . DG  A 1 12  ? 4.381   -1.547  -0.609  1.00 24.76  ? 12  DG  B C5    1 
ATOM   241  C C6    . DG  A 1 12  ? 3.510   -2.663  -0.682  1.00 31.87  ? 12  DG  B C6    1 
ATOM   242  O O6    . DG  A 1 12  ? 2.275   -2.670  -0.820  1.00 19.49  ? 12  DG  B O6    1 
ATOM   243  N N1    . DG  A 1 12  ? 4.205   -3.867  -0.575  1.00 4.91   ? 12  DG  B N1    1 
ATOM   244  C C2    . DG  A 1 12  ? 5.567   -3.972  -0.409  1.00 28.41  ? 12  DG  B C2    1 
ATOM   245  N N2    . DG  A 1 12  ? 6.058   -5.219  -0.319  1.00 41.46  ? 12  DG  B N2    1 
ATOM   246  N N3    . DG  A 1 12  ? 6.392   -2.932  -0.338  1.00 19.77  ? 12  DG  B N3    1 
ATOM   247  C C4    . DG  A 1 12  ? 5.733   -1.754  -0.443  1.00 20.21  ? 12  DG  B C4    1 
ATOM   248  P P     . DA  A 1 13  ? 11.617  0.455   -1.503  1.00 76.08  ? 13  DA  B P     1 
ATOM   249  O OP1   . DA  A 1 13  ? 12.747  1.260   -0.997  1.00 64.62  ? 13  DA  B OP1   1 
ATOM   250  O OP2   . DA  A 1 13  ? 10.961  0.818   -2.783  1.00 63.58  ? 13  DA  B OP2   1 
ATOM   251  O "O5'" . DA  A 1 13  ? 12.071  -1.080  -1.578  1.00 68.95  ? 13  DA  B "O5'" 1 
ATOM   252  C "C5'" . DA  A 1 13  ? 11.284  -2.086  -0.931  1.00 74.52  ? 13  DA  B "C5'" 1 
ATOM   253  C "C4'" . DA  A 1 13  ? 10.989  -3.256  -1.860  1.00 72.56  ? 13  DA  B "C4'" 1 
ATOM   254  O "O4'" . DA  A 1 13  ? 9.549   -3.438  -2.024  1.00 44.53  ? 13  DA  B "O4'" 1 
ATOM   255  C "C3'" . DA  A 1 13  ? 11.549  -3.134  -3.272  1.00 54.13  ? 13  DA  B "C3'" 1 
ATOM   256  O "O3'" . DA  A 1 13  ? 11.848  -4.442  -3.740  1.00 67.96  ? 13  DA  B "O3'" 1 
ATOM   257  C "C2'" . DA  A 1 13  ? 10.375  -2.522  -4.026  1.00 40.93  ? 13  DA  B "C2'" 1 
ATOM   258  C "C1'" . DA  A 1 13  ? 9.231   -3.320  -3.404  1.00 49.12  ? 13  DA  B "C1'" 1 
ATOM   259  N N9    . DA  A 1 13  ? 7.926   -2.680  -3.542  1.00 44.26  ? 13  DA  B N9    1 
ATOM   260  C C8    . DA  A 1 13  ? 7.664   -1.338  -3.632  1.00 45.18  ? 13  DA  B C8    1 
ATOM   261  N N7    . DA  A 1 13  ? 6.385   -1.053  -3.747  1.00 44.57  ? 13  DA  B N7    1 
ATOM   262  C C5    . DA  A 1 13  ? 5.769   -2.295  -3.739  1.00 19.01  ? 13  DA  B C5    1 
ATOM   263  C C6    . DA  A 1 13  ? 4.422   -2.686  -3.829  1.00 29.99  ? 13  DA  B C6    1 
ATOM   264  N N6    . DA  A 1 13  ? 3.416   -1.819  -3.953  1.00 45.61  ? 13  DA  B N6    1 
ATOM   265  N N1    . DA  A 1 13  ? 4.142   -4.005  -3.789  1.00 28.83  ? 13  DA  B N1    1 
ATOM   266  C C2    . DA  A 1 13  ? 5.154   -4.872  -3.668  1.00 11.27  ? 13  DA  B C2    1 
ATOM   267  N N3    . DA  A 1 13  ? 6.459   -4.627  -3.573  1.00 15.21  ? 13  DA  B N3    1 
ATOM   268  C C4    . DA  A 1 13  ? 6.703   -3.307  -3.614  1.00 27.29  ? 13  DA  B C4    1 
ATOM   269  P P     . DA  A 1 14  ? 12.935  -4.720  -4.886  1.00 80.71  ? 14  DA  B P     1 
ATOM   270  O OP1   . DA  A 1 14  ? 14.175  -5.193  -4.217  1.00 63.35  ? 14  DA  B OP1   1 
ATOM   271  O OP2   . DA  A 1 14  ? 12.969  -3.568  -5.818  1.00 71.39  ? 14  DA  B OP2   1 
ATOM   272  O "O5'" . DA  A 1 14  ? 12.273  -5.953  -5.662  1.00 49.02  ? 14  DA  B "O5'" 1 
ATOM   273  C "C5'" . DA  A 1 14  ? 11.915  -7.097  -4.892  1.00 94.30  ? 14  DA  B "C5'" 1 
ATOM   274  C "C4'" . DA  A 1 14  ? 10.576  -7.654  -5.330  1.00 85.36  ? 14  DA  B "C4'" 1 
ATOM   275  O "O4'" . DA  A 1 14  ? 9.553   -6.631  -5.270  1.00 94.00  ? 14  DA  B "O4'" 1 
ATOM   276  C "C3'" . DA  A 1 14  ? 10.574  -8.177  -6.757  1.00 80.14  ? 14  DA  B "C3'" 1 
ATOM   277  O "O3'" . DA  A 1 14  ? 10.330  -9.576  -6.713  1.00 66.78  ? 14  DA  B "O3'" 1 
ATOM   278  C "C2'" . DA  A 1 14  ? 9.463   -7.387  -7.462  1.00 82.42  ? 14  DA  B "C2'" 1 
ATOM   279  C "C1'" . DA  A 1 14  ? 8.621   -6.860  -6.304  1.00 59.13  ? 14  DA  B "C1'" 1 
ATOM   280  N N9    . DA  A 1 14  ? 7.912   -5.601  -6.541  1.00 50.32  ? 14  DA  B N9    1 
ATOM   281  C C8    . DA  A 1 14  ? 8.466   -4.354  -6.664  1.00 45.73  ? 14  DA  B C8    1 
ATOM   282  N N7    . DA  A 1 14  ? 7.591   -3.390  -6.852  1.00 18.30  ? 14  DA  B N7    1 
ATOM   283  C C5    . DA  A 1 14  ? 6.376   -4.051  -6.852  1.00 18.92  ? 14  DA  B C5    1 
ATOM   284  C C6    . DA  A 1 14  ? 5.054   -3.589  -7.005  1.00 33.63  ? 14  DA  B C6    1 
ATOM   285  N N6    . DA  A 1 14  ? 4.749   -2.301  -7.199  1.00 8.71   ? 14  DA  B N6    1 
ATOM   286  N N1    . DA  A 1 14  ? 4.061   -4.503  -6.956  1.00 32.10  ? 14  DA  B N1    1 
ATOM   287  C C2    . DA  A 1 14  ? 4.381   -5.792  -6.757  1.00 40.28  ? 14  DA  B C2    1 
ATOM   288  N N3    . DA  A 1 14  ? 5.585   -6.345  -6.595  1.00 32.50  ? 14  DA  B N3    1 
ATOM   289  C C4    . DA  A 1 14  ? 6.551   -5.412  -6.657  1.00 37.25  ? 14  DA  B C4    1 
ATOM   290  P P     . DA  A 1 15  ? 10.557  -10.446 -8.035  1.00 95.73  ? 15  DA  B P     1 
ATOM   291  O OP1   . DA  A 1 15  ? 11.164  -11.743 -7.632  1.00 62.44  ? 15  DA  B OP1   1 
ATOM   292  O OP2   . DA  A 1 15  ? 11.196  -9.568  -9.053  1.00 51.59  ? 15  DA  B OP2   1 
ATOM   293  O "O5'" . DA  A 1 15  ? 9.057   -10.737 -8.495  1.00 80.20  ? 15  DA  B "O5'" 1 
ATOM   294  C "C5'" . DA  A 1 15  ? 8.080   -10.971 -7.486  1.00 92.76  ? 15  DA  B "C5'" 1 
ATOM   295  C "C4'" . DA  A 1 15  ? 6.731   -11.249 -8.117  1.00 80.32  ? 15  DA  B "C4'" 1 
ATOM   296  O "O4'" . DA  A 1 15  ? 5.971   -10.016 -8.212  1.00 86.02  ? 15  DA  B "O4'" 1 
ATOM   297  C "C3'" . DA  A 1 15  ? 6.795   -11.783 -9.538  1.00 73.07  ? 15  DA  B "C3'" 1 
ATOM   298  O "O3'" . DA  A 1 15  ? 5.602   -12.525 -9.773  1.00 70.35  ? 15  DA  B "O3'" 1 
ATOM   299  C "C2'" . DA  A 1 15  ? 6.857   -10.484 -10.346 1.00 41.71  ? 15  DA  B "C2'" 1 
ATOM   300  C "C1'" . DA  A 1 15  ? 5.840   -9.643  -9.576  1.00 54.22  ? 15  DA  B "C1'" 1 
ATOM   301  N N9    . DA  A 1 15  ? 6.014   -8.195  -9.696  1.00 62.27  ? 15  DA  B N9    1 
ATOM   302  C C8    . DA  A 1 15  ? 7.183   -7.481  -9.681  1.00 73.18  ? 15  DA  B C8    1 
ATOM   303  N N7    . DA  A 1 15  ? 7.021   -6.182  -9.804  1.00 59.72  ? 15  DA  B N7    1 
ATOM   304  C C5    . DA  A 1 15  ? 5.647   -6.035  -9.911  1.00 64.59  ? 15  DA  B C5    1 
ATOM   305  C C6    . DA  A 1 15  ? 4.820   -4.904  -10.066 1.00 54.30  ? 15  DA  B C6    1 
ATOM   306  N N6    . DA  A 1 15  ? 5.289   -3.657  -10.146 1.00 37.79  ? 15  DA  B N6    1 
ATOM   307  N N1    . DA  A 1 15  ? 3.486   -5.104  -10.137 1.00 65.28  ? 15  DA  B N1    1 
ATOM   308  C C2    . DA  A 1 15  ? 3.013   -6.356  -10.057 1.00 63.33  ? 15  DA  B C2    1 
ATOM   309  N N3    . DA  A 1 15  ? 3.688   -7.496  -9.911  1.00 60.40  ? 15  DA  B N3    1 
ATOM   310  C C4    . DA  A 1 15  ? 5.011   -7.264  -9.844  1.00 67.10  ? 15  DA  B C4    1 
ATOM   311  P P     . DA  A 1 16  ? 5.472   -13.531 -11.009 1.00 72.17  ? 16  DA  B P     1 
ATOM   312  O OP1   . DA  A 1 16  ? 4.980   -14.823 -10.473 1.00 31.67  ? 16  DA  B OP1   1 
ATOM   313  O OP2   . DA  A 1 16  ? 6.733   -13.470 -11.788 1.00 50.30  ? 16  DA  B OP2   1 
ATOM   314  O "O5'" . DA  A 1 16  ? 4.316   -12.853 -11.890 1.00 72.71  ? 16  DA  B "O5'" 1 
ATOM   315  C "C5'" . DA  A 1 16  ? 3.695   -11.661 -11.415 1.00 84.67  ? 16  DA  B "C5'" 1 
ATOM   316  C "C4'" . DA  A 1 16  ? 2.235   -11.563 -11.814 1.00 76.57  ? 16  DA  B "C4'" 1 
ATOM   317  O "O4'" . DA  A 1 16  ? 1.862   -10.166 -11.889 1.00 73.30  ? 16  DA  B "O4'" 1 
ATOM   318  C "C3'" . DA  A 1 16  ? 1.895   -12.085 -13.194 1.00 68.93  ? 16  DA  B "C3'" 1 
ATOM   319  O "O3'" . DA  A 1 16  ? 0.485   -12.261 -13.262 1.00 62.04  ? 16  DA  B "O3'" 1 
ATOM   320  C "C2'" . DA  A 1 16  ? 2.398   -10.932 -14.062 1.00 59.57  ? 16  DA  B "C2'" 1 
ATOM   321  C "C1'" . DA  A 1 16  ? 2.065   -9.704  -13.212 1.00 31.27  ? 16  DA  B "C1'" 1 
ATOM   322  N N9    . DA  A 1 16  ? 3.121   -8.692  -13.201 1.00 36.39  ? 16  DA  B N9    1 
ATOM   323  C C8    . DA  A 1 16  ? 4.472   -8.908  -13.162 1.00 60.11  ? 16  DA  B C8    1 
ATOM   324  N N7    . DA  A 1 16  ? 5.195   -7.810  -13.157 1.00 49.26  ? 16  DA  B N7    1 
ATOM   325  C C5    . DA  A 1 16  ? 4.251   -6.797  -13.199 1.00 55.15  ? 16  DA  B C5    1 
ATOM   326  C C6    . DA  A 1 16  ? 4.369   -5.390  -13.218 1.00 55.01  ? 16  DA  B C6    1 
ATOM   327  N N6    . DA  A 1 16  ? 5.539   -4.744  -13.199 1.00 39.18  ? 16  DA  B N6    1 
ATOM   328  N N1    . DA  A 1 16  ? 3.230   -4.665  -13.260 1.00 51.82  ? 16  DA  B N1    1 
ATOM   329  C C2    . DA  A 1 16  ? 2.057   -5.315  -13.281 1.00 62.80  ? 16  DA  B C2    1 
ATOM   330  N N3    . DA  A 1 16  ? 1.822   -6.629  -13.268 1.00 52.77  ? 16  DA  B N3    1 
ATOM   331  C C4    . DA  A 1 16  ? 2.969   -7.323  -13.225 1.00 41.43  ? 16  DA  B C4    1 
ATOM   332  P P     . DA  A 1 17  ? -0.255  -12.619 -14.636 1.00 94.00  ? 17  DA  B P     1 
ATOM   333  O OP1   . DA  A 1 17  ? -1.534  -13.290 -14.295 1.00 81.31  ? 17  DA  B OP1   1 
ATOM   334  O OP2   . DA  A 1 17  ? 0.717   -13.270 -15.544 1.00 75.45  ? 17  DA  B OP2   1 
ATOM   335  O "O5'" . DA  A 1 17  ? -0.595  -11.176 -15.230 1.00 79.20  ? 17  DA  B "O5'" 1 
ATOM   336  C "C5'" . DA  A 1 17  ? -1.278  -10.250 -14.402 1.00 85.46  ? 17  DA  B "C5'" 1 
ATOM   337  C "C4'" . DA  A 1 17  ? -1.607  -8.985  -15.170 1.00 79.24  ? 17  DA  B "C4'" 1 
ATOM   338  O "O4'" . DA  A 1 17  ? -0.493  -8.055  -15.104 1.00 86.24  ? 17  DA  B "O4'" 1 
ATOM   339  C "C3'" . DA  A 1 17  ? -1.883  -9.177  -16.654 1.00 64.98  ? 17  DA  B "C3'" 1 
ATOM   340  O "O3'" . DA  A 1 17  ? -2.849  -8.195  -17.001 1.00 78.84  ? 17  DA  B "O3'" 1 
ATOM   341  C "C2'" . DA  A 1 17  ? -0.515  -8.893  -17.275 1.00 60.96  ? 17  DA  B "C2'" 1 
ATOM   342  C "C1'" . DA  A 1 17  ? -0.132  -7.685  -16.425 1.00 60.30  ? 17  DA  B "C1'" 1 
ATOM   343  N N9    . DA  A 1 17  ? 1.283   -7.320  -16.416 1.00 43.11  ? 17  DA  B N9    1 
ATOM   344  C C8    . DA  A 1 17  ? 2.367   -8.152  -16.344 1.00 50.83  ? 17  DA  B C8    1 
ATOM   345  N N7    . DA  A 1 17  ? 3.521   -7.523  -16.339 1.00 28.40  ? 17  DA  B N7    1 
ATOM   346  C C5    . DA  A 1 17  ? 3.165   -6.187  -16.408 1.00 31.41  ? 17  DA  B C5    1 
ATOM   347  C C6    . DA  A 1 17  ? 3.927   -5.004  -16.442 1.00 47.15  ? 17  DA  B C6    1 
ATOM   348  N N6    . DA  A 1 17  ? 5.263   -5.006  -16.403 1.00 26.03  ? 17  DA  B N6    1 
ATOM   349  N N1    . DA  A 1 17  ? 3.266   -3.825  -16.515 1.00 57.12  ? 17  DA  B N1    1 
ATOM   350  C C2    . DA  A 1 17  ? 1.924   -3.837  -16.550 1.00 39.59  ? 17  DA  B C2    1 
ATOM   351  N N3    . DA  A 1 17  ? 1.098   -4.886  -16.523 1.00 35.45  ? 17  DA  B N3    1 
ATOM   352  C C4    . DA  A 1 17  ? 1.789   -6.040  -16.454 1.00 37.95  ? 17  DA  B C4    1 
ATOM   353  P P     . DT  A 1 18  ? -3.691  -8.250  -18.360 1.00 86.44  ? 18  DT  B P     1 
ATOM   354  O OP1   . DT  A 1 18  ? -5.067  -8.697  -18.035 1.00 52.91  ? 18  DT  B OP1   1 
ATOM   355  O OP2   . DT  A 1 18  ? -2.883  -8.963  -19.376 1.00 85.51  ? 18  DT  B OP2   1 
ATOM   356  O "O5'" . DT  A 1 18  ? -3.715  -6.704  -18.763 1.00 89.86  ? 18  DT  B "O5'" 1 
ATOM   357  C "C5'" . DT  A 1 18  ? -2.714  -5.837  -18.214 1.00 92.79  ? 18  DT  B "C5'" 1 
ATOM   358  C "C4'" . DT  A 1 18  ? -2.730  -4.494  -18.922 1.00 104.86 ? 18  DT  B "C4'" 1 
ATOM   359  O "O4'" . DT  A 1 18  ? -1.411  -3.896  -18.854 1.00 99.23  ? 18  DT  B "O4'" 1 
ATOM   360  C "C3'" . DT  A 1 18  ? -3.083  -4.555  -20.402 1.00 109.18 ? 18  DT  B "C3'" 1 
ATOM   361  O "O3'" . DT  A 1 18  ? -3.774  -3.371  -20.786 1.00 108.13 ? 18  DT  B "O3'" 1 
ATOM   362  C "C2'" . DT  A 1 18  ? -1.719  -4.671  -21.079 1.00 102.41 ? 18  DT  B "C2'" 1 
ATOM   363  C "C1'" . DT  A 1 18  ? -0.790  -3.931  -20.123 1.00 81.97  ? 18  DT  B "C1'" 1 
ATOM   364  N N1    . DT  A 1 18  ? 0.525   -4.608  -19.976 1.00 73.17  ? 18  DT  B N1    1 
ATOM   365  C C2    . DT  A 1 18  ? 1.677   -3.851  -20.020 1.00 69.89  ? 18  DT  B C2    1 
ATOM   366  O O2    . DT  A 1 18  ? 1.669   -2.643  -20.172 1.00 91.95  ? 18  DT  B O2    1 
ATOM   367  N N3    . DT  A 1 18  ? 2.844   -4.558  -19.876 1.00 48.16  ? 18  DT  B N3    1 
ATOM   368  C C4    . DT  A 1 18  ? 2.966   -5.925  -19.699 1.00 57.45  ? 18  DT  B C4    1 
ATOM   369  O O4    . DT  A 1 18  ? 4.053   -6.478  -19.579 1.00 62.59  ? 18  DT  B O4    1 
ATOM   370  C C5    . DT  A 1 18  ? 1.721   -6.649  -19.664 1.00 63.57  ? 18  DT  B C5    1 
ATOM   371  C C7    . DT  A 1 18  ? 1.640   -8.035  -19.494 1.00 63.93  ? 18  DT  B C7    1 
ATOM   372  C C6    . DT  A 1 18  ? 0.571   -5.977  -19.800 1.00 63.93  ? 18  DT  B C6    1 
ATOM   373  P P     . DT  A 1 19  ? -4.117  -3.088  -22.322 1.00 101.71 ? 19  DT  B P     1 
ATOM   374  O OP1   . DT  A 1 19  ? -5.432  -2.412  -22.362 1.00 82.34  ? 19  DT  B OP1   1 
ATOM   375  O OP2   . DT  A 1 19  ? -3.920  -4.343  -23.083 1.00 96.46  ? 19  DT  B OP2   1 
ATOM   376  O "O5'" . DT  A 1 19  ? -2.969  -2.051  -22.749 1.00 94.20  ? 19  DT  B "O5'" 1 
ATOM   377  C "C5'" . DT  A 1 19  ? -3.013  -0.703  -22.274 1.00 88.78  ? 19  DT  B "C5'" 1 
ATOM   378  C "C4'" . DT  A 1 19  ? -1.725  0.050   -22.568 1.00 96.40  ? 19  DT  B "C4'" 1 
ATOM   379  O "O4'" . DT  A 1 19  ? -0.578  -0.777  -22.247 1.00 84.28  ? 19  DT  B "O4'" 1 
ATOM   380  C "C3'" . DT  A 1 19  ? -1.525  0.478   -24.020 1.00 105.04 ? 19  DT  B "C3'" 1 
ATOM   381  O "O3'" . DT  A 1 19  ? -0.855  1.736   -24.082 1.00 111.05 ? 19  DT  B "O3'" 1 
ATOM   382  C "C2'" . DT  A 1 19  ? -0.620  -0.623  -24.553 1.00 97.99  ? 19  DT  B "C2'" 1 
ATOM   383  C "C1'" . DT  A 1 19  ? 0.301   -0.750  -23.352 1.00 58.68  ? 19  DT  B "C1'" 1 
ATOM   384  N N1    . DT  A 1 19  ? 1.114   -1.984  -23.347 1.00 58.43  ? 19  DT  B N1    1 
ATOM   385  C C2    . DT  A 1 19  ? 2.484   -1.875  -23.203 1.00 72.75  ? 19  DT  B C2    1 
ATOM   386  O O2    . DT  A 1 19  ? 3.060   -0.805  -23.081 1.00 59.01  ? 19  DT  B O2    1 
ATOM   387  N N3    . DT  A 1 19  ? 3.161   -3.072  -23.208 1.00 75.30  ? 19  DT  B N3    1 
ATOM   388  C C4    . DT  A 1 19  ? 2.613   -4.336  -23.338 1.00 62.94  ? 19  DT  B C4    1 
ATOM   389  O O4    . DT  A 1 19  ? 3.301   -5.354  -23.331 1.00 54.00  ? 19  DT  B O4    1 
ATOM   390  C C5    . DT  A 1 19  ? 1.177   -4.363  -23.483 1.00 48.83  ? 19  DT  B C5    1 
ATOM   391  C C7    . DT  A 1 19  ? 0.439   -5.543  -23.627 1.00 49.06  ? 19  DT  B C7    1 
ATOM   392  C C6    . DT  A 1 19  ? 0.494   -3.210  -23.482 1.00 15.69  ? 19  DT  B C6    1 
ATOM   393  P P     . DT  A 1 20  ? -0.988  2.623   -25.407 1.00 106.82 ? 20  DT  B P     1 
ATOM   394  O OP1   . DT  A 1 20  ? -2.013  3.660   -25.144 1.00 105.00 ? 20  DT  B OP1   1 
ATOM   395  O OP2   . DT  A 1 20  ? -1.149  1.686   -26.544 1.00 87.86  ? 20  DT  B OP2   1 
ATOM   396  O "O5'" . DT  A 1 20  ? 0.435   3.342   -25.578 1.00 94.57  ? 20  DT  B "O5'" 1 
ATOM   397  C "C5'" . DT  A 1 20  ? 1.415   3.302   -24.550 1.00 103.35 ? 20  DT  B "C5'" 1 
ATOM   398  C "C4'" . DT  A 1 20  ? 2.769   2.877   -25.102 1.00 114.54 ? 20  DT  B "C4'" 1 
ATOM   399  O "O4'" . DT  A 1 20  ? 2.921   1.436   -25.006 1.00 116.44 ? 20  DT  B "O4'" 1 
ATOM   400  C "C3'" . DT  A 1 20  ? 3.029   3.220   -26.570 1.00 115.71 ? 20  DT  B "C3'" 1 
ATOM   401  O "O3'" . DT  A 1 20  ? 4.348   3.737   -26.692 1.00 118.92 ? 20  DT  B "O3'" 1 
ATOM   402  C "C2'" . DT  A 1 20  ? 2.920   1.867   -27.268 1.00 111.45 ? 20  DT  B "C2'" 1 
ATOM   403  C "C1'" . DT  A 1 20  ? 3.559   1.006   -26.189 1.00 101.29 ? 20  DT  B "C1'" 1 
ATOM   404  N N1    . DT  A 1 20  ? 3.380   -0.462  -26.340 1.00 90.79  ? 20  DT  B N1    1 
ATOM   405  C C2    . DT  A 1 20  ? 4.510   -1.255  -26.355 1.00 79.15  ? 20  DT  B C2    1 
ATOM   406  O O2    . DT  A 1 20  ? 5.637   -0.803  -26.257 1.00 74.84  ? 20  DT  B O2    1 
ATOM   407  N N3    . DT  A 1 20  ? 4.273   -2.600  -26.494 1.00 58.52  ? 20  DT  B N3    1 
ATOM   408  C C4    . DT  A 1 20  ? 3.039   -3.211  -26.615 1.00 66.35  ? 20  DT  B C4    1 
ATOM   409  O O4    . DT  A 1 20  ? 2.926   -4.424  -26.734 1.00 63.42  ? 20  DT  B O4    1 
ATOM   410  C C5    . DT  A 1 20  ? 1.903   -2.320  -26.590 1.00 68.25  ? 20  DT  B C5    1 
ATOM   411  C C6    . DT  A 1 20  ? 2.114   -1.003  -26.457 1.00 82.08  ? 20  DT  B C6    1 
ATOM   412  P P     . DT  A 1 21  ? 4.724   4.751   -27.869 1.00 115.99 ? 21  DT  B P     1 
ATOM   413  O OP1   . DT  A 1 21  ? 4.474   6.125   -27.379 1.00 106.70 ? 21  DT  B OP1   1 
ATOM   414  O OP2   . DT  A 1 21  ? 4.071   4.274   -29.106 1.00 121.15 ? 21  DT  B OP2   1 
ATOM   415  O "O5'" . DT  A 1 21  ? 6.301   4.538   -28.036 1.00 102.05 ? 21  DT  B "O5'" 1 
ATOM   416  C "C5'" . DT  A 1 21  ? 7.107   4.239   -26.900 1.00 113.89 ? 21  DT  B "C5'" 1 
ATOM   417  C "C4'" . DT  A 1 21  ? 8.338   3.444   -27.299 1.00 123.06 ? 21  DT  B "C4'" 1 
ATOM   418  O "O4'" . DT  A 1 21  ? 8.012   2.030   -27.348 1.00 123.87 ? 21  DT  B "O4'" 1 
ATOM   419  C "C3'" . DT  A 1 21  ? 8.927   3.800   -28.661 1.00 124.52 ? 21  DT  B "C3'" 1 
ATOM   420  O "O3'" . DT  A 1 21  ? 10.351  3.818   -28.586 1.00 128.09 ? 21  DT  B "O3'" 1 
ATOM   421  C "C2'" . DT  A 1 21  ? 8.415   2.685   -29.567 1.00 114.61 ? 21  DT  B "C2'" 1 
ATOM   422  C "C1'" . DT  A 1 21  ? 8.367   1.501   -28.610 1.00 114.97 ? 21  DT  B "C1'" 1 
ATOM   423  N N1    . DT  A 1 21  ? 7.360   0.475   -29.008 1.00 106.95 ? 21  DT  B N1    1 
ATOM   424  C C2    . DT  A 1 21  ? 7.763   -0.830  -29.221 1.00 92.04  ? 21  DT  B C2    1 
ATOM   425  O O2    . DT  A 1 21  ? 8.919   -1.205  -29.096 1.00 68.03  ? 21  DT  B O2    1 
ATOM   426  N N3    . DT  A 1 21  ? 6.755   -1.689  -29.589 1.00 68.05  ? 21  DT  B N3    1 
ATOM   427  C C4    . DT  A 1 21  ? 5.417   -1.380  -29.764 1.00 84.94  ? 21  DT  B C4    1 
ATOM   428  O O4    . DT  A 1 21  ? 4.582   -2.216  -30.097 1.00 82.84  ? 21  DT  B O4    1 
ATOM   429  C C5    . DT  A 1 21  ? 5.077   0.000   -29.525 1.00 97.46  ? 21  DT  B C5    1 
ATOM   430  C C7    . DT  A 1 21  ? 3.779   0.507   -29.649 1.00 97.03  ? 21  DT  B C7    1 
ATOM   431  C C6    . DT  A 1 21  ? 6.040   0.857   -29.165 1.00 102.43 ? 21  DT  B C6    1 
ATOM   432  P P     . DT  A 1 22  ? 11.241  4.121   -29.882 1.00 117.16 ? 22  DT  B P     1 
ATOM   433  O OP1   . DT  A 1 22  ? 12.458  4.848   -29.453 1.00 109.00 ? 22  DT  B OP1   1 
ATOM   434  O OP2   . DT  A 1 22  ? 10.364  4.719   -30.915 1.00 128.03 ? 22  DT  B OP2   1 
ATOM   435  O "O5'" . DT  A 1 22  ? 11.660  2.653   -30.365 1.00 118.63 ? 22  DT  B "O5'" 1 
ATOM   436  C "C5'" . DT  A 1 22  ? 12.047  1.673   -29.405 1.00 106.76 ? 22  DT  B "C5'" 1 
ATOM   437  C "C4'" . DT  A 1 22  ? 12.722  0.472   -30.052 1.00 114.30 ? 22  DT  B "C4'" 1 
ATOM   438  O "O4'" . DT  A 1 22  ? 11.743  -0.576  -30.278 1.00 117.44 ? 22  DT  B "O4'" 1 
ATOM   439  C "C3'" . DT  A 1 22  ? 13.401  0.725   -31.397 1.00 109.44 ? 22  DT  B "C3'" 1 
ATOM   440  O "O3'" . DT  A 1 22  ? 14.662  0.060   -31.439 1.00 80.54  ? 22  DT  B "O3'" 1 
ATOM   441  C "C2'" . DT  A 1 22  ? 12.423  0.140   -32.414 1.00 110.52 ? 22  DT  B "C2'" 1 
ATOM   442  C "C1'" . DT  A 1 22  ? 11.772  -0.994  -31.628 1.00 107.49 ? 22  DT  B "C1'" 1 
ATOM   443  N N1    . DT  A 1 22  ? 10.365  -1.276  -32.027 1.00 93.51  ? 22  DT  B N1    1 
ATOM   444  C C2    . DT  A 1 22  ? 9.965   -2.582  -32.249 1.00 90.03  ? 22  DT  B C2    1 
ATOM   445  O O2    . DT  A 1 22  ? 10.714  -3.544  -32.144 1.00 63.85  ? 22  DT  B O2    1 
ATOM   446  N N3    . DT  A 1 22  ? 8.642   -2.716  -32.606 1.00 78.44  ? 22  DT  B N3    1 
ATOM   447  C C4    . DT  A 1 22  ? 7.708   -1.704  -32.756 1.00 63.06  ? 22  DT  B C4    1 
ATOM   448  O O4    . DT  A 1 22  ? 6.544   -1.916  -33.076 1.00 52.39  ? 22  DT  B O4    1 
ATOM   449  C C5    . DT  A 1 22  ? 8.204   -0.376  -32.507 1.00 64.60  ? 22  DT  B C5    1 
ATOM   450  C C7    . DT  A 1 22  ? 7.416   0.776   -32.610 1.00 64.89  ? 22  DT  B C7    1 
ATOM   451  C C6    . DT  A 1 22  ? 9.485   -0.218  -32.157 1.00 71.60  ? 22  DT  B C6    1 
ATOM   452  P P     . DA  B 2 1   ? 11.539  -9.454  -32.384 1.00 167.82 ? 101 DA  C P     1 
ATOM   453  O OP1   . DA  B 2 1   ? 10.973  -8.267  -31.703 1.00 162.43 ? 101 DA  C OP1   1 
ATOM   454  O OP2   . DA  B 2 1   ? 12.264  -10.498 -31.624 1.00 154.09 ? 101 DA  C OP2   1 
ATOM   455  O "O5'" . DA  B 2 1   ? 10.395  -10.157 -33.259 1.00 153.28 ? 101 DA  C "O5'" 1 
ATOM   456  C "C5'" . DA  B 2 1   ? 9.960   -11.482 -32.979 1.00 141.80 ? 101 DA  C "C5'" 1 
ATOM   457  C "C4'" . DA  B 2 1   ? 8.731   -11.418 -32.097 1.00 136.75 ? 101 DA  C "C4'" 1 
ATOM   458  O "O4'" . DA  B 2 1   ? 8.171   -10.082 -32.148 1.00 135.65 ? 101 DA  C "O4'" 1 
ATOM   459  C "C3'" . DA  B 2 1   ? 7.592   -12.368 -32.460 1.00 127.33 ? 101 DA  C "C3'" 1 
ATOM   460  O "O3'" . DA  B 2 1   ? 7.291   -13.201 -31.330 1.00 130.63 ? 101 DA  C "O3'" 1 
ATOM   461  C "C2'" . DA  B 2 1   ? 6.430   -11.426 -32.805 1.00 115.70 ? 101 DA  C "C2'" 1 
ATOM   462  C "C1'" . DA  B 2 1   ? 6.790   -10.237 -31.921 1.00 114.10 ? 101 DA  C "C1'" 1 
ATOM   463  N N9    . DA  B 2 1   ? 6.106   -8.958  -32.145 1.00 87.20  ? 101 DA  C N9    1 
ATOM   464  C C8    . DA  B 2 1   ? 4.756   -8.744  -32.235 1.00 63.03  ? 101 DA  C C8    1 
ATOM   465  N N7    . DA  B 2 1   ? 4.428   -7.482  -32.418 1.00 60.73  ? 101 DA  C N7    1 
ATOM   466  C C5    . DA  B 2 1   ? 5.645   -6.818  -32.441 1.00 69.80  ? 101 DA  C C5    1 
ATOM   467  C C6    . DA  B 2 1   ? 5.989   -5.455  -32.602 1.00 66.37  ? 101 DA  C C6    1 
ATOM   468  N N6    . DA  B 2 1   ? 5.085   -4.484  -32.776 1.00 62.15  ? 101 DA  C N6    1 
ATOM   469  N N1    . DA  B 2 1   ? 7.299   -5.125  -32.579 1.00 56.22  ? 101 DA  C N1    1 
ATOM   470  C C2    . DA  B 2 1   ? 8.203   -6.099  -32.406 1.00 70.39  ? 101 DA  C C2    1 
ATOM   471  N N3    . DA  B 2 1   ? 8.001   -7.409  -32.241 1.00 75.64  ? 101 DA  C N3    1 
ATOM   472  C C4    . DA  B 2 1   ? 6.691   -7.711  -32.270 1.00 74.26  ? 101 DA  C C4    1 
ATOM   473  P P     . DA  B 2 2   ? 8.421   -13.756 -30.328 1.00 130.85 ? 102 DA  C P     1 
ATOM   474  O OP1   . DA  B 2 2   ? 9.549   -14.287 -31.127 1.00 134.43 ? 102 DA  C OP1   1 
ATOM   475  O OP2   . DA  B 2 2   ? 7.747   -14.647 -29.357 1.00 134.38 ? 102 DA  C OP2   1 
ATOM   476  O "O5'" . DA  B 2 2   ? 8.917   -12.457 -29.525 1.00 130.10 ? 102 DA  C "O5'" 1 
ATOM   477  C "C5'" . DA  B 2 2   ? 10.031  -12.525 -28.627 1.00 122.22 ? 102 DA  C "C5'" 1 
ATOM   478  C "C4'" . DA  B 2 2   ? 11.025  -11.400 -28.875 1.00 116.01 ? 102 DA  C "C4'" 1 
ATOM   479  O "O4'" . DA  B 2 2   ? 10.348  -10.279 -29.499 1.00 111.51 ? 102 DA  C "O4'" 1 
ATOM   480  C "C3'" . DA  B 2 2   ? 11.705  -10.819 -27.637 1.00 116.81 ? 102 DA  C "C3'" 1 
ATOM   481  O "O3'" . DA  B 2 2   ? 13.033  -10.409 -27.959 1.00 126.25 ? 102 DA  C "O3'" 1 
ATOM   482  C "C2'" . DA  B 2 2   ? 10.822  -9.617  -27.316 1.00 111.20 ? 102 DA  C "C2'" 1 
ATOM   483  C "C1'" . DA  B 2 2   ? 10.535  -9.113  -28.724 1.00 107.31 ? 102 DA  C "C1'" 1 
ATOM   484  N N9    . DA  B 2 2   ? 9.338   -8.282  -28.844 1.00 102.42 ? 102 DA  C N9    1 
ATOM   485  C C8    . DA  B 2 2   ? 8.035   -8.703  -28.824 1.00 83.92  ? 102 DA  C C8    1 
ATOM   486  N N7    . DA  B 2 2   ? 7.162   -7.733  -28.957 1.00 76.10  ? 102 DA  C N7    1 
ATOM   487  C C5    . DA  B 2 2   ? 7.946   -6.596  -29.076 1.00 83.50  ? 102 DA  C C5    1 
ATOM   488  C C6    . DA  B 2 2   ? 7.623   -5.234  -29.245 1.00 71.90  ? 102 DA  C C6    1 
ATOM   489  N N6    . DA  B 2 2   ? 6.365   -4.785  -29.326 1.00 43.67  ? 102 DA  C N6    1 
ATOM   490  N N1    . DA  B 2 2   ? 8.646   -4.353  -29.330 1.00 88.57  ? 102 DA  C N1    1 
ATOM   491  C C2    . DA  B 2 2   ? 9.905   -4.811  -29.250 1.00 94.87  ? 102 DA  C C2    1 
ATOM   492  N N3    . DA  B 2 2   ? 10.330  -6.065  -29.092 1.00 87.17  ? 102 DA  C N3    1 
ATOM   493  C C4    . DA  B 2 2   ? 9.291   -6.916  -29.010 1.00 95.01  ? 102 DA  C C4    1 
ATOM   494  P P     . DA  B 2 3   ? 14.087  -10.047 -26.807 1.00 139.45 ? 103 DA  C P     1 
ATOM   495  O OP1   . DA  B 2 3   ? 15.439  -10.073 -27.409 1.00 130.76 ? 103 DA  C OP1   1 
ATOM   496  O OP2   . DA  B 2 3   ? 13.797  -10.900 -25.631 1.00 124.08 ? 103 DA  C OP2   1 
ATOM   497  O "O5'" . DA  B 2 3   ? 13.720  -8.535  -26.423 1.00 133.35 ? 103 DA  C "O5'" 1 
ATOM   498  C "C5'" . DA  B 2 3   ? 14.050  -7.461  -27.304 1.00 128.26 ? 103 DA  C "C5'" 1 
ATOM   499  C "C4'" . DA  B 2 3   ? 13.533  -6.124  -26.792 1.00 119.55 ? 103 DA  C "C4'" 1 
ATOM   500  O "O4'" . DA  B 2 3   ? 12.106  -6.003  -27.038 1.00 110.08 ? 103 DA  C "O4'" 1 
ATOM   501  C "C3'" . DA  B 2 3   ? 13.717  -5.853  -25.300 1.00 106.77 ? 103 DA  C "C3'" 1 
ATOM   502  O "O3'" . DA  B 2 3   ? 14.135  -4.506  -25.122 1.00 111.98 ? 103 DA  C "O3'" 1 
ATOM   503  C "C2'" . DA  B 2 3   ? 12.310  -6.053  -24.742 1.00 86.93  ? 103 DA  C "C2'" 1 
ATOM   504  C "C1'" . DA  B 2 3   ? 11.515  -5.442  -25.886 1.00 75.75  ? 103 DA  C "C1'" 1 
ATOM   505  N N9    . DA  B 2 3   ? 10.086  -5.741  -25.869 1.00 71.63  ? 103 DA  C N9    1 
ATOM   506  C C8    . DA  B 2 3   ? 9.483   -6.949  -25.653 1.00 64.79  ? 103 DA  C C8    1 
ATOM   507  N N7    . DA  B 2 3   ? 8.169   -6.904  -25.699 1.00 44.10  ? 103 DA  C N7    1 
ATOM   508  C C5    . DA  B 2 3   ? 7.891   -5.571  -25.961 1.00 62.15  ? 103 DA  C C5    1 
ATOM   509  C C6    . DA  B 2 3   ? 6.681   -4.861  -26.134 1.00 67.63  ? 103 DA  C C6    1 
ATOM   510  N N6    . DA  B 2 3   ? 5.466   -5.423  -26.059 1.00 46.60  ? 103 DA  C N6    1 
ATOM   511  N N1    . DA  B 2 3   ? 6.769   -3.537  -26.388 1.00 74.49  ? 103 DA  C N1    1 
ATOM   512  C C2    . DA  B 2 3   ? 7.980   -2.967  -26.462 1.00 74.39  ? 103 DA  C C2    1 
ATOM   513  N N3    . DA  B 2 3   ? 9.182   -3.527  -26.319 1.00 58.22  ? 103 DA  C N3    1 
ATOM   514  C C4    . DA  B 2 3   ? 9.065   -4.842  -26.069 1.00 71.60  ? 103 DA  C C4    1 
ATOM   515  P P     . DA  B 2 4   ? 15.056  -4.088  -23.880 1.00 125.79 ? 104 DA  C P     1 
ATOM   516  O OP1   . DA  B 2 4   ? 16.432  -4.562  -24.162 1.00 109.52 ? 104 DA  C OP1   1 
ATOM   517  O OP2   . DA  B 2 4   ? 14.374  -4.496  -22.630 1.00 120.10 ? 104 DA  C OP2   1 
ATOM   518  O "O5'" . DA  B 2 4   ? 15.019  -2.489  -23.946 1.00 108.74 ? 104 DA  C "O5'" 1 
ATOM   519  C "C5'" . DA  B 2 4   ? 14.242  -1.845  -24.950 1.00 104.43 ? 104 DA  C "C5'" 1 
ATOM   520  C "C4'" . DA  B 2 4   ? 13.100  -1.044  -24.345 1.00 111.26 ? 104 DA  C "C4'" 1 
ATOM   521  O "O4'" . DA  B 2 4   ? 11.852  -1.778  -24.472 1.00 110.42 ? 104 DA  C "O4'" 1 
ATOM   522  C "C3'" . DA  B 2 4   ? 13.244  -0.697  -22.861 1.00 99.18  ? 104 DA  C "C3'" 1 
ATOM   523  O "O3'" . DA  B 2 4   ? 13.070  0.713   -22.706 1.00 90.89  ? 104 DA  C "O3'" 1 
ATOM   524  C "C2'" . DA  B 2 4   ? 12.124  -1.500  -22.202 1.00 84.09  ? 104 DA  C "C2'" 1 
ATOM   525  C "C1'" . DA  B 2 4   ? 11.091  -1.498  -23.318 1.00 87.01  ? 104 DA  C "C1'" 1 
ATOM   526  N N9    . DA  B 2 4   ? 10.037  -2.495  -23.159 1.00 77.12  ? 104 DA  C N9    1 
ATOM   527  C C8    . DA  B 2 4   ? 10.185  -3.829  -22.901 1.00 69.01  ? 104 DA  C C8    1 
ATOM   528  N N7    . DA  B 2 4   ? 9.048   -4.479  -22.807 1.00 50.59  ? 104 DA  C N7    1 
ATOM   529  C C5    . DA  B 2 4   ? 8.088   -3.504  -23.014 1.00 56.18  ? 104 DA  C C5    1 
ATOM   530  C C6    . DA  B 2 4   ? 6.678   -3.547  -23.040 1.00 71.48  ? 104 DA  C C6    1 
ATOM   531  N N6    . DA  B 2 4   ? 5.969   -4.666  -22.849 1.00 39.52  ? 104 DA  C N6    1 
ATOM   532  N N1    . DA  B 2 4   ? 6.022   -2.387  -23.274 1.00 88.11  ? 104 DA  C N1    1 
ATOM   533  C C2    . DA  B 2 4   ? 6.733   -1.268  -23.468 1.00 90.22  ? 104 DA  C C2    1 
ATOM   534  N N3    . DA  B 2 4   ? 8.057   -1.106  -23.468 1.00 86.01  ? 104 DA  C N3    1 
ATOM   535  C C4    . DA  B 2 4   ? 8.681   -2.274  -23.232 1.00 79.06  ? 104 DA  C C4    1 
ATOM   536  P P     . DA  B 2 5   ? 12.682  1.407   -21.312 1.00 104.10 ? 105 DA  C P     1 
ATOM   537  O OP1   . DA  B 2 5   ? 13.906  2.031   -20.757 1.00 100.35 ? 105 DA  C OP1   1 
ATOM   538  O OP2   . DA  B 2 5   ? 11.888  0.469   -20.483 1.00 66.57  ? 105 DA  C OP2   1 
ATOM   539  O "O5'" . DA  B 2 5   ? 11.696  2.574   -21.790 1.00 107.88 ? 105 DA  C "O5'" 1 
ATOM   540  C "C5'" . DA  B 2 5   ? 10.552  2.257   -22.581 1.00 108.98 ? 105 DA  C "C5'" 1 
ATOM   541  C "C4'" . DA  B 2 5   ? 9.269   2.694   -21.893 1.00 106.76 ? 105 DA  C "C4'" 1 
ATOM   542  O "O4'" . DA  B 2 5   ? 8.365   1.561   -21.792 1.00 107.68 ? 105 DA  C "O4'" 1 
ATOM   543  C "C3'" . DA  B 2 5   ? 9.439   3.228   -20.472 1.00 99.89  ? 105 DA  C "C3'" 1 
ATOM   544  O "O3'" . DA  B 2 5   ? 8.538   4.307   -20.252 1.00 101.61 ? 105 DA  C "O3'" 1 
ATOM   545  C "C2'" . DA  B 2 5   ? 9.082   2.021   -19.613 1.00 86.30  ? 105 DA  C "C2'" 1 
ATOM   546  C "C1'" . DA  B 2 5   ? 7.976   1.386   -20.444 1.00 85.64  ? 105 DA  C "C1'" 1 
ATOM   547  N N9    . DA  B 2 5   ? 7.808   -0.038  -20.175 1.00 60.48  ? 105 DA  C N9    1 
ATOM   548  C C8    . DA  B 2 5   ? 8.796   -0.938  -19.878 1.00 61.95  ? 105 DA  C C8    1 
ATOM   549  N N7    . DA  B 2 5   ? 8.359   -2.158  -19.678 1.00 54.08  ? 105 DA  C N7    1 
ATOM   550  C C5    . DA  B 2 5   ? 6.989   -2.050  -19.856 1.00 50.70  ? 105 DA  C C5    1 
ATOM   551  C C6    . DA  B 2 5   ? 5.948   -2.996  -19.776 1.00 55.22  ? 105 DA  C C6    1 
ATOM   552  N N6    . DA  B 2 5   ? 6.156   -4.287  -19.491 1.00 30.43  ? 105 DA  C N6    1 
ATOM   553  N N1    . DA  B 2 5   ? 4.689   -2.563  -20.008 1.00 58.40  ? 105 DA  C N1    1 
ATOM   554  C C2    . DA  B 2 5   ? 4.494   -1.269  -20.298 1.00 61.95  ? 105 DA  C C2    1 
ATOM   555  N N3    . DA  B 2 5   ? 5.391   -0.287  -20.397 1.00 56.59  ? 105 DA  C N3    1 
ATOM   556  C C4    . DA  B 2 5   ? 6.631   -0.750  -20.163 1.00 41.81  ? 105 DA  C C4    1 
ATOM   557  P P     . DT  B 2 6   ? 8.676   5.257   -18.968 1.00 110.41 ? 106 DT  C P     1 
ATOM   558  O OP1   . DT  B 2 6   ? 9.054   6.609   -19.439 1.00 101.10 ? 106 DT  C OP1   1 
ATOM   559  O OP2   . DT  B 2 6   ? 9.518   4.576   -17.957 1.00 93.36  ? 106 DT  C OP2   1 
ATOM   560  O "O5'" . DT  B 2 6   ? 7.173   5.306   -18.419 1.00 116.33 ? 106 DT  C "O5'" 1 
ATOM   561  C "C5'" . DT  B 2 6   ? 6.514   4.093   -18.069 1.00 97.04  ? 106 DT  C "C5'" 1 
ATOM   562  C "C4'" . DT  B 2 6   ? 5.019   4.157   -18.328 1.00 89.31  ? 106 DT  C "C4'" 1 
ATOM   563  O "O4'" . DT  B 2 6   ? 4.537   2.824   -18.640 1.00 93.19  ? 106 DT  C "O4'" 1 
ATOM   564  C "C3'" . DT  B 2 6   ? 4.184   4.556   -17.123 1.00 75.12  ? 106 DT  C "C3'" 1 
ATOM   565  O "O3'" . DT  B 2 6   ? 2.880   4.931   -17.553 1.00 78.24  ? 106 DT  C "O3'" 1 
ATOM   566  C "C2'" . DT  B 2 6   ? 4.183   3.248   -16.340 1.00 69.54  ? 106 DT  C "C2'" 1 
ATOM   567  C "C1'" . DT  B 2 6   ? 4.033   2.218   -17.460 1.00 62.03  ? 106 DT  C "C1'" 1 
ATOM   568  N N1    . DT  B 2 6   ? 4.775   0.938   -17.231 1.00 41.39  ? 106 DT  C N1    1 
ATOM   569  C C2    . DT  B 2 6   ? 4.059   -0.235  -17.096 1.00 47.09  ? 106 DT  C C2    1 
ATOM   570  O O2    . DT  B 2 6   ? 2.840   -0.284  -17.150 1.00 45.85  ? 106 DT  C O2    1 
ATOM   571  N N3    . DT  B 2 6   ? 4.830   -1.358  -16.895 1.00 38.62  ? 106 DT  C N3    1 
ATOM   572  C C4    . DT  B 2 6   ? 6.213   -1.418  -16.816 1.00 32.20  ? 106 DT  C C4    1 
ATOM   573  O O4    . DT  B 2 6   ? 6.823   -2.467  -16.634 1.00 25.67  ? 106 DT  C O4    1 
ATOM   574  C C5    . DT  B 2 6   ? 6.889   -0.155  -16.964 1.00 25.03  ? 106 DT  C C5    1 
ATOM   575  C C7    . DT  B 2 6   ? 8.280   -0.010  -16.911 1.00 24.61  ? 106 DT  C C7    1 
ATOM   576  C C6    . DT  B 2 6   ? 6.157   0.948   -17.164 1.00 35.37  ? 106 DT  C C6    1 
ATOM   577  P P     . DT  B 2 7   ? 1.612   4.813   -16.582 1.00 82.75  ? 107 DT  C P     1 
ATOM   578  O OP1   . DT  B 2 7   ? 0.596   5.785   -17.048 1.00 58.36  ? 107 DT  C OP1   1 
ATOM   579  O OP2   . DT  B 2 7   ? 2.089   4.863   -15.179 1.00 83.97  ? 107 DT  C OP2   1 
ATOM   580  O "O5'" . DT  B 2 7   ? 1.083   3.330   -16.874 1.00 76.99  ? 107 DT  C "O5'" 1 
ATOM   581  C "C5'" . DT  B 2 7   ? -0.315  3.079   -17.003 1.00 82.96  ? 107 DT  C "C5'" 1 
ATOM   582  C "C4'" . DT  B 2 7   ? -0.812  2.168   -15.893 1.00 90.98  ? 107 DT  C "C4'" 1 
ATOM   583  O "O4'" . DT  B 2 7   ? 0.134   1.085   -15.687 1.00 97.66  ? 107 DT  C "O4'" 1 
ATOM   584  C "C3'" . DT  B 2 7   ? -0.985  2.837   -14.531 1.00 86.11  ? 107 DT  C "C3'" 1 
ATOM   585  O "O3'" . DT  B 2 7   ? -2.087  2.280   -13.822 1.00 86.69  ? 107 DT  C "O3'" 1 
ATOM   586  C "C2'" . DT  B 2 7   ? 0.316   2.464   -13.829 1.00 82.35  ? 107 DT  C "C2'" 1 
ATOM   587  C "C1'" . DT  B 2 7   ? 0.443   1.024   -14.311 1.00 77.07  ? 107 DT  C "C1'" 1 
ATOM   588  N N1    . DT  B 2 7   ? 1.792   0.414   -14.126 1.00 57.86  ? 107 DT  C N1    1 
ATOM   589  C C2    . DT  B 2 7   ? 1.912   -0.962  -14.139 1.00 50.82  ? 107 DT  C C2    1 
ATOM   590  O O2    . DT  B 2 7   ? 0.962   -1.710  -14.299 1.00 43.20  ? 107 DT  C O2    1 
ATOM   591  N N3    . DT  B 2 7   ? 3.190   -1.435  -13.954 1.00 31.47  ? 107 DT  C N3    1 
ATOM   592  C C4    . DT  B 2 7   ? 4.331   -0.675  -13.764 1.00 32.61  ? 107 DT  C C4    1 
ATOM   593  O O4    . DT  B 2 7   ? 5.436   -1.176  -13.611 1.00 51.12  ? 107 DT  C O4    1 
ATOM   594  C C5    . DT  B 2 7   ? 4.126   0.751   -13.761 1.00 30.63  ? 107 DT  C C5    1 
ATOM   595  C C7    . DT  B 2 7   ? 5.157   1.680   -13.582 1.00 32.07  ? 107 DT  C C7    1 
ATOM   596  C C6    . DT  B 2 7   ? 2.890   1.231   -13.937 1.00 40.84  ? 107 DT  C C6    1 
ATOM   597  P P     . DT  B 2 8   ? -3.569  2.204   -14.421 1.00 87.33  ? 108 DT  C P     1 
ATOM   598  O OP1   . DT  B 2 8   ? -3.497  1.981   -15.881 1.00 91.12  ? 108 DT  C OP1   1 
ATOM   599  O OP2   . DT  B 2 8   ? -4.334  3.352   -13.884 1.00 91.94  ? 108 DT  C OP2   1 
ATOM   600  O "O5'" . DT  B 2 8   ? -4.120  0.867   -13.739 1.00 96.57  ? 108 DT  C "O5'" 1 
ATOM   601  C "C5'" . DT  B 2 8   ? -3.314  0.204   -12.763 1.00 98.09  ? 108 DT  C "C5'" 1 
ATOM   602  C "C4'" . DT  B 2 8   ? -3.499  -1.305  -12.800 1.00 75.69  ? 108 DT  C "C4'" 1 
ATOM   603  O "O4'" . DT  B 2 8   ? -2.198  -1.946  -12.859 1.00 65.37  ? 108 DT  C "O4'" 1 
ATOM   604  C "C3'" . DT  B 2 8   ? -4.144  -1.892  -11.555 1.00 48.31  ? 108 DT  C "C3'" 1 
ATOM   605  O "O3'" . DT  B 2 8   ? -4.659  -3.183  -11.854 1.00 52.42  ? 108 DT  C "O3'" 1 
ATOM   606  C "C2'" . DT  B 2 8   ? -2.938  -1.963  -10.626 1.00 61.31  ? 108 DT  C "C2'" 1 
ATOM   607  C "C1'" . DT  B 2 8   ? -1.889  -2.509  -11.592 1.00 65.80  ? 108 DT  C "C1'" 1 
ATOM   608  N N1    . DT  B 2 8   ? -0.462  -2.180  -11.249 1.00 69.76  ? 108 DT  C N1    1 
ATOM   609  C C2    . DT  B 2 8   ? 0.406   -3.191  -10.865 1.00 71.55  ? 108 DT  C C2    1 
ATOM   610  O O2    . DT  B 2 8   ? 0.082   -4.366  -10.774 1.00 64.12  ? 108 DT  C O2    1 
ATOM   611  N N3    . DT  B 2 8   ? 1.686   -2.778  -10.581 1.00 56.46  ? 108 DT  C N3    1 
ATOM   612  C C4    . DT  B 2 8   ? 2.178   -1.483  -10.646 1.00 55.03  ? 108 DT  C C4    1 
ATOM   613  O O4    . DT  B 2 8   ? 3.343   -1.201  -10.377 1.00 38.40  ? 108 DT  C O4    1 
ATOM   614  C C5    . DT  B 2 8   ? 1.217   -0.489  -11.050 1.00 47.55  ? 108 DT  C C5    1 
ATOM   615  C C7    . DT  B 2 8   ? 1.519   0.872   -11.168 1.00 99.11  ? 108 DT  C C7    1 
ATOM   616  C C6    . DT  B 2 8   ? -0.036  -0.868  -11.331 1.00 52.98  ? 108 DT  C C6    1 
ATOM   617  P P     . DT  B 2 9   ? -5.443  -4.014  -10.733 1.00 68.15  ? 109 DT  C P     1 
ATOM   618  O OP1   . DT  B 2 9   ? -6.295  -5.026  -11.393 1.00 74.15  ? 109 DT  C OP1   1 
ATOM   619  O OP2   . DT  B 2 9   ? -6.059  -3.034  -9.812  1.00 48.70  ? 109 DT  C OP2   1 
ATOM   620  O "O5'" . DT  B 2 9   ? -4.265  -4.782  -9.970  1.00 56.20  ? 109 DT  C "O5'" 1 
ATOM   621  C "C5'" . DT  B 2 9   ? -3.340  -5.568  -10.724 1.00 49.30  ? 109 DT  C "C5'" 1 
ATOM   622  C "C4'" . DT  B 2 9   ? -3.026  -6.879  -10.028 1.00 63.27  ? 109 DT  C "C4'" 1 
ATOM   623  O "O4'" . DT  B 2 9   ? -1.651  -6.874  -9.574  1.00 67.14  ? 109 DT  C "O4'" 1 
ATOM   624  C "C3'" . DT  B 2 9   ? -3.866  -7.173  -8.795  1.00 73.69  ? 109 DT  C "C3'" 1 
ATOM   625  O "O3'" . DT  B 2 9   ? -4.035  -8.591  -8.697  1.00 87.72  ? 109 DT  C "O3'" 1 
ATOM   626  C "C2'" . DT  B 2 9   ? -3.036  -6.559  -7.666  1.00 58.57  ? 109 DT  C "C2'" 1 
ATOM   627  C "C1'" . DT  B 2 9   ? -1.601  -6.707  -8.168  1.00 72.09  ? 109 DT  C "C1'" 1 
ATOM   628  N N1    . DT  B 2 9   ? -0.717  -5.534  -7.876  1.00 58.79  ? 109 DT  C N1    1 
ATOM   629  C C2    . DT  B 2 9   ? 0.611   -5.760  -7.575  1.00 59.19  ? 109 DT  C C2    1 
ATOM   630  O O2    . DT  B 2 9   ? 1.105   -6.873  -7.530  1.00 46.82  ? 109 DT  C O2    1 
ATOM   631  N N3    . DT  B 2 9   ? 1.352   -4.631  -7.326  1.00 57.16  ? 109 DT  C N3    1 
ATOM   632  C C4    . DT  B 2 9   ? 0.907   -3.322  -7.347  1.00 60.97  ? 109 DT  C C4    1 
ATOM   633  O O4    . DT  B 2 9   ? 1.652   -2.377  -7.108  1.00 64.13  ? 109 DT  C O4    1 
ATOM   634  C C5    . DT  B 2 9   ? -0.491  -3.162  -7.668  1.00 33.10  ? 109 DT  C C5    1 
ATOM   635  C C7    . DT  B 2 9   ? -1.130  -1.919  -7.737  1.00 34.61  ? 109 DT  C C7    1 
ATOM   636  C C6    . DT  B 2 9   ? -1.232  -4.251  -7.916  1.00 15.48  ? 109 DT  C C6    1 
ATOM   637  P P     . DT  B 2 10  ? -4.380  -9.325  -7.316  1.00 88.57  ? 110 DT  C P     1 
ATOM   638  O OP1   . DT  B 2 10  ? -4.989  -10.636 -7.638  1.00 62.69  ? 110 DT  C OP1   1 
ATOM   639  O OP2   . DT  B 2 10  ? -5.110  -8.379  -6.436  1.00 76.09  ? 110 DT  C OP2   1 
ATOM   640  O "O5'" . DT  B 2 10  ? -2.916  -9.583  -6.718  1.00 70.90  ? 110 DT  C "O5'" 1 
ATOM   641  C "C5'" . DT  B 2 10  ? -1.985  -10.352 -7.469  1.00 30.45  ? 110 DT  C "C5'" 1 
ATOM   642  C "C4'" . DT  B 2 10  ? -0.682  -10.544 -6.710  1.00 55.82  ? 110 DT  C "C4'" 1 
ATOM   643  O "O4'" . DT  B 2 10  ? -0.063  -9.255  -6.468  1.00 67.51  ? 110 DT  C "O4'" 1 
ATOM   644  C "C3'" . DT  B 2 10  ? -0.792  -11.222 -5.343  1.00 51.93  ? 110 DT  C "C3'" 1 
ATOM   645  O "O3'" . DT  B 2 10  ? 0.244   -12.194 -5.234  1.00 62.57  ? 110 DT  C "O3'" 1 
ATOM   646  C "C2'" . DT  B 2 10  ? -0.605  -10.078 -4.347  1.00 22.65  ? 110 DT  C "C2'" 1 
ATOM   647  C "C1'" . DT  B 2 10  ? 0.374   -9.199  -5.123  1.00 69.59  ? 110 DT  C "C1'" 1 
ATOM   648  N N1    . DT  B 2 10  ? 0.439   -7.752  -4.723  1.00 58.40  ? 110 DT  C N1    1 
ATOM   649  C C2    . DT  B 2 10  ? 1.676   -7.171  -4.506  1.00 58.14  ? 110 DT  C C2    1 
ATOM   650  O O2    . DT  B 2 10  ? 2.731   -7.772  -4.611  1.00 74.73  ? 110 DT  C O2    1 
ATOM   651  N N3    . DT  B 2 10  ? 1.639   -5.846  -4.153  1.00 49.01  ? 110 DT  C N3    1 
ATOM   652  C C4    . DT  B 2 10  ? 0.513   -5.058  -4.006  1.00 46.77  ? 110 DT  C C4    1 
ATOM   653  O O4    . DT  B 2 10  ? 0.583   -3.873  -3.695  1.00 24.61  ? 110 DT  C O4    1 
ATOM   654  C C5    . DT  B 2 10  ? -0.741  -5.730  -4.251  1.00 22.45  ? 110 DT  C C5    1 
ATOM   655  C C7    . DT  B 2 10  ? -1.987  -5.102  -4.148  1.00 23.96  ? 110 DT  C C7    1 
ATOM   656  C C6    . DT  B 2 10  ? -0.730  -7.025  -4.597  1.00 20.02  ? 110 DT  C C6    1 
ATOM   657  P P     . DC  B 2 11  ? 0.232   -13.256 -4.039  1.00 54.36  ? 111 DC  C P     1 
ATOM   658  O OP1   . DC  B 2 11  ? 0.752   -14.540 -4.558  1.00 38.95  ? 111 DC  C OP1   1 
ATOM   659  O OP2   . DC  B 2 11  ? -1.106  -13.200 -3.402  1.00 18.89  ? 111 DC  C OP2   1 
ATOM   660  O "O5'" . DC  B 2 11  ? 1.319   -12.639 -3.044  1.00 46.23  ? 111 DC  C "O5'" 1 
ATOM   661  C "C5'" . DC  B 2 11  ? 2.602   -12.289 -3.545  1.00 41.60  ? 111 DC  C "C5'" 1 
ATOM   662  C "C4'" . DC  B 2 11  ? 3.346   -11.375 -2.587  1.00 39.12  ? 111 DC  C "C4'" 1 
ATOM   663  O "O4'" . DC  B 2 11  ? 2.775   -10.044 -2.604  1.00 48.75  ? 111 DC  C "O4'" 1 
ATOM   664  C "C3'" . DC  B 2 11  ? 3.334   -11.808 -1.121  1.00 50.95  ? 111 DC  C "C3'" 1 
ATOM   665  O "O3'" . DC  B 2 11  ? 4.638   -12.231 -0.734  1.00 33.35  ? 111 DC  C "O3'" 1 
ATOM   666  C "C2'" . DC  B 2 11  ? 2.914   -10.556 -0.350  1.00 55.51  ? 111 DC  C "C2'" 1 
ATOM   667  C "C1'" . DC  B 2 11  ? 3.116   -9.448  -1.374  1.00 35.21  ? 111 DC  C "C1'" 1 
ATOM   668  N N1    . DC  B 2 11  ? 2.279   -8.234  -1.135  1.00 38.86  ? 111 DC  C N1    1 
ATOM   669  C C2    . DC  B 2 11  ? 2.899   -7.061  -0.684  1.00 44.95  ? 111 DC  C C2    1 
ATOM   670  O O2    . DC  B 2 11  ? 4.122   -7.059  -0.499  1.00 42.58  ? 111 DC  C O2    1 
ATOM   671  N N3    . DC  B 2 11  ? 2.144   -5.955  -0.465  1.00 38.20  ? 111 DC  C N3    1 
ATOM   672  C C4    . DC  B 2 11  ? 0.829   -5.997  -0.678  1.00 26.26  ? 111 DC  C C4    1 
ATOM   673  N N4    . DC  B 2 11  ? 0.137   -4.881  -0.445  1.00 36.66  ? 111 DC  C N4    1 
ATOM   674  C C5    . DC  B 2 11  ? 0.168   -7.178  -1.133  1.00 17.62  ? 111 DC  C C5    1 
ATOM   675  C C6    . DC  B 2 11  ? 0.928   -8.263  -1.346  1.00 50.90  ? 111 DC  C C6    1 
ATOM   676  P P     . DT  B 2 12  ? 4.848   -13.337 0.405   1.00 47.55  ? 112 DT  C P     1 
ATOM   677  O OP1   . DT  B 2 12  ? 5.966   -14.209 -0.033  1.00 22.13  ? 112 DT  C OP1   1 
ATOM   678  O OP2   . DT  B 2 12  ? 3.536   -13.930 0.761   1.00 34.47  ? 112 DT  C OP2   1 
ATOM   679  O "O5'" . DT  B 2 12  ? 5.330   -12.443 1.630   1.00 53.99  ? 112 DT  C "O5'" 1 
ATOM   680  C "C5'" . DT  B 2 12  ? 6.361   -11.514 1.371   1.00 10.09  ? 112 DT  C "C5'" 1 
ATOM   681  C "C4'" . DT  B 2 12  ? 6.319   -10.358 2.352   1.00 32.79  ? 112 DT  C "C4'" 1 
ATOM   682  O "O4'" . DT  B 2 12  ? 5.235   -9.478  1.968   1.00 40.59  ? 112 DT  C "O4'" 1 
ATOM   683  C "C3'" . DT  B 2 12  ? 6.068   -10.740 3.809   1.00 35.59  ? 112 DT  C "C3'" 1 
ATOM   684  O "O3'" . DT  B 2 12  ? 6.913   -9.976  4.648   1.00 46.54  ? 112 DT  C "O3'" 1 
ATOM   685  C "C2'" . DT  B 2 12  ? 4.628   -10.304 4.025   1.00 38.28  ? 112 DT  C "C2'" 1 
ATOM   686  C "C1'" . DT  B 2 12  ? 4.655   -9.043  3.166   1.00 165.13 ? 112 DT  C "C1'" 1 
ATOM   687  N N1    . DT  B 2 12  ? 3.255   -8.455  2.911   1.00 12.88  ? 112 DT  C N1    1 
ATOM   688  C C2    . DT  B 2 12  ? 3.141   -7.085  2.753   1.00 27.61  ? 112 DT  C C2    1 
ATOM   689  O O2    . DT  B 2 12  ? 4.107   -6.338  2.798   1.00 23.22  ? 112 DT  C O2    1 
ATOM   690  N N3    . DT  B 2 12  ? 1.861   -6.622  2.540   1.00 8.16   ? 112 DT  C N3    1 
ATOM   691  C C4    . DT  B 2 12  ? 0.702   -7.379  2.477   1.00 30.12  ? 112 DT  C C4    1 
ATOM   692  O O4    . DT  B 2 12  ? -0.398  -6.865  2.280   1.00 15.09  ? 112 DT  C O4    1 
ATOM   693  C C5    . DT  B 2 12  ? 0.884   -8.805  2.657   1.00 9.07   ? 112 DT  C C5    1 
ATOM   694  C C6    . DT  B 2 12  ? 2.127   -9.271  2.864   1.00 15.97  ? 112 DT  C C6    1 
ATOM   695  P P     . DA  B 2 13  ? 7.854   -10.714 5.704   1.00 54.99  ? 113 DA  C P     1 
ATOM   696  O OP1   . DA  B 2 13  ? 8.506   -11.826 4.974   1.00 28.89  ? 113 DA  C OP1   1 
ATOM   697  O OP2   . DA  B 2 13  ? 7.071   -11.004 6.922   1.00 45.54  ? 113 DA  C OP2   1 
ATOM   698  O "O5'" . DA  B 2 13  ? 8.918   -9.575  6.077   1.00 35.08  ? 113 DA  C "O5'" 1 
ATOM   699  C "C5'" . DA  B 2 13  ? 9.510   -8.798  5.044   1.00 47.26  ? 113 DA  C "C5'" 1 
ATOM   700  C "C4'" . DA  B 2 13  ? 9.414   -7.311  5.330   1.00 41.78  ? 113 DA  C "C4'" 1 
ATOM   701  O "O4'" . DA  B 2 13  ? 8.096   -6.803  4.984   1.00 57.63  ? 113 DA  C "O4'" 1 
ATOM   702  C "C3'" . DA  B 2 13  ? 9.652   -6.912  6.778   1.00 26.39  ? 113 DA  C "C3'" 1 
ATOM   703  O "O3'" . DA  B 2 13  ? 10.462  -5.750  6.780   1.00 28.42  ? 113 DA  C "O3'" 1 
ATOM   704  C "C2'" . DA  B 2 13  ? 8.247   -6.625  7.300   1.00 41.96  ? 113 DA  C "C2'" 1 
ATOM   705  C "C1'" . DA  B 2 13  ? 7.556   -6.066  6.062   1.00 20.33  ? 113 DA  C "C1'" 1 
ATOM   706  N N9    . DA  B 2 13  ? 6.103   -6.251  6.056   1.00 20.74  ? 113 DA  C N9    1 
ATOM   707  C C8    . DA  B 2 13  ? 5.432   -7.443  6.114   1.00 26.34  ? 113 DA  C C8    1 
ATOM   708  N N7    . DA  B 2 13  ? 4.123   -7.325  6.090   1.00 36.86  ? 113 DA  C N7    1 
ATOM   709  C C5    . DA  B 2 13  ? 3.918   -5.958  6.010   1.00 11.79  ? 113 DA  C C5    1 
ATOM   710  C C6    . DA  B 2 13  ? 2.745   -5.179  5.947   1.00 28.63  ? 113 DA  C C6    1 
ATOM   711  N N6    . DA  B 2 13  ? 1.515   -5.710  5.958   1.00 7.19   ? 113 DA  C N6    1 
ATOM   712  N N1    . DA  B 2 13  ? 2.883   -3.839  5.876   1.00 9.45   ? 113 DA  C N1    1 
ATOM   713  C C2    . DA  B 2 13  ? 4.110   -3.320  5.861   1.00 12.76  ? 113 DA  C C2    1 
ATOM   714  N N3    . DA  B 2 13  ? 5.284   -3.947  5.913   1.00 24.08  ? 113 DA  C N3    1 
ATOM   715  C C4    . DA  B 2 13  ? 5.123   -5.279  5.986   1.00 19.24  ? 113 DA  C C4    1 
ATOM   716  P P     . DA  B 2 14  ? 10.956  -5.088  8.151   1.00 47.36  ? 114 DA  C P     1 
ATOM   717  O OP1   . DA  B 2 14  ? 12.259  -4.434  7.879   1.00 25.47  ? 114 DA  C OP1   1 
ATOM   718  O OP2   . DA  B 2 14  ? 10.815  -6.082  9.242   1.00 17.63  ? 114 DA  C OP2   1 
ATOM   719  O "O5'" . DA  B 2 14  ? 9.864   -3.952  8.404   1.00 47.55  ? 114 DA  C "O5'" 1 
ATOM   720  C "C5'" . DA  B 2 14  ? 9.667   -2.960  7.410   1.00 46.31  ? 114 DA  C "C5'" 1 
ATOM   721  C "C4'" . DA  B 2 14  ? 8.890   -1.794  7.983   1.00 35.53  ? 114 DA  C "C4'" 1 
ATOM   722  O "O4'" . DA  B 2 14  ? 7.471   -2.096  7.953   1.00 57.43  ? 114 DA  C "O4'" 1 
ATOM   723  C "C3'" . DA  B 2 14  ? 9.193   -1.497  9.438   1.00 16.60  ? 114 DA  C "C3'" 1 
ATOM   724  O "O3'" . DA  B 2 14  ? 8.957   -0.113  9.682   1.00 8.80   ? 114 DA  C "O3'" 1 
ATOM   725  C "C2'" . DA  B 2 14  ? 8.190   -2.402  10.157  1.00 20.18  ? 114 DA  C "C2'" 1 
ATOM   726  C "C1'" . DA  B 2 14  ? 6.963   -2.197  9.271   1.00 7.55   ? 114 DA  C "C1'" 1 
ATOM   727  N N9    . DA  B 2 14  ? 6.004   -3.296  9.291   1.00 15.03  ? 114 DA  C N9    1 
ATOM   728  C C8    . DA  B 2 14  ? 6.278   -4.635  9.395   1.00 32.71  ? 114 DA  C C8    1 
ATOM   729  N N7    . DA  B 2 14  ? 5.207   -5.398  9.371   1.00 20.07  ? 114 DA  C N7    1 
ATOM   730  C C5    . DA  B 2 14  ? 4.156   -4.500  9.242   1.00 12.14  ? 114 DA  C C5    1 
ATOM   731  C C6    . DA  B 2 14  ? 2.753   -4.670  9.163   1.00 15.05  ? 114 DA  C C6    1 
ATOM   732  N N6    . DA  B 2 14  ? 2.133   -5.861  9.201   1.00 6.06   ? 114 DA  C N6    1 
ATOM   733  N N1    . DA  B 2 14  ? 2.000   -3.556  9.041   1.00 17.62  ? 114 DA  C N1    1 
ATOM   734  C C2    . DA  B 2 14  ? 2.603   -2.361  9.002   1.00 30.71  ? 114 DA  C C2    1 
ATOM   735  N N3    . DA  B 2 14  ? 3.904   -2.076  9.073   1.00 24.20  ? 114 DA  C N3    1 
ATOM   736  C C4    . DA  B 2 14  ? 4.633   -3.199  9.191   1.00 17.95  ? 114 DA  C C4    1 
ATOM   737  P P     . DG  B 2 15  ? 9.651   0.617   10.924  1.00 37.14  ? 115 DG  C P     1 
ATOM   738  O OP1   . DG  B 2 15  ? 10.797  1.402   10.401  1.00 18.92  ? 115 DG  C OP1   1 
ATOM   739  O OP2   . DG  B 2 15  ? 9.832   -0.379  12.012  1.00 10.92  ? 115 DG  C OP2   1 
ATOM   740  O "O5'" . DG  B 2 15  ? 8.502   1.608   11.400  1.00 33.52  ? 115 DG  C "O5'" 1 
ATOM   741  C "C5'" . DG  B 2 15  ? 7.500   1.081   12.244  1.00 29.83  ? 115 DG  C "C5'" 1 
ATOM   742  C "C4'" . DG  B 2 15  ? 6.157   1.738   11.980  1.00 21.95  ? 115 DG  C "C4'" 1 
ATOM   743  O "O4'" . DG  B 2 15  ? 5.346   0.779   11.265  1.00 12.18  ? 115 DG  C "O4'" 1 
ATOM   744  C "C3'" . DG  B 2 15  ? 5.404   2.116   13.251  1.00 34.99  ? 115 DG  C "C3'" 1 
ATOM   745  O "O3'" . DG  B 2 15  ? 5.104   3.499   13.313  1.00 18.81  ? 115 DG  C "O3'" 1 
ATOM   746  C "C2'" . DG  B 2 15  ? 4.119   1.295   13.239  1.00 40.02  ? 115 DG  C "C2'" 1 
ATOM   747  C "C1'" . DG  B 2 15  ? 4.112   0.564   11.904  1.00 7.73   ? 115 DG  C "C1'" 1 
ATOM   748  N N9    . DG  B 2 15  ? 3.916   -0.873  12.061  1.00 13.98  ? 115 DG  C N9    1 
ATOM   749  C C8    . DG  B 2 15  ? 4.878   -1.845  12.179  1.00 17.26  ? 115 DG  C C8    1 
ATOM   750  N N7    . DG  B 2 15  ? 4.389   -3.049  12.307  1.00 15.02  ? 115 DG  C N7    1 
ATOM   751  C C5    . DG  B 2 15  ? 3.014   -2.859  12.277  1.00 10.49  ? 115 DG  C C5    1 
ATOM   752  C C6    . DG  B 2 15  ? 1.961   -3.798  12.373  1.00 13.01  ? 115 DG  C C6    1 
ATOM   753  O O6    . DG  B 2 15  ? 2.049   -5.025  12.508  1.00 39.45  ? 115 DG  C O6    1 
ATOM   754  N N1    . DG  B 2 15  ? 0.710   -3.188  12.301  1.00 4.93   ? 115 DG  C N1    1 
ATOM   755  C C2    . DG  B 2 15  ? 0.504   -1.833  12.150  1.00 26.04  ? 115 DG  C C2    1 
ATOM   756  N N2    . DG  B 2 15  ? -0.772  -1.414  12.096  1.00 6.98   ? 115 DG  C N2    1 
ATOM   757  N N3    . DG  B 2 15  ? 1.485   -0.943  12.058  1.00 14.09  ? 115 DG  C N3    1 
ATOM   758  C C4    . DG  B 2 15  ? 2.707   -1.526  12.130  1.00 15.59  ? 115 DG  C C4    1 
ATOM   759  P P     . DT  B 2 16  ? 4.629   4.072   14.734  1.00 52.80  ? 116 DT  C P     1 
ATOM   760  O OP1   . DT  B 2 16  ? 4.733   5.553   14.701  1.00 23.66  ? 116 DT  C OP1   1 
ATOM   761  O OP2   . DT  B 2 16  ? 5.349   3.300   15.772  1.00 25.24  ? 116 DT  C OP2   1 
ATOM   762  O "O5'" . DT  B 2 16  ? 3.083   3.652   14.824  1.00 9.27   ? 116 DT  C "O5'" 1 
ATOM   763  C "C5'" . DT  B 2 16  ? 2.143   4.315   13.976  1.00 31.14  ? 116 DT  C "C5'" 1 
ATOM   764  C "C4'" . DT  B 2 16  ? 0.717   3.862   14.236  1.00 29.04  ? 116 DT  C "C4'" 1 
ATOM   765  O "O4'" . DT  B 2 16  ? 0.627   2.434   14.021  1.00 28.79  ? 116 DT  C "O4'" 1 
ATOM   766  C "C3'" . DT  B 2 16  ? 0.202   4.123   15.644  1.00 27.78  ? 116 DT  C "C3'" 1 
ATOM   767  O "O3'" . DT  B 2 16  ? -1.066  4.760   15.565  1.00 24.69  ? 116 DT  C "O3'" 1 
ATOM   768  C "C2'" . DT  B 2 16  ? 0.118   2.741   16.290  1.00 30.52  ? 116 DT  C "C2'" 1 
ATOM   769  C "C1'" . DT  B 2 16  ? -0.041  1.810   15.094  1.00 12.00  ? 116 DT  C "C1'" 1 
ATOM   770  N N1    . DT  B 2 16  ? 0.579   0.454   15.252  1.00 9.53   ? 116 DT  C N1    1 
ATOM   771  C C2    . DT  B 2 16  ? -0.217  -0.681  15.263  1.00 9.25   ? 116 DT  C C2    1 
ATOM   772  O O2    . DT  B 2 16  ? -1.434  -0.674  15.160  1.00 18.72  ? 116 DT  C O2    1 
ATOM   773  N N3    . DT  B 2 16  ? 0.464   -1.864  15.408  1.00 14.88  ? 116 DT  C N3    1 
ATOM   774  C C4    . DT  B 2 16  ? 1.832   -2.029  15.534  1.00 14.01  ? 116 DT  C C4    1 
ATOM   775  O O4    . DT  B 2 16  ? 2.345   -3.133  15.658  1.00 15.65  ? 116 DT  C O4    1 
ATOM   776  C C5    . DT  B 2 16  ? 2.600   -0.811  15.517  1.00 12.97  ? 116 DT  C C5    1 
ATOM   777  C C7    . DT  B 2 16  ? 3.994   -0.776  15.638  1.00 13.14  ? 116 DT  C C7    1 
ATOM   778  C C6    . DT  B 2 16  ? 1.953   0.358   15.378  1.00 12.63  ? 116 DT  C C6    1 
ATOM   779  P P     . DC  B 2 17  ? -1.677  5.497   16.847  1.00 41.50  ? 117 DC  C P     1 
ATOM   780  O OP1   . DC  B 2 17  ? -2.502  6.618   16.359  1.00 42.94  ? 117 DC  C OP1   1 
ATOM   781  O OP2   . DC  B 2 17  ? -0.590  5.752   17.823  1.00 16.17  ? 117 DC  C OP2   1 
ATOM   782  O "O5'" . DC  B 2 17  ? -2.643  4.372   17.443  1.00 30.76  ? 117 DC  C "O5'" 1 
ATOM   783  C "C5'" . DC  B 2 17  ? -3.569  3.737   16.578  1.00 49.38  ? 117 DC  C "C5'" 1 
ATOM   784  C "C4'" . DC  B 2 17  ? -4.081  2.443   17.177  1.00 34.54  ? 117 DC  C "C4'" 1 
ATOM   785  O "O4'" . DC  B 2 17  ? -3.041  1.439   17.093  1.00 35.05  ? 117 DC  C "O4'" 1 
ATOM   786  C "C3'" . DC  B 2 17  ? -4.494  2.511   18.646  1.00 50.04  ? 117 DC  C "C3'" 1 
ATOM   787  O "O3'" . DC  B 2 17  ? -5.829  2.025   18.786  1.00 44.90  ? 117 DC  C "O3'" 1 
ATOM   788  C "C2'" . DC  B 2 17  ? -3.475  1.615   19.355  1.00 54.71  ? 117 DC  C "C2'" 1 
ATOM   789  C "C1'" . DC  B 2 17  ? -3.143  0.631   18.243  1.00 41.98  ? 117 DC  C "C1'" 1 
ATOM   790  N N1    . DC  B 2 17  ? -1.866  -0.120  18.420  1.00 17.81  ? 117 DC  C N1    1 
ATOM   791  C C2    . DC  B 2 17  ? -1.884  -1.521  18.418  1.00 14.86  ? 117 DC  C C2    1 
ATOM   792  O O2    . DC  B 2 17  ? -2.961  -2.116  18.278  1.00 15.36  ? 117 DC  C O2    1 
ATOM   793  N N3    . DC  B 2 17  ? -0.714  -2.190  18.574  1.00 14.00  ? 117 DC  C N3    1 
ATOM   794  C C4    . DC  B 2 17  ? 0.427   -1.511  18.721  1.00 23.63  ? 117 DC  C C4    1 
ATOM   795  N N4    . DC  B 2 17  ? 1.554   -2.216  18.871  1.00 51.62  ? 117 DC  C N4    1 
ATOM   796  C C5    . DC  B 2 17  ? 0.467   -0.086  18.717  1.00 21.68  ? 117 DC  C C5    1 
ATOM   797  C C6    . DC  B 2 17  ? -0.693  0.562   18.569  1.00 13.01  ? 117 DC  C C6    1 
ATOM   798  P P     . DT  B 2 18  ? -6.602  2.137   20.186  1.00 63.46  ? 118 DT  C P     1 
ATOM   799  O OP1   . DT  B 2 18  ? -7.883  2.836   19.941  1.00 53.45  ? 118 DT  C OP1   1 
ATOM   800  O OP2   . DT  B 2 18  ? -5.671  2.652   21.217  1.00 42.52  ? 118 DT  C OP2   1 
ATOM   801  O "O5'" . DT  B 2 18  ? -6.901  0.605   20.528  1.00 58.73  ? 118 DT  C "O5'" 1 
ATOM   802  C "C5'" . DT  B 2 18  ? -7.372  -0.262  19.503  1.00 60.69  ? 118 DT  C "C5'" 1 
ATOM   803  C "C4'" . DT  B 2 18  ? -7.450  -1.698  19.992  1.00 53.97  ? 118 DT  C "C4'" 1 
ATOM   804  O "O4'" . DT  B 2 18  ? -6.119  -2.280  20.020  1.00 52.75  ? 118 DT  C "O4'" 1 
ATOM   805  C "C3'" . DT  B 2 18  ? -7.985  -1.879  21.407  1.00 62.14  ? 118 DT  C "C3'" 1 
ATOM   806  O "O3'" . DT  B 2 18  ? -8.580  -3.169  21.494  1.00 75.17  ? 118 DT  C "O3'" 1 
ATOM   807  C "C2'" . DT  B 2 18  ? -6.699  -1.797  22.225  1.00 34.26  ? 118 DT  C "C2'" 1 
ATOM   808  C "C1'" . DT  B 2 18  ? -5.812  -2.673  21.347  1.00 26.02  ? 118 DT  C "C1'" 1 
ATOM   809  N N1    . DT  B 2 18  ? -4.333  -2.530  21.567  1.00 31.25  ? 118 DT  C N1    1 
ATOM   810  C C2    . DT  B 2 18  ? -3.552  -3.669  21.716  1.00 39.50  ? 118 DT  C C2    1 
ATOM   811  O O2    . DT  B 2 18  ? -3.995  -4.807  21.689  1.00 19.50  ? 118 DT  C O2    1 
ATOM   812  N N3    . DT  B 2 18  ? -2.209  -3.435  21.902  1.00 41.00  ? 118 DT  C N3    1 
ATOM   813  C C4    . DT  B 2 18  ? -1.574  -2.206  21.953  1.00 53.03  ? 118 DT  C C4    1 
ATOM   814  O O4    . DT  B 2 18  ? -0.359  -2.097  22.127  1.00 43.98  ? 118 DT  C O4    1 
ATOM   815  C C5    . DT  B 2 18  ? -2.452  -1.069  21.787  1.00 36.09  ? 118 DT  C C5    1 
ATOM   816  C C7    . DT  B 2 18  ? -2.005  0.257   21.806  1.00 36.29  ? 118 DT  C C7    1 
ATOM   817  C C6    . DT  B 2 18  ? -3.767  -1.269  21.604  1.00 29.42  ? 118 DT  C C6    1 
ATOM   818  P P     . DT  B 2 19  ? -9.936  -3.423  22.311  1.00 65.12  ? 119 DT  C P     1 
ATOM   819  O OP1   . DT  B 2 19  ? -11.065 -3.317  21.365  1.00 67.06  ? 119 DT  C OP1   1 
ATOM   820  O OP2   . DT  B 2 19  ? -9.900  -2.575  23.524  1.00 65.17  ? 119 DT  C OP2   1 
ATOM   821  O "O5'" . DT  B 2 19  ? -9.803  -4.955  22.759  1.00 51.77  ? 119 DT  C "O5'" 1 
ATOM   822  C "C5'" . DT  B 2 19  ? -9.069  -5.879  21.955  1.00 62.24  ? 119 DT  C "C5'" 1 
ATOM   823  C "C4'" . DT  B 2 19  ? -8.160  -6.774  22.789  1.00 63.30  ? 119 DT  C "C4'" 1 
ATOM   824  O "O4'" . DT  B 2 19  ? -6.842  -6.186  22.982  1.00 56.19  ? 119 DT  C "O4'" 1 
ATOM   825  C "C3'" . DT  B 2 19  ? -8.651  -7.110  24.193  1.00 66.27  ? 119 DT  C "C3'" 1 
ATOM   826  O "O3'" . DT  B 2 19  ? -8.322  -8.468  24.410  1.00 77.80  ? 119 DT  C "O3'" 1 
ATOM   827  C "C2'" . DT  B 2 19  ? -7.805  -6.191  25.073  1.00 50.11  ? 119 DT  C "C2'" 1 
ATOM   828  C "C1'" . DT  B 2 19  ? -6.476  -6.336  24.344  1.00 37.04  ? 119 DT  C "C1'" 1 
ATOM   829  N N1    . DT  B 2 19  ? -5.444  -5.307  24.656  1.00 45.19  ? 119 DT  C N1    1 
ATOM   830  C C2    . DT  B 2 19  ? -4.142  -5.693  24.942  1.00 53.36  ? 119 DT  C C2    1 
ATOM   831  O O2    . DT  B 2 19  ? -3.768  -6.856  24.974  1.00 34.79  ? 119 DT  C O2    1 
ATOM   832  N N3    . DT  B 2 19  ? -3.274  -4.654  25.197  1.00 42.35  ? 119 DT  C N3    1 
ATOM   833  C C4    . DT  B 2 19  ? -3.574  -3.301  25.189  1.00 48.95  ? 119 DT  C C4    1 
ATOM   834  O O4    . DT  B 2 19  ? -2.742  -2.431  25.428  1.00 50.63  ? 119 DT  C O4    1 
ATOM   835  C C5    . DT  B 2 19  ? -4.944  -2.984  24.881  1.00 41.33  ? 119 DT  C C5    1 
ATOM   836  C C7    . DT  B 2 19  ? -5.436  -1.675  24.826  1.00 42.51  ? 119 DT  C C7    1 
ATOM   837  C C6    . DT  B 2 19  ? -5.808  -3.977  24.631  1.00 36.35  ? 119 DT  C C6    1 
ATOM   838  P P     . DT  B 2 20  ? -8.988  -9.328  25.579  1.00 77.02  ? 120 DT  C P     1 
ATOM   839  O OP1   . DT  B 2 20  ? -10.407 -9.548  25.207  1.00 38.44  ? 120 DT  C OP1   1 
ATOM   840  O OP2   . DT  B 2 20  ? -8.621  -8.710  26.882  1.00 45.36  ? 120 DT  C OP2   1 
ATOM   841  O "O5'" . DT  B 2 20  ? -8.181  -10.707 25.445  1.00 71.32  ? 120 DT  C "O5'" 1 
ATOM   842  C "C5'" . DT  B 2 20  ? -6.839  -10.667 24.957  1.00 94.23  ? 120 DT  C "C5'" 1 
ATOM   843  C "C4'" . DT  B 2 20  ? -5.823  -10.724 26.091  1.00 94.10  ? 120 DT  C "C4'" 1 
ATOM   844  O "O4'" . DT  B 2 20  ? -5.187  -9.434  26.296  1.00 84.10  ? 120 DT  C "O4'" 1 
ATOM   845  C "C3'" . DT  B 2 20  ? -6.373  -11.143 27.452  1.00 89.37  ? 120 DT  C "C3'" 1 
ATOM   846  O "O3'" . DT  B 2 20  ? -5.708  -12.344 27.820  1.00 86.30  ? 120 DT  C "O3'" 1 
ATOM   847  C "C2'" . DT  B 2 20  ? -6.043  -9.969  28.379  1.00 88.24  ? 120 DT  C "C2'" 1 
ATOM   848  C "C1'" . DT  B 2 20  ? -4.860  -9.322  27.666  1.00 69.03  ? 120 DT  C "C1'" 1 
ATOM   849  N N1    . DT  B 2 20  ? -4.647  -7.877  27.984  1.00 56.85  ? 120 DT  C N1    1 
ATOM   850  C C2    . DT  B 2 20  ? -3.382  -7.430  28.324  1.00 49.58  ? 120 DT  C C2    1 
ATOM   851  O O2    . DT  B 2 20  ? -2.407  -8.159  28.389  1.00 33.32  ? 120 DT  C O2    1 
ATOM   852  N N3    . DT  B 2 20  ? -3.294  -6.082  28.588  1.00 34.16  ? 120 DT  C N3    1 
ATOM   853  C C4    . DT  B 2 20  ? -4.325  -5.156  28.545  1.00 44.85  ? 120 DT  C C4    1 
ATOM   854  O O4    . DT  B 2 20  ? -4.159  -3.964  28.796  1.00 45.64  ? 120 DT  C O4    1 
ATOM   855  C C5    . DT  B 2 20  ? -5.611  -5.699  28.185  1.00 2.89   ? 120 DT  C C5    1 
ATOM   856  C C7    . DT  B 2 20  ? -6.774  -4.927  28.091  1.00 9.43   ? 120 DT  C C7    1 
ATOM   857  C C6    . DT  B 2 20  ? -5.720  -7.008  27.923  1.00 43.86  ? 120 DT  C C6    1 
ATOM   858  P P     . DT  B 2 21  ? -5.874  -13.006 29.263  1.00 99.71  ? 121 DT  C P     1 
ATOM   859  O OP1   . DT  B 2 21  ? -5.685  -14.466 29.092  1.00 88.28  ? 121 DT  C OP1   1 
ATOM   860  O OP2   . DT  B 2 21  ? -7.112  -12.486 29.892  1.00 107.89 ? 121 DT  C OP2   1 
ATOM   861  O "O5'" . DT  B 2 21  ? -4.613  -12.407 30.044  1.00 89.24  ? 121 DT  C "O5'" 1 
ATOM   862  C "C5'" . DT  B 2 21  ? -3.373  -12.273 29.355  1.00 89.70  ? 121 DT  C "C5'" 1 
ATOM   863  C "C4'" . DT  B 2 21  ? -2.217  -12.051 30.317  1.00 90.34  ? 121 DT  C "C4'" 1 
ATOM   864  O "O4'" . DT  B 2 21  ? -1.960  -10.622 30.426  1.00 81.61  ? 121 DT  C "O4'" 1 
ATOM   865  C "C3'" . DT  B 2 21  ? -2.458  -12.521 31.748  1.00 100.50 ? 121 DT  C "C3'" 1 
ATOM   866  O "O3'" . DT  B 2 21  ? -1.195  -12.797 32.337  1.00 127.71 ? 121 DT  C "O3'" 1 
ATOM   867  C "C2'" . DT  B 2 21  ? -3.094  -11.283 32.368  1.00 88.80  ? 121 DT  C "C2'" 1 
ATOM   868  C "C1'" . DT  B 2 21  ? -2.177  -10.218 31.768  1.00 67.63  ? 121 DT  C "C1'" 1 
ATOM   869  N N1    . DT  B 2 21  ? -2.741  -8.836  31.792  1.00 45.90  ? 121 DT  C N1    1 
ATOM   870  C C2    . DT  B 2 21  ? -1.894  -7.772  32.036  1.00 46.86  ? 121 DT  C C2    1 
ATOM   871  O O2    . DT  B 2 21  ? -0.699  -7.906  32.235  1.00 19.07  ? 121 DT  C O2    1 
ATOM   872  N N3    . DT  B 2 21  ? -2.501  -6.538  32.038  1.00 31.35  ? 121 DT  C N3    1 
ATOM   873  C C4    . DT  B 2 21  ? -3.845  -6.274  31.823  1.00 51.27  ? 121 DT  C C4    1 
ATOM   874  O O4    . DT  B 2 21  ? -4.306  -5.136  31.842  1.00 43.99  ? 121 DT  C O4    1 
ATOM   875  C C5    . DT  B 2 21  ? -4.665  -7.435  31.573  1.00 37.09  ? 121 DT  C C5    1 
ATOM   876  C C7    . DT  B 2 21  ? -6.042  -7.372  31.331  1.00 39.94  ? 121 DT  C C7    1 
ATOM   877  C C6    . DT  B 2 21  ? -4.093  -8.646  31.569  1.00 47.30  ? 121 DT  C C6    1 
ATOM   878  P P     . DT  B 2 22  ? -1.046  -13.566 33.733  1.00 132.65 ? 122 DT  C P     1 
ATOM   879  O OP1   . DT  B 2 22  ? -1.339  -14.996 33.488  1.00 124.34 ? 122 DT  C OP1   1 
ATOM   880  O OP2   . DT  B 2 22  ? -1.800  -12.828 34.775  1.00 106.42 ? 122 DT  C OP2   1 
ATOM   881  O "O5'" . DT  B 2 22  ? 0.520   -13.393 34.034  1.00 117.83 ? 122 DT  C "O5'" 1 
ATOM   882  C "C5'" . DT  B 2 22  ? 1.398   -12.929 33.004  1.00 121.80 ? 122 DT  C "C5'" 1 
ATOM   883  C "C4'" . DT  B 2 22  ? 2.411   -11.913 33.514  1.00 120.72 ? 122 DT  C "C4'" 1 
ATOM   884  O "O4'" . DT  B 2 22  ? 1.820   -10.583 33.507  1.00 114.36 ? 122 DT  C "O4'" 1 
ATOM   885  C "C3'" . DT  B 2 22  ? 2.915   -12.142 34.934  1.00 120.86 ? 122 DT  C "C3'" 1 
ATOM   886  O "O3'" . DT  B 2 22  ? 4.292   -11.800 35.022  1.00 124.25 ? 122 DT  C "O3'" 1 
ATOM   887  C "C2'" . DT  B 2 22  ? 2.047   -11.200 35.764  1.00 106.37 ? 122 DT  C "C2'" 1 
ATOM   888  C "C1'" . DT  B 2 22  ? 1.830   -10.026 34.811  1.00 82.06  ? 122 DT  C "C1'" 1 
ATOM   889  N N1    . DT  B 2 22  ? 0.543   -9.267  35.006  1.00 52.45  ? 122 DT  C N1    1 
ATOM   890  C C2    . DT  B 2 22  ? 0.588   -7.902  35.244  1.00 53.41  ? 122 DT  C C2    1 
ATOM   891  O O2    . DT  B 2 22  ? 1.631   -7.273  35.312  1.00 51.78  ? 122 DT  C O2    1 
ATOM   892  N N3    . DT  B 2 22  ? -0.637  -7.287  35.404  1.00 16.67  ? 122 DT  C N3    1 
ATOM   893  C C4    . DT  B 2 22  ? -1.882  -7.896  35.346  1.00 44.45  ? 122 DT  C C4    1 
ATOM   894  O O4    . DT  B 2 22  ? -2.934  -7.273  35.493  1.00 26.44  ? 122 DT  C O4    1 
ATOM   895  C C5    . DT  B 2 22  ? -1.847  -9.320  35.097  1.00 35.42  ? 122 DT  C C5    1 
ATOM   896  C C7    . DT  B 2 22  ? -2.996  -10.114 35.013  1.00 36.76  ? 122 DT  C C7    1 
ATOM   897  C C6    . DT  B 2 22  ? -0.665  -9.935  34.935  1.00 15.23  ? 122 DT  C C6    1 
ATOM   898  N N     . LYS C 3 29  ? -22.844 -4.976  -7.891  1.00 46.87  ? 202 LYS A N     1 
ATOM   899  C CA    . LYS C 3 29  ? -23.478 -5.242  -6.560  1.00 41.81  ? 202 LYS A CA    1 
ATOM   900  C C     . LYS C 3 29  ? -22.482 -5.460  -5.546  0.00 38.70  ? 202 LYS A C     1 
ATOM   901  O O     . LYS C 3 29  ? -21.290 -5.794  -5.728  0.00 35.38  ? 202 LYS A O     1 
ATOM   902  C CB    . LYS C 3 29  ? -24.708 -5.948  -6.712  0.00 36.08  ? 202 LYS A CB    1 
ATOM   903  N N     . TRP C 3 30  ? -23.029 -5.414  -4.351  0.00 37.28  ? 203 TRP A N     1 
ATOM   904  C CA    . TRP C 3 30  ? -21.665 -5.860  -3.492  1.00 48.83  ? 203 TRP A CA    1 
ATOM   905  C C     . TRP C 3 30  ? -23.136 -5.236  -2.002  0.00 37.79  ? 203 TRP A C     1 
ATOM   906  O O     . TRP C 3 30  ? -24.532 -5.622  -2.394  1.00 50.74  ? 203 TRP A O     1 
ATOM   907  C CB    . TRP C 3 30  ? -21.486 -4.333  -3.358  1.00 52.21  ? 203 TRP A CB    1 
ATOM   908  N N     . LYS C 3 31  ? -22.987 -4.941  -0.424  1.00 22.35  ? 204 LYS A N     1 
ATOM   909  C CA    . LYS C 3 31  ? -23.676 -4.323  0.713   1.00 34.10  ? 204 LYS A CA    1 
ATOM   910  C C     . LYS C 3 31  ? -23.982 -2.844  0.435   1.00 36.80  ? 204 LYS A C     1 
ATOM   911  O O     . LYS C 3 31  ? -24.291 -2.471  -0.707  1.00 37.84  ? 204 LYS A O     1 
ATOM   912  C CB    . LYS C 3 31  ? -24.154 -5.288  1.372   0.00 25.67  ? 204 LYS A CB    1 
ATOM   913  C CG    . LYS C 3 31  ? -24.374 -6.758  1.240   0.00 29.90  ? 204 LYS A CG    1 
ATOM   914  C CD    . LYS C 3 31  ? -23.931 -7.447  2.549   0.00 33.34  ? 204 LYS A CD    1 
ATOM   915  C CE    . LYS C 3 31  ? -24.369 -6.562  3.724   0.00 30.14  ? 204 LYS A CE    1 
ATOM   916  N NZ    . LYS C 3 31  ? -25.618 -7.092  4.343   0.00 40.61  ? 204 LYS A NZ    1 
ATOM   917  N N     . TRP C 3 32  ? -23.892 -1.999  1.468   1.00 35.79  ? 205 TRP A N     1 
ATOM   918  C CA    . TRP C 3 32  ? -23.614 -2.433  2.842   1.00 33.55  ? 205 TRP A CA    1 
ATOM   919  C C     . TRP C 3 32  ? -23.399 -1.222  3.764   1.00 40.06  ? 205 TRP A C     1 
ATOM   920  O O     . TRP C 3 32  ? -23.793 -1.234  4.929   1.00 35.46  ? 205 TRP A O     1 
ATOM   921  C CB    . TRP C 3 32  ? -22.662 -3.446  3.471   0.00 28.97  ? 205 TRP A CB    1 
ATOM   922  C CG    . TRP C 3 32  ? -21.213 -3.196  3.255   0.00 36.20  ? 205 TRP A CG    1 
ATOM   923  C CD1   . TRP C 3 32  ? -20.281 -3.764  2.465   0.00 47.88  ? 205 TRP A CD1   1 
ATOM   924  C CD2   . TRP C 3 32  ? -20.478 -2.217  4.043   0.00 38.12  ? 205 TRP A CD2   1 
ATOM   925  N NE1   . TRP C 3 32  ? -19.039 -3.149  2.665   0.00 32.46  ? 205 TRP A NE1   1 
ATOM   926  C CE2   . TRP C 3 32  ? -19.154 -2.176  3.643   0.00 36.75  ? 205 TRP A CE2   1 
ATOM   927  C CE3   . TRP C 3 32  ? -20.895 -1.547  5.155   0.00 33.34  ? 205 TRP A CE3   1 
ATOM   928  C CZ2   . TRP C 3 32  ? -18.740 -0.861  3.737   1.00 35.80  ? 205 TRP A CZ2   1 
ATOM   929  C CZ3   . TRP C 3 32  ? -20.051 -0.530  5.649   0.00 39.48  ? 205 TRP A CZ3   1 
ATOM   930  C CH2   . TRP C 3 32  ? -18.693 -0.445  5.246   0.00 26.54  ? 205 TRP A CH2   1 
ATOM   931  N N     . TRP C 3 33  ? -22.771 -0.171  3.237   1.00 41.41  ? 206 TRP A N     1 
ATOM   932  C CA    . TRP C 3 33  ? -23.238 1.192   3.869   0.00 27.55  ? 206 TRP A CA    1 
ATOM   933  C C     . TRP C 3 33  ? -24.670 1.853   4.126   1.00 37.05  ? 206 TRP A C     1 
ATOM   934  O O     . TRP C 3 33  ? -24.962 1.833   5.329   1.00 35.85  ? 206 TRP A O     1 
ATOM   935  C CB    . TRP C 3 33  ? -22.725 2.351   2.998   0.00 24.61  ? 206 TRP A CB    1 
ATOM   936  C CG    . TRP C 3 33  ? -22.527 2.057   1.507   0.00 35.88  ? 206 TRP A CG    1 
ATOM   937  C CD1   . TRP C 3 33  ? -23.058 2.759   0.457   0.00 31.59  ? 206 TRP A CD1   1 
ATOM   938  C CD2   . TRP C 3 33  ? -21.712 1.026   0.918   0.00 39.20  ? 206 TRP A CD2   1 
ATOM   939  N NE1   . TRP C 3 33  ? -22.638 2.223   -0.738  0.00 29.06  ? 206 TRP A NE1   1 
ATOM   940  C CE2   . TRP C 3 33  ? -21.809 1.164   -0.493  0.00 28.65  ? 206 TRP A CE2   1 
ATOM   941  C CE3   . TRP C 3 33  ? -20.910 -0.002  1.437   0.00 31.28  ? 206 TRP A CE3   1 
ATOM   942  C CZ2   . TRP C 3 33  ? -21.133 0.318   -1.393  0.00 33.51  ? 206 TRP A CZ2   1 
ATOM   943  C CZ3   . TRP C 3 33  ? -20.243 -0.857  0.538   0.00 42.14  ? 206 TRP A CZ3   1 
ATOM   944  C CH2   . TRP C 3 33  ? -20.362 -0.688  -0.861  0.00 39.27  ? 206 TRP A CH2   1 
ATOM   945  N N     . GLU C 3 34  ? -25.478 1.337   3.185   1.00 48.94  ? 207 GLU A N     1 
ATOM   946  C CA    . GLU C 3 34  ? -26.884 1.010   3.443   1.00 40.04  ? 207 GLU A CA    1 
ATOM   947  C C     . GLU C 3 34  ? -26.979 -0.325  4.178   1.00 43.32  ? 207 GLU A C     1 
ATOM   948  O O     . GLU C 3 34  ? -27.282 -1.363  3.578   1.00 58.04  ? 207 GLU A O     1 
ATOM   949  C CB    . GLU C 3 34  ? -27.802 1.090   2.177   0.00 26.15  ? 207 GLU A CB    1 
ATOM   950  C CG    . GLU C 3 34  ? -28.093 2.389   1.457   0.00 27.41  ? 207 GLU A CG    1 
ATOM   951  C CD    . GLU C 3 34  ? -28.122 2.171   -0.042  0.00 53.78  ? 207 GLU A CD    1 
ATOM   952  O OE1   . GLU C 3 34  ? -27.250 2.757   -0.750  0.00 52.35  ? 207 GLU A OE1   1 
ATOM   953  O OE2   . GLU C 3 34  ? -29.005 1.392   -0.504  0.00 53.43  ? 207 GLU A OE2   1 
ATOM   954  N N     . GLU C 3 35  ? -26.706 -0.289  5.481   1.00 34.21  ? 208 GLU A N     1 
ATOM   955  C CA    . GLU C 3 35  ? -26.727 -1.488  6.318   1.00 34.35  ? 208 GLU A CA    1 
ATOM   956  C C     . GLU C 3 35  ? -26.869 -1.011  7.759   1.00 43.37  ? 208 GLU A C     1 
ATOM   957  O O     . GLU C 3 35  ? -26.679 0.175   8.052   1.00 45.22  ? 208 GLU A O     1 
ATOM   958  C CB    . GLU C 3 35  ? -27.034 -2.708  5.835   0.00 22.28  ? 208 GLU A CB    1 
ATOM   959  C CG    . GLU C 3 35  ? -28.387 -3.326  5.457   0.00 36.59  ? 208 GLU A CG    1 
ATOM   960  C CD    . GLU C 3 35  ? -28.977 -4.159  6.581   0.00 58.93  ? 208 GLU A CD    1 
ATOM   961  O OE1   . GLU C 3 35  ? -29.705 -3.626  7.492   0.00 38.52  ? 208 GLU A OE1   1 
ATOM   962  O OE2   . GLU C 3 35  ? -28.713 -5.380  6.520   0.00 53.35  ? 208 GLU A OE2   1 
ATOM   963  N N     . GLU C 3 36  ? -27.201 -1.923  8.664   1.00 49.97  ? 209 GLU A N     1 
ATOM   964  C CA    . GLU C 3 36  ? -27.530 -1.506  10.027  1.00 51.89  ? 209 GLU A CA    1 
ATOM   965  C C     . GLU C 3 36  ? -26.438 -1.806  11.047  1.00 49.78  ? 209 GLU A C     1 
ATOM   966  O O     . GLU C 3 36  ? -26.304 -2.937  11.524  1.00 48.60  ? 209 GLU A O     1 
ATOM   967  C CB    . GLU C 3 36  ? -28.888 -2.083  10.463  1.00 50.88  ? 209 GLU A CB    1 
ATOM   968  C CG    . GLU C 3 36  ? -30.056 -1.486  9.641   1.00 49.05  ? 209 GLU A CG    1 
ATOM   969  C CD    . GLU C 3 36  ? -31.245 -2.441  9.598   1.00 73.06  ? 209 GLU A CD    1 
ATOM   970  O OE1   . GLU C 3 36  ? -32.097 -2.299  8.688   1.00 64.57  ? 209 GLU A OE1   1 
ATOM   971  O OE2   . GLU C 3 36  ? -31.329 -3.331  10.477  1.00 76.55  ? 209 GLU A OE2   1 
ATOM   972  N N     . ARG C 3 37  ? -25.661 -0.764  11.359  1.00 51.54  ? 210 ARG A N     1 
ATOM   973  C CA    . ARG C 3 37  ? -24.598 -0.814  12.386  1.00 56.03  ? 210 ARG A CA    1 
ATOM   974  C C     . ARG C 3 37  ? -24.442 -2.086  13.223  1.00 52.30  ? 210 ARG A C     1 
ATOM   975  O O     . ARG C 3 37  ? -25.248 -2.383  14.119  1.00 46.98  ? 210 ARG A O     1 
ATOM   976  C CB    . ARG C 3 37  ? -24.672 0.420   13.299  1.00 56.19  ? 210 ARG A CB    1 
ATOM   977  C CG    . ARG C 3 37  ? -23.307 0.906   13.786  1.00 60.29  ? 210 ARG A CG    1 
ATOM   978  C CD    . ARG C 3 37  ? -23.235 2.414   14.008  1.00 65.88  ? 210 ARG A CD    1 
ATOM   979  N NE    . ARG C 3 37  ? -22.109 2.780   14.865  1.00 73.18  ? 210 ARG A NE    1 
ATOM   980  C CZ    . ARG C 3 37  ? -21.897 4.000   15.348  1.00 68.77  ? 210 ARG A CZ    1 
ATOM   981  N NH1   . ARG C 3 37  ? -22.736 4.989   15.062  1.00 58.80  ? 210 ARG A NH1   1 
ATOM   982  N NH2   . ARG C 3 37  ? -20.842 4.234   16.117  1.00 62.95  ? 210 ARG A NH2   1 
ATOM   983  N N     . TYR C 3 38  ? -23.403 -2.843  12.892  1.00 46.71  ? 211 TYR A N     1 
ATOM   984  C CA    . TYR C 3 38  ? -22.853 -3.839  13.814  1.00 48.66  ? 211 TYR A CA    1 
ATOM   985  C C     . TYR C 3 38  ? -22.295 -3.136  15.044  1.00 46.33  ? 211 TYR A C     1 
ATOM   986  O O     . TYR C 3 38  ? -21.497 -2.195  14.925  1.00 45.51  ? 211 TYR A O     1 
ATOM   987  C CB    . TYR C 3 38  ? -21.702 -4.579  13.122  1.00 48.86  ? 211 TYR A CB    1 
ATOM   988  C CG    . TYR C 3 38  ? -22.047 -5.969  12.667  1.00 60.17  ? 211 TYR A CG    1 
ATOM   989  C CD1   . TYR C 3 38  ? -21.489 -6.490  11.506  1.00 53.88  ? 211 TYR A CD1   1 
ATOM   990  C CD2   . TYR C 3 38  ? -22.925 -6.767  13.395  1.00 61.39  ? 211 TYR A CD2   1 
ATOM   991  C CE1   . TYR C 3 38  ? -21.794 -7.768  11.078  1.00 61.90  ? 211 TYR A CE1   1 
ATOM   992  C CE2   . TYR C 3 38  ? -23.238 -8.048  12.975  1.00 66.11  ? 211 TYR A CE2   1 
ATOM   993  C CZ    . TYR C 3 38  ? -22.668 -8.543  11.816  1.00 69.85  ? 211 TYR A CZ    1 
ATOM   994  O OH    . TYR C 3 38  ? -22.974 -9.813  11.387  1.00 57.94  ? 211 TYR A OH    1 
ATOM   995  N N     . PRO C 3 39  ? -22.687 -3.605  16.227  1.00 47.72  ? 212 PRO A N     1 
ATOM   996  C CA    . PRO C 3 39  ? -22.201 -2.996  17.476  1.00 47.14  ? 212 PRO A CA    1 
ATOM   997  C C     . PRO C 3 39  ? -20.729 -3.309  17.667  1.00 45.56  ? 212 PRO A C     1 
ATOM   998  O O     . PRO C 3 39  ? -20.235 -4.305  17.110  1.00 41.45  ? 212 PRO A O     1 
ATOM   999  C CB    . PRO C 3 39  ? -23.010 -3.717  18.567  1.00 41.08  ? 212 PRO A CB    1 
ATOM   1000 C CG    . PRO C 3 39  ? -23.363 -5.039  17.950  1.00 41.19  ? 212 PRO A CG    1 
ATOM   1001 C CD    . PRO C 3 39  ? -23.592 -4.749  16.475  1.00 39.59  ? 212 PRO A CD    1 
ATOM   1002 N N     . GLU C 3 40  ? -20.045 -2.458  18.441  1.00 31.67  ? 213 GLU A N     1 
ATOM   1003 C CA    . GLU C 3 40  ? -18.684 -2.784  18.904  1.00 32.76  ? 213 GLU A CA    1 
ATOM   1004 C C     . GLU C 3 40  ? -18.608 -4.178  19.545  1.00 31.89  ? 213 GLU A C     1 
ATOM   1005 O O     . GLU C 3 40  ? -19.575 -4.658  20.154  1.00 49.87  ? 213 GLU A O     1 
ATOM   1006 C CB    . GLU C 3 40  ? -18.225 -1.718  19.922  1.00 32.05  ? 213 GLU A CB    1 
ATOM   1007 C CG    . GLU C 3 40  ? -17.476 -0.548  19.288  1.00 36.57  ? 213 GLU A CG    1 
ATOM   1008 C CD    . GLU C 3 40  ? -15.969 -0.798  19.232  1.00 45.79  ? 213 GLU A CD    1 
ATOM   1009 O OE1   . GLU C 3 40  ? -15.253 -0.035  18.523  1.00 37.05  ? 213 GLU A OE1   1 
ATOM   1010 O OE2   . GLU C 3 40  ? -15.503 -1.759  19.907  1.00 35.65  ? 213 GLU A OE2   1 
ATOM   1011 N N     . GLY C 3 41  ? -17.444 -4.817  19.404  1.00 34.94  ? 214 GLY A N     1 
ATOM   1012 C CA    . GLY C 3 41  ? -17.207 -6.102  20.041  1.00 48.67  ? 214 GLY A CA    1 
ATOM   1013 C C     . GLY C 3 41  ? -17.502 -7.291  19.143  1.00 52.03  ? 214 GLY A C     1 
ATOM   1014 O O     . GLY C 3 41  ? -16.748 -8.269  19.113  1.00 51.64  ? 214 GLY A O     1 
ATOM   1015 N N     . ILE C 3 42  ? -18.600 -7.214  18.400  1.00 43.98  ? 215 ILE A N     1 
ATOM   1016 C CA    . ILE C 3 42  ? -18.946 -8.288  17.479  1.00 44.50  ? 215 ILE A CA    1 
ATOM   1017 C C     . ILE C 3 42  ? -18.382 -8.011  16.087  1.00 51.93  ? 215 ILE A C     1 
ATOM   1018 O O     . ILE C 3 42  ? -18.605 -6.940  15.513  1.00 58.99  ? 215 ILE A O     1 
ATOM   1019 C CB    . ILE C 3 42  ? -20.479 -8.500  17.440  1.00 47.85  ? 215 ILE A CB    1 
ATOM   1020 C CG1   . ILE C 3 42  ? -20.814 -9.959  17.118  1.00 39.70  ? 215 ILE A CG1   1 
ATOM   1021 C CG2   . ILE C 3 42  ? -21.145 -7.543  16.451  1.00 59.33  ? 215 ILE A CG2   1 
ATOM   1022 C CD1   . ILE C 3 42  ? -20.807 -10.865 18.351  1.00 42.78  ? 215 ILE A CD1   1 
ATOM   1023 N N     . LYS C 3 43  ? -17.630 -8.971  15.559  1.00 58.26  ? 216 LYS A N     1 
ATOM   1024 C CA    . LYS C 3 43  ? -17.066 -8.835  14.222  1.00 61.41  ? 216 LYS A CA    1 
ATOM   1025 C C     . LYS C 3 43  ? -17.971 -9.533  13.217  1.00 65.15  ? 216 LYS A C     1 
ATOM   1026 O O     . LYS C 3 43  ? -18.329 -8.961  12.182  1.00 67.49  ? 216 LYS A O     1 
ATOM   1027 C CB    . LYS C 3 43  ? -15.649 -9.415  14.160  1.00 62.64  ? 216 LYS A CB    1 
ATOM   1028 C CG    . LYS C 3 43  ? -14.630 -8.697  15.042  1.00 57.98  ? 216 LYS A CG    1 
ATOM   1029 C CD    . LYS C 3 43  ? -14.610 -7.199  14.773  1.00 63.25  ? 216 LYS A CD    1 
ATOM   1030 C CE    . LYS C 3 43  ? -13.868 -6.443  15.867  1.00 67.18  ? 216 LYS A CE    1 
ATOM   1031 N NZ    . LYS C 3 43  ? -13.213 -5.208  15.339  1.00 54.46  ? 216 LYS A NZ    1 
ATOM   1032 N N     . TRP C 3 44  ? -18.351 -10.767 13.536  1.00 64.44  ? 217 TRP A N     1 
ATOM   1033 C CA    . TRP C 3 44  ? -19.212 -11.552 12.658  1.00 69.09  ? 217 TRP A CA    1 
ATOM   1034 C C     . TRP C 3 44  ? -20.088 -12.520 13.442  1.00 67.28  ? 217 TRP A C     1 
ATOM   1035 O O     . TRP C 3 44  ? -19.825 -12.807 14.612  1.00 73.01  ? 217 TRP A O     1 
ATOM   1036 C CB    . TRP C 3 44  ? -18.376 -12.323 11.633  1.00 69.54  ? 217 TRP A CB    1 
ATOM   1037 C CG    . TRP C 3 44  ? -17.142 -12.961 12.208  1.00 77.09  ? 217 TRP A CG    1 
ATOM   1038 C CD1   . TRP C 3 44  ? -15.874 -12.452 12.200  1.00 66.25  ? 217 TRP A CD1   1 
ATOM   1039 C CD2   . TRP C 3 44  ? -17.058 -14.227 12.872  1.00 71.81  ? 217 TRP A CD2   1 
ATOM   1040 N NE1   . TRP C 3 44  ? -15.010 -13.324 12.818  1.00 62.27  ? 217 TRP A NE1   1 
ATOM   1041 C CE2   . TRP C 3 44  ? -15.714 -14.422 13.240  1.00 53.48  ? 217 TRP A CE2   1 
ATOM   1042 C CE3   . TRP C 3 44  ? -17.988 -15.221 13.197  1.00 71.91  ? 217 TRP A CE3   1 
ATOM   1043 C CZ2   . TRP C 3 44  ? -15.279 -15.562 13.907  1.00 45.12  ? 217 TRP A CZ2   1 
ATOM   1044 C CZ3   . TRP C 3 44  ? -17.553 -16.350 13.861  1.00 67.97  ? 217 TRP A CZ3   1 
ATOM   1045 C CH2   . TRP C 3 44  ? -16.211 -16.511 14.209  1.00 53.58  ? 217 TRP A CH2   1 
ATOM   1046 N N     . LYS C 3 45  ? -21.132 -13.019 12.787  1.00 64.04  ? 218 LYS A N     1 
ATOM   1047 C CA    . LYS C 3 45  ? -22.006 -14.022 13.380  1.00 60.43  ? 218 LYS A CA    1 
ATOM   1048 C C     . LYS C 3 45  ? -21.718 -15.379 12.751  1.00 56.57  ? 218 LYS A C     1 
ATOM   1049 O O     . LYS C 3 45  ? -21.673 -16.403 13.439  1.00 51.57  ? 218 LYS A O     1 
ATOM   1050 C CB    . LYS C 3 45  ? -23.474 -13.644 13.179  1.00 58.95  ? 218 LYS A CB    1 
ATOM   1051 C CG    . LYS C 3 45  ? -24.071 -12.846 14.328  1.00 77.20  ? 218 LYS A CG    1 
ATOM   1052 C CD    . LYS C 3 45  ? -24.790 -13.753 15.317  1.00 92.81  ? 218 LYS A CD    1 
ATOM   1053 C CE    . LYS C 3 45  ? -24.281 -13.542 16.735  1.00 84.63  ? 218 LYS A CE    1 
ATOM   1054 N NZ    . LYS C 3 45  ? -24.002 -14.836 17.421  1.00 93.29  ? 218 LYS A NZ    1 
ATOM   1055 N N     . PHE C 3 46  ? -21.516 -15.371 11.438  1.00 48.70  ? 219 PHE A N     1 
ATOM   1056 C CA    . PHE C 3 46  ? -21.165 -16.577 10.706  1.00 46.63  ? 219 PHE A CA    1 
ATOM   1057 C C     . PHE C 3 46  ? -19.889 -16.358 9.909   1.00 51.08  ? 219 PHE A C     1 
ATOM   1058 O O     . PHE C 3 46  ? -19.734 -15.344 9.231   1.00 58.85  ? 219 PHE A O     1 
ATOM   1059 C CB    . PHE C 3 46  ? -22.298 -16.972 9.765   1.00 52.20  ? 219 PHE A CB    1 
ATOM   1060 C CG    . PHE C 3 46  ? -21.997 -18.182 8.933   1.00 51.62  ? 219 PHE A CG    1 
ATOM   1061 C CD1   . PHE C 3 46  ? -22.177 -19.451 9.451   1.00 41.82  ? 219 PHE A CD1   1 
ATOM   1062 C CD2   . PHE C 3 46  ? -21.537 -18.052 7.632   1.00 46.57  ? 219 PHE A CD2   1 
ATOM   1063 C CE1   . PHE C 3 46  ? -21.904 -20.571 8.691   1.00 64.96  ? 219 PHE A CE1   1 
ATOM   1064 C CE2   . PHE C 3 46  ? -21.261 -19.168 6.868   1.00 34.24  ? 219 PHE A CE2   1 
ATOM   1065 C CZ    . PHE C 3 46  ? -21.445 -20.430 7.398   1.00 55.87  ? 219 PHE A CZ    1 
ATOM   1066 N N     . LEU C 3 47  ? -18.975 -17.318 9.992   1.00 49.48  ? 220 LEU A N     1 
ATOM   1067 C CA    . LEU C 3 47  ? -17.723 -17.249 9.248   1.00 44.97  ? 220 LEU A CA    1 
ATOM   1068 C C     . LEU C 3 47  ? -17.287 -18.643 8.839   1.00 35.62  ? 220 LEU A C     1 
ATOM   1069 O O     . LEU C 3 47  ? -17.096 -19.505 9.696   1.00 31.70  ? 220 LEU A O     1 
ATOM   1070 C CB    . LEU C 3 47  ? -16.633 -16.595 10.100  1.00 44.93  ? 220 LEU A CB    1 
ATOM   1071 C CG    . LEU C 3 47  ? -15.259 -16.376 9.459   1.00 39.02  ? 220 LEU A CG    1 
ATOM   1072 C CD1   . LEU C 3 47  ? -15.369 -15.867 8.022   1.00 24.94  ? 220 LEU A CD1   1 
ATOM   1073 C CD2   . LEU C 3 47  ? -14.468 -15.403 10.306  1.00 41.41  ? 220 LEU A CD2   1 
ATOM   1074 N N     . GLU C 3 48  ? -17.131 -18.860 7.534   1.00 24.02  ? 221 GLU A N     1 
ATOM   1075 C CA    . GLU C 3 48  ? -16.705 -20.160 7.027   1.00 34.45  ? 221 GLU A CA    1 
ATOM   1076 C C     . GLU C 3 48  ? -15.897 -20.024 5.739   1.00 45.35  ? 221 GLU A C     1 
ATOM   1077 O O     . GLU C 3 48  ? -16.253 -19.249 4.852   1.00 52.15  ? 221 GLU A O     1 
ATOM   1078 C CB    . GLU C 3 48  ? -17.917 -21.073 6.819   1.00 35.39  ? 221 GLU A CB    1 
ATOM   1079 C CG    . GLU C 3 48  ? -18.120 -21.559 5.391   1.00 53.32  ? 221 GLU A CG    1 
ATOM   1080 C CD    . GLU C 3 48  ? -18.766 -22.931 5.334   1.00 59.84  ? 221 GLU A CD    1 
ATOM   1081 O OE1   . GLU C 3 48  ? -18.952 -23.448 4.211   1.00 28.57  ? 221 GLU A OE1   1 
ATOM   1082 O OE2   . GLU C 3 48  ? -19.084 -23.489 6.411   1.00 50.28  ? 221 GLU A OE2   1 
ATOM   1083 N N     . HIS C 3 49  ? -14.803 -20.776 5.644   1.00 52.40  ? 222 HIS A N     1 
ATOM   1084 C CA    . HIS C 3 49  ? -13.937 -20.713 4.467   1.00 56.50  ? 222 HIS A CA    1 
ATOM   1085 C C     . HIS C 3 49  ? -13.322 -22.069 4.124   1.00 61.78  ? 222 HIS A C     1 
ATOM   1086 O O     . HIS C 3 49  ? -13.730 -23.101 4.662   1.00 64.28  ? 222 HIS A O     1 
ATOM   1087 C CB    . HIS C 3 49  ? -12.842 -19.657 4.653   1.00 54.58  ? 222 HIS A CB    1 
ATOM   1088 C CG    . HIS C 3 49  ? -12.095 -19.780 5.944   1.00 38.53  ? 222 HIS A CG    1 
ATOM   1089 N ND1   . HIS C 3 49  ? -10.888 -20.437 6.043   1.00 29.53  ? 222 HIS A ND1   1 
ATOM   1090 C CD2   . HIS C 3 49  ? -12.382 -19.328 7.188   1.00 45.91  ? 222 HIS A CD2   1 
ATOM   1091 C CE1   . HIS C 3 49  ? -10.464 -20.385 7.294   1.00 62.63  ? 222 HIS A CE1   1 
ATOM   1092 N NE2   . HIS C 3 49  ? -11.352 -19.719 8.010   1.00 38.36  ? 222 HIS A NE2   1 
ATOM   1093 N N     . LYS C 3 50  ? -12.338 -22.060 3.227   1.00 59.68  ? 223 LYS A N     1 
ATOM   1094 C CA    . LYS C 3 50  ? -11.749 -23.300 2.730   1.00 60.93  ? 223 LYS A CA    1 
ATOM   1095 C C     . LYS C 3 50  ? -10.270 -23.448 3.087   1.00 62.43  ? 223 LYS A C     1 
ATOM   1096 O O     . LYS C 3 50  ? -9.563  -24.278 2.508   1.00 65.69  ? 223 LYS A O     1 
ATOM   1097 C CB    . LYS C 3 50  ? -11.945 -23.412 1.214   1.00 62.74  ? 223 LYS A CB    1 
ATOM   1098 C CG    . LYS C 3 50  ? -12.412 -24.786 0.748   1.00 64.86  ? 223 LYS A CG    1 
ATOM   1099 C CD    . LYS C 3 50  ? -13.255 -24.689 -0.515  1.00 75.89  ? 223 LYS A CD    1 
ATOM   1100 C CE    . LYS C 3 50  ? -14.728 -24.944 -0.217  1.00 92.65  ? 223 LYS A CE    1 
ATOM   1101 N NZ    . LYS C 3 50  ? -15.569 -24.849 -1.444  1.00 100.95 ? 223 LYS A NZ    1 
ATOM   1102 N N     . GLY C 3 51  ? -9.808  -22.644 4.041   1.00 61.47  ? 224 GLY A N     1 
ATOM   1103 C CA    . GLY C 3 51  ? -8.430  -22.718 4.498   1.00 55.53  ? 224 GLY A CA    1 
ATOM   1104 C C     . GLY C 3 51  ? -7.438  -22.066 3.552   1.00 55.70  ? 224 GLY A C     1 
ATOM   1105 O O     . GLY C 3 51  ? -7.808  -21.571 2.485   1.00 60.56  ? 224 GLY A O     1 
ATOM   1106 N N     . PRO C 3 52  ? -6.167  -22.079 3.938   1.00 54.34  ? 225 PRO A N     1 
ATOM   1107 C CA    . PRO C 3 52  ? -5.119  -21.359 3.211   1.00 46.79  ? 225 PRO A CA    1 
ATOM   1108 C C     . PRO C 3 52  ? -4.415  -22.225 2.173   1.00 41.73  ? 225 PRO A C     1 
ATOM   1109 O O     . PRO C 3 52  ? -4.234  -23.422 2.391   1.00 45.87  ? 225 PRO A O     1 
ATOM   1110 C CB    . PRO C 3 52  ? -4.141  -20.993 4.324   1.00 46.83  ? 225 PRO A CB    1 
ATOM   1111 C CG    . PRO C 3 52  ? -4.286  -22.123 5.334   1.00 39.89  ? 225 PRO A CG    1 
ATOM   1112 C CD    . PRO C 3 52  ? -5.628  -22.789 5.114   1.00 56.12  ? 225 PRO A CD    1 
ATOM   1113 N N     . VAL C 3 53  ? -4.020  -21.618 1.058   1.00 44.58  ? 226 VAL A N     1 
ATOM   1114 C CA    . VAL C 3 53  ? -3.286  -22.331 0.018   1.00 47.87  ? 226 VAL A CA    1 
ATOM   1115 C C     . VAL C 3 53  ? -1.798  -22.364 0.351   1.00 45.78  ? 226 VAL A C     1 
ATOM   1116 O O     . VAL C 3 53  ? -1.116  -21.343 0.280   1.00 48.94  ? 226 VAL A O     1 
ATOM   1117 C CB    . VAL C 3 53  ? -3.490  -21.685 -1.369  1.00 48.38  ? 226 VAL A CB    1 
ATOM   1118 C CG1   . VAL C 3 53  ? -2.605  -22.354 -2.409  1.00 62.08  ? 226 VAL A CG1   1 
ATOM   1119 C CG2   . VAL C 3 53  ? -4.947  -21.764 -1.782  1.00 36.75  ? 226 VAL A CG2   1 
ATOM   1120 N N     . PHE C 3 54  ? -1.301  -23.542 0.718   1.00 46.42  ? 227 PHE A N     1 
ATOM   1121 C CA    . PHE C 3 54  ? 0.093   -23.696 1.121   1.00 45.20  ? 227 PHE A CA    1 
ATOM   1122 C C     . PHE C 3 54  ? 1.033   -23.584 -0.071  1.00 52.22  ? 227 PHE A C     1 
ATOM   1123 O O     . PHE C 3 54  ? 0.607   -23.712 -1.220  1.00 54.88  ? 227 PHE A O     1 
ATOM   1124 C CB    . PHE C 3 54  ? 0.302   -25.037 1.821   1.00 37.68  ? 227 PHE A CB    1 
ATOM   1125 C CG    . PHE C 3 54  ? -0.518  -25.200 3.066   1.00 30.08  ? 227 PHE A CG    1 
ATOM   1126 C CD1   . PHE C 3 54  ? -0.136  -24.590 4.248   1.00 37.61  ? 227 PHE A CD1   1 
ATOM   1127 C CD2   . PHE C 3 54  ? -1.676  -25.960 3.056   1.00 36.13  ? 227 PHE A CD2   1 
ATOM   1128 C CE1   . PHE C 3 54  ? -0.889  -24.736 5.399   1.00 46.29  ? 227 PHE A CE1   1 
ATOM   1129 C CE2   . PHE C 3 54  ? -2.433  -26.108 4.202   1.00 28.79  ? 227 PHE A CE2   1 
ATOM   1130 C CZ    . PHE C 3 54  ? -2.039  -25.493 5.375   1.00 41.73  ? 227 PHE A CZ    1 
ATOM   1131 N N     . ALA C 3 55  ? 2.310   -23.341 0.208   1.00 48.92  ? 228 ALA A N     1 
ATOM   1132 C CA    . ALA C 3 55  ? 3.303   -23.239 -0.851  1.00 47.51  ? 228 ALA A CA    1 
ATOM   1133 C C     . ALA C 3 55  ? 3.541   -24.608 -1.467  1.00 52.16  ? 228 ALA A C     1 
ATOM   1134 O O     . ALA C 3 55  ? 3.790   -25.581 -0.754  1.00 56.73  ? 228 ALA A O     1 
ATOM   1135 C CB    . ALA C 3 55  ? 4.596   -22.667 -0.313  1.00 50.93  ? 228 ALA A CB    1 
ATOM   1136 N N     . PRO C 3 56  ? 3.448   -24.681 -2.791  1.00 55.97  ? 229 PRO A N     1 
ATOM   1137 C CA    . PRO C 3 56  ? 3.645   -25.937 -3.521  1.00 62.39  ? 229 PRO A CA    1 
ATOM   1138 C C     . PRO C 3 56  ? 4.977   -26.589 -3.171  1.00 64.54  ? 229 PRO A C     1 
ATOM   1139 O O     . PRO C 3 56  ? 5.990   -25.894 -3.056  1.00 68.36  ? 229 PRO A O     1 
ATOM   1140 C CB    . PRO C 3 56  ? 3.639   -25.497 -4.991  1.00 66.41  ? 229 PRO A CB    1 
ATOM   1141 C CG    . PRO C 3 56  ? 3.802   -24.003 -4.957  1.00 56.46  ? 229 PRO A CG    1 
ATOM   1142 C CD    . PRO C 3 56  ? 3.143   -23.557 -3.692  1.00 59.79  ? 229 PRO A CD    1 
ATOM   1143 N N     . PRO C 3 57  ? 4.963   -27.908 -2.994  1.00 61.69  ? 230 PRO A N     1 
ATOM   1144 C CA    . PRO C 3 57  ? 6.161   -28.667 -2.622  1.00 58.62  ? 230 PRO A CA    1 
ATOM   1145 C C     . PRO C 3 57  ? 7.378   -28.309 -3.469  1.00 53.61  ? 230 PRO A C     1 
ATOM   1146 O O     . PRO C 3 57  ? 7.250   -28.005 -4.655  1.00 46.60  ? 230 PRO A O     1 
ATOM   1147 C CB    . PRO C 3 57  ? 5.738   -30.113 -2.875  1.00 57.97  ? 230 PRO A CB    1 
ATOM   1148 C CG    . PRO C 3 57  ? 4.276   -30.104 -2.613  1.00 65.01  ? 230 PRO A CG    1 
ATOM   1149 C CD    . PRO C 3 57  ? 3.780   -28.774 -3.129  1.00 59.51  ? 230 PRO A CD    1 
ATOM   1150 N N     . TYR C 3 58  ? 8.551   -28.350 -2.845  1.00 55.44  ? 231 TYR A N     1 
ATOM   1151 C CA    . TYR C 3 58  ? 9.789   -27.928 -3.486  1.00 60.78  ? 231 TYR A CA    1 
ATOM   1152 C C     . TYR C 3 58  ? 10.215  -28.901 -4.573  1.00 64.98  ? 231 TYR A C     1 
ATOM   1153 O O     . TYR C 3 58  ? 10.372  -30.096 -4.321  1.00 66.87  ? 231 TYR A O     1 
ATOM   1154 C CB    . TYR C 3 58  ? 10.893  -27.792 -2.436  1.00 64.94  ? 231 TYR A CB    1 
ATOM   1155 C CG    . TYR C 3 58  ? 12.292  -27.691 -2.996  1.00 61.56  ? 231 TYR A CG    1 
ATOM   1156 C CD1   . TYR C 3 58  ? 12.703  -26.563 -3.692  1.00 62.52  ? 231 TYR A CD1   1 
ATOM   1157 C CD2   . TYR C 3 58  ? 13.206  -28.718 -2.813  1.00 78.10  ? 231 TYR A CD2   1 
ATOM   1158 C CE1   . TYR C 3 58  ? 13.985  -26.466 -4.199  1.00 80.04  ? 231 TYR A CE1   1 
ATOM   1159 C CE2   . TYR C 3 58  ? 14.490  -28.631 -3.317  1.00 92.24  ? 231 TYR A CE2   1 
ATOM   1160 C CZ    . TYR C 3 58  ? 14.874  -27.503 -4.010  1.00 91.79  ? 231 TYR A CZ    1 
ATOM   1161 O OH    . TYR C 3 58  ? 16.151  -27.408 -4.514  1.00 105.90 ? 231 TYR A OH    1 
ATOM   1162 N N     . GLU C 3 59  ? 10.395  -28.379 -5.782  1.00 67.95  ? 232 GLU A N     1 
ATOM   1163 C CA    . GLU C 3 59  ? 10.859  -29.187 -6.903  1.00 71.61  ? 232 GLU A CA    1 
ATOM   1164 C C     . GLU C 3 59  ? 12.384  -29.222 -6.932  1.00 70.04  ? 232 GLU A C     1 
ATOM   1165 O O     . GLU C 3 59  ? 13.036  -28.185 -7.071  1.00 66.41  ? 232 GLU A O     1 
ATOM   1166 C CB    . GLU C 3 59  ? 10.304  -28.650 -8.225  1.00 75.98  ? 232 GLU A CB    1 
ATOM   1167 C CG    . GLU C 3 59  ? 10.413  -27.139 -8.382  1.00 106.54 ? 232 GLU A CG    1 
ATOM   1168 C CD    . GLU C 3 59  ? 9.275   -26.551 -9.197  1.00 126.65 ? 232 GLU A CD    1 
ATOM   1169 O OE1   . GLU C 3 59  ? 9.519   -26.130 -10.349 1.00 128.15 ? 232 GLU A OE1   1 
ATOM   1170 O OE2   . GLU C 3 59  ? 8.135   -26.508 -8.686  1.00 131.51 ? 232 GLU A OE2   1 
ATOM   1171 N N     . PRO C 3 60  ? 12.947  -30.419 -6.790  1.00 70.42  ? 233 PRO A N     1 
ATOM   1172 C CA    . PRO C 3 60  ? 14.401  -30.603 -6.751  1.00 70.80  ? 233 PRO A CA    1 
ATOM   1173 C C     . PRO C 3 60  ? 15.066  -30.178 -8.054  1.00 73.16  ? 233 PRO A C     1 
ATOM   1174 O O     . PRO C 3 60  ? 14.435  -30.231 -9.112  1.00 77.50  ? 233 PRO A O     1 
ATOM   1175 C CB    . PRO C 3 60  ? 14.556  -32.114 -6.543  1.00 72.61  ? 233 PRO A CB    1 
ATOM   1176 C CG    . PRO C 3 60  ? 13.255  -32.547 -5.957  1.00 76.03  ? 233 PRO A CG    1 
ATOM   1177 C CD    . PRO C 3 60  ? 12.225  -31.695 -6.650  1.00 75.76  ? 233 PRO A CD    1 
ATOM   1178 N N     . LEU C 3 61  ? 16.328  -29.764 -7.972  1.00 71.16  ? 234 LEU A N     1 
ATOM   1179 C CA    . LEU C 3 61  ? 17.044  -29.252 -9.136  1.00 73.35  ? 234 LEU A CA    1 
ATOM   1180 C C     . LEU C 3 61  ? 17.266  -30.339 -10.180 1.00 73.52  ? 234 LEU A C     1 
ATOM   1181 O O     . LEU C 3 61  ? 17.516  -31.494 -9.836  1.00 80.10  ? 234 LEU A O     1 
ATOM   1182 C CB    . LEU C 3 61  ? 18.389  -28.651 -8.716  1.00 69.45  ? 234 LEU A CB    1 
ATOM   1183 C CG    . LEU C 3 61  ? 18.363  -27.204 -8.217  1.00 64.59  ? 234 LEU A CG    1 
ATOM   1184 C CD1   . LEU C 3 61  ? 19.665  -26.865 -7.517  1.00 63.89  ? 234 LEU A CD1   1 
ATOM   1185 C CD2   . LEU C 3 61  ? 18.102  -26.238 -9.364  1.00 62.01  ? 234 LEU A CD2   1 
ATOM   1186 N N     . PRO C 3 62  ? 17.160  -29.965 -11.453 1.00 68.75  ? 235 PRO A N     1 
ATOM   1187 C CA    . PRO C 3 62  ? 17.476  -30.873 -12.560 1.00 74.62  ? 235 PRO A CA    1 
ATOM   1188 C C     . PRO C 3 62  ? 18.894  -31.429 -12.440 1.00 78.83  ? 235 PRO A C     1 
ATOM   1189 O O     . PRO C 3 62  ? 19.706  -30.894 -11.682 1.00 81.09  ? 235 PRO A O     1 
ATOM   1190 C CB    . PRO C 3 62  ? 17.367  -29.968 -13.791 1.00 74.71  ? 235 PRO A CB    1 
ATOM   1191 C CG    . PRO C 3 62  ? 16.420  -28.904 -13.381 1.00 69.21  ? 235 PRO A CG    1 
ATOM   1192 C CD    . PRO C 3 62  ? 16.708  -28.645 -11.929 1.00 68.37  ? 235 PRO A CD    1 
ATOM   1193 N N     . GLU C 3 63  ? 19.184  -32.490 -13.184 1.00 77.92  ? 236 GLU A N     1 
ATOM   1194 C CA    . GLU C 3 63  ? 20.484  -33.141 -13.097 1.00 82.69  ? 236 GLU A CA    1 
ATOM   1195 C C     . GLU C 3 63  ? 21.618  -32.210 -13.500 1.00 79.26  ? 236 GLU A C     1 
ATOM   1196 O O     . GLU C 3 63  ? 22.582  -32.040 -12.754 1.00 76.55  ? 236 GLU A O     1 
ATOM   1197 C CB    . GLU C 3 63  ? 20.507  -34.409 -13.953 1.00 90.75  ? 236 GLU A CB    1 
ATOM   1198 C CG    . GLU C 3 63  ? 20.325  -35.696 -13.159 1.00 122.19 ? 236 GLU A CG    1 
ATOM   1199 C CD    . GLU C 3 63  ? 19.748  -35.460 -11.773 1.00 139.44 ? 236 GLU A CD    1 
ATOM   1200 O OE1   . GLU C 3 63  ? 18.551  -35.102 -11.673 1.00 134.91 ? 236 GLU A OE1   1 
ATOM   1201 O OE2   . GLU C 3 63  ? 20.493  -35.635 -10.782 1.00 131.69 ? 236 GLU A OE2   1 
ATOM   1202 N N     . ASN C 3 64  ? 21.493  -31.597 -14.675 1.00 77.35  ? 237 ASN A N     1 
ATOM   1203 C CA    . ASN C 3 64  ? 22.551  -30.739 -15.205 1.00 75.10  ? 237 ASN A CA    1 
ATOM   1204 C C     . ASN C 3 64  ? 22.586  -29.338 -14.594 1.00 69.74  ? 237 ASN A C     1 
ATOM   1205 O O     . ASN C 3 64  ? 23.125  -28.410 -15.190 1.00 71.26  ? 237 ASN A O     1 
ATOM   1206 C CB    . ASN C 3 64  ? 22.467  -30.651 -16.733 1.00 77.67  ? 237 ASN A CB    1 
ATOM   1207 C CG    . ASN C 3 64  ? 21.121  -30.146 -17.217 1.00 85.20  ? 237 ASN A CG    1 
ATOM   1208 O OD1   . ASN C 3 64  ? 20.211  -30.931 -17.482 1.00 100.86 ? 237 ASN A OD1   1 
ATOM   1209 N ND2   . ASN C 3 64  ? 20.990  -28.830 -17.338 1.00 72.92  ? 237 ASN A ND2   1 
ATOM   1210 N N     . VAL C 3 65  ? 22.000  -29.188 -13.412 1.00 66.27  ? 238 VAL A N     1 
ATOM   1211 C CA    . VAL C 3 65  ? 22.104  -27.941 -12.661 1.00 64.05  ? 238 VAL A CA    1 
ATOM   1212 C C     . VAL C 3 65  ? 22.859  -28.238 -11.373 1.00 65.35  ? 238 VAL A C     1 
ATOM   1213 O O     . VAL C 3 65  ? 22.293  -28.772 -10.411 1.00 55.39  ? 238 VAL A O     1 
ATOM   1214 C CB    . VAL C 3 65  ? 20.724  -27.331 -12.339 1.00 66.51  ? 238 VAL A CB    1 
ATOM   1215 C CG1   . VAL C 3 65  ? 20.889  -25.991 -11.635 1.00 63.19  ? 238 VAL A CG1   1 
ATOM   1216 C CG2   . VAL C 3 65  ? 19.898  -27.166 -13.611 1.00 64.92  ? 238 VAL A CG2   1 
ATOM   1217 N N     . LYS C 3 66  ? 24.145  -27.897 -11.366 1.00 69.47  ? 239 LYS A N     1 
ATOM   1218 C CA    . LYS C 3 66  ? 25.034  -28.323 -10.291 1.00 68.83  ? 239 LYS A CA    1 
ATOM   1219 C C     . LYS C 3 66  ? 25.459  -27.198 -9.356  1.00 63.18  ? 239 LYS A C     1 
ATOM   1220 O O     . LYS C 3 66  ? 25.331  -26.014 -9.680  1.00 59.41  ? 239 LYS A O     1 
ATOM   1221 C CB    . LYS C 3 66  ? 26.267  -29.022 -10.871 1.00 67.67  ? 239 LYS A CB    1 
ATOM   1222 C CG    . LYS C 3 66  ? 26.137  -30.536 -10.944 1.00 74.84  ? 239 LYS A CG    1 
ATOM   1223 C CD    . LYS C 3 66  ? 25.751  -30.996 -12.342 1.00 82.35  ? 239 LYS A CD    1 
ATOM   1224 C CE    . LYS C 3 66  ? 26.127  -32.454 -12.559 1.00 83.39  ? 239 LYS A CE    1 
ATOM   1225 N NZ    . LYS C 3 66  ? 24.935  -33.316 -12.795 1.00 101.16 ? 239 LYS A NZ    1 
ATOM   1226 N N     . PHE C 3 67  ? 25.963  -27.587 -8.189  1.00 56.56  ? 240 PHE A N     1 
ATOM   1227 C CA    . PHE C 3 67  ? 26.440  -26.640 -7.193  1.00 52.78  ? 240 PHE A CA    1 
ATOM   1228 C C     . PHE C 3 67  ? 27.820  -27.054 -6.694  1.00 58.86  ? 240 PHE A C     1 
ATOM   1229 O O     . PHE C 3 67  ? 27.960  -28.082 -6.028  1.00 67.07  ? 240 PHE A O     1 
ATOM   1230 C CB    . PHE C 3 67  ? 25.469  -26.583 -6.018  1.00 41.07  ? 240 PHE A CB    1 
ATOM   1231 C CG    . PHE C 3 67  ? 26.082  -26.059 -4.757  1.00 41.25  ? 240 PHE A CG    1 
ATOM   1232 C CD1   . PHE C 3 67  ? 26.423  -24.722 -4.645  1.00 35.98  ? 240 PHE A CD1   1 
ATOM   1233 C CD2   . PHE C 3 67  ? 26.323  -26.903 -3.685  1.00 45.29  ? 240 PHE A CD2   1 
ATOM   1234 C CE1   . PHE C 3 67  ? 26.986  -24.236 -3.484  1.00 52.95  ? 240 PHE A CE1   1 
ATOM   1235 C CE2   . PHE C 3 67  ? 26.888  -26.423 -2.520  1.00 29.22  ? 240 PHE A CE2   1 
ATOM   1236 C CZ    . PHE C 3 67  ? 27.218  -25.088 -2.418  1.00 48.32  ? 240 PHE A CZ    1 
ATOM   1237 N N     . TYR C 3 68  ? 28.836  -26.255 -7.010  1.00 55.27  ? 241 TYR A N     1 
ATOM   1238 C CA    . TYR C 3 68  ? 30.200  -26.580 -6.603  1.00 50.26  ? 241 TYR A CA    1 
ATOM   1239 C C     . TYR C 3 68  ? 30.668  -25.769 -5.398  1.00 52.44  ? 241 TYR A C     1 
ATOM   1240 O O     . TYR C 3 68  ? 30.532  -24.545 -5.370  1.00 63.22  ? 241 TYR A O     1 
ATOM   1241 C CB    . TYR C 3 68  ? 31.179  -26.381 -7.760  1.00 52.84  ? 241 TYR A CB    1 
ATOM   1242 C CG    . TYR C 3 68  ? 30.553  -26.383 -9.137  1.00 53.71  ? 241 TYR A CG    1 
ATOM   1243 C CD1   . TYR C 3 68  ? 30.072  -25.208 -9.704  1.00 67.08  ? 241 TYR A CD1   1 
ATOM   1244 C CD2   . TYR C 3 68  ? 30.468  -27.554 -9.880  1.00 38.78  ? 241 TYR A CD2   1 
ATOM   1245 C CE1   . TYR C 3 68  ? 29.509  -25.202 -10.968 1.00 77.25  ? 241 TYR A CE1   1 
ATOM   1246 C CE2   . TYR C 3 68  ? 29.907  -27.559 -11.143 1.00 72.15  ? 241 TYR A CE2   1 
ATOM   1247 C CZ    . TYR C 3 68  ? 29.430  -26.379 -11.682 1.00 80.16  ? 241 TYR A CZ    1 
ATOM   1248 O OH    . TYR C 3 68  ? 28.870  -26.376 -12.940 1.00 83.67  ? 241 TYR A OH    1 
ATOM   1249 N N     . TYR C 3 69  ? 31.225  -26.458 -4.406  1.00 45.43  ? 242 TYR A N     1 
ATOM   1250 C CA    . TYR C 3 69  ? 31.803  -25.802 -3.240  1.00 47.02  ? 242 TYR A CA    1 
ATOM   1251 C C     . TYR C 3 69  ? 33.327  -25.931 -3.268  1.00 56.91  ? 242 TYR A C     1 
ATOM   1252 O O     . TYR C 3 69  ? 33.878  -26.991 -2.949  1.00 58.64  ? 242 TYR A O     1 
ATOM   1253 C CB    . TYR C 3 69  ? 31.234  -26.405 -1.954  1.00 44.18  ? 242 TYR A CB    1 
ATOM   1254 C CG    . TYR C 3 69  ? 31.962  -25.996 -0.690  1.00 57.83  ? 242 TYR A CG    1 
ATOM   1255 C CD1   . TYR C 3 69  ? 31.993  -24.668 -0.275  1.00 67.73  ? 242 TYR A CD1   1 
ATOM   1256 C CD2   . TYR C 3 69  ? 32.615  -26.941 0.093   1.00 56.56  ? 242 TYR A CD2   1 
ATOM   1257 C CE1   . TYR C 3 69  ? 32.656  -24.294 0.886   1.00 61.55  ? 242 TYR A CE1   1 
ATOM   1258 C CE2   . TYR C 3 69  ? 33.280  -26.575 1.255   1.00 67.99  ? 242 TYR A CE2   1 
ATOM   1259 C CZ    . TYR C 3 69  ? 33.297  -25.251 1.646   1.00 56.83  ? 242 TYR A CZ    1 
ATOM   1260 O OH    . TYR C 3 69  ? 33.958  -24.886 2.797   1.00 45.25  ? 242 TYR A OH    1 
ATOM   1261 N N     . ASP C 3 70  ? 33.998  -24.847 -3.654  1.00 60.88  ? 243 ASP A N     1 
ATOM   1262 C CA    . ASP C 3 70  ? 35.450  -24.845 -3.823  1.00 67.73  ? 243 ASP A CA    1 
ATOM   1263 C C     . ASP C 3 70  ? 35.825  -25.402 -5.195  1.00 70.42  ? 243 ASP A C     1 
ATOM   1264 O O     . ASP C 3 70  ? 36.936  -25.896 -5.397  1.00 82.04  ? 243 ASP A O     1 
ATOM   1265 C CB    . ASP C 3 70  ? 36.137  -25.651 -2.711  1.00 66.01  ? 243 ASP A CB    1 
ATOM   1266 C CG    . ASP C 3 70  ? 37.608  -25.291 -2.545  1.00 63.01  ? 243 ASP A CG    1 
ATOM   1267 O OD1   . ASP C 3 70  ? 38.305  -25.994 -1.784  1.00 69.04  ? 243 ASP A OD1   1 
ATOM   1268 O OD2   . ASP C 3 70  ? 38.153  -24.330 -3.129  1.00 53.83  ? 243 ASP A OD2   1 
ATOM   1269 N N     . GLY C 3 71  ? 34.895  -25.312 -6.140  1.00 62.17  ? 244 GLY A N     1 
ATOM   1270 C CA    . GLY C 3 71  ? 35.102  -25.875 -7.460  1.00 58.51  ? 244 GLY A CA    1 
ATOM   1271 C C     . GLY C 3 71  ? 34.695  -27.335 -7.476  1.00 67.37  ? 244 GLY A C     1 
ATOM   1272 O O     . GLY C 3 71  ? 34.466  -27.918 -8.539  1.00 76.34  ? 244 GLY A O     1 
ATOM   1273 N N     . LYS C 3 72  ? 34.598  -27.923 -6.287  1.00 64.54  ? 245 LYS A N     1 
ATOM   1274 C CA    . LYS C 3 72  ? 34.194  -29.318 -6.139  1.00 60.44  ? 245 LYS A CA    1 
ATOM   1275 C C     . LYS C 3 72  ? 32.688  -29.465 -6.294  1.00 50.11  ? 245 LYS A C     1 
ATOM   1276 O O     . LYS C 3 72  ? 31.922  -28.862 -5.548  1.00 46.92  ? 245 LYS A O     1 
ATOM   1277 C CB    . LYS C 3 72  ? 34.625  -29.854 -4.772  1.00 66.84  ? 245 LYS A CB    1 
ATOM   1278 C CG    . LYS C 3 72  ? 35.117  -31.294 -4.792  1.00 75.54  ? 245 LYS A CG    1 
ATOM   1279 C CD    . LYS C 3 72  ? 36.090  -31.560 -3.652  1.00 61.61  ? 245 LYS A CD    1 
ATOM   1280 C CE    . LYS C 3 72  ? 37.459  -30.972 -3.941  1.00 36.16  ? 245 LYS A CE    1 
ATOM   1281 N NZ    . LYS C 3 72  ? 38.539  -31.882 -3.472  1.00 67.81  ? 245 LYS A NZ    1 
ATOM   1282 N N     . VAL C 3 73  ? 32.273  -30.274 -7.264  1.00 50.54  ? 246 VAL A N     1 
ATOM   1283 C CA    . VAL C 3 73  ? 30.855  -30.511 -7.520  1.00 50.55  ? 246 VAL A CA    1 
ATOM   1284 C C     . VAL C 3 73  ? 30.178  -31.164 -6.323  1.00 47.60  ? 246 VAL A C     1 
ATOM   1285 O O     . VAL C 3 73  ? 30.732  -32.073 -5.705  1.00 53.52  ? 246 VAL A O     1 
ATOM   1286 C CB    . VAL C 3 73  ? 30.651  -31.413 -8.747  1.00 53.39  ? 246 VAL A CB    1 
ATOM   1287 C CG1   . VAL C 3 73  ? 29.319  -31.109 -9.412  1.00 59.12  ? 246 VAL A CG1   1 
ATOM   1288 C CG2   . VAL C 3 73  ? 31.808  -31.253 -9.731  1.00 73.73  ? 246 VAL A CG2   1 
ATOM   1289 N N     . MET C 3 74  ? 28.977  -30.697 -5.996  1.00 46.71  ? 247 MET A N     1 
ATOM   1290 C CA    . MET C 3 74  ? 28.247  -31.230 -4.851  1.00 51.28  ? 247 MET A CA    1 
ATOM   1291 C C     . MET C 3 74  ? 26.742  -31.341 -5.105  1.00 61.58  ? 247 MET A C     1 
ATOM   1292 O O     . MET C 3 74  ? 26.145  -30.513 -5.808  1.00 63.52  ? 247 MET A O     1 
ATOM   1293 C CB    . MET C 3 74  ? 28.512  -30.387 -3.604  1.00 31.23  ? 247 MET A CB    1 
ATOM   1294 C CG    . MET C 3 74  ? 29.169  -31.154 -2.474  1.00 39.41  ? 247 MET A CG    1 
ATOM   1295 S SD    . MET C 3 74  ? 29.029  -30.298 -0.885  1.00 57.54  ? 247 MET A SD    1 
ATOM   1296 C CE    . MET C 3 74  ? 28.538  -31.651 0.201   1.00 64.57  ? 247 MET A CE    1 
ATOM   1297 N N     . LYS C 3 75  ? 26.143  -32.385 -4.537  1.00 61.53  ? 248 LYS A N     1 
ATOM   1298 C CA    . LYS C 3 75  ? 24.704  -32.585 -4.608  1.00 64.44  ? 248 LYS A CA    1 
ATOM   1299 C C     . LYS C 3 75  ? 24.154  -32.538 -3.194  1.00 61.64  ? 248 LYS A C     1 
ATOM   1300 O O     . LYS C 3 75  ? 24.302  -33.490 -2.428  1.00 62.98  ? 248 LYS A O     1 
ATOM   1301 C CB    . LYS C 3 75  ? 24.370  -33.928 -5.261  1.00 70.05  ? 248 LYS A CB    1 
ATOM   1302 C CG    . LYS C 3 75  ? 25.357  -34.367 -6.338  1.00 98.91  ? 248 LYS A CG    1 
ATOM   1303 C CD    . LYS C 3 75  ? 26.204  -35.549 -5.877  1.00 108.30 ? 248 LYS A CD    1 
ATOM   1304 C CE    . LYS C 3 75  ? 27.682  -35.319 -6.159  1.00 105.73 ? 248 LYS A CE    1 
ATOM   1305 N NZ    . LYS C 3 75  ? 28.403  -34.832 -4.949  1.00 104.33 ? 248 LYS A NZ    1 
ATOM   1306 N N     . LEU C 3 76  ? 23.531  -31.419 -2.848  1.00 53.71  ? 249 LEU A N     1 
ATOM   1307 C CA    . LEU C 3 76  ? 23.046  -31.213 -1.493  1.00 44.67  ? 249 LEU A CA    1 
ATOM   1308 C C     . LEU C 3 76  ? 21.748  -31.962 -1.230  1.00 49.49  ? 249 LEU A C     1 
ATOM   1309 O O     . LEU C 3 76  ? 20.985  -32.248 -2.154  1.00 51.56  ? 249 LEU A O     1 
ATOM   1310 C CB    . LEU C 3 76  ? 22.842  -29.724 -1.229  1.00 46.48  ? 249 LEU A CB    1 
ATOM   1311 C CG    . LEU C 3 76  ? 23.928  -28.794 -1.767  1.00 41.81  ? 249 LEU A CG    1 
ATOM   1312 C CD1   . LEU C 3 76  ? 23.359  -27.880 -2.837  1.00 50.73  ? 249 LEU A CD1   1 
ATOM   1313 C CD2   . LEU C 3 76  ? 24.537  -27.986 -0.635  1.00 31.68  ? 249 LEU A CD2   1 
ATOM   1314 N N     . SER C 3 77  ? 21.508  -32.283 0.039   1.00 52.57  ? 250 SER A N     1 
ATOM   1315 C CA    . SER C 3 77  ? 20.242  -32.867 0.456   1.00 54.77  ? 250 SER A CA    1 
ATOM   1316 C C     . SER C 3 77  ? 19.100  -31.894 0.148   1.00 60.19  ? 250 SER A C     1 
ATOM   1317 O O     . SER C 3 77  ? 19.309  -30.681 0.085   1.00 61.33  ? 250 SER A O     1 
ATOM   1318 C CB    . SER C 3 77  ? 20.281  -33.192 1.949   1.00 53.55  ? 250 SER A CB    1 
ATOM   1319 O OG    . SER C 3 77  ? 20.773  -32.091 2.691   1.00 53.63  ? 250 SER A OG    1 
ATOM   1320 N N     . PRO C 3 78  ? 17.895  -32.424 -0.040  1.00 60.41  ? 251 PRO A N     1 
ATOM   1321 C CA    . PRO C 3 78  ? 16.748  -31.615 -0.471  1.00 55.04  ? 251 PRO A CA    1 
ATOM   1322 C C     . PRO C 3 78  ? 16.480  -30.409 0.430   1.00 49.96  ? 251 PRO A C     1 
ATOM   1323 O O     . PRO C 3 78  ? 16.113  -29.348 -0.079  1.00 45.46  ? 251 PRO A O     1 
ATOM   1324 C CB    . PRO C 3 78  ? 15.579  -32.605 -0.405  1.00 51.29  ? 251 PRO A CB    1 
ATOM   1325 C CG    . PRO C 3 78  ? 16.079  -33.720 0.465   1.00 61.97  ? 251 PRO A CG    1 
ATOM   1326 C CD    . PRO C 3 78  ? 17.534  -33.840 0.154   1.00 59.66  ? 251 PRO A CD    1 
ATOM   1327 N N     . LYS C 3 79  ? 16.661  -30.569 1.739   1.00 44.52  ? 252 LYS A N     1 
ATOM   1328 C CA    . LYS C 3 79  ? 16.439  -29.472 2.675   1.00 51.01  ? 252 LYS A CA    1 
ATOM   1329 C C     . LYS C 3 79  ? 17.528  -28.407 2.553   1.00 53.24  ? 252 LYS A C     1 
ATOM   1330 O O     . LYS C 3 79  ? 17.267  -27.212 2.712   1.00 56.79  ? 252 LYS A O     1 
ATOM   1331 C CB    . LYS C 3 79  ? 16.365  -29.994 4.110   1.00 53.30  ? 252 LYS A CB    1 
ATOM   1332 C CG    . LYS C 3 79  ? 15.358  -29.256 4.979   1.00 76.13  ? 252 LYS A CG    1 
ATOM   1333 C CD    . LYS C 3 79  ? 15.178  -29.935 6.332   1.00 104.75 ? 252 LYS A CD    1 
ATOM   1334 C CE    . LYS C 3 79  ? 13.753  -29.770 6.853   1.00 116.47 ? 252 LYS A CE    1 
ATOM   1335 N NZ    . LYS C 3 79  ? 13.548  -28.469 7.559   1.00 97.04  ? 252 LYS A NZ    1 
ATOM   1336 N N     . ALA C 3 80  ? 18.747  -28.846 2.267   1.00 51.57  ? 253 ALA A N     1 
ATOM   1337 C CA    . ALA C 3 80  ? 19.864  -27.930 2.082   1.00 51.66  ? 253 ALA A CA    1 
ATOM   1338 C C     . ALA C 3 80  ? 19.847  -27.326 0.683   1.00 50.23  ? 253 ALA A C     1 
ATOM   1339 O O     . ALA C 3 80  ? 20.175  -26.154 0.501   1.00 49.04  ? 253 ALA A O     1 
ATOM   1340 C CB    . ALA C 3 80  ? 21.180  -28.644 2.337   1.00 56.34  ? 253 ALA A CB    1 
ATOM   1341 N N     . GLU C 3 81  ? 19.467  -28.137 -0.302  1.00 49.80  ? 254 GLU A N     1 
ATOM   1342 C CA    . GLU C 3 81  ? 19.384  -27.687 -1.688  1.00 52.07  ? 254 GLU A CA    1 
ATOM   1343 C C     . GLU C 3 81  ? 18.287  -26.644 -1.845  1.00 54.96  ? 254 GLU A C     1 
ATOM   1344 O O     . GLU C 3 81  ? 18.393  -25.731 -2.667  1.00 49.41  ? 254 GLU A O     1 
ATOM   1345 C CB    . GLU C 3 81  ? 19.116  -28.867 -2.624  1.00 54.05  ? 254 GLU A CB    1 
ATOM   1346 C CG    . GLU C 3 81  ? 19.224  -28.525 -4.106  1.00 29.12  ? 254 GLU A CG    1 
ATOM   1347 C CD    . GLU C 3 81  ? 18.561  -29.570 -4.990  1.00 65.53  ? 254 GLU A CD    1 
ATOM   1348 O OE1   . GLU C 3 81  ? 18.894  -30.769 -4.852  1.00 86.61  ? 254 GLU A OE1   1 
ATOM   1349 O OE2   . GLU C 3 81  ? 17.705  -29.195 -5.828  1.00 62.75  ? 254 GLU A OE2   1 
ATOM   1350 N N     . GLU C 3 82  ? 17.229  -26.793 -1.055  1.00 54.13  ? 255 GLU A N     1 
ATOM   1351 C CA    . GLU C 3 82  ? 16.130  -25.841 -1.073  1.00 56.46  ? 255 GLU A CA    1 
ATOM   1352 C C     . GLU C 3 82  ? 16.661  -24.458 -0.738  1.00 46.71  ? 255 GLU A C     1 
ATOM   1353 O O     . GLU C 3 82  ? 16.583  -23.531 -1.549  1.00 47.82  ? 255 GLU A O     1 
ATOM   1354 C CB    . GLU C 3 82  ? 15.052  -26.248 -0.067  1.00 64.14  ? 255 GLU A CB    1 
ATOM   1355 C CG    . GLU C 3 82  ? 13.685  -25.635 -0.334  1.00 75.70  ? 255 GLU A CG    1 
ATOM   1356 C CD    . GLU C 3 82  ? 12.566  -26.395 0.351   1.00 86.90  ? 255 GLU A CD    1 
ATOM   1357 O OE1   . GLU C 3 82  ? 12.704  -27.626 0.524   1.00 89.15  ? 255 GLU A OE1   1 
ATOM   1358 O OE2   . GLU C 3 82  ? 11.549  -25.765 0.714   1.00 84.34  ? 255 GLU A OE2   1 
ATOM   1359 N N     . VAL C 3 83  ? 17.217  -24.331 0.461   1.00 39.35  ? 256 VAL A N     1 
ATOM   1360 C CA    . VAL C 3 83  ? 17.764  -23.062 0.913   1.00 38.46  ? 256 VAL A CA    1 
ATOM   1361 C C     . VAL C 3 83  ? 18.734  -22.490 -0.115  1.00 39.58  ? 256 VAL A C     1 
ATOM   1362 O O     . VAL C 3 83  ? 18.672  -21.308 -0.449  1.00 35.31  ? 256 VAL A O     1 
ATOM   1363 C CB    . VAL C 3 83  ? 18.483  -23.225 2.259   1.00 39.28  ? 256 VAL A CB    1 
ATOM   1364 C CG1   . VAL C 3 83  ? 19.039  -21.890 2.733   1.00 26.16  ? 256 VAL A CG1   1 
ATOM   1365 C CG2   . VAL C 3 83  ? 17.535  -23.825 3.293   1.00 19.13  ? 256 VAL A CG2   1 
ATOM   1366 N N     . ALA C 3 84  ? 19.623  -23.339 -0.623  1.00 45.67  ? 257 ALA A N     1 
ATOM   1367 C CA    . ALA C 3 84  ? 20.601  -22.914 -1.616  1.00 46.76  ? 257 ALA A CA    1 
ATOM   1368 C C     . ALA C 3 84  ? 19.938  -22.140 -2.750  1.00 47.33  ? 257 ALA A C     1 
ATOM   1369 O O     . ALA C 3 84  ? 20.462  -21.123 -3.209  1.00 48.50  ? 257 ALA A O     1 
ATOM   1370 C CB    . ALA C 3 84  ? 21.355  -24.112 -2.162  1.00 47.83  ? 257 ALA A CB    1 
ATOM   1371 N N     . THR C 3 85  ? 18.781  -22.623 -3.194  1.00 47.77  ? 258 THR A N     1 
ATOM   1372 C CA    . THR C 3 85  ? 18.066  -21.983 -4.292  1.00 48.28  ? 258 THR A CA    1 
ATOM   1373 C C     . THR C 3 85  ? 17.627  -20.574 -3.914  1.00 49.94  ? 258 THR A C     1 
ATOM   1374 O O     . THR C 3 85  ? 17.638  -19.667 -4.747  1.00 51.83  ? 258 THR A O     1 
ATOM   1375 C CB    . THR C 3 85  ? 16.848  -22.824 -4.721  1.00 48.89  ? 258 THR A CB    1 
ATOM   1376 O OG1   . THR C 3 85  ? 16.229  -23.398 -3.558  1.00 26.51  ? 258 THR A OG1   1 
ATOM   1377 C CG2   . THR C 3 85  ? 17.300  -24.046 -5.526  1.00 48.31  ? 258 THR A CG2   1 
ATOM   1378 N N     . PHE C 3 86  ? 17.248  -20.397 -2.651  1.00 50.17  ? 259 PHE A N     1 
ATOM   1379 C CA    . PHE C 3 86  ? 16.802  -19.098 -2.157  1.00 48.41  ? 259 PHE A CA    1 
ATOM   1380 C C     . PHE C 3 86  ? 17.875  -18.049 -2.392  1.00 46.02  ? 259 PHE A C     1 
ATOM   1381 O O     . PHE C 3 86  ? 17.584  -16.944 -2.847  1.00 55.02  ? 259 PHE A O     1 
ATOM   1382 C CB    . PHE C 3 86  ? 16.466  -19.169 -0.665  1.00 48.30  ? 259 PHE A CB    1 
ATOM   1383 C CG    . PHE C 3 86  ? 15.295  -20.060 -0.340  1.00 48.13  ? 259 PHE A CG    1 
ATOM   1384 C CD1   . PHE C 3 86  ? 14.431  -20.492 -1.333  1.00 50.20  ? 259 PHE A CD1   1 
ATOM   1385 C CD2   . PHE C 3 86  ? 15.057  -20.458 0.968   1.00 38.04  ? 259 PHE A CD2   1 
ATOM   1386 C CE1   . PHE C 3 86  ? 13.358  -21.306 -1.030  1.00 22.81  ? 259 PHE A CE1   1 
ATOM   1387 C CE2   . PHE C 3 86  ? 13.987  -21.267 1.278   1.00 30.98  ? 259 PHE A CE2   1 
ATOM   1388 C CZ    . PHE C 3 86  ? 13.136  -21.694 0.277   1.00 44.77  ? 259 PHE A CZ    1 
ATOM   1389 N N     . PHE C 3 87  ? 19.117  -18.408 -2.083  1.00 40.79  ? 260 PHE A N     1 
ATOM   1390 C CA    . PHE C 3 87  ? 20.257  -17.529 -2.303  1.00 37.12  ? 260 PHE A CA    1 
ATOM   1391 C C     . PHE C 3 87  ? 20.586  -17.447 -3.787  1.00 40.07  ? 260 PHE A C     1 
ATOM   1392 O O     . PHE C 3 87  ? 20.960  -16.389 -4.293  1.00 42.16  ? 260 PHE A O     1 
ATOM   1393 C CB    . PHE C 3 87  ? 21.472  -18.042 -1.534  1.00 40.01  ? 260 PHE A CB    1 
ATOM   1394 C CG    . PHE C 3 87  ? 22.521  -16.997 -1.291  1.00 50.84  ? 260 PHE A CG    1 
ATOM   1395 C CD1   . PHE C 3 87  ? 22.569  -16.315 -0.082  1.00 52.55  ? 260 PHE A CD1   1 
ATOM   1396 C CD2   . PHE C 3 87  ? 23.463  -16.698 -2.268  1.00 48.27  ? 260 PHE A CD2   1 
ATOM   1397 C CE1   . PHE C 3 87  ? 23.531  -15.354 0.149   1.00 48.20  ? 260 PHE A CE1   1 
ATOM   1398 C CE2   . PHE C 3 87  ? 24.425  -15.735 -2.047  1.00 45.68  ? 260 PHE A CE2   1 
ATOM   1399 C CZ    . PHE C 3 87  ? 24.459  -15.061 -0.834  1.00 51.94  ? 260 PHE A CZ    1 
ATOM   1400 N N     . ALA C 3 88  ? 20.442  -18.572 -4.478  1.00 37.66  ? 261 ALA A N     1 
ATOM   1401 C CA    . ALA C 3 88  ? 20.718  -18.641 -5.907  1.00 40.07  ? 261 ALA A CA    1 
ATOM   1402 C C     . ALA C 3 88  ? 19.875  -17.638 -6.689  1.00 48.79  ? 261 ALA A C     1 
ATOM   1403 O O     . ALA C 3 88  ? 20.324  -17.086 -7.696  1.00 55.42  ? 261 ALA A O     1 
ATOM   1404 C CB    . ALA C 3 88  ? 20.466  -20.050 -6.419  1.00 43.09  ? 261 ALA A CB    1 
ATOM   1405 N N     . LYS C 3 89  ? 18.651  -17.411 -6.222  1.00 49.52  ? 262 LYS A N     1 
ATOM   1406 C CA    . LYS C 3 89  ? 17.732  -16.502 -6.892  1.00 43.11  ? 262 LYS A CA    1 
ATOM   1407 C C     . LYS C 3 89  ? 18.094  -15.048 -6.623  1.00 47.52  ? 262 LYS A C     1 
ATOM   1408 O O     . LYS C 3 89  ? 17.937  -14.190 -7.491  1.00 60.91  ? 262 LYS A O     1 
ATOM   1409 C CB    . LYS C 3 89  ? 16.291  -16.792 -6.471  1.00 42.36  ? 262 LYS A CB    1 
ATOM   1410 C CG    . LYS C 3 89  ? 15.605  -17.829 -7.357  1.00 42.13  ? 262 LYS A CG    1 
ATOM   1411 C CD    . LYS C 3 89  ? 14.401  -18.457 -6.670  1.00 61.34  ? 262 LYS A CD    1 
ATOM   1412 C CE    . LYS C 3 89  ? 14.229  -19.911 -7.092  1.00 64.13  ? 262 LYS A CE    1 
ATOM   1413 N NZ    . LYS C 3 89  ? 12.820  -20.379 -6.946  1.00 55.34  ? 262 LYS A NZ    1 
ATOM   1414 N N     . MET C 3 90  ? 18.599  -14.771 -5.428  1.00 47.28  ? 263 MET A N     1 
ATOM   1415 C CA    . MET C 3 90  ? 18.966  -13.406 -5.073  1.00 49.67  ? 263 MET A CA    1 
ATOM   1416 C C     . MET C 3 90  ? 20.439  -13.116 -5.347  1.00 60.34  ? 263 MET A C     1 
ATOM   1417 O O     . MET C 3 90  ? 20.997  -12.156 -4.812  1.00 71.06  ? 263 MET A O     1 
ATOM   1418 C CB    . MET C 3 90  ? 18.641  -13.126 -3.602  1.00 44.33  ? 263 MET A CB    1 
ATOM   1419 C CG    . MET C 3 90  ? 17.169  -13.267 -3.247  1.00 19.81  ? 263 MET A CG    1 
ATOM   1420 S SD    . MET C 3 90  ? 16.919  -13.425 -1.464  1.00 66.37  ? 263 MET A SD    1 
ATOM   1421 C CE    . MET C 3 90  ? 17.014  -11.713 -0.964  1.00 48.25  ? 263 MET A CE    1 
ATOM   1422 N N     . LEU C 3 91  ? 21.068  -13.934 -6.186  1.00 63.78  ? 264 LEU A N     1 
ATOM   1423 C CA    . LEU C 3 91  ? 22.490  -13.765 -6.476  1.00 65.66  ? 264 LEU A CA    1 
ATOM   1424 C C     . LEU C 3 91  ? 22.735  -12.637 -7.466  1.00 66.44  ? 264 LEU A C     1 
ATOM   1425 O O     . LEU C 3 91  ? 23.782  -12.580 -8.109  1.00 70.90  ? 264 LEU A O     1 
ATOM   1426 C CB    . LEU C 3 91  ? 23.099  -15.067 -7.003  1.00 67.52  ? 264 LEU A CB    1 
ATOM   1427 C CG    . LEU C 3 91  ? 24.364  -15.558 -6.294  1.00 64.64  ? 264 LEU A CG    1 
ATOM   1428 C CD1   . LEU C 3 91  ? 25.305  -16.234 -7.275  1.00 77.36  ? 264 LEU A CD1   1 
ATOM   1429 C CD2   . LEU C 3 91  ? 25.067  -14.416 -5.570  1.00 66.63  ? 264 LEU A CD2   1 
ATOM   1430 N N     . ASP C 3 92  ? 21.762  -11.744 -7.588  1.00 68.22  ? 265 ASP A N     1 
ATOM   1431 C CA    . ASP C 3 92  ? 21.883  -10.595 -8.473  1.00 75.67  ? 265 ASP A CA    1 
ATOM   1432 C C     . ASP C 3 92  ? 21.426  -9.339  -7.743  1.00 76.93  ? 265 ASP A C     1 
ATOM   1433 O O     . ASP C 3 92  ? 21.238  -8.283  -8.349  1.00 83.12  ? 265 ASP A O     1 
ATOM   1434 C CB    . ASP C 3 92  ? 21.045  -10.808 -9.737  1.00 79.49  ? 265 ASP A CB    1 
ATOM   1435 C CG    . ASP C 3 92  ? 21.891  -10.882 -10.992 1.00 71.19  ? 265 ASP A CG    1 
ATOM   1436 O OD1   . ASP C 3 92  ? 22.664  -9.934  -11.248 1.00 78.37  ? 265 ASP A OD1   1 
ATOM   1437 O OD2   . ASP C 3 92  ? 21.850  -11.847 -11.783 1.00 87.35  ? 265 ASP A OD2   1 
ATOM   1438 N N     . HIS C 3 93  ? 21.254  -9.463  -6.432  1.00 70.86  ? 266 HIS A N     1 
ATOM   1439 C CA    . HIS C 3 93  ? 20.688  -8.386  -5.632  1.00 65.81  ? 266 HIS A CA    1 
ATOM   1440 C C     . HIS C 3 93  ? 21.678  -7.832  -4.613  1.00 60.52  ? 266 HIS A C     1 
ATOM   1441 O O     . HIS C 3 93  ? 22.663  -8.487  -4.270  1.00 65.81  ? 266 HIS A O     1 
ATOM   1442 C CB    . HIS C 3 93  ? 19.422  -8.867  -4.923  1.00 65.38  ? 266 HIS A CB    1 
ATOM   1443 C CG    . HIS C 3 93  ? 18.487  -7.762  -4.554  1.00 61.68  ? 266 HIS A CG    1 
ATOM   1444 N ND1   . HIS C 3 93  ? 18.021  -7.578  -3.270  1.00 58.34  ? 266 HIS A ND1   1 
ATOM   1445 C CD2   . HIS C 3 93  ? 17.940  -6.772  -5.299  1.00 59.58  ? 266 HIS A CD2   1 
ATOM   1446 C CE1   . HIS C 3 93  ? 17.223  -6.527  -3.241  1.00 65.03  ? 266 HIS A CE1   1 
ATOM   1447 N NE2   . HIS C 3 93  ? 17.157  -6.019  -4.459  1.00 83.37  ? 266 HIS A NE2   1 
ATOM   1448 N N     . GLU C 3 94  ? 21.404  -6.622  -4.134  1.00 52.59  ? 267 GLU A N     1 
ATOM   1449 C CA    . GLU C 3 94  ? 22.267  -5.953  -3.169  1.00 56.78  ? 267 GLU A CA    1 
ATOM   1450 C C     . GLU C 3 94  ? 22.322  -6.721  -1.855  1.00 56.24  ? 267 GLU A C     1 
ATOM   1451 O O     . GLU C 3 94  ? 23.359  -6.765  -1.187  1.00 57.63  ? 267 GLU A O     1 
ATOM   1452 C CB    . GLU C 3 94  ? 21.791  -4.519  -2.920  1.00 59.48  ? 267 GLU A CB    1 
ATOM   1453 C CG    . GLU C 3 94  ? 21.918  -3.597  -4.124  1.00 87.68  ? 267 GLU A CG    1 
ATOM   1454 C CD    . GLU C 3 94  ? 20.758  -3.737  -5.098  1.00 110.49 ? 267 GLU A CD    1 
ATOM   1455 O OE1   . GLU C 3 94  ? 21.007  -3.774  -6.324  1.00 103.27 ? 267 GLU A OE1   1 
ATOM   1456 O OE2   . GLU C 3 94  ? 19.596  -3.812  -4.638  1.00 99.48  ? 267 GLU A OE2   1 
ATOM   1457 N N     . TYR C 3 95  ? 21.197  -7.327  -1.490  1.00 53.20  ? 268 TYR A N     1 
ATOM   1458 C CA    . TYR C 3 95  ? 21.103  -8.062  -0.238  1.00 57.86  ? 268 TYR A CA    1 
ATOM   1459 C C     . TYR C 3 95  ? 22.309  -8.977  -0.050  1.00 61.71  ? 268 TYR A C     1 
ATOM   1460 O O     . TYR C 3 95  ? 22.970  -8.941  0.991   1.00 64.73  ? 268 TYR A O     1 
ATOM   1461 C CB    . TYR C 3 95  ? 19.803  -8.872  -0.188  1.00 62.13  ? 268 TYR A CB    1 
ATOM   1462 C CG    . TYR C 3 95  ? 18.672  -8.170  0.530   1.00 56.74  ? 268 TYR A CG    1 
ATOM   1463 C CD1   . TYR C 3 95  ? 17.490  -7.862  -0.127  1.00 30.87  ? 268 TYR A CD1   1 
ATOM   1464 C CD2   . TYR C 3 95  ? 18.788  -7.812  1.867   1.00 72.07  ? 268 TYR A CD2   1 
ATOM   1465 C CE1   . TYR C 3 95  ? 16.455  -7.218  0.525   1.00 55.65  ? 268 TYR A CE1   1 
ATOM   1466 C CE2   . TYR C 3 95  ? 17.756  -7.167  2.528   1.00 76.18  ? 268 TYR A CE2   1 
ATOM   1467 C CZ    . TYR C 3 95  ? 16.593  -6.873  1.852   1.00 57.82  ? 268 TYR A CZ    1 
ATOM   1468 O OH    . TYR C 3 95  ? 15.566  -6.231  2.506   1.00 63.00  ? 268 TYR A OH    1 
ATOM   1469 N N     . THR C 3 96  ? 22.605  -9.774  -1.073  1.00 62.79  ? 269 THR A N     1 
ATOM   1470 C CA    . THR C 3 96  ? 23.665  -10.775 -0.995  1.00 62.61  ? 269 THR A CA    1 
ATOM   1471 C C     . THR C 3 96  ? 25.080  -10.196 -1.043  1.00 64.77  ? 269 THR A C     1 
ATOM   1472 O O     . THR C 3 96  ? 26.059  -10.945 -1.018  1.00 63.65  ? 269 THR A O     1 
ATOM   1473 C CB    . THR C 3 96  ? 23.484  -11.835 -2.099  1.00 60.04  ? 269 THR A CB    1 
ATOM   1474 O OG1   . THR C 3 96  ? 23.486  -11.198 -3.387  1.00 74.89  ? 269 THR A OG1   1 
ATOM   1475 C CG2   . THR C 3 96  ? 22.095  -12.444 -2.013  1.00 54.93  ? 269 THR A CG2   1 
ATOM   1476 N N     . THR C 3 97  ? 25.191  -8.872  -1.113  1.00 67.49  ? 270 THR A N     1 
ATOM   1477 C CA    . THR C 3 97  ? 26.503  -8.231  -1.060  1.00 69.84  ? 270 THR A CA    1 
ATOM   1478 C C     . THR C 3 97  ? 26.790  -7.698  0.341   1.00 68.65  ? 270 THR A C     1 
ATOM   1479 O O     . THR C 3 97  ? 27.874  -7.184  0.605   1.00 69.77  ? 270 THR A O     1 
ATOM   1480 C CB    . THR C 3 97  ? 26.622  -7.089  -2.104  1.00 67.76  ? 270 THR A CB    1 
ATOM   1481 O OG1   . THR C 3 97  ? 26.064  -5.879  -1.567  1.00 59.18  ? 270 THR A OG1   1 
ATOM   1482 C CG2   . THR C 3 97  ? 25.749  -7.371  -3.322  1.00 59.57  ? 270 THR A CG2   1 
ATOM   1483 N N     . LYS C 3 98  ? 25.814  -7.830  1.235   1.00 66.35  ? 271 LYS A N     1 
ATOM   1484 C CA    . LYS C 3 98  ? 25.931  -7.268  2.578   1.00 67.65  ? 271 LYS A CA    1 
ATOM   1485 C C     . LYS C 3 98  ? 26.237  -8.327  3.634   1.00 66.55  ? 271 LYS A C     1 
ATOM   1486 O O     . LYS C 3 98  ? 25.676  -9.424  3.612   1.00 68.28  ? 271 LYS A O     1 
ATOM   1487 C CB    . LYS C 3 98  ? 24.657  -6.500  2.945   1.00 65.66  ? 271 LYS A CB    1 
ATOM   1488 C CG    . LYS C 3 98  ? 24.765  -4.996  2.725   1.00 82.41  ? 271 LYS A CG    1 
ATOM   1489 C CD    . LYS C 3 98  ? 24.153  -4.582  1.394   1.00 91.20  ? 271 LYS A CD    1 
ATOM   1490 C CE    . LYS C 3 98  ? 23.088  -3.508  1.586   1.00 96.53  ? 271 LYS A CE    1 
ATOM   1491 N NZ    . LYS C 3 98  ? 21.915  -4.003  2.372   1.00 69.12  ? 271 LYS A NZ    1 
ATOM   1492 N N     . GLU C 3 99  ? 27.130  -7.984  4.561   1.00 63.89  ? 272 GLU A N     1 
ATOM   1493 C CA    . GLU C 3 99  ? 27.597  -8.925  5.573   1.00 62.96  ? 272 GLU A CA    1 
ATOM   1494 C C     . GLU C 3 99  ? 26.477  -9.447  6.474   1.00 59.90  ? 272 GLU A C     1 
ATOM   1495 O O     . GLU C 3 99  ? 26.290  -10.657 6.591   1.00 60.31  ? 272 GLU A O     1 
ATOM   1496 C CB    . GLU C 3 99  ? 28.708  -8.296  6.422   1.00 67.45  ? 272 GLU A CB    1 
ATOM   1497 C CG    . GLU C 3 99  ? 29.576  -7.294  5.675   1.00 81.72  ? 272 GLU A CG    1 
ATOM   1498 C CD    . GLU C 3 99  ? 30.839  -7.918  5.106   1.00 102.92 ? 272 GLU A CD    1 
ATOM   1499 O OE1   . GLU C 3 99  ? 31.331  -8.911  5.685   1.00 79.61  ? 272 GLU A OE1   1 
ATOM   1500 O OE2   . GLU C 3 99  ? 31.343  -7.411  4.078   1.00 119.55 ? 272 GLU A OE2   1 
ATOM   1501 N N     . ILE C 3 100 ? 25.740  -8.536  7.106   1.00 58.22  ? 273 ILE A N     1 
ATOM   1502 C CA    . ILE C 3 100 ? 24.656  -8.918  8.013   1.00 50.32  ? 273 ILE A CA    1 
ATOM   1503 C C     . ILE C 3 100 ? 23.792  -10.001 7.381   1.00 46.08  ? 273 ILE A C     1 
ATOM   1504 O O     . ILE C 3 100 ? 23.453  -10.998 8.022   1.00 43.27  ? 273 ILE A O     1 
ATOM   1505 C CB    . ILE C 3 100 ? 23.791  -7.693  8.398   1.00 47.59  ? 273 ILE A CB    1 
ATOM   1506 C CG1   . ILE C 3 100 ? 24.572  -6.735  9.304   1.00 30.18  ? 273 ILE A CG1   1 
ATOM   1507 C CG2   . ILE C 3 100 ? 22.522  -8.138  9.100   1.00 42.40  ? 273 ILE A CG2   1 
ATOM   1508 N N     . PHE C 3 101 ? 23.449  -9.794  6.113   1.00 41.41  ? 274 PHE A N     1 
ATOM   1509 C CA    . PHE C 3 101 ? 22.666  -10.753 5.346   1.00 42.87  ? 274 PHE A CA    1 
ATOM   1510 C C     . PHE C 3 101 ? 23.378  -12.097 5.257   1.00 41.91  ? 274 PHE A C     1 
ATOM   1511 O O     . PHE C 3 101 ? 22.864  -13.123 5.713   1.00 36.19  ? 274 PHE A O     1 
ATOM   1512 C CB    . PHE C 3 101 ? 22.426  -10.213 3.934   1.00 44.16  ? 274 PHE A CB    1 
ATOM   1513 C CG    . PHE C 3 101 ? 21.468  -11.033 3.126   1.00 37.05  ? 274 PHE A CG    1 
ATOM   1514 C CD1   . PHE C 3 101 ? 20.099  -10.836 3.244   1.00 66.04  ? 274 PHE A CD1   1 
ATOM   1515 C CD2   . PHE C 3 101 ? 21.930  -11.993 2.246   1.00 31.64  ? 274 PHE A CD2   1 
ATOM   1516 C CE1   . PHE C 3 101 ? 19.209  -11.586 2.501   1.00 62.97  ? 274 PHE A CE1   1 
ATOM   1517 C CE2   . PHE C 3 101 ? 21.047  -12.748 1.500   1.00 70.94  ? 274 PHE A CE2   1 
ATOM   1518 C CZ    . PHE C 3 101 ? 19.684  -12.545 1.627   1.00 72.28  ? 274 PHE A CZ    1 
ATOM   1519 N N     . ARG C 3 102 ? 24.569  -12.070 4.662   1.00 37.90  ? 275 ARG A N     1 
ATOM   1520 C CA    . ARG C 3 102 ? 25.362  -13.268 4.445   1.00 31.22  ? 275 ARG A CA    1 
ATOM   1521 C C     . ARG C 3 102 ? 25.728  -13.967 5.754   1.00 35.97  ? 275 ARG A C     1 
ATOM   1522 O O     . ARG C 3 102 ? 25.860  -15.192 5.792   1.00 41.16  ? 275 ARG A O     1 
ATOM   1523 C CB    . ARG C 3 102 ? 26.619  -12.921 3.650   1.00 26.42  ? 275 ARG A CB    1 
ATOM   1524 C CG    . ARG C 3 102 ? 26.340  -12.533 2.204   1.00 37.29  ? 275 ARG A CG    1 
ATOM   1525 C CD    . ARG C 3 102 ? 27.468  -11.758 1.530   1.00 25.34  ? 275 ARG A CD    1 
ATOM   1526 N NE    . ARG C 3 102 ? 28.700  -12.543 1.444   1.00 52.18  ? 275 ARG A NE    1 
ATOM   1527 C CZ    . ARG C 3 102 ? 29.001  -13.357 0.437   1.00 53.10  ? 275 ARG A CZ    1 
ATOM   1528 N NH1   . ARG C 3 102 ? 28.159  -13.502 -0.581  1.00 52.44  ? 275 ARG A NH1   1 
ATOM   1529 N NH2   . ARG C 3 102 ? 30.146  -14.029 0.445   1.00 45.98  ? 275 ARG A NH2   1 
ATOM   1530 N N     . LYS C 3 103 ? 25.888  -13.190 6.822   1.00 37.71  ? 276 LYS A N     1 
ATOM   1531 C CA    . LYS C 3 103 ? 26.203  -13.750 8.135   1.00 43.32  ? 276 LYS A CA    1 
ATOM   1532 C C     . LYS C 3 103 ? 25.032  -14.575 8.656   1.00 56.15  ? 276 LYS A C     1 
ATOM   1533 O O     . LYS C 3 103 ? 25.201  -15.727 9.071   1.00 67.30  ? 276 LYS A O     1 
ATOM   1534 C CB    . LYS C 3 103 ? 26.569  -12.643 9.132   1.00 38.04  ? 276 LYS A CB    1 
ATOM   1535 C CG    . LYS C 3 103 ? 26.370  -13.008 10.604  1.00 44.25  ? 276 LYS A CG    1 
ATOM   1536 C CD    . LYS C 3 103 ? 27.435  -13.988 11.099  1.00 91.23  ? 276 LYS A CD    1 
ATOM   1537 C CE    . LYS C 3 103 ? 26.891  -14.915 12.189  1.00 92.02  ? 276 LYS A CE    1 
ATOM   1538 N NZ    . LYS C 3 103 ? 27.279  -16.346 11.975  1.00 63.79  ? 276 LYS A NZ    1 
ATOM   1539 N N     . ASN C 3 104 ? 23.843  -13.980 8.620   1.00 56.84  ? 277 ASN A N     1 
ATOM   1540 C CA    . ASN C 3 104 ? 22.636  -14.638 9.101   1.00 46.92  ? 277 ASN A CA    1 
ATOM   1541 C C     . ASN C 3 104 ? 22.206  -15.800 8.211   1.00 41.79  ? 277 ASN A C     1 
ATOM   1542 O O     . ASN C 3 104 ? 21.763  -16.836 8.708   1.00 41.91  ? 277 ASN A O     1 
ATOM   1543 C CB    . ASN C 3 104 ? 21.500  -13.624 9.233   1.00 49.62  ? 277 ASN A CB    1 
ATOM   1544 C CG    . ASN C 3 104 ? 21.728  -12.643 10.363  1.00 60.28  ? 277 ASN A CG    1 
ATOM   1545 O OD1   . ASN C 3 104 ? 21.964  -13.041 11.502  1.00 72.42  ? 277 ASN A OD1   1 
ATOM   1546 N ND2   . ASN C 3 104 ? 21.659  -11.353 10.054  1.00 70.67  ? 277 ASN A ND2   1 
ATOM   1547 N N     . PHE C 3 105 ? 22.343  -15.624 6.899   1.00 31.66  ? 278 PHE A N     1 
ATOM   1548 C CA    . PHE C 3 105 ? 21.945  -16.659 5.954   1.00 34.87  ? 278 PHE A CA    1 
ATOM   1549 C C     . PHE C 3 105 ? 22.689  -17.968 6.186   1.00 42.99  ? 278 PHE A C     1 
ATOM   1550 O O     . PHE C 3 105 ? 22.068  -19.020 6.332   1.00 49.78  ? 278 PHE A O     1 
ATOM   1551 C CB    . PHE C 3 105 ? 22.171  -16.201 4.514   1.00 39.71  ? 278 PHE A CB    1 
ATOM   1552 C CG    . PHE C 3 105 ? 22.238  -17.330 3.522   1.00 44.94  ? 278 PHE A CG    1 
ATOM   1553 C CD1   . PHE C 3 105 ? 21.095  -18.028 3.166   1.00 58.64  ? 278 PHE A CD1   1 
ATOM   1554 C CD2   . PHE C 3 105 ? 23.444  -17.694 2.945   1.00 67.28  ? 278 PHE A CD2   1 
ATOM   1555 C CE1   . PHE C 3 105 ? 21.153  -19.064 2.253   1.00 71.88  ? 278 PHE A CE1   1 
ATOM   1556 C CE2   . PHE C 3 105 ? 23.507  -18.731 2.033   1.00 76.51  ? 278 PHE A CE2   1 
ATOM   1557 C CZ    . PHE C 3 105 ? 22.360  -19.416 1.687   1.00 75.14  ? 278 PHE A CZ    1 
ATOM   1558 N N     . PHE C 3 106 ? 24.016  -17.905 6.210   1.00 41.70  ? 279 PHE A N     1 
ATOM   1559 C CA    . PHE C 3 106 ? 24.821  -19.114 6.324   1.00 38.32  ? 279 PHE A CA    1 
ATOM   1560 C C     . PHE C 3 106 ? 24.496  -19.878 7.600   1.00 36.31  ? 279 PHE A C     1 
ATOM   1561 O O     . PHE C 3 106 ? 24.227  -21.081 7.563   1.00 31.32  ? 279 PHE A O     1 
ATOM   1562 C CB    . PHE C 3 106 ? 26.313  -18.785 6.273   1.00 42.49  ? 279 PHE A CB    1 
ATOM   1563 C CG    . PHE C 3 106 ? 27.189  -19.987 6.045   1.00 42.63  ? 279 PHE A CG    1 
ATOM   1564 C CD1   . PHE C 3 106 ? 27.328  -20.529 4.776   1.00 48.98  ? 279 PHE A CD1   1 
ATOM   1565 C CD2   . PHE C 3 106 ? 27.869  -20.579 7.101   1.00 43.65  ? 279 PHE A CD2   1 
ATOM   1566 C CE1   . PHE C 3 106 ? 28.132  -21.633 4.563   1.00 55.31  ? 279 PHE A CE1   1 
ATOM   1567 C CE2   . PHE C 3 106 ? 28.673  -21.684 6.893   1.00 60.06  ? 279 PHE A CE2   1 
ATOM   1568 C CZ    . PHE C 3 106 ? 28.804  -22.211 5.623   1.00 47.97  ? 279 PHE A CZ    1 
ATOM   1569 N N     . LYS C 3 107 ? 24.519  -19.174 8.727   1.00 39.49  ? 280 LYS A N     1 
ATOM   1570 C CA    . LYS C 3 107 ? 24.246  -19.796 10.015  1.00 38.36  ? 280 LYS A CA    1 
ATOM   1571 C C     . LYS C 3 107 ? 22.952  -20.606 9.956   1.00 43.97  ? 280 LYS A C     1 
ATOM   1572 O O     . LYS C 3 107 ? 22.912  -21.761 10.385  1.00 56.08  ? 280 LYS A O     1 
ATOM   1573 C CB    . LYS C 3 107 ? 24.176  -18.737 11.116  1.00 31.95  ? 280 LYS A CB    1 
ATOM   1574 C CG    . LYS C 3 107 ? 23.780  -19.276 12.481  1.00 42.06  ? 280 LYS A CG    1 
ATOM   1575 C CD    . LYS C 3 107 ? 23.022  -18.228 13.286  1.00 95.61  ? 280 LYS A CD    1 
ATOM   1576 C CE    . LYS C 3 107 ? 21.732  -17.806 12.583  1.00 108.02 ? 280 LYS A CE    1 
ATOM   1577 N NZ    . LYS C 3 107 ? 21.623  -16.324 12.431  1.00 103.33 ? 280 LYS A NZ    1 
ATOM   1578 N N     . ASP C 3 108 ? 21.902  -20.002 9.407   1.00 39.75  ? 281 ASP A N     1 
ATOM   1579 C CA    . ASP C 3 108 ? 20.609  -20.662 9.300   1.00 38.76  ? 281 ASP A CA    1 
ATOM   1580 C C     . ASP C 3 108 ? 20.660  -21.801 8.293   1.00 45.06  ? 281 ASP A C     1 
ATOM   1581 O O     . ASP C 3 108 ? 20.014  -22.830 8.478   1.00 60.38  ? 281 ASP A O     1 
ATOM   1582 C CB    . ASP C 3 108 ? 19.524  -19.658 8.907   1.00 34.83  ? 281 ASP A CB    1 
ATOM   1583 C CG    . ASP C 3 108 ? 18.884  -18.992 10.110  1.00 65.27  ? 281 ASP A CG    1 
ATOM   1584 O OD1   . ASP C 3 108 ? 18.079  -18.057 9.912   1.00 81.90  ? 281 ASP A OD1   1 
ATOM   1585 O OD2   . ASP C 3 108 ? 19.121  -19.335 11.290  1.00 76.27  ? 281 ASP A OD2   1 
ATOM   1586 N N     . TRP C 3 109 ? 21.431  -21.611 7.228   1.00 46.06  ? 282 TRP A N     1 
ATOM   1587 C CA    . TRP C 3 109 ? 21.610  -22.639 6.210   1.00 42.21  ? 282 TRP A CA    1 
ATOM   1588 C C     . TRP C 3 109 ? 22.415  -23.799 6.780   1.00 44.24  ? 282 TRP A C     1 
ATOM   1589 O O     . TRP C 3 109 ? 22.255  -24.945 6.362   1.00 52.04  ? 282 TRP A O     1 
ATOM   1590 C CB    . TRP C 3 109 ? 22.324  -22.052 4.995   1.00 42.68  ? 282 TRP A CB    1 
ATOM   1591 C CG    . TRP C 3 109 ? 22.477  -22.996 3.845   1.00 24.45  ? 282 TRP A CG    1 
ATOM   1592 C CD1   . TRP C 3 109 ? 21.623  -23.994 3.478   1.00 43.45  ? 282 TRP A CD1   1 
ATOM   1593 C CD2   . TRP C 3 109 ? 23.551  -23.022 2.898   1.00 52.23  ? 282 TRP A CD2   1 
ATOM   1594 N NE1   . TRP C 3 109 ? 22.099  -24.641 2.363   1.00 46.07  ? 282 TRP A NE1   1 
ATOM   1595 C CE2   . TRP C 3 109 ? 23.282  -24.063 1.986   1.00 47.65  ? 282 TRP A CE2   1 
ATOM   1596 C CE3   . TRP C 3 109 ? 24.719  -22.269 2.727   1.00 46.85  ? 282 TRP A CE3   1 
ATOM   1597 C CZ2   . TRP C 3 109 ? 24.132  -24.367 0.927   1.00 45.43  ? 282 TRP A CZ2   1 
ATOM   1598 C CZ3   . TRP C 3 109 ? 25.562  -22.573 1.676   1.00 34.55  ? 282 TRP A CZ3   1 
ATOM   1599 C CH2   . TRP C 3 109 ? 25.265  -23.612 0.789   1.00 48.70  ? 282 TRP A CH2   1 
ATOM   1600 N N     . ARG C 3 110 ? 23.276  -23.495 7.743   1.00 44.22  ? 283 ARG A N     1 
ATOM   1601 C CA    . ARG C 3 110 ? 24.080  -24.521 8.391   1.00 49.25  ? 283 ARG A CA    1 
ATOM   1602 C C     . ARG C 3 110 ? 23.194  -25.463 9.193   1.00 50.52  ? 283 ARG A C     1 
ATOM   1603 O O     . ARG C 3 110 ? 23.538  -26.626 9.392   1.00 62.09  ? 283 ARG A O     1 
ATOM   1604 C CB    . ARG C 3 110 ? 25.145  -23.890 9.294   1.00 54.15  ? 283 ARG A CB    1 
ATOM   1605 C CG    . ARG C 3 110 ? 26.532  -23.824 8.663   1.00 52.56  ? 283 ARG A CG    1 
ATOM   1606 C CD    . ARG C 3 110 ? 27.677  -23.954 9.653   1.00 46.49  ? 283 ARG A CD    1 
ATOM   1607 N NE    . ARG C 3 110 ? 28.518  -25.114 9.365   1.00 65.99  ? 283 ARG A NE    1 
ATOM   1608 C CZ    . ARG C 3 110 ? 28.911  -25.994 10.277  1.00 78.43  ? 283 ARG A CZ    1 
ATOM   1609 N NH1   . ARG C 3 110 ? 28.542  -25.851 11.544  1.00 69.44  ? 283 ARG A NH1   1 
ATOM   1610 N NH2   . ARG C 3 110 ? 29.676  -27.020 9.927   1.00 92.56  ? 283 ARG A NH2   1 
ATOM   1611 N N     . LYS C 3 111 ? 22.052  -24.957 9.646   1.00 43.18  ? 284 LYS A N     1 
ATOM   1612 C CA    . LYS C 3 111 ? 21.132  -25.746 10.457  1.00 44.53  ? 284 LYS A CA    1 
ATOM   1613 C C     . LYS C 3 111 ? 20.369  -26.746 9.604   1.00 45.29  ? 284 LYS A C     1 
ATOM   1614 O O     . LYS C 3 111 ? 20.025  -27.836 10.061  1.00 50.37  ? 284 LYS A O     1 
ATOM   1615 C CB    . LYS C 3 111 ? 20.157  -24.833 11.201  1.00 45.52  ? 284 LYS A CB    1 
ATOM   1616 C CG    . LYS C 3 111 ? 20.803  -24.041 12.330  1.00 59.97  ? 284 LYS A CG    1 
ATOM   1617 C CD    . LYS C 3 111 ? 20.029  -22.763 12.631  1.00 59.90  ? 284 LYS A CD    1 
ATOM   1618 C CE    . LYS C 3 111 ? 19.652  -22.689 14.105  1.00 66.17  ? 284 LYS A CE    1 
ATOM   1619 N NZ    . LYS C 3 111 ? 19.731  -21.300 14.640  1.00 49.89  ? 284 LYS A NZ    1 
ATOM   1620 N N     . GLU C 3 112 ? 20.114  -26.373 8.358   1.00 47.72  ? 285 GLU A N     1 
ATOM   1621 C CA    . GLU C 3 112 ? 19.378  -27.233 7.444   1.00 57.07  ? 285 GLU A CA    1 
ATOM   1622 C C     . GLU C 3 112 ? 20.338  -28.167 6.721   1.00 64.49  ? 285 GLU A C     1 
ATOM   1623 O O     . GLU C 3 112 ? 20.076  -28.598 5.595   1.00 69.16  ? 285 GLU A O     1 
ATOM   1624 C CB    . GLU C 3 112 ? 18.593  -26.390 6.437   1.00 58.93  ? 285 GLU A CB    1 
ATOM   1625 C CG    . GLU C 3 112 ? 17.642  -25.384 7.073   1.00 63.07  ? 285 GLU A CG    1 
ATOM   1626 C CD    . GLU C 3 112 ? 16.420  -26.039 7.692   1.00 66.80  ? 285 GLU A CD    1 
ATOM   1627 O OE1   . GLU C 3 112 ? 15.505  -26.435 6.934   1.00 47.46  ? 285 GLU A OE1   1 
ATOM   1628 O OE2   . GLU C 3 112 ? 16.373  -26.159 8.938   1.00 52.29  ? 285 GLU A OE2   1 
ATOM   1629 N N     . MET C 3 113 ? 21.449  -28.484 7.378   1.00 66.20  ? 286 MET A N     1 
ATOM   1630 C CA    . MET C 3 113 ? 22.487  -29.302 6.765   1.00 66.21  ? 286 MET A CA    1 
ATOM   1631 C C     . MET C 3 113 ? 22.770  -30.585 7.540   1.00 67.67  ? 286 MET A C     1 
ATOM   1632 O O     . MET C 3 113 ? 22.848  -30.583 8.771   1.00 59.55  ? 286 MET A O     1 
ATOM   1633 C CB    . MET C 3 113 ? 23.771  -28.493 6.613   1.00 64.60  ? 286 MET A CB    1 
ATOM   1634 C CG    . MET C 3 113 ? 23.879  -27.767 5.294   1.00 50.72  ? 286 MET A CG    1 
ATOM   1635 S SD    . MET C 3 113 ? 25.571  -27.260 4.971   1.00 53.76  ? 286 MET A SD    1 
ATOM   1636 C CE    . MET C 3 113 ? 25.491  -25.533 5.416   1.00 19.75  ? 286 MET A CE    1 
ATOM   1637 N N     . THR C 3 114 ? 22.923  -31.679 6.800   1.00 67.94  ? 287 THR A N     1 
ATOM   1638 C CA    . THR C 3 114 ? 23.246  -32.973 7.383   1.00 64.68  ? 287 THR A CA    1 
ATOM   1639 C C     . THR C 3 114 ? 24.705  -32.985 7.807   1.00 65.12  ? 287 THR A C     1 
ATOM   1640 O O     . THR C 3 114 ? 25.525  -32.276 7.228   1.00 67.72  ? 287 THR A O     1 
ATOM   1641 C CB    . THR C 3 114 ? 23.002  -34.074 6.353   1.00 63.55  ? 287 THR A CB    1 
ATOM   1642 O OG1   . THR C 3 114 ? 24.240  -34.432 5.728   1.00 71.79  ? 287 THR A OG1   1 
ATOM   1643 C CG2   . THR C 3 114 ? 22.186  -33.534 5.199   1.00 59.19  ? 287 THR A CG2   1 
ATOM   1644 N N     . ASN C 3 115 ? 25.026  -33.795 8.812   1.00 64.93  ? 288 ASN A N     1 
ATOM   1645 C CA    . ASN C 3 115 ? 26.396  -33.897 9.308   1.00 64.78  ? 288 ASN A CA    1 
ATOM   1646 C C     . ASN C 3 115 ? 27.421  -33.998 8.184   1.00 66.18  ? 288 ASN A C     1 
ATOM   1647 O O     . ASN C 3 115 ? 28.495  -33.392 8.257   1.00 63.64  ? 288 ASN A O     1 
ATOM   1648 C CB    . ASN C 3 115 ? 26.534  -35.086 10.255  1.00 62.88  ? 288 ASN A CB    1 
ATOM   1649 C CG    . ASN C 3 115 ? 25.571  -35.012 11.416  1.00 71.10  ? 288 ASN A CG    1 
ATOM   1650 O OD1   . ASN C 3 115 ? 24.667  -35.839 11.542  1.00 82.26  ? 288 ASN A OD1   1 
ATOM   1651 N ND2   . ASN C 3 115 ? 25.754  -34.012 12.272  1.00 76.49  ? 288 ASN A ND2   1 
ATOM   1652 N N     . GLU C 3 116 ? 27.082  -34.768 7.150   1.00 67.51  ? 289 GLU A N     1 
ATOM   1653 C CA    . GLU C 3 116 ? 27.918  -34.872 5.962   1.00 71.54  ? 289 GLU A CA    1 
ATOM   1654 C C     . GLU C 3 116 ? 28.306  -33.482 5.468   1.00 71.88  ? 289 GLU A C     1 
ATOM   1655 O O     . GLU C 3 116 ? 29.471  -33.081 5.555   1.00 76.60  ? 289 GLU A O     1 
ATOM   1656 C CB    . GLU C 3 116 ? 27.176  -35.629 4.856   1.00 74.51  ? 289 GLU A CB    1 
ATOM   1657 C CG    . GLU C 3 116 ? 28.070  -36.153 3.744   1.00 94.08  ? 289 GLU A CG    1 
ATOM   1658 C CD    . GLU C 3 116 ? 28.434  -37.612 3.938   1.00 124.53 ? 289 GLU A CD    1 
ATOM   1659 O OE1   . GLU C 3 116 ? 29.428  -37.893 4.643   1.00 134.48 ? 289 GLU A OE1   1 
ATOM   1660 O OE2   . GLU C 3 116 ? 27.724  -38.481 3.388   1.00 119.35 ? 289 GLU A OE2   1 
ATOM   1661 N N     . GLU C 3 117 ? 27.317  -32.749 4.961   1.00 67.84  ? 290 GLU A N     1 
ATOM   1662 C CA    . GLU C 3 117 ? 27.533  -31.406 4.437   1.00 59.37  ? 290 GLU A CA    1 
ATOM   1663 C C     . GLU C 3 117 ? 28.021  -30.452 5.519   1.00 56.72  ? 290 GLU A C     1 
ATOM   1664 O O     . GLU C 3 117 ? 29.008  -29.746 5.328   1.00 60.90  ? 290 GLU A O     1 
ATOM   1665 C CB    . GLU C 3 117 ? 26.248  -30.863 3.814   1.00 63.84  ? 290 GLU A CB    1 
ATOM   1666 C CG    . GLU C 3 117 ? 25.234  -31.928 3.428   1.00 67.92  ? 290 GLU A CG    1 
ATOM   1667 C CD    . GLU C 3 117 ? 23.916  -31.328 2.980   1.00 70.89  ? 290 GLU A CD    1 
ATOM   1668 O OE1   . GLU C 3 117 ? 23.650  -31.325 1.757   1.00 47.19  ? 290 GLU A OE1   1 
ATOM   1669 O OE2   . GLU C 3 117 ? 23.153  -30.855 3.854   1.00 57.28  ? 290 GLU A OE2   1 
ATOM   1670 N N     . LYS C 3 118 ? 27.323  -30.432 6.651   1.00 56.81  ? 291 LYS A N     1 
ATOM   1671 C CA    . LYS C 3 118 ? 27.702  -29.586 7.777   1.00 59.58  ? 291 LYS A CA    1 
ATOM   1672 C C     . LYS C 3 118 ? 29.217  -29.511 7.907   1.00 65.49  ? 291 LYS A C     1 
ATOM   1673 O O     . LYS C 3 118 ? 29.802  -28.425 7.881   1.00 70.30  ? 291 LYS A O     1 
ATOM   1674 C CB    . LYS C 3 118 ? 27.102  -30.123 9.078   1.00 57.97  ? 291 LYS A CB    1 
ATOM   1675 C CG    . LYS C 3 118 ? 25.933  -29.309 9.619   1.00 64.38  ? 291 LYS A CG    1 
ATOM   1676 C CD    . LYS C 3 118 ? 25.641  -29.672 11.072  1.00 84.77  ? 291 LYS A CD    1 
ATOM   1677 C CE    . LYS C 3 118 ? 24.440  -28.905 11.611  1.00 85.04  ? 291 LYS A CE    1 
ATOM   1678 N NZ    . LYS C 3 118 ? 23.284  -29.802 11.904  1.00 80.34  ? 291 LYS A NZ    1 
ATOM   1679 N N     . ASN C 3 119 ? 29.846  -30.675 8.038   1.00 65.18  ? 292 ASN A N     1 
ATOM   1680 C CA    . ASN C 3 119 ? 31.291  -30.753 8.213   1.00 65.27  ? 292 ASN A CA    1 
ATOM   1681 C C     . ASN C 3 119 ? 32.070  -30.197 7.025   1.00 60.47  ? 292 ASN A C     1 
ATOM   1682 O O     . ASN C 3 119 ? 33.094  -29.535 7.203   1.00 68.82  ? 292 ASN A O     1 
ATOM   1683 C CB    . ASN C 3 119 ? 31.718  -32.195 8.501   1.00 68.60  ? 292 ASN A CB    1 
ATOM   1684 C CG    . ASN C 3 119 ? 31.709  -32.520 9.986   1.00 78.70  ? 292 ASN A CG    1 
ATOM   1685 O OD1   . ASN C 3 119 ? 32.286  -31.793 10.797  1.00 93.19  ? 292 ASN A OD1   1 
ATOM   1686 N ND2   . ASN C 3 119 ? 31.050  -33.615 10.348  1.00 76.53  ? 292 ASN A ND2   1 
ATOM   1687 N N     . ILE C 3 120 ? 31.577  -30.459 5.820   1.00 49.98  ? 293 ILE A N     1 
ATOM   1688 C CA    . ILE C 3 120 ? 32.260  -30.034 4.601   1.00 47.34  ? 293 ILE A CA    1 
ATOM   1689 C C     . ILE C 3 120 ? 32.171  -28.528 4.345   1.00 52.68  ? 293 ILE A C     1 
ATOM   1690 O O     . ILE C 3 120 ? 33.195  -27.842 4.282   1.00 52.33  ? 293 ILE A O     1 
ATOM   1691 C CB    . ILE C 3 120 ? 31.719  -30.808 3.397   1.00 43.09  ? 293 ILE A CB    1 
ATOM   1692 C CG1   . ILE C 3 120 ? 31.993  -32.302 3.575   1.00 55.15  ? 293 ILE A CG1   1 
ATOM   1693 C CG2   . ILE C 3 120 ? 32.338  -30.292 2.109   1.00 35.40  ? 293 ILE A CG2   1 
ATOM   1694 N N     . ILE C 3 121 ? 30.950  -28.021 4.188   1.00 57.51  ? 294 ILE A N     1 
ATOM   1695 C CA    . ILE C 3 121 ? 30.736  -26.594 3.942   1.00 55.65  ? 294 ILE A CA    1 
ATOM   1696 C C     . ILE C 3 121 ? 30.935  -25.786 5.219   1.00 60.51  ? 294 ILE A C     1 
ATOM   1697 O O     . ILE C 3 121 ? 30.116  -25.852 6.139   1.00 60.41  ? 294 ILE A O     1 
ATOM   1698 C CB    . ILE C 3 121 ? 29.330  -26.331 3.360   1.00 47.10  ? 294 ILE A CB    1 
ATOM   1699 C CG1   . ILE C 3 121 ? 28.680  -27.640 2.900   1.00 29.46  ? 294 ILE A CG1   1 
ATOM   1700 C CG2   . ILE C 3 121 ? 29.417  -25.357 2.196   1.00 35.31  ? 294 ILE A CG2   1 
ATOM   1701 N N     . THR C 3 122 ? 32.026  -25.027 5.270   1.00 59.14  ? 295 THR A N     1 
ATOM   1702 C CA    . THR C 3 122 ? 32.358  -24.252 6.462   1.00 59.26  ? 295 THR A CA    1 
ATOM   1703 C C     . THR C 3 122 ? 32.157  -22.755 6.258   1.00 58.23  ? 295 THR A C     1 
ATOM   1704 O O     . THR C 3 122 ? 31.957  -22.014 7.223   1.00 54.15  ? 295 THR A O     1 
ATOM   1705 C CB    . THR C 3 122 ? 33.799  -24.545 6.923   1.00 58.20  ? 295 THR A CB    1 
ATOM   1706 O OG1   . THR C 3 122 ? 34.657  -24.669 5.781   1.00 55.08  ? 295 THR A OG1   1 
ATOM   1707 C CG2   . THR C 3 122 ? 33.877  -25.918 7.578   1.00 60.02  ? 295 THR A CG2   1 
ATOM   1708 N N     . ASN C 3 123 ? 32.210  -22.312 5.005   1.00 54.55  ? 296 ASN A N     1 
ATOM   1709 C CA    . ASN C 3 123 ? 31.990  -20.903 4.696   1.00 54.92  ? 296 ASN A CA    1 
ATOM   1710 C C     . ASN C 3 123 ? 31.213  -20.688 3.403   1.00 56.39  ? 296 ASN A C     1 
ATOM   1711 O O     . ASN C 3 123 ? 31.264  -21.507 2.483   1.00 64.49  ? 296 ASN A O     1 
ATOM   1712 C CB    . ASN C 3 123 ? 33.314  -20.145 4.647   1.00 57.23  ? 296 ASN A CB    1 
ATOM   1713 C CG    . ASN C 3 123 ? 34.108  -20.443 3.399   1.00 70.81  ? 296 ASN A CG    1 
ATOM   1714 O OD1   . ASN C 3 123 ? 33.992  -19.740 2.393   1.00 86.45  ? 296 ASN A OD1   1 
ATOM   1715 N ND2   . ASN C 3 123 ? 34.922  -21.490 3.453   1.00 83.26  ? 296 ASN A ND2   1 
ATOM   1716 N N     . LEU C 3 124 ? 30.502  -19.570 3.340   1.00 49.29  ? 297 LEU A N     1 
ATOM   1717 C CA    . LEU C 3 124 ? 29.622  -19.278 2.219   1.00 45.10  ? 297 LEU A CA    1 
ATOM   1718 C C     . LEU C 3 124 ? 30.404  -18.829 0.987   1.00 48.43  ? 297 LEU A C     1 
ATOM   1719 O O     . LEU C 3 124 ? 30.048  -19.160 -0.147  1.00 48.13  ? 297 LEU A O     1 
ATOM   1720 C CB    . LEU C 3 124 ? 28.597  -18.216 2.638   1.00 40.42  ? 297 LEU A CB    1 
ATOM   1721 C CG    . LEU C 3 124 ? 27.966  -17.263 1.618   1.00 49.02  ? 297 LEU A CG    1 
ATOM   1722 C CD1   . LEU C 3 124 ? 27.031  -17.991 0.646   1.00 34.82  ? 297 LEU A CD1   1 
ATOM   1723 C CD2   . LEU C 3 124 ? 27.214  -16.180 2.373   1.00 41.68  ? 297 LEU A CD2   1 
ATOM   1724 N N     . SER C 3 125 ? 31.479  -18.085 1.217   1.00 53.81  ? 298 SER A N     1 
ATOM   1725 C CA    . SER C 3 125 ? 32.244  -17.489 0.129   1.00 49.02  ? 298 SER A CA    1 
ATOM   1726 C C     . SER C 3 125 ? 32.853  -18.525 -0.810  1.00 41.62  ? 298 SER A C     1 
ATOM   1727 O O     . SER C 3 125 ? 33.184  -18.212 -1.952  1.00 39.56  ? 298 SER A O     1 
ATOM   1728 C CB    . SER C 3 125 ? 33.335  -16.571 0.685   1.00 50.33  ? 298 SER A CB    1 
ATOM   1729 O OG    . SER C 3 125 ? 32.814  -15.283 0.965   1.00 50.51  ? 298 SER A OG    1 
ATOM   1730 N N     . LYS C 3 126 ? 32.993  -19.757 -0.330  1.00 45.42  ? 299 LYS A N     1 
ATOM   1731 C CA    . LYS C 3 126 ? 33.597  -20.821 -1.133  1.00 54.63  ? 299 LYS A CA    1 
ATOM   1732 C C     . LYS C 3 126 ? 32.582  -21.536 -2.028  1.00 53.92  ? 299 LYS A C     1 
ATOM   1733 O O     . LYS C 3 126 ? 32.960  -22.290 -2.931  1.00 49.86  ? 299 LYS A O     1 
ATOM   1734 C CB    . LYS C 3 126 ? 34.321  -21.829 -0.237  1.00 53.80  ? 299 LYS A CB    1 
ATOM   1735 C CG    . LYS C 3 126 ? 35.791  -21.503 0.006   1.00 62.45  ? 299 LYS A CG    1 
ATOM   1736 C CD    . LYS C 3 126 ? 36.701  -22.350 -0.872  1.00 69.12  ? 299 LYS A CD    1 
ATOM   1737 C CE    . LYS C 3 126 ? 38.050  -22.601 -0.208  1.00 66.03  ? 299 LYS A CE    1 
ATOM   1738 N NZ    . LYS C 3 126 ? 37.912  -23.016 1.224   1.00 44.67  ? 299 LYS A NZ    1 
ATOM   1739 N N     . CYS C 3 127 ? 31.298  -21.286 -1.772  1.00 51.49  ? 300 CYS A N     1 
ATOM   1740 C CA    . CYS C 3 127 ? 30.210  -21.890 -2.535  1.00 41.09  ? 300 CYS A CA    1 
ATOM   1741 C C     . CYS C 3 127 ? 29.975  -21.164 -3.857  1.00 50.60  ? 300 CYS A C     1 
ATOM   1742 O O     . CYS C 3 127 ? 30.096  -19.940 -3.934  1.00 57.91  ? 300 CYS A O     1 
ATOM   1743 C CB    . CYS C 3 127 ? 28.925  -21.882 -1.709  1.00 31.51  ? 300 CYS A CB    1 
ATOM   1744 S SG    . CYS C 3 127 ? 29.148  -22.360 0.020   1.00 45.04  ? 300 CYS A SG    1 
ATOM   1745 N N     . ASP C 3 128 ? 29.630  -21.924 -4.893  1.00 54.80  ? 301 ASP A N     1 
ATOM   1746 C CA    . ASP C 3 128 ? 29.402  -21.363 -6.221  1.00 59.36  ? 301 ASP A CA    1 
ATOM   1747 C C     . ASP C 3 128 ? 27.980  -21.655 -6.695  1.00 61.92  ? 301 ASP A C     1 
ATOM   1748 O O     . ASP C 3 128 ? 27.669  -22.778 -7.096  1.00 69.48  ? 301 ASP A O     1 
ATOM   1749 C CB    . ASP C 3 128 ? 30.424  -21.926 -7.214  1.00 63.41  ? 301 ASP A CB    1 
ATOM   1750 C CG    . ASP C 3 128 ? 30.348  -21.258 -8.580  1.00 74.77  ? 301 ASP A CG    1 
ATOM   1751 O OD1   . ASP C 3 128 ? 29.267  -20.751 -8.942  1.00 78.27  ? 301 ASP A OD1   1 
ATOM   1752 O OD2   . ASP C 3 128 ? 31.321  -21.198 -9.365  1.00 77.32  ? 301 ASP A OD2   1 
ATOM   1753 N N     . PHE C 3 129 ? 27.125  -20.635 -6.652  1.00 56.93  ? 302 PHE A N     1 
ATOM   1754 C CA    . PHE C 3 129 ? 25.724  -20.777 -7.045  1.00 48.65  ? 302 PHE A CA    1 
ATOM   1755 C C     . PHE C 3 129 ? 25.486  -20.366 -8.494  1.00 51.83  ? 302 PHE A C     1 
ATOM   1756 O O     . PHE C 3 129 ? 24.370  -20.481 -8.996  1.00 60.14  ? 302 PHE A O     1 
ATOM   1757 C CB    . PHE C 3 129 ? 24.828  -19.917 -6.150  1.00 40.82  ? 302 PHE A CB    1 
ATOM   1758 C CG    . PHE C 3 129 ? 24.900  -20.262 -4.687  1.00 43.59  ? 302 PHE A CG    1 
ATOM   1759 C CD1   . PHE C 3 129 ? 24.382  -21.457 -4.212  1.00 49.34  ? 302 PHE A CD1   1 
ATOM   1760 C CD2   . PHE C 3 129 ? 25.460  -19.377 -3.779  1.00 26.31  ? 302 PHE A CD2   1 
ATOM   1761 C CE1   . PHE C 3 129 ? 24.436  -21.767 -2.862  1.00 53.39  ? 302 PHE A CE1   1 
ATOM   1762 C CE2   . PHE C 3 129 ? 25.518  -19.683 -2.432  1.00 45.02  ? 302 PHE A CE2   1 
ATOM   1763 C CZ    . PHE C 3 129 ? 25.006  -20.878 -1.972  1.00 44.12  ? 302 PHE A CZ    1 
ATOM   1764 N N     . THR C 3 130 ? 26.529  -19.885 -9.162  1.00 52.29  ? 303 THR A N     1 
ATOM   1765 C CA    . THR C 3 130 ? 26.370  -19.244 -10.470 1.00 53.37  ? 303 THR A CA    1 
ATOM   1766 C C     . THR C 3 130 ? 25.582  -20.071 -11.484 1.00 50.93  ? 303 THR A C     1 
ATOM   1767 O O     . THR C 3 130 ? 24.888  -19.517 -12.334 1.00 54.13  ? 303 THR A O     1 
ATOM   1768 C CB    . THR C 3 130 ? 27.741  -18.836 -11.060 1.00 58.47  ? 303 THR A CB    1 
ATOM   1769 O OG1   . THR C 3 130 ? 28.676  -19.913 -10.916 1.00 56.25  ? 303 THR A OG1   1 
ATOM   1770 C CG2   . THR C 3 130 ? 28.361  -17.707 -10.242 1.00 53.18  ? 303 THR A CG2   1 
ATOM   1771 N N     . GLN C 3 131 ? 25.689  -21.393 -11.390 1.00 51.31  ? 304 GLN A N     1 
ATOM   1772 C CA    . GLN C 3 131 ? 24.983  -22.282 -12.308 1.00 58.76  ? 304 GLN A CA    1 
ATOM   1773 C C     . GLN C 3 131 ? 23.491  -22.352 -11.980 1.00 58.50  ? 304 GLN A C     1 
ATOM   1774 O O     . GLN C 3 131 ? 22.642  -22.309 -12.875 1.00 48.23  ? 304 GLN A O     1 
ATOM   1775 C CB    . GLN C 3 131 ? 25.600  -23.683 -12.282 1.00 64.56  ? 304 GLN A CB    1 
ATOM   1776 C CG    . GLN C 3 131 ? 26.809  -23.849 -13.196 1.00 78.66  ? 304 GLN A CG    1 
ATOM   1777 C CD    . GLN C 3 131 ? 26.547  -24.805 -14.352 1.00 102.88 ? 304 GLN A CD    1 
ATOM   1778 O OE1   . GLN C 3 131 ? 26.171  -25.962 -14.140 1.00 101.69 ? 304 GLN A OE1   1 
ATOM   1779 N NE2   . GLN C 3 131 ? 26.747  -24.324 -15.577 1.00 85.22  ? 304 GLN A NE2   1 
ATOM   1780 N N     . MET C 3 132 ? 23.183  -22.464 -10.690 1.00 61.08  ? 305 MET A N     1 
ATOM   1781 C CA    . MET C 3 132 ? 21.800  -22.463 -10.228 1.00 55.50  ? 305 MET A CA    1 
ATOM   1782 C C     . MET C 3 132 ? 21.157  -21.116 -10.521 1.00 56.59  ? 305 MET A C     1 
ATOM   1783 O O     . MET C 3 132 ? 19.975  -21.044 -10.861 1.00 61.31  ? 305 MET A O     1 
ATOM   1784 C CB    . MET C 3 132 ? 21.730  -22.751 -8.729  1.00 50.45  ? 305 MET A CB    1 
ATOM   1785 C CG    . MET C 3 132 ? 22.417  -24.030 -8.303  1.00 42.13  ? 305 MET A CG    1 
ATOM   1786 S SD    . MET C 3 132 ? 22.689  -24.099 -6.520  1.00 56.80  ? 305 MET A SD    1 
ATOM   1787 C CE    . MET C 3 132 ? 21.037  -23.818 -5.907  1.00 33.42  ? 305 MET A CE    1 
ATOM   1788 N N     . SER C 3 133 ? 21.945  -20.053 -10.383 1.00 53.57  ? 306 SER A N     1 
ATOM   1789 C CA    . SER C 3 133 ? 21.481  -18.710 -10.699 1.00 57.82  ? 306 SER A CA    1 
ATOM   1790 C C     . SER C 3 133 ? 21.052  -18.637 -12.162 1.00 60.50  ? 306 SER A C     1 
ATOM   1791 O O     . SER C 3 133 ? 19.897  -18.317 -12.470 1.00 62.59  ? 306 SER A O     1 
ATOM   1792 C CB    . SER C 3 133 ? 22.573  -17.678 -10.412 1.00 55.64  ? 306 SER A CB    1 
ATOM   1793 O OG    . SER C 3 133 ? 22.044  -16.361 -10.409 1.00 51.71  ? 306 SER A OG    1 
ATOM   1794 N N     . GLN C 3 134 ? 21.982  -18.949 -13.060 1.00 53.52  ? 307 GLN A N     1 
ATOM   1795 C CA    . GLN C 3 134 ? 21.692  -18.929 -14.487 1.00 55.56  ? 307 GLN A CA    1 
ATOM   1796 C C     . GLN C 3 134 ? 20.426  -19.727 -14.793 1.00 59.05  ? 307 GLN A C     1 
ATOM   1797 O O     . GLN C 3 134 ? 19.651  -19.360 -15.679 1.00 60.13  ? 307 GLN A O     1 
ATOM   1798 C CB    . GLN C 3 134 ? 22.871  -19.496 -15.277 1.00 52.28  ? 307 GLN A CB    1 
ATOM   1799 C CG    . GLN C 3 134 ? 24.065  -18.561 -15.358 1.00 75.95  ? 307 GLN A CG    1 
ATOM   1800 C CD    . GLN C 3 134 ? 25.367  -19.301 -15.608 1.00 110.29 ? 307 GLN A CD    1 
ATOM   1801 O OE1   . GLN C 3 134 ? 26.433  -18.688 -15.664 1.00 122.60 ? 307 GLN A OE1   1 
ATOM   1802 N NE2   . GLN C 3 134 ? 25.283  -20.619 -15.759 1.00 118.93 ? 307 GLN A NE2   1 
ATOM   1803 N N     . TYR C 3 135 ? 20.219  -20.810 -14.044 1.00 60.02  ? 308 TYR A N     1 
ATOM   1804 C CA    . TYR C 3 135 ? 19.105  -21.727 -14.285 1.00 58.37  ? 308 TYR A CA    1 
ATOM   1805 C C     . TYR C 3 135 ? 17.746  -21.066 -14.105 1.00 57.36  ? 308 TYR A C     1 
ATOM   1806 O O     . TYR C 3 135 ? 16.908  -21.096 -15.006 1.00 54.31  ? 308 TYR A O     1 
ATOM   1807 C CB    . TYR C 3 135 ? 19.205  -22.958 -13.377 1.00 59.35  ? 308 TYR A CB    1 
ATOM   1808 C CG    . TYR C 3 135 ? 17.975  -23.841 -13.414 1.00 36.69  ? 308 TYR A CG    1 
ATOM   1809 C CD1   . TYR C 3 135 ? 17.540  -24.406 -14.604 1.00 41.50  ? 308 TYR A CD1   1 
ATOM   1810 C CD2   . TYR C 3 135 ? 17.248  -24.105 -12.260 1.00 44.79  ? 308 TYR A CD2   1 
ATOM   1811 C CE1   . TYR C 3 135 ? 16.417  -25.209 -14.647 1.00 62.75  ? 308 TYR A CE1   1 
ATOM   1812 C CE2   . TYR C 3 135 ? 16.121  -24.911 -12.292 1.00 54.97  ? 308 TYR A CE2   1 
ATOM   1813 C CZ    . TYR C 3 135 ? 15.710  -25.459 -13.492 1.00 63.89  ? 308 TYR A CZ    1 
ATOM   1814 O OH    . TYR C 3 135 ? 14.592  -26.263 -13.545 1.00 56.60  ? 308 TYR A OH    1 
ATOM   1815 N N     . PHE C 3 136 ? 17.524  -20.481 -12.934 1.00 56.64  ? 309 PHE A N     1 
ATOM   1816 C CA    . PHE C 3 136 ? 16.255  -19.826 -12.653 1.00 55.07  ? 309 PHE A CA    1 
ATOM   1817 C C     . PHE C 3 136 ? 16.086  -18.607 -13.543 1.00 56.89  ? 309 PHE A C     1 
ATOM   1818 O O     . PHE C 3 136 ? 14.967  -18.234 -13.891 1.00 53.27  ? 309 PHE A O     1 
ATOM   1819 C CB    . PHE C 3 136 ? 16.164  -19.441 -11.180 1.00 50.65  ? 309 PHE A CB    1 
ATOM   1820 C CG    . PHE C 3 136 ? 16.210  -20.618 -10.251 1.00 55.46  ? 309 PHE A CG    1 
ATOM   1821 C CD1   . PHE C 3 136 ? 15.330  -21.674 -10.410 1.00 60.04  ? 309 PHE A CD1   1 
ATOM   1822 C CD2   . PHE C 3 136 ? 17.136  -20.671 -9.223  1.00 67.97  ? 309 PHE A CD2   1 
ATOM   1823 C CE1   . PHE C 3 136 ? 15.370  -22.760 -9.559  1.00 65.09  ? 309 PHE A CE1   1 
ATOM   1824 C CE2   . PHE C 3 136 ? 17.180  -21.753 -8.367  1.00 54.64  ? 309 PHE A CE2   1 
ATOM   1825 C CZ    . PHE C 3 136 ? 16.297  -22.799 -8.536  1.00 64.31  ? 309 PHE A CZ    1 
ATOM   1826 N N     . LYS C 3 137 ? 17.209  -17.996 -13.912 1.00 61.73  ? 310 LYS A N     1 
ATOM   1827 C CA    . LYS C 3 137 ? 17.203  -16.888 -14.856 1.00 66.31  ? 310 LYS A CA    1 
ATOM   1828 C C     . LYS C 3 137 ? 16.719  -17.375 -16.216 1.00 63.97  ? 310 LYS A C     1 
ATOM   1829 O O     . LYS C 3 137 ? 16.025  -16.655 -16.934 1.00 57.14  ? 310 LYS A O     1 
ATOM   1830 C CB    . LYS C 3 137 ? 18.598  -16.277 -14.975 1.00 70.20  ? 310 LYS A CB    1 
ATOM   1831 C CG    . LYS C 3 137 ? 19.045  -15.511 -13.739 1.00 69.91  ? 310 LYS A CG    1 
ATOM   1832 C CD    . LYS C 3 137 ? 20.494  -15.066 -13.859 1.00 69.06  ? 310 LYS A CD    1 
ATOM   1833 C CE    . LYS C 3 137 ? 20.585  -13.607 -14.271 1.00 72.22  ? 310 LYS A CE    1 
ATOM   1834 N NZ    . LYS C 3 137 ? 19.749  -12.739 -13.393 1.00 74.83  ? 310 LYS A NZ    1 
ATOM   1835 N N     . ALA C 3 138 ? 17.093  -18.604 -16.562 1.00 66.99  ? 311 ALA A N     1 
ATOM   1836 C CA    . ALA C 3 138 ? 16.584  -19.250 -17.768 1.00 65.60  ? 311 ALA A CA    1 
ATOM   1837 C C     . ALA C 3 138 ? 15.101  -19.539 -17.573 1.00 67.19  ? 311 ALA A C     1 
ATOM   1838 O O     . ALA C 3 138 ? 14.273  -19.203 -18.424 1.00 65.72  ? 311 ALA A O     1 
ATOM   1839 C CB    . ALA C 3 138 ? 17.344  -20.543 -18.042 1.00 57.69  ? 311 ALA A CB    1 
ATOM   1840 N N     . GLN C 3 139 ? 14.777  -20.153 -16.437 1.00 71.77  ? 312 GLN A N     1 
ATOM   1841 C CA    . GLN C 3 139 ? 13.395  -20.474 -16.099 1.00 71.26  ? 312 GLN A CA    1 
ATOM   1842 C C     . GLN C 3 139 ? 12.503  -19.243 -16.213 1.00 70.87  ? 312 GLN A C     1 
ATOM   1843 O O     . GLN C 3 139 ? 11.410  -19.311 -16.771 1.00 71.24  ? 312 GLN A O     1 
ATOM   1844 C CB    . GLN C 3 139 ? 13.309  -21.060 -14.685 1.00 72.27  ? 312 GLN A CB    1 
ATOM   1845 C CG    . GLN C 3 139 ? 13.866  -22.473 -14.557 1.00 75.49  ? 312 GLN A CG    1 
ATOM   1846 C CD    . GLN C 3 139 ? 12.920  -23.411 -13.827 1.00 99.11  ? 312 GLN A CD    1 
ATOM   1847 O OE1   . GLN C 3 139 ? 12.743  -23.303 -12.612 1.00 93.02  ? 312 GLN A OE1   1 
ATOM   1848 N NE2   . GLN C 3 139 ? 12.310  -24.334 -14.567 1.00 108.10 ? 312 GLN A NE2   1 
ATOM   1849 N N     . THR C 3 140 ? 12.975  -18.118 -15.685 1.00 73.54  ? 313 THR A N     1 
ATOM   1850 C CA    . THR C 3 140 ? 12.223  -16.870 -15.753 1.00 76.35  ? 313 THR A CA    1 
ATOM   1851 C C     . THR C 3 140 ? 12.072  -16.419 -17.197 1.00 80.07  ? 313 THR A C     1 
ATOM   1852 O O     . THR C 3 140 ? 10.985  -16.035 -17.627 1.00 81.33  ? 313 THR A O     1 
ATOM   1853 C CB    . THR C 3 140 ? 12.918  -15.771 -14.931 1.00 77.17  ? 313 THR A CB    1 
ATOM   1854 O OG1   . THR C 3 140 ? 12.660  -15.978 -13.536 1.00 64.95  ? 313 THR A OG1   1 
ATOM   1855 C CG2   . THR C 3 140 ? 12.282  -14.415 -15.206 1.00 70.32  ? 313 THR A CG2   1 
ATOM   1856 N N     . GLU C 3 141 ? 13.170  -16.471 -17.942 1.00 84.46  ? 314 GLU A N     1 
ATOM   1857 C CA    . GLU C 3 141 ? 13.150  -16.109 -19.352 1.00 88.02  ? 314 GLU A CA    1 
ATOM   1858 C C     . GLU C 3 141 ? 12.255  -17.061 -20.140 1.00 88.32  ? 314 GLU A C     1 
ATOM   1859 O O     . GLU C 3 141 ? 11.531  -16.641 -21.046 1.00 89.24  ? 314 GLU A O     1 
ATOM   1860 C CB    . GLU C 3 141 ? 14.569  -16.117 -19.926 1.00 87.57  ? 314 GLU A CB    1 
ATOM   1861 C CG    . GLU C 3 141 ? 14.696  -15.442 -21.282 1.00 99.89  ? 314 GLU A CG    1 
ATOM   1862 C CD    . GLU C 3 141 ? 14.299  -13.979 -21.251 1.00 114.10 ? 314 GLU A CD    1 
ATOM   1863 O OE1   . GLU C 3 141 ? 13.995  -13.426 -22.331 1.00 118.41 ? 314 GLU A OE1   1 
ATOM   1864 O OE2   . GLU C 3 141 ? 14.292  -13.380 -20.150 1.00 128.27 ? 314 GLU A OE2   1 
ATOM   1865 N N     . ALA C 3 142 ? 12.305  -18.342 -19.786 1.00 89.96  ? 315 ALA A N     1 
ATOM   1866 C CA    . ALA C 3 142 ? 11.495  -19.356 -20.454 1.00 93.95  ? 315 ALA A CA    1 
ATOM   1867 C C     . ALA C 3 142 ? 10.007  -19.128 -20.212 1.00 97.73  ? 315 ALA A C     1 
ATOM   1868 O O     . ALA C 3 142 ? 9.193   -19.314 -21.115 1.00 99.72  ? 315 ALA A O     1 
ATOM   1869 C CB    . ALA C 3 142 ? 11.900  -20.751 -20.003 1.00 96.08  ? 315 ALA A CB    1 
ATOM   1870 N N     . ARG C 3 143 ? 9.660   -18.725 -18.992 1.00 101.20 ? 316 ARG A N     1 
ATOM   1871 C CA    . ARG C 3 143 ? 8.270   -18.439 -18.647 1.00 101.74 ? 316 ARG A CA    1 
ATOM   1872 C C     . ARG C 3 143 ? 7.858   -17.055 -19.145 1.00 102.04 ? 316 ARG A C     1 
ATOM   1873 O O     . ARG C 3 143 ? 6.687   -16.680 -19.083 1.00 103.60 ? 316 ARG A O     1 
ATOM   1874 C CB    . ARG C 3 143 ? 8.036   -18.584 -17.137 1.00 102.44 ? 316 ARG A CB    1 
ATOM   1875 C CG    . ARG C 3 143 ? 8.118   -17.286 -16.340 1.00 103.29 ? 316 ARG A CG    1 
ATOM   1876 C CD    . ARG C 3 143 ? 8.231   -17.487 -14.831 1.00 97.87  ? 316 ARG A CD    1 
ATOM   1877 N NE    . ARG C 3 143 ? 7.598   -18.728 -14.386 1.00 99.24  ? 316 ARG A NE    1 
ATOM   1878 C CZ    . ARG C 3 143 ? 8.234   -19.709 -13.755 1.00 95.21  ? 316 ARG A CZ    1 
ATOM   1879 N NH1   . ARG C 3 143 ? 7.574   -20.799 -13.389 1.00 92.10  ? 316 ARG A NH1   1 
ATOM   1880 N NH2   . ARG C 3 143 ? 9.529   -19.604 -13.488 1.00 81.89  ? 316 ARG A NH2   1 
ATOM   1881 N N     . LYS C 3 144 ? 8.833   -16.306 -19.647 1.00 101.20 ? 317 LYS A N     1 
ATOM   1882 C CA    . LYS C 3 144 ? 8.575   -14.994 -20.219 1.00 100.89 ? 317 LYS A CA    1 
ATOM   1883 C C     . LYS C 3 144 ? 8.076   -15.128 -21.654 1.00 104.75 ? 317 LYS A C     1 
ATOM   1884 O O     . LYS C 3 144 ? 7.440   -14.216 -22.186 1.00 103.60 ? 317 LYS A O     1 
ATOM   1885 C CB    . LYS C 3 144 ? 9.848   -14.144 -20.190 1.00 97.50  ? 317 LYS A CB    1 
ATOM   1886 C CG    . LYS C 3 144 ? 9.602   -12.651 -20.121 1.00 77.59  ? 317 LYS A CG    1 
ATOM   1887 C CD    . LYS C 3 144 ? 9.987   -12.101 -18.758 1.00 83.54  ? 317 LYS A CD    1 
ATOM   1888 C CE    . LYS C 3 144 ? 11.219  -11.206 -18.852 1.00 96.16  ? 317 LYS A CE    1 
ATOM   1889 N NZ    . LYS C 3 144 ? 11.604  -10.655 -17.519 1.00 102.13 ? 317 LYS A NZ    1 
ATOM   1890 N N     . GLN C 3 145 ? 8.358   -16.273 -22.271 1.00 106.01 ? 318 GLN A N     1 
ATOM   1891 C CA    . GLN C 3 145 ? 8.104   -16.455 -23.697 1.00 108.13 ? 318 GLN A CA    1 
ATOM   1892 C C     . GLN C 3 145 ? 7.367   -17.748 -24.050 1.00 109.84 ? 318 GLN A C     1 
ATOM   1893 O O     . GLN C 3 145 ? 7.421   -18.198 -25.196 1.00 109.72 ? 318 GLN A O     1 
ATOM   1894 C CB    . GLN C 3 145 ? 9.426   -16.396 -24.470 1.00 106.39 ? 318 GLN A CB    1 
ATOM   1895 C CG    . GLN C 3 145 ? 9.684   -15.070 -25.163 1.00 116.54 ? 318 GLN A CG    1 
ATOM   1896 C CD    . GLN C 3 145 ? 9.932   -13.942 -24.180 1.00 143.65 ? 318 GLN A CD    1 
ATOM   1897 O OE1   . GLN C 3 145 ? 11.001  -13.865 -23.572 1.00 151.98 ? 318 GLN A OE1   1 
ATOM   1898 N NE2   . GLN C 3 145 ? 8.944   -13.066 -24.018 1.00 147.08 ? 318 GLN A NE2   1 
ATOM   1899 N N     . MET C 3 146 ? 6.677   -18.344 -23.082 1.00 112.10 ? 319 MET A N     1 
ATOM   1900 C CA    . MET C 3 146 ? 5.965   -19.597 -23.340 1.00 113.22 ? 319 MET A CA    1 
ATOM   1901 C C     . MET C 3 146 ? 4.836   -19.409 -24.348 1.00 108.83 ? 319 MET A C     1 
ATOM   1902 O O     . MET C 3 146 ? 4.468   -18.281 -24.683 1.00 106.10 ? 319 MET A O     1 
ATOM   1903 C CB    . MET C 3 146 ? 5.408   -20.207 -22.049 1.00 116.11 ? 319 MET A CB    1 
ATOM   1904 C CG    . MET C 3 146 ? 6.148   -19.826 -20.788 1.00 112.35 ? 319 MET A CG    1 
ATOM   1905 S SD    . MET C 3 146 ? 5.096   -19.953 -19.334 1.00 117.96 ? 319 MET A SD    1 
ATOM   1906 C CE    . MET C 3 146 ? 4.175   -18.417 -19.444 1.00 107.80 ? 319 MET A CE    1 
ATOM   1907 N N     . SER C 3 147 ? 4.290   -20.526 -24.824 1.00 104.26 ? 320 SER A N     1 
ATOM   1908 C CA    . SER C 3 147 ? 3.199   -20.498 -25.791 1.00 99.17  ? 320 SER A CA    1 
ATOM   1909 C C     . SER C 3 147 ? 1.976   -19.799 -25.207 1.00 93.86  ? 320 SER A C     1 
ATOM   1910 O O     . SER C 3 147 ? 1.348   -20.303 -24.274 1.00 89.32  ? 320 SER A O     1 
ATOM   1911 C CB    . SER C 3 147 ? 2.842   -21.917 -26.250 1.00 98.91  ? 320 SER A CB    1 
ATOM   1912 O OG    . SER C 3 147 ? 2.134   -22.622 -25.244 1.00 96.57  ? 320 SER A OG    1 
ATOM   1913 N N     . LYS C 3 148 ? 1.653   -18.631 -25.763 1.00 93.71  ? 321 LYS A N     1 
ATOM   1914 C CA    . LYS C 3 148 ? 0.511   -17.840 -25.312 1.00 89.69  ? 321 LYS A CA    1 
ATOM   1915 C C     . LYS C 3 148 ? -0.686  -18.726 -24.982 1.00 87.11  ? 321 LYS A C     1 
ATOM   1916 O O     . LYS C 3 148 ? -1.433  -18.452 -24.040 1.00 83.71  ? 321 LYS A O     1 
ATOM   1917 C CB    . LYS C 3 148 ? 0.123   -16.801 -26.370 1.00 87.72  ? 321 LYS A CB    1 
ATOM   1918 C CG    . LYS C 3 148 ? 0.974   -15.535 -26.350 1.00 88.97  ? 321 LYS A CG    1 
ATOM   1919 C CD    . LYS C 3 148 ? 1.376   -15.114 -27.760 1.00 109.12 ? 321 LYS A CD    1 
ATOM   1920 C CE    . LYS C 3 148 ? 0.495   -13.981 -28.279 1.00 121.67 ? 321 LYS A CE    1 
ATOM   1921 N NZ    . LYS C 3 148 ? -0.559  -14.470 -29.217 1.00 123.66 ? 321 LYS A NZ    1 
ATOM   1922 N N     . GLU C 3 149 ? -0.857  -19.792 -25.760 1.00 90.72  ? 322 GLU A N     1 
ATOM   1923 C CA    . GLU C 3 149 ? -1.939  -20.743 -25.537 1.00 96.42  ? 322 GLU A CA    1 
ATOM   1924 C C     . GLU C 3 149 ? -1.912  -21.288 -24.113 1.00 97.77  ? 322 GLU A C     1 
ATOM   1925 O O     . GLU C 3 149 ? -2.950  -21.390 -23.459 1.00 100.15 ? 322 GLU A O     1 
ATOM   1926 C CB    . GLU C 3 149 ? -1.856  -21.895 -26.543 1.00 98.73  ? 322 GLU A CB    1 
ATOM   1927 C CG    . GLU C 3 149 ? -3.090  -22.785 -26.569 1.00 107.24 ? 322 GLU A CG    1 
ATOM   1928 C CD    . GLU C 3 149 ? -2.818  -24.183 -26.044 1.00 110.18 ? 322 GLU A CD    1 
ATOM   1929 O OE1   . GLU C 3 149 ? -2.284  -24.312 -24.921 1.00 104.42 ? 322 GLU A OE1   1 
ATOM   1930 O OE2   . GLU C 3 149 ? -3.142  -25.157 -26.756 1.00 114.88 ? 322 GLU A OE2   1 
ATOM   1931 N N     . GLU C 3 150 ? -0.719  -21.637 -23.640 1.00 99.28  ? 323 GLU A N     1 
ATOM   1932 C CA    . GLU C 3 150 ? -0.560  -22.194 -22.301 1.00 100.12 ? 323 GLU A CA    1 
ATOM   1933 C C     . GLU C 3 150 ? -0.693  -21.109 -21.238 1.00 97.91  ? 323 GLU A C     1 
ATOM   1934 O O     . GLU C 3 150 ? -1.195  -21.364 -20.142 1.00 101.65 ? 323 GLU A O     1 
ATOM   1935 C CB    . GLU C 3 150 ? 0.785   -22.920 -22.178 1.00 100.39 ? 323 GLU A CB    1 
ATOM   1936 C CG    . GLU C 3 150 ? 1.451   -22.801 -20.817 1.00 114.15 ? 323 GLU A CG    1 
ATOM   1937 C CD    . GLU C 3 150 ? 2.079   -21.438 -20.598 1.00 125.24 ? 323 GLU A CD    1 
ATOM   1938 O OE1   . GLU C 3 150 ? 2.093   -20.963 -19.439 1.00 117.99 ? 323 GLU A OE1   1 
ATOM   1939 O OE2   . GLU C 3 150 ? 2.545   -20.834 -21.587 1.00 128.91 ? 323 GLU A OE2   1 
ATOM   1940 N N     . LYS C 3 151 ? -0.251  -19.898 -21.570 1.00 92.40  ? 324 LYS A N     1 
ATOM   1941 C CA    . LYS C 3 151 ? -0.320  -18.776 -20.642 1.00 89.47  ? 324 LYS A CA    1 
ATOM   1942 C C     . LYS C 3 151 ? -1.735  -18.614 -20.101 1.00 94.66  ? 324 LYS A C     1 
ATOM   1943 O O     . LYS C 3 151 ? -1.933  -18.371 -18.905 1.00 101.85 ? 324 LYS A O     1 
ATOM   1944 C CB    . LYS C 3 151 ? 0.140   -17.484 -21.315 1.00 84.27  ? 324 LYS A CB    1 
ATOM   1945 C CG    . LYS C 3 151 ? 1.623   -17.442 -21.625 1.00 69.86  ? 324 LYS A CG    1 
ATOM   1946 C CD    . LYS C 3 151 ? 2.138   -16.012 -21.646 1.00 94.57  ? 324 LYS A CD    1 
ATOM   1947 C CE    . LYS C 3 151 ? 2.940   -15.728 -22.909 1.00 95.73  ? 324 LYS A CE    1 
ATOM   1948 N NZ    . LYS C 3 151 ? 3.290   -14.285 -23.030 1.00 82.63  ? 324 LYS A NZ    1 
ATOM   1949 N N     . LEU C 3 152 ? -2.717  -18.759 -20.990 1.00 92.02  ? 325 LEU A N     1 
ATOM   1950 C CA    . LEU C 3 152 ? -4.117  -18.686 -20.597 1.00 91.48  ? 325 LEU A CA    1 
ATOM   1951 C C     . LEU C 3 152 ? -4.431  -19.700 -19.498 1.00 89.31  ? 325 LEU A C     1 
ATOM   1952 O O     . LEU C 3 152 ? -5.215  -19.415 -18.591 1.00 92.67  ? 325 LEU A O     1 
ATOM   1953 C CB    . LEU C 3 152 ? -5.027  -18.905 -21.810 1.00 92.01  ? 325 LEU A CB    1 
ATOM   1954 C CG    . LEU C 3 152 ? -6.545  -18.840 -21.600 1.00 101.26 ? 325 LEU A CG    1 
ATOM   1955 C CD1   . LEU C 3 152 ? -6.990  -17.447 -21.148 1.00 93.51  ? 325 LEU A CD1   1 
ATOM   1956 C CD2   . LEU C 3 152 ? -7.280  -19.259 -22.868 1.00 87.81  ? 325 LEU A CD2   1 
ATOM   1957 N N     . LYS C 3 153 ? -3.810  -20.874 -19.569 1.00 82.16  ? 326 LYS A N     1 
ATOM   1958 C CA    . LYS C 3 153 ? -4.071  -21.921 -18.585 1.00 86.91  ? 326 LYS A CA    1 
ATOM   1959 C C     . LYS C 3 153 ? -3.472  -21.619 -17.211 1.00 87.30  ? 326 LYS A C     1 
ATOM   1960 O O     . LYS C 3 153 ? -4.020  -22.036 -16.190 1.00 89.74  ? 326 LYS A O     1 
ATOM   1961 C CB    . LYS C 3 153 ? -3.596  -23.290 -19.085 1.00 91.27  ? 326 LYS A CB    1 
ATOM   1962 C CG    . LYS C 3 153 ? -4.406  -24.467 -18.525 1.00 93.19  ? 326 LYS A CG    1 
ATOM   1963 C CD    . LYS C 3 153 ? -3.497  -25.647 -18.170 1.00 104.72 ? 326 LYS A CD    1 
ATOM   1964 C CE    . LYS C 3 153 ? -2.447  -25.890 -19.253 1.00 97.24  ? 326 LYS A CE    1 
ATOM   1965 N NZ    . LYS C 3 153 ? -3.023  -26.549 -20.462 1.00 95.12  ? 326 LYS A NZ    1 
ATOM   1966 N N     . ILE C 3 154 ? -2.354  -20.898 -17.181 1.00 84.64  ? 327 ILE A N     1 
ATOM   1967 C CA    . ILE C 3 154 ? -1.770  -20.481 -15.909 1.00 83.14  ? 327 ILE A CA    1 
ATOM   1968 C C     . ILE C 3 154 ? -2.582  -19.345 -15.307 1.00 85.71  ? 327 ILE A C     1 
ATOM   1969 O O     . ILE C 3 154 ? -2.616  -19.169 -14.089 1.00 87.93  ? 327 ILE A O     1 
ATOM   1970 C CB    . ILE C 3 154 ? -0.301  -20.058 -16.066 1.00 81.86  ? 327 ILE A CB    1 
ATOM   1971 C CG1   . ILE C 3 154 ? 0.209   -20.392 -17.467 1.00 70.72  ? 327 ILE A CG1   1 
ATOM   1972 C CG2   . ILE C 3 154 ? 0.555   -20.743 -15.011 1.00 75.88  ? 327 ILE A CG2   1 
ATOM   1973 N N     . LYS C 3 155 ? -3.229  -18.570 -16.172 1.00 83.64  ? 328 LYS A N     1 
ATOM   1974 C CA    . LYS C 3 155 ? -4.185  -17.569 -15.729 1.00 82.10  ? 328 LYS A CA    1 
ATOM   1975 C C     . LYS C 3 155 ? -5.476  -18.269 -15.327 1.00 84.26  ? 328 LYS A C     1 
ATOM   1976 O O     . LYS C 3 155 ? -6.220  -17.781 -14.479 1.00 91.52  ? 328 LYS A O     1 
ATOM   1977 C CB    . LYS C 3 155 ? -4.454  -16.546 -16.833 1.00 78.46  ? 328 LYS A CB    1 
ATOM   1978 C CG    . LYS C 3 155 ? -5.095  -15.257 -16.338 1.00 81.91  ? 328 LYS A CG    1 
ATOM   1979 C CD    . LYS C 3 155 ? -6.289  -14.858 -17.196 1.00 100.55 ? 328 LYS A CD    1 
ATOM   1980 C CE    . LYS C 3 155 ? -7.535  -15.655 -16.831 1.00 109.00 ? 328 LYS A CE    1 
ATOM   1981 N NZ    . LYS C 3 155 ? -8.413  -14.923 -15.873 1.00 105.28 ? 328 LYS A NZ    1 
ATOM   1982 N N     . GLU C 3 156 ? -5.731  -19.422 -15.939 1.00 81.41  ? 329 GLU A N     1 
ATOM   1983 C CA    . GLU C 3 156 ? -6.897  -20.231 -15.605 1.00 86.00  ? 329 GLU A CA    1 
ATOM   1984 C C     . GLU C 3 156 ? -6.692  -20.947 -14.275 1.00 87.62  ? 329 GLU A C     1 
ATOM   1985 O O     . GLU C 3 156 ? -7.508  -20.811 -13.359 1.00 91.49  ? 329 GLU A O     1 
ATOM   1986 C CB    . GLU C 3 156 ? -7.183  -21.248 -16.710 1.00 92.43  ? 329 GLU A CB    1 
ATOM   1987 C CG    . GLU C 3 156 ? -8.181  -20.776 -17.756 1.00 103.59 ? 329 GLU A CG    1 
ATOM   1988 C CD    . GLU C 3 156 ? -8.522  -21.857 -18.765 1.00 98.99  ? 329 GLU A CD    1 
ATOM   1989 O OE1   . GLU C 3 156 ? -8.093  -21.737 -19.933 1.00 97.68  ? 329 GLU A OE1   1 
ATOM   1990 O OE2   . GLU C 3 156 ? -9.218  -22.827 -18.389 1.00 95.25  ? 329 GLU A OE2   1 
ATOM   1991 N N     . GLU C 3 157 ? -5.604  -21.712 -14.174 1.00 88.55  ? 330 GLU A N     1 
ATOM   1992 C CA    . GLU C 3 157 ? -5.251  -22.363 -12.917 1.00 93.24  ? 330 GLU A CA    1 
ATOM   1993 C C     . GLU C 3 157 ? -5.283  -21.334 -11.790 1.00 90.61  ? 330 GLU A C     1 
ATOM   1994 O O     . GLU C 3 157 ? -5.824  -21.595 -10.709 1.00 89.46  ? 330 GLU A O     1 
ATOM   1995 C CB    . GLU C 3 157 ? -3.865  -23.007 -13.008 1.00 98.02  ? 330 GLU A CB    1 
ATOM   1996 C CG    . GLU C 3 157 ? -3.827  -24.316 -13.786 1.00 114.30 ? 330 GLU A CG    1 
ATOM   1997 C CD    . GLU C 3 157 ? -2.418  -24.722 -14.187 1.00 123.25 ? 330 GLU A CD    1 
ATOM   1998 O OE1   . GLU C 3 157 ? -2.276  -25.671 -14.990 1.00 126.69 ? 330 GLU A OE1   1 
ATOM   1999 O OE2   . GLU C 3 157 ? -1.452  -24.094 -13.701 1.00 126.07 ? 330 GLU A OE2   1 
ATOM   2000 N N     . ASN C 3 158 ? -4.704  -20.162 -12.057 1.00 85.94  ? 331 ASN A N     1 
ATOM   2001 C CA    . ASN C 3 158 ? -4.752  -19.044 -11.124 1.00 79.85  ? 331 ASN A CA    1 
ATOM   2002 C C     . ASN C 3 158 ? -6.186  -18.690 -10.769 1.00 73.32  ? 331 ASN A C     1 
ATOM   2003 O O     . ASN C 3 158 ? -6.541  -18.589 -9.594  1.00 70.33  ? 331 ASN A O     1 
ATOM   2004 C CB    . ASN C 3 158 ? -4.057  -17.818 -11.723 1.00 78.12  ? 331 ASN A CB    1 
ATOM   2005 C CG    . ASN C 3 158 ? -2.660  -17.604 -11.166 1.00 76.26  ? 331 ASN A CG    1 
ATOM   2006 O OD1   . ASN C 3 158 ? -2.315  -18.113 -10.097 1.00 62.36  ? 331 ASN A OD1   1 
ATOM   2007 N ND2   . ASN C 3 158 ? -1.848  -16.842 -11.891 1.00 66.94  ? 331 ASN A ND2   1 
ATOM   2008 N N     . GLU C 3 159 ? -7.007  -18.506 -11.800 1.00 70.85  ? 332 GLU A N     1 
ATOM   2009 C CA    . GLU C 3 159 ? -8.396  -18.108 -11.619 1.00 76.76  ? 332 GLU A CA    1 
ATOM   2010 C C     . GLU C 3 159 ? -9.154  -19.119 -10.772 1.00 73.31  ? 332 GLU A C     1 
ATOM   2011 O O     . GLU C 3 159 ? -9.923  -18.743 -9.889  1.00 77.67  ? 332 GLU A O     1 
ATOM   2012 C CB    . GLU C 3 159 ? -9.088  -17.922 -12.974 1.00 82.48  ? 332 GLU A CB    1 
ATOM   2013 C CG    . GLU C 3 159 ? -10.565 -17.565 -12.886 1.00 104.02 ? 332 GLU A CG    1 
ATOM   2014 C CD    . GLU C 3 159 ? -10.835 -16.400 -11.950 1.00 121.99 ? 332 GLU A CD    1 
ATOM   2015 O OE1   . GLU C 3 159 ? -11.571 -16.589 -10.956 1.00 118.98 ? 332 GLU A OE1   1 
ATOM   2016 O OE2   . GLU C 3 159 ? -10.313 -15.294 -12.208 1.00 127.52 ? 332 GLU A OE2   1 
ATOM   2017 N N     . LYS C 3 160 ? -8.933  -20.402 -11.037 1.00 70.38  ? 333 LYS A N     1 
ATOM   2018 C CA    . LYS C 3 160 ? -9.612  -21.447 -10.281 1.00 75.45  ? 333 LYS A CA    1 
ATOM   2019 C C     . LYS C 3 160 ? -9.188  -21.420 -8.817  1.00 66.19  ? 333 LYS A C     1 
ATOM   2020 O O     . LYS C 3 160 ? -10.004 -21.650 -7.922  1.00 65.38  ? 333 LYS A O     1 
ATOM   2021 C CB    . LYS C 3 160 ? -9.360  -22.827 -10.892 1.00 82.16  ? 333 LYS A CB    1 
ATOM   2022 C CG    . LYS C 3 160 ? -10.619 -23.678 -11.027 1.00 90.81  ? 333 LYS A CG    1 
ATOM   2023 C CD    . LYS C 3 160 ? -10.674 -24.384 -12.378 1.00 101.89 ? 333 LYS A CD    1 
ATOM   2024 C CE    . LYS C 3 160 ? -10.352 -25.868 -12.241 1.00 96.66  ? 333 LYS A CE    1 
ATOM   2025 N NZ    . LYS C 3 160 ? -9.998  -26.478 -13.556 1.00 93.12  ? 333 LYS A NZ    1 
ATOM   2026 N N     . LEU C 3 161 ? -7.912  -21.131 -8.578  1.00 55.99  ? 334 LEU A N     1 
ATOM   2027 C CA    . LEU C 3 161 ? -7.419  -20.962 -7.219  1.00 58.66  ? 334 LEU A CA    1 
ATOM   2028 C C     . LEU C 3 161 ? -8.155  -19.799 -6.563  1.00 58.01  ? 334 LEU A C     1 
ATOM   2029 O O     . LEU C 3 161 ? -8.476  -19.841 -5.372  1.00 58.47  ? 334 LEU A O     1 
ATOM   2030 C CB    . LEU C 3 161 ? -5.909  -20.704 -7.217  1.00 58.54  ? 334 LEU A CB    1 
ATOM   2031 C CG    . LEU C 3 161 ? -5.033  -21.617 -6.349  1.00 58.83  ? 334 LEU A CG    1 
ATOM   2032 C CD1   . LEU C 3 161 ? -5.858  -22.692 -5.645  1.00 61.61  ? 334 LEU A CD1   1 
ATOM   2033 C CD2   . LEU C 3 161 ? -3.932  -22.254 -7.181  1.00 52.70  ? 334 LEU A CD2   1 
ATOM   2034 N N     . LEU C 3 162 ? -8.426  -18.768 -7.359  1.00 56.05  ? 335 LEU A N     1 
ATOM   2035 C CA    . LEU C 3 162 ? -9.168  -17.601 -6.898  1.00 51.65  ? 335 LEU A CA    1 
ATOM   2036 C C     . LEU C 3 162 ? -10.585 -17.997 -6.531  1.00 52.27  ? 335 LEU A C     1 
ATOM   2037 O O     . LEU C 3 162 ? -11.087 -17.637 -5.467  1.00 51.36  ? 335 LEU A O     1 
ATOM   2038 C CB    . LEU C 3 162 ? -9.215  -16.535 -7.996  1.00 46.74  ? 335 LEU A CB    1 
ATOM   2039 C CG    . LEU C 3 162 ? -9.205  -15.060 -7.587  1.00 52.57  ? 335 LEU A CG    1 
ATOM   2040 C CD1   . LEU C 3 162 ? -9.990  -14.835 -6.304  1.00 64.29  ? 335 LEU A CD1   1 
ATOM   2041 C CD2   . LEU C 3 162 ? -7.772  -14.554 -7.445  1.00 69.08  ? 335 LEU A CD2   1 
ATOM   2042 N N     . LYS C 3 163 ? -11.222 -18.744 -7.427  1.00 54.45  ? 336 LYS A N     1 
ATOM   2043 C CA    . LYS C 3 163 ? -12.619 -19.130 -7.265  1.00 49.77  ? 336 LYS A CA    1 
ATOM   2044 C C     . LYS C 3 163 ? -12.827 -20.047 -6.062  1.00 45.99  ? 336 LYS A C     1 
ATOM   2045 O O     . LYS C 3 163 ? -13.852 -19.972 -5.380  1.00 42.84  ? 336 LYS A O     1 
ATOM   2046 C CB    . LYS C 3 163 ? -13.131 -19.794 -8.547  1.00 41.35  ? 336 LYS A CB    1 
ATOM   2047 C CG    . LYS C 3 163 ? -14.000 -21.025 -8.328  1.00 75.34  ? 336 LYS A CG    1 
ATOM   2048 C CD    . LYS C 3 163 ? -15.479 -20.662 -8.257  1.00 87.25  ? 336 LYS A CD    1 
ATOM   2049 C CE    . LYS C 3 163 ? -16.299 -21.538 -9.190  1.00 73.53  ? 336 LYS A CE    1 
ATOM   2050 N NZ    . LYS C 3 163 ? -17.471 -20.803 -9.738  1.00 63.58  ? 336 LYS A NZ    1 
ATOM   2051 N N     . GLU C 3 164 ? -11.844 -20.899 -5.796  1.00 44.22  ? 337 GLU A N     1 
ATOM   2052 C CA    . GLU C 3 164 ? -11.986 -21.916 -4.765  1.00 50.70  ? 337 GLU A CA    1 
ATOM   2053 C C     . GLU C 3 164 ? -11.569 -21.442 -3.375  1.00 53.06  ? 337 GLU A C     1 
ATOM   2054 O O     . GLU C 3 164 ? -12.308 -21.629 -2.405  1.00 52.58  ? 337 GLU A O     1 
ATOM   2055 C CB    . GLU C 3 164 ? -11.216 -23.183 -5.154  1.00 55.03  ? 337 GLU A CB    1 
ATOM   2056 C CG    . GLU C 3 164 ? -11.676 -24.441 -4.432  1.00 80.70  ? 337 GLU A CG    1 
ATOM   2057 C CD    . GLU C 3 164 ? -12.905 -25.077 -5.064  1.00 104.99 ? 337 GLU A CD    1 
ATOM   2058 O OE1   . GLU C 3 164 ? -13.673 -24.366 -5.752  1.00 93.71  ? 337 GLU A OE1   1 
ATOM   2059 O OE2   . GLU C 3 164 ? -13.105 -26.296 -4.868  1.00 111.70 ? 337 GLU A OE2   1 
ATOM   2060 N N     . TYR C 3 165 ? -10.393 -20.827 -3.277  1.00 50.72  ? 338 TYR A N     1 
ATOM   2061 C CA    . TYR C 3 165 ? -9.852  -20.434 -1.976  1.00 44.93  ? 338 TYR A CA    1 
ATOM   2062 C C     . TYR C 3 165 ? -9.796  -18.927 -1.784  1.00 42.17  ? 338 TYR A C     1 
ATOM   2063 O O     . TYR C 3 165 ? -9.501  -18.446 -0.690  1.00 33.82  ? 338 TYR A O     1 
ATOM   2064 C CB    . TYR C 3 165 ? -8.459  -21.024 -1.776  1.00 42.83  ? 338 TYR A CB    1 
ATOM   2065 C CG    . TYR C 3 165 ? -8.428  -22.530 -1.757  1.00 41.20  ? 338 TYR A CG    1 
ATOM   2066 C CD1   . TYR C 3 165 ? -8.230  -23.255 -2.925  1.00 51.66  ? 338 TYR A CD1   1 
ATOM   2067 C CD2   . TYR C 3 165 ? -8.591  -23.229 -0.571  1.00 52.81  ? 338 TYR A CD2   1 
ATOM   2068 C CE1   . TYR C 3 165 ? -8.201  -24.636 -2.913  1.00 35.09  ? 338 TYR A CE1   1 
ATOM   2069 C CE2   . TYR C 3 165 ? -8.563  -24.611 -0.546  1.00 58.48  ? 338 TYR A CE2   1 
ATOM   2070 C CZ    . TYR C 3 165 ? -8.368  -25.309 -1.718  1.00 20.79  ? 338 TYR A CZ    1 
ATOM   2071 O OH    . TYR C 3 165 ? -8.340  -26.685 -1.691  1.00 56.04  ? 338 TYR A OH    1 
ATOM   2072 N N     . GLY C 3 166 ? -10.085 -18.183 -2.845  1.00 48.49  ? 339 GLY A N     1 
ATOM   2073 C CA    . GLY C 3 166 ? -10.020 -16.734 -2.795  1.00 59.02  ? 339 GLY A CA    1 
ATOM   2074 C C     . GLY C 3 166 ? -11.235 -16.067 -2.177  1.00 56.29  ? 339 GLY A C     1 
ATOM   2075 O O     . GLY C 3 166 ? -11.213 -14.869 -1.894  1.00 55.35  ? 339 GLY A O     1 
ATOM   2076 N N     . PHE C 3 167 ? -12.298 -16.837 -1.968  1.00 55.34  ? 340 PHE A N     1 
ATOM   2077 C CA    . PHE C 3 167 ? -13.526 -16.296 -1.400  1.00 57.40  ? 340 PHE A CA    1 
ATOM   2078 C C     . PHE C 3 167 ? -13.914 -17.008 -0.110  1.00 60.46  ? 340 PHE A C     1 
ATOM   2079 O O     . PHE C 3 167 ? -13.473 -18.128 0.158   1.00 63.09  ? 340 PHE A O     1 
ATOM   2080 C CB    . PHE C 3 167 ? -14.675 -16.375 -2.411  1.00 54.60  ? 340 PHE A CB    1 
ATOM   2081 C CG    . PHE C 3 167 ? -14.497 -15.475 -3.599  1.00 57.41  ? 340 PHE A CG    1 
ATOM   2082 C CD1   . PHE C 3 167 ? -15.108 -14.233 -3.640  1.00 57.20  ? 340 PHE A CD1   1 
ATOM   2083 C CD2   . PHE C 3 167 ? -13.716 -15.870 -4.676  1.00 55.44  ? 340 PHE A CD2   1 
ATOM   2084 C CE1   . PHE C 3 167 ? -14.944 -13.401 -4.732  1.00 62.69  ? 340 PHE A CE1   1 
ATOM   2085 C CE2   . PHE C 3 167 ? -13.547 -15.045 -5.768  1.00 44.07  ? 340 PHE A CE2   1 
ATOM   2086 C CZ    . PHE C 3 167 ? -14.163 -13.808 -5.797  1.00 59.58  ? 340 PHE A CZ    1 
ATOM   2087 N N     . CYS C 3 168 ? -14.746 -16.346 0.685   1.00 54.59  ? 341 CYS A N     1 
ATOM   2088 C CA    . CYS C 3 168 ? -15.218 -16.907 1.937   1.00 50.47  ? 341 CYS A CA    1 
ATOM   2089 C C     . CYS C 3 168 ? -16.642 -16.445 2.192   1.00 52.67  ? 341 CYS A C     1 
ATOM   2090 O O     . CYS C 3 168 ? -17.155 -15.577 1.486   1.00 58.41  ? 341 CYS A O     1 
ATOM   2091 C CB    . CYS C 3 168 ? -14.320 -16.462 3.086   1.00 52.79  ? 341 CYS A CB    1 
ATOM   2092 S SG    . CYS C 3 168 ? -14.883 -14.948 3.900   1.00 56.40  ? 341 CYS A SG    1 
ATOM   2093 N N     . ILE C 3 169 ? -17.279 -17.026 3.205   1.00 48.62  ? 342 ILE A N     1 
ATOM   2094 C CA    . ILE C 3 169 ? -18.650 -16.665 3.549   1.00 40.23  ? 342 ILE A CA    1 
ATOM   2095 C C     . ILE C 3 169 ? -18.728 -16.043 4.944   1.00 48.34  ? 342 ILE A C     1 
ATOM   2096 O O     . ILE C 3 169 ? -18.690 -16.736 5.967   1.00 43.49  ? 342 ILE A O     1 
ATOM   2097 C CB    . ILE C 3 169 ? -19.587 -17.885 3.427   1.00 33.29  ? 342 ILE A CB    1 
ATOM   2098 C CG1   . ILE C 3 169 ? -19.643 -18.364 1.969   1.00 29.35  ? 342 ILE A CG1   1 
ATOM   2099 C CG2   . ILE C 3 169 ? -20.985 -17.536 3.919   1.00 38.23  ? 342 ILE A CG2   1 
ATOM   2100 N N     . MET C 3 170 ? -18.815 -14.719 4.969   1.00 51.66  ? 343 MET A N     1 
ATOM   2101 C CA    . MET C 3 170 ? -18.996 -13.993 6.213   1.00 48.08  ? 343 MET A CA    1 
ATOM   2102 C C     . MET C 3 170 ? -20.461 -13.598 6.313   1.00 56.39  ? 343 MET A C     1 
ATOM   2103 O O     . MET C 3 170 ? -21.046 -13.095 5.346   1.00 60.18  ? 343 MET A O     1 
ATOM   2104 C CB    . MET C 3 170 ? -18.100 -12.754 6.258   1.00 36.90  ? 343 MET A CB    1 
ATOM   2105 C CG    . MET C 3 170 ? -18.290 -11.908 7.504   1.00 39.54  ? 343 MET A CG    1 
ATOM   2106 S SD    . MET C 3 170 ? -16.925 -10.778 7.817   1.00 65.76  ? 343 MET A SD    1 
ATOM   2107 C CE    . MET C 3 170 ? -15.859 -11.810 8.794   1.00 26.54  ? 343 MET A CE    1 
ATOM   2108 N N     . ASP C 3 171 ? -21.050 -13.844 7.480   1.00 59.15  ? 344 ASP A N     1 
ATOM   2109 C CA    . ASP C 3 171 ? -22.452 -13.530 7.720   1.00 46.05  ? 344 ASP A CA    1 
ATOM   2110 C C     . ASP C 3 171 ? -23.326 -13.993 6.569   1.00 49.37  ? 344 ASP A C     1 
ATOM   2111 O O     . ASP C 3 171 ? -23.490 -15.200 6.345   1.00 53.55  ? 344 ASP A O     1 
ATOM   2112 C CB    . ASP C 3 171 ? -22.628 -12.034 7.948   1.00 32.85  ? 344 ASP A CB    1 
ATOM   2113 C CG    . ASP C 3 171 ? -22.099 -11.590 9.286   1.00 44.12  ? 344 ASP A CG    1 
ATOM   2114 O OD1   . ASP C 3 171 ? -21.749 -10.399 9.413   1.00 59.54  ? 344 ASP A OD1   1 
ATOM   2115 O OD2   . ASP C 3 171 ? -21.993 -12.360 10.267  1.00 39.12  ? 344 ASP A OD2   1 
ATOM   2116 N N     . ASN C 3 172 ? -23.861 -13.034 5.817   1.00 51.15  ? 345 ASN A N     1 
ATOM   2117 C CA    . ASN C 3 172 ? -24.834 -13.351 4.778   1.00 53.81  ? 345 ASN A CA    1 
ATOM   2118 C C     . ASN C 3 172 ? -24.328 -13.206 3.339   1.00 53.13  ? 345 ASN A C     1 
ATOM   2119 O O     . ASN C 3 172 ? -25.124 -13.205 2.403   1.00 57.54  ? 345 ASN A O     1 
ATOM   2120 C CB    . ASN C 3 172 ? -26.100 -12.509 4.986   1.00 56.94  ? 345 ASN A CB    1 
ATOM   2121 C CG    . ASN C 3 172 ? -26.743 -12.747 6.346   1.00 48.93  ? 345 ASN A CG    1 
ATOM   2122 O OD1   . ASN C 3 172 ? -27.194 -13.854 6.647   1.00 85.92  ? 345 ASN A OD1   1 
ATOM   2123 N ND2   . ASN C 3 172 ? -26.783 -11.711 7.175   1.00 39.26  ? 345 ASN A ND2   1 
ATOM   2124 N N     . HIS C 3 173 ? -23.015 -13.086 3.152   1.00 54.74  ? 346 HIS A N     1 
ATOM   2125 C CA    . HIS C 3 173 ? -22.479 -12.858 1.808   1.00 63.25  ? 346 HIS A CA    1 
ATOM   2126 C C     . HIS C 3 173 ? -21.155 -13.560 1.502   1.00 62.08  ? 346 HIS A C     1 
ATOM   2127 O O     . HIS C 3 173 ? -20.510 -14.133 2.384   1.00 62.68  ? 346 HIS A O     1 
ATOM   2128 C CB    . HIS C 3 173 ? -22.342 -11.358 1.517   1.00 70.07  ? 346 HIS A CB    1 
ATOM   2129 C CG    . HIS C 3 173 ? -23.602 -10.582 1.743   1.00 81.40  ? 346 HIS A CG    1 
ATOM   2130 N ND1   . HIS C 3 173 ? -24.600 -10.490 0.795   1.00 88.54  ? 346 HIS A ND1   1 
ATOM   2131 C CD2   . HIS C 3 173 ? -24.026 -9.860  2.809   1.00 98.20  ? 346 HIS A CD2   1 
ATOM   2132 C CE1   . HIS C 3 173 ? -25.585 -9.745  1.267   1.00 97.21  ? 346 HIS A CE1   1 
ATOM   2133 N NE2   . HIS C 3 173 ? -25.262 -9.351  2.487   1.00 103.80 ? 346 HIS A NE2   1 
ATOM   2134 N N     . LYS C 3 174 ? -20.761 -13.486 0.234   1.00 57.04  ? 347 LYS A N     1 
ATOM   2135 C CA    . LYS C 3 174 ? -19.530 -14.092 -0.253  1.00 56.49  ? 347 LYS A CA    1 
ATOM   2136 C C     . LYS C 3 174 ? -18.459 -13.023 -0.438  1.00 56.37  ? 347 LYS A C     1 
ATOM   2137 O O     . LYS C 3 174 ? -18.271 -12.509 -1.542  1.00 57.88  ? 347 LYS A O     1 
ATOM   2138 C CB    . LYS C 3 174 ? -19.784 -14.800 -1.589  1.00 58.28  ? 347 LYS A CB    1 
ATOM   2139 C CG    . LYS C 3 174 ? -18.902 -16.020 -1.845  1.00 62.66  ? 347 LYS A CG    1 
ATOM   2140 C CD    . LYS C 3 174 ? -18.550 -16.147 -3.324  1.00 69.28  ? 347 LYS A CD    1 
ATOM   2141 C CE    . LYS C 3 174 ? -19.197 -17.376 -3.956  1.00 63.89  ? 347 LYS A CE    1 
ATOM   2142 N NZ    . LYS C 3 174 ? -18.767 -17.567 -5.374  1.00 61.67  ? 347 LYS A NZ    1 
ATOM   2143 N N     . GLU C 3 175 ? -17.762 -12.690 0.645   1.00 53.12  ? 348 GLU A N     1 
ATOM   2144 C CA    . GLU C 3 175 ? -16.700 -11.687 0.596   1.00 48.00  ? 348 GLU A CA    1 
ATOM   2145 C C     . GLU C 3 175 ? -15.370 -12.312 0.188   1.00 47.74  ? 348 GLU A C     1 
ATOM   2146 O O     . GLU C 3 175 ? -15.091 -13.466 0.515   1.00 53.02  ? 348 GLU A O     1 
ATOM   2147 C CB    . GLU C 3 175 ? -16.562 -10.985 1.946   1.00 43.98  ? 348 GLU A CB    1 
ATOM   2148 C CG    . GLU C 3 175 ? -17.869 -10.445 2.501   1.00 60.89  ? 348 GLU A CG    1 
ATOM   2149 C CD    . GLU C 3 175 ? -17.855 -8.939  2.649   1.00 73.82  ? 348 GLU A CD    1 
ATOM   2150 O OE1   . GLU C 3 175 ? -17.951 -8.451  3.795   1.00 88.82  ? 348 GLU A OE1   1 
ATOM   2151 O OE2   . GLU C 3 175 ? -17.746 -8.242  1.619   1.00 88.27  ? 348 GLU A OE2   1 
ATOM   2152 N N     . ARG C 3 176 ? -14.554 -11.544 -0.528  1.00 44.44  ? 349 ARG A N     1 
ATOM   2153 C CA    . ARG C 3 176 ? -13.276 -12.041 -1.030  1.00 44.61  ? 349 ARG A CA    1 
ATOM   2154 C C     . ARG C 3 176 ? -12.166 -12.007 0.027   1.00 49.81  ? 349 ARG A C     1 
ATOM   2155 O O     . ARG C 3 176 ? -12.117 -11.111 0.873   1.00 51.29  ? 349 ARG A O     1 
ATOM   2156 C CB    . ARG C 3 176 ? -12.852 -11.254 -2.273  1.00 41.52  ? 349 ARG A CB    1 
ATOM   2157 C CG    . ARG C 3 176 ? -11.345 -11.112 -2.446  1.00 55.25  ? 349 ARG A CG    1 
ATOM   2158 C CD    . ARG C 3 176 ? -10.694 -12.232 -3.244  1.00 56.17  ? 349 ARG A CD    1 
ATOM   2159 N NE    . ARG C 3 176 ? -10.224 -11.769 -4.549  1.00 67.25  ? 349 ARG A NE    1 
ATOM   2160 C CZ    . ARG C 3 176 ? -8.976  -11.402 -4.805  1.00 56.18  ? 349 ARG A CZ    1 
ATOM   2161 N NH1   . ARG C 3 176 ? -8.060  -11.441 -3.844  1.00 68.72  ? 349 ARG A NH1   1 
ATOM   2162 N NH2   . ARG C 3 176 ? -8.642  -10.995 -6.025  1.00 54.89  ? 349 ARG A NH2   1 
ATOM   2163 N N     . ILE C 3 177 ? -11.279 -12.998 -0.029  1.00 49.21  ? 350 ILE A N     1 
ATOM   2164 C CA    . ILE C 3 177 ? -10.138 -13.067 0.872   1.00 40.66  ? 350 ILE A CA    1 
ATOM   2165 C C     . ILE C 3 177 ? -8.954  -12.369 0.223   1.00 47.73  ? 350 ILE A C     1 
ATOM   2166 O O     . ILE C 3 177 ? -8.729  -12.510 -0.980  1.00 52.02  ? 350 ILE A O     1 
ATOM   2167 C CB    . ILE C 3 177 ? -9.789  -14.534 1.178   1.00 37.55  ? 350 ILE A CB    1 
ATOM   2168 C CG1   . ILE C 3 177 ? -10.972 -15.237 1.847   1.00 31.58  ? 350 ILE A CG1   1 
ATOM   2169 C CG2   . ILE C 3 177 ? -8.569  -14.620 2.070   1.00 53.79  ? 350 ILE A CG2   1 
ATOM   2170 N N     . ALA C 3 178 ? -8.198  -11.618 1.021   1.00 52.68  ? 351 ALA A N     1 
ATOM   2171 C CA    . ALA C 3 178 ? -7.049  -10.875 0.515   1.00 53.99  ? 351 ALA A CA    1 
ATOM   2172 C C     . ALA C 3 178 ? -5.883  -11.796 0.167   1.00 60.27  ? 351 ALA A C     1 
ATOM   2173 O O     . ALA C 3 178 ? -5.728  -12.213 -0.982  1.00 65.84  ? 351 ALA A O     1 
ATOM   2174 C CB    . ALA C 3 178 ? -6.614  -9.826  1.523   1.00 52.86  ? 351 ALA A CB    1 
ATOM   2175 N N     . ASN C 3 179 ? -5.064  -12.102 1.167   1.00 65.03  ? 352 ASN A N     1 
ATOM   2176 C CA    . ASN C 3 179 ? -3.887  -12.944 0.977   1.00 62.30  ? 352 ASN A CA    1 
ATOM   2177 C C     . ASN C 3 179 ? -4.194  -14.402 1.291   1.00 58.08  ? 352 ASN A C     1 
ATOM   2178 O O     . ASN C 3 179 ? -3.778  -14.922 2.327   1.00 53.74  ? 352 ASN A O     1 
ATOM   2179 C CB    . ASN C 3 179 ? -2.738  -12.448 1.859   1.00 60.84  ? 352 ASN A CB    1 
ATOM   2180 C CG    . ASN C 3 179 ? -3.182  -12.151 3.285   1.00 63.14  ? 352 ASN A CG    1 
ATOM   2181 O OD1   . ASN C 3 179 ? -3.915  -11.195 3.536   1.00 69.48  ? 352 ASN A OD1   1 
ATOM   2182 N ND2   . ASN C 3 179 ? -2.740  -12.975 4.225   1.00 57.75  ? 352 ASN A ND2   1 
ATOM   2183 N N     . PHE C 3 180 ? -4.923  -15.060 0.394   1.00 54.43  ? 353 PHE A N     1 
ATOM   2184 C CA    . PHE C 3 180 ? -5.330  -16.445 0.621   1.00 51.39  ? 353 PHE A CA    1 
ATOM   2185 C C     . PHE C 3 180 ? -4.187  -17.441 0.423   1.00 46.03  ? 353 PHE A C     1 
ATOM   2186 O O     . PHE C 3 180 ? -4.264  -18.583 0.878   1.00 36.17  ? 353 PHE A O     1 
ATOM   2187 C CB    . PHE C 3 180 ? -6.540  -16.816 -0.245  1.00 54.08  ? 353 PHE A CB    1 
ATOM   2188 C CG    . PHE C 3 180 ? -6.321  -16.633 -1.724  1.00 65.29  ? 353 PHE A CG    1 
ATOM   2189 C CD1   . PHE C 3 180 ? -6.649  -15.433 -2.344  1.00 74.19  ? 353 PHE A CD1   1 
ATOM   2190 C CD2   . PHE C 3 180 ? -5.812  -17.667 -2.498  1.00 42.40  ? 353 PHE A CD2   1 
ATOM   2191 C CE1   . PHE C 3 180 ? -6.461  -15.263 -3.708  1.00 76.88  ? 353 PHE A CE1   1 
ATOM   2192 C CE2   . PHE C 3 180 ? -5.621  -17.502 -3.861  1.00 75.31  ? 353 PHE A CE2   1 
ATOM   2193 C CZ    . PHE C 3 180 ? -5.947  -16.298 -4.467  1.00 84.67  ? 353 PHE A CZ    1 
ATOM   2194 N N     . LYS C 3 181 ? -3.131  -17.000 -0.255  1.00 44.98  ? 354 LYS A N     1 
ATOM   2195 C CA    . LYS C 3 181 ? -1.947  -17.830 -0.449  1.00 35.04  ? 354 LYS A CA    1 
ATOM   2196 C C     . LYS C 3 181 ? -1.004  -17.678 0.737   1.00 42.69  ? 354 LYS A C     1 
ATOM   2197 O O     . LYS C 3 181 ? -0.624  -16.566 1.101   1.00 50.62  ? 354 LYS A O     1 
ATOM   2198 C CB    . LYS C 3 181 ? -1.227  -17.453 -1.744  1.00 29.00  ? 354 LYS A CB    1 
ATOM   2199 C CG    . LYS C 3 181 ? -1.732  -18.187 -2.982  1.00 23.22  ? 354 LYS A CG    1 
ATOM   2200 C CD    . LYS C 3 181 ? -1.702  -17.277 -4.210  1.00 40.83  ? 354 LYS A CD    1 
ATOM   2201 C CE    . LYS C 3 181 ? -1.415  -18.064 -5.482  1.00 48.02  ? 354 LYS A CE    1 
ATOM   2202 N NZ    . LYS C 3 181 ? -0.483  -17.340 -6.398  1.00 57.43  ? 354 LYS A NZ    1 
ATOM   2203 N N     . ILE C 3 182 ? -0.636  -18.806 1.339   1.00 49.82  ? 355 ILE A N     1 
ATOM   2204 C CA    . ILE C 3 182 ? 0.292   -18.826 2.467   1.00 44.48  ? 355 ILE A CA    1 
ATOM   2205 C C     . ILE C 3 182 ? 1.663   -18.259 2.080   1.00 51.19  ? 355 ILE A C     1 
ATOM   2206 O O     . ILE C 3 182 ? 2.038   -18.257 0.901   1.00 55.17  ? 355 ILE A O     1 
ATOM   2207 C CB    . ILE C 3 182 ? 0.416   -20.267 3.015   1.00 38.44  ? 355 ILE A CB    1 
ATOM   2208 C CG1   . ILE C 3 182 ? -0.267  -20.379 4.380   1.00 22.93  ? 355 ILE A CG1   1 
ATOM   2209 C CG2   . ILE C 3 182 ? 1.873   -20.705 3.091   1.00 55.50  ? 355 ILE A CG2   1 
ATOM   2210 N N     . GLU C 3 183 ? 2.398   -17.761 3.074   1.00 49.68  ? 356 GLU A N     1 
ATOM   2211 C CA    . GLU C 3 183 ? 3.733   -17.213 2.847   1.00 45.37  ? 356 GLU A CA    1 
ATOM   2212 C C     . GLU C 3 183 ? 4.725   -18.336 2.567   1.00 44.15  ? 356 GLU A C     1 
ATOM   2213 O O     . GLU C 3 183 ? 4.969   -19.188 3.418   1.00 48.48  ? 356 GLU A O     1 
ATOM   2214 C CB    . GLU C 3 183 ? 4.193   -16.412 4.064   1.00 44.97  ? 356 GLU A CB    1 
ATOM   2215 C CG    . GLU C 3 183 ? 4.342   -14.916 3.831   1.00 55.70  ? 356 GLU A CG    1 
ATOM   2216 C CD    . GLU C 3 183 ? 4.561   -14.149 5.125   1.00 71.85  ? 356 GLU A CD    1 
ATOM   2217 O OE1   . GLU C 3 183 ? 3.557   -13.733 5.742   1.00 73.44  ? 356 GLU A OE1   1 
ATOM   2218 O OE2   . GLU C 3 183 ? 5.732   -13.962 5.530   1.00 51.05  ? 356 GLU A OE2   1 
ATOM   2219 N N     . PRO C 3 184 ? 5.293   -18.341 1.369   1.00 45.03  ? 357 PRO A N     1 
ATOM   2220 C CA    . PRO C 3 184 ? 6.264   -19.370 0.986   1.00 41.91  ? 357 PRO A CA    1 
ATOM   2221 C C     . PRO C 3 184 ? 7.558   -19.203 1.775   1.00 42.24  ? 357 PRO A C     1 
ATOM   2222 O O     . PRO C 3 184 ? 7.832   -18.105 2.261   1.00 50.40  ? 357 PRO A O     1 
ATOM   2223 C CB    . PRO C 3 184 ? 6.507   -19.086 -0.504  1.00 41.49  ? 357 PRO A CB    1 
ATOM   2224 C CG    . PRO C 3 184 ? 5.393   -18.181 -0.922  1.00 46.60  ? 357 PRO A CG    1 
ATOM   2225 C CD    . PRO C 3 184 ? 5.057   -17.367 0.290   1.00 51.35  ? 357 PRO A CD    1 
ATOM   2226 N N     . PRO C 3 185 ? 8.337   -20.272 1.906   1.00 37.17  ? 358 PRO A N     1 
ATOM   2227 C CA    . PRO C 3 185 ? 9.625   -20.202 2.599   1.00 33.45  ? 358 PRO A CA    1 
ATOM   2228 C C     . PRO C 3 185 ? 10.633  -19.439 1.756   1.00 37.71  ? 358 PRO A C     1 
ATOM   2229 O O     . PRO C 3 185 ? 10.641  -19.597 0.532   1.00 47.51  ? 358 PRO A O     1 
ATOM   2230 C CB    . PRO C 3 185 ? 10.038  -21.668 2.699   1.00 32.94  ? 358 PRO A CB    1 
ATOM   2231 C CG    . PRO C 3 185 ? 9.374   -22.316 1.526   1.00 33.86  ? 358 PRO A CG    1 
ATOM   2232 C CD    . PRO C 3 185 ? 8.050   -21.627 1.400   1.00 40.08  ? 358 PRO A CD    1 
ATOM   2233 N N     . GLY C 3 186 ? 11.463  -18.620 2.395   1.00 29.65  ? 359 GLY A N     1 
ATOM   2234 C CA    . GLY C 3 186 ? 12.466  -17.860 1.674   1.00 34.39  ? 359 GLY A CA    1 
ATOM   2235 C C     . GLY C 3 186 ? 13.551  -17.309 2.575   1.00 33.30  ? 359 GLY A C     1 
ATOM   2236 O O     . GLY C 3 186 ? 14.025  -17.989 3.483   1.00 46.08  ? 359 GLY A O     1 
ATOM   2237 N N     . LEU C 3 187 ? 13.952  -16.072 2.313   1.00 29.39  ? 360 LEU A N     1 
ATOM   2238 C CA    . LEU C 3 187 ? 14.936  -15.404 3.147   1.00 35.33  ? 360 LEU A CA    1 
ATOM   2239 C C     . LEU C 3 187 ? 14.449  -14.008 3.519   1.00 33.63  ? 360 LEU A C     1 
ATOM   2240 O O     . LEU C 3 187 ? 14.268  -13.150 2.657   1.00 40.51  ? 360 LEU A O     1 
ATOM   2241 C CB    . LEU C 3 187 ? 16.294  -15.338 2.439   1.00 45.56  ? 360 LEU A CB    1 
ATOM   2242 C CG    . LEU C 3 187 ? 17.021  -16.666 2.195   1.00 38.70  ? 360 LEU A CG    1 
ATOM   2243 C CD1   . LEU C 3 187 ? 18.316  -16.441 1.424   1.00 20.86  ? 360 LEU A CD1   1 
ATOM   2244 C CD2   . LEU C 3 187 ? 17.295  -17.387 3.502   1.00 36.93  ? 360 LEU A CD2   1 
ATOM   2245 N N     . PHE C 3 188 ? 14.244  -13.795 4.813   1.00 29.92  ? 361 PHE A N     1 
ATOM   2246 C CA    . PHE C 3 188 ? 13.680  -12.555 5.333   1.00 34.80  ? 361 PHE A CA    1 
ATOM   2247 C C     . PHE C 3 188 ? 14.415  -11.329 4.812   1.00 41.21  ? 361 PHE A C     1 
ATOM   2248 O O     . PHE C 3 188 ? 15.602  -11.144 5.085   1.00 46.10  ? 361 PHE A O     1 
ATOM   2249 C CB    . PHE C 3 188 ? 13.699  -12.587 6.866   1.00 40.10  ? 361 PHE A CB    1 
ATOM   2250 C CG    . PHE C 3 188 ? 13.468  -11.253 7.511   1.00 24.12  ? 361 PHE A CG    1 
ATOM   2251 C CD1   . PHE C 3 188 ? 12.183  -10.753 7.661   1.00 8.17   ? 361 PHE A CD1   1 
ATOM   2252 C CD2   . PHE C 3 188 ? 14.536  -10.506 7.987   1.00 52.97  ? 361 PHE A CD2   1 
ATOM   2253 C CE1   . PHE C 3 188 ? 11.968  -9.527  8.264   1.00 37.97  ? 361 PHE A CE1   1 
ATOM   2254 C CE2   . PHE C 3 188 ? 14.328  -9.278  8.591   1.00 63.02  ? 361 PHE A CE2   1 
ATOM   2255 C CZ    . PHE C 3 188 ? 13.043  -8.788  8.730   1.00 49.55  ? 361 PHE A CZ    1 
ATOM   2256 N N     . ARG C 3 189 ? 13.702  -10.495 4.058   1.00 45.66  ? 362 ARG A N     1 
ATOM   2257 C CA    . ARG C 3 189 ? 14.280  -9.277  3.492   1.00 42.04  ? 362 ARG A CA    1 
ATOM   2258 C C     . ARG C 3 189 ? 14.028  -8.070  4.395   1.00 38.80  ? 362 ARG A C     1 
ATOM   2259 O O     . ARG C 3 189 ? 13.023  -7.375  4.255   1.00 38.90  ? 362 ARG A O     1 
ATOM   2260 C CB    . ARG C 3 189 ? 13.723  -9.016  2.090   1.00 39.44  ? 362 ARG A CB    1 
ATOM   2261 C CG    . ARG C 3 189 ? 14.157  -10.038 1.051   1.00 58.87  ? 362 ARG A CG    1 
ATOM   2262 C CD    . ARG C 3 189 ? 13.149  -10.264 -0.068  1.00 56.67  ? 362 ARG A CD    1 
ATOM   2263 N NE    . ARG C 3 189 ? 13.688  -9.878  -1.369  1.00 34.96  ? 362 ARG A NE    1 
ATOM   2264 C CZ    . ARG C 3 189 ? 13.851  -10.709 -2.390  1.00 53.95  ? 362 ARG A CZ    1 
ATOM   2265 N NH1   . ARG C 3 189 ? 13.516  -11.986 -2.271  1.00 77.51  ? 362 ARG A NH1   1 
ATOM   2266 N NH2   . ARG C 3 189 ? 14.351  -10.264 -3.537  1.00 76.75  ? 362 ARG A NH2   1 
ATOM   2267 N N     . GLY C 3 190 ? 14.951  -7.829  5.320   1.00 41.92  ? 363 GLY A N     1 
ATOM   2268 C CA    . GLY C 3 190 ? 14.822  -6.740  6.271   1.00 40.41  ? 363 GLY A CA    1 
ATOM   2269 C C     . GLY C 3 190 ? 15.088  -5.388  5.648   1.00 41.29  ? 363 GLY A C     1 
ATOM   2270 O O     . GLY C 3 190 ? 16.186  -5.126  5.164   1.00 45.02  ? 363 GLY A O     1 
ATOM   2271 N N     . ARG C 3 191 ? 14.073  -4.531  5.658   1.00 46.31  ? 364 ARG A N     1 
ATOM   2272 C CA    . ARG C 3 191 ? 14.196  -3.185  5.116   1.00 48.01  ? 364 ARG A CA    1 
ATOM   2273 C C     . ARG C 3 191 ? 15.122  -2.355  5.992   1.00 46.15  ? 364 ARG A C     1 
ATOM   2274 O O     . ARG C 3 191 ? 14.947  -2.290  7.206   1.00 38.54  ? 364 ARG A O     1 
ATOM   2275 C CB    . ARG C 3 191 ? 12.823  -2.514  5.032   1.00 52.50  ? 364 ARG A CB    1 
ATOM   2276 C CG    . ARG C 3 191 ? 11.876  -3.128  4.011   1.00 56.24  ? 364 ARG A CG    1 
ATOM   2277 C CD    . ARG C 3 191 ? 11.060  -2.102  3.234   1.00 65.13  ? 364 ARG A CD    1 
ATOM   2278 N NE    . ARG C 3 191 ? 9.628   -2.191  3.517   1.00 64.97  ? 364 ARG A NE    1 
ATOM   2279 C CZ    . ARG C 3 191 ? 8.735   -2.721  2.689   1.00 64.72  ? 364 ARG A CZ    1 
ATOM   2280 N NH1   . ARG C 3 191 ? 9.123   -3.215  1.520   1.00 65.43  ? 364 ARG A NH1   1 
ATOM   2281 N NH2   . ARG C 3 191 ? 7.451   -2.759  3.026   1.00 41.20  ? 364 ARG A NH2   1 
ATOM   2282 N N     . GLY C 3 192 ? 16.110  -1.722  5.370   1.00 54.84  ? 365 GLY A N     1 
ATOM   2283 C CA    . GLY C 3 192 ? 17.048  -0.885  6.095   1.00 56.04  ? 365 GLY A CA    1 
ATOM   2284 C C     . GLY C 3 192 ? 18.116  -1.695  6.800   1.00 55.96  ? 365 GLY A C     1 
ATOM   2285 O O     . GLY C 3 192 ? 18.464  -2.790  6.359   1.00 53.81  ? 365 GLY A O     1 
ATOM   2286 N N     . ASN C 3 193 ? 18.634  -1.156  7.900   1.00 61.17  ? 366 ASN A N     1 
ATOM   2287 C CA    . ASN C 3 193 ? 19.706  -1.810  8.647   1.00 64.49  ? 366 ASN A CA    1 
ATOM   2288 C C     . ASN C 3 193 ? 19.202  -2.880  9.611   1.00 64.61  ? 366 ASN A C     1 
ATOM   2289 O O     . ASN C 3 193 ? 19.410  -2.782  10.820  1.00 74.31  ? 366 ASN A O     1 
ATOM   2290 C CB    . ASN C 3 193 ? 20.525  -0.773  9.416   1.00 60.25  ? 366 ASN A CB    1 
ATOM   2291 C CG    . ASN C 3 193 ? 21.952  -1.217  9.644   1.00 65.85  ? 366 ASN A CG    1 
ATOM   2292 O OD1   . ASN C 3 193 ? 22.240  -1.975  10.571  1.00 64.86  ? 366 ASN A OD1   1 
ATOM   2293 N ND2   . ASN C 3 193 ? 22.858  -0.750  8.795   1.00 89.26  ? 366 ASN A ND2   1 
ATOM   2294 N N     . HIS C 3 194 ? 18.549  -3.903  9.072   1.00 59.46  ? 367 HIS A N     1 
ATOM   2295 C CA    . HIS C 3 194 ? 17.944  -4.941  9.898   1.00 56.22  ? 367 HIS A CA    1 
ATOM   2296 C C     . HIS C 3 194 ? 18.934  -6.046  10.217  1.00 53.23  ? 367 HIS A C     1 
ATOM   2297 O O     . HIS C 3 194 ? 19.437  -6.715  9.317   1.00 59.55  ? 367 HIS A O     1 
ATOM   2298 C CB    . HIS C 3 194 ? 16.716  -5.532  9.205   1.00 61.16  ? 367 HIS A CB    1 
ATOM   2299 C CG    . HIS C 3 194 ? 15.685  -6.058  10.154  1.00 56.40  ? 367 HIS A CG    1 
ATOM   2300 N ND1   . HIS C 3 194 ? 14.345  -5.757  10.039  1.00 59.19  ? 367 HIS A ND1   1 
ATOM   2301 C CD2   . HIS C 3 194 ? 15.800  -6.861  11.238  1.00 45.49  ? 367 HIS A CD2   1 
ATOM   2302 C CE1   . HIS C 3 194 ? 13.678  -6.353  11.011  1.00 62.60  ? 367 HIS A CE1   1 
ATOM   2303 N NE2   . HIS C 3 194 ? 14.537  -7.030  11.752  1.00 52.59  ? 367 HIS A NE2   1 
ATOM   2304 N N     . PRO C 3 195 ? 19.204  -6.238  11.504  1.00 52.62  ? 368 PRO A N     1 
ATOM   2305 C CA    . PRO C 3 195 ? 20.128  -7.281  11.963  1.00 56.72  ? 368 PRO A CA    1 
ATOM   2306 C C     . PRO C 3 195 ? 19.569  -8.695  11.808  1.00 53.21  ? 368 PRO A C     1 
ATOM   2307 O O     . PRO C 3 195 ? 20.149  -9.637  12.350  1.00 56.26  ? 368 PRO A O     1 
ATOM   2308 C CB    . PRO C 3 195 ? 20.314  -6.950  13.448  1.00 55.93  ? 368 PRO A CB    1 
ATOM   2309 C CG    . PRO C 3 195 ? 19.068  -6.244  13.829  1.00 60.08  ? 368 PRO A CG    1 
ATOM   2310 C CD    . PRO C 3 195 ? 18.651  -5.453  12.621  1.00 53.79  ? 368 PRO A CD    1 
ATOM   2311 N N     . LYS C 3 196 ? 18.468  -8.841  11.077  1.00 50.47  ? 369 LYS A N     1 
ATOM   2312 C CA    . LYS C 3 196 ? 17.842  -10.149 10.894  1.00 47.75  ? 369 LYS A CA    1 
ATOM   2313 C C     . LYS C 3 196 ? 17.782  -10.567 9.429   1.00 45.60  ? 369 LYS A C     1 
ATOM   2314 O O     . LYS C 3 196 ? 17.472  -11.716 9.118   1.00 45.72  ? 369 LYS A O     1 
ATOM   2315 C CB    . LYS C 3 196 ? 16.435  -10.160 11.492  1.00 38.76  ? 369 LYS A CB    1 
ATOM   2316 C CG    . LYS C 3 196 ? 16.406  -10.072 13.008  1.00 51.21  ? 369 LYS A CG    1 
ATOM   2317 C CD    . LYS C 3 196 ? 16.495  -11.449 13.639  1.00 51.76  ? 369 LYS A CD    1 
ATOM   2318 C CE    . LYS C 3 196 ? 16.310  -11.370 15.142  1.00 62.22  ? 369 LYS A CE    1 
ATOM   2319 N NZ    . LYS C 3 196 ? 14.877  -11.182 15.506  1.00 51.25  ? 369 LYS A NZ    1 
ATOM   2320 N N     . MET C 3 197 ? 18.076  -9.632  8.533   1.00 44.65  ? 370 MET A N     1 
ATOM   2321 C CA    . MET C 3 197 ? 18.002  -9.904  7.103   1.00 35.19  ? 370 MET A CA    1 
ATOM   2322 C C     . MET C 3 197 ? 18.836  -11.126 6.748   1.00 36.57  ? 370 MET A C     1 
ATOM   2323 O O     . MET C 3 197 ? 19.915  -11.333 7.301   1.00 36.60  ? 370 MET A O     1 
ATOM   2324 C CB    . MET C 3 197 ? 18.454  -8.685  6.297   1.00 34.44  ? 370 MET A CB    1 
ATOM   2325 C CG    . MET C 3 197 ? 19.944  -8.389  6.372   1.00 31.58  ? 370 MET A CG    1 
ATOM   2326 S SD    . MET C 3 197 ? 20.443  -7.129  5.182   1.00 57.14  ? 370 MET A SD    1 
ATOM   2327 C CE    . MET C 3 197 ? 20.270  -5.651  6.176   1.00 53.63  ? 370 MET A CE    1 
ATOM   2328 N N     . GLY C 3 198 ? 18.319  -11.944 5.838   1.00 39.70  ? 371 GLY A N     1 
ATOM   2329 C CA    . GLY C 3 198 ? 19.008  -13.151 5.422   1.00 35.31  ? 371 GLY A CA    1 
ATOM   2330 C C     . GLY C 3 198 ? 18.574  -14.395 6.176   1.00 30.17  ? 371 GLY A C     1 
ATOM   2331 O O     . GLY C 3 198 ? 18.746  -15.513 5.691   1.00 26.16  ? 371 GLY A O     1 
ATOM   2332 N N     . MET C 3 199 ? 18.018  -14.211 7.367   1.00 21.53  ? 372 MET A N     1 
ATOM   2333 C CA    . MET C 3 199 ? 17.575  -15.351 8.153   1.00 32.68  ? 372 MET A CA    1 
ATOM   2334 C C     . MET C 3 199 ? 16.563  -16.178 7.362   1.00 43.38  ? 372 MET A C     1 
ATOM   2335 O O     . MET C 3 199 ? 15.805  -15.637 6.552   1.00 40.58  ? 372 MET A O     1 
ATOM   2336 C CB    . MET C 3 199 ? 16.978  -14.894 9.484   1.00 32.42  ? 372 MET A CB    1 
ATOM   2337 C CG    . MET C 3 199 ? 18.001  -14.726 10.590  1.00 39.35  ? 372 MET A CG    1 
ATOM   2338 S SD    . MET C 3 199 ? 17.237  -14.468 12.195  1.00 41.60  ? 372 MET A SD    1 
ATOM   2339 C CE    . MET C 3 199 ? 18.328  -15.439 13.238  1.00 65.68  ? 372 MET A CE    1 
ATOM   2340 N N     . LEU C 3 200 ? 16.561  -17.487 7.599   1.00 48.73  ? 373 LEU A N     1 
ATOM   2341 C CA    . LEU C 3 200 ? 15.699  -18.399 6.854   1.00 46.83  ? 373 LEU A CA    1 
ATOM   2342 C C     . LEU C 3 200 ? 14.256  -18.322 7.316   1.00 42.92  ? 373 LEU A C     1 
ATOM   2343 O O     . LEU C 3 200 ? 13.969  -18.427 8.510   1.00 38.04  ? 373 LEU A O     1 
ATOM   2344 C CB    . LEU C 3 200 ? 16.199  -19.839 6.973   1.00 56.79  ? 373 LEU A CB    1 
ATOM   2345 C CG    . LEU C 3 200 ? 15.248  -20.928 6.471   1.00 56.41  ? 373 LEU A CG    1 
ATOM   2346 C CD1   . LEU C 3 200 ? 15.402  -21.117 4.972   1.00 37.73  ? 373 LEU A CD1   1 
ATOM   2347 C CD2   . LEU C 3 200 ? 15.484  -22.235 7.213   1.00 170.15 ? 373 LEU A CD2   1 
ATOM   2348 N N     . LYS C 3 201 ? 13.356  -18.137 6.353   1.00 44.59  ? 374 LYS A N     1 
ATOM   2349 C CA    . LYS C 3 201 ? 11.920  -18.163 6.600   1.00 45.78  ? 374 LYS A CA    1 
ATOM   2350 C C     . LYS C 3 201 ? 11.425  -19.585 6.373   1.00 46.95  ? 374 LYS A C     1 
ATOM   2351 O O     . LYS C 3 201 ? 11.461  -20.089 5.252   1.00 49.31  ? 374 LYS A O     1 
ATOM   2352 C CB    . LYS C 3 201 ? 11.207  -17.197 5.652   1.00 43.46  ? 374 LYS A CB    1 
ATOM   2353 C CG    . LYS C 3 201 ? 9.996   -16.508 6.253   1.00 39.09  ? 374 LYS A CG    1 
ATOM   2354 C CD    . LYS C 3 201 ? 9.794   -15.118 5.660   1.00 38.47  ? 374 LYS A CD    1 
ATOM   2355 C CE    . LYS C 3 201 ? 9.318   -15.180 4.215   1.00 38.19  ? 374 LYS A CE    1 
ATOM   2356 N NZ    . LYS C 3 201 ? 8.160   -14.275 3.980   1.00 54.90  ? 374 LYS A NZ    1 
ATOM   2357 N N     . ARG C 3 202 ? 10.974  -20.236 7.440   1.00 47.35  ? 375 ARG A N     1 
ATOM   2358 C CA    . ARG C 3 202 ? 10.601  -21.647 7.370   1.00 49.58  ? 375 ARG A CA    1 
ATOM   2359 C C     . ARG C 3 202 ? 9.357   -21.880 6.525   1.00 48.46  ? 375 ARG A C     1 
ATOM   2360 O O     . ARG C 3 202 ? 8.507   -20.999 6.393   1.00 58.17  ? 375 ARG A O     1 
ATOM   2361 C CB    . ARG C 3 202 ? 10.385  -22.219 8.775   1.00 50.16  ? 375 ARG A CB    1 
ATOM   2362 C CG    . ARG C 3 202 ? 9.179   -21.638 9.487   1.00 64.89  ? 375 ARG A CG    1 
ATOM   2363 C CD    . ARG C 3 202 ? 8.667   -22.456 10.659  1.00 85.44  ? 375 ARG A CD    1 
ATOM   2364 N NE    . ARG C 3 202 ? 7.220   -22.308 10.820  1.00 107.53 ? 375 ARG A NE    1 
ATOM   2365 C CZ    . ARG C 3 202 ? 6.612   -21.186 11.199  1.00 109.37 ? 375 ARG A CZ    1 
ATOM   2366 N NH1   . ARG C 3 202 ? 7.318   -20.095 11.470  1.00 102.25 ? 375 ARG A NH1   1 
ATOM   2367 N NH2   . ARG C 3 202 ? 5.291   -21.155 11.313  1.00 101.62 ? 375 ARG A NH2   1 
ATOM   2368 N N     . ARG C 3 203 ? 9.263   -23.074 5.949   1.00 52.50  ? 376 ARG A N     1 
ATOM   2369 C CA    . ARG C 3 203 ? 8.069   -23.490 5.226   1.00 53.81  ? 376 ARG A CA    1 
ATOM   2370 C C     . ARG C 3 203 ? 6.972   -23.817 6.227   1.00 53.45  ? 376 ARG A C     1 
ATOM   2371 O O     . ARG C 3 203 ? 7.131   -24.710 7.064   1.00 45.82  ? 376 ARG A O     1 
ATOM   2372 C CB    . ARG C 3 203 ? 8.366   -24.713 4.357   1.00 57.21  ? 376 ARG A CB    1 
ATOM   2373 C CG    . ARG C 3 203 ? 7.135   -25.367 3.750   1.00 49.82  ? 376 ARG A CG    1 
ATOM   2374 C CD    . ARG C 3 203 ? 7.417   -26.151 2.480   1.00 33.38  ? 376 ARG A CD    1 
ATOM   2375 N NE    . ARG C 3 203 ? 7.763   -25.272 1.368   1.00 39.52  ? 376 ARG A NE    1 
ATOM   2376 C CZ    . ARG C 3 203 ? 7.510   -25.546 0.097   1.00 68.98  ? 376 ARG A CZ    1 
ATOM   2377 N NH1   . ARG C 3 203 ? 6.906   -26.681 -0.230  1.00 75.60  ? 376 ARG A NH1   1 
ATOM   2378 N NH2   . ARG C 3 203 ? 7.860   -24.688 -0.852  1.00 77.22  ? 376 ARG A NH2   1 
ATOM   2379 N N     . ILE C 3 204 ? 5.863   -23.089 6.137   1.00 57.16  ? 377 ILE A N     1 
ATOM   2380 C CA    . ILE C 3 204 ? 4.786   -23.212 7.116   1.00 54.48  ? 377 ILE A CA    1 
ATOM   2381 C C     . ILE C 3 204 ? 3.823   -24.347 6.780   1.00 53.10  ? 377 ILE A C     1 
ATOM   2382 O O     . ILE C 3 204 ? 3.149   -24.323 5.749   1.00 49.02  ? 377 ILE A O     1 
ATOM   2383 C CB    . ILE C 3 204 ? 4.030   -21.872 7.258   1.00 51.28  ? 377 ILE A CB    1 
ATOM   2384 C CG1   . ILE C 3 204 ? 4.989   -20.772 7.728   1.00 28.01  ? 377 ILE A CG1   1 
ATOM   2385 C CG2   . ILE C 3 204 ? 2.868   -22.016 8.228   1.00 29.49  ? 377 ILE A CG2   1 
ATOM   2386 N N     . MET C 3 205 ? 3.776   -25.342 7.663   1.00 46.32  ? 378 MET A N     1 
ATOM   2387 C CA    . MET C 3 205 ? 2.905   -26.499 7.492   1.00 45.54  ? 378 MET A CA    1 
ATOM   2388 C C     . MET C 3 205 ? 1.543   -26.243 8.141   1.00 46.68  ? 378 MET A C     1 
ATOM   2389 O O     . MET C 3 205 ? 1.367   -25.249 8.849   1.00 53.23  ? 378 MET A O     1 
ATOM   2390 C CB    . MET C 3 205 ? 3.556   -27.744 8.102   1.00 41.72  ? 378 MET A CB    1 
ATOM   2391 C CG    . MET C 3 205 ? 4.884   -28.147 7.471   1.00 37.14  ? 378 MET A CG    1 
ATOM   2392 S SD    . MET C 3 205 ? 4.838   -28.244 5.673   1.00 64.10  ? 378 MET A SD    1 
ATOM   2393 C CE    . MET C 3 205 ? 3.788   -29.670 5.421   1.00 59.98  ? 378 MET A CE    1 
ATOM   2394 N N     . PRO C 3 206 ? 0.580   -27.131 7.902   1.00 36.37  ? 379 PRO A N     1 
ATOM   2395 C CA    . PRO C 3 206 ? -0.749  -27.006 8.506   1.00 37.29  ? 379 PRO A CA    1 
ATOM   2396 C C     . PRO C 3 206 ? -0.689  -27.149 10.024  1.00 38.94  ? 379 PRO A C     1 
ATOM   2397 O O     . PRO C 3 206 ? -1.522  -26.588 10.739  1.00 43.57  ? 379 PRO A O     1 
ATOM   2398 C CB    . PRO C 3 206 ? -1.523  -28.181 7.900   1.00 29.56  ? 379 PRO A CB    1 
ATOM   2399 C CG    . PRO C 3 206 ? -0.747  -28.575 6.704   1.00 43.50  ? 379 PRO A CG    1 
ATOM   2400 C CD    . PRO C 3 206 ? 0.682   -28.315 7.035   1.00 39.49  ? 379 PRO A CD    1 
ATOM   2401 N N     . GLU C 3 207 ? 0.294   -27.896 10.509  1.00 33.20  ? 380 GLU A N     1 
ATOM   2402 C CA    . GLU C 3 207 ? 0.438   -28.113 11.937  1.00 39.25  ? 380 GLU A CA    1 
ATOM   2403 C C     . GLU C 3 207 ? 0.750   -26.798 12.646  1.00 49.94  ? 380 GLU A C     1 
ATOM   2404 O O     . GLU C 3 207 ? 0.737   -26.725 13.876  1.00 54.30  ? 380 GLU A O     1 
ATOM   2405 C CB    . GLU C 3 207 ? 1.525   -29.152 12.206  1.00 37.79  ? 380 GLU A CB    1 
ATOM   2406 C CG    . GLU C 3 207 ? 1.041   -30.592 12.117  1.00 40.30  ? 380 GLU A CG    1 
ATOM   2407 C CD    . GLU C 3 207 ? 0.879   -31.079 10.683  1.00 74.78  ? 380 GLU A CD    1 
ATOM   2408 O OE1   . GLU C 3 207 ? 0.878   -32.313 10.470  1.00 86.61  ? 380 GLU A OE1   1 
ATOM   2409 O OE2   . GLU C 3 207 ? 0.746   -30.238 9.767   1.00 79.30  ? 380 GLU A OE2   1 
ATOM   2410 N N     . ASP C 3 208 ? 1.024   -25.762 11.857  1.00 54.39  ? 381 ASP A N     1 
ATOM   2411 C CA    . ASP C 3 208 ? 1.312   -24.435 12.389  1.00 60.09  ? 381 ASP A CA    1 
ATOM   2412 C C     . ASP C 3 208 ? 0.123   -23.508 12.176  1.00 65.13  ? 381 ASP A C     1 
ATOM   2413 O O     . ASP C 3 208 ? -0.043  -22.516 12.887  1.00 73.22  ? 381 ASP A O     1 
ATOM   2414 C CB    . ASP C 3 208 ? 2.544   -23.835 11.706  1.00 59.01  ? 381 ASP A CB    1 
ATOM   2415 C CG    . ASP C 3 208 ? 3.756   -24.738 11.791  1.00 63.51  ? 381 ASP A CG    1 
ATOM   2416 O OD1   . ASP C 3 208 ? 4.374   -25.003 10.737  1.00 70.61  ? 381 ASP A OD1   1 
ATOM   2417 O OD2   . ASP C 3 208 ? 4.168   -25.225 12.863  1.00 69.30  ? 381 ASP A OD2   1 
ATOM   2418 N N     . ILE C 3 209 ? -0.699  -23.839 11.186  1.00 60.16  ? 382 ILE A N     1 
ATOM   2419 C CA    . ILE C 3 209 ? -1.822  -22.995 10.799  1.00 46.49  ? 382 ILE A CA    1 
ATOM   2420 C C     . ILE C 3 209 ? -2.988  -23.090 11.783  1.00 42.82  ? 382 ILE A C     1 
ATOM   2421 O O     . ILE C 3 209 ? -3.542  -24.167 12.007  1.00 44.41  ? 382 ILE A O     1 
ATOM   2422 C CB    . ILE C 3 209 ? -2.280  -23.360 9.371   1.00 43.19  ? 382 ILE A CB    1 
ATOM   2423 C CG1   . ILE C 3 209 ? -1.401  -22.656 8.334   1.00 24.10  ? 382 ILE A CG1   1 
ATOM   2424 C CG2   . ILE C 3 209 ? -3.738  -23.005 9.167   1.00 44.11  ? 382 ILE A CG2   1 
ATOM   2425 N N     . ILE C 3 210 ? -3.341  -21.953 12.378  1.00 41.34  ? 383 ILE A N     1 
ATOM   2426 C CA    . ILE C 3 210 ? -4.521  -21.857 13.234  1.00 37.47  ? 383 ILE A CA    1 
ATOM   2427 C C     . ILE C 3 210 ? -5.725  -21.432 12.393  1.00 31.73  ? 383 ILE A C     1 
ATOM   2428 O O     . ILE C 3 210 ? -5.604  -20.571 11.523  1.00 27.84  ? 383 ILE A O     1 
ATOM   2429 C CB    . ILE C 3 210 ? -4.281  -20.844 14.376  1.00 37.58  ? 383 ILE A CB    1 
ATOM   2430 C CG1   . ILE C 3 210 ? -3.217  -21.365 15.351  1.00 25.72  ? 383 ILE A CG1   1 
ATOM   2431 C CG2   . ILE C 3 210 ? -5.580  -20.542 15.106  1.00 39.21  ? 383 ILE A CG2   1 
ATOM   2432 N N     . ILE C 3 211 ? -6.882  -22.036 12.648  1.00 31.68  ? 384 ILE A N     1 
ATOM   2433 C CA    . ILE C 3 211 ? -8.075  -21.743 11.859  1.00 29.86  ? 384 ILE A CA    1 
ATOM   2434 C C     . ILE C 3 211 ? -9.170  -21.044 12.659  1.00 36.00  ? 384 ILE A C     1 
ATOM   2435 O O     . ILE C 3 211 ? -9.468  -21.423 13.791  1.00 48.40  ? 384 ILE A O     1 
ATOM   2436 C CB    . ILE C 3 211 ? -8.634  -23.023 11.227  1.00 20.15  ? 384 ILE A CB    1 
ATOM   2437 C CG1   . ILE C 3 211 ? -7.725  -23.502 10.092  1.00 33.63  ? 384 ILE A CG1   1 
ATOM   2438 C CG2   . ILE C 3 211 ? -10.033 -22.777 10.703  1.00 25.93  ? 384 ILE A CG2   1 
ATOM   2439 N N     . ASN C 3 212 ? -9.767  -20.021 12.057  1.00 36.61  ? 385 ASN A N     1 
ATOM   2440 C CA    . ASN C 3 212 ? -10.911 -19.341 12.650  1.00 38.31  ? 385 ASN A CA    1 
ATOM   2441 C C     . ASN C 3 212 ? -12.158 -19.473 11.777  1.00 52.66  ? 385 ASN A C     1 
ATOM   2442 O O     . ASN C 3 212 ? -12.122 -19.205 10.567  1.00 55.06  ? 385 ASN A O     1 
ATOM   2443 C CB    . ASN C 3 212 ? -10.599 -17.867 12.906  1.00 29.25  ? 385 ASN A CB    1 
ATOM   2444 C CG    . ASN C 3 212 ? -11.509 -17.254 13.951  1.00 39.73  ? 385 ASN A CG    1 
ATOM   2445 O OD1   . ASN C 3 212 ? -12.458 -17.886 14.408  1.00 76.82  ? 385 ASN A OD1   1 
ATOM   2446 N ND2   . ASN C 3 212 ? -11.220 -16.016 14.337  1.00 45.68  ? 385 ASN A ND2   1 
ATOM   2447 N N     . CYS C 3 213 ? -13.251 -19.906 12.403  1.00 62.13  ? 386 CYS A N     1 
ATOM   2448 C CA    . CYS C 3 213 ? -14.552 -20.023 11.749  1.00 65.58  ? 386 CYS A CA    1 
ATOM   2449 C C     . CYS C 3 213 ? -15.640 -20.165 12.815  1.00 69.53  ? 386 CYS A C     1 
ATOM   2450 O O     . CYS C 3 213 ? -15.333 -20.402 13.985  1.00 63.72  ? 386 CYS A O     1 
ATOM   2451 C CB    . CYS C 3 213 ? -14.577 -21.205 10.773  1.00 60.72  ? 386 CYS A CB    1 
ATOM   2452 S SG    . CYS C 3 213 ? -14.636 -22.835 11.550  1.00 63.06  ? 386 CYS A SG    1 
ATOM   2453 N N     . SER C 3 214 ? -16.904 -20.016 12.414  1.00 72.76  ? 387 SER A N     1 
ATOM   2454 C CA    . SER C 3 214 ? -18.018 -20.043 13.366  1.00 74.27  ? 387 SER A CA    1 
ATOM   2455 C C     . SER C 3 214 ? -18.384 -21.457 13.832  1.00 70.51  ? 387 SER A C     1 
ATOM   2456 O O     . SER C 3 214 ? -18.614 -22.352 13.014  1.00 64.96  ? 387 SER A O     1 
ATOM   2457 C CB    . SER C 3 214 ? -19.252 -19.346 12.773  1.00 75.16  ? 387 SER A CB    1 
ATOM   2458 O OG    . SER C 3 214 ? -19.344 -19.567 11.374  1.00 83.53  ? 387 SER A OG    1 
ATOM   2459 N N     . ASP C 3 216 ? -20.626 -23.500 13.820  1.00 60.55  ? 389 ASP A N     1 
ATOM   2460 C CA    . ASP C 3 216 ? -21.708 -23.856 12.901  1.00 62.65  ? 389 ASP A CA    1 
ATOM   2461 C C     . ASP C 3 216 ? -21.235 -23.888 11.447  1.00 62.68  ? 389 ASP A C     1 
ATOM   2462 O O     . ASP C 3 216 ? -22.054 -23.889 10.521  1.00 56.76  ? 389 ASP A O     1 
ATOM   2463 C CB    . ASP C 3 216 ? -22.888 -22.879 13.037  1.00 63.03  ? 389 ASP A CB    1 
ATOM   2464 C CG    . ASP C 3 216 ? -22.459 -21.420 12.964  1.00 63.63  ? 389 ASP A CG    1 
ATOM   2465 O OD1   . ASP C 3 216 ? -22.515 -20.724 14.000  1.00 60.92  ? 389 ASP A OD1   1 
ATOM   2466 O OD2   . ASP C 3 216 ? -22.058 -20.877 11.916  1.00 63.82  ? 389 ASP A OD2   1 
ATOM   2467 N N     . ALA C 3 217 ? -19.916 -23.917 11.256  1.00 58.47  ? 390 ALA A N     1 
ATOM   2468 C CA    . ALA C 3 217 ? -19.328 -23.844 9.920   1.00 48.86  ? 390 ALA A CA    1 
ATOM   2469 C C     . ALA C 3 217 ? -18.656 -25.148 9.511   1.00 41.52  ? 390 ALA A C     1 
ATOM   2470 O O     . ALA C 3 217 ? -18.204 -25.913 10.355  1.00 36.44  ? 390 ALA A O     1 
ATOM   2471 C CB    . ALA C 3 217 ? -18.337 -22.701 9.849   1.00 48.70  ? 390 ALA A CB    1 
ATOM   2472 N N     . LYS C 3 218 ? -18.595 -25.397 8.208   1.00 44.58  ? 391 LYS A N     1 
ATOM   2473 C CA    . LYS C 3 218 ? -17.912 -26.575 7.701   1.00 48.00  ? 391 LYS A CA    1 
ATOM   2474 C C     . LYS C 3 218 ? -16.410 -26.368 7.808   1.00 54.71  ? 391 LYS A C     1 
ATOM   2475 O O     . LYS C 3 218 ? -15.808 -25.677 6.983   1.00 59.47  ? 391 LYS A O     1 
ATOM   2476 C CB    . LYS C 3 218 ? -18.304 -26.855 6.248   1.00 52.01  ? 391 LYS A CB    1 
ATOM   2477 C CG    . LYS C 3 218 ? -17.733 -28.158 5.694   1.00 61.15  ? 391 LYS A CG    1 
ATOM   2478 C CD    . LYS C 3 218 ? -17.813 -28.217 4.175   1.00 60.25  ? 391 LYS A CD    1 
ATOM   2479 C CE    . LYS C 3 218 ? -16.645 -27.475 3.535   1.00 92.19  ? 391 LYS A CE    1 
ATOM   2480 N NZ    . LYS C 3 218 ? -16.204 -28.117 2.262   1.00 95.42  ? 391 LYS A NZ    1 
ATOM   2481 N N     . VAL C 3 219 ? -15.816 -26.957 8.840   1.00 55.71  ? 392 VAL A N     1 
ATOM   2482 C CA    . VAL C 3 219 ? -14.372 -26.905 9.036   1.00 55.66  ? 392 VAL A CA    1 
ATOM   2483 C C     . VAL C 3 219 ? -13.641 -27.438 7.802   1.00 50.06  ? 392 VAL A C     1 
ATOM   2484 O O     . VAL C 3 219 ? -13.902 -28.556 7.356   1.00 53.75  ? 392 VAL A O     1 
ATOM   2485 C CB    . VAL C 3 219 ? -13.957 -27.721 10.280  1.00 55.61  ? 392 VAL A CB    1 
ATOM   2486 C CG1   . VAL C 3 219 ? -12.474 -28.072 10.236  1.00 71.07  ? 392 VAL A CG1   1 
ATOM   2487 C CG2   . VAL C 3 219 ? -14.297 -26.958 11.555  1.00 63.08  ? 392 VAL A CG2   1 
ATOM   2488 N N     . PRO C 3 220 ? -12.736 -26.637 7.246   1.00 45.39  ? 393 PRO A N     1 
ATOM   2489 C CA    . PRO C 3 220 ? -11.984 -27.042 6.053   1.00 51.70  ? 393 PRO A CA    1 
ATOM   2490 C C     . PRO C 3 220 ? -11.027 -28.178 6.388   1.00 55.36  ? 393 PRO A C     1 
ATOM   2491 O O     . PRO C 3 220 ? -10.276 -28.080 7.356   1.00 54.12  ? 393 PRO A O     1 
ATOM   2492 C CB    . PRO C 3 220 ? -11.209 -25.776 5.676   1.00 45.59  ? 393 PRO A CB    1 
ATOM   2493 C CG    . PRO C 3 220 ? -11.100 -25.005 6.944   1.00 47.74  ? 393 PRO A CG    1 
ATOM   2494 C CD    . PRO C 3 220 ? -12.350 -25.297 7.724   1.00 45.52  ? 393 PRO A CD    1 
ATOM   2495 N N     . SER C 3 221 ? -11.070 -29.251 5.607   1.00 60.55  ? 394 SER A N     1 
ATOM   2496 C CA    . SER C 3 221 ? -10.215 -30.403 5.857   1.00 65.64  ? 394 SER A CA    1 
ATOM   2497 C C     . SER C 3 221 ? -8.763  -30.076 5.524   1.00 61.48  ? 394 SER A C     1 
ATOM   2498 O O     . SER C 3 221 ? -8.472  -29.517 4.466   1.00 63.44  ? 394 SER A O     1 
ATOM   2499 C CB    . SER C 3 221 ? -10.688 -31.611 5.045   1.00 71.90  ? 394 SER A CB    1 
ATOM   2500 O OG    . SER C 3 221 ? -11.365 -31.200 3.869   1.00 92.65  ? 394 SER A OG    1 
ATOM   2501 N N     . PRO C 3 222 ? -7.857  -30.418 6.435   1.00 55.70  ? 395 PRO A N     1 
ATOM   2502 C CA    . PRO C 3 222 ? -6.426  -30.195 6.223   1.00 54.90  ? 395 PRO A CA    1 
ATOM   2503 C C     . PRO C 3 222 ? -5.913  -31.101 5.111   1.00 58.05  ? 395 PRO A C     1 
ATOM   2504 O O     . PRO C 3 222 ? -6.464  -32.185 4.922   1.00 52.51  ? 395 PRO A O     1 
ATOM   2505 C CB    . PRO C 3 222 ? -5.807  -30.589 7.569   1.00 57.31  ? 395 PRO A CB    1 
ATOM   2506 C CG    . PRO C 3 222 ? -6.798  -31.503 8.202   1.00 53.10  ? 395 PRO A CG    1 
ATOM   2507 C CD    . PRO C 3 222 ? -8.142  -31.047 7.737   1.00 61.12  ? 395 PRO A CD    1 
ATOM   2508 N N     . PRO C 3 223 ? -4.891  -30.664 4.379   1.00 64.90  ? 396 PRO A N     1 
ATOM   2509 C CA    . PRO C 3 223 ? -4.345  -31.461 3.275   1.00 69.66  ? 396 PRO A CA    1 
ATOM   2510 C C     . PRO C 3 223 ? -4.141  -32.916 3.696   1.00 71.37  ? 396 PRO A C     1 
ATOM   2511 O O     . PRO C 3 223 ? -3.697  -33.185 4.817   1.00 70.79  ? 396 PRO A O     1 
ATOM   2512 C CB    . PRO C 3 223 ? -3.004  -30.777 2.968   1.00 66.49  ? 396 PRO A CB    1 
ATOM   2513 C CG    . PRO C 3 223 ? -2.811  -29.763 4.061   1.00 61.26  ? 396 PRO A CG    1 
ATOM   2514 C CD    . PRO C 3 223 ? -4.176  -29.388 4.542   1.00 63.55  ? 396 PRO A CD    1 
ATOM   2515 N N     . PRO C 3 224 ? -4.475  -33.840 2.801   1.00 68.70  ? 397 PRO A N     1 
ATOM   2516 C CA    . PRO C 3 224 ? -4.462  -35.272 3.108   1.00 62.69  ? 397 PRO A CA    1 
ATOM   2517 C C     . PRO C 3 224 ? -3.324  -35.660 4.045   1.00 56.52  ? 397 PRO A C     1 
ATOM   2518 O O     . PRO C 3 224 ? -2.158  -35.546 3.672   1.00 60.06  ? 397 PRO A O     1 
ATOM   2519 C CB    . PRO C 3 224 ? -4.253  -35.911 1.734   1.00 65.64  ? 397 PRO A CB    1 
ATOM   2520 C CG    . PRO C 3 224 ? -4.865  -34.933 0.754   1.00 73.67  ? 397 PRO A CG    1 
ATOM   2521 C CD    . PRO C 3 224 ? -4.879  -33.573 1.407   1.00 69.86  ? 397 PRO A CD    1 
ATOM   2522 N N     . GLY C 3 225 ? -3.665  -36.096 5.254   1.00 54.35  ? 398 GLY A N     1 
ATOM   2523 C CA    . GLY C 3 225 ? -2.681  -36.617 6.186   1.00 60.23  ? 398 GLY A CA    1 
ATOM   2524 C C     . GLY C 3 225 ? -2.142  -35.620 7.197   1.00 63.71  ? 398 GLY A C     1 
ATOM   2525 O O     . GLY C 3 225 ? -1.172  -35.913 7.904   1.00 63.25  ? 398 GLY A O     1 
ATOM   2526 N N     . HIS C 3 226 ? -2.766  -34.448 7.276   1.00 63.24  ? 399 HIS A N     1 
ATOM   2527 C CA    . HIS C 3 226 ? -2.310  -33.408 8.196   1.00 68.01  ? 399 HIS A CA    1 
ATOM   2528 C C     . HIS C 3 226 ? -3.377  -33.032 9.218   1.00 63.15  ? 399 HIS A C     1 
ATOM   2529 O O     . HIS C 3 226 ? -4.520  -33.476 9.127   1.00 61.01  ? 399 HIS A O     1 
ATOM   2530 C CB    . HIS C 3 226 ? -1.877  -32.159 7.424   1.00 73.33  ? 399 HIS A CB    1 
ATOM   2531 C CG    . HIS C 3 226 ? -0.528  -32.277 6.786   1.00 63.71  ? 399 HIS A CG    1 
ATOM   2532 N ND1   . HIS C 3 226 ? -0.351  -32.740 5.500   1.00 59.86  ? 399 HIS A ND1   1 
ATOM   2533 C CD2   . HIS C 3 226 ? 0.709   -31.982 7.254   1.00 61.42  ? 399 HIS A CD2   1 
ATOM   2534 C CE1   . HIS C 3 226 ? 0.937   -32.731 5.205   1.00 66.02  ? 399 HIS A CE1   1 
ATOM   2535 N NE2   . HIS C 3 226 ? 1.601   -32.276 6.252   1.00 77.82  ? 399 HIS A NE2   1 
ATOM   2536 N N     . LYS C 3 227 ? -2.988  -32.210 10.190  1.00 58.11  ? 400 LYS A N     1 
ATOM   2537 C CA    . LYS C 3 227 ? -3.910  -31.688 11.193  1.00 57.08  ? 400 LYS A CA    1 
ATOM   2538 C C     . LYS C 3 227 ? -3.581  -30.228 11.496  1.00 56.97  ? 400 LYS A C     1 
ATOM   2539 O O     . LYS C 3 227 ? -2.411  -29.862 11.577  1.00 59.39  ? 400 LYS A O     1 
ATOM   2540 C CB    . LYS C 3 227 ? -3.832  -32.518 12.478  1.00 55.49  ? 400 LYS A CB    1 
ATOM   2541 C CG    . LYS C 3 227 ? -4.359  -33.942 12.338  1.00 54.79  ? 400 LYS A CG    1 
ATOM   2542 C CD    . LYS C 3 227 ? -5.054  -34.414 13.611  1.00 76.70  ? 400 LYS A CD    1 
ATOM   2543 C CE    . LYS C 3 227 ? -5.661  -35.802 13.428  1.00 77.68  ? 400 LYS A CE    1 
ATOM   2544 N NZ    . LYS C 3 227 ? -6.741  -36.097 14.416  1.00 76.14  ? 400 LYS A NZ    1 
ATOM   2545 N N     . TRP C 3 228 ? -4.609  -29.397 11.661  1.00 60.79  ? 401 TRP A N     1 
ATOM   2546 C CA    . TRP C 3 228 ? -4.406  -27.986 11.998  1.00 61.96  ? 401 TRP A CA    1 
ATOM   2547 C C     . TRP C 3 228 ? -3.774  -27.852 13.376  1.00 62.85  ? 401 TRP A C     1 
ATOM   2548 O O     . TRP C 3 228 ? -3.868  -28.763 14.200  1.00 64.47  ? 401 TRP A O     1 
ATOM   2549 C CB    . TRP C 3 228 ? -5.727  -27.205 11.971  1.00 62.46  ? 401 TRP A CB    1 
ATOM   2550 C CG    . TRP C 3 228 ? -6.543  -27.403 10.725  1.00 58.62  ? 401 TRP A CG    1 
ATOM   2551 C CD1   . TRP C 3 228 ? -7.678  -28.150 10.602  1.00 58.49  ? 401 TRP A CD1   1 
ATOM   2552 C CD2   . TRP C 3 228 ? -6.292  -26.842 9.428   1.00 51.66  ? 401 TRP A CD2   1 
ATOM   2553 N NE1   . TRP C 3 228 ? -8.144  -28.093 9.310   1.00 61.37  ? 401 TRP A NE1   1 
ATOM   2554 C CE2   . TRP C 3 228 ? -7.311  -27.298 8.568   1.00 49.71  ? 401 TRP A CE2   1 
ATOM   2555 C CE3   . TRP C 3 228 ? -5.302  -26.004 8.903   1.00 49.23  ? 401 TRP A CE3   1 
ATOM   2556 C CZ2   . TRP C 3 228 ? -7.371  -26.943 7.219   1.00 41.95  ? 401 TRP A CZ2   1 
ATOM   2557 C CZ3   . TRP C 3 228 ? -5.365  -25.652 7.564   1.00 53.15  ? 401 TRP A CZ3   1 
ATOM   2558 C CH2   . TRP C 3 228 ? -6.391  -26.123 6.738   1.00 22.46  ? 401 TRP A CH2   1 
ATOM   2559 N N     . LYS C 3 229 ? -3.127  -26.717 13.622  1.00 64.08  ? 402 LYS A N     1 
ATOM   2560 C CA    . LYS C 3 229 ? -2.546  -26.445 14.931  1.00 63.78  ? 402 LYS A CA    1 
ATOM   2561 C C     . LYS C 3 229 ? -3.657  -26.351 15.964  1.00 58.81  ? 402 LYS A C     1 
ATOM   2562 O O     . LYS C 3 229 ? -3.594  -26.974 17.026  1.00 55.60  ? 402 LYS A O     1 
ATOM   2563 C CB    . LYS C 3 229 ? -1.738  -25.145 14.905  1.00 66.94  ? 402 LYS A CB    1 
ATOM   2564 C CG    . LYS C 3 229 ? -1.322  -24.641 16.285  1.00 69.71  ? 402 LYS A CG    1 
ATOM   2565 C CD    . LYS C 3 229 ? 0.013   -23.914 16.237  1.00 53.29  ? 402 LYS A CD    1 
ATOM   2566 C CE    . LYS C 3 229 ? 0.730   -24.005 17.572  1.00 47.24  ? 402 LYS A CE    1 
ATOM   2567 N NZ    . LYS C 3 229 ? 0.408   -22.856 18.461  1.00 58.00  ? 402 LYS A NZ    1 
ATOM   2568 N N     . GLU C 3 230 ? -4.679  -25.568 15.632  1.00 56.20  ? 403 GLU A N     1 
ATOM   2569 C CA    . GLU C 3 230 ? -5.831  -25.373 16.501  1.00 56.87  ? 403 GLU A CA    1 
ATOM   2570 C C     . GLU C 3 230 ? -6.981  -24.771 15.706  1.00 61.07  ? 403 GLU A C     1 
ATOM   2571 O O     . GLU C 3 230 ? -6.806  -23.774 15.002  1.00 63.65  ? 403 GLU A O     1 
ATOM   2572 C CB    . GLU C 3 230 ? -5.472  -24.466 17.681  1.00 49.57  ? 403 GLU A CB    1 
ATOM   2573 C CG    . GLU C 3 230 ? -6.638  -23.638 18.211  1.00 46.60  ? 403 GLU A CG    1 
ATOM   2574 C CD    . GLU C 3 230 ? -6.180  -22.480 19.080  1.00 67.63  ? 403 GLU A CD    1 
ATOM   2575 O OE1   . GLU C 3 230 ? -4.961  -22.376 19.352  1.00 65.30  ? 403 GLU A OE1   1 
ATOM   2576 O OE2   . GLU C 3 230 ? -7.043  -21.672 19.492  1.00 45.37  ? 403 GLU A OE2   1 
ATOM   2577 N N     . VAL C 3 231 ? -8.153  -25.390 15.810  1.00 62.27  ? 404 VAL A N     1 
ATOM   2578 C CA    . VAL C 3 231 ? -9.349  -24.864 15.172  1.00 60.15  ? 404 VAL A CA    1 
ATOM   2579 C C     . VAL C 3 231 ? -10.197 -24.181 16.228  1.00 57.35  ? 404 VAL A C     1 
ATOM   2580 O O     . VAL C 3 231 ? -10.823 -24.847 17.055  1.00 59.43  ? 404 VAL A O     1 
ATOM   2581 C CB    . VAL C 3 231 ? -10.174 -25.972 14.494  1.00 63.90  ? 404 VAL A CB    1 
ATOM   2582 C CG1   . VAL C 3 231 ? -11.192 -25.366 13.533  1.00 54.43  ? 404 VAL A CG1   1 
ATOM   2583 C CG2   . VAL C 3 231 ? -9.258  -26.953 13.769  1.00 67.34  ? 404 VAL A CG2   1 
ATOM   2584 N N     . ARG C 3 232 ? -10.207 -22.851 16.203  1.00 57.14  ? 405 ARG A N     1 
ATOM   2585 C CA    . ARG C 3 232 ? -10.933 -22.081 17.206  1.00 61.45  ? 405 ARG A CA    1 
ATOM   2586 C C     . ARG C 3 232 ? -12.014 -21.203 16.584  1.00 56.77  ? 405 ARG A C     1 
ATOM   2587 O O     . ARG C 3 232 ? -11.976 -20.906 15.389  1.00 52.66  ? 405 ARG A O     1 
ATOM   2588 C CB    . ARG C 3 232 ? -9.967  -21.237 18.045  1.00 63.66  ? 405 ARG A CB    1 
ATOM   2589 C CG    . ARG C 3 232 ? -9.587  -19.905 17.422  1.00 57.08  ? 405 ARG A CG    1 
ATOM   2590 C CD    . ARG C 3 232 ? -8.859  -18.970 18.372  1.00 55.33  ? 405 ARG A CD    1 
ATOM   2591 N NE    . ARG C 3 232 ? -7.419  -19.205 18.369  1.00 45.77  ? 405 ARG A NE    1 
ATOM   2592 C CZ    . ARG C 3 232 ? -6.516  -18.317 18.765  1.00 56.55  ? 405 ARG A CZ    1 
ATOM   2593 N NH1   . ARG C 3 232 ? -6.898  -17.124 19.202  1.00 61.40  ? 405 ARG A NH1   1 
ATOM   2594 N NH2   . ARG C 3 232 ? -5.226  -18.619 18.725  1.00 72.20  ? 405 ARG A NH2   1 
ATOM   2595 N N     . HIS C 3 233 ? -12.977 -20.798 17.408  1.00 51.18  ? 406 HIS A N     1 
ATOM   2596 C CA    . HIS C 3 233 ? -14.090 -19.977 16.952  1.00 47.86  ? 406 HIS A CA    1 
ATOM   2597 C C     . HIS C 3 233 ? -14.149 -18.657 17.720  1.00 55.30  ? 406 HIS A C     1 
ATOM   2598 O O     . HIS C 3 233 ? -14.930 -18.507 18.661  1.00 63.91  ? 406 HIS A O     1 
ATOM   2599 C CB    . HIS C 3 233 ? -15.402 -20.744 17.104  1.00 43.84  ? 406 HIS A CB    1 
ATOM   2600 C CG    . HIS C 3 233 ? -15.331 -22.156 16.616  1.00 39.72  ? 406 HIS A CG    1 
ATOM   2601 N ND1   . HIS C 3 233 ? -15.102 -22.475 15.295  1.00 53.20  ? 406 HIS A ND1   1 
ATOM   2602 C CD2   . HIS C 3 233 ? -15.451 -23.335 17.272  1.00 43.83  ? 406 HIS A CD2   1 
ATOM   2603 C CE1   . HIS C 3 233 ? -15.087 -23.789 15.157  1.00 51.49  ? 406 HIS A CE1   1 
ATOM   2604 N NE2   . HIS C 3 233 ? -15.296 -24.335 16.342  1.00 62.68  ? 406 HIS A NE2   1 
ATOM   2605 N N     . ASP C 3 234 ? -13.315 -17.703 17.317  1.00 52.80  ? 407 ASP A N     1 
ATOM   2606 C CA    . ASP C 3 234 ? -13.249 -16.414 17.994  1.00 51.51  ? 407 ASP A CA    1 
ATOM   2607 C C     . ASP C 3 234 ? -13.795 -15.313 17.103  1.00 55.23  ? 407 ASP A C     1 
ATOM   2608 O O     . ASP C 3 234 ? -13.159 -14.921 16.122  1.00 51.09  ? 407 ASP A O     1 
ATOM   2609 C CB    . ASP C 3 234 ? -11.814 -16.088 18.409  1.00 52.96  ? 407 ASP A CB    1 
ATOM   2610 C CG    . ASP C 3 234 ? -11.735 -14.909 19.359  1.00 49.74  ? 407 ASP A CG    1 
ATOM   2611 O OD1   . ASP C 3 234 ? -12.755 -14.600 20.010  1.00 75.51  ? 407 ASP A OD1   1 
ATOM   2612 O OD2   . ASP C 3 234 ? -10.698 -14.232 19.521  1.00 52.25  ? 407 ASP A OD2   1 
ATOM   2613 N N     . ASN C 3 235 ? -14.975 -14.817 17.458  1.00 60.28  ? 408 ASN A N     1 
ATOM   2614 C CA    . ASN C 3 235 ? -15.644 -13.779 16.684  1.00 64.32  ? 408 ASN A CA    1 
ATOM   2615 C C     . ASN C 3 235 ? -15.319 -12.375 17.185  1.00 64.33  ? 408 ASN A C     1 
ATOM   2616 O O     . ASN C 3 235 ? -15.960 -11.401 16.794  1.00 69.07  ? 408 ASN A O     1 
ATOM   2617 C CB    . ASN C 3 235 ? -17.158 -14.010 16.681  1.00 63.12  ? 408 ASN A CB    1 
ATOM   2618 C CG    . ASN C 3 235 ? -17.744 -14.042 18.080  1.00 78.15  ? 408 ASN A CG    1 
ATOM   2619 O OD1   . ASN C 3 235 ? -17.268 -14.773 18.953  1.00 81.27  ? 408 ASN A OD1   1 
ATOM   2620 N ND2   . ASN C 3 235 ? -18.781 -13.244 18.303  1.00 81.88  ? 408 ASN A ND2   1 
ATOM   2621 N N     . LYS C 3 236 ? -14.321 -12.279 18.057  1.00 62.41  ? 409 LYS A N     1 
ATOM   2622 C CA    . LYS C 3 236 ? -13.875 -10.987 18.560  1.00 68.32  ? 409 LYS A CA    1 
ATOM   2623 C C     . LYS C 3 236 ? -12.709 -10.460 17.725  1.00 73.77  ? 409 LYS A C     1 
ATOM   2624 O O     . LYS C 3 236 ? -12.240 -9.338  17.932  1.00 79.79  ? 409 LYS A O     1 
ATOM   2625 C CB    . LYS C 3 236 ? -13.477 -11.091 20.034  1.00 72.49  ? 409 LYS A CB    1 
ATOM   2626 C CG    . LYS C 3 236 ? -14.600 -11.547 20.954  1.00 74.50  ? 409 LYS A CG    1 
ATOM   2627 C CD    . LYS C 3 236 ? -15.144 -10.380 21.779  1.00 90.13  ? 409 LYS A CD    1 
ATOM   2628 C CE    . LYS C 3 236 ? -16.367 -10.804 22.583  1.00 96.91  ? 409 LYS A CE    1 
ATOM   2629 N NZ    . LYS C 3 236 ? -17.118 -11.904 21.907  1.00 94.67  ? 409 LYS A NZ    1 
ATOM   2630 N N     . VAL C 3 237 ? -12.248 -11.285 16.784  1.00 69.10  ? 410 VAL A N     1 
ATOM   2631 C CA    . VAL C 3 237 ? -11.188 -10.909 15.850  1.00 62.64  ? 410 VAL A CA    1 
ATOM   2632 C C     . VAL C 3 237 ? -11.667 -11.145 14.421  1.00 60.02  ? 410 VAL A C     1 
ATOM   2633 O O     . VAL C 3 237 ? -12.706 -11.771 14.210  1.00 65.67  ? 410 VAL A O     1 
ATOM   2634 C CB    . VAL C 3 237 ? -9.898  -11.714 16.098  1.00 60.62  ? 410 VAL A CB    1 
ATOM   2635 C CG1   . VAL C 3 237 ? -9.159  -11.179 17.311  1.00 68.46  ? 410 VAL A CG1   1 
ATOM   2636 C CG2   . VAL C 3 237 ? -10.214 -13.190 16.275  1.00 69.01  ? 410 VAL A CG2   1 
ATOM   2637 N N     . THR C 3 238 ? -10.916 -10.653 13.439  1.00 50.88  ? 411 THR A N     1 
ATOM   2638 C CA    . THR C 3 238 ? -11.371 -10.714 12.051  1.00 43.17  ? 411 THR A CA    1 
ATOM   2639 C C     . THR C 3 238 ? -10.622 -11.716 11.185  1.00 41.07  ? 411 THR A C     1 
ATOM   2640 O O     . THR C 3 238 ? -11.105 -12.091 10.118  1.00 36.16  ? 411 THR A O     1 
ATOM   2641 C CB    . THR C 3 238 ? -11.293 -9.328  11.395  1.00 44.76  ? 411 THR A CB    1 
ATOM   2642 O OG1   . THR C 3 238 ? -9.981  -8.784  11.576  1.00 37.94  ? 411 THR A OG1   1 
ATOM   2643 C CG2   . THR C 3 238 ? -12.186 -8.346  12.131  1.00 77.05  ? 411 THR A CG2   1 
ATOM   2644 N N     . TRP C 3 239 ? -9.443  -12.140 11.630  1.00 51.39  ? 412 TRP A N     1 
ATOM   2645 C CA    . TRP C 3 239 ? -8.598  -13.011 10.810  1.00 56.81  ? 412 TRP A CA    1 
ATOM   2646 C C     . TRP C 3 239 ? -9.184  -14.407 10.620  1.00 58.63  ? 412 TRP A C     1 
ATOM   2647 O O     . TRP C 3 239 ? -9.952  -14.889 11.454  1.00 58.82  ? 412 TRP A O     1 
ATOM   2648 C CB    . TRP C 3 239 ? -7.177  -13.094 11.377  1.00 55.00  ? 412 TRP A CB    1 
ATOM   2649 C CG    . TRP C 3 239 ? -7.105  -13.525 12.809  1.00 52.93  ? 412 TRP A CG    1 
ATOM   2650 C CD1   . TRP C 3 239 ? -7.028  -12.715 13.907  1.00 45.51  ? 412 TRP A CD1   1 
ATOM   2651 C CD2   . TRP C 3 239 ? -7.085  -14.869 13.302  1.00 63.13  ? 412 TRP A CD2   1 
ATOM   2652 N NE1   . TRP C 3 239 ? -6.971  -13.473 15.052  1.00 51.56  ? 412 TRP A NE1   1 
ATOM   2653 C CE2   . TRP C 3 239 ? -7.003  -14.801 14.709  1.00 52.23  ? 412 TRP A CE2   1 
ATOM   2654 C CE3   . TRP C 3 239 ? -7.132  -16.132 12.696  1.00 70.41  ? 412 TRP A CE3   1 
ATOM   2655 C CZ2   . TRP C 3 239 ? -6.966  -15.939 15.514  1.00 35.28  ? 412 TRP A CZ2   1 
ATOM   2656 C CZ3   . TRP C 3 239 ? -7.097  -17.263 13.500  1.00 64.40  ? 412 TRP A CZ3   1 
ATOM   2657 C CH2   . TRP C 3 239 ? -7.015  -17.156 14.893  1.00 29.34  ? 412 TRP A CH2   1 
ATOM   2658 N N     . LEU C 3 240 ? -8.818  -15.047 9.512   1.00 61.79  ? 413 LEU A N     1 
ATOM   2659 C CA    . LEU C 3 240 ? -9.283  -16.398 9.202   1.00 58.78  ? 413 LEU A CA    1 
ATOM   2660 C C     . LEU C 3 240 ? -8.229  -17.439 9.548   1.00 62.52  ? 413 LEU A C     1 
ATOM   2661 O O     . LEU C 3 240 ? -8.555  -18.547 9.980   1.00 72.33  ? 413 LEU A O     1 
ATOM   2662 C CB    . LEU C 3 240 ? -9.631  -16.523 7.722   1.00 45.21  ? 413 LEU A CB    1 
ATOM   2663 C CG    . LEU C 3 240 ? -10.518 -15.431 7.137   1.00 30.21  ? 413 LEU A CG    1 
ATOM   2664 C CD1   . LEU C 3 240 ? -11.056 -15.867 5.780   1.00 44.62  ? 413 LEU A CD1   1 
ATOM   2665 C CD2   . LEU C 3 240 ? -11.650 -15.121 8.093   1.00 15.42  ? 413 LEU A CD2   1 
ATOM   2666 N N     . VAL C 3 241 ? -6.965  -17.080 9.338   1.00 55.47  ? 414 VAL A N     1 
ATOM   2667 C CA    . VAL C 3 241 ? -5.859  -17.986 9.607   1.00 43.98  ? 414 VAL A CA    1 
ATOM   2668 C C     . VAL C 3 241 ? -4.695  -17.242 10.253  1.00 48.09  ? 414 VAL A C     1 
ATOM   2669 O O     . VAL C 3 241 ? -4.349  -16.132 9.847   1.00 45.29  ? 414 VAL A O     1 
ATOM   2670 C CB    . VAL C 3 241 ? -5.379  -18.658 8.316   1.00 35.39  ? 414 VAL A CB    1 
ATOM   2671 C CG1   . VAL C 3 241 ? -4.230  -19.608 8.605   1.00 31.64  ? 414 VAL A CG1   1 
ATOM   2672 C CG2   . VAL C 3 241 ? -6.529  -19.387 7.653   1.00 29.43  ? 414 VAL A CG2   1 
ATOM   2673 N N     . SER C 3 242 ? -4.094  -17.857 11.264  1.00 46.44  ? 415 SER A N     1 
ATOM   2674 C CA    . SER C 3 242 ? -2.971  -17.237 11.949  1.00 46.32  ? 415 SER A CA    1 
ATOM   2675 C C     . SER C 3 242 ? -1.888  -18.252 12.290  1.00 48.50  ? 415 SER A C     1 
ATOM   2676 O O     . SER C 3 242 ? -2.181  -19.394 12.642  1.00 42.65  ? 415 SER A O     1 
ATOM   2677 C CB    . SER C 3 242 ? -3.444  -16.521 13.215  1.00 43.31  ? 415 SER A CB    1 
ATOM   2678 O OG    . SER C 3 242 ? -3.272  -17.346 14.353  1.00 49.51  ? 415 SER A OG    1 
ATOM   2679 N N     . TRP C 3 243 ? -0.636  -17.823 12.167  1.00 54.16  ? 416 TRP A N     1 
ATOM   2680 C CA    . TRP C 3 243 ? 0.506   -18.626 12.584  1.00 59.33  ? 416 TRP A CA    1 
ATOM   2681 C C     . TRP C 3 243 ? 1.626   -17.696 13.031  1.00 65.36  ? 416 TRP A C     1 
ATOM   2682 O O     . TRP C 3 243 ? 1.674   -16.531 12.619  1.00 71.62  ? 416 TRP A O     1 
ATOM   2683 C CB    . TRP C 3 243 ? 0.976   -19.536 11.447  1.00 52.77  ? 416 TRP A CB    1 
ATOM   2684 C CG    . TRP C 3 243 ? 1.696   -18.822 10.342  1.00 56.98  ? 416 TRP A CG    1 
ATOM   2685 C CD1   . TRP C 3 243 ? 3.046   -18.755 10.151  1.00 61.30  ? 416 TRP A CD1   1 
ATOM   2686 C CD2   . TRP C 3 243 ? 1.106   -18.081 9.268   1.00 58.05  ? 416 TRP A CD2   1 
ATOM   2687 N NE1   . TRP C 3 243 ? 3.331   -18.016 9.028   1.00 33.78  ? 416 TRP A NE1   1 
ATOM   2688 C CE2   . TRP C 3 243 ? 2.157   -17.590 8.466   1.00 46.94  ? 416 TRP A CE2   1 
ATOM   2689 C CE3   . TRP C 3 243 ? -0.209  -17.779 8.899   1.00 57.20  ? 416 TRP A CE3   1 
ATOM   2690 C CZ2   . TRP C 3 243 ? 1.934   -16.820 7.327   1.00 46.05  ? 416 TRP A CZ2   1 
ATOM   2691 C CZ3   . TRP C 3 243 ? -0.426  -17.013 7.765   1.00 54.22  ? 416 TRP A CZ3   1 
ATOM   2692 C CH2   . TRP C 3 243 ? 0.638   -16.544 6.994   1.00 49.51  ? 416 TRP A CH2   1 
ATOM   2693 N N     . THR C 3 244 ? 2.517   -18.199 13.880  1.00 65.92  ? 417 THR A N     1 
ATOM   2694 C CA    . THR C 3 244 ? 3.646   -17.394 14.339  1.00 68.55  ? 417 THR A CA    1 
ATOM   2695 C C     . THR C 3 244 ? 4.855   -17.596 13.430  1.00 61.94  ? 417 THR A C     1 
ATOM   2696 O O     . THR C 3 244 ? 5.230   -18.730 13.125  1.00 55.81  ? 417 THR A O     1 
ATOM   2697 C CB    . THR C 3 244 ? 4.010   -17.720 15.808  1.00 71.64  ? 417 THR A CB    1 
ATOM   2698 O OG1   . THR C 3 244 ? 4.502   -19.063 15.898  1.00 87.86  ? 417 THR A OG1   1 
ATOM   2699 C CG2   . THR C 3 244 ? 2.763   -17.742 16.687  1.00 74.51  ? 417 THR A CG2   1 
ATOM   2700 N N     . GLU C 3 245 ? 5.453   -16.488 12.998  1.00 60.40  ? 418 GLU A N     1 
ATOM   2701 C CA    . GLU C 3 245 ? 6.613   -16.531 12.113  1.00 58.13  ? 418 GLU A CA    1 
ATOM   2702 C C     . GLU C 3 245 ? 7.918   -16.654 12.901  1.00 59.89  ? 418 GLU A C     1 
ATOM   2703 O O     . GLU C 3 245 ? 8.114   -15.977 13.913  1.00 60.20  ? 418 GLU A O     1 
ATOM   2704 C CB    . GLU C 3 245 ? 6.636   -15.306 11.195  1.00 52.51  ? 418 GLU A CB    1 
ATOM   2705 C CG    . GLU C 3 245 ? 7.939   -14.529 11.210  1.00 56.09  ? 418 GLU A CG    1 
ATOM   2706 C CD    . GLU C 3 245 ? 7.862   -13.281 12.068  1.00 73.20  ? 418 GLU A CD    1 
ATOM   2707 O OE1   . GLU C 3 245 ? 7.149   -13.303 13.096  1.00 40.56  ? 418 GLU A OE1   1 
ATOM   2708 O OE2   . GLU C 3 245 ? 8.515   -12.275 11.712  1.00 89.17  ? 418 GLU A OE2   1 
ATOM   2709 N N     . ASN C 3 246 ? 8.801   -17.526 12.424  1.00 60.24  ? 419 ASN A N     1 
ATOM   2710 C CA    . ASN C 3 246 ? 10.049  -17.846 13.113  1.00 59.01  ? 419 ASN A CA    1 
ATOM   2711 C C     . ASN C 3 246 ? 10.996  -16.665 13.314  1.00 57.05  ? 419 ASN A C     1 
ATOM   2712 O O     . ASN C 3 246 ? 11.751  -16.624 14.285  1.00 60.32  ? 419 ASN A O     1 
ATOM   2713 C CB    . ASN C 3 246 ? 10.780  -18.968 12.370  1.00 62.17  ? 419 ASN A CB    1 
ATOM   2714 C CG    . ASN C 3 246 ? 10.640  -18.852 10.858  1.00 69.69  ? 419 ASN A CG    1 
ATOM   2715 O OD1   . ASN C 3 246 ? 9.562   -18.545 10.344  1.00 84.34  ? 419 ASN A OD1   1 
ATOM   2716 N ND2   . ASN C 3 246 ? 11.731  -19.100 10.140  1.00 63.21  ? 419 ASN A ND2   1 
ATOM   2717 N N     . ILE C 3 247 ? 10.957  -15.707 12.397  1.00 53.07  ? 420 ILE A N     1 
ATOM   2718 C CA    . ILE C 3 247 ? 11.924  -14.617 12.406  1.00 51.12  ? 420 ILE A CA    1 
ATOM   2719 C C     . ILE C 3 247 ? 11.733  -13.653 13.575  1.00 47.61  ? 420 ILE A C     1 
ATOM   2720 O O     . ILE C 3 247 ? 12.697  -13.292 14.245  1.00 57.20  ? 420 ILE A O     1 
ATOM   2721 C CB    . ILE C 3 247 ? 11.902  -13.858 11.066  1.00 54.39  ? 420 ILE A CB    1 
ATOM   2722 C CG1   . ILE C 3 247 ? 12.316  -14.785 9.915   1.00 44.71  ? 420 ILE A CG1   1 
ATOM   2723 C CG2   . ILE C 3 247 ? 12.816  -12.648 11.130  1.00 62.71  ? 420 ILE A CG2   1 
ATOM   2724 N N     . GLN C 3 248 ? 10.494  -13.242 13.823  1.00 45.56  ? 421 GLN A N     1 
ATOM   2725 C CA    . GLN C 3 248 ? 10.215  -12.280 14.889  1.00 49.52  ? 421 GLN A CA    1 
ATOM   2726 C C     . GLN C 3 248 ? 9.208   -12.789 15.915  1.00 50.78  ? 421 GLN A C     1 
ATOM   2727 O O     . GLN C 3 248 ? 8.948   -12.123 16.917  1.00 47.34  ? 421 GLN A O     1 
ATOM   2728 C CB    . GLN C 3 248 ? 9.711   -10.961 14.302  1.00 49.01  ? 421 GLN A CB    1 
ATOM   2729 C CG    . GLN C 3 248 ? 10.636  -10.347 13.271  1.00 69.13  ? 421 GLN A CG    1 
ATOM   2730 C CD    . GLN C 3 248 ? 11.604  -9.355  13.878  1.00 74.10  ? 421 GLN A CD    1 
ATOM   2731 O OE1   . GLN C 3 248 ? 12.094  -8.462  13.187  1.00 83.45  ? 421 GLN A OE1   1 
ATOM   2732 N NE2   . GLN C 3 248 ? 11.883  -9.503  15.171  1.00 70.08  ? 421 GLN A NE2   1 
ATOM   2733 N N     . GLY C 3 249 ? 8.637   -13.963 15.657  1.00 57.03  ? 422 GLY A N     1 
ATOM   2734 C CA    . GLY C 3 249 ? 7.620   -14.525 16.529  1.00 54.23  ? 422 GLY A CA    1 
ATOM   2735 C C     . GLY C 3 249 ? 6.245   -13.942 16.260  1.00 58.74  ? 422 GLY A C     1 
ATOM   2736 O O     . GLY C 3 249 ? 5.227   -14.586 16.527  1.00 57.75  ? 422 GLY A O     1 
ATOM   2737 N N     . SER C 3 250 ? 6.217   -12.720 15.726  1.00 65.19  ? 423 SER A N     1 
ATOM   2738 C CA    . SER C 3 250 ? 4.963   -12.026 15.431  1.00 66.89  ? 423 SER A CA    1 
ATOM   2739 C C     . SER C 3 250 ? 4.004   -12.897 14.621  1.00 62.04  ? 423 SER A C     1 
ATOM   2740 O O     . SER C 3 250 ? 4.433   -13.725 13.814  1.00 60.26  ? 423 SER A O     1 
ATOM   2741 C CB    . SER C 3 250 ? 5.231   -10.700 14.705  1.00 66.95  ? 423 SER A CB    1 
ATOM   2742 O OG    . SER C 3 250 ? 5.626   -10.914 13.359  1.00 50.69  ? 423 SER A OG    1 
ATOM   2743 N N     . ILE C 3 251 ? 2.707   -12.706 14.843  1.00 53.65  ? 424 ILE A N     1 
ATOM   2744 C CA    . ILE C 3 251 ? 1.695   -13.537 14.202  1.00 50.86  ? 424 ILE A CA    1 
ATOM   2745 C C     . ILE C 3 251 ? 1.233   -12.971 12.859  1.00 53.87  ? 424 ILE A C     1 
ATOM   2746 O O     . ILE C 3 251 ? 0.911   -11.787 12.745  1.00 53.85  ? 424 ILE A O     1 
ATOM   2747 C CB    . ILE C 3 251 ? 0.490   -13.732 15.137  1.00 48.18  ? 424 ILE A CB    1 
ATOM   2748 C CG1   . ILE C 3 251 ? 0.959   -14.144 16.534  1.00 33.47  ? 424 ILE A CG1   1 
ATOM   2749 C CG2   . ILE C 3 251 ? -0.451  -14.779 14.568  1.00 52.10  ? 424 ILE A CG2   1 
ATOM   2750 N N     . LYS C 3 252 ? 1.204   -13.830 11.845  1.00 52.69  ? 425 LYS A N     1 
ATOM   2751 C CA    . LYS C 3 252 ? 0.781   -13.429 10.510  1.00 51.59  ? 425 LYS A CA    1 
ATOM   2752 C C     . LYS C 3 252 ? -0.666  -13.836 10.272  1.00 54.73  ? 425 LYS A C     1 
ATOM   2753 O O     . LYS C 3 252 ? -1.072  -14.945 10.621  1.00 56.56  ? 425 LYS A O     1 
ATOM   2754 C CB    . LYS C 3 252 ? 1.688   -14.054 9.450   1.00 45.60  ? 425 LYS A CB    1 
ATOM   2755 C CG    . LYS C 3 252 ? 3.142   -13.627 9.542   1.00 50.72  ? 425 LYS A CG    1 
ATOM   2756 C CD    . LYS C 3 252 ? 3.280   -12.114 9.485   1.00 54.13  ? 425 LYS A CD    1 
ATOM   2757 C CE    . LYS C 3 252 ? 4.643   -11.703 8.954   1.00 53.03  ? 425 LYS A CE    1 
ATOM   2758 N NZ    . LYS C 3 252 ? 4.757   -11.930 7.485   1.00 34.74  ? 425 LYS A NZ    1 
ATOM   2759 N N     . TYR C 3 253 ? -1.437  -12.935 9.670   1.00 50.94  ? 426 TYR A N     1 
ATOM   2760 C CA    . TYR C 3 253 ? -2.871  -13.141 9.507   1.00 43.25  ? 426 TYR A CA    1 
ATOM   2761 C C     . TYR C 3 253 ? -3.296  -13.238 8.051   1.00 49.60  ? 426 TYR A C     1 
ATOM   2762 O O     . TYR C 3 253 ? -2.615  -12.735 7.155   1.00 52.97  ? 426 TYR A O     1 
ATOM   2763 C CB    . TYR C 3 253 ? -3.648  -12.002 10.168  1.00 38.73  ? 426 TYR A CB    1 
ATOM   2764 C CG    . TYR C 3 253 ? -3.404  -11.866 11.652  1.00 29.18  ? 426 TYR A CG    1 
ATOM   2765 C CD1   . TYR C 3 253 ? -2.902  -10.687 12.184  1.00 30.21  ? 426 TYR A CD1   1 
ATOM   2766 C CD2   . TYR C 3 253 ? -3.681  -12.912 12.521  1.00 16.63  ? 426 TYR A CD2   1 
ATOM   2767 C CE1   . TYR C 3 253 ? -2.680  -10.552 13.536  1.00 47.22  ? 426 TYR A CE1   1 
ATOM   2768 C CE2   . TYR C 3 253 ? -3.466  -12.786 13.875  1.00 51.61  ? 426 TYR A CE2   1 
ATOM   2769 C CZ    . TYR C 3 253 ? -2.964  -11.603 14.378  1.00 50.55  ? 426 TYR A CZ    1 
ATOM   2770 O OH    . TYR C 3 253 ? -2.742  -11.470 15.726  1.00 37.34  ? 426 TYR A OH    1 
ATOM   2771 N N     . ILE C 3 254 ? -4.433  -13.890 7.826   1.00 51.05  ? 427 ILE A N     1 
ATOM   2772 C CA    . ILE C 3 254 ? -5.077  -13.886 6.523   1.00 44.59  ? 427 ILE A CA    1 
ATOM   2773 C C     . ILE C 3 254 ? -6.407  -13.170 6.669   1.00 41.21  ? 427 ILE A C     1 
ATOM   2774 O O     . ILE C 3 254 ? -7.304  -13.646 7.372   1.00 37.94  ? 427 ILE A O     1 
ATOM   2775 C CB    . ILE C 3 254 ? -5.299  -15.312 6.010   1.00 47.15  ? 427 ILE A CB    1 
ATOM   2776 C CG1   . ILE C 3 254 ? -3.970  -16.067 5.920   1.00 54.05  ? 427 ILE A CG1   1 
ATOM   2777 C CG2   . ILE C 3 254 ? -5.985  -15.276 4.653   1.00 55.10  ? 427 ILE A CG2   1 
ATOM   2778 N N     . MET C 3 255 ? -6.522  -12.017 6.012   1.00 43.77  ? 428 MET A N     1 
ATOM   2779 C CA    . MET C 3 255 ? -7.705  -11.172 6.144   1.00 37.14  ? 428 MET A CA    1 
ATOM   2780 C C     . MET C 3 255 ? -8.409  -10.960 4.807   1.00 39.82  ? 428 MET A C     1 
ATOM   2781 O O     . MET C 3 255 ? -7.977  -11.478 3.776   1.00 45.91  ? 428 MET A O     1 
ATOM   2782 C CB    . MET C 3 255 ? -7.331  -9.829  6.772   1.00 33.01  ? 428 MET A CB    1 
ATOM   2783 C CG    . MET C 3 255 ? -7.213  -9.883  8.282   1.00 30.60  ? 428 MET A CG    1 
ATOM   2784 S SD    . MET C 3 255 ? -6.241  -8.528  8.945   1.00 50.52  ? 428 MET A SD    1 
ATOM   2785 C CE    . MET C 3 255 ? -6.101  -9.020  10.671  1.00 17.83  ? 428 MET A CE    1 
ATOM   2786 N N     . LEU C 3 256 ? -9.494  -10.191 4.831   1.00 39.06  ? 429 LEU A N     1 
ATOM   2787 C CA    . LEU C 3 256 ? -10.346 -10.033 3.658   1.00 41.39  ? 429 LEU A CA    1 
ATOM   2788 C C     . LEU C 3 256 ? -9.893  -8.915  2.724   1.00 44.22  ? 429 LEU A C     1 
ATOM   2789 O O     . LEU C 3 256 ? -9.099  -8.055  3.105   1.00 43.92  ? 429 LEU A O     1 
ATOM   2790 C CB    . LEU C 3 256 ? -11.796 -9.797  4.088   1.00 43.58  ? 429 LEU A CB    1 
ATOM   2791 C CG    . LEU C 3 256 ? -12.497 -10.947 4.809   1.00 33.95  ? 429 LEU A CG    1 
ATOM   2792 C CD1   . LEU C 3 256 ? -13.980 -10.661 4.925   1.00 37.13  ? 429 LEU A CD1   1 
ATOM   2793 C CD2   . LEU C 3 256 ? -12.267 -12.253 4.073   1.00 54.32  ? 429 LEU A CD2   1 
ATOM   2794 N N     . ASN C 3 257 ? -10.410 -8.942  1.498   1.00 49.56  ? 430 ASN A N     1 
ATOM   2795 C CA    . ASN C 3 257 ? -10.178 -7.884  0.522   1.00 49.28  ? 430 ASN A CA    1 
ATOM   2796 C C     . ASN C 3 257 ? -10.510 -6.517  1.110   1.00 52.01  ? 430 ASN A C     1 
ATOM   2797 O O     . ASN C 3 257 ? -11.381 -6.402  1.973   1.00 56.64  ? 430 ASN A O     1 
ATOM   2798 C CB    . ASN C 3 257 ? -11.042 -8.133  -0.717  1.00 47.98  ? 430 ASN A CB    1 
ATOM   2799 C CG    . ASN C 3 257 ? -10.353 -7.727  -2.005  1.00 68.98  ? 430 ASN A CG    1 
ATOM   2800 O OD1   . ASN C 3 257 ? -9.383  -8.358  -2.431  1.00 84.27  ? 430 ASN A OD1   1 
ATOM   2801 N ND2   . ASN C 3 257 ? -10.857 -6.673  -2.639  1.00 76.15  ? 430 ASN A ND2   1 
ATOM   2802 N N     . PRO C 3 258 ? -9.815  -5.480  0.651   1.00 51.97  ? 431 PRO A N     1 
ATOM   2803 C CA    . PRO C 3 258 ? -10.111 -4.107  1.075   1.00 52.18  ? 431 PRO A CA    1 
ATOM   2804 C C     . PRO C 3 258 ? -11.548 -3.711  0.744   1.00 51.43  ? 431 PRO A C     1 
ATOM   2805 O O     . PRO C 3 258 ? -12.084 -2.766  1.326   1.00 56.58  ? 431 PRO A O     1 
ATOM   2806 C CB    . PRO C 3 258 ? -9.136  -3.269  0.244   1.00 49.44  ? 431 PRO A CB    1 
ATOM   2807 C CG    . PRO C 3 258 ? -8.040  -4.206  -0.115  1.00 56.40  ? 431 PRO A CG    1 
ATOM   2808 C CD    . PRO C 3 258 ? -8.686  -5.543  -0.294  1.00 50.71  ? 431 PRO A CD    1 
ATOM   2809 N N     . SER C 3 259 ? -12.161 -4.439  -0.182  1.00 44.79  ? 432 SER A N     1 
ATOM   2810 C CA    . SER C 3 259 ? -13.523 -4.151  -0.609  1.00 50.86  ? 432 SER A CA    1 
ATOM   2811 C C     . SER C 3 259 ? -14.567 -4.609  0.411   1.00 56.30  ? 432 SER A C     1 
ATOM   2812 O O     . SER C 3 259 ? -15.682 -4.087  0.443   1.00 63.47  ? 432 SER A O     1 
ATOM   2813 C CB    . SER C 3 259 ? -13.799 -4.808  -1.963  1.00 51.32  ? 432 SER A CB    1 
ATOM   2814 O OG    . SER C 3 259 ? -14.448 -6.060  -1.802  1.00 59.73  ? 432 SER A OG    1 
ATOM   2815 N N     . SER C 3 260 ? -14.199 -5.585  1.240   1.00 55.93  ? 433 SER A N     1 
ATOM   2816 C CA    . SER C 3 260 ? -15.130 -6.192  2.191   1.00 51.02  ? 433 SER A CA    1 
ATOM   2817 C C     . SER C 3 260 ? -15.650 -5.193  3.215   1.00 50.91  ? 433 SER A C     1 
ATOM   2818 O O     . SER C 3 260 ? -15.073 -4.122  3.398   1.00 61.96  ? 433 SER A O     1 
ATOM   2819 C CB    . SER C 3 260 ? -14.468 -7.369  2.908   1.00 50.09  ? 433 SER A CB    1 
ATOM   2820 O OG    . SER C 3 260 ? -13.853 -6.948  4.114   1.00 47.97  ? 433 SER A OG    1 
ATOM   2821 N N     . ARG C 3 261 ? -16.738 -5.555  3.888   1.00 46.95  ? 434 ARG A N     1 
ATOM   2822 C CA    . ARG C 3 261 ? -17.359 -4.669  4.868   1.00 50.99  ? 434 ARG A CA    1 
ATOM   2823 C C     . ARG C 3 261 ? -16.571 -4.629  6.178   1.00 54.02  ? 434 ARG A C     1 
ATOM   2824 O O     . ARG C 3 261 ? -16.405 -3.570  6.781   1.00 56.30  ? 434 ARG A O     1 
ATOM   2825 C CB    . ARG C 3 261 ? -18.818 -5.075  5.116   1.00 49.94  ? 434 ARG A CB    1 
ATOM   2826 C CG    . ARG C 3 261 ? -19.321 -4.781  6.519   1.00 51.82  ? 434 ARG A CG    1 
ATOM   2827 C CD    . ARG C 3 261 ? -19.548 -6.021  7.373   1.00 46.64  ? 434 ARG A CD    1 
ATOM   2828 N NE    . ARG C 3 261 ? -18.948 -5.886  8.696   1.00 65.37  ? 434 ARG A NE    1 
ATOM   2829 C CZ    . ARG C 3 261 ? -18.721 -6.897  9.526   1.00 79.82  ? 434 ARG A CZ    1 
ATOM   2830 N NH1   . ARG C 3 261 ? -19.044 -8.137  9.178   1.00 56.30  ? 434 ARG A NH1   1 
ATOM   2831 N NH2   . ARG C 3 261 ? -18.170 -6.669  10.712  1.00 78.07  ? 434 ARG A NH2   1 
ATOM   2832 N N     . ILE C 3 262 ? -16.080 -5.785  6.612   1.00 56.66  ? 435 ILE A N     1 
ATOM   2833 C CA    . ILE C 3 262 ? -15.266 -5.858  7.821   1.00 53.82  ? 435 ILE A CA    1 
ATOM   2834 C C     . ILE C 3 262 ? -14.023 -4.970  7.697   1.00 52.04  ? 435 ILE A C     1 
ATOM   2835 O O     . ILE C 3 262 ? -13.337 -4.703  8.683   1.00 56.43  ? 435 ILE A O     1 
ATOM   2836 C CB    . ILE C 3 262 ? -14.886 -7.333  8.138   1.00 54.62  ? 435 ILE A CB    1 
ATOM   2837 C CG1   . ILE C 3 262 ? -14.617 -7.519  9.636   1.00 23.98  ? 435 ILE A CG1   1 
ATOM   2838 C CG2   . ILE C 3 262 ? -13.685 -7.779  7.313   1.00 52.15  ? 435 ILE A CG2   1 
ATOM   2839 N N     . LYS C 3 263 ? -13.749 -4.512  6.477   1.00 47.68  ? 436 LYS A N     1 
ATOM   2840 C CA    . LYS C 3 263 ? -12.646 -3.593  6.220   1.00 45.35  ? 436 LYS A CA    1 
ATOM   2841 C C     . LYS C 3 263 ? -13.165 -2.197  5.884   1.00 48.79  ? 436 LYS A C     1 
ATOM   2842 O O     . LYS C 3 263 ? -12.637 -1.196  6.366   1.00 54.34  ? 436 LYS A O     1 
ATOM   2843 C CB    . LYS C 3 263 ? -11.765 -4.112  5.084   1.00 41.64  ? 436 LYS A CB    1 
ATOM   2844 C CG    . LYS C 3 263 ? -11.066 -5.426  5.388   1.00 44.87  ? 436 LYS A CG    1 
ATOM   2845 C CD    . LYS C 3 263 ? -9.755  -5.207  6.130   1.00 45.80  ? 436 LYS A CD    1 
ATOM   2846 C CE    . LYS C 3 263 ? -9.030  -6.524  6.369   1.00 42.74  ? 436 LYS A CE    1 
ATOM   2847 N NZ    . LYS C 3 263 ? -7.546  -6.389  6.255   1.00 49.60  ? 436 LYS A NZ    1 
ATOM   2848 N N     . GLY C 3 264 ? -14.203 -2.134  5.056   1.00 44.55  ? 437 GLY A N     1 
ATOM   2849 C CA    . GLY C 3 264 ? -14.808 -0.866  4.693   1.00 43.16  ? 437 GLY A CA    1 
ATOM   2850 C C     . GLY C 3 264 ? -15.419 -0.163  5.892   1.00 43.13  ? 437 GLY A C     1 
ATOM   2851 O O     . GLY C 3 264 ? -15.245 1.045   6.081   1.00 39.65  ? 437 GLY A O     1 
ATOM   2852 N N     . GLU C 3 265 ? -16.135 -0.930  6.708   1.00 48.47  ? 438 GLU A N     1 
ATOM   2853 C CA    . GLU C 3 265 ? -16.782 -0.398  7.901   1.00 47.58  ? 438 GLU A CA    1 
ATOM   2854 C C     . GLU C 3 265 ? -15.793 0.392   8.750   1.00 46.37  ? 438 GLU A C     1 
ATOM   2855 O O     . GLU C 3 265 ? -16.136 1.429   9.318   1.00 42.53  ? 438 GLU A O     1 
ATOM   2856 C CB    . GLU C 3 265 ? -17.394 -1.536  8.722   1.00 42.22  ? 438 GLU A CB    1 
ATOM   2857 C CG    . GLU C 3 265 ? -18.043 -1.095  10.023  1.00 75.18  ? 438 GLU A CG    1 
ATOM   2858 C CD    . GLU C 3 265 ? -19.552 -1.249  10.007  1.00 90.91  ? 438 GLU A CD    1 
ATOM   2859 O OE1   . GLU C 3 265 ? -20.180 -1.097  11.077  1.00 111.56 ? 438 GLU A OE1   1 
ATOM   2860 O OE2   . GLU C 3 265 ? -20.111 -1.522  8.925   1.00 81.12  ? 438 GLU A OE2   1 
ATOM   2861 N N     . LYS C 3 266 ? -14.561 -0.100  8.828   1.00 47.65  ? 439 LYS A N     1 
ATOM   2862 C CA    . LYS C 3 266 ? -13.540 0.556   9.631   1.00 49.68  ? 439 LYS A CA    1 
ATOM   2863 C C     . LYS C 3 266 ? -12.864 1.695   8.875   1.00 51.78  ? 439 LYS A C     1 
ATOM   2864 O O     . LYS C 3 266 ? -12.392 2.657   9.481   1.00 47.55  ? 439 LYS A O     1 
ATOM   2865 C CB    . LYS C 3 266 ? -12.511 -0.459  10.135  1.00 44.37  ? 439 LYS A CB    1 
ATOM   2866 C CG    . LYS C 3 266 ? -12.717 -0.849  11.599  1.00 69.65  ? 439 LYS A CG    1 
ATOM   2867 C CD    . LYS C 3 266 ? -11.493 -1.546  12.182  1.00 93.49  ? 439 LYS A CD    1 
ATOM   2868 C CE    . LYS C 3 266 ? -10.498 -0.548  12.767  1.00 74.09  ? 439 LYS A CE    1 
ATOM   2869 N NZ    . LYS C 3 266 ? -9.087  -1.022  12.619  1.00 20.33  ? 439 LYS A NZ    1 
ATOM   2870 N N     . ASP C 3 267 ? -12.828 1.590   7.551   1.00 56.08  ? 440 ASP A N     1 
ATOM   2871 C CA    . ASP C 3 267 ? -12.242 2.637   6.725   1.00 58.89  ? 440 ASP A CA    1 
ATOM   2872 C C     . ASP C 3 267 ? -13.159 3.855   6.672   1.00 64.50  ? 440 ASP A C     1 
ATOM   2873 O O     . ASP C 3 267 ? -12.698 4.996   6.730   1.00 63.18  ? 440 ASP A O     1 
ATOM   2874 C CB    . ASP C 3 267 ? -11.971 2.117   5.317   1.00 59.08  ? 440 ASP A CB    1 
ATOM   2875 C CG    . ASP C 3 267 ? -10.696 2.678   4.729   1.00 75.74  ? 440 ASP A CG    1 
ATOM   2876 O OD1   . ASP C 3 267 ? -9.767  2.989   5.508   1.00 65.34  ? 440 ASP A OD1   1 
ATOM   2877 O OD2   . ASP C 3 267 ? -10.535 2.840   3.499   1.00 80.10  ? 440 ASP A OD2   1 
ATOM   2878 N N     . TRP C 3 268 ? -14.461 3.602   6.562   1.00 68.12  ? 441 TRP A N     1 
ATOM   2879 C CA    . TRP C 3 268 ? -15.459 4.665   6.574   1.00 63.25  ? 441 TRP A CA    1 
ATOM   2880 C C     . TRP C 3 268 ? -15.473 5.333   7.941   1.00 58.38  ? 441 TRP A C     1 
ATOM   2881 O O     . TRP C 3 268 ? -15.736 6.526   8.058   1.00 59.94  ? 441 TRP A O     1 
ATOM   2882 C CB    . TRP C 3 268 ? -16.841 4.101   6.234   1.00 64.87  ? 441 TRP A CB    1 
ATOM   2883 C CG    . TRP C 3 268 ? -17.989 4.961   6.677   1.00 73.57  ? 441 TRP A CG    1 
ATOM   2884 C CD1   . TRP C 3 268 ? -18.628 5.918   5.943   1.00 73.11  ? 441 TRP A CD1   1 
ATOM   2885 C CD2   . TRP C 3 268 ? -18.643 4.934   7.951   1.00 85.28  ? 441 TRP A CD2   1 
ATOM   2886 N NE1   . TRP C 3 268 ? -19.634 6.493   6.682   1.00 68.08  ? 441 TRP A NE1   1 
ATOM   2887 C CE2   . TRP C 3 268 ? -19.665 5.907   7.921   1.00 92.97  ? 441 TRP A CE2   1 
ATOM   2888 C CE3   . TRP C 3 268 ? -18.467 4.187   9.124   1.00 76.37  ? 441 TRP A CE3   1 
ATOM   2889 C CZ2   . TRP C 3 268 ? -20.501 6.151   9.011   1.00 101.57 ? 441 TRP A CZ2   1 
ATOM   2890 C CZ3   . TRP C 3 268 ? -19.299 4.431   10.205  1.00 77.15  ? 441 TRP A CZ3   1 
ATOM   2891 C CH2   . TRP C 3 268 ? -20.302 5.405   10.141  1.00 96.15  ? 441 TRP A CH2   1 
ATOM   2892 N N     . GLN C 3 269 ? -15.172 4.550   8.971   1.00 52.38  ? 442 GLN A N     1 
ATOM   2893 C CA    . GLN C 3 269 ? -15.148 5.042   10.343  1.00 46.96  ? 442 GLN A CA    1 
ATOM   2894 C C     . GLN C 3 269 ? -13.869 5.818   10.631  1.00 36.89  ? 442 GLN A C     1 
ATOM   2895 O O     . GLN C 3 269 ? -13.870 6.766   11.414  1.00 33.21  ? 442 GLN A O     1 
ATOM   2896 C CB    . GLN C 3 269 ? -15.286 3.869   11.313  1.00 53.15  ? 442 GLN A CB    1 
ATOM   2897 C CG    . GLN C 3 269 ? -15.106 4.221   12.783  1.00 63.14  ? 442 GLN A CG    1 
ATOM   2898 C CD    . GLN C 3 269 ? -15.343 3.018   13.682  1.00 85.44  ? 442 GLN A CD    1 
ATOM   2899 O OE1   . GLN C 3 269 ? -15.711 1.942   13.203  1.00 87.40  ? 442 GLN A OE1   1 
ATOM   2900 N NE2   . GLN C 3 269 ? -15.134 3.194   14.983  1.00 90.54  ? 442 GLN A NE2   1 
ATOM   2901 N N     . LYS C 3 270 ? -12.780 5.408   9.989   1.00 33.57  ? 443 LYS A N     1 
ATOM   2902 C CA    . LYS C 3 270 ? -11.483 6.045   10.188  1.00 36.60  ? 443 LYS A CA    1 
ATOM   2903 C C     . LYS C 3 270 ? -11.538 7.529   9.858   1.00 38.66  ? 443 LYS A C     1 
ATOM   2904 O O     . LYS C 3 270 ? -11.199 8.371   10.690  1.00 44.34  ? 443 LYS A O     1 
ATOM   2905 C CB    . LYS C 3 270 ? -10.416 5.364   9.330   1.00 34.04  ? 443 LYS A CB    1 
ATOM   2906 C CG    . LYS C 3 270 ? -9.056  6.035   9.371   1.00 23.43  ? 443 LYS A CG    1 
ATOM   2907 C CD    . LYS C 3 270 ? -8.014  5.200   8.628   1.00 43.53  ? 443 LYS A CD    1 
ATOM   2908 C CE    . LYS C 3 270 ? -7.812  5.690   7.199   1.00 21.21  ? 443 LYS A CE    1 
ATOM   2909 N NZ    . LYS C 3 270 ? -7.831  4.558   6.219   1.00 42.93  ? 443 LYS A NZ    1 
ATOM   2910 N N     . TYR C 3 271 ? -11.974 7.838   8.640   1.00 40.21  ? 444 TYR A N     1 
ATOM   2911 C CA    . TYR C 3 271 ? -12.042 9.216   8.170   1.00 36.72  ? 444 TYR A CA    1 
ATOM   2912 C C     . TYR C 3 271 ? -13.078 10.025  8.943   1.00 36.75  ? 444 TYR A C     1 
ATOM   2913 O O     . TYR C 3 271 ? -12.924 11.232  9.131   1.00 38.54  ? 444 TYR A O     1 
ATOM   2914 C CB    . TYR C 3 271 ? -12.340 9.248   6.672   1.00 30.27  ? 444 TYR A CB    1 
ATOM   2915 C CG    . TYR C 3 271 ? -11.270 8.581   5.837   1.00 51.03  ? 444 TYR A CG    1 
ATOM   2916 C CD1   . TYR C 3 271 ? -11.524 7.390   5.171   1.00 62.07  ? 444 TYR A CD1   1 
ATOM   2917 C CD2   . TYR C 3 271 ? -10.003 9.137   5.724   1.00 57.61  ? 444 TYR A CD2   1 
ATOM   2918 C CE1   . TYR C 3 271 ? -10.547 6.776   4.411   1.00 53.79  ? 444 TYR A CE1   1 
ATOM   2919 C CE2   . TYR C 3 271 ? -9.021  8.529   4.966   1.00 52.50  ? 444 TYR A CE2   1 
ATOM   2920 C CZ    . TYR C 3 271 ? -9.298  7.351   4.313   1.00 49.37  ? 444 TYR A CZ    1 
ATOM   2921 O OH    . TYR C 3 271 ? -8.325  6.741   3.561   1.00 44.84  ? 444 TYR A OH    1 
ATOM   2922 N N     . GLU C 3 272 ? -14.128 9.350   9.397   1.00 36.24  ? 445 GLU A N     1 
ATOM   2923 C CA    . GLU C 3 272 ? -15.158 9.997   10.190  1.00 38.46  ? 445 GLU A CA    1 
ATOM   2924 C C     . GLU C 3 272 ? -14.582 10.446  11.526  1.00 45.29  ? 445 GLU A C     1 
ATOM   2925 O O     . GLU C 3 272 ? -14.966 11.486  12.061  1.00 55.34  ? 445 GLU A O     1 
ATOM   2926 C CB    . GLU C 3 272 ? -16.338 9.050   10.408  1.00 40.29  ? 445 GLU A CB    1 
ATOM   2927 C CG    . GLU C 3 272 ? -17.286 8.956   9.223   1.00 42.23  ? 445 GLU A CG    1 
ATOM   2928 C CD    . GLU C 3 272 ? -17.970 10.274  8.909   1.00 77.85  ? 445 GLU A CD    1 
ATOM   2929 O OE1   . GLU C 3 272 ? -19.062 10.526  9.466   1.00 77.94  ? 445 GLU A OE1   1 
ATOM   2930 O OE2   . GLU C 3 272 ? -17.421 11.055  8.102   1.00 79.41  ? 445 GLU A OE2   1 
ATOM   2931 N N     . THR C 3 273 ? -13.654 9.658   12.061  1.00 46.80  ? 446 THR A N     1 
ATOM   2932 C CA    . THR C 3 273 ? -12.973 10.017  13.299  1.00 45.92  ? 446 THR A CA    1 
ATOM   2933 C C     . THR C 3 273 ? -12.052 11.213  13.074  1.00 43.90  ? 446 THR A C     1 
ATOM   2934 O O     . THR C 3 273 ? -11.896 12.065  13.950  1.00 44.16  ? 446 THR A O     1 
ATOM   2935 C CB    . THR C 3 273 ? -12.180 8.817   13.850  1.00 42.24  ? 446 THR A CB    1 
ATOM   2936 O OG1   . THR C 3 273 ? -13.084 7.748   14.160  1.00 32.71  ? 446 THR A OG1   1 
ATOM   2937 C CG2   . THR C 3 273 ? -11.577 9.151   15.203  1.00 39.84  ? 446 THR A CG2   1 
ATOM   2938 N N     . ALA C 3 274 ? -11.453 11.277  11.889  1.00 39.54  ? 447 ALA A N     1 
ATOM   2939 C CA    . ALA C 3 274 ? -10.594 12.398  11.532  1.00 39.87  ? 447 ALA A CA    1 
ATOM   2940 C C     . ALA C 3 274 ? -11.427 13.640  11.251  1.00 46.67  ? 447 ALA A C     1 
ATOM   2941 O O     . ALA C 3 274 ? -10.920 14.762  11.294  1.00 50.65  ? 447 ALA A O     1 
ATOM   2942 C CB    . ALA C 3 274 ? -9.743  12.053  10.335  1.00 40.36  ? 447 ALA A CB    1 
ATOM   2943 N N     . ARG C 3 275 ? -12.708 13.431  10.959  1.00 46.64  ? 448 ARG A N     1 
ATOM   2944 C CA    . ARG C 3 275 ? -13.640 14.532  10.746  1.00 40.91  ? 448 ARG A CA    1 
ATOM   2945 C C     . ARG C 3 275 ? -14.186 15.008  12.079  1.00 39.21  ? 448 ARG A C     1 
ATOM   2946 O O     . ARG C 3 275 ? -14.493 16.186  12.254  1.00 39.30  ? 448 ARG A O     1 
ATOM   2947 C CB    . ARG C 3 275 ? -14.785 14.102  9.831   1.00 37.57  ? 448 ARG A CB    1 
ATOM   2948 C CG    . ARG C 3 275 ? -14.444 14.193  8.360   1.00 32.81  ? 448 ARG A CG    1 
ATOM   2949 C CD    . ARG C 3 275 ? -15.347 13.384  7.463   1.00 48.89  ? 448 ARG A CD    1 
ATOM   2950 N NE    . ARG C 3 275 ? -16.195 14.246  6.648   1.00 56.08  ? 448 ARG A NE    1 
ATOM   2951 C CZ    . ARG C 3 275 ? -17.431 14.592  6.975   1.00 55.97  ? 448 ARG A CZ    1 
ATOM   2952 N NH1   . ARG C 3 275 ? -17.967 14.145  8.104   1.00 58.25  ? 448 ARG A NH1   1 
ATOM   2953 N NH2   . ARG C 3 275 ? -18.135 15.384  6.177   1.00 64.44  ? 448 ARG A NH2   1 
ATOM   2954 N N     . ARG C 3 276 ? -14.309 14.076  13.017  1.00 47.72  ? 449 ARG A N     1 
ATOM   2955 C CA    . ARG C 3 276 ? -14.718 14.410  14.370  1.00 60.01  ? 449 ARG A CA    1 
ATOM   2956 C C     . ARG C 3 276 ? -13.677 15.340  14.973  1.00 60.49  ? 449 ARG A C     1 
ATOM   2957 O O     . ARG C 3 276 ? -14.007 16.316  15.649  1.00 65.80  ? 449 ARG A O     1 
ATOM   2958 C CB    . ARG C 3 276 ? -14.847 13.142  15.216  1.00 62.43  ? 449 ARG A CB    1 
ATOM   2959 C CG    . ARG C 3 276 ? -16.008 13.157  16.196  1.00 77.43  ? 449 ARG A CG    1 
ATOM   2960 C CD    . ARG C 3 276 ? -16.858 11.897  16.164  1.00 79.82  ? 449 ARG A CD    1 
ATOM   2961 N NE    . ARG C 3 276 ? -16.096 10.739  15.709  1.00 87.35  ? 449 ARG A NE    1 
ATOM   2962 C CZ    . ARG C 3 276 ? -15.580 9.820   16.514  1.00 91.21  ? 449 ARG A CZ    1 
ATOM   2963 N NH1   . ARG C 3 276 ? -15.744 9.914   17.827  1.00 83.97  ? 449 ARG A NH1   1 
ATOM   2964 N NH2   . ARG C 3 276 ? -14.900 8.801   16.006  1.00 98.30  ? 449 ARG A NH2   1 
ATOM   2965 N N     . LEU C 3 277 ? -12.412 15.027  14.708  1.00 56.81  ? 450 LEU A N     1 
ATOM   2966 C CA    . LEU C 3 277 ? -11.302 15.827  15.200  1.00 56.12  ? 450 LEU A CA    1 
ATOM   2967 C C     . LEU C 3 277 ? -11.345 17.228  14.609  1.00 58.65  ? 450 LEU A C     1 
ATOM   2968 O O     . LEU C 3 277 ? -11.098 18.211  15.307  1.00 63.03  ? 450 LEU A O     1 
ATOM   2969 C CB    . LEU C 3 277 ? -9.972  15.150  14.865  1.00 55.42  ? 450 LEU A CB    1 
ATOM   2970 C CG    . LEU C 3 277 ? -8.696  15.980  15.015  1.00 32.33  ? 450 LEU A CG    1 
ATOM   2971 C CD1   . LEU C 3 277 ? -8.445  16.324  16.474  1.00 67.37  ? 450 LEU A CD1   1 
ATOM   2972 C CD2   . LEU C 3 277 ? -7.514  15.226  14.431  1.00 53.90  ? 450 LEU A CD2   1 
ATOM   2973 N N     . LYS C 3 278 ? -11.672 17.314  13.323  1.00 61.38  ? 451 LYS A N     1 
ATOM   2974 C CA    . LYS C 3 278 ? -11.721 18.595  12.628  1.00 64.40  ? 451 LYS A CA    1 
ATOM   2975 C C     . LYS C 3 278 ? -12.468 19.643  13.447  1.00 61.92  ? 451 LYS A C     1 
ATOM   2976 O O     . LYS C 3 278 ? -12.127 20.826  13.415  1.00 64.87  ? 451 LYS A O     1 
ATOM   2977 C CB    . LYS C 3 278 ? -12.350 18.433  11.237  1.00 65.43  ? 451 LYS A CB    1 
ATOM   2978 C CG    . LYS C 3 278 ? -13.438 19.448  10.896  1.00 81.42  ? 451 LYS A CG    1 
ATOM   2979 C CD    . LYS C 3 278 ? -12.877 20.629  10.106  1.00 86.89  ? 451 LYS A CD    1 
ATOM   2980 C CE    . LYS C 3 278 ? -13.734 20.937  8.886   1.00 71.63  ? 451 LYS A CE    1 
ATOM   2981 N NZ    . LYS C 3 278 ? -13.315 20.128  7.703   1.00 38.18  ? 451 LYS A NZ    1 
ATOM   2982 N N     . LYS C 3 279 ? -13.477 19.201  14.189  1.00 59.38  ? 452 LYS A N     1 
ATOM   2983 C CA    . LYS C 3 279 ? -14.260 20.110  15.014  1.00 63.78  ? 452 LYS A CA    1 
ATOM   2984 C C     . LYS C 3 279 ? -13.461 20.625  16.211  1.00 61.92  ? 452 LYS A C     1 
ATOM   2985 O O     . LYS C 3 279 ? -13.135 21.813  16.291  1.00 61.11  ? 452 LYS A O     1 
ATOM   2986 C CB    . LYS C 3 279 ? -15.547 19.431  15.484  1.00 65.26  ? 452 LYS A CB    1 
ATOM   2987 C CG    . LYS C 3 279 ? -16.811 20.043  14.903  1.00 85.86  ? 452 LYS A CG    1 
ATOM   2988 C CD    . LYS C 3 279 ? -17.793 18.972  14.457  1.00 94.48  ? 452 LYS A CD    1 
ATOM   2989 C CE    . LYS C 3 279 ? -17.595 18.617  12.993  1.00 80.50  ? 452 LYS A CE    1 
ATOM   2990 N NZ    . LYS C 3 279 ? -18.128 17.261  12.690  1.00 79.25  ? 452 LYS A NZ    1 
ATOM   2991 N N     . CYS C 3 280 ? -13.135 19.722  17.130  1.00 62.15  ? 453 CYS A N     1 
ATOM   2992 C CA    . CYS C 3 280 ? -12.480 20.098  18.378  1.00 68.01  ? 453 CYS A CA    1 
ATOM   2993 C C     . CYS C 3 280 ? -10.961 20.230  18.252  1.00 70.40  ? 453 CYS A C     1 
ATOM   2994 O O     . CYS C 3 280 ? -10.248 20.244  19.259  1.00 70.04  ? 453 CYS A O     1 
ATOM   2995 C CB    . CYS C 3 280 ? -12.834 19.096  19.478  1.00 72.26  ? 453 CYS A CB    1 
ATOM   2996 S SG    . CYS C 3 280 ? -12.831 17.373  18.933  1.00 74.89  ? 453 CYS A SG    1 
ATOM   2997 N N     . VAL C 3 281 ? -10.467 20.332  17.020  1.00 69.41  ? 454 VAL A N     1 
ATOM   2998 C CA    . VAL C 3 281 ? -9.034  20.501  16.792  1.00 62.91  ? 454 VAL A CA    1 
ATOM   2999 C C     . VAL C 3 281 ? -8.549  21.795  17.424  1.00 52.84  ? 454 VAL A C     1 
ATOM   3000 O O     . VAL C 3 281 ? -7.491  21.831  18.047  1.00 51.65  ? 454 VAL A O     1 
ATOM   3001 C CB    . VAL C 3 281 ? -8.670  20.486  15.283  1.00 67.90  ? 454 VAL A CB    1 
ATOM   3002 C CG1   . VAL C 3 281 ? -9.226  21.715  14.568  1.00 69.65  ? 454 VAL A CG1   1 
ATOM   3003 C CG2   . VAL C 3 281 ? -7.160  20.388  15.094  1.00 68.41  ? 454 VAL A CG2   1 
ATOM   3004 N N     . ASP C 3 282 ? -9.339  22.852  17.267  1.00 51.81  ? 455 ASP A N     1 
ATOM   3005 C CA    . ASP C 3 282 ? -9.007  24.149  17.831  1.00 53.41  ? 455 ASP A CA    1 
ATOM   3006 C C     . ASP C 3 282 ? -8.923  24.052  19.351  1.00 51.72  ? 455 ASP A C     1 
ATOM   3007 O O     . ASP C 3 282 ? -8.045  24.651  19.976  1.00 43.73  ? 455 ASP A O     1 
ATOM   3008 C CB    . ASP C 3 282 ? -10.045 25.194  17.409  1.00 54.06  ? 455 ASP A CB    1 
ATOM   3009 C CG    . ASP C 3 282 ? -9.660  25.911  16.125  1.00 80.61  ? 455 ASP A CG    1 
ATOM   3010 O OD1   . ASP C 3 282 ? -9.860  25.333  15.033  1.00 92.96  ? 455 ASP A OD1   1 
ATOM   3011 O OD2   . ASP C 3 282 ? -9.150  27.053  16.109  1.00 103.55 ? 455 ASP A OD2   1 
ATOM   3012 N N     . LYS C 3 283 ? -9.836  23.287  19.939  1.00 53.79  ? 456 LYS A N     1 
ATOM   3013 C CA    . LYS C 3 283 ? -9.836  23.077  21.379  1.00 58.78  ? 456 LYS A CA    1 
ATOM   3014 C C     . LYS C 3 283 ? -8.572  22.337  21.793  1.00 55.33  ? 456 LYS A C     1 
ATOM   3015 O O     . LYS C 3 283 ? -7.884  22.745  22.728  1.00 59.57  ? 456 LYS A O     1 
ATOM   3016 C CB    . LYS C 3 283 ? -11.079 22.293  21.814  1.00 62.88  ? 456 LYS A CB    1 
ATOM   3017 C CG    . LYS C 3 283 ? -10.990 21.699  23.218  1.00 74.38  ? 456 LYS A CG    1 
ATOM   3018 C CD    . LYS C 3 283 ? -11.740 20.373  23.307  1.00 99.13  ? 456 LYS A CD    1 
ATOM   3019 C CE    . LYS C 3 283 ? -11.355 19.589  24.558  1.00 104.49 ? 456 LYS A CE    1 
ATOM   3020 N NZ    . LYS C 3 283 ? -11.985 18.236  24.595  1.00 83.03  ? 456 LYS A NZ    1 
ATOM   3021 N N     . ILE C 3 284 ? -8.266  21.257  21.081  1.00 48.20  ? 457 ILE A N     1 
ATOM   3022 C CA    . ILE C 3 284 ? -7.101  20.436  21.393  1.00 44.20  ? 457 ILE A CA    1 
ATOM   3023 C C     . ILE C 3 284 ? -5.802  21.205  21.153  1.00 48.18  ? 457 ILE A C     1 
ATOM   3024 O O     . ILE C 3 284 ? -4.844  21.068  21.910  1.00 51.45  ? 457 ILE A O     1 
ATOM   3025 C CB    . ILE C 3 284 ? -7.126  19.126  20.575  1.00 46.64  ? 457 ILE A CB    1 
ATOM   3026 C CG1   . ILE C 3 284 ? -8.264  18.214  21.044  1.00 33.44  ? 457 ILE A CG1   1 
ATOM   3027 C CG2   . ILE C 3 284 ? -5.799  18.405  20.679  1.00 26.30  ? 457 ILE A CG2   1 
ATOM   3028 N N     . ARG C 3 285 ? -5.777  22.020  20.101  1.00 53.97  ? 458 ARG A N     1 
ATOM   3029 C CA    . ARG C 3 285 ? -4.613  22.851  19.808  1.00 55.76  ? 458 ARG A CA    1 
ATOM   3030 C C     . ARG C 3 285 ? -4.383  23.844  20.941  1.00 60.50  ? 458 ARG A C     1 
ATOM   3031 O O     . ARG C 3 285 ? -3.308  23.876  21.539  1.00 59.11  ? 458 ARG A O     1 
ATOM   3032 C CB    . ARG C 3 285 ? -4.790  23.591  18.481  1.00 58.64  ? 458 ARG A CB    1 
ATOM   3033 C CG    . ARG C 3 285 ? -4.039  22.966  17.315  1.00 60.85  ? 458 ARG A CG    1 
ATOM   3034 C CD    . ARG C 3 285 ? -4.164  23.739  16.009  1.00 78.28  ? 458 ARG A CD    1 
ATOM   3035 N NE    . ARG C 3 285 ? -4.059  22.868  14.839  1.00 80.15  ? 458 ARG A NE    1 
ATOM   3036 C CZ    . ARG C 3 285 ? -4.839  22.955  13.770  1.00 79.01  ? 458 ARG A CZ    1 
ATOM   3037 N NH1   . ARG C 3 285 ? -5.792  23.878  13.712  1.00 81.43  ? 458 ARG A NH1   1 
ATOM   3038 N NH2   . ARG C 3 285 ? -4.669  22.120  12.755  1.00 82.10  ? 458 ARG A NH2   1 
ATOM   3039 N N     . ASN C 3 286 ? -5.406  24.644  21.239  1.00 69.14  ? 459 ASN A N     1 
ATOM   3040 C CA    . ASN C 3 286 ? -5.340  25.597  22.343  1.00 72.45  ? 459 ASN A CA    1 
ATOM   3041 C C     . ASN C 3 286 ? -5.254  24.897  23.694  1.00 66.85  ? 459 ASN A C     1 
ATOM   3042 O O     . ASN C 3 286 ? -5.142  25.545  24.729  1.00 64.36  ? 459 ASN A O     1 
ATOM   3043 C CB    . ASN C 3 286 ? -6.548  26.539  22.321  1.00 77.26  ? 459 ASN A CB    1 
ATOM   3044 C CG    . ASN C 3 286 ? -6.699  27.269  20.999  1.00 87.64  ? 459 ASN A CG    1 
ATOM   3045 O OD1   . ASN C 3 286 ? -5.712  27.590  20.334  1.00 100.39 ? 459 ASN A OD1   1 
ATOM   3046 N ND2   . ASN C 3 286 ? -7.941  27.535  20.610  1.00 86.12  ? 459 ASN A ND2   1 
ATOM   3047 N N     . GLN C 3 287 ? -5.316  23.571  23.677  1.00 70.16  ? 460 GLN A N     1 
ATOM   3048 C CA    . GLN C 3 287 ? -5.215  22.788  24.901  1.00 74.79  ? 460 GLN A CA    1 
ATOM   3049 C C     . GLN C 3 287 ? -3.769  22.409  25.173  1.00 73.10  ? 460 GLN A C     1 
ATOM   3050 O O     . GLN C 3 287 ? -3.221  22.747  26.221  1.00 74.81  ? 460 GLN A O     1 
ATOM   3051 C CB    . GLN C 3 287 ? -6.079  21.529  24.814  1.00 79.58  ? 460 GLN A CB    1 
ATOM   3052 C CG    . GLN C 3 287 ? -6.936  21.279  26.043  1.00 85.79  ? 460 GLN A CG    1 
ATOM   3053 C CD    . GLN C 3 287 ? -6.382  20.174  26.920  1.00 89.14  ? 460 GLN A CD    1 
ATOM   3054 O OE1   . GLN C 3 287 ? -6.908  19.061  26.931  1.00 69.78  ? 460 GLN A OE1   1 
ATOM   3055 N NE2   . GLN C 3 287 ? -5.319  20.477  27.659  1.00 94.14  ? 460 GLN A NE2   1 
ATOM   3056 N N     . TYR C 3 288 ? -3.149  21.710  24.226  1.00 70.70  ? 461 TYR A N     1 
ATOM   3057 C CA    . TYR C 3 288 ? -1.763  21.290  24.396  1.00 73.77  ? 461 TYR A CA    1 
ATOM   3058 C C     . TYR C 3 288 ? -0.816  22.485  24.399  1.00 77.04  ? 461 TYR A C     1 
ATOM   3059 O O     . TYR C 3 288 ? 0.372   22.346  24.688  1.00 79.66  ? 461 TYR A O     1 
ATOM   3060 C CB    . TYR C 3 288 ? -1.352  20.243  23.345  1.00 73.50  ? 461 TYR A CB    1 
ATOM   3061 C CG    . TYR C 3 288 ? -1.199  20.754  21.920  1.00 67.45  ? 461 TYR A CG    1 
ATOM   3062 C CD1   . TYR C 3 288 ? -1.847  20.121  20.864  1.00 50.82  ? 461 TYR A CD1   1 
ATOM   3063 C CD2   . TYR C 3 288 ? -0.389  21.848  21.628  1.00 68.79  ? 461 TYR A CD2   1 
ATOM   3064 C CE1   . TYR C 3 288 ? -1.706  20.575  19.563  1.00 76.85  ? 461 TYR A CE1   1 
ATOM   3065 C CE2   . TYR C 3 288 ? -0.245  22.310  20.331  1.00 63.01  ? 461 TYR A CE2   1 
ATOM   3066 C CZ    . TYR C 3 288 ? -0.904  21.670  19.303  1.00 67.73  ? 461 TYR A CZ    1 
ATOM   3067 O OH    . TYR C 3 288 ? -0.759  22.128  18.013  1.00 61.13  ? 461 TYR A OH    1 
ATOM   3068 N N     . ARG C 3 289 ? -1.350  23.662  24.084  1.00 79.59  ? 462 ARG A N     1 
ATOM   3069 C CA    . ARG C 3 289 ? -0.548  24.879  24.078  1.00 86.93  ? 462 ARG A CA    1 
ATOM   3070 C C     . ARG C 3 289 ? -0.401  25.419  25.493  1.00 87.87  ? 462 ARG A C     1 
ATOM   3071 O O     . ARG C 3 289 ? 0.519   26.182  25.784  1.00 88.52  ? 462 ARG A O     1 
ATOM   3072 C CB    . ARG C 3 289 ? -1.168  25.935  23.163  1.00 91.10  ? 462 ARG A CB    1 
ATOM   3073 C CG    . ARG C 3 289 ? -0.665  25.882  21.727  1.00 92.28  ? 462 ARG A CG    1 
ATOM   3074 C CD    . ARG C 3 289 ? -1.328  26.889  20.803  1.00 108.20 ? 462 ARG A CD    1 
ATOM   3075 N NE    . ARG C 3 289 ? -0.549  28.120  20.703  1.00 129.98 ? 462 ARG A NE    1 
ATOM   3076 C CZ    . ARG C 3 289 ? -0.593  29.107  21.593  1.00 135.89 ? 462 ARG A CZ    1 
ATOM   3077 N NH1   . ARG C 3 289 ? -1.383  29.020  22.658  1.00 130.34 ? 462 ARG A NH1   1 
ATOM   3078 N NH2   . ARG C 3 289 ? 0.154   30.189  21.416  1.00 141.03 ? 462 ARG A NH2   1 
ATOM   3079 N N     . GLU C 3 290 ? -1.321  25.018  26.366  1.00 90.33  ? 463 GLU A N     1 
ATOM   3080 C CA    . GLU C 3 290 ? -1.241  25.361  27.781  1.00 90.04  ? 463 GLU A CA    1 
ATOM   3081 C C     . GLU C 3 290 ? -0.509  24.256  28.535  1.00 85.05  ? 463 GLU A C     1 
ATOM   3082 O O     . GLU C 3 290 ? 0.161   24.515  29.535  1.00 86.28  ? 463 GLU A O     1 
ATOM   3083 C CB    . GLU C 3 290 ? -2.637  25.570  28.381  1.00 92.86  ? 463 GLU A CB    1 
ATOM   3084 C CG    . GLU C 3 290 ? -3.666  26.153  27.422  1.00 97.73  ? 463 GLU A CG    1 
ATOM   3085 C CD    . GLU C 3 290 ? -3.338  27.571  26.991  1.00 109.74 ? 463 GLU A CD    1 
ATOM   3086 O OE1   . GLU C 3 290 ? -2.874  28.364  27.839  1.00 109.27 ? 463 GLU A OE1   1 
ATOM   3087 O OE2   . GLU C 3 290 ? -3.545  27.896  25.802  1.00 118.55 ? 463 GLU A OE2   1 
ATOM   3088 N N     . ASP C 3 291 ? -0.641  23.025  28.041  1.00 80.99  ? 464 ASP A N     1 
ATOM   3089 C CA    . ASP C 3 291 ? 0.029   21.870  28.635  1.00 76.33  ? 464 ASP A CA    1 
ATOM   3090 C C     . ASP C 3 291 ? 1.549   22.025  28.618  1.00 76.18  ? 464 ASP A C     1 
ATOM   3091 O O     . ASP C 3 291 ? 2.269   21.217  29.206  1.00 70.45  ? 464 ASP A O     1 
ATOM   3092 C CB    . ASP C 3 291 ? -0.370  20.589  27.902  1.00 69.51  ? 464 ASP A CB    1 
ATOM   3093 C CG    . ASP C 3 291 ? -1.710  20.056  28.349  1.00 75.01  ? 464 ASP A CG    1 
ATOM   3094 O OD1   . ASP C 3 291 ? -2.385  20.735  29.150  1.00 71.77  ? 464 ASP A OD1   1 
ATOM   3095 O OD2   . ASP C 3 291 ? -2.171  18.965  27.952  1.00 98.58  ? 464 ASP A OD2   1 
ATOM   3096 N N     . TRP C 3 292 ? 2.022   23.064  27.934  1.00 75.89  ? 465 TRP A N     1 
ATOM   3097 C CA    . TRP C 3 292 ? 3.441   23.395  27.899  1.00 74.84  ? 465 TRP A CA    1 
ATOM   3098 C C     . TRP C 3 292 ? 3.857   24.096  29.190  1.00 79.33  ? 465 TRP A C     1 
ATOM   3099 O O     . TRP C 3 292 ? 5.048   24.258  29.457  1.00 81.78  ? 465 TRP A O     1 
ATOM   3100 C CB    . TRP C 3 292 ? 3.755   24.298  26.702  1.00 73.23  ? 465 TRP A CB    1 
ATOM   3101 C CG    . TRP C 3 292 ? 3.492   23.679  25.358  1.00 75.09  ? 465 TRP A CG    1 
ATOM   3102 C CD1   . TRP C 3 292 ? 3.270   22.360  25.088  1.00 77.47  ? 465 TRP A CD1   1 
ATOM   3103 C CD2   . TRP C 3 292 ? 3.431   24.359  24.095  1.00 69.45  ? 465 TRP A CD2   1 
ATOM   3104 N NE1   . TRP C 3 292 ? 3.069   22.176  23.740  1.00 82.98  ? 465 TRP A NE1   1 
ATOM   3105 C CE2   . TRP C 3 292 ? 3.164   23.388  23.107  1.00 75.17  ? 465 TRP A CE2   1 
ATOM   3106 C CE3   . TRP C 3 292 ? 3.572   25.695  23.697  1.00 50.99  ? 465 TRP A CE3   1 
ATOM   3107 C CZ2   . TRP C 3 292 ? 3.037   23.709  21.754  1.00 63.96  ? 465 TRP A CZ2   1 
ATOM   3108 C CZ3   . TRP C 3 292 ? 3.447   26.011  22.352  1.00 47.51  ? 465 TRP A CZ3   1 
ATOM   3109 C CH2   . TRP C 3 292 ? 3.182   25.023  21.400  1.00 47.56  ? 465 TRP A CH2   1 
ATOM   3110 N N     . LYS C 3 293 ? 2.872   24.513  29.984  1.00 81.51  ? 466 LYS A N     1 
ATOM   3111 C CA    . LYS C 3 293 ? 3.125   25.240  31.229  1.00 78.89  ? 466 LYS A CA    1 
ATOM   3112 C C     . LYS C 3 293 ? 2.815   24.401  32.469  1.00 78.83  ? 466 LYS A C     1 
ATOM   3113 O O     . LYS C 3 293 ? 2.723   24.928  33.577  1.00 79.12  ? 466 LYS A O     1 
ATOM   3114 C CB    . LYS C 3 293 ? 2.302   26.533  31.275  1.00 76.31  ? 466 LYS A CB    1 
ATOM   3115 C CG    . LYS C 3 293 ? 2.571   27.507  30.138  1.00 77.00  ? 466 LYS A CG    1 
ATOM   3116 C CD    . LYS C 3 293 ? 4.062   27.671  29.889  1.00 107.33 ? 466 LYS A CD    1 
ATOM   3117 C CE    . LYS C 3 293 ? 4.402   27.412  28.432  1.00 115.89 ? 466 LYS A CE    1 
ATOM   3118 N NZ    . LYS C 3 293 ? 5.696   26.686  28.273  1.00 105.98 ? 466 LYS A NZ    1 
ATOM   3119 N N     . SER C 3 294 ? 2.657   23.096  32.279  1.00 79.69  ? 467 SER A N     1 
ATOM   3120 C CA    . SER C 3 294 ? 2.269   22.205  33.368  1.00 81.94  ? 467 SER A CA    1 
ATOM   3121 C C     . SER C 3 294 ? 3.329   22.101  34.463  1.00 82.82  ? 467 SER A C     1 
ATOM   3122 O O     . SER C 3 294 ? 4.516   22.327  34.220  1.00 78.17  ? 467 SER A O     1 
ATOM   3123 C CB    . SER C 3 294 ? 1.942   20.813  32.824  1.00 83.50  ? 467 SER A CB    1 
ATOM   3124 O OG    . SER C 3 294 ? 2.138   19.814  33.811  1.00 83.65  ? 467 SER A OG    1 
ATOM   3125 N N     . LYS C 3 295 ? 2.884   21.760  35.669  1.00 86.69  ? 468 LYS A N     1 
ATOM   3126 C CA    . LYS C 3 295 ? 3.788   21.516  36.788  1.00 91.09  ? 468 LYS A CA    1 
ATOM   3127 C C     . LYS C 3 295 ? 4.138   20.033  36.864  1.00 93.66  ? 468 LYS A C     1 
ATOM   3128 O O     . LYS C 3 295 ? 4.346   19.482  37.946  1.00 96.81  ? 468 LYS A O     1 
ATOM   3129 C CB    . LYS C 3 295 ? 3.164   21.985  38.104  1.00 89.95  ? 468 LYS A CB    1 
ATOM   3130 C CG    . LYS C 3 295 ? 2.692   23.432  38.092  1.00 99.92  ? 468 LYS A CG    1 
ATOM   3131 C CD    . LYS C 3 295 ? 3.844   24.396  37.820  1.00 107.93 ? 468 LYS A CD    1 
ATOM   3132 C CE    . LYS C 3 295 ? 3.418   25.527  36.887  1.00 117.97 ? 468 LYS A CE    1 
ATOM   3133 N NZ    . LYS C 3 295 ? 2.736   26.646  37.606  1.00 112.78 ? 468 LYS A NZ    1 
ATOM   3134 N N     . GLU C 3 296 ? 4.195   19.393  35.700  1.00 95.53  ? 469 GLU A N     1 
ATOM   3135 C CA    . GLU C 3 296 ? 4.543   17.984  35.607  1.00 98.74  ? 469 GLU A CA    1 
ATOM   3136 C C     . GLU C 3 296 ? 5.310   17.722  34.317  1.00 101.37 ? 469 GLU A C     1 
ATOM   3137 O O     . GLU C 3 296 ? 5.023   18.323  33.281  1.00 100.73 ? 469 GLU A O     1 
ATOM   3138 C CB    . GLU C 3 296 ? 3.284   17.118  35.657  1.00 100.44 ? 469 GLU A CB    1 
ATOM   3139 C CG    . GLU C 3 296 ? 3.548   15.659  35.998  1.00 105.99 ? 469 GLU A CG    1 
ATOM   3140 C CD    . GLU C 3 296 ? 2.611   15.134  37.066  1.00 110.17 ? 469 GLU A CD    1 
ATOM   3141 O OE1   . GLU C 3 296 ? 1.390   15.381  36.961  1.00 86.41  ? 469 GLU A OE1   1 
ATOM   3142 O OE2   . GLU C 3 296 ? 3.096   14.475  38.010  1.00 117.22 ? 469 GLU A OE2   1 
ATOM   3143 N N     . MET C 3 297 ? 6.287   16.822  34.387  1.00 103.14 ? 470 MET A N     1 
ATOM   3144 C CA    . MET C 3 297 ? 7.102   16.485  33.226  1.00 101.10 ? 470 MET A CA    1 
ATOM   3145 C C     . MET C 3 297 ? 6.275   15.831  32.124  1.00 101.26 ? 470 MET A C     1 
ATOM   3146 O O     . MET C 3 297 ? 6.059   16.427  31.067  1.00 100.63 ? 470 MET A O     1 
ATOM   3147 C CB    . MET C 3 297 ? 8.265   15.576  33.628  1.00 100.86 ? 470 MET A CB    1 
ATOM   3148 C CG    . MET C 3 297 ? 9.576   16.314  33.856  1.00 107.76 ? 470 MET A CG    1 
ATOM   3149 S SD    . MET C 3 297 ? 10.253  17.046  32.349  1.00 103.23 ? 470 MET A SD    1 
ATOM   3150 C CE    . MET C 3 297 ? 9.484   18.679  32.384  1.00 89.62  ? 470 MET A CE    1 
ATOM   3151 N N     . LYS C 3 298 ? 5.805   14.612  32.381  1.00 99.81  ? 471 LYS A N     1 
ATOM   3152 C CA    . LYS C 3 298 ? 5.064   13.847  31.378  1.00 97.81  ? 471 LYS A CA    1 
ATOM   3153 C C     . LYS C 3 298 ? 4.082   14.716  30.597  1.00 89.88  ? 471 LYS A C     1 
ATOM   3154 O O     . LYS C 3 298 ? 4.016   14.635  29.371  1.00 92.39  ? 471 LYS A O     1 
ATOM   3155 C CB    . LYS C 3 298 ? 4.352   12.638  32.007  1.00 101.18 ? 471 LYS A CB    1 
ATOM   3156 C CG    . LYS C 3 298 ? 3.287   12.969  33.050  1.00 111.91 ? 471 LYS A CG    1 
ATOM   3157 C CD    . LYS C 3 298 ? 2.841   11.716  33.803  1.00 107.62 ? 471 LYS A CD    1 
ATOM   3158 C CE    . LYS C 3 298 ? 1.789   10.933  33.023  1.00 97.57  ? 471 LYS A CE    1 
ATOM   3159 N NZ    . LYS C 3 298 ? 1.048   9.970   33.886  1.00 70.85  ? 471 LYS A NZ    1 
ATOM   3160 N N     . VAL C 3 299 ? 3.335   15.554  31.309  1.00 81.22  ? 472 VAL A N     1 
ATOM   3161 C CA    . VAL C 3 299 ? 2.384   16.454  30.670  1.00 77.08  ? 472 VAL A CA    1 
ATOM   3162 C C     . VAL C 3 299 ? 3.113   17.497  29.836  1.00 74.74  ? 472 VAL A C     1 
ATOM   3163 O O     . VAL C 3 299 ? 2.802   17.696  28.663  1.00 75.41  ? 472 VAL A O     1 
ATOM   3164 C CB    . VAL C 3 299 ? 1.492   17.165  31.701  1.00 76.25  ? 472 VAL A CB    1 
ATOM   3165 C CG1   . VAL C 3 299 ? 0.620   18.216  31.016  1.00 65.03  ? 472 VAL A CG1   1 
ATOM   3166 C CG2   . VAL C 3 299 ? 0.631   16.149  32.445  1.00 80.46  ? 472 VAL A CG2   1 
ATOM   3167 N N     . ARG C 3 300 ? 4.088   18.158  30.448  1.00 70.32  ? 473 ARG A N     1 
ATOM   3168 C CA    . ARG C 3 300 ? 4.898   19.137  29.741  1.00 74.73  ? 473 ARG A CA    1 
ATOM   3169 C C     . ARG C 3 300 ? 5.594   18.490  28.549  1.00 75.37  ? 473 ARG A C     1 
ATOM   3170 O O     . ARG C 3 300 ? 5.863   19.146  27.541  1.00 76.16  ? 473 ARG A O     1 
ATOM   3171 C CB    . ARG C 3 300 ? 5.934   19.745  30.684  1.00 78.36  ? 473 ARG A CB    1 
ATOM   3172 C CG    . ARG C 3 300 ? 5.501   21.052  31.319  1.00 78.44  ? 473 ARG A CG    1 
ATOM   3173 C CD    . ARG C 3 300 ? 6.603   22.101  31.357  1.00 59.09  ? 473 ARG A CD    1 
ATOM   3174 N NE    . ARG C 3 300 ? 6.222   23.248  32.173  1.00 87.63  ? 473 ARG A NE    1 
ATOM   3175 C CZ    . ARG C 3 300 ? 6.918   24.373  32.246  1.00 95.90  ? 473 ARG A CZ    1 
ATOM   3176 N NH1   . ARG C 3 300 ? 8.039   24.508  31.550  1.00 85.86  ? 473 ARG A NH1   1 
ATOM   3177 N NH2   . ARG C 3 300 ? 6.495   25.367  33.015  1.00 94.86  ? 473 ARG A NH2   1 
ATOM   3178 N N     . GLN C 3 301 ? 5.877   17.197  28.670  1.00 74.23  ? 474 GLN A N     1 
ATOM   3179 C CA    . GLN C 3 301 ? 6.558   16.455  27.617  1.00 69.16  ? 474 GLN A CA    1 
ATOM   3180 C C     . GLN C 3 301 ? 5.596   16.089  26.493  1.00 69.49  ? 474 GLN A C     1 
ATOM   3181 O O     . GLN C 3 301 ? 5.789   16.490  25.340  1.00 65.49  ? 474 GLN A O     1 
ATOM   3182 C CB    . GLN C 3 301 ? 7.199   15.193  28.193  1.00 63.60  ? 474 GLN A CB    1 
ATOM   3183 C CG    . GLN C 3 301 ? 8.371   15.468  29.110  1.00 62.83  ? 474 GLN A CG    1 
ATOM   3184 C CD    . GLN C 3 301 ? 9.474   14.444  28.963  1.00 80.50  ? 474 GLN A CD    1 
ATOM   3185 O OE1   . GLN C 3 301 ? 9.248   13.359  28.431  1.00 85.66  ? 474 GLN A OE1   1 
ATOM   3186 N NE2   . GLN C 3 301 ? 10.668  14.783  29.433  1.00 76.05  ? 474 GLN A NE2   1 
ATOM   3187 N N     . ARG C 3 302 ? 4.559   15.328  26.838  1.00 67.41  ? 475 ARG A N     1 
ATOM   3188 C CA    . ARG C 3 302 ? 3.565   14.889  25.865  1.00 63.94  ? 475 ARG A CA    1 
ATOM   3189 C C     . ARG C 3 302 ? 3.037   16.052  25.033  1.00 63.92  ? 475 ARG A C     1 
ATOM   3190 O O     . ARG C 3 302 ? 2.795   15.907  23.833  1.00 71.33  ? 475 ARG A O     1 
ATOM   3191 C CB    . ARG C 3 302 ? 2.406   14.172  26.561  1.00 61.55  ? 475 ARG A CB    1 
ATOM   3192 C CG    . ARG C 3 302 ? 1.126   14.992  26.644  1.00 62.46  ? 475 ARG A CG    1 
ATOM   3193 C CD    . ARG C 3 302 ? 0.123   14.466  27.661  1.00 78.01  ? 475 ARG A CD    1 
ATOM   3194 N NE    . ARG C 3 302 ? -0.878  15.469  28.016  1.00 76.83  ? 475 ARG A NE    1 
ATOM   3195 C CZ    . ARG C 3 302 ? -1.681  15.380  29.068  1.00 94.29  ? 475 ARG A CZ    1 
ATOM   3196 N NH1   . ARG C 3 302 ? -1.603  14.331  29.878  1.00 94.83  ? 475 ARG A NH1   1 
ATOM   3197 N NH2   . ARG C 3 302 ? -2.563  16.338  29.315  1.00 102.97 ? 475 ARG A NH2   1 
ATOM   3198 N N     . ALA C 3 303 ? 2.864   17.205  25.673  1.00 59.70  ? 476 ALA A N     1 
ATOM   3199 C CA    . ALA C 3 303 ? 2.360   18.391  24.992  1.00 61.63  ? 476 ALA A CA    1 
ATOM   3200 C C     . ALA C 3 303 ? 3.254   18.771  23.818  1.00 62.04  ? 476 ALA A C     1 
ATOM   3201 O O     . ALA C 3 303 ? 2.770   19.135  22.744  1.00 62.04  ? 476 ALA A O     1 
ATOM   3202 C CB    . ALA C 3 303 ? 2.253   19.545  25.965  1.00 69.93  ? 476 ALA A CB    1 
ATOM   3203 N N     . VAL C 3 304 ? 4.562   18.683  24.034  1.00 59.78  ? 477 VAL A N     1 
ATOM   3204 C CA    . VAL C 3 304 ? 5.534   18.994  22.994  1.00 56.18  ? 477 VAL A CA    1 
ATOM   3205 C C     . VAL C 3 304 ? 5.518   17.918  21.916  1.00 54.66  ? 477 VAL A C     1 
ATOM   3206 O O     . VAL C 3 304 ? 5.557   18.221  20.721  1.00 56.52  ? 477 VAL A O     1 
ATOM   3207 C CB    . VAL C 3 304 ? 6.949   19.111  23.573  1.00 55.36  ? 477 VAL A CB    1 
ATOM   3208 C CG1   . VAL C 3 304 ? 7.954   19.406  22.471  1.00 57.73  ? 477 VAL A CG1   1 
ATOM   3209 C CG2   . VAL C 3 304 ? 6.990   20.189  24.642  1.00 44.41  ? 477 VAL A CG2   1 
ATOM   3210 N N     . ALA C 3 305 ? 5.456   16.662  22.349  1.00 49.44  ? 478 ALA A N     1 
ATOM   3211 C CA    . ALA C 3 305 ? 5.365   15.537  21.427  1.00 42.87  ? 478 ALA A CA    1 
ATOM   3212 C C     . ALA C 3 305 ? 4.171   15.715  20.500  1.00 42.70  ? 478 ALA A C     1 
ATOM   3213 O O     . ALA C 3 305 ? 4.313   15.663  19.273  1.00 36.86  ? 478 ALA A O     1 
ATOM   3214 C CB    . ALA C 3 305 ? 5.244   14.234  22.195  1.00 43.08  ? 478 ALA A CB    1 
ATOM   3215 N N     . LEU C 3 306 ? 3.000   15.935  21.098  1.00 37.76  ? 479 LEU A N     1 
ATOM   3216 C CA    . LEU C 3 306 ? 1.771   16.146  20.342  1.00 34.80  ? 479 LEU A CA    1 
ATOM   3217 C C     . LEU C 3 306 ? 1.902   17.320  19.383  1.00 39.62  ? 479 LEU A C     1 
ATOM   3218 O O     . LEU C 3 306 ? 1.430   17.254  18.246  1.00 41.68  ? 479 LEU A O     1 
ATOM   3219 C CB    . LEU C 3 306 ? 0.588   16.374  21.282  1.00 32.14  ? 479 LEU A CB    1 
ATOM   3220 C CG    . LEU C 3 306 ? -0.805  16.352  20.649  1.00 36.39  ? 479 LEU A CG    1 
ATOM   3221 C CD1   . LEU C 3 306 ? -0.959  15.163  19.718  1.00 28.60  ? 479 LEU A CD1   1 
ATOM   3222 C CD2   . LEU C 3 306 ? -1.886  16.335  21.717  1.00 24.82  ? 479 LEU A CD2   1 
ATOM   3223 N N     . TYR C 3 307 ? 2.548   18.389  19.840  1.00 42.61  ? 480 TYR A N     1 
ATOM   3224 C CA    . TYR C 3 307 ? 2.750   19.566  19.002  1.00 45.20  ? 480 TYR A CA    1 
ATOM   3225 C C     . TYR C 3 307 ? 3.414   19.189  17.686  1.00 47.34  ? 480 TYR A C     1 
ATOM   3226 O O     . TYR C 3 307 ? 3.122   19.779  16.648  1.00 48.57  ? 480 TYR A O     1 
ATOM   3227 C CB    . TYR C 3 307 ? 3.585   20.618  19.730  1.00 45.79  ? 480 TYR A CB    1 
ATOM   3228 C CG    . TYR C 3 307 ? 4.029   21.770  18.848  1.00 48.60  ? 480 TYR A CG    1 
ATOM   3229 C CD1   . TYR C 3 307 ? 3.102   22.627  18.269  1.00 51.24  ? 480 TYR A CD1   1 
ATOM   3230 C CD2   . TYR C 3 307 ? 5.378   22.000  18.599  1.00 34.73  ? 480 TYR A CD2   1 
ATOM   3231 C CE1   . TYR C 3 307 ? 3.507   23.680  17.464  1.00 62.76  ? 480 TYR A CE1   1 
ATOM   3232 C CE2   . TYR C 3 307 ? 5.792   23.050  17.798  1.00 29.18  ? 480 TYR A CE2   1 
ATOM   3233 C CZ    . TYR C 3 307 ? 4.854   23.885  17.233  1.00 58.52  ? 480 TYR A CZ    1 
ATOM   3234 O OH    . TYR C 3 307 ? 5.263   24.928  16.436  1.00 74.71  ? 480 TYR A OH    1 
ATOM   3235 N N     . PHE C 3 308 ? 4.303   18.201  17.734  1.00 53.24  ? 481 PHE A N     1 
ATOM   3236 C CA    . PHE C 3 308 ? 4.988   17.721  16.537  1.00 57.35  ? 481 PHE A CA    1 
ATOM   3237 C C     . PHE C 3 308 ? 4.086   16.829  15.693  1.00 58.41  ? 481 PHE A C     1 
ATOM   3238 O O     . PHE C 3 308 ? 3.962   17.026  14.483  1.00 61.14  ? 481 PHE A O     1 
ATOM   3239 C CB    . PHE C 3 308 ? 6.254   16.958  16.915  1.00 58.28  ? 481 PHE A CB    1 
ATOM   3240 C CG    . PHE C 3 308 ? 7.293   17.803  17.584  1.00 58.88  ? 481 PHE A CG    1 
ATOM   3241 C CD1   . PHE C 3 308 ? 8.007   17.315  18.666  1.00 63.84  ? 481 PHE A CD1   1 
ATOM   3242 C CD2   . PHE C 3 308 ? 7.561   19.083  17.131  1.00 60.66  ? 481 PHE A CD2   1 
ATOM   3243 C CE1   . PHE C 3 308 ? 8.967   18.090  19.284  1.00 85.34  ? 481 PHE A CE1   1 
ATOM   3244 C CE2   . PHE C 3 308 ? 8.520   19.865  17.746  1.00 60.69  ? 481 PHE A CE2   1 
ATOM   3245 C CZ    . PHE C 3 308 ? 9.224   19.369  18.824  1.00 79.94  ? 481 PHE A CZ    1 
ATOM   3246 N N     . ILE C 3 309 ? 3.463   15.846  16.339  1.00 55.29  ? 482 ILE A N     1 
ATOM   3247 C CA    . ILE C 3 309 ? 2.555   14.931  15.659  1.00 48.56  ? 482 ILE A CA    1 
ATOM   3248 C C     . ILE C 3 309 ? 1.532   15.722  14.850  1.00 50.52  ? 482 ILE A C     1 
ATOM   3249 O O     . ILE C 3 309 ? 1.155   15.326  13.746  1.00 56.58  ? 482 ILE A O     1 
ATOM   3250 C CB    . ILE C 3 309 ? 1.841   14.016  16.680  1.00 49.11  ? 482 ILE A CB    1 
ATOM   3251 C CG1   . ILE C 3 309 ? 2.856   13.279  17.559  1.00 22.22  ? 482 ILE A CG1   1 
ATOM   3252 C CG2   . ILE C 3 309 ? 0.946   13.014  15.970  1.00 50.24  ? 482 ILE A CG2   1 
ATOM   3253 N N     . ASP C 3 310 ? 1.100   16.850  15.403  1.00 47.21  ? 483 ASP A N     1 
ATOM   3254 C CA    . ASP C 3 310 ? 0.101   17.690  14.756  1.00 51.12  ? 483 ASP A CA    1 
ATOM   3255 C C     . ASP C 3 310 ? 0.705   18.547  13.647  1.00 55.93  ? 483 ASP A C     1 
ATOM   3256 O O     . ASP C 3 310 ? 0.226   18.535  12.513  1.00 63.18  ? 483 ASP A O     1 
ATOM   3257 C CB    . ASP C 3 310 ? -0.588  18.584  15.792  1.00 52.98  ? 483 ASP A CB    1 
ATOM   3258 C CG    . ASP C 3 310 ? -1.608  19.520  15.174  1.00 57.64  ? 483 ASP A CG    1 
ATOM   3259 O OD1   . ASP C 3 310 ? -1.918  20.559  15.797  1.00 64.86  ? 483 ASP A OD1   1 
ATOM   3260 O OD2   . ASP C 3 310 ? -2.155  19.301  14.072  1.00 65.50  ? 483 ASP A OD2   1 
ATOM   3261 N N     . LYS C 3 311 ? 1.760   19.284  13.976  1.00 53.61  ? 484 LYS A N     1 
ATOM   3262 C CA    . LYS C 3 311 ? 2.317   20.271  13.057  1.00 51.22  ? 484 LYS A CA    1 
ATOM   3263 C C     . LYS C 3 311 ? 3.133   19.669  11.919  1.00 50.02  ? 484 LYS A C     1 
ATOM   3264 O O     . LYS C 3 311 ? 3.208   20.250  10.839  1.00 54.01  ? 484 LYS A O     1 
ATOM   3265 C CB    . LYS C 3 311 ? 3.163   21.294  13.817  1.00 52.80  ? 484 LYS A CB    1 
ATOM   3266 C CG    . LYS C 3 311 ? 2.620   22.713  13.755  1.00 73.50  ? 484 LYS A CG    1 
ATOM   3267 C CD    . LYS C 3 311 ? 2.625   23.245  12.328  1.00 90.38  ? 484 LYS A CD    1 
ATOM   3268 C CE    . LYS C 3 311 ? 3.707   24.298  12.124  1.00 86.34  ? 484 LYS A CE    1 
ATOM   3269 N NZ    . LYS C 3 311 ? 5.064   23.788  12.485  1.00 81.74  ? 484 LYS A NZ    1 
ATOM   3270 N N     . LEU C 3 312 ? 3.741   18.511  12.157  1.00 50.68  ? 485 LEU A N     1 
ATOM   3271 C CA    . LEU C 3 312 ? 4.628   17.909  11.162  1.00 53.28  ? 485 LEU A CA    1 
ATOM   3272 C C     . LEU C 3 312 ? 4.235   16.487  10.769  1.00 54.77  ? 485 LEU A C     1 
ATOM   3273 O O     . LEU C 3 312 ? 5.036   15.748  10.185  1.00 45.70  ? 485 LEU A O     1 
ATOM   3274 C CB    . LEU C 3 312 ? 6.075   17.939  11.656  1.00 48.69  ? 485 LEU A CB    1 
ATOM   3275 C CG    . LEU C 3 312 ? 6.764   19.293  11.481  1.00 52.45  ? 485 LEU A CG    1 
ATOM   3276 C CD1   . LEU C 3 312 ? 7.962   19.409  12.410  1.00 39.10  ? 485 LEU A CD1   1 
ATOM   3277 C CD2   . LEU C 3 312 ? 7.168   19.512  10.022  1.00 68.73  ? 485 LEU A CD2   1 
ATOM   3278 N N     . ALA C 3 313 ? 2.997   16.114  11.085  1.00 57.12  ? 486 ALA A N     1 
ATOM   3279 C CA    . ALA C 3 313 ? 2.490   14.781  10.784  1.00 56.66  ? 486 ALA A CA    1 
ATOM   3280 C C     . ALA C 3 313 ? 3.514   13.716  11.166  1.00 53.44  ? 486 ALA A C     1 
ATOM   3281 O O     . ALA C 3 313 ? 3.705   12.733  10.454  1.00 58.03  ? 486 ALA A O     1 
ATOM   3282 C CB    . ALA C 3 313 ? 2.107   14.668  9.310   1.00 58.14  ? 486 ALA A CB    1 
ATOM   3283 N N     . LEU C 3 314 ? 4.183   13.931  12.293  1.00 49.04  ? 487 LEU A N     1 
ATOM   3284 C CA    . LEU C 3 314 ? 5.102   12.944  12.834  1.00 47.93  ? 487 LEU A CA    1 
ATOM   3285 C C     . LEU C 3 314 ? 4.314   11.728  13.305  1.00 46.41  ? 487 LEU A C     1 
ATOM   3286 O O     . LEU C 3 314 ? 3.261   11.871  13.927  1.00 52.25  ? 487 LEU A O     1 
ATOM   3287 C CB    . LEU C 3 314 ? 5.884   13.539  14.009  1.00 46.38  ? 487 LEU A CB    1 
ATOM   3288 C CG    . LEU C 3 314 ? 7.164   14.327  13.708  1.00 37.68  ? 487 LEU A CG    1 
ATOM   3289 C CD1   . LEU C 3 314 ? 8.225   13.988  14.733  1.00 20.67  ? 487 LEU A CD1   1 
ATOM   3290 C CD2   . LEU C 3 314 ? 7.678   14.047  12.308  1.00 11.43  ? 487 LEU A CD2   1 
ATOM   3291 N N     . ARG C 3 315 ? 4.818   10.536  13.004  1.00 34.95  ? 488 ARG A N     1 
ATOM   3292 C CA    . ARG C 3 315 ? 4.175   9.305   13.448  1.00 28.18  ? 488 ARG A CA    1 
ATOM   3293 C C     . ARG C 3 315 ? 4.358   9.115   14.950  1.00 32.29  ? 488 ARG A C     1 
ATOM   3294 O O     . ARG C 3 315 ? 5.317   9.618   15.537  1.00 33.67  ? 488 ARG A O     1 
ATOM   3295 C CB    . ARG C 3 315 ? 4.755   8.110   12.699  1.00 26.61  ? 488 ARG A CB    1 
ATOM   3296 C CG    . ARG C 3 315 ? 5.153   8.427   11.276  1.00 49.36  ? 488 ARG A CG    1 
ATOM   3297 C CD    . ARG C 3 315 ? 5.552   7.212   10.463  1.00 52.43  ? 488 ARG A CD    1 
ATOM   3298 N NE    . ARG C 3 315 ? 4.538   6.845   9.478   1.00 17.47  ? 488 ARG A NE    1 
ATOM   3299 C CZ    . ARG C 3 315 ? 4.769   6.737   8.178   1.00 46.07  ? 488 ARG A CZ    1 
ATOM   3300 N NH1   . ARG C 3 315 ? 5.984   6.972   7.698   1.00 62.44  ? 488 ARG A NH1   1 
ATOM   3301 N NH2   . ARG C 3 315 ? 3.788   6.393   7.354   1.00 68.01  ? 488 ARG A NH2   1 
ATOM   3302 N N     . ALA C 3 316 ? 3.439   8.383   15.568  1.00 36.82  ? 489 ALA A N     1 
ATOM   3303 C CA    . ALA C 3 316 ? 3.483   8.145   17.010  1.00 39.79  ? 489 ALA A CA    1 
ATOM   3304 C C     . ALA C 3 316 ? 4.885   7.788   17.495  1.00 38.28  ? 489 ALA A C     1 
ATOM   3305 O O     . ALA C 3 316 ? 5.488   8.524   18.273  1.00 41.93  ? 489 ALA A O     1 
ATOM   3306 C CB    . ALA C 3 316 ? 2.491   7.055   17.399  1.00 45.34  ? 489 ALA A CB    1 
ATOM   3307 N N     . GLY C 3 317 ? 5.397   6.654   17.034  1.00 35.92  ? 490 GLY A N     1 
ATOM   3308 C CA    . GLY C 3 317 ? 6.731   6.223   17.408  1.00 40.49  ? 490 GLY A CA    1 
ATOM   3309 C C     . GLY C 3 317 ? 6.750   5.250   18.571  1.00 39.40  ? 490 GLY A C     1 
ATOM   3310 O O     . GLY C 3 317 ? 7.091   5.615   19.697  1.00 36.90  ? 490 GLY A O     1 
ATOM   3311 N N     . ASN C 3 318 ? 6.383   4.004   18.291  1.00 38.66  ? 491 ASN A N     1 
ATOM   3312 C CA    . ASN C 3 318 ? 6.396   2.959   19.302  1.00 41.75  ? 491 ASN A CA    1 
ATOM   3313 C C     . ASN C 3 318 ? 7.816   2.574   19.676  1.00 45.26  ? 491 ASN A C     1 
ATOM   3314 O O     . ASN C 3 318 ? 8.752   2.824   18.918  1.00 35.58  ? 491 ASN A O     1 
ATOM   3315 C CB    . ASN C 3 318 ? 5.646   1.725   18.806  1.00 40.60  ? 491 ASN A CB    1 
ATOM   3316 C CG    . ASN C 3 318 ? 4.160   1.803   19.073  1.00 51.16  ? 491 ASN A CG    1 
ATOM   3317 O OD1   . ASN C 3 318 ? 3.538   2.852   18.899  1.00 56.75  ? 491 ASN A OD1   1 
ATOM   3318 N ND2   . ASN C 3 318 ? 3.579   0.686   19.497  1.00 81.44  ? 491 ASN A ND2   1 
ATOM   3319 N N     . GLU C 3 319 ? 7.970   1.969   20.850  1.00 57.68  ? 492 GLU A N     1 
ATOM   3320 C CA    . GLU C 3 319 ? 9.267   1.487   21.300  1.00 65.30  ? 492 GLU A CA    1 
ATOM   3321 C C     . GLU C 3 319 ? 9.610   0.169   20.601  1.00 68.97  ? 492 GLU A C     1 
ATOM   3322 O O     . GLU C 3 319 ? 8.888   -0.824  20.721  1.00 69.54  ? 492 GLU A O     1 
ATOM   3323 C CB    . GLU C 3 319 ? 9.286   1.332   22.827  1.00 66.61  ? 492 GLU A CB    1 
ATOM   3324 C CG    . GLU C 3 319 ? 10.122  0.156   23.337  1.00 90.33  ? 492 GLU A CG    1 
ATOM   3325 C CD    . GLU C 3 319 ? 10.791  0.440   24.674  1.00 105.47 ? 492 GLU A CD    1 
ATOM   3326 O OE1   . GLU C 3 319 ? 11.854  -0.162  24.945  1.00 104.78 ? 492 GLU A OE1   1 
ATOM   3327 O OE2   . GLU C 3 319 ? 10.257  1.261   25.457  1.00 90.51  ? 492 GLU A OE2   1 
ATOM   3328 N N     . LYS C 3 320 ? 10.708  0.179   19.853  1.00 67.05  ? 493 LYS A N     1 
ATOM   3329 C CA    . LYS C 3 320 ? 11.176  -1.002  19.142  1.00 64.20  ? 493 LYS A CA    1 
ATOM   3330 C C     . LYS C 3 320 ? 12.075  -1.827  20.057  1.00 68.55  ? 493 LYS A C     1 
ATOM   3331 O O     . LYS C 3 320 ? 12.549  -1.331  21.080  1.00 77.94  ? 493 LYS A O     1 
ATOM   3332 C CB    . LYS C 3 320 ? 11.961  -0.580  17.893  1.00 66.95  ? 493 LYS A CB    1 
ATOM   3333 C CG    . LYS C 3 320 ? 11.249  -0.816  16.557  1.00 48.23  ? 493 LYS A CG    1 
ATOM   3334 C CD    . LYS C 3 320 ? 9.871   -1.443  16.749  1.00 85.92  ? 493 LYS A CD    1 
ATOM   3335 C CE    . LYS C 3 320 ? 8.842   -0.813  15.815  1.00 88.01  ? 493 LYS A CE    1 
ATOM   3336 N NZ    . LYS C 3 320 ? 7.722   -0.173  16.572  1.00 89.90  ? 493 LYS A NZ    1 
ATOM   3337 N N     . GLU C 3 321 ? 12.306  -3.085  19.692  1.00 64.92  ? 494 GLU A N     1 
ATOM   3338 C CA    . GLU C 3 321 ? 13.303  -3.904  20.375  1.00 67.20  ? 494 GLU A CA    1 
ATOM   3339 C C     . GLU C 3 321 ? 14.686  -3.512  19.869  1.00 68.30  ? 494 GLU A C     1 
ATOM   3340 O O     . GLU C 3 321 ? 14.888  -3.362  18.663  1.00 75.11  ? 494 GLU A O     1 
ATOM   3341 C CB    . GLU C 3 321 ? 13.055  -5.389  20.103  1.00 68.61  ? 494 GLU A CB    1 
ATOM   3342 C CG    . GLU C 3 321 ? 12.864  -6.244  21.346  1.00 85.98  ? 494 GLU A CG    1 
ATOM   3343 C CD    . GLU C 3 321 ? 11.968  -7.446  21.090  1.00 100.42 ? 494 GLU A CD    1 
ATOM   3344 O OE1   . GLU C 3 321 ? 10.767  -7.381  21.432  1.00 91.51  ? 494 GLU A OE1   1 
ATOM   3345 O OE2   . GLU C 3 321 ? 12.463  -8.457  20.546  1.00 113.92 ? 494 GLU A OE2   1 
ATOM   3346 N N     . GLU C 3 322 ? 15.638  -3.341  20.782  1.00 73.18  ? 495 GLU A N     1 
ATOM   3347 C CA    . GLU C 3 322 ? 17.000  -2.983  20.386  1.00 79.58  ? 495 GLU A CA    1 
ATOM   3348 C C     . GLU C 3 322 ? 17.831  -4.230  20.112  1.00 78.95  ? 495 GLU A C     1 
ATOM   3349 O O     . GLU C 3 322 ? 17.926  -5.120  20.955  1.00 82.62  ? 495 GLU A O     1 
ATOM   3350 C CB    . GLU C 3 322 ? 17.682  -2.116  21.449  1.00 80.87  ? 495 GLU A CB    1 
ATOM   3351 C CG    . GLU C 3 322 ? 16.727  -1.259  22.265  1.00 106.89 ? 495 GLU A CG    1 
ATOM   3352 C CD    . GLU C 3 322 ? 16.323  -1.919  23.571  1.00 128.31 ? 495 GLU A CD    1 
ATOM   3353 O OE1   . GLU C 3 322 ? 15.110  -1.957  23.871  1.00 123.07 ? 495 GLU A OE1   1 
ATOM   3354 O OE2   . GLU C 3 322 ? 17.220  -2.401  24.298  1.00 139.35 ? 495 GLU A OE2   1 
ATOM   3355 N N     . GLY C 3 323 ? 18.424  -4.291  18.926  1.00 81.02  ? 496 GLY A N     1 
ATOM   3356 C CA    . GLY C 3 323 ? 19.231  -5.433  18.536  1.00 80.62  ? 496 GLY A CA    1 
ATOM   3357 C C     . GLY C 3 323 ? 18.411  -6.557  17.932  1.00 78.81  ? 496 GLY A C     1 
ATOM   3358 O O     . GLY C 3 323 ? 18.961  -7.551  17.458  1.00 77.85  ? 496 GLY A O     1 
ATOM   3359 N N     . GLU C 3 324 ? 17.090  -6.401  17.951  1.00 76.02  ? 497 GLU A N     1 
ATOM   3360 C CA    . GLU C 3 324 ? 16.196  -7.393  17.364  1.00 72.54  ? 497 GLU A CA    1 
ATOM   3361 C C     . GLU C 3 324 ? 15.502  -6.836  16.129  1.00 61.56  ? 497 GLU A C     1 
ATOM   3362 O O     . GLU C 3 324 ? 14.965  -7.586  15.318  1.00 58.06  ? 497 GLU A O     1 
ATOM   3363 C CB    . GLU C 3 324 ? 15.162  -7.863  18.388  1.00 76.93  ? 497 GLU A CB    1 
ATOM   3364 C CG    . GLU C 3 324 ? 14.819  -9.342  18.292  1.00 98.94  ? 497 GLU A CG    1 
ATOM   3365 C CD    . GLU C 3 324 ? 15.941  -10.247 18.776  1.00 115.07 ? 497 GLU A CD    1 
ATOM   3366 O OE1   . GLU C 3 324 ? 15.890  -11.461 18.486  1.00 123.52 ? 497 GLU A OE1   1 
ATOM   3367 O OE2   . GLU C 3 324 ? 16.872  -9.751  19.449  1.00 105.32 ? 497 GLU A OE2   1 
ATOM   3368 N N     . THR C 3 325 ? 15.522  -5.515  15.994  1.00 57.16  ? 498 THR A N     1 
ATOM   3369 C CA    . THR C 3 325 ? 14.945  -4.846  14.832  1.00 58.49  ? 498 THR A CA    1 
ATOM   3370 C C     . THR C 3 325 ? 15.924  -3.817  14.280  1.00 53.11  ? 498 THR A C     1 
ATOM   3371 O O     . THR C 3 325 ? 16.964  -3.549  14.880  1.00 56.75  ? 498 THR A O     1 
ATOM   3372 C CB    . THR C 3 325 ? 13.627  -4.139  15.214  1.00 59.78  ? 498 THR A CB    1 
ATOM   3373 O OG1   . THR C 3 325 ? 13.046  -4.778  16.358  1.00 71.14  ? 498 THR A OG1   1 
ATOM   3374 C CG2   . THR C 3 325 ? 12.579  -4.338  14.128  1.00 76.16  ? 498 THR A CG2   1 
ATOM   3375 N N     . ALA C 3 326 ? 15.592  -3.245  13.130  1.00 43.22  ? 499 ALA A N     1 
ATOM   3376 C CA    . ALA C 3 326 ? 16.360  -2.130  12.605  1.00 47.87  ? 499 ALA A CA    1 
ATOM   3377 C C     . ALA C 3 326 ? 16.015  -0.895  13.427  1.00 54.01  ? 499 ALA A C     1 
ATOM   3378 O O     . ALA C 3 326 ? 14.843  -0.591  13.647  1.00 64.71  ? 499 ALA A O     1 
ATOM   3379 C CB    . ALA C 3 326 ? 16.045  -1.907  11.138  1.00 52.35  ? 499 ALA A CB    1 
ATOM   3380 N N     . ASP C 3 327 ? 17.036  -0.188  13.889  1.00 57.91  ? 500 ASP A N     1 
ATOM   3381 C CA    . ASP C 3 327 ? 16.823  0.935   14.793  1.00 59.26  ? 500 ASP A CA    1 
ATOM   3382 C C     . ASP C 3 327 ? 16.289  2.177   14.083  1.00 52.68  ? 500 ASP A C     1 
ATOM   3383 O O     . ASP C 3 327 ? 17.028  2.882   13.393  1.00 52.16  ? 500 ASP A O     1 
ATOM   3384 C CB    . ASP C 3 327 ? 18.115  1.263   15.547  1.00 66.46  ? 500 ASP A CB    1 
ATOM   3385 C CG    . ASP C 3 327 ? 17.939  2.393   16.538  1.00 57.99  ? 500 ASP A CG    1 
ATOM   3386 O OD1   . ASP C 3 327 ? 16.932  2.387   17.277  1.00 51.82  ? 500 ASP A OD1   1 
ATOM   3387 O OD2   . ASP C 3 327 ? 18.758  3.328   16.647  1.00 28.18  ? 500 ASP A OD2   1 
ATOM   3388 N N     . THR C 3 328 ? 14.996  2.430   14.256  1.00 49.17  ? 501 THR A N     1 
ATOM   3389 C CA    . THR C 3 328 ? 14.377  3.670   13.796  1.00 47.63  ? 501 THR A CA    1 
ATOM   3390 C C     . THR C 3 328 ? 13.574  4.279   14.937  1.00 49.48  ? 501 THR A C     1 
ATOM   3391 O O     . THR C 3 328 ? 13.376  3.641   15.975  1.00 49.24  ? 501 THR A O     1 
ATOM   3392 C CB    . THR C 3 328 ? 13.455  3.414   12.598  1.00 45.01  ? 501 THR A CB    1 
ATOM   3393 O OG1   . THR C 3 328 ? 12.563  2.333   12.903  1.00 53.52  ? 501 THR A OG1   1 
ATOM   3394 C CG2   . THR C 3 328 ? 14.256  2.909   11.398  1.00 39.86  ? 501 THR A CG2   1 
ATOM   3395 N N     . VAL C 3 329 ? 13.109  5.513   14.747  1.00 50.61  ? 502 VAL A N     1 
ATOM   3396 C CA    . VAL C 3 329 ? 12.332  6.187   15.781  1.00 51.34  ? 502 VAL A CA    1 
ATOM   3397 C C     . VAL C 3 329 ? 11.171  6.989   15.205  1.00 45.45  ? 502 VAL A C     1 
ATOM   3398 O O     . VAL C 3 329 ? 11.213  7.426   14.055  1.00 48.34  ? 502 VAL A O     1 
ATOM   3399 C CB    . VAL C 3 329 ? 13.210  7.119   16.644  1.00 56.34  ? 502 VAL A CB    1 
ATOM   3400 C CG1   . VAL C 3 329 ? 14.433  6.378   17.169  1.00 55.80  ? 502 VAL A CG1   1 
ATOM   3401 C CG2   . VAL C 3 329 ? 13.626  8.352   15.857  1.00 62.16  ? 502 VAL A CG2   1 
ATOM   3402 N N     . GLY C 3 330 ? 10.133  7.164   16.016  1.00 43.11  ? 503 GLY A N     1 
ATOM   3403 C CA    . GLY C 3 330 ? 9.008   8.010   15.667  1.00 43.39  ? 503 GLY A CA    1 
ATOM   3404 C C     . GLY C 3 330 ? 9.066   9.285   16.483  1.00 43.74  ? 503 GLY A C     1 
ATOM   3405 O O     . GLY C 3 330 ? 10.151  9.813   16.727  1.00 49.14  ? 503 GLY A O     1 
ATOM   3406 N N     . CYS C 3 331 ? 7.912   9.781   16.919  1.00 45.54  ? 504 CYS A N     1 
ATOM   3407 C CA    . CYS C 3 331 ? 7.880   11.017  17.697  1.00 48.76  ? 504 CYS A CA    1 
ATOM   3408 C C     . CYS C 3 331 ? 8.137   10.783  19.180  1.00 50.29  ? 504 CYS A C     1 
ATOM   3409 O O     . CYS C 3 331 ? 8.922   11.496  19.800  1.00 56.74  ? 504 CYS A O     1 
ATOM   3410 C CB    . CYS C 3 331 ? 6.551   11.743  17.516  1.00 50.42  ? 504 CYS A CB    1 
ATOM   3411 S SG    . CYS C 3 331 ? 6.566   13.426  18.171  1.00 44.21  ? 504 CYS A SG    1 
ATOM   3412 N N     . CYS C 3 332 ? 7.466   9.785   19.747  1.00 47.65  ? 505 CYS A N     1 
ATOM   3413 C CA    . CYS C 3 332 ? 7.654   9.444   21.153  1.00 51.06  ? 505 CYS A CA    1 
ATOM   3414 C C     . CYS C 3 332 ? 9.036   8.835   21.407  1.00 53.66  ? 505 CYS A C     1 
ATOM   3415 O O     . CYS C 3 332 ? 9.613   8.996   22.486  1.00 48.44  ? 505 CYS A O     1 
ATOM   3416 C CB    . CYS C 3 332 ? 6.567   8.465   21.612  1.00 44.54  ? 505 CYS A CB    1 
ATOM   3417 S SG    . CYS C 3 332 ? 4.891   9.136   21.575  1.00 64.19  ? 505 CYS A SG    1 
ATOM   3418 N N     . SER C 3 333 ? 9.561   8.137   20.403  1.00 50.25  ? 506 SER A N     1 
ATOM   3419 C CA    . SER C 3 333 ? 10.791  7.376   20.566  1.00 47.78  ? 506 SER A CA    1 
ATOM   3420 C C     . SER C 3 333 ? 12.024  8.166   20.154  1.00 53.75  ? 506 SER A C     1 
ATOM   3421 O O     . SER C 3 333 ? 13.087  7.589   19.925  1.00 57.68  ? 506 SER A O     1 
ATOM   3422 C CB    . SER C 3 333 ? 10.723  6.067   19.779  1.00 44.63  ? 506 SER A CB    1 
ATOM   3423 O OG    . SER C 3 333 ? 9.924   6.211   18.622  1.00 50.23  ? 506 SER A OG    1 
ATOM   3424 N N     . LEU C 3 334 ? 11.880  9.486   20.067  1.00 52.80  ? 507 LEU A N     1 
ATOM   3425 C CA    . LEU C 3 334 ? 13.012  10.352  19.752  1.00 48.31  ? 507 LEU A CA    1 
ATOM   3426 C C     . LEU C 3 334 ? 14.048  10.307  20.872  1.00 46.88  ? 507 LEU A C     1 
ATOM   3427 O O     . LEU C 3 334 ? 13.697  10.275  22.050  1.00 52.42  ? 507 LEU A O     1 
ATOM   3428 C CB    . LEU C 3 334 ? 12.544  11.796  19.534  1.00 42.97  ? 507 LEU A CB    1 
ATOM   3429 C CG    . LEU C 3 334 ? 11.842  12.134  18.211  1.00 34.81  ? 507 LEU A CG    1 
ATOM   3430 C CD1   . LEU C 3 334 ? 11.162  13.489  18.287  1.00 55.14  ? 507 LEU A CD1   1 
ATOM   3431 C CD2   . LEU C 3 334 ? 12.801  12.088  17.020  1.00 28.96  ? 507 LEU A CD2   1 
ATOM   3432 N N     . ARG C 3 335 ? 15.323  10.283  20.496  1.00 46.08  ? 508 ARG A N     1 
ATOM   3433 C CA    . ARG C 3 335 ? 16.415  10.417  21.456  1.00 49.88  ? 508 ARG A CA    1 
ATOM   3434 C C     . ARG C 3 335 ? 17.032  11.803  21.294  1.00 52.82  ? 508 ARG A C     1 
ATOM   3435 O O     . ARG C 3 335 ? 16.867  12.438  20.252  1.00 59.73  ? 508 ARG A O     1 
ATOM   3436 C CB    . ARG C 3 335 ? 17.478  9.337   21.241  1.00 52.21  ? 508 ARG A CB    1 
ATOM   3437 C CG    . ARG C 3 335 ? 16.980  7.911   21.432  1.00 59.66  ? 508 ARG A CG    1 
ATOM   3438 C CD    . ARG C 3 335 ? 18.065  6.847   21.304  1.00 68.37  ? 508 ARG A CD    1 
ATOM   3439 N NE    . ARG C 3 335 ? 18.732  6.889   20.003  1.00 72.54  ? 508 ARG A NE    1 
ATOM   3440 C CZ    . ARG C 3 335 ? 18.647  5.931   19.086  1.00 70.24  ? 508 ARG A CZ    1 
ATOM   3441 N NH1   . ARG C 3 335 ? 17.921  4.843   19.315  1.00 35.75  ? 508 ARG A NH1   1 
ATOM   3442 N NH2   . ARG C 3 335 ? 19.289  6.062   17.933  1.00 63.42  ? 508 ARG A NH2   1 
ATOM   3443 N N     . VAL C 3 336 ? 17.747  12.267  22.314  1.00 54.41  ? 509 VAL A N     1 
ATOM   3444 C CA    . VAL C 3 336 ? 18.303  13.623  22.301  1.00 50.20  ? 509 VAL A CA    1 
ATOM   3445 C C     . VAL C 3 336 ? 19.317  13.839  21.171  1.00 46.11  ? 509 VAL A C     1 
ATOM   3446 O O     . VAL C 3 336 ? 19.641  14.980  20.821  1.00 39.55  ? 509 VAL A O     1 
ATOM   3447 C CB    . VAL C 3 336 ? 18.918  14.014  23.677  1.00 45.24  ? 509 VAL A CB    1 
ATOM   3448 C CG1   . VAL C 3 336 ? 18.169  13.332  24.815  1.00 37.05  ? 509 VAL A CG1   1 
ATOM   3449 C CG2   . VAL C 3 336 ? 20.395  13.675  23.732  1.00 37.62  ? 509 VAL A CG2   1 
ATOM   3450 N N     . GLU C 3 337 ? 19.797  12.739  20.596  1.00 40.86  ? 510 GLU A N     1 
ATOM   3451 C CA    . GLU C 3 337 ? 20.773  12.799  19.515  1.00 48.78  ? 510 GLU A CA    1 
ATOM   3452 C C     . GLU C 3 337 ? 20.109  12.959  18.148  1.00 51.61  ? 510 GLU A C     1 
ATOM   3453 O O     . GLU C 3 337 ? 20.785  13.123  17.131  1.00 55.88  ? 510 GLU A O     1 
ATOM   3454 C CB    . GLU C 3 337 ? 21.665  11.558  19.533  1.00 51.45  ? 510 GLU A CB    1 
ATOM   3455 C CG    . GLU C 3 337 ? 20.945  10.282  19.949  1.00 64.89  ? 510 GLU A CG    1 
ATOM   3456 C CD    . GLU C 3 337 ? 21.537  9.046   19.297  1.00 73.76  ? 510 GLU A CD    1 
ATOM   3457 O OE1   . GLU C 3 337 ? 21.726  8.031   20.006  1.00 44.91  ? 510 GLU A OE1   1 
ATOM   3458 O OE2   . GLU C 3 337 ? 21.812  9.090   18.075  1.00 65.78  ? 510 GLU A OE2   1 
ATOM   3459 N N     . HIS C 3 338 ? 18.783  12.917  18.125  1.00 52.19  ? 511 HIS A N     1 
ATOM   3460 C CA    . HIS C 3 338 ? 18.048  13.113  16.883  1.00 55.34  ? 511 HIS A CA    1 
ATOM   3461 C C     . HIS C 3 338 ? 17.609  14.561  16.714  1.00 61.30  ? 511 HIS A C     1 
ATOM   3462 O O     . HIS C 3 338 ? 17.053  14.929  15.682  1.00 70.22  ? 511 HIS A O     1 
ATOM   3463 C CB    . HIS C 3 338 ? 16.845  12.174  16.817  1.00 50.37  ? 511 HIS A CB    1 
ATOM   3464 C CG    . HIS C 3 338 ? 17.210  10.728  16.939  1.00 58.79  ? 511 HIS A CG    1 
ATOM   3465 N ND1   . HIS C 3 338 ? 16.775  9.935   17.983  1.00 53.15  ? 511 HIS A ND1   1 
ATOM   3466 C CD2   . HIS C 3 338 ? 17.981  9.935   16.157  1.00 72.09  ? 511 HIS A CD2   1 
ATOM   3467 C CE1   . HIS C 3 338 ? 17.257  8.714   17.835  1.00 62.67  ? 511 HIS A CE1   1 
ATOM   3468 N NE2   . HIS C 3 338 ? 17.992  8.686   16.735  1.00 59.42  ? 511 HIS A NE2   1 
ATOM   3469 N N     . ILE C 3 339 ? 17.863  15.381  17.729  1.00 67.51  ? 512 ILE A N     1 
ATOM   3470 C CA    . ILE C 3 339 ? 17.518  16.800  17.664  1.00 71.25  ? 512 ILE A CA    1 
ATOM   3471 C C     . ILE C 3 339 ? 18.658  17.714  18.108  1.00 72.37  ? 512 ILE A C     1 
ATOM   3472 O O     . ILE C 3 339 ? 19.554  17.306  18.853  1.00 71.07  ? 512 ILE A O     1 
ATOM   3473 C CB    . ILE C 3 339 ? 16.257  17.106  18.508  1.00 71.30  ? 512 ILE A CB    1 
ATOM   3474 C CG1   . ILE C 3 339 ? 16.325  16.396  19.865  1.00 83.09  ? 512 ILE A CG1   1 
ATOM   3475 C CG2   . ILE C 3 339 ? 14.998  16.721  17.752  1.00 72.60  ? 512 ILE A CG2   1 
ATOM   3476 N N     . ASN C 3 340 ? 18.609  18.954  17.632  1.00 70.31  ? 513 ASN A N     1 
ATOM   3477 C CA    . ASN C 3 340 ? 19.510  20.004  18.082  1.00 67.75  ? 513 ASN A CA    1 
ATOM   3478 C C     . ASN C 3 340 ? 18.802  21.356  18.044  1.00 70.01  ? 513 ASN A C     1 
ATOM   3479 O O     . ASN C 3 340 ? 18.063  21.653  17.105  1.00 72.80  ? 513 ASN A O     1 
ATOM   3480 C CB    . ASN C 3 340 ? 20.780  20.036  17.233  1.00 69.11  ? 513 ASN A CB    1 
ATOM   3481 C CG    . ASN C 3 340 ? 21.939  20.704  17.948  1.00 76.12  ? 513 ASN A CG    1 
ATOM   3482 O OD1   . ASN C 3 340 ? 21.847  21.032  19.132  1.00 83.63  ? 513 ASN A OD1   1 
ATOM   3483 N ND2   . ASN C 3 340 ? 23.038  20.910  17.231  1.00 82.33  ? 513 ASN A ND2   1 
ATOM   3484 N N     . LEU C 3 341 ? 19.024  22.171  19.069  1.00 70.55  ? 514 LEU A N     1 
ATOM   3485 C CA    . LEU C 3 341 ? 18.313  23.437  19.198  1.00 68.94  ? 514 LEU A CA    1 
ATOM   3486 C C     . LEU C 3 341 ? 19.213  24.627  18.868  1.00 73.68  ? 514 LEU A C     1 
ATOM   3487 O O     . LEU C 3 341 ? 20.277  24.794  19.464  1.00 70.31  ? 514 LEU A O     1 
ATOM   3488 C CB    . LEU C 3 341 ? 17.736  23.570  20.609  1.00 67.90  ? 514 LEU A CB    1 
ATOM   3489 C CG    . LEU C 3 341 ? 16.776  22.466  21.066  1.00 65.17  ? 514 LEU A CG    1 
ATOM   3490 C CD1   . LEU C 3 341 ? 17.444  21.541  22.074  1.00 31.64  ? 514 LEU A CD1   1 
ATOM   3491 C CD2   . LEU C 3 341 ? 15.514  23.070  21.660  1.00 74.90  ? 514 LEU A CD2   1 
ATOM   3492 N N     . HIS C 3 342 ? 18.777  25.448  17.914  1.00 79.13  ? 515 HIS A N     1 
ATOM   3493 C CA    . HIS C 3 342 ? 19.566  26.591  17.450  1.00 80.45  ? 515 HIS A CA    1 
ATOM   3494 C C     . HIS C 3 342 ? 18.796  27.903  17.558  1.00 80.69  ? 515 HIS A C     1 
ATOM   3495 O O     . HIS C 3 342 ? 18.140  28.325  16.594  1.00 82.18  ? 515 HIS A O     1 
ATOM   3496 C CB    . HIS C 3 342 ? 19.998  26.394  15.994  1.00 76.72  ? 515 HIS A CB    1 
ATOM   3497 C CG    . HIS C 3 342 ? 20.497  25.017  15.691  1.00 78.44  ? 515 HIS A CG    1 
ATOM   3498 N ND1   . HIS C 3 342 ? 19.651  23.956  15.451  1.00 87.15  ? 515 HIS A ND1   1 
ATOM   3499 C CD2   . HIS C 3 342 ? 21.755  24.529  15.582  1.00 87.88  ? 515 HIS A CD2   1 
ATOM   3500 C CE1   . HIS C 3 342 ? 20.366  22.872  15.212  1.00 93.93  ? 515 HIS A CE1   1 
ATOM   3501 N NE2   . HIS C 3 342 ? 21.646  23.192  15.285  1.00 101.45 ? 515 HIS A NE2   1 
ATOM   3502 N N     . PRO C 3 343 ? 18.893  28.557  18.715  1.00 80.51  ? 516 PRO A N     1 
ATOM   3503 C CA    . PRO C 3 343 ? 18.175  29.811  18.960  1.00 83.75  ? 516 PRO A CA    1 
ATOM   3504 C C     . PRO C 3 343 ? 18.031  30.641  17.684  1.00 86.46  ? 516 PRO A C     1 
ATOM   3505 O O     . PRO C 3 343 ? 16.907  30.886  17.227  1.00 88.84  ? 516 PRO A O     1 
ATOM   3506 C CB    . PRO C 3 343 ? 19.072  30.519  19.972  1.00 85.62  ? 516 PRO A CB    1 
ATOM   3507 C CG    . PRO C 3 343 ? 19.701  29.387  20.761  1.00 82.44  ? 516 PRO A CG    1 
ATOM   3508 C CD    . PRO C 3 343 ? 19.715  28.159  19.873  1.00 75.33  ? 516 PRO A CD    1 
ATOM   3509 N N     . GLU C 3 344 ? 19.156  31.065  17.114  1.00 86.69  ? 517 GLU A N     1 
ATOM   3510 C CA    . GLU C 3 344 ? 19.132  31.738  15.823  1.00 87.86  ? 517 GLU A CA    1 
ATOM   3511 C C     . GLU C 3 344 ? 19.734  30.824  14.765  1.00 83.92  ? 517 GLU A C     1 
ATOM   3512 O O     . GLU C 3 344 ? 20.865  30.355  14.903  1.00 84.39  ? 517 GLU A O     1 
ATOM   3513 C CB    . GLU C 3 344 ? 19.891  33.069  15.879  1.00 91.35  ? 517 GLU A CB    1 
ATOM   3514 C CG    . GLU C 3 344 ? 20.436  33.533  14.532  1.00 109.03 ? 517 GLU A CG    1 
ATOM   3515 C CD    . GLU C 3 344 ? 20.048  34.964  14.197  1.00 124.16 ? 517 GLU A CD    1 
ATOM   3516 O OE1   . GLU C 3 344 ? 19.305  35.585  14.987  1.00 136.74 ? 517 GLU A OE1   1 
ATOM   3517 O OE2   . GLU C 3 344 ? 20.488  35.469  13.140  1.00 119.43 ? 517 GLU A OE2   1 
ATOM   3518 N N     . LEU C 3 345 ? 18.961  30.557  13.720  1.00 84.17  ? 518 LEU A N     1 
ATOM   3519 C CA    . LEU C 3 345 ? 19.449  29.793  12.578  1.00 85.57  ? 518 LEU A CA    1 
ATOM   3520 C C     . LEU C 3 345 ? 18.704  30.227  11.319  1.00 86.89  ? 518 LEU A C     1 
ATOM   3521 O O     . LEU C 3 345 ? 17.525  30.608  11.385  1.00 84.92  ? 518 LEU A O     1 
ATOM   3522 C CB    . LEU C 3 345 ? 19.282  28.290  12.815  1.00 83.42  ? 518 LEU A CB    1 
ATOM   3523 C CG    . LEU C 3 345 ? 20.069  27.360  11.889  1.00 78.96  ? 518 LEU A CG    1 
ATOM   3524 C CD1   . LEU C 3 345 ? 21.559  27.669  11.947  1.00 101.38 ? 518 LEU A CD1   1 
ATOM   3525 C CD2   . LEU C 3 345 ? 19.810  25.908  12.242  1.00 57.64  ? 518 LEU A CD2   1 
ATOM   3526 N N     . ASP C 3 346 ? 19.398  30.178  10.179  1.00 87.04  ? 519 ASP A N     1 
ATOM   3527 C CA    . ASP C 3 346 ? 18.836  30.652  8.917   1.00 90.84  ? 519 ASP A CA    1 
ATOM   3528 C C     . ASP C 3 346 ? 18.105  31.979  9.110   1.00 90.78  ? 519 ASP A C     1 
ATOM   3529 O O     . ASP C 3 346 ? 17.261  32.363  8.296   1.00 89.09  ? 519 ASP A O     1 
ATOM   3530 C CB    . ASP C 3 346 ? 17.906  29.599  8.306   1.00 94.14  ? 519 ASP A CB    1 
ATOM   3531 C CG    . ASP C 3 346 ? 18.620  28.289  8.014   1.00 106.15 ? 519 ASP A CG    1 
ATOM   3532 O OD1   . ASP C 3 346 ? 19.867  28.295  7.924   1.00 99.26  ? 519 ASP A OD1   1 
ATOM   3533 O OD2   . ASP C 3 346 ? 18.018  27.203  7.858   1.00 110.49 ? 519 ASP A OD2   1 
ATOM   3534 N N     . GLY C 3 347 ? 18.438  32.668  10.203  1.00 92.27  ? 520 GLY A N     1 
ATOM   3535 C CA    . GLY C 3 347 ? 17.871  33.968  10.514  1.00 94.97  ? 520 GLY A CA    1 
ATOM   3536 C C     . GLY C 3 347 ? 16.537  33.928  11.242  1.00 98.79  ? 520 GLY A C     1 
ATOM   3537 O O     . GLY C 3 347 ? 15.915  34.980  11.451  1.00 100.38 ? 520 GLY A O     1 
ATOM   3538 N N     . GLN C 3 348 ? 16.100  32.726  11.634  1.00 98.28  ? 521 GLN A N     1 
ATOM   3539 C CA    . GLN C 3 348 ? 14.790  32.532  12.267  1.00 96.44  ? 521 GLN A CA    1 
ATOM   3540 C C     . GLN C 3 348 ? 14.516  31.043  12.536  1.00 87.12  ? 521 GLN A C     1 
ATOM   3541 O O     . GLN C 3 348 ? 14.557  30.251  11.581  1.00 88.09  ? 521 GLN A O     1 
ATOM   3542 C CB    . GLN C 3 348 ? 13.687  33.089  11.350  1.00 105.07 ? 521 GLN A CB    1 
ATOM   3543 C CG    . GLN C 3 348 ? 14.001  33.028  9.845   1.00 115.90 ? 521 GLN A CG    1 
ATOM   3544 C CD    . GLN C 3 348 ? 13.906  31.620  9.277   1.00 127.12 ? 521 GLN A CD    1 
ATOM   3545 O OE1   . GLN C 3 348 ? 12.820  31.160  8.924   1.00 135.65 ? 521 GLN A OE1   1 
ATOM   3546 N NE2   . GLN C 3 348 ? 15.040  30.932  9.194   1.00 125.88 ? 521 GLN A NE2   1 
ATOM   3547 N N     . GLU C 3 349 ? 14.214  30.624  13.780  1.00 40.34  ? 522 GLU A N     1 
ATOM   3548 C CA    . GLU C 3 349 ? 13.940  31.440  14.972  1.00 29.31  ? 522 GLU A CA    1 
ATOM   3549 C C     . GLU C 3 349 ? 12.683  30.918  15.753  1.00 31.00  ? 522 GLU A C     1 
ATOM   3550 O O     . GLU C 3 349 ? 11.539  31.072  15.251  1.00 74.35  ? 522 GLU A O     1 
ATOM   3551 C CB    . GLU C 3 349 ? 13.715  32.925  14.575  1.00 27.87  ? 522 GLU A CB    1 
ATOM   3552 C CG    . GLU C 3 349 ? 13.191  33.785  15.721  1.00 33.99  ? 522 GLU A CG    1 
ATOM   3553 C CD    . GLU C 3 349 ? 14.296  34.603  16.377  1.00 41.55  ? 522 GLU A CD    1 
ATOM   3554 O OE1   . GLU C 3 349 ? 14.982  35.378  15.658  1.00 34.73  ? 522 GLU A OE1   1 
ATOM   3555 O OE2   . GLU C 3 349 ? 14.483  34.470  17.611  1.00 37.79  ? 522 GLU A OE2   1 
ATOM   3556 N N     . TYR C 3 350 ? 12.799  30.293  16.952  1.00 31.44  ? 523 TYR A N     1 
ATOM   3557 C CA    . TYR C 3 350 ? 13.935  29.397  17.343  1.00 34.49  ? 523 TYR A CA    1 
ATOM   3558 C C     . TYR C 3 350 ? 13.865  28.065  16.584  1.00 39.07  ? 523 TYR A C     1 
ATOM   3559 O O     . TYR C 3 350 ? 12.774  27.495  16.436  1.00 83.33  ? 523 TYR A O     1 
ATOM   3560 C CB    . TYR C 3 350 ? 13.825  29.039  18.855  1.00 24.80  ? 523 TYR A CB    1 
ATOM   3561 C CG    . TYR C 3 350 ? 13.733  30.216  19.801  1.00 25.18  ? 523 TYR A CG    1 
ATOM   3562 C CD1   . TYR C 3 350 ? 14.724  30.434  20.755  1.00 33.18  ? 523 TYR A CD1   1 
ATOM   3563 C CD2   . TYR C 3 350 ? 12.647  31.089  19.768  1.00 25.99  ? 523 TYR A CD2   1 
ATOM   3564 C CE1   . TYR C 3 350 ? 14.655  31.507  21.643  1.00 34.82  ? 523 TYR A CE1   1 
ATOM   3565 C CE2   . TYR C 3 350 ? 12.566  32.168  20.648  1.00 33.69  ? 523 TYR A CE2   1 
ATOM   3566 C CZ    . TYR C 3 350 ? 13.574  32.371  21.587  1.00 41.65  ? 523 TYR A CZ    1 
ATOM   3567 O OH    . TYR C 3 350 ? 13.511  33.437  22.471  1.00 34.62  ? 523 TYR A OH    1 
ATOM   3568 N N     . VAL C 3 351 ? 15.013  27.548  16.131  1.00 67.19  ? 524 VAL A N     1 
ATOM   3569 C CA    . VAL C 3 351 ? 15.001  26.370  15.261  1.00 65.04  ? 524 VAL A CA    1 
ATOM   3570 C C     . VAL C 3 351 ? 15.278  25.038  15.964  1.00 65.35  ? 524 VAL A C     1 
ATOM   3571 O O     . VAL C 3 351 ? 16.144  24.943  16.834  1.00 60.72  ? 524 VAL A O     1 
ATOM   3572 C CB    . VAL C 3 351 ? 15.973  26.538  14.081  1.00 62.94  ? 524 VAL A CB    1 
ATOM   3573 C CG1   . VAL C 3 351 ? 15.656  25.540  12.984  1.00 59.08  ? 524 VAL A CG1   1 
ATOM   3574 C CG2   . VAL C 3 351 ? 15.894  27.947  13.543  1.00 65.52  ? 524 VAL A CG2   1 
ATOM   3575 N N     . VAL C 3 352 ? 14.525  24.014  15.565  1.00 67.45  ? 525 VAL A N     1 
ATOM   3576 C CA    . VAL C 3 352 ? 14.724  22.647  16.041  1.00 66.27  ? 525 VAL A CA    1 
ATOM   3577 C C     . VAL C 3 352 ? 15.161  21.741  14.888  1.00 64.85  ? 525 VAL A C     1 
ATOM   3578 O O     . VAL C 3 352 ? 14.393  21.498  13.957  1.00 65.72  ? 525 VAL A O     1 
ATOM   3579 C CB    . VAL C 3 352 ? 13.437  22.074  16.660  1.00 60.80  ? 525 VAL A CB    1 
ATOM   3580 C CG1   . VAL C 3 352 ? 13.668  20.654  17.146  1.00 62.51  ? 525 VAL A CG1   1 
ATOM   3581 C CG2   . VAL C 3 352 ? 12.959  22.959  17.797  1.00 62.21  ? 525 VAL A CG2   1 
ATOM   3582 N N     . GLU C 3 353 ? 16.395  21.246  14.955  1.00 59.51  ? 526 GLU A N     1 
ATOM   3583 C CA    . GLU C 3 353 ? 16.951  20.420  13.886  1.00 55.49  ? 526 GLU A CA    1 
ATOM   3584 C C     . GLU C 3 353 ? 16.683  18.939  14.121  1.00 52.03  ? 526 GLU A C     1 
ATOM   3585 O O     . GLU C 3 353 ? 17.277  18.324  15.004  1.00 52.60  ? 526 GLU A O     1 
ATOM   3586 C CB    . GLU C 3 353 ? 18.456  20.665  13.742  1.00 58.34  ? 526 GLU A CB    1 
ATOM   3587 C CG    . GLU C 3 353 ? 19.134  19.827  12.665  1.00 69.16  ? 526 GLU A CG    1 
ATOM   3588 C CD    . GLU C 3 353 ? 20.412  20.464  12.143  1.00 68.88  ? 526 GLU A CD    1 
ATOM   3589 O OE1   . GLU C 3 353 ? 21.070  21.204  12.906  1.00 57.45  ? 526 GLU A OE1   1 
ATOM   3590 O OE2   . GLU C 3 353 ? 20.759  20.224  10.967  1.00 47.55  ? 526 GLU A OE2   1 
ATOM   3591 N N     . PHE C 3 354 ? 15.783  18.376  13.323  1.00 47.01  ? 527 PHE A N     1 
ATOM   3592 C CA    . PHE C 3 354 ? 15.473  16.956  13.394  1.00 35.46  ? 527 PHE A CA    1 
ATOM   3593 C C     . PHE C 3 354 ? 16.393  16.193  12.462  1.00 35.22  ? 527 PHE A C     1 
ATOM   3594 O O     . PHE C 3 354 ? 16.610  16.606  11.323  1.00 40.34  ? 527 PHE A O     1 
ATOM   3595 C CB    . PHE C 3 354 ? 14.041  16.701  12.944  1.00 37.44  ? 527 PHE A CB    1 
ATOM   3596 C CG    . PHE C 3 354 ? 12.998  17.173  13.909  1.00 44.64  ? 527 PHE A CG    1 
ATOM   3597 C CD1   . PHE C 3 354 ? 12.263  18.321  13.646  1.00 53.20  ? 527 PHE A CD1   1 
ATOM   3598 C CD2   . PHE C 3 354 ? 12.723  16.453  15.057  1.00 56.38  ? 527 PHE A CD2   1 
ATOM   3599 C CE1   . PHE C 3 354 ? 11.286  18.755  14.522  1.00 55.25  ? 527 PHE A CE1   1 
ATOM   3600 C CE2   . PHE C 3 354 ? 11.745  16.880  15.939  1.00 71.64  ? 527 PHE A CE2   1 
ATOM   3601 C CZ    . PHE C 3 354 ? 11.026  18.034  15.670  1.00 67.22  ? 527 PHE A CZ    1 
ATOM   3602 N N     . ASP C 3 355 ? 16.928  15.076  12.940  1.00 38.05  ? 528 ASP A N     1 
ATOM   3603 C CA    . ASP C 3 355 ? 17.678  14.167  12.082  1.00 50.56  ? 528 ASP A CA    1 
ATOM   3604 C C     . ASP C 3 355 ? 17.615  12.754  12.634  1.00 50.67  ? 528 ASP A C     1 
ATOM   3605 O O     . ASP C 3 355 ? 18.178  12.464  13.693  1.00 49.24  ? 528 ASP A O     1 
ATOM   3606 C CB    . ASP C 3 355 ? 19.134  14.614  11.925  1.00 60.60  ? 528 ASP A CB    1 
ATOM   3607 C CG    . ASP C 3 355 ? 19.774  14.077  10.650  1.00 76.26  ? 528 ASP A CG    1 
ATOM   3608 O OD1   . ASP C 3 355 ? 20.972  14.353  10.413  1.00 85.37  ? 528 ASP A OD1   1 
ATOM   3609 O OD2   . ASP C 3 355 ? 19.151  13.372  9.825   1.00 63.36  ? 528 ASP A OD2   1 
ATOM   3610 N N     . PHE C 3 356 ? 16.923  11.881  11.907  1.00 51.80  ? 529 PHE A N     1 
ATOM   3611 C CA    . PHE C 3 356 ? 16.730  10.501  12.334  1.00 49.29  ? 529 PHE A CA    1 
ATOM   3612 C C     . PHE C 3 356 ? 16.131  9.658   11.219  1.00 44.70  ? 529 PHE A C     1 
ATOM   3613 O O     . PHE C 3 356 ? 15.577  10.187  10.258  1.00 43.18  ? 529 PHE A O     1 
ATOM   3614 C CB    . PHE C 3 356 ? 15.812  10.453  13.551  1.00 49.28  ? 529 PHE A CB    1 
ATOM   3615 C CG    . PHE C 3 356 ? 14.480  11.122  13.335  1.00 65.15  ? 529 PHE A CG    1 
ATOM   3616 C CD1   . PHE C 3 356 ? 13.360  10.375  13.004  1.00 43.42  ? 529 PHE A CD1   1 
ATOM   3617 C CD2   . PHE C 3 356 ? 14.348  12.498  13.471  1.00 74.23  ? 529 PHE A CD2   1 
ATOM   3618 C CE1   . PHE C 3 356 ? 12.138  10.985  12.813  1.00 33.99  ? 529 PHE A CE1   1 
ATOM   3619 C CE2   . PHE C 3 356 ? 13.125  13.114  13.279  1.00 42.14  ? 529 PHE A CE2   1 
ATOM   3620 C CZ    . PHE C 3 356 ? 12.021  12.356  12.951  1.00 43.46  ? 529 PHE A CZ    1 
ATOM   3621 N N     . LEU C 3 357 ? 16.236  8.342   11.361  1.00 42.47  ? 530 LEU A N     1 
ATOM   3622 C CA    . LEU C 3 357 ? 15.636  7.421   10.405  1.00 39.02  ? 530 LEU A CA    1 
ATOM   3623 C C     . LEU C 3 357 ? 14.206  7.068   10.816  1.00 43.00  ? 530 LEU A C     1 
ATOM   3624 O O     . LEU C 3 357 ? 13.982  6.512   11.891  1.00 52.86  ? 530 LEU A O     1 
ATOM   3625 C CB    . LEU C 3 357 ? 16.485  6.152   10.293  1.00 33.46  ? 530 LEU A CB    1 
ATOM   3626 C CG    . LEU C 3 357 ? 17.822  6.282   9.554   1.00 44.63  ? 530 LEU A CG    1 
ATOM   3627 C CD1   . LEU C 3 357 ? 18.787  5.165   9.957   1.00 46.42  ? 530 LEU A CD1   1 
ATOM   3628 C CD2   . LEU C 3 357 ? 17.599  6.295   8.044   1.00 35.64  ? 530 LEU A CD2   1 
ATOM   3629 N N     . GLY C 3 358 ? 13.235  7.399   9.962   1.00 47.48  ? 531 GLY A N     1 
ATOM   3630 C CA    . GLY C 3 358 ? 11.826  7.111   10.229  1.00 55.02  ? 531 GLY A CA    1 
ATOM   3631 C C     . GLY C 3 358 ? 11.405  5.722   9.747   1.00 56.93  ? 531 GLY A C     1 
ATOM   3632 O O     . GLY C 3 358 ? 12.257  4.830   9.603   1.00 55.87  ? 531 GLY A O     1 
ATOM   3633 N N     . ARG C 3 359 ? 10.106  5.513   9.514   1.00 54.39  ? 532 ARG A N     1 
ATOM   3634 C CA    . ARG C 3 359 ? 9.600   4.185   9.153   1.00 56.75  ? 532 ARG A CA    1 
ATOM   3635 C C     . ARG C 3 359 ? 10.568  3.414   8.246   1.00 64.67  ? 532 ARG A C     1 
ATOM   3636 O O     . ARG C 3 359 ? 11.784  3.535   8.400   1.00 70.25  ? 532 ARG A O     1 
ATOM   3637 C CB    . ARG C 3 359 ? 8.217   4.288   8.502   1.00 62.10  ? 532 ARG A CB    1 
ATOM   3638 C CG    . ARG C 3 359 ? 7.137   3.497   9.220   1.00 54.75  ? 532 ARG A CG    1 
ATOM   3639 C CD    . ARG C 3 359 ? 5.934   3.176   8.343   1.00 59.50  ? 532 ARG A CD    1 
ATOM   3640 N NE    . ARG C 3 359 ? 5.795   1.738   8.132   1.00 54.20  ? 532 ARG A NE    1 
ATOM   3641 C CZ    . ARG C 3 359 ? 4.649   1.130   7.865   1.00 64.59  ? 532 ARG A CZ    1 
ATOM   3642 N NH1   . ARG C 3 359 ? 4.621   -0.188  7.701   1.00 67.32  ? 532 ARG A NH1   1 
ATOM   3643 N NH2   . ARG C 3 359 ? 3.527   1.835   7.767   1.00 59.73  ? 532 ARG A NH2   1 
ATOM   3644 N N     . ASP C 3 360 ? 10.068  2.546   7.330   1.00 69.35  ? 533 ASP A N     1 
ATOM   3645 C CA    . ASP C 3 360 ? 10.992  1.894   6.384   1.00 61.86  ? 533 ASP A CA    1 
ATOM   3646 C C     . ASP C 3 360 ? 12.277  2.708   6.200   1.00 56.85  ? 533 ASP A C     1 
ATOM   3647 O O     . ASP C 3 360 ? 12.434  3.437   5.210   1.00 60.24  ? 533 ASP A O     1 
ATOM   3648 C CB    . ASP C 3 360 ? 10.278  1.699   5.047   1.00 62.02  ? 533 ASP A CB    1 
ATOM   3649 C CG    . ASP C 3 360 ? 8.773   1.814   5.178   1.00 69.55  ? 533 ASP A CG    1 
ATOM   3650 O OD1   . ASP C 3 360 ? 8.089   0.768   5.090   1.00 69.97  ? 533 ASP A OD1   1 
ATOM   3651 O OD2   . ASP C 3 360 ? 8.188   2.902   5.398   1.00 69.79  ? 533 ASP A OD2   1 
ATOM   3652 N N     . SER C 3 361 ? 13.180  2.608   7.186   1.00 58.00  ? 534 SER A N     1 
ATOM   3653 C CA    . SER C 3 361 ? 14.365  3.483   7.283   1.00 60.12  ? 534 SER A CA    1 
ATOM   3654 C C     . SER C 3 361 ? 14.414  4.744   6.403   1.00 60.45  ? 534 SER A C     1 
ATOM   3655 O O     . SER C 3 361 ? 15.447  5.036   5.788   1.00 67.53  ? 534 SER A O     1 
ATOM   3656 C CB    . SER C 3 361 ? 15.658  2.664   7.113   1.00 63.26  ? 534 SER A CB    1 
ATOM   3657 O OG    . SER C 3 361 ? 15.762  1.726   8.195   1.00 83.36  ? 534 SER A OG    1 
ATOM   3658 N N     . ILE C 3 362 ? 13.319  5.512   6.334   1.00 56.28  ? 535 ILE A N     1 
ATOM   3659 C CA    . ILE C 3 362 ? 13.346  6.780   5.602   1.00 50.19  ? 535 ILE A CA    1 
ATOM   3660 C C     . ILE C 3 362 ? 13.906  7.885   6.496   1.00 52.36  ? 535 ILE A C     1 
ATOM   3661 O O     . ILE C 3 362 ? 13.301  8.241   7.509   1.00 45.32  ? 535 ILE A O     1 
ATOM   3662 C CB    . ILE C 3 362 ? 11.938  7.182   5.102   1.00 51.91  ? 535 ILE A CB    1 
ATOM   3663 C CG1   . ILE C 3 362 ? 11.367  6.119   4.156   1.00 27.71  ? 535 ILE A CG1   1 
ATOM   3664 C CG2   . ILE C 3 362 ? 11.997  8.535   4.395   1.00 40.45  ? 535 ILE A CG2   1 
ATOM   3665 N N     . ARG C 3 363 ? 15.049  8.433   6.128   1.00 56.71  ? 536 ARG A N     1 
ATOM   3666 C CA    . ARG C 3 363 ? 15.686  9.481   6.924   1.00 52.37  ? 536 ARG A CA    1 
ATOM   3667 C C     . ARG C 3 363 ? 14.883  10.778  6.937   1.00 45.86  ? 536 ARG A C     1 
ATOM   3668 O O     . ARG C 3 363 ? 14.673  11.410  5.900   1.00 38.50  ? 536 ARG A O     1 
ATOM   3669 C CB    . ARG C 3 363 ? 17.112  9.750   6.430   1.00 56.11  ? 536 ARG A CB    1 
ATOM   3670 C CG    . ARG C 3 363 ? 17.801  10.925  7.123   1.00 58.65  ? 536 ARG A CG    1 
ATOM   3671 C CD    . ARG C 3 363 ? 18.901  11.572  6.289   1.00 66.34  ? 536 ARG A CD    1 
ATOM   3672 N NE    . ARG C 3 363 ? 20.058  11.938  7.103   1.00 70.45  ? 536 ARG A NE    1 
ATOM   3673 C CZ    . ARG C 3 363 ? 21.099  12.629  6.657   1.00 86.11  ? 536 ARG A CZ    1 
ATOM   3674 N NH1   . ARG C 3 363 ? 21.139  13.035  5.395   1.00 95.28  ? 536 ARG A NH1   1 
ATOM   3675 N NH2   . ARG C 3 363 ? 22.103  12.916  7.472   1.00 80.66  ? 536 ARG A NH2   1 
ATOM   3676 N N     . TYR C 3 364 ? 14.429  11.162  8.123   1.00 47.35  ? 537 TYR A N     1 
ATOM   3677 C CA    . TYR C 3 364 ? 13.739  12.427  8.301   1.00 44.76  ? 537 TYR A CA    1 
ATOM   3678 C C     . TYR C 3 364 ? 14.737  13.459  8.785   1.00 51.07  ? 537 TYR A C     1 
ATOM   3679 O O     . TYR C 3 364 ? 15.366  13.284  9.829   1.00 57.97  ? 537 TYR A O     1 
ATOM   3680 C CB    . TYR C 3 364 ? 12.603  12.293  9.313   1.00 39.29  ? 537 TYR A CB    1 
ATOM   3681 C CG    . TYR C 3 364 ? 11.739  13.528  9.412   1.00 46.05  ? 537 TYR A CG    1 
ATOM   3682 C CD1   . TYR C 3 364 ? 10.536  13.614  8.724   1.00 60.37  ? 537 TYR A CD1   1 
ATOM   3683 C CD2   . TYR C 3 364 ? 12.129  14.613  10.187  1.00 55.39  ? 537 TYR A CD2   1 
ATOM   3684 C CE1   . TYR C 3 364 ? 9.747   14.742  8.806   1.00 42.47  ? 537 TYR A CE1   1 
ATOM   3685 C CE2   . TYR C 3 364 ? 11.342  15.746  10.276  1.00 57.60  ? 537 TYR A CE2   1 
ATOM   3686 C CZ    . TYR C 3 364 ? 10.153  15.804  9.584   1.00 43.43  ? 537 TYR A CZ    1 
ATOM   3687 O OH    . TYR C 3 364 ? 9.366   16.928  9.671   1.00 41.19  ? 537 TYR A OH    1 
ATOM   3688 N N     . TYR C 3 365 ? 14.888  14.530  8.015   1.00 53.18  ? 538 TYR A N     1 
ATOM   3689 C CA    . TYR C 3 365 ? 15.784  15.611  8.389   1.00 52.52  ? 538 TYR A CA    1 
ATOM   3690 C C     . TYR C 3 365 ? 15.079  16.937  8.188   1.00 52.86  ? 538 TYR A C     1 
ATOM   3691 O O     . TYR C 3 365 ? 14.704  17.277  7.064   1.00 59.01  ? 538 TYR A O     1 
ATOM   3692 C CB    . TYR C 3 365 ? 17.062  15.567  7.549   1.00 55.23  ? 538 TYR A CB    1 
ATOM   3693 C CG    . TYR C 3 365 ? 17.933  16.794  7.702   1.00 70.40  ? 538 TYR A CG    1 
ATOM   3694 C CD1   . TYR C 3 365 ? 18.818  16.911  8.767   1.00 63.79  ? 538 TYR A CD1   1 
ATOM   3695 C CD2   . TYR C 3 365 ? 17.869  17.837  6.783   1.00 85.99  ? 538 TYR A CD2   1 
ATOM   3696 C CE1   . TYR C 3 365 ? 19.616  18.033  8.914   1.00 87.50  ? 538 TYR A CE1   1 
ATOM   3697 C CE2   . TYR C 3 365 ? 18.662  18.964  6.921   1.00 88.90  ? 538 TYR A CE2   1 
ATOM   3698 C CZ    . TYR C 3 365 ? 19.535  19.056  7.989   1.00 93.64  ? 538 TYR A CZ    1 
ATOM   3699 O OH    . TYR C 3 365 ? 20.328  20.173  8.134   1.00 89.43  ? 538 TYR A OH    1 
ATOM   3700 N N     . ASN C 3 366 ? 14.891  17.684  9.273   1.00 53.87  ? 539 ASN A N     1 
ATOM   3701 C CA    . ASN C 3 366 ? 14.254  18.993  9.165   1.00 63.36  ? 539 ASN A CA    1 
ATOM   3702 C C     . ASN C 3 366 ? 14.679  20.002  10.225  1.00 69.39  ? 539 ASN A C     1 
ATOM   3703 O O     . ASN C 3 366 ? 14.880  19.661  11.397  1.00 70.31  ? 539 ASN A O     1 
ATOM   3704 C CB    . ASN C 3 366 ? 12.726  18.866  9.156   1.00 56.13  ? 539 ASN A CB    1 
ATOM   3705 C CG    . ASN C 3 366 ? 12.053  20.029  8.441   1.00 62.35  ? 539 ASN A CG    1 
ATOM   3706 O OD1   . ASN C 3 366 ? 12.706  21.005  8.062   1.00 55.25  ? 539 ASN A OD1   1 
ATOM   3707 N ND2   . ASN C 3 366 ? 10.742  19.929  8.253   1.00 69.15  ? 539 ASN A ND2   1 
ATOM   3708 N N     . LYS C 3 367 ? 14.825  21.248  9.784   1.00 70.92  ? 540 LYS A N     1 
ATOM   3709 C CA    . LYS C 3 367 ? 14.996  22.378  10.680  1.00 69.18  ? 540 LYS A CA    1 
ATOM   3710 C C     . LYS C 3 367 ? 13.656  23.104  10.725  1.00 66.04  ? 540 LYS A C     1 
ATOM   3711 O O     . LYS C 3 367 ? 13.246  23.735  9.741   1.00 70.62  ? 540 LYS A O     1 
ATOM   3712 C CB    . LYS C 3 367 ? 16.097  23.311  10.171  1.00 70.23  ? 540 LYS A CB    1 
ATOM   3713 C CG    . LYS C 3 367 ? 17.503  22.718  10.217  1.00 72.99  ? 540 LYS A CG    1 
ATOM   3714 C CD    . LYS C 3 367 ? 18.093  22.550  8.820   1.00 88.70  ? 540 LYS A CD    1 
ATOM   3715 C CE    . LYS C 3 367 ? 17.132  23.040  7.736   1.00 115.38 ? 540 LYS A CE    1 
ATOM   3716 N NZ    . LYS C 3 367 ? 16.287  21.938  7.166   1.00 111.48 ? 540 LYS A NZ    1 
ATOM   3717 N N     . VAL C 3 368 ? 12.963  22.996  11.855  1.00 55.22  ? 541 VAL A N     1 
ATOM   3718 C CA    . VAL C 3 368 ? 11.619  23.546  11.960  1.00 54.68  ? 541 VAL A CA    1 
ATOM   3719 C C     . VAL C 3 368 ? 11.554  24.683  12.969  1.00 56.46  ? 541 VAL A C     1 
ATOM   3720 O O     . VAL C 3 368 ? 11.681  24.459  14.174  1.00 58.43  ? 541 VAL A O     1 
ATOM   3721 C CB    . VAL C 3 368 ? 10.593  22.462  12.361  1.00 56.38  ? 541 VAL A CB    1 
ATOM   3722 C CG1   . VAL C 3 368 ? 9.179   22.913  12.024  1.00 50.98  ? 541 VAL A CG1   1 
ATOM   3723 C CG2   . VAL C 3 368 ? 10.913  21.140  11.683  1.00 54.94  ? 541 VAL A CG2   1 
ATOM   3724 N N     . PRO C 3 369 ? 11.358  25.902  12.475  1.00 56.77  ? 542 PRO A N     1 
ATOM   3725 C CA    . PRO C 3 369 ? 11.160  27.060  13.349  1.00 55.18  ? 542 PRO A CA    1 
ATOM   3726 C C     . PRO C 3 369 ? 9.897   26.832  14.155  1.00 61.11  ? 542 PRO A C     1 
ATOM   3727 O O     . PRO C 3 369 ? 8.842   26.567  13.568  1.00 62.16  ? 542 PRO A O     1 
ATOM   3728 C CB    . PRO C 3 369 ? 10.953  28.211  12.365  1.00 53.92  ? 542 PRO A CB    1 
ATOM   3729 C CG    . PRO C 3 369 ? 11.534  27.735  11.076  1.00 62.31  ? 542 PRO A CG    1 
ATOM   3730 C CD    . PRO C 3 369 ? 11.301  26.258  11.048  1.00 60.05  ? 542 PRO A CD    1 
ATOM   3731 N N     . VAL C 3 370 ? 10.002  26.910  15.477  1.00 63.36  ? 543 VAL A N     1 
ATOM   3732 C CA    . VAL C 3 370 ? 8.854   26.658  16.341  1.00 68.17  ? 543 VAL A CA    1 
ATOM   3733 C C     . VAL C 3 370 ? 8.581   27.816  17.298  1.00 72.28  ? 543 VAL A C     1 
ATOM   3734 O O     . VAL C 3 370 ? 9.217   28.872  17.217  1.00 73.86  ? 543 VAL A O     1 
ATOM   3735 C CB    . VAL C 3 370 ? 9.031   25.356  17.154  1.00 69.72  ? 543 VAL A CB    1 
ATOM   3736 C CG1   . VAL C 3 370 ? 9.288   24.179  16.220  1.00 66.87  ? 543 VAL A CG1   1 
ATOM   3737 C CG2   . VAL C 3 370 ? 10.162  25.502  18.177  1.00 77.90  ? 543 VAL A CG2   1 
ATOM   3738 N N     . GLU C 3 371 ? 7.622   27.608  18.197  1.00 72.81  ? 544 GLU A N     1 
ATOM   3739 C CA    . GLU C 3 371 ? 7.304   28.588  19.227  1.00 73.36  ? 544 GLU A CA    1 
ATOM   3740 C C     . GLU C 3 371 ? 8.362   28.553  20.325  1.00 65.20  ? 544 GLU A C     1 
ATOM   3741 O O     . GLU C 3 371 ? 9.059   27.552  20.493  1.00 56.25  ? 544 GLU A O     1 
ATOM   3742 C CB    . GLU C 3 371 ? 5.912   28.326  19.811  1.00 78.64  ? 544 GLU A CB    1 
ATOM   3743 C CG    . GLU C 3 371 ? 4.881   27.873  18.784  1.00 83.83  ? 544 GLU A CG    1 
ATOM   3744 C CD    . GLU C 3 371 ? 4.010   29.011  18.286  1.00 86.40  ? 544 GLU A CD    1 
ATOM   3745 O OE1   . GLU C 3 371 ? 2.775   28.945  18.474  1.00 86.71  ? 544 GLU A OE1   1 
ATOM   3746 O OE2   . GLU C 3 371 ? 4.559   29.972  17.705  1.00 85.58  ? 544 GLU A OE2   1 
ATOM   3747 N N     . LYS C 3 372 ? 8.483   29.652  21.063  1.00 67.21  ? 545 LYS A N     1 
ATOM   3748 C CA    . LYS C 3 372 ? 9.515   29.781  22.087  1.00 70.09  ? 545 LYS A CA    1 
ATOM   3749 C C     . LYS C 3 372 ? 9.285   28.804  23.231  1.00 69.51  ? 545 LYS A C     1 
ATOM   3750 O O     . LYS C 3 372 ? 10.232  28.227  23.767  1.00 68.00  ? 545 LYS A O     1 
ATOM   3751 C CB    . LYS C 3 372 ? 9.557   31.210  22.636  1.00 72.08  ? 545 LYS A CB    1 
ATOM   3752 C CG    . LYS C 3 372 ? 9.557   32.301  21.576  1.00 82.98  ? 545 LYS A CG    1 
ATOM   3753 C CD    . LYS C 3 372 ? 10.014  33.627  22.173  1.00 98.95  ? 545 LYS A CD    1 
ATOM   3754 C CE    . LYS C 3 372 ? 9.891   34.761  21.168  1.00 100.21 ? 545 LYS A CE    1 
ATOM   3755 N NZ    . LYS C 3 372 ? 8.969   35.835  21.649  1.00 73.48  ? 545 LYS A NZ    1 
ATOM   3756 N N     . ARG C 3 373 ? 8.021   28.624  23.598  1.00 73.82  ? 546 ARG A N     1 
ATOM   3757 C CA    . ARG C 3 373 ? 7.662   27.782  24.735  1.00 75.51  ? 546 ARG A CA    1 
ATOM   3758 C C     . ARG C 3 373 ? 8.154   26.348  24.555  1.00 74.19  ? 546 ARG A C     1 
ATOM   3759 O O     . ARG C 3 373 ? 8.640   25.734  25.502  1.00 73.87  ? 546 ARG A O     1 
ATOM   3760 C CB    . ARG C 3 373 ? 6.145   27.808  24.978  1.00 78.47  ? 546 ARG A CB    1 
ATOM   3761 C CG    . ARG C 3 373 ? 5.546   29.207  25.160  1.00 74.09  ? 546 ARG A CG    1 
ATOM   3762 C CD    . ARG C 3 373 ? 5.668   29.774  26.575  1.00 83.07  ? 546 ARG A CD    1 
ATOM   3763 N NE    . ARG C 3 373 ? 6.902   29.344  27.235  1.00 104.65 ? 546 ARG A NE    1 
ATOM   3764 C CZ    . ARG C 3 373 ? 7.614   30.095  28.070  1.00 108.68 ? 546 ARG A CZ    1 
ATOM   3765 N NH1   . ARG C 3 373 ? 8.725   29.614  28.616  1.00 84.32  ? 546 ARG A NH1   1 
ATOM   3766 N NH2   . ARG C 3 373 ? 7.219   31.328  28.362  1.00 117.85 ? 546 ARG A NH2   1 
ATOM   3767 N N     . VAL C 3 374 ? 8.030   25.823  23.338  1.00 75.59  ? 547 VAL A N     1 
ATOM   3768 C CA    . VAL C 3 374 ? 8.475   24.465  23.043  1.00 76.34  ? 547 VAL A CA    1 
ATOM   3769 C C     . VAL C 3 374 ? 9.996   24.386  23.017  1.00 77.31  ? 547 VAL A C     1 
ATOM   3770 O O     . VAL C 3 374 ? 10.587  23.454  23.570  1.00 77.02  ? 547 VAL A O     1 
ATOM   3771 C CB    . VAL C 3 374 ? 7.910   23.943  21.704  1.00 78.03  ? 547 VAL A CB    1 
ATOM   3772 C CG1   . VAL C 3 374 ? 6.895   22.841  21.952  1.00 72.56  ? 547 VAL A CG1   1 
ATOM   3773 C CG2   . VAL C 3 374 ? 7.288   25.073  20.901  1.00 92.25  ? 547 VAL A CG2   1 
ATOM   3774 N N     . PHE C 3 375 ? 10.628  25.364  22.371  1.00 77.20  ? 548 PHE A N     1 
ATOM   3775 C CA    . PHE C 3 375 ? 12.082  25.439  22.365  1.00 75.35  ? 548 PHE A CA    1 
ATOM   3776 C C     . PHE C 3 375 ? 12.584  25.341  23.800  1.00 75.99  ? 548 PHE A C     1 
ATOM   3777 O O     . PHE C 3 375 ? 13.368  24.446  24.137  1.00 79.09  ? 548 PHE A O     1 
ATOM   3778 C CB    . PHE C 3 375 ? 12.552  26.744  21.722  1.00 74.44  ? 548 PHE A CB    1 
ATOM   3779 C CG    . PHE C 3 375 ? 13.976  26.707  21.235  1.00 77.65  ? 548 PHE A CG    1 
ATOM   3780 C CD1   . PHE C 3 375 ? 14.254  26.659  19.871  1.00 76.41  ? 548 PHE A CD1   1 
ATOM   3781 C CD2   . PHE C 3 375 ? 15.036  26.728  22.136  1.00 68.18  ? 548 PHE A CD2   1 
ATOM   3782 C CE1   . PHE C 3 375 ? 15.561  26.632  19.416  1.00 80.84  ? 548 PHE A CE1   1 
ATOM   3783 C CE2   . PHE C 3 375 ? 16.344  26.700  21.687  1.00 75.71  ? 548 PHE A CE2   1 
ATOM   3784 C CZ    . PHE C 3 375 ? 16.605  26.654  20.324  1.00 87.70  ? 548 PHE A CZ    1 
ATOM   3785 N N     . LYS C 3 376 ? 12.112  26.254  24.645  1.00 75.13  ? 549 LYS A N     1 
ATOM   3786 C CA    . LYS C 3 376 ? 12.480  26.254  26.055  1.00 79.57  ? 549 LYS A CA    1 
ATOM   3787 C C     . LYS C 3 376 ? 12.122  24.932  26.730  1.00 77.61  ? 549 LYS A C     1 
ATOM   3788 O O     . LYS C 3 376 ? 12.839  24.462  27.613  1.00 78.27  ? 549 LYS A O     1 
ATOM   3789 C CB    . LYS C 3 376 ? 11.814  27.421  26.784  1.00 83.29  ? 549 LYS A CB    1 
ATOM   3790 C CG    . LYS C 3 376 ? 12.783  28.514  27.221  1.00 106.82 ? 549 LYS A CG    1 
ATOM   3791 C CD    . LYS C 3 376 ? 12.175  29.902  27.047  1.00 124.88 ? 549 LYS A CD    1 
ATOM   3792 C CE    . LYS C 3 376 ? 13.220  30.916  26.598  1.00 127.37 ? 549 LYS A CE    1 
ATOM   3793 N NZ    . LYS C 3 376 ? 13.027  31.319  25.173  1.00 127.07 ? 549 LYS A NZ    1 
ATOM   3794 N N     . ASN C 3 377 ? 11.014  24.332  26.309  1.00 76.57  ? 550 ASN A N     1 
ATOM   3795 C CA    . ASN C 3 377 ? 10.572  23.066  26.882  1.00 79.18  ? 550 ASN A CA    1 
ATOM   3796 C C     . ASN C 3 377 ? 11.466  21.907  26.462  1.00 78.10  ? 550 ASN A C     1 
ATOM   3797 O O     . ASN C 3 377 ? 11.695  20.978  27.235  1.00 78.87  ? 550 ASN A O     1 
ATOM   3798 C CB    . ASN C 3 377 ? 9.121   22.772  26.493  1.00 81.62  ? 550 ASN A CB    1 
ATOM   3799 C CG    . ASN C 3 377 ? 8.152   22.997  27.639  1.00 92.28  ? 550 ASN A CG    1 
ATOM   3800 O OD1   . ASN C 3 377 ? 7.936   22.111  28.468  1.00 94.13  ? 550 ASN A OD1   1 
ATOM   3801 N ND2   . ASN C 3 377 ? 7.560   24.186  27.691  1.00 99.32  ? 550 ASN A ND2   1 
ATOM   3802 N N     . LEU C 3 378 ? 11.968  21.968  25.233  1.00 76.39  ? 551 LEU A N     1 
ATOM   3803 C CA    . LEU C 3 378 ? 12.819  20.907  24.705  1.00 78.41  ? 551 LEU A CA    1 
ATOM   3804 C C     . LEU C 3 378 ? 14.139  20.839  25.461  1.00 79.02  ? 551 LEU A C     1 
ATOM   3805 O O     . LEU C 3 378 ? 14.615  19.754  25.805  1.00 77.87  ? 551 LEU A O     1 
ATOM   3806 C CB    . LEU C 3 378 ? 13.075  21.112  23.211  1.00 77.50  ? 551 LEU A CB    1 
ATOM   3807 C CG    . LEU C 3 378 ? 12.110  20.430  22.237  1.00 72.46  ? 551 LEU A CG    1 
ATOM   3808 C CD1   . LEU C 3 378 ? 12.435  20.834  20.806  1.00 61.98  ? 551 LEU A CD1   1 
ATOM   3809 C CD2   . LEU C 3 378 ? 12.143  18.912  22.395  1.00 27.10  ? 551 LEU A CD2   1 
ATOM   3810 N N     . GLN C 3 379 ? 14.721  22.007  25.722  1.00 77.99  ? 552 GLN A N     1 
ATOM   3811 C CA    . GLN C 3 379 ? 15.983  22.093  26.448  1.00 76.87  ? 552 GLN A CA    1 
ATOM   3812 C C     . GLN C 3 379 ? 15.859  21.522  27.854  1.00 73.60  ? 552 GLN A C     1 
ATOM   3813 O O     . GLN C 3 379 ? 16.831  21.016  28.416  1.00 74.32  ? 552 GLN A O     1 
ATOM   3814 C CB    . GLN C 3 379 ? 16.456  23.543  26.520  1.00 75.21  ? 552 GLN A CB    1 
ATOM   3815 C CG    . GLN C 3 379 ? 16.575  24.222  25.170  1.00 87.00  ? 552 GLN A CG    1 
ATOM   3816 C CD    . GLN C 3 379 ? 17.330  25.533  25.252  1.00 109.93 ? 552 GLN A CD    1 
ATOM   3817 O OE1   . GLN C 3 379 ? 17.060  26.357  26.128  1.00 111.41 ? 552 GLN A OE1   1 
ATOM   3818 N NE2   . GLN C 3 379 ? 18.279  25.729  24.344  1.00 113.17 ? 552 GLN A NE2   1 
ATOM   3819 N N     . LEU C 3 380 ? 14.657  21.607  28.416  1.00 67.78  ? 553 LEU A N     1 
ATOM   3820 C CA    . LEU C 3 380 ? 14.394  21.105  29.758  1.00 68.00  ? 553 LEU A CA    1 
ATOM   3821 C C     . LEU C 3 380 ? 14.429  19.578  29.790  1.00 70.39  ? 553 LEU A C     1 
ATOM   3822 O O     . LEU C 3 380 ? 14.900  18.977  30.757  1.00 69.25  ? 553 LEU A O     1 
ATOM   3823 C CB    . LEU C 3 380 ? 13.048  21.629  30.266  1.00 66.33  ? 553 LEU A CB    1 
ATOM   3824 C CG    . LEU C 3 380 ? 12.546  21.189  31.646  1.00 73.75  ? 553 LEU A CG    1 
ATOM   3825 C CD1   . LEU C 3 380 ? 13.612  21.363  32.722  1.00 86.80  ? 553 LEU A CD1   1 
ATOM   3826 C CD2   . LEU C 3 380 ? 11.288  21.958  32.010  1.00 72.16  ? 553 LEU A CD2   1 
ATOM   3827 N N     . PHE C 3 381 ? 13.937  18.952  28.726  1.00 74.15  ? 554 PHE A N     1 
ATOM   3828 C CA    . PHE C 3 381 ? 13.973  17.498  28.623  1.00 76.40  ? 554 PHE A CA    1 
ATOM   3829 C C     . PHE C 3 381 ? 15.382  17.037  28.269  1.00 77.93  ? 554 PHE A C     1 
ATOM   3830 O O     . PHE C 3 381 ? 15.655  15.838  28.205  1.00 74.82  ? 554 PHE A O     1 
ATOM   3831 C CB    . PHE C 3 381 ? 12.988  16.990  27.562  1.00 76.38  ? 554 PHE A CB    1 
ATOM   3832 C CG    . PHE C 3 381 ? 11.649  17.680  27.579  1.00 82.60  ? 554 PHE A CG    1 
ATOM   3833 C CD1   . PHE C 3 381 ? 10.928  17.838  26.405  1.00 87.76  ? 554 PHE A CD1   1 
ATOM   3834 C CD2   . PHE C 3 381 ? 11.106  18.160  28.761  1.00 87.14  ? 554 PHE A CD2   1 
ATOM   3835 C CE1   . PHE C 3 381 ? 9.696   18.466  26.408  1.00 82.37  ? 554 PHE A CE1   1 
ATOM   3836 C CE2   . PHE C 3 381 ? 9.875   18.792  28.769  1.00 86.69  ? 554 PHE A CE2   1 
ATOM   3837 C CZ    . PHE C 3 381 ? 9.169   18.944  27.590  1.00 75.17  ? 554 PHE A CZ    1 
ATOM   3838 N N     . MET C 3 382 ? 16.274  18.000  28.046  1.00 83.53  ? 555 MET A N     1 
ATOM   3839 C CA    . MET C 3 382 ? 17.609  17.711  27.531  1.00 86.06  ? 555 MET A CA    1 
ATOM   3840 C C     . MET C 3 382 ? 18.737  18.163  28.456  1.00 90.43  ? 555 MET A C     1 
ATOM   3841 O O     . MET C 3 382 ? 19.776  18.626  27.985  1.00 93.02  ? 555 MET A O     1 
ATOM   3842 C CB    . MET C 3 382 ? 17.790  18.359  26.154  1.00 85.51  ? 555 MET A CB    1 
ATOM   3843 C CG    . MET C 3 382 ? 17.153  17.586  25.011  1.00 77.58  ? 555 MET A CG    1 
ATOM   3844 S SD    . MET C 3 382 ? 17.580  18.251  23.392  1.00 54.62  ? 555 MET A SD    1 
ATOM   3845 C CE    . MET C 3 382 ? 19.365  18.124  23.438  1.00 69.94  ? 555 MET A CE    1 
ATOM   3846 N N     . GLU C 3 383 ? 18.538  18.034  29.763  1.00 94.64  ? 556 GLU A N     1 
ATOM   3847 C CA    . GLU C 3 383 ? 19.603  18.347  30.715  1.00 93.07  ? 556 GLU A CA    1 
ATOM   3848 C C     . GLU C 3 383 ? 20.021  17.121  31.522  1.00 90.28  ? 556 GLU A C     1 
ATOM   3849 O O     . GLU C 3 383 ? 19.176  16.386  32.040  1.00 84.47  ? 556 GLU A O     1 
ATOM   3850 C CB    . GLU C 3 383 ? 19.220  19.511  31.639  1.00 89.99  ? 556 GLU A CB    1 
ATOM   3851 C CG    . GLU C 3 383 ? 17.798  19.468  32.173  1.00 90.75  ? 556 GLU A CG    1 
ATOM   3852 C CD    . GLU C 3 383 ? 17.418  20.741  32.909  1.00 103.29 ? 556 GLU A CD    1 
ATOM   3853 O OE1   . GLU C 3 383 ? 17.997  21.807  32.598  1.00 95.74  ? 556 GLU A OE1   1 
ATOM   3854 O OE2   . GLU C 3 383 ? 16.540  20.676  33.800  1.00 111.32 ? 556 GLU A OE2   1 
ATOM   3855 N N     . ASN C 3 384 ? 21.332  16.910  31.610  1.00 90.31  ? 557 ASN A N     1 
ATOM   3856 C CA    . ASN C 3 384 ? 21.908  15.750  32.287  1.00 91.98  ? 557 ASN A CA    1 
ATOM   3857 C C     . ASN C 3 384 ? 21.493  14.428  31.644  1.00 91.77  ? 557 ASN A C     1 
ATOM   3858 O O     . ASN C 3 384 ? 20.918  13.559  32.301  1.00 94.10  ? 557 ASN A O     1 
ATOM   3859 C CB    . ASN C 3 384 ? 21.562  15.757  33.780  1.00 94.83  ? 557 ASN A CB    1 
ATOM   3860 C CG    . ASN C 3 384 ? 22.550  16.562  34.602  1.00 101.56 ? 557 ASN A CG    1 
ATOM   3861 O OD1   . ASN C 3 384 ? 23.735  16.229  34.674  1.00 106.52 ? 557 ASN A OD1   1 
ATOM   3862 N ND2   . ASN C 3 384 ? 22.066  17.628  35.229  1.00 108.94 ? 557 ASN A ND2   1 
ATOM   3863 N N     . LYS C 3 385 ? 21.793  14.286  30.356  1.00 92.75  ? 558 LYS A N     1 
ATOM   3864 C CA    . LYS C 3 385 ? 21.430  13.088  29.606  1.00 93.32  ? 558 LYS A CA    1 
ATOM   3865 C C     . LYS C 3 385 ? 22.388  12.839  28.444  1.00 92.69  ? 558 LYS A C     1 
ATOM   3866 O O     . LYS C 3 385 ? 22.762  13.765  27.720  1.00 90.10  ? 558 LYS A O     1 
ATOM   3867 C CB    . LYS C 3 385 ? 19.994  13.195  29.086  1.00 93.72  ? 558 LYS A CB    1 
ATOM   3868 C CG    . LYS C 3 385 ? 18.984  12.359  29.858  1.00 93.77  ? 558 LYS A CG    1 
ATOM   3869 C CD    . LYS C 3 385 ? 17.649  13.080  29.981  1.00 85.16  ? 558 LYS A CD    1 
ATOM   3870 C CE    . LYS C 3 385 ? 16.502  12.204  29.501  1.00 61.98  ? 558 LYS A CE    1 
ATOM   3871 N NZ    . LYS C 3 385 ? 15.433  13.005  28.838  1.00 66.74  ? 558 LYS A NZ    1 
ATOM   3872 N N     . GLN C 3 386 ? 22.779  11.580  28.271  1.00 88.17  ? 559 GLN A N     1 
ATOM   3873 C CA    . GLN C 3 386 ? 23.637  11.187  27.162  1.00 84.95  ? 559 GLN A CA    1 
ATOM   3874 C C     . GLN C 3 386 ? 22.781  10.914  25.931  1.00 83.45  ? 559 GLN A C     1 
ATOM   3875 O O     . GLN C 3 386 ? 21.691  10.352  26.042  1.00 85.58  ? 559 GLN A O     1 
ATOM   3876 C CB    . GLN C 3 386 ? 24.446  9.941   27.528  1.00 85.35  ? 559 GLN A CB    1 
ATOM   3877 C CG    . GLN C 3 386 ? 24.654  9.749   29.020  1.00 92.11  ? 559 GLN A CG    1 
ATOM   3878 C CD    . GLN C 3 386 ? 25.483  10.857  29.640  1.00 105.30 ? 559 GLN A CD    1 
ATOM   3879 O OE1   . GLN C 3 386 ? 26.644  11.044  29.278  1.00 112.30 ? 559 GLN A OE1   1 
ATOM   3880 N NE2   . GLN C 3 386 ? 24.888  11.596  30.571  1.00 104.42 ? 559 GLN A NE2   1 
ATOM   3881 N N     . PRO C 3 387 ? 23.274  11.320  24.762  1.00 76.96  ? 560 PRO A N     1 
ATOM   3882 C CA    . PRO C 3 387 ? 22.555  11.142  23.496  1.00 72.10  ? 560 PRO A CA    1 
ATOM   3883 C C     . PRO C 3 387 ? 21.699  9.878   23.419  1.00 65.79  ? 560 PRO A C     1 
ATOM   3884 O O     . PRO C 3 387 ? 20.653  9.898   22.769  1.00 59.87  ? 560 PRO A O     1 
ATOM   3885 C CB    . PRO C 3 387 ? 23.691  11.084  22.475  1.00 75.28  ? 560 PRO A CB    1 
ATOM   3886 C CG    . PRO C 3 387 ? 24.734  12.007  23.046  1.00 68.84  ? 560 PRO A CG    1 
ATOM   3887 C CD    . PRO C 3 387 ? 24.569  11.999  24.558  1.00 73.68  ? 560 PRO A CD    1 
ATOM   3888 N N     . GLU C 3 388 ? 22.130  8.807   24.081  1.00 65.72  ? 561 GLU A N     1 
ATOM   3889 C CA    . GLU C 3 388 ? 21.441  7.518   24.014  1.00 68.15  ? 561 GLU A CA    1 
ATOM   3890 C C     . GLU C 3 388 ? 20.140  7.460   24.816  1.00 60.92  ? 561 GLU A C     1 
ATOM   3891 O O     . GLU C 3 388 ? 19.446  6.446   24.799  1.00 56.63  ? 561 GLU A O     1 
ATOM   3892 C CB    . GLU C 3 388 ? 22.373  6.393   24.471  1.00 70.69  ? 561 GLU A CB    1 
ATOM   3893 C CG    . GLU C 3 388 ? 23.502  6.088   23.501  1.00 102.23 ? 561 GLU A CG    1 
ATOM   3894 C CD    . GLU C 3 388 ? 24.670  7.045   23.647  1.00 123.70 ? 561 GLU A CD    1 
ATOM   3895 O OE1   . GLU C 3 388 ? 25.262  7.101   24.746  1.00 128.85 ? 561 GLU A OE1   1 
ATOM   3896 O OE2   . GLU C 3 388 ? 24.995  7.743   22.663  1.00 137.05 ? 561 GLU A OE2   1 
ATOM   3897 N N     . ASP C 3 389 ? 19.812  8.544   25.512  1.00 63.14  ? 562 ASP A N     1 
ATOM   3898 C CA    . ASP C 3 389 ? 18.619  8.582   26.356  1.00 69.96  ? 562 ASP A CA    1 
ATOM   3899 C C     . ASP C 3 389 ? 17.386  9.104   25.622  1.00 71.58  ? 562 ASP A C     1 
ATOM   3900 O O     . ASP C 3 389 ? 17.490  9.940   24.721  1.00 71.81  ? 562 ASP A O     1 
ATOM   3901 C CB    . ASP C 3 389 ? 18.871  9.423   27.609  1.00 70.75  ? 562 ASP A CB    1 
ATOM   3902 C CG    . ASP C 3 389 ? 20.001  8.879   28.459  1.00 91.72  ? 562 ASP A CG    1 
ATOM   3903 O OD1   . ASP C 3 389 ? 19.971  7.672   28.786  1.00 102.68 ? 562 ASP A OD1   1 
ATOM   3904 O OD2   . ASP C 3 389 ? 20.960  9.585   28.844  1.00 87.59  ? 562 ASP A OD2   1 
ATOM   3905 N N     . ASP C 3 390 ? 16.219  8.608   26.025  1.00 72.84  ? 563 ASP A N     1 
ATOM   3906 C CA    . ASP C 3 390 ? 14.953  8.994   25.412  1.00 74.15  ? 563 ASP A CA    1 
ATOM   3907 C C     . ASP C 3 390 ? 14.634  10.461  25.689  1.00 68.47  ? 563 ASP A C     1 
ATOM   3908 O O     . ASP C 3 390 ? 14.597  10.892  26.841  1.00 69.03  ? 563 ASP A O     1 
ATOM   3909 C CB    . ASP C 3 390 ? 13.812  8.099   25.915  1.00 79.05  ? 563 ASP A CB    1 
ATOM   3910 C CG    . ASP C 3 390 ? 13.842  6.702   25.302  1.00 87.48  ? 563 ASP A CG    1 
ATOM   3911 O OD1   . ASP C 3 390 ? 12.808  6.002   25.368  1.00 69.42  ? 563 ASP A OD1   1 
ATOM   3912 O OD2   . ASP C 3 390 ? 14.849  6.217   24.740  1.00 93.35  ? 563 ASP A OD2   1 
ATOM   3913 N N     . LEU C 3 391 ? 14.410  11.221  24.621  1.00 64.98  ? 564 LEU A N     1 
ATOM   3914 C CA    . LEU C 3 391 ? 14.065  12.633  24.728  1.00 55.68  ? 564 LEU A CA    1 
ATOM   3915 C C     . LEU C 3 391 ? 12.747  12.819  25.472  1.00 52.37  ? 564 LEU A C     1 
ATOM   3916 O O     . LEU C 3 391 ? 12.658  13.621  26.398  1.00 56.72  ? 564 LEU A O     1 
ATOM   3917 C CB    . LEU C 3 391 ? 13.985  13.268  23.340  1.00 53.48  ? 564 LEU A CB    1 
ATOM   3918 C CG    . LEU C 3 391 ? 13.289  14.622  23.243  1.00 45.62  ? 564 LEU A CG    1 
ATOM   3919 C CD1   . LEU C 3 391 ? 14.036  15.663  24.054  1.00 65.27  ? 564 LEU A CD1   1 
ATOM   3920 C CD2   . LEU C 3 391 ? 13.194  15.049  21.792  1.00 82.01  ? 564 LEU A CD2   1 
ATOM   3921 N N     . PHE C 3 392 ? 11.727  12.075  25.067  1.00 51.72  ? 565 PHE A N     1 
ATOM   3922 C CA    . PHE C 3 392 ? 10.444  12.128  25.756  1.00 58.52  ? 565 PHE A CA    1 
ATOM   3923 C C     . PHE C 3 392 ? 10.299  10.967  26.730  1.00 68.48  ? 565 PHE A C     1 
ATOM   3924 O O     . PHE C 3 392 ? 9.502   10.055  26.505  1.00 74.71  ? 565 PHE A O     1 
ATOM   3925 C CB    . PHE C 3 392 ? 9.287   12.132  24.755  1.00 54.51  ? 565 PHE A CB    1 
ATOM   3926 C CG    . PHE C 3 392 ? 9.242   13.358  23.896  1.00 56.22  ? 565 PHE A CG    1 
ATOM   3927 C CD1   . PHE C 3 392 ? 9.452   13.271  22.530  1.00 51.04  ? 565 PHE A CD1   1 
ATOM   3928 C CD2   . PHE C 3 392 ? 9.000   14.601  24.453  1.00 49.14  ? 565 PHE A CD2   1 
ATOM   3929 C CE1   . PHE C 3 392 ? 9.416   14.400  21.734  1.00 53.10  ? 565 PHE A CE1   1 
ATOM   3930 C CE2   . PHE C 3 392 ? 8.964   15.735  23.662  1.00 61.57  ? 565 PHE A CE2   1 
ATOM   3931 C CZ    . PHE C 3 392 ? 9.172   15.634  22.300  1.00 45.55  ? 565 PHE A CZ    1 
ATOM   3932 N N     . ASP C 3 393 ? 11.079  11.001  27.808  1.00 72.73  ? 566 ASP A N     1 
ATOM   3933 C CA    . ASP C 3 393 ? 10.978  9.992   28.858  1.00 77.82  ? 566 ASP A CA    1 
ATOM   3934 C C     . ASP C 3 393 ? 9.771   10.286  29.739  1.00 80.97  ? 566 ASP A C     1 
ATOM   3935 O O     . ASP C 3 393 ? 9.232   11.392  29.710  1.00 76.53  ? 566 ASP A O     1 
ATOM   3936 C CB    . ASP C 3 393 ? 12.256  9.944   29.694  1.00 78.95  ? 566 ASP A CB    1 
ATOM   3937 C CG    . ASP C 3 393 ? 12.737  11.322  30.103  1.00 87.29  ? 566 ASP A CG    1 
ATOM   3938 O OD1   . ASP C 3 393 ? 12.522  12.283  29.331  1.00 78.04  ? 566 ASP A OD1   1 
ATOM   3939 O OD2   . ASP C 3 393 ? 13.338  11.540  31.177  1.00 85.75  ? 566 ASP A OD2   1 
ATOM   3940 N N     . ARG C 3 394 ? 9.353   9.297   30.524  1.00 88.72  ? 567 ARG A N     1 
ATOM   3941 C CA    . ARG C 3 394 ? 8.106   9.394   31.282  1.00 93.33  ? 567 ARG A CA    1 
ATOM   3942 C C     . ARG C 3 394 ? 6.946   9.569   30.306  1.00 86.67  ? 567 ARG A C     1 
ATOM   3943 O O     . ARG C 3 394 ? 5.890   10.099  30.657  1.00 84.48  ? 567 ARG A O     1 
ATOM   3944 C CB    . ARG C 3 394 ? 8.151   10.555  32.284  1.00 96.22  ? 567 ARG A CB    1 
ATOM   3945 C CG    . ARG C 3 394 ? 7.205   10.398  33.471  1.00 105.53 ? 567 ARG A CG    1 
ATOM   3946 C CD    . ARG C 3 394 ? 7.831   9.731   34.687  1.00 113.42 ? 567 ARG A CD    1 
ATOM   3947 N NE    . ARG C 3 394 ? 8.656   10.662  35.455  1.00 132.74 ? 567 ARG A NE    1 
ATOM   3948 C CZ    . ARG C 3 394 ? 9.983   10.635  35.488  1.00 137.21 ? 567 ARG A CZ    1 
ATOM   3949 N NH1   . ARG C 3 394 ? 10.649  9.720   34.796  1.00 138.84 ? 567 ARG A NH1   1 
ATOM   3950 N NH2   . ARG C 3 394 ? 10.647  11.524  36.215  1.00 135.40 ? 567 ARG A NH2   1 
ATOM   3951 N N     . LEU C 3 395 ? 7.162   9.115   29.074  1.00 83.45  ? 568 LEU A N     1 
ATOM   3952 C CA    . LEU C 3 395 ? 6.186   9.273   28.007  1.00 73.91  ? 568 LEU A CA    1 
ATOM   3953 C C     . LEU C 3 395 ? 6.318   8.164   26.972  1.00 68.06  ? 568 LEU A C     1 
ATOM   3954 O O     . LEU C 3 395 ? 7.423   7.778   26.581  1.00 68.14  ? 568 LEU A O     1 
ATOM   3955 C CB    . LEU C 3 395 ? 6.359   10.633  27.326  1.00 71.78  ? 568 LEU A CB    1 
ATOM   3956 C CG    . LEU C 3 395 ? 5.121   11.254  26.680  1.00 58.06  ? 568 LEU A CG    1 
ATOM   3957 C CD1   . LEU C 3 395 ? 5.196   11.142  25.164  1.00 10.04  ? 568 LEU A CD1   1 
ATOM   3958 C CD2   . LEU C 3 395 ? 3.853   10.605  27.217  1.00 43.56  ? 568 LEU A CD2   1 
ATOM   3959 N N     . ASN C 3 396 ? 5.175   7.651   26.540  1.00 62.37  ? 569 ASN A N     1 
ATOM   3960 C CA    . ASN C 3 396 ? 5.129   6.656   25.482  1.00 63.88  ? 569 ASN A CA    1 
ATOM   3961 C C     . ASN C 3 396 ? 3.825   6.773   24.710  1.00 62.86  ? 569 ASN A C     1 
ATOM   3962 O O     . ASN C 3 396 ? 2.899   7.470   25.133  1.00 65.01  ? 569 ASN A O     1 
ATOM   3963 C CB    . ASN C 3 396 ? 5.287   5.242   26.051  1.00 59.90  ? 569 ASN A CB    1 
ATOM   3964 C CG    . ASN C 3 396 ? 4.707   5.106   27.449  1.00 69.46  ? 569 ASN A CG    1 
ATOM   3965 O OD1   . ASN C 3 396 ? 3.619   5.608   27.737  1.00 74.07  ? 569 ASN A OD1   1 
ATOM   3966 N ND2   . ASN C 3 396 ? 5.434   4.421   28.324  1.00 66.09  ? 569 ASN A ND2   1 
ATOM   3967 N N     . THR C 3 397 ? 3.758   6.096   23.571  1.00 59.06  ? 570 THR A N     1 
ATOM   3968 C CA    . THR C 3 397 ? 2.544   6.092   22.772  1.00 59.68  ? 570 THR A CA    1 
ATOM   3969 C C     . THR C 3 397 ? 1.336   5.689   23.626  1.00 60.68  ? 570 THR A C     1 
ATOM   3970 O O     . THR C 3 397 ? 0.267   6.306   23.536  1.00 54.62  ? 570 THR A O     1 
ATOM   3971 C CB    . THR C 3 397 ? 2.711   5.156   21.563  1.00 57.64  ? 570 THR A CB    1 
ATOM   3972 O OG1   . THR C 3 397 ? 3.280   3.911   21.990  1.00 53.54  ? 570 THR A OG1   1 
ATOM   3973 C CG2   . THR C 3 397 ? 3.769   5.710   20.624  1.00 51.81  ? 570 THR A CG2   1 
ATOM   3974 N N     . GLY C 3 398 ? 1.521   4.669   24.465  1.00 58.96  ? 571 GLY A N     1 
ATOM   3975 C CA    . GLY C 3 398 ? 0.468   4.205   25.349  1.00 64.09  ? 571 GLY A CA    1 
ATOM   3976 C C     . GLY C 3 398 ? -0.196  5.322   26.134  1.00 72.04  ? 571 GLY A C     1 
ATOM   3977 O O     . GLY C 3 398 ? -1.425  5.434   26.151  1.00 76.76  ? 571 GLY A O     1 
ATOM   3978 N N     . ILE C 3 399 ? 0.615   6.150   26.788  1.00 69.33  ? 572 ILE A N     1 
ATOM   3979 C CA    . ILE C 3 399 ? 0.098   7.275   27.562  1.00 62.30  ? 572 ILE A CA    1 
ATOM   3980 C C     . ILE C 3 399 ? -0.464  8.349   26.642  1.00 59.55  ? 572 ILE A C     1 
ATOM   3981 O O     . ILE C 3 399 ? -1.586  8.823   26.835  1.00 51.43  ? 572 ILE A O     1 
ATOM   3982 C CB    . ILE C 3 399 ? 1.202   7.882   28.450  1.00 59.99  ? 572 ILE A CB    1 
ATOM   3983 C CG1   . ILE C 3 399 ? 1.442   7.001   29.680  1.00 71.66  ? 572 ILE A CG1   1 
ATOM   3984 C CG2   . ILE C 3 399 ? 0.826   9.298   28.872  1.00 57.80  ? 572 ILE A CG2   1 
ATOM   3985 N N     . LEU C 3 400 ? 0.326   8.722   25.639  1.00 58.87  ? 573 LEU A N     1 
ATOM   3986 C CA    . LEU C 3 400 ? -0.050  9.782   24.712  1.00 51.11  ? 573 LEU A CA    1 
ATOM   3987 C C     . LEU C 3 400 ? -1.413  9.514   24.080  1.00 50.25  ? 573 LEU A C     1 
ATOM   3988 O O     . LEU C 3 400 ? -2.245  10.417  23.980  1.00 54.89  ? 573 LEU A O     1 
ATOM   3989 C CB    . LEU C 3 400 ? 1.019   9.958   23.632  1.00 43.24  ? 573 LEU A CB    1 
ATOM   3990 C CG    . LEU C 3 400 ? 0.619   10.807  22.420  1.00 53.42  ? 573 LEU A CG    1 
ATOM   3991 C CD1   . LEU C 3 400 ? 0.549   12.283  22.796  1.00 30.81  ? 573 LEU A CD1   1 
ATOM   3992 C CD2   . LEU C 3 400 ? 1.563   10.582  21.234  1.00 18.98  ? 573 LEU A CD2   1 
ATOM   3993 N N     . ASN C 3 401 ? -1.643  8.271   23.667  1.00 46.56  ? 574 ASN A N     1 
ATOM   3994 C CA    . ASN C 3 401 ? -2.921  7.897   23.069  1.00 55.95  ? 574 ASN A CA    1 
ATOM   3995 C C     . ASN C 3 401 ? -4.052  7.859   24.094  1.00 62.04  ? 574 ASN A C     1 
ATOM   3996 O O     . ASN C 3 401 ? -5.183  8.253   23.795  1.00 56.81  ? 574 ASN A O     1 
ATOM   3997 C CB    . ASN C 3 401 ? -2.812  6.558   22.332  1.00 52.48  ? 574 ASN A CB    1 
ATOM   3998 C CG    . ASN C 3 401 ? -1.830  6.615   21.180  1.00 64.19  ? 574 ASN A CG    1 
ATOM   3999 O OD1   . ASN C 3 401 ? -1.866  7.536   20.361  1.00 52.95  ? 574 ASN A OD1   1 
ATOM   4000 N ND2   . ASN C 3 401 ? -0.938  5.629   21.114  1.00 67.93  ? 574 ASN A ND2   1 
ATOM   4001 N N     . LYS C 3 402 ? -3.743  7.390   25.302  1.00 67.69  ? 575 LYS A N     1 
ATOM   4002 C CA    . LYS C 3 402 ? -4.725  7.372   26.382  1.00 67.68  ? 575 LYS A CA    1 
ATOM   4003 C C     . LYS C 3 402 ? -5.234  8.785   26.639  1.00 64.43  ? 575 LYS A C     1 
ATOM   4004 O O     . LYS C 3 402 ? -6.435  9.004   26.810  1.00 68.60  ? 575 LYS A O     1 
ATOM   4005 C CB    . LYS C 3 402 ? -4.121  6.779   27.658  1.00 69.05  ? 575 LYS A CB    1 
ATOM   4006 C CG    . LYS C 3 402 ? -4.567  7.464   28.948  1.00 87.20  ? 575 LYS A CG    1 
ATOM   4007 C CD    . LYS C 3 402 ? -5.668  6.680   29.655  1.00 97.24  ? 575 LYS A CD    1 
ATOM   4008 C CE    . LYS C 3 402 ? -5.086  5.623   30.592  1.00 99.19  ? 575 LYS A CE    1 
ATOM   4009 N NZ    . LYS C 3 402 ? -6.150  4.858   31.302  1.00 100.20 ? 575 LYS A NZ    1 
ATOM   4010 N N     . HIS C 3 403 ? -4.308  9.742   26.648  1.00 61.13  ? 576 HIS A N     1 
ATOM   4011 C CA    . HIS C 3 403 ? -4.649  11.148  26.827  1.00 59.36  ? 576 HIS A CA    1 
ATOM   4012 C C     . HIS C 3 403 ? -5.507  11.651  25.671  1.00 65.82  ? 576 HIS A C     1 
ATOM   4013 O O     . HIS C 3 403 ? -6.287  12.593  25.825  1.00 65.64  ? 576 HIS A O     1 
ATOM   4014 C CB    . HIS C 3 403 ? -3.374  11.989  26.933  1.00 52.77  ? 576 HIS A CB    1 
ATOM   4015 C CG    . HIS C 3 403 ? -3.613  13.460  26.806  1.00 49.44  ? 576 HIS A CG    1 
ATOM   4016 N ND1   . HIS C 3 403 ? -2.939  14.248  25.897  1.00 63.88  ? 576 HIS A ND1   1 
ATOM   4017 C CD2   . HIS C 3 403 ? -4.453  14.288  27.472  1.00 55.27  ? 576 HIS A CD2   1 
ATOM   4018 C CE1   . HIS C 3 403 ? -3.352  15.499  26.010  1.00 62.87  ? 576 HIS A CE1   1 
ATOM   4019 N NE2   . HIS C 3 403 ? -4.271  15.550  26.959  1.00 55.96  ? 576 HIS A NE2   1 
ATOM   4020 N N     . LEU C 3 404 ? -5.361  11.012  24.513  1.00 66.86  ? 577 LEU A N     1 
ATOM   4021 C CA    . LEU C 3 404 ? -6.065  11.432  23.309  1.00 54.49  ? 577 LEU A CA    1 
ATOM   4022 C C     . LEU C 3 404 ? -7.514  10.965  23.308  1.00 55.43  ? 577 LEU A C     1 
ATOM   4023 O O     . LEU C 3 404 ? -8.423  11.769  23.101  1.00 55.54  ? 577 LEU A O     1 
ATOM   4024 C CB    . LEU C 3 404 ? -5.332  10.948  22.058  1.00 45.74  ? 577 LEU A CB    1 
ATOM   4025 C CG    . LEU C 3 404 ? -4.095  11.760  21.670  1.00 38.27  ? 577 LEU A CG    1 
ATOM   4026 C CD1   . LEU C 3 404 ? -3.992  11.900  20.161  1.00 28.06  ? 577 LEU A CD1   1 
ATOM   4027 C CD2   . LEU C 3 404 ? -4.114  13.129  22.332  1.00 38.74  ? 577 LEU A CD2   1 
ATOM   4028 N N     . GLN C 3 405 ? -7.732  9.672   23.546  1.00 59.59  ? 578 GLN A N     1 
ATOM   4029 C CA    . GLN C 3 405 ? -9.094  9.143   23.623  1.00 70.45  ? 578 GLN A CA    1 
ATOM   4030 C C     . GLN C 3 405 ? -9.787  9.684   24.863  1.00 73.73  ? 578 GLN A C     1 
ATOM   4031 O O     . GLN C 3 405 ? -10.916 9.306   25.172  1.00 76.87  ? 578 GLN A O     1 
ATOM   4032 C CB    . GLN C 3 405 ? -9.117  7.611   23.625  1.00 72.20  ? 578 GLN A CB    1 
ATOM   4033 C CG    . GLN C 3 405 ? -7.805  6.954   24.025  1.00 91.69  ? 578 GLN A CG    1 
ATOM   4034 C CD    . GLN C 3 405 ? -7.467  5.734   23.177  1.00 98.32  ? 578 GLN A CD    1 
ATOM   4035 O OE1   . GLN C 3 405 ? -6.806  4.808   23.653  1.00 59.11  ? 578 GLN A OE1   1 
ATOM   4036 N NE2   . GLN C 3 405 ? -7.916  5.732   21.922  1.00 86.99  ? 578 GLN A NE2   1 
ATOM   4037 N N     . ASP C 3 406 ? -9.090  10.573  25.566  1.00 77.21  ? 579 ASP A N     1 
ATOM   4038 C CA    . ASP C 3 406 ? -9.626  11.239  26.744  1.00 77.06  ? 579 ASP A CA    1 
ATOM   4039 C C     . ASP C 3 406 ? -10.388 12.481  26.314  1.00 72.20  ? 579 ASP A C     1 
ATOM   4040 O O     . ASP C 3 406 ? -11.478 12.760  26.812  1.00 73.77  ? 579 ASP A O     1 
ATOM   4041 C CB    . ASP C 3 406 ? -8.488  11.634  27.687  1.00 79.14  ? 579 ASP A CB    1 
ATOM   4042 C CG    . ASP C 3 406 ? -8.766  11.260  29.127  1.00 88.91  ? 579 ASP A CG    1 
ATOM   4043 O OD1   . ASP C 3 406 ? -8.415  10.128  29.528  1.00 88.80  ? 579 ASP A OD1   1 
ATOM   4044 O OD2   . ASP C 3 406 ? -9.326  12.034  29.932  1.00 95.55  ? 579 ASP A OD2   1 
ATOM   4045 N N     . LEU C 3 407 ? -9.802  13.221  25.378  1.00 69.61  ? 580 LEU A N     1 
ATOM   4046 C CA    . LEU C 3 407 ? -10.409 14.445  24.867  1.00 67.23  ? 580 LEU A CA    1 
ATOM   4047 C C     . LEU C 3 407 ? -11.516 14.130  23.870  1.00 63.00  ? 580 LEU A C     1 
ATOM   4048 O O     . LEU C 3 407 ? -12.649 14.591  24.017  1.00 67.24  ? 580 LEU A O     1 
ATOM   4049 C CB    . LEU C 3 407 ? -9.349  15.333  24.212  1.00 64.59  ? 580 LEU A CB    1 
ATOM   4050 C CG    . LEU C 3 407 ? -8.025  15.471  24.969  1.00 70.08  ? 580 LEU A CG    1 
ATOM   4051 C CD1   . LEU C 3 407 ? -7.038  16.324  24.184  1.00 67.47  ? 580 LEU A CD1   1 
ATOM   4052 C CD2   . LEU C 3 407 ? -8.253  16.052  26.359  1.00 61.67  ? 580 LEU A CD2   1 
ATOM   4053 N N     . MET C 3 408 ? -11.179 13.341  22.857  1.00 52.72  ? 581 MET A N     1 
ATOM   4054 C CA    . MET C 3 408 ? -12.143 12.942  21.844  1.00 49.06  ? 581 MET A CA    1 
ATOM   4055 C C     . MET C 3 408 ? -12.228 11.428  21.781  1.00 45.78  ? 581 MET A C     1 
ATOM   4056 O O     . MET C 3 408 ? -11.237 10.740  22.007  1.00 47.32  ? 581 MET A O     1 
ATOM   4057 C CB    . MET C 3 408 ? -11.746 13.504  20.481  1.00 49.66  ? 581 MET A CB    1 
ATOM   4058 C CG    . MET C 3 408 ? -12.903 13.640  19.505  1.00 67.33  ? 581 MET A CG    1 
ATOM   4059 S SD    . MET C 3 408 ? -12.358 13.814  17.796  1.00 59.64  ? 581 MET A SD    1 
ATOM   4060 C CE    . MET C 3 408 ? -12.023 12.115  17.378  1.00 74.39  ? 581 MET A CE    1 
ATOM   4061 N N     . GLU C 3 409 ? -13.413 10.915  21.467  1.00 49.79  ? 582 GLU A N     1 
ATOM   4062 C CA    . GLU C 3 409 ? -13.650 9.474   21.430  1.00 58.70  ? 582 GLU A CA    1 
ATOM   4063 C C     . GLU C 3 409 ? -12.871 8.765   20.314  1.00 62.17  ? 582 GLU A C     1 
ATOM   4064 O O     . GLU C 3 409 ? -12.893 9.190   19.155  1.00 56.78  ? 582 GLU A O     1 
ATOM   4065 C CB    . GLU C 3 409 ? -15.149 9.188   21.304  1.00 59.29  ? 582 GLU A CB    1 
ATOM   4066 C CG    . GLU C 3 409 ? -15.502 7.727   21.060  1.00 81.41  ? 582 GLU A CG    1 
ATOM   4067 C CD    . GLU C 3 409 ? -15.056 6.817   22.189  1.00 97.10  ? 582 GLU A CD    1 
ATOM   4068 O OE1   . GLU C 3 409 ? -14.691 5.655   21.907  1.00 105.72 ? 582 GLU A OE1   1 
ATOM   4069 O OE2   . GLU C 3 409 ? -15.072 7.262   23.358  1.00 100.77 ? 582 GLU A OE2   1 
ATOM   4070 N N     . GLY C 3 410 ? -12.179 7.686   20.683  1.00 68.58  ? 583 GLY A N     1 
ATOM   4071 C CA    . GLY C 3 410 ? -11.435 6.874   19.735  1.00 70.16  ? 583 GLY A CA    1 
ATOM   4072 C C     . GLY C 3 410 ? -10.389 7.639   18.943  1.00 72.11  ? 583 GLY A C     1 
ATOM   4073 O O     . GLY C 3 410 ? -10.096 7.293   17.798  1.00 78.89  ? 583 GLY A O     1 
ATOM   4074 N N     . LEU C 3 411 ? -9.823  8.676   19.554  1.00 66.56  ? 584 LEU A N     1 
ATOM   4075 C CA    . LEU C 3 411 ? -8.814  9.504   18.901  1.00 60.11  ? 584 LEU A CA    1 
ATOM   4076 C C     . LEU C 3 411 ? -7.407  9.023   19.238  1.00 59.13  ? 584 LEU A C     1 
ATOM   4077 O O     . LEU C 3 411 ? -7.092  8.785   20.401  1.00 65.75  ? 584 LEU A O     1 
ATOM   4078 C CB    . LEU C 3 411 ? -8.986  10.968  19.321  1.00 60.04  ? 584 LEU A CB    1 
ATOM   4079 C CG    . LEU C 3 411 ? -7.761  11.888  19.268  1.00 58.23  ? 584 LEU A CG    1 
ATOM   4080 C CD1   . LEU C 3 411 ? -7.362  12.187  17.828  1.00 45.98  ? 584 LEU A CD1   1 
ATOM   4081 C CD2   . LEU C 3 411 ? -8.029  13.178  20.030  1.00 48.59  ? 584 LEU A CD2   1 
ATOM   4082 N N     . THR C 3 412 ? -6.566  8.876   18.219  1.00 54.06  ? 585 THR A N     1 
ATOM   4083 C CA    . THR C 3 412 ? -5.180  8.458   18.421  1.00 50.75  ? 585 THR A CA    1 
ATOM   4084 C C     . THR C 3 412 ? -4.218  9.362   17.649  1.00 50.67  ? 585 THR A C     1 
ATOM   4085 O O     . THR C 3 412 ? -4.642  10.305  16.985  1.00 59.12  ? 585 THR A O     1 
ATOM   4086 C CB    . THR C 3 412 ? -4.988  6.989   18.001  1.00 51.93  ? 585 THR A CB    1 
ATOM   4087 O OG1   . THR C 3 412 ? -5.539  6.788   16.693  1.00 52.16  ? 585 THR A OG1   1 
ATOM   4088 C CG2   . THR C 3 412 ? -5.820  6.063   18.876  1.00 61.72  ? 585 THR A CG2   1 
ATOM   4089 N N     . ALA C 3 413 ? -2.924  9.072   17.738  1.00 46.45  ? 586 ALA A N     1 
ATOM   4090 C CA    . ALA C 3 413 ? -1.907  9.901   17.092  1.00 43.01  ? 586 ALA A CA    1 
ATOM   4091 C C     . ALA C 3 413 ? -1.990  9.877   15.565  1.00 47.01  ? 586 ALA A C     1 
ATOM   4092 O O     . ALA C 3 413 ? -1.803  10.900  14.907  1.00 49.62  ? 586 ALA A O     1 
ATOM   4093 C CB    . ALA C 3 413 ? -0.521  9.482   17.549  1.00 38.33  ? 586 ALA A CB    1 
ATOM   4094 N N     . LYS C 3 414 ? -2.263  8.700   15.009  1.00 50.53  ? 587 LYS A N     1 
ATOM   4095 C CA    . LYS C 3 414 ? -2.319  8.518   13.562  1.00 43.42  ? 587 LYS A CA    1 
ATOM   4096 C C     . LYS C 3 414 ? -3.435  9.346   12.940  1.00 35.76  ? 587 LYS A C     1 
ATOM   4097 O O     . LYS C 3 414 ? -3.318  9.808   11.808  1.00 31.08  ? 587 LYS A O     1 
ATOM   4098 C CB    . LYS C 3 414 ? -2.503  7.036   13.220  1.00 48.59  ? 587 LYS A CB    1 
ATOM   4099 C CG    . LYS C 3 414 ? -3.318  6.773   11.961  1.00 44.11  ? 587 LYS A CG    1 
ATOM   4100 C CD    . LYS C 3 414 ? -4.352  5.688   12.202  1.00 9.10   ? 587 LYS A CD    1 
ATOM   4101 C CE    . LYS C 3 414 ? -4.657  4.929   10.929  1.00 31.81  ? 587 LYS A CE    1 
ATOM   4102 N NZ    . LYS C 3 414 ? -3.934  3.631   10.873  1.00 30.07  ? 587 LYS A NZ    1 
ATOM   4103 N N     . VAL C 3 415 ? -4.515  9.529   13.692  1.00 36.56  ? 588 VAL A N     1 
ATOM   4104 C CA    . VAL C 3 415 ? -5.656  10.310  13.232  1.00 39.48  ? 588 VAL A CA    1 
ATOM   4105 C C     . VAL C 3 415 ? -5.227  11.692  12.741  1.00 44.23  ? 588 VAL A C     1 
ATOM   4106 O O     . VAL C 3 415 ? -5.707  12.174  11.711  1.00 47.56  ? 588 VAL A O     1 
ATOM   4107 C CB    . VAL C 3 415 ? -6.704  10.469  14.353  1.00 29.78  ? 588 VAL A CB    1 
ATOM   4108 C CG1   . VAL C 3 415 ? -7.654  11.606  14.040  1.00 43.91  ? 588 VAL A CG1   1 
ATOM   4109 C CG2   . VAL C 3 415 ? -7.475  9.177   14.539  1.00 48.66  ? 588 VAL A CG2   1 
ATOM   4110 N N     . PHE C 3 416 ? -4.308  12.314  13.472  1.00 45.87  ? 589 PHE A N     1 
ATOM   4111 C CA    . PHE C 3 416 ? -3.871  13.677  13.182  1.00 45.14  ? 589 PHE A CA    1 
ATOM   4112 C C     . PHE C 3 416 ? -3.325  13.850  11.765  1.00 41.64  ? 589 PHE A C     1 
ATOM   4113 O O     . PHE C 3 416 ? -3.490  14.907  11.154  1.00 36.39  ? 589 PHE A O     1 
ATOM   4114 C CB    . PHE C 3 416 ? -2.823  14.119  14.199  1.00 49.00  ? 589 PHE A CB    1 
ATOM   4115 C CG    . PHE C 3 416 ? -3.395  14.831  15.390  1.00 54.19  ? 589 PHE A CG    1 
ATOM   4116 C CD1   . PHE C 3 416 ? -3.623  14.152  16.576  1.00 43.39  ? 589 PHE A CD1   1 
ATOM   4117 C CD2   . PHE C 3 416 ? -3.698  16.181  15.326  1.00 47.37  ? 589 PHE A CD2   1 
ATOM   4118 C CE1   . PHE C 3 416 ? -4.145  14.807  17.674  1.00 39.81  ? 589 PHE A CE1   1 
ATOM   4119 C CE2   . PHE C 3 416 ? -4.217  16.842  16.423  1.00 39.75  ? 589 PHE A CE2   1 
ATOM   4120 C CZ    . PHE C 3 416 ? -4.442  16.155  17.596  1.00 19.81  ? 589 PHE A CZ    1 
ATOM   4121 N N     . ARG C 3 417 ? -2.676  12.813  11.250  1.00 37.98  ? 590 ARG A N     1 
ATOM   4122 C CA    . ARG C 3 417 ? -2.138  12.851  9.893   1.00 47.85  ? 590 ARG A CA    1 
ATOM   4123 C C     . ARG C 3 417 ? -3.252  12.762  8.852   1.00 47.85  ? 590 ARG A C     1 
ATOM   4124 O O     . ARG C 3 417 ? -3.211  13.441  7.824   1.00 49.93  ? 590 ARG A O     1 
ATOM   4125 C CB    . ARG C 3 417 ? -1.124  11.725  9.680   1.00 52.50  ? 590 ARG A CB    1 
ATOM   4126 C CG    . ARG C 3 417 ? 0.126   11.846  10.538  1.00 70.00  ? 590 ARG A CG    1 
ATOM   4127 C CD    . ARG C 3 417 ? 1.167   10.774  10.275  1.00 58.73  ? 590 ARG A CD    1 
ATOM   4128 N NE    . ARG C 3 417 ? 1.621   10.787  8.888   1.00 51.18  ? 590 ARG A NE    1 
ATOM   4129 C CZ    . ARG C 3 417 ? 1.998   9.707   8.220   1.00 58.22  ? 590 ARG A CZ    1 
ATOM   4130 N NH1   . ARG C 3 417 ? 1.976   8.521   8.813   1.00 68.84  ? 590 ARG A NH1   1 
ATOM   4131 N NH2   . ARG C 3 417 ? 2.397   9.810   6.959   1.00 68.66  ? 590 ARG A NH2   1 
ATOM   4132 N N     . THR C 3 418 ? -4.244  11.918  9.126   1.00 42.34  ? 591 THR A N     1 
ATOM   4133 C CA    . THR C 3 418 ? -5.392  11.770  8.242   1.00 35.58  ? 591 THR A CA    1 
ATOM   4134 C C     . THR C 3 418 ? -6.118  13.105  8.095   1.00 39.00  ? 591 THR A C     1 
ATOM   4135 O O     . THR C 3 418 ? -6.490  13.504  6.984   1.00 35.71  ? 591 THR A O     1 
ATOM   4136 C CB    . THR C 3 418 ? -6.349  10.687  8.787   1.00 33.29  ? 591 THR A CB    1 
ATOM   4137 O OG1   . THR C 3 418 ? -5.779  9.392   8.554   1.00 38.75  ? 591 THR A OG1   1 
ATOM   4138 C CG2   . THR C 3 418 ? -7.640  10.644  7.980   1.00 37.29  ? 591 THR A CG2   1 
ATOM   4139 N N     . TYR C 3 419 ? -6.310  13.796  9.218   1.00 38.60  ? 592 TYR A N     1 
ATOM   4140 C CA    . TYR C 3 419 ? -6.936  15.113  9.202   1.00 42.48  ? 592 TYR A CA    1 
ATOM   4141 C C     . TYR C 3 419 ? -6.073  16.119  8.455   1.00 44.83  ? 592 TYR A C     1 
ATOM   4142 O O     . TYR C 3 419 ? -6.544  16.816  7.555   1.00 41.56  ? 592 TYR A O     1 
ATOM   4143 C CB    . TYR C 3 419 ? -7.188  15.625  10.623  1.00 35.43  ? 592 TYR A CB    1 
ATOM   4144 C CG    . TYR C 3 419 ? -7.416  17.127  10.686  1.00 51.11  ? 592 TYR A CG    1 
ATOM   4145 C CD1   . TYR C 3 419 ? -8.690  17.666  10.509  1.00 75.14  ? 592 TYR A CD1   1 
ATOM   4146 C CD2   . TYR C 3 419 ? -6.356  18.007  10.917  1.00 52.16  ? 592 TYR A CD2   1 
ATOM   4147 C CE1   . TYR C 3 419 ? -8.901  19.038  10.563  1.00 73.26  ? 592 TYR A CE1   1 
ATOM   4148 C CE2   . TYR C 3 419 ? -6.559  19.380  10.971  1.00 54.45  ? 592 TYR A CE2   1 
ATOM   4149 C CZ    . TYR C 3 419 ? -7.833  19.888  10.795  1.00 71.41  ? 592 TYR A CZ    1 
ATOM   4150 O OH    . TYR C 3 419 ? -8.044  21.249  10.850  1.00 60.83  ? 592 TYR A OH    1 
ATOM   4151 N N     . ASN C 3 420 ? -4.805  16.192  8.838   1.00 46.74  ? 593 ASN A N     1 
ATOM   4152 C CA    . ASN C 3 420 ? -3.906  17.190  8.281   1.00 51.93  ? 593 ASN A CA    1 
ATOM   4153 C C     . ASN C 3 420 ? -3.830  17.142  6.766   1.00 43.22  ? 593 ASN A C     1 
ATOM   4154 O O     . ASN C 3 420 ? -3.735  18.181  6.118   1.00 51.49  ? 593 ASN A O     1 
ATOM   4155 C CB    . ASN C 3 420 ? -2.506  17.062  8.884   1.00 68.36  ? 593 ASN A CB    1 
ATOM   4156 C CG    . ASN C 3 420 ? -2.319  17.930  10.117  1.00 89.24  ? 593 ASN A CG    1 
ATOM   4157 O OD1   . ASN C 3 420 ? -3.134  18.809  10.408  1.00 84.21  ? 593 ASN A OD1   1 
ATOM   4158 N ND2   . ASN C 3 420 ? -1.236  17.688  10.850  1.00 109.42 ? 593 ASN A ND2   1 
ATOM   4159 N N     . ALA C 3 421 ? -3.881  15.941  6.195   1.00 22.61  ? 594 ALA A N     1 
ATOM   4160 C CA    . ALA C 3 421 ? -3.753  15.818  4.750   1.00 19.56  ? 594 ALA A CA    1 
ATOM   4161 C C     . ALA C 3 421 ? -4.935  15.185  4.011   1.00 28.92  ? 594 ALA A C     1 
ATOM   4162 O O     . ALA C 3 421 ? -4.777  14.676  2.892   1.00 31.17  ? 594 ALA A O     1 
ATOM   4163 C CB    . ALA C 3 421 ? -2.437  15.162  4.366   1.00 18.65  ? 594 ALA A CB    1 
ATOM   4164 N N     . SER C 3 422 ? -6.115  15.217  4.641   1.00 22.70  ? 595 SER A N     1 
ATOM   4165 C CA    . SER C 3 422 ? -7.323  15.311  3.808   1.00 23.27  ? 595 SER A CA    1 
ATOM   4166 C C     . SER C 3 422 ? -7.587  16.807  3.605   1.00 22.76  ? 595 SER A C     1 
ATOM   4167 O O     . SER C 3 422 ? -7.610  17.320  2.448   1.00 44.45  ? 595 SER A O     1 
ATOM   4168 C CB    . SER C 3 422 ? -8.510  14.621  4.488   1.00 33.33  ? 595 SER A CB    1 
ATOM   4169 O OG    . SER C 3 422 ? -8.656  13.296  3.961   1.00 36.72  ? 595 SER A OG    1 
ATOM   4170 N N     . ILE C 3 423 ? -7.761  17.499  4.749   1.00 22.33  ? 596 ILE A N     1 
ATOM   4171 C CA    . ILE C 3 423 ? -7.928  18.956  4.759   1.00 21.04  ? 596 ILE A CA    1 
ATOM   4172 C C     . ILE C 3 423 ? -7.043  19.658  3.731   1.00 22.82  ? 596 ILE A C     1 
ATOM   4173 O O     . ILE C 3 423 ? -7.522  20.501  2.969   1.00 38.34  ? 596 ILE A O     1 
ATOM   4174 C CB    . ILE C 3 423 ? -7.642  19.516  6.176   1.00 19.22  ? 596 ILE A CB    1 
ATOM   4175 C CG1   . ILE C 3 423 ? -8.920  19.511  7.012   1.00 19.90  ? 596 ILE A CG1   1 
ATOM   4176 C CG2   . ILE C 3 423 ? -7.056  20.924  6.107   1.00 19.04  ? 596 ILE A CG2   1 
ATOM   4177 C CD1   . ILE C 3 423 ? -9.426  20.902  7.349   1.00 21.31  ? 596 ILE A CD1   1 
ATOM   4178 N N     . THR C 3 424 ? -5.758  19.304  3.707   1.00 26.33  ? 597 THR A N     1 
ATOM   4179 C CA    . THR C 3 424 ? -4.813  19.932  2.790   1.00 38.27  ? 597 THR A CA    1 
ATOM   4180 C C     . THR C 3 424 ? -5.110  19.626  1.324   1.00 48.54  ? 597 THR A C     1 
ATOM   4181 O O     . THR C 3 424 ? -5.010  20.508  0.467   1.00 52.02  ? 597 THR A O     1 
ATOM   4182 C CB    . THR C 3 424 ? -3.377  19.537  3.136   1.00 36.15  ? 597 THR A CB    1 
ATOM   4183 O OG1   . THR C 3 424 ? -3.090  19.941  4.479   1.00 57.42  ? 597 THR A OG1   1 
ATOM   4184 C CG2   . THR C 3 424 ? -2.389  20.349  2.307   1.00 40.97  ? 597 THR A CG2   1 
ATOM   4185 N N     . LEU C 3 425 ? -5.469  18.379  1.034   1.00 53.72  ? 598 LEU A N     1 
ATOM   4186 C CA    . LEU C 3 425 ? -5.863  18.016  -0.322  1.00 50.50  ? 598 LEU A CA    1 
ATOM   4187 C C     . LEU C 3 425 ? -7.111  18.798  -0.732  1.00 50.17  ? 598 LEU A C     1 
ATOM   4188 O O     . LEU C 3 425 ? -7.136  19.427  -1.786  1.00 56.16  ? 598 LEU A O     1 
ATOM   4189 C CB    . LEU C 3 425 ? -6.105  16.508  -0.442  1.00 48.58  ? 598 LEU A CB    1 
ATOM   4190 C CG    . LEU C 3 425 ? -6.567  16.021  -1.822  1.00 29.97  ? 598 LEU A CG    1 
ATOM   4191 C CD1   . LEU C 3 425 ? -5.847  14.752  -2.230  1.00 33.24  ? 598 LEU A CD1   1 
ATOM   4192 C CD2   . LEU C 3 425 ? -8.064  15.787  -1.818  1.00 44.20  ? 598 LEU A CD2   1 
ATOM   4193 N N     . GLN C 3 426 ? -8.136  18.765  0.114   1.00 43.71  ? 599 GLN A N     1 
ATOM   4194 C CA    . GLN C 3 426 ? -9.392  19.455  -0.167  1.00 54.66  ? 599 GLN A CA    1 
ATOM   4195 C C     . GLN C 3 426 ? -9.170  20.918  -0.538  1.00 58.79  ? 599 GLN A C     1 
ATOM   4196 O O     . GLN C 3 426 ? -9.747  21.420  -1.505  1.00 56.23  ? 599 GLN A O     1 
ATOM   4197 C CB    . GLN C 3 426 ? -10.333 19.360  1.038   1.00 62.28  ? 599 GLN A CB    1 
ATOM   4198 C CG    . GLN C 3 426 ? -11.699 19.994  0.824   1.00 43.45  ? 599 GLN A CG    1 
ATOM   4199 C CD    . GLN C 3 426 ? -12.730 19.494  1.816   1.00 76.90  ? 599 GLN A CD    1 
ATOM   4200 O OE1   . GLN C 3 426 ? -12.756 19.934  2.966   1.00 73.10  ? 599 GLN A OE1   1 
ATOM   4201 N NE2   . GLN C 3 426 ? -13.580 18.573  1.377   1.00 72.60  ? 599 GLN A NE2   1 
ATOM   4202 N N     . GLN C 3 427 ? -8.329  21.592  0.241   1.00 61.59  ? 600 GLN A N     1 
ATOM   4203 C CA    . GLN C 3 427 ? -8.013  22.999  0.016   1.00 62.45  ? 600 GLN A CA    1 
ATOM   4204 C C     . GLN C 3 427 ? -7.177  23.200  -1.247  1.00 57.18  ? 600 GLN A C     1 
ATOM   4205 O O     . GLN C 3 427 ? -7.324  24.202  -1.945  1.00 54.45  ? 600 GLN A O     1 
ATOM   4206 C CB    . GLN C 3 427 ? -7.285  23.574  1.235   1.00 64.64  ? 600 GLN A CB    1 
ATOM   4207 C CG    . GLN C 3 427 ? -6.443  24.807  0.953   1.00 57.50  ? 600 GLN A CG    1 
ATOM   4208 C CD    . GLN C 3 427 ? -7.259  26.087  0.977   1.00 91.90  ? 600 GLN A CD    1 
ATOM   4209 O OE1   . GLN C 3 427 ? -7.903  26.398  1.980   1.00 108.56 ? 600 GLN A OE1   1 
ATOM   4210 N NE2   . GLN C 3 427 ? -7.235  26.830  -0.125  1.00 100.49 ? 600 GLN A NE2   1 
ATOM   4211 N N     . GLN C 3 428 ? -6.308  22.239  -1.540  1.00 59.03  ? 601 GLN A N     1 
ATOM   4212 C CA    . GLN C 3 428 ? -5.408  22.345  -2.685  1.00 60.54  ? 601 GLN A CA    1 
ATOM   4213 C C     . GLN C 3 428 ? -6.148  22.357  -4.021  1.00 63.41  ? 601 GLN A C     1 
ATOM   4214 O O     . GLN C 3 428 ? -5.822  23.148  -4.907  1.00 66.29  ? 601 GLN A O     1 
ATOM   4215 C CB    . GLN C 3 428 ? -4.364  21.225  -2.663  1.00 60.01  ? 601 GLN A CB    1 
ATOM   4216 C CG    . GLN C 3 428 ? -3.199  21.463  -1.703  1.00 58.34  ? 601 GLN A CG    1 
ATOM   4217 C CD    . GLN C 3 428 ? -2.550  22.821  -1.885  1.00 54.93  ? 601 GLN A CD    1 
ATOM   4218 O OE1   . GLN C 3 428 ? -1.841  23.052  -2.865  1.00 53.22  ? 601 GLN A OE1   1 
ATOM   4219 N NE2   . GLN C 3 428 ? -2.788  23.721  -0.940  1.00 57.14  ? 601 GLN A NE2   1 
ATOM   4220 N N     . LEU C 3 429 ? -7.142  21.483  -4.166  1.00 64.46  ? 602 LEU A N     1 
ATOM   4221 C CA    . LEU C 3 429 ? -7.910  21.410  -5.406  1.00 66.06  ? 602 LEU A CA    1 
ATOM   4222 C C     . LEU C 3 429 ? -8.777  22.646  -5.585  1.00 67.30  ? 602 LEU A C     1 
ATOM   4223 O O     . LEU C 3 429 ? -8.783  23.261  -6.649  1.00 68.51  ? 602 LEU A O     1 
ATOM   4224 C CB    . LEU C 3 429 ? -8.791  20.159  -5.443  1.00 65.89  ? 602 LEU A CB    1 
ATOM   4225 C CG    . LEU C 3 429 ? -8.308  18.901  -4.723  1.00 63.61  ? 602 LEU A CG    1 
ATOM   4226 C CD1   . LEU C 3 429 ? -9.447  18.305  -3.923  1.00 63.49  ? 602 LEU A CD1   1 
ATOM   4227 C CD2   . LEU C 3 429 ? -7.762  17.887  -5.710  1.00 54.22  ? 602 LEU A CD2   1 
ATOM   4228 N N     . LYS C 3 430 ? -9.509  23.005  -4.536  1.00 72.24  ? 603 LYS A N     1 
ATOM   4229 C CA    . LYS C 3 430 ? -10.407 24.152  -4.586  1.00 72.12  ? 603 LYS A CA    1 
ATOM   4230 C C     . LYS C 3 430 ? -9.652  25.422  -4.952  1.00 66.18  ? 603 LYS A C     1 
ATOM   4231 O O     . LYS C 3 430 ? -10.257 26.424  -5.330  1.00 73.23  ? 603 LYS A O     1 
ATOM   4232 C CB    . LYS C 3 430 ? -11.135 24.326  -3.251  1.00 76.64  ? 603 LYS A CB    1 
ATOM   4233 C CG    . LYS C 3 430 ? -12.098 23.189  -2.923  1.00 93.94  ? 603 LYS A CG    1 
ATOM   4234 C CD    . LYS C 3 430 ? -13.338 23.699  -2.200  1.00 99.01  ? 603 LYS A CD    1 
ATOM   4235 C CE    . LYS C 3 430 ? -13.147 23.663  -0.688  1.00 104.45 ? 603 LYS A CE    1 
ATOM   4236 N NZ    . LYS C 3 430 ? -12.645 24.965  -0.160  1.00 100.05 ? 603 LYS A NZ    1 
ATOM   4237 N N     . GLU C 3 431 ? -8.329  25.370  -4.846  1.00 59.09  ? 604 GLU A N     1 
ATOM   4238 C CA    . GLU C 3 431 ? -7.493  26.508  -5.202  1.00 56.95  ? 604 GLU A CA    1 
ATOM   4239 C C     . GLU C 3 431 ? -6.580  26.193  -6.384  1.00 55.37  ? 604 GLU A C     1 
ATOM   4240 O O     . GLU C 3 431 ? -5.821  27.045  -6.841  1.00 62.40  ? 604 GLU A O     1 
ATOM   4241 C CB    . GLU C 3 431 ? -6.689  26.994  -3.991  1.00 60.14  ? 604 GLU A CB    1 
ATOM   4242 C CG    . GLU C 3 431 ? -5.349  26.300  -3.784  1.00 69.25  ? 604 GLU A CG    1 
ATOM   4243 C CD    . GLU C 3 431 ? -4.496  26.991  -2.733  1.00 78.89  ? 604 GLU A CD    1 
ATOM   4244 O OE1   . GLU C 3 431 ? -5.028  27.850  -1.995  1.00 59.31  ? 604 GLU A OE1   1 
ATOM   4245 O OE2   . GLU C 3 431 ? -3.290  26.674  -2.645  1.00 80.53  ? 604 GLU A OE2   1 
ATOM   4246 N N     . LEU C 3 432 ? -6.665  24.967  -6.884  1.00 55.87  ? 605 LEU A N     1 
ATOM   4247 C CA    . LEU C 3 432 ? -5.906  24.585  -8.070  1.00 55.37  ? 605 LEU A CA    1 
ATOM   4248 C C     . LEU C 3 432 ? -6.833  24.378  -9.263  1.00 56.81  ? 605 LEU A C     1 
ATOM   4249 O O     . LEU C 3 432 ? -6.607  24.935  -10.336 1.00 56.93  ? 605 LEU A O     1 
ATOM   4250 C CB    . LEU C 3 432 ? -5.101  23.310  -7.809  1.00 53.34  ? 605 LEU A CB    1 
ATOM   4251 C CG    . LEU C 3 432 ? -3.584  23.471  -7.717  1.00 47.96  ? 605 LEU A CG    1 
ATOM   4252 C CD1   . LEU C 3 432 ? -2.922  22.112  -7.594  1.00 58.55  ? 605 LEU A CD1   1 
ATOM   4253 C CD2   . LEU C 3 432 ? -3.043  24.221  -8.923  1.00 51.82  ? 605 LEU A CD2   1 
ATOM   4254 N N     . THR C 3 433 ? -7.874  23.574  -9.060  1.00 62.42  ? 606 THR A N     1 
ATOM   4255 C CA    . THR C 3 433 ? -8.817  23.214  -10.117 1.00 67.16  ? 606 THR A CA    1 
ATOM   4256 C C     . THR C 3 433 ? -9.439  24.427  -10.802 1.00 69.47  ? 606 THR A C     1 
ATOM   4257 O O     . THR C 3 433 ? -10.164 25.199  -10.175 1.00 68.30  ? 606 THR A O     1 
ATOM   4258 C CB    . THR C 3 433 ? -9.934  22.310  -9.556  1.00 71.91  ? 606 THR A CB    1 
ATOM   4259 O OG1   . THR C 3 433 ? -9.373  21.342  -8.657  1.00 60.77  ? 606 THR A OG1   1 
ATOM   4260 C CG2   . THR C 3 433 ? -10.534 21.459  -10.666 1.00 80.83  ? 606 THR A CG2   1 
ATOM   4261 N N     . ALA C 3 434 ? -9.156  24.576  -12.094 1.00 75.07  ? 607 ALA A N     1 
ATOM   4262 C CA    . ALA C 3 434 ? -9.704  25.670  -12.892 1.00 80.02  ? 607 ALA A CA    1 
ATOM   4263 C C     . ALA C 3 434 ? -11.083 25.297  -13.430 1.00 83.97  ? 607 ALA A C     1 
ATOM   4264 O O     . ALA C 3 434 ? -11.209 24.432  -14.306 1.00 85.08  ? 607 ALA A O     1 
ATOM   4265 C CB    . ALA C 3 434 ? -8.761  26.022  -14.035 1.00 82.57  ? 607 ALA A CB    1 
ATOM   4266 N N     . PRO C 3 435 ? -12.108 25.968  -12.906 1.00 84.47  ? 608 PRO A N     1 
ATOM   4267 C CA    . PRO C 3 435 ? -13.512 25.632  -13.178 1.00 84.99  ? 608 PRO A CA    1 
ATOM   4268 C C     . PRO C 3 435 ? -13.867 25.378  -14.646 1.00 85.83  ? 608 PRO A C     1 
ATOM   4269 O O     . PRO C 3 435 ? -14.667 24.486  -14.923 1.00 85.09  ? 608 PRO A O     1 
ATOM   4270 C CB    . PRO C 3 435 ? -14.261 26.868  -12.671 1.00 85.82  ? 608 PRO A CB    1 
ATOM   4271 C CG    . PRO C 3 435 ? -13.401 27.389  -11.571 1.00 74.53  ? 608 PRO A CG    1 
ATOM   4272 C CD    . PRO C 3 435 ? -11.982 27.123  -11.994 1.00 84.13  ? 608 PRO A CD    1 
ATOM   4273 N N     . ASP C 3 436 ? -13.284 26.142  -15.564 1.00 90.14  ? 609 ASP A N     1 
ATOM   4274 C CA    . ASP C 3 436 ? -13.730 26.126  -16.956 1.00 96.88  ? 609 ASP A CA    1 
ATOM   4275 C C     . ASP C 3 436 ? -12.927 25.202  -17.874 1.00 96.96  ? 609 ASP A C     1 
ATOM   4276 O O     . ASP C 3 436 ? -13.270 25.036  -19.045 1.00 99.87  ? 609 ASP A O     1 
ATOM   4277 C CB    . ASP C 3 436 ? -13.739 27.549  -17.527 1.00 99.62  ? 609 ASP A CB    1 
ATOM   4278 C CG    . ASP C 3 436 ? -12.767 28.471  -16.810 1.00 104.44 ? 609 ASP A CG    1 
ATOM   4279 O OD1   . ASP C 3 436 ? -11.644 28.666  -17.321 1.00 109.00 ? 609 ASP A OD1   1 
ATOM   4280 O OD2   . ASP C 3 436 ? -13.038 29.045  -15.732 1.00 81.67  ? 609 ASP A OD2   1 
ATOM   4281 N N     . GLU C 3 437 ? -11.867 24.600  -17.348 1.00 95.59  ? 610 GLU A N     1 
ATOM   4282 C CA    . GLU C 3 437 ? -10.980 23.789  -18.177 1.00 96.19  ? 610 GLU A CA    1 
ATOM   4283 C C     . GLU C 3 437 ? -11.580 22.435  -18.541 1.00 90.78  ? 610 GLU A C     1 
ATOM   4284 O O     . GLU C 3 437 ? -12.615 22.039  -18.002 1.00 88.56  ? 610 GLU A O     1 
ATOM   4285 C CB    . GLU C 3 437 ? -9.621  23.610  -17.496 1.00 98.72  ? 610 GLU A CB    1 
ATOM   4286 C CG    . GLU C 3 437 ? -8.673  24.788  -17.688 1.00 118.76 ? 610 GLU A CG    1 
ATOM   4287 C CD    . GLU C 3 437 ? -9.119  25.741  -18.788 1.00 130.11 ? 610 GLU A CD    1 
ATOM   4288 O OE1   . GLU C 3 437 ? -8.834  25.466  -19.975 1.00 128.11 ? 610 GLU A OE1   1 
ATOM   4289 O OE2   . GLU C 3 437 ? -9.748  26.772  -18.465 1.00 128.12 ? 610 GLU A OE2   1 
ATOM   4290 N N     . ASN C 3 438 ? -10.927 21.736  -19.466 1.00 87.68  ? 611 ASN A N     1 
ATOM   4291 C CA    . ASN C 3 438 ? -11.387 20.423  -19.908 1.00 86.53  ? 611 ASN A CA    1 
ATOM   4292 C C     . ASN C 3 438 ? -10.849 19.292  -19.031 1.00 83.13  ? 611 ASN A C     1 
ATOM   4293 O O     . ASN C 3 438 ? -10.116 19.540  -18.075 1.00 86.15  ? 611 ASN A O     1 
ATOM   4294 C CB    . ASN C 3 438 ? -11.058 20.194  -21.388 1.00 88.55  ? 611 ASN A CB    1 
ATOM   4295 C CG    . ASN C 3 438 ? -9.616  19.774  -21.614 1.00 93.93  ? 611 ASN A CG    1 
ATOM   4296 O OD1   . ASN C 3 438 ? -9.345  18.821  -22.346 1.00 101.65 ? 611 ASN A OD1   1 
ATOM   4297 N ND2   . ASN C 3 438 ? -8.683  20.490  -20.996 1.00 98.78  ? 611 ASN A ND2   1 
ATOM   4298 N N     . ILE C 3 439 ? -11.209 18.056  -19.368 1.00 75.31  ? 612 ILE A N     1 
ATOM   4299 C CA    . ILE C 3 439 ? -10.973 16.910  -18.486 1.00 65.71  ? 612 ILE A CA    1 
ATOM   4300 C C     . ILE C 3 439 ? -9.500  16.584  -18.171 1.00 64.53  ? 612 ILE A C     1 
ATOM   4301 O O     . ILE C 3 439 ? -9.130  16.518  -17.001 1.00 67.65  ? 612 ILE A O     1 
ATOM   4302 C CB    . ILE C 3 439 ? -11.743 15.666  -18.997 1.00 65.13  ? 612 ILE A CB    1 
ATOM   4303 C CG1   . ILE C 3 439 ? -13.219 15.748  -18.570 1.00 42.07  ? 612 ILE A CG1   1 
ATOM   4304 C CG2   . ILE C 3 439 ? -11.093 14.377  -18.488 1.00 81.32  ? 612 ILE A CG2   1 
ATOM   4305 N N     . PRO C 3 440 ? -8.659  16.381  -19.185 1.00 63.64  ? 613 PRO A N     1 
ATOM   4306 C CA    . PRO C 3 440 ? -7.243  16.079  -18.944 1.00 63.35  ? 613 PRO A CA    1 
ATOM   4307 C C     . PRO C 3 440 ? -6.554  17.180  -18.141 1.00 68.62  ? 613 PRO A C     1 
ATOM   4308 O O     . PRO C 3 440 ? -5.725  16.886  -17.280 1.00 71.08  ? 613 PRO A O     1 
ATOM   4309 C CB    . PRO C 3 440 ? -6.652  16.007  -20.357 1.00 66.12  ? 613 PRO A CB    1 
ATOM   4310 C CG    . PRO C 3 440 ? -7.804  15.697  -21.235 1.00 59.21  ? 613 PRO A CG    1 
ATOM   4311 C CD    . PRO C 3 440 ? -8.976  16.413  -20.625 1.00 70.17  ? 613 PRO A CD    1 
ATOM   4312 N N     . ALA C 3 441 ? -6.901  18.433  -18.423 1.00 74.17  ? 614 ALA A N     1 
ATOM   4313 C CA    . ALA C 3 441 ? -6.328  19.568  -17.703 1.00 76.15  ? 614 ALA A CA    1 
ATOM   4314 C C     . ALA C 3 441 ? -6.883  19.665  -16.284 1.00 73.43  ? 614 ALA A C     1 
ATOM   4315 O O     . ALA C 3 441 ? -6.234  20.212  -15.390 1.00 75.40  ? 614 ALA A O     1 
ATOM   4316 C CB    . ALA C 3 441 ? -6.581  20.863  -18.462 1.00 79.14  ? 614 ALA A CB    1 
ATOM   4317 N N     . LYS C 3 442 ? -8.089  19.141  -16.086 1.00 67.27  ? 615 LYS A N     1 
ATOM   4318 C CA    . LYS C 3 442 ? -8.691  19.083  -14.761 1.00 56.67  ? 615 LYS A CA    1 
ATOM   4319 C C     . LYS C 3 442 ? -8.106  17.906  -13.992 1.00 56.13  ? 615 LYS A C     1 
ATOM   4320 O O     . LYS C 3 442 ? -7.991  17.945  -12.767 1.00 58.79  ? 615 LYS A O     1 
ATOM   4321 C CB    . LYS C 3 442 ? -10.212 18.946  -14.865 1.00 55.41  ? 615 LYS A CB    1 
ATOM   4322 C CG    . LYS C 3 442 ? -10.970 20.257  -14.713 1.00 47.40  ? 615 LYS A CG    1 
ATOM   4323 C CD    . LYS C 3 442 ? -12.436 20.013  -14.388 1.00 64.23  ? 615 LYS A CD    1 
ATOM   4324 C CE    . LYS C 3 442 ? -13.191 21.323  -14.209 1.00 83.25  ? 615 LYS A CE    1 
ATOM   4325 N NZ    . LYS C 3 442 ? -13.511 21.969  -15.516 1.00 94.05  ? 615 LYS A NZ    1 
ATOM   4326 N N     . ILE C 3 443 ? -7.732  16.861  -14.725 1.00 52.33  ? 616 ILE A N     1 
ATOM   4327 C CA    . ILE C 3 443 ? -7.124  15.681  -14.127 1.00 50.23  ? 616 ILE A CA    1 
ATOM   4328 C C     . ILE C 3 443 ? -5.754  16.029  -13.552 1.00 53.64  ? 616 ILE A C     1 
ATOM   4329 O O     . ILE C 3 443 ? -5.393  15.575  -12.463 1.00 53.62  ? 616 ILE A O     1 
ATOM   4330 C CB    . ILE C 3 443 ? -7.021  14.542  -15.165 1.00 47.66  ? 616 ILE A CB    1 
ATOM   4331 C CG1   . ILE C 3 443 ? -8.243  13.622  -15.071 1.00 39.31  ? 616 ILE A CG1   1 
ATOM   4332 C CG2   . ILE C 3 443 ? -5.730  13.747  -14.985 1.00 40.43  ? 616 ILE A CG2   1 
ATOM   4333 N N     . LEU C 3 444 ? -5.003  16.851  -14.279 1.00 50.67  ? 617 LEU A N     1 
ATOM   4334 C CA    . LEU C 3 444 ? -3.686  17.280  -13.822 1.00 53.73  ? 617 LEU A CA    1 
ATOM   4335 C C     . LEU C 3 444 ? -3.789  18.161  -12.582 1.00 51.23  ? 617 LEU A C     1 
ATOM   4336 O O     . LEU C 3 444 ? -2.940  18.100  -11.694 1.00 59.71  ? 617 LEU A O     1 
ATOM   4337 C CB    . LEU C 3 444 ? -2.938  18.020  -14.932 1.00 56.24  ? 617 LEU A CB    1 
ATOM   4338 C CG    . LEU C 3 444 ? -1.497  18.422  -14.606 1.00 52.25  ? 617 LEU A CG    1 
ATOM   4339 C CD1   . LEU C 3 444 ? -0.657  17.195  -14.278 1.00 55.97  ? 617 LEU A CD1   1 
ATOM   4340 C CD2   . LEU C 3 444 ? -0.881  19.229  -15.746 1.00 63.71  ? 617 LEU A CD2   1 
ATOM   4341 N N     . SER C 3 445 ? -4.829  18.984  -12.528 1.00 40.42  ? 618 SER A N     1 
ATOM   4342 C CA    . SER C 3 445 ? -5.082  19.796  -11.354 1.00 42.99  ? 618 SER A CA    1 
ATOM   4343 C C     . SER C 3 445 ? -5.229  18.888  -10.142 1.00 49.10  ? 618 SER A C     1 
ATOM   4344 O O     . SER C 3 445 ? -4.774  19.219  -9.048  1.00 60.13  ? 618 SER A O     1 
ATOM   4345 C CB    . SER C 3 445 ? -6.343  20.635  -11.543 1.00 45.65  ? 618 SER A CB    1 
ATOM   4346 O OG    . SER C 3 445 ? -6.130  21.660  -12.496 1.00 68.05  ? 618 SER A OG    1 
ATOM   4347 N N     . TYR C 3 446 ? -5.863  17.738  -10.341 1.00 50.51  ? 619 TYR A N     1 
ATOM   4348 C CA    . TYR C 3 446 ? -6.050  16.777  -9.260  1.00 57.09  ? 619 TYR A CA    1 
ATOM   4349 C C     . TYR C 3 446 ? -4.716  16.177  -8.827  1.00 58.88  ? 619 TYR A C     1 
ATOM   4350 O O     . TYR C 3 446 ? -4.405  16.115  -7.638  1.00 57.46  ? 619 TYR A O     1 
ATOM   4351 C CB    . TYR C 3 446 ? -7.010  15.666  -9.690  1.00 60.51  ? 619 TYR A CB    1 
ATOM   4352 C CG    . TYR C 3 446 ? -7.290  14.647  -8.609  1.00 57.60  ? 619 TYR A CG    1 
ATOM   4353 C CD1   . TYR C 3 446 ? -8.284  14.865  -7.661  1.00 55.62  ? 619 TYR A CD1   1 
ATOM   4354 C CD2   . TYR C 3 446 ? -6.561  13.468  -8.536  1.00 52.84  ? 619 TYR A CD2   1 
ATOM   4355 C CE1   . TYR C 3 446 ? -8.540  13.938  -6.670  1.00 39.88  ? 619 TYR A CE1   1 
ATOM   4356 C CE2   . TYR C 3 446 ? -6.811  12.538  -7.552  1.00 52.56  ? 619 TYR A CE2   1 
ATOM   4357 C CZ    . TYR C 3 446 ? -7.801  12.776  -6.624  1.00 48.26  ? 619 TYR A CZ    1 
ATOM   4358 O OH    . TYR C 3 446 ? -8.049  11.847  -5.644  1.00 72.28  ? 619 TYR A OH    1 
ATOM   4359 N N     . ASN C 3 447 ? -3.932  15.736  -9.803  1.00 60.89  ? 620 ASN A N     1 
ATOM   4360 C CA    . ASN C 3 447 ? -2.622  15.172  -9.523  1.00 61.63  ? 620 ASN A CA    1 
ATOM   4361 C C     . ASN C 3 447 ? -1.685  16.198  -8.898  1.00 63.48  ? 620 ASN A C     1 
ATOM   4362 O O     . ASN C 3 447 ? -0.902  15.867  -8.010  1.00 71.13  ? 620 ASN A O     1 
ATOM   4363 C CB    . ASN C 3 447 ? -2.005  14.589  -10.795 1.00 64.59  ? 620 ASN A CB    1 
ATOM   4364 C CG    . ASN C 3 447 ? -2.289  13.105  -10.952 1.00 79.95  ? 620 ASN A CG    1 
ATOM   4365 O OD1   . ASN C 3 447 ? -3.369  12.626  -10.603 1.00 92.09  ? 620 ASN A OD1   1 
ATOM   4366 N ND2   . ASN C 3 447 ? -1.315  12.370  -11.480 1.00 84.25  ? 620 ASN A ND2   1 
ATOM   4367 N N     . ARG C 3 448 ? -1.772  17.443  -9.360  1.00 60.41  ? 621 ARG A N     1 
ATOM   4368 C CA    . ARG C 3 448 ? -0.938  18.517  -8.828  1.00 60.21  ? 621 ARG A CA    1 
ATOM   4369 C C     . ARG C 3 448 ? -1.233  18.755  -7.353  1.00 57.08  ? 621 ARG A C     1 
ATOM   4370 O O     . ARG C 3 448 ? -0.322  18.952  -6.549  1.00 59.65  ? 621 ARG A O     1 
ATOM   4371 C CB    . ARG C 3 448 ? -1.141  19.808  -9.620  1.00 58.29  ? 621 ARG A CB    1 
ATOM   4372 C CG    . ARG C 3 448 ? -0.079  20.063  -10.676 1.00 69.29  ? 621 ARG A CG    1 
ATOM   4373 C CD    . ARG C 3 448 ? -0.563  20.909  -11.843 1.00 76.76  ? 621 ARG A CD    1 
ATOM   4374 N NE    . ARG C 3 448 ? 0.398   20.942  -12.941 1.00 79.91  ? 621 ARG A NE    1 
ATOM   4375 C CZ    . ARG C 3 448 ? 1.360   21.845  -13.061 1.00 88.46  ? 621 ARG A CZ    1 
ATOM   4376 N NH1   . ARG C 3 448 ? 1.498   22.797  -12.148 1.00 94.95  ? 621 ARG A NH1   1 
ATOM   4377 N NH2   . ARG C 3 448 ? 2.189   21.797  -14.095 1.00 90.22  ? 621 ARG A NH2   1 
ATOM   4378 N N     . ALA C 3 449 ? -2.513  18.731  -7.003  1.00 51.10  ? 622 ALA A N     1 
ATOM   4379 C CA    . ALA C 3 449 ? -2.913  18.838  -5.612  1.00 53.05  ? 622 ALA A CA    1 
ATOM   4380 C C     . ALA C 3 449 ? -2.282  17.703  -4.817  1.00 59.19  ? 622 ALA A C     1 
ATOM   4381 O O     . ALA C 3 449 ? -1.669  17.931  -3.773  1.00 62.52  ? 622 ALA A O     1 
ATOM   4382 C CB    . ALA C 3 449 ? -4.421  18.797  -5.492  1.00 55.36  ? 622 ALA A CB    1 
ATOM   4383 N N     . ASN C 3 450 ? -2.421  16.482  -5.327  1.00 62.66  ? 623 ASN A N     1 
ATOM   4384 C CA    . ASN C 3 450 ? -1.859  15.307  -4.667  1.00 65.63  ? 623 ASN A CA    1 
ATOM   4385 C C     . ASN C 3 450 ? -0.365  15.430  -4.364  1.00 60.93  ? 623 ASN A C     1 
ATOM   4386 O O     . ASN C 3 450 ? 0.103   14.940  -3.337  1.00 63.40  ? 623 ASN A O     1 
ATOM   4387 C CB    . ASN C 3 450 ? -2.134  14.041  -5.484  1.00 69.61  ? 623 ASN A CB    1 
ATOM   4388 C CG    . ASN C 3 450 ? -3.175  13.144  -4.838  1.00 73.50  ? 623 ASN A CG    1 
ATOM   4389 O OD1   . ASN C 3 450 ? -2.851  12.085  -4.299  1.00 86.75  ? 623 ASN A OD1   1 
ATOM   4390 N ND2   . ASN C 3 450 ? -4.434  13.566  -4.891  1.00 47.67  ? 623 ASN A ND2   1 
ATOM   4391 N N     . ARG C 3 451 ? 0.379   16.082  -5.254  1.00 55.84  ? 624 ARG A N     1 
ATOM   4392 C CA    . ARG C 3 451 ? 1.805   16.307  -5.026  1.00 63.17  ? 624 ARG A CA    1 
ATOM   4393 C C     . ARG C 3 451 ? 2.009   17.273  -3.869  1.00 63.27  ? 624 ARG A C     1 
ATOM   4394 O O     . ARG C 3 451 ? 2.883   17.069  -3.025  1.00 70.08  ? 624 ARG A O     1 
ATOM   4395 C CB    . ARG C 3 451 ? 2.491   16.858  -6.277  1.00 66.41  ? 624 ARG A CB    1 
ATOM   4396 C CG    . ARG C 3 451 ? 2.033   16.220  -7.578  1.00 81.54  ? 624 ARG A CG    1 
ATOM   4397 C CD    . ARG C 3 451 ? 2.679   16.827  -8.813  1.00 96.32  ? 624 ARG A CD    1 
ATOM   4398 N NE    . ARG C 3 451 ? 2.793   15.848  -9.890  1.00 106.20 ? 624 ARG A NE    1 
ATOM   4399 C CZ    . ARG C 3 451 ? 2.120   15.909  -11.032 1.00 97.10  ? 624 ARG A CZ    1 
ATOM   4400 N NH1   . ARG C 3 451 ? 1.278   16.909  -11.262 1.00 89.96  ? 624 ARG A NH1   1 
ATOM   4401 N NH2   . ARG C 3 451 ? 2.291   14.968  -11.949 1.00 80.52  ? 624 ARG A NH2   1 
ATOM   4402 N N     . ALA C 3 452 ? 1.198   18.326  -3.837  1.00 56.65  ? 625 ALA A N     1 
ATOM   4403 C CA    . ALA C 3 452 ? 1.268   19.308  -2.765  1.00 54.38  ? 625 ALA A CA    1 
ATOM   4404 C C     . ALA C 3 452 ? 0.931   18.675  -1.419  1.00 57.63  ? 625 ALA A C     1 
ATOM   4405 O O     . ALA C 3 452 ? 1.452   19.090  -0.384  1.00 65.98  ? 625 ALA A O     1 
ATOM   4406 C CB    . ALA C 3 452 ? 0.344   20.474  -3.051  1.00 55.36  ? 625 ALA A CB    1 
ATOM   4407 N N     . VAL C 3 453 ? 0.056   17.672  -1.437  1.00 57.17  ? 626 VAL A N     1 
ATOM   4408 C CA    . VAL C 3 453 ? -0.306  16.960  -0.218  1.00 60.83  ? 626 VAL A CA    1 
ATOM   4409 C C     . VAL C 3 453 ? 0.887   16.173  0.297   1.00 62.37  ? 626 VAL A C     1 
ATOM   4410 O O     . VAL C 3 453 ? 1.040   15.973  1.501   1.00 62.15  ? 626 VAL A O     1 
ATOM   4411 C CB    . VAL C 3 453 ? -1.468  15.985  -0.455  1.00 62.55  ? 626 VAL A CB    1 
ATOM   4412 C CG1   . VAL C 3 453 ? -2.125  15.617  0.864   1.00 75.98  ? 626 VAL A CG1   1 
ATOM   4413 C CG2   . VAL C 3 453 ? -2.487  16.590  -1.404  1.00 69.58  ? 626 VAL A CG2   1 
ATOM   4414 N N     . ALA C 3 454 ? 1.733   15.734  -0.629  1.00 65.41  ? 627 ALA A N     1 
ATOM   4415 C CA    . ALA C 3 454 ? 2.925   14.967  -0.292  1.00 74.98  ? 627 ALA A CA    1 
ATOM   4416 C C     . ALA C 3 454 ? 4.083   15.878  0.100   1.00 77.51  ? 627 ALA A C     1 
ATOM   4417 O O     . ALA C 3 454 ? 5.251   15.494  0.001   1.00 82.75  ? 627 ALA A O     1 
ATOM   4418 C CB    . ALA C 3 454 ? 3.327   14.075  -1.460  1.00 78.32  ? 627 ALA A CB    1 
ATOM   4419 N N     . ILE C 3 455 ? 3.757   17.089  0.538   1.00 78.49  ? 628 ILE A N     1 
ATOM   4420 C CA    . ILE C 3 455 ? 4.780   18.037  0.950   1.00 78.26  ? 628 ILE A CA    1 
ATOM   4421 C C     . ILE C 3 455 ? 4.893   18.100  2.470   1.00 86.27  ? 628 ILE A C     1 
ATOM   4422 O O     . ILE C 3 455 ? 6.001   18.211  3.008   1.00 89.29  ? 628 ILE A O     1 
ATOM   4423 C CB    . ILE C 3 455 ? 4.505   19.427  0.349   1.00 78.92  ? 628 ILE A CB    1 
ATOM   4424 C CG1   . ILE C 3 455 ? 5.717   19.899  -0.462  1.00 54.70  ? 628 ILE A CG1   1 
ATOM   4425 C CG2   . ILE C 3 455 ? 4.111   20.429  1.440   1.00 67.69  ? 628 ILE A CG2   1 
ATOM   4426 N N     . LEU C 3 456 ? 3.753   18.013  3.160   1.00 88.94  ? 629 LEU A N     1 
ATOM   4427 C CA    . LEU C 3 456 ? 3.770   18.020  4.623   1.00 90.66  ? 629 LEU A CA    1 
ATOM   4428 C C     . LEU C 3 456 ? 4.234   16.677  5.187   1.00 93.79  ? 629 LEU A C     1 
ATOM   4429 O O     . LEU C 3 456 ? 5.045   16.634  6.115   1.00 98.77  ? 629 LEU A O     1 
ATOM   4430 C CB    . LEU C 3 456 ? 2.420   18.454  5.221   1.00 86.23  ? 629 LEU A CB    1 
ATOM   4431 C CG    . LEU C 3 456 ? 1.082   17.834  4.791   1.00 74.25  ? 629 LEU A CG    1 
ATOM   4432 C CD1   . LEU C 3 456 ? 0.752   16.604  5.626   1.00 37.00  ? 629 LEU A CD1   1 
ATOM   4433 C CD2   . LEU C 3 456 ? -0.047  18.864  4.909   1.00 35.51  ? 629 LEU A CD2   1 
ATOM   4434 N N     . CYS C 3 457 ? 3.731   15.585  4.616   1.00 95.59  ? 630 CYS A N     1 
ATOM   4435 C CA    . CYS C 3 457 ? 4.159   14.246  5.016   1.00 103.48 ? 630 CYS A CA    1 
ATOM   4436 C C     . CYS C 3 457 ? 5.502   13.904  4.373   1.00 99.75  ? 630 CYS A C     1 
ATOM   4437 O O     . CYS C 3 457 ? 6.051   12.818  4.587   1.00 106.40 ? 630 CYS A O     1 
ATOM   4438 C CB    . CYS C 3 457 ? 3.122   13.203  4.584   1.00 108.08 ? 630 CYS A CB    1 
ATOM   4439 S SG    . CYS C 3 457 ? 1.440   13.484  5.183   1.00 125.91 ? 630 CYS A SG    1 
ATOM   4440 N N     . ASN C 3 458 ? 6.039   14.850  3.604   1.00 41.62  ? 631 ASN A N     1 
ATOM   4441 C CA    . ASN C 3 458 ? 7.065   14.550  2.597   1.00 35.71  ? 631 ASN A CA    1 
ATOM   4442 C C     . ASN C 3 458 ? 6.844   13.305  1.717   1.00 37.06  ? 631 ASN A C     1 
ATOM   4443 O O     . ASN C 3 458 ? 5.796   12.640  1.843   1.00 97.81  ? 631 ASN A O     1 
ATOM   4444 C CB    . ASN C 3 458 ? 8.514   14.708  3.151   1.00 30.05  ? 631 ASN A CB    1 
ATOM   4445 C CG    . ASN C 3 458 ? 9.391   15.563  2.206   1.00 37.24  ? 631 ASN A CG    1 
ATOM   4446 O OD1   . ASN C 3 458 ? 8.892   16.207  1.261   1.00 33.74  ? 631 ASN A OD1   1 
ATOM   4447 N ND2   . ASN C 3 458 ? 10.704  15.583  2.463   1.00 34.79  ? 631 ASN A ND2   1 
ATOM   4448 N N     . HIS C 3 459 ? 7.804   12.977  0.825   1.00 36.82  ? 632 HIS A N     1 
ATOM   4449 C CA    . HIS C 3 459 ? 7.380   12.162  -0.324  1.00 43.34  ? 632 HIS A CA    1 
ATOM   4450 C C     . HIS C 3 459 ? 7.238   10.622  -0.316  1.00 49.09  ? 632 HIS A C     1 
ATOM   4451 O O     . HIS C 3 459 ? 7.849   9.893   0.495   1.00 101.15 ? 632 HIS A O     1 
ATOM   4452 C CB    . HIS C 3 459 ? 8.045   12.665  -1.708  1.00 30.27  ? 632 HIS A CB    1 
ATOM   4453 C CG    . HIS C 3 459 ? 8.853   13.922  -1.504  1.00 36.71  ? 632 HIS A CG    1 
ATOM   4454 N ND1   . HIS C 3 459 ? 10.194  13.914  -1.145  1.00 34.84  ? 632 HIS A ND1   1 
ATOM   4455 C CD2   . HIS C 3 459 ? 8.517   15.236  -1.643  1.00 33.59  ? 632 HIS A CD2   1 
ATOM   4456 C CE1   . HIS C 3 459 ? 10.644  15.167  -1.058  1.00 37.76  ? 632 HIS A CE1   1 
ATOM   4457 N NE2   . HIS C 3 459 ? 9.649   15.988  -1.357  1.00 36.54  ? 632 HIS A NE2   1 
ATOM   4458 N N     . GLN C 3 460 ? 6.432   10.169  -1.289  1.00 106.20 ? 633 GLN A N     1 
ATOM   4459 C CA    . GLN C 3 460 ? 5.821   8.815   -1.300  1.00 116.35 ? 633 GLN A CA    1 
ATOM   4460 C C     . GLN C 3 460 ? 5.444   8.422   -2.753  1.00 120.98 ? 633 GLN A C     1 
ATOM   4461 O O     . GLN C 3 460 ? 5.448   9.340   -3.652  1.00 121.72 ? 633 GLN A O     1 
ATOM   4462 C CB    . GLN C 3 460 ? 4.535   8.813   -0.437  1.00 118.82 ? 633 GLN A CB    1 
ATOM   4463 C CG    . GLN C 3 460 ? 4.794   8.951   1.071   1.00 117.91 ? 633 GLN A CG    1 
ATOM   4464 C CD    . GLN C 3 460 ? 3.762   9.833   1.787   1.00 118.75 ? 633 GLN A CD    1 
ATOM   4465 O OE1   . GLN C 3 460 ? 4.112   10.641  2.656   1.00 116.27 ? 633 GLN A OE1   1 
ATOM   4466 N NE2   . GLN C 3 460 ? 2.493   9.670   1.432   1.00 109.65 ? 633 GLN A NE2   1 
ATOM   4467 N N     . MET C 3 471 ? 10.858  10.784  -20.842 1.00 134.88 ? 644 MET A N     1 
ATOM   4468 C CA    . MET C 3 471 ? 11.488  11.352  -22.033 1.00 132.71 ? 644 MET A CA    1 
ATOM   4469 C C     . MET C 3 471 ? 12.800  10.628  -22.352 1.00 130.34 ? 644 MET A C     1 
ATOM   4470 O O     . MET C 3 471 ? 13.181  9.690   -21.647 1.00 128.81 ? 644 MET A O     1 
ATOM   4471 C CB    . MET C 3 471 ? 11.725  12.857  -21.853 1.00 132.67 ? 644 MET A CB    1 
ATOM   4472 C CG    . MET C 3 471 ? 11.819  13.318  -20.402 1.00 131.50 ? 644 MET A CG    1 
ATOM   4473 S SD    . MET C 3 471 ? 13.018  14.661  -20.193 1.00 149.94 ? 644 MET A SD    1 
ATOM   4474 C CE    . MET C 3 471 ? 12.814  15.036  -18.452 1.00 142.52 ? 644 MET A CE    1 
ATOM   4475 N N     . MET C 3 472 ? 13.484  11.049  -23.415 1.00 129.54 ? 645 MET A N     1 
ATOM   4476 C CA    . MET C 3 472 ? 13.025  12.138  -24.275 1.00 129.63 ? 645 MET A CA    1 
ATOM   4477 C C     . MET C 3 472 ? 12.176  11.608  -25.427 1.00 129.40 ? 645 MET A C     1 
ATOM   4478 O O     . MET C 3 472 ? 11.823  12.352  -26.344 1.00 128.75 ? 645 MET A O     1 
ATOM   4479 C CB    . MET C 3 472 ? 14.215  12.934  -24.819 1.00 130.73 ? 645 MET A CB    1 
ATOM   4480 C CG    . MET C 3 472 ? 15.188  13.419  -23.752 1.00 128.73 ? 645 MET A CG    1 
ATOM   4481 S SD    . MET C 3 472 ? 16.235  14.775  -24.324 1.00 136.73 ? 645 MET A SD    1 
ATOM   4482 C CE    . MET C 3 472 ? 16.237  15.844  -22.873 1.00 113.30 ? 645 MET A CE    1 
ATOM   4483 N N     . ASN C 3 473 ? 11.852  10.318  -25.367 1.00 128.75 ? 646 ASN A N     1 
ATOM   4484 C CA    . ASN C 3 473 ? 11.023  9.668   -26.379 1.00 124.04 ? 646 ASN A CA    1 
ATOM   4485 C C     . ASN C 3 473 ? 9.620   10.262  -26.441 1.00 119.99 ? 646 ASN A C     1 
ATOM   4486 O O     . ASN C 3 473 ? 8.920   10.122  -27.444 1.00 117.53 ? 646 ASN A O     1 
ATOM   4487 C CB    . ASN C 3 473 ? 10.941  8.160   -26.116 1.00 123.76 ? 646 ASN A CB    1 
ATOM   4488 C CG    . ASN C 3 473 ? 10.517  7.836   -24.690 1.00 124.71 ? 646 ASN A CG    1 
ATOM   4489 O OD1   . ASN C 3 473 ? 9.327   7.829   -24.369 1.00 102.03 ? 646 ASN A OD1   1 
ATOM   4490 N ND2   . ASN C 3 473 ? 11.494  7.566   -23.829 1.00 107.98 ? 646 ASN A ND2   1 
ATOM   4491 N N     . LEU C 3 474 ? 9.219   10.922  -25.358 1.00 117.71 ? 647 LEU A N     1 
ATOM   4492 C CA    . LEU C 3 474 ? 7.904   11.544  -25.272 1.00 117.27 ? 647 LEU A CA    1 
ATOM   4493 C C     . LEU C 3 474 ? 7.804   12.763  -26.187 1.00 114.06 ? 647 LEU A C     1 
ATOM   4494 O O     . LEU C 3 474 ? 6.879   12.870  -26.994 1.00 114.19 ? 647 LEU A O     1 
ATOM   4495 C CB    . LEU C 3 474 ? 7.600   11.943  -23.825 1.00 118.35 ? 647 LEU A CB    1 
ATOM   4496 C CG    . LEU C 3 474 ? 6.240   11.540  -23.243 1.00 125.36 ? 647 LEU A CG    1 
ATOM   4497 C CD1   . LEU C 3 474 ? 5.260   12.704  -23.297 1.00 117.34 ? 647 LEU A CD1   1 
ATOM   4498 C CD2   . LEU C 3 474 ? 5.669   10.316  -23.951 1.00 130.01 ? 647 LEU A CD2   1 
ATOM   4499 N N     . GLN C 3 475 ? 8.769   13.671  -26.061 1.00 107.90 ? 648 GLN A N     1 
ATOM   4500 C CA    . GLN C 3 475 ? 8.776   14.908  -26.834 1.00 101.98 ? 648 GLN A CA    1 
ATOM   4501 C C     . GLN C 3 475 ? 8.866   14.669  -28.341 1.00 103.25 ? 648 GLN A C     1 
ATOM   4502 O O     . GLN C 3 475 ? 8.415   15.496  -29.130 1.00 103.25 ? 648 GLN A O     1 
ATOM   4503 C CB    . GLN C 3 475 ? 9.921   15.814  -26.378 1.00 101.59 ? 648 GLN A CB    1 
ATOM   4504 C CG    . GLN C 3 475 ? 9.601   16.639  -25.145 1.00 101.45 ? 648 GLN A CG    1 
ATOM   4505 C CD    . GLN C 3 475 ? 8.714   17.827  -25.456 1.00 105.30 ? 648 GLN A CD    1 
ATOM   4506 O OE1   . GLN C 3 475 ? 9.181   18.833  -25.991 1.00 102.18 ? 648 GLN A OE1   1 
ATOM   4507 N NE2   . GLN C 3 475 ? 7.432   17.715  -25.125 1.00 111.15 ? 648 GLN A NE2   1 
ATOM   4508 N N     . THR C 3 476 ? 9.450   13.539  -28.736 1.00 106.93 ? 649 THR A N     1 
ATOM   4509 C CA    . THR C 3 476 ? 9.567   13.197  -30.151 1.00 108.68 ? 649 THR A CA    1 
ATOM   4510 C C     . THR C 3 476 ? 8.263   12.626  -30.702 1.00 106.53 ? 649 THR A C     1 
ATOM   4511 O O     . THR C 3 476 ? 8.175   12.272  -31.878 1.00 108.99 ? 649 THR A O     1 
ATOM   4512 C CB    . THR C 3 476 ? 10.739  12.218  -30.402 1.00 110.32 ? 649 THR A CB    1 
ATOM   4513 O OG1   . THR C 3 476 ? 10.457  10.950  -29.787 1.00 118.14 ? 649 THR A OG1   1 
ATOM   4514 C CG2   . THR C 3 476 ? 12.000  12.693  -29.685 1.00 114.62 ? 649 THR A CG2   1 
ATOM   4515 N N     . LYS C 3 477 ? 7.258   12.532  -29.836 1.00 104.24 ? 650 LYS A N     1 
ATOM   4516 C CA    . LYS C 3 477 ? 5.917   12.133  -30.241 1.00 102.65 ? 650 LYS A CA    1 
ATOM   4517 C C     . LYS C 3 477 ? 4.960   13.285  -29.964 1.00 99.96  ? 650 LYS A C     1 
ATOM   4518 O O     . LYS C 3 477 ? 3.880   13.370  -30.547 1.00 95.84  ? 650 LYS A O     1 
ATOM   4519 C CB    . LYS C 3 477 ? 5.475   10.877  -29.489 1.00 103.10 ? 650 LYS A CB    1 
ATOM   4520 C CG    . LYS C 3 477 ? 5.871   9.575   -30.170 1.00 104.78 ? 650 LYS A CG    1 
ATOM   4521 C CD    . LYS C 3 477 ? 6.364   8.550   -29.159 1.00 121.39 ? 650 LYS A CD    1 
ATOM   4522 C CE    . LYS C 3 477 ? 7.501   7.710   -29.726 1.00 127.37 ? 650 LYS A CE    1 
ATOM   4523 N NZ    . LYS C 3 477 ? 8.472   7.301   -28.672 1.00 125.60 ? 650 LYS A NZ    1 
ATOM   4524 N N     . ILE C 3 478 ? 5.376   14.169  -29.062 1.00 99.42  ? 651 ILE A N     1 
ATOM   4525 C CA    . ILE C 3 478 ? 4.628   15.381  -28.758 1.00 97.21  ? 651 ILE A CA    1 
ATOM   4526 C C     . ILE C 3 478 ? 4.844   16.400  -29.867 1.00 90.35  ? 651 ILE A C     1 
ATOM   4527 O O     . ILE C 3 478 ? 3.887   16.887  -30.464 1.00 86.25  ? 651 ILE A O     1 
ATOM   4528 C CB    . ILE C 3 478 ? 5.079   15.970  -27.401 1.00 103.10 ? 651 ILE A CB    1 
ATOM   4529 C CG1   . ILE C 3 478 ? 4.646   15.062  -26.245 1.00 103.58 ? 651 ILE A CG1   1 
ATOM   4530 C CG2   . ILE C 3 478 ? 4.524   17.380  -27.210 1.00 109.42 ? 651 ILE A CG2   1 
ATOM   4531 N N     . ASP C 3 479 ? 6.110   16.711  -30.139 1.00 90.43  ? 652 ASP A N     1 
ATOM   4532 C CA    . ASP C 3 479 ? 6.473   17.653  -31.194 1.00 90.52  ? 652 ASP A CA    1 
ATOM   4533 C C     . ASP C 3 479 ? 6.086   17.108  -32.564 1.00 89.30  ? 652 ASP A C     1 
ATOM   4534 O O     . ASP C 3 479 ? 5.799   17.870  -33.487 1.00 86.88  ? 652 ASP A O     1 
ATOM   4535 C CB    . ASP C 3 479 ? 7.975   17.953  -31.158 1.00 89.15  ? 652 ASP A CB    1 
ATOM   4536 C CG    . ASP C 3 479 ? 8.329   19.069  -30.190 1.00 88.47  ? 652 ASP A CG    1 
ATOM   4537 O OD1   . ASP C 3 479 ? 7.478   19.953  -29.953 1.00 72.74  ? 652 ASP A OD1   1 
ATOM   4538 O OD2   . ASP C 3 479 ? 9.438   19.145  -29.621 1.00 85.54  ? 652 ASP A OD2   1 
ATOM   4539 N N     . ALA C 3 480 ? 6.082   15.783  -32.686 1.00 87.03  ? 653 ALA A N     1 
ATOM   4540 C CA    . ALA C 3 480 ? 5.682   15.123  -33.922 1.00 84.61  ? 653 ALA A CA    1 
ATOM   4541 C C     . ALA C 3 480 ? 4.220   15.420  -34.230 1.00 84.90  ? 653 ALA A C     1 
ATOM   4542 O O     . ALA C 3 480 ? 3.885   15.870  -35.327 1.00 86.43  ? 653 ALA A O     1 
ATOM   4543 C CB    . ALA C 3 480 ? 5.908   13.621  -33.817 1.00 83.63  ? 653 ALA A CB    1 
ATOM   4544 N N     . LYS C 3 481 ? 3.353   15.170  -33.253 1.00 89.05  ? 654 LYS A N     1 
ATOM   4545 C CA    . LYS C 3 481 ? 1.927   15.422  -33.414 1.00 90.96  ? 654 LYS A CA    1 
ATOM   4546 C C     . LYS C 3 481 ? 1.597   16.909  -33.277 1.00 87.05  ? 654 LYS A C     1 
ATOM   4547 O O     . LYS C 3 481 ? 0.490   17.333  -33.605 1.00 82.94  ? 654 LYS A O     1 
ATOM   4548 C CB    . LYS C 3 481 ? 1.112   14.601  -32.408 1.00 96.03  ? 654 LYS A CB    1 
ATOM   4549 C CG    . LYS C 3 481 ? 1.158   13.092  -32.641 1.00 111.70 ? 654 LYS A CG    1 
ATOM   4550 C CD    . LYS C 3 481 ? -0.246  12.493  -32.740 1.00 118.26 ? 654 LYS A CD    1 
ATOM   4551 C CE    . LYS C 3 481 ? -0.617  11.707  -31.484 1.00 109.36 ? 654 LYS A CE    1 
ATOM   4552 N NZ    . LYS C 3 481 ? 0.112   10.408  -31.385 1.00 90.64  ? 654 LYS A NZ    1 
ATOM   4553 N N     . LYS C 3 482 ? 2.560   17.691  -32.793 1.00 88.39  ? 655 LYS A N     1 
ATOM   4554 C CA    . LYS C 3 482 ? 2.385   19.136  -32.640 1.00 91.72  ? 655 LYS A CA    1 
ATOM   4555 C C     . LYS C 3 482 ? 2.352   19.819  -34.002 1.00 92.25  ? 655 LYS A C     1 
ATOM   4556 O O     . LYS C 3 482 ? 1.655   20.820  -34.200 1.00 87.97  ? 655 LYS A O     1 
ATOM   4557 C CB    . LYS C 3 482 ? 3.506   19.732  -31.782 1.00 94.93  ? 655 LYS A CB    1 
ATOM   4558 C CG    . LYS C 3 482 ? 3.030   20.735  -30.738 1.00 102.58 ? 655 LYS A CG    1 
ATOM   4559 C CD    . LYS C 3 482 ? 3.197   22.168  -31.226 1.00 112.40 ? 655 LYS A CD    1 
ATOM   4560 C CE    . LYS C 3 482 ? 4.196   22.937  -30.372 1.00 114.27 ? 655 LYS A CE    1 
ATOM   4561 N NZ    . LYS C 3 482 ? 5.603   22.549  -30.672 1.00 120.10 ? 655 LYS A NZ    1 
ATOM   4562 N N     . GLU C 3 483 ? 3.124   19.272  -34.936 1.00 95.85  ? 656 GLU A N     1 
ATOM   4563 C CA    . GLU C 3 483 ? 3.099   19.731  -36.315 1.00 93.64  ? 656 GLU A CA    1 
ATOM   4564 C C     . GLU C 3 483 ? 1.989   18.998  -37.054 1.00 86.74  ? 656 GLU A C     1 
ATOM   4565 O O     . GLU C 3 483 ? 1.316   19.578  -37.907 1.00 88.50  ? 656 GLU A O     1 
ATOM   4566 C CB    . GLU C 3 483 ? 4.451   19.486  -36.991 1.00 97.47  ? 656 GLU A CB    1 
ATOM   4567 C CG    . GLU C 3 483 ? 5.174   20.755  -37.431 1.00 110.60 ? 656 GLU A CG    1 
ATOM   4568 C CD    . GLU C 3 483 ? 4.990   21.908  -36.459 1.00 132.84 ? 656 GLU A CD    1 
ATOM   4569 O OE1   . GLU C 3 483 ? 3.989   22.651  -36.594 1.00 140.96 ? 656 GLU A OE1   1 
ATOM   4570 O OE2   . GLU C 3 483 ? 5.848   22.075  -35.560 1.00 137.94 ? 656 GLU A OE2   1 
ATOM   4571 N N     . GLN C 3 484 ? 1.797   17.725  -36.710 1.00 80.90  ? 657 GLN A N     1 
ATOM   4572 C CA    . GLN C 3 484 ? 0.711   16.924  -37.270 1.00 83.31  ? 657 GLN A CA    1 
ATOM   4573 C C     . GLN C 3 484 ? -0.639  17.611  -37.059 1.00 85.76  ? 657 GLN A C     1 
ATOM   4574 O O     . GLN C 3 484 ? -1.614  17.318  -37.751 1.00 83.01  ? 657 GLN A O     1 
ATOM   4575 C CB    . GLN C 3 484 ? 0.704   15.527  -36.642 1.00 83.18  ? 657 GLN A CB    1 
ATOM   4576 C CG    . GLN C 3 484 ? -0.147  14.493  -37.380 1.00 91.82  ? 657 GLN A CG    1 
ATOM   4577 C CD    . GLN C 3 484 ? -0.158  13.140  -36.681 1.00 105.39 ? 657 GLN A CD    1 
ATOM   4578 O OE1   . GLN C 3 484 ? -1.142  12.400  -36.758 1.00 102.61 ? 657 GLN A OE1   1 
ATOM   4579 N NE2   . GLN C 3 484 ? 0.936   12.814  -36.001 1.00 113.91 ? 657 GLN A NE2   1 
ATOM   4580 N N     . LEU C 3 485 ? -0.683  18.531  -36.101 1.00 91.35  ? 658 LEU A N     1 
ATOM   4581 C CA    . LEU C 3 485 ? -1.892  19.298  -35.820 1.00 94.45  ? 658 LEU A CA    1 
ATOM   4582 C C     . LEU C 3 485 ? -1.977  20.535  -36.712 1.00 101.54 ? 658 LEU A C     1 
ATOM   4583 O O     . LEU C 3 485 ? -3.024  20.817  -37.295 1.00 103.33 ? 658 LEU A O     1 
ATOM   4584 C CB    . LEU C 3 485 ? -1.934  19.704  -34.345 1.00 91.00  ? 658 LEU A CB    1 
ATOM   4585 C CG    . LEU C 3 485 ? -2.808  20.904  -33.977 1.00 88.54  ? 658 LEU A CG    1 
ATOM   4586 C CD1   . LEU C 3 485 ? -3.934  20.471  -33.050 1.00 91.02  ? 658 LEU A CD1   1 
ATOM   4587 C CD2   . LEU C 3 485 ? -1.971  22.011  -33.340 1.00 94.91  ? 658 LEU A CD2   1 
ATOM   4588 N N     . ALA C 3 486 ? -0.870  21.267  -36.815 1.00 108.72 ? 659 ALA A N     1 
ATOM   4589 C CA    . ALA C 3 486 ? -0.814  22.469  -37.643 1.00 113.55 ? 659 ALA A CA    1 
ATOM   4590 C C     . ALA C 3 486 ? -0.844  22.126  -39.132 1.00 116.55 ? 659 ALA A C     1 
ATOM   4591 O O     . ALA C 3 486 ? -1.310  22.921  -39.950 1.00 117.27 ? 659 ALA A O     1 
ATOM   4592 C CB    . ALA C 3 486 ? 0.422   23.293  -37.307 1.00 112.94 ? 659 ALA A CB    1 
ATOM   4593 N N     . ASP C 3 487 ? -0.346  20.940  -39.475 1.00 117.66 ? 660 ASP A N     1 
ATOM   4594 C CA    . ASP C 3 487 ? -0.375  20.454  -40.851 1.00 118.72 ? 660 ASP A CA    1 
ATOM   4595 C C     . ASP C 3 487 ? -1.703  19.765  -41.157 1.00 114.86 ? 660 ASP A C     1 
ATOM   4596 O O     . ASP C 3 487 ? -1.904  19.225  -42.250 1.00 114.72 ? 660 ASP A O     1 
ATOM   4597 C CB    . ASP C 3 487 ? 0.794   19.501  -41.119 1.00 122.47 ? 660 ASP A CB    1 
ATOM   4598 C CG    . ASP C 3 487 ? 2.129   20.223  -41.207 1.00 135.04 ? 660 ASP A CG    1 
ATOM   4599 O OD1   . ASP C 3 487 ? 3.175   19.575  -40.976 1.00 139.93 ? 660 ASP A OD1   1 
ATOM   4600 O OD2   . ASP C 3 487 ? 2.233   21.434  -41.501 1.00 143.07 ? 660 ASP A OD2   1 
ATOM   4601 N N     . ALA C 3 488 ? -2.599  19.783  -40.174 1.00 110.28 ? 661 ALA A N     1 
ATOM   4602 C CA    . ALA C 3 488 ? -3.964  19.309  -40.354 1.00 106.24 ? 661 ALA A CA    1 
ATOM   4603 C C     . ALA C 3 488 ? -4.920  20.480  -40.147 1.00 103.45 ? 661 ALA A C     1 
ATOM   4604 O O     . ALA C 3 488 ? -6.060  20.461  -40.610 1.00 103.94 ? 661 ALA A O     1 
ATOM   4605 C CB    . ALA C 3 488 ? -4.272  18.184  -39.389 1.00 105.69 ? 661 ALA A CB    1 
ATOM   4606 N N     . ARG C 3 489 ? -4.442  21.498  -39.438 1.00 100.90 ? 662 ARG A N     1 
ATOM   4607 C CA    . ARG C 3 489 ? -5.147  22.768  -39.350 1.00 99.72  ? 662 ARG A CA    1 
ATOM   4608 C C     . ARG C 3 489 ? -4.960  23.496  -40.676 1.00 92.29  ? 662 ARG A C     1 
ATOM   4609 O O     . ARG C 3 489 ? -5.650  24.472  -40.970 1.00 79.50  ? 662 ARG A O     1 
ATOM   4610 C CB    . ARG C 3 489 ? -4.595  23.610  -38.198 1.00 104.17 ? 662 ARG A CB    1 
ATOM   4611 C CG    . ARG C 3 489 ? -5.646  24.421  -37.445 1.00 117.36 ? 662 ARG A CG    1 
ATOM   4612 C CD    . ARG C 3 489 ? -5.078  25.299  -36.336 1.00 119.10 ? 662 ARG A CD    1 
ATOM   4613 N NE    . ARG C 3 489 ? -5.984  25.415  -35.195 1.00 104.74 ? 662 ARG A NE    1 
ATOM   4614 C CZ    . ARG C 3 489 ? -5.726  24.939  -33.983 1.00 90.77  ? 662 ARG A CZ    1 
ATOM   4615 N NH1   . ARG C 3 489 ? -4.586  24.303  -33.744 1.00 78.86  ? 662 ARG A NH1   1 
ATOM   4616 N NH2   . ARG C 3 489 ? -6.609  25.095  -33.005 1.00 85.45  ? 662 ARG A NH2   1 
ATOM   4617 N N     . ARG C 3 490 ? -4.014  23.000  -41.469 1.00 95.23  ? 663 ARG A N     1 
ATOM   4618 C CA    . ARG C 3 490 ? -3.725  23.551  -42.789 1.00 101.75 ? 663 ARG A CA    1 
ATOM   4619 C C     . ARG C 3 490 ? -4.753  23.067  -43.810 1.00 100.28 ? 663 ARG A C     1 
ATOM   4620 O O     . ARG C 3 490 ? -5.077  23.781  -44.761 1.00 96.35  ? 663 ARG A O     1 
ATOM   4621 C CB    . ARG C 3 490 ? -2.313  23.154  -43.233 1.00 104.76 ? 663 ARG A CB    1 
ATOM   4622 C CG    . ARG C 3 490 ? -1.434  24.330  -43.645 1.00 120.58 ? 663 ARG A CG    1 
ATOM   4623 C CD    . ARG C 3 490 ? -0.396  24.735  -42.606 1.00 132.90 ? 663 ARG A CD    1 
ATOM   4624 N NE    . ARG C 3 490 ? 0.954   24.325  -42.987 1.00 145.89 ? 663 ARG A NE    1 
ATOM   4625 C CZ    . ARG C 3 490 ? 2.054   24.667  -42.328 1.00 151.30 ? 663 ARG A CZ    1 
ATOM   4626 N NH1   . ARG C 3 490 ? 1.974   25.430  -41.246 1.00 149.94 ? 663 ARG A NH1   1 
ATOM   4627 N NH2   . ARG C 3 490 ? 3.239   24.245  -42.750 1.00 156.84 ? 663 ARG A NH2   1 
ATOM   4628 N N     . ASP C 3 491 ? -5.253  21.849  -43.609 1.00 102.94 ? 664 ASP A N     1 
ATOM   4629 C CA    . ASP C 3 491 ? -6.321  21.302  -44.442 1.00 100.72 ? 664 ASP A CA    1 
ATOM   4630 C C     . ASP C 3 491 ? -7.563  22.175  -44.317 1.00 97.53  ? 664 ASP A C     1 
ATOM   4631 O O     . ASP C 3 491 ? -8.190  22.527  -45.316 1.00 95.70  ? 664 ASP A O     1 
ATOM   4632 C CB    . ASP C 3 491 ? -6.661  19.872  -44.012 1.00 101.25 ? 664 ASP A CB    1 
ATOM   4633 C CG    . ASP C 3 491 ? -5.619  18.862  -44.453 1.00 109.67 ? 664 ASP A CG    1 
ATOM   4634 O OD1   . ASP C 3 491 ? -4.516  19.278  -44.866 1.00 129.19 ? 664 ASP A OD1   1 
ATOM   4635 O OD2   . ASP C 3 491 ? -5.815  17.628  -44.416 1.00 115.41 ? 664 ASP A OD2   1 
ATOM   4636 N N     . LEU C 3 492 ? -7.904  22.518  -43.077 1.00 94.36  ? 665 LEU A N     1 
ATOM   4637 C CA    . LEU C 3 492 ? -9.046  23.377  -42.789 1.00 96.04  ? 665 LEU A CA    1 
ATOM   4638 C C     . LEU C 3 492 ? -8.778  24.807  -43.248 1.00 98.57  ? 665 LEU A C     1 
ATOM   4639 O O     . LEU C 3 492 ? -9.707  25.562  -43.534 1.00 99.74  ? 665 LEU A O     1 
ATOM   4640 C CB    . LEU C 3 492 ? -9.371  23.347  -41.290 1.00 95.96  ? 665 LEU A CB    1 
ATOM   4641 C CG    . LEU C 3 492 ? -10.479 24.274  -40.775 1.00 98.31  ? 665 LEU A CG    1 
ATOM   4642 C CD1   . LEU C 3 492 ? -11.715 23.487  -40.355 1.00 77.46  ? 665 LEU A CD1   1 
ATOM   4643 C CD2   . LEU C 3 492 ? -9.969  25.125  -39.622 1.00 96.37  ? 665 LEU A CD2   1 
ATOM   4644 N N     . LYS C 3 493 ? -7.502  25.173  -43.316 1.00 101.66 ? 666 LYS A N     1 
ATOM   4645 C CA    . LYS C 3 493 ? -7.112  26.498  -43.777 1.00 104.04 ? 666 LYS A CA    1 
ATOM   4646 C C     . LYS C 3 493 ? -7.477  26.685  -45.246 1.00 105.63 ? 666 LYS A C     1 
ATOM   4647 O O     . LYS C 3 493 ? -8.119  27.671  -45.615 1.00 104.35 ? 666 LYS A O     1 
ATOM   4648 C CB    . LYS C 3 493 ? -5.611  26.717  -43.572 1.00 105.40 ? 666 LYS A CB    1 
ATOM   4649 C CG    . LYS C 3 493 ? -5.132  28.109  -43.948 1.00 112.77 ? 666 LYS A CG    1 
ATOM   4650 C CD    . LYS C 3 493 ? -3.634  28.126  -44.205 1.00 109.63 ? 666 LYS A CD    1 
ATOM   4651 C CE    . LYS C 3 493 ? -3.284  29.075  -45.342 1.00 114.55 ? 666 LYS A CE    1 
ATOM   4652 N NZ    . LYS C 3 493 ? -2.817  30.397  -44.838 1.00 112.55 ? 666 LYS A NZ    1 
ATOM   4653 N N     . SER C 3 494 ? -7.068  25.730  -46.078 1.00 108.98 ? 667 SER A N     1 
ATOM   4654 C CA    . SER C 3 494 ? -7.360  25.777  -47.508 1.00 106.28 ? 667 SER A CA    1 
ATOM   4655 C C     . SER C 3 494 ? -8.818  25.434  -47.789 1.00 102.94 ? 667 SER A C     1 
ATOM   4656 O O     . SER C 3 494 ? -9.381  25.863  -48.796 1.00 100.85 ? 667 SER A O     1 
ATOM   4657 C CB    . SER C 3 494 ? -6.432  24.838  -48.285 1.00 105.12 ? 667 SER A CB    1 
ATOM   4658 O OG    . SER C 3 494 ? -6.924  23.509  -48.279 1.00 99.21  ? 667 SER A OG    1 
ATOM   4659 N N     . ALA C 3 495 ? -9.422  24.659  -46.893 1.00 101.25 ? 668 ALA A N     1 
ATOM   4660 C CA    . ALA C 3 495 ? -10.831 24.303  -47.012 1.00 100.91 ? 668 ALA A CA    1 
ATOM   4661 C C     . ALA C 3 495 ? -11.718 25.467  -46.585 1.00 100.63 ? 668 ALA A C     1 
ATOM   4662 O O     . ALA C 3 495 ? -12.910 25.502  -46.893 1.00 100.36 ? 668 ALA A O     1 
ATOM   4663 C CB    . ALA C 3 495 ? -11.140 23.064  -46.187 1.00 99.57  ? 668 ALA A CB    1 
ATOM   4664 N N     . LYS C 3 496 ? -11.128 26.421  -45.873 1.00 101.55 ? 669 LYS A N     1 
ATOM   4665 C CA    . LYS C 3 496 ? -11.851 27.611  -45.447 1.00 104.68 ? 669 LYS A CA    1 
ATOM   4666 C C     . LYS C 3 496 ? -12.157 28.491  -46.654 1.00 105.67 ? 669 LYS A C     1 
ATOM   4667 O O     . LYS C 3 496 ? -13.283 28.971  -46.816 1.00 106.41 ? 669 LYS A O     1 
ATOM   4668 C CB    . LYS C 3 496 ? -11.038 28.385  -44.401 1.00 108.33 ? 669 LYS A CB    1 
ATOM   4669 C CG    . LYS C 3 496 ? -11.112 29.908  -44.517 1.00 107.69 ? 669 LYS A CG    1 
ATOM   4670 C CD    . LYS C 3 496 ? -9.753  30.554  -44.255 1.00 106.11 ? 669 LYS A CD    1 
ATOM   4671 C CE    . LYS C 3 496 ? -8.897  29.711  -43.315 1.00 114.03 ? 669 LYS A CE    1 
ATOM   4672 N NZ    . LYS C 3 496 ? -9.194  29.980  -41.876 1.00 100.99 ? 669 LYS A NZ    1 
ATOM   4673 N N     . ALA C 3 497 ? -11.151 28.683  -47.505 1.00 107.37 ? 670 ALA A N     1 
ATOM   4674 C CA    . ALA C 3 497 ? -11.284 29.529  -48.686 1.00 108.12 ? 670 ALA A CA    1 
ATOM   4675 C C     . ALA C 3 497 ? -12.228 28.912  -49.712 1.00 110.41 ? 670 ALA A C     1 
ATOM   4676 O O     . ALA C 3 497 ? -12.782 29.615  -50.558 1.00 114.85 ? 670 ALA A O     1 
ATOM   4677 C CB    . ALA C 3 497 ? -9.918  29.794  -49.309 1.00 107.43 ? 670 ALA A CB    1 
ATOM   4678 N N     . ASP C 3 498 ? -12.405 27.596  -49.631 1.00 109.87 ? 671 ASP A N     1 
ATOM   4679 C CA    . ASP C 3 498 ? -13.315 26.887  -50.520 1.00 108.09 ? 671 ASP A CA    1 
ATOM   4680 C C     . ASP C 3 498 ? -14.739 27.393  -50.328 1.00 105.42 ? 671 ASP A C     1 
ATOM   4681 O O     . ASP C 3 498 ? -15.399 27.794  -51.285 1.00 106.01 ? 671 ASP A O     1 
ATOM   4682 C CB    . ASP C 3 498 ? -13.262 25.380  -50.250 1.00 111.45 ? 671 ASP A CB    1 
ATOM   4683 C CG    . ASP C 3 498 ? -12.131 24.689  -50.993 1.00 115.74 ? 671 ASP A CG    1 
ATOM   4684 O OD1   . ASP C 3 498 ? -11.200 25.383  -51.451 1.00 125.56 ? 671 ASP A OD1   1 
ATOM   4685 O OD2   . ASP C 3 498 ? -12.090 23.452  -51.165 1.00 118.75 ? 671 ASP A OD2   1 
ATOM   4686 N N     . ALA C 3 499 ? -15.197 27.390  -49.081 1.00 105.37 ? 672 ALA A N     1 
ATOM   4687 C CA    . ALA C 3 499 ? -16.574 27.751  -48.761 1.00 107.26 ? 672 ALA A CA    1 
ATOM   4688 C C     . ALA C 3 499 ? -16.853 29.246  -48.885 1.00 106.45 ? 672 ALA A C     1 
ATOM   4689 O O     . ALA C 3 499 ? -17.994 29.650  -49.105 1.00 108.36 ? 672 ALA A O     1 
ATOM   4690 C CB    . ALA C 3 499 ? -16.937 27.261  -47.368 1.00 109.54 ? 672 ALA A CB    1 
ATOM   4691 N N     . LYS C 3 500 ? -15.813 30.063  -48.740 1.00 105.60 ? 673 LYS A N     1 
ATOM   4692 C CA    . LYS C 3 500 ? -15.971 31.514  -48.785 1.00 109.78 ? 673 LYS A CA    1 
ATOM   4693 C C     . LYS C 3 500 ? -16.707 31.980  -50.041 1.00 112.46 ? 673 LYS A C     1 
ATOM   4694 O O     . LYS C 3 500 ? -17.629 32.794  -49.961 1.00 115.20 ? 673 LYS A O     1 
ATOM   4695 C CB    . LYS C 3 500 ? -14.612 32.210  -48.683 1.00 112.24 ? 673 LYS A CB    1 
ATOM   4696 C CG    . LYS C 3 500 ? -14.696 33.728  -48.640 1.00 115.24 ? 673 LYS A CG    1 
ATOM   4697 C CD    . LYS C 3 500 ? -13.390 34.339  -48.163 1.00 115.44 ? 673 LYS A CD    1 
ATOM   4698 C CE    . LYS C 3 500 ? -13.635 35.581  -47.320 1.00 107.06 ? 673 LYS A CE    1 
ATOM   4699 N NZ    . LYS C 3 500 ? -12.641 36.653  -47.622 1.00 92.27  ? 673 LYS A NZ    1 
ATOM   4700 N N     . VAL C 3 501 ? -16.299 31.461  -51.196 1.00 109.13 ? 674 VAL A N     1 
ATOM   4701 C CA    . VAL C 3 501 ? -16.899 31.855  -52.468 1.00 104.43 ? 674 VAL A CA    1 
ATOM   4702 C C     . VAL C 3 501 ? -17.813 30.770  -53.034 1.00 103.11 ? 674 VAL A C     1 
ATOM   4703 O O     . VAL C 3 501 ? -18.704 31.053  -53.835 1.00 103.25 ? 674 VAL A O     1 
ATOM   4704 C CB    . VAL C 3 501 ? -15.828 32.223  -53.508 1.00 103.41 ? 674 VAL A CB    1 
ATOM   4705 C CG1   . VAL C 3 501 ? -14.858 33.246  -52.930 1.00 105.73 ? 674 VAL A CG1   1 
ATOM   4706 C CG2   . VAL C 3 501 ? -15.091 30.980  -53.975 1.00 98.51  ? 674 VAL A CG2   1 
ATOM   4707 N N     . MET C 3 502 ? -17.580 29.527  -52.621 1.00 102.20 ? 675 MET A N     1 
ATOM   4708 C CA    . MET C 3 502 ? -18.475 28.427  -52.961 1.00 100.87 ? 675 MET A CA    1 
ATOM   4709 C C     . MET C 3 502 ? -19.383 28.156  -51.769 1.00 98.50  ? 675 MET A C     1 
ATOM   4710 O O     . MET C 3 502 ? -19.160 27.219  -51.000 1.00 96.07  ? 675 MET A O     1 
ATOM   4711 C CB    . MET C 3 502 ? -17.687 27.165  -53.319 1.00 102.64 ? 675 MET A CB    1 
ATOM   4712 C CG    . MET C 3 502 ? -16.849 27.276  -54.582 1.00 101.27 ? 675 MET A CG    1 
ATOM   4713 S SD    . MET C 3 502 ? -16.120 25.691  -55.046 1.00 123.01 ? 675 MET A SD    1 
ATOM   4714 C CE    . MET C 3 502 ? -14.944 25.445  -53.714 1.00 112.41 ? 675 MET A CE    1 
ATOM   4715 N N     . LYS C 3 503 ? -20.406 28.990  -51.621 1.00 97.16  ? 676 LYS A N     1 
ATOM   4716 C CA    . LYS C 3 503 ? -21.287 28.934  -50.463 1.00 94.58  ? 676 LYS A CA    1 
ATOM   4717 C C     . LYS C 3 503 ? -22.444 27.956  -50.648 1.00 95.86  ? 676 LYS A C     1 
ATOM   4718 O O     . LYS C 3 503 ? -23.593 28.289  -50.352 1.00 99.98  ? 676 LYS A O     1 
ATOM   4719 C CB    . LYS C 3 503 ? -21.828 30.332  -50.141 1.00 92.74  ? 676 LYS A CB    1 
ATOM   4720 C CG    . LYS C 3 503 ? -21.349 31.426  -51.092 1.00 92.07  ? 676 LYS A CG    1 
ATOM   4721 C CD    . LYS C 3 503 ? -22.440 31.843  -52.071 1.00 98.58  ? 676 LYS A CD    1 
ATOM   4722 C CE    . LYS C 3 503 ? -21.884 32.048  -53.476 1.00 113.22 ? 676 LYS A CE    1 
ATOM   4723 N NZ    . LYS C 3 503 ? -21.284 33.403  -53.667 1.00 117.05 ? 676 LYS A NZ    1 
ATOM   4724 N N     . ASP C 3 504 ? -22.144 26.747  -51.132 1.00 91.39  ? 677 ASP A N     1 
ATOM   4725 C CA    . ASP C 3 504 ? -23.197 25.760  -51.351 1.00 88.80  ? 677 ASP A CA    1 
ATOM   4726 C C     . ASP C 3 504 ? -23.652 25.089  -50.055 1.00 83.38  ? 677 ASP A C     1 
ATOM   4727 O O     . ASP C 3 504 ? -24.377 25.699  -49.261 1.00 90.48  ? 677 ASP A O     1 
ATOM   4728 C CB    . ASP C 3 504 ? -22.800 24.723  -52.413 1.00 93.97  ? 677 ASP A CB    1 
ATOM   4729 C CG    . ASP C 3 504 ? -21.398 24.178  -52.212 1.00 109.48 ? 677 ASP A CG    1 
ATOM   4730 O OD1   . ASP C 3 504 ? -21.268 23.025  -51.748 1.00 114.34 ? 677 ASP A OD1   1 
ATOM   4731 O OD2   . ASP C 3 504 ? -20.369 24.827  -52.501 1.00 122.50 ? 677 ASP A OD2   1 
ATOM   4732 N N     . ALA C 3 505 ? -23.230 23.841  -49.840 1.00 35.10  ? 678 ALA A N     1 
ATOM   4733 C CA    . ALA C 3 505 ? -23.668 23.087  -48.660 1.00 38.65  ? 678 ALA A CA    1 
ATOM   4734 C C     . ALA C 3 505 ? -22.794 21.855  -48.403 1.00 45.24  ? 678 ALA A C     1 
ATOM   4735 O O     . ALA C 3 505 ? -22.277 21.672  -47.298 1.00 95.58  ? 678 ALA A O     1 
ATOM   4736 C CB    . ALA C 3 505 ? -25.145 22.680  -48.796 1.00 28.39  ? 678 ALA A CB    1 
ATOM   4737 N N     . LYS C 3 506 ? -22.640 21.015  -49.428 1.00 93.43  ? 679 LYS A N     1 
ATOM   4738 C CA    . LYS C 3 506 ? -21.769 19.849  -49.338 1.00 98.70  ? 679 LYS A CA    1 
ATOM   4739 C C     . LYS C 3 506 ? -20.334 20.296  -49.098 1.00 98.86  ? 679 LYS A C     1 
ATOM   4740 O O     . LYS C 3 506 ? -19.505 19.526  -48.618 1.00 100.98 ? 679 LYS A O     1 
ATOM   4741 C CB    . LYS C 3 506 ? -21.859 19.008  -50.612 1.00 104.53 ? 679 LYS A CB    1 
ATOM   4742 C CG    . LYS C 3 506 ? -23.146 18.203  -50.732 1.00 116.03 ? 679 LYS A CG    1 
ATOM   4743 C CD    . LYS C 3 506 ? -22.984 17.022  -51.680 1.00 116.80 ? 679 LYS A CD    1 
ATOM   4744 C CE    . LYS C 3 506 ? -22.788 17.489  -53.120 1.00 100.99 ? 679 LYS A CE    1 
ATOM   4745 N NZ    . LYS C 3 506 ? -22.155 16.431  -53.957 1.00 77.10  ? 679 LYS A NZ    1 
ATOM   4746 N N     . THR C 3 507 ? -20.054 21.550  -49.442 1.00 98.50  ? 680 THR A N     1 
ATOM   4747 C CA    . THR C 3 507 ? -18.769 22.167  -49.146 1.00 99.26  ? 680 THR A CA    1 
ATOM   4748 C C     . THR C 3 507 ? -18.675 22.462  -47.653 1.00 97.23  ? 680 THR A C     1 
ATOM   4749 O O     . THR C 3 507 ? -17.638 22.238  -47.028 1.00 97.55  ? 680 THR A O     1 
ATOM   4750 C CB    . THR C 3 507 ? -18.597 23.464  -49.958 1.00 99.00  ? 680 THR A CB    1 
ATOM   4751 O OG1   . THR C 3 507 ? -18.499 23.147  -51.352 1.00 99.52  ? 680 THR A OG1   1 
ATOM   4752 C CG2   . THR C 3 507 ? -17.259 24.123  -49.651 1.00 91.49  ? 680 THR A CG2   1 
ATOM   4753 N N     . LYS C 3 508 ? -19.769 22.963  -47.088 1.00 94.10  ? 681 LYS A N     1 
ATOM   4754 C CA    . LYS C 3 508 ? -19.831 23.261  -45.664 1.00 93.78  ? 681 LYS A CA    1 
ATOM   4755 C C     . LYS C 3 508 ? -19.753 21.977  -44.846 1.00 95.81  ? 681 LYS A C     1 
ATOM   4756 O O     . LYS C 3 508 ? -19.376 21.998  -43.674 1.00 99.70  ? 681 LYS A O     1 
ATOM   4757 C CB    . LYS C 3 508 ? -21.113 24.023  -45.333 1.00 93.42  ? 681 LYS A CB    1 
ATOM   4758 C CG    . LYS C 3 508 ? -21.059 24.793  -44.025 1.00 100.63 ? 681 LYS A CG    1 
ATOM   4759 C CD    . LYS C 3 508 ? -22.452 25.204  -43.578 1.00 106.18 ? 681 LYS A CD    1 
ATOM   4760 C CE    . LYS C 3 508 ? -22.766 26.632  -44.002 1.00 111.52 ? 681 LYS A CE    1 
ATOM   4761 N NZ    . LYS C 3 508 ? -23.024 26.747  -45.466 1.00 85.79  ? 681 LYS A NZ    1 
ATOM   4762 N N     . LYS C 3 509 ? -20.116 20.862  -45.470 1.00 97.94  ? 682 LYS A N     1 
ATOM   4763 C CA    . LYS C 3 509 ? -19.995 19.561  -44.827 1.00 102.47 ? 682 LYS A CA    1 
ATOM   4764 C C     . LYS C 3 509 ? -18.528 19.160  -44.735 1.00 105.91 ? 682 LYS A C     1 
ATOM   4765 O O     . LYS C 3 509 ? -18.121 18.479  -43.794 1.00 107.66 ? 682 LYS A O     1 
ATOM   4766 C CB    . LYS C 3 509 ? -20.785 18.500  -45.596 1.00 103.41 ? 682 LYS A CB    1 
ATOM   4767 C CG    . LYS C 3 509 ? -22.268 18.808  -45.746 1.00 99.80  ? 682 LYS A CG    1 
ATOM   4768 C CD    . LYS C 3 509 ? -23.032 18.517  -44.464 1.00 102.98 ? 682 LYS A CD    1 
ATOM   4769 C CE    . LYS C 3 509 ? -24.135 19.541  -44.243 1.00 110.31 ? 682 LYS A CE    1 
ATOM   4770 N NZ    . LYS C 3 509 ? -23.952 20.302  -42.966 1.00 110.72 ? 682 LYS A NZ    1 
ATOM   4771 N N     . VAL C 3 510 ? -17.740 19.593  -45.717 1.00 107.66 ? 683 VAL A N     1 
ATOM   4772 C CA    . VAL C 3 510 ? -16.306 19.308  -45.751 1.00 103.41 ? 683 VAL A CA    1 
ATOM   4773 C C     . VAL C 3 510 ? -15.540 20.214  -44.787 1.00 102.49 ? 683 VAL A C     1 
ATOM   4774 O O     . VAL C 3 510 ? -14.564 19.790  -44.167 1.00 102.15 ? 683 VAL A O     1 
ATOM   4775 C CB    . VAL C 3 510 ? -15.725 19.455  -47.180 1.00 100.80 ? 683 VAL A CB    1 
ATOM   4776 C CG1   . VAL C 3 510 ? -14.235 19.151  -47.190 1.00 91.85  ? 683 VAL A CG1   1 
ATOM   4777 C CG2   . VAL C 3 510 ? -16.455 18.540  -48.153 1.00 92.68  ? 683 VAL A CG2   1 
ATOM   4778 N N     . VAL C 3 511 ? -15.991 21.460  -44.665 1.00 101.14 ? 684 VAL A N     1 
ATOM   4779 C CA    . VAL C 3 511 ? -15.393 22.411  -43.732 1.00 98.57  ? 684 VAL A CA    1 
ATOM   4780 C C     . VAL C 3 511 ? -15.570 21.940  -42.291 1.00 97.34  ? 684 VAL A C     1 
ATOM   4781 O O     . VAL C 3 511 ? -14.649 22.033  -41.478 1.00 96.58  ? 684 VAL A O     1 
ATOM   4782 C CB    . VAL C 3 511 ? -15.996 23.826  -43.901 1.00 97.66  ? 684 VAL A CB    1 
ATOM   4783 C CG1   . VAL C 3 511 ? -16.246 24.484  -42.547 1.00 86.74  ? 684 VAL A CG1   1 
ATOM   4784 C CG2   . VAL C 3 511 ? -15.089 24.691  -44.758 1.00 101.28 ? 684 VAL A CG2   1 
ATOM   4785 N N     . GLU C 3 512 ? -16.758 21.423  -41.989 1.00 96.73  ? 685 GLU A N     1 
ATOM   4786 C CA    . GLU C 3 512 ? -17.078 20.950  -40.648 1.00 97.37  ? 685 GLU A CA    1 
ATOM   4787 C C     . GLU C 3 512 ? -16.390 19.624  -40.335 1.00 94.94  ? 685 GLU A C     1 
ATOM   4788 O O     . GLU C 3 512 ? -16.145 19.306  -39.172 1.00 94.70  ? 685 GLU A O     1 
ATOM   4789 C CB    . GLU C 3 512 ? -18.596 20.822  -40.475 1.00 98.08  ? 685 GLU A CB    1 
ATOM   4790 C CG    . GLU C 3 512 ? -19.143 19.424  -40.727 1.00 109.31 ? 685 GLU A CG    1 
ATOM   4791 C CD    . GLU C 3 512 ? -20.658 19.388  -40.801 1.00 118.17 ? 685 GLU A CD    1 
ATOM   4792 O OE1   . GLU C 3 512 ? -21.199 18.495  -41.490 1.00 122.18 ? 685 GLU A OE1   1 
ATOM   4793 O OE2   . GLU C 3 512 ? -21.309 20.249  -40.170 1.00 110.26 ? 685 GLU A OE2   1 
ATOM   4794 N N     . SER C 3 513 ? -16.074 18.858  -41.377 1.00 95.57  ? 686 SER A N     1 
ATOM   4795 C CA    . SER C 3 513 ? -15.438 17.554  -41.210 1.00 97.01  ? 686 SER A CA    1 
ATOM   4796 C C     . SER C 3 513 ? -13.943 17.687  -40.933 1.00 96.85  ? 686 SER A C     1 
ATOM   4797 O O     . SER C 3 513 ? -13.295 16.731  -40.502 1.00 100.88 ? 686 SER A O     1 
ATOM   4798 C CB    . SER C 3 513 ? -15.672 16.674  -42.442 1.00 97.87  ? 686 SER A CB    1 
ATOM   4799 O OG    . SER C 3 513 ? -14.499 16.581  -43.237 1.00 107.80 ? 686 SER A OG    1 
ATOM   4800 N N     . LYS C 3 514 ? -13.400 18.872  -41.193 1.00 95.47  ? 687 LYS A N     1 
ATOM   4801 C CA    . LYS C 3 514 ? -12.011 19.168  -40.866 1.00 93.00  ? 687 LYS A CA    1 
ATOM   4802 C C     . LYS C 3 514 ? -11.934 19.854  -39.506 1.00 91.84  ? 687 LYS A C     1 
ATOM   4803 O O     . LYS C 3 514 ? -10.907 19.799  -38.829 1.00 90.35  ? 687 LYS A O     1 
ATOM   4804 C CB    . LYS C 3 514 ? -11.380 20.052  -41.940 1.00 92.54  ? 687 LYS A CB    1 
ATOM   4805 C CG    . LYS C 3 514 ? -11.508 19.502  -43.350 1.00 94.64  ? 687 LYS A CG    1 
ATOM   4806 C CD    . LYS C 3 514 ? -10.268 18.722  -43.752 1.00 111.78 ? 687 LYS A CD    1 
ATOM   4807 C CE    . LYS C 3 514 ? -10.010 18.835  -45.249 1.00 114.14 ? 687 LYS A CE    1 
ATOM   4808 N NZ    . LYS C 3 514 ? -8.944  17.896  -45.702 1.00 123.91 ? 687 LYS A NZ    1 
ATOM   4809 N N     . LYS C 3 515 ? -13.032 20.499  -39.117 1.00 90.48  ? 688 LYS A N     1 
ATOM   4810 C CA    . LYS C 3 515 ? -13.132 21.165  -37.822 1.00 85.02  ? 688 LYS A CA    1 
ATOM   4811 C C     . LYS C 3 515 ? -13.034 20.154  -36.689 1.00 86.94  ? 688 LYS A C     1 
ATOM   4812 O O     . LYS C 3 515 ? -12.305 20.364  -35.718 1.00 85.78  ? 688 LYS A O     1 
ATOM   4813 C CB    . LYS C 3 515 ? -14.450 21.931  -37.718 1.00 81.04  ? 688 LYS A CB    1 
ATOM   4814 C CG    . LYS C 3 515 ? -14.292 23.435  -37.605 1.00 77.36  ? 688 LYS A CG    1 
ATOM   4815 C CD    . LYS C 3 515 ? -15.579 24.083  -37.110 1.00 107.65 ? 688 LYS A CD    1 
ATOM   4816 C CE    . LYS C 3 515 ? -15.721 25.506  -37.634 1.00 128.50 ? 688 LYS A CE    1 
ATOM   4817 N NZ    . LYS C 3 515 ? -15.758 26.510  -36.530 1.00 126.03 ? 688 LYS A NZ    1 
ATOM   4818 N N     . LYS C 3 516 ? -13.776 19.058  -36.816 1.00 91.58  ? 689 LYS A N     1 
ATOM   4819 C CA    . LYS C 3 516 ? -13.743 17.996  -35.818 1.00 95.53  ? 689 LYS A CA    1 
ATOM   4820 C C     . LYS C 3 516 ? -12.447 17.200  -35.922 1.00 95.11  ? 689 LYS A C     1 
ATOM   4821 O O     . LYS C 3 516 ? -11.979 16.637  -34.932 1.00 96.38  ? 689 LYS A O     1 
ATOM   4822 C CB    . LYS C 3 516 ? -14.955 17.068  -35.959 1.00 96.24  ? 689 LYS A CB    1 
ATOM   4823 C CG    . LYS C 3 516 ? -15.475 16.921  -37.381 1.00 100.79 ? 689 LYS A CG    1 
ATOM   4824 C CD    . LYS C 3 516 ? -15.830 15.474  -37.700 1.00 121.78 ? 689 LYS A CD    1 
ATOM   4825 C CE    . LYS C 3 516 ? -14.596 14.676  -38.105 1.00 129.53 ? 689 LYS A CE    1 
ATOM   4826 N NZ    . LYS C 3 516 ? -14.786 13.956  -39.400 1.00 118.06 ? 689 LYS A NZ    1 
ATOM   4827 N N     . ALA C 3 517 ? -11.870 17.161  -37.121 1.00 92.57  ? 690 ALA A N     1 
ATOM   4828 C CA    . ALA C 3 517 ? -10.605 16.466  -37.348 1.00 89.95  ? 690 ALA A CA    1 
ATOM   4829 C C     . ALA C 3 517 ? -9.459  17.186  -36.648 1.00 90.63  ? 690 ALA A C     1 
ATOM   4830 O O     . ALA C 3 517 ? -8.527  16.554  -36.150 1.00 90.52  ? 690 ALA A O     1 
ATOM   4831 C CB    . ALA C 3 517 ? -10.324 16.342  -38.835 1.00 88.63  ? 690 ALA A CB    1 
ATOM   4832 N N     . VAL C 3 518 ? -9.537  18.513  -36.618 1.00 93.40  ? 691 VAL A N     1 
ATOM   4833 C CA    . VAL C 3 518 ? -8.565  19.332  -35.904 1.00 89.74  ? 691 VAL A CA    1 
ATOM   4834 C C     . VAL C 3 518 ? -8.773  19.206  -34.400 1.00 93.07  ? 691 VAL A C     1 
ATOM   4835 O O     . VAL C 3 518 ? -7.816  19.236  -33.625 1.00 93.32  ? 691 VAL A O     1 
ATOM   4836 C CB    . VAL C 3 518 ? -8.666  20.814  -36.324 1.00 87.08  ? 691 VAL A CB    1 
ATOM   4837 C CG1   . VAL C 3 518 ? -8.899  21.713  -35.115 1.00 74.15  ? 691 VAL A CG1   1 
ATOM   4838 C CG2   . VAL C 3 518 ? -7.417  21.234  -37.083 1.00 87.78  ? 691 VAL A CG2   1 
ATOM   4839 N N     . GLN C 3 519 ? -10.031 19.051  -33.998 1.00 97.94  ? 692 GLN A N     1 
ATOM   4840 C CA    . GLN C 3 519 ? -10.388 18.932  -32.590 1.00 98.34  ? 692 GLN A CA    1 
ATOM   4841 C C     . GLN C 3 519 ? -9.873  17.632  -31.985 1.00 96.27  ? 692 GLN A C     1 
ATOM   4842 O O     . GLN C 3 519 ? -9.500  17.592  -30.813 1.00 98.45  ? 692 GLN A O     1 
ATOM   4843 C CB    . GLN C 3 519 ? -11.904 19.030  -32.415 1.00 99.64  ? 692 GLN A CB    1 
ATOM   4844 C CG    . GLN C 3 519 ? -12.393 20.415  -32.032 1.00 107.12 ? 692 GLN A CG    1 
ATOM   4845 C CD    . GLN C 3 519 ? -13.206 20.409  -30.754 1.00 119.30 ? 692 GLN A CD    1 
ATOM   4846 O OE1   . GLN C 3 519 ? -12.648 20.455  -29.656 1.00 133.31 ? 692 GLN A OE1   1 
ATOM   4847 N NE2   . GLN C 3 519 ? -14.526 20.349  -30.892 1.00 118.06 ? 692 GLN A NE2   1 
ATOM   4848 N N     . ARG C 3 520 ? -9.860  16.570  -32.786 1.00 93.75  ? 693 ARG A N     1 
ATOM   4849 C CA    . ARG C 3 520 ? -9.346  15.280  -32.339 1.00 94.00  ? 693 ARG A CA    1 
ATOM   4850 C C     . ARG C 3 520 ? -7.845  15.380  -32.112 1.00 91.05  ? 693 ARG A C     1 
ATOM   4851 O O     . ARG C 3 520 ? -7.286  14.686  -31.264 1.00 89.73  ? 693 ARG A O     1 
ATOM   4852 C CB    . ARG C 3 520 ? -9.654  14.183  -33.362 1.00 97.56  ? 693 ARG A CB    1 
ATOM   4853 C CG    . ARG C 3 520 ? -11.120 13.774  -33.423 1.00 107.02 ? 693 ARG A CG    1 
ATOM   4854 C CD    . ARG C 3 520 ? -11.536 12.767  -32.360 1.00 119.50 ? 693 ARG A CD    1 
ATOM   4855 N NE    . ARG C 3 520 ? -12.789 13.145  -31.711 1.00 125.09 ? 693 ARG A NE    1 
ATOM   4856 C CZ    . ARG C 3 520 ? -13.619 12.290  -31.127 1.00 121.67 ? 693 ARG A CZ    1 
ATOM   4857 N NH1   . ARG C 3 520 ? -13.335 10.993  -31.106 1.00 122.60 ? 693 ARG A NH1   1 
ATOM   4858 N NH2   . ARG C 3 520 ? -14.735 12.730  -30.563 1.00 105.99 ? 693 ARG A NH2   1 
ATOM   4859 N N     . LEU C 3 521 ? -7.199  16.251  -32.878 1.00 90.82  ? 694 LEU A N     1 
ATOM   4860 C CA    . LEU C 3 521 ? -5.774  16.497  -32.715 1.00 91.95  ? 694 LEU A CA    1 
ATOM   4861 C C     . LEU C 3 521 ? -5.541  17.517  -31.606 1.00 93.29  ? 694 LEU A C     1 
ATOM   4862 O O     . LEU C 3 521 ? -4.502  17.507  -30.948 1.00 95.28  ? 694 LEU A O     1 
ATOM   4863 C CB    . LEU C 3 521 ? -5.156  16.969  -34.032 1.00 91.25  ? 694 LEU A CB    1 
ATOM   4864 C CG    . LEU C 3 521 ? -5.098  15.906  -35.134 1.00 79.28  ? 694 LEU A CG    1 
ATOM   4865 C CD1   . LEU C 3 521 ? -5.118  16.550  -36.507 1.00 69.80  ? 694 LEU A CD1   1 
ATOM   4866 C CD2   . LEU C 3 521 ? -3.868  15.021  -34.970 1.00 78.77  ? 694 LEU A CD2   1 
ATOM   4867 N N     . GLU C 3 522 ? -6.519  18.397  -31.407 1.00 94.49  ? 695 GLU A N     1 
ATOM   4868 C CA    . GLU C 3 522 ? -6.509  19.320  -30.280 1.00 93.35  ? 695 GLU A CA    1 
ATOM   4869 C C     . GLU C 3 522 ? -6.624  18.516  -28.993 1.00 89.41  ? 695 GLU A C     1 
ATOM   4870 O O     . GLU C 3 522 ? -5.975  18.824  -27.995 1.00 86.24  ? 695 GLU A O     1 
ATOM   4871 C CB    . GLU C 3 522 ? -7.683  20.293  -30.379 1.00 97.38  ? 695 GLU A CB    1 
ATOM   4872 C CG    . GLU C 3 522 ? -7.334  21.657  -30.944 1.00 93.65  ? 695 GLU A CG    1 
ATOM   4873 C CD    . GLU C 3 522 ? -8.500  22.623  -30.863 1.00 99.74  ? 695 GLU A CD    1 
ATOM   4874 O OE1   . GLU C 3 522 ? -9.633  22.220  -31.204 1.00 91.71  ? 695 GLU A OE1   1 
ATOM   4875 O OE2   . GLU C 3 522 ? -8.285  23.783  -30.453 1.00 117.80 ? 695 GLU A OE2   1 
ATOM   4876 N N     . GLU C 3 523 ? -7.467  17.488  -29.026 1.00 89.38  ? 696 GLU A N     1 
ATOM   4877 C CA    . GLU C 3 523 ? -7.627  16.582  -27.899 1.00 93.03  ? 696 GLU A CA    1 
ATOM   4878 C C     . GLU C 3 523 ? -6.341  15.785  -27.695 1.00 90.60  ? 696 GLU A C     1 
ATOM   4879 O O     . GLU C 3 523 ? -5.604  16.017  -26.726 1.00 91.27  ? 696 GLU A O     1 
ATOM   4880 C CB    . GLU C 3 523 ? -8.816  15.640  -28.130 1.00 95.22  ? 696 GLU A CB    1 
ATOM   4881 C CG    . GLU C 3 523 ? -9.430  15.075  -26.856 1.00 108.28 ? 696 GLU A CG    1 
ATOM   4882 C CD    . GLU C 3 523 ? -10.950 15.104  -26.863 1.00 117.28 ? 696 GLU A CD    1 
ATOM   4883 O OE1   . GLU C 3 523 ? -11.553 14.936  -27.944 1.00 110.40 ? 696 GLU A OE1   1 
ATOM   4884 O OE2   . GLU C 3 523 ? -11.545 15.292  -25.780 1.00 119.09 ? 696 GLU A OE2   1 
ATOM   4885 N N     . GLN C 3 524 ? -6.072  14.861  -28.621 1.00 86.69  ? 697 GLN A N     1 
ATOM   4886 C CA    . GLN C 3 524 ? -4.868  14.038  -28.562 1.00 86.26  ? 697 GLN A CA    1 
ATOM   4887 C C     . GLN C 3 524 ? -3.686  14.792  -27.967 1.00 85.93  ? 697 GLN A C     1 
ATOM   4888 O O     . GLN C 3 524 ? -3.025  14.296  -27.057 1.00 86.50  ? 697 GLN A O     1 
ATOM   4889 C CB    . GLN C 3 524 ? -4.499  13.534  -29.956 1.00 89.78  ? 697 GLN A CB    1 
ATOM   4890 C CG    . GLN C 3 524 ? -5.324  12.355  -30.440 1.00 86.05  ? 697 GLN A CG    1 
ATOM   4891 C CD    . GLN C 3 524 ? -5.266  12.196  -31.946 1.00 87.40  ? 697 GLN A CD    1 
ATOM   4892 O OE1   . GLN C 3 524 ? -4.224  12.437  -32.561 1.00 87.14  ? 697 GLN A OE1   1 
ATOM   4893 N NE2   . GLN C 3 524 ? -6.382  11.794  -32.545 1.00 86.24  ? 697 GLN A NE2   1 
ATOM   4894 N N     . LEU C 3 525 ? -3.425  15.990  -28.485 1.00 85.66  ? 698 LEU A N     1 
ATOM   4895 C CA    . LEU C 3 525 ? -2.289  16.793  -28.047 1.00 85.33  ? 698 LEU A CA    1 
ATOM   4896 C C     . LEU C 3 525 ? -2.331  17.084  -26.553 1.00 86.15  ? 698 LEU A C     1 
ATOM   4897 O O     . LEU C 3 525 ? -1.388  16.768  -25.830 1.00 91.54  ? 698 LEU A O     1 
ATOM   4898 C CB    . LEU C 3 525 ? -2.212  18.105  -28.830 1.00 87.34  ? 698 LEU A CB    1 
ATOM   4899 C CG    . LEU C 3 525 ? -0.933  18.924  -28.638 1.00 94.15  ? 698 LEU A CG    1 
ATOM   4900 C CD1   . LEU C 3 525 ? -0.004  18.738  -29.821 1.00 85.38  ? 698 LEU A CD1   1 
ATOM   4901 C CD2   . LEU C 3 525 ? -1.243  20.401  -28.420 1.00 92.36  ? 698 LEU A CD2   1 
ATOM   4902 N N     . MET C 3 526 ? -3.425  17.681  -26.091 1.00 85.03  ? 699 MET A N     1 
ATOM   4903 C CA    . MET C 3 526 ? -3.552  18.040  -24.683 1.00 87.84  ? 699 MET A CA    1 
ATOM   4904 C C     . MET C 3 526 ? -3.312  16.848  -23.761 1.00 87.70  ? 699 MET A C     1 
ATOM   4905 O O     . MET C 3 526 ? -2.876  17.016  -22.625 1.00 89.04  ? 699 MET A O     1 
ATOM   4906 C CB    . MET C 3 526 ? -4.919  18.668  -24.395 1.00 90.36  ? 699 MET A CB    1 
ATOM   4907 C CG    . MET C 3 526 ? -4.887  19.749  -23.322 1.00 91.28  ? 699 MET A CG    1 
ATOM   4908 S SD    . MET C 3 526 ? -3.309  20.637  -23.285 1.00 122.85 ? 699 MET A SD    1 
ATOM   4909 C CE    . MET C 3 526 ? -3.349  21.357  -21.633 1.00 101.65 ? 699 MET A CE    1 
ATOM   4910 N N     . LYS C 3 527 ? -3.591  15.647  -24.257 1.00 86.04  ? 700 LYS A N     1 
ATOM   4911 C CA    . LYS C 3 527 ? -3.405  14.434  -23.466 1.00 89.28  ? 700 LYS A CA    1 
ATOM   4912 C C     . LYS C 3 527 ? -1.925  14.105  -23.284 1.00 90.08  ? 700 LYS A C     1 
ATOM   4913 O O     . LYS C 3 527 ? -1.515  13.615  -22.231 1.00 93.85  ? 700 LYS A O     1 
ATOM   4914 C CB    . LYS C 3 527 ? -4.136  13.246  -24.103 1.00 90.89  ? 700 LYS A CB    1 
ATOM   4915 C CG    . LYS C 3 527 ? -5.574  13.540  -24.516 1.00 94.77  ? 700 LYS A CG    1 
ATOM   4916 C CD    . LYS C 3 527 ? -6.580  12.836  -23.615 1.00 76.94  ? 700 LYS A CD    1 
ATOM   4917 C CE    . LYS C 3 527 ? -8.008  13.121  -24.057 1.00 73.69  ? 700 LYS A CE    1 
ATOM   4918 N NZ    . LYS C 3 527 ? -9.007  12.293  -23.321 1.00 82.73  ? 700 LYS A NZ    1 
ATOM   4919 N N     . LEU C 3 528 ? -1.130  14.375  -24.314 1.00 87.08  ? 701 LEU A N     1 
ATOM   4920 C CA    . LEU C 3 528 ? 0.309   14.147  -24.242 1.00 88.55  ? 701 LEU A CA    1 
ATOM   4921 C C     . LEU C 3 528 ? 1.017   15.359  -23.647 1.00 89.93  ? 701 LEU A C     1 
ATOM   4922 O O     . LEU C 3 528 ? 2.075   15.231  -23.035 1.00 93.35  ? 701 LEU A O     1 
ATOM   4923 C CB    . LEU C 3 528 ? 0.888   13.827  -25.624 1.00 90.19  ? 701 LEU A CB    1 
ATOM   4924 C CG    . LEU C 3 528 ? 0.032   13.014  -26.600 1.00 89.21  ? 701 LEU A CG    1 
ATOM   4925 C CD1   . LEU C 3 528 ? -0.023  13.711  -27.955 1.00 81.20  ? 701 LEU A CD1   1 
ATOM   4926 C CD2   . LEU C 3 528 ? 0.565   11.592  -26.748 1.00 73.86  ? 701 LEU A CD2   1 
ATOM   4927 N N     . GLU C 3 529 ? 0.430   16.536  -23.836 1.00 91.36  ? 702 GLU A N     1 
ATOM   4928 C CA    . GLU C 3 529 ? 0.973   17.757  -23.254 1.00 95.19  ? 702 GLU A CA    1 
ATOM   4929 C C     . GLU C 3 529 ? 0.780   17.732  -21.743 1.00 93.81  ? 702 GLU A C     1 
ATOM   4930 O O     . GLU C 3 529 ? 1.602   18.265  -20.997 1.00 96.06  ? 702 GLU A O     1 
ATOM   4931 C CB    . GLU C 3 529 ? 0.306   18.996  -23.860 1.00 99.64  ? 702 GLU A CB    1 
ATOM   4932 C CG    . GLU C 3 529 ? 0.731   19.297  -25.291 1.00 108.25 ? 702 GLU A CG    1 
ATOM   4933 C CD    . GLU C 3 529 ? 1.385   20.658  -25.440 1.00 115.47 ? 702 GLU A CD    1 
ATOM   4934 O OE1   . GLU C 3 529 ? 0.708   21.597  -25.911 1.00 114.14 ? 702 GLU A OE1   1 
ATOM   4935 O OE2   . GLU C 3 529 ? 2.578   20.789  -25.090 1.00 112.08 ? 702 GLU A OE2   1 
ATOM   4936 N N     . VAL C 3 530 ? -0.310  17.110  -21.302 1.00 89.24  ? 703 VAL A N     1 
ATOM   4937 C CA    . VAL C 3 530 ? -0.571  16.925  -19.879 1.00 86.51  ? 703 VAL A CA    1 
ATOM   4938 C C     . VAL C 3 530 ? 0.378   15.874  -19.319 1.00 83.37  ? 703 VAL A C     1 
ATOM   4939 O O     . VAL C 3 530 ? 1.042   16.101  -18.308 1.00 83.29  ? 703 VAL A O     1 
ATOM   4940 C CB    . VAL C 3 530 ? -2.032  16.492  -19.617 1.00 87.65  ? 703 VAL A CB    1 
ATOM   4941 C CG1   . VAL C 3 530 ? -2.142  15.705  -18.317 1.00 88.28  ? 703 VAL A CG1   1 
ATOM   4942 C CG2   . VAL C 3 530 ? -2.952  17.704  -19.585 1.00 94.57  ? 703 VAL A CG2   1 
ATOM   4943 N N     . GLN C 3 531 ? 0.447   14.730  -19.995 1.00 84.37  ? 704 GLN A N     1 
ATOM   4944 C CA    . GLN C 3 531 ? 1.327   13.640  -19.587 1.00 86.35  ? 704 GLN A CA    1 
ATOM   4945 C C     . GLN C 3 531 ? 2.761   14.123  -19.400 1.00 81.05  ? 704 GLN A C     1 
ATOM   4946 O O     . GLN C 3 531 ? 3.425   13.758  -18.432 1.00 81.29  ? 704 GLN A O     1 
ATOM   4947 C CB    . GLN C 3 531 ? 1.288   12.509  -20.621 1.00 90.27  ? 704 GLN A CB    1 
ATOM   4948 C CG    . GLN C 3 531 ? 0.985   11.134  -20.039 1.00 105.28 ? 704 GLN A CG    1 
ATOM   4949 C CD    . GLN C 3 531 ? 0.434   10.169  -21.077 1.00 118.19 ? 704 GLN A CD    1 
ATOM   4950 O OE1   . GLN C 3 531 ? 0.580   8.952   -20.943 1.00 114.76 ? 704 GLN A OE1   1 
ATOM   4951 N NE2   . GLN C 3 531 ? -0.202  10.709  -22.112 1.00 125.56 ? 704 GLN A NE2   1 
ATOM   4952 N N     . ALA C 3 532 ? 3.229   14.949  -20.331 1.00 79.65  ? 705 ALA A N     1 
ATOM   4953 C CA    . ALA C 3 532 ? 4.603   15.438  -20.314 1.00 80.92  ? 705 ALA A CA    1 
ATOM   4954 C C     . ALA C 3 532 ? 4.915   16.237  -19.054 1.00 78.80  ? 705 ALA A C     1 
ATOM   4955 O O     . ALA C 3 532 ? 5.828   15.893  -18.305 1.00 80.89  ? 705 ALA A O     1 
ATOM   4956 C CB    . ALA C 3 532 ? 4.887   16.275  -21.558 1.00 86.34  ? 705 ALA A CB    1 
ATOM   4957 N N     . THR C 3 533 ? 4.155   17.305  -18.827 1.00 76.04  ? 706 THR A N     1 
ATOM   4958 C CA    . THR C 3 533 ? 4.380   18.163  -17.669 1.00 77.76  ? 706 THR A CA    1 
ATOM   4959 C C     . THR C 3 533 ? 4.074   17.422  -16.364 1.00 83.51  ? 706 THR A C     1 
ATOM   4960 O O     . THR C 3 533 ? 4.716   17.660  -15.335 1.00 80.98  ? 706 THR A O     1 
ATOM   4961 C CB    . THR C 3 533 ? 3.557   19.467  -17.786 1.00 75.12  ? 706 THR A CB    1 
ATOM   4962 O OG1   . THR C 3 533 ? 3.523   20.135  -16.517 1.00 86.90  ? 706 THR A OG1   1 
ATOM   4963 C CG2   . THR C 3 533 ? 2.098   19.164  -18.061 1.00 54.18  ? 706 THR A CG2   1 
ATOM   4964 N N     . ASP C 3 534 ? 3.099   16.515  -16.424 1.00 89.45  ? 707 ASP A N     1 
ATOM   4965 C CA    . ASP C 3 534 ? 2.773   15.652  -15.295 1.00 90.44  ? 707 ASP A CA    1 
ATOM   4966 C C     . ASP C 3 534 ? 3.984   14.798  -14.929 1.00 90.59  ? 707 ASP A C     1 
ATOM   4967 O O     . ASP C 3 534 ? 4.564   14.958  -13.849 1.00 91.16  ? 707 ASP A O     1 
ATOM   4968 C CB    . ASP C 3 534 ? 1.578   14.761  -15.644 1.00 92.57  ? 707 ASP A CB    1 
ATOM   4969 C CG    . ASP C 3 534 ? 1.333   13.675  -14.617 1.00 95.98  ? 707 ASP A CG    1 
ATOM   4970 O OD1   . ASP C 3 534 ? 0.630   13.949  -13.623 1.00 95.30  ? 707 ASP A OD1   1 
ATOM   4971 O OD2   . ASP C 3 534 ? 1.792   12.516  -14.725 1.00 103.66 ? 707 ASP A OD2   1 
ATOM   4972 N N     . ARG C 3 535 ? 4.365   13.902  -15.843 1.00 92.52  ? 708 ARG A N     1 
ATOM   4973 C CA    . ARG C 3 535 ? 5.522   13.031  -15.645 1.00 96.76  ? 708 ARG A CA    1 
ATOM   4974 C C     . ARG C 3 535 ? 6.752   13.803  -15.165 1.00 98.64  ? 708 ARG A C     1 
ATOM   4975 O O     . ARG C 3 535 ? 7.528   13.302  -14.349 1.00 98.51  ? 708 ARG A O     1 
ATOM   4976 C CB    . ARG C 3 535 ? 5.852   12.277  -16.938 1.00 96.86  ? 708 ARG A CB    1 
ATOM   4977 C CG    . ARG C 3 535 ? 5.666   10.768  -16.860 1.00 97.62  ? 708 ARG A CG    1 
ATOM   4978 C CD    . ARG C 3 535 ? 6.779   9.975   -17.530 1.00 98.13  ? 708 ARG A CD    1 
ATOM   4979 N NE    . ARG C 3 535 ? 6.309   8.709   -18.087 1.00 96.10  ? 708 ARG A NE    1 
ATOM   4980 C CZ    . ARG C 3 535 ? 6.196   8.460   -19.387 1.00 109.39 ? 708 ARG A CZ    1 
ATOM   4981 N NH1   . ARG C 3 535 ? 6.514   9.393   -20.277 1.00 101.97 ? 708 ARG A NH1   1 
ATOM   4982 N NH2   . ARG C 3 535 ? 5.761   7.276   -19.801 1.00 103.66 ? 708 ARG A NH2   1 
ATOM   4983 N N     . GLU C 3 536 ? 6.923   15.022  -15.674 1.00 96.37  ? 709 GLU A N     1 
ATOM   4984 C CA    . GLU C 3 536 ? 8.061   15.857  -15.303 1.00 98.42  ? 709 GLU A CA    1 
ATOM   4985 C C     . GLU C 3 536 ? 7.914   16.403  -13.887 1.00 99.81  ? 709 GLU A C     1 
ATOM   4986 O O     . GLU C 3 536 ? 8.866   16.381  -13.105 1.00 104.08 ? 709 GLU A O     1 
ATOM   4987 C CB    . GLU C 3 536 ? 8.238   17.010  -16.295 1.00 102.03 ? 709 GLU A CB    1 
ATOM   4988 C CG    . GLU C 3 536 ? 9.369   17.967  -15.941 1.00 109.63 ? 709 GLU A CG    1 
ATOM   4989 C CD    . GLU C 3 536 ? 10.091  18.506  -17.163 1.00 114.93 ? 709 GLU A CD    1 
ATOM   4990 O OE1   . GLU C 3 536 ? 9.459   19.238  -17.955 1.00 117.96 ? 709 GLU A OE1   1 
ATOM   4991 O OE2   . GLU C 3 536 ? 11.293  18.202  -17.329 1.00 104.89 ? 709 GLU A OE2   1 
ATOM   4992 N N     . GLU C 3 537 ? 6.721   16.893  -13.565 1.00 100.35 ? 710 GLU A N     1 
ATOM   4993 C CA    . GLU C 3 537 ? 6.442   17.401  -12.226 1.00 102.02 ? 710 GLU A CA    1 
ATOM   4994 C C     . GLU C 3 537 ? 6.890   16.394  -11.169 1.00 99.91  ? 710 GLU A C     1 
ATOM   4995 O O     . GLU C 3 537 ? 7.581   16.746  -10.208 1.00 98.58  ? 710 GLU A O     1 
ATOM   4996 C CB    . GLU C 3 537 ? 4.950   17.700  -12.066 1.00 102.69 ? 710 GLU A CB    1 
ATOM   4997 C CG    . GLU C 3 537 ? 4.648   18.965  -11.280 1.00 102.38 ? 710 GLU A CG    1 
ATOM   4998 C CD    . GLU C 3 537 ? 4.285   20.135  -12.174 1.00 104.28 ? 710 GLU A CD    1 
ATOM   4999 O OE1   . GLU C 3 537 ? 4.052   21.239  -11.637 1.00 102.08 ? 710 GLU A OE1   1 
ATOM   5000 O OE2   . GLU C 3 537 ? 4.231   19.954  -13.411 1.00 88.53  ? 710 GLU A OE2   1 
ATOM   5001 N N     . ASN C 3 538 ? 6.498   15.139  -11.362 1.00 97.59  ? 711 ASN A N     1 
ATOM   5002 C CA    . ASN C 3 538 ? 6.851   14.078  -10.431 1.00 94.29  ? 711 ASN A CA    1 
ATOM   5003 C C     . ASN C 3 538 ? 8.329   13.710  -10.489 1.00 86.73  ? 711 ASN A C     1 
ATOM   5004 O O     . ASN C 3 538 ? 8.848   13.319  -11.536 1.00 87.66  ? 711 ASN A O     1 
ATOM   5005 C CB    . ASN C 3 538 ? 5.984   12.838  -10.669 1.00 96.54  ? 711 ASN A CB    1 
ATOM   5006 C CG    . ASN C 3 538 ? 5.032   12.562  -9.517  1.00 102.30 ? 711 ASN A CG    1 
ATOM   5007 O OD1   . ASN C 3 538 ? 4.097   13.326  -9.270  1.00 96.31  ? 711 ASN A OD1   1 
ATOM   5008 N ND2   . ASN C 3 538 ? 5.267   11.465  -8.804  1.00 104.28 ? 711 ASN A ND2   1 
ATOM   5009 N N     . LYS C 3 539 ? 9.002   13.853  -9.352  1.00 39.87  ? 712 LYS A N     1 
ATOM   5010 C CA    . LYS C 3 539 ? 10.396  13.440  -9.220  1.00 40.06  ? 712 LYS A CA    1 
ATOM   5011 C C     . LYS C 3 539 ? 10.522  12.358  -8.144  1.00 47.92  ? 712 LYS A C     1 
ATOM   5012 O O     . LYS C 3 539 ? 10.868  11.209  -8.440  1.00 99.32  ? 712 LYS A O     1 
ATOM   5013 C CB    . LYS C 3 539 ? 11.297  14.641  -8.897  1.00 26.93  ? 712 LYS A CB    1 
ATOM   5014 C CG    . LYS C 3 539 ? 10.863  15.947  -9.568  1.00 28.01  ? 712 LYS A CG    1 
ATOM   5015 C CD    . LYS C 3 539 ? 10.424  16.991  -8.540  1.00 25.96  ? 712 LYS A CD    1 
ATOM   5016 C CE    . LYS C 3 539 ? 10.765  16.549  -7.120  1.00 32.26  ? 712 LYS A CE    1 
ATOM   5017 N NZ    . LYS C 3 539 ? 9.697   15.632  -6.552  1.00 28.54  ? 712 LYS A NZ    1 
ATOM   5018 N N     . GLN C 3 540 ? 10.230  12.732  -6.900  1.00 105.60 ? 713 GLN A N     1 
ATOM   5019 C CA    . GLN C 3 540 ? 10.291  11.797  -5.784  1.00 117.63 ? 713 GLN A CA    1 
ATOM   5020 C C     . GLN C 3 540 ? 8.908   11.219  -5.483  1.00 122.96 ? 713 GLN A C     1 
ATOM   5021 O O     . GLN C 3 540 ? 8.461   11.211  -4.335  1.00 126.15 ? 713 GLN A O     1 
ATOM   5022 C CB    . GLN C 3 540 ? 10.874  12.486  -4.544  1.00 121.97 ? 713 GLN A CB    1 
ATOM   5023 C CG    . GLN C 3 540 ? 12.403  12.463  -4.478  1.00 115.26 ? 713 GLN A CG    1 
ATOM   5024 C CD    . GLN C 3 540 ? 13.053  13.566  -5.301  1.00 112.45 ? 713 GLN A CD    1 
ATOM   5025 O OE1   . GLN C 3 540 ? 13.137  14.713  -4.857  1.00 116.19 ? 713 GLN A OE1   1 
ATOM   5026 N NE2   . GLN C 3 540 ? 13.517  13.219  -6.497  1.00 105.14 ? 713 GLN A NE2   1 
ATOM   5027 N N     . SER C 3 546 ? -0.054  8.643   0.207   1.00 95.40  ? 719 SER A N     1 
ATOM   5028 C CA    . SER C 3 546 ? -1.279  8.972   0.928   1.00 88.96  ? 719 SER A CA    1 
ATOM   5029 C C     . SER C 3 546 ? -2.501  8.543   0.126   1.00 83.99  ? 719 SER A C     1 
ATOM   5030 O O     . SER C 3 546 ? -3.566  8.263   0.689   1.00 74.98  ? 719 SER A O     1 
ATOM   5031 C CB    . SER C 3 546 ? -1.344  10.475  1.226   1.00 88.23  ? 719 SER A CB    1 
ATOM   5032 O OG    . SER C 3 546 ? -0.074  11.091  1.074   1.00 78.46  ? 719 SER A OG    1 
ATOM   5033 N N     . LYS C 3 547 ? -2.327  8.488   -1.193  1.00 85.91  ? 720 LYS A N     1 
ATOM   5034 C CA    . LYS C 3 547 ? -3.398  8.150   -2.131  1.00 97.69  ? 720 LYS A CA    1 
ATOM   5035 C C     . LYS C 3 547 ? -4.143  6.878   -1.744  1.00 97.12  ? 720 LYS A C     1 
ATOM   5036 O O     . LYS C 3 547 ? -5.335  6.727   -2.023  1.00 97.07  ? 720 LYS A O     1 
ATOM   5037 C CB    . LYS C 3 547 ? -2.825  8.016   -3.550  1.00 103.96 ? 720 LYS A CB    1 
ATOM   5038 C CG    . LYS C 3 547 ? -3.220  6.737   -4.288  1.00 117.77 ? 720 LYS A CG    1 
ATOM   5039 C CD    . LYS C 3 547 ? -2.652  6.721   -5.704  1.00 127.18 ? 720 LYS A CD    1 
ATOM   5040 C CE    . LYS C 3 547 ? -3.199  7.880   -6.536  1.00 121.05 ? 720 LYS A CE    1 
ATOM   5041 N NZ    . LYS C 3 547 ? -2.164  8.422   -7.465  1.00 107.16 ? 720 LYS A NZ    1 
ATOM   5042 N N     . LEU C 3 548 ? -3.429  5.971   -1.088  1.00 100.12 ? 721 LEU A N     1 
ATOM   5043 C CA    . LEU C 3 548 ? -3.980  4.678   -0.718  1.00 99.02  ? 721 LEU A CA    1 
ATOM   5044 C C     . LEU C 3 548 ? -4.400  4.609   0.754   1.00 90.37  ? 721 LEU A C     1 
ATOM   5045 O O     . LEU C 3 548 ? -4.974  3.607   1.185   1.00 92.49  ? 721 LEU A O     1 
ATOM   5046 C CB    . LEU C 3 548 ? -2.957  3.577   -1.032  1.00 99.40  ? 721 LEU A CB    1 
ATOM   5047 C CG    . LEU C 3 548 ? -3.381  2.106   -0.985  1.00 103.72 ? 721 LEU A CG    1 
ATOM   5048 C CD1   . LEU C 3 548 ? -4.615  1.855   -1.845  1.00 109.68 ? 721 LEU A CD1   1 
ATOM   5049 C CD2   . LEU C 3 548 ? -2.223  1.215   -1.418  1.00 88.75  ? 721 LEU A CD2   1 
ATOM   5050 N N     . ASN C 3 549 ? -4.136  5.663   1.527   1.00 73.32  ? 722 ASN A N     1 
ATOM   5051 C CA    . ASN C 3 549 ? -4.307  5.544   2.975   1.00 64.28  ? 722 ASN A CA    1 
ATOM   5052 C C     . ASN C 3 549 ? -4.852  6.733   3.757   1.00 55.45  ? 722 ASN A C     1 
ATOM   5053 O O     . ASN C 3 549 ? -5.818  6.598   4.523   1.00 44.78  ? 722 ASN A O     1 
ATOM   5054 C CB    . ASN C 3 549 ? -2.995  5.081   3.605   1.00 65.02  ? 722 ASN A CB    1 
ATOM   5055 C CG    . ASN C 3 549 ? -2.760  3.603   3.407   1.00 77.03  ? 722 ASN A CG    1 
ATOM   5056 O OD1   . ASN C 3 549 ? -2.109  3.187   2.438   1.00 67.22  ? 722 ASN A OD1   1 
ATOM   5057 N ND2   . ASN C 3 549 ? -3.306  2.791   4.316   1.00 61.78  ? 722 ASN A ND2   1 
ATOM   5058 N N     . PHE C 3 550 ? -4.228  7.894   3.577   1.00 55.98  ? 723 PHE A N     1 
ATOM   5059 C CA    . PHE C 3 550 ? -4.511  9.034   4.444   1.00 56.26  ? 723 PHE A CA    1 
ATOM   5060 C C     . PHE C 3 550 ? -5.564  9.984   3.893   1.00 49.38  ? 723 PHE A C     1 
ATOM   5061 O O     . PHE C 3 550 ? -5.997  10.908  4.581   1.00 45.68  ? 723 PHE A O     1 
ATOM   5062 C CB    . PHE C 3 550 ? -3.218  9.794   4.742   1.00 59.90  ? 723 PHE A CB    1 
ATOM   5063 C CG    . PHE C 3 550 ? -2.216  8.990   5.514   1.00 88.84  ? 723 PHE A CG    1 
ATOM   5064 C CD1   . PHE C 3 550 ? -0.937  8.789   5.018   1.00 104.35 ? 723 PHE A CD1   1 
ATOM   5065 C CD2   . PHE C 3 550 ? -2.557  8.423   6.736   1.00 102.89 ? 723 PHE A CD2   1 
ATOM   5066 C CE1   . PHE C 3 550 ? -0.014  8.047   5.727   1.00 107.52 ? 723 PHE A CE1   1 
ATOM   5067 C CE2   . PHE C 3 550 ? -1.640  7.677   7.451   1.00 106.55 ? 723 PHE A CE2   1 
ATOM   5068 C CZ    . PHE C 3 550 ? -0.365  7.487   6.945   1.00 113.34 ? 723 PHE A CZ    1 
ATOM   5069 N N     . LEU C 3 551 ? -5.981  9.753   2.655   1.00 51.90  ? 724 LEU A N     1 
ATOM   5070 C CA    . LEU C 3 551 ? -6.924  10.650  2.002   1.00 51.90  ? 724 LEU A CA    1 
ATOM   5071 C C     . LEU C 3 551 ? -8.346  10.102  2.007   1.00 52.51  ? 724 LEU A C     1 
ATOM   5072 O O     . LEU C 3 551 ? -8.598  9.009   1.503   1.00 57.00  ? 724 LEU A O     1 
ATOM   5073 C CB    . LEU C 3 551 ? -6.474  10.934  0.569   1.00 47.96  ? 724 LEU A CB    1 
ATOM   5074 C CG    . LEU C 3 551 ? -5.094  11.577  0.424   1.00 39.46  ? 724 LEU A CG    1 
ATOM   5075 C CD1   . LEU C 3 551 ? -4.577  11.437  -1.000  1.00 49.06  ? 724 LEU A CD1   1 
ATOM   5076 C CD2   . LEU C 3 551 ? -5.152  13.034  0.825   1.00 36.83  ? 724 LEU A CD2   1 
ATOM   5077 N N     . ASP C 3 552 ? -9.267  10.862  2.593   1.00 49.83  ? 725 ASP A N     1 
ATOM   5078 C CA    . ASP C 3 552 ? -10.682 10.532  2.521   1.00 44.51  ? 725 ASP A CA    1 
ATOM   5079 C C     . ASP C 3 552 ? -11.078 10.549  1.056   1.00 45.57  ? 725 ASP A C     1 
ATOM   5080 O O     . ASP C 3 552 ? -10.936 11.571  0.382   1.00 43.55  ? 725 ASP A O     1 
ATOM   5081 C CB    . ASP C 3 552 ? -11.511 11.550  3.306   1.00 44.57  ? 725 ASP A CB    1 
ATOM   5082 C CG    . ASP C 3 552 ? -12.928 11.068  3.583   1.00 53.37  ? 725 ASP A CG    1 
ATOM   5083 O OD1   . ASP C 3 552 ? -13.499 10.350  2.738   1.00 38.76  ? 725 ASP A OD1   1 
ATOM   5084 O OD2   . ASP C 3 552 ? -13.555 11.367  4.621   1.00 56.46  ? 725 ASP A OD2   1 
ATOM   5085 N N     . PRO C 3 553 ? -11.554 9.410   0.559   1.00 48.54  ? 726 PRO A N     1 
ATOM   5086 C CA    . PRO C 3 553 ? -11.932 9.274   -0.852  1.00 42.04  ? 726 PRO A CA    1 
ATOM   5087 C C     . PRO C 3 553 ? -13.114 10.166  -1.187  1.00 38.03  ? 726 PRO A C     1 
ATOM   5088 O O     . PRO C 3 553 ? -13.157 10.735  -2.284  1.00 37.32  ? 726 PRO A O     1 
ATOM   5089 C CB    . PRO C 3 553 ? -12.337 7.803   -0.965  1.00 34.81  ? 726 PRO A CB    1 
ATOM   5090 C CG    . PRO C 3 553 ? -12.704 7.405   0.425   1.00 44.99  ? 726 PRO A CG    1 
ATOM   5091 C CD    . PRO C 3 553 ? -11.767 8.163   1.318   1.00 53.87  ? 726 PRO A CD    1 
ATOM   5092 N N     . ARG C 3 554 ? -14.051 10.289  -0.246  1.00 36.17  ? 727 ARG A N     1 
ATOM   5093 C CA    . ARG C 3 554 ? -15.238 11.116  -0.447  1.00 47.14  ? 727 ARG A CA    1 
ATOM   5094 C C     . ARG C 3 554 ? -14.874 12.503  -0.977  1.00 48.53  ? 727 ARG A C     1 
ATOM   5095 O O     . ARG C 3 554 ? -15.599 13.072  -1.798  1.00 49.90  ? 727 ARG A O     1 
ATOM   5096 C CB    . ARG C 3 554 ? -16.038 11.235  0.851   1.00 45.51  ? 727 ARG A CB    1 
ATOM   5097 C CG    . ARG C 3 554 ? -16.612 9.925   1.353   1.00 49.68  ? 727 ARG A CG    1 
ATOM   5098 C CD    . ARG C 3 554 ? -17.358 10.042  2.671   1.00 48.68  ? 727 ARG A CD    1 
ATOM   5099 N NE    . ARG C 3 554 ? -16.473 9.898   3.823   1.00 28.97  ? 727 ARG A NE    1 
ATOM   5100 C CZ    . ARG C 3 554 ? -16.760 10.344  5.041   1.00 52.07  ? 727 ARG A CZ    1 
ATOM   5101 N NH1   . ARG C 3 554 ? -17.911 10.966  5.271   1.00 60.53  ? 727 ARG A NH1   1 
ATOM   5102 N NH2   . ARG C 3 554 ? -15.898 10.172  6.034   1.00 24.85  ? 727 ARG A NH2   1 
ATOM   5103 N N     . ILE C 3 555 ? -13.751 13.039  -0.506  1.00 45.49  ? 728 ILE A N     1 
ATOM   5104 C CA    . ILE C 3 555 ? -13.254 14.321  -0.989  1.00 39.38  ? 728 ILE A CA    1 
ATOM   5105 C C     . ILE C 3 555 ? -13.082 14.273  -2.501  1.00 43.72  ? 728 ILE A C     1 
ATOM   5106 O O     . ILE C 3 555 ? -13.460 15.206  -3.211  1.00 50.55  ? 728 ILE A O     1 
ATOM   5107 C CB    . ILE C 3 555 ? -11.906 14.675  -0.324  1.00 33.22  ? 728 ILE A CB    1 
ATOM   5108 C CG1   . ILE C 3 555 ? -12.009 14.584  1.202   1.00 13.00  ? 728 ILE A CG1   1 
ATOM   5109 C CG2   . ILE C 3 555 ? -11.464 16.063  -0.740  1.00 30.26  ? 728 ILE A CG2   1 
ATOM   5110 N N     . THR C 3 556 ? -12.512 13.177  -2.989  1.00 43.84  ? 729 THR A N     1 
ATOM   5111 C CA    . THR C 3 556 ? -12.274 13.012  -4.416  1.00 46.76  ? 729 THR A CA    1 
ATOM   5112 C C     . THR C 3 556 ? -13.584 12.820  -5.162  1.00 46.51  ? 729 THR A C     1 
ATOM   5113 O O     . THR C 3 556 ? -13.816 13.435  -6.200  1.00 49.25  ? 729 THR A O     1 
ATOM   5114 C CB    . THR C 3 556 ? -11.351 11.817  -4.661  1.00 47.35  ? 729 THR A CB    1 
ATOM   5115 O OG1   . THR C 3 556 ? -10.019 12.158  -4.259  1.00 58.82  ? 729 THR A OG1   1 
ATOM   5116 C CG2   . THR C 3 556 ? -11.215 11.542  -6.151  1.00 45.13  ? 729 THR A CG2   1 
ATOM   5117 N N     . VAL C 3 557 ? -14.439 11.961  -4.621  1.00 47.25  ? 730 VAL A N     1 
ATOM   5118 C CA    . VAL C 3 557 ? -15.733 11.686  -5.225  1.00 49.38  ? 730 VAL A CA    1 
ATOM   5119 C C     . VAL C 3 557 ? -16.536 12.968  -5.433  1.00 47.97  ? 730 VAL A C     1 
ATOM   5120 O O     . VAL C 3 557 ? -17.112 13.179  -6.500  1.00 52.84  ? 730 VAL A O     1 
ATOM   5121 C CB    . VAL C 3 557 ? -16.547 10.700  -4.372  1.00 50.48  ? 730 VAL A CB    1 
ATOM   5122 C CG1   . VAL C 3 557 ? -17.868 10.375  -5.045  1.00 65.73  ? 730 VAL A CG1   1 
ATOM   5123 C CG2   . VAL C 3 557 ? -15.746 9.432   -4.127  1.00 42.74  ? 730 VAL A CG2   1 
ATOM   5124 N N     . ALA C 3 558 ? -16.562 13.823  -4.414  1.00 46.73  ? 731 ALA A N     1 
ATOM   5125 C CA    . ALA C 3 558 ? -17.292 15.089  -4.482  1.00 49.61  ? 731 ALA A CA    1 
ATOM   5126 C C     . ALA C 3 558 ? -16.700 16.018  -5.540  1.00 54.12  ? 731 ALA A C     1 
ATOM   5127 O O     . ALA C 3 558 ? -17.427 16.720  -6.240  1.00 56.60  ? 731 ALA A O     1 
ATOM   5128 C CB    . ALA C 3 558 ? -17.304 15.773  -3.121  1.00 48.13  ? 731 ALA A CB    1 
ATOM   5129 N N     . TRP C 3 559 ? -15.377 16.017  -5.647  1.00 58.80  ? 732 TRP A N     1 
ATOM   5130 C CA    . TRP C 3 559 ? -14.687 16.804  -6.660  1.00 62.64  ? 732 TRP A CA    1 
ATOM   5131 C C     . TRP C 3 559 ? -15.001 16.265  -8.053  1.00 67.82  ? 732 TRP A C     1 
ATOM   5132 O O     . TRP C 3 559 ? -15.464 17.006  -8.932  1.00 71.54  ? 732 TRP A O     1 
ATOM   5133 C CB    . TRP C 3 559 ? -13.180 16.775  -6.402  1.00 60.36  ? 732 TRP A CB    1 
ATOM   5134 C CG    . TRP C 3 559 ? -12.361 17.504  -7.420  1.00 47.11  ? 732 TRP A CG    1 
ATOM   5135 C CD1   . TRP C 3 559 ? -12.040 18.831  -7.418  1.00 65.38  ? 732 TRP A CD1   1 
ATOM   5136 C CD2   . TRP C 3 559 ? -11.740 16.946  -8.582  1.00 36.55  ? 732 TRP A CD2   1 
ATOM   5137 N NE1   . TRP C 3 559 ? -11.262 19.133  -8.510  1.00 54.73  ? 732 TRP A NE1   1 
ATOM   5138 C CE2   . TRP C 3 559 ? -11.064 17.993  -9.242  1.00 40.89  ? 732 TRP A CE2   1 
ATOM   5139 C CE3   . TRP C 3 559 ? -11.686 15.662  -9.137  1.00 41.66  ? 732 TRP A CE3   1 
ATOM   5140 C CZ2   . TRP C 3 559 ? -10.349 17.797  -10.423 1.00 13.45  ? 732 TRP A CZ2   1 
ATOM   5141 C CZ3   . TRP C 3 559 ? -10.975 15.469  -10.311 1.00 43.18  ? 732 TRP A CZ3   1 
ATOM   5142 C CH2   . TRP C 3 559 ? -10.317 16.531  -10.941 1.00 39.44  ? 732 TRP A CH2   1 
ATOM   5143 N N     . CYS C 3 560 ? -14.756 14.968  -8.240  1.00 65.37  ? 733 CYS A N     1 
ATOM   5144 C CA    . CYS C 3 560 ? -15.008 14.308  -9.514  1.00 63.35  ? 733 CYS A CA    1 
ATOM   5145 C C     . CYS C 3 560 ? -16.432 14.543  -9.998  1.00 65.79  ? 733 CYS A C     1 
ATOM   5146 O O     . CYS C 3 560 ? -16.667 14.735  -11.190 1.00 72.71  ? 733 CYS A O     1 
ATOM   5147 C CB    . CYS C 3 560 ? -14.745 12.808  -9.394  1.00 60.93  ? 733 CYS A CB    1 
ATOM   5148 S SG    . CYS C 3 560 ? -12.998 12.364  -9.482  1.00 67.97  ? 733 CYS A SG    1 
ATOM   5149 N N     . LYS C 3 561 ? -17.380 14.530  -9.068  1.00 62.22  ? 734 LYS A N     1 
ATOM   5150 C CA    . LYS C 3 561 ? -18.783 14.702  -9.418  1.00 66.82  ? 734 LYS A CA    1 
ATOM   5151 C C     . LYS C 3 561 ? -19.109 16.144  -9.801  1.00 71.76  ? 734 LYS A C     1 
ATOM   5152 O O     . LYS C 3 561 ? -19.735 16.391  -10.834 1.00 74.42  ? 734 LYS A O     1 
ATOM   5153 C CB    . LYS C 3 561 ? -19.685 14.236  -8.274  1.00 64.83  ? 734 LYS A CB    1 
ATOM   5154 C CG    . LYS C 3 561 ? -20.237 12.831  -8.456  1.00 59.02  ? 734 LYS A CG    1 
ATOM   5155 C CD    . LYS C 3 561 ? -20.545 12.177  -7.116  1.00 72.13  ? 734 LYS A CD    1 
ATOM   5156 C CE    . LYS C 3 561 ? -21.443 10.957  -7.289  1.00 84.20  ? 734 LYS A CE    1 
ATOM   5157 N NZ    . LYS C 3 561 ? -21.693 10.251  -5.998  1.00 79.78  ? 734 LYS A NZ    1 
ATOM   5158 N N     . LYS C 3 562 ? -18.678 17.092  -8.973  1.00 73.75  ? 735 LYS A N     1 
ATOM   5159 C CA    . LYS C 3 562 ? -18.989 18.502  -9.197  1.00 75.31  ? 735 LYS A CA    1 
ATOM   5160 C C     . LYS C 3 562 ? -18.369 19.035  -10.483 1.00 74.27  ? 735 LYS A C     1 
ATOM   5161 O O     . LYS C 3 562 ? -18.962 19.874  -11.160 1.00 78.94  ? 735 LYS A O     1 
ATOM   5162 C CB    . LYS C 3 562 ? -18.546 19.359  -8.008  1.00 78.94  ? 735 LYS A CB    1 
ATOM   5163 C CG    . LYS C 3 562 ? -19.034 20.802  -8.074  1.00 90.82  ? 735 LYS A CG    1 
ATOM   5164 C CD    . LYS C 3 562 ? -19.246 21.391  -6.682  1.00 95.67  ? 735 LYS A CD    1 
ATOM   5165 C CE    . LYS C 3 562 ? -19.217 22.915  -6.717  1.00 97.97  ? 735 LYS A CE    1 
ATOM   5166 N NZ    . LYS C 3 562 ? -17.975 23.435  -7.360  1.00 105.78 ? 735 LYS A NZ    1 
ATOM   5167 N N     . TRP C 3 563 ? -17.181 18.548  -10.822 1.00 71.60  ? 736 TRP A N     1 
ATOM   5168 C CA    . TRP C 3 563 ? -16.523 18.970  -12.055 1.00 73.90  ? 736 TRP A CA    1 
ATOM   5169 C C     . TRP C 3 563 ? -16.753 17.991  -13.207 1.00 75.96  ? 736 TRP A C     1 
ATOM   5170 O O     . TRP C 3 563 ? -16.078 18.054  -14.235 1.00 78.46  ? 736 TRP A O     1 
ATOM   5171 C CB    . TRP C 3 563 ? -15.031 19.204  -11.819 1.00 71.80  ? 736 TRP A CB    1 
ATOM   5172 C CG    . TRP C 3 563 ? -14.767 20.331  -10.873 1.00 83.17  ? 736 TRP A CG    1 
ATOM   5173 C CD1   . TRP C 3 563 ? -14.020 20.288  -9.732  1.00 88.46  ? 736 TRP A CD1   1 
ATOM   5174 C CD2   . TRP C 3 563 ? -15.258 21.672  -10.976 1.00 92.57  ? 736 TRP A CD2   1 
ATOM   5175 N NE1   . TRP C 3 563 ? -14.012 21.519  -9.121  1.00 74.02  ? 736 TRP A NE1   1 
ATOM   5176 C CE2   . TRP C 3 563 ? -14.767 22.387  -9.866  1.00 85.48  ? 736 TRP A CE2   1 
ATOM   5177 C CE3   . TRP C 3 563 ? -16.068 22.346  -11.899 1.00 106.01 ? 736 TRP A CE3   1 
ATOM   5178 C CZ2   . TRP C 3 563 ? -15.056 23.735  -9.653  1.00 87.26  ? 736 TRP A CZ2   1 
ATOM   5179 C CZ3   . TRP C 3 563 ? -16.354 23.683  -11.687 1.00 100.36 ? 736 TRP A CZ3   1 
ATOM   5180 C CH2   . TRP C 3 563 ? -15.850 24.363  -10.573 1.00 97.42  ? 736 TRP A CH2   1 
ATOM   5181 N N     . GLY C 3 564 ? -17.716 17.092  -13.026 1.00 71.02  ? 737 GLY A N     1 
ATOM   5182 C CA    . GLY C 3 564 ? -18.085 16.141  -14.056 1.00 65.88  ? 737 GLY A CA    1 
ATOM   5183 C C     . GLY C 3 564 ? -16.912 15.346  -14.593 1.00 67.10  ? 737 GLY A C     1 
ATOM   5184 O O     . GLY C 3 564 ? -16.718 15.248  -15.806 1.00 67.30  ? 737 GLY A O     1 
ATOM   5185 N N     . VAL C 3 565 ? -16.123 14.782  -13.686 1.00 71.16  ? 738 VAL A N     1 
ATOM   5186 C CA    . VAL C 3 565 ? -15.005 13.929  -14.069 1.00 71.45  ? 738 VAL A CA    1 
ATOM   5187 C C     . VAL C 3 565 ? -15.290 12.478  -13.698 1.00 71.88  ? 738 VAL A C     1 
ATOM   5188 O O     . VAL C 3 565 ? -15.451 12.149  -12.521 1.00 70.81  ? 738 VAL A O     1 
ATOM   5189 C CB    . VAL C 3 565 ? -13.692 14.376  -13.399 1.00 71.91  ? 738 VAL A CB    1 
ATOM   5190 C CG1   . VAL C 3 565 ? -12.496 13.710  -14.064 1.00 68.66  ? 738 VAL A CG1   1 
ATOM   5191 C CG2   . VAL C 3 565 ? -13.559 15.888  -13.448 1.00 76.87  ? 738 VAL A CG2   1 
ATOM   5192 N N     . PRO C 3 566 ? -15.367 11.616  -14.707 1.00 73.23  ? 739 PRO A N     1 
ATOM   5193 C CA    . PRO C 3 566 ? -15.550 10.178  -14.487 1.00 73.70  ? 739 PRO A CA    1 
ATOM   5194 C C     . PRO C 3 566 ? -14.488 9.617   -13.544 1.00 69.72  ? 739 PRO A C     1 
ATOM   5195 O O     . PRO C 3 566 ? -13.294 9.860   -13.735 1.00 65.91  ? 739 PRO A O     1 
ATOM   5196 C CB    . PRO C 3 566 ? -15.394 9.580   -15.894 1.00 72.90  ? 739 PRO A CB    1 
ATOM   5197 C CG    . PRO C 3 566 ? -14.812 10.673  -16.731 1.00 73.39  ? 739 PRO A CG    1 
ATOM   5198 C CD    . PRO C 3 566 ? -15.297 11.956  -16.137 1.00 74.48  ? 739 PRO A CD    1 
ATOM   5199 N N     . ILE C 3 567 ? -14.933 8.877   -12.533 1.00 64.91  ? 740 ILE A N     1 
ATOM   5200 C CA    . ILE C 3 567 ? -14.040 8.324   -11.521 1.00 65.69  ? 740 ILE A CA    1 
ATOM   5201 C C     . ILE C 3 567 ? -13.050 7.325   -12.113 1.00 63.95  ? 740 ILE A C     1 
ATOM   5202 O O     . ILE C 3 567 ? -11.971 7.104   -11.559 1.00 60.05  ? 740 ILE A O     1 
ATOM   5203 C CB    . ILE C 3 567 ? -14.856 7.662   -10.393 1.00 65.80  ? 740 ILE A CB    1 
ATOM   5204 C CG1   . ILE C 3 567 ? -16.210 8.359   -10.240 1.00 77.87  ? 740 ILE A CG1   1 
ATOM   5205 C CG2   . ILE C 3 567 ? -14.091 7.710   -9.077  1.00 57.33  ? 740 ILE A CG2   1 
ATOM   5206 N N     . GLU C 3 568 ? -13.420 6.728   -13.241 1.00 64.05  ? 741 GLU A N     1 
ATOM   5207 C CA    . GLU C 3 568 ? -12.567 5.751   -13.908 1.00 69.20  ? 741 GLU A CA    1 
ATOM   5208 C C     . GLU C 3 568 ? -11.178 6.316   -14.200 1.00 62.74  ? 741 GLU A C     1 
ATOM   5209 O O     . GLU C 3 568 ? -10.198 5.574   -14.263 1.00 54.65  ? 741 GLU A O     1 
ATOM   5210 C CB    . GLU C 3 568 ? -13.221 5.273   -15.209 1.00 78.77  ? 741 GLU A CB    1 
ATOM   5211 C CG    . GLU C 3 568 ? -13.392 3.762   -15.312 1.00 103.77 ? 741 GLU A CG    1 
ATOM   5212 C CD    . GLU C 3 568 ? -12.309 3.096   -16.149 1.00 124.43 ? 741 GLU A CD    1 
ATOM   5213 O OE1   . GLU C 3 568 ? -11.739 2.082   -15.688 1.00 129.51 ? 741 GLU A OE1   1 
ATOM   5214 O OE2   . GLU C 3 568 ? -12.028 3.581   -17.269 1.00 113.39 ? 741 GLU A OE2   1 
ATOM   5215 N N     . LYS C 3 569 ? -11.102 7.633   -14.370 1.00 66.76  ? 742 LYS A N     1 
ATOM   5216 C CA    . LYS C 3 569 ? -9.859  8.289   -14.769 1.00 70.76  ? 742 LYS A CA    1 
ATOM   5217 C C     . LYS C 3 569 ? -8.923  8.526   -13.588 1.00 67.31  ? 742 LYS A C     1 
ATOM   5218 O O     . LYS C 3 569 ? -7.711  8.666   -13.762 1.00 66.83  ? 742 LYS A O     1 
ATOM   5219 C CB    . LYS C 3 569 ? -10.156 9.610   -15.485 1.00 71.18  ? 742 LYS A CB    1 
ATOM   5220 C CG    . LYS C 3 569 ? -11.331 9.537   -16.454 1.00 79.82  ? 742 LYS A CG    1 
ATOM   5221 C CD    . LYS C 3 569 ? -11.026 10.244  -17.765 1.00 84.68  ? 742 LYS A CD    1 
ATOM   5222 C CE    . LYS C 3 569 ? -10.755 9.249   -18.881 1.00 89.45  ? 742 LYS A CE    1 
ATOM   5223 N NZ    . LYS C 3 569 ? -9.295  9.102   -19.148 1.00 95.17  ? 742 LYS A NZ    1 
ATOM   5224 N N     . ILE C 3 570 ? -9.491  8.565   -12.388 1.00 62.51  ? 743 ILE A N     1 
ATOM   5225 C CA    . ILE C 3 570 ? -8.719  8.828   -11.181 1.00 57.35  ? 743 ILE A CA    1 
ATOM   5226 C C     . ILE C 3 570 ? -8.424  7.541   -10.413 1.00 61.58  ? 743 ILE A C     1 
ATOM   5227 O O     . ILE C 3 570 ? -7.350  7.390   -9.832  1.00 66.14  ? 743 ILE A O     1 
ATOM   5228 C CB    . ILE C 3 570 ? -9.468  9.831   -10.283 1.00 54.59  ? 743 ILE A CB    1 
ATOM   5229 C CG1   . ILE C 3 570 ? -9.644  11.166  -11.007 1.00 53.94  ? 743 ILE A CG1   1 
ATOM   5230 C CG2   . ILE C 3 570 ? -8.734  10.039  -8.974  1.00 51.77  ? 743 ILE A CG2   1 
ATOM   5231 N N     . TYR C 3 571 ? -9.377  6.612   -10.425 1.00 63.50  ? 744 TYR A N     1 
ATOM   5232 C CA    . TYR C 3 571 ? -9.255  5.368   -9.671  1.00 61.03  ? 744 TYR A CA    1 
ATOM   5233 C C     . TYR C 3 571 ? -9.264  4.130   -10.566 1.00 60.70  ? 744 TYR A C     1 
ATOM   5234 O O     . TYR C 3 571 ? -10.078 4.023   -11.482 1.00 65.72  ? 744 TYR A O     1 
ATOM   5235 C CB    . TYR C 3 571 ? -10.397 5.256   -8.658  1.00 61.96  ? 744 TYR A CB    1 
ATOM   5236 C CG    . TYR C 3 571 ? -10.252 6.141   -7.439  1.00 64.08  ? 744 TYR A CG    1 
ATOM   5237 C CD1   . TYR C 3 571 ? -11.342 6.401   -6.618  1.00 56.72  ? 744 TYR A CD1   1 
ATOM   5238 C CD2   . TYR C 3 571 ? -9.029  6.711   -7.104  1.00 64.86  ? 744 TYR A CD2   1 
ATOM   5239 C CE1   . TYR C 3 571 ? -11.221 7.207   -5.503  1.00 63.90  ? 744 TYR A CE1   1 
ATOM   5240 C CE2   . TYR C 3 571 ? -8.899  7.521   -5.989  1.00 70.18  ? 744 TYR A CE2   1 
ATOM   5241 C CZ    . TYR C 3 571 ? -9.999  7.766   -5.192  1.00 58.61  ? 744 TYR A CZ    1 
ATOM   5242 O OH    . TYR C 3 571 ? -9.883  8.568   -4.078  1.00 66.87  ? 744 TYR A OH    1 
ATOM   5243 N N     . ASN C 3 572 ? -8.362  3.191   -10.295 1.00 60.82  ? 745 ASN A N     1 
ATOM   5244 C CA    . ASN C 3 572 ? -8.388  1.902   -10.980 1.00 63.08  ? 745 ASN A CA    1 
ATOM   5245 C C     . ASN C 3 572 ? -9.380  0.973   -10.297 1.00 68.26  ? 745 ASN A C     1 
ATOM   5246 O O     . ASN C 3 572 ? -10.000 1.352   -9.304  1.00 68.59  ? 745 ASN A O     1 
ATOM   5247 C CB    . ASN C 3 572 ? -6.996  1.260   -11.017 1.00 63.38  ? 745 ASN A CB    1 
ATOM   5248 C CG    . ASN C 3 572 ? -6.334  1.214   -9.651  1.00 43.70  ? 745 ASN A CG    1 
ATOM   5249 O OD1   . ASN C 3 572 ? -6.956  1.516   -8.635  1.00 38.53  ? 745 ASN A OD1   1 
ATOM   5250 N ND2   . ASN C 3 572 ? -5.061  0.838   -9.624  1.00 52.83  ? 745 ASN A ND2   1 
ATOM   5251 N N     . LYS C 3 573 ? -9.521  -0.243  -10.821 1.00 75.65  ? 746 LYS A N     1 
ATOM   5252 C CA    . LYS C 3 573 ? -10.481 -1.201  -10.273 1.00 82.06  ? 746 LYS A CA    1 
ATOM   5253 C C     . LYS C 3 573 ? -10.171 -1.561  -8.823  1.00 76.93  ? 746 LYS A C     1 
ATOM   5254 O O     . LYS C 3 573 ? -11.083 -1.747  -8.015  1.00 75.59  ? 746 LYS A O     1 
ATOM   5255 C CB    . LYS C 3 573 ? -10.564 -2.464  -11.140 1.00 90.56  ? 746 LYS A CB    1 
ATOM   5256 C CG    . LYS C 3 573 ? -9.222  -3.022  -11.601 1.00 108.58 ? 746 LYS A CG    1 
ATOM   5257 C CD    . LYS C 3 573 ? -9.375  -4.447  -12.125 1.00 120.63 ? 746 LYS A CD    1 
ATOM   5258 C CE    . LYS C 3 573 ? -8.623  -4.645  -13.440 1.00 117.94 ? 746 LYS A CE    1 
ATOM   5259 N NZ    . LYS C 3 573 ? -8.041  -6.019  -13.542 1.00 89.57  ? 746 LYS A NZ    1 
ATOM   5260 N N     . THR C 3 574 ? -8.882  -1.654  -8.501  1.00 71.48  ? 747 THR A N     1 
ATOM   5261 C CA    . THR C 3 574 ? -8.451  -1.875  -7.127  1.00 71.99  ? 747 THR A CA    1 
ATOM   5262 C C     . THR C 3 574 ? -9.019  -0.786  -6.221  1.00 73.73  ? 747 THR A C     1 
ATOM   5263 O O     . THR C 3 574 ? -9.482  -1.062  -5.110  1.00 78.62  ? 747 THR A O     1 
ATOM   5264 C CB    . THR C 3 574 ? -6.906  -1.878  -7.050  1.00 73.84  ? 747 THR A CB    1 
ATOM   5265 O OG1   . THR C 3 574 ? -6.427  -3.231  -7.066  1.00 98.69  ? 747 THR A OG1   1 
ATOM   5266 C CG2   . THR C 3 574 ? -6.413  -1.349  -5.705  1.00 81.85  ? 747 THR A CG2   1 
ATOM   5267 N N     . GLN C 3 575 ? -8.996  0.449   -6.715  1.00 68.26  ? 748 GLN A N     1 
ATOM   5268 C CA    . GLN C 3 575 ? -9.379  1.605   -5.917  1.00 61.68  ? 748 GLN A CA    1 
ATOM   5269 C C     . GLN C 3 575 ? -10.888 1.737   -5.734  1.00 61.83  ? 748 GLN A C     1 
ATOM   5270 O O     . GLN C 3 575 ? -11.368 1.865   -4.609  1.00 69.28  ? 748 GLN A O     1 
ATOM   5271 C CB    . GLN C 3 575 ? -8.796  2.886   -6.516  1.00 62.06  ? 748 GLN A CB    1 
ATOM   5272 C CG    . GLN C 3 575 ? -7.669  3.492   -5.689  1.00 65.24  ? 748 GLN A CG    1 
ATOM   5273 C CD    . GLN C 3 575 ? -6.479  3.928   -6.531  1.00 67.95  ? 748 GLN A CD    1 
ATOM   5274 O OE1   . GLN C 3 575 ? -5.386  4.139   -6.004  1.00 94.76  ? 748 GLN A OE1   1 
ATOM   5275 N NE2   . GLN C 3 575 ? -6.688  4.066   -7.835  1.00 62.35  ? 748 GLN A NE2   1 
ATOM   5276 N N     . ARG C 3 576 ? -11.638 1.700   -6.829  1.00 61.88  ? 749 ARG A N     1 
ATOM   5277 C CA    . ARG C 3 576 ? -13.087 1.870   -6.739  1.00 62.02  ? 749 ARG A CA    1 
ATOM   5278 C C     . ARG C 3 576 ? -13.798 0.645   -6.161  1.00 59.58  ? 749 ARG A C     1 
ATOM   5279 O O     . ARG C 3 576 ? -14.925 0.752   -5.674  1.00 56.90  ? 749 ARG A O     1 
ATOM   5280 C CB    . ARG C 3 576 ? -13.702 2.278   -8.088  1.00 63.45  ? 749 ARG A CB    1 
ATOM   5281 C CG    . ARG C 3 576 ? -13.205 1.502   -9.297  1.00 65.08  ? 749 ARG A CG    1 
ATOM   5282 C CD    . ARG C 3 576 ? -13.017 2.366   -10.534 1.00 69.55  ? 749 ARG A CD    1 
ATOM   5283 N NE    . ARG C 3 576 ? -13.706 1.817   -11.699 1.00 89.25  ? 749 ARG A NE    1 
ATOM   5284 C CZ    . ARG C 3 576 ? -13.102 1.161   -12.682 1.00 97.06  ? 749 ARG A CZ    1 
ATOM   5285 N NH1   . ARG C 3 576 ? -11.788 0.968   -12.645 1.00 99.94  ? 749 ARG A NH1   1 
ATOM   5286 N NH2   . ARG C 3 576 ? -13.809 0.696   -13.704 1.00 96.12  ? 749 ARG A NH2   1 
ATOM   5287 N N     . GLU C 3 577 ? -13.142 -0.512  -6.210  1.00 57.42  ? 750 GLU A N     1 
ATOM   5288 C CA    . GLU C 3 577 ? -13.707 -1.716  -5.605  1.00 59.95  ? 750 GLU A CA    1 
ATOM   5289 C C     . GLU C 3 577 ? -13.633 -1.622  -4.083  1.00 59.69  ? 750 GLU A C     1 
ATOM   5290 O O     . GLU C 3 577 ? -14.476 -2.174  -3.373  1.00 57.63  ? 750 GLU A O     1 
ATOM   5291 C CB    . GLU C 3 577 ? -12.992 -2.975  -6.100  1.00 59.32  ? 750 GLU A CB    1 
ATOM   5292 C CG    . GLU C 3 577 ? -13.778 -3.768  -7.137  1.00 59.81  ? 750 GLU A CG    1 
ATOM   5293 C CD    . GLU C 3 577 ? -12.908 -4.744  -7.911  1.00 75.27  ? 750 GLU A CD    1 
ATOM   5294 O OE1   . GLU C 3 577 ? -11.984 -5.329  -7.305  1.00 65.75  ? 750 GLU A OE1   1 
ATOM   5295 O OE2   . GLU C 3 577 ? -13.146 -4.928  -9.124  1.00 74.68  ? 750 GLU A OE2   1 
ATOM   5296 N N     . LYS C 3 578 ? -12.624 -0.906  -3.594  1.00 59.64  ? 751 LYS A N     1 
ATOM   5297 C CA    . LYS C 3 578 ? -12.446 -0.697  -2.162  1.00 59.81  ? 751 LYS A CA    1 
ATOM   5298 C C     . LYS C 3 578 ? -13.177 0.558   -1.709  1.00 58.23  ? 751 LYS A C     1 
ATOM   5299 O O     . LYS C 3 578 ? -13.722 0.607   -0.603  1.00 62.10  ? 751 LYS A O     1 
ATOM   5300 C CB    . LYS C 3 578 ? -10.959 -0.578  -1.820  1.00 63.85  ? 751 LYS A CB    1 
ATOM   5301 C CG    . LYS C 3 578 ? -10.687 -0.173  -0.376  1.00 64.76  ? 751 LYS A CG    1 
ATOM   5302 C CD    . LYS C 3 578 ? -9.661  0.945   -0.296  1.00 58.13  ? 751 LYS A CD    1 
ATOM   5303 C CE    . LYS C 3 578 ? -8.244  0.394   -0.295  1.00 56.23  ? 751 LYS A CE    1 
ATOM   5304 N NZ    . LYS C 3 578 ? -7.399  1.032   0.747   1.00 29.30  ? 751 LYS A NZ    1 
ATOM   5305 N N     . PHE C 3 579 ? -13.181 1.573   -2.569  1.00 58.21  ? 752 PHE A N     1 
ATOM   5306 C CA    . PHE C 3 579 ? -13.816 2.844   -2.241  1.00 59.48  ? 752 PHE A CA    1 
ATOM   5307 C C     . PHE C 3 579 ? -15.276 2.856   -2.679  1.00 59.93  ? 752 PHE A C     1 
ATOM   5308 O O     . PHE C 3 579 ? -15.894 3.920   -2.814  1.00 61.98  ? 752 PHE A O     1 
ATOM   5309 C CB    . PHE C 3 579 ? -13.045 4.006   -2.875  1.00 59.26  ? 752 PHE A CB    1 
ATOM   5310 C CG    . PHE C 3 579 ? -11.720 4.282   -2.218  1.00 58.65  ? 752 PHE A CG    1 
ATOM   5311 C CD1   . PHE C 3 579 ? -10.603 4.583   -2.977  1.00 49.17  ? 752 PHE A CD1   1 
ATOM   5312 C CD2   . PHE C 3 579 ? -11.591 4.235   -0.837  1.00 71.02  ? 752 PHE A CD2   1 
ATOM   5313 C CE1   . PHE C 3 579 ? -9.383  4.835   -2.374  1.00 75.76  ? 752 PHE A CE1   1 
ATOM   5314 C CE2   . PHE C 3 579 ? -10.375 4.487   -0.227  1.00 68.57  ? 752 PHE A CE2   1 
ATOM   5315 C CZ    . PHE C 3 579 ? -9.269  4.787   -0.996  1.00 81.23  ? 752 PHE A CZ    1 
ATOM   5316 N N     . ALA C 3 580 ? -15.820 1.659   -2.889  1.00 56.93  ? 753 ALA A N     1 
ATOM   5317 C CA    . ALA C 3 580 ? -17.209 1.502   -3.301  1.00 49.94  ? 753 ALA A CA    1 
ATOM   5318 C C     . ALA C 3 580 ? -18.149 2.387   -2.489  1.00 41.77  ? 753 ALA A C     1 
ATOM   5319 O O     . ALA C 3 580 ? -18.968 3.108   -3.057  1.00 43.51  ? 753 ALA A O     1 
ATOM   5320 C CB    . ALA C 3 580 ? -17.627 0.045   -3.200  1.00 56.56  ? 753 ALA A CB    1 
ATOM   5321 N N     . TRP C 3 581 ? -18.027 2.334   -1.165  1.00 27.53  ? 754 TRP A N     1 
ATOM   5322 C CA    . TRP C 3 581 ? -18.907 3.104   -0.297  1.00 34.55  ? 754 TRP A CA    1 
ATOM   5323 C C     . TRP C 3 581 ? -18.796 4.603   -0.551  1.00 45.26  ? 754 TRP A C     1 
ATOM   5324 O O     . TRP C 3 581 ? -19.807 5.299   -0.625  1.00 58.84  ? 754 TRP A O     1 
ATOM   5325 C CB    . TRP C 3 581 ? -18.655 2.788   1.180   1.00 37.45  ? 754 TRP A CB    1 
ATOM   5326 C CG    . TRP C 3 581 ? -17.289 3.164   1.662   1.00 65.55  ? 754 TRP A CG    1 
ATOM   5327 C CD1   . TRP C 3 581 ? -16.171 2.381   1.653   1.00 74.64  ? 754 TRP A CD1   1 
ATOM   5328 C CD2   . TRP C 3 581 ? -16.893 4.418   2.231   1.00 65.07  ? 754 TRP A CD2   1 
ATOM   5329 N NE1   . TRP C 3 581 ? -15.104 3.071   2.177   1.00 52.76  ? 754 TRP A NE1   1 
ATOM   5330 C CE2   . TRP C 3 581 ? -15.522 4.325   2.539   1.00 45.87  ? 754 TRP A CE2   1 
ATOM   5331 C CE3   . TRP C 3 581 ? -17.559 5.618   2.508   1.00 77.38  ? 754 TRP A CE3   1 
ATOM   5332 C CZ2   . TRP C 3 581 ? -14.809 5.380   3.104   1.00 43.01  ? 754 TRP A CZ2   1 
ATOM   5333 C CZ3   . TRP C 3 581 ? -16.848 6.662   3.071   1.00 68.97  ? 754 TRP A CZ3   1 
ATOM   5334 C CH2   . TRP C 3 581 ? -15.490 6.537   3.362   1.00 25.98  ? 754 TRP A CH2   1 
ATOM   5335 N N     . ALA C 3 582 ? -17.573 5.099   -0.700  1.00 45.43  ? 755 ALA A N     1 
ATOM   5336 C CA    . ALA C 3 582 ? -17.364 6.532   -0.888  1.00 46.68  ? 755 ALA A CA    1 
ATOM   5337 C C     . ALA C 3 582 ? -17.826 6.981   -2.266  1.00 55.83  ? 755 ALA A C     1 
ATOM   5338 O O     . ALA C 3 582 ? -18.381 8.066   -2.414  1.00 65.90  ? 755 ALA A O     1 
ATOM   5339 C CB    . ALA C 3 582 ? -15.916 6.895   -0.671  1.00 38.44  ? 755 ALA A CB    1 
ATOM   5340 N N     . ILE C 3 583 ? -17.595 6.141   -3.270  1.00 59.01  ? 756 ILE A N     1 
ATOM   5341 C CA    . ILE C 3 583 ? -18.044 6.426   -4.628  1.00 60.59  ? 756 ILE A CA    1 
ATOM   5342 C C     . ILE C 3 583 ? -19.566 6.540   -4.655  1.00 67.84  ? 756 ILE A C     1 
ATOM   5343 O O     . ILE C 3 583 ? -20.132 7.295   -5.447  1.00 70.87  ? 756 ILE A O     1 
ATOM   5344 C CB    . ILE C 3 583 ? -17.557 5.320   -5.598  1.00 61.68  ? 756 ILE A CB    1 
ATOM   5345 C CG1   . ILE C 3 583 ? -16.095 5.552   -5.984  1.00 33.77  ? 756 ILE A CG1   1 
ATOM   5346 C CG2   . ILE C 3 583 ? -18.431 5.256   -6.844  1.00 49.75  ? 756 ILE A CG2   1 
ATOM   5347 N N     . ASP C 3 584 ? -20.222 5.801   -3.766  1.00 71.13  ? 757 ASP A N     1 
ATOM   5348 C CA    . ASP C 3 584 ? -21.677 5.776   -3.714  1.00 73.98  ? 757 ASP A CA    1 
ATOM   5349 C C     . ASP C 3 584 ? -22.251 6.914   -2.873  1.00 74.45  ? 757 ASP A C     1 
ATOM   5350 O O     . ASP C 3 584 ? -22.911 7.811   -3.400  1.00 78.11  ? 757 ASP A O     1 
ATOM   5351 C CB    . ASP C 3 584 ? -22.164 4.428   -3.177  1.00 74.84  ? 757 ASP A CB    1 
ATOM   5352 C CG    . ASP C 3 584 ? -23.665 4.386   -2.982  1.00 70.00  ? 757 ASP A CG    1 
ATOM   5353 O OD1   . ASP C 3 584 ? -24.378 4.105   -3.966  1.00 59.28  ? 757 ASP A OD1   1 
ATOM   5354 O OD2   . ASP C 3 584 ? -24.219 4.618   -1.885  1.00 58.60  ? 757 ASP A OD2   1 
ATOM   5355 N N     . MET C 3 585 ? -21.989 6.878   -1.569  1.00 65.79  ? 758 MET A N     1 
ATOM   5356 C CA    . MET C 3 585 ? -22.626 7.800   -0.632  1.00 59.63  ? 758 MET A CA    1 
ATOM   5357 C C     . MET C 3 585 ? -21.906 9.141   -0.488  1.00 56.01  ? 758 MET A C     1 
ATOM   5358 O O     . MET C 3 585 ? -21.564 9.555   0.622   1.00 49.84  ? 758 MET A O     1 
ATOM   5359 C CB    . MET C 3 585 ? -22.793 7.136   0.739   1.00 67.46  ? 758 MET A CB    1 
ATOM   5360 C CG    . MET C 3 585 ? -21.543 6.438   1.268   1.00 50.78  ? 758 MET A CG    1 
ATOM   5361 S SD    . MET C 3 585 ? -21.060 7.016   2.910   1.00 65.46  ? 758 MET A SD    1 
ATOM   5362 C CE    . MET C 3 585 ? -22.278 6.182   3.950   1.00 57.78  ? 758 MET A CE    1 
ATOM   5363 N N     . ALA C 3 586 ? -21.691 9.824   -1.608  1.00 62.05  ? 759 ALA A N     1 
ATOM   5364 C CA    . ALA C 3 586 ? -21.044 11.134  -1.586  1.00 65.04  ? 759 ALA A CA    1 
ATOM   5365 C C     . ALA C 3 586 ? -21.577 12.047  -2.681  1.00 67.98  ? 759 ALA A C     1 
ATOM   5366 O O     . ALA C 3 586 ? -21.318 11.822  -3.862  1.00 69.79  ? 759 ALA A O     1 
ATOM   5367 C CB    . ALA C 3 586 ? -19.537 10.985  -1.715  1.00 63.77  ? 759 ALA A CB    1 
ATOM   5368 N N     . ASP C 3 587 ? -22.320 13.076  -2.284  1.00 73.42  ? 760 ASP A N     1 
ATOM   5369 C CA    . ASP C 3 587 ? -22.834 14.059  -3.234  1.00 79.50  ? 760 ASP A CA    1 
ATOM   5370 C C     . ASP C 3 587 ? -21.728 15.022  -3.645  1.00 75.48  ? 760 ASP A C     1 
ATOM   5371 O O     . ASP C 3 587 ? -20.660 15.048  -3.032  1.00 76.96  ? 760 ASP A O     1 
ATOM   5372 C CB    . ASP C 3 587 ? -24.022 14.825  -2.644  1.00 81.53  ? 760 ASP A CB    1 
ATOM   5373 C CG    . ASP C 3 587 ? -23.629 15.698  -1.467  1.00 95.51  ? 760 ASP A CG    1 
ATOM   5374 O OD1   . ASP C 3 587 ? -22.901 15.211  -0.576  1.00 104.96 ? 760 ASP A OD1   1 
ATOM   5375 O OD2   . ASP C 3 587 ? -24.004 16.884  -1.347  1.00 106.95 ? 760 ASP A OD2   1 
ATOM   5376 N N     . GLU C 3 588 ? -21.983 15.812  -4.681  1.00 72.81  ? 761 GLU A N     1 
ATOM   5377 C CA    . GLU C 3 588 ? -20.970 16.721  -5.210  1.00 75.91  ? 761 GLU A CA    1 
ATOM   5378 C C     . GLU C 3 588 ? -20.604 17.820  -4.215  1.00 74.74  ? 761 GLU A C     1 
ATOM   5379 O O     . GLU C 3 588 ? -19.611 18.526  -4.397  1.00 75.94  ? 761 GLU A O     1 
ATOM   5380 C CB    . GLU C 3 588 ? -21.427 17.332  -6.540  1.00 76.83  ? 761 GLU A CB    1 
ATOM   5381 C CG    . GLU C 3 588 ? -22.483 18.418  -6.405  1.00 96.36  ? 761 GLU A CG    1 
ATOM   5382 C CD    . GLU C 3 588 ? -23.816 18.013  -7.004  1.00 107.08 ? 761 GLU A CD    1 
ATOM   5383 O OE1   . GLU C 3 588 ? -24.769 17.775  -6.231  1.00 101.19 ? 761 GLU A OE1   1 
ATOM   5384 O OE2   . GLU C 3 588 ? -23.913 17.934  -8.248  1.00 117.82 ? 761 GLU A OE2   1 
ATOM   5385 N N     . ASP C 3 589 ? -21.404 17.957  -3.162  1.00 73.23  ? 762 ASP A N     1 
ATOM   5386 C CA    . ASP C 3 589 ? -21.187 19.008  -2.174  1.00 76.58  ? 762 ASP A CA    1 
ATOM   5387 C C     . ASP C 3 589 ? -20.778 18.453  -0.814  1.00 71.12  ? 762 ASP A C     1 
ATOM   5388 O O     . ASP C 3 589 ? -21.272 18.899  0.222   1.00 68.67  ? 762 ASP A O     1 
ATOM   5389 C CB    . ASP C 3 589 ? -22.438 19.880  -2.035  1.00 83.69  ? 762 ASP A CB    1 
ATOM   5390 C CG    . ASP C 3 589 ? -22.105 21.343  -1.801  1.00 102.94 ? 762 ASP A CG    1 
ATOM   5391 O OD1   . ASP C 3 589 ? -21.286 21.630  -0.898  1.00 87.39  ? 762 ASP A OD1   1 
ATOM   5392 O OD2   . ASP C 3 589 ? -22.612 22.273  -2.468  1.00 128.55 ? 762 ASP A OD2   1 
ATOM   5393 N N     . TYR C 3 590 ? -19.876 17.478  -0.823  1.00 70.20  ? 763 TYR A N     1 
ATOM   5394 C CA    . TYR C 3 590 ? -19.364 16.905  0.415   1.00 69.92  ? 763 TYR A CA    1 
ATOM   5395 C C     . TYR C 3 590 ? -18.102 17.639  0.843   1.00 74.09  ? 763 TYR A C     1 
ATOM   5396 O O     . TYR C 3 590 ? -17.194 17.843  0.037   1.00 82.90  ? 763 TYR A O     1 
ATOM   5397 C CB    . TYR C 3 590 ? -19.067 15.412  0.245   1.00 65.04  ? 763 TYR A CB    1 
ATOM   5398 C CG    . TYR C 3 590 ? -18.185 14.843  1.334   1.00 58.47  ? 763 TYR A CG    1 
ATOM   5399 C CD1   . TYR C 3 590 ? -18.735 14.317  2.500   1.00 66.38  ? 763 TYR A CD1   1 
ATOM   5400 C CD2   . TYR C 3 590 ? -16.800 14.837  1.202   1.00 60.40  ? 763 TYR A CD2   1 
ATOM   5401 C CE1   . TYR C 3 590 ? -17.930 13.796  3.503   1.00 34.40  ? 763 TYR A CE1   1 
ATOM   5402 C CE2   . TYR C 3 590 ? -15.988 14.326  2.199   1.00 49.00  ? 763 TYR A CE2   1 
ATOM   5403 C CZ    . TYR C 3 590 ? -16.559 13.807  3.345   1.00 50.16  ? 763 TYR A CZ    1 
ATOM   5404 O OH    . TYR C 3 590 ? -15.753 13.296  4.332   1.00 51.82  ? 763 TYR A OH    1 
ATOM   5405 N N     . GLU C 3 591 ? -18.048 18.039  2.109   1.00 69.90  ? 764 GLU A N     1 
ATOM   5406 C CA    . GLU C 3 591 ? -16.841 18.649  2.656   1.00 64.38  ? 764 GLU A CA    1 
ATOM   5407 C C     . GLU C 3 591 ? -16.401 17.908  3.912   1.00 57.08  ? 764 GLU A C     1 
ATOM   5408 O O     . GLU C 3 591 ? -17.225 17.524  4.742   1.00 55.34  ? 764 GLU A O     1 
ATOM   5409 C CB    . GLU C 3 591 ? -17.051 20.141  2.937   1.00 67.53  ? 764 GLU A CB    1 
ATOM   5410 C CG    . GLU C 3 591 ? -18.051 20.442  4.041   1.00 87.28  ? 764 GLU A CG    1 
ATOM   5411 C CD    . GLU C 3 591 ? -17.860 21.822  4.638   1.00 102.90 ? 764 GLU A CD    1 
ATOM   5412 O OE1   . GLU C 3 591 ? -17.658 22.781  3.863   1.00 100.64 ? 764 GLU A OE1   1 
ATOM   5413 O OE2   . GLU C 3 591 ? -17.913 21.948  5.881   1.00 102.95 ? 764 GLU A OE2   1 
ATOM   5414 N N     . PHE C 3 592 ? -15.094 17.704  4.035   1.00 54.33  ? 765 PHE A N     1 
ATOM   5415 C CA    . PHE C 3 592 ? -14.523 16.917  5.125   1.00 53.02  ? 765 PHE A CA    1 
ATOM   5416 C C     . PHE C 3 592 ? -15.088 17.281  6.500   1.00 50.81  ? 765 PHE A C     1 
ATOM   5417 C CB    . PHE C 3 592 ? -13.002 17.054  5.126   1.00 51.89  ? 765 PHE A CB    1 
ATOM   5418 C CG    . PHE C 3 592 ? -12.300 16.016  5.953   1.00 69.17  ? 765 PHE A CG    1 
ATOM   5419 C CD1   . PHE C 3 592 ? -12.163 14.717  5.487   1.00 75.25  ? 765 PHE A CD1   1 
ATOM   5420 C CD2   . PHE C 3 592 ? -11.771 16.343  7.194   1.00 59.79  ? 765 PHE A CD2   1 
ATOM   5421 C CE1   . PHE C 3 592 ? -11.518 13.762  6.247   1.00 72.42  ? 765 PHE A CE1   1 
ATOM   5422 C CE2   . PHE C 3 592 ? -11.123 15.394  7.959   1.00 30.99  ? 765 PHE A CE2   1 
ATOM   5423 C CZ    . PHE C 3 592 ? -10.997 14.101  7.486   1.00 68.80  ? 765 PHE A CZ    1 
ATOM   5424 O OXT   . PHE C 3 592 ? -15.247 18.452  6.853   1.00 49.72  ? 765 PHE A OXT   1 
HETATM 5425 O O     . HOH D 4 .   ? 9.145   -15.396 -8.372  1.00 26.03  ? 145 HOH B O     1 
HETATM 5426 O O     . HOH E 4 .   ? -0.346  1.383   11.728  1.00 22.06  ? 137 HOH C O     1 
HETATM 5427 O O     . HOH E 4 .   ? 1.976   -7.587  32.332  1.00 18.06  ? 138 HOH C O     1 
HETATM 5428 O O     . HOH E 4 .   ? -3.970  5.683   -11.768 1.00 29.75  ? 154 HOH C O     1 
HETATM 5429 O O     . HOH F 4 .   ? 1.363   7.024   1.858   1.00 23.41  ? 123 HOH A O     1 
HETATM 5430 O O     . HOH F 4 .   ? -7.310  -30.391 13.267  1.00 17.74  ? 124 HOH A O     1 
HETATM 5431 O O     . HOH F 4 .   ? -19.788 -22.661 -9.324  1.00 19.72  ? 125 HOH A O     1 
HETATM 5432 O O     . HOH F 4 .   ? 20.970  -32.047 11.870  1.00 29.35  ? 127 HOH A O     1 
HETATM 5433 O O     . HOH F 4 .   ? 7.499   4.251   22.475  1.00 20.64  ? 129 HOH A O     1 
HETATM 5434 O O     . HOH F 4 .   ? -20.994 -0.022  16.103  1.00 30.84  ? 131 HOH A O     1 
HETATM 5435 O O     . HOH F 4 .   ? -20.721 10.321  3.520   1.00 20.85  ? 132 HOH A O     1 
HETATM 5436 O O     . HOH F 4 .   ? -28.381 -3.340  1.594   1.00 24.02  ? 134 HOH A O     1 
HETATM 5437 O O     . HOH F 4 .   ? -12.912 3.332   20.631  1.00 27.98  ? 135 HOH A O     1 
HETATM 5438 O O     . HOH F 4 .   ? -21.372 8.648   11.959  1.00 24.67  ? 142 HOH A O     1 
HETATM 5439 O O     . HOH F 4 .   ? -20.914 -20.601 -4.967  1.00 28.44  ? 143 HOH A O     1 
HETATM 5440 O O     . HOH F 4 .   ? 1.727   7.382   -1.519  1.00 20.87  ? 144 HOH A O     1 
HETATM 5441 O O     . HOH F 4 .   ? 23.312  -24.091 16.292  1.00 20.98  ? 146 HOH A O     1 
HETATM 5442 O O     . HOH F 4 .   ? 21.434  -35.415 9.065   1.00 28.24  ? 147 HOH A O     1 
HETATM 5443 O O     . HOH F 4 .   ? 22.675  39.143  13.875  1.00 32.34  ? 148 HOH A O     1 
HETATM 5444 O O     . HOH F 4 .   ? -8.833  29.925  -5.788  1.00 24.98  ? 149 HOH A O     1 
HETATM 5445 O O     . HOH F 4 .   ? 1.327   -24.963 -12.250 1.00 23.68  ? 150 HOH A O     1 
HETATM 5446 O O     . HOH F 4 .   ? -14.192 26.984  -31.895 1.00 26.92  ? 151 HOH A O     1 
HETATM 5447 O O     . HOH F 4 .   ? -0.466  25.091  12.259  1.00 29.98  ? 152 HOH A O     1 
HETATM 5448 O O     . HOH F 4 .   ? -9.019  27.870  -10.453 1.00 22.22  ? 153 HOH A O     1 
HETATM 5449 O O     . HOH F 4 .   ? 12.252  -0.333  13.496  1.00 25.10  ? 155 HOH A O     1 
HETATM 5450 O O     . HOH F 4 .   ? -16.326 6.199   -15.302 1.00 23.48  ? 156 HOH A O     1 
HETATM 5451 O O     . HOH F 4 .   ? -4.677  14.225  -44.207 1.00 23.77  ? 157 HOH A O     1 
HETATM 5452 O O     . HOH F 4 .   ? 0.536   10.439  13.599  1.00 25.91  ? 158 HOH A O     1 
HETATM 5453 O O     . HOH F 4 .   ? 10.647  -31.736 -11.866 1.00 28.25  ? 159 HOH A O     1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'chirality errors at LYS204A and GLU208A' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   B . n 
A 1 2   DA  2   2   2   DA  A   B . n 
A 1 3   DA  3   3   3   DA  A   B . n 
A 1 4   DA  4   4   4   DA  A   B . n 
A 1 5   DA  5   5   5   DA  A   B . n 
A 1 6   DG  6   6   6   DG  G   B . n 
A 1 7   DA  7   7   7   DA  A   B . n 
A 1 8   DC  8   8   8   DC  C   B . n 
A 1 9   DT  9   9   9   DT  T   B . n 
A 1 10  DT  10  10  10  DT  T   B . n 
A 1 11  DA  11  11  11  DA  A   B . n 
A 1 12  DG  12  12  12  DG  G   B . n 
A 1 13  DA  13  13  13  DA  A   B . n 
A 1 14  DA  14  14  14  DA  A   B . n 
A 1 15  DA  15  15  15  DA  A   B . n 
A 1 16  DA  16  16  16  DA  A   B . n 
A 1 17  DA  17  17  17  DA  A   B . n 
A 1 18  DT  18  18  18  DT  T   B . n 
A 1 19  DT  19  19  19  DT  T   B . n 
A 1 20  DT  20  20  20  DT  T   B . n 
A 1 21  DT  21  21  21  DT  T   B . n 
A 1 22  DT  22  22  22  DT  T   B . n 
B 2 1   DA  1   101 101 DA  A   C . n 
B 2 2   DA  2   102 102 DA  A   C . n 
B 2 3   DA  3   103 103 DA  A   C . n 
B 2 4   DA  4   104 104 DA  A   C . n 
B 2 5   DA  5   105 105 DA  A   C . n 
B 2 6   DT  6   106 106 DT  T   C . n 
B 2 7   DT  7   107 107 DT  T   C . n 
B 2 8   DT  8   108 108 DT  T   C . n 
B 2 9   DT  9   109 109 DT  T   C . n 
B 2 10  DT  10  110 110 DT  T   C . n 
B 2 11  DC  11  111 111 DC  C   C . n 
B 2 12  DT  12  112 112 DT  T   C . n 
B 2 13  DA  13  113 113 DA  A   C . n 
B 2 14  DA  14  114 114 DA  A   C . n 
B 2 15  DG  15  115 115 DG  G   C . n 
B 2 16  DT  16  116 116 DT  T   C . n 
B 2 17  DC  17  117 117 DC  C   C . n 
B 2 18  DT  18  118 118 DT  T   C . n 
B 2 19  DT  19  119 119 DT  T   C . n 
B 2 20  DT  20  120 120 DT  T   C . n 
B 2 21  DT  21  121 121 DT  T   C . n 
B 2 22  DT  22  122 122 DT  T   C . n 
C 3 1   LYS 1   174 ?   ?   ?   A . n 
C 3 2   LYS 2   175 ?   ?   ?   A . n 
C 3 3   PRO 3   176 ?   ?   ?   A . n 
C 3 4   LYS 4   177 ?   ?   ?   A . n 
C 3 5   ASN 5   178 ?   ?   ?   A . n 
C 3 6   LYS 6   179 ?   ?   ?   A . n 
C 3 7   ASP 7   180 ?   ?   ?   A . n 
C 3 8   LYS 8   181 ?   ?   ?   A . n 
C 3 9   ASP 9   182 ?   ?   ?   A . n 
C 3 10  LYS 10  183 ?   ?   ?   A . n 
C 3 11  LYS 11  184 ?   ?   ?   A . n 
C 3 12  VAL 12  185 ?   ?   ?   A . n 
C 3 13  PRO 13  186 ?   ?   ?   A . n 
C 3 14  GLU 14  187 ?   ?   ?   A . n 
C 3 15  PRO 15  188 ?   ?   ?   A . n 
C 3 16  ASP 16  189 ?   ?   ?   A . n 
C 3 17  ASN 17  190 ?   ?   ?   A . n 
C 3 18  LYS 18  191 ?   ?   ?   A . n 
C 3 19  LYS 19  192 ?   ?   ?   A . n 
C 3 20  LYS 20  193 ?   ?   ?   A . n 
C 3 21  LYS 21  194 ?   ?   ?   A . n 
C 3 22  PRO 22  195 ?   ?   ?   A . n 
C 3 23  LYS 23  196 ?   ?   ?   A . n 
C 3 24  LYS 24  197 ?   ?   ?   A . n 
C 3 25  GLU 25  198 ?   ?   ?   A . n 
C 3 26  GLU 26  199 ?   ?   ?   A . n 
C 3 27  GLU 27  200 ?   ?   ?   A . n 
C 3 28  GLN 28  201 ?   ?   ?   A . n 
C 3 29  LYS 29  202 202 LYS ALA A . n 
C 3 30  TRP 30  203 203 TRP ALA A . n 
C 3 31  LYS 31  204 204 LYS LYS A . n 
C 3 32  TRP 32  205 205 TRP TRP A . n 
C 3 33  TRP 33  206 206 TRP TRP A . n 
C 3 34  GLU 34  207 207 GLU GLU A . n 
C 3 35  GLU 35  208 208 GLU GLU A . n 
C 3 36  GLU 36  209 209 GLU GLU A . n 
C 3 37  ARG 37  210 210 ARG ARG A . n 
C 3 38  TYR 38  211 211 TYR TYR A . n 
C 3 39  PRO 39  212 212 PRO PRO A . n 
C 3 40  GLU 40  213 213 GLU GLU A . n 
C 3 41  GLY 41  214 214 GLY GLY A . n 
C 3 42  ILE 42  215 215 ILE ILE A . n 
C 3 43  LYS 43  216 216 LYS LYS A . n 
C 3 44  TRP 44  217 217 TRP TRP A . n 
C 3 45  LYS 45  218 218 LYS LYS A . n 
C 3 46  PHE 46  219 219 PHE PHE A . n 
C 3 47  LEU 47  220 220 LEU LEU A . n 
C 3 48  GLU 48  221 221 GLU GLU A . n 
C 3 49  HIS 49  222 222 HIS HIS A . n 
C 3 50  LYS 50  223 223 LYS LYS A . n 
C 3 51  GLY 51  224 224 GLY GLY A . n 
C 3 52  PRO 52  225 225 PRO PRO A . n 
C 3 53  VAL 53  226 226 VAL VAL A . n 
C 3 54  PHE 54  227 227 PHE PHE A . n 
C 3 55  ALA 55  228 228 ALA ALA A . n 
C 3 56  PRO 56  229 229 PRO PRO A . n 
C 3 57  PRO 57  230 230 PRO PRO A . n 
C 3 58  TYR 58  231 231 TYR TYR A . n 
C 3 59  GLU 59  232 232 GLU GLU A . n 
C 3 60  PRO 60  233 233 PRO PRO A . n 
C 3 61  LEU 61  234 234 LEU LEU A . n 
C 3 62  PRO 62  235 235 PRO PRO A . n 
C 3 63  GLU 63  236 236 GLU GLU A . n 
C 3 64  ASN 64  237 237 ASN ASN A . n 
C 3 65  VAL 65  238 238 VAL VAL A . n 
C 3 66  LYS 66  239 239 LYS LYS A . n 
C 3 67  PHE 67  240 240 PHE PHE A . n 
C 3 68  TYR 68  241 241 TYR TYR A . n 
C 3 69  TYR 69  242 242 TYR TYR A . n 
C 3 70  ASP 70  243 243 ASP ASP A . n 
C 3 71  GLY 71  244 244 GLY GLY A . n 
C 3 72  LYS 72  245 245 LYS LYS A . n 
C 3 73  VAL 73  246 246 VAL VAL A . n 
C 3 74  MET 74  247 247 MET MET A . n 
C 3 75  LYS 75  248 248 LYS LYS A . n 
C 3 76  LEU 76  249 249 LEU LEU A . n 
C 3 77  SER 77  250 250 SER SER A . n 
C 3 78  PRO 78  251 251 PRO PRO A . n 
C 3 79  LYS 79  252 252 LYS LYS A . n 
C 3 80  ALA 80  253 253 ALA ALA A . n 
C 3 81  GLU 81  254 254 GLU GLU A . n 
C 3 82  GLU 82  255 255 GLU GLU A . n 
C 3 83  VAL 83  256 256 VAL VAL A . n 
C 3 84  ALA 84  257 257 ALA ALA A . n 
C 3 85  THR 85  258 258 THR THR A . n 
C 3 86  PHE 86  259 259 PHE PHE A . n 
C 3 87  PHE 87  260 260 PHE PHE A . n 
C 3 88  ALA 88  261 261 ALA ALA A . n 
C 3 89  LYS 89  262 262 LYS LYS A . n 
C 3 90  MET 90  263 263 MET MET A . n 
C 3 91  LEU 91  264 264 LEU LEU A . n 
C 3 92  ASP 92  265 265 ASP ASP A . n 
C 3 93  HIS 93  266 266 HIS HIS A . n 
C 3 94  GLU 94  267 267 GLU GLU A . n 
C 3 95  TYR 95  268 268 TYR TYR A . n 
C 3 96  THR 96  269 269 THR THR A . n 
C 3 97  THR 97  270 270 THR THR A . n 
C 3 98  LYS 98  271 271 LYS LYS A . n 
C 3 99  GLU 99  272 272 GLU GLU A . n 
C 3 100 ILE 100 273 273 ILE ILE A . n 
C 3 101 PHE 101 274 274 PHE PHE A . n 
C 3 102 ARG 102 275 275 ARG ARG A . n 
C 3 103 LYS 103 276 276 LYS LYS A . n 
C 3 104 ASN 104 277 277 ASN ASN A . n 
C 3 105 PHE 105 278 278 PHE PHE A . n 
C 3 106 PHE 106 279 279 PHE PHE A . n 
C 3 107 LYS 107 280 280 LYS LYS A . n 
C 3 108 ASP 108 281 281 ASP ASP A . n 
C 3 109 TRP 109 282 282 TRP TRP A . n 
C 3 110 ARG 110 283 283 ARG ARG A . n 
C 3 111 LYS 111 284 284 LYS LYS A . n 
C 3 112 GLU 112 285 285 GLU GLU A . n 
C 3 113 MET 113 286 286 MET MET A . n 
C 3 114 THR 114 287 287 THR THR A . n 
C 3 115 ASN 115 288 288 ASN ASN A . n 
C 3 116 GLU 116 289 289 GLU GLU A . n 
C 3 117 GLU 117 290 290 GLU GLU A . n 
C 3 118 LYS 118 291 291 LYS LYS A . n 
C 3 119 ASN 119 292 292 ASN ASN A . n 
C 3 120 ILE 120 293 293 ILE ILE A . n 
C 3 121 ILE 121 294 294 ILE ILE A . n 
C 3 122 THR 122 295 295 THR THR A . n 
C 3 123 ASN 123 296 296 ASN ASN A . n 
C 3 124 LEU 124 297 297 LEU LEU A . n 
C 3 125 SER 125 298 298 SER SER A . n 
C 3 126 LYS 126 299 299 LYS LYS A . n 
C 3 127 CYS 127 300 300 CYS CYS A . n 
C 3 128 ASP 128 301 301 ASP ASP A . n 
C 3 129 PHE 129 302 302 PHE PHE A . n 
C 3 130 THR 130 303 303 THR THR A . n 
C 3 131 GLN 131 304 304 GLN GLN A . n 
C 3 132 MET 132 305 305 MET MET A . n 
C 3 133 SER 133 306 306 SER SER A . n 
C 3 134 GLN 134 307 307 GLN GLN A . n 
C 3 135 TYR 135 308 308 TYR TYR A . n 
C 3 136 PHE 136 309 309 PHE PHE A . n 
C 3 137 LYS 137 310 310 LYS LYS A . n 
C 3 138 ALA 138 311 311 ALA ALA A . n 
C 3 139 GLN 139 312 312 GLN GLN A . n 
C 3 140 THR 140 313 313 THR THR A . n 
C 3 141 GLU 141 314 314 GLU GLU A . n 
C 3 142 ALA 142 315 315 ALA ALA A . n 
C 3 143 ARG 143 316 316 ARG ARG A . n 
C 3 144 LYS 144 317 317 LYS LYS A . n 
C 3 145 GLN 145 318 318 GLN GLN A . n 
C 3 146 MET 146 319 319 MET MET A . n 
C 3 147 SER 147 320 320 SER SER A . n 
C 3 148 LYS 148 321 321 LYS LYS A . n 
C 3 149 GLU 149 322 322 GLU GLU A . n 
C 3 150 GLU 150 323 323 GLU GLU A . n 
C 3 151 LYS 151 324 324 LYS LYS A . n 
C 3 152 LEU 152 325 325 LEU LEU A . n 
C 3 153 LYS 153 326 326 LYS LYS A . n 
C 3 154 ILE 154 327 327 ILE ILE A . n 
C 3 155 LYS 155 328 328 LYS LYS A . n 
C 3 156 GLU 156 329 329 GLU GLU A . n 
C 3 157 GLU 157 330 330 GLU GLU A . n 
C 3 158 ASN 158 331 331 ASN ASN A . n 
C 3 159 GLU 159 332 332 GLU GLU A . n 
C 3 160 LYS 160 333 333 LYS LYS A . n 
C 3 161 LEU 161 334 334 LEU LEU A . n 
C 3 162 LEU 162 335 335 LEU LEU A . n 
C 3 163 LYS 163 336 336 LYS LYS A . n 
C 3 164 GLU 164 337 337 GLU GLU A . n 
C 3 165 TYR 165 338 338 TYR TYR A . n 
C 3 166 GLY 166 339 339 GLY GLY A . n 
C 3 167 PHE 167 340 340 PHE PHE A . n 
C 3 168 CYS 168 341 341 CYS CYS A . n 
C 3 169 ILE 169 342 342 ILE ILE A . n 
C 3 170 MET 170 343 343 MET MET A . n 
C 3 171 ASP 171 344 344 ASP ASP A . n 
C 3 172 ASN 172 345 345 ASN ASN A . n 
C 3 173 HIS 173 346 346 HIS HIS A . n 
C 3 174 LYS 174 347 347 LYS LYS A . n 
C 3 175 GLU 175 348 348 GLU GLU A . n 
C 3 176 ARG 176 349 349 ARG ARG A . n 
C 3 177 ILE 177 350 350 ILE ILE A . n 
C 3 178 ALA 178 351 351 ALA ALA A . n 
C 3 179 ASN 179 352 352 ASN ASN A . n 
C 3 180 PHE 180 353 353 PHE PHE A . n 
C 3 181 LYS 181 354 354 LYS LYS A . n 
C 3 182 ILE 182 355 355 ILE ILE A . n 
C 3 183 GLU 183 356 356 GLU GLU A . n 
C 3 184 PRO 184 357 357 PRO PRO A . n 
C 3 185 PRO 185 358 358 PRO PRO A . n 
C 3 186 GLY 186 359 359 GLY GLY A . n 
C 3 187 LEU 187 360 360 LEU LEU A . n 
C 3 188 PHE 188 361 361 PHE PHE A . n 
C 3 189 ARG 189 362 362 ARG ARG A . n 
C 3 190 GLY 190 363 363 GLY GLY A . n 
C 3 191 ARG 191 364 364 ARG ARG A . n 
C 3 192 GLY 192 365 365 GLY GLY A . n 
C 3 193 ASN 193 366 366 ASN ASN A . n 
C 3 194 HIS 194 367 367 HIS HIS A . n 
C 3 195 PRO 195 368 368 PRO PRO A . n 
C 3 196 LYS 196 369 369 LYS LYS A . n 
C 3 197 MET 197 370 370 MET MET A . n 
C 3 198 GLY 198 371 371 GLY GLY A . n 
C 3 199 MET 199 372 372 MET MET A . n 
C 3 200 LEU 200 373 373 LEU LEU A . n 
C 3 201 LYS 201 374 374 LYS LYS A . n 
C 3 202 ARG 202 375 375 ARG ARG A . n 
C 3 203 ARG 203 376 376 ARG ARG A . n 
C 3 204 ILE 204 377 377 ILE ILE A . n 
C 3 205 MET 205 378 378 MET MET A . n 
C 3 206 PRO 206 379 379 PRO PRO A . n 
C 3 207 GLU 207 380 380 GLU GLU A . n 
C 3 208 ASP 208 381 381 ASP ASP A . n 
C 3 209 ILE 209 382 382 ILE ILE A . n 
C 3 210 ILE 210 383 383 ILE ILE A . n 
C 3 211 ILE 211 384 384 ILE ILE A . n 
C 3 212 ASN 212 385 385 ASN ASN A . n 
C 3 213 CYS 213 386 386 CYS CYS A . n 
C 3 214 SER 214 387 387 SER SER A . n 
C 3 215 LYS 215 388 ?   ?   ?   A . n 
C 3 216 ASP 216 389 389 ASP ASP A . n 
C 3 217 ALA 217 390 390 ALA ALA A . n 
C 3 218 LYS 218 391 391 LYS LYS A . n 
C 3 219 VAL 219 392 392 VAL VAL A . n 
C 3 220 PRO 220 393 393 PRO PRO A . n 
C 3 221 SER 221 394 394 SER SER A . n 
C 3 222 PRO 222 395 395 PRO PRO A . n 
C 3 223 PRO 223 396 396 PRO PRO A . n 
C 3 224 PRO 224 397 397 PRO PRO A . n 
C 3 225 GLY 225 398 398 GLY GLY A . n 
C 3 226 HIS 226 399 399 HIS HIS A . n 
C 3 227 LYS 227 400 400 LYS LYS A . n 
C 3 228 TRP 228 401 401 TRP TRP A . n 
C 3 229 LYS 229 402 402 LYS LYS A . n 
C 3 230 GLU 230 403 403 GLU GLU A . n 
C 3 231 VAL 231 404 404 VAL VAL A . n 
C 3 232 ARG 232 405 405 ARG ARG A . n 
C 3 233 HIS 233 406 406 HIS HIS A . n 
C 3 234 ASP 234 407 407 ASP ASP A . n 
C 3 235 ASN 235 408 408 ASN ASN A . n 
C 3 236 LYS 236 409 409 LYS LYS A . n 
C 3 237 VAL 237 410 410 VAL VAL A . n 
C 3 238 THR 238 411 411 THR THR A . n 
C 3 239 TRP 239 412 412 TRP TRP A . n 
C 3 240 LEU 240 413 413 LEU LEU A . n 
C 3 241 VAL 241 414 414 VAL VAL A . n 
C 3 242 SER 242 415 415 SER SER A . n 
C 3 243 TRP 243 416 416 TRP TRP A . n 
C 3 244 THR 244 417 417 THR THR A . n 
C 3 245 GLU 245 418 418 GLU GLU A . n 
C 3 246 ASN 246 419 419 ASN ASN A . n 
C 3 247 ILE 247 420 420 ILE ILE A . n 
C 3 248 GLN 248 421 421 GLN GLN A . n 
C 3 249 GLY 249 422 422 GLY GLY A . n 
C 3 250 SER 250 423 423 SER SER A . n 
C 3 251 ILE 251 424 424 ILE ILE A . n 
C 3 252 LYS 252 425 425 LYS LYS A . n 
C 3 253 TYR 253 426 426 TYR TYR A . n 
C 3 254 ILE 254 427 427 ILE ILE A . n 
C 3 255 MET 255 428 428 MET MET A . n 
C 3 256 LEU 256 429 429 LEU LEU A . n 
C 3 257 ASN 257 430 430 ASN ASN A . n 
C 3 258 PRO 258 431 431 PRO PRO A . n 
C 3 259 SER 259 432 432 SER SER A . n 
C 3 260 SER 260 433 433 SER SER A . n 
C 3 261 ARG 261 434 434 ARG ARG A . n 
C 3 262 ILE 262 435 435 ILE ILE A . n 
C 3 263 LYS 263 436 436 LYS LYS A . n 
C 3 264 GLY 264 437 437 GLY GLY A . n 
C 3 265 GLU 265 438 438 GLU GLU A . n 
C 3 266 LYS 266 439 439 LYS LYS A . n 
C 3 267 ASP 267 440 440 ASP ASP A . n 
C 3 268 TRP 268 441 441 TRP TRP A . n 
C 3 269 GLN 269 442 442 GLN GLN A . n 
C 3 270 LYS 270 443 443 LYS LYS A . n 
C 3 271 TYR 271 444 444 TYR TYR A . n 
C 3 272 GLU 272 445 445 GLU GLU A . n 
C 3 273 THR 273 446 446 THR THR A . n 
C 3 274 ALA 274 447 447 ALA ALA A . n 
C 3 275 ARG 275 448 448 ARG ARG A . n 
C 3 276 ARG 276 449 449 ARG ARG A . n 
C 3 277 LEU 277 450 450 LEU LEU A . n 
C 3 278 LYS 278 451 451 LYS LYS A . n 
C 3 279 LYS 279 452 452 LYS LYS A . n 
C 3 280 CYS 280 453 453 CYS CYS A . n 
C 3 281 VAL 281 454 454 VAL VAL A . n 
C 3 282 ASP 282 455 455 ASP ASP A . n 
C 3 283 LYS 283 456 456 LYS LYS A . n 
C 3 284 ILE 284 457 457 ILE ILE A . n 
C 3 285 ARG 285 458 458 ARG ARG A . n 
C 3 286 ASN 286 459 459 ASN ASN A . n 
C 3 287 GLN 287 460 460 GLN GLN A . n 
C 3 288 TYR 288 461 461 TYR TYR A . n 
C 3 289 ARG 289 462 462 ARG ARG A . n 
C 3 290 GLU 290 463 463 GLU GLU A . n 
C 3 291 ASP 291 464 464 ASP ASP A . n 
C 3 292 TRP 292 465 465 TRP TRP A . n 
C 3 293 LYS 293 466 466 LYS LYS A . n 
C 3 294 SER 294 467 467 SER SER A . n 
C 3 295 LYS 295 468 468 LYS LYS A . n 
C 3 296 GLU 296 469 469 GLU GLU A . n 
C 3 297 MET 297 470 470 MET MET A . n 
C 3 298 LYS 298 471 471 LYS LYS A . n 
C 3 299 VAL 299 472 472 VAL VAL A . n 
C 3 300 ARG 300 473 473 ARG ARG A . n 
C 3 301 GLN 301 474 474 GLN GLN A . n 
C 3 302 ARG 302 475 475 ARG ARG A . n 
C 3 303 ALA 303 476 476 ALA ALA A . n 
C 3 304 VAL 304 477 477 VAL VAL A . n 
C 3 305 ALA 305 478 478 ALA ALA A . n 
C 3 306 LEU 306 479 479 LEU LEU A . n 
C 3 307 TYR 307 480 480 TYR TYR A . n 
C 3 308 PHE 308 481 481 PHE PHE A . n 
C 3 309 ILE 309 482 482 ILE ILE A . n 
C 3 310 ASP 310 483 483 ASP ASP A . n 
C 3 311 LYS 311 484 484 LYS LYS A . n 
C 3 312 LEU 312 485 485 LEU LEU A . n 
C 3 313 ALA 313 486 486 ALA ALA A . n 
C 3 314 LEU 314 487 487 LEU LEU A . n 
C 3 315 ARG 315 488 488 ARG ARG A . n 
C 3 316 ALA 316 489 489 ALA ALA A . n 
C 3 317 GLY 317 490 490 GLY GLY A . n 
C 3 318 ASN 318 491 491 ASN ASN A . n 
C 3 319 GLU 319 492 492 GLU GLU A . n 
C 3 320 LYS 320 493 493 LYS LYS A . n 
C 3 321 GLU 321 494 494 GLU GLU A . n 
C 3 322 GLU 322 495 495 GLU GLU A . n 
C 3 323 GLY 323 496 496 GLY GLY A . n 
C 3 324 GLU 324 497 497 GLU GLU A . n 
C 3 325 THR 325 498 498 THR THR A . n 
C 3 326 ALA 326 499 499 ALA ALA A . n 
C 3 327 ASP 327 500 500 ASP ASP A . n 
C 3 328 THR 328 501 501 THR THR A . n 
C 3 329 VAL 329 502 502 VAL VAL A . n 
C 3 330 GLY 330 503 503 GLY GLY A . n 
C 3 331 CYS 331 504 504 CYS CYS A . n 
C 3 332 CYS 332 505 505 CYS CYS A . n 
C 3 333 SER 333 506 506 SER SER A . n 
C 3 334 LEU 334 507 507 LEU LEU A . n 
C 3 335 ARG 335 508 508 ARG ARG A . n 
C 3 336 VAL 336 509 509 VAL VAL A . n 
C 3 337 GLU 337 510 510 GLU GLU A . n 
C 3 338 HIS 338 511 511 HIS HIS A . n 
C 3 339 ILE 339 512 512 ILE ILE A . n 
C 3 340 ASN 340 513 513 ASN ASN A . n 
C 3 341 LEU 341 514 514 LEU LEU A . n 
C 3 342 HIS 342 515 515 HIS HIS A . n 
C 3 343 PRO 343 516 516 PRO PRO A . n 
C 3 344 GLU 344 517 517 GLU GLU A . n 
C 3 345 LEU 345 518 518 LEU LEU A . n 
C 3 346 ASP 346 519 519 ASP ASP A . n 
C 3 347 GLY 347 520 520 GLY GLY A . n 
C 3 348 GLN 348 521 521 GLN GLN A . n 
C 3 349 GLU 349 522 522 GLU GLU A . n 
C 3 350 TYR 350 523 523 TYR TYR A . n 
C 3 351 VAL 351 524 524 VAL VAL A . n 
C 3 352 VAL 352 525 525 VAL VAL A . n 
C 3 353 GLU 353 526 526 GLU GLU A . n 
C 3 354 PHE 354 527 527 PHE PHE A . n 
C 3 355 ASP 355 528 528 ASP ASP A . n 
C 3 356 PHE 356 529 529 PHE PHE A . n 
C 3 357 LEU 357 530 530 LEU LEU A . n 
C 3 358 GLY 358 531 531 GLY GLY A . n 
C 3 359 ARG 359 532 532 ARG ARG A . n 
C 3 360 ASP 360 533 533 ASP ASP A . n 
C 3 361 SER 361 534 534 SER SER A . n 
C 3 362 ILE 362 535 535 ILE ILE A . n 
C 3 363 ARG 363 536 536 ARG ARG A . n 
C 3 364 TYR 364 537 537 TYR TYR A . n 
C 3 365 TYR 365 538 538 TYR TYR A . n 
C 3 366 ASN 366 539 539 ASN ASN A . n 
C 3 367 LYS 367 540 540 LYS LYS A . n 
C 3 368 VAL 368 541 541 VAL VAL A . n 
C 3 369 PRO 369 542 542 PRO PRO A . n 
C 3 370 VAL 370 543 543 VAL VAL A . n 
C 3 371 GLU 371 544 544 GLU GLU A . n 
C 3 372 LYS 372 545 545 LYS LYS A . n 
C 3 373 ARG 373 546 546 ARG ARG A . n 
C 3 374 VAL 374 547 547 VAL VAL A . n 
C 3 375 PHE 375 548 548 PHE PHE A . n 
C 3 376 LYS 376 549 549 LYS LYS A . n 
C 3 377 ASN 377 550 550 ASN ASN A . n 
C 3 378 LEU 378 551 551 LEU LEU A . n 
C 3 379 GLN 379 552 552 GLN GLN A . n 
C 3 380 LEU 380 553 553 LEU LEU A . n 
C 3 381 PHE 381 554 554 PHE PHE A . n 
C 3 382 MET 382 555 555 MET MET A . n 
C 3 383 GLU 383 556 556 GLU GLU A . n 
C 3 384 ASN 384 557 557 ASN ASN A . n 
C 3 385 LYS 385 558 558 LYS LYS A . n 
C 3 386 GLN 386 559 559 GLN GLN A . n 
C 3 387 PRO 387 560 560 PRO PRO A . n 
C 3 388 GLU 388 561 561 GLU GLU A . n 
C 3 389 ASP 389 562 562 ASP ASP A . n 
C 3 390 ASP 390 563 563 ASP ASP A . n 
C 3 391 LEU 391 564 564 LEU LEU A . n 
C 3 392 PHE 392 565 565 PHE PHE A . n 
C 3 393 ASP 393 566 566 ASP ASP A . n 
C 3 394 ARG 394 567 567 ARG ARG A . n 
C 3 395 LEU 395 568 568 LEU LEU A . n 
C 3 396 ASN 396 569 569 ASN ASN A . n 
C 3 397 THR 397 570 570 THR THR A . n 
C 3 398 GLY 398 571 571 GLY GLY A . n 
C 3 399 ILE 399 572 572 ILE ILE A . n 
C 3 400 LEU 400 573 573 LEU LEU A . n 
C 3 401 ASN 401 574 574 ASN ASN A . n 
C 3 402 LYS 402 575 575 LYS LYS A . n 
C 3 403 HIS 403 576 576 HIS HIS A . n 
C 3 404 LEU 404 577 577 LEU LEU A . n 
C 3 405 GLN 405 578 578 GLN GLN A . n 
C 3 406 ASP 406 579 579 ASP ASP A . n 
C 3 407 LEU 407 580 580 LEU LEU A . n 
C 3 408 MET 408 581 581 MET MET A . n 
C 3 409 GLU 409 582 582 GLU GLU A . n 
C 3 410 GLY 410 583 583 GLY GLY A . n 
C 3 411 LEU 411 584 584 LEU LEU A . n 
C 3 412 THR 412 585 585 THR THR A . n 
C 3 413 ALA 413 586 586 ALA ALA A . n 
C 3 414 LYS 414 587 587 LYS LYS A . n 
C 3 415 VAL 415 588 588 VAL VAL A . n 
C 3 416 PHE 416 589 589 PHE PHE A . n 
C 3 417 ARG 417 590 590 ARG ARG A . n 
C 3 418 THR 418 591 591 THR THR A . n 
C 3 419 TYR 419 592 592 TYR TYR A . n 
C 3 420 ASN 420 593 593 ASN ASN A . n 
C 3 421 ALA 421 594 594 ALA ALA A . n 
C 3 422 SER 422 595 595 SER SER A . n 
C 3 423 ILE 423 596 596 ILE ILE A . n 
C 3 424 THR 424 597 597 THR THR A . n 
C 3 425 LEU 425 598 598 LEU LEU A . n 
C 3 426 GLN 426 599 599 GLN GLN A . n 
C 3 427 GLN 427 600 600 GLN GLN A . n 
C 3 428 GLN 428 601 601 GLN GLN A . n 
C 3 429 LEU 429 602 602 LEU LEU A . n 
C 3 430 LYS 430 603 603 LYS LYS A . n 
C 3 431 GLU 431 604 604 GLU GLU A . n 
C 3 432 LEU 432 605 605 LEU LEU A . n 
C 3 433 THR 433 606 606 THR THR A . n 
C 3 434 ALA 434 607 607 ALA ALA A . n 
C 3 435 PRO 435 608 608 PRO PRO A . n 
C 3 436 ASP 436 609 609 ASP ASP A . n 
C 3 437 GLU 437 610 610 GLU GLU A . n 
C 3 438 ASN 438 611 611 ASN ASN A . n 
C 3 439 ILE 439 612 612 ILE ILE A . n 
C 3 440 PRO 440 613 613 PRO PRO A . n 
C 3 441 ALA 441 614 614 ALA ALA A . n 
C 3 442 LYS 442 615 615 LYS LYS A . n 
C 3 443 ILE 443 616 616 ILE ILE A . n 
C 3 444 LEU 444 617 617 LEU LEU A . n 
C 3 445 SER 445 618 618 SER SER A . n 
C 3 446 TYR 446 619 619 TYR TYR A . n 
C 3 447 ASN 447 620 620 ASN ASN A . n 
C 3 448 ARG 448 621 621 ARG ARG A . n 
C 3 449 ALA 449 622 622 ALA ALA A . n 
C 3 450 ASN 450 623 623 ASN ASN A . n 
C 3 451 ARG 451 624 624 ARG ARG A . n 
C 3 452 ALA 452 625 625 ALA ALA A . n 
C 3 453 VAL 453 626 626 VAL VAL A . n 
C 3 454 ALA 454 627 627 ALA ALA A . n 
C 3 455 ILE 455 628 628 ILE ILE A . n 
C 3 456 LEU 456 629 629 LEU LEU A . n 
C 3 457 CYS 457 630 630 CYS CYS A . n 
C 3 458 ASN 458 631 631 ASN ASN A . n 
C 3 459 HIS 459 632 632 HIS HIS A . n 
C 3 460 GLN 460 633 633 GLN GLN A . n 
C 3 461 ARG 461 634 ?   ?   ?   A . n 
C 3 462 ALA 462 635 ?   ?   ?   A . n 
C 3 463 PRO 463 636 ?   ?   ?   A . n 
C 3 464 PRO 464 637 ?   ?   ?   A . n 
C 3 465 LYS 465 638 ?   ?   ?   A . n 
C 3 466 THR 466 639 ?   ?   ?   A . n 
C 3 467 PHE 467 640 ?   ?   ?   A . n 
C 3 468 GLU 468 641 ?   ?   ?   A . n 
C 3 469 LYS 469 642 ?   ?   ?   A . n 
C 3 470 SER 470 643 ?   ?   ?   A . n 
C 3 471 MET 471 644 644 MET MET A . n 
C 3 472 MET 472 645 645 MET MET A . n 
C 3 473 ASN 473 646 646 ASN ASN A . n 
C 3 474 LEU 474 647 647 LEU LEU A . n 
C 3 475 GLN 475 648 648 GLN GLN A . n 
C 3 476 THR 476 649 649 THR THR A . n 
C 3 477 LYS 477 650 650 LYS LYS A . n 
C 3 478 ILE 478 651 651 ILE ILE A . n 
C 3 479 ASP 479 652 652 ASP ASP A . n 
C 3 480 ALA 480 653 653 ALA ALA A . n 
C 3 481 LYS 481 654 654 LYS LYS A . n 
C 3 482 LYS 482 655 655 LYS LYS A . n 
C 3 483 GLU 483 656 656 GLU GLU A . n 
C 3 484 GLN 484 657 657 GLN GLN A . n 
C 3 485 LEU 485 658 658 LEU LEU A . n 
C 3 486 ALA 486 659 659 ALA ALA A . n 
C 3 487 ASP 487 660 660 ASP ASP A . n 
C 3 488 ALA 488 661 661 ALA ALA A . n 
C 3 489 ARG 489 662 662 ARG ARG A . n 
C 3 490 ARG 490 663 663 ARG ARG A . n 
C 3 491 ASP 491 664 664 ASP ASP A . n 
C 3 492 LEU 492 665 665 LEU LEU A . n 
C 3 493 LYS 493 666 666 LYS LYS A . n 
C 3 494 SER 494 667 667 SER SER A . n 
C 3 495 ALA 495 668 668 ALA ALA A . n 
C 3 496 LYS 496 669 669 LYS LYS A . n 
C 3 497 ALA 497 670 670 ALA ALA A . n 
C 3 498 ASP 498 671 671 ASP ASP A . n 
C 3 499 ALA 499 672 672 ALA ALA A . n 
C 3 500 LYS 500 673 673 LYS LYS A . n 
C 3 501 VAL 501 674 674 VAL VAL A . n 
C 3 502 MET 502 675 675 MET MET A . n 
C 3 503 LYS 503 676 676 LYS LYS A . n 
C 3 504 ASP 504 677 677 ASP ASP A . n 
C 3 505 ALA 505 678 678 ALA ALA A . n 
C 3 506 LYS 506 679 679 LYS LYS A . n 
C 3 507 THR 507 680 680 THR THR A . n 
C 3 508 LYS 508 681 681 LYS LYS A . n 
C 3 509 LYS 509 682 682 LYS LYS A . n 
C 3 510 VAL 510 683 683 VAL VAL A . n 
C 3 511 VAL 511 684 684 VAL VAL A . n 
C 3 512 GLU 512 685 685 GLU GLU A . n 
C 3 513 SER 513 686 686 SER SER A . n 
C 3 514 LYS 514 687 687 LYS LYS A . n 
C 3 515 LYS 515 688 688 LYS LYS A . n 
C 3 516 LYS 516 689 689 LYS LYS A . n 
C 3 517 ALA 517 690 690 ALA ALA A . n 
C 3 518 VAL 518 691 691 VAL VAL A . n 
C 3 519 GLN 519 692 692 GLN GLN A . n 
C 3 520 ARG 520 693 693 ARG ARG A . n 
C 3 521 LEU 521 694 694 LEU LEU A . n 
C 3 522 GLU 522 695 695 GLU GLU A . n 
C 3 523 GLU 523 696 696 GLU GLU A . n 
C 3 524 GLN 524 697 697 GLN GLN A . n 
C 3 525 LEU 525 698 698 LEU LEU A . n 
C 3 526 MET 526 699 699 MET MET A . n 
C 3 527 LYS 527 700 700 LYS LYS A . n 
C 3 528 LEU 528 701 701 LEU LEU A . n 
C 3 529 GLU 529 702 702 GLU GLU A . n 
C 3 530 VAL 530 703 703 VAL VAL A . n 
C 3 531 GLN 531 704 704 GLN GLN A . n 
C 3 532 ALA 532 705 705 ALA ALA A . n 
C 3 533 THR 533 706 706 THR THR A . n 
C 3 534 ASP 534 707 707 ASP ASP A . n 
C 3 535 ARG 535 708 708 ARG ARG A . n 
C 3 536 GLU 536 709 709 GLU GLU A . n 
C 3 537 GLU 537 710 710 GLU GLU A . n 
C 3 538 ASN 538 711 711 ASN ASN A . n 
C 3 539 LYS 539 712 712 LYS LYS A . n 
C 3 540 GLN 540 713 713 GLN GLN A . n 
C 3 541 ILE 541 714 ?   ?   ?   A . n 
C 3 542 ALA 542 715 ?   ?   ?   A . n 
C 3 543 LEU 543 716 ?   ?   ?   A . n 
C 3 544 GLY 544 717 ?   ?   ?   A . n 
C 3 545 THR 545 718 ?   ?   ?   A . n 
C 3 546 SER 546 719 719 SER SER A . n 
C 3 547 LYS 547 720 720 LYS LYS A . n 
C 3 548 LEU 548 721 721 LEU LEU A . n 
C 3 549 ASN 549 722 722 ASN ASN A . n 
C 3 550 PHE 550 723 723 PHE PHE A . n 
C 3 551 LEU 551 724 724 LEU LEU A . n 
C 3 552 ASP 552 725 725 ASP ASP A . n 
C 3 553 PRO 553 726 726 PRO PRO A . n 
C 3 554 ARG 554 727 727 ARG ARG A . n 
C 3 555 ILE 555 728 728 ILE ILE A . n 
C 3 556 THR 556 729 729 THR THR A . n 
C 3 557 VAL 557 730 730 VAL VAL A . n 
C 3 558 ALA 558 731 731 ALA ALA A . n 
C 3 559 TRP 559 732 732 TRP TRP A . n 
C 3 560 CYS 560 733 733 CYS CYS A . n 
C 3 561 LYS 561 734 734 LYS LYS A . n 
C 3 562 LYS 562 735 735 LYS LYS A . n 
C 3 563 TRP 563 736 736 TRP TRP A . n 
C 3 564 GLY 564 737 737 GLY GLY A . n 
C 3 565 VAL 565 738 738 VAL VAL A . n 
C 3 566 PRO 566 739 739 PRO PRO A . n 
C 3 567 ILE 567 740 740 ILE ILE A . n 
C 3 568 GLU 568 741 741 GLU GLU A . n 
C 3 569 LYS 569 742 742 LYS LYS A . n 
C 3 570 ILE 570 743 743 ILE ILE A . n 
C 3 571 TYR 571 744 744 TYR TYR A . n 
C 3 572 ASN 572 745 745 ASN ASN A . n 
C 3 573 LYS 573 746 746 LYS LYS A . n 
C 3 574 THR 574 747 747 THR THR A . n 
C 3 575 GLN 575 748 748 GLN GLN A . n 
C 3 576 ARG 576 749 749 ARG ARG A . n 
C 3 577 GLU 577 750 750 GLU GLU A . n 
C 3 578 LYS 578 751 751 LYS LYS A . n 
C 3 579 PHE 579 752 752 PHE PHE A . n 
C 3 580 ALA 580 753 753 ALA ALA A . n 
C 3 581 TRP 581 754 754 TRP TRP A . n 
C 3 582 ALA 582 755 755 ALA ALA A . n 
C 3 583 ILE 583 756 756 ILE ILE A . n 
C 3 584 ASP 584 757 757 ASP ASP A . n 
C 3 585 MET 585 758 758 MET MET A . n 
C 3 586 ALA 586 759 759 ALA ALA A . n 
C 3 587 ASP 587 760 760 ASP ASP A . n 
C 3 588 GLU 588 761 761 GLU GLU A . n 
C 3 589 ASP 589 762 762 ASP ASP A . n 
C 3 590 TYR 590 763 763 TYR TYR A . n 
C 3 591 GLU 591 764 764 GLU GLU A . n 
C 3 592 PHE 592 765 765 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1  145 145 HOH HOH B . 
E 4 HOH 1  137 137 HOH HOH C . 
E 4 HOH 2  138 138 HOH HOH C . 
E 4 HOH 3  154 154 HOH HOH C . 
F 4 HOH 1  123 123 HOH HOH A . 
F 4 HOH 2  124 124 HOH HOH A . 
F 4 HOH 3  125 125 HOH HOH A . 
F 4 HOH 4  127 127 HOH HOH A . 
F 4 HOH 5  129 129 HOH HOH A . 
F 4 HOH 6  131 131 HOH HOH A . 
F 4 HOH 7  132 132 HOH HOH A . 
F 4 HOH 8  134 134 HOH HOH A . 
F 4 HOH 9  135 135 HOH HOH A . 
F 4 HOH 10 142 142 HOH HOH A . 
F 4 HOH 11 143 143 HOH HOH A . 
F 4 HOH 12 144 144 HOH HOH A . 
F 4 HOH 13 146 146 HOH HOH A . 
F 4 HOH 14 147 147 HOH HOH A . 
F 4 HOH 15 148 148 HOH HOH A . 
F 4 HOH 16 149 149 HOH HOH A . 
F 4 HOH 17 150 150 HOH HOH A . 
F 4 HOH 18 151 151 HOH HOH A . 
F 4 HOH 19 152 152 HOH HOH A . 
F 4 HOH 20 153 153 HOH HOH A . 
F 4 HOH 21 155 155 HOH HOH A . 
F 4 HOH 22 156 156 HOH HOH A . 
F 4 HOH 23 157 157 HOH HOH A . 
F 4 HOH 24 158 158 HOH HOH A . 
F 4 HOH 25 159 159 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-16 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLU 255 ? ? OG1 A THR 258 ? ? 2.04 
2 1 O A ARG 532 ? ? N   A SER 534 ? ? 2.07 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NZ A LYS 204 ? ? 1_555 OE2 A GLU 272 ? ? 1_455 0.42 
2 1 NZ A LYS 204 ? ? 1_555 CD  A GLU 272 ? ? 1_455 1.23 
3 1 CE A LYS 204 ? ? 1_555 OE2 A GLU 272 ? ? 1_455 1.54 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 C5  B DT  9   ? ? C7  B DT  9   ? ? 1.400 1.496 -0.096 0.006 N 
2  1 C5  B DT  10  ? ? C7  B DT  10  ? ? 1.400 1.496 -0.096 0.006 N 
3  1 C5  B DT  18  ? ? C7  B DT  18  ? ? 1.399 1.496 -0.097 0.006 N 
4  1 C5  B DT  19  ? ? C7  B DT  19  ? ? 1.399 1.496 -0.097 0.006 N 
5  1 C5  B DT  21  ? ? C7  B DT  21  ? ? 1.399 1.496 -0.097 0.006 N 
6  1 C5  B DT  22  ? ? C7  B DT  22  ? ? 1.400 1.496 -0.096 0.006 N 
7  1 C5  C DT  106 ? ? C7  C DT  106 ? ? 1.400 1.496 -0.096 0.006 N 
8  1 C5  C DT  107 ? ? C7  C DT  107 ? ? 1.399 1.496 -0.097 0.006 N 
9  1 C5  C DT  108 ? ? C7  C DT  108 ? ? 1.399 1.496 -0.097 0.006 N 
10 1 C5  C DT  109 ? ? C7  C DT  109 ? ? 1.399 1.496 -0.097 0.006 N 
11 1 C5  C DT  110 ? ? C7  C DT  110 ? ? 1.399 1.496 -0.097 0.006 N 
12 1 C5  C DT  116 ? ? C7  C DT  116 ? ? 1.400 1.496 -0.096 0.006 N 
13 1 C5  C DT  118 ? ? C7  C DT  118 ? ? 1.399 1.496 -0.097 0.006 N 
14 1 C5  C DT  119 ? ? C7  C DT  119 ? ? 1.399 1.496 -0.097 0.006 N 
15 1 C5  C DT  120 ? ? C7  C DT  120 ? ? 1.399 1.496 -0.097 0.006 N 
16 1 C5  C DT  121 ? ? C7  C DT  121 ? ? 1.400 1.496 -0.096 0.006 N 
17 1 C5  C DT  122 ? ? C7  C DT  122 ? ? 1.399 1.496 -0.097 0.006 N 
18 1 N   A TRP 203 ? ? CA  A TRP 203 ? ? 1.673 1.459 0.214  0.020 N 
19 1 CA  A TRP 203 ? ? C   A TRP 203 ? ? 2.185 1.525 0.660  0.026 N 
20 1 C   A TRP 203 ? ? O   A TRP 203 ? ? 1.500 1.229 0.271  0.019 N 
21 1 C   A TRP 203 ? ? N   A LYS 204 ? ? 1.612 1.336 0.276  0.023 Y 
22 1 CA  A LYS 204 ? ? CB  A LYS 204 ? ? 1.263 1.535 -0.272 0.022 N 
23 1 CH2 A TRP 205 ? ? CZ2 A TRP 205 ? ? 1.566 1.369 0.197  0.019 N 
24 1 CA  A GLU 208 ? ? CB  A GLU 208 ? ? 1.348 1.535 -0.187 0.022 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C4    B DT  9   ? ? C5    B DT  9   ? ? C7  B DT  9   ? ? 123.44 119.00 4.44   0.60 N 
2  1 C6    B DT  9   ? ? C5    B DT  9   ? ? C7  B DT  9   ? ? 117.44 122.90 -5.46  0.60 N 
3  1 C4    B DT  10  ? ? C5    B DT  10  ? ? C7  B DT  10  ? ? 123.39 119.00 4.39   0.60 N 
4  1 C6    B DT  10  ? ? C5    B DT  10  ? ? C7  B DT  10  ? ? 117.44 122.90 -5.46  0.60 N 
5  1 C4    B DT  18  ? ? C5    B DT  18  ? ? C7  B DT  18  ? ? 123.43 119.00 4.43   0.60 N 
6  1 C6    B DT  18  ? ? C5    B DT  18  ? ? C7  B DT  18  ? ? 117.38 122.90 -5.52  0.60 N 
7  1 C4    B DT  19  ? ? C5    B DT  19  ? ? C7  B DT  19  ? ? 123.42 119.00 4.42   0.60 N 
8  1 C6    B DT  19  ? ? C5    B DT  19  ? ? C7  B DT  19  ? ? 117.18 122.90 -5.72  0.60 N 
9  1 C4    B DT  21  ? ? C5    B DT  21  ? ? C7  B DT  21  ? ? 123.45 119.00 4.45   0.60 N 
10 1 C6    B DT  21  ? ? C5    B DT  21  ? ? C7  B DT  21  ? ? 117.34 122.90 -5.56  0.60 N 
11 1 C4    B DT  22  ? ? C5    B DT  22  ? ? C7  B DT  22  ? ? 123.55 119.00 4.55   0.60 N 
12 1 C6    B DT  22  ? ? C5    B DT  22  ? ? C7  B DT  22  ? ? 117.47 122.90 -5.43  0.60 N 
13 1 C4    C DT  106 ? ? C5    C DT  106 ? ? C7  C DT  106 ? ? 123.61 119.00 4.61   0.60 N 
14 1 C6    C DT  106 ? ? C5    C DT  106 ? ? C7  C DT  106 ? ? 117.63 122.90 -5.27  0.60 N 
15 1 C4    C DT  107 ? ? C5    C DT  107 ? ? C7  C DT  107 ? ? 123.54 119.00 4.54   0.60 N 
16 1 C6    C DT  107 ? ? C5    C DT  107 ? ? C7  C DT  107 ? ? 117.35 122.90 -5.55  0.60 N 
17 1 C4    C DT  108 ? ? C5    C DT  108 ? ? C7  C DT  108 ? ? 123.43 119.00 4.43   0.60 N 
18 1 C6    C DT  108 ? ? C5    C DT  108 ? ? C7  C DT  108 ? ? 117.37 122.90 -5.53  0.60 N 
19 1 C4    C DT  109 ? ? C5    C DT  109 ? ? C7  C DT  109 ? ? 123.49 119.00 4.49   0.60 N 
20 1 C6    C DT  109 ? ? C5    C DT  109 ? ? C7  C DT  109 ? ? 117.40 122.90 -5.50  0.60 N 
21 1 C4    C DT  110 ? ? C5    C DT  110 ? ? C7  C DT  110 ? ? 123.51 119.00 4.51   0.60 N 
22 1 C6    C DT  110 ? ? C5    C DT  110 ? ? C7  C DT  110 ? ? 117.38 122.90 -5.52  0.60 N 
23 1 "O4'" C DC  111 ? ? "C1'" C DC  111 ? ? N1  C DC  111 ? ? 110.36 108.30 2.06   0.30 N 
24 1 "O4'" C DT  112 ? ? "C1'" C DT  112 ? ? N1  C DT  112 ? ? 110.70 108.30 2.40   0.30 N 
25 1 C4    C DT  116 ? ? C5    C DT  116 ? ? C7  C DT  116 ? ? 123.46 119.00 4.46   0.60 N 
26 1 C6    C DT  116 ? ? C5    C DT  116 ? ? C7  C DT  116 ? ? 117.83 122.90 -5.07  0.60 N 
27 1 C4    C DT  118 ? ? C5    C DT  118 ? ? C7  C DT  118 ? ? 123.33 119.00 4.33   0.60 N 
28 1 C6    C DT  118 ? ? C5    C DT  118 ? ? C7  C DT  118 ? ? 117.12 122.90 -5.78  0.60 N 
29 1 C4    C DT  119 ? ? C5    C DT  119 ? ? C7  C DT  119 ? ? 123.30 119.00 4.30   0.60 N 
30 1 C6    C DT  119 ? ? C5    C DT  119 ? ? C7  C DT  119 ? ? 117.34 122.90 -5.56  0.60 N 
31 1 C4    C DT  120 ? ? C5    C DT  120 ? ? C7  C DT  120 ? ? 123.40 119.00 4.40   0.60 N 
32 1 C6    C DT  120 ? ? C5    C DT  120 ? ? C7  C DT  120 ? ? 117.29 122.90 -5.61  0.60 N 
33 1 C4    C DT  121 ? ? C5    C DT  121 ? ? C7  C DT  121 ? ? 123.56 119.00 4.56   0.60 N 
34 1 C6    C DT  121 ? ? C5    C DT  121 ? ? C7  C DT  121 ? ? 117.41 122.90 -5.49  0.60 N 
35 1 C4    C DT  122 ? ? C5    C DT  122 ? ? C7  C DT  122 ? ? 123.32 119.00 4.32   0.60 N 
36 1 C6    C DT  122 ? ? C5    C DT  122 ? ? C7  C DT  122 ? ? 117.12 122.90 -5.78  0.60 N 
37 1 CB    A LYS 202 ? ? CA    A LYS 202 ? ? C   A LYS 202 ? ? 126.68 110.40 16.28  2.00 N 
38 1 C     A LYS 202 ? ? N     A TRP 203 ? ? CA  A TRP 203 ? ? 96.79  121.70 -24.91 2.50 Y 
39 1 CB    A TRP 203 ? ? CA    A TRP 203 ? ? C   A TRP 203 ? ? 74.71  110.40 -35.69 2.00 N 
40 1 N     A TRP 203 ? ? CA    A TRP 203 ? ? CB  A TRP 203 ? ? 82.84  110.60 -27.76 1.80 N 
41 1 N     A TRP 203 ? ? CA    A TRP 203 ? ? C   A TRP 203 ? ? 74.04  111.00 -36.96 2.70 N 
42 1 CA    A TRP 203 ? ? C     A TRP 203 ? ? N   A LYS 204 ? ? 131.11 117.20 13.91  2.20 Y 
43 1 O     A TRP 203 ? ? C     A TRP 203 ? ? N   A LYS 204 ? ? 112.88 122.70 -9.82  1.60 Y 
44 1 C     A TRP 203 ? ? N     A LYS 204 ? ? CA  A LYS 204 ? ? 142.44 121.70 20.74  2.50 Y 
45 1 CB    A LYS 204 ? ? CA    A LYS 204 ? ? C   A LYS 204 ? ? 139.04 110.40 28.64  2.00 N 
46 1 CA    A LYS 204 ? ? CB    A LYS 204 ? ? CG  A LYS 204 ? ? 139.69 113.40 26.29  2.20 N 
47 1 N     A TRP 205 ? ? CA    A TRP 205 ? ? CB  A TRP 205 ? ? 134.47 110.60 23.87  1.80 N 
48 1 CD2   A TRP 205 ? ? CE2   A TRP 205 ? ? CZ2 A TRP 205 ? ? 107.17 122.30 -15.13 1.20 N 
49 1 CG    A TRP 205 ? ? CD2   A TRP 205 ? ? CE3 A TRP 205 ? ? 128.13 133.90 -5.77  0.90 N 
50 1 CZ3   A TRP 205 ? ? CH2   A TRP 205 ? ? CZ2 A TRP 205 ? ? 103.24 121.60 -18.36 1.20 N 
51 1 CH2   A TRP 205 ? ? CZ2   A TRP 205 ? ? CE2 A TRP 205 ? ? 109.11 117.40 -8.29  1.00 N 
52 1 CB    A TRP 206 ? ? CA    A TRP 206 ? ? C   A TRP 206 ? ? 94.49  110.40 -15.91 2.00 N 
53 1 N     A TRP 206 ? ? CA    A TRP 206 ? ? C   A TRP 206 ? ? 133.55 111.00 22.55  2.70 N 
54 1 CB    A GLU 208 ? ? CA    A GLU 208 ? ? C   A GLU 208 ? ? 126.93 110.40 16.53  2.00 N 
55 1 N     A GLU 208 ? ? CA    A GLU 208 ? ? CB  A GLU 208 ? ? 122.71 110.60 12.11  1.80 N 
56 1 CA    A GLU 208 ? ? CB    A GLU 208 ? ? CG  A GLU 208 ? ? 130.82 113.40 17.42  2.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 203 ? ? 170.74  -168.60 
2  1 LYS A 204 ? ? -57.68  -143.74 
3  1 TRP A 205 ? ? 172.90  -36.18  
4  1 ARG A 210 ? ? -5.12   105.13  
5  1 ASN A 237 ? ? -79.12  21.20   
6  1 ASP A 243 ? ? 82.86   24.34   
7  1 LEU A 264 ? ? -78.36  20.20   
8  1 LYS A 321 ? ? -39.73  -36.18  
9  1 ASP A 344 ? ? 46.14   -110.22 
10 1 ALA A 351 ? ? -72.28  -86.11  
11 1 PRO A 397 ? ? -35.95  114.03  
12 1 LYS A 468 ? ? -92.56  32.56   
13 1 ASP A 519 ? ? 43.53   20.12   
14 1 GLN A 521 ? ? 176.63  124.58  
15 1 GLU A 522 ? ? 134.81  108.54  
16 1 ARG A 532 ? ? -36.92  -148.24 
17 1 ASP A 533 ? ? -23.49  77.75   
18 1 SER A 534 ? ? 13.39   45.45   
19 1 PRO A 560 ? ? -33.14  -32.24  
20 1 GLN A 578 ? ? -68.31  4.38    
21 1 ASN A 631 ? ? 43.64   -177.11 
22 1 LYS A 676 ? ? -87.27  46.62   
23 1 ASP A 677 ? ? -77.65  -104.49 
24 1 ALA A 678 ? ? -164.45 -53.28  
25 1 GLU A 696 ? ? -66.94  -71.00  
26 1 ASN A 722 ? ? -142.64 -52.61  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 TRP A 205 ? ? TRP A 206 ? ? 149.31 
2 1 TRP A 206 ? ? GLU A 207 ? ? 143.35 
3 1 GLU A 522 ? ? TYR A 523 ? ? -34.29 
4 1 ALA A 594 ? ? SER A 595 ? ? 148.33 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 TRP A 203 ? ? 15.08  
2 1 TRP A 206 ? ? -24.58 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 CA ? A LYS 204 ? 'WRONG HAND' . 
2 1 CA ? A GLU 208 ? 'WRONG HAND' . 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   TRP 
_pdbx_validate_polymer_linkage.auth_seq_id_1    203 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   LYS 
_pdbx_validate_polymer_linkage.auth_seq_id_2    204 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.61 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B DT  20  ? C7  ? A DT  20  C7  
2  1 Y 1 C DT  112 ? C7  ? B DT  12  C7  
3  1 Y 1 A LYS 202 ? CG  ? C LYS 29  CG  
4  1 Y 1 A LYS 202 ? CD  ? C LYS 29  CD  
5  1 Y 1 A LYS 202 ? CE  ? C LYS 29  CE  
6  1 Y 1 A LYS 202 ? NZ  ? C LYS 29  NZ  
7  1 Y 0 A LYS 202 ? C   ? C LYS 29  C   
8  1 Y 0 A LYS 202 ? O   ? C LYS 29  O   
9  1 Y 0 A LYS 202 ? CB  ? C LYS 29  CB  
10 1 Y 1 A TRP 203 ? CG  ? C TRP 30  CG  
11 1 Y 1 A TRP 203 ? CD1 ? C TRP 30  CD1 
12 1 Y 1 A TRP 203 ? CD2 ? C TRP 30  CD2 
13 1 Y 1 A TRP 203 ? NE1 ? C TRP 30  NE1 
14 1 Y 1 A TRP 203 ? CE2 ? C TRP 30  CE2 
15 1 Y 1 A TRP 203 ? CE3 ? C TRP 30  CE3 
16 1 Y 1 A TRP 203 ? CZ2 ? C TRP 30  CZ2 
17 1 Y 1 A TRP 203 ? CZ3 ? C TRP 30  CZ3 
18 1 Y 1 A TRP 203 ? CH2 ? C TRP 30  CH2 
19 1 Y 0 A TRP 203 ? N   ? C TRP 30  N   
20 1 Y 0 A TRP 203 ? C   ? C TRP 30  C   
21 1 Y 0 A LYS 204 ? CB  ? C LYS 31  CB  
22 1 Y 0 A LYS 204 ? CG  ? C LYS 31  CG  
23 1 Y 0 A LYS 204 ? CD  ? C LYS 31  CD  
24 1 Y 0 A LYS 204 ? CE  ? C LYS 31  CE  
25 1 Y 0 A LYS 204 ? NZ  ? C LYS 31  NZ  
26 1 Y 0 A TRP 205 ? CB  ? C TRP 32  CB  
27 1 Y 0 A TRP 205 ? CG  ? C TRP 32  CG  
28 1 Y 0 A TRP 205 ? CD1 ? C TRP 32  CD1 
29 1 Y 0 A TRP 205 ? CD2 ? C TRP 32  CD2 
30 1 Y 0 A TRP 205 ? NE1 ? C TRP 32  NE1 
31 1 Y 0 A TRP 205 ? CE2 ? C TRP 32  CE2 
32 1 Y 0 A TRP 205 ? CE3 ? C TRP 32  CE3 
33 1 Y 0 A TRP 205 ? CZ3 ? C TRP 32  CZ3 
34 1 Y 0 A TRP 205 ? CH2 ? C TRP 32  CH2 
35 1 Y 0 A TRP 206 ? CA  ? C TRP 33  CA  
36 1 Y 0 A TRP 206 ? CB  ? C TRP 33  CB  
37 1 Y 0 A TRP 206 ? CG  ? C TRP 33  CG  
38 1 Y 0 A TRP 206 ? CD1 ? C TRP 33  CD1 
39 1 Y 0 A TRP 206 ? CD2 ? C TRP 33  CD2 
40 1 Y 0 A TRP 206 ? NE1 ? C TRP 33  NE1 
41 1 Y 0 A TRP 206 ? CE2 ? C TRP 33  CE2 
42 1 Y 0 A TRP 206 ? CE3 ? C TRP 33  CE3 
43 1 Y 0 A TRP 206 ? CZ2 ? C TRP 33  CZ2 
44 1 Y 0 A TRP 206 ? CZ3 ? C TRP 33  CZ3 
45 1 Y 0 A TRP 206 ? CH2 ? C TRP 33  CH2 
46 1 Y 0 A GLU 207 ? CB  ? C GLU 34  CB  
47 1 Y 0 A GLU 207 ? CG  ? C GLU 34  CG  
48 1 Y 0 A GLU 207 ? CD  ? C GLU 34  CD  
49 1 Y 0 A GLU 207 ? OE1 ? C GLU 34  OE1 
50 1 Y 0 A GLU 207 ? OE2 ? C GLU 34  OE2 
51 1 Y 0 A GLU 208 ? CB  ? C GLU 35  CB  
52 1 Y 0 A GLU 208 ? CG  ? C GLU 35  CG  
53 1 Y 0 A GLU 208 ? CD  ? C GLU 35  CD  
54 1 Y 0 A GLU 208 ? OE1 ? C GLU 35  OE1 
55 1 Y 0 A GLU 208 ? OE2 ? C GLU 35  OE2 
56 1 Y 1 A ILE 273 ? CD1 ? C ILE 100 CD1 
57 1 Y 1 A ILE 293 ? CD1 ? C ILE 120 CD1 
58 1 Y 1 A ILE 294 ? CD1 ? C ILE 121 CD1 
59 1 Y 1 A ILE 327 ? CD1 ? C ILE 154 CD1 
60 1 Y 1 A ILE 342 ? CD1 ? C ILE 169 CD1 
61 1 Y 1 A ILE 350 ? CD1 ? C ILE 177 CD1 
62 1 Y 1 A ILE 355 ? CD1 ? C ILE 182 CD1 
63 1 Y 1 A ILE 377 ? CD1 ? C ILE 204 CD1 
64 1 Y 1 A ILE 382 ? CD1 ? C ILE 209 CD1 
65 1 Y 1 A ILE 383 ? CD1 ? C ILE 210 CD1 
66 1 Y 1 A ILE 384 ? CD1 ? C ILE 211 CD1 
67 1 Y 1 A ILE 420 ? CD1 ? C ILE 247 CD1 
68 1 Y 1 A ILE 424 ? CD1 ? C ILE 251 CD1 
69 1 Y 1 A ILE 427 ? CD1 ? C ILE 254 CD1 
70 1 Y 1 A ILE 435 ? CD1 ? C ILE 262 CD1 
71 1 Y 1 A ILE 457 ? CD1 ? C ILE 284 CD1 
72 1 Y 1 A ILE 482 ? CD1 ? C ILE 309 CD1 
73 1 Y 1 A ILE 512 ? CD1 ? C ILE 339 CD1 
74 1 Y 1 A ILE 535 ? CD1 ? C ILE 362 CD1 
75 1 Y 1 A ILE 572 ? CD1 ? C ILE 399 CD1 
76 1 Y 1 A ILE 612 ? CD1 ? C ILE 439 CD1 
77 1 Y 1 A ILE 616 ? CD1 ? C ILE 443 CD1 
78 1 Y 1 A ILE 628 ? CD1 ? C ILE 455 CD1 
79 1 Y 1 A ILE 651 ? CD1 ? C ILE 478 CD1 
80 1 Y 1 A ILE 728 ? CD1 ? C ILE 555 CD1 
81 1 Y 1 A ILE 740 ? CD1 ? C ILE 567 CD1 
82 1 Y 1 A ILE 743 ? CD1 ? C ILE 570 CD1 
83 1 Y 1 A ILE 756 ? CD1 ? C ILE 583 CD1 
84 1 Y 1 A PHE 765 ? O   ? C PHE 592 O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 174 ? C LYS 1   
2  1 Y 1 A LYS 175 ? C LYS 2   
3  1 Y 1 A PRO 176 ? C PRO 3   
4  1 Y 1 A LYS 177 ? C LYS 4   
5  1 Y 1 A ASN 178 ? C ASN 5   
6  1 Y 1 A LYS 179 ? C LYS 6   
7  1 Y 1 A ASP 180 ? C ASP 7   
8  1 Y 1 A LYS 181 ? C LYS 8   
9  1 Y 1 A ASP 182 ? C ASP 9   
10 1 Y 1 A LYS 183 ? C LYS 10  
11 1 Y 1 A LYS 184 ? C LYS 11  
12 1 Y 1 A VAL 185 ? C VAL 12  
13 1 Y 1 A PRO 186 ? C PRO 13  
14 1 Y 1 A GLU 187 ? C GLU 14  
15 1 Y 1 A PRO 188 ? C PRO 15  
16 1 Y 1 A ASP 189 ? C ASP 16  
17 1 Y 1 A ASN 190 ? C ASN 17  
18 1 Y 1 A LYS 191 ? C LYS 18  
19 1 Y 1 A LYS 192 ? C LYS 19  
20 1 Y 1 A LYS 193 ? C LYS 20  
21 1 Y 1 A LYS 194 ? C LYS 21  
22 1 Y 1 A PRO 195 ? C PRO 22  
23 1 Y 1 A LYS 196 ? C LYS 23  
24 1 Y 1 A LYS 197 ? C LYS 24  
25 1 Y 1 A GLU 198 ? C GLU 25  
26 1 Y 1 A GLU 199 ? C GLU 26  
27 1 Y 1 A GLU 200 ? C GLU 27  
28 1 Y 1 A GLN 201 ? C GLN 28  
29 1 Y 1 A LYS 388 ? C LYS 215 
30 1 Y 1 A ARG 634 ? C ARG 461 
31 1 Y 1 A ALA 635 ? C ALA 462 
32 1 Y 1 A PRO 636 ? C PRO 463 
33 1 Y 1 A PRO 637 ? C PRO 464 
34 1 Y 1 A LYS 638 ? C LYS 465 
35 1 Y 1 A THR 639 ? C THR 466 
36 1 Y 1 A PHE 640 ? C PHE 467 
37 1 Y 1 A GLU 641 ? C GLU 468 
38 1 Y 1 A LYS 642 ? C LYS 469 
39 1 Y 1 A SER 643 ? C SER 470 
40 1 Y 1 A ILE 714 ? C ILE 541 
41 1 Y 1 A ALA 715 ? C ALA 542 
42 1 Y 1 A LEU 716 ? C LEU 543 
43 1 Y 1 A GLY 717 ? C GLY 544 
44 1 Y 1 A THR 718 ? C THR 545 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1R49 'double helix'        
1R49 'b-form double helix' 
1R49 'triple helix'        
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 21 1_555 0.269  -0.420 0.752  5.604   -5.118  3.172  1  B_DA2:DT121_C  B 2  ? C 121 ? 20 1 
1 A DA 3  1_555 B DT 20 1_555 -0.196 -0.173 0.833  6.688   -9.968  -1.251 2  B_DA3:DT120_C  B 3  ? C 120 ? 20 1 
1 A DA 4  1_555 B DT 19 1_555 -0.137 0.222  0.566  4.074   -8.336  1.246  3  B_DA4:DT119_C  B 4  ? C 119 ? 20 1 
1 A DA 5  1_555 B DT 18 1_555 0.064  -0.132 0.258  -4.022  -6.369  0.961  4  B_DA5:DT118_C  B 5  ? C 118 ? 20 1 
1 A DG 6  1_555 B DC 17 1_555 0.285  0.078  -0.045 -8.577  -8.284  4.888  5  B_DG6:DC117_C  B 6  ? C 117 ? 19 1 
1 A DA 7  1_555 B DT 16 1_555 0.649  -0.186 -0.012 -3.816  -3.965  4.859  6  B_DA7:DT116_C  B 7  ? C 116 ? 20 1 
1 A DC 8  1_555 B DG 15 1_555 0.327  -0.424 0.053  0.734   -1.363  2.267  7  B_DC8:DG115_C  B 8  ? C 115 ? 19 1 
1 A DT 9  1_555 B DA 14 1_555 0.226  0.028  0.124  -6.284  -2.076  8.991  8  B_DT9:DA114_C  B 9  ? C 114 ? 20 1 
1 A DT 10 1_555 B DA 13 1_555 0.234  -0.255 0.476  -8.479  -6.191  4.690  9  B_DT10:DA113_C B 10 ? C 113 ? 20 1 
1 A DA 11 1_555 B DT 12 1_555 -0.248 -0.239 -0.287 -6.320  5.721   9.251  10 B_DA11:DT112_C B 11 ? C 112 ? 20 1 
1 A DG 12 1_555 B DC 11 1_555 -0.828 -0.282 0.964  17.396  -5.128  2.306  11 B_DG12:DC111_C B 12 ? C 111 ? 19 1 
1 A DA 13 1_555 B DT 10 1_555 0.621  0.226  0.276  7.586   -15.909 4.588  12 B_DA13:DT110_C B 13 ? C 110 ? ?  ? 
1 A DA 14 1_555 B DT 9  1_555 0.646  -0.172 0.286  8.440   -11.919 4.331  13 B_DA14:DT109_C B 14 ? C 109 ? 20 1 
1 A DA 15 1_555 B DT 8  1_555 -0.168 0.002  0.337  10.503  -4.903  0.136  14 B_DA15:DT108_C B 15 ? C 108 ? 20 1 
1 A DA 16 1_555 B DT 7  1_555 -0.162 0.315  -0.648 -0.960  -7.393  4.794  15 B_DA16:DT107_C B 16 ? C 107 ? ?  ? 
1 A DA 17 1_555 B DT 6  1_555 -0.077 -0.058 -0.104 4.808   -3.332  -2.929 16 B_DA17:DT106_C B 17 ? C 106 ? 20 1 
1 A DT 18 1_555 B DA 5  1_555 0.586  -0.326 0.125  -1.243  -5.643  4.037  17 B_DT18:DA105_C B 18 ? C 105 ? 20 1 
1 A DT 19 1_555 B DA 4  1_555 0.537  -0.231 -0.144 2.668   -14.511 -7.253 18 B_DT19:DA104_C B 19 ? C 104 ? 20 1 
1 A DT 20 1_555 B DA 3  1_555 0.617  -0.451 0.231  -10.019 -12.835 -0.249 19 B_DT20:DA103_C B 20 ? C 103 ? 20 1 
1 A DT 21 1_555 B DA 2  1_555 1.175  -0.144 0.556  -18.111 -10.530 -6.909 20 B_DT21:DA102_C B 21 ? C 102 ? 20 1 
1 A DT 22 1_555 B DA 1  1_555 -0.515 -0.143 0.493  -16.274 -5.054  0.819  21 B_DT22:DA101_C B 22 ? C 101 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 21 1_555 A DA 3  1_555 B DT 20 1_555 -0.272 -0.553 3.182 -2.082  2.076  29.243 -1.522 0.102  3.147 4.099   
4.110   29.387 1  BB_DA2DA3:DT120DT121_CC   B 2  ? C 121 ? B 3  ? C 120 ? 
1 A DA 3  1_555 B DT 20 1_555 A DA 4  1_555 B DT 19 1_555 -0.028 -0.088 3.352 1.090   -5.232 36.513 0.589  0.196  3.331 -8.295  
-1.728  36.888 2  BB_DA3DA4:DT119DT120_CC   B 3  ? C 120 ? B 4  ? C 119 ? 
1 A DA 4  1_555 B DT 19 1_555 A DA 5  1_555 B DT 18 1_555 -0.033 -0.176 3.427 0.874   -5.466 39.011 0.419  0.157  3.419 -8.136  
-1.301  39.386 3  BB_DA4DA5:DT118DT119_CC   B 4  ? C 119 ? B 5  ? C 118 ? 
1 A DA 5  1_555 B DT 18 1_555 A DG 6  1_555 B DC 17 1_555 0.494  -0.638 3.354 2.064   -2.962 36.393 -0.594 -0.493 3.415 -4.728  
-3.295  36.566 4  BB_DA5DG6:DC117DT118_CC   B 5  ? C 118 ? B 6  ? C 117 ? 
1 A DG 6  1_555 B DC 17 1_555 A DA 7  1_555 B DT 16 1_555 -0.459 -0.452 3.138 -0.181  -1.324 34.954 -0.560 0.737  3.155 -2.203  
0.301   34.979 5  BB_DG6DA7:DT116DC117_CC   B 6  ? C 117 ? B 7  ? C 116 ? 
1 A DA 7  1_555 B DT 16 1_555 A DC 8  1_555 B DG 15 1_555 0.253  -0.765 3.137 -1.951  -0.659 33.161 -1.233 -0.755 3.132 -1.153  
3.415   33.223 6  BB_DA7DC8:DG115DT116_CC   B 7  ? C 116 ? B 8  ? C 115 ? 
1 A DC 8  1_555 B DG 15 1_555 A DT 9  1_555 B DA 14 1_555 -0.002 -0.619 3.406 1.001   -3.306 36.142 -0.509 0.150  3.446 -5.314  
-1.608  36.301 7  BB_DC8DT9:DA114DG115_CC   B 8  ? C 115 ? B 9  ? C 114 ? 
1 A DT 9  1_555 B DA 14 1_555 A DT 10 1_555 B DA 13 1_555 -0.475 -0.447 3.364 -2.527  -3.251 38.261 -0.259 0.395  3.412 -4.942  
3.841   38.474 8  BB_DT9DT10:DA113DA114_CC  B 9  ? C 114 ? B 10 ? C 113 ? 
1 A DT 10 1_555 B DA 13 1_555 A DA 11 1_555 B DT 12 1_555 0.976  0.099  3.242 6.398   -1.015 34.441 0.320  -0.642 3.360 -1.696  
-10.688 35.027 9  BB_DT10DA11:DT112DA113_CC B 10 ? C 113 ? B 11 ? C 112 ? 
1 A DA 11 1_555 B DT 12 1_555 A DG 12 1_555 B DC 11 1_555 -1.377 0.579  2.731 -11.433 -2.349 29.675 1.444  0.616  2.991 -4.379  
21.314  31.840 10 BB_DA11DG12:DC111DT112_CC B 11 ? C 112 ? B 12 ? C 111 ? 
1 A DG 12 1_555 B DC 11 1_555 A DA 13 1_555 B DT 10 1_555 -0.415 -0.278 3.560 3.603   1.815  37.661 -0.681 1.139  3.490 2.801   
-5.562  37.868 11 BB_DG12DA13:DT110DC111_CC B 12 ? C 111 ? B 13 ? C 110 ? 
1 A DA 13 1_555 B DT 10 1_555 A DA 14 1_555 B DT 9  1_555 -0.188 -0.149 3.157 -2.870  -8.960 34.757 1.004  -0.094 3.104 -14.669 
4.699   35.970 12 BB_DA13DA14:DT109DT110_CC B 13 ? C 110 ? B 14 ? C 109 ? 
1 A DA 14 1_555 B DT 9  1_555 A DA 15 1_555 B DT 8  1_555 -0.068 -0.605 3.066 -2.444  -4.025 36.638 -0.440 -0.205 3.111 -6.370  
3.868   36.929 13 BB_DA14DA15:DT108DT109_CC B 14 ? C 109 ? B 15 ? C 108 ? 
1 A DA 15 1_555 B DT 8  1_555 A DA 16 1_555 B DT 7  1_555 0.141  -0.475 3.522 8.103   -0.348 38.909 -0.655 0.813  3.485 -0.516  
-12.006 39.713 14 BB_DA15DA16:DT107DT108_CC B 15 ? C 108 ? B 16 ? C 107 ? 
1 A DA 16 1_555 B DT 7  1_555 A DA 17 1_555 B DT 6  1_555 -0.035 -0.409 2.970 -5.915  -2.250 31.765 -0.371 -0.890 2.949 -4.061  
10.673  32.374 15 BB_DA16DA17:DT106DT107_CC B 16 ? C 107 ? B 17 ? C 106 ? 
1 A DA 17 1_555 B DT 6  1_555 A DT 18 1_555 B DA 5  1_555 0.097  -0.708 3.321 -1.467  4.315  39.578 -1.540 -0.313 3.223 6.346   
2.158   39.829 16 BB_DA17DT18:DA105DT106_CC B 17 ? C 106 ? B 18 ? C 105 ? 
1 A DT 18 1_555 B DA 5  1_555 A DT 19 1_555 B DA 4  1_555 -0.645 -0.516 3.200 0.164   -5.813 35.076 -0.005 1.080  3.238 -9.564  
-0.271  35.540 17 BB_DT18DT19:DA104DA105_CC B 18 ? C 105 ? B 19 ? C 104 ? 
1 A DT 19 1_555 B DA 4  1_555 A DT 20 1_555 B DA 3  1_555 0.478  -0.499 3.453 -1.489  -0.272 36.076 -0.765 -0.993 3.435 -0.439  
2.403   36.107 18 BB_DT19DT20:DA103DA104_CC B 19 ? C 104 ? B 20 ? C 103 ? 
1 A DT 20 1_555 B DA 3  1_555 A DT 21 1_555 B DA 2  1_555 -1.218 -0.480 3.359 -3.389  -5.409 42.535 -0.093 1.310  3.474 -7.405  
4.640   42.989 19 BB_DT20DT21:DA102DA103_CC B 20 ? C 103 ? B 21 ? C 102 ? 
1 A DT 21 1_555 B DA 2  1_555 A DT 22 1_555 B DA 1  1_555 0.524  -0.751 3.094 3.203   -3.737 30.411 -0.707 -0.381 3.199 -7.065  
-6.057  30.798 20 BB_DT21DT22:DA101DA102_CC B 21 ? C 102 ? B 22 ? C 101 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#