data_1R5C
# 
_entry.id   1R5C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1R5C         
RCSB  RCSB020456   
WWPDB D_1000020456 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1R5D 
_pdbx_database_related.details        'Same protein, unliganded' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R5C 
_pdbx_database_status.recvd_initial_deposition_date   2003-10-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Merlino, A.'    1 
'Vitagliano, L.' 2 
'Sica, F.'       3 
'Zagari, A.'     4 
'Mazzarella, L.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Population shift vs induced fit: The case of bovine seminal ribonuclease swapping dimer' Biopolymers                73  
689  695  2004 BIPMAA US 0006-3525 0161 ? 15048772 10.1002/bip.20016              
1       'BOVINE SEMINAL RIBONUCLEASE: STRUCTURE AT 1.9 A RESOLUTION' 'Acta Crystallogr.,Sect.D' 49  389  402  1993 ABCRE6 DK 
0907-4449 0766 ? ?        10.1107/S0907444993003403      
2       
;Binding of a Substrate Analog to a Domain Swapping Protein: X-Ray Structure of the Complex of Bovine Seminal Ribonuclease with Uridylyl(2'-5')Adenosine
;
'Protein Sci.'             7   1691 1699 1998 PRCIEI US 0961-8368 0795 ? ?        ?                              
3       
'Cosolute Effect on Crystallization of Two Dinucleotide Complexes of Bovine Seminal Ribonuclease from Concentrated Salt Solutions' 
J.Cryst.Growth             168 192  197  1996 JCRGAE NE 0022-0248 0229 ? ?        '10.1016/0022-0248(96)00354-5' 
4       'A potential allosteric subsite generated by domain swapping in bovine seminal ribonuclease' J.Mol.Biol.                
293 569  577  1999 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1999.3158         
5       'Crystallization of Multiple Forms of Bovine Seminal Ribonuclease: the liganded and Unliganded State' J.Cryst.Growth 196 
305  312  1999 JCRGAE NE 0022-0248 0229 ? ?        ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Merlino, A.'    1  
primary 'Vitagliano, L.' 2  
primary 'Sica, F.'       3  
primary 'Zagari, A.'     4  
primary 'Mazzarella, L.' 5  
1       'Mazzarella, L.' 6  
1       'Capasso, S.'    7  
1       'Demasi, D.'     8  
1       'Di Lorenzo, G.' 9  
1       'Mattia, C.A.'   10 
1       'Zagari, A.'     11 
2       'Vitagliano, L.' 12 
2       'Adinolfi, S.'   13 
2       'Riccio, A.'     14 
2       'Sica, F.'       15 
2       'Zagari, A.'     16 
2       'Mazzarella, L.' 17 
3       'Sica, F.'       18 
3       'Adinolfi, S.'   19 
3       'Vitagliano, L.' 20 
3       'Zagari, A.'     21 
3       'Capasso, S.'    22 
3       'Mazzarella, L.' 23 
4       'VITAGLIANO, L.' 24 
4       'Adinolfi, S.'   25 
4       'Sica, F.'       26 
4       'Merlino, A.'    27 
4       'Zagari, A.'     28 
4       'Mazzarella, L.' 29 
# 
_cell.entry_id           1R5C 
_cell.length_a           49.540 
_cell.length_b           60.020 
_cell.length_c           83.690 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1R5C 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Ribonuclease, seminal'                                  13632.640 2  3.1.27.5 ? ? ? 
2 non-polymer syn "2'-DEOXYCYTIDINE-2'-DEOXYADENOSINE-3',5'-MONOPHOSPHATE" 540.424   2  ?        ? ? ? 
3 water       nat water                                                    18.015    91 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Seminal RNase, S-RNase, Ribonuclease BS-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMR
ITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMR
ITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   SER n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   LYS n 
1 8   PHE n 
1 9   GLU n 
1 10  ARG n 
1 11  GLN n 
1 12  HIS n 
1 13  MET n 
1 14  ASP n 
1 15  SER n 
1 16  GLY n 
1 17  ASN n 
1 18  SER n 
1 19  PRO n 
1 20  SER n 
1 21  SER n 
1 22  SER n 
1 23  SER n 
1 24  ASN n 
1 25  TYR n 
1 26  CYS n 
1 27  ASN n 
1 28  LEU n 
1 29  MET n 
1 30  MET n 
1 31  CYS n 
1 32  CYS n 
1 33  ARG n 
1 34  LYS n 
1 35  MET n 
1 36  THR n 
1 37  GLN n 
1 38  GLY n 
1 39  LYS n 
1 40  CYS n 
1 41  LYS n 
1 42  PRO n 
1 43  VAL n 
1 44  ASN n 
1 45  THR n 
1 46  PHE n 
1 47  VAL n 
1 48  HIS n 
1 49  GLU n 
1 50  SER n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  VAL n 
1 55  LYS n 
1 56  ALA n 
1 57  VAL n 
1 58  CYS n 
1 59  SER n 
1 60  GLN n 
1 61  LYS n 
1 62  LYS n 
1 63  VAL n 
1 64  THR n 
1 65  CYS n 
1 66  LYS n 
1 67  ASN n 
1 68  GLY n 
1 69  GLN n 
1 70  THR n 
1 71  ASN n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  SER n 
1 76  LYS n 
1 77  SER n 
1 78  THR n 
1 79  MET n 
1 80  ARG n 
1 81  ILE n 
1 82  THR n 
1 83  ASP n 
1 84  CYS n 
1 85  ARG n 
1 86  GLU n 
1 87  THR n 
1 88  GLY n 
1 89  SER n 
1 90  SER n 
1 91  LYS n 
1 92  TYR n 
1 93  PRO n 
1 94  ASN n 
1 95  CYS n 
1 96  ALA n 
1 97  TYR n 
1 98  LYS n 
1 99  THR n 
1 100 THR n 
1 101 GLN n 
1 102 VAL n 
1 103 GLU n 
1 104 LYS n 
1 105 HIS n 
1 106 ILE n 
1 107 ILE n 
1 108 VAL n 
1 109 ALA n 
1 110 CYS n 
1 111 GLY n 
1 112 GLY n 
1 113 LYS n 
1 114 PRO n 
1 115 SER n 
1 116 VAL n 
1 117 PRO n 
1 118 VAL n 
1 119 HIS n 
1 120 PHE n 
1 121 ASP n 
1 122 ALA n 
1 123 SER n 
1 124 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNS_BOVIN 
_struct_ref.pdbx_db_accession          P00669 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMR
ITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1R5C A 1 ? 124 ? P00669 27 ? 150 ? 1 124 
2 1 1R5C B 1 ? 124 ? P00669 27 ? 150 ? 1 124 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                  ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                 ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                               ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                          ? 'C4 H7 N O4'      133.103 
CPA non-polymer         . "2'-DEOXYCYTIDINE-2'-DEOXYADENOSINE-3',5'-MONOPHOSPHATE" ? 'C19 H25 N8 O9 P' 540.424 
CYS 'L-peptide linking' y CYSTEINE                                                 ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                          ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                  ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                    ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                               ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                  ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                   ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                               ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                            ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                  ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                   ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                                                 ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                   ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1R5C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.07 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pdbx_details    
;62-64% saturation ammonium sulfate, 8-10% 2-methyl-2,4-pentandiol, dinucleotide-protein molar ratio of 8:1, pH 5.4, MICRO-BATCH, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAC Science DIP-2030B' 
_diffrn_detector.pdbx_collection_date   2000-11-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ENRAF-NONIUS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1R5C 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.10 
_reflns.d_resolution_low             20.00 
_reflns.number_all                   13184 
_reflns.number_obs                   13184 
_reflns.percent_possible_obs         87 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           0.279 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1R5C 
_refine.ls_d_res_high                            2.1 
_refine.ls_d_res_low                             8.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     12521 
_refine.ls_number_reflns_obs                     12054 
_refine.ls_number_reflns_R_free                  615 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.2 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1BSR' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1882 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         74 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               2047 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1R5C 
_struct.title                     'X-ray structure of the complex of Bovine seminal ribonuclease swapping dimer with d(CpA)' 
_struct.pdbx_descriptor           'Ribonuclease, seminal (E.C.3.1.27.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R5C 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'ribonucleases, protein dynamics, protein structure-function, ligand binding, population shift, 3D domain swapping, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3  ? MET A 13 ? SER A 3  MET A 13 1 ? 11 
HELX_P HELX_P2  2  SER A 21 ? SER A 23 ? SER A 21 SER A 23 5 ? 3  
HELX_P HELX_P3  3  ASN A 24 ? ARG A 33 ? ASN A 24 ARG A 33 1 ? 10 
HELX_P HELX_P4  4  SER A 50 ? VAL A 57 ? SER A 50 VAL A 57 1 ? 8  
HELX_P HELX_P5  5  CYS A 58 ? GLN A 60 ? CYS A 58 GLN A 60 5 ? 3  
HELX_P HELX_P6  6  SER B 3  ? MET B 13 ? SER B 3  MET B 13 1 ? 11 
HELX_P HELX_P7  7  SER B 21 ? SER B 23 ? SER B 21 SER B 23 5 ? 3  
HELX_P HELX_P8  8  ASN B 24 ? ARG B 33 ? ASN B 24 ARG B 33 1 ? 10 
HELX_P HELX_P9  9  SER B 50 ? ALA B 56 ? SER B 50 ALA B 56 1 ? 7  
HELX_P HELX_P10 10 VAL B 57 ? GLN B 60 ? VAL B 57 GLN B 60 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84  SG ? ? A CYS 26 A CYS 84  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2  disulf ? ? A CYS 31 SG ? ? ? 1_555 B CYS 32  SG ? ? A CYS 31 B CYS 32  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf3  disulf ? ? A CYS 32 SG ? ? ? 1_555 B CYS 31  SG ? ? A CYS 32 B CYS 31  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4  disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 40 A CYS 95  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf5  disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf6  disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72  SG ? ? A CYS 65 A CYS 72  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf7  disulf ? ? B CYS 26 SG ? ? ? 1_555 B CYS 84  SG ? ? B CYS 26 B CYS 84  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf8  disulf ? ? B CYS 40 SG ? ? ? 1_555 B CYS 95  SG ? ? B CYS 40 B CYS 95  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf9  disulf ? ? B CYS 58 SG ? ? ? 1_555 B CYS 110 SG ? ? B CYS 58 B CYS 110 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf10 disulf ? ? B CYS 65 SG ? ? ? 1_555 B CYS 72  SG ? ? B CYS 65 B CYS 72  1_555 ? ? ? ? ? ? ? 2.020 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 92  A . ? TYR 92  A PRO 93  A ? PRO 93  A 1 -0.18 
2 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 1 -0.02 
3 TYR 92  B . ? TYR 92  B PRO 93  B ? PRO 93  B 1 0.11  
4 LYS 113 B . ? LYS 113 B PRO 114 B ? PRO 114 B 1 0.79  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 43  ? VAL A 47  ? VAL A 43  VAL A 47  
A 2 MET A 79  ? GLU A 86  ? MET A 79  GLU A 86  
A 3 TYR A 97  ? GLY A 111 ? TYR A 97  GLY A 111 
A 4 CYS A 72  ? GLN A 74  ? CYS A 72  GLN A 74  
A 5 LYS A 61  ? VAL A 63  ? LYS A 61  VAL A 63  
B 1 VAL A 43  ? VAL A 47  ? VAL A 43  VAL A 47  
B 2 MET A 79  ? GLU A 86  ? MET A 79  GLU A 86  
B 3 TYR A 97  ? GLY A 111 ? TYR A 97  GLY A 111 
B 4 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 
C 1 VAL B 43  ? VAL B 47  ? VAL B 43  VAL B 47  
C 2 MET B 79  ? GLU B 86  ? MET B 79  GLU B 86  
C 3 TYR B 97  ? GLY B 111 ? TYR B 97  GLY B 111 
C 4 CYS B 72  ? GLN B 74  ? CYS B 72  GLN B 74  
C 5 LYS B 61  ? VAL B 63  ? LYS B 61  VAL B 63  
D 1 VAL B 43  ? VAL B 47  ? VAL B 43  VAL B 47  
D 2 MET B 79  ? GLU B 86  ? MET B 79  GLU B 86  
D 3 TYR B 97  ? GLY B 111 ? TYR B 97  GLY B 111 
D 4 VAL B 116 ? VAL B 124 ? VAL B 116 VAL B 124 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 46  ? N PHE A 46  O THR A 82  ? O THR A 82  
A 2 3 N ASP A 83  ? N ASP A 83  O THR A 100 ? O THR A 100 
A 3 4 O VAL A 108 ? O VAL A 108 N TYR A 73  ? N TYR A 73  
A 4 5 O GLN A 74  ? O GLN A 74  N LYS A 61  ? N LYS A 61  
B 1 2 N PHE A 46  ? N PHE A 46  O THR A 82  ? O THR A 82  
B 2 3 N ASP A 83  ? N ASP A 83  O THR A 100 ? O THR A 100 
B 3 4 N ALA A 109 ? N ALA A 109 O VAL A 118 ? O VAL A 118 
C 1 2 N PHE B 46  ? N PHE B 46  O THR B 82  ? O THR B 82  
C 2 3 N ASP B 83  ? N ASP B 83  O THR B 100 ? O THR B 100 
C 3 4 O VAL B 108 ? O VAL B 108 N TYR B 73  ? N TYR B 73  
C 4 5 O CYS B 72  ? O CYS B 72  N VAL B 63  ? N VAL B 63  
D 1 2 N PHE B 46  ? N PHE B 46  O THR B 82  ? O THR B 82  
D 2 3 N ASP B 83  ? N ASP B 83  O THR B 100 ? O THR B 100 
D 3 4 N HIS B 105 ? N HIS B 105 O VAL B 124 ? O VAL B 124 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CPA A 125' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CPA B 126' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LYS A 41  ? LYS A 41  . ? 1_555 ? 
2  AC1 15 VAL A 43  ? VAL A 43  . ? 1_555 ? 
3  AC1 15 ASN A 44  ? ASN A 44  . ? 1_555 ? 
4  AC1 15 THR A 45  ? THR A 45  . ? 1_555 ? 
5  AC1 15 CYS A 65  ? CYS A 65  . ? 1_555 ? 
6  AC1 15 ASN A 67  ? ASN A 67  . ? 1_555 ? 
7  AC1 15 GLN A 69  ? GLN A 69  . ? 1_555 ? 
8  AC1 15 ASN A 71  ? ASN A 71  . ? 1_555 ? 
9  AC1 15 ALA A 109 ? ALA A 109 . ? 1_555 ? 
10 AC1 15 HIS A 119 ? HIS A 119 . ? 1_555 ? 
11 AC1 15 PHE A 120 ? PHE A 120 . ? 1_555 ? 
12 AC1 15 HOH E .   ? HOH A 210 . ? 1_555 ? 
13 AC1 15 GLN B 11  ? GLN B 11  . ? 1_555 ? 
14 AC1 15 HIS B 12  ? HIS B 12  . ? 1_555 ? 
15 AC1 15 CPA D .   ? CPA B 126 . ? 3_655 ? 
16 AC2 17 GLN A 11  ? GLN A 11  . ? 1_555 ? 
17 AC2 17 HIS A 12  ? HIS A 12  . ? 1_555 ? 
18 AC2 17 CPA C .   ? CPA A 125 . ? 3_645 ? 
19 AC2 17 LYS B 41  ? LYS B 41  . ? 1_555 ? 
20 AC2 17 VAL B 43  ? VAL B 43  . ? 1_555 ? 
21 AC2 17 ASN B 44  ? ASN B 44  . ? 1_555 ? 
22 AC2 17 THR B 45  ? THR B 45  . ? 1_555 ? 
23 AC2 17 ASN B 67  ? ASN B 67  . ? 1_555 ? 
24 AC2 17 GLN B 69  ? GLN B 69  . ? 1_555 ? 
25 AC2 17 ASN B 71  ? ASN B 71  . ? 1_555 ? 
26 AC2 17 ALA B 109 ? ALA B 109 . ? 1_555 ? 
27 AC2 17 VAL B 118 ? VAL B 118 . ? 1_555 ? 
28 AC2 17 HIS B 119 ? HIS B 119 . ? 1_555 ? 
29 AC2 17 PHE B 120 ? PHE B 120 . ? 1_555 ? 
30 AC2 17 HOH F .   ? HOH B 139 . ? 1_555 ? 
31 AC2 17 HOH F .   ? HOH B 149 . ? 1_555 ? 
32 AC2 17 HOH F .   ? HOH B 649 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1R5C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1R5C 
_atom_sites.fract_transf_matrix[1][1]   0.02019 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01666 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01195 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 1   ? 15.765  22.868 33.067  1.00 43.66 ? 1   LYS A N   1 
ATOM   2    C CA  . LYS A 1 1   ? 15.523  21.745 32.108  1.00 42.58 ? 1   LYS A CA  1 
ATOM   3    C C   . LYS A 1 1   ? 14.584  22.190 30.985  1.00 40.04 ? 1   LYS A C   1 
ATOM   4    O O   . LYS A 1 1   ? 13.684  23.015 31.198  1.00 40.78 ? 1   LYS A O   1 
ATOM   5    C CB  . LYS A 1 1   ? 14.883  20.530 32.812  1.00 44.96 ? 1   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 1   ? 15.323  20.275 34.258  1.00 49.21 ? 1   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 1   ? 14.595  21.194 35.268  1.00 50.84 ? 1   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 1   ? 15.118  20.996 36.700  1.00 51.80 ? 1   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 1   ? 16.599  21.225 36.801  1.00 52.55 ? 1   LYS A NZ  1 
ATOM   10   N N   . GLU A 1 2   ? 14.827  21.685 29.779  1.00 35.89 ? 2   GLU A N   1 
ATOM   11   C CA  . GLU A 1 2   ? 13.955  21.994 28.654  1.00 30.52 ? 2   GLU A CA  1 
ATOM   12   C C   . GLU A 1 2   ? 12.704  21.152 28.893  1.00 27.97 ? 2   GLU A C   1 
ATOM   13   O O   . GLU A 1 2   ? 12.799  19.947 29.162  1.00 26.20 ? 2   GLU A O   1 
ATOM   14   C CB  . GLU A 1 2   ? 14.605  21.591 27.332  1.00 31.12 ? 2   GLU A CB  1 
ATOM   15   C CG  . GLU A 1 2   ? 13.710  21.794 26.116  1.00 29.91 ? 2   GLU A CG  1 
ATOM   16   C CD  . GLU A 1 2   ? 14.444  21.600 24.808  1.00 29.79 ? 2   GLU A CD  1 
ATOM   17   O OE1 . GLU A 1 2   ? 15.246  20.646 24.702  1.00 30.21 ? 2   GLU A OE1 1 
ATOM   18   O OE2 . GLU A 1 2   ? 14.228  22.416 23.892  1.00 29.22 ? 2   GLU A OE2 1 
ATOM   19   N N   . SER A 1 3   ? 11.549  21.805 28.919  1.00 23.86 ? 3   SER A N   1 
ATOM   20   C CA  . SER A 1 3   ? 10.305  21.089 29.133  1.00 19.53 ? 3   SER A CA  1 
ATOM   21   C C   . SER A 1 3   ? 10.082  20.117 27.979  1.00 16.65 ? 3   SER A C   1 
ATOM   22   O O   . SER A 1 3   ? 10.690  20.260 26.917  1.00 13.58 ? 3   SER A O   1 
ATOM   23   C CB  . SER A 1 3   ? 9.137   22.074 29.227  1.00 20.59 ? 3   SER A CB  1 
ATOM   24   O OG  . SER A 1 3   ? 8.860   22.677 27.972  1.00 20.14 ? 3   SER A OG  1 
ATOM   25   N N   . ALA A 1 4   ? 9.247   19.110 28.214  1.00 14.44 ? 4   ALA A N   1 
ATOM   26   C CA  . ALA A 1 4   ? 8.923   18.130 27.180  1.00 15.20 ? 4   ALA A CA  1 
ATOM   27   C C   . ALA A 1 4   ? 8.188   18.807 26.010  1.00 13.77 ? 4   ALA A C   1 
ATOM   28   O O   . ALA A 1 4   ? 8.403   18.462 24.858  1.00 13.23 ? 4   ALA A O   1 
ATOM   29   C CB  . ALA A 1 4   ? 8.070   16.978 27.768  1.00 13.94 ? 4   ALA A CB  1 
ATOM   30   N N   . ALA A 1 5   ? 7.324   19.775 26.315  1.00 14.71 ? 5   ALA A N   1 
ATOM   31   C CA  . ALA A 1 5   ? 6.569   20.489 25.274  1.00 13.45 ? 5   ALA A CA  1 
ATOM   32   C C   . ALA A 1 5   ? 7.494   21.278 24.370  1.00 13.31 ? 5   ALA A C   1 
ATOM   33   O O   . ALA A 1 5   ? 7.348   21.272 23.149  1.00 11.61 ? 5   ALA A O   1 
ATOM   34   C CB  . ALA A 1 5   ? 5.560   21.426 25.905  1.00 14.74 ? 5   ALA A CB  1 
ATOM   35   N N   . ALA A 1 6   ? 8.452   21.967 24.987  1.00 13.53 ? 6   ALA A N   1 
ATOM   36   C CA  . ALA A 1 6   ? 9.413   22.774 24.246  1.00 12.11 ? 6   ALA A CA  1 
ATOM   37   C C   . ALA A 1 6   ? 10.372  21.903 23.442  1.00 12.25 ? 6   ALA A C   1 
ATOM   38   O O   . ALA A 1 6   ? 10.750  22.256 22.332  1.00 13.05 ? 6   ALA A O   1 
ATOM   39   C CB  . ALA A 1 6   ? 10.173  23.697 25.191  1.00 13.75 ? 6   ALA A CB  1 
ATOM   40   N N   . LYS A 1 7   ? 10.742  20.750 23.990  1.00 11.96 ? 7   LYS A N   1 
ATOM   41   C CA  . LYS A 1 7   ? 11.624  19.834 23.283  1.00 11.50 ? 7   LYS A CA  1 
ATOM   42   C C   . LYS A 1 7   ? 10.900  19.337 22.025  1.00 10.88 ? 7   LYS A C   1 
ATOM   43   O O   . LYS A 1 7   ? 11.465  19.326 20.931  1.00 12.02 ? 7   LYS A O   1 
ATOM   44   C CB  . LYS A 1 7   ? 12.009  18.677 24.196  1.00 13.18 ? 7   LYS A CB  1 
ATOM   45   C CG  . LYS A 1 7   ? 12.910  17.643 23.565  1.00 17.89 ? 7   LYS A CG  1 
ATOM   46   C CD  . LYS A 1 7   ? 13.240  16.539 24.566  1.00 21.92 ? 7   LYS A CD  1 
ATOM   47   C CE  . LYS A 1 7   ? 14.064  15.431 23.914  1.00 27.86 ? 7   LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 7   ? 14.312  14.260 24.831  1.00 30.80 ? 7   LYS A NZ  1 
ATOM   49   N N   . PHE A 1 8   ? 9.627   18.990 22.169  1.00 9.65  ? 8   PHE A N   1 
ATOM   50   C CA  . PHE A 1 8   ? 8.850   18.526 21.033  1.00 8.66  ? 8   PHE A CA  1 
ATOM   51   C C   . PHE A 1 8   ? 8.810   19.580 19.940  1.00 9.38  ? 8   PHE A C   1 
ATOM   52   O O   . PHE A 1 8   ? 8.924   19.247 18.773  1.00 10.30 ? 8   PHE A O   1 
ATOM   53   C CB  . PHE A 1 8   ? 7.425   18.141 21.433  1.00 8.02  ? 8   PHE A CB  1 
ATOM   54   C CG  . PHE A 1 8   ? 6.590   17.687 20.272  1.00 8.36  ? 8   PHE A CG  1 
ATOM   55   C CD1 . PHE A 1 8   ? 5.898   18.607 19.496  1.00 7.93  ? 8   PHE A CD1 1 
ATOM   56   C CD2 . PHE A 1 8   ? 6.557   16.348 19.910  1.00 8.78  ? 8   PHE A CD2 1 
ATOM   57   C CE1 . PHE A 1 8   ? 5.193   18.207 18.375  1.00 10.64 ? 8   PHE A CE1 1 
ATOM   58   C CE2 . PHE A 1 8   ? 5.851   15.930 18.784  1.00 9.24  ? 8   PHE A CE2 1 
ATOM   59   C CZ  . PHE A 1 8   ? 5.169   16.857 18.014  1.00 10.24 ? 8   PHE A CZ  1 
ATOM   60   N N   . GLU A 1 9   ? 8.573   20.840 20.303  1.00 10.66 ? 9   GLU A N   1 
ATOM   61   C CA  . GLU A 1 9   ? 8.543   21.937 19.328  1.00 12.12 ? 9   GLU A CA  1 
ATOM   62   C C   . GLU A 1 9   ? 9.887   22.085 18.610  1.00 12.10 ? 9   GLU A C   1 
ATOM   63   O O   . GLU A 1 9   ? 9.935   22.162 17.383  1.00 12.92 ? 9   GLU A O   1 
ATOM   64   C CB  . GLU A 1 9   ? 8.167   23.255 20.012  1.00 13.98 ? 9   GLU A CB  1 
ATOM   65   C CG  . GLU A 1 9   ? 6.742   23.259 20.547  1.00 17.87 ? 9   GLU A CG  1 
ATOM   66   C CD  . GLU A 1 9   ? 6.276   24.635 20.979  1.00 20.32 ? 9   GLU A CD  1 
ATOM   67   O OE1 . GLU A 1 9   ? 6.546   25.615 20.252  1.00 21.56 ? 9   GLU A OE1 1 
ATOM   68   O OE2 . GLU A 1 9   ? 5.636   24.743 22.050  1.00 22.71 ? 9   GLU A OE2 1 
ATOM   69   N N   . ARG A 1 10  ? 10.979  22.085 19.368  1.00 11.33 ? 10  ARG A N   1 
ATOM   70   C CA  . ARG A 1 10  ? 12.312  22.187 18.778  1.00 11.06 ? 10  ARG A CA  1 
ATOM   71   C C   . ARG A 1 10  ? 12.615  21.005 17.842  1.00 11.41 ? 10  ARG A C   1 
ATOM   72   O O   . ARG A 1 10  ? 13.134  21.186 16.747  1.00 9.62  ? 10  ARG A O   1 
ATOM   73   C CB  . ARG A 1 10  ? 13.371  22.230 19.882  1.00 12.34 ? 10  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 10  ? 14.826  22.094 19.392  1.00 12.02 ? 10  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 10  ? 15.855  22.225 20.537  1.00 12.90 ? 10  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 10  ? 15.729  21.196 21.577  1.00 12.70 ? 10  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 10  ? 16.224  19.959 21.501  1.00 14.89 ? 10  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 10  ? 16.900  19.562 20.421  1.00 13.97 ? 10  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 10  ? 16.017  19.098 22.497  1.00 14.31 ? 10  ARG A NH2 1 
ATOM   80   N N   . GLN A 1 11  ? 12.280  19.791 18.258  1.00 11.04 ? 11  GLN A N   1 
ATOM   81   C CA  . GLN A 1 11  ? 12.604  18.640 17.426  1.00 12.45 ? 11  GLN A CA  1 
ATOM   82   C C   . GLN A 1 11  ? 11.687  18.298 16.267  1.00 12.55 ? 11  GLN A C   1 
ATOM   83   O O   . GLN A 1 11  ? 12.147  17.718 15.279  1.00 10.96 ? 11  GLN A O   1 
ATOM   84   C CB  . GLN A 1 11  ? 12.741  17.388 18.277  1.00 13.23 ? 11  GLN A CB  1 
ATOM   85   C CG  . GLN A 1 11  ? 13.764  17.472 19.377  1.00 15.80 ? 11  GLN A CG  1 
ATOM   86   C CD  . GLN A 1 11  ? 14.041  16.104 19.972  1.00 18.97 ? 11  GLN A CD  1 
ATOM   87   O OE1 . GLN A 1 11  ? 15.149  15.576 19.864  1.00 22.90 ? 11  GLN A OE1 1 
ATOM   88   N NE2 . GLN A 1 11  ? 13.035  15.518 20.589  1.00 20.93 ? 11  GLN A NE2 1 
ATOM   89   N N   . HIS A 1 12  ? 10.416  18.693 16.355  1.00 10.99 ? 12  HIS A N   1 
ATOM   90   C CA  . HIS A 1 12  ? 9.446   18.303 15.330  1.00 11.54 ? 12  HIS A CA  1 
ATOM   91   C C   . HIS A 1 12  ? 8.570   19.312 14.628  1.00 10.81 ? 12  HIS A C   1 
ATOM   92   O O   . HIS A 1 12  ? 7.802   18.922 13.750  1.00 11.47 ? 12  HIS A O   1 
ATOM   93   C CB  . HIS A 1 12  ? 8.508   17.261 15.921  1.00 7.46  ? 12  HIS A CB  1 
ATOM   94   C CG  . HIS A 1 12  ? 9.214   16.050 16.421  1.00 7.68  ? 12  HIS A CG  1 
ATOM   95   N ND1 . HIS A 1 12  ? 9.739   15.098 15.574  1.00 6.12  ? 12  HIS A ND1 1 
ATOM   96   C CD2 . HIS A 1 12  ? 9.484   15.633 17.678  1.00 5.75  ? 12  HIS A CD2 1 
ATOM   97   C CE1 . HIS A 1 12  ? 10.301  14.142 16.289  1.00 7.39  ? 12  HIS A CE1 1 
ATOM   98   N NE2 . HIS A 1 12  ? 10.161  14.442 17.568  1.00 6.08  ? 12  HIS A NE2 1 
ATOM   99   N N   . MET A 1 13  ? 8.615   20.566 15.044  1.00 9.99  ? 13  MET A N   1 
ATOM   100  C CA  . MET A 1 13  ? 7.760   21.577 14.443  1.00 9.88  ? 13  MET A CA  1 
ATOM   101  C C   . MET A 1 13  ? 8.470   22.536 13.509  1.00 11.94 ? 13  MET A C   1 
ATOM   102  O O   . MET A 1 13  ? 9.546   23.039 13.820  1.00 12.97 ? 13  MET A O   1 
ATOM   103  C CB  . MET A 1 13  ? 7.029   22.372 15.535  1.00 8.40  ? 13  MET A CB  1 
ATOM   104  C CG  . MET A 1 13  ? 6.009   21.575 16.366  1.00 7.59  ? 13  MET A CG  1 
ATOM   105  S SD  . MET A 1 13  ? 4.618   20.871 15.394  1.00 12.06 ? 13  MET A SD  1 
ATOM   106  C CE  . MET A 1 13  ? 4.000   22.293 14.589  1.00 7.97  ? 13  MET A CE  1 
ATOM   107  N N   . ASP A 1 14  ? 7.917   22.686 12.311  1.00 11.72 ? 14  ASP A N   1 
ATOM   108  C CA  . ASP A 1 14  ? 8.443   23.629 11.337  1.00 12.69 ? 14  ASP A CA  1 
ATOM   109  C C   . ASP A 1 14  ? 7.284   24.025 10.442  1.00 12.29 ? 14  ASP A C   1 
ATOM   110  O O   . ASP A 1 14  ? 7.231   23.692 9.254   1.00 12.48 ? 14  ASP A O   1 
ATOM   111  C CB  . ASP A 1 14  ? 9.591   23.046 10.516  1.00 12.39 ? 14  ASP A CB  1 
ATOM   112  C CG  . ASP A 1 14  ? 10.249  24.093 9.620   1.00 14.08 ? 14  ASP A CG  1 
ATOM   113  O OD1 . ASP A 1 14  ? 10.208  25.292 9.961   1.00 14.37 ? 14  ASP A OD1 1 
ATOM   114  O OD2 . ASP A 1 14  ? 10.789  23.720 8.565   1.00 15.15 ? 14  ASP A OD2 1 
ATOM   115  N N   . SER A 1 15  ? 6.324   24.697 11.058  1.00 13.97 ? 15  SER A N   1 
ATOM   116  C CA  . SER A 1 15  ? 5.105   25.133 10.400  1.00 16.44 ? 15  SER A CA  1 
ATOM   117  C C   . SER A 1 15  ? 5.360   26.026 9.191   1.00 18.21 ? 15  SER A C   1 
ATOM   118  O O   . SER A 1 15  ? 6.135   26.970 9.269   1.00 18.08 ? 15  SER A O   1 
ATOM   119  C CB  . SER A 1 15  ? 4.218   25.848 11.420  1.00 14.68 ? 15  SER A CB  1 
ATOM   120  O OG  . SER A 1 15  ? 3.878   24.977 12.479  1.00 15.71 ? 15  SER A OG  1 
ATOM   121  N N   . GLY A 1 16  ? 4.682   25.743 8.081   1.00 21.61 ? 16  GLY A N   1 
ATOM   122  C CA  . GLY A 1 16  ? 4.864   26.543 6.877   1.00 25.05 ? 16  GLY A CA  1 
ATOM   123  C C   . GLY A 1 16  ? 4.528   25.797 5.597   1.00 28.29 ? 16  GLY A C   1 
ATOM   124  O O   . GLY A 1 16  ? 4.417   24.570 5.597   1.00 28.22 ? 16  GLY A O   1 
ATOM   125  N N   . ASN A 1 17  ? 4.403   26.545 4.502   1.00 30.62 ? 17  ASN A N   1 
ATOM   126  C CA  . ASN A 1 17  ? 4.062   25.999 3.187   1.00 33.18 ? 17  ASN A CA  1 
ATOM   127  C C   . ASN A 1 17  ? 5.232   25.435 2.401   1.00 34.94 ? 17  ASN A C   1 
ATOM   128  O O   . ASN A 1 17  ? 5.124   24.359 1.807   1.00 35.66 ? 17  ASN A O   1 
ATOM   129  C CB  . ASN A 1 17  ? 3.400   27.069 2.328   1.00 33.92 ? 17  ASN A CB  1 
ATOM   130  C CG  . ASN A 1 17  ? 1.910   27.028 2.409   1.00 35.92 ? 17  ASN A CG  1 
ATOM   131  O OD1 . ASN A 1 17  ? 1.306   25.956 2.359   1.00 35.98 ? 17  ASN A OD1 1 
ATOM   132  N ND2 . ASN A 1 17  ? 1.292   28.202 2.506   1.00 36.19 ? 17  ASN A ND2 1 
ATOM   133  N N   . SER A 1 18  ? 6.323   26.200 2.335   1.00 36.11 ? 18  SER A N   1 
ATOM   134  C CA  . SER A 1 18  ? 7.515   25.779 1.599   1.00 37.94 ? 18  SER A CA  1 
ATOM   135  C C   . SER A 1 18  ? 8.726   25.703 2.529   1.00 38.84 ? 18  SER A C   1 
ATOM   136  O O   . SER A 1 18  ? 9.613   26.564 2.485   1.00 38.32 ? 18  SER A O   1 
ATOM   137  C CB  . SER A 1 18  ? 7.809   26.740 0.434   1.00 38.71 ? 18  SER A CB  1 
ATOM   138  O OG  . SER A 1 18  ? 6.764   26.744 -0.530  1.00 40.04 ? 18  SER A OG  1 
ATOM   139  N N   . PRO A 1 19  ? 8.768   24.668 3.395   1.00 39.82 ? 19  PRO A N   1 
ATOM   140  C CA  . PRO A 1 19  ? 9.876   24.478 4.343   1.00 39.41 ? 19  PRO A CA  1 
ATOM   141  C C   . PRO A 1 19  ? 11.220  24.143 3.671   1.00 38.45 ? 19  PRO A C   1 
ATOM   142  O O   . PRO A 1 19  ? 12.274  24.579 4.126   1.00 37.77 ? 19  PRO A O   1 
ATOM   143  C CB  . PRO A 1 19  ? 9.361   23.340 5.233   1.00 39.83 ? 19  PRO A CB  1 
ATOM   144  C CG  . PRO A 1 19  ? 8.472   22.550 4.299   1.00 39.23 ? 19  PRO A CG  1 
ATOM   145  C CD  . PRO A 1 19  ? 7.733   23.625 3.573   1.00 39.10 ? 19  PRO A CD  1 
ATOM   146  N N   . SER A 1 20  ? 11.162  23.393 2.572   1.00 38.76 ? 20  SER A N   1 
ATOM   147  C CA  . SER A 1 20  ? 12.360  22.994 1.820   1.00 39.11 ? 20  SER A CA  1 
ATOM   148  C C   . SER A 1 20  ? 12.771  23.997 0.729   1.00 39.03 ? 20  SER A C   1 
ATOM   149  O O   . SER A 1 20  ? 13.591  23.684 -0.142  1.00 37.72 ? 20  SER A O   1 
ATOM   150  C CB  . SER A 1 20  ? 12.134  21.617 1.195   1.00 39.72 ? 20  SER A CB  1 
ATOM   151  O OG  . SER A 1 20  ? 10.902  21.588 0.489   1.00 41.69 ? 20  SER A OG  1 
ATOM   152  N N   . SER A 1 21  ? 12.159  25.183 0.760   1.00 38.48 ? 21  SER A N   1 
ATOM   153  C CA  . SER A 1 21  ? 12.434  26.253 -0.203  1.00 37.93 ? 21  SER A CA  1 
ATOM   154  C C   . SER A 1 21  ? 13.873  26.765 -0.103  1.00 37.64 ? 21  SER A C   1 
ATOM   155  O O   . SER A 1 21  ? 14.388  26.996 0.997   1.00 37.71 ? 21  SER A O   1 
ATOM   156  C CB  . SER A 1 21  ? 11.472  27.415 0.033   1.00 37.54 ? 21  SER A CB  1 
ATOM   157  O OG  . SER A 1 21  ? 11.590  28.380 -0.994  1.00 39.92 ? 21  SER A OG  1 
ATOM   158  N N   . SER A 1 22  ? 14.513  26.966 -1.251  1.00 37.10 ? 22  SER A N   1 
ATOM   159  C CA  . SER A 1 22  ? 15.891  27.451 -1.255  1.00 35.82 ? 22  SER A CA  1 
ATOM   160  C C   . SER A 1 22  ? 16.050  28.884 -0.697  1.00 34.94 ? 22  SER A C   1 
ATOM   161  O O   . SER A 1 22  ? 17.149  29.284 -0.294  1.00 33.62 ? 22  SER A O   1 
ATOM   162  C CB  . SER A 1 22  ? 16.526  27.301 -2.650  1.00 37.20 ? 22  SER A CB  1 
ATOM   163  O OG  . SER A 1 22  ? 15.816  27.995 -3.669  1.00 39.59 ? 22  SER A OG  1 
ATOM   164  N N   . SER A 1 23  ? 14.960  29.652 -0.651  1.00 31.67 ? 23  SER A N   1 
ATOM   165  C CA  . SER A 1 23  ? 15.035  30.999 -0.097  1.00 30.13 ? 23  SER A CA  1 
ATOM   166  C C   . SER A 1 23  ? 15.180  30.899 1.429   1.00 28.45 ? 23  SER A C   1 
ATOM   167  O O   . SER A 1 23  ? 15.316  31.904 2.115   1.00 29.55 ? 23  SER A O   1 
ATOM   168  C CB  . SER A 1 23  ? 13.804  31.828 -0.480  1.00 29.65 ? 23  SER A CB  1 
ATOM   169  O OG  . SER A 1 23  ? 12.624  31.339 0.131   1.00 30.42 ? 23  SER A OG  1 
ATOM   170  N N   . ASN A 1 24  ? 15.135  29.672 1.941   1.00 26.31 ? 24  ASN A N   1 
ATOM   171  C CA  . ASN A 1 24  ? 15.294  29.403 3.367   1.00 25.86 ? 24  ASN A CA  1 
ATOM   172  C C   . ASN A 1 24  ? 16.748  29.064 3.699   1.00 22.91 ? 24  ASN A C   1 
ATOM   173  O O   . ASN A 1 24  ? 17.090  28.886 4.869   1.00 22.03 ? 24  ASN A O   1 
ATOM   174  C CB  . ASN A 1 24  ? 14.433  28.194 3.783   1.00 29.71 ? 24  ASN A CB  1 
ATOM   175  C CG  . ASN A 1 24  ? 12.970  28.545 3.955   1.00 33.09 ? 24  ASN A CG  1 
ATOM   176  O OD1 . ASN A 1 24  ? 12.200  28.585 2.990   1.00 35.45 ? 24  ASN A OD1 1 
ATOM   177  N ND2 . ASN A 1 24  ? 12.573  28.795 5.193   1.00 37.32 ? 24  ASN A ND2 1 
ATOM   178  N N   . TYR A 1 25  ? 17.565  28.859 2.660   1.00 19.28 ? 25  TYR A N   1 
ATOM   179  C CA  . TYR A 1 25  ? 18.970  28.474 2.817   1.00 15.66 ? 25  TYR A CA  1 
ATOM   180  C C   . TYR A 1 25  ? 19.695  29.206 3.941   1.00 13.58 ? 25  TYR A C   1 
ATOM   181  O O   . TYR A 1 25  ? 20.247  28.579 4.847   1.00 12.81 ? 25  TYR A O   1 
ATOM   182  C CB  . TYR A 1 25  ? 19.732  28.631 1.497   1.00 14.72 ? 25  TYR A CB  1 
ATOM   183  C CG  . TYR A 1 25  ? 21.225  28.362 1.614   1.00 14.63 ? 25  TYR A CG  1 
ATOM   184  C CD1 . TYR A 1 25  ? 21.735  27.055 1.583   1.00 14.51 ? 25  TYR A CD1 1 
ATOM   185  C CD2 . TYR A 1 25  ? 22.128  29.415 1.777   1.00 13.84 ? 25  TYR A CD2 1 
ATOM   186  C CE1 . TYR A 1 25  ? 23.116  26.807 1.714   1.00 12.65 ? 25  TYR A CE1 1 
ATOM   187  C CE2 . TYR A 1 25  ? 23.493  29.179 1.911   1.00 13.28 ? 25  TYR A CE2 1 
ATOM   188  C CZ  . TYR A 1 25  ? 23.974  27.874 1.879   1.00 13.42 ? 25  TYR A CZ  1 
ATOM   189  O OH  . TYR A 1 25  ? 25.308  27.673 2.036   1.00 12.19 ? 25  TYR A OH  1 
ATOM   190  N N   . CYS A 1 26  ? 19.684  30.526 3.887   1.00 12.19 ? 26  CYS A N   1 
ATOM   191  C CA  . CYS A 1 26  ? 20.336  31.324 4.908   1.00 12.24 ? 26  CYS A CA  1 
ATOM   192  C C   . CYS A 1 26  ? 19.753  31.127 6.307   1.00 12.74 ? 26  CYS A C   1 
ATOM   193  O O   . CYS A 1 26  ? 20.496  31.105 7.285   1.00 11.59 ? 26  CYS A O   1 
ATOM   194  C CB  . CYS A 1 26  ? 20.280  32.797 4.535   1.00 11.83 ? 26  CYS A CB  1 
ATOM   195  S SG  . CYS A 1 26  ? 21.406  33.233 3.183   1.00 13.54 ? 26  CYS A SG  1 
ATOM   196  N N   . ASN A 1 27  ? 18.428  31.043 6.411   1.00 12.86 ? 27  ASN A N   1 
ATOM   197  C CA  . ASN A 1 27  ? 17.778  30.861 7.702   1.00 12.67 ? 27  ASN A CA  1 
ATOM   198  C C   . ASN A 1 27  ? 18.283  29.585 8.368   1.00 13.16 ? 27  ASN A C   1 
ATOM   199  O O   . ASN A 1 27  ? 18.640  29.574 9.551   1.00 13.00 ? 27  ASN A O   1 
ATOM   200  C CB  . ASN A 1 27  ? 16.253  30.803 7.538   1.00 12.42 ? 27  ASN A CB  1 
ATOM   201  C CG  . ASN A 1 27  ? 15.637  32.175 7.312   1.00 14.04 ? 27  ASN A CG  1 
ATOM   202  O OD1 . ASN A 1 27  ? 16.318  33.198 7.414   1.00 13.81 ? 27  ASN A OD1 1 
ATOM   203  N ND2 . ASN A 1 27  ? 14.335  32.207 7.037   1.00 13.31 ? 27  ASN A ND2 1 
ATOM   204  N N   . LEU A 1 28  ? 18.350  28.511 7.591   1.00 13.56 ? 28  LEU A N   1 
ATOM   205  C CA  . LEU A 1 28  ? 18.808  27.240 8.120   1.00 13.73 ? 28  LEU A CA  1 
ATOM   206  C C   . LEU A 1 28  ? 20.319  27.198 8.346   1.00 14.30 ? 28  LEU A C   1 
ATOM   207  O O   . LEU A 1 28  ? 20.773  26.690 9.373   1.00 15.34 ? 28  LEU A O   1 
ATOM   208  C CB  . LEU A 1 28  ? 18.357  26.097 7.216   1.00 14.99 ? 28  LEU A CB  1 
ATOM   209  C CG  . LEU A 1 28  ? 16.845  26.051 6.978   1.00 14.50 ? 28  LEU A CG  1 
ATOM   210  C CD1 . LEU A 1 28  ? 16.514  24.828 6.150   1.00 15.13 ? 28  LEU A CD1 1 
ATOM   211  C CD2 . LEU A 1 28  ? 16.111  26.036 8.310   1.00 15.87 ? 28  LEU A CD2 1 
ATOM   212  N N   . MET A 1 29  ? 21.099  27.683 7.384   1.00 13.02 ? 29  MET A N   1 
ATOM   213  C CA  . MET A 1 29  ? 22.547  27.684 7.540   1.00 13.52 ? 29  MET A CA  1 
ATOM   214  C C   . MET A 1 29  ? 23.012  28.607 8.666   1.00 12.53 ? 29  MET A C   1 
ATOM   215  O O   . MET A 1 29  ? 23.906  28.255 9.424   1.00 11.17 ? 29  MET A O   1 
ATOM   216  C CB  . MET A 1 29  ? 23.241  28.060 6.225   1.00 16.05 ? 29  MET A CB  1 
ATOM   217  C CG  . MET A 1 29  ? 23.400  26.887 5.257   1.00 16.94 ? 29  MET A CG  1 
ATOM   218  S SD  . MET A 1 29  ? 24.564  25.670 5.886   1.00 18.61 ? 29  MET A SD  1 
ATOM   219  C CE  . MET A 1 29  ? 26.051  26.454 5.439   1.00 16.98 ? 29  MET A CE  1 
ATOM   220  N N   . MET A 1 30  ? 22.439  29.801 8.754   1.00 12.05 ? 30  MET A N   1 
ATOM   221  C CA  . MET A 1 30  ? 22.815  30.743 9.806   1.00 13.61 ? 30  MET A CA  1 
ATOM   222  C C   . MET A 1 30  ? 22.564  30.150 11.181  1.00 13.90 ? 30  MET A C   1 
ATOM   223  O O   . MET A 1 30  ? 23.264  30.477 12.142  1.00 15.33 ? 30  MET A O   1 
ATOM   224  C CB  . MET A 1 30  ? 22.055  32.069 9.670   1.00 13.72 ? 30  MET A CB  1 
ATOM   225  C CG  . MET A 1 30  ? 22.497  32.903 8.496   1.00 13.81 ? 30  MET A CG  1 
ATOM   226  S SD  . MET A 1 30  ? 24.261  33.312 8.576   1.00 16.96 ? 30  MET A SD  1 
ATOM   227  C CE  . MET A 1 30  ? 24.243  34.692 9.769   1.00 13.88 ? 30  MET A CE  1 
ATOM   228  N N   . CYS A 1 31  ? 21.537  29.311 11.270  1.00 13.12 ? 31  CYS A N   1 
ATOM   229  C CA  . CYS A 1 31  ? 21.175  28.639 12.508  1.00 12.31 ? 31  CYS A CA  1 
ATOM   230  C C   . CYS A 1 31  ? 22.119  27.442 12.747  1.00 12.35 ? 31  CYS A C   1 
ATOM   231  O O   . CYS A 1 31  ? 22.707  27.314 13.825  1.00 11.84 ? 31  CYS A O   1 
ATOM   232  C CB  . CYS A 1 31  ? 19.709  28.176 12.439  1.00 10.75 ? 31  CYS A CB  1 
ATOM   233  S SG  . CYS A 1 31  ? 19.212  27.055 13.782  1.00 12.35 ? 31  CYS A SG  1 
ATOM   234  N N   . CYS A 1 32  ? 22.248  26.575 11.738  1.00 11.00 ? 32  CYS A N   1 
ATOM   235  C CA  . CYS A 1 32  ? 23.108  25.389 11.805  1.00 12.61 ? 32  CYS A CA  1 
ATOM   236  C C   . CYS A 1 32  ? 24.532  25.792 12.182  1.00 13.03 ? 32  CYS A C   1 
ATOM   237  O O   . CYS A 1 32  ? 25.091  25.283 13.148  1.00 12.58 ? 32  CYS A O   1 
ATOM   238  C CB  . CYS A 1 32  ? 23.109  24.660 10.442  1.00 10.40 ? 32  CYS A CB  1 
ATOM   239  S SG  . CYS A 1 32  ? 24.325  23.314 10.219  1.00 10.15 ? 32  CYS A SG  1 
ATOM   240  N N   . ARG A 1 33  ? 25.073  26.758 11.444  1.00 13.13 ? 33  ARG A N   1 
ATOM   241  C CA  . ARG A 1 33  ? 26.423  27.258 11.664  1.00 13.90 ? 33  ARG A CA  1 
ATOM   242  C C   . ARG A 1 33  ? 26.609  28.145 12.898  1.00 16.26 ? 33  ARG A C   1 
ATOM   243  O O   . ARG A 1 33  ? 27.629  28.829 13.029  1.00 17.51 ? 33  ARG A O   1 
ATOM   244  C CB  . ARG A 1 33  ? 26.946  27.943 10.401  1.00 12.06 ? 33  ARG A CB  1 
ATOM   245  C CG  . ARG A 1 33  ? 27.003  26.999 9.210   1.00 9.10  ? 33  ARG A CG  1 
ATOM   246  C CD  . ARG A 1 33  ? 27.958  25.838 9.483   1.00 10.91 ? 33  ARG A CD  1 
ATOM   247  N NE  . ARG A 1 33  ? 28.059  24.957 8.323   1.00 10.03 ? 33  ARG A NE  1 
ATOM   248  C CZ  . ARG A 1 33  ? 28.902  25.136 7.310   1.00 10.05 ? 33  ARG A CZ  1 
ATOM   249  N NH1 . ARG A 1 33  ? 29.735  26.166 7.311   1.00 8.32  ? 33  ARG A NH1 1 
ATOM   250  N NH2 . ARG A 1 33  ? 28.862  24.319 6.266   1.00 9.04  ? 33  ARG A NH2 1 
ATOM   251  N N   . LYS A 1 34  ? 25.607  28.148 13.778  1.00 18.26 ? 34  LYS A N   1 
ATOM   252  C CA  . LYS A 1 34  ? 25.642  28.860 15.060  1.00 20.43 ? 34  LYS A CA  1 
ATOM   253  C C   . LYS A 1 34  ? 25.892  30.369 15.044  1.00 20.78 ? 34  LYS A C   1 
ATOM   254  O O   . LYS A 1 34  ? 26.607  30.911 15.897  1.00 21.28 ? 34  LYS A O   1 
ATOM   255  C CB  . LYS A 1 34  ? 26.644  28.170 16.004  1.00 22.00 ? 34  LYS A CB  1 
ATOM   256  C CG  . LYS A 1 34  ? 26.560  26.634 16.019  1.00 26.11 ? 34  LYS A CG  1 
ATOM   257  C CD  . LYS A 1 34  ? 27.849  26.017 16.574  1.00 30.95 ? 34  LYS A CD  1 
ATOM   258  C CE  . LYS A 1 34  ? 28.025  24.574 16.115  1.00 33.36 ? 34  LYS A CE  1 
ATOM   259  N NZ  . LYS A 1 34  ? 29.369  24.027 16.495  1.00 37.26 ? 34  LYS A NZ  1 
ATOM   260  N N   . MET A 1 35  ? 25.275  31.052 14.097  1.00 21.89 ? 35  MET A N   1 
ATOM   261  C CA  . MET A 1 35  ? 25.409  32.495 14.015  1.00 23.39 ? 35  MET A CA  1 
ATOM   262  C C   . MET A 1 35  ? 24.110  33.225 14.382  1.00 25.11 ? 35  MET A C   1 
ATOM   263  O O   . MET A 1 35  ? 23.930  34.398 14.033  1.00 24.80 ? 35  MET A O   1 
ATOM   264  C CB  . MET A 1 35  ? 25.920  32.906 12.640  1.00 21.47 ? 35  MET A CB  1 
ATOM   265  C CG  . MET A 1 35  ? 27.371  32.492 12.422  1.00 20.87 ? 35  MET A CG  1 
ATOM   266  S SD  . MET A 1 35  ? 27.926  32.904 10.790  1.00 19.87 ? 35  MET A SD  1 
ATOM   267  C CE  . MET A 1 35  ? 27.341  31.459 9.889   1.00 16.78 ? 35  MET A CE  1 
ATOM   268  N N   . THR A 1 36  ? 23.221  32.532 15.095  1.00 26.84 ? 36  THR A N   1 
ATOM   269  C CA  . THR A 1 36  ? 21.950  33.122 15.543  1.00 28.67 ? 36  THR A CA  1 
ATOM   270  C C   . THR A 1 36  ? 21.753  32.900 17.049  1.00 30.92 ? 36  THR A C   1 
ATOM   271  O O   . THR A 1 36  ? 20.632  32.838 17.545  1.00 31.63 ? 36  THR A O   1 
ATOM   272  C CB  . THR A 1 36  ? 20.724  32.551 14.770  1.00 27.52 ? 36  THR A CB  1 
ATOM   273  O OG1 . THR A 1 36  ? 20.651  31.132 14.944  1.00 26.84 ? 36  THR A OG1 1 
ATOM   274  C CG2 . THR A 1 36  ? 20.816  32.876 13.289  1.00 26.00 ? 36  THR A CG2 1 
ATOM   275  N N   . GLN A 1 37  ? 22.855  32.761 17.775  1.00 33.35 ? 37  GLN A N   1 
ATOM   276  C CA  . GLN A 1 37  ? 22.796  32.544 19.211  1.00 36.09 ? 37  GLN A CA  1 
ATOM   277  C C   . GLN A 1 37  ? 23.141  33.853 19.910  1.00 36.85 ? 37  GLN A C   1 
ATOM   278  O O   . GLN A 1 37  ? 24.196  34.432 19.664  1.00 38.05 ? 37  GLN A O   1 
ATOM   279  C CB  . GLN A 1 37  ? 23.792  31.457 19.612  1.00 38.75 ? 37  GLN A CB  1 
ATOM   280  C CG  . GLN A 1 37  ? 23.912  30.338 18.590  1.00 43.48 ? 37  GLN A CG  1 
ATOM   281  C CD  . GLN A 1 37  ? 23.727  28.960 19.197  1.00 45.83 ? 37  GLN A CD  1 
ATOM   282  O OE1 . GLN A 1 37  ? 24.616  28.445 19.878  1.00 47.01 ? 37  GLN A OE1 1 
ATOM   283  N NE2 . GLN A 1 37  ? 22.566  28.353 18.953  1.00 46.70 ? 37  GLN A NE2 1 
ATOM   284  N N   . GLY A 1 38  ? 22.269  34.310 20.802  1.00 37.52 ? 38  GLY A N   1 
ATOM   285  C CA  . GLY A 1 38  ? 22.519  35.560 21.502  1.00 36.11 ? 38  GLY A CA  1 
ATOM   286  C C   . GLY A 1 38  ? 21.987  36.745 20.716  1.00 35.95 ? 38  GLY A C   1 
ATOM   287  O O   . GLY A 1 38  ? 21.334  37.631 21.274  1.00 35.86 ? 38  GLY A O   1 
ATOM   288  N N   . LYS A 1 39  ? 22.311  36.787 19.428  1.00 34.83 ? 39  LYS A N   1 
ATOM   289  C CA  . LYS A 1 39  ? 21.851  37.852 18.538  1.00 35.11 ? 39  LYS A CA  1 
ATOM   290  C C   . LYS A 1 39  ? 21.841  37.314 17.106  1.00 33.50 ? 39  LYS A C   1 
ATOM   291  O O   . LYS A 1 39  ? 22.303  36.196 16.849  1.00 32.37 ? 39  LYS A O   1 
ATOM   292  C CB  . LYS A 1 39  ? 22.742  39.117 18.630  1.00 37.18 ? 39  LYS A CB  1 
ATOM   293  C CG  . LYS A 1 39  ? 24.136  39.013 17.970  1.00 40.76 ? 39  LYS A CG  1 
ATOM   294  C CD  . LYS A 1 39  ? 25.113  38.161 18.797  1.00 43.96 ? 39  LYS A CD  1 
ATOM   295  C CE  . LYS A 1 39  ? 26.267  37.614 17.961  1.00 45.46 ? 39  LYS A CE  1 
ATOM   296  N NZ  . LYS A 1 39  ? 25.794  36.605 16.961  1.00 48.00 ? 39  LYS A NZ  1 
ATOM   297  N N   . CYS A 1 40  ? 21.244  38.073 16.193  1.00 30.57 ? 40  CYS A N   1 
ATOM   298  C CA  . CYS A 1 40  ? 21.219  37.660 14.799  1.00 27.14 ? 40  CYS A CA  1 
ATOM   299  C C   . CYS A 1 40  ? 22.404  38.318 14.117  1.00 25.50 ? 40  CYS A C   1 
ATOM   300  O O   . CYS A 1 40  ? 22.509  39.543 14.103  1.00 23.20 ? 40  CYS A O   1 
ATOM   301  C CB  . CYS A 1 40  ? 19.930  38.109 14.112  1.00 26.55 ? 40  CYS A CB  1 
ATOM   302  S SG  . CYS A 1 40  ? 18.402  37.613 14.965  1.00 24.89 ? 40  CYS A SG  1 
ATOM   303  N N   . LYS A 1 41  ? 23.359  37.524 13.647  1.00 22.62 ? 41  LYS A N   1 
ATOM   304  C CA  . LYS A 1 41  ? 24.482  38.136 12.956  1.00 21.61 ? 41  LYS A CA  1 
ATOM   305  C C   . LYS A 1 41  ? 23.824  38.785 11.737  1.00 20.70 ? 41  LYS A C   1 
ATOM   306  O O   . LYS A 1 41  ? 23.175  38.111 10.944  1.00 21.89 ? 41  LYS A O   1 
ATOM   307  C CB  . LYS A 1 41  ? 25.512  37.087 12.550  1.00 20.80 ? 41  LYS A CB  1 
ATOM   308  C CG  . LYS A 1 41  ? 26.746  37.669 11.892  1.00 19.53 ? 41  LYS A CG  1 
ATOM   309  C CD  . LYS A 1 41  ? 27.862  36.634 11.812  1.00 20.14 ? 41  LYS A CD  1 
ATOM   310  C CE  . LYS A 1 41  ? 28.982  37.080 10.887  1.00 18.48 ? 41  LYS A CE  1 
ATOM   311  N NZ  . LYS A 1 41  ? 30.048  36.063 10.779  1.00 17.73 ? 41  LYS A NZ  1 
ATOM   312  N N   . PRO A 1 42  ? 23.960  40.108 11.595  1.00 19.36 ? 42  PRO A N   1 
ATOM   313  C CA  . PRO A 1 42  ? 23.371  40.858 10.484  1.00 18.15 ? 42  PRO A CA  1 
ATOM   314  C C   . PRO A 1 42  ? 23.731  40.475 9.051   1.00 17.53 ? 42  PRO A C   1 
ATOM   315  O O   . PRO A 1 42  ? 22.863  40.468 8.181   1.00 18.24 ? 42  PRO A O   1 
ATOM   316  C CB  . PRO A 1 42  ? 23.737  42.315 10.821  1.00 18.29 ? 42  PRO A CB  1 
ATOM   317  C CG  . PRO A 1 42  ? 24.955  42.195 11.650  1.00 17.75 ? 42  PRO A CG  1 
ATOM   318  C CD  . PRO A 1 42  ? 24.685  41.006 12.511  1.00 19.14 ? 42  PRO A CD  1 
ATOM   319  N N   . VAL A 1 43  ? 25.005  40.215 8.783   1.00 17.18 ? 43  VAL A N   1 
ATOM   320  C CA  . VAL A 1 43  ? 25.446  39.853 7.438   1.00 15.18 ? 43  VAL A CA  1 
ATOM   321  C C   . VAL A 1 43  ? 26.460  38.725 7.520   1.00 13.62 ? 43  VAL A C   1 
ATOM   322  O O   . VAL A 1 43  ? 27.263  38.681 8.434   1.00 13.61 ? 43  VAL A O   1 
ATOM   323  C CB  . VAL A 1 43  ? 26.129  41.034 6.725   1.00 16.12 ? 43  VAL A CB  1 
ATOM   324  C CG1 . VAL A 1 43  ? 26.488  40.647 5.286   1.00 15.21 ? 43  VAL A CG1 1 
ATOM   325  C CG2 . VAL A 1 43  ? 25.228  42.243 6.745   1.00 16.85 ? 43  VAL A CG2 1 
ATOM   326  N N   . ASN A 1 44  ? 26.429  37.824 6.553   1.00 11.58 ? 44  ASN A N   1 
ATOM   327  C CA  . ASN A 1 44  ? 27.354  36.710 6.539   1.00 9.40  ? 44  ASN A CA  1 
ATOM   328  C C   . ASN A 1 44  ? 27.373  36.124 5.154   1.00 9.49  ? 44  ASN A C   1 
ATOM   329  O O   . ASN A 1 44  ? 26.319  35.891 4.566   1.00 11.21 ? 44  ASN A O   1 
ATOM   330  C CB  . ASN A 1 44  ? 26.931  35.635 7.552   1.00 8.67  ? 44  ASN A CB  1 
ATOM   331  C CG  . ASN A 1 44  ? 28.019  34.593 7.775   1.00 9.96  ? 44  ASN A CG  1 
ATOM   332  O OD1 . ASN A 1 44  ? 29.069  34.895 8.334   1.00 9.47  ? 44  ASN A OD1 1 
ATOM   333  N ND2 . ASN A 1 44  ? 27.786  33.377 7.311   1.00 7.24  ? 44  ASN A ND2 1 
ATOM   334  N N   . THR A 1 45  ? 28.563  35.852 4.641   1.00 8.22  ? 45  THR A N   1 
ATOM   335  C CA  . THR A 1 45  ? 28.695  35.273 3.315   1.00 9.27  ? 45  THR A CA  1 
ATOM   336  C C   . THR A 1 45  ? 29.162  33.813 3.407   1.00 10.55 ? 45  THR A C   1 
ATOM   337  O O   . THR A 1 45  ? 30.003  33.481 4.251   1.00 10.84 ? 45  THR A O   1 
ATOM   338  C CB  . THR A 1 45  ? 29.772  36.031 2.502   1.00 10.92 ? 45  THR A CB  1 
ATOM   339  O OG1 . THR A 1 45  ? 29.476  37.431 2.485   1.00 9.77  ? 45  THR A OG1 1 
ATOM   340  C CG2 . THR A 1 45  ? 29.865  35.500 1.070   1.00 9.72  ? 45  THR A CG2 1 
ATOM   341  N N   . PHE A 1 46  ? 28.642  32.961 2.526   1.00 9.23  ? 46  PHE A N   1 
ATOM   342  C CA  . PHE A 1 46  ? 29.049  31.562 2.441   1.00 9.43  ? 46  PHE A CA  1 
ATOM   343  C C   . PHE A 1 46  ? 29.656  31.418 1.061   1.00 10.46 ? 46  PHE A C   1 
ATOM   344  O O   . PHE A 1 46  ? 29.095  31.896 0.077   1.00 11.44 ? 46  PHE A O   1 
ATOM   345  C CB  . PHE A 1 46  ? 27.857  30.612 2.580   1.00 9.46  ? 46  PHE A CB  1 
ATOM   346  C CG  . PHE A 1 46  ? 27.364  30.480 3.984   1.00 9.40  ? 46  PHE A CG  1 
ATOM   347  C CD1 . PHE A 1 46  ? 28.115  29.790 4.926   1.00 9.83  ? 46  PHE A CD1 1 
ATOM   348  C CD2 . PHE A 1 46  ? 26.188  31.098 4.379   1.00 6.42  ? 46  PHE A CD2 1 
ATOM   349  C CE1 . PHE A 1 46  ? 27.706  29.726 6.238   1.00 8.66  ? 46  PHE A CE1 1 
ATOM   350  C CE2 . PHE A 1 46  ? 25.769  31.043 5.687   1.00 6.51  ? 46  PHE A CE2 1 
ATOM   351  C CZ  . PHE A 1 46  ? 26.520  30.361 6.622   1.00 8.88  ? 46  PHE A CZ  1 
ATOM   352  N N   . VAL A 1 47  ? 30.834  30.814 1.002   1.00 11.14 ? 47  VAL A N   1 
ATOM   353  C CA  . VAL A 1 47  ? 31.542  30.607 -0.253  1.00 10.15 ? 47  VAL A CA  1 
ATOM   354  C C   . VAL A 1 47  ? 31.344  29.167 -0.697  1.00 10.97 ? 47  VAL A C   1 
ATOM   355  O O   . VAL A 1 47  ? 31.591  28.229 0.062   1.00 10.18 ? 47  VAL A O   1 
ATOM   356  C CB  . VAL A 1 47  ? 33.068  30.888 -0.100  1.00 10.47 ? 47  VAL A CB  1 
ATOM   357  C CG1 . VAL A 1 47  ? 33.751  30.843 -1.466  1.00 9.20  ? 47  VAL A CG1 1 
ATOM   358  C CG2 . VAL A 1 47  ? 33.299  32.254 0.561   1.00 8.44  ? 47  VAL A CG2 1 
ATOM   359  N N   . HIS A 1 48  ? 30.902  28.991 -1.931  1.00 11.30 ? 48  HIS A N   1 
ATOM   360  C CA  . HIS A 1 48  ? 30.658  27.659 -2.435  1.00 15.17 ? 48  HIS A CA  1 
ATOM   361  C C   . HIS A 1 48  ? 31.803  27.145 -3.288  1.00 17.41 ? 48  HIS A C   1 
ATOM   362  O O   . HIS A 1 48  ? 31.576  26.390 -4.221  1.00 21.97 ? 48  HIS A O   1 
ATOM   363  C CB  . HIS A 1 48  ? 29.326  27.623 -3.202  1.00 14.55 ? 48  HIS A CB  1 
ATOM   364  C CG  . HIS A 1 48  ? 28.171  28.136 -2.400  1.00 13.37 ? 48  HIS A CG  1 
ATOM   365  N ND1 . HIS A 1 48  ? 27.763  27.538 -1.229  1.00 15.08 ? 48  HIS A ND1 1 
ATOM   366  C CD2 . HIS A 1 48  ? 27.412  29.249 -2.537  1.00 14.58 ? 48  HIS A CD2 1 
ATOM   367  C CE1 . HIS A 1 48  ? 26.814  28.268 -0.668  1.00 15.73 ? 48  HIS A CE1 1 
ATOM   368  N NE2 . HIS A 1 48  ? 26.581  29.313 -1.444  1.00 12.99 ? 48  HIS A NE2 1 
ATOM   369  N N   . GLU A 1 49  ? 33.027  27.561 -2.971  1.00 18.39 ? 49  GLU A N   1 
ATOM   370  C CA  . GLU A 1 49  ? 34.202  27.114 -3.720  1.00 17.64 ? 49  GLU A CA  1 
ATOM   371  C C   . GLU A 1 49  ? 35.014  26.120 -2.902  1.00 17.11 ? 49  GLU A C   1 
ATOM   372  O O   . GLU A 1 49  ? 34.826  26.003 -1.694  1.00 16.61 ? 49  GLU A O   1 
ATOM   373  C CB  . GLU A 1 49  ? 35.091  28.304 -4.101  1.00 16.86 ? 49  GLU A CB  1 
ATOM   374  C CG  . GLU A 1 49  ? 34.400  29.366 -4.945  1.00 17.44 ? 49  GLU A CG  1 
ATOM   375  C CD  . GLU A 1 49  ? 34.053  28.906 -6.356  1.00 18.05 ? 49  GLU A CD  1 
ATOM   376  O OE1 . GLU A 1 49  ? 34.589  27.878 -6.824  1.00 19.91 ? 49  GLU A OE1 1 
ATOM   377  O OE2 . GLU A 1 49  ? 33.236  29.586 -7.015  1.00 15.68 ? 49  GLU A OE2 1 
ATOM   378  N N   . SER A 1 50  ? 35.914  25.411 -3.575  1.00 16.80 ? 50  SER A N   1 
ATOM   379  C CA  . SER A 1 50  ? 36.792  24.444 -2.936  1.00 16.14 ? 50  SER A CA  1 
ATOM   380  C C   . SER A 1 50  ? 37.625  25.166 -1.869  1.00 15.38 ? 50  SER A C   1 
ATOM   381  O O   . SER A 1 50  ? 38.014  26.312 -2.063  1.00 11.74 ? 50  SER A O   1 
ATOM   382  C CB  . SER A 1 50  ? 37.726  23.852 -3.992  1.00 16.18 ? 50  SER A CB  1 
ATOM   383  O OG  . SER A 1 50  ? 38.585  22.866 -3.443  1.00 18.66 ? 50  SER A OG  1 
ATOM   384  N N   . LEU A 1 51  ? 37.894  24.499 -0.746  1.00 16.79 ? 51  LEU A N   1 
ATOM   385  C CA  . LEU A 1 51  ? 38.693  25.100 0.317   1.00 17.77 ? 51  LEU A CA  1 
ATOM   386  C C   . LEU A 1 51  ? 40.115  25.374 -0.182  1.00 19.18 ? 51  LEU A C   1 
ATOM   387  O O   . LEU A 1 51  ? 40.812  26.231 0.368   1.00 18.25 ? 51  LEU A O   1 
ATOM   388  C CB  . LEU A 1 51  ? 38.720  24.218 1.573   1.00 17.80 ? 51  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 51  ? 39.490  24.820 2.767   1.00 19.22 ? 51  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 51  ? 38.908  26.191 3.183   1.00 15.44 ? 51  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 51  ? 39.491  23.830 3.941   1.00 16.44 ? 51  LEU A CD2 1 
ATOM   392  N N   . ALA A 1 52  ? 40.542  24.635 -1.210  1.00 19.07 ? 52  ALA A N   1 
ATOM   393  C CA  . ALA A 1 52  ? 41.869  24.812 -1.803  1.00 18.49 ? 52  ALA A CA  1 
ATOM   394  C C   . ALA A 1 52  ? 41.919  26.160 -2.520  1.00 17.62 ? 52  ALA A C   1 
ATOM   395  O O   . ALA A 1 52  ? 42.909  26.881 -2.416  1.00 19.26 ? 52  ALA A O   1 
ATOM   396  C CB  . ALA A 1 52  ? 42.175  23.679 -2.784  1.00 15.51 ? 52  ALA A CB  1 
ATOM   397  N N   . ASP A 1 53  ? 40.840  26.499 -3.226  1.00 16.73 ? 53  ASP A N   1 
ATOM   398  C CA  . ASP A 1 53  ? 40.740  27.772 -3.952  1.00 16.32 ? 53  ASP A CA  1 
ATOM   399  C C   . ASP A 1 53  ? 40.626  28.980 -3.012  1.00 14.15 ? 53  ASP A C   1 
ATOM   400  O O   . ASP A 1 53  ? 41.106  30.066 -3.316  1.00 14.42 ? 53  ASP A O   1 
ATOM   401  C CB  . ASP A 1 53  ? 39.547  27.759 -4.924  1.00 18.13 ? 53  ASP A CB  1 
ATOM   402  C CG  . ASP A 1 53  ? 39.825  26.960 -6.193  1.00 20.59 ? 53  ASP A CG  1 
ATOM   403  O OD1 . ASP A 1 53  ? 40.992  26.561 -6.444  1.00 21.96 ? 53  ASP A OD1 1 
ATOM   404  O OD2 . ASP A 1 53  ? 38.875  26.748 -6.971  1.00 23.62 ? 53  ASP A OD2 1 
ATOM   405  N N   . VAL A 1 54  ? 39.928  28.814 -1.898  1.00 13.70 ? 54  VAL A N   1 
ATOM   406  C CA  . VAL A 1 54  ? 39.791  29.909 -0.953  1.00 12.86 ? 54  VAL A CA  1 
ATOM   407  C C   . VAL A 1 54  ? 41.112  30.148 -0.219  1.00 13.02 ? 54  VAL A C   1 
ATOM   408  O O   . VAL A 1 54  ? 41.466  31.290 0.056   1.00 13.98 ? 54  VAL A O   1 
ATOM   409  C CB  . VAL A 1 54  ? 38.641  29.672 0.047   1.00 14.29 ? 54  VAL A CB  1 
ATOM   410  C CG1 . VAL A 1 54  ? 38.447  30.897 0.922   1.00 12.91 ? 54  VAL A CG1 1 
ATOM   411  C CG2 . VAL A 1 54  ? 37.328  29.356 -0.715  1.00 14.50 ? 54  VAL A CG2 1 
ATOM   412  N N   . LYS A 1 55  ? 41.827  29.082 0.127   1.00 11.38 ? 55  LYS A N   1 
ATOM   413  C CA  . LYS A 1 55  ? 43.119  29.234 0.807   1.00 12.01 ? 55  LYS A CA  1 
ATOM   414  C C   . LYS A 1 55  ? 44.132  29.910 -0.110  1.00 10.33 ? 55  LYS A C   1 
ATOM   415  O O   . LYS A 1 55  ? 44.996  30.641 0.351   1.00 9.96  ? 55  LYS A O   1 
ATOM   416  C CB  . LYS A 1 55  ? 43.681  27.876 1.232   1.00 12.26 ? 55  LYS A CB  1 
ATOM   417  C CG  . LYS A 1 55  ? 43.062  27.263 2.481   1.00 15.65 ? 55  LYS A CG  1 
ATOM   418  C CD  . LYS A 1 55  ? 43.312  25.746 2.454   1.00 19.70 ? 55  LYS A CD  1 
ATOM   419  C CE  . LYS A 1 55  ? 43.867  25.197 3.768   1.00 22.04 ? 55  LYS A CE  1 
ATOM   420  N NZ  . LYS A 1 55  ? 42.863  24.926 4.822   1.00 23.73 ? 55  LYS A NZ  1 
ATOM   421  N N   . ALA A 1 56  ? 44.029  29.637 -1.407  1.00 8.18  ? 56  ALA A N   1 
ATOM   422  C CA  . ALA A 1 56  ? 44.947  30.212 -2.374  1.00 8.26  ? 56  ALA A CA  1 
ATOM   423  C C   . ALA A 1 56  ? 44.873  31.740 -2.398  1.00 9.08  ? 56  ALA A C   1 
ATOM   424  O O   . ALA A 1 56  ? 45.854  32.400 -2.729  1.00 11.68 ? 56  ALA A O   1 
ATOM   425  C CB  . ALA A 1 56  ? 44.682  29.641 -3.747  1.00 6.02  ? 56  ALA A CB  1 
ATOM   426  N N   . VAL A 1 57  ? 43.724  32.302 -2.014  1.00 9.92  ? 57  VAL A N   1 
ATOM   427  C CA  . VAL A 1 57  ? 43.542  33.757 -1.989  1.00 10.20 ? 57  VAL A CA  1 
ATOM   428  C C   . VAL A 1 57  ? 44.586  34.441 -1.099  1.00 10.14 ? 57  VAL A C   1 
ATOM   429  O O   . VAL A 1 57  ? 44.932  35.597 -1.320  1.00 10.04 ? 57  VAL A O   1 
ATOM   430  C CB  . VAL A 1 57  ? 42.099  34.152 -1.521  1.00 10.53 ? 57  VAL A CB  1 
ATOM   431  C CG1 . VAL A 1 57  ? 41.969  35.667 -1.399  1.00 10.52 ? 57  VAL A CG1 1 
ATOM   432  C CG2 . VAL A 1 57  ? 41.059  33.632 -2.518  1.00 9.22  ? 57  VAL A CG2 1 
ATOM   433  N N   . CYS A 1 58  ? 45.081  33.728 -0.092  1.00 11.68 ? 58  CYS A N   1 
ATOM   434  C CA  . CYS A 1 58  ? 46.090  34.276 0.818   1.00 13.16 ? 58  CYS A CA  1 
ATOM   435  C C   . CYS A 1 58  ? 47.458  34.546 0.186   1.00 15.00 ? 58  CYS A C   1 
ATOM   436  O O   . CYS A 1 58  ? 48.385  34.996 0.866   1.00 15.36 ? 58  CYS A O   1 
ATOM   437  C CB  . CYS A 1 58  ? 46.272  33.362 2.014   1.00 12.29 ? 58  CYS A CB  1 
ATOM   438  S SG  . CYS A 1 58  ? 44.837  33.353 3.119   1.00 11.76 ? 58  CYS A SG  1 
ATOM   439  N N   . SER A 1 59  ? 47.605  34.230 -1.095  1.00 16.00 ? 59  SER A N   1 
ATOM   440  C CA  . SER A 1 59  ? 48.860  34.494 -1.788  1.00 18.12 ? 59  SER A CA  1 
ATOM   441  C C   . SER A 1 59  ? 48.512  35.219 -3.087  1.00 18.06 ? 59  SER A C   1 
ATOM   442  O O   . SER A 1 59  ? 49.271  35.181 -4.061  1.00 16.51 ? 59  SER A O   1 
ATOM   443  C CB  . SER A 1 59  ? 49.596  33.191 -2.089  1.00 17.49 ? 59  SER A CB  1 
ATOM   444  O OG  . SER A 1 59  ? 48.991  32.543 -3.191  1.00 22.52 ? 59  SER A OG  1 
ATOM   445  N N   . GLN A 1 60  ? 47.351  35.878 -3.092  1.00 17.83 ? 60  GLN A N   1 
ATOM   446  C CA  . GLN A 1 60  ? 46.904  36.613 -4.264  1.00 18.71 ? 60  GLN A CA  1 
ATOM   447  C C   . GLN A 1 60  ? 47.011  38.142 -4.130  1.00 19.92 ? 60  GLN A C   1 
ATOM   448  O O   . GLN A 1 60  ? 48.045  38.631 -3.675  1.00 18.54 ? 60  GLN A O   1 
ATOM   449  C CB  . GLN A 1 60  ? 45.528  36.120 -4.722  1.00 18.52 ? 60  GLN A CB  1 
ATOM   450  C CG  . GLN A 1 60  ? 45.599  34.674 -5.199  1.00 15.05 ? 60  GLN A CG  1 
ATOM   451  C CD  . GLN A 1 60  ? 44.293  34.137 -5.704  1.00 16.12 ? 60  GLN A CD  1 
ATOM   452  O OE1 . GLN A 1 60  ? 43.269  34.808 -5.657  1.00 17.10 ? 60  GLN A OE1 1 
ATOM   453  N NE2 . GLN A 1 60  ? 44.326  32.923 -6.227  1.00 18.90 ? 60  GLN A NE2 1 
ATOM   454  N N   . LYS A 1 61  ? 45.996  38.907 -4.525  1.00 20.33 ? 61  LYS A N   1 
ATOM   455  C CA  . LYS A 1 61  ? 46.134  40.367 -4.439  1.00 22.52 ? 61  LYS A CA  1 
ATOM   456  C C   . LYS A 1 61  ? 45.993  40.996 -3.055  1.00 21.34 ? 61  LYS A C   1 
ATOM   457  O O   . LYS A 1 61  ? 44.944  40.916 -2.428  1.00 22.23 ? 61  LYS A O   1 
ATOM   458  C CB  . LYS A 1 61  ? 45.205  41.077 -5.424  1.00 24.34 ? 61  LYS A CB  1 
ATOM   459  C CG  . LYS A 1 61  ? 45.501  42.580 -5.532  1.00 28.38 ? 61  LYS A CG  1 
ATOM   460  C CD  . LYS A 1 61  ? 44.486  43.291 -6.405  1.00 31.58 ? 61  LYS A CD  1 
ATOM   461  C CE  . LYS A 1 61  ? 44.669  44.790 -6.329  1.00 33.70 ? 61  LYS A CE  1 
ATOM   462  N NZ  . LYS A 1 61  ? 43.476  45.493 -6.881  1.00 36.68 ? 61  LYS A NZ  1 
ATOM   463  N N   . LYS A 1 62  ? 47.032  41.700 -2.626  1.00 20.96 ? 62  LYS A N   1 
ATOM   464  C CA  . LYS A 1 62  ? 47.039  42.355 -1.317  1.00 21.23 ? 62  LYS A CA  1 
ATOM   465  C C   . LYS A 1 62  ? 46.210  43.651 -1.307  1.00 20.08 ? 62  LYS A C   1 
ATOM   466  O O   . LYS A 1 62  ? 46.261  44.424 -2.267  1.00 19.50 ? 62  LYS A O   1 
ATOM   467  C CB  . LYS A 1 62  ? 48.491  42.632 -0.922  1.00 24.03 ? 62  LYS A CB  1 
ATOM   468  C CG  . LYS A 1 62  ? 48.749  42.689 0.571   1.00 29.46 ? 62  LYS A CG  1 
ATOM   469  C CD  . LYS A 1 62  ? 50.221  42.361 0.876   1.00 32.45 ? 62  LYS A CD  1 
ATOM   470  C CE  . LYS A 1 62  ? 50.551  42.549 2.371   1.00 35.82 ? 62  LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 62  ? 49.643  41.794 3.309   1.00 38.58 ? 62  LYS A NZ  1 
ATOM   472  N N   . VAL A 1 63  ? 45.396  43.846 -0.268  1.00 17.19 ? 63  VAL A N   1 
ATOM   473  C CA  . VAL A 1 63  ? 44.566  45.050 -0.131  1.00 16.80 ? 63  VAL A CA  1 
ATOM   474  C C   . VAL A 1 63  ? 44.383  45.370 1.348   1.00 16.65 ? 63  VAL A C   1 
ATOM   475  O O   . VAL A 1 63  ? 44.627  44.519 2.203   1.00 16.58 ? 63  VAL A O   1 
ATOM   476  C CB  . VAL A 1 63  ? 43.149  44.914 -0.800  1.00 17.85 ? 63  VAL A CB  1 
ATOM   477  C CG1 . VAL A 1 63  ? 43.285  44.684 -2.292  1.00 16.51 ? 63  VAL A CG1 1 
ATOM   478  C CG2 . VAL A 1 63  ? 42.320  43.779 -0.144  1.00 15.31 ? 63  VAL A CG2 1 
ATOM   479  N N   . THR A 1 64  ? 43.993  46.604 1.653   1.00 16.57 ? 64  THR A N   1 
ATOM   480  C CA  . THR A 1 64  ? 43.780  47.015 3.037   1.00 15.71 ? 64  THR A CA  1 
ATOM   481  C C   . THR A 1 64  ? 42.415  46.525 3.485   1.00 13.90 ? 64  THR A C   1 
ATOM   482  O O   . THR A 1 64  ? 41.482  46.561 2.715   1.00 14.19 ? 64  THR A O   1 
ATOM   483  C CB  . THR A 1 64  ? 43.793  48.557 3.178   1.00 16.50 ? 64  THR A CB  1 
ATOM   484  O OG1 . THR A 1 64  ? 45.003  49.083 2.615   1.00 21.37 ? 64  THR A OG1 1 
ATOM   485  C CG2 . THR A 1 64  ? 43.725  48.972 4.653   1.00 14.38 ? 64  THR A CG2 1 
ATOM   486  N N   . CYS A 1 65  ? 42.306  46.064 4.724   1.00 13.81 ? 65  CYS A N   1 
ATOM   487  C CA  . CYS A 1 65  ? 41.019  45.621 5.249   1.00 15.33 ? 65  CYS A CA  1 
ATOM   488  C C   . CYS A 1 65  ? 40.199  46.876 5.539   1.00 15.16 ? 65  CYS A C   1 
ATOM   489  O O   . CYS A 1 65  ? 40.758  47.973 5.609   1.00 14.49 ? 65  CYS A O   1 
ATOM   490  C CB  . CYS A 1 65  ? 41.199  44.831 6.549   1.00 13.68 ? 65  CYS A CB  1 
ATOM   491  S SG  . CYS A 1 65  ? 42.408  43.475 6.468   1.00 17.06 ? 65  CYS A SG  1 
ATOM   492  N N   . LYS A 1 66  ? 38.890  46.716 5.725   1.00 17.12 ? 66  LYS A N   1 
ATOM   493  C CA  . LYS A 1 66  ? 37.993  47.836 6.028   1.00 18.29 ? 66  LYS A CA  1 
ATOM   494  C C   . LYS A 1 66  ? 38.321  48.492 7.367   1.00 17.19 ? 66  LYS A C   1 
ATOM   495  O O   . LYS A 1 66  ? 38.071  49.675 7.551   1.00 16.40 ? 66  LYS A O   1 
ATOM   496  C CB  . LYS A 1 66  ? 36.536  47.374 6.078   1.00 21.13 ? 66  LYS A CB  1 
ATOM   497  C CG  . LYS A 1 66  ? 35.917  46.977 4.758   1.00 24.61 ? 66  LYS A CG  1 
ATOM   498  C CD  . LYS A 1 66  ? 34.444  46.654 5.007   1.00 29.82 ? 66  LYS A CD  1 
ATOM   499  C CE  . LYS A 1 66  ? 33.751  45.994 3.821   1.00 31.84 ? 66  LYS A CE  1 
ATOM   500  N NZ  . LYS A 1 66  ? 32.400  45.447 4.212   1.00 32.79 ? 66  LYS A NZ  1 
ATOM   501  N N   . ASN A 1 67  ? 38.833  47.713 8.317   1.00 17.39 ? 67  ASN A N   1 
ATOM   502  C CA  . ASN A 1 67  ? 39.176  48.247 9.634   1.00 17.29 ? 67  ASN A CA  1 
ATOM   503  C C   . ASN A 1 67  ? 40.600  48.784 9.772   1.00 16.53 ? 67  ASN A C   1 
ATOM   504  O O   . ASN A 1 67  ? 41.032  49.114 10.871  1.00 15.46 ? 67  ASN A O   1 
ATOM   505  C CB  . ASN A 1 67  ? 38.868  47.224 10.743  1.00 18.59 ? 67  ASN A CB  1 
ATOM   506  C CG  . ASN A 1 67  ? 39.813  46.030 10.737  1.00 19.49 ? 67  ASN A CG  1 
ATOM   507  O OD1 . ASN A 1 67  ? 40.786  45.984 9.975   1.00 17.93 ? 67  ASN A OD1 1 
ATOM   508  N ND2 . ASN A 1 67  ? 39.553  45.072 11.636  1.00 20.79 ? 67  ASN A ND2 1 
ATOM   509  N N   . GLY A 1 68  ? 41.307  48.911 8.653   1.00 16.48 ? 68  GLY A N   1 
ATOM   510  C CA  . GLY A 1 68  ? 42.661  49.438 8.697   1.00 16.24 ? 68  GLY A CA  1 
ATOM   511  C C   . GLY A 1 68  ? 43.768  48.410 8.835   1.00 16.97 ? 68  GLY A C   1 
ATOM   512  O O   . GLY A 1 68  ? 44.959  48.750 8.730   1.00 17.07 ? 68  GLY A O   1 
ATOM   513  N N   . GLN A 1 69  ? 43.416  47.156 9.091   1.00 16.26 ? 69  GLN A N   1 
ATOM   514  C CA  . GLN A 1 69  ? 44.457  46.153 9.209   1.00 16.60 ? 69  GLN A CA  1 
ATOM   515  C C   . GLN A 1 69  ? 45.043  45.937 7.830   1.00 16.95 ? 69  GLN A C   1 
ATOM   516  O O   . GLN A 1 69  ? 44.411  46.271 6.819   1.00 16.07 ? 69  GLN A O   1 
ATOM   517  C CB  . GLN A 1 69  ? 43.949  44.870 9.858   1.00 17.05 ? 69  GLN A CB  1 
ATOM   518  C CG  . GLN A 1 69  ? 43.715  45.057 11.340  1.00 18.31 ? 69  GLN A CG  1 
ATOM   519  C CD  . GLN A 1 69  ? 43.503  43.761 12.070  1.00 20.50 ? 69  GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 69  ? 42.412  43.492 12.565  1.00 22.54 ? 69  GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 69  ? 44.555  42.957 12.171  1.00 20.90 ? 69  GLN A NE2 1 
ATOM   522  N N   . THR A 1 70  ? 46.261  45.422 7.783   1.00 15.86 ? 70  THR A N   1 
ATOM   523  C CA  . THR A 1 70  ? 46.925  45.260 6.508   1.00 18.30 ? 70  THR A CA  1 
ATOM   524  C C   . THR A 1 70  ? 47.154  43.828 6.069   1.00 17.70 ? 70  THR A C   1 
ATOM   525  O O   . THR A 1 70  ? 47.962  43.579 5.177   1.00 19.58 ? 70  THR A O   1 
ATOM   526  C CB  . THR A 1 70  ? 48.256  46.055 6.508   1.00 19.21 ? 70  THR A CB  1 
ATOM   527  O OG1 . THR A 1 70  ? 49.027  45.687 7.657   1.00 19.99 ? 70  THR A OG1 1 
ATOM   528  C CG2 . THR A 1 70  ? 47.973  47.567 6.604   1.00 21.32 ? 70  THR A CG2 1 
ATOM   529  N N   . ASN A 1 71  ? 46.408  42.892 6.643   1.00 16.10 ? 71  ASN A N   1 
ATOM   530  C CA  . ASN A 1 71  ? 46.572  41.496 6.277   1.00 15.38 ? 71  ASN A CA  1 
ATOM   531  C C   . ASN A 1 71  ? 45.439  40.958 5.408   1.00 14.91 ? 71  ASN A C   1 
ATOM   532  O O   . ASN A 1 71  ? 45.071  39.791 5.525   1.00 14.97 ? 71  ASN A O   1 
ATOM   533  C CB  . ASN A 1 71  ? 46.744  40.626 7.526   1.00 15.13 ? 71  ASN A CB  1 
ATOM   534  C CG  . ASN A 1 71  ? 45.563  40.714 8.459   1.00 15.63 ? 71  ASN A CG  1 
ATOM   535  O OD1 . ASN A 1 71  ? 44.927  41.759 8.565   1.00 16.16 ? 71  ASN A OD1 1 
ATOM   536  N ND2 . ASN A 1 71  ? 45.256  39.614 9.142   1.00 15.89 ? 71  ASN A ND2 1 
ATOM   537  N N   . CYS A 1 72  ? 44.906  41.788 4.513   1.00 13.93 ? 72  CYS A N   1 
ATOM   538  C CA  . CYS A 1 72  ? 43.826  41.353 3.628   1.00 12.49 ? 72  CYS A CA  1 
ATOM   539  C C   . CYS A 1 72  ? 44.269  41.087 2.197   1.00 11.93 ? 72  CYS A C   1 
ATOM   540  O O   . CYS A 1 72  ? 45.281  41.617 1.728   1.00 9.29  ? 72  CYS A O   1 
ATOM   541  C CB  . CYS A 1 72  ? 42.641  42.323 3.662   1.00 12.60 ? 72  CYS A CB  1 
ATOM   542  S SG  . CYS A 1 72  ? 41.618  42.148 5.153   1.00 13.12 ? 72  CYS A SG  1 
ATOM   543  N N   . TYR A 1 73  ? 43.538  40.187 1.544   1.00 11.66 ? 73  TYR A N   1 
ATOM   544  C CA  . TYR A 1 73  ? 43.805  39.771 0.167   1.00 12.74 ? 73  TYR A CA  1 
ATOM   545  C C   . TYR A 1 73  ? 42.490  39.616 -0.600  1.00 13.21 ? 73  TYR A C   1 
ATOM   546  O O   . TYR A 1 73  ? 41.474  39.173 -0.045  1.00 11.81 ? 73  TYR A O   1 
ATOM   547  C CB  . TYR A 1 73  ? 44.547  38.428 0.149   1.00 13.07 ? 73  TYR A CB  1 
ATOM   548  C CG  . TYR A 1 73  ? 45.907  38.452 0.807   1.00 15.84 ? 73  TYR A CG  1 
ATOM   549  C CD1 . TYR A 1 73  ? 46.045  38.308 2.193   1.00 15.82 ? 73  TYR A CD1 1 
ATOM   550  C CD2 . TYR A 1 73  ? 47.060  38.626 0.047   1.00 17.33 ? 73  TYR A CD2 1 
ATOM   551  C CE1 . TYR A 1 73  ? 47.299  38.341 2.801   1.00 17.36 ? 73  TYR A CE1 1 
ATOM   552  C CE2 . TYR A 1 73  ? 48.324  38.658 0.647   1.00 18.57 ? 73  TYR A CE2 1 
ATOM   553  C CZ  . TYR A 1 73  ? 48.432  38.514 2.021   1.00 17.97 ? 73  TYR A CZ  1 
ATOM   554  O OH  . TYR A 1 73  ? 49.679  38.535 2.595   1.00 20.71 ? 73  TYR A OH  1 
ATOM   555  N N   . GLN A 1 74  ? 42.527  39.970 -1.878  1.00 15.21 ? 74  GLN A N   1 
ATOM   556  C CA  . GLN A 1 74  ? 41.371  39.884 -2.766  1.00 17.02 ? 74  GLN A CA  1 
ATOM   557  C C   . GLN A 1 74  ? 41.573  38.783 -3.804  1.00 16.91 ? 74  GLN A C   1 
ATOM   558  O O   . GLN A 1 74  ? 42.646  38.678 -4.412  1.00 16.31 ? 74  GLN A O   1 
ATOM   559  C CB  . GLN A 1 74  ? 41.188  41.217 -3.489  1.00 20.73 ? 74  GLN A CB  1 
ATOM   560  C CG  . GLN A 1 74  ? 40.058  41.230 -4.504  1.00 24.86 ? 74  GLN A CG  1 
ATOM   561  C CD  . GLN A 1 74  ? 40.181  42.385 -5.463  1.00 27.66 ? 74  GLN A CD  1 
ATOM   562  O OE1 . GLN A 1 74  ? 40.224  43.546 -5.052  1.00 29.87 ? 74  GLN A OE1 1 
ATOM   563  N NE2 . GLN A 1 74  ? 40.252  42.077 -6.753  1.00 30.41 ? 74  GLN A NE2 1 
ATOM   564  N N   . SER A 1 75  ? 40.541  37.979 -4.020  1.00 15.46 ? 75  SER A N   1 
ATOM   565  C CA  . SER A 1 75  ? 40.631  36.909 -4.989  1.00 16.03 ? 75  SER A CA  1 
ATOM   566  C C   . SER A 1 75  ? 40.797  37.460 -6.396  1.00 16.38 ? 75  SER A C   1 
ATOM   567  O O   . SER A 1 75  ? 40.143  38.421 -6.783  1.00 16.04 ? 75  SER A O   1 
ATOM   568  C CB  . SER A 1 75  ? 39.404  35.999 -4.913  1.00 15.17 ? 75  SER A CB  1 
ATOM   569  O OG  . SER A 1 75  ? 38.196  36.731 -5.009  1.00 16.09 ? 75  SER A OG  1 
ATOM   570  N N   . LYS A 1 76  ? 41.713  36.868 -7.146  1.00 17.59 ? 76  LYS A N   1 
ATOM   571  C CA  . LYS A 1 76  ? 41.964  37.281 -8.511  1.00 20.11 ? 76  LYS A CA  1 
ATOM   572  C C   . LYS A 1 76  ? 40.744  37.020 -9.409  1.00 20.40 ? 76  LYS A C   1 
ATOM   573  O O   . LYS A 1 76  ? 40.436  37.826 -10.284 1.00 21.30 ? 76  LYS A O   1 
ATOM   574  C CB  . LYS A 1 76  ? 43.237  36.581 -9.010  1.00 22.01 ? 76  LYS A CB  1 
ATOM   575  C CG  . LYS A 1 76  ? 43.229  36.102 -10.442 1.00 27.53 ? 76  LYS A CG  1 
ATOM   576  C CD  . LYS A 1 76  ? 44.583  35.486 -10.798 1.00 31.79 ? 76  LYS A CD  1 
ATOM   577  C CE  . LYS A 1 76  ? 44.984  34.380 -9.817  1.00 33.21 ? 76  LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 76  ? 46.411  33.992 -9.984  1.00 35.08 ? 76  LYS A NZ  1 
ATOM   579  N N   . SER A 1 77  ? 40.028  35.929 -9.139  1.00 20.37 ? 77  SER A N   1 
ATOM   580  C CA  . SER A 1 77  ? 38.837  35.533 -9.888  1.00 20.45 ? 77  SER A CA  1 
ATOM   581  C C   . SER A 1 77  ? 37.562  35.641 -9.025  1.00 20.35 ? 77  SER A C   1 
ATOM   582  O O   . SER A 1 77  ? 37.620  35.736 -7.795  1.00 18.61 ? 77  SER A O   1 
ATOM   583  C CB  . SER A 1 77  ? 38.988  34.082 -10.357 1.00 22.48 ? 77  SER A CB  1 
ATOM   584  O OG  . SER A 1 77  ? 40.126  33.906 -11.199 1.00 28.03 ? 77  SER A OG  1 
ATOM   585  N N   . THR A 1 78  ? 36.401  35.636 -9.667  1.00 19.51 ? 78  THR A N   1 
ATOM   586  C CA  . THR A 1 78  ? 35.150  35.712 -8.925  1.00 18.64 ? 78  THR A CA  1 
ATOM   587  C C   . THR A 1 78  ? 34.811  34.338 -8.342  1.00 18.63 ? 78  THR A C   1 
ATOM   588  O O   . THR A 1 78  ? 35.235  33.294 -8.847  1.00 17.52 ? 78  THR A O   1 
ATOM   589  C CB  . THR A 1 78  ? 33.967  36.203 -9.799  1.00 18.97 ? 78  THR A CB  1 
ATOM   590  O OG1 . THR A 1 78  ? 33.902  35.438 -11.004 1.00 21.00 ? 78  THR A OG1 1 
ATOM   591  C CG2 . THR A 1 78  ? 34.115  37.657 -10.145 1.00 18.21 ? 78  THR A CG2 1 
ATOM   592  N N   . MET A 1 79  ? 34.056  34.345 -7.259  1.00 18.18 ? 79  MET A N   1 
ATOM   593  C CA  . MET A 1 79  ? 33.668  33.119 -6.611  1.00 16.90 ? 79  MET A CA  1 
ATOM   594  C C   . MET A 1 79  ? 32.173  33.083 -6.371  1.00 17.41 ? 79  MET A C   1 
ATOM   595  O O   . MET A 1 79  ? 31.545  34.119 -6.155  1.00 14.79 ? 79  MET A O   1 
ATOM   596  C CB  . MET A 1 79  ? 34.416  32.984 -5.297  1.00 17.59 ? 79  MET A CB  1 
ATOM   597  C CG  . MET A 1 79  ? 35.897  32.762 -5.503  1.00 19.30 ? 79  MET A CG  1 
ATOM   598  S SD  . MET A 1 79  ? 36.701  32.305 -3.988  1.00 20.94 ? 79  MET A SD  1 
ATOM   599  C CE  . MET A 1 79  ? 38.367  32.004 -4.594  1.00 19.35 ? 79  MET A CE  1 
ATOM   600  N N   . ARG A 1 80  ? 31.604  31.888 -6.474  1.00 16.77 ? 80  ARG A N   1 
ATOM   601  C CA  . ARG A 1 80  ? 30.184  31.703 -6.230  1.00 18.45 ? 80  ARG A CA  1 
ATOM   602  C C   . ARG A 1 80  ? 29.972  31.762 -4.724  1.00 16.35 ? 80  ARG A C   1 
ATOM   603  O O   . ARG A 1 80  ? 30.484  30.920 -3.971  1.00 15.50 ? 80  ARG A O   1 
ATOM   604  C CB  . ARG A 1 80  ? 29.701  30.370 -6.805  1.00 21.69 ? 80  ARG A CB  1 
ATOM   605  C CG  . ARG A 1 80  ? 29.960  30.239 -8.296  1.00 27.25 ? 80  ARG A CG  1 
ATOM   606  C CD  . ARG A 1 80  ? 29.200  29.078 -8.873  1.00 34.30 ? 80  ARG A CD  1 
ATOM   607  N NE  . ARG A 1 80  ? 27.758  29.249 -8.690  1.00 41.59 ? 80  ARG A NE  1 
ATOM   608  C CZ  . ARG A 1 80  ? 26.916  28.280 -8.327  1.00 44.53 ? 80  ARG A CZ  1 
ATOM   609  N NH1 . ARG A 1 80  ? 27.363  27.040 -8.103  1.00 46.83 ? 80  ARG A NH1 1 
ATOM   610  N NH2 . ARG A 1 80  ? 25.619  28.550 -8.184  1.00 45.00 ? 80  ARG A NH2 1 
ATOM   611  N N   . ILE A 1 81  ? 29.266  32.798 -4.286  1.00 15.11 ? 81  ILE A N   1 
ATOM   612  C CA  . ILE A 1 81  ? 28.977  33.014 -2.879  1.00 13.08 ? 81  ILE A CA  1 
ATOM   613  C C   . ILE A 1 81  ? 27.483  33.244 -2.632  1.00 13.20 ? 81  ILE A C   1 
ATOM   614  O O   . ILE A 1 81  ? 26.718  33.574 -3.534  1.00 11.92 ? 81  ILE A O   1 
ATOM   615  C CB  . ILE A 1 81  ? 29.750  34.284 -2.327  1.00 13.78 ? 81  ILE A CB  1 
ATOM   616  C CG1 . ILE A 1 81  ? 29.334  35.553 -3.089  1.00 14.81 ? 81  ILE A CG1 1 
ATOM   617  C CG2 . ILE A 1 81  ? 31.272  34.124 -2.469  1.00 12.73 ? 81  ILE A CG2 1 
ATOM   618  C CD1 . ILE A 1 81  ? 30.069  36.820 -2.652  1.00 12.60 ? 81  ILE A CD1 1 
ATOM   619  N N   . THR A 1 82  ? 27.076  33.058 -1.388  1.00 12.56 ? 82  THR A N   1 
ATOM   620  C CA  . THR A 1 82  ? 25.710  33.331 -1.007  1.00 11.72 ? 82  THR A CA  1 
ATOM   621  C C   . THR A 1 82  ? 25.775  34.402 0.039   1.00 12.92 ? 82  THR A C   1 
ATOM   622  O O   . THR A 1 82  ? 26.499  34.253 1.044   1.00 12.76 ? 82  THR A O   1 
ATOM   623  C CB  . THR A 1 82  ? 25.006  32.129 -0.390  1.00 10.12 ? 82  THR A CB  1 
ATOM   624  O OG1 . THR A 1 82  ? 24.783  31.152 -1.411  1.00 12.39 ? 82  THR A OG1 1 
ATOM   625  C CG2 . THR A 1 82  ? 23.658  32.553 0.201   1.00 8.30  ? 82  THR A CG2 1 
ATOM   626  N N   . ASP A 1 83  ? 25.042  35.481 -0.201  1.00 13.56 ? 83  ASP A N   1 
ATOM   627  C CA  . ASP A 1 83  ? 24.987  36.581 0.745   1.00 14.02 ? 83  ASP A CA  1 
ATOM   628  C C   . ASP A 1 83  ? 23.760  36.385 1.622   1.00 14.59 ? 83  ASP A C   1 
ATOM   629  O O   . ASP A 1 83  ? 22.668  36.147 1.091   1.00 13.87 ? 83  ASP A O   1 
ATOM   630  C CB  . ASP A 1 83  ? 24.914  37.917 -0.004  1.00 16.87 ? 83  ASP A CB  1 
ATOM   631  C CG  . ASP A 1 83  ? 24.769  39.100 0.934   1.00 19.68 ? 83  ASP A CG  1 
ATOM   632  O OD1 . ASP A 1 83  ? 25.800  39.638 1.359   1.00 21.45 ? 83  ASP A OD1 1 
ATOM   633  O OD2 . ASP A 1 83  ? 23.623  39.491 1.245   1.00 20.00 ? 83  ASP A OD2 1 
ATOM   634  N N   . CYS A 1 84  ? 23.954  36.354 2.940   1.00 14.98 ? 84  CYS A N   1 
ATOM   635  C CA  . CYS A 1 84  ? 22.837  36.215 3.832   1.00 15.85 ? 84  CYS A CA  1 
ATOM   636  C C   . CYS A 1 84  ? 22.706  37.527 4.563   1.00 18.13 ? 84  CYS A C   1 
ATOM   637  O O   . CYS A 1 84  ? 23.604  37.899 5.313   1.00 18.79 ? 84  CYS A O   1 
ATOM   638  C CB  . CYS A 1 84  ? 23.094  35.107 4.849   1.00 13.50 ? 84  CYS A CB  1 
ATOM   639  S SG  . CYS A 1 84  ? 23.188  33.438 4.142   1.00 10.59 ? 84  CYS A SG  1 
ATOM   640  N N   . ARG A 1 85  ? 21.564  38.205 4.395   1.00 20.47 ? 85  ARG A N   1 
ATOM   641  C CA  . ARG A 1 85  ? 21.352  39.489 5.026   1.00 20.99 ? 85  ARG A CA  1 
ATOM   642  C C   . ARG A 1 85  ? 20.041  39.531 5.781   1.00 20.69 ? 85  ARG A C   1 
ATOM   643  O O   . ARG A 1 85  ? 19.001  39.196 5.237   1.00 19.72 ? 85  ARG A O   1 
ATOM   644  C CB  . ARG A 1 85  ? 21.333  40.560 3.948   1.00 23.59 ? 85  ARG A CB  1 
ATOM   645  C CG  . ARG A 1 85  ? 22.233  41.716 4.186   1.00 26.57 ? 85  ARG A CG  1 
ATOM   646  C CD  . ARG A 1 85  ? 22.211  42.614 2.974   1.00 30.22 ? 85  ARG A CD  1 
ATOM   647  N NE  . ARG A 1 85  ? 23.332  42.406 2.058   1.00 32.83 ? 85  ARG A NE  1 
ATOM   648  C CZ  . ARG A 1 85  ? 24.621  42.480 2.386   1.00 34.27 ? 85  ARG A CZ  1 
ATOM   649  N NH1 . ARG A 1 85  ? 25.004  42.738 3.633   1.00 38.96 ? 85  ARG A NH1 1 
ATOM   650  N NH2 . ARG A 1 85  ? 25.528  42.433 1.430   1.00 33.92 ? 85  ARG A NH2 1 
ATOM   651  N N   . GLU A 1 86  ? 20.099  40.002 7.023   1.00 20.32 ? 86  GLU A N   1 
ATOM   652  C CA  . GLU A 1 86  ? 18.931  40.135 7.902   1.00 24.03 ? 86  GLU A CA  1 
ATOM   653  C C   . GLU A 1 86  ? 17.831  40.986 7.276   1.00 24.78 ? 86  GLU A C   1 
ATOM   654  O O   . GLU A 1 86  ? 18.116  42.033 6.695   1.00 24.77 ? 86  GLU A O   1 
ATOM   655  C CB  . GLU A 1 86  ? 19.359  40.766 9.231   1.00 24.55 ? 86  GLU A CB  1 
ATOM   656  C CG  . GLU A 1 86  ? 19.008  39.937 10.442  1.00 26.94 ? 86  GLU A CG  1 
ATOM   657  C CD  . GLU A 1 86  ? 19.140  40.732 11.711  1.00 26.44 ? 86  GLU A CD  1 
ATOM   658  O OE1 . GLU A 1 86  ? 20.082  41.559 11.803  1.00 28.07 ? 86  GLU A OE1 1 
ATOM   659  O OE2 . GLU A 1 86  ? 18.299  40.542 12.606  1.00 26.49 ? 86  GLU A OE2 1 
ATOM   660  N N   . THR A 1 87  ? 16.592  40.515 7.359   1.00 26.46 ? 87  THR A N   1 
ATOM   661  C CA  . THR A 1 87  ? 15.459  41.258 6.809   1.00 28.37 ? 87  THR A CA  1 
ATOM   662  C C   . THR A 1 87  ? 14.993  42.326 7.805   1.00 30.88 ? 87  THR A C   1 
ATOM   663  O O   . THR A 1 87  ? 15.350  42.283 8.986   1.00 31.35 ? 87  THR A O   1 
ATOM   664  C CB  . THR A 1 87  ? 14.264  40.341 6.474   1.00 26.65 ? 87  THR A CB  1 
ATOM   665  O OG1 . THR A 1 87  ? 13.919  39.549 7.619   1.00 26.22 ? 87  THR A OG1 1 
ATOM   666  C CG2 . THR A 1 87  ? 14.583  39.443 5.291   1.00 26.31 ? 87  THR A CG2 1 
ATOM   667  N N   . GLY A 1 88  ? 14.237  43.310 7.316   1.00 33.40 ? 88  GLY A N   1 
ATOM   668  C CA  . GLY A 1 88  ? 13.735  44.355 8.193   1.00 35.60 ? 88  GLY A CA  1 
ATOM   669  C C   . GLY A 1 88  ? 12.842  43.761 9.272   1.00 36.78 ? 88  GLY A C   1 
ATOM   670  O O   . GLY A 1 88  ? 12.763  44.274 10.388  1.00 37.44 ? 88  GLY A O   1 
ATOM   671  N N   . SER A 1 89  ? 12.167  42.672 8.926   1.00 37.89 ? 89  SER A N   1 
ATOM   672  C CA  . SER A 1 89  ? 11.277  41.972 9.841   1.00 39.75 ? 89  SER A CA  1 
ATOM   673  C C   . SER A 1 89  ? 11.991  41.132 10.911  1.00 40.12 ? 89  SER A C   1 
ATOM   674  O O   . SER A 1 89  ? 11.409  40.845 11.962  1.00 41.00 ? 89  SER A O   1 
ATOM   675  C CB  . SER A 1 89  ? 10.292  41.094 9.048   1.00 40.91 ? 89  SER A CB  1 
ATOM   676  O OG  . SER A 1 89  ? 10.668  40.961 7.679   1.00 42.46 ? 89  SER A OG  1 
ATOM   677  N N   . SER A 1 90  ? 13.237  40.739 10.644  1.00 39.95 ? 90  SER A N   1 
ATOM   678  C CA  . SER A 1 90  ? 14.022  39.926 11.577  1.00 38.20 ? 90  SER A CA  1 
ATOM   679  C C   . SER A 1 90  ? 14.168  40.563 12.961  1.00 37.89 ? 90  SER A C   1 
ATOM   680  O O   . SER A 1 90  ? 14.494  41.745 13.088  1.00 36.94 ? 90  SER A O   1 
ATOM   681  C CB  . SER A 1 90  ? 15.413  39.636 10.998  1.00 38.11 ? 90  SER A CB  1 
ATOM   682  O OG  . SER A 1 90  ? 16.153  38.757 11.843  1.00 37.01 ? 90  SER A OG  1 
ATOM   683  N N   . LYS A 1 91  ? 13.914  39.772 13.997  1.00 38.10 ? 91  LYS A N   1 
ATOM   684  C CA  . LYS A 1 91  ? 14.018  40.245 15.370  1.00 39.80 ? 91  LYS A CA  1 
ATOM   685  C C   . LYS A 1 91  ? 14.334  39.052 16.256  1.00 38.91 ? 91  LYS A C   1 
ATOM   686  O O   . LYS A 1 91  ? 13.543  38.120 16.348  1.00 39.96 ? 91  LYS A O   1 
ATOM   687  C CB  . LYS A 1 91  ? 12.700  40.907 15.802  1.00 40.97 ? 91  LYS A CB  1 
ATOM   688  C CG  . LYS A 1 91  ? 12.863  42.255 16.531  1.00 45.25 ? 91  LYS A CG  1 
ATOM   689  C CD  . LYS A 1 91  ? 11.597  43.129 16.446  1.00 47.15 ? 91  LYS A CD  1 
ATOM   690  C CE  . LYS A 1 91  ? 10.364  42.401 17.009  1.00 50.21 ? 91  LYS A CE  1 
ATOM   691  N NZ  . LYS A 1 91  ? 9.083   43.181 16.912  1.00 49.95 ? 91  LYS A NZ  1 
ATOM   692  N N   . TYR A 1 92  ? 15.496  39.078 16.900  1.00 39.22 ? 92  TYR A N   1 
ATOM   693  C CA  . TYR A 1 92  ? 15.926  37.982 17.780  1.00 39.43 ? 92  TYR A CA  1 
ATOM   694  C C   . TYR A 1 92  ? 14.842  37.651 18.815  1.00 38.81 ? 92  TYR A C   1 
ATOM   695  O O   . TYR A 1 92  ? 14.202  38.551 19.361  1.00 39.71 ? 92  TYR A O   1 
ATOM   696  C CB  . TYR A 1 92  ? 17.241  38.360 18.484  1.00 39.27 ? 92  TYR A CB  1 
ATOM   697  C CG  . TYR A 1 92  ? 17.820  37.261 19.338  1.00 39.30 ? 92  TYR A CG  1 
ATOM   698  C CD1 . TYR A 1 92  ? 18.452  36.163 18.755  1.00 38.73 ? 92  TYR A CD1 1 
ATOM   699  C CD2 . TYR A 1 92  ? 17.692  37.292 20.725  1.00 39.06 ? 92  TYR A CD2 1 
ATOM   700  C CE1 . TYR A 1 92  ? 18.932  35.119 19.528  1.00 38.89 ? 92  TYR A CE1 1 
ATOM   701  C CE2 . TYR A 1 92  ? 18.169  36.252 21.508  1.00 39.49 ? 92  TYR A CE2 1 
ATOM   702  C CZ  . TYR A 1 92  ? 18.783  35.165 20.902  1.00 39.26 ? 92  TYR A CZ  1 
ATOM   703  O OH  . TYR A 1 92  ? 19.204  34.106 21.672  1.00 38.79 ? 92  TYR A OH  1 
ATOM   704  N N   . PRO A 1 93  ? 14.648  36.363 19.130  1.00 38.21 ? 93  PRO A N   1 
ATOM   705  C CA  . PRO A 1 93  ? 15.336  35.174 18.616  1.00 37.17 ? 93  PRO A CA  1 
ATOM   706  C C   . PRO A 1 93  ? 14.818  34.648 17.269  1.00 36.09 ? 93  PRO A C   1 
ATOM   707  O O   . PRO A 1 93  ? 15.184  33.551 16.835  1.00 34.94 ? 93  PRO A O   1 
ATOM   708  C CB  . PRO A 1 93  ? 15.124  34.159 19.739  1.00 38.55 ? 93  PRO A CB  1 
ATOM   709  C CG  . PRO A 1 93  ? 13.734  34.486 20.201  1.00 37.87 ? 93  PRO A CG  1 
ATOM   710  C CD  . PRO A 1 93  ? 13.728  36.006 20.229  1.00 37.79 ? 93  PRO A CD  1 
ATOM   711  N N   . ASN A 1 94  ? 13.950  35.417 16.627  1.00 34.17 ? 94  ASN A N   1 
ATOM   712  C CA  . ASN A 1 94  ? 13.418  35.020 15.331  1.00 33.17 ? 94  ASN A CA  1 
ATOM   713  C C   . ASN A 1 94  ? 14.176  35.764 14.244  1.00 31.82 ? 94  ASN A C   1 
ATOM   714  O O   . ASN A 1 94  ? 13.737  36.814 13.768  1.00 31.78 ? 94  ASN A O   1 
ATOM   715  C CB  . ASN A 1 94  ? 11.925  35.316 15.254  1.00 34.98 ? 94  ASN A CB  1 
ATOM   716  C CG  . ASN A 1 94  ? 11.119  34.450 16.195  1.00 35.85 ? 94  ASN A CG  1 
ATOM   717  O OD1 . ASN A 1 94  ? 10.636  34.920 17.233  1.00 36.78 ? 94  ASN A OD1 1 
ATOM   718  N ND2 . ASN A 1 94  ? 10.989  33.168 15.854  1.00 36.50 ? 94  ASN A ND2 1 
ATOM   719  N N   . CYS A 1 95  ? 15.347  35.227 13.898  1.00 30.00 ? 95  CYS A N   1 
ATOM   720  C CA  . CYS A 1 95  ? 16.233  35.807 12.886  1.00 25.98 ? 95  CYS A CA  1 
ATOM   721  C C   . CYS A 1 95  ? 15.762  35.393 11.495  1.00 24.27 ? 95  CYS A C   1 
ATOM   722  O O   . CYS A 1 95  ? 15.429  34.231 11.265  1.00 23.70 ? 95  CYS A O   1 
ATOM   723  C CB  . CYS A 1 95  ? 17.681  35.331 13.116  1.00 26.23 ? 95  CYS A CB  1 
ATOM   724  S SG  . CYS A 1 95  ? 18.342  35.597 14.805  1.00 23.15 ? 95  CYS A SG  1 
ATOM   725  N N   . ALA A 1 96  ? 15.686  36.355 10.585  1.00 21.42 ? 96  ALA A N   1 
ATOM   726  C CA  . ALA A 1 96  ? 15.243  36.081 9.228   1.00 19.28 ? 96  ALA A CA  1 
ATOM   727  C C   . ALA A 1 96  ? 16.249  36.677 8.270   1.00 17.93 ? 96  ALA A C   1 
ATOM   728  O O   . ALA A 1 96  ? 16.665  37.819 8.417   1.00 18.12 ? 96  ALA A O   1 
ATOM   729  C CB  . ALA A 1 96  ? 13.863  36.675 8.989   1.00 19.97 ? 96  ALA A CB  1 
ATOM   730  N N   . TYR A 1 97  ? 16.617  35.904 7.264   1.00 17.02 ? 97  TYR A N   1 
ATOM   731  C CA  . TYR A 1 97  ? 17.601  36.341 6.299   1.00 15.70 ? 97  TYR A CA  1 
ATOM   732  C C   . TYR A 1 97  ? 17.105  36.261 4.886   1.00 16.07 ? 97  TYR A C   1 
ATOM   733  O O   . TYR A 1 97  ? 16.280  35.431 4.556   1.00 15.58 ? 97  TYR A O   1 
ATOM   734  C CB  . TYR A 1 97  ? 18.850  35.454 6.418   1.00 15.50 ? 97  TYR A CB  1 
ATOM   735  C CG  . TYR A 1 97  ? 19.540  35.587 7.741   1.00 12.98 ? 97  TYR A CG  1 
ATOM   736  C CD1 . TYR A 1 97  ? 20.548  36.520 7.916   1.00 14.28 ? 97  TYR A CD1 1 
ATOM   737  C CD2 . TYR A 1 97  ? 19.115  34.863 8.845   1.00 12.69 ? 97  TYR A CD2 1 
ATOM   738  C CE1 . TYR A 1 97  ? 21.110  36.741 9.163   1.00 13.96 ? 97  TYR A CE1 1 
ATOM   739  C CE2 . TYR A 1 97  ? 19.673  35.076 10.097  1.00 12.92 ? 97  TYR A CE2 1 
ATOM   740  C CZ  . TYR A 1 97  ? 20.668  36.021 10.244  1.00 12.18 ? 97  TYR A CZ  1 
ATOM   741  O OH  . TYR A 1 97  ? 21.210  36.269 11.476  1.00 13.33 ? 97  TYR A OH  1 
ATOM   742  N N   . LYS A 1 98  ? 17.633  37.139 4.052   1.00 16.80 ? 98  LYS A N   1 
ATOM   743  C CA  . LYS A 1 98  ? 17.318  37.145 2.639   1.00 18.40 ? 98  LYS A CA  1 
ATOM   744  C C   . LYS A 1 98  ? 18.511  36.408 2.038   1.00 18.13 ? 98  LYS A C   1 
ATOM   745  O O   . LYS A 1 98  ? 19.664  36.689 2.383   1.00 18.66 ? 98  LYS A O   1 
ATOM   746  C CB  . LYS A 1 98  ? 17.287  38.585 2.108   1.00 21.18 ? 98  LYS A CB  1 
ATOM   747  C CG  . LYS A 1 98  ? 16.462  38.779 0.849   1.00 26.00 ? 98  LYS A CG  1 
ATOM   748  C CD  . LYS A 1 98  ? 17.117  38.176 -0.377  1.00 30.22 ? 98  LYS A CD  1 
ATOM   749  C CE  . LYS A 1 98  ? 16.155  38.132 -1.553  1.00 32.15 ? 98  LYS A CE  1 
ATOM   750  N NZ  . LYS A 1 98  ? 15.610  39.504 -1.871  1.00 37.64 ? 98  LYS A NZ  1 
ATOM   751  N N   . THR A 1 99  ? 18.235  35.449 1.173   1.00 15.58 ? 99  THR A N   1 
ATOM   752  C CA  . THR A 1 99  ? 19.282  34.692 0.527   1.00 13.96 ? 99  THR A CA  1 
ATOM   753  C C   . THR A 1 99  ? 19.557  35.262 -0.866  1.00 13.80 ? 99  THR A C   1 
ATOM   754  O O   . THR A 1 99  ? 18.652  35.349 -1.691  1.00 14.51 ? 99  THR A O   1 
ATOM   755  C CB  . THR A 1 99  ? 18.843  33.216 0.391   1.00 13.25 ? 99  THR A CB  1 
ATOM   756  O OG1 . THR A 1 99  ? 18.718  32.642 1.693   1.00 11.44 ? 99  THR A OG1 1 
ATOM   757  C CG2 . THR A 1 99  ? 19.847  32.405 -0.435  1.00 10.06 ? 99  THR A CG2 1 
ATOM   758  N N   . THR A 1 100 ? 20.801  35.625 -1.144  1.00 13.10 ? 100 THR A N   1 
ATOM   759  C CA  . THR A 1 100 ? 21.158  36.134 -2.467  1.00 12.80 ? 100 THR A CA  1 
ATOM   760  C C   . THR A 1 100 ? 22.401  35.402 -2.988  1.00 14.05 ? 100 THR A C   1 
ATOM   761  O O   . THR A 1 100 ? 23.434  35.389 -2.333  1.00 13.65 ? 100 THR A O   1 
ATOM   762  C CB  . THR A 1 100 ? 21.447  37.665 -2.465  1.00 12.31 ? 100 THR A CB  1 
ATOM   763  O OG1 . THR A 1 100 ? 20.299  38.382 -1.996  1.00 13.01 ? 100 THR A OG1 1 
ATOM   764  C CG2 . THR A 1 100 ? 21.753  38.132 -3.874  1.00 10.20 ? 100 THR A CG2 1 
ATOM   765  N N   . GLN A 1 101 ? 22.295  34.784 -4.160  1.00 13.75 ? 101 GLN A N   1 
ATOM   766  C CA  . GLN A 1 101 ? 23.426  34.084 -4.754  1.00 16.71 ? 101 GLN A CA  1 
ATOM   767  C C   . GLN A 1 101 ? 24.042  34.956 -5.829  1.00 16.19 ? 101 GLN A C   1 
ATOM   768  O O   . GLN A 1 101 ? 23.330  35.455 -6.704  1.00 14.05 ? 101 GLN A O   1 
ATOM   769  C CB  . GLN A 1 101 ? 22.973  32.748 -5.329  1.00 17.68 ? 101 GLN A CB  1 
ATOM   770  C CG  . GLN A 1 101 ? 22.458  31.842 -4.245  1.00 22.53 ? 101 GLN A CG  1 
ATOM   771  C CD  . GLN A 1 101 ? 21.738  30.654 -4.789  1.00 26.15 ? 101 GLN A CD  1 
ATOM   772  O OE1 . GLN A 1 101 ? 22.358  29.674 -5.186  1.00 31.05 ? 101 GLN A OE1 1 
ATOM   773  N NE2 . GLN A 1 101 ? 20.408  30.716 -4.801  1.00 28.19 ? 101 GLN A NE2 1 
ATOM   774  N N   . VAL A 1 102 ? 25.347  35.202 -5.717  1.00 15.70 ? 102 VAL A N   1 
ATOM   775  C CA  . VAL A 1 102 ? 26.086  36.046 -6.677  1.00 16.22 ? 102 VAL A CA  1 
ATOM   776  C C   . VAL A 1 102 ? 27.510  35.551 -6.926  1.00 16.92 ? 102 VAL A C   1 
ATOM   777  O O   . VAL A 1 102 ? 28.006  34.664 -6.234  1.00 16.74 ? 102 VAL A O   1 
ATOM   778  C CB  . VAL A 1 102 ? 26.205  37.531 -6.203  1.00 15.18 ? 102 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 102 ? 24.836  38.202 -6.159  1.00 12.78 ? 102 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 102 ? 26.886  37.608 -4.833  1.00 13.91 ? 102 VAL A CG2 1 
ATOM   781  N N   . GLU A 1 103 ? 28.152  36.113 -7.942  1.00 16.83 ? 103 GLU A N   1 
ATOM   782  C CA  . GLU A 1 103 ? 29.527  35.743 -8.260  1.00 18.34 ? 103 GLU A CA  1 
ATOM   783  C C   . GLU A 1 103 ? 30.328  37.020 -8.166  1.00 17.19 ? 103 GLU A C   1 
ATOM   784  O O   . GLU A 1 103 ? 30.181  37.904 -9.002  1.00 16.97 ? 103 GLU A O   1 
ATOM   785  C CB  . GLU A 1 103 ? 29.640  35.140 -9.657  1.00 19.53 ? 103 GLU A CB  1 
ATOM   786  C CG  . GLU A 1 103 ? 28.943  33.792 -9.800  1.00 26.70 ? 103 GLU A CG  1 
ATOM   787  C CD  . GLU A 1 103 ? 29.027  33.243 -11.218 1.00 30.96 ? 103 GLU A CD  1 
ATOM   788  O OE1 . GLU A 1 103 ? 30.154  33.191 -11.763 1.00 31.63 ? 103 GLU A OE1 1 
ATOM   789  O OE2 . GLU A 1 103 ? 27.967  32.876 -11.788 1.00 33.82 ? 103 GLU A OE2 1 
ATOM   790  N N   . LYS A 1 104 ? 31.091  37.145 -7.084  1.00 16.29 ? 104 LYS A N   1 
ATOM   791  C CA  . LYS A 1 104 ? 31.910  38.327 -6.825  1.00 16.17 ? 104 LYS A CA  1 
ATOM   792  C C   . LYS A 1 104 ? 33.284  37.912 -6.319  1.00 15.16 ? 104 LYS A C   1 
ATOM   793  O O   . LYS A 1 104 ? 33.485  36.752 -5.962  1.00 13.92 ? 104 LYS A O   1 
ATOM   794  C CB  . LYS A 1 104 ? 31.257  39.183 -5.739  1.00 15.29 ? 104 LYS A CB  1 
ATOM   795  C CG  . LYS A 1 104 ? 29.844  39.618 -6.046  1.00 17.66 ? 104 LYS A CG  1 
ATOM   796  C CD  . LYS A 1 104 ? 29.344  40.588 -5.001  1.00 19.44 ? 104 LYS A CD  1 
ATOM   797  C CE  . LYS A 1 104 ? 30.157  41.875 -5.025  1.00 20.80 ? 104 LYS A CE  1 
ATOM   798  N NZ  . LYS A 1 104 ? 29.628  42.858 -4.049  1.00 23.35 ? 104 LYS A NZ  1 
ATOM   799  N N   . HIS A 1 105 ? 34.232  38.849 -6.335  1.00 13.90 ? 105 HIS A N   1 
ATOM   800  C CA  . HIS A 1 105 ? 35.582  38.607 -5.809  1.00 12.26 ? 105 HIS A CA  1 
ATOM   801  C C   . HIS A 1 105 ? 35.424  38.680 -4.292  1.00 11.40 ? 105 HIS A C   1 
ATOM   802  O O   . HIS A 1 105 ? 34.545  39.374 -3.789  1.00 12.03 ? 105 HIS A O   1 
ATOM   803  C CB  . HIS A 1 105 ? 36.547  39.713 -6.254  1.00 14.00 ? 105 HIS A CB  1 
ATOM   804  C CG  . HIS A 1 105 ? 36.818  39.722 -7.725  1.00 17.11 ? 105 HIS A CG  1 
ATOM   805  N ND1 . HIS A 1 105 ? 36.023  40.402 -8.626  1.00 18.27 ? 105 HIS A ND1 1 
ATOM   806  C CD2 . HIS A 1 105 ? 37.748  39.067 -8.464  1.00 17.12 ? 105 HIS A CD2 1 
ATOM   807  C CE1 . HIS A 1 105 ? 36.442  40.153 -9.854  1.00 19.01 ? 105 HIS A CE1 1 
ATOM   808  N NE2 . HIS A 1 105 ? 37.486  39.347 -9.783  1.00 19.17 ? 105 HIS A NE2 1 
ATOM   809  N N   . ILE A 1 106 ? 36.209  37.922 -3.547  1.00 10.53 ? 106 ILE A N   1 
ATOM   810  C CA  . ILE A 1 106 ? 36.092  37.990 -2.101  1.00 9.82  ? 106 ILE A CA  1 
ATOM   811  C C   . ILE A 1 106 ? 37.363  38.600 -1.543  1.00 10.63 ? 106 ILE A C   1 
ATOM   812  O O   . ILE A 1 106 ? 38.404  38.622 -2.212  1.00 10.61 ? 106 ILE A O   1 
ATOM   813  C CB  . ILE A 1 106 ? 35.851  36.604 -1.446  1.00 9.36  ? 106 ILE A CB  1 
ATOM   814  C CG1 . ILE A 1 106 ? 36.998  35.649 -1.764  1.00 8.23  ? 106 ILE A CG1 1 
ATOM   815  C CG2 . ILE A 1 106 ? 34.531  36.015 -1.906  1.00 8.59  ? 106 ILE A CG2 1 
ATOM   816  C CD1 . ILE A 1 106 ? 37.030  34.461 -0.821  1.00 10.21 ? 106 ILE A CD1 1 
ATOM   817  N N   . ILE A 1 107 ? 37.245  39.166 -0.348  1.00 10.62 ? 107 ILE A N   1 
ATOM   818  C CA  . ILE A 1 107 ? 38.368  39.769 0.348   1.00 10.11 ? 107 ILE A CA  1 
ATOM   819  C C   . ILE A 1 107 ? 38.338  39.125 1.724   1.00 10.95 ? 107 ILE A C   1 
ATOM   820  O O   . ILE A 1 107 ? 37.301  39.109 2.399   1.00 11.14 ? 107 ILE A O   1 
ATOM   821  C CB  . ILE A 1 107 ? 38.223  41.310 0.491   1.00 11.41 ? 107 ILE A CB  1 
ATOM   822  C CG1 . ILE A 1 107 ? 38.218  41.981 -0.886  1.00 12.39 ? 107 ILE A CG1 1 
ATOM   823  C CG2 . ILE A 1 107 ? 39.393  41.870 1.306   1.00 11.26 ? 107 ILE A CG2 1 
ATOM   824  C CD1 . ILE A 1 107 ? 37.751  43.406 -0.850  1.00 15.32 ? 107 ILE A CD1 1 
ATOM   825  N N   . VAL A 1 108 ? 39.455  38.520 2.103   1.00 10.31 ? 108 VAL A N   1 
ATOM   826  C CA  . VAL A 1 108 ? 39.551  37.861 3.399   1.00 9.72  ? 108 VAL A CA  1 
ATOM   827  C C   . VAL A 1 108 ? 40.838  38.304 4.077   1.00 9.03  ? 108 VAL A C   1 
ATOM   828  O O   . VAL A 1 108 ? 41.750  38.786 3.414   1.00 10.67 ? 108 VAL A O   1 
ATOM   829  C CB  . VAL A 1 108 ? 39.620  36.306 3.236   1.00 8.98  ? 108 VAL A CB  1 
ATOM   830  C CG1 . VAL A 1 108 ? 38.381  35.784 2.524   1.00 9.74  ? 108 VAL A CG1 1 
ATOM   831  C CG2 . VAL A 1 108 ? 40.883  35.897 2.461   1.00 7.45  ? 108 VAL A CG2 1 
ATOM   832  N N   . ALA A 1 109 ? 40.882  38.209 5.399   1.00 8.33  ? 109 ALA A N   1 
ATOM   833  C CA  . ALA A 1 109 ? 42.104  38.507 6.122   1.00 9.99  ? 109 ALA A CA  1 
ATOM   834  C C   . ALA A 1 109 ? 42.767  37.123 6.373   1.00 10.82 ? 109 ALA A C   1 
ATOM   835  O O   . ALA A 1 109 ? 42.086  36.148 6.659   1.00 12.37 ? 109 ALA A O   1 
ATOM   836  C CB  . ALA A 1 109 ? 41.784  39.186 7.408   1.00 7.56  ? 109 ALA A CB  1 
ATOM   837  N N   . CYS A 1 110 ? 44.075  37.012 6.190   1.00 12.84 ? 110 CYS A N   1 
ATOM   838  C CA  . CYS A 1 110 ? 44.768  35.742 6.406   1.00 11.63 ? 110 CYS A CA  1 
ATOM   839  C C   . CYS A 1 110 ? 45.669  35.862 7.620   1.00 12.57 ? 110 CYS A C   1 
ATOM   840  O O   . CYS A 1 110 ? 46.191  36.935 7.888   1.00 12.79 ? 110 CYS A O   1 
ATOM   841  C CB  . CYS A 1 110 ? 45.598  35.407 5.184   1.00 10.76 ? 110 CYS A CB  1 
ATOM   842  S SG  . CYS A 1 110 ? 44.575  35.267 3.687   1.00 11.74 ? 110 CYS A SG  1 
ATOM   843  N N   . GLY A 1 111 ? 45.832  34.776 8.361   1.00 11.05 ? 111 GLY A N   1 
ATOM   844  C CA  . GLY A 1 111 ? 46.673  34.809 9.545   1.00 13.55 ? 111 GLY A CA  1 
ATOM   845  C C   . GLY A 1 111 ? 47.176  33.427 9.925   1.00 14.21 ? 111 GLY A C   1 
ATOM   846  O O   . GLY A 1 111 ? 46.792  32.427 9.297   1.00 13.95 ? 111 GLY A O   1 
ATOM   847  N N   . GLY A 1 112 ? 48.024  33.376 10.953  1.00 14.44 ? 112 GLY A N   1 
ATOM   848  C CA  . GLY A 1 112 ? 48.582  32.115 11.413  1.00 14.38 ? 112 GLY A CA  1 
ATOM   849  C C   . GLY A 1 112 ? 49.664  31.565 10.497  1.00 15.19 ? 112 GLY A C   1 
ATOM   850  O O   . GLY A 1 112 ? 50.095  32.238 9.560   1.00 11.85 ? 112 GLY A O   1 
ATOM   851  N N   . LYS A 1 113 ? 50.152  30.364 10.809  1.00 15.19 ? 113 LYS A N   1 
ATOM   852  C CA  . LYS A 1 113 ? 51.173  29.707 9.998   1.00 15.25 ? 113 LYS A CA  1 
ATOM   853  C C   . LYS A 1 113 ? 50.917  28.195 9.902   1.00 14.16 ? 113 LYS A C   1 
ATOM   854  O O   . LYS A 1 113 ? 50.937  27.510 10.907  1.00 14.21 ? 113 LYS A O   1 
ATOM   855  C CB  . LYS A 1 113 ? 52.550  29.978 10.590  1.00 17.25 ? 113 LYS A CB  1 
ATOM   856  C CG  . LYS A 1 113 ? 53.653  29.860 9.568   1.00 24.22 ? 113 LYS A CG  1 
ATOM   857  C CD  . LYS A 1 113 ? 54.933  30.524 10.054  1.00 26.59 ? 113 LYS A CD  1 
ATOM   858  C CE  . LYS A 1 113 ? 55.904  30.758 8.893   1.00 29.27 ? 113 LYS A CE  1 
ATOM   859  N NZ  . LYS A 1 113 ? 56.319  29.491 8.208   1.00 30.51 ? 113 LYS A NZ  1 
ATOM   860  N N   . PRO A 1 114 ? 50.649  27.658 8.695   1.00 13.55 ? 114 PRO A N   1 
ATOM   861  C CA  . PRO A 1 114 ? 50.560  28.330 7.397   1.00 13.09 ? 114 PRO A CA  1 
ATOM   862  C C   . PRO A 1 114 ? 49.529  29.447 7.394   1.00 14.28 ? 114 PRO A C   1 
ATOM   863  O O   . PRO A 1 114 ? 48.664  29.503 8.263   1.00 12.82 ? 114 PRO A O   1 
ATOM   864  C CB  . PRO A 1 114 ? 50.187  27.192 6.439   1.00 14.47 ? 114 PRO A CB  1 
ATOM   865  C CG  . PRO A 1 114 ? 49.517  26.191 7.321   1.00 15.61 ? 114 PRO A CG  1 
ATOM   866  C CD  . PRO A 1 114 ? 50.382  26.218 8.546   1.00 12.52 ? 114 PRO A CD  1 
ATOM   867  N N   . SER A 1 115 ? 49.660  30.360 6.441   1.00 12.90 ? 115 SER A N   1 
ATOM   868  C CA  . SER A 1 115 ? 48.754  31.494 6.356   1.00 14.77 ? 115 SER A CA  1 
ATOM   869  C C   . SER A 1 115 ? 47.410  31.084 5.736   1.00 11.79 ? 115 SER A C   1 
ATOM   870  O O   . SER A 1 115 ? 47.338  30.689 4.575   1.00 13.17 ? 115 SER A O   1 
ATOM   871  C CB  . SER A 1 115 ? 49.423  32.618 5.559   1.00 13.74 ? 115 SER A CB  1 
ATOM   872  O OG  . SER A 1 115 ? 48.847  33.867 5.875   1.00 18.03 ? 115 SER A OG  1 
ATOM   873  N N   . VAL A 1 116 ? 46.337  31.191 6.508   1.00 12.10 ? 116 VAL A N   1 
ATOM   874  C CA  . VAL A 1 116 ? 45.015  30.796 6.015   1.00 12.48 ? 116 VAL A CA  1 
ATOM   875  C C   . VAL A 1 116 ? 43.949  31.865 6.317   1.00 13.52 ? 116 VAL A C   1 
ATOM   876  O O   . VAL A 1 116 ? 44.173  32.755 7.142   1.00 14.16 ? 116 VAL A O   1 
ATOM   877  C CB  . VAL A 1 116 ? 44.589  29.422 6.613   1.00 11.51 ? 116 VAL A CB  1 
ATOM   878  C CG1 . VAL A 1 116 ? 45.524  28.322 6.147   1.00 10.93 ? 116 VAL A CG1 1 
ATOM   879  C CG2 . VAL A 1 116 ? 44.562  29.495 8.131   1.00 12.32 ? 116 VAL A CG2 1 
ATOM   880  N N   . PRO A 1 117 ? 42.792  31.817 5.621   1.00 12.22 ? 117 PRO A N   1 
ATOM   881  C CA  . PRO A 1 117 ? 41.746  32.816 5.874   1.00 11.41 ? 117 PRO A CA  1 
ATOM   882  C C   . PRO A 1 117 ? 41.225  32.753 7.298   1.00 11.79 ? 117 PRO A C   1 
ATOM   883  O O   . PRO A 1 117 ? 40.897  31.677 7.801   1.00 11.42 ? 117 PRO A O   1 
ATOM   884  C CB  . PRO A 1 117 ? 40.662  32.436 4.869   1.00 10.51 ? 117 PRO A CB  1 
ATOM   885  C CG  . PRO A 1 117 ? 41.444  31.788 3.747   1.00 11.97 ? 117 PRO A CG  1 
ATOM   886  C CD  . PRO A 1 117 ? 42.409  30.929 4.507   1.00 10.60 ? 117 PRO A CD  1 
ATOM   887  N N   . VAL A 1 118 ? 41.163  33.902 7.961   1.00 10.17 ? 118 VAL A N   1 
ATOM   888  C CA  . VAL A 1 118 ? 40.661  33.939 9.334   1.00 10.46 ? 118 VAL A CA  1 
ATOM   889  C C   . VAL A 1 118 ? 39.499  34.925 9.547   1.00 10.01 ? 118 VAL A C   1 
ATOM   890  O O   . VAL A 1 118 ? 39.008  35.078 10.660  1.00 10.19 ? 118 VAL A O   1 
ATOM   891  C CB  . VAL A 1 118 ? 41.787  34.279 10.341  1.00 10.47 ? 118 VAL A CB  1 
ATOM   892  C CG1 . VAL A 1 118 ? 42.854  33.177 10.340  1.00 10.09 ? 118 VAL A CG1 1 
ATOM   893  C CG2 . VAL A 1 118 ? 42.393  35.642 10.018  1.00 9.07  ? 118 VAL A CG2 1 
ATOM   894  N N   . HIS A 1 119 ? 39.080  35.593 8.482   1.00 8.56  ? 119 HIS A N   1 
ATOM   895  C CA  . HIS A 1 119 ? 38.011  36.574 8.558   1.00 7.65  ? 119 HIS A CA  1 
ATOM   896  C C   . HIS A 1 119 ? 37.581  36.919 7.140   1.00 8.19  ? 119 HIS A C   1 
ATOM   897  O O   . HIS A 1 119 ? 38.401  36.916 6.223   1.00 6.24  ? 119 HIS A O   1 
ATOM   898  C CB  . HIS A 1 119 ? 38.544  37.802 9.322   1.00 10.58 ? 119 HIS A CB  1 
ATOM   899  C CG  . HIS A 1 119 ? 37.920  39.112 8.934   1.00 12.87 ? 119 HIS A CG  1 
ATOM   900  N ND1 . HIS A 1 119 ? 36.740  39.571 9.482   1.00 13.39 ? 119 HIS A ND1 1 
ATOM   901  C CD2 . HIS A 1 119 ? 38.340  40.079 8.084   1.00 12.30 ? 119 HIS A CD2 1 
ATOM   902  C CE1 . HIS A 1 119 ? 36.459  40.762 8.985   1.00 12.73 ? 119 HIS A CE1 1 
ATOM   903  N NE2 . HIS A 1 119 ? 37.416  41.094 8.135   1.00 13.88 ? 119 HIS A NE2 1 
ATOM   904  N N   . PHE A 1 120 ? 36.280  37.113 6.938   1.00 8.10  ? 120 PHE A N   1 
ATOM   905  C CA  . PHE A 1 120 ? 35.771  37.491 5.624   1.00 9.42  ? 120 PHE A CA  1 
ATOM   906  C C   . PHE A 1 120 ? 35.598  39.005 5.715   1.00 10.13 ? 120 PHE A C   1 
ATOM   907  O O   . PHE A 1 120 ? 34.912  39.502 6.612   1.00 11.29 ? 120 PHE A O   1 
ATOM   908  C CB  . PHE A 1 120 ? 34.426  36.805 5.334   1.00 8.03  ? 120 PHE A CB  1 
ATOM   909  C CG  . PHE A 1 120 ? 33.913  37.048 3.946   1.00 7.10  ? 120 PHE A CG  1 
ATOM   910  C CD1 . PHE A 1 120 ? 33.201  38.211 3.642   1.00 7.50  ? 120 PHE A CD1 1 
ATOM   911  C CD2 . PHE A 1 120 ? 34.174  36.138 2.930   1.00 7.92  ? 120 PHE A CD2 1 
ATOM   912  C CE1 . PHE A 1 120 ? 32.759  38.467 2.344   1.00 7.85  ? 120 PHE A CE1 1 
ATOM   913  C CE2 . PHE A 1 120 ? 33.733  36.382 1.615   1.00 9.23  ? 120 PHE A CE2 1 
ATOM   914  C CZ  . PHE A 1 120 ? 33.028  37.554 1.326   1.00 9.01  ? 120 PHE A CZ  1 
ATOM   915  N N   . ASP A 1 121 ? 36.230  39.736 4.809   1.00 9.61  ? 121 ASP A N   1 
ATOM   916  C CA  . ASP A 1 121 ? 36.165  41.189 4.852   1.00 10.01 ? 121 ASP A CA  1 
ATOM   917  C C   . ASP A 1 121 ? 35.091  41.801 3.972   1.00 9.92  ? 121 ASP A C   1 
ATOM   918  O O   . ASP A 1 121 ? 34.297  42.609 4.438   1.00 9.31  ? 121 ASP A O   1 
ATOM   919  C CB  . ASP A 1 121 ? 37.536  41.803 4.493   1.00 9.45  ? 121 ASP A CB  1 
ATOM   920  C CG  . ASP A 1 121 ? 37.731  43.201 5.085   1.00 10.40 ? 121 ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 121 ? 37.610  43.338 6.308   1.00 11.10 ? 121 ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 121 ? 38.014  44.161 4.346   1.00 10.32 ? 121 ASP A OD2 1 
ATOM   923  N N   . ALA A 1 122 ? 35.051  41.406 2.703   1.00 10.29 ? 122 ALA A N   1 
ATOM   924  C CA  . ALA A 1 122 ? 34.090  41.984 1.778   1.00 11.06 ? 122 ALA A CA  1 
ATOM   925  C C   . ALA A 1 122 ? 34.068  41.216 0.482   1.00 12.44 ? 122 ALA A C   1 
ATOM   926  O O   . ALA A 1 122 ? 34.837  40.284 0.293   1.00 12.22 ? 122 ALA A O   1 
ATOM   927  C CB  . ALA A 1 122 ? 34.474  43.439 1.484   1.00 10.20 ? 122 ALA A CB  1 
ATOM   928  N N   . SER A 1 123 ? 33.192  41.629 -0.420  1.00 14.93 ? 123 SER A N   1 
ATOM   929  C CA  . SER A 1 123 ? 33.090  41.012 -1.729  1.00 18.29 ? 123 SER A CA  1 
ATOM   930  C C   . SER A 1 123 ? 32.991  42.181 -2.680  1.00 19.37 ? 123 SER A C   1 
ATOM   931  O O   . SER A 1 123 ? 32.351  43.172 -2.371  1.00 22.24 ? 123 SER A O   1 
ATOM   932  C CB  . SER A 1 123 ? 31.879  40.068 -1.824  1.00 17.56 ? 123 SER A CB  1 
ATOM   933  O OG  . SER A 1 123 ? 30.646  40.733 -1.645  1.00 19.38 ? 123 SER A OG  1 
ATOM   934  N N   . VAL A 1 124 ? 33.701  42.103 -3.796  1.00 22.04 ? 124 VAL A N   1 
ATOM   935  C CA  . VAL A 1 124 ? 33.718  43.182 -4.755  1.00 24.72 ? 124 VAL A CA  1 
ATOM   936  C C   . VAL A 1 124 ? 33.538  42.695 -6.205  1.00 25.24 ? 124 VAL A C   1 
ATOM   937  O O   . VAL A 1 124 ? 33.937  41.559 -6.531  1.00 25.95 ? 124 VAL A O   1 
ATOM   938  C CB  . VAL A 1 124 ? 35.024  44.023 -4.551  1.00 26.22 ? 124 VAL A CB  1 
ATOM   939  C CG1 . VAL A 1 124 ? 36.258  43.157 -4.727  1.00 28.56 ? 124 VAL A CG1 1 
ATOM   940  C CG2 . VAL A 1 124 ? 35.065  45.221 -5.478  1.00 29.36 ? 124 VAL A CG2 1 
ATOM   941  O OXT . VAL A 1 124 ? 32.922  43.431 -7.002  1.00 27.55 ? 124 VAL A OXT 1 
ATOM   942  N N   . LYS B 1 1   ? 38.649  26.557 23.071  1.00 37.21 ? 1   LYS B N   1 
ATOM   943  C CA  . LYS B 1 1   ? 38.911  27.671 22.110  1.00 36.10 ? 1   LYS B CA  1 
ATOM   944  C C   . LYS B 1 1   ? 39.074  27.180 20.675  1.00 33.35 ? 1   LYS B C   1 
ATOM   945  O O   . LYS B 1 1   ? 40.091  26.580 20.316  1.00 35.15 ? 1   LYS B O   1 
ATOM   946  C CB  . LYS B 1 1   ? 40.157  28.459 22.525  1.00 38.26 ? 1   LYS B CB  1 
ATOM   947  C CG  . LYS B 1 1   ? 40.572  29.537 21.523  1.00 41.20 ? 1   LYS B CG  1 
ATOM   948  C CD  . LYS B 1 1   ? 39.568  30.691 21.440  1.00 42.73 ? 1   LYS B CD  1 
ATOM   949  C CE  . LYS B 1 1   ? 39.553  31.501 22.730  1.00 44.73 ? 1   LYS B CE  1 
ATOM   950  N NZ  . LYS B 1 1   ? 38.600  32.648 22.692  1.00 43.68 ? 1   LYS B NZ  1 
ATOM   951  N N   . GLU B 1 2   ? 38.058  27.456 19.869  1.00 28.89 ? 2   GLU B N   1 
ATOM   952  C CA  . GLU B 1 2   ? 38.028  27.089 18.463  1.00 24.02 ? 2   GLU B CA  1 
ATOM   953  C C   . GLU B 1 2   ? 39.095  27.915 17.735  1.00 21.62 ? 2   GLU B C   1 
ATOM   954  O O   . GLU B 1 2   ? 39.301  29.092 18.047  1.00 20.10 ? 2   GLU B O   1 
ATOM   955  C CB  . GLU B 1 2   ? 36.628  27.403 17.934  1.00 24.51 ? 2   GLU B CB  1 
ATOM   956  C CG  . GLU B 1 2   ? 36.423  27.284 16.445  1.00 24.13 ? 2   GLU B CG  1 
ATOM   957  C CD  . GLU B 1 2   ? 35.021  27.694 16.045  1.00 25.69 ? 2   GLU B CD  1 
ATOM   958  O OE1 . GLU B 1 2   ? 34.543  28.737 16.539  1.00 26.14 ? 2   GLU B OE1 1 
ATOM   959  O OE2 . GLU B 1 2   ? 34.388  26.971 15.253  1.00 26.54 ? 2   GLU B OE2 1 
ATOM   960  N N   . SER B 1 3   ? 39.825  27.297 16.821  1.00 19.28 ? 3   SER B N   1 
ATOM   961  C CA  . SER B 1 3   ? 40.852  28.037 16.109  1.00 17.38 ? 3   SER B CA  1 
ATOM   962  C C   . SER B 1 3   ? 40.237  29.025 15.121  1.00 16.83 ? 3   SER B C   1 
ATOM   963  O O   . SER B 1 3   ? 39.106  28.850 14.678  1.00 16.54 ? 3   SER B O   1 
ATOM   964  C CB  . SER B 1 3   ? 41.817  27.085 15.396  1.00 17.67 ? 3   SER B CB  1 
ATOM   965  O OG  . SER B 1 3   ? 41.244  26.495 14.244  1.00 15.82 ? 3   SER B OG  1 
ATOM   966  N N   . ALA B 1 4   ? 40.970  30.093 14.822  1.00 15.75 ? 4   ALA B N   1 
ATOM   967  C CA  . ALA B 1 4   ? 40.517  31.098 13.867  1.00 14.06 ? 4   ALA B CA  1 
ATOM   968  C C   . ALA B 1 4   ? 40.229  30.444 12.512  1.00 14.60 ? 4   ALA B C   1 
ATOM   969  O O   . ALA B 1 4   ? 39.217  30.757 11.879  1.00 15.11 ? 4   ALA B O   1 
ATOM   970  C CB  . ALA B 1 4   ? 41.565  32.188 13.708  1.00 12.49 ? 4   ALA B CB  1 
ATOM   971  N N   . ALA B 1 5   ? 41.126  29.568 12.055  1.00 12.25 ? 5   ALA B N   1 
ATOM   972  C CA  . ALA B 1 5   ? 40.933  28.880 10.776  1.00 11.65 ? 5   ALA B CA  1 
ATOM   973  C C   . ALA B 1 5   ? 39.641  28.047 10.771  1.00 11.68 ? 5   ALA B C   1 
ATOM   974  O O   . ALA B 1 5   ? 38.913  28.030 9.788   1.00 8.80  ? 5   ALA B O   1 
ATOM   975  C CB  . ALA B 1 5   ? 42.121  27.987 10.476  1.00 13.70 ? 5   ALA B CB  1 
ATOM   976  N N   . ALA B 1 6   ? 39.376  27.354 11.878  1.00 11.48 ? 6   ALA B N   1 
ATOM   977  C CA  . ALA B 1 6   ? 38.191  26.506 12.002  1.00 11.87 ? 6   ALA B CA  1 
ATOM   978  C C   . ALA B 1 6   ? 36.953  27.384 12.071  1.00 13.66 ? 6   ALA B C   1 
ATOM   979  O O   . ALA B 1 6   ? 35.924  27.058 11.487  1.00 12.59 ? 6   ALA B O   1 
ATOM   980  C CB  . ALA B 1 6   ? 38.287  25.628 13.250  1.00 11.90 ? 6   ALA B CB  1 
ATOM   981  N N   . LYS B 1 7   ? 37.073  28.510 12.771  1.00 14.05 ? 7   LYS B N   1 
ATOM   982  C CA  . LYS B 1 7   ? 35.967  29.452 12.909  1.00 14.30 ? 7   LYS B CA  1 
ATOM   983  C C   . LYS B 1 7   ? 35.576  30.001 11.544  1.00 12.82 ? 7   LYS B C   1 
ATOM   984  O O   . LYS B 1 7   ? 34.387  30.162 11.251  1.00 12.22 ? 7   LYS B O   1 
ATOM   985  C CB  . LYS B 1 7   ? 36.332  30.595 13.847  1.00 15.28 ? 7   LYS B CB  1 
ATOM   986  C CG  . LYS B 1 7   ? 35.172  31.560 14.064  1.00 18.84 ? 7   LYS B CG  1 
ATOM   987  C CD  . LYS B 1 7   ? 35.517  32.659 15.043  1.00 22.81 ? 7   LYS B CD  1 
ATOM   988  C CE  . LYS B 1 7   ? 34.319  33.581 15.264  1.00 25.86 ? 7   LYS B CE  1 
ATOM   989  N NZ  . LYS B 1 7   ? 34.671  34.707 16.172  1.00 30.30 ? 7   LYS B NZ  1 
ATOM   990  N N   . PHE B 1 8   ? 36.571  30.246 10.697  1.00 10.14 ? 8   PHE B N   1 
ATOM   991  C CA  . PHE B 1 8   ? 36.312  30.747 9.342   1.00 9.68  ? 8   PHE B CA  1 
ATOM   992  C C   . PHE B 1 8   ? 35.579  29.703 8.476   1.00 8.88  ? 8   PHE B C   1 
ATOM   993  O O   . PHE B 1 8   ? 34.714  30.064 7.660   1.00 7.11  ? 8   PHE B O   1 
ATOM   994  C CB  . PHE B 1 8   ? 37.614  31.192 8.643   1.00 6.57  ? 8   PHE B CB  1 
ATOM   995  C CG  . PHE B 1 8   ? 37.412  31.634 7.219   1.00 4.13  ? 8   PHE B CG  1 
ATOM   996  C CD1 . PHE B 1 8   ? 37.473  30.719 6.180   1.00 4.45  ? 8   PHE B CD1 1 
ATOM   997  C CD2 . PHE B 1 8   ? 37.115  32.957 6.923   1.00 6.12  ? 8   PHE B CD2 1 
ATOM   998  C CE1 . PHE B 1 8   ? 37.233  31.115 4.858   1.00 5.06  ? 8   PHE B CE1 1 
ATOM   999  C CE2 . PHE B 1 8   ? 36.871  33.370 5.605   1.00 6.27  ? 8   PHE B CE2 1 
ATOM   1000 C CZ  . PHE B 1 8   ? 36.932  32.446 4.572   1.00 6.81  ? 8   PHE B CZ  1 
ATOM   1001 N N   . GLU B 1 9   ? 35.968  28.432 8.591   1.00 8.39  ? 9   GLU B N   1 
ATOM   1002 C CA  . GLU B 1 9   ? 35.326  27.360 7.820   1.00 10.34 ? 9   GLU B CA  1 
ATOM   1003 C C   . GLU B 1 9   ? 33.867  27.193 8.232   1.00 10.79 ? 9   GLU B C   1 
ATOM   1004 O O   . GLU B 1 9   ? 32.987  27.125 7.381   1.00 10.40 ? 9   GLU B O   1 
ATOM   1005 C CB  . GLU B 1 9   ? 36.068  26.030 7.989   1.00 12.21 ? 9   GLU B CB  1 
ATOM   1006 C CG  . GLU B 1 9   ? 37.505  26.065 7.455   1.00 17.41 ? 9   GLU B CG  1 
ATOM   1007 C CD  . GLU B 1 9   ? 38.201  24.713 7.505   1.00 18.63 ? 9   GLU B CD  1 
ATOM   1008 O OE1 . GLU B 1 9   ? 37.529  23.684 7.276   1.00 20.89 ? 9   GLU B OE1 1 
ATOM   1009 O OE2 . GLU B 1 9   ? 39.417  24.675 7.788   1.00 20.92 ? 9   GLU B OE2 1 
ATOM   1010 N N   . ARG B 1 10  ? 33.618  27.180 9.536   1.00 9.60  ? 10  ARG B N   1 
ATOM   1011 C CA  . ARG B 1 10  ? 32.260  27.039 10.061  1.00 12.37 ? 10  ARG B CA  1 
ATOM   1012 C C   . ARG B 1 10  ? 31.344  28.196 9.661   1.00 12.39 ? 10  ARG B C   1 
ATOM   1013 O O   . ARG B 1 10  ? 30.172  28.009 9.341   1.00 13.73 ? 10  ARG B O   1 
ATOM   1014 C CB  . ARG B 1 10  ? 32.300  26.943 11.593  1.00 12.10 ? 10  ARG B CB  1 
ATOM   1015 C CG  . ARG B 1 10  ? 30.962  27.228 12.285  1.00 11.39 ? 10  ARG B CG  1 
ATOM   1016 C CD  . ARG B 1 10  ? 31.061  27.080 13.808  1.00 12.28 ? 10  ARG B CD  1 
ATOM   1017 N NE  . ARG B 1 10  ? 31.851  28.134 14.443  1.00 11.19 ? 10  ARG B NE  1 
ATOM   1018 C CZ  . ARG B 1 10  ? 31.380  29.328 14.782  1.00 12.35 ? 10  ARG B CZ  1 
ATOM   1019 N NH1 . ARG B 1 10  ? 30.108  29.636 14.547  1.00 10.20 ? 10  ARG B NH1 1 
ATOM   1020 N NH2 . ARG B 1 10  ? 32.182  30.226 15.349  1.00 12.64 ? 10  ARG B NH2 1 
ATOM   1021 N N   . GLN B 1 11  ? 31.869  29.408 9.744   1.00 13.72 ? 11  GLN B N   1 
ATOM   1022 C CA  . GLN B 1 11  ? 31.083  30.583 9.423   1.00 13.45 ? 11  GLN B CA  1 
ATOM   1023 C C   . GLN B 1 11  ? 30.978  30.945 7.941   1.00 12.34 ? 11  GLN B C   1 
ATOM   1024 O O   . GLN B 1 11  ? 29.972  31.501 7.522   1.00 11.91 ? 11  GLN B O   1 
ATOM   1025 C CB  . GLN B 1 11  ? 31.608  31.792 10.206  1.00 14.02 ? 11  GLN B CB  1 
ATOM   1026 C CG  . GLN B 1 11  ? 31.468  31.688 11.718  1.00 17.88 ? 11  GLN B CG  1 
ATOM   1027 C CD  . GLN B 1 11  ? 31.680  33.036 12.411  1.00 20.85 ? 11  GLN B CD  1 
ATOM   1028 O OE1 . GLN B 1 11  ? 32.529  33.820 12.004  1.00 22.97 ? 11  GLN B OE1 1 
ATOM   1029 N NE2 . GLN B 1 11  ? 30.909  33.300 13.462  1.00 20.90 ? 11  GLN B NE2 1 
ATOM   1030 N N   . HIS B 1 12  ? 31.982  30.605 7.139   1.00 10.18 ? 12  HIS B N   1 
ATOM   1031 C CA  . HIS B 1 12  ? 31.947  31.007 5.736   1.00 9.60  ? 12  HIS B CA  1 
ATOM   1032 C C   . HIS B 1 12  ? 32.098  29.947 4.636   1.00 11.12 ? 12  HIS B C   1 
ATOM   1033 O O   . HIS B 1 12  ? 32.012  30.285 3.453   1.00 10.67 ? 12  HIS B O   1 
ATOM   1034 C CB  . HIS B 1 12  ? 32.992  32.122 5.522   1.00 7.02  ? 12  HIS B CB  1 
ATOM   1035 C CG  . HIS B 1 12  ? 32.799  33.313 6.417   1.00 6.77  ? 12  HIS B CG  1 
ATOM   1036 N ND1 . HIS B 1 12  ? 31.808  34.249 6.208   1.00 5.65  ? 12  HIS B ND1 1 
ATOM   1037 C CD2 . HIS B 1 12  ? 33.448  33.699 7.541   1.00 5.02  ? 12  HIS B CD2 1 
ATOM   1038 C CE1 . HIS B 1 12  ? 31.854  35.156 7.165   1.00 6.37  ? 12  HIS B CE1 1 
ATOM   1039 N NE2 . HIS B 1 12  ? 32.840  34.847 7.985   1.00 5.25  ? 12  HIS B NE2 1 
ATOM   1040 N N   . MET B 1 13  ? 32.348  28.689 4.993   1.00 10.12 ? 13  MET B N   1 
ATOM   1041 C CA  . MET B 1 13  ? 32.533  27.672 3.962   1.00 11.96 ? 13  MET B CA  1 
ATOM   1042 C C   . MET B 1 13  ? 31.365  26.693 3.780   1.00 11.77 ? 13  MET B C   1 
ATOM   1043 O O   . MET B 1 13  ? 30.800  26.192 4.746   1.00 12.44 ? 13  MET B O   1 
ATOM   1044 C CB  . MET B 1 13  ? 33.846  26.872 4.181   1.00 11.56 ? 13  MET B CB  1 
ATOM   1045 C CG  . MET B 1 13  ? 35.171  27.645 3.987   1.00 10.17 ? 13  MET B CG  1 
ATOM   1046 S SD  . MET B 1 13  ? 35.402  28.342 2.321   1.00 13.14 ? 13  MET B SD  1 
ATOM   1047 C CE  . MET B 1 13  ? 35.263  26.900 1.339   1.00 14.12 ? 13  MET B CE  1 
ATOM   1048 N N   . ASP B 1 14  ? 30.930  26.555 2.533   1.00 11.34 ? 14  ASP B N   1 
ATOM   1049 C CA  . ASP B 1 14  ? 29.888  25.598 2.183   1.00 12.21 ? 14  ASP B CA  1 
ATOM   1050 C C   . ASP B 1 14  ? 30.203  25.022 0.798   1.00 13.29 ? 14  ASP B C   1 
ATOM   1051 O O   . ASP B 1 14  ? 29.521  25.304 -0.203  1.00 9.50  ? 14  ASP B O   1 
ATOM   1052 C CB  . ASP B 1 14  ? 28.476  26.189 2.227   1.00 12.23 ? 14  ASP B CB  1 
ATOM   1053 C CG  . ASP B 1 14  ? 27.406  25.102 2.183   1.00 13.70 ? 14  ASP B CG  1 
ATOM   1054 O OD1 . ASP B 1 14  ? 27.745  23.914 2.331   1.00 15.26 ? 14  ASP B OD1 1 
ATOM   1055 O OD2 . ASP B 1 14  ? 26.221  25.406 1.993   1.00 17.48 ? 14  ASP B OD2 1 
ATOM   1056 N N   . SER B 1 15  ? 31.334  24.320 0.745   1.00 12.98 ? 15  SER B N   1 
ATOM   1057 C CA  . SER B 1 15  ? 31.809  23.683 -0.462  1.00 15.52 ? 15  SER B CA  1 
ATOM   1058 C C   . SER B 1 15  ? 30.916  22.492 -0.745  1.00 18.65 ? 15  SER B C   1 
ATOM   1059 O O   . SER B 1 15  ? 30.433  21.798 0.170   1.00 16.80 ? 15  SER B O   1 
ATOM   1060 C CB  . SER B 1 15  ? 33.237  23.192 -0.264  1.00 13.57 ? 15  SER B CB  1 
ATOM   1061 O OG  . SER B 1 15  ? 34.072  24.271 0.082   1.00 18.05 ? 15  SER B OG  1 
ATOM   1062 N N   . GLY B 1 16  ? 30.646  22.272 -2.015  1.00 19.60 ? 16  GLY B N   1 
ATOM   1063 C CA  . GLY B 1 16  ? 29.824  21.123 -2.350  1.00 28.08 ? 16  GLY B CA  1 
ATOM   1064 C C   . GLY B 1 16  ? 28.446  20.940 -1.723  1.00 29.24 ? 16  GLY B C   1 
ATOM   1065 O O   . GLY B 1 16  ? 28.038  19.832 -1.332  1.00 30.00 ? 16  GLY B O   1 
ATOM   1066 N N   . ASN B 1 17  ? 27.690  22.021 -1.760  1.00 31.41 ? 17  ASN B N   1 
ATOM   1067 C CA  . ASN B 1 17  ? 26.346  22.053 -1.239  1.00 32.20 ? 17  ASN B CA  1 
ATOM   1068 C C   . ASN B 1 17  ? 25.743  23.189 -2.035  1.00 32.13 ? 17  ASN B C   1 
ATOM   1069 O O   . ASN B 1 17  ? 26.331  24.269 -2.127  1.00 32.04 ? 17  ASN B O   1 
ATOM   1070 C CB  . ASN B 1 17  ? 26.383  22.396 0.242   1.00 35.09 ? 17  ASN B CB  1 
ATOM   1071 C CG  . ASN B 1 17  ? 25.253  21.769 1.015   1.00 36.31 ? 17  ASN B CG  1 
ATOM   1072 O OD1 . ASN B 1 17  ? 25.316  20.585 1.378   1.00 36.19 ? 17  ASN B OD1 1 
ATOM   1073 N ND2 . ASN B 1 17  ? 24.215  22.555 1.290   1.00 37.25 ? 17  ASN B ND2 1 
ATOM   1074 N N   . SER B 1 18  ? 24.697  22.886 -2.789  1.00 31.76 ? 18  SER B N   1 
ATOM   1075 C CA  . SER B 1 18  ? 24.054  23.917 -3.579  1.00 31.84 ? 18  SER B CA  1 
ATOM   1076 C C   . SER B 1 18  ? 22.923  24.540 -2.787  1.00 31.46 ? 18  SER B C   1 
ATOM   1077 O O   . SER B 1 18  ? 22.101  23.839 -2.212  1.00 28.83 ? 18  SER B O   1 
ATOM   1078 C CB  . SER B 1 18  ? 23.535  23.364 -4.910  1.00 31.59 ? 18  SER B CB  1 
ATOM   1079 O OG  . SER B 1 18  ? 22.736  22.213 -4.746  1.00 34.49 ? 18  SER B OG  1 
ATOM   1080 N N   . PRO B 1 19  ? 22.899  25.877 -2.723  1.00 31.03 ? 19  PRO B N   1 
ATOM   1081 C CA  . PRO B 1 19  ? 21.865  26.621 -2.000  1.00 32.54 ? 19  PRO B CA  1 
ATOM   1082 C C   . PRO B 1 19  ? 20.501  26.336 -2.618  1.00 33.92 ? 19  PRO B C   1 
ATOM   1083 O O   . PRO B 1 19  ? 19.480  26.507 -1.976  1.00 35.17 ? 19  PRO B O   1 
ATOM   1084 C CB  . PRO B 1 19  ? 22.249  28.083 -2.249  1.00 32.08 ? 19  PRO B CB  1 
ATOM   1085 C CG  . PRO B 1 19  ? 23.702  28.025 -2.577  1.00 31.78 ? 19  PRO B CG  1 
ATOM   1086 C CD  . PRO B 1 19  ? 23.833  26.787 -3.402  1.00 31.07 ? 19  PRO B CD  1 
ATOM   1087 N N   . SER B 1 20  ? 20.495  26.018 -3.909  1.00 36.09 ? 20  SER B N   1 
ATOM   1088 C CA  . SER B 1 20  ? 19.259  25.723 -4.619  1.00 38.62 ? 20  SER B CA  1 
ATOM   1089 C C   . SER B 1 20  ? 19.047  24.218 -4.664  1.00 39.30 ? 20  SER B C   1 
ATOM   1090 O O   . SER B 1 20  ? 19.066  23.609 -5.730  1.00 40.49 ? 20  SER B O   1 
ATOM   1091 C CB  . SER B 1 20  ? 19.296  26.323 -6.034  1.00 38.98 ? 20  SER B CB  1 
ATOM   1092 O OG  . SER B 1 20  ? 20.460  25.939 -6.750  1.00 40.17 ? 20  SER B OG  1 
ATOM   1093 N N   . SER B 1 21  ? 18.811  23.630 -3.498  1.00 40.87 ? 21  SER B N   1 
ATOM   1094 C CA  . SER B 1 21  ? 18.615  22.193 -3.389  1.00 41.64 ? 21  SER B CA  1 
ATOM   1095 C C   . SER B 1 21  ? 17.611  21.837 -2.299  1.00 41.81 ? 21  SER B C   1 
ATOM   1096 O O   . SER B 1 21  ? 17.839  22.105 -1.120  1.00 42.72 ? 21  SER B O   1 
ATOM   1097 C CB  . SER B 1 21  ? 19.949  21.514 -3.090  1.00 42.38 ? 21  SER B CB  1 
ATOM   1098 O OG  . SER B 1 21  ? 19.814  20.109 -3.154  1.00 44.48 ? 21  SER B OG  1 
ATOM   1099 N N   . SER B 1 22  ? 16.510  21.201 -2.696  1.00 40.84 ? 22  SER B N   1 
ATOM   1100 C CA  . SER B 1 22  ? 15.468  20.813 -1.749  1.00 39.01 ? 22  SER B CA  1 
ATOM   1101 C C   . SER B 1 22  ? 15.830  19.567 -0.937  1.00 37.38 ? 22  SER B C   1 
ATOM   1102 O O   . SER B 1 22  ? 15.296  19.348 0.158   1.00 37.92 ? 22  SER B O   1 
ATOM   1103 C CB  . SER B 1 22  ? 14.148  20.578 -2.491  1.00 40.06 ? 22  SER B CB  1 
ATOM   1104 O OG  . SER B 1 22  ? 13.731  21.751 -3.184  1.00 43.45 ? 22  SER B OG  1 
ATOM   1105 N N   . SER B 1 23  ? 16.702  18.735 -1.493  1.00 33.51 ? 23  SER B N   1 
ATOM   1106 C CA  . SER B 1 23  ? 17.117  17.505 -0.840  1.00 31.04 ? 23  SER B CA  1 
ATOM   1107 C C   . SER B 1 23  ? 17.961  17.741 0.416   1.00 29.32 ? 23  SER B C   1 
ATOM   1108 O O   . SER B 1 23  ? 18.086  16.860 1.263   1.00 29.37 ? 23  SER B O   1 
ATOM   1109 C CB  . SER B 1 23  ? 17.890  16.621 -1.833  1.00 32.02 ? 23  SER B CB  1 
ATOM   1110 O OG  . SER B 1 23  ? 19.209  17.105 -2.079  1.00 34.46 ? 23  SER B OG  1 
ATOM   1111 N N   . ASN B 1 24  ? 18.513  18.943 0.544   1.00 26.63 ? 24  ASN B N   1 
ATOM   1112 C CA  . ASN B 1 24  ? 19.373  19.283 1.673   1.00 24.01 ? 24  ASN B CA  1 
ATOM   1113 C C   . ASN B 1 24  ? 18.688  19.636 2.980   1.00 20.46 ? 24  ASN B C   1 
ATOM   1114 O O   . ASN B 1 24  ? 19.335  19.740 4.029   1.00 18.88 ? 24  ASN B O   1 
ATOM   1115 C CB  . ASN B 1 24  ? 20.303  20.424 1.281   1.00 29.54 ? 24  ASN B CB  1 
ATOM   1116 C CG  . ASN B 1 24  ? 21.738  20.097 1.557   1.00 32.10 ? 24  ASN B CG  1 
ATOM   1117 O OD1 . ASN B 1 24  ? 22.251  20.350 2.654   1.00 36.92 ? 24  ASN B OD1 1 
ATOM   1118 N ND2 . ASN B 1 24  ? 22.386  19.450 0.593   1.00 36.15 ? 24  ASN B ND2 1 
ATOM   1119 N N   . TYR B 1 25  ? 17.379  19.835 2.909   1.00 17.68 ? 25  TYR B N   1 
ATOM   1120 C CA  . TYR B 1 25  ? 16.585  20.211 4.061   1.00 13.81 ? 25  TYR B CA  1 
ATOM   1121 C C   . TYR B 1 25  ? 16.914  19.477 5.359   1.00 12.74 ? 25  TYR B C   1 
ATOM   1122 O O   . TYR B 1 25  ? 17.198  20.098 6.388   1.00 9.98  ? 25  TYR B O   1 
ATOM   1123 C CB  . TYR B 1 25  ? 15.099  20.051 3.732   1.00 14.59 ? 25  TYR B CB  1 
ATOM   1124 C CG  . TYR B 1 25  ? 14.164  20.391 4.885   1.00 14.81 ? 25  TYR B CG  1 
ATOM   1125 C CD1 . TYR B 1 25  ? 13.786  21.717 5.149   1.00 14.42 ? 25  TYR B CD1 1 
ATOM   1126 C CD2 . TYR B 1 25  ? 13.659  19.382 5.706   1.00 13.45 ? 25  TYR B CD2 1 
ATOM   1127 C CE1 . TYR B 1 25  ? 12.923  22.014 6.210   1.00 14.97 ? 25  TYR B CE1 1 
ATOM   1128 C CE2 . TYR B 1 25  ? 12.808  19.663 6.754   1.00 13.77 ? 25  TYR B CE2 1 
ATOM   1129 C CZ  . TYR B 1 25  ? 12.441  20.970 7.000   1.00 14.21 ? 25  TYR B CZ  1 
ATOM   1130 O OH  . TYR B 1 25  ? 11.581  21.194 8.036   1.00 15.28 ? 25  TYR B OH  1 
ATOM   1131 N N   . CYS B 1 26  ? 16.787  18.162 5.340   1.00 11.22 ? 26  CYS B N   1 
ATOM   1132 C CA  . CYS B 1 26  ? 17.047  17.388 6.546   1.00 12.57 ? 26  CYS B CA  1 
ATOM   1133 C C   . CYS B 1 26  ? 18.417  17.627 7.182   1.00 12.83 ? 26  CYS B C   1 
ATOM   1134 O O   . CYS B 1 26  ? 18.503  17.822 8.399   1.00 14.14 ? 26  CYS B O   1 
ATOM   1135 C CB  . CYS B 1 26  ? 16.784  15.903 6.294   1.00 11.69 ? 26  CYS B CB  1 
ATOM   1136 S SG  . CYS B 1 26  ? 15.009  15.496 6.230   1.00 9.37  ? 26  CYS B SG  1 
ATOM   1137 N N   . ASN B 1 27  ? 19.466  17.656 6.367   1.00 11.53 ? 27  ASN B N   1 
ATOM   1138 C CA  . ASN B 1 27  ? 20.825  17.895 6.842   1.00 13.35 ? 27  ASN B CA  1 
ATOM   1139 C C   . ASN B 1 27  ? 20.939  19.204 7.614   1.00 13.88 ? 27  ASN B C   1 
ATOM   1140 O O   . ASN B 1 27  ? 21.479  19.242 8.721   1.00 14.43 ? 27  ASN B O   1 
ATOM   1141 C CB  . ASN B 1 27  ? 21.799  17.905 5.661   1.00 13.59 ? 27  ASN B CB  1 
ATOM   1142 C CG  . ASN B 1 27  ? 21.944  16.535 5.026   1.00 16.13 ? 27  ASN B CG  1 
ATOM   1143 O OD1 . ASN B 1 27  ? 21.946  15.519 5.723   1.00 14.44 ? 27  ASN B OD1 1 
ATOM   1144 N ND2 . ASN B 1 27  ? 22.061  16.495 3.696   1.00 16.89 ? 27  ASN B ND2 1 
ATOM   1145 N N   . LEU B 1 28  ? 20.431  20.283 7.029   1.00 13.94 ? 28  LEU B N   1 
ATOM   1146 C CA  . LEU B 1 28  ? 20.479  21.588 7.678   1.00 13.74 ? 28  LEU B CA  1 
ATOM   1147 C C   . LEU B 1 28  ? 19.548  21.670 8.890   1.00 13.84 ? 28  LEU B C   1 
ATOM   1148 O O   . LEU B 1 28  ? 19.928  22.211 9.937   1.00 12.17 ? 28  LEU B O   1 
ATOM   1149 C CB  . LEU B 1 28  ? 20.124  22.679 6.673   1.00 14.89 ? 28  LEU B CB  1 
ATOM   1150 C CG  . LEU B 1 28  ? 21.050  22.777 5.458   1.00 16.94 ? 28  LEU B CG  1 
ATOM   1151 C CD1 . LEU B 1 28  ? 20.663  23.966 4.606   1.00 17.30 ? 28  LEU B CD1 1 
ATOM   1152 C CD2 . LEU B 1 28  ? 22.485  22.940 5.935   1.00 19.84 ? 28  LEU B CD2 1 
ATOM   1153 N N   . MET B 1 29  ? 18.320  21.166 8.739   1.00 13.29 ? 29  MET B N   1 
ATOM   1154 C CA  . MET B 1 29  ? 17.354  21.207 9.834   1.00 13.52 ? 29  MET B CA  1 
ATOM   1155 C C   . MET B 1 29  ? 17.790  20.387 11.038  1.00 11.88 ? 29  MET B C   1 
ATOM   1156 O O   . MET B 1 29  ? 17.648  20.843 12.175  1.00 13.13 ? 29  MET B O   1 
ATOM   1157 C CB  . MET B 1 29  ? 15.948  20.794 9.367   1.00 14.98 ? 29  MET B CB  1 
ATOM   1158 C CG  . MET B 1 29  ? 15.096  21.954 8.884   1.00 15.07 ? 29  MET B CG  1 
ATOM   1159 S SD  . MET B 1 29  ? 14.827  23.187 10.175  1.00 19.98 ? 29  MET B SD  1 
ATOM   1160 C CE  . MET B 1 29  ? 13.402  22.507 10.977  1.00 21.97 ? 29  MET B CE  1 
ATOM   1161 N N   . MET B 1 30  ? 18.297  19.179 10.791  1.00 12.12 ? 30  MET B N   1 
ATOM   1162 C CA  . MET B 1 30  ? 18.776  18.304 11.863  1.00 12.74 ? 30  MET B CA  1 
ATOM   1163 C C   . MET B 1 30  ? 19.927  18.974 12.606  1.00 13.45 ? 30  MET B C   1 
ATOM   1164 O O   . MET B 1 30  ? 20.068  18.811 13.826  1.00 11.93 ? 30  MET B O   1 
ATOM   1165 C CB  . MET B 1 30  ? 19.243  16.953 11.306  1.00 13.56 ? 30  MET B CB  1 
ATOM   1166 C CG  . MET B 1 30  ? 18.107  16.023 10.820  1.00 15.12 ? 30  MET B CG  1 
ATOM   1167 S SD  . MET B 1 30  ? 16.908  15.692 12.130  1.00 14.86 ? 30  MET B SD  1 
ATOM   1168 C CE  . MET B 1 30  ? 17.811  14.465 13.070  1.00 15.92 ? 30  MET B CE  1 
ATOM   1169 N N   . CYS B 1 31  ? 20.753  19.706 11.858  1.00 12.37 ? 31  CYS B N   1 
ATOM   1170 C CA  . CYS B 1 31  ? 21.878  20.441 12.438  1.00 12.96 ? 31  CYS B CA  1 
ATOM   1171 C C   . CYS B 1 31  ? 21.360  21.644 13.213  1.00 12.65 ? 31  CYS B C   1 
ATOM   1172 O O   . CYS B 1 31  ? 21.691  21.824 14.380  1.00 12.40 ? 31  CYS B O   1 
ATOM   1173 C CB  . CYS B 1 31  ? 22.849  20.908 11.344  1.00 13.61 ? 31  CYS B CB  1 
ATOM   1174 S SG  . CYS B 1 31  ? 24.083  22.156 11.867  1.00 13.46 ? 31  CYS B SG  1 
ATOM   1175 N N   . CYS B 1 32  ? 20.538  22.466 12.562  1.00 11.96 ? 32  CYS B N   1 
ATOM   1176 C CA  . CYS B 1 32  ? 19.985  23.660 13.203  1.00 11.33 ? 32  CYS B CA  1 
ATOM   1177 C C   . CYS B 1 32  ? 19.210  23.381 14.488  1.00 12.82 ? 32  CYS B C   1 
ATOM   1178 O O   . CYS B 1 32  ? 19.298  24.147 15.456  1.00 10.87 ? 32  CYS B O   1 
ATOM   1179 C CB  . CYS B 1 32  ? 19.090  24.399 12.216  1.00 10.64 ? 32  CYS B CB  1 
ATOM   1180 S SG  . CYS B 1 32  ? 17.980  25.665 12.923  1.00 12.98 ? 32  CYS B SG  1 
ATOM   1181 N N   . ARG B 1 33  ? 18.449  22.283 14.490  1.00 13.57 ? 33  ARG B N   1 
ATOM   1182 C CA  . ARG B 1 33  ? 17.621  21.915 15.635  1.00 15.43 ? 33  ARG B CA  1 
ATOM   1183 C C   . ARG B 1 33  ? 18.318  21.093 16.711  1.00 15.74 ? 33  ARG B C   1 
ATOM   1184 O O   . ARG B 1 33  ? 17.671  20.475 17.546  1.00 15.55 ? 33  ARG B O   1 
ATOM   1185 C CB  . ARG B 1 33  ? 16.321  21.243 15.164  1.00 13.39 ? 33  ARG B CB  1 
ATOM   1186 C CG  . ARG B 1 33  ? 15.424  22.152 14.313  1.00 12.35 ? 33  ARG B CG  1 
ATOM   1187 C CD  . ARG B 1 33  ? 14.934  23.382 15.081  1.00 10.51 ? 33  ARG B CD  1 
ATOM   1188 N NE  . ARG B 1 33  ? 14.015  24.202 14.279  1.00 12.53 ? 33  ARG B NE  1 
ATOM   1189 C CZ  . ARG B 1 33  ? 12.713  23.949 14.127  1.00 13.17 ? 33  ARG B CZ  1 
ATOM   1190 N NH1 . ARG B 1 33  ? 12.172  22.901 14.727  1.00 11.83 ? 33  ARG B NH1 1 
ATOM   1191 N NH2 . ARG B 1 33  ? 11.956  24.712 13.349  1.00 10.57 ? 33  ARG B NH2 1 
ATOM   1192 N N   . LYS B 1 34  ? 19.644  21.103 16.670  1.00 18.41 ? 34  LYS B N   1 
ATOM   1193 C CA  . LYS B 1 34  ? 20.489  20.433 17.652  1.00 20.29 ? 34  LYS B CA  1 
ATOM   1194 C C   . LYS B 1 34  ? 20.352  18.916 17.785  1.00 20.09 ? 34  LYS B C   1 
ATOM   1195 O O   . LYS B 1 34  ? 20.475  18.385 18.888  1.00 21.57 ? 34  LYS B O   1 
ATOM   1196 C CB  . LYS B 1 34  ? 20.284  21.094 19.026  1.00 21.89 ? 34  LYS B CB  1 
ATOM   1197 C CG  . LYS B 1 34  ? 20.537  22.603 19.069  1.00 25.61 ? 34  LYS B CG  1 
ATOM   1198 C CD  . LYS B 1 34  ? 22.037  22.945 18.997  1.00 31.15 ? 34  LYS B CD  1 
ATOM   1199 C CE  . LYS B 1 34  ? 22.511  23.458 17.614  1.00 33.87 ? 34  LYS B CE  1 
ATOM   1200 N NZ  . LYS B 1 34  ? 22.106  24.881 17.312  1.00 34.83 ? 34  LYS B NZ  1 
ATOM   1201 N N   . MET B 1 35  ? 20.128  18.208 16.685  1.00 20.86 ? 35  MET B N   1 
ATOM   1202 C CA  . MET B 1 35  ? 19.993  16.752 16.753  1.00 21.94 ? 35  MET B CA  1 
ATOM   1203 C C   . MET B 1 35  ? 21.173  15.970 16.182  1.00 23.99 ? 35  MET B C   1 
ATOM   1204 O O   . MET B 1 35  ? 21.071  14.767 15.931  1.00 24.15 ? 35  MET B O   1 
ATOM   1205 C CB  . MET B 1 35  ? 18.672  16.293 16.112  1.00 19.54 ? 35  MET B CB  1 
ATOM   1206 C CG  . MET B 1 35  ? 17.449  16.624 16.967  1.00 19.16 ? 35  MET B CG  1 
ATOM   1207 S SD  . MET B 1 35  ? 15.862  16.329 16.165  1.00 17.77 ? 35  MET B SD  1 
ATOM   1208 C CE  . MET B 1 35  ? 15.676  17.841 15.234  1.00 18.58 ? 35  MET B CE  1 
ATOM   1209 N N   . THR B 1 36  ? 22.300  16.643 16.002  1.00 25.80 ? 36  THR B N   1 
ATOM   1210 C CA  . THR B 1 36  ? 23.490  15.989 15.474  1.00 27.90 ? 36  THR B CA  1 
ATOM   1211 C C   . THR B 1 36  ? 24.708  16.234 16.375  1.00 30.15 ? 36  THR B C   1 
ATOM   1212 O O   . THR B 1 36  ? 25.859  16.134 15.941  1.00 31.16 ? 36  THR B O   1 
ATOM   1213 C CB  . THR B 1 36  ? 23.776  16.445 14.029  1.00 27.16 ? 36  THR B CB  1 
ATOM   1214 O OG1 . THR B 1 36  ? 23.927  17.870 13.994  1.00 25.32 ? 36  THR B OG1 1 
ATOM   1215 C CG2 . THR B 1 36  ? 22.629  16.034 13.114  1.00 25.08 ? 36  THR B CG2 1 
ATOM   1216 N N   . GLN B 1 37  ? 24.440  16.511 17.647  1.00 31.77 ? 37  GLN B N   1 
ATOM   1217 C CA  . GLN B 1 37  ? 25.486  16.760 18.627  1.00 33.93 ? 37  GLN B CA  1 
ATOM   1218 C C   . GLN B 1 37  ? 25.652  15.516 19.484  1.00 34.13 ? 37  GLN B C   1 
ATOM   1219 O O   . GLN B 1 37  ? 24.676  15.013 20.045  1.00 35.34 ? 37  GLN B O   1 
ATOM   1220 C CB  . GLN B 1 37  ? 25.102  17.945 19.506  1.00 34.76 ? 37  GLN B CB  1 
ATOM   1221 C CG  . GLN B 1 37  ? 24.707  19.170 18.717  1.00 36.98 ? 37  GLN B CG  1 
ATOM   1222 C CD  . GLN B 1 37  ? 24.726  20.417 19.553  1.00 38.95 ? 37  GLN B CD  1 
ATOM   1223 O OE1 . GLN B 1 37  ? 24.977  21.518 19.050  1.00 41.19 ? 37  GLN B OE1 1 
ATOM   1224 N NE2 . GLN B 1 37  ? 24.494  20.257 20.856  1.00 39.73 ? 37  GLN B NE2 1 
ATOM   1225 N N   . GLY B 1 38  ? 26.889  15.062 19.648  1.00 34.33 ? 38  GLY B N   1 
ATOM   1226 C CA  . GLY B 1 38  ? 27.129  13.857 20.424  1.00 34.57 ? 38  GLY B CA  1 
ATOM   1227 C C   . GLY B 1 38  ? 27.075  12.657 19.490  1.00 35.40 ? 38  GLY B C   1 
ATOM   1228 O O   . GLY B 1 38  ? 27.916  11.749 19.570  1.00 35.73 ? 38  GLY B O   1 
ATOM   1229 N N   . LYS B 1 39  ? 26.055  12.640 18.630  1.00 34.24 ? 39  LYS B N   1 
ATOM   1230 C CA  . LYS B 1 39  ? 25.852  11.597 17.623  1.00 32.00 ? 39  LYS B CA  1 
ATOM   1231 C C   . LYS B 1 39  ? 24.690  11.978 16.703  1.00 29.67 ? 39  LYS B C   1 
ATOM   1232 O O   . LYS B 1 39  ? 23.996  12.960 16.956  1.00 27.76 ? 39  LYS B O   1 
ATOM   1233 C CB  . LYS B 1 39  ? 25.618  10.222 18.257  1.00 33.62 ? 39  LYS B CB  1 
ATOM   1234 C CG  . LYS B 1 39  ? 24.328  10.068 19.017  1.00 36.32 ? 39  LYS B CG  1 
ATOM   1235 C CD  . LYS B 1 39  ? 23.958  8.593  19.108  1.00 38.10 ? 39  LYS B CD  1 
ATOM   1236 C CE  . LYS B 1 39  ? 22.751  8.383  19.996  1.00 39.38 ? 39  LYS B CE  1 
ATOM   1237 N NZ  . LYS B 1 39  ? 21.643  9.308  19.627  1.00 42.45 ? 39  LYS B NZ  1 
ATOM   1238 N N   . CYS B 1 40  ? 24.520  11.238 15.612  1.00 26.74 ? 40  CYS B N   1 
ATOM   1239 C CA  . CYS B 1 40  ? 23.445  11.517 14.667  1.00 24.77 ? 40  CYS B CA  1 
ATOM   1240 C C   . CYS B 1 40  ? 22.124  10.901 15.116  1.00 23.37 ? 40  CYS B C   1 
ATOM   1241 O O   . CYS B 1 40  ? 22.070  9.719  15.484  1.00 23.65 ? 40  CYS B O   1 
ATOM   1242 C CB  . CYS B 1 40  ? 23.795  10.966 13.285  1.00 24.38 ? 40  CYS B CB  1 
ATOM   1243 S SG  . CYS B 1 40  ? 25.459  11.396 12.674  1.00 24.56 ? 40  CYS B SG  1 
ATOM   1244 N N   . LYS B 1 41  ? 21.069  11.711 15.173  1.00 21.14 ? 41  LYS B N   1 
ATOM   1245 C CA  . LYS B 1 41  ? 19.764  11.164 15.540  1.00 18.55 ? 41  LYS B CA  1 
ATOM   1246 C C   . LYS B 1 41  ? 19.367  10.373 14.291  1.00 17.13 ? 41  LYS B C   1 
ATOM   1247 O O   . LYS B 1 41  ? 19.274  10.927 13.205  1.00 17.30 ? 41  LYS B O   1 
ATOM   1248 C CB  . LYS B 1 41  ? 18.751  12.274 15.861  1.00 16.96 ? 41  LYS B CB  1 
ATOM   1249 C CG  . LYS B 1 41  ? 17.420  11.724 16.397  1.00 17.10 ? 41  LYS B CG  1 
ATOM   1250 C CD  . LYS B 1 41  ? 16.506  12.789 16.982  1.00 15.47 ? 41  LYS B CD  1 
ATOM   1251 C CE  . LYS B 1 41  ? 15.166  12.181 17.357  1.00 15.19 ? 41  LYS B CE  1 
ATOM   1252 N NZ  . LYS B 1 41  ? 14.186  13.200 17.746  1.00 14.45 ? 41  LYS B NZ  1 
ATOM   1253 N N   . PRO B 1 42  ? 19.160  9.060  14.434  1.00 17.06 ? 42  PRO B N   1 
ATOM   1254 C CA  . PRO B 1 42  ? 18.788  8.134  13.351  1.00 17.12 ? 42  PRO B CA  1 
ATOM   1255 C C   . PRO B 1 42  ? 17.616  8.566  12.471  1.00 16.91 ? 42  PRO B C   1 
ATOM   1256 O O   . PRO B 1 42  ? 17.708  8.592  11.237  1.00 17.17 ? 42  PRO B O   1 
ATOM   1257 C CB  . PRO B 1 42  ? 18.395  6.862  14.105  1.00 16.01 ? 42  PRO B CB  1 
ATOM   1258 C CG  . PRO B 1 42  ? 19.089  6.978  15.410  1.00 16.83 ? 42  PRO B CG  1 
ATOM   1259 C CD  . PRO B 1 42  ? 19.021  8.418  15.752  1.00 16.52 ? 42  PRO B CD  1 
ATOM   1260 N N   . VAL B 1 43  ? 16.499  8.854  13.124  1.00 15.14 ? 43  VAL B N   1 
ATOM   1261 C CA  . VAL B 1 43  ? 15.263  9.215  12.446  1.00 13.56 ? 43  VAL B CA  1 
ATOM   1262 C C   . VAL B 1 43  ? 14.613  10.403 13.157  1.00 13.26 ? 43  VAL B C   1 
ATOM   1263 O O   . VAL B 1 43  ? 14.700  10.532 14.383  1.00 11.04 ? 43  VAL B O   1 
ATOM   1264 C CB  . VAL B 1 43  ? 14.244  8.017  12.527  1.00 13.89 ? 43  VAL B CB  1 
ATOM   1265 C CG1 . VAL B 1 43  ? 12.978  8.315  11.730  1.00 11.10 ? 43  VAL B CG1 1 
ATOM   1266 C CG2 . VAL B 1 43  ? 14.892  6.736  12.061  1.00 14.29 ? 43  VAL B CG2 1 
ATOM   1267 N N   . ASN B 1 44  ? 13.964  11.271 12.388  1.00 12.30 ? 44  ASN B N   1 
ATOM   1268 C CA  . ASN B 1 44  ? 13.256  12.400 12.973  1.00 12.22 ? 44  ASN B CA  1 
ATOM   1269 C C   . ASN B 1 44  ? 12.291  12.997 11.976  1.00 13.01 ? 44  ASN B C   1 
ATOM   1270 O O   . ASN B 1 44  ? 12.653  13.232 10.825  1.00 12.92 ? 44  ASN B O   1 
ATOM   1271 C CB  . ASN B 1 44  ? 14.211  13.483 13.471  1.00 12.64 ? 44  ASN B CB  1 
ATOM   1272 C CG  . ASN B 1 44  ? 13.481  14.597 14.204  1.00 13.44 ? 44  ASN B CG  1 
ATOM   1273 O OD1 . ASN B 1 44  ? 13.070  14.423 15.354  1.00 13.15 ? 44  ASN B OD1 1 
ATOM   1274 N ND2 . ASN B 1 44  ? 13.311  15.742 13.544  1.00 12.37 ? 44  ASN B ND2 1 
ATOM   1275 N N   . THR B 1 45  ? 11.069  13.256 12.432  1.00 12.29 ? 45  THR B N   1 
ATOM   1276 C CA  . THR B 1 45  ? 10.036  13.834 11.586  1.00 11.45 ? 45  THR B CA  1 
ATOM   1277 C C   . THR B 1 45  ? 9.796   15.304 11.901  1.00 10.87 ? 45  THR B C   1 
ATOM   1278 O O   . THR B 1 45  ? 9.776   15.712 13.066  1.00 9.62  ? 45  THR B O   1 
ATOM   1279 C CB  . THR B 1 45  ? 8.704   13.087 11.804  1.00 12.86 ? 45  THR B CB  1 
ATOM   1280 O OG1 . THR B 1 45  ? 8.918   11.693 11.614  1.00 16.43 ? 45  THR B OG1 1 
ATOM   1281 C CG2 . THR B 1 45  ? 7.642   13.541 10.829  1.00 14.03 ? 45  THR B CG2 1 
ATOM   1282 N N   . PHE B 1 46  ? 9.611   16.099 10.857  1.00 10.13 ? 46  PHE B N   1 
ATOM   1283 C CA  . PHE B 1 46  ? 9.293   17.509 11.013  1.00 9.32  ? 46  PHE B CA  1 
ATOM   1284 C C   . PHE B 1 46  ? 7.863   17.668 10.505  1.00 9.77  ? 46  PHE B C   1 
ATOM   1285 O O   . PHE B 1 46  ? 7.518   17.123 9.456   1.00 9.27  ? 46  PHE B O   1 
ATOM   1286 C CB  . PHE B 1 46  ? 10.248  18.399 10.210  1.00 9.33  ? 46  PHE B CB  1 
ATOM   1287 C CG  . PHE B 1 46  ? 11.594  18.534 10.836  1.00 11.44 ? 46  PHE B CG  1 
ATOM   1288 C CD1 . PHE B 1 46  ? 11.755  19.275 12.003  1.00 10.52 ? 46  PHE B CD1 1 
ATOM   1289 C CD2 . PHE B 1 46  ? 12.698  17.858 10.301  1.00 11.68 ? 46  PHE B CD2 1 
ATOM   1290 C CE1 . PHE B 1 46  ? 12.999  19.335 12.636  1.00 11.87 ? 46  PHE B CE1 1 
ATOM   1291 C CE2 . PHE B 1 46  ? 13.953  17.910 10.926  1.00 10.23 ? 46  PHE B CE2 1 
ATOM   1292 C CZ  . PHE B 1 46  ? 14.102  18.648 12.094  1.00 11.99 ? 46  PHE B CZ  1 
ATOM   1293 N N   . VAL B 1 47  ? 7.027   18.365 11.271  1.00 9.80  ? 47  VAL B N   1 
ATOM   1294 C CA  . VAL B 1 47  ? 5.628   18.583 10.900  1.00 8.90  ? 47  VAL B CA  1 
ATOM   1295 C C   . VAL B 1 47  ? 5.444   20.011 10.408  1.00 9.31  ? 47  VAL B C   1 
ATOM   1296 O O   . VAL B 1 47  ? 5.858   20.968 11.069  1.00 8.71  ? 47  VAL B O   1 
ATOM   1297 C CB  . VAL B 1 47  ? 4.674   18.294 12.090  1.00 9.45  ? 47  VAL B CB  1 
ATOM   1298 C CG1 . VAL B 1 47  ? 3.204   18.401 11.629  1.00 8.18  ? 47  VAL B CG1 1 
ATOM   1299 C CG2 . VAL B 1 47  ? 4.953   16.882 12.661  1.00 8.03  ? 47  VAL B CG2 1 
ATOM   1300 N N   . HIS B 1 48  ? 4.824   20.153 9.241   1.00 9.26  ? 48  HIS B N   1 
ATOM   1301 C CA  . HIS B 1 48  ? 4.633   21.469 8.648   1.00 11.10 ? 48  HIS B CA  1 
ATOM   1302 C C   . HIS B 1 48  ? 3.278   22.136 8.894   1.00 12.55 ? 48  HIS B C   1 
ATOM   1303 O O   . HIS B 1 48  ? 3.092   23.314 8.546   1.00 12.57 ? 48  HIS B O   1 
ATOM   1304 C CB  . HIS B 1 48  ? 4.985   21.403 7.157   1.00 13.38 ? 48  HIS B CB  1 
ATOM   1305 C CG  . HIS B 1 48  ? 6.339   20.808 6.903   1.00 13.49 ? 48  HIS B CG  1 
ATOM   1306 N ND1 . HIS B 1 48  ? 7.469   21.230 7.573   1.00 12.03 ? 48  HIS B ND1 1 
ATOM   1307 C CD2 . HIS B 1 48  ? 6.727   19.760 6.138   1.00 13.81 ? 48  HIS B CD2 1 
ATOM   1308 C CE1 . HIS B 1 48  ? 8.489   20.463 7.241   1.00 13.88 ? 48  HIS B CE1 1 
ATOM   1309 N NE2 . HIS B 1 48  ? 8.066   19.564 6.370   1.00 13.91 ? 48  HIS B NE2 1 
ATOM   1310 N N   . GLU B 1 49  ? 2.361   21.403 9.530   1.00 11.64 ? 49  GLU B N   1 
ATOM   1311 C CA  . GLU B 1 49  ? 1.041   21.935 9.854   1.00 12.00 ? 49  GLU B CA  1 
ATOM   1312 C C   . GLU B 1 49  ? 1.202   22.953 10.995  1.00 13.52 ? 49  GLU B C   1 
ATOM   1313 O O   . GLU B 1 49  ? 2.288   23.075 11.572  1.00 11.51 ? 49  GLU B O   1 
ATOM   1314 C CB  . GLU B 1 49  ? 0.091   20.808 10.287  1.00 12.98 ? 49  GLU B CB  1 
ATOM   1315 C CG  . GLU B 1 49  ? -0.083  19.682 9.246   1.00 14.10 ? 49  GLU B CG  1 
ATOM   1316 C CD  . GLU B 1 49  ? -0.706  20.150 7.940   1.00 12.81 ? 49  GLU B CD  1 
ATOM   1317 O OE1 . GLU B 1 49  ? -1.397  21.177 7.946   1.00 15.10 ? 49  GLU B OE1 1 
ATOM   1318 O OE2 . GLU B 1 49  ? -0.518  19.479 6.902   1.00 14.38 ? 49  GLU B OE2 1 
ATOM   1319 N N   . SER B 1 50  ? 0.134   23.682 11.317  1.00 12.41 ? 50  SER B N   1 
ATOM   1320 C CA  . SER B 1 50  ? 0.178   24.688 12.375  1.00 12.42 ? 50  SER B CA  1 
ATOM   1321 C C   . SER B 1 50  ? 0.332   24.039 13.739  1.00 12.28 ? 50  SER B C   1 
ATOM   1322 O O   . SER B 1 50  ? -0.002  22.872 13.926  1.00 10.12 ? 50  SER B O   1 
ATOM   1323 C CB  . SER B 1 50  ? -1.099  25.551 12.345  1.00 11.97 ? 50  SER B CB  1 
ATOM   1324 O OG  . SER B 1 50  ? -2.252  24.755 12.561  1.00 13.80 ? 50  SER B OG  1 
ATOM   1325 N N   . LEU B 1 51  ? 0.881   24.779 14.689  1.00 14.25 ? 51  LEU B N   1 
ATOM   1326 C CA  . LEU B 1 51  ? 1.043   24.236 16.029  1.00 16.79 ? 51  LEU B CA  1 
ATOM   1327 C C   . LEU B 1 51  ? -0.331  23.848 16.589  1.00 17.50 ? 51  LEU B C   1 
ATOM   1328 O O   . LEU B 1 51  ? -0.458  22.827 17.276  1.00 18.96 ? 51  LEU B O   1 
ATOM   1329 C CB  . LEU B 1 51  ? 1.728   25.255 16.942  1.00 18.33 ? 51  LEU B CB  1 
ATOM   1330 C CG  . LEU B 1 51  ? 1.996   24.821 18.391  1.00 21.82 ? 51  LEU B CG  1 
ATOM   1331 C CD1 . LEU B 1 51  ? 2.788   23.507 18.438  1.00 23.33 ? 51  LEU B CD1 1 
ATOM   1332 C CD2 . LEU B 1 51  ? 2.739   25.928 19.136  1.00 23.04 ? 51  LEU B CD2 1 
ATOM   1333 N N   . ALA B 1 52  ? -1.342  24.691 16.335  1.00 17.17 ? 52  ALA B N   1 
ATOM   1334 C CA  . ALA B 1 52  ? -2.719  24.442 16.792  1.00 15.91 ? 52  ALA B CA  1 
ATOM   1335 C C   . ALA B 1 52  ? -3.268  23.089 16.302  1.00 14.68 ? 52  ALA B C   1 
ATOM   1336 O O   . ALA B 1 52  ? -3.834  22.330 17.082  1.00 14.40 ? 52  ALA B O   1 
ATOM   1337 C CB  . ALA B 1 52  ? -3.642  25.588 16.357  1.00 14.56 ? 52  ALA B CB  1 
ATOM   1338 N N   . ASP B 1 53  ? -3.071  22.780 15.025  1.00 14.55 ? 53  ASP B N   1 
ATOM   1339 C CA  . ASP B 1 53  ? -3.524  21.501 14.463  1.00 15.03 ? 53  ASP B CA  1 
ATOM   1340 C C   . ASP B 1 53  ? -2.780  20.297 15.079  1.00 14.71 ? 53  ASP B C   1 
ATOM   1341 O O   . ASP B 1 53  ? -3.343  19.216 15.220  1.00 14.33 ? 53  ASP B O   1 
ATOM   1342 C CB  . ASP B 1 53  ? -3.370  21.492 12.932  1.00 16.29 ? 53  ASP B CB  1 
ATOM   1343 C CG  . ASP B 1 53  ? -4.489  22.262 12.213  1.00 19.18 ? 53  ASP B CG  1 
ATOM   1344 O OD1 . ASP B 1 53  ? -5.395  22.801 12.887  1.00 18.36 ? 53  ASP B OD1 1 
ATOM   1345 O OD2 . ASP B 1 53  ? -4.500  22.287 10.959  1.00 20.89 ? 53  ASP B OD2 1 
ATOM   1346 N N   . VAL B 1 54  ? -1.511  20.471 15.440  1.00 13.52 ? 54  VAL B N   1 
ATOM   1347 C CA  . VAL B 1 54  ? -0.750  19.368 16.032  1.00 12.54 ? 54  VAL B CA  1 
ATOM   1348 C C   . VAL B 1 54  ? -1.184  19.133 17.485  1.00 11.34 ? 54  VAL B C   1 
ATOM   1349 O O   . VAL B 1 54  ? -1.356  17.996 17.919  1.00 10.03 ? 54  VAL B O   1 
ATOM   1350 C CB  . VAL B 1 54  ? 0.785   19.614 15.918  1.00 11.92 ? 54  VAL B CB  1 
ATOM   1351 C CG1 . VAL B 1 54  ? 1.568   18.544 16.689  1.00 11.32 ? 54  VAL B CG1 1 
ATOM   1352 C CG2 . VAL B 1 54  ? 1.193   19.582 14.459  1.00 9.56  ? 54  VAL B CG2 1 
ATOM   1353 N N   . LYS B 1 55  ? -1.369  20.219 18.219  1.00 13.07 ? 55  LYS B N   1 
ATOM   1354 C CA  . LYS B 1 55  ? -1.802  20.148 19.610  1.00 15.12 ? 55  LYS B CA  1 
ATOM   1355 C C   . LYS B 1 55  ? -3.172  19.481 19.727  1.00 15.10 ? 55  LYS B C   1 
ATOM   1356 O O   . LYS B 1 55  ? -3.453  18.754 20.688  1.00 14.38 ? 55  LYS B O   1 
ATOM   1357 C CB  . LYS B 1 55  ? -1.879  21.547 20.207  1.00 16.76 ? 55  LYS B CB  1 
ATOM   1358 C CG  . LYS B 1 55  ? -0.564  22.118 20.660  1.00 20.73 ? 55  LYS B CG  1 
ATOM   1359 C CD  . LYS B 1 55  ? -0.853  23.413 21.390  1.00 25.09 ? 55  LYS B CD  1 
ATOM   1360 C CE  . LYS B 1 55  ? 0.364   23.964 22.101  1.00 25.90 ? 55  LYS B CE  1 
ATOM   1361 N NZ  . LYS B 1 55  ? -0.018  25.196 22.856  1.00 29.68 ? 55  LYS B NZ  1 
ATOM   1362 N N   . ALA B 1 56  ? -4.013  19.715 18.726  1.00 14.39 ? 56  ALA B N   1 
ATOM   1363 C CA  . ALA B 1 56  ? -5.353  19.153 18.697  1.00 13.17 ? 56  ALA B CA  1 
ATOM   1364 C C   . ALA B 1 56  ? -5.343  17.631 18.558  1.00 14.10 ? 56  ALA B C   1 
ATOM   1365 O O   . ALA B 1 56  ? -6.341  16.975 18.876  1.00 13.80 ? 56  ALA B O   1 
ATOM   1366 C CB  . ALA B 1 56  ? -6.153  19.788 17.563  1.00 12.26 ? 56  ALA B CB  1 
ATOM   1367 N N   . VAL B 1 57  ? -4.233  17.060 18.075  1.00 13.28 ? 57  VAL B N   1 
ATOM   1368 C CA  . VAL B 1 57  ? -4.148  15.602 17.917  1.00 11.90 ? 57  VAL B CA  1 
ATOM   1369 C C   . VAL B 1 57  ? -4.291  14.929 19.282  1.00 11.56 ? 57  VAL B C   1 
ATOM   1370 O O   . VAL B 1 57  ? -4.742  13.792 19.384  1.00 11.04 ? 57  VAL B O   1 
ATOM   1371 C CB  . VAL B 1 57  ? -2.822  15.149 17.220  1.00 13.05 ? 57  VAL B CB  1 
ATOM   1372 C CG1 . VAL B 1 57  ? -2.782  13.628 17.098  1.00 11.57 ? 57  VAL B CG1 1 
ATOM   1373 C CG2 . VAL B 1 57  ? -2.706  15.771 15.832  1.00 9.68  ? 57  VAL B CG2 1 
ATOM   1374 N N   . CYS B 1 58  ? -3.900  15.630 20.338  1.00 12.52 ? 58  CYS B N   1 
ATOM   1375 C CA  . CYS B 1 58  ? -4.027  15.087 21.685  1.00 16.04 ? 58  CYS B CA  1 
ATOM   1376 C C   . CYS B 1 58  ? -5.479  14.861 22.125  1.00 18.51 ? 58  CYS B C   1 
ATOM   1377 O O   . CYS B 1 58  ? -5.722  14.288 23.187  1.00 20.71 ? 58  CYS B O   1 
ATOM   1378 C CB  . CYS B 1 58  ? -3.337  15.993 22.689  1.00 14.29 ? 58  CYS B CB  1 
ATOM   1379 S SG  . CYS B 1 58  ? -1.547  16.026 22.442  1.00 14.85 ? 58  CYS B SG  1 
ATOM   1380 N N   . SER B 1 59  ? -6.440  15.356 21.350  1.00 20.01 ? 59  SER B N   1 
ATOM   1381 C CA  . SER B 1 59  ? -7.845  15.156 21.690  1.00 21.36 ? 59  SER B CA  1 
ATOM   1382 C C   . SER B 1 59  ? -8.526  14.272 20.647  1.00 20.98 ? 59  SER B C   1 
ATOM   1383 O O   . SER B 1 59  ? -9.754  14.170 20.596  1.00 22.12 ? 59  SER B O   1 
ATOM   1384 C CB  . SER B 1 59  ? -8.564  16.498 21.823  1.00 20.94 ? 59  SER B CB  1 
ATOM   1385 O OG  . SER B 1 59  ? -8.756  17.137 20.571  1.00 26.09 ? 59  SER B OG  1 
ATOM   1386 N N   . GLN B 1 60  ? -7.722  13.595 19.839  1.00 19.47 ? 60  GLN B N   1 
ATOM   1387 C CA  . GLN B 1 60  ? -8.262  12.740 18.808  1.00 18.06 ? 60  GLN B CA  1 
ATOM   1388 C C   . GLN B 1 60  ? -8.212  11.258 19.140  1.00 19.36 ? 60  GLN B C   1 
ATOM   1389 O O   . GLN B 1 60  ? -8.426  10.870 20.290  1.00 18.97 ? 60  GLN B O   1 
ATOM   1390 C CB  . GLN B 1 60  ? -7.622  13.070 17.465  1.00 16.57 ? 60  GLN B CB  1 
ATOM   1391 C CG  . GLN B 1 60  ? -8.084  14.430 16.974  1.00 16.62 ? 60  GLN B CG  1 
ATOM   1392 C CD  . GLN B 1 60  ? -7.251  14.995 15.856  1.00 16.83 ? 60  GLN B CD  1 
ATOM   1393 O OE1 . GLN B 1 60  ? -6.683  14.263 15.060  1.00 16.05 ? 60  GLN B OE1 1 
ATOM   1394 N NE2 . GLN B 1 60  ? -7.206  16.311 15.772  1.00 17.44 ? 60  GLN B NE2 1 
ATOM   1395 N N   . LYS B 1 61  ? -7.925  10.441 18.136  1.00 19.58 ? 61  LYS B N   1 
ATOM   1396 C CA  . LYS B 1 61  ? -7.902  8.999  18.287  1.00 22.00 ? 61  LYS B CA  1 
ATOM   1397 C C   . LYS B 1 61  ? -6.826  8.377  19.191  1.00 22.61 ? 61  LYS B C   1 
ATOM   1398 O O   . LYS B 1 61  ? -5.652  8.337  18.848  1.00 23.32 ? 61  LYS B O   1 
ATOM   1399 C CB  . LYS B 1 61  ? -7.889  8.359  16.898  1.00 22.94 ? 61  LYS B CB  1 
ATOM   1400 C CG  . LYS B 1 61  ? -8.160  6.859  16.883  1.00 26.17 ? 61  LYS B CG  1 
ATOM   1401 C CD  . LYS B 1 61  ? -8.279  6.362  15.455  1.00 28.22 ? 61  LYS B CD  1 
ATOM   1402 C CE  . LYS B 1 61  ? -8.432  4.859  15.394  1.00 29.33 ? 61  LYS B CE  1 
ATOM   1403 N NZ  . LYS B 1 61  ? -8.537  4.426  13.966  1.00 32.41 ? 61  LYS B NZ  1 
ATOM   1404 N N   . LYS B 1 62  ? -7.267  7.854  20.332  1.00 23.71 ? 62  LYS B N   1 
ATOM   1405 C CA  . LYS B 1 62  ? -6.413  7.181  21.313  1.00 24.82 ? 62  LYS B CA  1 
ATOM   1406 C C   . LYS B 1 62  ? -5.866  5.855  20.768  1.00 24.15 ? 62  LYS B C   1 
ATOM   1407 O O   . LYS B 1 62  ? -6.642  4.978  20.396  1.00 24.63 ? 62  LYS B O   1 
ATOM   1408 C CB  . LYS B 1 62  ? -7.253  6.849  22.544  1.00 26.47 ? 62  LYS B CB  1 
ATOM   1409 C CG  . LYS B 1 62  ? -6.774  7.423  23.835  1.00 30.21 ? 62  LYS B CG  1 
ATOM   1410 C CD  . LYS B 1 62  ? -5.465  6.821  24.263  1.00 33.18 ? 62  LYS B CD  1 
ATOM   1411 C CE  . LYS B 1 62  ? -5.064  7.400  25.612  1.00 36.66 ? 62  LYS B CE  1 
ATOM   1412 N NZ  . LYS B 1 62  ? -6.086  7.111  26.664  1.00 37.59 ? 62  LYS B NZ  1 
ATOM   1413 N N   . VAL B 1 63  ? -4.546  5.700  20.720  1.00 22.22 ? 63  VAL B N   1 
ATOM   1414 C CA  . VAL B 1 63  ? -3.934  4.449  20.261  1.00 20.50 ? 63  VAL B CA  1 
ATOM   1415 C C   . VAL B 1 63  ? -2.785  4.087  21.217  1.00 20.04 ? 63  VAL B C   1 
ATOM   1416 O O   . VAL B 1 63  ? -2.426  4.890  22.077  1.00 21.33 ? 63  VAL B O   1 
ATOM   1417 C CB  . VAL B 1 63  ? -3.395  4.538  18.786  1.00 22.21 ? 63  VAL B CB  1 
ATOM   1418 C CG1 . VAL B 1 63  ? -4.517  4.897  17.805  1.00 21.94 ? 63  VAL B CG1 1 
ATOM   1419 C CG2 . VAL B 1 63  ? -2.257  5.544  18.680  1.00 22.91 ? 63  VAL B CG2 1 
ATOM   1420 N N   . THR B 1 64  ? -2.252  2.871  21.113  1.00 19.30 ? 64  THR B N   1 
ATOM   1421 C CA  . THR B 1 64  ? -1.125  2.452  21.961  1.00 19.09 ? 64  THR B CA  1 
ATOM   1422 C C   . THR B 1 64  ? 0.189   2.864  21.294  1.00 18.33 ? 64  THR B C   1 
ATOM   1423 O O   . THR B 1 64  ? 0.336   2.760  20.074  1.00 18.54 ? 64  THR B O   1 
ATOM   1424 C CB  . THR B 1 64  ? -1.041  0.922  22.122  1.00 20.09 ? 64  THR B CB  1 
ATOM   1425 O OG1 . THR B 1 64  ? -2.318  0.390  22.494  1.00 23.65 ? 64  THR B OG1 1 
ATOM   1426 C CG2 . THR B 1 64  ? -0.029  0.567  23.203  1.00 20.46 ? 64  THR B CG2 1 
ATOM   1427 N N   . CYS B 1 65  ? 1.148   3.300  22.097  1.00 17.27 ? 65  CYS B N   1 
ATOM   1428 C CA  . CYS B 1 65  ? 2.450   3.697  21.585  1.00 17.54 ? 65  CYS B CA  1 
ATOM   1429 C C   . CYS B 1 65  ? 3.232   2.443  21.199  1.00 17.63 ? 65  CYS B C   1 
ATOM   1430 O O   . CYS B 1 65  ? 2.920   1.338  21.659  1.00 16.59 ? 65  CYS B O   1 
ATOM   1431 C CB  . CYS B 1 65  ? 3.229   4.467  22.663  1.00 17.09 ? 65  CYS B CB  1 
ATOM   1432 S SG  . CYS B 1 65  ? 2.281   5.815  23.427  1.00 17.90 ? 65  CYS B SG  1 
ATOM   1433 N N   . LYS B 1 66  ? 4.277   2.621  20.397  1.00 18.25 ? 66  LYS B N   1 
ATOM   1434 C CA  . LYS B 1 66  ? 5.106   1.505  19.979  1.00 18.46 ? 66  LYS B CA  1 
ATOM   1435 C C   . LYS B 1 66  ? 5.737   0.839  21.182  1.00 17.26 ? 66  LYS B C   1 
ATOM   1436 O O   . LYS B 1 66  ? 5.987   -0.365 21.167  1.00 17.02 ? 66  LYS B O   1 
ATOM   1437 C CB  . LYS B 1 66  ? 6.206   1.977  19.040  1.00 20.00 ? 66  LYS B CB  1 
ATOM   1438 C CG  . LYS B 1 66  ? 5.771   2.060  17.608  1.00 25.87 ? 66  LYS B CG  1 
ATOM   1439 C CD  . LYS B 1 66  ? 6.931   2.428  16.709  1.00 29.65 ? 66  LYS B CD  1 
ATOM   1440 C CE  . LYS B 1 66  ? 6.480   2.459  15.247  1.00 34.10 ? 66  LYS B CE  1 
ATOM   1441 N NZ  . LYS B 1 66  ? 7.556   2.940  14.323  1.00 37.27 ? 66  LYS B NZ  1 
ATOM   1442 N N   . ASN B 1 67  ? 6.027   1.634  22.206  1.00 16.94 ? 67  ASN B N   1 
ATOM   1443 C CA  . ASN B 1 67  ? 6.659   1.135  23.420  1.00 17.18 ? 67  ASN B CA  1 
ATOM   1444 C C   . ASN B 1 67  ? 5.713   0.557  24.470  1.00 16.39 ? 67  ASN B C   1 
ATOM   1445 O O   . ASN B 1 67  ? 6.126   0.284  25.589  1.00 15.96 ? 67  ASN B O   1 
ATOM   1446 C CB  . ASN B 1 67  ? 7.548   2.215  24.045  1.00 16.71 ? 67  ASN B CB  1 
ATOM   1447 C CG  . ASN B 1 67  ? 6.757   3.365  24.676  1.00 18.51 ? 67  ASN B CG  1 
ATOM   1448 O OD1 . ASN B 1 67  ? 5.515   3.379  24.695  1.00 18.62 ? 67  ASN B OD1 1 
ATOM   1449 N ND2 . ASN B 1 67  ? 7.491   4.330  25.236  1.00 18.62 ? 67  ASN B ND2 1 
ATOM   1450 N N   . GLY B 1 68  ? 4.449   0.358  24.114  1.00 16.97 ? 68  GLY B N   1 
ATOM   1451 C CA  . GLY B 1 68  ? 3.516   -0.202 25.076  1.00 15.79 ? 68  GLY B CA  1 
ATOM   1452 C C   . GLY B 1 68  ? 2.808   0.817  25.942  1.00 16.79 ? 68  GLY B C   1 
ATOM   1453 O O   . GLY B 1 68  ? 1.810   0.473  26.572  1.00 16.85 ? 68  GLY B O   1 
ATOM   1454 N N   . GLN B 1 69  ? 3.302   2.055  25.993  1.00 14.90 ? 69  GLN B N   1 
ATOM   1455 C CA  . GLN B 1 69  ? 2.648   3.100  26.790  1.00 15.51 ? 69  GLN B CA  1 
ATOM   1456 C C   . GLN B 1 69  ? 1.268   3.411  26.191  1.00 14.95 ? 69  GLN B C   1 
ATOM   1457 O O   . GLN B 1 69  ? 1.048   3.235  24.994  1.00 15.45 ? 69  GLN B O   1 
ATOM   1458 C CB  . GLN B 1 69  ? 3.507   4.375  26.859  1.00 17.24 ? 69  GLN B CB  1 
ATOM   1459 C CG  . GLN B 1 69  ? 4.596   4.322  27.925  1.00 19.67 ? 69  GLN B CG  1 
ATOM   1460 C CD  . GLN B 1 69  ? 5.310   5.651  28.121  1.00 22.74 ? 69  GLN B CD  1 
ATOM   1461 O OE1 . GLN B 1 69  ? 6.415   5.856  27.619  1.00 23.76 ? 69  GLN B OE1 1 
ATOM   1462 N NE2 . GLN B 1 69  ? 4.708   6.540  28.905  1.00 24.80 ? 69  GLN B NE2 1 
ATOM   1463 N N   . THR B 1 70  ? 0.370   3.965  26.989  1.00 14.04 ? 70  THR B N   1 
ATOM   1464 C CA  . THR B 1 70  ? -0.975  4.215  26.502  1.00 14.97 ? 70  THR B CA  1 
ATOM   1465 C C   . THR B 1 70  ? -1.411  5.665  26.253  1.00 15.52 ? 70  THR B C   1 
ATOM   1466 O O   . THR B 1 70  ? -2.607  5.918  26.066  1.00 17.11 ? 70  THR B O   1 
ATOM   1467 C CB  . THR B 1 70  ? -1.957  3.550  27.454  1.00 14.38 ? 70  THR B CB  1 
ATOM   1468 O OG1 . THR B 1 70  ? -1.636  3.950  28.794  1.00 13.95 ? 70  THR B OG1 1 
ATOM   1469 C CG2 . THR B 1 70  ? -1.833  2.025  27.365  1.00 14.88 ? 70  THR B CG2 1 
ATOM   1470 N N   . ASN B 1 71  ? -0.478  6.616  26.273  1.00 13.93 ? 71  ASN B N   1 
ATOM   1471 C CA  . ASN B 1 71  ? -0.829  8.028  26.055  1.00 13.79 ? 71  ASN B CA  1 
ATOM   1472 C C   . ASN B 1 71  ? -0.604  8.515  24.622  1.00 11.74 ? 71  ASN B C   1 
ATOM   1473 O O   . ASN B 1 71  ? -0.274  9.676  24.412  1.00 11.51 ? 71  ASN B O   1 
ATOM   1474 C CB  . ASN B 1 71  ? -0.066  8.939  27.031  1.00 13.53 ? 71  ASN B CB  1 
ATOM   1475 C CG  . ASN B 1 71  ? 1.436   8.823  26.875  1.00 15.39 ? 71  ASN B CG  1 
ATOM   1476 O OD1 . ASN B 1 71  ? 1.940   7.796  26.438  1.00 13.51 ? 71  ASN B OD1 1 
ATOM   1477 N ND2 . ASN B 1 71  ? 2.162   9.871  27.253  1.00 17.69 ? 71  ASN B ND2 1 
ATOM   1478 N N   . CYS B 1 72  ? -0.782  7.636  23.642  1.00 11.52 ? 72  CYS B N   1 
ATOM   1479 C CA  . CYS B 1 72  ? -0.603  8.014  22.242  1.00 12.24 ? 72  CYS B CA  1 
ATOM   1480 C C   . CYS B 1 72  ? -1.912  8.293  21.517  1.00 11.35 ? 72  CYS B C   1 
ATOM   1481 O O   . CYS B 1 72  ? -2.931  7.678  21.797  1.00 10.78 ? 72  CYS B O   1 
ATOM   1482 C CB  . CYS B 1 72  ? 0.220   6.961  21.495  1.00 14.20 ? 72  CYS B CB  1 
ATOM   1483 S SG  . CYS B 1 72  ? 2.004   7.072  21.870  1.00 15.11 ? 72  CYS B SG  1 
ATOM   1484 N N   . TYR B 1 73  ? -1.863  9.251  20.600  1.00 13.03 ? 73  TYR B N   1 
ATOM   1485 C CA  . TYR B 1 73  ? -3.011  9.696  19.808  1.00 14.10 ? 73  TYR B CA  1 
ATOM   1486 C C   . TYR B 1 73  ? -2.631  9.782  18.331  1.00 15.59 ? 73  TYR B C   1 
ATOM   1487 O O   . TYR B 1 73  ? -1.504  10.189 17.996  1.00 15.67 ? 73  TYR B O   1 
ATOM   1488 C CB  . TYR B 1 73  ? -3.457  11.086 20.278  1.00 13.70 ? 73  TYR B CB  1 
ATOM   1489 C CG  . TYR B 1 73  ? -3.915  11.099 21.710  1.00 15.67 ? 73  TYR B CG  1 
ATOM   1490 C CD1 . TYR B 1 73  ? -3.005  11.252 22.750  1.00 15.18 ? 73  TYR B CD1 1 
ATOM   1491 C CD2 . TYR B 1 73  ? -5.245  10.841 22.034  1.00 16.22 ? 73  TYR B CD2 1 
ATOM   1492 C CE1 . TYR B 1 73  ? -3.406  11.133 24.076  1.00 16.79 ? 73  TYR B CE1 1 
ATOM   1493 C CE2 . TYR B 1 73  ? -5.654  10.718 23.359  1.00 17.33 ? 73  TYR B CE2 1 
ATOM   1494 C CZ  . TYR B 1 73  ? -4.728  10.861 24.370  1.00 17.54 ? 73  TYR B CZ  1 
ATOM   1495 O OH  . TYR B 1 73  ? -5.125  10.697 25.680  1.00 22.89 ? 73  TYR B OH  1 
ATOM   1496 N N   . GLN B 1 74  ? -3.572  9.409  17.464  1.00 14.35 ? 74  GLN B N   1 
ATOM   1497 C CA  . GLN B 1 74  ? -3.387  9.451  16.021  1.00 15.97 ? 74  GLN B CA  1 
ATOM   1498 C C   . GLN B 1 74  ? -4.256  10.542 15.393  1.00 17.59 ? 74  GLN B C   1 
ATOM   1499 O O   . GLN B 1 74  ? -5.431  10.683 15.753  1.00 18.51 ? 74  GLN B O   1 
ATOM   1500 C CB  . GLN B 1 74  ? -3.771  8.113  15.423  1.00 16.23 ? 74  GLN B CB  1 
ATOM   1501 C CG  . GLN B 1 74  ? -3.750  8.100  13.913  1.00 20.24 ? 74  GLN B CG  1 
ATOM   1502 C CD  . GLN B 1 74  ? -4.063  6.735  13.353  1.00 22.02 ? 74  GLN B CD  1 
ATOM   1503 O OE1 . GLN B 1 74  ? -4.784  6.614  12.373  1.00 25.47 ? 74  GLN B OE1 1 
ATOM   1504 N NE2 . GLN B 1 74  ? -3.515  5.696  13.972  1.00 23.06 ? 74  GLN B NE2 1 
ATOM   1505 N N   . SER B 1 75  ? -3.700  11.291 14.443  1.00 17.41 ? 75  SER B N   1 
ATOM   1506 C CA  . SER B 1 75  ? -4.451  12.353 13.773  1.00 16.52 ? 75  SER B CA  1 
ATOM   1507 C C   . SER B 1 75  ? -5.568  11.797 12.884  1.00 19.41 ? 75  SER B C   1 
ATOM   1508 O O   . SER B 1 75  ? -5.437  10.725 12.282  1.00 17.94 ? 75  SER B O   1 
ATOM   1509 C CB  . SER B 1 75  ? -3.525  13.227 12.931  1.00 16.05 ? 75  SER B CB  1 
ATOM   1510 O OG  . SER B 1 75  ? -2.888  12.478 11.916  1.00 11.42 ? 75  SER B OG  1 
ATOM   1511 N N   . LYS B 1 76  ? -6.687  12.510 12.845  1.00 21.04 ? 76  LYS B N   1 
ATOM   1512 C CA  . LYS B 1 76  ? -7.822  12.107 12.032  1.00 24.36 ? 76  LYS B CA  1 
ATOM   1513 C C   . LYS B 1 76  ? -7.517  12.238 10.540  1.00 24.09 ? 76  LYS B C   1 
ATOM   1514 O O   . LYS B 1 76  ? -8.008  11.450 9.725   1.00 24.80 ? 76  LYS B O   1 
ATOM   1515 C CB  . LYS B 1 76  ? -9.056  12.935 12.402  1.00 27.29 ? 76  LYS B CB  1 
ATOM   1516 C CG  . LYS B 1 76  ? -8.828  14.451 12.417  1.00 32.38 ? 76  LYS B CG  1 
ATOM   1517 C CD  . LYS B 1 76  ? -10.118 15.176 12.816  1.00 35.72 ? 76  LYS B CD  1 
ATOM   1518 C CE  . LYS B 1 76  ? -9.849  16.506 13.508  1.00 37.07 ? 76  LYS B CE  1 
ATOM   1519 N NZ  . LYS B 1 76  ? -11.047 16.867 14.341  1.00 36.95 ? 76  LYS B NZ  1 
ATOM   1520 N N   . SER B 1 77  ? -6.694  13.218 10.188  1.00 24.17 ? 77  SER B N   1 
ATOM   1521 C CA  . SER B 1 77  ? -6.325  13.448 8.797   1.00 23.81 ? 77  SER B CA  1 
ATOM   1522 C C   . SER B 1 77  ? -4.823  13.310 8.539   1.00 23.05 ? 77  SER B C   1 
ATOM   1523 O O   . SER B 1 77  ? -4.023  13.148 9.466   1.00 21.11 ? 77  SER B O   1 
ATOM   1524 C CB  . SER B 1 77  ? -6.773  14.847 8.372   1.00 24.29 ? 77  SER B CB  1 
ATOM   1525 O OG  . SER B 1 77  ? -8.193  14.936 8.346   1.00 29.95 ? 77  SER B OG  1 
ATOM   1526 N N   . THR B 1 78  ? -4.456  13.274 7.260   1.00 21.07 ? 78  THR B N   1 
ATOM   1527 C CA  . THR B 1 78  ? -3.050  13.221 6.911   1.00 19.51 ? 78  THR B CA  1 
ATOM   1528 C C   . THR B 1 78  ? -2.518  14.637 7.145   1.00 18.40 ? 78  THR B C   1 
ATOM   1529 O O   . THR B 1 78  ? -3.276  15.613 7.161   1.00 15.09 ? 78  THR B O   1 
ATOM   1530 C CB  . THR B 1 78  ? -2.813  12.812 5.435   1.00 20.51 ? 78  THR B CB  1 
ATOM   1531 O OG1 . THR B 1 78  ? -3.596  13.636 4.566   1.00 19.50 ? 78  THR B OG1 1 
ATOM   1532 C CG2 . THR B 1 78  ? -3.174  11.346 5.220   1.00 20.99 ? 78  THR B CG2 1 
ATOM   1533 N N   . MET B 1 79  ? -1.227  14.724 7.428   1.00 17.44 ? 79  MET B N   1 
ATOM   1534 C CA  . MET B 1 79  ? -0.575  15.999 7.667   1.00 16.49 ? 79  MET B CA  1 
ATOM   1535 C C   . MET B 1 79  ? 0.672   16.071 6.807   1.00 15.68 ? 79  MET B C   1 
ATOM   1536 O O   . MET B 1 79  ? 1.222   15.042 6.425   1.00 13.40 ? 79  MET B O   1 
ATOM   1537 C CB  . MET B 1 79  ? -0.191  16.117 9.138   1.00 16.77 ? 79  MET B CB  1 
ATOM   1538 C CG  . MET B 1 79  ? -1.383  16.109 10.086  1.00 17.16 ? 79  MET B CG  1 
ATOM   1539 S SD  . MET B 1 79  ? -0.896  16.768 11.674  1.00 19.01 ? 79  MET B SD  1 
ATOM   1540 C CE  . MET B 1 79  ? -2.468  17.330 12.284  1.00 19.95 ? 79  MET B CE  1 
ATOM   1541 N N   . ARG B 1 80  ? 1.096   17.284 6.478   1.00 15.48 ? 80  ARG B N   1 
ATOM   1542 C CA  . ARG B 1 80  ? 2.300   17.481 5.675   1.00 17.00 ? 80  ARG B CA  1 
ATOM   1543 C C   . ARG B 1 80  ? 3.491   17.412 6.627   1.00 16.26 ? 80  ARG B C   1 
ATOM   1544 O O   . ARG B 1 80  ? 3.604   18.216 7.557   1.00 15.79 ? 80  ARG B O   1 
ATOM   1545 C CB  . ARG B 1 80  ? 2.256   18.838 4.959   1.00 20.47 ? 80  ARG B CB  1 
ATOM   1546 C CG  . ARG B 1 80  ? 1.073   18.998 3.984   1.00 25.05 ? 80  ARG B CG  1 
ATOM   1547 C CD  . ARG B 1 80  ? 0.584   20.441 3.911   1.00 29.45 ? 80  ARG B CD  1 
ATOM   1548 N NE  . ARG B 1 80  ? 1.666   21.348 3.534   1.00 35.16 ? 80  ARG B NE  1 
ATOM   1549 C CZ  . ARG B 1 80  ? 2.327   22.138 4.385   1.00 36.93 ? 80  ARG B CZ  1 
ATOM   1550 N NH1 . ARG B 1 80  ? 2.017   22.156 5.677   1.00 38.23 ? 80  ARG B NH1 1 
ATOM   1551 N NH2 . ARG B 1 80  ? 3.394   22.814 3.964   1.00 37.53 ? 80  ARG B NH2 1 
ATOM   1552 N N   . ILE B 1 81  ? 4.348   16.416 6.427   1.00 14.72 ? 81  ILE B N   1 
ATOM   1553 C CA  . ILE B 1 81  ? 5.517   16.237 7.276   1.00 14.33 ? 81  ILE B CA  1 
ATOM   1554 C C   . ILE B 1 81  ? 6.735   15.911 6.420   1.00 13.77 ? 81  ILE B C   1 
ATOM   1555 O O   . ILE B 1 81  ? 6.609   15.596 5.231   1.00 14.15 ? 81  ILE B O   1 
ATOM   1556 C CB  . ILE B 1 81  ? 5.317   15.055 8.308   1.00 13.98 ? 81  ILE B CB  1 
ATOM   1557 C CG1 . ILE B 1 81  ? 5.236   13.715 7.581   1.00 14.19 ? 81  ILE B CG1 1 
ATOM   1558 C CG2 . ILE B 1 81  ? 4.052   15.253 9.147   1.00 12.26 ? 81  ILE B CG2 1 
ATOM   1559 C CD1 . ILE B 1 81  ? 5.096   12.509 8.500   1.00 12.62 ? 81  ILE B CD1 1 
ATOM   1560 N N   . THR B 1 82  ? 7.914   16.026 7.018   1.00 13.16 ? 82  THR B N   1 
ATOM   1561 C CA  . THR B 1 82  ? 9.137   15.674 6.328   1.00 12.19 ? 82  THR B CA  1 
ATOM   1562 C C   . THR B 1 82  ? 9.810   14.595 7.162   1.00 12.47 ? 82  THR B C   1 
ATOM   1563 O O   . THR B 1 82  ? 10.031  14.773 8.370   1.00 10.44 ? 82  THR B O   1 
ATOM   1564 C CB  . THR B 1 82  ? 10.078  16.886 6.125   1.00 13.49 ? 82  THR B CB  1 
ATOM   1565 O OG1 . THR B 1 82  ? 9.499   17.785 5.169   1.00 12.99 ? 82  THR B OG1 1 
ATOM   1566 C CG2 . THR B 1 82  ? 11.440  16.430 5.603   1.00 11.28 ? 82  THR B CG2 1 
ATOM   1567 N N   . ASP B 1 83  ? 10.066  13.458 6.515   1.00 13.23 ? 83  ASP B N   1 
ATOM   1568 C CA  . ASP B 1 83  ? 10.708  12.291 7.134   1.00 14.73 ? 83  ASP B CA  1 
ATOM   1569 C C   . ASP B 1 83  ? 12.199  12.410 6.856   1.00 14.70 ? 83  ASP B C   1 
ATOM   1570 O O   . ASP B 1 83  ? 12.587  12.625 5.708   1.00 14.44 ? 83  ASP B O   1 
ATOM   1571 C CB  . ASP B 1 83  ? 10.145  11.003 6.504   1.00 16.70 ? 83  ASP B CB  1 
ATOM   1572 C CG  . ASP B 1 83  ? 10.729  9.729  7.105   1.00 18.09 ? 83  ASP B CG  1 
ATOM   1573 O OD1 . ASP B 1 83  ? 11.866  9.353  6.778   1.00 16.98 ? 83  ASP B OD1 1 
ATOM   1574 O OD2 . ASP B 1 83  ? 10.020  9.056  7.864   1.00 20.18 ? 83  ASP B OD2 1 
ATOM   1575 N N   . CYS B 1 84  ? 13.002  12.416 7.922   1.00 14.48 ? 84  CYS B N   1 
ATOM   1576 C CA  . CYS B 1 84  ? 14.457  12.513 7.830   1.00 14.50 ? 84  CYS B CA  1 
ATOM   1577 C C   . CYS B 1 84  ? 15.093  11.242 8.368   1.00 16.22 ? 84  CYS B C   1 
ATOM   1578 O O   . CYS B 1 84  ? 14.933  10.923 9.556   1.00 17.07 ? 84  CYS B O   1 
ATOM   1579 C CB  . CYS B 1 84  ? 14.985  13.671 8.672   1.00 13.05 ? 84  CYS B CB  1 
ATOM   1580 S SG  . CYS B 1 84  ? 14.483  15.346 8.178   1.00 12.16 ? 84  CYS B SG  1 
ATOM   1581 N N   . ARG B 1 85  ? 15.891  10.582 7.532   1.00 17.25 ? 85  ARG B N   1 
ATOM   1582 C CA  . ARG B 1 85  ? 16.570  9.338  7.903   1.00 19.41 ? 85  ARG B CA  1 
ATOM   1583 C C   . ARG B 1 85  ? 18.012  9.283  7.437   1.00 18.94 ? 85  ARG B C   1 
ATOM   1584 O O   . ARG B 1 85  ? 18.328  9.655  6.307   1.00 18.62 ? 85  ARG B O   1 
ATOM   1585 C CB  . ARG B 1 85  ? 15.834  8.118  7.327   1.00 21.00 ? 85  ARG B CB  1 
ATOM   1586 C CG  . ARG B 1 85  ? 14.719  7.601  8.188   1.00 23.04 ? 85  ARG B CG  1 
ATOM   1587 C CD  . ARG B 1 85  ? 13.700  6.852  7.379   1.00 23.04 ? 85  ARG B CD  1 
ATOM   1588 N NE  . ARG B 1 85  ? 12.423  6.907  8.074   1.00 24.55 ? 85  ARG B NE  1 
ATOM   1589 C CZ  . ARG B 1 85  ? 12.054  6.054  9.018   1.00 27.21 ? 85  ARG B CZ  1 
ATOM   1590 N NH1 . ARG B 1 85  ? 12.864  5.049  9.367   1.00 28.82 ? 85  ARG B NH1 1 
ATOM   1591 N NH2 . ARG B 1 85  ? 10.922  6.249  9.677   1.00 26.50 ? 85  ARG B NH2 1 
ATOM   1592 N N   . GLU B 1 86  ? 18.884  8.809  8.320   1.00 20.38 ? 86  GLU B N   1 
ATOM   1593 C CA  . GLU B 1 86  ? 20.299  8.662  8.001   1.00 21.73 ? 86  GLU B CA  1 
ATOM   1594 C C   . GLU B 1 86  ? 20.501  7.840  6.755   1.00 22.22 ? 86  GLU B C   1 
ATOM   1595 O O   . GLU B 1 86  ? 19.780  6.879  6.500   1.00 21.55 ? 86  GLU B O   1 
ATOM   1596 C CB  . GLU B 1 86  ? 21.040  7.947  9.116   1.00 22.26 ? 86  GLU B CB  1 
ATOM   1597 C CG  . GLU B 1 86  ? 21.389  8.797  10.299  1.00 25.21 ? 86  GLU B CG  1 
ATOM   1598 C CD  . GLU B 1 86  ? 22.396  8.101  11.182  1.00 24.39 ? 86  GLU B CD  1 
ATOM   1599 O OE1 . GLU B 1 86  ? 22.010  7.116  11.833  1.00 26.24 ? 86  GLU B OE1 1 
ATOM   1600 O OE2 . GLU B 1 86  ? 23.571  8.515  11.189  1.00 23.27 ? 86  GLU B OE2 1 
ATOM   1601 N N   . THR B 1 87  ? 21.490  8.229  5.971   1.00 25.73 ? 87  THR B N   1 
ATOM   1602 C CA  . THR B 1 87  ? 21.833  7.517  4.757   1.00 28.65 ? 87  THR B CA  1 
ATOM   1603 C C   . THR B 1 87  ? 22.795  6.409  5.170   1.00 30.89 ? 87  THR B C   1 
ATOM   1604 O O   . THR B 1 87  ? 23.134  6.275  6.350   1.00 31.72 ? 87  THR B O   1 
ATOM   1605 C CB  . THR B 1 87  ? 22.540  8.449  3.773   1.00 29.15 ? 87  THR B CB  1 
ATOM   1606 O OG1 . THR B 1 87  ? 23.617  9.121  4.442   1.00 30.83 ? 87  THR B OG1 1 
ATOM   1607 C CG2 . THR B 1 87  ? 21.574  9.483  3.245   1.00 29.27 ? 87  THR B CG2 1 
ATOM   1608 N N   . GLY B 1 88  ? 23.188  5.571  4.218   1.00 33.44 ? 88  GLY B N   1 
ATOM   1609 C CA  . GLY B 1 88  ? 24.134  4.515  4.539   1.00 36.21 ? 88  GLY B CA  1 
ATOM   1610 C C   . GLY B 1 88  ? 25.503  5.123  4.804   1.00 36.60 ? 88  GLY B C   1 
ATOM   1611 O O   . GLY B 1 88  ? 26.220  4.711  5.713   1.00 37.13 ? 88  GLY B O   1 
ATOM   1612 N N   . SER B 1 89  ? 25.857  6.109  3.995   1.00 37.99 ? 89  SER B N   1 
ATOM   1613 C CA  . SER B 1 89  ? 27.127  6.802  4.127   1.00 40.81 ? 89  SER B CA  1 
ATOM   1614 C C   . SER B 1 89  ? 27.204  7.798  5.298   1.00 41.45 ? 89  SER B C   1 
ATOM   1615 O O   . SER B 1 89  ? 28.207  8.516  5.440   1.00 42.95 ? 89  SER B O   1 
ATOM   1616 C CB  . SER B 1 89  ? 27.486  7.494  2.802   1.00 42.15 ? 89  SER B CB  1 
ATOM   1617 O OG  . SER B 1 89  ? 26.335  7.964  2.109   1.00 44.51 ? 89  SER B OG  1 
ATOM   1618 N N   . SER B 1 90  ? 26.169  7.842  6.137   1.00 40.97 ? 90  SER B N   1 
ATOM   1619 C CA  . SER B 1 90  ? 26.172  8.754  7.284   1.00 40.23 ? 90  SER B CA  1 
ATOM   1620 C C   . SER B 1 90  ? 27.146  8.254  8.349   1.00 39.94 ? 90  SER B C   1 
ATOM   1621 O O   . SER B 1 90  ? 27.091  7.091  8.756   1.00 40.06 ? 90  SER B O   1 
ATOM   1622 C CB  . SER B 1 90  ? 24.772  8.890  7.893   1.00 38.87 ? 90  SER B CB  1 
ATOM   1623 O OG  . SER B 1 90  ? 24.790  9.809  8.979   1.00 36.18 ? 90  SER B OG  1 
ATOM   1624 N N   . LYS B 1 91  ? 28.041  9.126  8.795   1.00 39.69 ? 91  LYS B N   1 
ATOM   1625 C CA  . LYS B 1 91  ? 29.017  8.753  9.807   1.00 39.69 ? 91  LYS B CA  1 
ATOM   1626 C C   . LYS B 1 91  ? 29.293  9.967  10.678  1.00 39.11 ? 91  LYS B C   1 
ATOM   1627 O O   . LYS B 1 91  ? 29.762  10.994 10.179  1.00 38.96 ? 91  LYS B O   1 
ATOM   1628 C CB  . LYS B 1 91  ? 30.320  8.301  9.130   1.00 41.24 ? 91  LYS B CB  1 
ATOM   1629 C CG  . LYS B 1 91  ? 31.054  7.181  9.849   1.00 42.32 ? 91  LYS B CG  1 
ATOM   1630 C CD  . LYS B 1 91  ? 31.516  7.587  11.242  1.00 44.35 ? 91  LYS B CD  1 
ATOM   1631 C CE  . LYS B 1 91  ? 31.758  6.354  12.114  1.00 46.26 ? 91  LYS B CE  1 
ATOM   1632 N NZ  . LYS B 1 91  ? 32.667  5.343  11.472  1.00 45.79 ? 91  LYS B NZ  1 
ATOM   1633 N N   . TYR B 1 92  ? 29.014  9.856  11.976  1.00 37.18 ? 92  TYR B N   1 
ATOM   1634 C CA  . TYR B 1 92  ? 29.259  10.969 12.896  1.00 36.16 ? 92  TYR B CA  1 
ATOM   1635 C C   . TYR B 1 92  ? 30.747  11.373 12.838  1.00 35.82 ? 92  TYR B C   1 
ATOM   1636 O O   . TYR B 1 92  ? 31.623  10.504 12.830  1.00 36.20 ? 92  TYR B O   1 
ATOM   1637 C CB  . TYR B 1 92  ? 28.883  10.564 14.323  1.00 35.97 ? 92  TYR B CB  1 
ATOM   1638 C CG  . TYR B 1 92  ? 29.039  11.681 15.327  1.00 37.70 ? 92  TYR B CG  1 
ATOM   1639 C CD1 . TYR B 1 92  ? 28.166  12.769 15.327  1.00 38.44 ? 92  TYR B CD1 1 
ATOM   1640 C CD2 . TYR B 1 92  ? 30.087  11.682 16.246  1.00 38.43 ? 92  TYR B CD2 1 
ATOM   1641 C CE1 . TYR B 1 92  ? 28.333  13.833 16.207  1.00 38.13 ? 92  TYR B CE1 1 
ATOM   1642 C CE2 . TYR B 1 92  ? 30.260  12.745 17.135  1.00 39.02 ? 92  TYR B CE2 1 
ATOM   1643 C CZ  . TYR B 1 92  ? 29.377  13.815 17.104  1.00 38.95 ? 92  TYR B CZ  1 
ATOM   1644 O OH  . TYR B 1 92  ? 29.535  14.871 17.968  1.00 40.57 ? 92  TYR B OH  1 
ATOM   1645 N N   . PRO B 1 93  ? 31.055  12.684 12.851  1.00 34.37 ? 93  PRO B N   1 
ATOM   1646 C CA  . PRO B 1 93  ? 30.145  13.829 12.917  1.00 34.65 ? 93  PRO B CA  1 
ATOM   1647 C C   . PRO B 1 93  ? 29.631  14.311 11.565  1.00 34.24 ? 93  PRO B C   1 
ATOM   1648 O O   . PRO B 1 93  ? 29.110  15.417 11.464  1.00 34.46 ? 93  PRO B O   1 
ATOM   1649 C CB  . PRO B 1 93  ? 30.999  14.890 13.599  1.00 34.97 ? 93  PRO B CB  1 
ATOM   1650 C CG  . PRO B 1 93  ? 32.324  14.655 12.968  1.00 34.44 ? 93  PRO B CG  1 
ATOM   1651 C CD  . PRO B 1 93  ? 32.450  13.134 12.999  1.00 34.49 ? 93  PRO B CD  1 
ATOM   1652 N N   . ASN B 1 94  ? 29.836  13.514 10.524  1.00 34.22 ? 94  ASN B N   1 
ATOM   1653 C CA  . ASN B 1 94  ? 29.345  13.864 9.185   1.00 35.36 ? 94  ASN B CA  1 
ATOM   1654 C C   . ASN B 1 94  ? 27.964  13.222 8.990   1.00 33.68 ? 94  ASN B C   1 
ATOM   1655 O O   . ASN B 1 94  ? 27.812  12.276 8.203   1.00 34.12 ? 94  ASN B O   1 
ATOM   1656 C CB  . ASN B 1 94  ? 30.309  13.352 8.098   1.00 37.34 ? 94  ASN B CB  1 
ATOM   1657 C CG  . ASN B 1 94  ? 31.610  14.142 8.035   1.00 38.58 ? 94  ASN B CG  1 
ATOM   1658 O OD1 . ASN B 1 94  ? 32.668  13.582 7.747   1.00 39.97 ? 94  ASN B OD1 1 
ATOM   1659 N ND2 . ASN B 1 94  ? 31.533  15.454 8.279   1.00 37.83 ? 94  ASN B ND2 1 
ATOM   1660 N N   . CYS B 1 95  ? 26.965  13.705 9.729   1.00 31.67 ? 95  CYS B N   1 
ATOM   1661 C CA  . CYS B 1 95  ? 25.623  13.137 9.628   1.00 27.87 ? 95  CYS B CA  1 
ATOM   1662 C C   . CYS B 1 95  ? 25.003  13.471 8.282   1.00 27.06 ? 95  CYS B C   1 
ATOM   1663 O O   . CYS B 1 95  ? 25.111  14.601 7.807   1.00 27.59 ? 95  CYS B O   1 
ATOM   1664 C CB  . CYS B 1 95  ? 24.737  13.645 10.757  1.00 26.45 ? 95  CYS B CB  1 
ATOM   1665 S SG  . CYS B 1 95  ? 25.428  13.405 12.422  1.00 23.26 ? 95  CYS B SG  1 
ATOM   1666 N N   . ALA B 1 96  ? 24.413  12.474 7.636   1.00 24.16 ? 96  ALA B N   1 
ATOM   1667 C CA  . ALA B 1 96  ? 23.784  12.685 6.342   1.00 23.21 ? 96  ALA B CA  1 
ATOM   1668 C C   . ALA B 1 96  ? 22.378  12.099 6.373   1.00 23.81 ? 96  ALA B C   1 
ATOM   1669 O O   . ALA B 1 96  ? 22.168  10.967 6.828   1.00 23.33 ? 96  ALA B O   1 
ATOM   1670 C CB  . ALA B 1 96  ? 24.610  12.044 5.235   1.00 24.33 ? 96  ALA B CB  1 
ATOM   1671 N N   . TYR B 1 97  ? 21.407  12.891 5.934   1.00 21.59 ? 97  TYR B N   1 
ATOM   1672 C CA  . TYR B 1 97  ? 20.020  12.451 5.925   1.00 20.94 ? 97  TYR B CA  1 
ATOM   1673 C C   . TYR B 1 97  ? 19.411  12.484 4.538   1.00 20.83 ? 97  TYR B C   1 
ATOM   1674 O O   . TYR B 1 97  ? 19.884  13.187 3.651   1.00 21.63 ? 97  TYR B O   1 
ATOM   1675 C CB  . TYR B 1 97  ? 19.172  13.330 6.861   1.00 18.41 ? 97  TYR B CB  1 
ATOM   1676 C CG  . TYR B 1 97  ? 19.617  13.279 8.306   1.00 18.14 ? 97  TYR B CG  1 
ATOM   1677 C CD1 . TYR B 1 97  ? 19.160  12.274 9.157   1.00 16.19 ? 97  TYR B CD1 1 
ATOM   1678 C CD2 . TYR B 1 97  ? 20.541  14.201 8.808   1.00 16.29 ? 97  TYR B CD2 1 
ATOM   1679 C CE1 . TYR B 1 97  ? 19.619  12.180 10.467  1.00 16.24 ? 97  TYR B CE1 1 
ATOM   1680 C CE2 . TYR B 1 97  ? 21.000  14.119 10.117  1.00 12.94 ? 97  TYR B CE2 1 
ATOM   1681 C CZ  . TYR B 1 97  ? 20.539  13.108 10.938  1.00 15.51 ? 97  TYR B CZ  1 
ATOM   1682 O OH  . TYR B 1 97  ? 20.997  13.021 12.233  1.00 14.98 ? 97  TYR B OH  1 
ATOM   1683 N N   . LYS B 1 98  ? 18.445  11.604 4.333   1.00 20.24 ? 98  LYS B N   1 
ATOM   1684 C CA  . LYS B 1 98  ? 17.704  11.559 3.092   1.00 20.03 ? 98  LYS B CA  1 
ATOM   1685 C C   . LYS B 1 98  ? 16.408  12.294 3.468   1.00 18.58 ? 98  LYS B C   1 
ATOM   1686 O O   . LYS B 1 98  ? 15.863  12.055 4.544   1.00 18.59 ? 98  LYS B O   1 
ATOM   1687 C CB  . LYS B 1 98  ? 17.418  10.102 2.720   1.00 21.82 ? 98  LYS B CB  1 
ATOM   1688 C CG  . LYS B 1 98  ? 16.990  9.888  1.278   1.00 24.10 ? 98  LYS B CG  1 
ATOM   1689 C CD  . LYS B 1 98  ? 15.571  10.319 1.035   1.00 27.98 ? 98  LYS B CD  1 
ATOM   1690 C CE  . LYS B 1 98  ? 15.136  9.941  -0.355  1.00 31.17 ? 98  LYS B CE  1 
ATOM   1691 N NZ  . LYS B 1 98  ? 15.181  8.443  -0.502  1.00 36.59 ? 98  LYS B NZ  1 
ATOM   1692 N N   . THR B 1 99  ? 15.959  13.211 2.616   1.00 17.25 ? 99  THR B N   1 
ATOM   1693 C CA  . THR B 1 99  ? 14.743  13.992 2.852   1.00 16.07 ? 99  THR B CA  1 
ATOM   1694 C C   . THR B 1 99  ? 13.612  13.457 2.000   1.00 15.27 ? 99  THR B C   1 
ATOM   1695 O O   . THR B 1 99  ? 13.708  13.443 0.771   1.00 15.28 ? 99  THR B O   1 
ATOM   1696 C CB  . THR B 1 99  ? 14.941  15.480 2.435   1.00 16.69 ? 99  THR B CB  1 
ATOM   1697 O OG1 . THR B 1 99  ? 15.922  16.097 3.273   1.00 17.35 ? 99  THR B OG1 1 
ATOM   1698 C CG2 . THR B 1 99  ? 13.646  16.262 2.559   1.00 15.64 ? 99  THR B CG2 1 
ATOM   1699 N N   . THR B 1 100 ? 12.507  13.106 2.643   1.00 16.31 ? 100 THR B N   1 
ATOM   1700 C CA  . THR B 1 100 ? 11.338  12.592 1.938   1.00 16.38 ? 100 THR B CA  1 
ATOM   1701 C C   . THR B 1 100 ? 10.109  13.368 2.373   1.00 16.11 ? 100 THR B C   1 
ATOM   1702 O O   . THR B 1 100 ? 9.799   13.440 3.558   1.00 13.91 ? 100 THR B O   1 
ATOM   1703 C CB  . THR B 1 100 ? 11.101  11.097 2.244   1.00 18.28 ? 100 THR B CB  1 
ATOM   1704 O OG1 . THR B 1 100 ? 12.293  10.351 1.959   1.00 20.31 ? 100 THR B OG1 1 
ATOM   1705 C CG2 . THR B 1 100 ? 9.954   10.555 1.396   1.00 17.46 ? 100 THR B CG2 1 
ATOM   1706 N N   . GLN B 1 101 ? 9.460   14.020 1.417   1.00 17.31 ? 101 GLN B N   1 
ATOM   1707 C CA  . GLN B 1 101 ? 8.239   14.765 1.695   1.00 20.52 ? 101 GLN B CA  1 
ATOM   1708 C C   . GLN B 1 101 ? 7.086   13.786 1.664   1.00 20.22 ? 101 GLN B C   1 
ATOM   1709 O O   . GLN B 1 101 ? 6.921   13.059 0.687   1.00 20.46 ? 101 GLN B O   1 
ATOM   1710 C CB  . GLN B 1 101 ? 8.030   15.869 0.666   1.00 22.76 ? 101 GLN B CB  1 
ATOM   1711 C CG  . GLN B 1 101 ? 8.612   17.178 1.146   1.00 29.12 ? 101 GLN B CG  1 
ATOM   1712 C CD  . GLN B 1 101 ? 8.800   18.180 0.038   1.00 31.82 ? 101 GLN B CD  1 
ATOM   1713 O OE1 . GLN B 1 101 ? 9.913   18.364 -0.465  1.00 34.08 ? 101 GLN B OE1 1 
ATOM   1714 N NE2 . GLN B 1 101 ? 7.712   18.833 -0.361  1.00 32.84 ? 101 GLN B NE2 1 
ATOM   1715 N N   . VAL B 1 102 ? 6.322   13.725 2.750   1.00 19.21 ? 102 VAL B N   1 
ATOM   1716 C CA  . VAL B 1 102 ? 5.212   12.793 2.836   1.00 18.64 ? 102 VAL B CA  1 
ATOM   1717 C C   . VAL B 1 102 ? 3.937   13.396 3.431   1.00 19.50 ? 102 VAL B C   1 
ATOM   1718 O O   . VAL B 1 102 ? 3.966   14.428 4.089   1.00 17.80 ? 102 VAL B O   1 
ATOM   1719 C CB  . VAL B 1 102 ? 5.607   11.520 3.672   1.00 18.60 ? 102 VAL B CB  1 
ATOM   1720 C CG1 . VAL B 1 102 ? 7.061   11.110 3.429   1.00 17.79 ? 102 VAL B CG1 1 
ATOM   1721 C CG2 . VAL B 1 102 ? 5.355   11.715 5.130   1.00 19.85 ? 102 VAL B CG2 1 
ATOM   1722 N N   . GLU B 1 103 ? 2.822   12.724 3.182   1.00 19.45 ? 103 GLU B N   1 
ATOM   1723 C CA  . GLU B 1 103 ? 1.529   13.118 3.707   1.00 20.89 ? 103 GLU B CA  1 
ATOM   1724 C C   . GLU B 1 103 ? 0.899   11.892 4.378   1.00 19.73 ? 103 GLU B C   1 
ATOM   1725 O O   . GLU B 1 103 ? 0.348   11.018 3.709   1.00 18.56 ? 103 GLU B O   1 
ATOM   1726 C CB  . GLU B 1 103 ? 0.652   13.634 2.581   1.00 23.77 ? 103 GLU B CB  1 
ATOM   1727 C CG  . GLU B 1 103 ? 0.437   15.110 2.663   1.00 28.01 ? 103 GLU B CG  1 
ATOM   1728 C CD  . GLU B 1 103 ? -0.390  15.628 1.525   1.00 31.74 ? 103 GLU B CD  1 
ATOM   1729 O OE1 . GLU B 1 103 ? 0.208   16.112 0.532   1.00 32.79 ? 103 GLU B OE1 1 
ATOM   1730 O OE2 . GLU B 1 103 ? -1.637  15.572 1.632   1.00 34.84 ? 103 GLU B OE2 1 
ATOM   1731 N N   . LYS B 1 104 ? 1.041   11.810 5.701   1.00 19.17 ? 104 LYS B N   1 
ATOM   1732 C CA  . LYS B 1 104 ? 0.535   10.677 6.484   1.00 17.72 ? 104 LYS B CA  1 
ATOM   1733 C C   . LYS B 1 104 ? -0.063  11.109 7.826   1.00 17.11 ? 104 LYS B C   1 
ATOM   1734 O O   . LYS B 1 104 ? 0.094   12.255 8.266   1.00 15.50 ? 104 LYS B O   1 
ATOM   1735 C CB  . LYS B 1 104 ? 1.685   9.700  6.781   1.00 21.03 ? 104 LYS B CB  1 
ATOM   1736 C CG  . LYS B 1 104 ? 2.287   8.982  5.566   1.00 22.97 ? 104 LYS B CG  1 
ATOM   1737 C CD  . LYS B 1 104 ? 3.332   7.934  5.987   1.00 25.08 ? 104 LYS B CD  1 
ATOM   1738 C CE  . LYS B 1 104 ? 3.713   7.020  4.829   1.00 25.66 ? 104 LYS B CE  1 
ATOM   1739 N NZ  . LYS B 1 104 ? 4.750   6.031  5.199   1.00 27.13 ? 104 LYS B NZ  1 
ATOM   1740 N N   . HIS B 1 105 ? -0.736  10.184 8.490   1.00 14.53 ? 105 HIS B N   1 
ATOM   1741 C CA  . HIS B 1 105 ? -1.312  10.478 9.793   1.00 15.14 ? 105 HIS B CA  1 
ATOM   1742 C C   . HIS B 1 105 ? -0.162  10.394 10.762  1.00 13.36 ? 105 HIS B C   1 
ATOM   1743 O O   . HIS B 1 105 ? 0.691   9.543  10.596  1.00 14.78 ? 105 HIS B O   1 
ATOM   1744 C CB  . HIS B 1 105 ? -2.305  9.398  10.182  1.00 16.08 ? 105 HIS B CB  1 
ATOM   1745 C CG  . HIS B 1 105 ? -3.446  9.270  9.240   1.00 16.36 ? 105 HIS B CG  1 
ATOM   1746 N ND1 . HIS B 1 105 ? -4.640  9.925  9.439   1.00 19.74 ? 105 HIS B ND1 1 
ATOM   1747 C CD2 . HIS B 1 105 ? -3.580  8.576  8.087   1.00 17.47 ? 105 HIS B CD2 1 
ATOM   1748 C CE1 . HIS B 1 105 ? -5.464  9.642  8.445   1.00 20.25 ? 105 HIS B CE1 1 
ATOM   1749 N NE2 . HIS B 1 105 ? -4.844  8.825  7.611   1.00 20.84 ? 105 HIS B NE2 1 
ATOM   1750 N N   . ILE B 1 106 ? -0.110  11.273 11.756  1.00 13.59 ? 106 ILE B N   1 
ATOM   1751 C CA  . ILE B 1 106 ? 0.970   11.203 12.731  1.00 11.39 ? 106 ILE B CA  1 
ATOM   1752 C C   . ILE B 1 106 ? 0.462   10.628 14.050  1.00 11.57 ? 106 ILE B C   1 
ATOM   1753 O O   . ILE B 1 106 ? -0.720  10.722 14.370  1.00 10.42 ? 106 ILE B O   1 
ATOM   1754 C CB  . ILE B 1 106 ? 1.599   12.589 13.005  1.00 10.85 ? 106 ILE B CB  1 
ATOM   1755 C CG1 . ILE B 1 106 ? 0.588   13.512 13.675  1.00 9.04  ? 106 ILE B CG1 1 
ATOM   1756 C CG2 . ILE B 1 106 ? 2.101   13.208 11.712  1.00 9.34  ? 106 ILE B CG2 1 
ATOM   1757 C CD1 . ILE B 1 106 ? 1.209   14.759 14.275  1.00 8.58  ? 106 ILE B CD1 1 
ATOM   1758 N N   . ILE B 1 107 ? 1.349   9.996  14.797  1.00 10.05 ? 107 ILE B N   1 
ATOM   1759 C CA  . ILE B 1 107 ? 0.977   9.466  16.087  1.00 10.18 ? 107 ILE B CA  1 
ATOM   1760 C C   . ILE B 1 107 ? 1.939   10.111 17.075  1.00 11.50 ? 107 ILE B C   1 
ATOM   1761 O O   . ILE B 1 107 ? 3.152   10.113 16.847  1.00 11.38 ? 107 ILE B O   1 
ATOM   1762 C CB  . ILE B 1 107 ? 1.061   7.930  16.101  1.00 10.80 ? 107 ILE B CB  1 
ATOM   1763 C CG1 . ILE B 1 107 ? 0.077   7.368  15.059  1.00 9.98  ? 107 ILE B CG1 1 
ATOM   1764 C CG2 . ILE B 1 107 ? 0.741   7.398  17.492  1.00 9.40  ? 107 ILE B CG2 1 
ATOM   1765 C CD1 . ILE B 1 107 ? 0.111   5.874  14.874  1.00 11.09 ? 107 ILE B CD1 1 
ATOM   1766 N N   . VAL B 1 108 ? 1.385   10.772 18.095  1.00 10.09 ? 108 VAL B N   1 
ATOM   1767 C CA  . VAL B 1 108 ? 2.188   11.447 19.112  1.00 9.69  ? 108 VAL B CA  1 
ATOM   1768 C C   . VAL B 1 108 ? 1.785   11.030 20.510  1.00 9.63  ? 108 VAL B C   1 
ATOM   1769 O O   . VAL B 1 108 ? 0.696   10.502 20.718  1.00 10.93 ? 108 VAL B O   1 
ATOM   1770 C CB  . VAL B 1 108 ? 2.054   13.016 19.041  1.00 10.26 ? 108 VAL B CB  1 
ATOM   1771 C CG1 . VAL B 1 108 ? 2.596   13.551 17.734  1.00 12.22 ? 108 VAL B CG1 1 
ATOM   1772 C CG2 . VAL B 1 108 ? 0.595   13.452 19.248  1.00 9.81  ? 108 VAL B CG2 1 
ATOM   1773 N N   . ALA B 1 109 ? 2.707   11.174 21.452  1.00 10.00 ? 109 ALA B N   1 
ATOM   1774 C CA  . ALA B 1 109 ? 2.407   10.883 22.847  1.00 10.44 ? 109 ALA B CA  1 
ATOM   1775 C C   . ALA B 1 109 ? 2.123   12.259 23.429  1.00 11.36 ? 109 ALA B C   1 
ATOM   1776 O O   . ALA B 1 109 ? 2.779   13.244 23.054  1.00 10.68 ? 109 ALA B O   1 
ATOM   1777 C CB  . ALA B 1 109 ? 3.596   10.245 23.544  1.00 11.40 ? 109 ALA B CB  1 
ATOM   1778 N N   . CYS B 1 110 ? 1.110   12.344 24.283  1.00 10.94 ? 110 CYS B N   1 
ATOM   1779 C CA  . CYS B 1 110 ? 0.738   13.608 24.901  1.00 13.97 ? 110 CYS B CA  1 
ATOM   1780 C C   . CYS B 1 110 ? 0.864   13.505 26.406  1.00 13.58 ? 110 CYS B C   1 
ATOM   1781 O O   . CYS B 1 110 ? 0.612   12.454 26.990  1.00 15.90 ? 110 CYS B O   1 
ATOM   1782 C CB  . CYS B 1 110 ? -0.693  13.976 24.539  1.00 12.62 ? 110 CYS B CB  1 
ATOM   1783 S SG  . CYS B 1 110 ? -0.980  14.097 22.753  1.00 14.21 ? 110 CYS B SG  1 
ATOM   1784 N N   . GLY B 1 111 ? 1.244   14.605 27.033  1.00 14.07 ? 111 GLY B N   1 
ATOM   1785 C CA  . GLY B 1 111 ? 1.392   14.610 28.472  1.00 14.84 ? 111 GLY B CA  1 
ATOM   1786 C C   . GLY B 1 111 ? 1.286   16.037 28.935  1.00 15.44 ? 111 GLY B C   1 
ATOM   1787 O O   . GLY B 1 111 ? 1.213   16.938 28.095  1.00 14.59 ? 111 GLY B O   1 
ATOM   1788 N N   . GLY B 1 112 ? 1.346   16.247 30.249  1.00 15.09 ? 112 GLY B N   1 
ATOM   1789 C CA  . GLY B 1 112 ? 1.238   17.586 30.806  1.00 17.68 ? 112 GLY B CA  1 
ATOM   1790 C C   . GLY B 1 112 ? -0.209  18.022 31.019  1.00 19.37 ? 112 GLY B C   1 
ATOM   1791 O O   . GLY B 1 112 ? -1.154  17.327 30.627  1.00 19.28 ? 112 GLY B O   1 
ATOM   1792 N N   . LYS B 1 113 ? -0.402  19.130 31.720  1.00 19.73 ? 113 LYS B N   1 
ATOM   1793 C CA  . LYS B 1 113 ? -1.744  19.652 31.957  1.00 20.86 ? 113 LYS B CA  1 
ATOM   1794 C C   . LYS B 1 113 ? -1.648  21.142 31.679  1.00 20.01 ? 113 LYS B C   1 
ATOM   1795 O O   . LYS B 1 113 ? -1.166  21.902 32.522  1.00 18.55 ? 113 LYS B O   1 
ATOM   1796 C CB  . LYS B 1 113 ? -2.185  19.436 33.409  1.00 23.25 ? 113 LYS B CB  1 
ATOM   1797 C CG  . LYS B 1 113 ? -2.292  17.979 33.872  1.00 27.33 ? 113 LYS B CG  1 
ATOM   1798 C CD  . LYS B 1 113 ? -3.270  17.143 33.057  1.00 29.54 ? 113 LYS B CD  1 
ATOM   1799 C CE  . LYS B 1 113 ? -4.664  17.749 33.006  1.00 35.97 ? 113 LYS B CE  1 
ATOM   1800 N NZ  . LYS B 1 113 ? -4.811  18.952 32.098  1.00 38.11 ? 113 LYS B NZ  1 
ATOM   1801 N N   . PRO B 1 114 ? -2.192  21.594 30.537  1.00 19.17 ? 114 PRO B N   1 
ATOM   1802 C CA  . PRO B 1 114 ? -2.899  20.837 29.497  1.00 17.34 ? 114 PRO B CA  1 
ATOM   1803 C C   . PRO B 1 114 ? -2.060  19.781 28.791  1.00 17.43 ? 114 PRO B C   1 
ATOM   1804 O O   . PRO B 1 114 ? -0.859  19.902 28.699  1.00 15.85 ? 114 PRO B O   1 
ATOM   1805 C CB  . PRO B 1 114 ? -3.288  21.924 28.494  1.00 19.91 ? 114 PRO B CB  1 
ATOM   1806 C CG  . PRO B 1 114 ? -3.222  23.184 29.269  1.00 19.37 ? 114 PRO B CG  1 
ATOM   1807 C CD  . PRO B 1 114 ? -2.025  22.991 30.118  1.00 19.10 ? 114 PRO B CD  1 
ATOM   1808 N N   . SER B 1 115 ? -2.734  18.781 28.238  1.00 16.62 ? 115 SER B N   1 
ATOM   1809 C CA  . SER B 1 115 ? -2.089  17.691 27.504  1.00 16.99 ? 115 SER B CA  1 
ATOM   1810 C C   . SER B 1 115 ? -1.586  18.215 26.153  1.00 16.33 ? 115 SER B C   1 
ATOM   1811 O O   . SER B 1 115 ? -2.387  18.608 25.306  1.00 14.97 ? 115 SER B O   1 
ATOM   1812 C CB  . SER B 1 115 ? -3.117  16.580 27.278  1.00 16.19 ? 115 SER B CB  1 
ATOM   1813 O OG  . SER B 1 115 ? -2.528  15.380 26.840  1.00 20.30 ? 115 SER B OG  1 
ATOM   1814 N N   . VAL B 1 116 ? -0.267  18.269 25.979  1.00 14.63 ? 116 VAL B N   1 
ATOM   1815 C CA  . VAL B 1 116 ? 0.342   18.739 24.728  1.00 13.66 ? 116 VAL B CA  1 
ATOM   1816 C C   . VAL B 1 116 ? 1.262   17.635 24.202  1.00 11.88 ? 116 VAL B C   1 
ATOM   1817 O O   . VAL B 1 116 ? 1.601   16.706 24.939  1.00 10.97 ? 116 VAL B O   1 
ATOM   1818 C CB  . VAL B 1 116 ? 1.183   20.035 24.943  1.00 15.23 ? 116 VAL B CB  1 
ATOM   1819 C CG1 . VAL B 1 116 ? 0.269   21.235 25.262  1.00 16.21 ? 116 VAL B CG1 1 
ATOM   1820 C CG2 . VAL B 1 116 ? 2.177   19.849 26.078  1.00 15.81 ? 116 VAL B CG2 1 
ATOM   1821 N N   . PRO B 1 117 ? 1.629   17.680 22.912  1.00 10.89 ? 117 PRO B N   1 
ATOM   1822 C CA  . PRO B 1 117 ? 2.520   16.655 22.344  1.00 11.27 ? 117 PRO B CA  1 
ATOM   1823 C C   . PRO B 1 117 ? 3.938   16.718 22.953  1.00 11.50 ? 117 PRO B C   1 
ATOM   1824 O O   . PRO B 1 117 ? 4.552   17.780 22.999  1.00 9.27  ? 117 PRO B O   1 
ATOM   1825 C CB  . PRO B 1 117 ? 2.533   17.001 20.852  1.00 12.55 ? 117 PRO B CB  1 
ATOM   1826 C CG  . PRO B 1 117 ? 1.209   17.713 20.642  1.00 10.95 ? 117 PRO B CG  1 
ATOM   1827 C CD  . PRO B 1 117 ? 1.136   18.585 21.859  1.00 11.83 ? 117 PRO B CD  1 
ATOM   1828 N N   . VAL B 1 118 ? 4.442   15.575 23.424  1.00 11.22 ? 118 VAL B N   1 
ATOM   1829 C CA  . VAL B 1 118 ? 5.763   15.503 24.040  1.00 11.09 ? 118 VAL B CA  1 
ATOM   1830 C C   . VAL B 1 118 ? 6.709   14.454 23.408  1.00 11.97 ? 118 VAL B C   1 
ATOM   1831 O O   . VAL B 1 118 ? 7.805   14.237 23.909  1.00 11.37 ? 118 VAL B O   1 
ATOM   1832 C CB  . VAL B 1 118 ? 5.634   15.199 25.564  1.00 13.45 ? 118 VAL B CB  1 
ATOM   1833 C CG1 . VAL B 1 118 ? 4.788   16.265 26.254  1.00 11.25 ? 118 VAL B CG1 1 
ATOM   1834 C CG2 . VAL B 1 118 ? 5.016   13.811 25.785  1.00 10.25 ? 118 VAL B CG2 1 
ATOM   1835 N N   . HIS B 1 119 ? 6.253   13.751 22.368  1.00 11.26 ? 119 HIS B N   1 
ATOM   1836 C CA  . HIS B 1 119 ? 7.068   12.732 21.709  1.00 9.66  ? 119 HIS B CA  1 
ATOM   1837 C C   . HIS B 1 119 ? 6.417   12.337 20.405  1.00 9.77  ? 119 HIS B C   1 
ATOM   1838 O O   . HIS B 1 119 ? 5.190   12.240 20.341  1.00 8.91  ? 119 HIS B O   1 
ATOM   1839 C CB  . HIS B 1 119 ? 7.208   11.508 22.626  1.00 11.49 ? 119 HIS B CB  1 
ATOM   1840 C CG  . HIS B 1 119 ? 7.271   10.193 21.907  1.00 14.46 ? 119 HIS B CG  1 
ATOM   1841 N ND1 . HIS B 1 119 ? 8.417   9.716  21.307  1.00 14.65 ? 119 HIS B ND1 1 
ATOM   1842 C CD2 . HIS B 1 119 ? 6.343   9.214  21.757  1.00 15.34 ? 119 HIS B CD2 1 
ATOM   1843 C CE1 . HIS B 1 119 ? 8.201   8.505  20.827  1.00 13.45 ? 119 HIS B CE1 1 
ATOM   1844 N NE2 . HIS B 1 119 ? 6.951   8.176  21.087  1.00 14.17 ? 119 HIS B NE2 1 
ATOM   1845 N N   . PHE B 1 120 ? 7.216   12.159 19.354  1.00 7.84  ? 120 PHE B N   1 
ATOM   1846 C CA  . PHE B 1 120 ? 6.678   11.742 18.069  1.00 7.80  ? 120 PHE B CA  1 
ATOM   1847 C C   . PHE B 1 120 ? 6.832   10.224 17.992  1.00 10.40 ? 120 PHE B C   1 
ATOM   1848 O O   . PHE B 1 120 ? 7.924   9.704  18.150  1.00 9.08  ? 120 PHE B O   1 
ATOM   1849 C CB  . PHE B 1 120 ? 7.412   12.419 16.925  1.00 7.51  ? 120 PHE B CB  1 
ATOM   1850 C CG  . PHE B 1 120 ? 6.745   12.244 15.591  1.00 8.09  ? 120 PHE B CG  1 
ATOM   1851 C CD1 . PHE B 1 120 ? 6.988   11.112 14.811  1.00 7.55  ? 120 PHE B CD1 1 
ATOM   1852 C CD2 . PHE B 1 120 ? 5.865   13.207 15.112  1.00 7.63  ? 120 PHE B CD2 1 
ATOM   1853 C CE1 . PHE B 1 120 ? 6.357   10.949 13.578  1.00 8.71  ? 120 PHE B CE1 1 
ATOM   1854 C CE2 . PHE B 1 120 ? 5.230   13.053 13.874  1.00 7.10  ? 120 PHE B CE2 1 
ATOM   1855 C CZ  . PHE B 1 120 ? 5.473   11.929 13.108  1.00 6.82  ? 120 PHE B CZ  1 
ATOM   1856 N N   . ASP B 1 121 ? 5.729   9.521  17.756  1.00 12.21 ? 121 ASP B N   1 
ATOM   1857 C CA  . ASP B 1 121 ? 5.743   8.066  17.730  1.00 13.41 ? 121 ASP B CA  1 
ATOM   1858 C C   . ASP B 1 121 ? 5.878   7.427  16.363  1.00 13.73 ? 121 ASP B C   1 
ATOM   1859 O O   . ASP B 1 121 ? 6.748   6.586  16.155  1.00 13.72 ? 121 ASP B O   1 
ATOM   1860 C CB  . ASP B 1 121 ? 4.506   7.515  18.436  1.00 14.55 ? 121 ASP B CB  1 
ATOM   1861 C CG  . ASP B 1 121 ? 4.771   6.174  19.086  1.00 18.95 ? 121 ASP B CG  1 
ATOM   1862 O OD1 . ASP B 1 121 ? 5.792   6.063  19.800  1.00 19.04 ? 121 ASP B OD1 1 
ATOM   1863 O OD2 . ASP B 1 121 ? 3.977   5.234  18.878  1.00 19.00 ? 121 ASP B OD2 1 
ATOM   1864 N N   . ALA B 1 122 ? 5.039   7.831  15.416  1.00 14.12 ? 122 ALA B N   1 
ATOM   1865 C CA  . ALA B 1 122 ? 5.107   7.247  14.084  1.00 14.46 ? 122 ALA B CA  1 
ATOM   1866 C C   . ALA B 1 122 ? 4.169   7.965  13.132  1.00 15.96 ? 122 ALA B C   1 
ATOM   1867 O O   . ALA B 1 122 ? 3.328   8.753  13.561  1.00 14.27 ? 122 ALA B O   1 
ATOM   1868 C CB  . ALA B 1 122 ? 4.723   5.776  14.153  1.00 15.27 ? 122 ALA B CB  1 
ATOM   1869 N N   . SER B 1 123 ? 4.370   7.745  11.837  1.00 16.64 ? 123 SER B N   1 
ATOM   1870 C CA  . SER B 1 123 ? 3.493   8.302  10.822  1.00 18.58 ? 123 SER B CA  1 
ATOM   1871 C C   . SER B 1 123 ? 2.936   7.076  10.105  1.00 20.68 ? 123 SER B C   1 
ATOM   1872 O O   . SER B 1 123 ? 3.655   6.106  9.879   1.00 21.47 ? 123 SER B O   1 
ATOM   1873 C CB  . SER B 1 123 ? 4.248   9.229  9.877   1.00 18.46 ? 123 SER B CB  1 
ATOM   1874 O OG  . SER B 1 123 ? 5.279   8.561  9.194   1.00 20.98 ? 123 SER B OG  1 
ATOM   1875 N N   . VAL B 1 124 ? 1.639   7.081  9.808   1.00 23.26 ? 124 VAL B N   1 
ATOM   1876 C CA  . VAL B 1 124 ? 1.011   5.923  9.176   1.00 24.54 ? 124 VAL B CA  1 
ATOM   1877 C C   . VAL B 1 124 ? -0.001  6.248  8.062   1.00 24.61 ? 124 VAL B C   1 
ATOM   1878 O O   . VAL B 1 124 ? -0.481  7.393  7.982   1.00 23.53 ? 124 VAL B O   1 
ATOM   1879 C CB  . VAL B 1 124 ? 0.348   5.053  10.261  1.00 24.74 ? 124 VAL B CB  1 
ATOM   1880 C CG1 . VAL B 1 124 ? -0.766  5.824  10.938  1.00 24.80 ? 124 VAL B CG1 1 
ATOM   1881 C CG2 . VAL B 1 124 ? -0.169  3.750  9.678   1.00 27.33 ? 124 VAL B CG2 1 
ATOM   1882 O OXT . VAL B 1 124 ? -0.292  5.337  7.258   1.00 26.95 ? 124 VAL B OXT 1 
HETATM 1883 P P   . CPA C 2 .   ? 34.030  37.211 10.681  1.00 28.25 ? 125 CPA A P   1 
HETATM 1884 O O1P . CPA C 2 .   ? 33.748  36.190 11.680  1.00 32.76 ? 125 CPA A O1P 1 
HETATM 1885 O O2P . CPA C 2 .   ? 34.596  36.833 9.371   1.00 28.65 ? 125 CPA A O2P 1 
HETATM 1886 O O5D C CPA C 2 .   ? 32.708  42.114 9.712   1.00 39.26 ? 125 CPA A O5D 1 
HETATM 1887 C C5X C CPA C 2 .   ? 31.885  41.352 10.639  1.00 36.60 ? 125 CPA A C5X 1 
HETATM 1888 C C4X C CPA C 2 .   ? 31.475  40.028 10.022  1.00 34.26 ? 125 CPA A C4X 1 
HETATM 1889 O O4D C CPA C 2 .   ? 30.671  40.309 8.861   1.00 32.93 ? 125 CPA A O4D 1 
HETATM 1890 C C3X C CPA C 2 .   ? 32.628  39.137 9.544   1.00 33.43 ? 125 CPA A C3X 1 
HETATM 1891 O O3D C CPA C 2 .   ? 32.655  37.964 10.364  1.00 33.83 ? 125 CPA A O3D 1 
HETATM 1892 C C2X C CPA C 2 .   ? 32.129  38.529 8.224   1.00 33.01 ? 125 CPA A C2X 1 
HETATM 1893 C C1X C CPA C 2 .   ? 30.811  39.251 7.963   1.00 28.96 ? 125 CPA A C1X 1 
HETATM 1894 N N1C . CPA C 2 .   ? 30.563  39.704 6.595   1.00 25.43 ? 125 CPA A N1C 1 
HETATM 1895 C CC2 . CPA C 2 .   ? 30.332  38.734 5.620   1.00 25.04 ? 125 CPA A CC2 1 
HETATM 1896 N N3C . CPA C 2 .   ? 30.014  39.121 4.370   1.00 21.81 ? 125 CPA A N3C 1 
HETATM 1897 C CC4 . CPA C 2 .   ? 29.975  40.411 4.063   1.00 22.48 ? 125 CPA A CC4 1 
HETATM 1898 C CC5 . CPA C 2 .   ? 30.239  41.421 5.028   1.00 23.49 ? 125 CPA A CC5 1 
HETATM 1899 C CC6 . CPA C 2 .   ? 30.529  41.025 6.274   1.00 25.36 ? 125 CPA A CC6 1 
HETATM 1900 O O2C . CPA C 2 .   ? 30.439  37.533 5.928   1.00 22.65 ? 125 CPA A O2C 1 
HETATM 1901 N N4C . CPA C 2 .   ? 29.689  40.737 2.814   1.00 21.00 ? 125 CPA A N4C 1 
HETATM 1902 O O5B . CPA C 2 .   ? 34.971  38.282 11.388  1.00 35.60 ? 125 CPA A O5B 1 
HETATM 1903 C C5B . CPA C 2 .   ? 35.257  38.095 12.803  1.00 39.40 ? 125 CPA A C5B 1 
HETATM 1904 C C4B . CPA C 2 .   ? 36.033  39.255 13.400  1.00 41.99 ? 125 CPA A C4B 1 
HETATM 1905 O O4B . CPA C 2 .   ? 37.434  39.213 13.032  1.00 43.88 ? 125 CPA A O4B 1 
HETATM 1906 C C3B . CPA C 2 .   ? 35.641  40.681 13.030  1.00 41.68 ? 125 CPA A C3B 1 
HETATM 1907 O O3B . CPA C 2 .   ? 34.446  41.103 13.674  1.00 42.82 ? 125 CPA A O3B 1 
HETATM 1908 C C2B . CPA C 2 .   ? 36.842  41.470 13.549  1.00 41.94 ? 125 CPA A C2B 1 
HETATM 1909 C C1B . CPA C 2 .   ? 37.995  40.484 13.318  1.00 42.44 ? 125 CPA A C1B 1 
HETATM 1910 N N9A . CPA C 2 .   ? 38.896  40.869 12.232  1.00 41.71 ? 125 CPA A N9A 1 
HETATM 1911 C C8A . CPA C 2 .   ? 38.774  41.941 11.373  1.00 41.01 ? 125 CPA A C8A 1 
HETATM 1912 N N7A . CPA C 2 .   ? 39.792  42.077 10.557  1.00 41.82 ? 125 CPA A N7A 1 
HETATM 1913 C C5A . CPA C 2 .   ? 40.630  41.021 10.890  1.00 40.28 ? 125 CPA A C5A 1 
HETATM 1914 C C6A . CPA C 2 .   ? 41.876  40.626 10.403  1.00 39.47 ? 125 CPA A C6A 1 
HETATM 1915 N N6A . CPA C 2 .   ? 42.528  41.292 9.451   1.00 37.38 ? 125 CPA A N6A 1 
HETATM 1916 N N1A . CPA C 2 .   ? 42.443  39.520 10.942  1.00 39.04 ? 125 CPA A N1A 1 
HETATM 1917 C C2A . CPA C 2 .   ? 41.784  38.870 11.912  1.00 37.98 ? 125 CPA A C2A 1 
HETATM 1918 N N3A . CPA C 2 .   ? 40.610  39.150 12.465  1.00 38.76 ? 125 CPA A N3A 1 
HETATM 1919 C C4A . CPA C 2 .   ? 40.078  40.253 11.902  1.00 40.63 ? 125 CPA A C4A 1 
HETATM 1920 P P   . CPA D 2 .   ? 11.247  12.092 20.498  1.00 27.88 ? 126 CPA B P   1 
HETATM 1921 O O1P . CPA D 2 .   ? 10.286  12.836 19.661  1.00 31.98 ? 126 CPA B O1P 1 
HETATM 1922 O O2P . CPA D 2 .   ? 12.056  12.777 21.520  1.00 33.76 ? 126 CPA B O2P 1 
HETATM 1923 O O5D . CPA D 2 .   ? 12.015  7.295  19.346  1.00 29.88 ? 126 CPA B O5D 1 
HETATM 1924 C C5X . CPA D 2 .   ? 13.190  8.105  19.203  1.00 28.26 ? 126 CPA B C5X 1 
HETATM 1925 C C4X . CPA D 2 .   ? 12.891  9.311  18.347  1.00 28.22 ? 126 CPA B C4X 1 
HETATM 1926 O O4D . CPA D 2 .   ? 12.559  8.888  17.009  1.00 28.53 ? 126 CPA B O4D 1 
HETATM 1927 C C3X . CPA D 2 .   ? 11.698  10.149 18.807  1.00 29.59 ? 126 CPA B C3X 1 
HETATM 1928 O O3D . CPA D 2 .   ? 12.183  11.317 19.468  1.00 30.37 ? 126 CPA B O3D 1 
HETATM 1929 C C2X . CPA D 2 .   ? 11.107  10.721 17.513  1.00 28.41 ? 126 CPA B C2X 1 
HETATM 1930 C C1X . CPA D 2 .   ? 11.789  9.909  16.422  1.00 25.51 ? 126 CPA B C1X 1 
HETATM 1931 N N1C . CPA D 2 .   ? 10.924  9.386  15.358  1.00 21.18 ? 126 CPA B N1C 1 
HETATM 1932 C CC2 . CPA D 2 .   ? 10.370  10.317 14.474  1.00 18.12 ? 126 CPA B CC2 1 
HETATM 1933 N N3C . CPA D 2 .   ? 9.654   9.883  13.425  1.00 17.58 ? 126 CPA B N3C 1 
HETATM 1934 C CC4 . CPA D 2 .   ? 9.450   8.578  13.250  1.00 20.45 ? 126 CPA B CC4 1 
HETATM 1935 C CC5 . CPA D 2 .   ? 9.964   7.603  14.164  1.00 18.84 ? 126 CPA B CC5 1 
HETATM 1936 C CC6 . CPA D 2 .   ? 10.687  8.053  15.198  1.00 20.62 ? 126 CPA B CC6 1 
HETATM 1937 O O2C . CPA D 2 .   ? 10.543  11.521 14.688  1.00 14.70 ? 126 CPA B O2C 1 
HETATM 1938 N N4C . CPA D 2 .   ? 8.740   8.199  12.192  1.00 18.83 ? 126 CPA B N4C 1 
HETATM 1939 O O5B . CPA D 2 .   ? 10.417  10.970 21.236  1.00 34.37 ? 126 CPA B O5B 1 
HETATM 1940 C C5B . CPA D 2 .   ? 11.071  9.844  21.843  1.00 41.80 ? 126 CPA B C5B 1 
HETATM 1941 C C4B . CPA D 2 .   ? 11.427  10.164 23.280  1.00 45.13 ? 126 CPA B C4B 1 
HETATM 1942 O O4B . CPA D 2 .   ? 10.269  10.756 23.941  1.00 46.35 ? 126 CPA B O4B 1 
HETATM 1943 C C3B . CPA D 2 .   ? 11.761  8.932  24.112  1.00 45.96 ? 126 CPA B C3B 1 
HETATM 1944 O O3B . CPA D 2 .   ? 13.146  8.602  24.025  1.00 48.81 ? 126 CPA B O3B 1 
HETATM 1945 C C2B . CPA D 2 .   ? 11.364  9.374  25.515  1.00 46.37 ? 126 CPA B C2B 1 
HETATM 1946 C C1B . CPA D 2 .   ? 10.097  10.181 25.227  1.00 44.52 ? 126 CPA B C1B 1 
HETATM 1947 N N9A . CPA D 2 .   ? 8.904   9.337  25.173  1.00 42.14 ? 126 CPA B N9A 1 
HETATM 1948 C C8A . CPA D 2 .   ? 8.772   8.123  24.543  1.00 41.84 ? 126 CPA B C8A 1 
HETATM 1949 N N7A . CPA D 2 .   ? 7.583   7.591  24.662  1.00 41.62 ? 126 CPA B N7A 1 
HETATM 1950 C C5A . CPA D 2 .   ? 6.880   8.519  25.425  1.00 40.90 ? 126 CPA B C5A 1 
HETATM 1951 C C6A . CPA D 2 .   ? 5.559   8.542  25.903  1.00 40.52 ? 126 CPA B C6A 1 
HETATM 1952 N N6A . CPA D 2 .   ? 4.662   7.581  25.663  1.00 39.08 ? 126 CPA B N6A 1 
HETATM 1953 N N1A . CPA D 2 .   ? 5.182   9.613  26.634  1.00 40.27 ? 126 CPA B N1A 1 
HETATM 1954 C C2A . CPA D 2 .   ? 6.078   10.581 26.864  1.00 39.43 ? 126 CPA B C2A 1 
HETATM 1955 N N3A . CPA D 2 .   ? 7.338   10.672 26.468  1.00 39.24 ? 126 CPA B N3A 1 
HETATM 1956 C C4A . CPA D 2 .   ? 7.687   9.593  25.747  1.00 40.60 ? 126 CPA B C4A 1 
HETATM 1957 O O   . HOH E 3 .   ? 47.253  28.021 10.134  1.00 14.30 ? 131 HOH A O   1 
HETATM 1958 O O   . HOH E 3 .   ? 38.148  44.926 8.505   1.00 14.00 ? 132 HOH A O   1 
HETATM 1959 O O   . HOH E 3 .   ? 20.867  38.848 0.672   1.00 16.54 ? 133 HOH A O   1 
HETATM 1960 O O   . HOH E 3 .   ? 40.369  28.977 7.254   1.00 8.86  ? 138 HOH A O   1 
HETATM 1961 O O   . HOH E 3 .   ? 36.780  21.906 -0.090  1.00 16.49 ? 142 HOH A O   1 
HETATM 1962 O O   . HOH E 3 .   ? 44.112  48.642 -0.640  1.00 13.82 ? 143 HOH A O   1 
HETATM 1963 O O   . HOH E 3 .   ? 40.787  33.686 -7.430  1.00 15.87 ? 147 HOH A O   1 
HETATM 1964 O O   . HOH E 3 .   ? 27.881  40.745 10.539  1.00 17.79 ? 151 HOH A O   1 
HETATM 1965 O O   . HOH E 3 .   ? 21.401  42.039 14.643  1.00 25.61 ? 161 HOH A O   1 
HETATM 1966 O O   . HOH E 3 .   ? 9.805   25.677 16.700  1.00 34.64 ? 165 HOH A O   1 
HETATM 1967 O O   . HOH E 3 .   ? 15.448  34.800 -0.394  1.00 44.34 ? 167 HOH A O   1 
HETATM 1968 O O   . HOH E 3 .   ? 27.507  22.835 13.247  1.00 59.19 ? 170 HOH A O   1 
HETATM 1969 O O   . HOH E 3 .   ? 6.922   25.296 28.159  1.00 34.13 ? 186 HOH A O   1 
HETATM 1970 O O   . HOH E 3 .   ? 51.160  27.597 13.925  1.00 15.34 ? 187 HOH A O   1 
HETATM 1971 O O   . HOH E 3 .   ? -2.955  25.756 4.650   1.00 47.77 ? 203 HOH A O   1 
HETATM 1972 O O   . HOH E 3 .   ? 28.406  44.831 3.349   1.00 15.78 ? 207 HOH A O   1 
HETATM 1973 O O   . HOH E 3 .   ? 30.998  44.103 1.064   1.00 35.76 ? 208 HOH A O   1 
HETATM 1974 O O   . HOH E 3 .   ? 28.499  38.986 0.552   1.00 26.58 ? 210 HOH A O   1 
HETATM 1975 O O   . HOH E 3 .   ? 32.115  36.819 14.773  1.00 41.10 ? 215 HOH A O   1 
HETATM 1976 O O   . HOH E 3 .   ? 45.459  25.242 -3.306  1.00 42.38 ? 217 HOH A O   1 
HETATM 1977 O O   . HOH E 3 .   ? 41.752  31.067 -5.767  1.00 24.11 ? 218 HOH A O   1 
HETATM 1978 O O   . HOH E 3 .   ? 36.740  36.412 -13.026 1.00 36.52 ? 226 HOH A O   1 
HETATM 1979 O O   . HOH E 3 .   ? 18.273  16.909 24.010  1.00 50.13 ? 227 HOH A O   1 
HETATM 1980 O O   . HOH E 3 .   ? 14.033  28.583 7.766   1.00 41.15 ? 232 HOH A O   1 
HETATM 1981 O O   . HOH E 3 .   ? 27.506  44.308 9.517   1.00 31.69 ? 233 HOH A O   1 
HETATM 1982 O O   . HOH E 3 .   ? 5.905   25.754 17.382  1.00 52.27 ? 240 HOH A O   1 
HETATM 1983 O O   . HOH E 3 .   ? 31.813  22.794 9.566   1.00 46.94 ? 241 HOH A O   1 
HETATM 1984 O O   . HOH E 3 .   ? 36.320  25.528 -6.396  1.00 27.57 ? 247 HOH A O   1 
HETATM 1985 O O   . HOH E 3 .   ? 50.597  42.801 8.585   1.00 47.77 ? 262 HOH A O   1 
HETATM 1986 O O   . HOH E 3 .   ? 12.083  25.986 7.104   1.00 30.55 ? 265 HOH A O   1 
HETATM 1987 O O   . HOH E 3 .   ? 18.107  31.796 11.369  1.00 39.41 ? 266 HOH A O   1 
HETATM 1988 O O   . HOH E 3 .   ? 42.586  48.342 -3.749  1.00 23.84 ? 639 HOH A O   1 
HETATM 1989 O O   . HOH E 3 .   ? 42.050  26.726 6.375   1.00 32.02 ? 641 HOH A O   1 
HETATM 1990 O O   . HOH E 3 .   ? 15.830  23.098 2.300   1.00 27.32 ? 642 HOH A O   1 
HETATM 1991 O O   . HOH E 3 .   ? 45.232  30.975 11.989  1.00 35.12 ? 653 HOH A O   1 
HETATM 1992 O O   . HOH E 3 .   ? 16.796  32.306 4.443   1.00 24.94 ? 657 HOH A O   1 
HETATM 1993 O O   . HOH E 3 .   ? 48.250  30.430 0.464   1.00 23.76 ? 663 HOH A O   1 
HETATM 1994 O O   . HOH E 3 .   ? 52.852  30.588 5.497   1.00 22.56 ? 664 HOH A O   1 
HETATM 1995 O O   . HOH E 3 .   ? 35.633  33.715 10.239  1.00 20.79 ? 666 HOH A O   1 
HETATM 1996 O O   . HOH E 3 .   ? 7.264   25.757 13.512  1.00 19.56 ? 667 HOH A O   1 
HETATM 1997 O O   . HOH E 3 .   ? 49.513  38.037 8.488   1.00 35.25 ? 669 HOH A O   1 
HETATM 1998 O O   . HOH E 3 .   ? 38.307  45.620 1.840   1.00 28.37 ? 674 HOH A O   1 
HETATM 1999 O O   . HOH E 3 .   ? 26.404  32.004 -6.139  1.00 30.46 ? 675 HOH A O   1 
HETATM 2000 O O   . HOH E 3 .   ? 48.796  35.593 12.687  1.00 24.23 ? 677 HOH A O   1 
HETATM 2001 O O   . HOH E 3 .   ? 43.256  49.712 12.631  1.00 23.66 ? 678 HOH A O   1 
HETATM 2002 O O   . HOH E 3 .   ? 11.508  25.111 21.563  1.00 32.68 ? 687 HOH A O   1 
HETATM 2003 O O   . HOH F 3 .   ? -5.632  18.218 14.073  1.00 18.58 ? 135 HOH B O   1 
HETATM 2004 O O   . HOH F 3 .   ? 4.387   20.318 22.168  1.00 13.96 ? 136 HOH B O   1 
HETATM 2005 O O   . HOH F 3 .   ? 10.127  15.428 21.046  1.00 11.03 ? 139 HOH B O   1 
HETATM 2006 O O   . HOH F 3 .   ? 1.859   13.836 31.918  1.00 20.31 ? 140 HOH B O   1 
HETATM 2007 O O   . HOH F 3 .   ? 13.928  9.823  4.263   1.00 13.68 ? 146 HOH B O   1 
HETATM 2008 O O   . HOH F 3 .   ? -2.079  23.484 9.570   1.00 17.46 ? 148 HOH B O   1 
HETATM 2009 O O   . HOH F 3 .   ? 9.094   12.520 27.437  1.00 39.76 ? 149 HOH B O   1 
HETATM 2010 O O   . HOH F 3 .   ? 1.038   -0.951 28.922  1.00 11.84 ? 150 HOH B O   1 
HETATM 2011 O O   . HOH F 3 .   ? 34.483  24.113 14.095  1.00 48.09 ? 153 HOH B O   1 
HETATM 2012 O O   . HOH F 3 .   ? -1.310  10.122 1.810   1.00 36.49 ? 155 HOH B O   1 
HETATM 2013 O O   . HOH F 3 .   ? 7.587   5.101  11.105  1.00 30.83 ? 157 HOH B O   1 
HETATM 2014 O O   . HOH F 3 .   ? 2.145   20.256 32.866  1.00 23.71 ? 158 HOH B O   1 
HETATM 2015 O O   . HOH F 3 .   ? 6.941   4.567  22.014  1.00 35.11 ? 159 HOH B O   1 
HETATM 2016 O O   . HOH F 3 .   ? -9.844  4.998  20.200  1.00 33.69 ? 162 HOH B O   1 
HETATM 2017 O O   . HOH F 3 .   ? -6.367  22.600 20.714  1.00 71.18 ? 164 HOH B O   1 
HETATM 2018 O O   . HOH F 3 .   ? -6.178  15.724 11.840  1.00 39.96 ? 168 HOH B O   1 
HETATM 2019 O O   . HOH F 3 .   ? 35.694  23.687 4.499   1.00 21.33 ? 171 HOH B O   1 
HETATM 2020 O O   . HOH F 3 .   ? 1.367   21.391 28.924  1.00 38.78 ? 172 HOH B O   1 
HETATM 2021 O O   . HOH F 3 .   ? 2.698   23.188 23.489  1.00 54.88 ? 200 HOH B O   1 
HETATM 2022 O O   . HOH F 3 .   ? 14.510  26.933 12.898  1.00 36.98 ? 202 HOH B O   1 
HETATM 2023 O O   . HOH F 3 .   ? 18.379  24.942 -0.372  1.00 38.57 ? 209 HOH B O   1 
HETATM 2024 O O   . HOH F 3 .   ? 17.721  5.268  10.003  1.00 32.07 ? 214 HOH B O   1 
HETATM 2025 O O   . HOH F 3 .   ? 22.816  7.108  14.661  1.00 27.88 ? 221 HOH B O   1 
HETATM 2026 O O   . HOH F 3 .   ? -4.404  26.861 12.736  1.00 28.53 ? 222 HOH B O   1 
HETATM 2027 O O   . HOH F 3 .   ? 1.709   3.689  17.665  1.00 33.25 ? 223 HOH B O   1 
HETATM 2028 O O   . HOH F 3 .   ? 17.338  13.565 -0.097  1.00 38.42 ? 224 HOH B O   1 
HETATM 2029 O O   . HOH F 3 .   ? 29.465  21.877 3.102   1.00 22.11 ? 225 HOH B O   1 
HETATM 2030 O O   . HOH F 3 .   ? 9.221   5.934  18.209  1.00 36.31 ? 229 HOH B O   1 
HETATM 2031 O O   . HOH F 3 .   ? -6.964  23.627 16.195  1.00 32.73 ? 234 HOH B O   1 
HETATM 2032 O O   . HOH F 3 .   ? 39.480  24.456 16.606  1.00 32.28 ? 237 HOH B O   1 
HETATM 2033 O O   . HOH F 3 .   ? 19.031  15.898 3.764   1.00 11.49 ? 243 HOH B O   1 
HETATM 2034 O O   . HOH F 3 .   ? 32.734  22.605 -4.879  1.00 60.01 ? 251 HOH B O   1 
HETATM 2035 O O   . HOH F 3 .   ? 8.168   10.201 9.278   1.00 27.94 ? 255 HOH B O   1 
HETATM 2036 O O   . HOH F 3 .   ? 9.544   16.138 24.398  1.00 26.40 ? 259 HOH B O   1 
HETATM 2037 O O   . HOH F 3 .   ? 5.729   -0.596 28.390  1.00 19.95 ? 260 HOH B O   1 
HETATM 2038 O O   . HOH F 3 .   ? 26.821  8.636  15.420  1.00 38.86 ? 261 HOH B O   1 
HETATM 2039 O O   . HOH F 3 .   ? 21.441  23.375 0.610   1.00 25.25 ? 632 HOH B O   1 
HETATM 2040 O O   . HOH F 3 .   ? -2.183  20.323 22.948  1.00 47.70 ? 638 HOH B O   1 
HETATM 2041 O O   . HOH F 3 .   ? 23.614  20.027 16.086  1.00 34.18 ? 640 HOH B O   1 
HETATM 2042 O O   . HOH F 3 .   ? 32.370  23.346 3.338   1.00 24.96 ? 643 HOH B O   1 
HETATM 2043 O O   . HOH F 3 .   ? -7.097  12.644 5.243   0.50 29.56 ? 644 HOH B O   1 
HETATM 2044 O O   . HOH F 3 .   ? 23.215  17.078 9.560   1.00 29.26 ? 647 HOH B O   1 
HETATM 2045 O O   . HOH F 3 .   ? 26.262  18.326 11.101  1.00 47.47 ? 648 HOH B O   1 
HETATM 2046 O O   . HOH F 3 .   ? 15.369  8.269  16.101  1.00 21.41 ? 649 HOH B O   1 
HETATM 2047 O O   . HOH F 3 .   ? -0.807  22.889 4.962   1.00 45.12 ? 686 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  CYS 40  40  40  CYS CYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  CYS 72  72  72  CYS CYS A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
B 1 1   LYS 1   1   1   LYS LYS B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ALA 5   5   5   ALA ALA B . n 
B 1 6   ALA 6   6   6   ALA ALA B . n 
B 1 7   LYS 7   7   7   LYS LYS B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  ARG 10  10  10  ARG ARG B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  HIS 12  12  12  HIS HIS B . n 
B 1 13  MET 13  13  13  MET MET B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  SER 18  18  18  SER SER B . n 
B 1 19  PRO 19  19  19  PRO PRO B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  SER 21  21  21  SER SER B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  TYR 25  25  25  TYR TYR B . n 
B 1 26  CYS 26  26  26  CYS CYS B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  MET 29  29  29  MET MET B . n 
B 1 30  MET 30  30  30  MET MET B . n 
B 1 31  CYS 31  31  31  CYS CYS B . n 
B 1 32  CYS 32  32  32  CYS CYS B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  LYS 34  34  34  LYS LYS B . n 
B 1 35  MET 35  35  35  MET MET B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  GLN 37  37  37  GLN GLN B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  CYS 40  40  40  CYS CYS B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  CYS 58  58  58  CYS CYS B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  CYS 65  65  65  CYS CYS B . n 
B 1 66  LYS 66  66  66  LYS LYS B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ASN 71  71  71  ASN ASN B . n 
B 1 72  CYS 72  72  72  CYS CYS B . n 
B 1 73  TYR 73  73  73  TYR TYR B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  ARG 80  80  80  ARG ARG B . n 
B 1 81  ILE 81  81  81  ILE ILE B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  CYS 84  84  84  CYS CYS B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  THR 87  87  87  THR THR B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  TYR 92  92  92  TYR TYR B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  ASN 94  94  94  ASN ASN B . n 
B 1 95  CYS 95  95  95  CYS CYS B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 VAL 102 102 102 VAL VAL B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 HIS 105 105 105 HIS HIS B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 CYS 110 110 110 CYS CYS B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 GLY 112 112 112 GLY GLY B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 SER 115 115 115 SER SER B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 PRO 117 117 117 PRO PRO B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 HIS 119 119 119 HIS HIS B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 SER 123 123 123 SER SER B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5570  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  12900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
X-PLOR    'model building' .     ? 3 
X-PLOR    refinement       3.851 ? 4 
X-PLOR    phasing          .     ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 14 ? ? -153.46 65.38   
2 1 HIS A 48 ? ? -99.02  31.89   
3 1 GLN A 60 ? ? -106.11 -135.09 
4 1 GLN B 60 ? ? -102.96 -141.84 
5 1 ASN B 71 ? ? -97.72  32.61   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "2'-DEOXYCYTIDINE-2'-DEOXYADENOSINE-3',5'-MONOPHOSPHATE" CPA 
3 water                                                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CPA 1  125 125 CPA CPA A . 
D 2 CPA 1  126 126 CPA CPA B . 
E 3 HOH 1  131 131 HOH HOH A . 
E 3 HOH 2  132 132 HOH HOH A . 
E 3 HOH 3  133 133 HOH HOH A . 
E 3 HOH 4  138 138 HOH HOH A . 
E 3 HOH 5  142 142 HOH HOH A . 
E 3 HOH 6  143 143 HOH HOH A . 
E 3 HOH 7  147 147 HOH HOH A . 
E 3 HOH 8  151 151 HOH HOH A . 
E 3 HOH 9  161 161 HOH HOH A . 
E 3 HOH 10 165 165 HOH HOH A . 
E 3 HOH 11 167 167 HOH HOH A . 
E 3 HOH 12 170 170 HOH HOH A . 
E 3 HOH 13 186 186 HOH HOH A . 
E 3 HOH 14 187 187 HOH HOH A . 
E 3 HOH 15 203 203 HOH HOH A . 
E 3 HOH 16 207 207 HOH HOH A . 
E 3 HOH 17 208 208 HOH HOH A . 
E 3 HOH 18 210 210 HOH HOH A . 
E 3 HOH 19 215 215 HOH HOH A . 
E 3 HOH 20 217 217 HOH HOH A . 
E 3 HOH 21 218 218 HOH HOH A . 
E 3 HOH 22 226 226 HOH HOH A . 
E 3 HOH 23 227 227 HOH HOH A . 
E 3 HOH 24 232 232 HOH HOH A . 
E 3 HOH 25 233 233 HOH HOH A . 
E 3 HOH 26 240 240 HOH HOH A . 
E 3 HOH 27 241 241 HOH HOH A . 
E 3 HOH 28 247 247 HOH HOH A . 
E 3 HOH 29 262 262 HOH HOH A . 
E 3 HOH 30 265 265 HOH HOH A . 
E 3 HOH 31 266 266 HOH HOH A . 
E 3 HOH 32 639 639 HOH HOH A . 
E 3 HOH 33 641 641 HOH HOH A . 
E 3 HOH 34 642 642 HOH HOH A . 
E 3 HOH 35 653 653 HOH HOH A . 
E 3 HOH 36 657 657 HOH HOH A . 
E 3 HOH 37 663 663 HOH HOH A . 
E 3 HOH 38 664 664 HOH HOH A . 
E 3 HOH 39 666 666 HOH HOH A . 
E 3 HOH 40 667 667 HOH HOH A . 
E 3 HOH 41 669 669 HOH HOH A . 
E 3 HOH 42 674 674 HOH HOH A . 
E 3 HOH 43 675 675 HOH HOH A . 
E 3 HOH 44 677 677 HOH HOH A . 
E 3 HOH 45 678 678 HOH HOH A . 
E 3 HOH 46 687 687 HOH HOH A . 
F 3 HOH 1  135 135 HOH HOH B . 
F 3 HOH 2  136 136 HOH HOH B . 
F 3 HOH 3  139 139 HOH HOH B . 
F 3 HOH 4  140 140 HOH HOH B . 
F 3 HOH 5  146 146 HOH HOH B . 
F 3 HOH 6  148 148 HOH HOH B . 
F 3 HOH 7  149 149 HOH HOH B . 
F 3 HOH 8  150 150 HOH HOH B . 
F 3 HOH 9  153 153 HOH HOH B . 
F 3 HOH 10 155 155 HOH HOH B . 
F 3 HOH 11 157 157 HOH HOH B . 
F 3 HOH 12 158 158 HOH HOH B . 
F 3 HOH 13 159 159 HOH HOH B . 
F 3 HOH 14 162 162 HOH HOH B . 
F 3 HOH 15 164 164 HOH HOH B . 
F 3 HOH 16 168 168 HOH HOH B . 
F 3 HOH 17 171 171 HOH HOH B . 
F 3 HOH 18 172 172 HOH HOH B . 
F 3 HOH 19 200 200 HOH HOH B . 
F 3 HOH 20 202 202 HOH HOH B . 
F 3 HOH 21 209 209 HOH HOH B . 
F 3 HOH 22 214 214 HOH HOH B . 
F 3 HOH 23 221 221 HOH HOH B . 
F 3 HOH 24 222 222 HOH HOH B . 
F 3 HOH 25 223 223 HOH HOH B . 
F 3 HOH 26 224 224 HOH HOH B . 
F 3 HOH 27 225 225 HOH HOH B . 
F 3 HOH 28 229 229 HOH HOH B . 
F 3 HOH 29 234 234 HOH HOH B . 
F 3 HOH 30 237 237 HOH HOH B . 
F 3 HOH 31 243 243 HOH HOH B . 
F 3 HOH 32 251 251 HOH HOH B . 
F 3 HOH 33 255 255 HOH HOH B . 
F 3 HOH 34 259 259 HOH HOH B . 
F 3 HOH 35 260 260 HOH HOH B . 
F 3 HOH 36 261 261 HOH HOH B . 
F 3 HOH 37 632 632 HOH HOH B . 
F 3 HOH 38 638 638 HOH HOH B . 
F 3 HOH 39 640 640 HOH HOH B . 
F 3 HOH 40 643 643 HOH HOH B . 
F 3 HOH 41 644 644 HOH HOH B . 
F 3 HOH 42 647 647 HOH HOH B . 
F 3 HOH 43 648 648 HOH HOH B . 
F 3 HOH 44 649 649 HOH HOH B . 
F 3 HOH 45 686 686 HOH HOH B . 
#