data_1R6J
# 
_entry.id   1R6J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1R6J         
RCSB  RCSB020497   
WWPDB D_1000020497 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R6J 
_pdbx_database_status.recvd_initial_deposition_date   2003-10-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kang, B.S.'      1 
'Devedjiev, Y.'   2 
'Derewenda, U.'   3 
'Derewenda, Z.S.' 4 
# 
_citation.id                        primary 
_citation.title                     
'The PDZ2 domain of syntenin at ultra-high resolution: bridging the gap between small molecule and macromolecular crystal chemistry' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            338 
_citation.page_first                483 
_citation.page_last                 493 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15081807 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.02.057 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kang, B.S.'      1 
primary 'Devedjiev, Y.'   2 
primary 'Derewenda, U.'   3 
primary 'Derewenda, Z.S.' 4 
# 
_cell.entry_id           1R6J 
_cell.length_a           25.876 
_cell.length_b           39.544 
_cell.length_c           32.276 
_cell.angle_alpha        90.00 
_cell.angle_beta         109.64 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1R6J 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Syntenin 1'   8709.964 1   ? ? 'PDZ2 domain (residues 197-273)' ? 
2 non-polymer syn 'CHLORIDE ION' 35.453   1   ? ? ?                                ? 
3 water       nat water          18.015   237 ? ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Syndecan binding protein 1, Melanoma differentiation associated protein-9, Mda-9, Scaffold protein Pbp1, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, TACIP18
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMDPRTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP
AF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMDPRTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP
AF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  MET n 
1 4  ASP n 
1 5  PRO n 
1 6  ARG n 
1 7  THR n 
1 8  ILE n 
1 9  THR n 
1 10 MET n 
1 11 HIS n 
1 12 LYS n 
1 13 ASP n 
1 14 SER n 
1 15 THR n 
1 16 GLY n 
1 17 HIS n 
1 18 VAL n 
1 19 GLY n 
1 20 PHE n 
1 21 ILE n 
1 22 PHE n 
1 23 LYS n 
1 24 ASN n 
1 25 GLY n 
1 26 LYS n 
1 27 ILE n 
1 28 THR n 
1 29 SER n 
1 30 ILE n 
1 31 VAL n 
1 32 LYS n 
1 33 ASP n 
1 34 SER n 
1 35 SER n 
1 36 ALA n 
1 37 ALA n 
1 38 ARG n 
1 39 ASN n 
1 40 GLY n 
1 41 LEU n 
1 42 LEU n 
1 43 THR n 
1 44 GLU n 
1 45 HIS n 
1 46 ASN n 
1 47 ILE n 
1 48 CYS n 
1 49 GLU n 
1 50 ILE n 
1 51 ASN n 
1 52 GLY n 
1 53 GLN n 
1 54 ASN n 
1 55 VAL n 
1 56 ILE n 
1 57 GLY n 
1 58 LEU n 
1 59 LYS n 
1 60 ASP n 
1 61 SER n 
1 62 GLN n 
1 63 ILE n 
1 64 ALA n 
1 65 ASP n 
1 66 ILE n 
1 67 LEU n 
1 68 SER n 
1 69 THR n 
1 70 SER n 
1 71 GLY n 
1 72 THR n 
1 73 VAL n 
1 74 VAL n 
1 75 THR n 
1 76 ILE n 
1 77 THR n 
1 78 ILE n 
1 79 MET n 
1 80 PRO n 
1 81 ALA n 
1 82 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'SDCBP OR MDA9 OR SYCL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGST-parallel1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SDCB1_HUMAN 
_struct_ref.pdbx_db_accession          O00560 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF 
_struct_ref.pdbx_align_begin           197 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1R6J 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 82 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O00560 
_struct_ref_seq.db_align_beg                  197 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  273 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       197 
_struct_ref_seq.pdbx_auth_seq_align_end       273 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1R6J GLY A 1 ? UNP O00560 ? ? 'CLONING ARTIFACT' 192 1 
1 1R6J ALA A 2 ? UNP O00560 ? ? 'CLONING ARTIFACT' 193 2 
1 1R6J MET A 3 ? UNP O00560 ? ? 'CLONING ARTIFACT' 194 3 
1 1R6J ASP A 4 ? UNP O00560 ? ? 'CLONING ARTIFACT' 195 4 
1 1R6J PRO A 5 ? UNP O00560 ? ? 'CLONING ARTIFACT' 196 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1R6J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   31.11 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      1.79 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG 4000, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-04-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.85 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X8C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X8C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.85 
# 
_reflns.entry_id                     1R6J 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            0.73 
_reflns.number_obs                   71347 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         83.9 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        3.8 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             0.73 
_reflns_shell.d_res_low              0.76 
_reflns_shell.percent_possible_all   9.6 
_reflns_shell.Rmerge_I_obs           0.387 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1R6J 
_refine.ls_number_reflns_obs                     71289 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            0.73 
_refine.ls_percent_reflns_obs                    84.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.0747 
_refine.ls_R_factor_R_free                       0.0866 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1389 
_refine.ls_number_parameters                     9304 
_refine.ls_number_restraints                     610 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  
'Rwork and Rfree are the values before the final refinement including Free reflections' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'AB INITIO' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1R6J 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      22 
_refine_analyze.occupancy_sum_hydrogen          604.03 
_refine_analyze.occupancy_sum_non_hydrogen      757.02 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        726 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             237 
_refine_hist.number_atoms_total               964 
_refine_hist.d_res_high                       0.73 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.019  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.033  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0355 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.081  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.105  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1R6J 
_pdbx_refine.R_factor_all_no_cutoff                      0.0745 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.0662 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               59545 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1R6J 
_struct.title                     'Ultrahigh resolution Crystal Structure of syntenin PDZ2' 
_struct.pdbx_descriptor           'Syntenin 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R6J 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'PDZ, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 34 ? GLY A 40 ? SER A 225 GLY A 231 1 ? 7  
HELX_P HELX_P2 2 LYS A 59 ? SER A 70 ? LYS A 250 SER A 261 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 6  ? HIS A 11 ? ARG A 197 HIS A 202 
A 2 VAL A 73 ? PRO A 80 ? VAL A 264 PRO A 271 
A 3 HIS A 45 ? ILE A 50 ? HIS A 236 ILE A 241 
A 4 GLN A 53 ? ASN A 54 ? GLN A 244 ASN A 245 
B 1 PHE A 20 ? LYS A 23 ? PHE A 211 LYS A 214 
B 2 LYS A 26 ? ILE A 30 ? LYS A 217 ILE A 221 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 10 ? N MET A 201 O VAL A 74 ? O VAL A 265 
A 2 3 O MET A 79 ? O MET A 270 N ASN A 46 ? N ASN A 237 
A 3 4 N ILE A 50 ? N ILE A 241 O GLN A 53 ? O GLN A 244 
B 1 2 N ILE A 21 ? N ILE A 212 O THR A 28 ? O THR A 219 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE CL A 274' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 GLY A 1 ? GLY A 192 . ? 1_555 ? 
2 AC1 2 ALA A 2 ? ALA A 193 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1R6J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1R6J 
_atom_sites.fract_transf_matrix[1][1]   0.038646 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.013792 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025288 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.032897 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   A GLY A 1 1  ? -5.757  17.929  11.426  0.82 8.19  ? 192 GLY A N   1 
ATOM   2   N  N   B GLY A 1 1  ? -11.574 16.821  9.078   0.18 10.20 ? 192 GLY A N   1 
ATOM   3   C  CA  A GLY A 1 1  ? -7.006  17.405  10.947  0.82 10.14 ? 192 GLY A CA  1 
ATOM   4   C  CA  B GLY A 1 1  ? -10.486 17.655  9.563   0.18 11.74 ? 192 GLY A CA  1 
ATOM   5   C  C   A GLY A 1 1  ? -6.782  16.071  10.271  0.82 7.59  ? 192 GLY A C   1 
ATOM   6   C  C   B GLY A 1 1  ? -9.286  17.656  8.635   0.18 12.28 ? 192 GLY A C   1 
ATOM   7   O  O   A GLY A 1 1  ? -5.910  15.294  10.699  0.82 7.87  ? 192 GLY A O   1 
ATOM   8   O  O   B GLY A 1 1  ? -9.553  17.755  7.401   0.18 13.47 ? 192 GLY A O   1 
ATOM   9   N  N   A ALA A 1 2  ? -7.535  15.839  9.206   0.82 6.42  ? 193 ALA A N   1 
ATOM   10  N  N   B ALA A 1 2  ? -8.074  17.634  9.142   0.18 13.86 ? 193 ALA A N   1 
ATOM   11  C  CA  A ALA A 1 2  ? -7.488  14.575  8.481   0.82 5.76  ? 193 ALA A CA  1 
ATOM   12  C  CA  B ALA A 1 2  ? -6.837  17.643  8.358   0.18 8.69  ? 193 ALA A CA  1 
ATOM   13  C  C   A ALA A 1 2  ? -6.094  14.260  7.966   0.82 4.62  ? 193 ALA A C   1 
ATOM   14  C  C   B ALA A 1 2  ? -6.660  16.243  7.787   0.18 7.25  ? 193 ALA A C   1 
ATOM   15  O  O   A ALA A 1 2  ? -5.774  13.091  7.783   0.82 5.52  ? 193 ALA A O   1 
ATOM   16  O  O   B ALA A 1 2  ? -7.265  15.239  8.192   0.18 8.74  ? 193 ALA A O   1 
ATOM   17  C  CB  A ALA A 1 2  ? -8.454  14.611  7.318   0.82 7.36  ? 193 ALA A CB  1 
ATOM   18  C  CB  B ALA A 1 2  ? -5.717  18.050  9.294   0.18 13.30 ? 193 ALA A CB  1 
ATOM   19  N  N   A MET A 1 3  ? -5.267  15.277  7.723   0.82 3.97  ? 194 MET A N   1 
ATOM   20  N  N   B MET A 1 3  ? -5.739  16.193  6.831   0.18 5.12  ? 194 MET A N   1 
ATOM   21  C  CA  A MET A 1 3  ? -3.954  15.065  7.145   0.82 4.06  ? 194 MET A CA  1 
ATOM   22  C  CA  B MET A 1 3  ? -5.129  14.946  6.369   0.18 7.22  ? 194 MET A CA  1 
ATOM   23  C  C   A MET A 1 3  ? -2.841  14.975  8.198   0.82 4.69  ? 194 MET A C   1 
ATOM   24  C  C   B MET A 1 3  ? -4.143  14.524  7.444   0.18 8.12  ? 194 MET A C   1 
ATOM   25  O  O   A MET A 1 3  ? -1.659  14.928  7.816   0.82 6.27  ? 194 MET A O   1 
ATOM   26  O  O   B MET A 1 3  ? -3.120  15.144  7.682   0.18 9.71  ? 194 MET A O   1 
ATOM   27  C  CB  A MET A 1 3  ? -3.639  16.105  6.067   0.82 4.09  ? 194 MET A CB  1 
ATOM   28  C  CB  B MET A 1 3  ? -4.453  15.167  5.029   0.18 5.33  ? 194 MET A CB  1 
ATOM   29  C  CG  A MET A 1 3  ? -4.671  16.131  4.954   0.82 4.43  ? 194 MET A CG  1 
ATOM   30  C  CG  B MET A 1 3  ? -5.295  15.445  3.817   0.18 8.89  ? 194 MET A CG  1 
ATOM   31  S  SD  A MET A 1 3  ? -4.741  14.541  4.102   0.82 5.05  ? 194 MET A SD  1 
ATOM   32  S  SD  B MET A 1 3  ? -6.566  14.256  3.468   0.18 7.95  ? 194 MET A SD  1 
ATOM   33  C  CE  A MET A 1 3  ? -6.433  14.365  3.695   0.82 8.16  ? 194 MET A CE  1 
ATOM   34  C  CE  B MET A 1 3  ? -7.923  14.781  4.479   0.18 8.03  ? 194 MET A CE  1 
ATOM   35  N  N   A ASP A 1 4  ? -3.175  14.865  9.464   0.82 4.03  ? 195 ASP A N   1 
ATOM   36  N  N   B ASP A 1 4  ? -4.530  13.494  8.203   0.18 6.18  ? 195 ASP A N   1 
ATOM   37  C  CA  A ASP A 1 4  ? -2.145  14.513  10.426  0.82 4.32  ? 195 ASP A CA  1 
ATOM   38  C  CA  B ASP A 1 4  ? -3.700  13.172  9.387   0.18 8.23  ? 195 ASP A CA  1 
ATOM   39  C  C   A ASP A 1 4  ? -1.602  13.132  10.062  0.82 4.11  ? 195 ASP A C   1 
ATOM   40  C  C   B ASP A 1 4  ? -2.677  12.091  9.064   0.18 5.05  ? 195 ASP A C   1 
ATOM   41  O  O   A ASP A 1 4  ? -2.384  12.223  9.707   0.82 4.49  ? 195 ASP A O   1 
ATOM   42  O  O   B ASP A 1 4  ? -3.017  11.017  8.552   0.18 7.27  ? 195 ASP A O   1 
ATOM   43  C  CB  A ASP A 1 4  ? -2.668  14.521  11.870  0.82 4.74  ? 195 ASP A CB  1 
ATOM   44  C  CG  A ASP A 1 4  ? -2.873  15.863  12.546  0.41 4.49  ? 195 ASP A CG  1 
ATOM   45  C  CG  C ASP A 1 4  ? -2.549  15.899  12.632  0.41 6.32  ? 195 ASP A CG  1 
ATOM   46  O  OD1 A ASP A 1 4  ? -3.172  16.874  11.866  0.41 5.95  ? 195 ASP A OD1 1 
ATOM   47  O  OD1 C ASP A 1 4  ? -2.206  16.861  11.953  0.41 6.00  ? 195 ASP A OD1 1 
ATOM   48  O  OD2 A ASP A 1 4  ? -2.747  15.875  13.788  0.41 7.70  ? 195 ASP A OD2 1 
ATOM   49  O  OD2 C ASP A 1 4  ? -2.847  15.876  13.835  0.41 7.04  ? 195 ASP A OD2 1 
ATOM   50  N  N   A PRO A 1 5  ? -0.304  12.909  10.205  0.82 4.00  ? 196 PRO A N   1 
ATOM   51  N  N   B PRO A 1 5  ? -1.422  12.324  9.446   0.18 8.89  ? 196 PRO A N   1 
ATOM   52  C  CA  A PRO A 1 5  ? 0.234   11.579  9.921   0.82 3.93  ? 196 PRO A CA  1 
ATOM   53  C  CA  B PRO A 1 5  ? -0.482  11.195  9.346   0.18 6.96  ? 196 PRO A CA  1 
ATOM   54  C  C   A PRO A 1 5  ? -0.212  10.593  10.991  0.82 3.42  ? 196 PRO A C   1 
ATOM   55  C  C   B PRO A 1 5  ? -0.779  10.216  10.474  0.18 5.67  ? 196 PRO A C   1 
ATOM   56  O  O   A PRO A 1 5  ? -0.685  10.983  12.076  0.82 3.90  ? 196 PRO A O   1 
ATOM   57  O  O   B PRO A 1 5  ? -1.350  10.629  11.482  0.18 7.91  ? 196 PRO A O   1 
ATOM   58  C  CB  A PRO A 1 5  ? 1.765   11.813  9.949   0.82 4.43  ? 196 PRO A CB  1 
ATOM   59  C  CB  B PRO A 1 5  ? 0.863   11.826  9.686   0.18 6.62  ? 196 PRO A CB  1 
ATOM   60  C  CG  A PRO A 1 5  ? 1.907   12.950  10.964  0.82 4.79  ? 196 PRO A CG  1 
ATOM   61  C  CG  B PRO A 1 5  ? 0.497   12.961  10.599  0.18 9.15  ? 196 PRO A CG  1 
ATOM   62  C  CD  A PRO A 1 5  ? 0.718   13.854  10.683  0.82 4.93  ? 196 PRO A CD  1 
ATOM   63  C  CD  B PRO A 1 5  ? -0.797  13.506  10.044  0.18 10.44 ? 196 PRO A CD  1 
ATOM   64  N  N   A ARG A 1 6  ? -0.039  9.321   10.686  0.82 3.53  ? 197 ARG A N   1 
ATOM   65  N  N   B ARG A 1 6  ? -0.379  8.978   10.353  0.18 6.43  ? 197 ARG A N   1 
ATOM   66  C  CA  A ARG A 1 6  ? -0.228  8.269   11.687  0.82 3.31  ? 197 ARG A CA  1 
ATOM   67  C  CA  B ARG A 1 6  ? -0.566  7.942   11.371  0.18 4.75  ? 197 ARG A CA  1 
ATOM   68  C  C   A ARG A 1 6  ? 1.025   7.411   11.698  0.82 3.41  ? 197 ARG A C   1 
ATOM   69  C  C   B ARG A 1 6  ? 0.748   7.161   11.407  0.18 5.59  ? 197 ARG A C   1 
ATOM   70  O  O   A ARG A 1 6  ? 1.600   7.091   10.649  0.82 4.07  ? 197 ARG A O   1 
ATOM   71  O  O   B ARG A 1 6  ? 1.275   6.894   10.336  0.18 5.04  ? 197 ARG A O   1 
ATOM   72  C  CB  A ARG A 1 6  ? -1.433  7.379   11.368  0.82 3.85  ? 197 ARG A CB  1 
ATOM   73  C  CB  B ARG A 1 6  ? -1.755  7.063   11.023  0.18 7.94  ? 197 ARG A CB  1 
ATOM   74  C  CG  A ARG A 1 6  ? -2.758  8.119   11.480  0.82 4.03  ? 197 ARG A CG  1 
ATOM   75  C  CG  B ARG A 1 6  ? -2.997  7.847   10.629  0.18 9.28  ? 197 ARG A CG  1 
ATOM   76  C  CD  A ARG A 1 6  ? -3.926  7.274   11.035  0.82 4.50  ? 197 ARG A CD  1 
ATOM   77  C  CD  B ARG A 1 6  ? -4.182  6.959   10.425  0.18 10.32 ? 197 ARG A CD  1 
ATOM   78  N  NE  A ARG A 1 6  ? -5.224  7.913   11.172  0.82 5.09  ? 197 ARG A NE  1 
ATOM   79  N  NE  B ARG A 1 6  ? -5.446  7.686   10.408  0.18 14.26 ? 197 ARG A NE  1 
ATOM   80  C  CZ  A ARG A 1 6  ? -5.942  7.966   12.296  0.82 5.29  ? 197 ARG A CZ  1 
ATOM   81  C  CZ  B ARG A 1 6  ? -6.163  7.877   11.493  0.18 11.82 ? 197 ARG A CZ  1 
ATOM   82  N  NH1 A ARG A 1 6  ? -5.471  7.480   13.428  0.82 6.17  ? 197 ARG A NH1 1 
ATOM   83  N  NH1 B ARG A 1 6  ? -5.786  7.438   12.696  0.18 10.95 ? 197 ARG A NH1 1 
ATOM   84  N  NH2 A ARG A 1 6  ? -7.148  8.545   12.323  0.82 6.45  ? 197 ARG A NH2 1 
ATOM   85  N  NH2 B ARG A 1 6  ? -7.303  8.542   11.405  0.18 9.69  ? 197 ARG A NH2 1 
ATOM   86  N  N   A THR A 1 7  ? 1.420   7.003   12.913  0.82 3.50  ? 198 THR A N   1 
ATOM   87  N  N   B THR A 1 7  ? 1.240   6.848   12.602  0.18 3.15  ? 198 THR A N   1 
ATOM   88  C  CA  A THR A 1 7  ? 2.506   6.065   13.094  0.82 3.44  ? 198 THR A CA  1 
ATOM   89  C  CA  B THR A 1 7  ? 2.434   6.058   12.794  0.18 4.54  ? 198 THR A CA  1 
ATOM   90  C  C   A THR A 1 7  ? 1.907   4.736   13.552  0.82 3.64  ? 198 THR A C   1 
ATOM   91  C  C   B THR A 1 7  ? 2.030   4.771   13.489  0.18 3.63  ? 198 THR A C   1 
ATOM   92  O  O   A THR A 1 7  ? 1.234   4.674   14.575  0.82 3.71  ? 198 THR A O   1 
ATOM   93  O  O   B THR A 1 7  ? 1.593   4.743   14.619  0.18 12.27 ? 198 THR A O   1 
ATOM   94  C  CB  A THR A 1 7  ? 3.499   6.610   14.127  0.82 3.83  ? 198 THR A CB  1 
ATOM   95  C  CB  B THR A 1 7  ? 3.512   6.781   13.625  0.18 6.32  ? 198 THR A CB  1 
ATOM   96  O  OG1 A THR A 1 7  ? 4.212   7.704   13.487  0.82 4.37  ? 198 THR A OG1 1 
ATOM   97  O  OG1 B THR A 1 7  ? 3.962   7.914   12.873  0.18 12.16 ? 198 THR A OG1 1 
ATOM   98  C  CG2 A THR A 1 7  ? 4.444   5.561   14.670  0.82 5.63  ? 198 THR A CG2 1 
ATOM   99  C  CG2 B THR A 1 7  ? 4.672   5.830   13.902  0.18 5.98  ? 198 THR A CG2 1 
ATOM   100 N  N   . ILE A 1 8  ? 2.188   3.688   12.770  1.00 3.49  ? 199 ILE A N   1 
ATOM   101 C  CA  . ILE A 1 8  ? 1.647   2.367   13.002  1.00 3.57  ? 199 ILE A CA  1 
ATOM   102 C  C   . ILE A 1 8  ? 2.810   1.421   13.312  1.00 3.77  ? 199 ILE A C   1 
ATOM   103 O  O   . ILE A 1 8  ? 3.633   1.160   12.430  1.00 4.18  ? 199 ILE A O   1 
ATOM   104 C  CB  . ILE A 1 8  ? 0.844   1.879   11.779  1.00 4.11  ? 199 ILE A CB  1 
ATOM   105 C  CG1 . ILE A 1 8  ? -0.172  2.896   11.274  1.00 4.61  ? 199 ILE A CG1 1 
ATOM   106 C  CG2 . ILE A 1 8  ? 0.183   0.531   12.116  1.00 4.88  ? 199 ILE A CG2 1 
ATOM   107 C  CD1 . ILE A 1 8  ? -1.212  3.360   12.288  1.00 4.88  ? 199 ILE A CD1 1 
ATOM   108 N  N   . THR A 1 9  ? 2.853   0.933   14.547  1.00 4.01  ? 200 THR A N   1 
ATOM   109 C  CA  . THR A 1 9  ? 3.869   -0.006  14.971  1.00 4.07  ? 200 THR A CA  1 
ATOM   110 C  C   . THR A 1 9  ? 3.257   -1.402  15.018  1.00 3.84  ? 200 THR A C   1 
ATOM   111 O  O   . THR A 1 9  ? 2.248   -1.635  15.694  1.00 5.02  ? 200 THR A O   1 
ATOM   112 C  CB  . THR A 1 9  ? 4.492   0.396   16.320  1.00 4.54  ? 200 THR A CB  1 
ATOM   113 O  OG1 . THR A 1 9  ? 5.222   1.588   16.121  1.00 5.88  ? 200 THR A OG1 1 
ATOM   114 C  CG2 . THR A 1 9  ? 5.366   -0.707  16.892  1.00 5.75  ? 200 THR A CG2 1 
ATOM   115 N  N   . MET A 1 10 ? 3.887   -2.294  14.270  1.00 3.83  ? 201 MET A N   1 
ATOM   116 C  CA  . MET A 1 10 ? 3.445   -3.653  14.067  1.00 3.82  ? 201 MET A CA  1 
ATOM   117 C  C   . MET A 1 10 ? 4.569   -4.615  14.482  1.00 3.86  ? 201 MET A C   1 
ATOM   118 O  O   . MET A 1 10 ? 5.733   -4.224  14.583  1.00 4.79  ? 201 MET A O   1 
ATOM   119 C  CB  . MET A 1 10 ? 3.121   -3.872  12.584  1.00 3.91  ? 201 MET A CB  1 
ATOM   120 C  CG  . MET A 1 10 ? 1.938   -3.010  12.142  1.00 4.37  ? 201 MET A CG  1 
ATOM   121 S  SD  . MET A 1 10 ? 1.809   -2.831  10.350  1.00 4.24  ? 201 MET A SD  1 
ATOM   122 C  CE  . MET A 1 10 ? 3.159   -1.673  10.068  1.00 5.52  ? 201 MET A CE  1 
ATOM   123 N  N   A HIS A 1 11 ? 4.174   -5.868  14.682  0.84 4.12  ? 202 HIS A N   1 
ATOM   124 N  N   B HIS A 1 11 ? 4.201   -5.839  14.820  0.16 3.12  ? 202 HIS A N   1 
ATOM   125 C  CA  A HIS A 1 11 ? 5.078   -6.949  15.024  0.84 4.47  ? 202 HIS A CA  1 
ATOM   126 C  CA  B HIS A 1 11 ? 5.248   -6.853  14.977  0.16 3.69  ? 202 HIS A CA  1 
ATOM   127 C  C   A HIS A 1 11 ? 4.843   -8.103  14.063  0.84 4.06  ? 202 HIS A C   1 
ATOM   128 C  C   B HIS A 1 11 ? 4.897   -7.985  14.010  0.16 4.56  ? 202 HIS A C   1 
ATOM   129 O  O   A HIS A 1 11 ? 3.743   -8.611  13.926  0.84 4.96  ? 202 HIS A O   1 
ATOM   130 O  O   B HIS A 1 11 ? 3.735   -8.334  13.806  0.16 5.39  ? 202 HIS A O   1 
ATOM   131 C  CB  A HIS A 1 11 ? 4.849   -7.424  16.470  0.84 5.70  ? 202 HIS A CB  1 
ATOM   132 C  CB  B HIS A 1 11 ? 5.429   -7.280  16.414  0.16 4.62  ? 202 HIS A CB  1 
ATOM   133 C  CG  A HIS A 1 11 ? 5.381   -6.486  17.492  0.42 6.04  ? 202 HIS A CG  1 
ATOM   134 C  CG  B HIS A 1 11 ? 4.280   -7.687  17.274  0.16 4.67  ? 202 HIS A CG  1 
ATOM   135 C  CG  C HIS A 1 11 ? 5.235   -6.399  17.516  0.42 7.06  ? 202 HIS A CG  1 
ATOM   136 N  ND1 A HIS A 1 11 ? 6.445   -6.671  18.346  0.42 8.65  ? 202 HIS A ND1 1 
ATOM   137 N  ND1 B HIS A 1 11 ? 4.091   -9.006  17.695  0.16 5.67  ? 202 HIS A ND1 1 
ATOM   138 N  ND1 C HIS A 1 11 ? 4.574   -5.258  17.786  0.42 7.32  ? 202 HIS A ND1 1 
ATOM   139 C  CD2 A HIS A 1 11 ? 4.904   -5.269  17.757  0.42 8.36  ? 202 HIS A CD2 1 
ATOM   140 C  CD2 B HIS A 1 11 ? 3.230   -6.995  17.780  0.16 4.60  ? 202 HIS A CD2 1 
ATOM   141 C  CD2 C HIS A 1 11 ? 6.435   -6.257  18.167  0.42 12.48 ? 202 HIS A CD2 1 
ATOM   142 C  CE1 A HIS A 1 11 ? 6.582   -5.589  19.108  0.42 8.24  ? 202 HIS A CE1 1 
ATOM   143 C  CE1 B HIS A 1 11 ? 2.985   -9.061  18.443  0.16 6.93  ? 202 HIS A CE1 1 
ATOM   144 C  CE1 C HIS A 1 11 ? 5.304   -4.398  18.484  0.42 9.31  ? 202 HIS A CE1 1 
ATOM   145 N  NE2 A HIS A 1 11 ? 5.630   -4.701  18.745  0.42 9.03  ? 202 HIS A NE2 1 
ATOM   146 N  NE2 B HIS A 1 11 ? 2.448   -7.851  18.521  0.16 5.26  ? 202 HIS A NE2 1 
ATOM   147 N  NE2 C HIS A 1 11 ? 6.265   -5.180  19.035  0.42 9.87  ? 202 HIS A NE2 1 
ATOM   148 N  N   . LYS A 1 12 ? 5.917   -8.521  13.374  1.00 4.03  ? 203 LYS A N   1 
ATOM   149 C  CA  . LYS A 1 12 ? 5.816   -9.649  12.471  1.00 3.94  ? 203 LYS A CA  1 
ATOM   150 C  C   . LYS A 1 12 ? 5.322   -10.881 13.228  1.00 4.29  ? 203 LYS A C   1 
ATOM   151 O  O   . LYS A 1 12 ? 5.723   -11.151 14.351  1.00 4.99  ? 203 LYS A O   1 
ATOM   152 C  CB  . LYS A 1 12 ? 7.177   -9.950  11.842  1.00 3.96  ? 203 LYS A CB  1 
ATOM   153 C  CG  . LYS A 1 12 ? 7.626   -8.879  10.843  1.00 4.05  ? 203 LYS A CG  1 
ATOM   154 C  CD  . LYS A 1 12 ? 9.003   -9.118  10.250  1.00 3.73  ? 203 LYS A CD  1 
ATOM   155 C  CE  . LYS A 1 12 ? 9.305   -8.115  9.163   1.00 4.21  ? 203 LYS A CE  1 
ATOM   156 N  NZ  . LYS A 1 12 ? 10.542  -8.430  8.424   1.00 4.02  ? 203 LYS A NZ  1 
ATOM   157 N  N   A ASP A 1 13 ? 4.459   -11.607 12.529  0.81 3.96  ? 204 ASP A N   1 
ATOM   158 N  N   B ASP A 1 13 ? 4.734   -11.800 12.440  0.19 7.08  ? 204 ASP A N   1 
ATOM   159 C  CA  A ASP A 1 13 ? 3.931   -12.867 13.055  0.81 4.20  ? 204 ASP A CA  1 
ATOM   160 C  CA  B ASP A 1 13 ? 4.285   -13.164 12.711  0.19 6.71  ? 204 ASP A CA  1 
ATOM   161 C  C   A ASP A 1 13 ? 4.976   -13.977 12.908  0.81 4.05  ? 204 ASP A C   1 
ATOM   162 C  C   B ASP A 1 13 ? 5.386   -14.196 12.459  0.19 6.22  ? 204 ASP A C   1 
ATOM   163 O  O   A ASP A 1 13 ? 6.126   -13.762 12.506  0.81 4.40  ? 204 ASP A O   1 
ATOM   164 O  O   B ASP A 1 13 ? 6.532   -13.838 12.141  0.19 8.70  ? 204 ASP A O   1 
ATOM   165 C  CB  A ASP A 1 13 ? 2.605   -13.184 12.397  0.81 4.75  ? 204 ASP A CB  1 
ATOM   166 C  CB  B ASP A 1 13 ? 3.033   -13.517 11.907  0.19 10.09 ? 204 ASP A CB  1 
ATOM   167 C  CG  A ASP A 1 13 ? 2.655   -13.584 10.939  0.81 4.76  ? 204 ASP A CG  1 
ATOM   168 C  CG  B ASP A 1 13 ? 3.251   -13.919 10.460  0.19 8.20  ? 204 ASP A CG  1 
ATOM   169 O  OD1 A ASP A 1 13 ? 3.789   -13.828 10.429  0.81 4.50  ? 204 ASP A OD1 1 
ATOM   170 O  OD1 B ASP A 1 13 ? 4.389   -13.874 9.967   0.19 11.44 ? 204 ASP A OD1 1 
ATOM   171 O  OD2 A ASP A 1 13 ? 1.601   -13.663 10.266  0.81 6.76  ? 204 ASP A OD2 1 
ATOM   172 O  OD2 B ASP A 1 13 ? 2.267   -14.300 9.775   0.19 12.73 ? 204 ASP A OD2 1 
ATOM   173 N  N   A SER A 1 14 ? 4.564   -15.208 13.252  0.81 4.83  ? 205 SER A N   1 
ATOM   174 N  N   B SER A 1 14 ? 5.155   -15.513 12.623  0.19 8.42  ? 205 SER A N   1 
ATOM   175 C  CA  A SER A 1 14 ? 5.480   -16.336 13.267  0.81 5.09  ? 205 SER A CA  1 
ATOM   176 C  CA  B SER A 1 14 ? 6.177   -16.558 12.637  0.19 9.20  ? 205 SER A CA  1 
ATOM   177 C  C   A SER A 1 14 ? 5.953   -16.753 11.893  0.81 5.33  ? 205 SER A C   1 
ATOM   178 C  C   B SER A 1 14 ? 6.883   -16.741 11.283  0.19 10.41 ? 205 SER A C   1 
ATOM   179 O  O   A SER A 1 14 ? 6.862   -17.576 11.780  0.81 7.50  ? 205 SER A O   1 
ATOM   180 O  O   B SER A 1 14 ? 7.931   -17.395 11.206  0.19 11.91 ? 205 SER A O   1 
ATOM   181 C  CB  A SER A 1 14 ? 4.796   -17.518 13.938  0.81 5.64  ? 205 SER A CB  1 
ATOM   182 C  CB  B SER A 1 14 ? 5.577   -17.911 13.048  0.19 14.50 ? 205 SER A CB  1 
ATOM   183 O  OG  A SER A 1 14 ? 4.397   -17.156 15.215  0.43 6.88  ? 205 SER A OG  1 
ATOM   184 O  OG  B SER A 1 14 ? 4.683   -18.400 12.044  0.10 8.01  ? 205 SER A OG  1 
ATOM   185 O  OG  C SER A 1 14 ? 3.634   -17.881 13.225  0.18 8.13  ? 205 SER A OG  1 
ATOM   186 O  OG  D SER A 1 14 ? 5.437   -18.777 14.025  0.20 5.30  ? 205 SER A OG  1 
ATOM   187 N  N   A THR A 1 15 ? 5.343   -16.231 10.866  0.81 5.17  ? 206 THR A N   1 
ATOM   188 N  N   B THR A 1 15 ? 6.278   -16.182 10.233  0.19 13.15 ? 206 THR A N   1 
ATOM   189 C  CA  A THR A 1 15 ? 5.754   -16.483 9.485   0.81 5.97  ? 206 THR A CA  1 
ATOM   190 C  CA  B THR A 1 15 ? 6.885   -16.322 8.890   0.19 9.51  ? 206 THR A CA  1 
ATOM   191 C  C   A THR A 1 15 ? 6.605   -15.337 8.900   0.81 5.73  ? 206 THR A C   1 
ATOM   192 C  C   B THR A 1 15 ? 7.317   -14.929 8.418   0.19 8.47  ? 206 THR A C   1 
ATOM   193 O  O   A THR A 1 15 ? 7.055   -15.448 7.753   0.81 7.65  ? 206 THR A O   1 
ATOM   194 O  O   B THR A 1 15 ? 7.602   -14.779 7.234   0.19 13.00 ? 206 THR A O   1 
ATOM   195 C  CB  A THR A 1 15 ? 4.528   -16.696 8.563   0.81 6.43  ? 206 THR A CB  1 
ATOM   196 C  CB  B THR A 1 15 ? 6.019   -17.038 7.863   0.19 10.49 ? 206 THR A CB  1 
ATOM   197 O  OG1 A THR A 1 15 ? 3.852   -15.475 8.329   0.81 5.78  ? 206 THR A OG1 1 
ATOM   198 O  OG1 B THR A 1 15 ? 4.704   -16.484 7.854   0.19 7.74  ? 206 THR A OG1 1 
ATOM   199 C  CG2 A THR A 1 15 ? 3.498   -17.644 9.211   0.81 9.83  ? 206 THR A CG2 1 
ATOM   200 C  CG2 B THR A 1 15 ? 5.862   -18.517 8.242   0.19 11.59 ? 206 THR A CG2 1 
ATOM   201 N  N   A GLY A 1 16 ? 6.809   -14.255 9.664   0.81 4.76  ? 207 GLY A N   1 
ATOM   202 N  N   B GLY A 1 16 ? 7.362   -13.972 9.333   0.19 6.92  ? 207 GLY A N   1 
ATOM   203 C  CA  A GLY A 1 16 ? 7.599   -13.157 9.194   0.81 4.97  ? 207 GLY A CA  1 
ATOM   204 C  CA  B GLY A 1 16 ? 7.890   -12.667 9.096   0.19 6.99  ? 207 GLY A CA  1 
ATOM   205 C  C   A GLY A 1 16 ? 6.815   -11.970 8.637   0.81 4.13  ? 207 GLY A C   1 
ATOM   206 C  C   B GLY A 1 16 ? 6.877   -11.666 8.588   0.19 6.74  ? 207 GLY A C   1 
ATOM   207 O  O   A GLY A 1 16 ? 7.449   -11.139 7.992   0.81 4.68  ? 207 GLY A O   1 
ATOM   208 O  O   B GLY A 1 16 ? 7.332   -10.724 7.939   0.19 5.02  ? 207 GLY A O   1 
ATOM   209 N  N   . HIS A 1 17 ? 5.513   -11.875 8.866   1.00 4.22  ? 208 HIS A N   1 
ATOM   210 C  CA  . HIS A 1 17 ? 4.673   -10.913 8.172   1.00 3.93  ? 208 HIS A CA  1 
ATOM   211 C  C   . HIS A 1 17 ? 3.866   -10.046 9.131   1.00 3.83  ? 208 HIS A C   1 
ATOM   212 O  O   . HIS A 1 17 ? 3.356   -10.527 10.141  1.00 4.58  ? 208 HIS A O   1 
ATOM   213 C  CB  . HIS A 1 17 ? 3.702   -11.659 7.229   1.00 4.35  ? 208 HIS A CB  1 
ATOM   214 C  CG  . HIS A 1 17 ? 4.435   -12.470 6.232   1.00 4.38  ? 208 HIS A CG  1 
ATOM   215 N  ND1 . HIS A 1 17 ? 4.751   -13.787 6.430   1.00 5.41  ? 208 HIS A ND1 1 
ATOM   216 C  CD2 . HIS A 1 17 ? 4.968   -12.141 5.039   1.00 4.94  ? 208 HIS A CD2 1 
ATOM   217 C  CE1 . HIS A 1 17 ? 5.465   -14.229 5.373   1.00 5.87  ? 208 HIS A CE1 1 
ATOM   218 N  NE2 . HIS A 1 17 ? 5.605   -13.227 4.512   1.00 5.31  ? 208 HIS A NE2 1 
ATOM   219 N  N   . VAL A 1 18 ? 3.731   -8.778  8.761   1.00 3.73  ? 209 VAL A N   1 
ATOM   220 C  CA  . VAL A 1 18 ? 2.878   -7.876  9.510   1.00 3.86  ? 209 VAL A CA  1 
ATOM   221 C  C   . VAL A 1 18 ? 1.438   -7.794  8.960   1.00 3.63  ? 209 VAL A C   1 
ATOM   222 O  O   . VAL A 1 18 ? 0.551   -7.421  9.734   1.00 4.40  ? 209 VAL A O   1 
ATOM   223 C  CB  . VAL A 1 18 ? 3.478   -6.456  9.670   1.00 4.27  ? 209 VAL A CB  1 
ATOM   224 C  CG1 . VAL A 1 18 ? 4.706   -6.516  10.555  1.00 4.95  ? 209 VAL A CG1 1 
ATOM   225 C  CG2 . VAL A 1 18 ? 3.803   -5.797  8.339   1.00 5.31  ? 209 VAL A CG2 1 
ATOM   226 N  N   . GLY A 1 19 ? 1.235   -8.133  7.697   1.00 3.85  ? 210 GLY A N   1 
ATOM   227 C  CA  . GLY A 1 19 ? -0.107  -8.270  7.154   1.00 3.91  ? 210 GLY A CA  1 
ATOM   228 C  C   . GLY A 1 19 ? -0.611  -7.195  6.206   1.00 3.38  ? 210 GLY A C   1 
ATOM   229 O  O   . GLY A 1 19 ? -1.746  -6.742  6.369   1.00 3.71  ? 210 GLY A O   1 
ATOM   230 N  N   . PHE A 1 20 ? 0.157   -6.826  5.165   1.00 3.51  ? 211 PHE A N   1 
ATOM   231 C  CA  . PHE A 1 20 ? -0.400  -5.898  4.194   1.00 3.38  ? 211 PHE A CA  1 
ATOM   232 C  C   . PHE A 1 20 ? 0.215   -6.094  2.830   1.00 3.42  ? 211 PHE A C   1 
ATOM   233 O  O   . PHE A 1 20 ? 1.285   -6.679  2.645   1.00 4.06  ? 211 PHE A O   1 
ATOM   234 C  CB  . PHE A 1 20 ? -0.307  -4.415  4.650   1.00 3.57  ? 211 PHE A CB  1 
ATOM   235 C  CG  . PHE A 1 20 ? 1.094   -3.863  4.631   1.00 3.64  ? 211 PHE A CG  1 
ATOM   236 C  CD1 . PHE A 1 20 ? 1.932   -3.976  5.723   1.00 4.52  ? 211 PHE A CD1 1 
ATOM   237 C  CD2 . PHE A 1 20 ? 1.549   -3.164  3.516   1.00 4.37  ? 211 PHE A CD2 1 
ATOM   238 C  CE1 . PHE A 1 20 ? 3.199   -3.418  5.727   1.00 5.07  ? 211 PHE A CE1 1 
ATOM   239 C  CE2 . PHE A 1 20 ? 2.814   -2.593  3.511   1.00 4.81  ? 211 PHE A CE2 1 
ATOM   240 C  CZ  . PHE A 1 20 ? 3.643   -2.716  4.623   1.00 4.72  ? 211 PHE A CZ  1 
ATOM   241 N  N   . ILE A 1 21 ? -0.505  -5.524  1.849   1.00 3.48  ? 212 ILE A N   1 
ATOM   242 C  CA  . ILE A 1 21 ? -0.128  -5.421  0.455   1.00 3.44  ? 212 ILE A CA  1 
ATOM   243 C  C   . ILE A 1 21 ? -0.038  -3.942  0.121   1.00 3.37  ? 212 ILE A C   1 
ATOM   244 O  O   . ILE A 1 21 ? -0.851  -3.149  0.632   1.00 3.57  ? 212 ILE A O   1 
ATOM   245 C  CB  . ILE A 1 21 ? -1.186  -6.120  -0.435  1.00 3.81  ? 212 ILE A CB  1 
ATOM   246 C  CG1 . ILE A 1 21 ? -1.321  -7.594  -0.049  1.00 5.25  ? 212 ILE A CG1 1 
ATOM   247 C  CG2 . ILE A 1 21 ? -0.843  -5.991  -1.921  1.00 4.54  ? 212 ILE A CG2 1 
ATOM   248 C  CD1 . ILE A 1 21 ? -2.394  -8.344  -0.820  1.00 5.93  ? 212 ILE A CD1 1 
ATOM   249 N  N   . PHE A 1 22 ? 0.911   -3.572  -0.741  1.00 3.59  ? 213 PHE A N   1 
ATOM   250 C  CA  . PHE A 1 22 ? 1.033   -2.200  -1.204  1.00 3.51  ? 213 PHE A CA  1 
ATOM   251 C  C   . PHE A 1 22 ? 1.452   -2.184  -2.677  1.00 3.63  ? 213 PHE A C   1 
ATOM   252 O  O   . PHE A 1 22 ? 1.924   -3.162  -3.226  1.00 4.21  ? 213 PHE A O   1 
ATOM   253 C  CB  . PHE A 1 22 ? 2.023   -1.384  -0.327  1.00 3.59  ? 213 PHE A CB  1 
ATOM   254 C  CG  . PHE A 1 22 ? 3.478   -1.671  -0.594  1.00 3.56  ? 213 PHE A CG  1 
ATOM   255 C  CD1 . PHE A 1 22 ? 4.220   -0.800  -1.385  1.00 4.03  ? 213 PHE A CD1 1 
ATOM   256 C  CD2 . PHE A 1 22 ? 4.121   -2.813  -0.088  1.00 4.01  ? 213 PHE A CD2 1 
ATOM   257 C  CE1 . PHE A 1 22 ? 5.561   -1.050  -1.664  1.00 4.76  ? 213 PHE A CE1 1 
ATOM   258 C  CE2 . PHE A 1 22 ? 5.435   -3.060  -0.372  1.00 4.53  ? 213 PHE A CE2 1 
ATOM   259 C  CZ  . PHE A 1 22 ? 6.173   -2.183  -1.167  1.00 4.89  ? 213 PHE A CZ  1 
ATOM   260 N  N   . LYS A 1 23 ? 1.302   -0.996  -3.287  1.00 3.68  ? 214 LYS A N   1 
ATOM   261 C  CA  . LYS A 1 23 ? 1.620   -0.810  -4.697  1.00 4.35  ? 214 LYS A CA  1 
ATOM   262 C  C   . LYS A 1 23 ? 1.840   0.668   -4.933  1.00 3.87  ? 214 LYS A C   1 
ATOM   263 O  O   . LYS A 1 23 ? 1.016   1.507   -4.530  1.00 4.16  ? 214 LYS A O   1 
ATOM   264 C  CB  . LYS A 1 23 ? 0.438   -1.302  -5.573  1.00 6.35  ? 214 LYS A CB  1 
ATOM   265 C  CG  . LYS A 1 23 ? 0.615   -1.224  -7.057  1.00 7.37  ? 214 LYS A CG  1 
ATOM   266 C  CD  . LYS A 1 23 ? -0.452  -1.967  -7.817  1.00 15.17 ? 214 LYS A CD  1 
ATOM   267 C  CE  . LYS A 1 23 ? -0.480  -1.923  -9.279  1.00 11.61 ? 214 LYS A CE  1 
ATOM   268 N  NZ  A LYS A 1 23 ? -1.232  -0.691  -9.701  0.55 15.28 ? 214 LYS A NZ  1 
ATOM   269 N  NZ  B LYS A 1 23 ? 0.172   -0.898  -9.984  0.45 13.85 ? 214 LYS A NZ  1 
ATOM   270 N  N   . ASN A 1 24 ? 2.956   1.029   -5.579  1.00 3.95  ? 215 ASN A N   1 
ATOM   271 C  CA  . ASN A 1 24 ? 3.305   2.409   -5.821  1.00 4.09  ? 215 ASN A CA  1 
ATOM   272 C  C   . ASN A 1 24 ? 3.306   3.223   -4.510  1.00 3.87  ? 215 ASN A C   1 
ATOM   273 O  O   . ASN A 1 24 ? 2.788   4.337   -4.423  1.00 4.80  ? 215 ASN A O   1 
ATOM   274 C  CB  . ASN A 1 24 ? 2.430   3.073   -6.879  1.00 4.77  ? 215 ASN A CB  1 
ATOM   275 C  CG  . ASN A 1 24 ? 3.037   4.306   -7.467  1.00 4.58  ? 215 ASN A CG  1 
ATOM   276 O  OD1 . ASN A 1 24 ? 4.262   4.512   -7.417  1.00 7.51  ? 215 ASN A OD1 1 
ATOM   277 N  ND2 . ASN A 1 24 ? 2.227   5.150   -8.068  1.00 5.72  ? 215 ASN A ND2 1 
ATOM   278 N  N   . GLY A 1 25 ? 3.906   2.614   -3.471  1.00 3.72  ? 216 GLY A N   1 
ATOM   279 C  CA  . GLY A 1 25 ? 4.051   3.266   -2.198  1.00 4.04  ? 216 GLY A CA  1 
ATOM   280 C  C   . GLY A 1 25 ? 2.778   3.339   -1.362  1.00 3.66  ? 216 GLY A C   1 
ATOM   281 O  O   . GLY A 1 25 ? 2.792   3.948   -0.305  1.00 5.20  ? 216 GLY A O   1 
ATOM   282 N  N   . LYS A 1 26 ? 1.685   2.753   -1.846  1.00 3.59  ? 217 LYS A N   1 
ATOM   283 C  CA  . LYS A 1 26 ? 0.343   2.962   -1.294  1.00 3.48  ? 217 LYS A CA  1 
ATOM   284 C  C   . LYS A 1 26 ? -0.194  1.647   -0.779  1.00 3.47  ? 217 LYS A C   1 
ATOM   285 O  O   . LYS A 1 26 ? -0.207  0.634   -1.477  1.00 4.03  ? 217 LYS A O   1 
ATOM   286 C  CB  . LYS A 1 26 ? -0.547  3.485   -2.438  1.00 3.97  ? 217 LYS A CB  1 
ATOM   287 C  CG  . LYS A 1 26 ? -1.964  3.847   -1.983  1.00 4.08  ? 217 LYS A CG  1 
ATOM   288 C  CD  . LYS A 1 26 ? -2.808  4.321   -3.161  1.00 4.53  ? 217 LYS A CD  1 
ATOM   289 C  CE  . LYS A 1 26 ? -2.187  5.467   -3.959  1.00 4.33  ? 217 LYS A CE  1 
ATOM   290 N  NZ  . LYS A 1 26 ? -1.911  6.623   -3.081  1.00 4.26  ? 217 LYS A NZ  1 
ATOM   291 N  N   . ILE A 1 27 ? -0.671  1.643   0.467   1.00 3.62  ? 218 ILE A N   1 
ATOM   292 C  CA  . ILE A 1 27 ? -1.226  0.436   1.049   1.00 3.76  ? 218 ILE A CA  1 
ATOM   293 C  C   . ILE A 1 27 ? -2.547  0.103   0.347   1.00 3.62  ? 218 ILE A C   1 
ATOM   294 O  O   . ILE A 1 27 ? -3.412  0.984   0.194   1.00 4.20  ? 218 ILE A O   1 
ATOM   295 C  CB  A ILE A 1 27 ? -1.360  0.624   2.551   0.74 4.20  ? 218 ILE A CB  1 
ATOM   296 C  CB  B ILE A 1 27 ? -1.491  0.676   2.557   0.26 4.58  ? 218 ILE A CB  1 
ATOM   297 C  CG1 A ILE A 1 27 ? 0.064   0.812   3.132   0.74 4.16  ? 218 ILE A CG1 1 
ATOM   298 C  CG1 B ILE A 1 27 ? -0.342  1.250   3.441   0.26 4.10  ? 218 ILE A CG1 1 
ATOM   299 C  CG2 A ILE A 1 27 ? -2.086  -0.525  3.241   0.74 4.59  ? 218 ILE A CG2 1 
ATOM   300 C  CG2 B ILE A 1 27 ? -1.998  -0.699  3.129   0.26 4.57  ? 218 ILE A CG2 1 
ATOM   301 C  CD1 A ILE A 1 27 ? 0.053   1.680   4.371   0.74 5.18  ? 218 ILE A CD1 1 
ATOM   302 C  CD1 B ILE A 1 27 ? 0.872   0.406   3.410   0.26 4.75  ? 218 ILE A CD1 1 
ATOM   303 N  N   . THR A 1 28 ? -2.696  -1.148  -0.068  1.00 3.63  ? 219 THR A N   1 
ATOM   304 C  CA  . THR A 1 28 ? -3.848  -1.585  -0.848  1.00 4.12  ? 219 THR A CA  1 
ATOM   305 C  C   . THR A 1 28 ? -4.650  -2.715  -0.199  1.00 3.96  ? 219 THR A C   1 
ATOM   306 O  O   . THR A 1 28 ? -5.792  -2.947  -0.623  1.00 5.30  ? 219 THR A O   1 
ATOM   307 C  CB  . THR A 1 28 ? -3.480  -1.972  -2.278  1.00 5.31  ? 219 THR A CB  1 
ATOM   308 O  OG1 . THR A 1 28 ? -2.540  -3.049  -2.179  1.00 6.19  ? 219 THR A OG1 1 
ATOM   309 C  CG2 . THR A 1 28 ? -2.915  -0.808  -3.042  1.00 6.91  ? 219 THR A CG2 1 
ATOM   310 N  N   . SER A 1 29 ? -4.127  -3.428  0.798   1.00 3.58  ? 220 SER A N   1 
ATOM   311 C  CA  . SER A 1 29 ? -4.938  -4.452  1.451   1.00 3.53  ? 220 SER A CA  1 
ATOM   312 C  C   . SER A 1 29 ? -4.330  -4.775  2.796   1.00 3.50  ? 220 SER A C   1 
ATOM   313 O  O   . SER A 1 29 ? -3.107  -4.771  2.938   1.00 4.10  ? 220 SER A O   1 
ATOM   314 C  CB  . SER A 1 29 ? -4.996  -5.740  0.597   1.00 4.14  ? 220 SER A CB  1 
ATOM   315 O  OG  . SER A 1 29 ? -6.141  -6.511  0.915   1.00 4.54  ? 220 SER A OG  1 
ATOM   316 N  N   . ILE A 1 30 ? -5.196  -5.123  3.747   1.00 3.69  ? 221 ILE A N   1 
ATOM   317 C  CA  . ILE A 1 30 ? -4.807  -5.528  5.096   1.00 3.68  ? 221 ILE A CA  1 
ATOM   318 C  C   . ILE A 1 30 ? -5.246  -6.985  5.308   1.00 3.77  ? 221 ILE A C   1 
ATOM   319 O  O   . ILE A 1 30 ? -6.369  -7.357  4.972   1.00 4.24  ? 221 ILE A O   1 
ATOM   320 C  CB  . ILE A 1 30 ? -5.447  -4.612  6.152   1.00 4.09  ? 221 ILE A CB  1 
ATOM   321 C  CG1 . ILE A 1 30 ? -5.166  -3.130  5.890   1.00 4.34  ? 221 ILE A CG1 1 
ATOM   322 C  CG2 . ILE A 1 30 ? -5.035  -5.037  7.552   1.00 5.21  ? 221 ILE A CG2 1 
ATOM   323 C  CD1 . ILE A 1 30 ? -3.699  -2.745  5.886   1.00 5.16  ? 221 ILE A CD1 1 
ATOM   324 N  N   . VAL A 1 31 ? -4.355  -7.792  5.885   1.00 3.68  ? 222 VAL A N   1 
ATOM   325 C  CA  . VAL A 1 31 ? -4.641  -9.196  6.175   1.00 3.93  ? 222 VAL A CA  1 
ATOM   326 C  C   . VAL A 1 31 ? -5.429  -9.296  7.469   1.00 3.89  ? 222 VAL A C   1 
ATOM   327 O  O   . VAL A 1 31 ? -5.120  -8.643  8.477   1.00 4.08  ? 222 VAL A O   1 
ATOM   328 C  CB  . VAL A 1 31 ? -3.323  -9.996  6.238   1.00 3.91  ? 222 VAL A CB  1 
ATOM   329 C  CG1 . VAL A 1 31 ? -3.555  -11.432 6.661   1.00 4.88  ? 222 VAL A CG1 1 
ATOM   330 C  CG2 . VAL A 1 31 ? -2.593  -9.941  4.899   1.00 4.28  ? 222 VAL A CG2 1 
ATOM   331 N  N   . LYS A 1 32 ? -6.465  -10.137 7.501   1.00 4.07  ? 223 LYS A N   1 
ATOM   332 C  CA  . LYS A 1 32 ? -7.322  -10.207 8.681   1.00 4.18  ? 223 LYS A CA  1 
ATOM   333 C  C   . LYS A 1 32 ? -6.551  -10.710 9.905   1.00 4.00  ? 223 LYS A C   1 
ATOM   334 O  O   . LYS A 1 32 ? -5.728  -11.620 9.837   1.00 4.49  ? 223 LYS A O   1 
ATOM   335 C  CB  . LYS A 1 32 ? -8.521  -11.108 8.417   1.00 4.30  ? 223 LYS A CB  1 
ATOM   336 C  CG  . LYS A 1 32 ? -9.400  -10.537 7.353   1.00 4.57  ? 223 LYS A CG  1 
ATOM   337 C  CD  . LYS A 1 32 ? -10.770 -11.215 7.248   1.00 4.56  ? 223 LYS A CD  1 
ATOM   338 C  CE  . LYS A 1 32 ? -11.620 -10.937 8.440   1.00 4.68  ? 223 LYS A CE  1 
ATOM   339 N  NZ  . LYS A 1 32 ? -13.016 -11.382 8.206   1.00 4.94  ? 223 LYS A NZ  1 
ATOM   340 N  N   . ASP A 1 33 ? -6.874  -10.075 11.038  1.00 4.15  ? 224 ASP A N   1 
ATOM   341 C  CA  . ASP A 1 33 ? -6.325  -10.421 12.353  1.00 4.41  ? 224 ASP A CA  1 
ATOM   342 C  C   . ASP A 1 33 ? -4.820  -10.195 12.447  1.00 4.47  ? 224 ASP A C   1 
ATOM   343 O  O   . ASP A 1 33 ? -4.199  -10.607 13.430  1.00 5.40  ? 224 ASP A O   1 
ATOM   344 C  CB  . ASP A 1 33 ? -6.672  -11.829 12.832  1.00 4.83  ? 224 ASP A CB  1 
ATOM   345 C  CG  . ASP A 1 33 ? -8.150  -12.075 13.024  0.83 4.10  ? 224 ASP A CG  1 
ATOM   346 O  OD1 . ASP A 1 33 ? -8.826  -11.191 13.614  0.83 4.52  ? 224 ASP A OD1 1 
ATOM   347 O  OD2 . ASP A 1 33 ? -8.613  -13.172 12.628  0.83 4.69  ? 224 ASP A OD2 1 
ATOM   348 N  N   . SER A 1 34 ? -4.237  -9.538  11.447  1.00 4.05  ? 225 SER A N   1 
ATOM   349 C  CA  . SER A 1 34 ? -2.808  -9.305  11.438  1.00 4.28  ? 225 SER A CA  1 
ATOM   350 C  C   . SER A 1 34 ? -2.425  -8.181  12.365  1.00 4.19  ? 225 SER A C   1 
ATOM   351 O  O   . SER A 1 34 ? -3.258  -7.414  12.858  1.00 4.20  ? 225 SER A O   1 
ATOM   352 C  CB  . SER A 1 34 ? -2.350  -8.987  10.016  1.00 4.47  ? 225 SER A CB  1 
ATOM   353 O  OG  . SER A 1 34 ? -2.868  -7.725  9.602   1.00 4.45  ? 225 SER A OG  1 
ATOM   354 N  N   . SER A 1 35 ? -1.112  -8.014  12.559  1.00 4.06  ? 226 SER A N   1 
ATOM   355 C  CA  . SER A 1 35 ? -0.636  -6.879  13.303  1.00 3.92  ? 226 SER A CA  1 
ATOM   356 C  C   . SER A 1 35 ? -1.012  -5.557  12.627  1.00 3.65  ? 226 SER A C   1 
ATOM   357 O  O   . SER A 1 35 ? -1.358  -4.578  13.281  1.00 4.08  ? 226 SER A O   1 
ATOM   358 C  CB  . SER A 1 35 ? 0.872   -7.019  13.531  1.00 4.36  ? 226 SER A CB  1 
ATOM   359 O  OG  . SER A 1 35 ? 1.343   -5.996  14.370  1.00 4.67  ? 226 SER A OG  1 
ATOM   360 N  N   . ALA A 1 36 ? -0.945  -5.525  11.289  1.00 3.71  ? 227 ALA A N   1 
ATOM   361 C  CA  . ALA A 1 36 ? -1.380  -4.365  10.543  1.00 3.71  ? 227 ALA A CA  1 
ATOM   362 C  C   . ALA A 1 36 ? -2.845  -4.045  10.838  1.00 3.73  ? 227 ALA A C   1 
ATOM   363 O  O   . ALA A 1 36 ? -3.220  -2.895  11.069  1.00 4.34  ? 227 ALA A O   1 
ATOM   364 C  CB  . ALA A 1 36 ? -1.161  -4.588  9.066   1.00 3.90  ? 227 ALA A CB  1 
ATOM   365 N  N   . ALA A 1 37 ? -3.694  -5.091  10.825  1.00 3.74  ? 228 ALA A N   1 
ATOM   366 C  CA  . ALA A 1 37 ? -5.109  -4.861  11.076  1.00 4.13  ? 228 ALA A CA  1 
ATOM   367 C  C   . ALA A 1 37 ? -5.334  -4.326  12.494  1.00 4.22  ? 228 ALA A C   1 
ATOM   368 O  O   . ALA A 1 37 ? -6.125  -3.383  12.686  1.00 5.07  ? 228 ALA A O   1 
ATOM   369 C  CB  . ALA A 1 37 ? -5.902  -6.146  10.905  1.00 4.64  ? 228 ALA A CB  1 
ATOM   370 N  N   . ARG A 1 38 ? -4.692  -4.942  13.470  1.00 4.00  ? 229 ARG A N   1 
ATOM   371 C  CA  . ARG A 1 38 ? -4.945  -4.653  14.885  1.00 4.35  ? 229 ARG A CA  1 
ATOM   372 C  C   . ARG A 1 38 ? -4.341  -3.346  15.359  1.00 4.60  ? 229 ARG A C   1 
ATOM   373 O  O   . ARG A 1 38 ? -4.738  -2.810  16.387  1.00 6.77  ? 229 ARG A O   1 
ATOM   374 C  CB  . ARG A 1 38 ? -4.476  -5.821  15.734  1.00 4.70  ? 229 ARG A CB  1 
ATOM   375 C  CG  . ARG A 1 38 ? -5.327  -7.081  15.500  1.00 5.39  ? 229 ARG A CG  1 
ATOM   376 C  CD  . ARG A 1 38 ? -4.828  -8.278  16.267  1.00 5.81  ? 229 ARG A CD  1 
ATOM   377 N  NE  . ARG A 1 38 ? -4.823  -8.075  17.722  1.00 6.08  ? 229 ARG A NE  1 
ATOM   378 C  CZ  . ARG A 1 38 ? -5.918  -8.153  18.489  1.00 5.24  ? 229 ARG A CZ  1 
ATOM   379 N  NH1 . ARG A 1 38 ? -7.069  -8.496  17.969  1.00 5.55  ? 229 ARG A NH1 1 
ATOM   380 N  NH2 . ARG A 1 38 ? -5.829  -7.850  19.786  1.00 6.38  ? 229 ARG A NH2 1 
ATOM   381 N  N   . ASN A 1 39 ? -3.374  -2.809  14.598  1.00 4.32  ? 230 ASN A N   1 
ATOM   382 C  CA  . ASN A 1 39 ? -2.748  -1.540  14.954  1.00 4.60  ? 230 ASN A CA  1 
ATOM   383 C  C   . ASN A 1 39 ? -3.180  -0.415  14.006  1.00 5.03  ? 230 ASN A C   1 
ATOM   384 O  O   . ASN A 1 39 ? -2.733  0.707   14.142  1.00 6.23  ? 230 ASN A O   1 
ATOM   385 C  CB  . ASN A 1 39 ? -1.222  -1.670  15.051  1.00 4.93  ? 230 ASN A CB  1 
ATOM   386 C  CG  . ASN A 1 39 ? -0.871  -2.533  16.239  1.00 5.16  ? 230 ASN A CG  1 
ATOM   387 O  OD1 . ASN A 1 39 ? -0.871  -2.095  17.377  1.00 6.57  ? 230 ASN A OD1 1 
ATOM   388 N  ND2 . ASN A 1 39 ? -0.575  -3.807  15.964  1.00 5.84  ? 230 ASN A ND2 1 
ATOM   389 N  N   . GLY A 1 40 ? -4.097  -0.706  13.079  1.00 5.34  ? 231 GLY A N   1 
ATOM   390 C  CA  . GLY A 1 40 ? -4.713  0.353   12.311  1.00 5.91  ? 231 GLY A CA  1 
ATOM   391 C  C   . GLY A 1 40 ? -3.950  0.845   11.105  1.00 4.75  ? 231 GLY A C   1 
ATOM   392 O  O   . GLY A 1 40 ? -4.100  2.006   10.718  1.00 5.33  ? 231 GLY A O   1 
ATOM   393 N  N   . LEU A 1 41 ? -3.179  -0.020  10.461  1.00 4.18  ? 232 LEU A N   1 
ATOM   394 C  CA  . LEU A 1 41 ? -2.661  0.351   9.156   1.00 3.77  ? 232 LEU A CA  1 
ATOM   395 C  C   . LEU A 1 41 ? -3.837  0.514   8.189   1.00 3.97  ? 232 LEU A C   1 
ATOM   396 O  O   . LEU A 1 41 ? -4.772  -0.289  8.222   1.00 5.13  ? 232 LEU A O   1 
ATOM   397 C  CB  . LEU A 1 41 ? -1.689  -0.722  8.654   1.00 3.96  ? 232 LEU A CB  1 
ATOM   398 C  CG  . LEU A 1 41 ? -0.757  -0.264  7.527   1.00 4.22  ? 232 LEU A CG  1 
ATOM   399 C  CD1 . LEU A 1 41 ? 0.329   0.666   8.037   1.00 5.04  ? 232 LEU A CD1 1 
ATOM   400 C  CD2 . LEU A 1 41 ? -0.114  -1.458  6.847   1.00 4.86  ? 232 LEU A CD2 1 
ATOM   401 N  N   . LEU A 1 42 ? -3.782  1.527   7.323   1.00 4.05  ? 233 LEU A N   1 
ATOM   402 C  CA  . LEU A 1 42 ? -4.905  1.937   6.489   1.00 4.24  ? 233 LEU A CA  1 
ATOM   403 C  C   . LEU A 1 42 ? -4.532  1.882   5.014   1.00 4.09  ? 233 LEU A C   1 
ATOM   404 O  O   . LEU A 1 42 ? -3.488  2.359   4.601   1.00 4.53  ? 233 LEU A O   1 
ATOM   405 C  CB  . LEU A 1 42 ? -5.328  3.366   6.825   1.00 4.69  ? 233 LEU A CB  1 
ATOM   406 C  CG  . LEU A 1 42 ? -5.704  3.608   8.270   1.00 5.67  ? 233 LEU A CG  1 
ATOM   407 C  CD1 . LEU A 1 42 ? -5.918  5.075   8.542   1.00 8.23  ? 233 LEU A CD1 1 
ATOM   408 C  CD2 . LEU A 1 42 ? -6.913  2.792   8.689   1.00 7.90  ? 233 LEU A CD2 1 
ATOM   409 N  N   . THR A 1 43 ? -5.479  1.346   4.201   1.00 4.48  ? 234 THR A N   1 
ATOM   410 C  CA  . THR A 1 43 ? -5.405  1.503   2.778   1.00 4.33  ? 234 THR A CA  1 
ATOM   411 C  C   . THR A 1 43 ? -5.627  2.952   2.381   1.00 4.23  ? 234 THR A C   1 
ATOM   412 O  O   . THR A 1 43 ? -6.062  3.800   3.173   1.00 4.43  ? 234 THR A O   1 
ATOM   413 C  CB  . THR A 1 43 ? -6.432  0.602   2.065   1.00 4.90  ? 234 THR A CB  1 
ATOM   414 O  OG1 . THR A 1 43 ? -7.747  1.051   2.344   1.00 4.78  ? 234 THR A OG1 1 
ATOM   415 C  CG2 . THR A 1 43 ? -6.257  -0.870  2.424   1.00 6.12  ? 234 THR A CG2 1 
ATOM   416 N  N   . GLU A 1 44 ? -5.304  3.274   1.108   1.00 4.83  ? 235 GLU A N   1 
ATOM   417 C  CA  . GLU A 1 44 ? -5.461  4.624   0.589   1.00 5.43  ? 235 GLU A CA  1 
ATOM   418 C  C   . GLU A 1 44 ? -4.608  5.623   1.385   1.00 5.01  ? 235 GLU A C   1 
ATOM   419 O  O   . GLU A 1 44 ? -4.951  6.830   1.563   1.00 5.97  ? 235 GLU A O   1 
ATOM   420 C  CB  . GLU A 1 44 ? -6.929  5.065   0.462   1.00 5.96  ? 235 GLU A CB  1 
ATOM   421 C  CG  . GLU A 1 44 ? -7.646  4.431   -0.718  1.00 6.17  ? 235 GLU A CG  1 
ATOM   422 C  CD  A GLU A 1 44 ? -7.315  5.034   -2.076  0.84 4.19  ? 235 GLU A CD  1 
ATOM   423 C  CD  B GLU A 1 44 ? -6.868  3.531   -1.648  0.16 16.90 ? 235 GLU A CD  1 
ATOM   424 O  OE1 A GLU A 1 44 ? -7.758  4.497   -3.121  0.84 5.55  ? 235 GLU A OE1 1 
ATOM   425 O  OE1 B GLU A 1 44 ? -5.700  3.872   -1.908  0.16 33.73 ? 235 GLU A OE1 1 
ATOM   426 O  OE2 A GLU A 1 44 ? -6.619  6.084   -2.116  0.84 4.65  ? 235 GLU A OE2 1 
ATOM   427 O  OE2 B GLU A 1 44 ? -7.409  2.505   -2.101  0.16 28.20 ? 235 GLU A OE2 1 
ATOM   428 N  N   . HIS A 1 45 ? -3.473  5.131   1.874   1.00 4.33  ? 236 HIS A N   1 
ATOM   429 C  CA  . HIS A 1 45 ? -2.457  5.913   2.545   1.00 3.99  ? 236 HIS A CA  1 
ATOM   430 C  C   . HIS A 1 45 ? -1.106  5.463   1.979   1.00 3.80  ? 236 HIS A C   1 
ATOM   431 O  O   . HIS A 1 45 ? -0.934  4.294   1.639   1.00 4.45  ? 236 HIS A O   1 
ATOM   432 C  CB  A HIS A 1 45 ? -2.458  5.683   4.072   0.92 3.98  ? 236 HIS A CB  1 
ATOM   433 C  CB  B HIS A 1 45 ? -2.627  5.919   4.075   0.08 5.50  ? 236 HIS A CB  1 
ATOM   434 C  CG  A HIS A 1 45 ? -3.589  6.299   4.793   0.92 4.09  ? 236 HIS A CG  1 
ATOM   435 C  CG  B HIS A 1 45 ? -3.937  6.424   4.543   0.08 3.40  ? 236 HIS A CG  1 
ATOM   436 N  ND1 A HIS A 1 45 ? -4.902  5.962   4.592   0.92 4.23  ? 236 HIS A ND1 1 
ATOM   437 N  ND1 B HIS A 1 45 ? -5.131  5.799   4.273   0.08 2.71  ? 236 HIS A ND1 1 
ATOM   438 C  CD2 A HIS A 1 45 ? -3.607  7.278   5.757   0.92 4.94  ? 236 HIS A CD2 1 
ATOM   439 C  CD2 B HIS A 1 45 ? -4.246  7.522   5.305   0.08 5.08  ? 236 HIS A CD2 1 
ATOM   440 C  CE1 A HIS A 1 45 ? -5.658  6.736   5.419   0.92 4.85  ? 236 HIS A CE1 1 
ATOM   441 C  CE1 B HIS A 1 45 ? -6.100  6.544   4.857   0.08 3.09  ? 236 HIS A CE1 1 
ATOM   442 N  NE2 A HIS A 1 45 ? -4.903  7.535   6.155   0.92 5.66  ? 236 HIS A NE2 1 
ATOM   443 N  NE2 B HIS A 1 45 ? -5.597  7.592   5.512   0.08 2.76  ? 236 HIS A NE2 1 
ATOM   444 N  N   . ASN A 1 46 ? -0.172  6.407   1.925   1.00 3.65  ? 237 ASN A N   1 
ATOM   445 C  CA  . ASN A 1 46 ? 1.158   6.169   1.414   1.00 3.53  ? 237 ASN A CA  1 
ATOM   446 C  C   . ASN A 1 46 ? 2.165   6.004   2.550   1.00 3.71  ? 237 ASN A C   1 
ATOM   447 O  O   . ASN A 1 46 ? 2.063   6.604   3.623   1.00 4.22  ? 237 ASN A O   1 
ATOM   448 C  CB  . ASN A 1 46 ? 1.621   7.264   0.460   1.00 4.08  ? 237 ASN A CB  1 
ATOM   449 C  CG  . ASN A 1 46 ? 1.013   7.098   -0.923  1.00 4.08  ? 237 ASN A CG  1 
ATOM   450 O  OD1 . ASN A 1 46 ? 0.045   6.353   -1.103  1.00 4.29  ? 237 ASN A OD1 1 
ATOM   451 N  ND2 . ASN A 1 46 ? 1.552   7.808   -1.899  1.00 5.02  ? 237 ASN A ND2 1 
ATOM   452 N  N   . ILE A 1 47 ? 3.155   5.161   2.246   1.00 3.87  ? 238 ILE A N   1 
ATOM   453 C  CA  . ILE A 1 47 ? 4.246   4.791   3.138   1.00 3.95  ? 238 ILE A CA  1 
ATOM   454 C  C   . ILE A 1 47 ? 5.334   5.863   3.036   1.00 4.37  ? 238 ILE A C   1 
ATOM   455 O  O   . ILE A 1 47 ? 5.940   6.055   1.972   1.00 6.01  ? 238 ILE A O   1 
ATOM   456 C  CB  . ILE A 1 47 ? 4.798   3.421   2.723   1.00 4.56  ? 238 ILE A CB  1 
ATOM   457 C  CG1 . ILE A 1 47 ? 3.733   2.352   2.852   1.00 5.36  ? 238 ILE A CG1 1 
ATOM   458 C  CG2 . ILE A 1 47 ? 6.039   3.062   3.522   1.00 6.05  ? 238 ILE A CG2 1 
ATOM   459 C  CD1 . ILE A 1 47 ? 4.106   1.027   2.179   1.00 7.89  ? 238 ILE A CD1 1 
ATOM   460 N  N   . CYS A 1 48 ? 5.599   6.535   4.147   1.00 4.12  ? 239 CYS A N   1 
ATOM   461 C  CA  . CYS A 1 48 ? 6.544   7.653   4.148   1.00 4.22  ? 239 CYS A CA  1 
ATOM   462 C  C   . CYS A 1 48 ? 7.870   7.340   4.838   1.00 3.91  ? 239 CYS A C   1 
ATOM   463 O  O   . CYS A 1 48 ? 8.906   7.878   4.470   1.00 4.36  ? 239 CYS A O   1 
ATOM   464 C  CB  . CYS A 1 48 ? 5.916   8.874   4.807   1.00 5.48  ? 239 CYS A CB  1 
ATOM   465 S  SG  . CYS A 1 48 ? 4.401   9.440   3.958   1.00 7.99  ? 239 CYS A SG  1 
ATOM   466 N  N   . GLU A 1 49 ? 7.822   6.490   5.869   1.00 3.88  ? 240 GLU A N   1 
ATOM   467 C  CA  . GLU A 1 49 ? 8.988   6.217   6.702   1.00 4.05  ? 240 GLU A CA  1 
ATOM   468 C  C   . GLU A 1 49 ? 8.811   4.824   7.284   1.00 3.85  ? 240 GLU A C   1 
ATOM   469 O  O   . GLU A 1 49 ? 7.687   4.474   7.673   1.00 4.60  ? 240 GLU A O   1 
ATOM   470 C  CB  . GLU A 1 49 ? 9.085   7.241   7.840   1.00 5.02  ? 240 GLU A CB  1 
ATOM   471 C  CG  A GLU A 1 49 ? 10.371  7.277   8.605   0.68 5.06  ? 240 GLU A CG  1 
ATOM   472 C  CG  B GLU A 1 49 ? 9.270   8.655   7.447   0.32 10.51 ? 240 GLU A CG  1 
ATOM   473 C  CD  A GLU A 1 49 ? 10.269  8.164   9.810   0.68 6.83  ? 240 GLU A CD  1 
ATOM   474 C  CD  B GLU A 1 49 ? 9.397   9.592   8.611   0.32 17.53 ? 240 GLU A CD  1 
ATOM   475 O  OE1 A GLU A 1 49 ? 9.843   7.603   10.852  0.68 7.51  ? 240 GLU A OE1 1 
ATOM   476 O  OE1 B GLU A 1 49 ? 10.521  9.838   9.105   0.32 24.20 ? 240 GLU A OE1 1 
ATOM   477 O  OE2 A GLU A 1 49 ? 10.626  9.332   9.699   0.68 9.78  ? 240 GLU A OE2 1 
ATOM   478 O  OE2 B GLU A 1 49 ? 8.324   10.094  9.046   0.32 21.65 ? 240 GLU A OE2 1 
ATOM   479 N  N   . ILE A 1 50 ? 9.893   4.054   7.370   1.00 3.72  ? 241 ILE A N   1 
ATOM   480 C  CA  . ILE A 1 50 ? 9.866   2.721   7.962   1.00 3.71  ? 241 ILE A CA  1 
ATOM   481 C  C   . ILE A 1 50 ? 11.005  2.643   8.972   1.00 3.56  ? 241 ILE A C   1 
ATOM   482 O  O   . ILE A 1 50 ? 12.176  2.843   8.602   1.00 3.99  ? 241 ILE A O   1 
ATOM   483 C  CB  . ILE A 1 50 ? 10.006  1.610   6.911   1.00 3.99  ? 241 ILE A CB  1 
ATOM   484 C  CG1 . ILE A 1 50 ? 8.877   1.680   5.897   1.00 4.61  ? 241 ILE A CG1 1 
ATOM   485 C  CG2 . ILE A 1 50 ? 10.052  0.261   7.613   1.00 4.75  ? 241 ILE A CG2 1 
ATOM   486 C  CD1 . ILE A 1 50 ? 9.081   0.774   4.692   1.00 5.37  ? 241 ILE A CD1 1 
ATOM   487 N  N   . ASN A 1 51 ? 10.689  2.328   10.231  1.00 3.66  ? 242 ASN A N   1 
ATOM   488 C  CA  . ASN A 1 51 ? 11.706  2.174   11.266  1.00 4.07  ? 242 ASN A CA  1 
ATOM   489 C  C   . ASN A 1 51 ? 12.619  3.390   11.346  1.00 4.63  ? 242 ASN A C   1 
ATOM   490 O  O   . ASN A 1 51 ? 13.804  3.283   11.623  1.00 5.78  ? 242 ASN A O   1 
ATOM   491 C  CB  . ASN A 1 51 ? 12.485  0.877   11.090  1.00 4.28  ? 242 ASN A CB  1 
ATOM   492 C  CG  . ASN A 1 51 ? 11.596  -0.316  11.319  1.00 4.59  ? 242 ASN A CG  1 
ATOM   493 O  OD1 . ASN A 1 51 ? 10.556  -0.232  11.967  1.00 5.67  ? 242 ASN A OD1 1 
ATOM   494 N  ND2 . ASN A 1 51 ? 12.021  -1.452  10.776  1.00 5.57  ? 242 ASN A ND2 1 
ATOM   495 N  N   . GLY A 1 52 ? 12.029  4.584   11.156  1.00 4.53  ? 243 GLY A N   1 
ATOM   496 C  CA  . GLY A 1 52 ? 12.767  5.819   11.229  1.00 5.74  ? 243 GLY A CA  1 
ATOM   497 C  C   . GLY A 1 52 ? 13.490  6.218   9.953   1.00 6.36  ? 243 GLY A C   1 
ATOM   498 O  O   . GLY A 1 52 ? 14.044  7.308   9.915   1.00 12.01 ? 243 GLY A O   1 
ATOM   499 N  N   . GLN A 1 53 ? 13.475  5.390   8.938   1.00 4.55  ? 244 GLN A N   1 
ATOM   500 C  CA  . GLN A 1 53 ? 14.160  5.662   7.697   1.00 4.79  ? 244 GLN A CA  1 
ATOM   501 C  C   . GLN A 1 53 ? 13.170  6.256   6.675   1.00 4.54  ? 244 GLN A C   1 
ATOM   502 O  O   . GLN A 1 53 ? 12.120  5.674   6.413   1.00 4.98  ? 244 GLN A O   1 
ATOM   503 C  CB  . GLN A 1 53 ? 14.758  4.394   7.143   1.00 5.40  ? 244 GLN A CB  1 
ATOM   504 C  CG  . GLN A 1 53 ? 15.506  4.630   5.842   1.00 6.38  ? 244 GLN A CG  1 
ATOM   505 C  CD  . GLN A 1 53 ? 16.240  3.432   5.314   1.00 7.50  ? 244 GLN A CD  1 
ATOM   506 O  OE1 . GLN A 1 53 ? 16.184  2.363   5.852   1.00 9.83  ? 244 GLN A OE1 1 
ATOM   507 N  NE2 . GLN A 1 53 ? 16.987  3.710   4.227   1.00 9.07  ? 244 GLN A NE2 1 
ATOM   508 N  N   . ASN A 1 54 ? 13.546  7.386   6.109   1.00 4.88  ? 245 ASN A N   1 
ATOM   509 C  CA  . ASN A 1 54 ? 12.754  8.026   5.060   1.00 4.96  ? 245 ASN A CA  1 
ATOM   510 C  C   . ASN A 1 54 ? 12.741  7.133   3.830   1.00 5.15  ? 245 ASN A C   1 
ATOM   511 O  O   . ASN A 1 54 ? 13.795  6.762   3.307   1.00 8.84  ? 245 ASN A O   1 
ATOM   512 C  CB  . ASN A 1 54 ? 13.409  9.350   4.728   1.00 6.37  ? 245 ASN A CB  1 
ATOM   513 C  CG  A ASN A 1 54 ? 12.514  10.141  3.798   0.68 5.50  ? 245 ASN A CG  1 
ATOM   514 C  CG  B ASN A 1 54 ? 12.717  10.283  3.769   0.32 4.10  ? 245 ASN A CG  1 
ATOM   515 O  OD1 A ASN A 1 54 ? 11.463  9.756   3.420   0.68 6.19  ? 245 ASN A OD1 1 
ATOM   516 O  OD1 B ASN A 1 54 ? 12.176  9.773   2.785   0.32 5.25  ? 245 ASN A OD1 1 
ATOM   517 N  ND2 A ASN A 1 54 ? 13.050  11.298  3.501   0.68 7.14  ? 245 ASN A ND2 1 
ATOM   518 N  ND2 B ASN A 1 54 ? 12.695  11.623  3.884   0.32 4.73  ? 245 ASN A ND2 1 
ATOM   519 N  N   . VAL A 1 55 ? 11.543  6.774   3.346   1.00 4.05  ? 246 VAL A N   1 
ATOM   520 C  CA  . VAL A 1 55 ? 11.417  5.984   2.137   1.00 4.04  ? 246 VAL A CA  1 
ATOM   521 C  C   . VAL A 1 55 ? 10.660  6.734   1.027   1.00 3.85  ? 246 VAL A C   1 
ATOM   522 O  O   . VAL A 1 55 ? 10.311  6.136   0.010   1.00 4.23  ? 246 VAL A O   1 
ATOM   523 C  CB  . VAL A 1 55 ? 10.832  4.575   2.380   1.00 4.36  ? 246 VAL A CB  1 
ATOM   524 C  CG1 . VAL A 1 55 ? 11.749  3.803   3.340   1.00 5.16  ? 246 VAL A CG1 1 
ATOM   525 C  CG2 . VAL A 1 55 ? 9.407   4.633   2.905   1.00 4.88  ? 246 VAL A CG2 1 
ATOM   526 N  N   . ILE A 1 56 ? 10.449  8.032   1.211   1.00 3.99  ? 247 ILE A N   1 
ATOM   527 C  CA  . ILE A 1 56 ? 9.922   8.846   0.112   1.00 3.89  ? 247 ILE A CA  1 
ATOM   528 C  C   . ILE A 1 56 ? 10.871  8.742   -1.063  1.00 3.80  ? 247 ILE A C   1 
ATOM   529 O  O   . ILE A 1 56 ? 12.086  8.802   -0.919  1.00 4.82  ? 247 ILE A O   1 
ATOM   530 C  CB  . ILE A 1 56 ? 9.707   10.295  0.591   1.00 4.36  ? 247 ILE A CB  1 
ATOM   531 C  CG1 . ILE A 1 56 ? 8.564   10.373  1.624   1.00 5.55  ? 247 ILE A CG1 1 
ATOM   532 C  CG2 . ILE A 1 56 ? 9.490   11.257  -0.579  1.00 4.29  ? 247 ILE A CG2 1 
ATOM   533 C  CD1 . ILE A 1 56 ? 7.210   10.087  1.105   1.00 6.47  ? 247 ILE A CD1 1 
ATOM   534 N  N   . GLY A 1 57 ? 10.296  8.573   -2.253  1.00 3.77  ? 248 GLY A N   1 
ATOM   535 C  CA  . GLY A 1 57 ? 11.098  8.508   -3.443  1.00 4.28  ? 248 GLY A CA  1 
ATOM   536 C  C   . GLY A 1 57 ? 11.835  7.216   -3.689  1.00 3.81  ? 248 GLY A C   1 
ATOM   537 O  O   . GLY A 1 57 ? 12.662  7.178   -4.630  1.00 4.24  ? 248 GLY A O   1 
ATOM   538 N  N   . LEU A 1 58 ? 11.556  6.175   -2.927  1.00 3.47  ? 249 LEU A N   1 
ATOM   539 C  CA  . LEU A 1 58 ? 12.149  4.875   -3.149  1.00 3.64  ? 249 LEU A CA  1 
ATOM   540 C  C   . LEU A 1 58 ? 11.164  3.975   -3.919  1.00 3.53  ? 249 LEU A C   1 
ATOM   541 O  O   . LEU A 1 58 ? 9.948   4.115   -3.811  1.00 4.18  ? 249 LEU A O   1 
ATOM   542 C  CB  . LEU A 1 58 ? 12.568  4.194   -1.847  1.00 3.94  ? 249 LEU A CB  1 
ATOM   543 C  CG  . LEU A 1 58 ? 13.584  4.997   -1.019  1.00 4.08  ? 249 LEU A CG  1 
ATOM   544 C  CD1 . LEU A 1 58 ? 14.075  4.130   0.137   1.00 5.09  ? 249 LEU A CD1 1 
ATOM   545 C  CD2 . LEU A 1 58 ? 14.748  5.518   -1.845  1.00 4.98  ? 249 LEU A CD2 1 
ATOM   546 N  N   . LYS A 1 59 ? 11.727  3.070   -4.703  1.00 3.88  ? 250 LYS A N   1 
ATOM   547 C  CA  . LYS A 1 59 ? 10.907  2.127   -5.460  1.00 4.08  ? 250 LYS A CA  1 
ATOM   548 C  C   . LYS A 1 59 ? 10.217  1.162   -4.556  1.00 3.64  ? 250 LYS A C   1 
ATOM   549 O  O   . LYS A 1 59 ? 10.675  0.827   -3.450  1.00 3.85  ? 250 LYS A O   1 
ATOM   550 C  CB  . LYS A 1 59 ? 11.780  1.327   -6.452  1.00 4.67  ? 250 LYS A CB  1 
ATOM   551 C  CG  . LYS A 1 59 ? 12.252  2.177   -7.595  1.00 5.39  ? 250 LYS A CG  1 
ATOM   552 C  CD  . LYS A 1 59 ? 12.890  1.374   -8.695  0.85 5.28  ? 250 LYS A CD  1 
ATOM   553 C  CE  . LYS A 1 59 ? 13.176  2.176   -9.947  0.78 5.20  ? 250 LYS A CE  1 
ATOM   554 N  NZ  . LYS A 1 59 ? 11.965  2.819   -10.513 0.64 5.04  ? 250 LYS A NZ  1 
ATOM   555 N  N   . ASP A 1 60 ? 9.111   0.579   -5.057  1.00 3.67  ? 251 ASP A N   1 
ATOM   556 C  CA  . ASP A 1 60 ? 8.439   -0.458  -4.314  1.00 3.74  ? 251 ASP A CA  1 
ATOM   557 C  C   . ASP A 1 60 ? 9.375   -1.606  -3.931  1.00 3.62  ? 251 ASP A C   1 
ATOM   558 O  O   . ASP A 1 60 ? 9.271   -2.129  -2.836  1.00 4.13  ? 251 ASP A O   1 
ATOM   559 C  CB  . ASP A 1 60 ? 7.267   -1.021  -5.085  1.00 4.15  ? 251 ASP A CB  1 
ATOM   560 C  CG  . ASP A 1 60 ? 6.047   -0.129  -5.163  1.00 3.90  ? 251 ASP A CG  1 
ATOM   561 O  OD1 . ASP A 1 60 ? 5.981   0.891   -4.461  1.00 4.03  ? 251 ASP A OD1 1 
ATOM   562 O  OD2 . ASP A 1 60 ? 5.137   -0.524  -5.947  1.00 5.55  ? 251 ASP A OD2 1 
ATOM   563 N  N   . SER A 1 61 ? 10.283  -2.014  -4.842  1.00 3.76  ? 252 SER A N   1 
ATOM   564 C  CA  . SER A 1 61 ? 11.185  -3.110  -4.493  1.00 4.06  ? 252 SER A CA  1 
ATOM   565 C  C   . SER A 1 61 ? 12.115  -2.736  -3.322  1.00 3.69  ? 252 SER A C   1 
ATOM   566 O  O   . SER A 1 61 ? 12.503  -3.592  -2.549  1.00 4.07  ? 252 SER A O   1 
ATOM   567 C  CB  . SER A 1 61 ? 11.999  -3.509  -5.707  1.00 4.94  ? 252 SER A CB  1 
ATOM   568 O  OG  . SER A 1 61 ? 12.720  -2.424  -6.225  1.00 5.25  ? 252 SER A OG  1 
ATOM   569 N  N   . GLN A 1 62 ? 12.509  -1.455  -3.259  1.00 3.82  ? 253 GLN A N   1 
ATOM   570 C  CA  . GLN A 1 62 ? 13.328  -1.000  -2.142  1.00 3.70  ? 253 GLN A CA  1 
ATOM   571 C  C   . GLN A 1 62 ? 12.548  -1.014  -0.838  1.00 3.78  ? 253 GLN A C   1 
ATOM   572 O  O   . GLN A 1 62 ? 13.062  -1.450  0.202   1.00 4.16  ? 253 GLN A O   1 
ATOM   573 C  CB  . GLN A 1 62 ? 13.902  0.393   -2.423  1.00 3.98  ? 253 GLN A CB  1 
ATOM   574 C  CG  . GLN A 1 62 ? 14.920  0.392   -3.540  1.00 4.47  ? 253 GLN A CG  1 
ATOM   575 C  CD  . GLN A 1 62 ? 15.343  1.822   -3.875  1.00 4.85  ? 253 GLN A CD  1 
ATOM   576 O  OE1 . GLN A 1 62 ? 14.546  2.623   -4.389  1.00 5.71  ? 253 GLN A OE1 1 
ATOM   577 N  NE2 . GLN A 1 62 ? 16.545  2.170   -3.504  1.00 6.57  ? 253 GLN A NE2 1 
ATOM   578 N  N   . ILE A 1 63 ? 11.307  -0.530  -0.866  1.00 3.61  ? 254 ILE A N   1 
ATOM   579 C  CA  . ILE A 1 63 ? 10.437  -0.594  0.303   1.00 3.83  ? 254 ILE A CA  1 
ATOM   580 C  C   . ILE A 1 63 ? 10.259  -2.045  0.740   1.00 3.67  ? 254 ILE A C   1 
ATOM   581 O  O   . ILE A 1 63 ? 10.355  -2.374  1.920   1.00 3.97  ? 254 ILE A O   1 
ATOM   582 C  CB  . ILE A 1 63 ? 9.107   0.120   0.006   1.00 4.13  ? 254 ILE A CB  1 
ATOM   583 C  CG1 . ILE A 1 63 ? 9.343   1.611   -0.194  1.00 5.76  ? 254 ILE A CG1 1 
ATOM   584 C  CG2 . ILE A 1 63 ? 8.091   -0.167  1.074   1.00 4.73  ? 254 ILE A CG2 1 
ATOM   585 C  CD1 . ILE A 1 63 ? 8.123   2.367   -0.742  1.00 8.69  ? 254 ILE A CD1 1 
ATOM   586 N  N   . ALA A 1 64 ? 9.973   -2.928  -0.228  1.00 3.81  ? 255 ALA A N   1 
ATOM   587 C  CA  . ALA A 1 64 ? 9.777   -4.338  0.044   1.00 3.90  ? 255 ALA A CA  1 
ATOM   588 C  C   . ALA A 1 64 ? 10.988  -4.925  0.766   1.00 3.56  ? 255 ALA A C   1 
ATOM   589 O  O   . ALA A 1 64 ? 10.849  -5.634  1.766   1.00 3.92  ? 255 ALA A O   1 
ATOM   590 C  CB  . ALA A 1 64 ? 9.550   -5.088  -1.264  1.00 4.35  ? 255 ALA A CB  1 
ATOM   591 N  N   . ASP A 1 65 ? 12.196  -4.654  0.260   1.00 3.59  ? 256 ASP A N   1 
ATOM   592 C  CA  . ASP A 1 65 ? 13.375  -5.239  0.870   1.00 3.65  ? 256 ASP A CA  1 
ATOM   593 C  C   . ASP A 1 65 ? 13.609  -4.686  2.272   1.00 3.46  ? 256 ASP A C   1 
ATOM   594 O  O   . ASP A 1 65 ? 14.078  -5.430  3.159   1.00 3.86  ? 256 ASP A O   1 
ATOM   595 C  CB  . ASP A 1 65 ? 14.595  -5.038  0.010   1.00 3.77  ? 256 ASP A CB  1 
ATOM   596 C  CG  . ASP A 1 65 ? 14.653  -5.900  -1.241  1.00 4.35  ? 256 ASP A CG  1 
ATOM   597 O  OD1 . ASP A 1 65 ? 13.817  -6.786  -1.420  1.00 5.10  ? 256 ASP A OD1 1 
ATOM   598 O  OD2 . ASP A 1 65 ? 15.615  -5.648  -2.031  1.00 5.18  ? 256 ASP A OD2 1 
ATOM   599 N  N   . ILE A 1 66 ? 13.323  -3.404  2.515   1.00 3.50  ? 257 ILE A N   1 
ATOM   600 C  CA  . ILE A 1 66 ? 13.411  -2.876  3.864   1.00 3.37  ? 257 ILE A CA  1 
ATOM   601 C  C   . ILE A 1 66 ? 12.438  -3.612  4.788   1.00 3.48  ? 257 ILE A C   1 
ATOM   602 O  O   . ILE A 1 66 ? 12.788  -4.019  5.903   1.00 3.76  ? 257 ILE A O   1 
ATOM   603 C  CB  . ILE A 1 66 ? 13.190  -1.354  3.868   1.00 3.72  ? 257 ILE A CB  1 
ATOM   604 C  CG1 . ILE A 1 66 ? 14.384  -0.644  3.207   1.00 4.04  ? 257 ILE A CG1 1 
ATOM   605 C  CG2 . ILE A 1 66 ? 12.955  -0.833  5.273   1.00 4.45  ? 257 ILE A CG2 1 
ATOM   606 C  CD1 . ILE A 1 66 ? 14.142  0.804   2.858   1.00 5.22  ? 257 ILE A CD1 1 
ATOM   607 N  N   . LEU A 1 67 ? 11.199  -3.799  4.325   1.00 3.41  ? 258 LEU A N   1 
ATOM   608 C  CA  . LEU A 1 67 ? 10.212  -4.522  5.125   1.00 3.53  ? 258 LEU A CA  1 
ATOM   609 C  C   . LEU A 1 67 ? 10.659  -5.948  5.414   1.00 3.55  ? 258 LEU A C   1 
ATOM   610 O  O   . LEU A 1 67 ? 10.579  -6.395  6.568   1.00 4.07  ? 258 LEU A O   1 
ATOM   611 C  CB  . LEU A 1 67 ? 8.863   -4.540  4.395   1.00 3.71  ? 258 LEU A CB  1 
ATOM   612 C  CG  . LEU A 1 67 ? 8.162   -3.185  4.293   1.00 3.77  ? 258 LEU A CG  1 
ATOM   613 C  CD1 . LEU A 1 67 ? 7.041   -3.267  3.254   1.00 4.63  ? 258 LEU A CD1 1 
ATOM   614 C  CD2 . LEU A 1 67 ? 7.621   -2.736  5.633   1.00 4.71  ? 258 LEU A CD2 1 
ATOM   615 N  N   . SER A 1 68 ? 11.088  -6.680  4.384   1.00 3.47  ? 259 SER A N   1 
ATOM   616 C  CA  . SER A 1 68 ? 11.410  -8.082  4.581   1.00 3.66  ? 259 SER A CA  1 
ATOM   617 C  C   . SER A 1 68 ? 12.601  -8.267  5.510   1.00 3.54  ? 259 SER A C   1 
ATOM   618 O  O   . SER A 1 68 ? 12.640  -9.204  6.310   1.00 4.04  ? 259 SER A O   1 
ATOM   619 C  CB  . SER A 1 68 ? 11.674  -8.745  3.241   1.00 4.29  ? 259 SER A CB  1 
ATOM   620 O  OG  A SER A 1 68 ? 10.664  -8.590  2.337   0.51 4.26  ? 259 SER A OG  1 
ATOM   621 O  OG  B SER A 1 68 ? 12.812  -8.330  2.660   0.49 3.95  ? 259 SER A OG  1 
ATOM   622 N  N   . THR A 1 69 ? 13.599  -7.382  5.388   1.00 3.57  ? 260 THR A N   1 
ATOM   623 C  CA  . THR A 1 69 ? 14.819  -7.525  6.156   1.00 3.54  ? 260 THR A CA  1 
ATOM   624 C  C   . THR A 1 69 ? 14.722  -6.926  7.559   1.00 3.78  ? 260 THR A C   1 
ATOM   625 O  O   . THR A 1 69 ? 15.636  -7.135  8.380   1.00 4.03  ? 260 THR A O   1 
ATOM   626 C  CB  . THR A 1 69 ? 16.047  -6.988  5.407   1.00 3.61  ? 260 THR A CB  1 
ATOM   627 O  OG1 . THR A 1 69 ? 15.903  -5.582  5.166   1.00 3.71  ? 260 THR A OG1 1 
ATOM   628 C  CG2 . THR A 1 69 ? 16.315  -7.747  4.133   1.00 4.05  ? 260 THR A CG2 1 
ATOM   629 N  N   . SER A 1 70 ? 13.661  -6.196  7.869   1.00 3.88  ? 261 SER A N   1 
ATOM   630 C  CA  . SER A 1 70 ? 13.461  -5.664  9.190   1.00 3.95  ? 261 SER A CA  1 
ATOM   631 C  C   . SER A 1 70 ? 13.396  -6.776  10.232  1.00 3.69  ? 261 SER A C   1 
ATOM   632 O  O   . SER A 1 70 ? 12.917  -7.882  9.970   1.00 4.17  ? 261 SER A O   1 
ATOM   633 C  CB  . SER A 1 70 ? 12.122  -4.893  9.210   1.00 4.20  ? 261 SER A CB  1 
ATOM   634 O  OG  . SER A 1 70 ? 11.842  -4.323  10.479  1.00 4.35  ? 261 SER A OG  1 
ATOM   635 N  N   . GLY A 1 71 ? 13.792  -6.415  11.441  1.00 4.03  ? 262 GLY A N   1 
ATOM   636 C  CA  . GLY A 1 71 ? 13.442  -7.207  12.611  1.00 4.20  ? 262 GLY A CA  1 
ATOM   637 C  C   . GLY A 1 71 ? 11.911  -7.202  12.801  1.00 3.92  ? 262 GLY A C   1 
ATOM   638 O  O   . GLY A 1 71 ? 11.142  -6.611  12.048  1.00 4.18  ? 262 GLY A O   1 
ATOM   639 N  N   . THR A 1 72 ? 11.498  -7.930  13.832  1.00 4.12  ? 263 THR A N   1 
ATOM   640 C  CA  . THR A 1 72 ? 10.089  -8.152  14.084  1.00 3.95  ? 263 THR A CA  1 
ATOM   641 C  C   . THR A 1 72 ? 9.285   -6.874  14.180  1.00 3.95  ? 263 THR A C   1 
ATOM   642 O  O   . THR A 1 72 ? 8.136   -6.833  13.700  1.00 4.35  ? 263 THR A O   1 
ATOM   643 C  CB  . THR A 1 72 ? 9.938   -9.012  15.329  1.00 4.46  ? 263 THR A CB  1 
ATOM   644 O  OG1 . THR A 1 72 ? 10.499  -10.262 14.993  1.00 5.31  ? 263 THR A OG1 1 
ATOM   645 C  CG2 . THR A 1 72 ? 8.511   -9.181  15.801  1.00 5.03  ? 263 THR A CG2 1 
ATOM   646 N  N   . VAL A 1 73 ? 9.823   -5.838  14.823  1.00 4.01  ? 264 VAL A N   1 
ATOM   647 C  CA  . VAL A 1 73 ? 9.054   -4.604  14.978  1.00 4.28  ? 264 VAL A CA  1 
ATOM   648 C  C   . VAL A 1 73 ? 9.194   -3.775  13.705  1.00 4.10  ? 264 VAL A C   1 
ATOM   649 O  O   . VAL A 1 73 ? 10.308  -3.478  13.230  1.00 5.68  ? 264 VAL A O   1 
ATOM   650 C  CB  . VAL A 1 73 ? 9.454   -3.834  16.230  1.00 5.56  ? 264 VAL A CB  1 
ATOM   651 C  CG1 . VAL A 1 73 ? 8.454   -2.699  16.438  1.00 7.84  ? 264 VAL A CG1 1 
ATOM   652 C  CG2 . VAL A 1 73 ? 9.447   -4.720  17.462  1.00 7.94  ? 264 VAL A CG2 1 
ATOM   653 N  N   . VAL A 1 74 ? 8.056   -3.395  13.131  1.00 3.90  ? 265 VAL A N   1 
ATOM   654 C  CA  . VAL A 1 74 ? 8.002   -2.588  11.926  1.00 3.76  ? 265 VAL A CA  1 
ATOM   655 C  C   . VAL A 1 74 ? 7.109   -1.392  12.204  1.00 3.68  ? 265 VAL A C   1 
ATOM   656 O  O   . VAL A 1 74 ? 5.917   -1.557  12.462  1.00 4.29  ? 265 VAL A O   1 
ATOM   657 C  CB  . VAL A 1 74 ? 7.434   -3.396  10.738  1.00 4.15  ? 265 VAL A CB  1 
ATOM   658 C  CG1 . VAL A 1 74 ? 7.379   -2.519  9.501   1.00 5.32  ? 265 VAL A CG1 1 
ATOM   659 C  CG2 . VAL A 1 74 ? 8.233   -4.673  10.499  1.00 5.00  ? 265 VAL A CG2 1 
ATOM   660 N  N   . THR A 1 75 ? 7.688   -0.188  12.142  1.00 3.59  ? 266 THR A N   1 
ATOM   661 C  CA  . THR A 1 75 ? 6.947   1.037   12.419  1.00 3.63  ? 266 THR A CA  1 
ATOM   662 C  C   . THR A 1 75 ? 6.880   1.856   11.150  1.00 3.80  ? 266 THR A C   1 
ATOM   663 O  O   . THR A 1 75 ? 7.926   2.224   10.585  1.00 4.78  ? 266 THR A O   1 
ATOM   664 C  CB  . THR A 1 75 ? 7.603   1.846   13.539  1.00 4.17  ? 266 THR A CB  1 
ATOM   665 O  OG1 . THR A 1 75 ? 7.595   1.057   14.727  1.00 4.92  ? 266 THR A OG1 1 
ATOM   666 C  CG2 . THR A 1 75 ? 6.877   3.147   13.773  1.00 5.27  ? 266 THR A CG2 1 
ATOM   667 N  N   . ILE A 1 76 ? 5.667   2.200   10.712  1.00 3.94  ? 267 ILE A N   1 
ATOM   668 C  CA  . ILE A 1 76 ? 5.477   2.912   9.459   1.00 3.90  ? 267 ILE A CA  1 
ATOM   669 C  C   . ILE A 1 76 ? 4.735   4.207   9.718   1.00 4.02  ? 267 ILE A C   1 
ATOM   670 O  O   . ILE A 1 76 ? 3.675   4.202   10.365  1.00 4.81  ? 267 ILE A O   1 
ATOM   671 C  CB  . ILE A 1 76 ? 4.724   2.063   8.428   1.00 4.26  ? 267 ILE A CB  1 
ATOM   672 C  CG1 . ILE A 1 76 ? 5.391   0.678   8.278   1.00 4.72  ? 267 ILE A CG1 1 
ATOM   673 C  CG2 . ILE A 1 76 ? 4.652   2.786   7.100   1.00 5.02  ? 267 ILE A CG2 1 
ATOM   674 C  CD1 . ILE A 1 76 ? 4.816   -0.186  7.157   1.00 5.49  ? 267 ILE A CD1 1 
ATOM   675 N  N   . THR A 1 77 ? 5.245   5.306   9.157   1.00 4.10  ? 268 THR A N   1 
ATOM   676 C  CA  . THR A 1 77 ? 4.506   6.561   9.079   1.00 4.41  ? 268 THR A CA  1 
ATOM   677 C  C   . THR A 1 77 ? 3.707   6.582   7.781   1.00 3.54  ? 268 THR A C   1 
ATOM   678 O  O   . THR A 1 77 ? 4.318   6.401   6.716   1.00 4.10  ? 268 THR A O   1 
ATOM   679 C  CB  A THR A 1 77 ? 5.465   7.816   8.930   0.66 4.34  ? 268 THR A CB  1 
ATOM   680 C  CB  B THR A 1 77 ? 5.265   7.662   9.547   0.34 6.35  ? 268 THR A CB  1 
ATOM   681 O  OG1 A THR A 1 77 ? 6.393   7.793   10.045  0.66 4.78  ? 268 THR A OG1 1 
ATOM   682 O  OG1 B THR A 1 77 ? 5.564   7.424   10.956  0.34 7.41  ? 268 THR A OG1 1 
ATOM   683 C  CG2 A THR A 1 77 ? 4.715   9.105   8.893   0.66 5.27  ? 268 THR A CG2 1 
ATOM   684 C  CG2 B THR A 1 77 ? 4.448   8.938   9.428   0.34 6.14  ? 268 THR A CG2 1 
ATOM   685 N  N   . ILE A 1 78 ? 2.413   6.815   7.890   1.00 3.55  ? 269 ILE A N   1 
ATOM   686 C  CA  . ILE A 1 78 ? 1.521   6.854   6.734   1.00 3.95  ? 269 ILE A CA  1 
ATOM   687 C  C   . ILE A 1 78 ? 0.784   8.189   6.696   1.00 3.87  ? 269 ILE A C   1 
ATOM   688 O  O   . ILE A 1 78 ? 0.539   8.835   7.699   1.00 4.87  ? 269 ILE A O   1 
ATOM   689 C  CB  . ILE A 1 78 ? 0.533   5.657   6.736   1.00 4.65  ? 269 ILE A CB  1 
ATOM   690 C  CG1 . ILE A 1 78 ? -0.448  5.711   7.883   1.00 5.14  ? 269 ILE A CG1 1 
ATOM   691 C  CG2 . ILE A 1 78 ? 1.310   4.354   6.691   1.00 5.33  ? 269 ILE A CG2 1 
ATOM   692 C  CD1 . ILE A 1 78 ? -1.526  4.614   7.852   1.00 6.04  ? 269 ILE A CD1 1 
ATOM   693 N  N   . MET A 1 79 ? 0.405   8.563   5.461   1.00 4.11  ? 270 MET A N   1 
ATOM   694 C  CA  . MET A 1 79 ? -0.335  9.786   5.168   1.00 4.42  ? 270 MET A CA  1 
ATOM   695 C  C   . MET A 1 79 ? -1.377  9.502   4.112   1.00 3.69  ? 270 MET A C   1 
ATOM   696 O  O   . MET A 1 79 ? -1.095  8.754   3.165   1.00 4.15  ? 270 MET A O   1 
ATOM   697 C  CB  . MET A 1 79 ? 0.591   10.890  4.586   1.00 5.10  ? 270 MET A CB  1 
ATOM   698 C  CG  . MET A 1 79 ? 1.383   11.609  5.599   1.00 6.91  ? 270 MET A CG  1 
ATOM   699 S  SD  A MET A 1 79 ? 0.294   12.766  6.539   0.70 5.69  ? 270 MET A SD  1 
ATOM   700 S  SD  B MET A 1 79 ? 2.553   12.667  5.213   0.30 8.96  ? 270 MET A SD  1 
ATOM   701 C  CE  A MET A 1 79 ? -0.123  14.010  5.280   0.70 6.47  ? 270 MET A CE  1 
ATOM   702 C  CE  B MET A 1 79 ? 4.022   12.535  6.265   0.30 9.10  ? 270 MET A CE  1 
ATOM   703 N  N   . PRO A 1 80 ? -2.544  10.162  4.149   1.00 3.66  ? 271 PRO A N   1 
ATOM   704 C  CA  . PRO A 1 80 ? -3.454  10.085  3.001   1.00 3.66  ? 271 PRO A CA  1 
ATOM   705 C  C   . PRO A 1 80 ? -2.764  10.608  1.754   1.00 3.53  ? 271 PRO A C   1 
ATOM   706 O  O   . PRO A 1 80 ? -1.917  11.496  1.823   1.00 3.98  ? 271 PRO A O   1 
ATOM   707 C  CB  . PRO A 1 80 ? -4.624  10.997  3.415   1.00 4.42  ? 271 PRO A CB  1 
ATOM   708 C  CG  . PRO A 1 80 ? -4.560  11.010  4.933   1.00 4.66  ? 271 PRO A CG  1 
ATOM   709 C  CD  . PRO A 1 80 ? -3.073  11.023  5.197   1.00 4.63  ? 271 PRO A CD  1 
ATOM   710 N  N   . ALA A 1 81 ? -3.189  10.113  0.582   1.00 4.20  ? 272 ALA A N   1 
ATOM   711 C  CA  . ALA A 1 81 ? -2.606  10.524  -0.684  1.00 3.96  ? 272 ALA A CA  1 
ATOM   712 C  C   . ALA A 1 81 ? -3.685  10.483  -1.760  1.00 3.63  ? 272 ALA A C   1 
ATOM   713 O  O   . ALA A 1 81 ? -4.659  9.728   -1.664  1.00 4.26  ? 272 ALA A O   1 
ATOM   714 C  CB  . ALA A 1 81 ? -1.429  9.624   -1.050  1.00 4.59  ? 272 ALA A CB  1 
ATOM   715 N  N   . PHE A 1 82 ? -3.480  11.282  -2.802  1.00 3.74  ? 273 PHE A N   1 
ATOM   716 C  CA  . PHE A 1 82 ? -4.473  11.521  -3.816  1.00 3.57  ? 273 PHE A CA  1 
ATOM   717 C  C   . PHE A 1 82 ? -3.931  11.382  -5.226  1.00 3.68  ? 273 PHE A C   1 
ATOM   718 O  O   . PHE A 1 82 ? -4.770  11.448  -6.169  1.00 4.47  ? 273 PHE A O   1 
ATOM   719 C  CB  . PHE A 1 82 ? -5.141  12.916  -3.591  1.00 4.17  ? 273 PHE A CB  1 
ATOM   720 C  CG  . PHE A 1 82 ? -5.821  12.922  -2.263  1.00 3.97  ? 273 PHE A CG  1 
ATOM   721 C  CD1 . PHE A 1 82 ? -5.127  13.263  -1.098  1.00 4.26  ? 273 PHE A CD1 1 
ATOM   722 C  CD2 . PHE A 1 82 ? -7.126  12.441  -2.146  1.00 4.46  ? 273 PHE A CD2 1 
ATOM   723 C  CE1 . PHE A 1 82 ? -5.709  13.078  0.153   1.00 4.74  ? 273 PHE A CE1 1 
ATOM   724 C  CE2 . PHE A 1 82 ? -7.687  12.261  -0.916  1.00 5.03  ? 273 PHE A CE2 1 
ATOM   725 C  CZ  . PHE A 1 82 ? -6.992  12.537  0.235   1.00 4.79  ? 273 PHE A CZ  1 
ATOM   726 O  OXT . PHE A 1 82 ? -2.689  11.229  -5.392  1.00 4.05  ? 273 PHE A OXT 1 
HETATM 727 CL CL  A CL  B 2 .  ? -9.458  18.248  8.139   0.82 5.59  ? 274 CL  A CL  1 
HETATM 728 O  O   . HOH C 3 .  ? -6.049  -8.694  2.515   1.00 4.72  ? 275 HOH A O   1 
HETATM 729 O  O   . HOH C 3 .  ? -2.740  14.140  1.468   1.00 4.64  ? 276 HOH A O   1 
HETATM 730 O  O   . HOH C 3 .  ? -4.147  7.059   -1.484  0.99 5.08  ? 277 HOH A O   1 
HETATM 731 O  O   . HOH C 3 .  ? 2.953   10.044  12.466  0.97 5.71  ? 278 HOH A O   1 
HETATM 732 O  O   . HOH C 3 .  ? 17.893  -4.084  3.896   1.00 4.89  ? 279 HOH A O   1 
HETATM 733 O  O   . HOH C 3 .  ? 15.108  -3.126  7.200   0.98 4.37  ? 280 HOH A O   1 
HETATM 734 O  O   . HOH C 3 .  ? -6.989  -11.865 5.214   0.96 5.04  ? 281 HOH A O   1 
HETATM 735 O  O   . HOH C 3 .  ? 10.116  -11.002 7.469   0.93 4.70  ? 282 HOH A O   1 
HETATM 736 O  O   . HOH C 3 .  ? 15.793  -1.716  -0.100  0.86 4.44  ? 283 HOH A O   1 
HETATM 737 O  O   . HOH C 3 .  ? -1.256  8.916   -4.605  1.00 4.67  ? 284 HOH A O   1 
HETATM 738 O  O   . HOH C 3 .  ? 16.702  -8.222  10.795  0.95 4.89  ? 285 HOH A O   1 
HETATM 739 O  O   . HOH C 3 .  ? 13.009  4.007   -12.873 0.86 5.27  ? 286 HOH A O   1 
HETATM 740 O  O   . HOH C 3 .  ? 0.947   6.461   -4.472  1.00 4.98  ? 287 HOH A O   1 
HETATM 741 O  O   . HOH C 3 .  ? 12.601  -5.467  16.093  1.00 6.46  ? 288 HOH A O   1 
HETATM 742 O  O   . HOH C 3 .  ? 13.460  -9.193  15.518  0.84 4.30  ? 289 HOH A O   1 
HETATM 743 O  O   . HOH C 3 .  ? -3.049  -12.581 10.159  0.91 5.95  ? 290 HOH A O   1 
HETATM 744 O  O   . HOH C 3 .  ? -1.639  2.351   16.041  0.87 5.66  ? 291 HOH A O   1 
HETATM 745 O  O   . HOH C 3 .  ? 0.083   12.748  14.057  0.87 5.02  ? 292 HOH A O   1 
HETATM 746 O  O   . HOH C 3 .  ? 0.972   1.755   16.476  0.92 5.26  ? 293 HOH A O   1 
HETATM 747 O  O   . HOH C 3 .  ? 7.238   3.406   -4.339  1.00 7.26  ? 294 HOH A O   1 
HETATM 748 O  O   . HOH C 3 .  ? 15.404  7.835   -4.926  1.00 5.77  ? 295 HOH A O   1 
HETATM 749 O  O   . HOH C 3 .  ? -9.185  0.849   -0.026  0.79 5.51  ? 296 HOH A O   1 
HETATM 750 O  O   . HOH C 3 .  ? 10.996  5.070   -8.955  0.75 4.65  ? 297 HOH A O   1 
HETATM 751 O  O   . HOH C 3 .  ? 12.911  5.797   -7.031  0.83 4.48  ? 298 HOH A O   1 
HETATM 752 O  O   . HOH C 3 .  ? 10.717  -11.677 12.694  0.90 5.20  ? 299 HOH A O   1 
HETATM 753 O  O   . HOH C 3 .  ? 16.124  -3.006  -2.639  0.87 5.59  ? 300 HOH A O   1 
HETATM 754 O  O   . HOH C 3 .  ? 6.270   5.581   -8.892  0.92 5.19  ? 301 HOH A O   1 
HETATM 755 O  O   . HOH C 3 .  ? 17.734  0.441   4.916   0.93 5.62  ? 302 HOH A O   1 
HETATM 756 O  O   . HOH C 3 .  ? 9.231   6.251   -5.461  0.86 4.81  ? 303 HOH A O   1 
HETATM 757 O  O   . HOH C 3 .  ? -11.221 -11.691 15.011  0.86 4.11  ? 304 HOH A O   1 
HETATM 758 O  O   . HOH C 3 .  ? 7.452   8.724   -2.612  1.00 6.13  ? 305 HOH A O   1 
HETATM 759 O  O   . HOH C 3 .  ? -7.431  -1.024  8.294   0.76 5.17  ? 306 HOH A O   1 
HETATM 760 O  O   . HOH C 3 .  ? -0.990  2.564   -6.313  0.91 6.96  ? 307 HOH A O   1 
HETATM 761 O  O   . HOH C 3 .  ? 4.835   3.577   17.925  0.85 5.94  ? 308 HOH A O   1 
HETATM 762 O  O   . HOH C 3 .  ? 2.507   -3.628  17.565  0.90 9.50  ? 309 HOH A O   1 
HETATM 763 O  O   . HOH C 3 .  ? -7.818  -5.294  -0.813  1.00 7.74  ? 310 HOH A O   1 
HETATM 764 O  O   . HOH C 3 .  ? -10.812 -10.039 11.970  0.88 5.11  ? 311 HOH A O   1 
HETATM 765 O  O   . HOH C 3 .  ? 15.304  -2.562  -5.343  0.96 8.42  ? 312 HOH A O   1 
HETATM 766 O  O   . HOH C 3 .  ? -7.783  -2.836  10.427  0.79 5.99  ? 313 HOH A O   1 
HETATM 767 O  O   . HOH C 3 .  ? -1.285  5.059   15.621  0.85 5.69  ? 314 HOH A O   1 
HETATM 768 O  O   . HOH C 3 .  ? 17.023  -4.604  8.496   0.91 9.09  ? 315 HOH A O   1 
HETATM 769 O  O   . HOH C 3 .  ? -7.434  10.669  -5.874  1.00 7.30  ? 316 HOH A O   1 
HETATM 770 O  O   . HOH C 3 .  ? -10.912 -12.950 11.098  0.73 4.31  ? 317 HOH A O   1 
HETATM 771 O  O   . HOH C 3 .  ? 14.388  -1.184  9.038   0.82 5.94  ? 318 HOH A O   1 
HETATM 772 O  O   . HOH C 3 .  ? 9.199   4.986   11.084  0.85 6.14  ? 319 HOH A O   1 
HETATM 773 O  O   . HOH C 3 .  ? -7.411  0.522   -2.022  0.69 6.49  ? 320 HOH A O   1 
HETATM 774 O  O   . HOH C 3 .  ? 1.894   6.740   17.298  0.84 4.62  ? 321 HOH A O   1 
HETATM 775 O  O   . HOH C 3 .  ? 8.172   1.930   -7.444  0.93 6.57  ? 322 HOH A O   1 
HETATM 776 O  O   . HOH C 3 .  ? -5.200  2.041   -1.746  0.78 6.26  ? 323 HOH A O   1 
HETATM 777 O  O   . HOH C 3 .  ? 0.188   -12.116 6.886   1.00 5.65  ? 324 HOH A O   1 
HETATM 778 O  O   . HOH C 3 .  ? 8.610   4.708   -7.662  0.86 4.73  ? 325 HOH A O   1 
HETATM 779 O  O   . HOH C 3 .  ? -8.569  -2.073  5.882   0.92 5.56  ? 326 HOH A O   1 
HETATM 780 O  O   . HOH C 3 .  ? -8.491  -3.515  1.261   0.92 6.03  ? 327 HOH A O   1 
HETATM 781 O  O   . HOH C 3 .  ? 8.786   -10.164 3.698   0.88 7.19  ? 328 HOH A O   1 
HETATM 782 O  O   . HOH C 3 .  ? 12.834  -3.526  14.159  0.94 8.41  ? 329 HOH A O   1 
HETATM 783 O  O   . HOH C 3 .  ? 4.108   9.095   -1.503  0.97 7.85  ? 330 HOH A O   1 
HETATM 784 O  O   . HOH C 3 .  ? -7.175  -2.099  -2.778  0.66 5.49  ? 331 HOH A O   1 
HETATM 785 O  O   . HOH C 3 .  ? 12.249  -10.461 10.775  0.82 5.92  ? 332 HOH A O   1 
HETATM 786 O  O   . HOH C 3 .  ? 5.088   11.669  11.537  0.94 6.88  ? 333 HOH A O   1 
HETATM 787 O  O   . HOH C 3 .  ? 8.942   -13.684 12.304  0.70 4.85  ? 334 HOH A O   1 
HETATM 788 O  O   . HOH C 3 .  ? 5.726   5.516   -4.971  0.89 7.44  ? 335 HOH A O   1 
HETATM 789 O  O   . HOH C 3 .  ? -7.856  -9.123  15.290  0.83 6.27  ? 336 HOH A O   1 
HETATM 790 O  O   . HOH C 3 .  ? 0.723   -10.141 11.605  0.83 6.82  ? 337 HOH A O   1 
HETATM 791 O  O   . HOH C 3 .  ? 5.129   -15.078 16.593  0.98 8.25  ? 338 HOH A O   1 
HETATM 792 O  O   . HOH C 3 .  ? -7.108  -15.128 11.435  0.76 7.66  ? 339 HOH A O   1 
HETATM 793 O  O   . HOH C 3 .  ? -5.557  2.369   -4.514  0.93 9.04  ? 340 HOH A O   1 
HETATM 794 O  O   . HOH C 3 .  ? 6.934   -13.140 15.831  1.00 10.07 ? 341 HOH A O   1 
HETATM 795 O  O   . HOH C 3 .  ? 0.721   -0.023  18.511  0.60 5.20  ? 342 HOH A O   1 
HETATM 796 O  O   . HOH C 3 .  ? 0.843   -14.674 7.640   0.92 8.08  ? 343 HOH A O   1 
HETATM 797 O  O   . HOH C 3 .  ? 3.351   -18.296 5.768   0.78 7.17  ? 344 HOH A O   1 
HETATM 798 O  O   . HOH C 3 .  ? 5.001   -20.188 15.702  0.65 6.57  ? 345 HOH A O   1 
HETATM 799 O  O   . HOH C 3 .  ? 13.737  -1.514  -10.843 0.78 7.96  ? 346 HOH A O   1 
HETATM 800 O  O   . HOH C 3 .  ? -0.386  -11.727 9.612   0.81 7.69  ? 347 HOH A O   1 
HETATM 801 O  O   . HOH C 3 .  ? -8.710  5.840   -5.381  0.55 5.22  ? 348 HOH A O   1 
HETATM 802 O  O   . HOH C 3 .  ? 16.642  6.449   3.404   0.90 9.66  ? 349 HOH A O   1 
HETATM 803 O  O   . HOH C 3 .  ? 0.269   -6.677  16.734  0.72 9.50  ? 350 HOH A O   1 
HETATM 804 O  O   . HOH C 3 .  ? 15.732  -1.906  11.280  0.71 7.49  ? 351 HOH A O   1 
HETATM 805 O  O   . HOH C 3 .  ? 5.338   -1.660  -8.312  1.00 11.15 ? 352 HOH A O   1 
HETATM 806 O  O   . HOH C 3 .  ? -8.127  -7.348  13.258  0.57 5.86  ? 353 HOH A O   1 
HETATM 807 O  O   . HOH C 3 .  ? -3.383  17.823  15.683  0.63 5.40  ? 354 HOH A O   1 
HETATM 808 O  O   . HOH C 3 .  ? -2.284  -10.617 15.426  0.78 8.77  ? 355 HOH A O   1 
HETATM 809 O  O   . HOH C 3 .  ? 12.542  -3.493  18.108  0.85 9.71  ? 356 HOH A O   1 
HETATM 810 O  O   . HOH C 3 .  ? 15.152  4.363   -6.360  0.72 6.57  ? 357 HOH A O   1 
HETATM 811 O  O   . HOH C 3 .  ? -3.514  5.572   14.074  0.93 12.22 ? 358 HOH A O   1 
HETATM 812 O  O   . HOH C 3 .  ? -2.623  9.700   8.295   0.69 7.46  ? 359 HOH A O   1 
HETATM 813 O  O   . HOH C 3 .  ? 9.583   1.210   -9.788  0.59 6.42  ? 360 HOH A O   1 
HETATM 814 O  O   . HOH C 3 .  ? 12.331  -2.633  -8.838  0.79 10.12 ? 361 HOH A O   1 
HETATM 815 O  O   . HOH C 3 .  ? -7.296  10.837  7.610   0.67 6.34  ? 362 HOH A O   1 
HETATM 816 O  O   . HOH C 3 .  ? 3.724   -20.795 13.132  0.61 8.05  ? 363 HOH A O   1 
HETATM 817 O  O   . HOH C 3 .  ? -5.115  3.950   12.349  1.00 12.70 ? 364 HOH A O   1 
HETATM 818 O  O   . HOH C 3 .  ? -9.623  -0.623  13.611  0.56 7.76  ? 365 HOH A O   1 
HETATM 819 O  O   . HOH C 3 .  ? -0.159  1.771   -8.915  0.76 8.93  ? 366 HOH A O   1 
HETATM 820 O  O   . HOH C 3 .  ? 9.597   10.538  5.504   0.75 8.97  ? 367 HOH A O   1 
HETATM 821 O  O   . HOH C 3 .  ? 3.719   15.713  9.650   0.43 6.98  ? 368 HOH A O   1 
HETATM 822 O  O   . HOH C 3 .  ? -2.977  18.176  9.662   0.81 13.02 ? 369 HOH A O   1 
HETATM 823 O  O   . HOH C 3 .  ? 2.669   -15.080 15.529  0.46 6.86  ? 370 HOH A O   1 
HETATM 824 O  O   . HOH C 3 .  ? -6.051  0.298   15.651  0.66 10.33 ? 371 HOH A O   1 
HETATM 825 O  O   . HOH C 3 .  ? 5.764   -20.255 11.209  0.58 9.42  ? 372 HOH A O   1 
HETATM 826 O  O   . HOH C 3 .  ? 16.111  2.718   10.459  0.63 8.52  ? 373 HOH A O   1 
HETATM 827 O  O   . HOH C 3 .  ? 9.190   9.070   12.986  0.67 7.62  ? 374 HOH A O   1 
HETATM 828 O  O   . HOH C 3 .  ? 16.027  -0.454  -9.630  0.66 8.32  ? 375 HOH A O   1 
HETATM 829 O  O   . HOH C 3 .  ? 5.570   1.634   -8.325  0.89 12.33 ? 376 HOH A O   1 
HETATM 830 O  O   . HOH C 3 .  ? -3.826  -13.181 14.652  0.65 9.66  ? 377 HOH A O   1 
HETATM 831 O  O   . HOH C 3 .  ? 16.182  -0.043  -6.767  0.82 13.20 ? 378 HOH A O   1 
HETATM 832 O  O   . HOH C 3 .  ? 14.006  -1.179  15.107  0.51 10.71 ? 379 HOH A O   1 
HETATM 833 O  O   . HOH C 3 .  ? 16.032  8.545   6.924   0.65 12.14 ? 380 HOH A O   1 
HETATM 834 O  O   . HOH C 3 .  ? 7.405   -18.088 6.495   0.63 10.62 ? 381 HOH A O   1 
HETATM 835 O  O   . HOH C 3 .  ? 16.296  -6.815  -4.362  0.67 11.92 ? 382 HOH A O   1 
HETATM 836 O  O   . HOH C 3 .  ? 14.466  12.858  6.028   0.77 21.52 ? 383 HOH A O   1 
HETATM 837 O  O   . HOH C 3 .  ? 5.248   13.416  9.448   0.82 15.25 ? 384 HOH A O   1 
HETATM 838 O  O   . HOH C 3 .  ? 16.664  5.424   10.448  0.49 7.62  ? 385 HOH A O   1 
HETATM 839 O  O   . HOH C 3 .  ? 12.321  10.281  11.650  0.46 8.11  ? 386 HOH A O   1 
HETATM 840 O  O   . HOH C 3 .  ? -7.991  9.857   5.009   0.80 12.13 ? 387 HOH A O   1 
HETATM 841 O  O   . HOH C 3 .  ? -5.920  20.381  12.402  0.72 16.42 ? 388 HOH A O   1 
HETATM 842 O  O   . HOH C 3 .  ? 16.082  -4.977  -6.281  0.35 7.41  ? 389 HOH A O   1 
HETATM 843 O  O   . HOH C 3 .  ? 2.230   -18.385 15.926  0.61 12.80 ? 390 HOH A O   1 
HETATM 844 O  O   . HOH C 3 .  ? -6.014  -2.891  -5.167  0.68 15.22 ? 391 HOH A O   1 
HETATM 845 O  O   . HOH C 3 .  ? 11.540  10.501  7.549   0.78 14.40 ? 392 HOH A O   1 
HETATM 846 O  O   . HOH C 3 .  ? 7.096   -2.255  19.974  0.83 22.39 ? 393 HOH A O   1 
HETATM 847 O  O   . HOH C 3 .  ? -0.183  -11.667 13.904  0.89 25.51 ? 394 HOH A O   1 
HETATM 848 O  O   . HOH C 3 .  ? 2.084   -6.841  19.009  0.50 10.62 ? 395 HOH A O   1 
HETATM 849 O  O   . HOH C 3 .  ? 1.670   -16.499 12.917  0.62 17.24 ? 396 HOH A O   1 
HETATM 850 O  O   . HOH C 3 .  ? -6.604  2.712   14.615  0.62 20.88 ? 397 HOH A O   1 
HETATM 851 O  O   . HOH C 3 .  ? 8.145   -4.381  20.904  0.56 10.74 ? 398 HOH A O   1 
HETATM 852 O  O   . HOH C 3 .  ? 15.535  7.235   12.622  0.47 20.98 ? 399 HOH A O   1 
HETATM 853 O  O   . HOH C 3 .  ? -5.260  -15.243 13.594  0.46 15.65 ? 400 HOH A O   1 
HETATM 854 O  O   . HOH C 3 .  ? 3.341   -10.622 16.214  0.71 26.07 ? 401 HOH A O   1 
HETATM 855 O  O   . HOH C 3 .  ? 7.341   10.879  7.377   0.94 19.55 ? 402 HOH A O   1 
HETATM 856 O  O   . HOH C 3 .  ? 4.192   2.295   -10.443 0.34 7.21  ? 403 HOH A O   1 
HETATM 857 O  O   . HOH C 3 .  ? 8.998   11.367  9.379   0.41 9.32  ? 404 HOH A O   1 
HETATM 858 O  O   . HOH C 3 .  ? -3.874  -0.997  -6.970  0.64 23.50 ? 405 HOH A O   1 
HETATM 859 O  O   . HOH C 3 .  ? 14.935  9.318   11.626  0.54 12.66 ? 406 HOH A O   1 
HETATM 860 O  O   . HOH C 3 .  ? 2.082   0.828   -10.190 0.70 12.12 ? 407 HOH A O   1 
HETATM 861 O  O   . HOH C 3 .  ? -6.505  -5.674  -3.294  0.88 23.85 ? 408 HOH A O   1 
HETATM 862 O  O   . HOH C 3 .  ? 7.202   15.152  6.713   0.70 26.09 ? 409 HOH A O   1 
HETATM 863 O  O   . HOH C 3 .  ? -8.904  9.396   10.311  0.23 5.59  ? 410 HOH A O   1 
HETATM 864 O  O   . HOH C 3 .  ? 1.838   -10.473 14.447  0.43 10.81 ? 411 HOH A O   1 
HETATM 865 O  O   . HOH C 3 .  ? -14.203 -13.566 10.069  0.45 12.23 ? 412 HOH A O   1 
HETATM 866 O  O   . HOH C 3 .  ? 12.069  13.120  6.925   0.44 19.04 ? 413 HOH A O   1 
HETATM 867 O  O   . HOH C 3 .  ? 2.950   4.860   -11.587 0.60 20.91 ? 414 HOH A O   1 
HETATM 868 O  O   . HOH C 3 .  ? 1.708   -19.115 12.316  0.88 20.90 ? 415 HOH A O   1 
HETATM 869 O  O   . HOH C 3 .  ? 0.098   17.834  12.678  0.72 35.49 ? 416 HOH A O   1 
HETATM 870 O  O   . HOH C 3 .  ? -7.759  4.068   12.284  0.76 20.51 ? 417 HOH A O   1 
HETATM 871 O  O   . HOH C 3 .  ? -0.097  -9.440  16.235  0.36 13.19 ? 418 HOH A O   1 
HETATM 872 O  O   . HOH C 3 .  ? 11.946  -5.319  -9.090  0.55 22.99 ? 419 HOH A O   1 
HETATM 873 O  O   . HOH C 3 .  ? -8.815  5.621   14.166  0.87 28.12 ? 420 HOH A O   1 
HETATM 874 O  O   . HOH C 3 .  ? 4.300   -6.328  21.920  0.42 12.89 ? 421 HOH A O   1 
HETATM 875 O  O   . HOH C 3 .  ? -10.565 13.252  10.176  0.63 21.46 ? 422 HOH A O   1 
HETATM 876 O  O   . HOH C 3 .  ? -3.859  -5.140  -3.149  0.45 20.36 ? 423 HOH A O   1 
HETATM 877 O  O   . HOH C 3 .  ? -2.622  19.397  12.650  0.70 29.71 ? 424 HOH A O   1 
HETATM 878 O  O   . HOH C 3 .  ? 6.963   12.173  4.560   0.52 22.15 ? 425 HOH A O   1 
HETATM 879 O  O   . HOH C 3 .  ? 1.629   1.502   -13.705 1.00 53.70 ? 426 HOH A O   1 
HETATM 880 O  O   . HOH C 3 .  ? 16.879  1.863   12.955  0.58 32.03 ? 427 HOH A O   1 
HETATM 881 O  O   . HOH C 3 .  ? -8.504  10.431  10.253  0.16 4.13  ? 428 HOH A O   1 
HETATM 882 O  O   . HOH C 3 .  ? 14.486  1.282   7.774   0.44 8.05  ? 429 HOH A O   1 
HETATM 883 O  O   . HOH C 3 .  ? 10.094  -17.771 7.876   1.00 83.77 ? 430 HOH A O   1 
HETATM 884 O  O   . HOH C 3 .  ? 5.710   12.775  6.970   0.62 15.75 ? 431 HOH A O   1 
HETATM 885 O  O   . HOH C 3 .  ? 7.390   5.809   -0.313  0.45 10.99 ? 432 HOH A O   1 
HETATM 886 O  O   . HOH C 3 .  ? 16.908  -5.812  12.474  0.28 5.07  ? 433 HOH A O   1 
HETATM 887 O  O   . HOH C 3 .  ? 2.830   14.573  7.394   0.53 20.50 ? 434 HOH A O   1 
HETATM 888 O  O   . HOH C 3 .  ? 14.930  -4.184  12.769  0.53 5.09  ? 435 HOH A O   1 
HETATM 889 O  O   . HOH C 3 .  ? 16.191  0.890   8.364   0.56 5.68  ? 436 HOH A O   1 
HETATM 890 O  O   . HOH C 3 .  ? 5.750   7.086   -0.769  0.33 7.78  ? 437 HOH A O   1 
HETATM 891 O  O   . HOH C 3 .  ? 8.310   5.710   -1.853  0.22 5.96  ? 438 HOH A O   1 
HETATM 892 O  O   . HOH C 3 .  ? -1.515  14.414  15.648  0.45 4.51  ? 439 HOH A O   1 
HETATM 893 O  O   . HOH C 3 .  ? 7.364   10.180  11.163  0.58 7.27  ? 440 HOH A O   1 
HETATM 894 O  O   . HOH C 3 .  ? -8.493  7.362   8.503   0.45 6.57  ? 441 HOH A O   1 
HETATM 895 O  O   . HOH C 3 .  ? 1.493   -12.575 15.832  0.56 13.72 ? 442 HOH A O   1 
HETATM 896 O  O   . HOH C 3 .  ? 8.071   2.113   -11.912 0.56 4.93  ? 443 HOH A O   1 
HETATM 897 O  O   . HOH C 3 .  ? 6.291   6.493   12.413  0.51 4.09  ? 444 HOH A O   1 
HETATM 898 O  O   . HOH C 3 .  ? -3.964  -1.372  -9.201  0.41 10.97 ? 445 HOH A O   1 
HETATM 899 O  O   . HOH C 3 .  ? 10.139  -15.456 8.966   0.33 4.90  ? 446 HOH A O   1 
HETATM 900 O  O   . HOH C 3 .  ? -6.014  9.020   1.033   0.48 5.51  ? 447 HOH A O   1 
HETATM 901 O  O   . HOH C 3 .  ? 9.157   -17.681 10.398  0.52 6.06  ? 448 HOH A O   1 
HETATM 902 O  O   . HOH C 3 .  ? -0.551  -14.515 12.346  0.48 30.62 ? 449 HOH A O   1 
HETATM 903 O  O   . HOH C 3 .  ? 14.696  3.383   14.870  0.66 70.20 ? 450 HOH A O   1 
HETATM 904 O  O   . HOH C 3 .  ? 14.199  10.242  8.231   0.69 28.18 ? 451 HOH A O   1 
HETATM 905 O  O   . HOH C 3 .  ? 12.486  -8.542  -0.083  0.56 4.86  ? 452 HOH A O   1 
HETATM 906 O  O   . HOH C 3 .  ? 14.453  7.926   0.653   0.45 4.67  ? 453 HOH A O   1 
HETATM 907 O  O   . HOH C 3 .  ? -2.580  -7.601  19.219  0.67 15.67 ? 454 HOH A O   1 
HETATM 908 O  O   . HOH C 3 .  ? -10.001 11.657  8.017   0.21 3.67  ? 455 HOH A O   1 
HETATM 909 O  O   . HOH C 3 .  ? -8.020  9.463   2.863   0.57 9.10  ? 456 HOH A O   1 
HETATM 910 O  O   . HOH C 3 .  ? 15.796  11.294  1.500   0.48 6.35  ? 457 HOH A O   1 
HETATM 911 O  O   . HOH C 3 .  ? -9.459  7.646   0.869   0.39 8.72  ? 458 HOH A O   1 
HETATM 912 O  O   . HOH C 3 .  ? 0.110   -3.978  19.122  0.37 7.71  ? 459 HOH A O   1 
HETATM 913 O  O   . HOH C 3 .  ? 3.907   16.333  6.143   0.45 10.05 ? 460 HOH A O   1 
HETATM 914 O  O   . HOH C 3 .  ? 5.831   6.811   -2.176  0.43 6.46  ? 461 HOH A O   1 
HETATM 915 O  O   . HOH C 3 .  ? 13.983  8.912   0.919   0.46 5.80  ? 462 HOH A O   1 
HETATM 916 O  O   . HOH C 3 .  ? -2.175  -6.487  18.777  0.45 4.21  ? 463 HOH A O   1 
HETATM 917 O  O   . HOH C 3 .  ? 11.381  -8.131  -0.368  0.52 6.10  ? 464 HOH A O   1 
HETATM 918 O  O   . HOH C 3 .  ? 16.486  12.191  3.949   0.44 10.15 ? 465 HOH A O   1 
HETATM 919 O  O   . HOH C 3 .  ? -1.131  -4.613  18.951  0.41 15.12 ? 466 HOH A O   1 
HETATM 920 O  O   . HOH C 3 .  ? -3.372  -4.210  -4.746  0.65 21.72 ? 467 HOH A O   1 
HETATM 921 O  O   . HOH C 3 .  ? 4.323   6.593   -3.094  0.35 6.20  ? 468 HOH A O   1 
HETATM 922 O  O   . HOH C 3 .  ? 16.098  11.606  2.688   0.48 7.76  ? 469 HOH A O   1 
HETATM 923 O  O   . HOH C 3 .  ? -8.873  8.956   0.587   0.39 4.20  ? 470 HOH A O   1 
HETATM 924 O  O   . HOH C 3 .  ? -9.867  13.038  4.832   0.43 12.42 ? 471 HOH A O   1 
HETATM 925 O  O   . HOH C 3 .  ? -7.224  8.327   2.697   0.44 4.49  ? 472 HOH A O   1 
HETATM 926 O  O   . HOH C 3 .  ? 14.873  -3.871  12.089  0.44 8.39  ? 473 HOH A O   1 
HETATM 927 O  O   . HOH C 3 .  ? -9.519  0.175   9.535   0.29 9.39  ? 474 HOH A O   1 
HETATM 928 O  O   . HOH C 3 .  ? 17.152  7.189   9.392   0.62 14.43 ? 475 HOH A O   1 
HETATM 929 O  O   . HOH C 3 .  ? -2.156  13.450  15.291  0.28 4.42  ? 476 HOH A O   1 
HETATM 930 O  O   . HOH C 3 .  ? 7.595   10.325  10.130  0.30 7.23  ? 477 HOH A O   1 
HETATM 931 O  O   . HOH C 3 .  ? 2.822   -13.284 16.080  0.65 21.57 ? 478 HOH A O   1 
HETATM 932 O  O   . HOH C 3 .  ? -7.696  8.373   -1.132  0.44 5.51  ? 479 HOH A O   1 
HETATM 933 O  O   . HOH C 3 .  ? -7.364  8.823   -1.753  0.40 4.04  ? 480 HOH A O   1 
HETATM 934 O  O   . HOH C 3 .  ? -5.964  8.653   8.506   0.52 5.24  ? 481 HOH A O   1 
HETATM 935 O  O   . HOH C 3 .  ? -5.154  8.977   8.279   0.51 8.52  ? 482 HOH A O   1 
HETATM 936 O  O   . HOH C 3 .  ? 14.642  -2.007  9.615   0.13 4.54  ? 483 HOH A O   1 
HETATM 937 O  O   . HOH C 3 .  ? -0.710  14.465  4.907   0.21 5.06  ? 484 HOH A O   1 
HETATM 938 O  O   . HOH C 3 .  ? 16.420  8.026   5.990   0.23 5.10  ? 485 HOH A O   1 
HETATM 939 O  O   . HOH C 3 .  ? -8.511  10.622  5.479   0.38 9.44  ? 486 HOH A O   1 
HETATM 940 O  O   . HOH C 3 .  ? 4.845   -20.475 6.621   0.40 14.68 ? 487 HOH A O   1 
HETATM 941 O  O   . HOH C 3 .  ? -9.176  5.173   -5.021  0.50 14.94 ? 488 HOH A O   1 
HETATM 942 O  O   . HOH C 3 .  ? 10.111  12.258  4.065   0.23 4.70  ? 489 HOH A O   1 
HETATM 943 O  O   . HOH C 3 .  ? -6.758  11.749  7.318   0.12 6.41  ? 490 HOH A O   1 
HETATM 944 O  O   . HOH C 3 .  ? -8.005  4.986   11.309  0.30 8.45  ? 491 HOH A O   1 
HETATM 945 O  O   . HOH C 3 .  ? -1.231  -8.285  16.647  0.35 15.63 ? 492 HOH A O   1 
HETATM 946 O  O   . HOH C 3 .  ? 1.294   -6.112  17.020  0.17 8.97  ? 493 HOH A O   1 
HETATM 947 O  O   . HOH C 3 .  ? -7.929  11.785  6.666   0.14 7.18  ? 494 HOH A O   1 
HETATM 948 O  O   . HOH C 3 .  ? -0.289  -3.223  19.848  0.20 9.58  ? 495 HOH A O   1 
HETATM 949 O  O   . HOH C 3 .  ? -9.379  -0.383  0.483   0.20 9.08  ? 496 HOH A O   1 
HETATM 950 O  O   . HOH C 3 .  ? 3.181   14.863  8.332   0.17 8.36  ? 497 HOH A O   1 
HETATM 951 O  O   . HOH C 3 .  ? -6.693  -0.376  -4.900  0.33 12.92 ? 498 HOH A O   1 
HETATM 952 O  O   . HOH C 3 .  ? -1.631  -3.666  -4.777  0.30 10.04 ? 499 HOH A O   1 
HETATM 953 O  O   . HOH C 3 .  ? 8.812   -13.862 13.381  0.40 17.13 ? 500 HOH A O   1 
HETATM 954 O  O   . HOH C 3 .  ? 4.891   12.719  3.593   0.78 42.56 ? 501 HOH A O   1 
HETATM 955 O  O   . HOH C 3 .  ? 1.580   -0.477  18.380  0.29 11.77 ? 502 HOH A O   1 
HETATM 956 O  O   . HOH C 3 .  ? -0.025  -15.848 10.733  0.23 5.58  ? 503 HOH A O   1 
HETATM 957 O  O   . HOH C 3 .  ? 18.023  0.124   5.873   0.13 7.39  ? 504 HOH A O   1 
HETATM 958 O  O   . HOH C 3 .  ? 8.540   4.858   10.714  0.26 14.90 ? 505 HOH A O   1 
HETATM 959 O  O   . HOH C 3 .  ? -6.929  -0.343  -1.730  0.22 12.39 ? 506 HOH A O   1 
HETATM 960 O  O   . HOH C 3 .  ? 6.257   -19.748 8.241   0.18 11.30 ? 507 HOH A O   1 
HETATM 961 O  O   . HOH C 3 .  ? 0.986   14.007  7.536   0.21 9.12  ? 508 HOH A O   1 
HETATM 962 O  O   . HOH C 3 .  ? 8.149   7.276   11.498  0.15 17.25 ? 509 HOH A O   1 
HETATM 963 O  O   . HOH C 3 .  ? 13.856  -8.345  15.982  0.29 16.24 ? 510 HOH A O   1 
HETATM 964 O  O   . HOH C 3 .  ? 4.272   0.767   -10.242 0.12 7.02  ? 511 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N  N   A GLY A 1  ? 0.1105 0.0949 0.1058 0.0339  0.0378  0.0380  192 GLY A N   
2   N  N   B GLY A 1  ? 0.1597 0.1148 0.1131 0.0645  0.0367  0.0094  192 GLY A N   
3   C  CA  A GLY A 1  ? 0.0923 0.2144 0.0788 0.0707  -0.0189 -0.0537 192 GLY A CA  
4   C  CA  B GLY A 1  ? 0.2600 0.0989 0.0871 0.0363  -0.0328 -0.0284 192 GLY A CA  
5   C  C   A GLY A 1  ? 0.0707 0.1625 0.0553 0.0554  0.0028  -0.0087 192 GLY A C   
6   C  C   B GLY A 1  ? 0.1978 0.1244 0.1444 0.0526  -0.0356 0.0913  192 GLY A C   
7   O  O   A GLY A 1  ? 0.0744 0.1681 0.0565 0.0577  0.0060  0.0071  192 GLY A O   
8   O  O   B GLY A 1  ? 0.2617 0.2043 0.0459 -0.1001 -0.0464 -0.0495 192 GLY A O   
9   N  N   A ALA A 2  ? 0.0592 0.1228 0.0619 0.0325  0.0033  0.0053  193 ALA A N   
10  N  N   B ALA A 2  ? 0.2170 0.2154 0.0941 0.1083  -0.0148 -0.0486 193 ALA A N   
11  C  CA  A ALA A 2  ? 0.0478 0.0919 0.0793 0.0050  0.0014  0.0148  193 ALA A CA  
12  C  CA  B ALA A 2  ? 0.1796 0.1082 0.0423 0.1078  -0.0170 -0.0238 193 ALA A CA  
13  C  C   A ALA A 2  ? 0.0517 0.0592 0.0648 -0.0053 -0.0038 0.0075  193 ALA A C   
14  C  C   B ALA A 2  ? 0.1157 0.0655 0.0941 -0.0248 -0.0291 0.0085  193 ALA A C   
15  O  O   A ALA A 2  ? 0.0710 0.0535 0.0852 -0.0093 0.0058  0.0022  193 ALA A O   
16  O  O   B ALA A 2  ? 0.1338 0.0817 0.1168 0.0321  0.0423  -0.0034 193 ALA A O   
17  C  CB  A ALA A 2  ? 0.0662 0.0959 0.1175 -0.0096 -0.0277 0.0193  193 ALA A CB  
18  C  CB  B ALA A 2  ? 0.1998 0.2735 0.0318 -0.1005 0.0136  0.0350  193 ALA A CB  
19  N  N   A MET A 3  ? 0.0490 0.0470 0.0547 0.0040  0.0037  0.0058  194 MET A N   
20  N  N   B MET A 3  ? 0.0706 0.0550 0.0689 0.0150  0.0002  -0.0121 194 MET A N   
21  C  CA  A MET A 3  ? 0.0536 0.0488 0.0520 0.0069  0.0010  0.0060  194 MET A CA  
22  C  CA  B MET A 3  ? 0.1335 0.0794 0.0614 -0.0052 0.0091  -0.0085 194 MET A CA  
23  C  C   A MET A 3  ? 0.0488 0.0533 0.0759 0.0108  -0.0007 0.0159  194 MET A C   
24  C  C   B MET A 3  ? 0.1157 0.0947 0.0982 0.0290  0.0150  0.0346  194 MET A C   
25  O  O   A MET A 3  ? 0.0514 0.1030 0.0839 0.0218  0.0118  0.0400  194 MET A O   
26  O  O   B MET A 3  ? 0.0895 0.1483 0.1310 -0.0613 -0.0209 0.0305  194 MET A O   
27  C  CB  A MET A 3  ? 0.0530 0.0465 0.0558 0.0033  0.0039  0.0087  194 MET A CB  
28  C  CB  B MET A 3  ? 0.0875 0.0601 0.0549 0.0147  0.0005  -0.0363 194 MET A CB  
29  C  CG  A MET A 3  ? 0.0608 0.0487 0.0588 0.0098  0.0045  0.0035  194 MET A CG  
30  C  CG  B MET A 3  ? 0.0661 0.2135 0.0584 0.0414  0.0014  0.0664  194 MET A CG  
31  S  SD  A MET A 3  ? 0.0654 0.0534 0.0730 0.0038  -0.0050 -0.0041 194 MET A SD  
32  S  SD  B MET A 3  ? 0.0611 0.1762 0.0649 0.0371  -0.0079 -0.0155 194 MET A SD  
33  C  CE  A MET A 3  ? 0.0837 0.1225 0.1037 0.0052  -0.0281 -0.0423 194 MET A CE  
34  C  CE  B MET A 3  ? 0.1530 0.0778 0.0743 -0.0027 -0.0453 -0.0236 194 MET A CE  
35  N  N   A ASP A 4  ? 0.0449 0.0444 0.0637 0.0069  -0.0030 0.0090  195 ASP A N   
36  N  N   B ASP A 4  ? 0.1036 0.0731 0.0580 0.0058  -0.0060 -0.0105 195 ASP A N   
37  C  CA  A ASP A 4  ? 0.0521 0.0436 0.0685 0.0051  -0.0087 0.0092  195 ASP A CA  
38  C  CA  B ASP A 4  ? 0.1316 0.1219 0.0591 0.0522  0.0021  0.0225  195 ASP A CA  
39  C  C   A ASP A 4  ? 0.0500 0.0469 0.0592 0.0040  -0.0091 0.0044  195 ASP A C   
40  C  C   B ASP A 4  ? 0.0944 0.0340 0.0635 0.0001  0.0154  -0.0012 195 ASP A C   
41  O  O   A ASP A 4  ? 0.0541 0.0472 0.0692 0.0014  -0.0090 0.0020  195 ASP A O   
42  O  O   B ASP A 4  ? 0.0915 0.1125 0.0720 -0.0157 -0.0100 -0.0209 195 ASP A O   
43  C  CB  A ASP A 4  ? 0.0671 0.0510 0.0619 0.0111  -0.0080 0.0025  195 ASP A CB  
44  C  CG  A ASP A 4  ? 0.0631 0.0627 0.0448 -0.0027 -0.0015 0.0056  195 ASP A CG  
45  C  CG  C ASP A 4  ? 0.0872 0.0781 0.0749 -0.0007 -0.0263 0.0029  195 ASP A CG  
46  O  OD1 A ASP A 4  ? 0.1072 0.0562 0.0624 0.0111  -0.0107 -0.0037 195 ASP A OD1 
47  O  OD1 C ASP A 4  ? 0.0960 0.0474 0.0847 0.0036  -0.0225 -0.0004 195 ASP A OD1 
48  O  OD2 A ASP A 4  ? 0.1472 0.0874 0.0578 0.0178  -0.0437 -0.0159 195 ASP A OD2 
49  O  OD2 C ASP A 4  ? 0.0709 0.1207 0.0758 0.0495  0.0282  0.0182  195 ASP A OD2 
50  N  N   A PRO A 5  ? 0.0482 0.0407 0.0631 0.0057  -0.0035 0.0070  196 PRO A N   
51  N  N   B PRO A 5  ? 0.2271 0.0739 0.0369 0.0146  -0.0314 0.0074  196 PRO A N   
52  C  CA  A PRO A 5  ? 0.0507 0.0455 0.0530 0.0053  -0.0018 0.0054  196 PRO A CA  
53  C  CA  B PRO A 5  ? 0.1044 0.0603 0.0997 0.0098  -0.0361 -0.0069 196 PRO A CA  
54  C  C   A PRO A 5  ? 0.0410 0.0412 0.0476 0.0042  -0.0038 -0.0009 196 PRO A C   
55  C  C   B PRO A 5  ? 0.0919 0.0575 0.0662 0.0269  -0.0089 0.0016  196 PRO A C   
56  O  O   A PRO A 5  ? 0.0553 0.0424 0.0504 0.0056  0.0047  -0.0020 196 PRO A O   
57  O  O   B PRO A 5  ? 0.1385 0.0717 0.0902 0.0178  -0.0105 -0.0186 196 PRO A O   
58  C  CB  A PRO A 5  ? 0.0464 0.0564 0.0657 0.0037  0.0019  0.0098  196 PRO A CB  
59  C  CB  B PRO A 5  ? 0.0977 0.0932 0.0607 0.0032  0.0226  -0.0278 196 PRO A CB  
60  C  CG  A PRO A 5  ? 0.0488 0.0505 0.0829 0.0013  -0.0079 0.0075  196 PRO A CG  
61  C  CG  B PRO A 5  ? 0.1020 0.1410 0.1047 -0.0217 0.0125  -0.0446 196 PRO A CG  
62  C  CD  A PRO A 5  ? 0.0585 0.0501 0.0789 0.0002  -0.0106 0.0053  196 PRO A CD  
63  C  CD  B PRO A 5  ? 0.2242 0.0911 0.0815 0.0589  -0.0731 -0.0073 196 PRO A CD  
64  N  N   A ARG A 6  ? 0.0474 0.0392 0.0474 0.0032  0.0020  0.0001  197 ARG A N   
65  N  N   B ARG A 6  ? 0.0838 0.0684 0.0919 0.0017  0.0239  0.0490  197 ARG A N   
66  C  CA  A ARG A 6  ? 0.0479 0.0307 0.0472 0.0027  -0.0013 -0.0026 197 ARG A CA  
67  C  CA  B ARG A 6  ? 0.0858 0.0506 0.0441 0.0277  0.0169  -0.0083 197 ARG A CA  
68  C  C   A ARG A 6  ? 0.0458 0.0405 0.0432 0.0000  0.0043  -0.0043 197 ARG A C   
69  C  C   B ARG A 6  ? 0.1411 0.0308 0.0405 0.0280  0.0012  -0.0242 197 ARG A C   
70  O  O   A ARG A 6  ? 0.0528 0.0615 0.0406 0.0158  0.0011  -0.0012 197 ARG A O   
71  O  O   B ARG A 6  ? 0.0707 0.0797 0.0412 0.0211  -0.0105 -0.0100 197 ARG A O   
72  C  CB  A ARG A 6  ? 0.0422 0.0393 0.0648 0.0025  0.0010  -0.0045 197 ARG A CB  
73  C  CB  B ARG A 6  ? 0.1044 0.1054 0.0920 -0.0462 0.0185  0.0274  197 ARG A CB  
74  C  CG  A ARG A 6  ? 0.0462 0.0432 0.0636 0.0011  0.0040  0.0043  197 ARG A CG  
75  C  CG  B ARG A 6  ? 0.1170 0.0666 0.1689 -0.0059 -0.0521 -0.0181 197 ARG A CG  
76  C  CD  A ARG A 6  ? 0.0486 0.0523 0.0702 0.0003  -0.0068 -0.0024 197 ARG A CD  
77  C  CD  B ARG A 6  ? 0.1292 0.0551 0.2079 -0.0411 0.0034  0.0456  197 ARG A CD  
78  N  NE  A ARG A 6  ? 0.0491 0.0657 0.0787 -0.0012 -0.0071 0.0092  197 ARG A NE  
79  N  NE  B ARG A 6  ? 0.2739 0.1292 0.1388 0.1035  -0.0371 -0.0627 197 ARG A NE  
80  C  CZ  A ARG A 6  ? 0.0490 0.0512 0.1008 -0.0027 0.0058  -0.0041 197 ARG A CZ  
81  C  CZ  B ARG A 6  ? 0.1897 0.1921 0.0673 -0.0461 -0.0240 -0.0663 197 ARG A CZ  
82  N  NH1 A ARG A 6  ? 0.0665 0.0805 0.0876 0.0019  0.0075  0.0080  197 ARG A NH1 
83  N  NH1 B ARG A 6  ? 0.0682 0.1927 0.1552 0.0355  -0.0296 -0.0125 197 ARG A NH1 
84  N  NH2 A ARG A 6  ? 0.0555 0.0767 0.1128 0.0089  0.0041  -0.0025 197 ARG A NH2 
85  N  NH2 B ARG A 6  ? 0.1299 0.1792 0.0589 0.0794  -0.0403 -0.0136 197 ARG A NH2 
86  N  N   A THR A 7  ? 0.0523 0.0398 0.0408 0.0019  0.0005  -0.0042 198 THR A N   
87  N  N   B THR A 7  ? 0.0725 0.0170 0.0303 0.0127  0.0012  -0.0139 198 THR A N   
88  C  CA  A THR A 7  ? 0.0516 0.0398 0.0395 0.0023  0.0041  0.0026  198 THR A CA  
89  C  CA  B THR A 7  ? 0.0771 0.0428 0.0527 0.0013  -0.0099 -0.0176 198 THR A CA  
90  C  C   A THR A 7  ? 0.0491 0.0455 0.0438 -0.0022 0.0015  -0.0035 198 THR A C   
91  C  C   B THR A 7  ? 0.0432 0.0498 0.0451 0.0249  0.0138  0.0162  198 THR A C   
92  O  O   A THR A 7  ? 0.0523 0.0448 0.0437 -0.0024 0.0108  -0.0053 198 THR A O   
93  O  O   B THR A 7  ? 0.3674 0.0294 0.0697 0.0373  0.0036  0.0319  198 THR A O   
94  C  CB  A THR A 7  ? 0.0564 0.0436 0.0454 -0.0025 -0.0009 0.0045  198 THR A CB  
95  C  CB  B THR A 7  ? 0.1081 0.1119 0.0203 -0.0376 0.0080  0.0270  198 THR A CB  
96  O  OG1 A THR A 7  ? 0.0497 0.0434 0.0730 -0.0040 -0.0017 -0.0040 198 THR A OG1 
97  O  OG1 B THR A 7  ? 0.2143 0.0876 0.1601 -0.0495 -0.1510 0.0368  198 THR A OG1 
98  C  CG2 A THR A 7  ? 0.0672 0.0608 0.0858 -0.0012 -0.0225 0.0061  198 THR A CG2 
99  C  CG2 B THR A 7  ? 0.0606 0.1305 0.0360 -0.0449 -0.0011 0.0255  198 THR A CG2 
100 N  N   . ILE A 8  ? 0.0495 0.0394 0.0438 0.0004  0.0046  0.0012  199 ILE A N   
101 C  CA  . ILE A 8  ? 0.0435 0.0361 0.0560 -0.0024 0.0040  0.0016  199 ILE A CA  
102 C  C   . ILE A 8  ? 0.0476 0.0382 0.0575 -0.0005 -0.0002 -0.0006 199 ILE A C   
103 O  O   . ILE A 8  ? 0.0449 0.0523 0.0616 0.0068  0.0073  0.0072  199 ILE A O   
104 C  CB  . ILE A 8  ? 0.0460 0.0447 0.0652 0.0032  -0.0005 -0.0046 199 ILE A CB  
105 C  CG1 . ILE A 8  ? 0.0549 0.0557 0.0648 0.0012  -0.0076 -0.0047 199 ILE A CG1 
106 C  CG2 . ILE A 8  ? 0.0498 0.0424 0.0932 -0.0024 0.0008  -0.0071 199 ILE A CG2 
107 C  CD1 . ILE A 8  ? 0.0480 0.0567 0.0805 0.0055  -0.0029 -0.0022 199 ILE A CD1 
108 N  N   . THR A 9  ? 0.0519 0.0446 0.0559 0.0068  0.0047  0.0012  200 THR A N   
109 C  CA  . THR A 9  ? 0.0564 0.0403 0.0580 0.0024  0.0001  0.0048  200 THR A CA  
110 C  C   . THR A 9  ? 0.0460 0.0440 0.0561 0.0034  0.0005  0.0036  200 THR A C   
111 O  O   . THR A 9  ? 0.0620 0.0440 0.0849 0.0015  0.0200  -0.0001 200 THR A O   
112 C  CB  . THR A 9  ? 0.0552 0.0592 0.0582 0.0006  0.0032  -0.0018 200 THR A CB  
113 O  OG1 . THR A 9  ? 0.0635 0.0618 0.0981 -0.0036 -0.0067 -0.0099 200 THR A OG1 
114 C  CG2 . THR A 9  ? 0.0671 0.0827 0.0687 0.0070  -0.0125 0.0081  200 THR A CG2 
115 N  N   . MET A 10 ? 0.0424 0.0462 0.0570 0.0013  -0.0005 0.0002  201 MET A N   
116 C  CA  . MET A 10 ? 0.0436 0.0422 0.0595 0.0033  0.0043  -0.0029 201 MET A CA  
117 C  C   . MET A 10 ? 0.0453 0.0461 0.0553 0.0033  0.0000  -0.0009 201 MET A C   
118 O  O   . MET A 10 ? 0.0492 0.0540 0.0788 0.0011  -0.0003 0.0119  201 MET A O   
119 C  CB  . MET A 10 ? 0.0497 0.0399 0.0592 0.0047  -0.0003 0.0020  201 MET A CB  
120 C  CG  . MET A 10 ? 0.0502 0.0547 0.0613 0.0064  -0.0035 0.0026  201 MET A CG  
121 S  SD  . MET A 10 ? 0.0481 0.0529 0.0603 -0.0021 -0.0044 0.0046  201 MET A SD  
122 C  CE  . MET A 10 ? 0.0572 0.0702 0.0824 -0.0096 -0.0037 0.0230  201 MET A CE  
123 N  N   A HIS A 11 ? 0.0482 0.0433 0.0651 0.0089  0.0046  0.0027  202 HIS A N   
124 N  N   B HIS A 11 ? 0.0379 0.0508 0.0300 -0.0206 -0.0143 -0.0032 202 HIS A N   
125 C  CA  A HIS A 11 ? 0.0567 0.0514 0.0617 0.0113  0.0010  0.0010  202 HIS A CA  
126 C  CA  B HIS A 11 ? 0.0475 0.0428 0.0498 -0.0106 -0.0134 0.0135  202 HIS A CA  
127 C  C   A HIS A 11 ? 0.0513 0.0463 0.0566 0.0059  0.0039  0.0016  202 HIS A C   
128 C  C   B HIS A 11 ? 0.0496 0.0509 0.0729 -0.0054 -0.0039 0.0070  202 HIS A C   
129 O  O   A HIS A 11 ? 0.0516 0.0513 0.0857 -0.0003 0.0086  -0.0017 202 HIS A O   
130 O  O   B HIS A 11 ? 0.0577 0.0293 0.1180 0.0059  0.0046  -0.0314 202 HIS A O   
131 C  CB  A HIS A 11 ? 0.0842 0.0636 0.0688 0.0245  0.0077  0.0091  202 HIS A CB  
132 C  CB  B HIS A 11 ? 0.0431 0.0850 0.0476 0.0429  0.0177  0.0118  202 HIS A CB  
133 C  CG  A HIS A 11 ? 0.0840 0.0765 0.0692 0.0237  -0.0137 -0.0059 202 HIS A CG  
134 C  CG  B HIS A 11 ? 0.0697 0.0485 0.0592 0.0117  0.0316  0.0029  202 HIS A CG  
135 C  CG  C HIS A 11 ? 0.1417 0.0809 0.0455 0.0059  0.0155  0.0000  202 HIS A CG  
136 N  ND1 A HIS A 11 ? 0.0956 0.1715 0.0614 0.0363  -0.0066 -0.0110 202 HIS A ND1 
137 N  ND1 B HIS A 11 ? 0.0926 0.0426 0.0802 0.0172  -0.0190 0.0177  202 HIS A ND1 
138 N  ND1 C HIS A 11 ? 0.1248 0.0856 0.0676 0.0085  0.0299  -0.0131 202 HIS A ND1 
139 C  CD2 A HIS A 11 ? 0.1447 0.0773 0.0957 0.0425  -0.0576 -0.0035 202 HIS A CD2 
140 C  CD2 B HIS A 11 ? 0.0454 0.0604 0.0689 0.0039  0.0032  -0.0048 202 HIS A CD2 
141 C  CD2 C HIS A 11 ? 0.1908 0.1623 0.1209 0.0140  -0.0265 -0.0220 202 HIS A CD2 
142 C  CE1 A HIS A 11 ? 0.0947 0.1372 0.0810 -0.0027 -0.0287 -0.0388 202 HIS A CE1 
143 C  CE1 B HIS A 11 ? 0.1130 0.0982 0.0521 -0.0135 0.0041  0.0160  202 HIS A CE1 
144 C  CE1 C HIS A 11 ? 0.0884 0.1492 0.1161 0.0318  -0.0067 -0.0848 202 HIS A CE1 
145 N  NE2 A HIS A 11 ? 0.2042 0.0840 0.0551 0.0037  -0.0364 -0.0050 202 HIS A NE2 
146 N  NE2 B HIS A 11 ? 0.0706 0.0666 0.0627 0.0185  -0.0063 0.0094  202 HIS A NE2 
147 N  NE2 C HIS A 11 ? 0.1981 0.0985 0.0784 0.0428  -0.0316 -0.0049 202 HIS A NE2 
148 N  N   . LYS A 12 ? 0.0456 0.0501 0.0574 0.0032  0.0010  0.0006  203 LYS A N   
149 C  CA  . LYS A 12 ? 0.0474 0.0503 0.0521 -0.0006 -0.0038 0.0013  203 LYS A CA  
150 C  C   . LYS A 12 ? 0.0539 0.0538 0.0554 0.0007  0.0048  0.0028  203 LYS A C   
151 O  O   . LYS A 12 ? 0.0773 0.0596 0.0528 -0.0025 -0.0041 0.0050  203 LYS A O   
152 C  CB  . LYS A 12 ? 0.0558 0.0450 0.0497 0.0035  0.0014  0.0011  203 LYS A CB  
153 C  CG  . LYS A 12 ? 0.0565 0.0446 0.0530 0.0041  0.0022  -0.0032 203 LYS A CG  
154 C  CD  . LYS A 12 ? 0.0486 0.0444 0.0487 0.0035  0.0010  0.0004  203 LYS A CD  
155 C  CE  . LYS A 12 ? 0.0504 0.0503 0.0592 0.0014  0.0077  0.0018  203 LYS A CE  
156 N  NZ  . LYS A 12 ? 0.0527 0.0451 0.0549 -0.0029 0.0011  0.0027  203 LYS A NZ  
157 N  N   A ASP A 13 ? 0.0465 0.0512 0.0526 -0.0053 -0.0010 0.0039  204 ASP A N   
158 N  N   B ASP A 13 ? 0.1344 0.0266 0.1080 -0.0071 -0.0459 0.0051  204 ASP A N   
159 C  CA  A ASP A 13 ? 0.0561 0.0413 0.0624 -0.0048 0.0045  0.0013  204 ASP A CA  
160 C  CA  B ASP A 13 ? 0.0825 0.0674 0.1052 -0.0035 0.0052  0.0295  204 ASP A CA  
161 C  C   A ASP A 13 ? 0.0500 0.0495 0.0543 -0.0051 0.0008  -0.0067 204 ASP A C   
162 C  C   B ASP A 13 ? 0.1110 0.0663 0.0589 -0.0054 0.0051  0.0439  204 ASP A C   
163 O  O   A ASP A 13 ? 0.0469 0.0512 0.0690 -0.0008 -0.0035 -0.0006 204 ASP A O   
164 O  O   B ASP A 13 ? 0.1633 0.0622 0.1052 -0.0145 -0.0270 0.0003  204 ASP A O   
165 C  CB  A ASP A 13 ? 0.0482 0.0471 0.0853 -0.0032 0.0070  -0.0095 204 ASP A CB  
166 C  CB  B ASP A 13 ? 0.2551 0.0351 0.0931 -0.0207 -0.0878 0.0152  204 ASP A CB  
167 C  CG  A ASP A 13 ? 0.0443 0.0432 0.0934 0.0018  -0.0054 -0.0081 204 ASP A CG  
168 C  CG  B ASP A 13 ? 0.0692 0.1048 0.1376 -0.0274 0.0106  0.0509  204 ASP A CG  
169 O  OD1 A ASP A 13 ? 0.0447 0.0540 0.0722 0.0073  -0.0092 -0.0048 204 ASP A OD1 
170 O  OD1 B ASP A 13 ? 0.1381 0.1201 0.1763 -0.0271 -0.0579 0.0621  204 ASP A OD1 
171 O  OD2 A ASP A 13 ? 0.0514 0.0822 0.1234 0.0126  -0.0304 -0.0275 204 ASP A OD2 
172 O  OD2 B ASP A 13 ? 0.0906 0.2168 0.1764 0.0354  0.0108  -0.0760 204 ASP A OD2 
173 N  N   A SER A 14 ? 0.0620 0.0377 0.0839 -0.0055 0.0075  0.0030  205 SER A N   
174 N  N   B SER A 14 ? 0.1122 0.1164 0.0912 0.0028  -0.0160 0.0394  205 SER A N   
175 C  CA  A SER A 14 ? 0.0665 0.0442 0.0826 0.0046  -0.0046 -0.0062 205 SER A CA  
176 C  CA  B SER A 14 ? 0.2080 0.0498 0.0920 -0.0094 -0.0399 0.0161  205 SER A CA  
177 C  C   A SER A 14 ? 0.0737 0.0485 0.0802 0.0088  -0.0024 0.0002  205 SER A C   
178 C  C   B SER A 14 ? 0.1920 0.0390 0.1645 -0.0331 -0.0616 0.0527  205 SER A C   
179 O  O   A SER A 14 ? 0.1054 0.0860 0.0935 0.0507  0.0101  0.0197  205 SER A O   
180 O  O   B SER A 14 ? 0.1586 0.1053 0.1886 -0.0432 -0.1001 0.0708  205 SER A O   
181 C  CB  A SER A 14 ? 0.0905 0.0460 0.0779 -0.0012 -0.0181 0.0084  205 SER A CB  
182 C  CB  B SER A 14 ? 0.3248 0.1235 0.1027 -0.0543 -0.0326 -0.0143 205 SER A CB  
183 O  OG  A SER A 14 ? 0.0980 0.0751 0.0882 -0.0041 -0.0155 0.0013  205 SER A OG  
184 O  OG  B SER A 14 ? 0.1208 0.0220 0.1615 -0.0008 -0.0108 -0.0072 205 SER A OG  
185 O  OG  C SER A 14 ? 0.1067 0.0495 0.1529 -0.0264 -0.0454 0.0422  205 SER A OG  
186 O  OG  D SER A 14 ? 0.0758 0.0526 0.0731 0.0115  -0.0103 0.0037  205 SER A OG  
187 N  N   A THR A 15 ? 0.0648 0.0536 0.0779 0.0143  -0.0152 -0.0164 206 THR A N   
188 N  N   B THR A 15 ? 0.3654 0.0259 0.1083 -0.0182 -0.1087 0.0014  206 THR A N   
189 C  CA  A THR A 15 ? 0.0889 0.0600 0.0779 0.0232  -0.0269 -0.0180 206 THR A CA  
190 C  CA  B THR A 15 ? 0.1711 0.0710 0.1193 -0.0208 -0.1065 0.0114  206 THR A CA  
191 C  C   A THR A 15 ? 0.0583 0.0881 0.0713 0.0306  -0.0179 -0.0179 206 THR A C   
192 C  C   B THR A 15 ? 0.1305 0.0690 0.1224 0.0346  -0.0245 -0.0210 206 THR A C   
193 O  O   A THR A 15 ? 0.0723 0.1491 0.0692 0.0310  -0.0080 -0.0371 206 THR A O   
194 O  O   B THR A 15 ? 0.3023 0.0627 0.1290 -0.0155 0.0159  -0.0587 206 THR A O   
195 C  CB  A THR A 15 ? 0.1029 0.0590 0.0822 0.0012  -0.0360 -0.0031 206 THR A CB  
196 C  CB  B THR A 15 ? 0.1220 0.1162 0.1603 -0.0316 -0.0539 -0.0187 206 THR A CB  
197 O  OG1 A THR A 15 ? 0.0596 0.0960 0.0641 0.0045  -0.0114 -0.0015 206 THR A OG1 
198 O  OG1 B THR A 15 ? 0.0785 0.1040 0.1114 -0.0111 -0.0236 -0.0086 206 THR A OG1 
199 C  CG2 A THR A 15 ? 0.1512 0.0861 0.1363 -0.0526 -0.0674 0.0371  206 THR A CG2 
200 C  CG2 B THR A 15 ? 0.1165 0.0673 0.2564 0.0112  -0.0703 0.0003  206 THR A CG2 
201 N  N   A GLY A 16 ? 0.0527 0.0615 0.0666 0.0201  -0.0045 -0.0040 207 GLY A N   
202 N  N   B GLY A 16 ? 0.0682 0.0792 0.1157 -0.0163 -0.0211 0.0040  207 GLY A N   
203 C  CA  A GLY A 16 ? 0.0429 0.0772 0.0688 0.0103  -0.0073 0.0026  207 GLY A CA  
204 C  CA  B GLY A 16 ? 0.0710 0.0313 0.1635 0.0124  -0.0468 -0.0451 207 GLY A CA  
205 C  C   A GLY A 16 ? 0.0448 0.0576 0.0545 0.0046  -0.0018 -0.0154 207 GLY A C   
206 C  C   B GLY A 16 ? 0.1064 0.0883 0.0613 0.0100  -0.0163 0.0390  207 GLY A C   
207 O  O   A GLY A 16 ? 0.0373 0.0736 0.0669 0.0167  -0.0035 -0.0082 207 GLY A O   
208 O  O   B GLY A 16 ? 0.0381 0.0811 0.0716 0.0405  -0.0064 -0.0107 207 GLY A O   
209 N  N   . HIS A 17 ? 0.0443 0.0552 0.0608 0.0114  -0.0113 -0.0071 208 HIS A N   
210 C  CA  . HIS A 17 ? 0.0418 0.0471 0.0603 0.0051  -0.0079 -0.0056 208 HIS A CA  
211 C  C   . HIS A 17 ? 0.0437 0.0523 0.0496 0.0011  -0.0076 -0.0015 208 HIS A C   
212 O  O   . HIS A 17 ? 0.0609 0.0546 0.0585 0.0062  -0.0004 0.0013  208 HIS A O   
213 C  CB  . HIS A 17 ? 0.0459 0.0600 0.0594 0.0060  -0.0082 -0.0108 208 HIS A CB  
214 C  CG  . HIS A 17 ? 0.0500 0.0558 0.0605 0.0046  -0.0129 -0.0115 208 HIS A CG  
215 N  ND1 . HIS A 17 ? 0.0789 0.0577 0.0691 0.0068  -0.0168 -0.0068 208 HIS A ND1 
216 C  CD2 . HIS A 17 ? 0.0609 0.0559 0.0708 0.0036  -0.0064 -0.0117 208 HIS A CD2 
217 C  CE1 . HIS A 17 ? 0.0854 0.0613 0.0765 0.0170  -0.0163 -0.0241 208 HIS A CE1 
218 N  NE2 . HIS A 17 ? 0.0711 0.0619 0.0687 0.0123  -0.0102 -0.0156 208 HIS A NE2 
219 N  N   . VAL A 18 ? 0.0414 0.0482 0.0523 0.0067  -0.0013 -0.0035 209 VAL A N   
220 C  CA  . VAL A 18 ? 0.0444 0.0521 0.0501 0.0103  -0.0005 -0.0020 209 VAL A CA  
221 C  C   . VAL A 18 ? 0.0403 0.0467 0.0510 0.0050  0.0036  0.0018  209 VAL A C   
222 O  O   . VAL A 18 ? 0.0460 0.0618 0.0594 0.0070  0.0058  -0.0072 209 VAL A O   
223 C  CB  . VAL A 18 ? 0.0469 0.0549 0.0605 0.0101  -0.0070 -0.0053 209 VAL A CB  
224 C  CG1 . VAL A 18 ? 0.0544 0.0557 0.0781 0.0098  -0.0176 -0.0134 209 VAL A CG1 
225 C  CG2 . VAL A 18 ? 0.0650 0.0606 0.0762 -0.0066 -0.0077 0.0054  209 VAL A CG2 
226 N  N   . GLY A 19 ? 0.0365 0.0603 0.0496 0.0061  0.0030  -0.0012 210 GLY A N   
227 C  CA  . GLY A 19 ? 0.0402 0.0529 0.0556 -0.0053 0.0002  0.0022  210 GLY A CA  
228 C  C   . GLY A 19 ? 0.0364 0.0420 0.0499 -0.0037 0.0012  -0.0044 210 GLY A C   
229 O  O   . GLY A 19 ? 0.0340 0.0496 0.0573 -0.0010 0.0022  -0.0019 210 GLY A O   
230 N  N   . PHE A 20 ? 0.0345 0.0492 0.0499 0.0020  0.0030  0.0044  211 PHE A N   
231 C  CA  . PHE A 20 ? 0.0349 0.0392 0.0545 -0.0009 -0.0006 0.0041  211 PHE A CA  
232 C  C   . PHE A 20 ? 0.0335 0.0416 0.0550 -0.0006 0.0015  0.0023  211 PHE A C   
233 O  O   . PHE A 20 ? 0.0420 0.0555 0.0569 0.0115  0.0026  0.0034  211 PHE A O   
234 C  CB  . PHE A 20 ? 0.0385 0.0443 0.0527 0.0019  0.0022  0.0024  211 PHE A CB  
235 C  CG  . PHE A 20 ? 0.0389 0.0411 0.0584 -0.0008 0.0021  -0.0045 211 PHE A CG  
236 C  CD1 . PHE A 20 ? 0.0454 0.0621 0.0643 -0.0027 -0.0039 0.0087  211 PHE A CD1 
237 C  CD2 . PHE A 20 ? 0.0562 0.0549 0.0551 -0.0099 -0.0027 0.0033  211 PHE A CD2 
238 C  CE1 . PHE A 20 ? 0.0461 0.0722 0.0743 -0.0040 -0.0079 0.0110  211 PHE A CE1 
239 C  CE2 . PHE A 20 ? 0.0586 0.0592 0.0649 -0.0151 0.0035  0.0002  211 PHE A CE2 
240 C  CZ  . PHE A 20 ? 0.0405 0.0612 0.0777 -0.0099 0.0028  -0.0029 211 PHE A CZ  
241 N  N   . ILE A 21 ? 0.0365 0.0432 0.0528 0.0055  0.0025  0.0035  212 ILE A N   
242 C  CA  . ILE A 21 ? 0.0402 0.0373 0.0531 0.0010  0.0014  -0.0007 212 ILE A CA  
243 C  C   . ILE A 21 ? 0.0364 0.0423 0.0492 0.0000  -0.0020 -0.0038 212 ILE A C   
244 O  O   . ILE A 21 ? 0.0397 0.0408 0.0552 0.0037  0.0058  0.0010  212 ILE A O   
245 C  CB  . ILE A 21 ? 0.0426 0.0408 0.0615 -0.0039 0.0025  -0.0058 212 ILE A CB  
246 C  CG1 . ILE A 21 ? 0.0660 0.0457 0.0880 -0.0104 -0.0008 0.0025  212 ILE A CG1 
247 C  CG2 . ILE A 21 ? 0.0528 0.0619 0.0576 -0.0114 -0.0019 -0.0085 212 ILE A CG2 
248 C  CD1 . ILE A 21 ? 0.0764 0.0566 0.0923 -0.0182 0.0140  -0.0156 212 ILE A CD1 
249 N  N   . PHE A 22 ? 0.0378 0.0410 0.0576 0.0028  0.0075  -0.0011 213 PHE A N   
250 C  CA  . PHE A 22 ? 0.0402 0.0371 0.0562 0.0017  0.0065  -0.0029 213 PHE A CA  
251 C  C   . PHE A 22 ? 0.0441 0.0377 0.0560 -0.0030 0.0060  -0.0045 213 PHE A C   
252 O  O   . PHE A 22 ? 0.0588 0.0408 0.0603 -0.0005 0.0100  -0.0024 213 PHE A O   
253 C  CB  . PHE A 22 ? 0.0468 0.0380 0.0518 -0.0010 0.0053  0.0006  213 PHE A CB  
254 C  CG  . PHE A 22 ? 0.0447 0.0389 0.0518 -0.0043 0.0036  -0.0019 213 PHE A CG  
255 C  CD1 . PHE A 22 ? 0.0493 0.0483 0.0555 -0.0062 0.0000  0.0068  213 PHE A CD1 
256 C  CD2 . PHE A 22 ? 0.0522 0.0411 0.0592 -0.0040 -0.0030 0.0020  213 PHE A CD2 
257 C  CE1 . PHE A 22 ? 0.0473 0.0705 0.0632 -0.0152 0.0055  0.0051  213 PHE A CE1 
258 C  CE2 . PHE A 22 ? 0.0490 0.0480 0.0751 0.0009  -0.0055 -0.0024 213 PHE A CE2 
259 C  CZ  . PHE A 22 ? 0.0440 0.0708 0.0712 0.0009  0.0018  -0.0084 213 PHE A CZ  
260 N  N   . LYS A 23 ? 0.0494 0.0403 0.0503 -0.0018 0.0068  -0.0029 214 LYS A N   
261 C  CA  . LYS A 23 ? 0.0690 0.0399 0.0566 -0.0030 0.0117  -0.0014 214 LYS A CA  
262 C  C   . LYS A 23 ? 0.0513 0.0449 0.0509 -0.0062 0.0031  -0.0011 214 LYS A C   
263 O  O   . LYS A 23 ? 0.0491 0.0481 0.0610 0.0000  0.0078  -0.0031 214 LYS A O   
264 C  CB  . LYS A 23 ? 0.1143 0.0582 0.0690 -0.0198 -0.0133 0.0007  214 LYS A CB  
265 C  CG  . LYS A 23 ? 0.1382 0.0737 0.0680 0.0103  -0.0225 -0.0065 214 LYS A CG  
266 C  CD  . LYS A 23 ? 0.3060 0.1588 0.1116 -0.0944 -0.0750 0.0031  214 LYS A CD  
267 C  CE  . LYS A 23 ? 0.1610 0.1644 0.1156 -0.0308 -0.0400 -0.0177 214 LYS A CE  
268 N  NZ  A LYS A 23 ? 0.2095 0.1537 0.2173 -0.0649 -0.1146 0.0644  214 LYS A NZ  
269 N  NZ  B LYS A 23 ? 0.1566 0.2565 0.1132 -0.0520 -0.0046 -0.0072 214 LYS A NZ  
270 N  N   . ASN A 24 ? 0.0461 0.0494 0.0546 0.0003  0.0064  0.0025  215 ASN A N   
271 C  CA  . ASN A 24 ? 0.0476 0.0541 0.0537 -0.0021 0.0041  0.0077  215 ASN A CA  
272 C  C   . ASN A 24 ? 0.0383 0.0445 0.0643 -0.0021 0.0029  0.0092  215 ASN A C   
273 O  O   . ASN A 24 ? 0.0596 0.0438 0.0789 0.0051  -0.0004 0.0056  215 ASN A O   
274 C  CB  . ASN A 24 ? 0.0505 0.0629 0.0677 -0.0043 -0.0028 0.0113  215 ASN A CB  
275 C  CG  . ASN A 24 ? 0.0580 0.0576 0.0583 -0.0026 0.0020  0.0084  215 ASN A CG  
276 O  OD1 . ASN A 24 ? 0.0532 0.0958 0.1364 -0.0110 -0.0021 0.0601  215 ASN A OD1 
277 N  ND2 . ASN A 24 ? 0.0712 0.0635 0.0828 -0.0117 -0.0150 0.0209  215 ASN A ND2 
278 N  N   . GLY A 25 ? 0.0414 0.0426 0.0573 0.0012  0.0049  -0.0009 216 GLY A N   
279 C  CA  . GLY A 25 ? 0.0405 0.0492 0.0639 -0.0051 0.0025  -0.0027 216 GLY A CA  
280 C  C   . GLY A 25 ? 0.0428 0.0413 0.0552 0.0060  -0.0004 -0.0079 216 GLY A C   
281 O  O   . GLY A 25 ? 0.0455 0.0832 0.0688 0.0072  -0.0035 -0.0271 216 GLY A O   
282 N  N   . LYS A 26 ? 0.0428 0.0412 0.0524 -0.0033 0.0061  -0.0028 217 LYS A N   
283 C  CA  . LYS A 26 ? 0.0384 0.0346 0.0592 0.0007  0.0076  -0.0005 217 LYS A CA  
284 C  C   . LYS A 26 ? 0.0377 0.0380 0.0562 0.0029  0.0029  0.0005  217 LYS A C   
285 O  O   . LYS A 26 ? 0.0515 0.0360 0.0657 -0.0004 0.0103  -0.0002 217 LYS A O   
286 C  CB  . LYS A 26 ? 0.0449 0.0431 0.0628 0.0022  0.0052  0.0006  217 LYS A CB  
287 C  CG  . LYS A 26 ? 0.0415 0.0450 0.0684 -0.0020 0.0052  0.0073  217 LYS A CG  
288 C  CD  . LYS A 26 ? 0.0459 0.0502 0.0760 -0.0005 -0.0026 -0.0019 217 LYS A CD  
289 C  CE  . LYS A 26 ? 0.0450 0.0567 0.0628 0.0066  -0.0045 0.0033  217 LYS A CE  
290 N  NZ  . LYS A 26 ? 0.0470 0.0492 0.0658 -0.0036 -0.0063 0.0114  217 LYS A NZ  
291 N  N   . ILE A 27 ? 0.0446 0.0368 0.0561 0.0012  0.0103  0.0009  218 ILE A N   
292 C  CA  . ILE A 27 ? 0.0406 0.0392 0.0632 0.0010  0.0032  0.0092  218 ILE A CA  
293 C  C   . ILE A 27 ? 0.0423 0.0400 0.0551 0.0040  0.0056  0.0093  218 ILE A C   
294 O  O   . ILE A 27 ? 0.0437 0.0441 0.0718 0.0062  0.0018  0.0110  218 ILE A O   
295 C  CB  A ILE A 27 ? 0.0504 0.0519 0.0573 -0.0035 0.0012  0.0033  218 ILE A CB  
296 C  CB  B ILE A 27 ? 0.0578 0.0606 0.0557 -0.0078 -0.0122 0.0172  218 ILE A CB  
297 C  CG1 A ILE A 27 ? 0.0458 0.0540 0.0582 0.0029  0.0041  0.0001  218 ILE A CG1 
298 C  CG1 B ILE A 27 ? 0.0690 0.0356 0.0511 0.0025  0.0237  0.0115  218 ILE A CG1 
299 C  CG2 A ILE A 27 ? 0.0627 0.0522 0.0595 0.0022  0.0060  0.0145  218 ILE A CG2 
300 C  CG2 B ILE A 27 ? 0.0182 0.0855 0.0701 -0.0172 0.0005  0.0301  218 ILE A CG2 
301 C  CD1 A ILE A 27 ? 0.0618 0.0800 0.0551 -0.0076 -0.0075 -0.0009 218 ILE A CD1 
302 C  CD1 B ILE A 27 ? 0.0568 0.0650 0.0587 -0.0058 0.0062  -0.0089 218 ILE A CD1 
303 N  N   . THR A 28 ? 0.0342 0.0455 0.0582 0.0036  0.0016  0.0074  219 THR A N   
304 C  CA  . THR A 28 ? 0.0450 0.0555 0.0561 0.0005  -0.0021 0.0081  219 THR A CA  
305 C  C   . THR A 28 ? 0.0401 0.0550 0.0554 -0.0018 -0.0027 0.0020  219 THR A C   
306 O  O   . THR A 28 ? 0.0455 0.0824 0.0734 -0.0106 -0.0106 0.0223  219 THR A O   
307 C  CB  . THR A 28 ? 0.0613 0.0835 0.0571 -0.0123 0.0027  0.0065  219 THR A CB  
308 O  OG1 . THR A 28 ? 0.0733 0.0897 0.0723 0.0088  0.0086  -0.0132 219 THR A OG1 
309 C  CG2 . THR A 28 ? 0.0853 0.1149 0.0624 -0.0144 0.0067  0.0222  219 THR A CG2 
310 N  N   . SER A 29 ? 0.0341 0.0464 0.0556 -0.0061 -0.0009 0.0030  220 SER A N   
311 C  CA  . SER A 29 ? 0.0339 0.0438 0.0563 -0.0052 0.0022  0.0030  220 SER A CA  
312 C  C   . SER A 29 ? 0.0351 0.0418 0.0563 -0.0030 0.0006  -0.0005 220 SER A C   
313 O  O   . SER A 29 ? 0.0319 0.0633 0.0605 -0.0014 0.0022  0.0058  220 SER A O   
314 C  CB  . SER A 29 ? 0.0441 0.0514 0.0618 -0.0068 0.0045  -0.0030 220 SER A CB  
315 O  OG  . SER A 29 ? 0.0512 0.0516 0.0698 -0.0137 -0.0062 0.0011  220 SER A OG  
316 N  N   . ILE A 30 ? 0.0306 0.0547 0.0548 -0.0027 -0.0010 0.0019  221 ILE A N   
317 C  CA  . ILE A 30 ? 0.0343 0.0500 0.0554 -0.0042 0.0000  0.0051  221 ILE A CA  
318 C  C   . ILE A 30 ? 0.0319 0.0507 0.0605 -0.0016 0.0014  -0.0021 221 ILE A C   
319 O  O   . ILE A 30 ? 0.0340 0.0551 0.0720 -0.0052 -0.0046 0.0003  221 ILE A O   
320 C  CB  . ILE A 30 ? 0.0440 0.0529 0.0583 0.0030  -0.0011 0.0032  221 ILE A CB  
321 C  CG1 . ILE A 30 ? 0.0513 0.0508 0.0629 0.0028  -0.0029 -0.0017 221 ILE A CG1 
322 C  CG2 . ILE A 30 ? 0.0861 0.0598 0.0519 0.0058  -0.0015 0.0004  221 ILE A CG2 
323 C  CD1 . ILE A 30 ? 0.0619 0.0586 0.0757 -0.0075 -0.0028 -0.0111 221 ILE A CD1 
324 N  N   . VAL A 31 ? 0.0345 0.0461 0.0593 -0.0045 -0.0013 -0.0019 222 VAL A N   
325 C  CA  . VAL A 31 ? 0.0423 0.0471 0.0601 -0.0085 -0.0022 0.0005  222 VAL A CA  
326 C  C   . VAL A 31 ? 0.0416 0.0416 0.0647 -0.0004 0.0007  -0.0015 222 VAL A C   
327 O  O   . VAL A 31 ? 0.0464 0.0486 0.0600 -0.0078 0.0051  -0.0032 222 VAL A O   
328 C  CB  . VAL A 31 ? 0.0473 0.0437 0.0576 -0.0007 0.0026  0.0010  222 VAL A CB  
329 C  CG1 . VAL A 31 ? 0.0582 0.0481 0.0790 0.0079  0.0072  0.0021  222 VAL A CG1 
330 C  CG2 . VAL A 31 ? 0.0471 0.0497 0.0656 0.0053  0.0038  -0.0055 222 VAL A CG2 
331 N  N   . LYS A 32 ? 0.0439 0.0490 0.0617 -0.0051 0.0040  -0.0086 223 LYS A N   
332 C  CA  . LYS A 32 ? 0.0466 0.0487 0.0637 -0.0032 0.0082  -0.0034 223 LYS A CA  
333 C  C   . LYS A 32 ? 0.0420 0.0456 0.0643 -0.0062 0.0043  0.0012  223 LYS A C   
334 O  O   . LYS A 32 ? 0.0511 0.0480 0.0716 -0.0002 -0.0006 -0.0034 223 LYS A O   
335 C  CB  . LYS A 32 ? 0.0493 0.0501 0.0639 -0.0036 0.0046  0.0025  223 LYS A CB  
336 C  CG  . LYS A 32 ? 0.0516 0.0561 0.0659 -0.0027 0.0034  0.0030  223 LYS A CG  
337 C  CD  . LYS A 32 ? 0.0557 0.0526 0.0649 0.0022  -0.0075 -0.0030 223 LYS A CD  
338 C  CE  . LYS A 32 ? 0.0505 0.0580 0.0693 0.0009  -0.0029 -0.0014 223 LYS A CE  
339 N  NZ  . LYS A 32 ? 0.0502 0.0636 0.0739 0.0028  -0.0022 -0.0035 223 LYS A NZ  
340 N  N   . ASP A 33 ? 0.0454 0.0484 0.0640 -0.0030 0.0079  -0.0051 224 ASP A N   
341 C  CA  . ASP A 33 ? 0.0513 0.0541 0.0622 -0.0015 0.0077  0.0008  224 ASP A CA  
342 C  C   . ASP A 33 ? 0.0497 0.0563 0.0638 -0.0035 0.0023  -0.0029 224 ASP A C   
343 O  O   . ASP A 33 ? 0.0617 0.0749 0.0687 -0.0088 -0.0047 0.0168  224 ASP A O   
344 C  CB  . ASP A 33 ? 0.0495 0.0652 0.0689 -0.0035 0.0015  0.0079  224 ASP A CB  
345 C  CG  . ASP A 33 ? 0.0463 0.0531 0.0564 -0.0055 0.0038  0.0067  224 ASP A CG  
346 O  OD1 . ASP A 33 ? 0.0453 0.0635 0.0628 -0.0036 0.0052  0.0025  224 ASP A OD1 
347 O  OD2 . ASP A 33 ? 0.0511 0.0595 0.0676 -0.0083 0.0044  0.0037  224 ASP A OD2 
348 N  N   . SER A 34 ? 0.0500 0.0470 0.0571 -0.0050 0.0041  0.0040  225 SER A N   
349 C  CA  . SER A 34 ? 0.0463 0.0531 0.0632 0.0005  0.0044  0.0007  225 SER A CA  
350 C  C   . SER A 34 ? 0.0531 0.0452 0.0608 0.0017  0.0000  0.0106  225 SER A C   
351 O  O   . SER A 34 ? 0.0456 0.0523 0.0617 0.0020  0.0055  0.0029  225 SER A O   
352 C  CB  . SER A 34 ? 0.0522 0.0528 0.0649 -0.0070 0.0027  -0.0037 225 SER A CB  
353 O  OG  . SER A 34 ? 0.0529 0.0571 0.0591 -0.0141 -0.0021 0.0049  225 SER A OG  
354 N  N   . SER A 35 ? 0.0494 0.0465 0.0585 0.0029  -0.0001 0.0025  226 SER A N   
355 C  CA  . SER A 35 ? 0.0442 0.0477 0.0572 0.0016  0.0006  0.0007  226 SER A CA  
356 C  C   . SER A 35 ? 0.0391 0.0485 0.0509 -0.0014 0.0025  0.0000  226 SER A C   
357 O  O   . SER A 35 ? 0.0533 0.0497 0.0521 0.0052  0.0035  -0.0027 226 SER A O   
358 C  CB  . SER A 35 ? 0.0476 0.0522 0.0658 0.0044  -0.0022 0.0005  226 SER A CB  
359 O  OG  . SER A 35 ? 0.0499 0.0609 0.0668 -0.0004 -0.0075 -0.0025 226 SER A OG  
360 N  N   . ALA A 36 ? 0.0431 0.0459 0.0520 0.0016  0.0050  0.0021  227 ALA A N   
361 C  CA  . ALA A 36 ? 0.0421 0.0448 0.0540 -0.0038 0.0062  0.0005  227 ALA A CA  
362 C  C   . ALA A 36 ? 0.0480 0.0438 0.0501 0.0009  0.0055  0.0023  227 ALA A C   
363 O  O   . ALA A 36 ? 0.0518 0.0445 0.0687 0.0050  0.0084  0.0052  227 ALA A O   
364 C  CB  . ALA A 36 ? 0.0471 0.0494 0.0518 -0.0011 0.0034  0.0033  227 ALA A CB  
365 N  N   . ALA A 37 ? 0.0427 0.0461 0.0534 -0.0003 0.0055  0.0006  228 ALA A N   
366 C  CA  . ALA A 37 ? 0.0427 0.0608 0.0533 0.0038  0.0014  0.0004  228 ALA A CA  
367 C  C   . ALA A 37 ? 0.0445 0.0609 0.0551 0.0018  0.0093  0.0061  228 ALA A C   
368 O  O   . ALA A 37 ? 0.0579 0.0690 0.0655 0.0151  0.0084  0.0023  228 ALA A O   
369 C  CB  . ALA A 37 ? 0.0483 0.0691 0.0590 -0.0038 0.0051  -0.0034 228 ALA A CB  
370 N  N   . ARG A 38 ? 0.0472 0.0545 0.0504 0.0046  0.0068  0.0022  229 ARG A N   
371 C  CA  . ARG A 38 ? 0.0561 0.0616 0.0477 -0.0021 0.0080  0.0024  229 ARG A CA  
372 C  C   . ARG A 38 ? 0.0664 0.0580 0.0505 -0.0032 0.0124  0.0005  229 ARG A C   
373 O  O   . ARG A 38 ? 0.1024 0.0819 0.0728 -0.0235 0.0378  -0.0224 229 ARG A O   
374 C  CB  . ARG A 38 ? 0.0635 0.0605 0.0547 -0.0056 0.0084  0.0063  229 ARG A CB  
375 C  CG  . ARG A 38 ? 0.0822 0.0613 0.0612 -0.0101 0.0156  0.0003  229 ARG A CG  
376 C  CD  . ARG A 38 ? 0.0868 0.0607 0.0734 -0.0008 0.0218  0.0059  229 ARG A CD  
377 N  NE  . ARG A 38 ? 0.0723 0.0759 0.0828 0.0018  0.0043  0.0110  229 ARG A NE  
378 C  CZ  . ARG A 38 ? 0.0786 0.0501 0.0704 -0.0010 0.0133  0.0060  229 ARG A CZ  
379 N  NH1 . ARG A 38 ? 0.0782 0.0653 0.0673 -0.0122 0.0194  -0.0040 229 ARG A NH1 
380 N  NH2 . ARG A 38 ? 0.0798 0.0963 0.0663 -0.0052 0.0011  0.0099  229 ARG A NH2 
381 N  N   . ASN A 39 ? 0.0574 0.0547 0.0520 0.0001  0.0063  -0.0002 230 ASN A N   
382 C  CA  . ASN A 39 ? 0.0624 0.0534 0.0588 -0.0041 0.0070  -0.0008 230 ASN A CA  
383 C  C   . ASN A 39 ? 0.0680 0.0537 0.0694 0.0055  0.0238  0.0030  230 ASN A C   
384 O  O   . ASN A 39 ? 0.0994 0.0518 0.0856 -0.0034 0.0143  0.0015  230 ASN A O   
385 C  CB  . ASN A 39 ? 0.0588 0.0578 0.0708 -0.0113 0.0040  0.0000  230 ASN A CB  
386 C  CG  . ASN A 39 ? 0.0575 0.0750 0.0634 -0.0057 -0.0010 -0.0066 230 ASN A CG  
387 O  OD1 . ASN A 39 ? 0.0853 0.0985 0.0657 0.0048  -0.0050 -0.0219 230 ASN A OD1 
388 N  ND2 . ASN A 39 ? 0.0918 0.0692 0.0608 0.0011  -0.0086 0.0025  230 ASN A ND2 
389 N  N   . GLY A 40 ? 0.0843 0.0618 0.0568 0.0106  0.0094  0.0055  231 GLY A N   
390 C  CA  . GLY A 40 ? 0.0835 0.0725 0.0687 0.0258  0.0145  0.0136  231 GLY A CA  
391 C  C   . GLY A 40 ? 0.0611 0.0569 0.0627 0.0095  0.0022  0.0097  231 GLY A C   
392 O  O   . GLY A 40 ? 0.0797 0.0550 0.0680 0.0172  0.0028  0.0027  231 GLY A O   
393 N  N   . LEU A 41 ? 0.0540 0.0500 0.0547 0.0065  0.0040  0.0063  232 LEU A N   
394 C  CA  . LEU A 41 ? 0.0475 0.0398 0.0559 -0.0014 -0.0021 0.0022  232 LEU A CA  
395 C  C   . LEU A 41 ? 0.0488 0.0431 0.0590 -0.0031 -0.0031 -0.0029 232 LEU A C   
396 O  O   . LEU A 41 ? 0.0509 0.0543 0.0896 -0.0125 -0.0118 0.0140  232 LEU A O   
397 C  CB  . LEU A 41 ? 0.0510 0.0431 0.0562 -0.0049 -0.0019 -0.0010 232 LEU A CB  
398 C  CG  . LEU A 41 ? 0.0507 0.0509 0.0586 -0.0004 0.0023  0.0020  232 LEU A CG  
399 C  CD1 . LEU A 41 ? 0.0576 0.0561 0.0778 -0.0024 0.0101  -0.0042 232 LEU A CD1 
400 C  CD2 . LEU A 41 ? 0.0606 0.0559 0.0683 0.0055  0.0047  -0.0074 232 LEU A CD2 
401 N  N   . LEU A 42 ? 0.0438 0.0484 0.0617 -0.0047 -0.0061 0.0087  233 LEU A N   
402 C  CA  . LEU A 42 ? 0.0433 0.0526 0.0651 -0.0031 -0.0035 0.0095  233 LEU A CA  
403 C  C   . LEU A 42 ? 0.0436 0.0519 0.0597 -0.0016 -0.0055 0.0048  233 LEU A C   
404 O  O   . LEU A 42 ? 0.0411 0.0670 0.0642 -0.0064 -0.0019 0.0009  233 LEU A O   
405 C  CB  . LEU A 42 ? 0.0548 0.0564 0.0670 0.0025  -0.0041 0.0101  233 LEU A CB  
406 C  CG  . LEU A 42 ? 0.0891 0.0576 0.0689 0.0059  -0.0036 0.0025  233 LEU A CG  
407 C  CD1 . LEU A 42 ? 0.1288 0.0786 0.1051 0.0113  0.0092  -0.0195 233 LEU A CD1 
408 C  CD2 . LEU A 42 ? 0.1176 0.0814 0.1010 0.0076  0.0352  -0.0058 233 LEU A CD2 
409 N  N   . THR A 43 ? 0.0417 0.0631 0.0653 -0.0048 -0.0015 0.0012  234 THR A N   
410 C  CA  . THR A 43 ? 0.0409 0.0674 0.0561 -0.0060 -0.0019 -0.0024 234 THR A CA  
411 C  C   . THR A 43 ? 0.0346 0.0743 0.0516 -0.0092 -0.0034 -0.0030 234 THR A C   
412 O  O   . THR A 43 ? 0.0396 0.0735 0.0553 -0.0006 0.0008  0.0048  234 THR A O   
413 C  CB  . THR A 43 ? 0.0408 0.0794 0.0658 -0.0086 0.0042  -0.0089 234 THR A CB  
414 O  OG1 . THR A 43 ? 0.0439 0.0665 0.0713 -0.0069 -0.0054 0.0024  234 THR A OG1 
415 C  CG2 . THR A 43 ? 0.0522 0.0690 0.1113 0.0028  -0.0091 -0.0257 234 THR A CG2 
416 N  N   . GLU A 44 ? 0.0523 0.0795 0.0516 -0.0156 0.0036  -0.0013 235 GLU A N   
417 C  CA  . GLU A 44 ? 0.0533 0.0960 0.0569 -0.0123 0.0018  0.0122  235 GLU A CA  
418 C  C   . GLU A 44 ? 0.0488 0.0900 0.0516 -0.0057 -0.0007 0.0133  235 GLU A C   
419 O  O   . GLU A 44 ? 0.0641 0.0802 0.0823 0.0127  -0.0136 0.0023  235 GLU A O   
420 C  CB  . GLU A 44 ? 0.0587 0.1111 0.0568 -0.0168 -0.0047 0.0181  235 GLU A CB  
421 C  CG  . GLU A 44 ? 0.0493 0.0993 0.0857 -0.0223 -0.0079 0.0256  235 GLU A CG  
422 C  CD  A GLU A 44 ? 0.0389 0.0552 0.0652 -0.0082 -0.0105 0.0014  235 GLU A CD  
423 C  CD  B GLU A 44 ? 0.1409 0.3178 0.1834 0.0450  -0.1392 -0.1142 235 GLU A CD  
424 O  OE1 A GLU A 44 ? 0.0703 0.0720 0.0686 -0.0273 -0.0124 0.0032  235 GLU A OE1 
425 O  OE1 B GLU A 44 ? 0.8608 0.3301 0.0908 0.0611  0.1393  0.1510  235 GLU A OE1 
426 O  OE2 A GLU A 44 ? 0.0518 0.0664 0.0582 -0.0151 -0.0019 0.0078  235 GLU A OE2 
427 O  OE2 B GLU A 44 ? 0.4308 0.4357 0.2052 0.1752  -0.1767 -0.1112 235 GLU A OE2 
428 N  N   . HIS A 45 ? 0.0411 0.0591 0.0643 -0.0036 0.0036  -0.0036 236 HIS A N   
429 C  CA  . HIS A 45 ? 0.0378 0.0490 0.0650 0.0002  0.0064  0.0001  236 HIS A CA  
430 C  C   . HIS A 45 ? 0.0398 0.0438 0.0609 0.0009  0.0033  -0.0022 236 HIS A C   
431 O  O   . HIS A 45 ? 0.0476 0.0405 0.0811 -0.0042 0.0121  -0.0081 236 HIS A O   
432 C  CB  A HIS A 45 ? 0.0465 0.0476 0.0571 0.0076  0.0042  -0.0016 236 HIS A CB  
433 C  CB  B HIS A 45 ? 0.0362 0.0562 0.1167 -0.0426 -0.0295 0.0310  236 HIS A CB  
434 C  CG  A HIS A 45 ? 0.0528 0.0444 0.0581 0.0011  0.0067  0.0077  236 HIS A CG  
435 C  CG  B HIS A 45 ? 0.0707 0.0338 0.0247 0.0447  0.0090  -0.0124 236 HIS A CG  
436 N  ND1 A HIS A 45 ? 0.0503 0.0538 0.0564 0.0013  0.0033  -0.0008 236 HIS A ND1 
437 N  ND1 B HIS A 45 ? 0.0148 0.0402 0.0482 0.0115  0.0205  0.0268  236 HIS A ND1 
438 C  CD2 A HIS A 45 ? 0.0625 0.0528 0.0723 -0.0060 0.0120  -0.0049 236 HIS A CD2 
439 C  CD2 B HIS A 45 ? 0.0126 0.1169 0.0636 0.0057  0.0332  0.0150  236 HIS A CD2 
440 C  CE1 A HIS A 45 ? 0.0520 0.0555 0.0768 0.0070  0.0196  0.0007  236 HIS A CE1 
441 C  CE1 B HIS A 45 ? 0.0586 0.0327 0.0260 -0.0016 0.0163  -0.0240 236 HIS A CE1 
442 N  NE2 A HIS A 45 ? 0.0732 0.0493 0.0925 -0.0004 0.0290  -0.0073 236 HIS A NE2 
443 N  NE2 B HIS A 45 ? 0.0395 0.0335 0.0316 -0.0311 -0.0224 0.0206  236 HIS A NE2 
444 N  N   . ASN A 46 ? 0.0377 0.0404 0.0607 0.0012  0.0039  -0.0048 237 ASN A N   
445 C  CA  . ASN A 46 ? 0.0323 0.0431 0.0589 -0.0015 0.0010  -0.0043 237 ASN A CA  
446 C  C   . ASN A 46 ? 0.0407 0.0462 0.0541 -0.0010 0.0011  -0.0041 237 ASN A C   
447 O  O   . ASN A 46 ? 0.0491 0.0595 0.0517 0.0045  0.0019  -0.0095 237 ASN A O   
448 C  CB  . ASN A 46 ? 0.0415 0.0466 0.0671 -0.0065 -0.0020 0.0029  237 ASN A CB  
449 C  CG  . ASN A 46 ? 0.0398 0.0515 0.0637 0.0005  0.0004  0.0107  237 ASN A CG  
450 O  OD1 . ASN A 46 ? 0.0448 0.0554 0.0629 -0.0059 -0.0080 0.0064  237 ASN A OD1 
451 N  ND2 . ASN A 46 ? 0.0514 0.0748 0.0646 -0.0170 -0.0024 0.0107  237 ASN A ND2 
452 N  N   . ILE A 47 ? 0.0392 0.0595 0.0486 0.0026  -0.0018 -0.0076 238 ILE A N   
453 C  CA  . ILE A 47 ? 0.0359 0.0658 0.0484 0.0012  -0.0013 -0.0011 238 ILE A CA  
454 C  C   . ILE A 47 ? 0.0407 0.0765 0.0487 -0.0019 0.0018  0.0025  238 ILE A C   
455 O  O   . ILE A 47 ? 0.0612 0.1090 0.0581 -0.0173 0.0146  -0.0010 238 ILE A O   
456 C  CB  . ILE A 47 ? 0.0453 0.0695 0.0582 0.0092  0.0043  0.0023  238 ILE A CB  
457 C  CG1 . ILE A 47 ? 0.0618 0.0625 0.0794 0.0079  0.0008  0.0056  238 ILE A CG1 
458 C  CG2 . ILE A 47 ? 0.0604 0.0974 0.0719 0.0194  -0.0009 0.0155  238 ILE A CG2 
459 C  CD1 . ILE A 47 ? 0.1014 0.0588 0.1397 0.0094  0.0098  -0.0125 238 ILE A CD1 
460 N  N   . CYS A 48 ? 0.0424 0.0632 0.0509 -0.0055 -0.0015 0.0087  239 CYS A N   
461 C  CA  . CYS A 48 ? 0.0418 0.0552 0.0632 -0.0020 -0.0025 0.0108  239 CYS A CA  
462 C  C   . CYS A 48 ? 0.0464 0.0448 0.0573 -0.0017 -0.0032 0.0041  239 CYS A C   
463 O  O   . CYS A 48 ? 0.0418 0.0574 0.0665 -0.0047 0.0008  0.0123  239 CYS A O   
464 C  CB  . CYS A 48 ? 0.0490 0.0600 0.0995 0.0046  -0.0030 0.0100  239 CYS A CB  
465 S  SG  . CYS A 48 ? 0.0547 0.0796 0.1694 0.0067  -0.0154 0.0395  239 CYS A SG  
466 N  N   . GLU A 49 ? 0.0418 0.0485 0.0572 -0.0058 -0.0017 0.0114  240 GLU A N   
467 C  CA  . GLU A 49 ? 0.0409 0.0498 0.0632 -0.0014 -0.0055 0.0066  240 GLU A CA  
468 C  C   . GLU A 49 ? 0.0439 0.0466 0.0556 -0.0002 0.0022  0.0056  240 GLU A C   
469 O  O   . GLU A 49 ? 0.0472 0.0529 0.0748 0.0068  0.0101  0.0154  240 GLU A O   
470 C  CB  . GLU A 49 ? 0.0679 0.0494 0.0735 0.0028  -0.0091 -0.0069 240 GLU A CB  
471 C  CG  A GLU A 49 ? 0.0748 0.0419 0.0755 0.0078  -0.0232 -0.0113 240 GLU A CG  
472 C  CG  B GLU A 49 ? 0.1627 0.1091 0.1276 -0.0691 0.0617  -0.0276 240 GLU A CG  
473 C  CD  A GLU A 49 ? 0.1324 0.0498 0.0772 0.0046  -0.0475 -0.0084 240 GLU A CD  
474 C  CD  B GLU A 49 ? 0.3156 0.2282 0.1224 -0.0780 0.0735  -0.0616 240 GLU A CD  
475 O  OE1 A GLU A 49 ? 0.1390 0.0598 0.0864 0.0109  -0.0293 -0.0141 240 GLU A OE1 
476 O  OE1 B GLU A 49 ? 0.2716 0.3453 0.3025 0.1399  -0.1719 -0.1493 240 GLU A OE1 
477 O  OE2 A GLU A 49 ? 0.2279 0.0507 0.0929 0.0000  -0.0608 -0.0113 240 GLU A OE2 
478 O  OE2 B GLU A 49 ? 0.3139 0.2508 0.2578 0.0017  0.1782  -0.0691 240 GLU A OE2 
479 N  N   . ILE A 50 ? 0.0412 0.0447 0.0554 0.0004  0.0019  0.0019  241 ILE A N   
480 C  CA  . ILE A 50 ? 0.0419 0.0440 0.0552 -0.0018 0.0026  0.0003  241 ILE A CA  
481 C  C   . ILE A 50 ? 0.0469 0.0337 0.0547 0.0013  -0.0009 0.0009  241 ILE A C   
482 O  O   . ILE A 50 ? 0.0424 0.0502 0.0591 -0.0009 0.0015  -0.0024 241 ILE A O   
483 C  CB  . ILE A 50 ? 0.0428 0.0489 0.0600 0.0007  0.0032  -0.0067 241 ILE A CB  
484 C  CG1 . ILE A 50 ? 0.0575 0.0518 0.0659 0.0032  -0.0060 -0.0111 241 ILE A CG1 
485 C  CG2 . ILE A 50 ? 0.0657 0.0430 0.0718 0.0034  0.0016  -0.0045 241 ILE A CG2 
486 C  CD1 . ILE A 50 ? 0.0794 0.0578 0.0668 -0.0072 -0.0057 -0.0085 241 ILE A CD1 
487 N  N   . ASN A 51 ? 0.0449 0.0424 0.0519 0.0002  0.0012  0.0049  242 ASN A N   
488 C  CA  . ASN A 51 ? 0.0513 0.0472 0.0562 0.0022  -0.0055 0.0024  242 ASN A CA  
489 C  C   . ASN A 51 ? 0.0669 0.0580 0.0509 -0.0044 -0.0031 0.0022  242 ASN A C   
490 O  O   . ASN A 51 ? 0.0693 0.0655 0.0850 -0.0153 -0.0183 0.0046  242 ASN A O   
491 C  CB  . ASN A 51 ? 0.0451 0.0471 0.0703 0.0012  -0.0058 0.0057  242 ASN A CB  
492 C  CG  . ASN A 51 ? 0.0403 0.0502 0.0839 0.0014  -0.0059 0.0116  242 ASN A CG  
493 O  OD1 . ASN A 51 ? 0.0417 0.0532 0.1206 0.0033  0.0006  0.0166  242 ASN A OD1 
494 N  ND2 . ASN A 51 ? 0.0545 0.0464 0.1106 0.0025  -0.0006 0.0008  242 ASN A ND2 
495 N  N   . GLY A 52 ? 0.0756 0.0454 0.0510 -0.0043 -0.0009 -0.0014 243 GLY A N   
496 C  CA  . GLY A 52 ? 0.1044 0.0545 0.0592 -0.0164 -0.0019 -0.0057 243 GLY A CA  
497 C  C   . GLY A 52 ? 0.1103 0.0660 0.0653 -0.0380 -0.0013 -0.0008 243 GLY A C   
498 O  O   . GLY A 52 ? 0.2589 0.0987 0.0986 -0.1062 0.0559  -0.0289 243 GLY A O   
499 N  N   . GLN A 53 ? 0.0563 0.0606 0.0559 -0.0136 -0.0042 0.0059  244 GLN A N   
500 C  CA  . GLN A 53 ? 0.0506 0.0711 0.0605 -0.0145 -0.0030 0.0117  244 GLN A CA  
501 C  C   . GLN A 53 ? 0.0505 0.0708 0.0512 -0.0138 -0.0016 0.0059  244 GLN A C   
502 O  O   . GLN A 53 ? 0.0495 0.0765 0.0631 -0.0145 -0.0029 0.0114  244 GLN A O   
503 C  CB  . GLN A 53 ? 0.0502 0.0854 0.0697 -0.0014 0.0043  0.0074  244 GLN A CB  
504 C  CG  . GLN A 53 ? 0.0566 0.1088 0.0770 0.0035  0.0136  0.0096  244 GLN A CG  
505 C  CD  . GLN A 53 ? 0.0744 0.1237 0.0870 0.0173  0.0280  0.0253  244 GLN A CD  
506 O  OE1 . GLN A 53 ? 0.1351 0.1189 0.1196 0.0286  0.0695  0.0202  244 GLN A OE1 
507 N  NE2 . GLN A 53 ? 0.0812 0.1507 0.1127 0.0412  0.0484  0.0425  244 GLN A NE2 
508 N  N   . ASN A 54 ? 0.0510 0.0738 0.0606 -0.0185 -0.0052 0.0075  245 ASN A N   
509 C  CA  . ASN A 54 ? 0.0523 0.0765 0.0595 -0.0086 -0.0061 0.0101  245 ASN A CA  
510 C  C   . ASN A 54 ? 0.0469 0.0928 0.0559 -0.0035 -0.0021 0.0092  245 ASN A C   
511 O  O   . ASN A 54 ? 0.0415 0.2166 0.0778 0.0096  0.0038  -0.0269 245 ASN A O   
512 C  CB  . ASN A 54 ? 0.0713 0.0941 0.0766 -0.0170 -0.0168 0.0272  245 ASN A CB  
513 C  CG  A ASN A 54 ? 0.0642 0.0737 0.0710 -0.0103 -0.0166 0.0148  245 ASN A CG  
514 C  CG  B ASN A 54 ? 0.0446 0.0677 0.0437 -0.0188 0.0061  -0.0065 245 ASN A CG  
515 O  OD1 A ASN A 54 ? 0.0648 0.0669 0.1033 -0.0088 -0.0155 0.0071  245 ASN A OD1 
516 O  OD1 B ASN A 54 ? 0.0837 0.0456 0.0701 -0.0162 -0.0317 0.0106  245 ASN A OD1 
517 N  ND2 A ASN A 54 ? 0.0758 0.0995 0.0961 -0.0261 -0.0209 0.0371  245 ASN A ND2 
518 N  ND2 B ASN A 54 ? 0.0737 0.0598 0.0461 -0.0026 -0.0053 0.0066  245 ASN A ND2 
519 N  N   . VAL A 55 ? 0.0436 0.0565 0.0538 0.0027  0.0055  0.0071  246 VAL A N   
520 C  CA  . VAL A 55 ? 0.0478 0.0523 0.0534 0.0078  0.0077  0.0031  246 VAL A CA  
521 C  C   . VAL A 55 ? 0.0487 0.0463 0.0513 0.0035  0.0006  0.0013  246 VAL A C   
522 O  O   . VAL A 55 ? 0.0597 0.0471 0.0540 0.0030  -0.0002 -0.0011 246 VAL A O   
523 C  CB  . VAL A 55 ? 0.0595 0.0476 0.0584 0.0056  0.0069  0.0066  246 VAL A CB  
524 C  CG1 . VAL A 55 ? 0.0740 0.0546 0.0674 0.0134  0.0104  0.0122  246 VAL A CG1 
525 C  CG2 . VAL A 55 ? 0.0606 0.0513 0.0736 -0.0015 0.0155  0.0055  246 VAL A CG2 
526 N  N   . ILE A 56 ? 0.0582 0.0440 0.0492 0.0018  -0.0012 0.0012  247 ILE A N   
527 C  CA  . ILE A 56 ? 0.0515 0.0443 0.0520 -0.0002 -0.0020 -0.0010 247 ILE A CA  
528 C  C   . ILE A 56 ? 0.0452 0.0390 0.0603 -0.0050 -0.0007 0.0036  247 ILE A C   
529 O  O   . ILE A 56 ? 0.0443 0.0599 0.0790 -0.0056 -0.0009 -0.0032 247 ILE A O   
530 C  CB  . ILE A 56 ? 0.0635 0.0466 0.0557 0.0049  -0.0028 -0.0022 247 ILE A CB  
531 C  CG1 . ILE A 56 ? 0.0942 0.0605 0.0562 0.0295  0.0073  0.0051  247 ILE A CG1 
532 C  CG2 . ILE A 56 ? 0.0618 0.0424 0.0587 0.0011  -0.0019 0.0014  247 ILE A CG2 
533 C  CD1 . ILE A 56 ? 0.0801 0.0867 0.0791 0.0229  0.0229  0.0213  247 ILE A CD1 
534 N  N   . GLY A 57 ? 0.0501 0.0413 0.0519 0.0018  0.0033  0.0001  248 GLY A N   
535 C  CA  . GLY A 57 ? 0.0592 0.0472 0.0561 0.0062  0.0109  0.0063  248 GLY A CA  
536 C  C   . GLY A 57 ? 0.0483 0.0491 0.0472 -0.0010 0.0024  0.0035  248 GLY A C   
537 O  O   . GLY A 57 ? 0.0539 0.0510 0.0560 0.0025  0.0094  0.0062  248 GLY A O   
538 N  N   . LEU A 58 ? 0.0424 0.0400 0.0496 -0.0020 0.0002  0.0017  249 LEU A N   
539 C  CA  . LEU A 58 ? 0.0381 0.0447 0.0555 -0.0005 0.0005  -0.0004 249 LEU A CA  
540 C  C   . LEU A 58 ? 0.0440 0.0371 0.0532 0.0005  -0.0008 0.0041  249 LEU A C   
541 O  O   . LEU A 58 ? 0.0411 0.0460 0.0718 -0.0006 -0.0058 -0.0051 249 LEU A O   
542 C  CB  . LEU A 58 ? 0.0471 0.0430 0.0597 0.0016  -0.0021 0.0005  249 LEU A CB  
543 C  CG  . LEU A 58 ? 0.0502 0.0522 0.0526 0.0047  -0.0030 -0.0028 249 LEU A CG  
544 C  CD1 . LEU A 58 ? 0.0636 0.0740 0.0557 0.0167  -0.0046 -0.0025 249 LEU A CD1 
545 C  CD2 . LEU A 58 ? 0.0448 0.0712 0.0732 -0.0059 -0.0063 -0.0051 249 LEU A CD2 
546 N  N   . LYS A 59 ? 0.0464 0.0452 0.0557 -0.0065 -0.0004 -0.0020 250 LYS A N   
547 C  CA  . LYS A 59 ? 0.0502 0.0510 0.0539 -0.0062 -0.0031 -0.0026 250 LYS A CA  
548 C  C   . LYS A 59 ? 0.0489 0.0336 0.0559 0.0043  -0.0029 -0.0028 250 LYS A C   
549 O  O   . LYS A 59 ? 0.0495 0.0425 0.0541 0.0008  -0.0063 -0.0001 250 LYS A O   
550 C  CB  . LYS A 59 ? 0.0646 0.0522 0.0607 -0.0051 -0.0005 -0.0064 250 LYS A CB  
551 C  CG  . LYS A 59 ? 0.0786 0.0583 0.0678 -0.0092 0.0095  -0.0062 250 LYS A CG  
552 C  CD  . LYS A 59 ? 0.0738 0.0669 0.0598 -0.0046 0.0119  -0.0056 250 LYS A CD  
553 C  CE  . LYS A 59 ? 0.0616 0.0643 0.0716 -0.0059 0.0087  -0.0003 250 LYS A CE  
554 N  NZ  . LYS A 59 ? 0.0641 0.0683 0.0591 -0.0096 0.0027  0.0143  250 LYS A NZ  
555 N  N   . ASP A 60 ? 0.0434 0.0434 0.0525 -0.0029 -0.0050 0.0013  251 ASP A N   
556 C  CA  . ASP A 60 ? 0.0434 0.0429 0.0558 -0.0020 0.0026  0.0027  251 ASP A CA  
557 C  C   . ASP A 60 ? 0.0395 0.0431 0.0550 -0.0056 0.0019  0.0007  251 ASP A C   
558 O  O   . ASP A 60 ? 0.0474 0.0496 0.0599 -0.0001 0.0022  0.0095  251 ASP A O   
559 C  CB  . ASP A 60 ? 0.0462 0.0448 0.0667 -0.0008 -0.0005 -0.0051 251 ASP A CB  
560 C  CG  . ASP A 60 ? 0.0424 0.0455 0.0603 -0.0013 0.0006  -0.0052 251 ASP A CG  
561 O  OD1 . ASP A 60 ? 0.0472 0.0448 0.0614 0.0025  -0.0010 -0.0027 251 ASP A OD1 
562 O  OD2 . ASP A 60 ? 0.0509 0.0692 0.0907 0.0013  -0.0176 -0.0241 251 ASP A OD2 
563 N  N   . SER A 61 ? 0.0454 0.0426 0.0549 -0.0014 -0.0007 0.0034  252 SER A N   
564 C  CA  . SER A 61 ? 0.0496 0.0411 0.0634 0.0019  -0.0022 -0.0022 252 SER A CA  
565 C  C   . SER A 61 ? 0.0449 0.0357 0.0596 0.0008  0.0047  0.0017  252 SER A C   
566 O  O   . SER A 61 ? 0.0505 0.0435 0.0605 0.0011  0.0014  0.0061  252 SER A O   
567 C  CB  . SER A 61 ? 0.0659 0.0561 0.0656 0.0144  -0.0053 -0.0130 252 SER A CB  
568 O  OG  . SER A 61 ? 0.0546 0.0803 0.0645 0.0033  0.0052  -0.0017 252 SER A OG  
569 N  N   . GLN A 62 ? 0.0453 0.0444 0.0555 -0.0015 0.0006  0.0026  253 GLN A N   
570 C  CA  . GLN A 62 ? 0.0394 0.0427 0.0584 0.0024  0.0026  0.0027  253 GLN A CA  
571 C  C   . GLN A 62 ? 0.0461 0.0420 0.0554 -0.0011 -0.0044 0.0016  253 GLN A C   
572 O  O   . GLN A 62 ? 0.0455 0.0535 0.0590 0.0020  -0.0025 0.0079  253 GLN A O   
573 C  CB  . GLN A 62 ? 0.0431 0.0462 0.0619 -0.0037 0.0014  0.0016  253 GLN A CB  
574 C  CG  . GLN A 62 ? 0.0488 0.0574 0.0636 -0.0026 0.0031  -0.0032 253 GLN A CG  
575 C  CD  . GLN A 62 ? 0.0520 0.0630 0.0694 -0.0086 0.0086  0.0001  253 GLN A CD  
576 O  OE1 . GLN A 62 ? 0.0543 0.0663 0.0963 0.0035  0.0070  0.0189  253 GLN A OE1 
577 N  NE2 . GLN A 62 ? 0.0489 0.0669 0.1339 -0.0093 -0.0027 -0.0108 253 GLN A NE2 
578 N  N   . ILE A 63 ? 0.0411 0.0432 0.0528 0.0007  0.0024  0.0035  254 ILE A N   
579 C  CA  . ILE A 63 ? 0.0458 0.0483 0.0514 0.0034  -0.0008 -0.0019 254 ILE A CA  
580 C  C   . ILE A 63 ? 0.0346 0.0504 0.0546 0.0023  -0.0001 0.0046  254 ILE A C   
581 O  O   . ILE A 63 ? 0.0406 0.0563 0.0541 0.0033  -0.0001 0.0063  254 ILE A O   
582 C  CB  . ILE A 63 ? 0.0474 0.0545 0.0549 0.0087  -0.0001 -0.0050 254 ILE A CB  
583 C  CG1 . ILE A 63 ? 0.0790 0.0534 0.0866 0.0157  0.0052  -0.0037 254 ILE A CG1 
584 C  CG2 . ILE A 63 ? 0.0503 0.0754 0.0540 0.0151  0.0045  -0.0047 254 ILE A CG2 
585 C  CD1 . ILE A 63 ? 0.1132 0.0779 0.1390 0.0426  0.0188  0.0331  254 ILE A CD1 
586 N  N   . ALA A 64 ? 0.0457 0.0469 0.0523 -0.0011 -0.0008 0.0061  255 ALA A N   
587 C  CA  . ALA A 64 ? 0.0415 0.0474 0.0592 -0.0060 -0.0053 0.0063  255 ALA A CA  
588 C  C   . ALA A 64 ? 0.0412 0.0394 0.0548 -0.0047 0.0004  0.0005  255 ALA A C   
589 O  O   . ALA A 64 ? 0.0489 0.0472 0.0529 -0.0052 -0.0016 0.0077  255 ALA A O   
590 C  CB  . ALA A 64 ? 0.0520 0.0495 0.0637 -0.0093 -0.0096 0.0043  255 ALA A CB  
591 N  N   . ASP A 65 ? 0.0417 0.0404 0.0542 -0.0006 0.0007  0.0027  256 ASP A N   
592 C  CA  . ASP A 65 ? 0.0428 0.0372 0.0585 0.0016  0.0000  -0.0028 256 ASP A CA  
593 C  C   . ASP A 65 ? 0.0376 0.0393 0.0545 0.0024  0.0013  0.0025  256 ASP A C   
594 O  O   . ASP A 65 ? 0.0496 0.0420 0.0550 0.0064  -0.0041 0.0017  256 ASP A O   
595 C  CB  . ASP A 65 ? 0.0402 0.0422 0.0610 0.0021  0.0033  -0.0007 256 ASP A CB  
596 C  CG  . ASP A 65 ? 0.0572 0.0521 0.0562 0.0130  -0.0005 -0.0046 256 ASP A CG  
597 O  OD1 . ASP A 65 ? 0.0754 0.0472 0.0710 0.0035  -0.0078 -0.0113 256 ASP A OD1 
598 O  OD2 . ASP A 65 ? 0.0675 0.0663 0.0631 0.0103  0.0087  -0.0098 256 ASP A OD2 
599 N  N   . ILE A 66 ? 0.0398 0.0405 0.0529 0.0031  -0.0017 0.0012  257 ILE A N   
600 C  CA  . ILE A 66 ? 0.0355 0.0417 0.0506 0.0009  -0.0027 -0.0008 257 ILE A CA  
601 C  C   . ILE A 66 ? 0.0409 0.0382 0.0532 -0.0001 0.0005  0.0030  257 ILE A C   
602 O  O   . ILE A 66 ? 0.0409 0.0504 0.0517 -0.0019 -0.0043 0.0024  257 ILE A O   
603 C  CB  . ILE A 66 ? 0.0409 0.0420 0.0585 -0.0021 0.0006  -0.0009 257 ILE A CB  
604 C  CG1 . ILE A 66 ? 0.0453 0.0434 0.0646 -0.0040 0.0023  0.0030  257 ILE A CG1 
605 C  CG2 . ILE A 66 ? 0.0650 0.0390 0.0650 0.0011  0.0051  -0.0026 257 ILE A CG2 
606 C  CD1 . ILE A 66 ? 0.0642 0.0487 0.0855 -0.0055 0.0119  0.0060  257 ILE A CD1 
607 N  N   . LEU A 67 ? 0.0367 0.0431 0.0496 -0.0008 -0.0002 0.0045  258 LEU A N   
608 C  CA  . LEU A 67 ? 0.0387 0.0444 0.0508 -0.0043 0.0004  0.0046  258 LEU A CA  
609 C  C   . LEU A 67 ? 0.0341 0.0490 0.0520 -0.0047 -0.0006 0.0044  258 LEU A C   
610 O  O   . LEU A 67 ? 0.0504 0.0500 0.0541 -0.0011 0.0030  0.0069  258 LEU A O   
611 C  CB  . LEU A 67 ? 0.0386 0.0469 0.0553 -0.0021 -0.0009 0.0020  258 LEU A CB  
612 C  CG  . LEU A 67 ? 0.0382 0.0455 0.0596 0.0019  0.0031  0.0043  258 LEU A CG  
613 C  CD1 . LEU A 67 ? 0.0402 0.0689 0.0668 0.0084  -0.0015 0.0025  258 LEU A CD1 
614 C  CD2 . LEU A 67 ? 0.0483 0.0644 0.0662 0.0121  0.0027  -0.0048 258 LEU A CD2 
615 N  N   . SER A 68 ? 0.0412 0.0401 0.0505 -0.0008 0.0001  0.0055  259 SER A N   
616 C  CA  . SER A 68 ? 0.0396 0.0416 0.0580 -0.0042 -0.0004 0.0055  259 SER A CA  
617 C  C   . SER A 68 ? 0.0404 0.0407 0.0534 -0.0003 0.0016  -0.0025 259 SER A C   
618 O  O   . SER A 68 ? 0.0494 0.0430 0.0609 -0.0025 -0.0026 0.0125  259 SER A O   
619 C  CB  . SER A 68 ? 0.0474 0.0536 0.0620 0.0050  -0.0045 0.0019  259 SER A CB  
620 O  OG  A SER A 68 ? 0.0502 0.0466 0.0652 0.0015  -0.0065 -0.0032 259 SER A OG  
621 O  OG  B SER A 68 ? 0.0450 0.0504 0.0549 -0.0021 0.0019  0.0003  259 SER A OG  
622 N  N   . THR A 69 ? 0.0392 0.0416 0.0547 -0.0011 -0.0015 0.0055  260 THR A N   
623 C  CA  . THR A 69 ? 0.0357 0.0438 0.0549 0.0027  -0.0017 0.0008  260 THR A CA  
624 C  C   . THR A 69 ? 0.0413 0.0452 0.0573 -0.0005 0.0021  0.0092  260 THR A C   
625 O  O   . THR A 69 ? 0.0450 0.0535 0.0547 0.0043  -0.0046 0.0035  260 THR A O   
626 C  CB  . THR A 69 ? 0.0411 0.0422 0.0540 0.0022  -0.0020 -0.0004 260 THR A CB  
627 O  OG1 . THR A 69 ? 0.0418 0.0424 0.0567 -0.0046 0.0003  0.0017  260 THR A OG1 
628 C  CG2 . THR A 69 ? 0.0440 0.0494 0.0605 0.0032  -0.0001 -0.0039 260 THR A CG2 
629 N  N   . SER A 70 ? 0.0434 0.0484 0.0557 0.0013  -0.0009 0.0046  261 SER A N   
630 C  CA  . SER A 70 ? 0.0493 0.0454 0.0554 0.0022  -0.0002 -0.0015 261 SER A CA  
631 C  C   . SER A 70 ? 0.0400 0.0442 0.0561 0.0022  0.0015  -0.0014 261 SER A C   
632 O  O   . SER A 70 ? 0.0553 0.0443 0.0588 0.0008  -0.0027 0.0021  261 SER A O   
633 C  CB  . SER A 70 ? 0.0516 0.0449 0.0629 0.0046  0.0023  0.0043  261 SER A CB  
634 O  OG  . SER A 70 ? 0.0629 0.0409 0.0616 0.0049  0.0104  0.0012  261 SER A OG  
635 N  N   . GLY A 71 ? 0.0435 0.0520 0.0576 0.0002  0.0000  0.0005  262 GLY A N   
636 C  CA  . GLY A 71 ? 0.0515 0.0544 0.0537 0.0045  -0.0018 0.0042  262 GLY A CA  
637 C  C   . GLY A 71 ? 0.0486 0.0472 0.0531 0.0051  -0.0032 -0.0023 262 GLY A C   
638 O  O   . GLY A 71 ? 0.0496 0.0524 0.0569 0.0040  -0.0048 0.0069  262 GLY A O   
639 N  N   . THR A 72 ? 0.0526 0.0491 0.0551 0.0084  -0.0048 0.0060  263 THR A N   
640 C  CA  . THR A 72 ? 0.0490 0.0457 0.0554 0.0037  -0.0046 -0.0030 263 THR A CA  
641 C  C   . THR A 72 ? 0.0495 0.0488 0.0519 0.0033  -0.0066 0.0062  263 THR A C   
642 O  O   . THR A 72 ? 0.0460 0.0555 0.0639 0.0013  -0.0039 0.0042  263 THR A O   
643 C  CB  . THR A 72 ? 0.0626 0.0474 0.0594 0.0034  -0.0055 0.0026  263 THR A CB  
644 O  OG1 . THR A 72 ? 0.0791 0.0486 0.0742 0.0132  -0.0005 0.0046  263 THR A OG1 
645 C  CG2 . THR A 72 ? 0.0644 0.0639 0.0627 0.0008  0.0009  0.0114  263 THR A CG2 
646 N  N   . VAL A 73 ? 0.0465 0.0451 0.0610 0.0078  -0.0062 0.0039  264 VAL A N   
647 C  CA  . VAL A 73 ? 0.0508 0.0445 0.0671 0.0136  -0.0041 -0.0022 264 VAL A CA  
648 C  C   . VAL A 73 ? 0.0473 0.0420 0.0666 0.0072  -0.0055 0.0009  264 VAL A C   
649 O  O   . VAL A 73 ? 0.0440 0.0715 0.1003 0.0032  -0.0075 0.0293  264 VAL A O   
650 C  CB  . VAL A 73 ? 0.0807 0.0604 0.0701 0.0178  -0.0087 -0.0082 264 VAL A CB  
651 C  CG1 . VAL A 73 ? 0.1122 0.0893 0.0964 0.0419  -0.0120 -0.0270 264 VAL A CG1 
652 C  CG2 . VAL A 73 ? 0.1323 0.1083 0.0611 0.0373  -0.0055 -0.0070 264 VAL A CG2 
653 N  N   . VAL A 74 ? 0.0445 0.0431 0.0606 0.0043  -0.0019 0.0042  265 VAL A N   
654 C  CA  . VAL A 74 ? 0.0419 0.0429 0.0583 0.0044  0.0003  0.0024  265 VAL A CA  
655 C  C   . VAL A 74 ? 0.0424 0.0463 0.0513 0.0028  0.0002  0.0016  265 VAL A C   
656 O  O   . VAL A 74 ? 0.0398 0.0446 0.0787 0.0057  0.0044  0.0042  265 VAL A O   
657 C  CB  . VAL A 74 ? 0.0462 0.0470 0.0644 0.0067  -0.0044 -0.0003 265 VAL A CB  
658 C  CG1 . VAL A 74 ? 0.0811 0.0618 0.0591 0.0104  -0.0071 -0.0039 265 VAL A CG1 
659 C  CG2 . VAL A 74 ? 0.0575 0.0573 0.0753 0.0117  -0.0059 -0.0145 265 VAL A CG2 
660 N  N   . THR A 75 ? 0.0378 0.0413 0.0575 0.0019  -0.0002 0.0029  266 THR A N   
661 C  CA  . THR A 75 ? 0.0406 0.0433 0.0540 0.0043  -0.0003 0.0048  266 THR A CA  
662 C  C   . THR A 75 ? 0.0410 0.0461 0.0573 0.0056  0.0015  0.0032  266 THR A C   
663 O  O   . THR A 75 ? 0.0438 0.0705 0.0672 0.0089  0.0040  0.0174  266 THR A O   
664 C  CB  . THR A 75 ? 0.0561 0.0467 0.0558 0.0000  0.0014  0.0023  266 THR A CB  
665 O  OG1 . THR A 75 ? 0.0732 0.0590 0.0548 0.0067  -0.0037 0.0020  266 THR A OG1 
666 C  CG2 . THR A 75 ? 0.0809 0.0503 0.0692 0.0036  -0.0002 -0.0053 266 THR A CG2 
667 N  N   . ILE A 76 ? 0.0421 0.0550 0.0526 0.0084  0.0032  0.0071  267 ILE A N   
668 C  CA  . ILE A 76 ? 0.0434 0.0530 0.0518 0.0091  0.0018  0.0067  267 ILE A CA  
669 C  C   . ILE A 76 ? 0.0449 0.0606 0.0473 0.0125  0.0003  0.0057  267 ILE A C   
670 O  O   . ILE A 76 ? 0.0530 0.0720 0.0576 0.0196  0.0109  0.0083  267 ILE A O   
671 C  CB  . ILE A 76 ? 0.0411 0.0636 0.0571 0.0070  0.0030  0.0019  267 ILE A CB  
672 C  CG1 . ILE A 76 ? 0.0515 0.0620 0.0657 0.0068  0.0056  -0.0001 267 ILE A CG1 
673 C  CG2 . ILE A 76 ? 0.0633 0.0673 0.0600 0.0081  -0.0038 0.0023  267 ILE A CG2 
674 C  CD1 . ILE A 76 ? 0.0768 0.0709 0.0609 0.0046  0.0069  -0.0057 267 ILE A CD1 
675 N  N   . THR A 77 ? 0.0472 0.0541 0.0547 0.0123  0.0031  0.0051  268 THR A N   
676 C  CA  . THR A 77 ? 0.0606 0.0547 0.0522 0.0187  -0.0043 -0.0044 268 THR A CA  
677 C  C   . THR A 77 ? 0.0517 0.0385 0.0442 0.0072  0.0035  -0.0016 268 THR A C   
678 O  O   . THR A 77 ? 0.0511 0.0539 0.0507 0.0076  0.0090  0.0032  268 THR A O   
679 C  CB  A THR A 77 ? 0.0598 0.0616 0.0434 -0.0069 -0.0072 -0.0030 268 THR A CB  
680 C  CB  B THR A 77 ? 0.1041 0.0715 0.0658 0.0288  -0.0374 -0.0377 268 THR A CB  
681 O  OG1 A THR A 77 ? 0.0674 0.0590 0.0552 -0.0062 -0.0097 -0.0021 268 THR A OG1 
682 O  OG1 B THR A 77 ? 0.1394 0.0862 0.0560 0.0097  -0.0156 -0.0226 268 THR A OG1 
683 C  CG2 A THR A 77 ? 0.0714 0.0508 0.0782 0.0054  0.0032  -0.0098 268 THR A CG2 
684 C  CG2 B THR A 77 ? 0.0952 0.0530 0.0851 0.0006  0.0053  -0.0262 268 THR A CG2 
685 N  N   . ILE A 78 ? 0.0467 0.0421 0.0461 0.0058  0.0033  0.0013  269 ILE A N   
686 C  CA  . ILE A 78 ? 0.0496 0.0447 0.0559 0.0098  -0.0051 0.0002  269 ILE A CA  
687 C  C   . ILE A 78 ? 0.0486 0.0425 0.0558 0.0048  -0.0004 0.0045  269 ILE A C   
688 O  O   . ILE A 78 ? 0.0773 0.0508 0.0569 0.0169  0.0071  0.0011  269 ILE A O   
689 C  CB  . ILE A 78 ? 0.0562 0.0493 0.0711 0.0037  -0.0083 0.0025  269 ILE A CB  
690 C  CG1 . ILE A 78 ? 0.0504 0.0537 0.0913 0.0017  0.0009  0.0037  269 ILE A CG1 
691 C  CG2 . ILE A 78 ? 0.0679 0.0450 0.0898 0.0033  -0.0061 -0.0013 269 ILE A CG2 
692 C  CD1 . ILE A 78 ? 0.0554 0.0696 0.1046 -0.0074 -0.0078 0.0128  269 ILE A CD1 
693 N  N   . MET A 79 ? 0.0521 0.0461 0.0580 0.0094  -0.0037 -0.0011 270 MET A N   
694 C  CA  . MET A 79 ? 0.0579 0.0446 0.0656 0.0076  -0.0105 -0.0004 270 MET A CA  
695 C  C   . MET A 79 ? 0.0464 0.0339 0.0600 0.0020  -0.0022 0.0012  270 MET A C   
696 O  O   . MET A 79 ? 0.0508 0.0410 0.0661 0.0078  -0.0029 -0.0064 270 MET A O   
697 C  CB  . MET A 79 ? 0.0582 0.0554 0.0801 0.0082  -0.0016 0.0076  270 MET A CB  
698 C  CG  . MET A 79 ? 0.0886 0.0843 0.0895 -0.0291 0.0049  -0.0094 270 MET A CG  
699 S  SD  A MET A 79 ? 0.1051 0.0513 0.0598 -0.0108 0.0019  0.0011  270 MET A SD  
700 S  SD  B MET A 79 ? 0.1016 0.0905 0.1485 0.0081  0.0137  0.0629  270 MET A SD  
701 C  CE  A MET A 79 ? 0.1098 0.0567 0.0792 0.0099  0.0156  -0.0041 270 MET A CE  
702 C  CE  B MET A 79 ? 0.0915 0.1179 0.1364 -0.0378 0.0422  -0.0316 270 MET A CE  
703 N  N   . PRO A 80 ? 0.0450 0.0390 0.0549 0.0065  -0.0005 0.0012  271 PRO A N   
704 C  CA  . PRO A 80 ? 0.0408 0.0400 0.0582 -0.0020 -0.0003 0.0018  271 PRO A CA  
705 C  C   . PRO A 80 ? 0.0360 0.0384 0.0598 0.0035  -0.0039 -0.0031 271 PRO A C   
706 O  O   . PRO A 80 ? 0.0533 0.0422 0.0558 -0.0038 -0.0009 0.0019  271 PRO A O   
707 C  CB  . PRO A 80 ? 0.0385 0.0635 0.0660 0.0062  0.0009  -0.0007 271 PRO A CB  
708 C  CG  . PRO A 80 ? 0.0563 0.0568 0.0641 0.0140  0.0105  0.0021  271 PRO A CG  
709 C  CD  . PRO A 80 ? 0.0605 0.0574 0.0581 0.0169  -0.0021 -0.0061 271 PRO A CD  
710 N  N   . ALA A 81 ? 0.0477 0.0587 0.0531 -0.0112 -0.0031 0.0013  272 ALA A N   
711 C  CA  . ALA A 81 ? 0.0410 0.0531 0.0565 -0.0031 -0.0019 0.0010  272 ALA A CA  
712 C  C   . ALA A 81 ? 0.0372 0.0444 0.0562 0.0022  0.0019  -0.0041 272 ALA A C   
713 O  O   . ALA A 81 ? 0.0432 0.0518 0.0670 -0.0074 -0.0045 0.0085  272 ALA A O   
714 C  CB  . ALA A 81 ? 0.0426 0.0710 0.0608 0.0033  -0.0033 0.0017  272 ALA A CB  
715 N  N   . PHE A 82 ? 0.0383 0.0526 0.0511 -0.0021 0.0000  -0.0008 273 PHE A N   
716 C  CA  . PHE A 82 ? 0.0372 0.0481 0.0503 -0.0021 0.0005  0.0011  273 PHE A CA  
717 C  C   . PHE A 82 ? 0.0369 0.0467 0.0563 -0.0024 0.0010  -0.0007 273 PHE A C   
718 O  O   . PHE A 82 ? 0.0474 0.0687 0.0539 -0.0024 -0.0041 -0.0001 273 PHE A O   
719 C  CB  . PHE A 82 ? 0.0511 0.0501 0.0573 0.0033  -0.0023 -0.0019 273 PHE A CB  
720 C  CG  . PHE A 82 ? 0.0452 0.0459 0.0599 0.0084  -0.0003 -0.0013 273 PHE A CG  
721 C  CD1 . PHE A 82 ? 0.0484 0.0481 0.0655 0.0062  -0.0063 -0.0082 273 PHE A CD1 
722 C  CD2 . PHE A 82 ? 0.0446 0.0586 0.0664 0.0067  -0.0035 -0.0081 273 PHE A CD2 
723 C  CE1 . PHE A 82 ? 0.0544 0.0593 0.0665 0.0123  -0.0037 -0.0088 273 PHE A CE1 
724 C  CE2 . PHE A 82 ? 0.0460 0.0751 0.0699 0.0019  0.0049  -0.0129 273 PHE A CE2 
725 C  CZ  . PHE A 82 ? 0.0567 0.0622 0.0630 0.0060  0.0074  -0.0090 273 PHE A CZ  
726 O  OXT . PHE A 82 ? 0.0402 0.0562 0.0576 -0.0007 0.0030  -0.0001 273 PHE A OXT 
727 CL CL  A CL  B .  ? 0.0663 0.0813 0.0650 0.0077  -0.0057 0.0027  274 CL  A CL  
728 O  O   . HOH C .  ? 0.0535 0.0509 0.0750 -0.0023 -0.0074 0.0024  275 HOH A O   
729 O  O   . HOH C .  ? 0.0495 0.0430 0.0838 -0.0053 0.0023  0.0069  276 HOH A O   
730 O  O   . HOH C .  ? 0.0620 0.0550 0.0760 -0.0071 0.0101  0.0017  277 HOH A O   
731 O  O   . HOH C .  ? 0.0890 0.0658 0.0623 -0.0112 -0.0068 0.0007  278 HOH A O   
732 O  O   . HOH C .  ? 0.0408 0.0616 0.0834 -0.0056 -0.0011 0.0149  279 HOH A O   
733 O  O   . HOH C .  ? 0.0468 0.0559 0.0634 -0.0071 -0.0029 0.0007  280 HOH A O   
734 O  O   . HOH C .  ? 0.0610 0.0496 0.0807 -0.0028 -0.0024 -0.0113 281 HOH A O   
735 O  O   . HOH C .  ? 0.0406 0.0632 0.0747 -0.0013 -0.0007 -0.0174 282 HOH A O   
736 O  O   . HOH C .  ? 0.0426 0.0588 0.0673 0.0028  -0.0008 0.0025  283 HOH A O   
737 O  O   . HOH C .  ? 0.0535 0.0578 0.0663 0.0019  -0.0010 0.0159  284 HOH A O   
738 O  O   . HOH C .  ? 0.0477 0.0780 0.0602 0.0130  0.0018  0.0076  285 HOH A O   
739 O  O   . HOH C .  ? 0.0770 0.0580 0.0653 0.0010  0.0087  0.0014  286 HOH A O   
740 O  O   . HOH C .  ? 0.0582 0.0602 0.0709 0.0062  0.0001  0.0049  287 HOH A O   
741 O  O   . HOH C .  ? 0.0761 0.0767 0.0926 0.0096  -0.0220 -0.0017 288 HOH A O   
742 O  O   . HOH C .  ? 0.0529 0.0499 0.0604 0.0024  -0.0085 0.0011  289 HOH A O   
743 O  O   . HOH C .  ? 0.0693 0.0687 0.0882 0.0067  -0.0023 -0.0164 290 HOH A O   
744 O  O   . HOH C .  ? 0.0645 0.0723 0.0783 0.0087  0.0047  -0.0038 291 HOH A O   
745 O  O   . HOH C .  ? 0.0554 0.0655 0.0700 0.0031  -0.0042 -0.0027 292 HOH A O   
746 O  O   . HOH C .  ? 0.0680 0.0600 0.0719 0.0097  0.0084  -0.0043 293 HOH A O   
747 O  O   . HOH C .  ? 0.0491 0.0513 0.1754 -0.0015 -0.0150 -0.0028 294 HOH A O   
748 O  O   . HOH C .  ? 0.0612 0.0891 0.0688 -0.0042 0.0034  0.0105  295 HOH A O   
749 O  O   . HOH C .  ? 0.0654 0.0633 0.0807 -0.0131 -0.0223 0.0128  296 HOH A O   
750 O  O   . HOH C .  ? 0.0517 0.0643 0.0605 0.0009  -0.0015 0.0081  297 HOH A O   
751 O  O   . HOH C .  ? 0.0575 0.0512 0.0617 0.0022  -0.0001 -0.0014 298 HOH A O   
752 O  O   . HOH C .  ? 0.0681 0.0596 0.0698 -0.0021 -0.0011 0.0009  299 HOH A O   
753 O  O   . HOH C .  ? 0.0523 0.0625 0.0978 0.0079  0.0063  -0.0031 300 HOH A O   
754 O  O   . HOH C .  ? 0.0513 0.0577 0.0882 0.0037  0.0056  0.0174  301 HOH A O   
755 O  O   . HOH C .  ? 0.0592 0.0786 0.0755 -0.0163 0.0088  0.0089  302 HOH A O   
756 O  O   . HOH C .  ? 0.0563 0.0514 0.0751 0.0009  -0.0032 0.0145  303 HOH A O   
757 O  O   . HOH C .  ? 0.0540 0.0509 0.0514 -0.0051 0.0044  0.0025  304 HOH A O   
758 O  O   . HOH C .  ? 0.0572 0.0595 0.1160 0.0120  -0.0236 -0.0198 305 HOH A O   
759 O  O   . HOH C .  ? 0.0404 0.0696 0.0863 -0.0081 0.0081  -0.0100 306 HOH A O   
760 O  O   . HOH C .  ? 0.0692 0.0947 0.1004 -0.0031 -0.0087 0.0117  307 HOH A O   
761 O  O   . HOH C .  ? 0.0813 0.0600 0.0845 0.0000  -0.0009 -0.0066 308 HOH A O   
762 O  O   . HOH C .  ? 0.1328 0.1341 0.0940 0.0510  0.0274  0.0478  309 HOH A O   
763 O  O   . HOH C .  ? 0.0572 0.1112 0.1257 -0.0113 -0.0155 0.0440  310 HOH A O   
764 O  O   . HOH C .  ? 0.0628 0.0643 0.0673 0.0015  -0.0022 0.0059  311 HOH A O   
765 O  O   . HOH C .  ? 0.0663 0.1396 0.1139 0.0203  -0.0062 -0.0254 312 HOH A O   
766 O  O   . HOH C .  ? 0.0583 0.0724 0.0968 0.0015  -0.0164 0.0134  313 HOH A O   
767 O  O   . HOH C .  ? 0.0754 0.0638 0.0772 0.0074  0.0194  -0.0083 314 HOH A O   
768 O  O   . HOH C .  ? 0.1002 0.0686 0.1765 -0.0197 -0.0653 0.0349  315 HOH A O   
769 O  O   . HOH C .  ? 0.0556 0.0837 0.1381 -0.0041 0.0003  0.0005  316 HOH A O   
770 O  O   . HOH C .  ? 0.0543 0.0571 0.0526 0.0023  -0.0010 0.0017  317 HOH A O   
771 O  O   . HOH C .  ? 0.0821 0.0702 0.0733 0.0062  0.0040  -0.0020 318 HOH A O   
772 O  O   . HOH C .  ? 0.0690 0.0668 0.0973 0.0102  -0.0003 -0.0171 319 HOH A O   
773 O  O   . HOH C .  ? 0.0692 0.0753 0.1023 -0.0004 -0.0226 0.0171  320 HOH A O   
774 O  O   . HOH C .  ? 0.0580 0.0579 0.0598 0.0022  0.0004  0.0016  321 HOH A O   
775 O  O   . HOH C .  ? 0.0960 0.0743 0.0795 -0.0009 -0.0298 0.0126  322 HOH A O   
776 O  O   . HOH C .  ? 0.0654 0.0755 0.0971 0.0015  -0.0169 0.0113  323 HOH A O   
777 O  O   . HOH C .  ? 0.0573 0.0849 0.0727 -0.0119 -0.0066 0.0092  324 HOH A O   
778 O  O   . HOH C .  ? 0.0545 0.0551 0.0701 -0.0037 0.0011  -0.0037 325 HOH A O   
779 O  O   . HOH C .  ? 0.0484 0.0710 0.0917 -0.0034 0.0121  0.0055  326 HOH A O   
780 O  O   . HOH C .  ? 0.0624 0.0793 0.0875 -0.0034 -0.0192 0.0107  327 HOH A O   
781 O  O   . HOH C .  ? 0.0549 0.0765 0.1418 -0.0019 0.0088  0.0156  328 HOH A O   
782 O  O   . HOH C .  ? 0.0590 0.1330 0.1277 0.0063  -0.0279 0.0351  329 HOH A O   
783 O  O   . HOH C .  ? 0.0592 0.1204 0.1188 -0.0279 -0.0101 0.0346  330 HOH A O   
784 O  O   . HOH C .  ? 0.0441 0.0857 0.0789 -0.0086 -0.0108 0.0268  331 HOH A O   
785 O  O   . HOH C .  ? 0.0866 0.0441 0.0941 0.0048  0.0337  0.0010  332 HOH A O   
786 O  O   . HOH C .  ? 0.1061 0.0714 0.0838 -0.0141 -0.0073 -0.0051 333 HOH A O   
787 O  O   . HOH C .  ? 0.0501 0.0620 0.0723 -0.0056 -0.0048 0.0067  334 HOH A O   
788 O  O   . HOH C .  ? 0.0623 0.0586 0.1616 -0.0033 -0.0198 0.0267  335 HOH A O   
789 O  O   . HOH C .  ? 0.0987 0.0718 0.0677 0.0026  -0.0032 -0.0126 336 HOH A O   
790 O  O   . HOH C .  ? 0.0741 0.0635 0.1215 0.0224  -0.0199 -0.0079 337 HOH A O   
791 O  O   . HOH C .  ? 0.1053 0.1225 0.0858 -0.0183 0.0082  -0.0072 338 HOH A O   
792 O  O   . HOH C .  ? 0.1247 0.0597 0.1068 -0.0088 0.0472  -0.0112 339 HOH A O   
793 O  O   . HOH C .  ? 0.1456 0.0977 0.1003 0.0029  -0.0176 -0.0040 340 HOH A O   
794 O  O   . HOH C .  ? 0.1056 0.1316 0.1455 -0.0182 -0.0452 0.0628  341 HOH A O   
795 O  O   . HOH C .  ? 0.0823 0.0624 0.0531 0.0019  -0.0038 0.0001  342 HOH A O   
796 O  O   . HOH C .  ? 0.0948 0.0839 0.1281 -0.0044 -0.0396 0.0100  343 HOH A O   
797 O  O   . HOH C .  ? 0.0805 0.0926 0.0995 0.0236  -0.0180 -0.0126 344 HOH A O   
798 O  O   . HOH C .  ? 0.0900 0.0808 0.0790 -0.0150 0.0000  0.0168  345 HOH A O   
799 O  O   . HOH C .  ? 0.1149 0.1213 0.0663 -0.0117 0.0105  -0.0054 346 HOH A O   
800 O  O   . HOH C .  ? 0.0894 0.0899 0.1131 0.0077  0.0089  -0.0386 347 HOH A O   
801 O  O   . HOH C .  ? 0.0567 0.0717 0.0698 -0.0034 -0.0168 0.0157  348 HOH A O   
802 O  O   . HOH C .  ? 0.0626 0.1417 0.1627 0.0096  0.0376  0.0474  349 HOH A O   
803 O  O   . HOH C .  ? 0.1634 0.1303 0.0673 0.0463  0.0177  0.0201  350 HOH A O   
804 O  O   . HOH C .  ? 0.0739 0.1305 0.0802 -0.0273 -0.0026 0.0066  351 HOH A O   
805 O  O   . HOH C .  ? 0.2529 0.0746 0.0961 -0.0200 0.0300  0.0009  352 HOH A O   
806 O  O   . HOH C .  ? 0.0710 0.0800 0.0716 -0.0038 0.0036  -0.0028 353 HOH A O   
807 O  O   . HOH C .  ? 0.0776 0.0562 0.0711 -0.0097 0.0162  -0.0025 354 HOH A O   
808 O  O   . HOH C .  ? 0.0836 0.1555 0.0943 0.0463  -0.0247 -0.0216 355 HOH A O   
809 O  O   . HOH C .  ? 0.1449 0.0871 0.1369 0.0229  -0.0536 -0.0232 356 HOH A O   
810 O  O   . HOH C .  ? 0.0629 0.0858 0.1011 0.0069  -0.0150 0.0273  357 HOH A O   
811 O  O   . HOH C .  ? 0.1785 0.1464 0.1395 0.0776  -0.0459 -0.0288 358 HOH A O   
812 O  O   . HOH C .  ? 0.1462 0.0708 0.0663 0.0270  -0.0309 -0.0087 359 HOH A O   
813 O  O   . HOH C .  ? 0.0621 0.0846 0.0973 -0.0104 -0.0170 0.0128  360 HOH A O   
814 O  O   . HOH C .  ? 0.1752 0.1447 0.0646 -0.0639 -0.0174 0.0224  361 HOH A O   
815 O  O   . HOH C .  ? 0.0765 0.0493 0.1151 -0.0042 0.0091  0.0034  362 HOH A O   
816 O  O   . HOH C .  ? 0.1070 0.0726 0.1263 -0.0260 -0.0415 0.0201  363 HOH A O   
817 O  O   . HOH C .  ? 0.2053 0.1014 0.1760 0.0185  0.0765  -0.0427 364 HOH A O   
818 O  O   . HOH C .  ? 0.0829 0.1037 0.1084 0.0144  -0.0174 0.0083  365 HOH A O   
819 O  O   . HOH C .  ? 0.1327 0.1001 0.1067 0.0087  -0.0223 -0.0108 366 HOH A O   
820 O  O   . HOH C .  ? 0.1372 0.0797 0.1238 -0.0280 0.0225  -0.0155 367 HOH A O   
821 O  O   . HOH C .  ? 0.1356 0.0600 0.0694 -0.0203 -0.0068 0.0062  368 HOH A O   
822 O  O   . HOH C .  ? 0.2062 0.1128 0.1757 -0.0185 -0.0901 0.0446  369 HOH A O   
823 O  O   . HOH C .  ? 0.0951 0.0930 0.0724 -0.0116 0.0014  0.0217  370 HOH A O   
824 O  O   . HOH C .  ? 0.1937 0.1055 0.0932 -0.0472 0.0112  -0.0081 371 HOH A O   
825 O  O   . HOH C .  ? 0.1836 0.0815 0.0926 -0.0339 -0.0331 0.0223  372 HOH A O   
826 O  O   . HOH C .  ? 0.1070 0.0862 0.1306 0.0009  0.0517  -0.0003 373 HOH A O   
827 O  O   . HOH C .  ? 0.1170 0.0812 0.0915 0.0040  -0.0146 -0.0086 374 HOH A O   
828 O  O   . HOH C .  ? 0.0790 0.1476 0.0896 -0.0083 0.0069  0.0025  375 HOH A O   
829 O  O   . HOH C .  ? 0.0863 0.2552 0.1272 -0.0026 -0.0035 -0.0321 376 HOH A O   
830 O  O   . HOH C .  ? 0.1297 0.1189 0.1186 0.0053  0.0364  0.0075  377 HOH A O   
831 O  O   . HOH C .  ? 0.1968 0.2089 0.0957 -0.0918 0.0242  -0.0059 378 HOH A O   
832 O  O   . HOH C .  ? 0.0650 0.1199 0.2220 0.0132  -0.0132 -0.0542 379 HOH A O   
833 O  O   . HOH C .  ? 0.1183 0.2084 0.1345 -0.1098 -0.0448 0.0667  380 HOH A O   
834 O  O   . HOH C .  ? 0.1057 0.1971 0.1007 0.0687  -0.0140 -0.0437 381 HOH A O   
835 O  O   . HOH C .  ? 0.2490 0.1004 0.1035 -0.0165 0.0890  -0.0297 382 HOH A O   
836 O  O   . HOH C .  ? 0.4544 0.0776 0.2856 -0.0032 -0.2741 -0.0024 383 HOH A O   
837 O  O   . HOH C .  ? 0.2431 0.1658 0.1706 0.0385  0.0878  0.0837  384 HOH A O   
838 O  O   . HOH C .  ? 0.0940 0.0944 0.1013 -0.0125 -0.0099 -0.0012 385 HOH A O   
839 O  O   . HOH C .  ? 0.1074 0.1062 0.0947 -0.0192 0.0017  -0.0102 386 HOH A O   
840 O  O   . HOH C .  ? 0.1380 0.1722 0.1506 -0.0492 0.0411  -0.0749 387 HOH A O   
841 O  O   . HOH C .  ? 0.2636 0.1881 0.1722 0.1357  -0.1295 -0.0896 388 HOH A O   
842 O  O   . HOH C .  ? 0.1313 0.0690 0.0811 0.0395  -0.0186 -0.0262 389 HOH A O   
843 O  O   . HOH C .  ? 0.1846 0.1835 0.1182 -0.0743 0.0278  -0.0196 390 HOH A O   
844 O  O   . HOH C .  ? 0.2012 0.2944 0.0827 0.0826  0.0038  -0.0353 391 HOH A O   
845 O  O   . HOH C .  ? 0.1807 0.1225 0.2439 -0.0445 -0.0830 0.0615  392 HOH A O   
846 O  O   . HOH C .  ? 0.2578 0.1468 0.4461 0.0549  0.1929  0.0255  393 HOH A O   
847 O  O   . HOH C .  ? 0.2996 0.5321 0.1374 0.3117  0.0335  -0.0019 394 HOH A O   
848 O  O   . HOH C .  ? 0.1228 0.1583 0.1224 0.0528  0.0336  0.0118  395 HOH A O   
849 O  O   . HOH C .  ? 0.1193 0.2135 0.3224 0.0067  -0.0091 0.1077  396 HOH A O   
850 O  O   . HOH C .  ? 0.3972 0.0842 0.3120 0.0164  0.2268  0.0298  397 HOH A O   
851 O  O   . HOH C .  ? 0.1661 0.1369 0.1051 0.0299  -0.0375 -0.0325 398 HOH A O   
852 O  O   . HOH C .  ? 0.1045 0.6184 0.0743 -0.1286 0.0241  -0.0864 399 HOH A O   
853 O  O   . HOH C .  ? 0.2806 0.0753 0.2389 -0.0314 -0.1504 0.0191  400 HOH A O   
854 O  O   . HOH C .  ? 0.4754 0.2252 0.2900 -0.1233 0.2803  -0.0958 401 HOH A O   
855 O  O   . HOH C .  ? 0.1555 0.4218 0.1654 -0.0851 -0.0079 0.0863  402 HOH A O   
856 O  O   . HOH C .  ? 0.0924 0.0953 0.0864 0.0076  -0.0017 0.0207  403 HOH A O   
857 O  O   . HOH C .  ? 0.1353 0.0750 0.1440 0.0083  0.0101  0.0155  404 HOH A O   
858 O  O   . HOH C .  ? 0.4038 0.1244 0.3646 0.1337  -0.0813 -0.0675 405 HOH A O   
859 O  O   . HOH C .  ? 0.1358 0.1307 0.2143 -0.0432 -0.0367 -0.0207 406 HOH A O   
860 O  O   . HOH C .  ? 0.1857 0.1144 0.1604 0.0005  0.0037  -0.0246 407 HOH A O   
861 O  O   . HOH C .  ? 0.2643 0.5056 0.1363 0.0062  0.0686  0.0298  408 HOH A O   
862 O  O   . HOH C .  ? 0.1977 0.3855 0.4079 0.0201  0.0303  0.2882  409 HOH A O   
863 O  O   . HOH C .  ? 0.0786 0.0609 0.0728 0.0166  -0.0180 -0.0162 410 HOH A O   
864 O  O   . HOH C .  ? 0.1731 0.0765 0.1611 -0.0142 0.0517  0.0023  411 HOH A O   
865 O  O   . HOH C .  ? 0.2480 0.1501 0.0668 -0.1207 -0.0026 0.0062  412 HOH A O   
866 O  O   . HOH C .  ? 0.1940 0.1942 0.3353 0.0487  0.0563  0.1380  413 HOH A O   
867 O  O   . HOH C .  ? 0.3735 0.2150 0.2059 -0.1306 0.0830  -0.1349 414 HOH A O   
868 O  O   . HOH C .  ? 0.2888 0.2165 0.2888 -0.0240 -0.1390 0.0656  415 HOH A O   
869 O  O   . HOH C .  ? 0.1749 0.7962 0.3774 -0.1145 -0.1427 0.3468  416 HOH A O   
870 O  O   . HOH C .  ? 0.1959 0.3898 0.1934 0.0787  0.0459  -0.0421 417 HOH A O   
871 O  O   . HOH C .  ? 0.1609 0.2535 0.0866 -0.1363 0.0486  -0.0600 418 HOH A O   
872 O  O   . HOH C .  ? 0.4124 0.1158 0.3451 0.0399  0.2306  -0.0114 419 HOH A O   
873 O  O   . HOH C .  ? 0.2048 0.5027 0.3608 -0.1315 0.1510  -0.2719 420 HOH A O   
874 O  O   . HOH C .  ? 0.2078 0.1495 0.1325 0.0518  -0.0605 -0.0273 421 HOH A O   
875 O  O   . HOH C .  ? 0.3926 0.3290 0.0938 0.2456  -0.0097 -0.0219 422 HOH A O   
876 O  O   . HOH C .  ? 0.1732 0.2136 0.3868 0.0159  -0.0926 -0.1888 423 HOH A O   
877 O  O   . HOH C .  ? 0.7163 0.1888 0.2236 -0.2030 0.0518  -0.0645 424 HOH A O   
878 O  O   . HOH C .  ? 0.2930 0.1690 0.3798 -0.0364 0.2256  -0.0340 425 HOH A O   
879 O  O   . HOH C .  ? 0.4792 0.5381 1.0230 0.1693  -0.2237 -0.4725 426 HOH A O   
880 O  O   . HOH C .  ? 0.5060 0.2064 0.5045 -0.0889 -0.1923 0.2173  427 HOH A O   
881 O  O   . HOH C .  ? 0.0411 0.0431 0.0727 -0.0016 -0.0016 0.0117  428 HOH A O   
882 O  O   . HOH C .  ? 0.1089 0.0780 0.1191 0.0095  0.0250  -0.0059 429 HOH A O   
883 O  O   . HOH C .  ? 0.3220 1.6178 1.2430 0.2453  -0.1823 -0.4495 430 HOH A O   
884 O  O   . HOH C .  ? 0.1842 0.2437 0.1703 0.0599  0.0401  0.0676  431 HOH A O   
885 O  O   . HOH C .  ? 0.0540 0.3026 0.0608 0.0102  0.0069  -0.0349 432 HOH A O   
886 O  O   . HOH C .  ? 0.0547 0.0672 0.0709 0.0010  -0.0052 -0.0066 433 HOH A O   
887 O  O   . HOH C .  ? 0.3084 0.3115 0.1590 -0.2498 -0.0479 0.0157  434 HOH A O   
888 O  O   . HOH C .  ? 0.0682 0.0613 0.0638 -0.0150 -0.0058 0.0008  435 HOH A O   
889 O  O   . HOH C .  ? 0.0718 0.0601 0.0837 0.0034  0.0206  0.0079  436 HOH A O   
890 O  O   . HOH C .  ? 0.1113 0.1328 0.0516 -0.0697 -0.0103 0.0157  437 HOH A O   
891 O  O   . HOH C .  ? 0.0821 0.0627 0.0815 -0.0067 0.0281  -0.0041 438 HOH A O   
892 O  O   . HOH C .  ? 0.0651 0.0507 0.0556 0.0136  0.0005  -0.0073 439 HOH A O   
893 O  O   . HOH C .  ? 0.0919 0.0918 0.0925 0.0093  0.0022  0.0098  440 HOH A O   
894 O  O   . HOH C .  ? 0.0602 0.0772 0.1122 0.0028  -0.0158 0.0135  441 HOH A O   
895 O  O   . HOH C .  ? 0.1456 0.2806 0.0953 0.0993  0.0418  0.0498  442 HOH A O   
896 O  O   . HOH C .  ? 0.0694 0.0637 0.0542 0.0015  0.0033  0.0006  443 HOH A O   
897 O  O   . HOH C .  ? 0.0481 0.0570 0.0503 0.0043  -0.0003 0.0037  444 HOH A O   
898 O  O   . HOH C .  ? 0.2314 0.0800 0.1054 0.0465  -0.0661 -0.0289 445 HOH A O   
899 O  O   . HOH C .  ? 0.0647 0.0661 0.0555 -0.0088 0.0013  0.0033  446 HOH A O   
900 O  O   . HOH C .  ? 0.0674 0.0620 0.0802 0.0056  -0.0021 0.0003  447 HOH A O   
901 O  O   . HOH C .  ? 0.0688 0.0896 0.0720 -0.0154 -0.0100 -0.0030 448 HOH A O   
902 O  O   . HOH C .  ? 0.0925 0.5268 0.5440 -0.0281 -0.0657 0.2148  449 HOH A O   
903 O  O   . HOH C .  ? 0.5840 1.5598 0.5237 0.0456  0.2999  0.2237  450 HOH A O   
904 O  O   . HOH C .  ? 0.2304 0.7174 0.1229 0.0465  -0.0739 -0.0318 451 HOH A O   
905 O  O   . HOH C .  ? 0.0679 0.0553 0.0616 -0.0024 -0.0048 -0.0016 452 HOH A O   
906 O  O   . HOH C .  ? 0.0451 0.0708 0.0616 -0.0045 -0.0044 0.0070  453 HOH A O   
907 O  O   . HOH C .  ? 0.1355 0.1497 0.3101 0.0449  -0.0985 -0.1101 454 HOH A O   
908 O  O   . HOH C .  ? 0.0453 0.0559 0.0382 -0.0033 -0.0042 0.0100  455 HOH A O   
909 O  O   . HOH C .  ? 0.0660 0.1303 0.1494 0.0135  0.0040  -0.0425 456 HOH A O   
910 O  O   . HOH C .  ? 0.0654 0.0683 0.1077 0.0024  -0.0153 -0.0139 457 HOH A O   
911 O  O   . HOH C .  ? 0.0654 0.1422 0.1237 0.0264  0.0207  0.0711  458 HOH A O   
912 O  O   . HOH C .  ? 0.0853 0.1215 0.0863 -0.0058 0.0097  0.0268  459 HOH A O   
913 O  O   . HOH C .  ? 0.1430 0.1232 0.1158 -0.0162 -0.0006 0.0170  460 HOH A O   
914 O  O   . HOH C .  ? 0.0850 0.0738 0.0867 0.0054  0.0196  0.0122  461 HOH A O   
915 O  O   . HOH C .  ? 0.0524 0.0674 0.1007 0.0028  -0.0037 0.0134  462 HOH A O   
916 O  O   . HOH C .  ? 0.0389 0.0731 0.0482 0.0097  -0.0045 -0.0071 463 HOH A O   
917 O  O   . HOH C .  ? 0.0830 0.0691 0.0796 -0.0155 0.0191  -0.0078 464 HOH A O   
918 O  O   . HOH C .  ? 0.1741 0.1183 0.0931 0.0590  -0.0033 0.0021  465 HOH A O   
919 O  O   . HOH C .  ? 0.1727 0.3107 0.0913 0.0598  0.0239  0.0595  466 HOH A O   
920 O  O   . HOH C .  ? 0.1604 0.4874 0.1774 0.1269  -0.0499 -0.2054 467 HOH A O   
921 O  O   . HOH C .  ? 0.0772 0.0706 0.0877 0.0012  0.0204  -0.0194 468 HOH A O   
922 O  O   . HOH C .  ? 0.0846 0.1064 0.1039 0.0057  -0.0094 0.0173  469 HOH A O   
923 O  O   . HOH C .  ? 0.0357 0.0656 0.0583 -0.0040 -0.0019 0.0073  470 HOH A O   
924 O  O   . HOH C .  ? 0.1886 0.1625 0.1209 0.0460  -0.0269 0.0056  471 HOH A O   
925 O  O   . HOH C .  ? 0.0474 0.0604 0.0630 0.0048  -0.0003 0.0035  472 HOH A O   
926 O  O   . HOH C .  ? 0.0847 0.0798 0.1541 0.0101  -0.0283 -0.0272 473 HOH A O   
927 O  O   . HOH C .  ? 0.0848 0.1203 0.1517 -0.0004 0.0528  0.0056  474 HOH A O   
928 O  O   . HOH C .  ? 0.1272 0.2914 0.1297 0.0045  0.0079  -0.0625 475 HOH A O   
929 O  O   . HOH C .  ? 0.0625 0.0496 0.0560 -0.0019 -0.0044 0.0020  476 HOH A O   
930 O  O   . HOH C .  ? 0.0593 0.1101 0.1052 0.0134  0.0041  0.0192  477 HOH A O   
931 O  O   . HOH C .  ? 0.2416 0.4207 0.1572 -0.0951 0.0449  -0.1054 478 HOH A O   
932 O  O   . HOH C .  ? 0.0573 0.0832 0.0690 0.0071  -0.0091 -0.0023 479 HOH A O   
933 O  O   . HOH C .  ? 0.0365 0.0503 0.0668 -0.0013 -0.0016 0.0055  480 HOH A O   
934 O  O   . HOH C .  ? 0.0770 0.0609 0.0613 0.0209  -0.0081 -0.0027 481 HOH A O   
935 O  O   . HOH C .  ? 0.0938 0.1305 0.0996 -0.0157 0.0161  -0.0431 482 HOH A O   
936 O  O   . HOH C .  ? 0.0232 0.0406 0.1087 -0.0065 0.0019  0.0065  483 HOH A O   
937 O  O   . HOH C .  ? 0.0524 0.0677 0.0723 0.0337  -0.0002 0.0064  484 HOH A O   
938 O  O   . HOH C .  ? 0.0321 0.0911 0.0706 -0.0184 -0.0032 -0.0013 485 HOH A O   
939 O  O   . HOH C .  ? 0.1133 0.1512 0.0943 -0.0323 0.0002  -0.0003 486 HOH A O   
940 O  O   . HOH C .  ? 0.2559 0.1717 0.1302 0.1574  0.0826  0.0567  487 HOH A O   
941 O  O   . HOH C .  ? 0.3232 0.1001 0.1442 0.0294  0.0993  0.0277  488 HOH A O   
942 O  O   . HOH C .  ? 0.0498 0.0641 0.0645 0.0114  0.0198  -0.0103 489 HOH A O   
943 O  O   . HOH C .  ? 0.1013 0.0391 0.1032 0.0080  0.0133  -0.0064 490 HOH A O   
944 O  O   . HOH C .  ? 0.1141 0.0724 0.1345 0.0245  0.0548  -0.0103 491 HOH A O   
945 O  O   . HOH C .  ? 0.1321 0.2612 0.2005 -0.0933 0.0339  -0.1218 492 HOH A O   
946 O  O   . HOH C .  ? 0.0730 0.1938 0.0741 0.0333  0.0047  -0.0118 493 HOH A O   
947 O  O   . HOH C .  ? 0.1401 0.0572 0.0756 -0.0050 0.0124  0.0190  494 HOH A O   
948 O  O   . HOH C .  ? 0.1094 0.1799 0.0748 0.0447  0.0455  -0.0017 495 HOH A O   
949 O  O   . HOH C .  ? 0.0637 0.1592 0.1222 -0.0089 0.0178  -0.0132 496 HOH A O   
950 O  O   . HOH C .  ? 0.1272 0.1024 0.0881 0.0471  0.0498  0.0636  497 HOH A O   
951 O  O   . HOH C .  ? 0.1316 0.2135 0.1459 -0.0783 -0.0167 -0.0218 498 HOH A O   
952 O  O   . HOH C .  ? 0.0927 0.1692 0.1195 -0.0115 0.0132  -0.0402 499 HOH A O   
953 O  O   . HOH C .  ? 0.1727 0.1387 0.3393 -0.0169 -0.0344 0.0093  500 HOH A O   
954 O  O   . HOH C .  ? 0.3906 0.3675 0.8591 0.1033  -0.4076 -0.1389 501 HOH A O   
955 O  O   . HOH C .  ? 0.1979 0.0952 0.1541 -0.0246 0.0145  0.0131  502 HOH A O   
956 O  O   . HOH C .  ? 0.0647 0.0646 0.0826 -0.0101 0.0015  -0.0104 503 HOH A O   
957 O  O   . HOH C .  ? 0.0735 0.1069 0.1006 0.0148  0.0161  0.0354  504 HOH A O   
958 O  O   . HOH C .  ? 0.1595 0.2200 0.1864 -0.0200 -0.0832 0.0210  505 HOH A O   
959 O  O   . HOH C .  ? 0.1719 0.1583 0.1405 0.0403  -0.0189 0.0746  506 HOH A O   
960 O  O   . HOH C .  ? 0.1152 0.1360 0.1781 0.0294  -0.0049 0.0629  507 HOH A O   
961 O  O   . HOH C .  ? 0.0548 0.1787 0.1130 0.0234  0.0132  0.0463  508 HOH A O   
962 O  O   . HOH C .  ? 0.1821 0.1392 0.3343 0.1161  -0.2069 -0.1756 509 HOH A O   
963 O  O   . HOH C .  ? 0.2125 0.1988 0.2059 -0.1049 -0.1202 0.0909  510 HOH A O   
964 O  O   . HOH C .  ? 0.0788 0.1013 0.0868 -0.0076 0.0204  -0.0782 511 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  192 192 GLY GLY A . n 
A 1 2  ALA 2  193 193 ALA ALA A . n 
A 1 3  MET 3  194 194 MET MET A . n 
A 1 4  ASP 4  195 195 ASP ASP A . n 
A 1 5  PRO 5  196 196 PRO PRO A . n 
A 1 6  ARG 6  197 197 ARG ARG A . n 
A 1 7  THR 7  198 198 THR THR A . n 
A 1 8  ILE 8  199 199 ILE ILE A . n 
A 1 9  THR 9  200 200 THR THR A . n 
A 1 10 MET 10 201 201 MET MET A . n 
A 1 11 HIS 11 202 202 HIS HIS A . n 
A 1 12 LYS 12 203 203 LYS LYS A . n 
A 1 13 ASP 13 204 204 ASP ASP A . n 
A 1 14 SER 14 205 205 SER SER A . n 
A 1 15 THR 15 206 206 THR THR A . n 
A 1 16 GLY 16 207 207 GLY GLY A . n 
A 1 17 HIS 17 208 208 HIS HIS A . n 
A 1 18 VAL 18 209 209 VAL VAL A . n 
A 1 19 GLY 19 210 210 GLY GLY A . n 
A 1 20 PHE 20 211 211 PHE PHE A . n 
A 1 21 ILE 21 212 212 ILE ILE A . n 
A 1 22 PHE 22 213 213 PHE PHE A . n 
A 1 23 LYS 23 214 214 LYS LYS A . n 
A 1 24 ASN 24 215 215 ASN ASN A . n 
A 1 25 GLY 25 216 216 GLY GLY A . n 
A 1 26 LYS 26 217 217 LYS LYS A . n 
A 1 27 ILE 27 218 218 ILE ILE A . n 
A 1 28 THR 28 219 219 THR THR A . n 
A 1 29 SER 29 220 220 SER SER A . n 
A 1 30 ILE 30 221 221 ILE ILE A . n 
A 1 31 VAL 31 222 222 VAL VAL A . n 
A 1 32 LYS 32 223 223 LYS LYS A . n 
A 1 33 ASP 33 224 224 ASP ASP A . n 
A 1 34 SER 34 225 225 SER SER A . n 
A 1 35 SER 35 226 226 SER SER A . n 
A 1 36 ALA 36 227 227 ALA ALA A . n 
A 1 37 ALA 37 228 228 ALA ALA A . n 
A 1 38 ARG 38 229 229 ARG ARG A . n 
A 1 39 ASN 39 230 230 ASN ASN A . n 
A 1 40 GLY 40 231 231 GLY GLY A . n 
A 1 41 LEU 41 232 232 LEU LEU A . n 
A 1 42 LEU 42 233 233 LEU LEU A . n 
A 1 43 THR 43 234 234 THR THR A . n 
A 1 44 GLU 44 235 235 GLU GLU A . n 
A 1 45 HIS 45 236 236 HIS HIS A . n 
A 1 46 ASN 46 237 237 ASN ASN A . n 
A 1 47 ILE 47 238 238 ILE ILE A . n 
A 1 48 CYS 48 239 239 CYS CYS A . n 
A 1 49 GLU 49 240 240 GLU GLU A . n 
A 1 50 ILE 50 241 241 ILE ILE A . n 
A 1 51 ASN 51 242 242 ASN ASN A . n 
A 1 52 GLY 52 243 243 GLY GLY A . n 
A 1 53 GLN 53 244 244 GLN GLN A . n 
A 1 54 ASN 54 245 245 ASN ASN A . n 
A 1 55 VAL 55 246 246 VAL VAL A . n 
A 1 56 ILE 56 247 247 ILE ILE A . n 
A 1 57 GLY 57 248 248 GLY GLY A . n 
A 1 58 LEU 58 249 249 LEU LEU A . n 
A 1 59 LYS 59 250 250 LYS LYS A . n 
A 1 60 ASP 60 251 251 ASP ASP A . n 
A 1 61 SER 61 252 252 SER SER A . n 
A 1 62 GLN 62 253 253 GLN GLN A . n 
A 1 63 ILE 63 254 254 ILE ILE A . n 
A 1 64 ALA 64 255 255 ALA ALA A . n 
A 1 65 ASP 65 256 256 ASP ASP A . n 
A 1 66 ILE 66 257 257 ILE ILE A . n 
A 1 67 LEU 67 258 258 LEU LEU A . n 
A 1 68 SER 68 259 259 SER SER A . n 
A 1 69 THR 69 260 260 THR THR A . n 
A 1 70 SER 70 261 261 SER SER A . n 
A 1 71 GLY 71 262 262 GLY GLY A . n 
A 1 72 THR 72 263 263 THR THR A . n 
A 1 73 VAL 73 264 264 VAL VAL A . n 
A 1 74 VAL 74 265 265 VAL VAL A . n 
A 1 75 THR 75 266 266 THR THR A . n 
A 1 76 ILE 76 267 267 ILE ILE A . n 
A 1 77 THR 77 268 268 THR THR A . n 
A 1 78 ILE 78 269 269 ILE ILE A . n 
A 1 79 MET 79 270 270 MET MET A . n 
A 1 80 PRO 80 271 271 PRO PRO A . n 
A 1 81 ALA 81 272 272 ALA ALA A . n 
A 1 82 PHE 82 273 273 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   274 1   CL  CL  A . 
C 3 HOH 1   275 1   HOH HOH A . 
C 3 HOH 2   276 2   HOH HOH A . 
C 3 HOH 3   277 3   HOH HOH A . 
C 3 HOH 4   278 4   HOH HOH A . 
C 3 HOH 5   279 5   HOH HOH A . 
C 3 HOH 6   280 6   HOH HOH A . 
C 3 HOH 7   281 7   HOH HOH A . 
C 3 HOH 8   282 8   HOH HOH A . 
C 3 HOH 9   283 9   HOH HOH A . 
C 3 HOH 10  284 10  HOH HOH A . 
C 3 HOH 11  285 11  HOH HOH A . 
C 3 HOH 12  286 12  HOH HOH A . 
C 3 HOH 13  287 13  HOH HOH A . 
C 3 HOH 14  288 14  HOH HOH A . 
C 3 HOH 15  289 15  HOH HOH A . 
C 3 HOH 16  290 16  HOH HOH A . 
C 3 HOH 17  291 17  HOH HOH A . 
C 3 HOH 18  292 18  HOH HOH A . 
C 3 HOH 19  293 19  HOH HOH A . 
C 3 HOH 20  294 20  HOH HOH A . 
C 3 HOH 21  295 21  HOH HOH A . 
C 3 HOH 22  296 22  HOH HOH A . 
C 3 HOH 23  297 23  HOH HOH A . 
C 3 HOH 24  298 24  HOH HOH A . 
C 3 HOH 25  299 25  HOH HOH A . 
C 3 HOH 26  300 26  HOH HOH A . 
C 3 HOH 27  301 27  HOH HOH A . 
C 3 HOH 28  302 28  HOH HOH A . 
C 3 HOH 29  303 29  HOH HOH A . 
C 3 HOH 30  304 30  HOH HOH A . 
C 3 HOH 31  305 31  HOH HOH A . 
C 3 HOH 32  306 32  HOH HOH A . 
C 3 HOH 33  307 33  HOH HOH A . 
C 3 HOH 34  308 34  HOH HOH A . 
C 3 HOH 35  309 35  HOH HOH A . 
C 3 HOH 36  310 36  HOH HOH A . 
C 3 HOH 37  311 37  HOH HOH A . 
C 3 HOH 38  312 38  HOH HOH A . 
C 3 HOH 39  313 39  HOH HOH A . 
C 3 HOH 40  314 40  HOH HOH A . 
C 3 HOH 41  315 41  HOH HOH A . 
C 3 HOH 42  316 42  HOH HOH A . 
C 3 HOH 43  317 43  HOH HOH A . 
C 3 HOH 44  318 44  HOH HOH A . 
C 3 HOH 45  319 45  HOH HOH A . 
C 3 HOH 46  320 46  HOH HOH A . 
C 3 HOH 47  321 47  HOH HOH A . 
C 3 HOH 48  322 48  HOH HOH A . 
C 3 HOH 49  323 49  HOH HOH A . 
C 3 HOH 50  324 50  HOH HOH A . 
C 3 HOH 51  325 51  HOH HOH A . 
C 3 HOH 52  326 52  HOH HOH A . 
C 3 HOH 53  327 53  HOH HOH A . 
C 3 HOH 54  328 54  HOH HOH A . 
C 3 HOH 55  329 55  HOH HOH A . 
C 3 HOH 56  330 56  HOH HOH A . 
C 3 HOH 57  331 57  HOH HOH A . 
C 3 HOH 58  332 58  HOH HOH A . 
C 3 HOH 59  333 59  HOH HOH A . 
C 3 HOH 60  334 60  HOH HOH A . 
C 3 HOH 61  335 61  HOH HOH A . 
C 3 HOH 62  336 62  HOH HOH A . 
C 3 HOH 63  337 63  HOH HOH A . 
C 3 HOH 64  338 64  HOH HOH A . 
C 3 HOH 65  339 65  HOH HOH A . 
C 3 HOH 66  340 66  HOH HOH A . 
C 3 HOH 67  341 67  HOH HOH A . 
C 3 HOH 68  342 68  HOH HOH A . 
C 3 HOH 69  343 69  HOH HOH A . 
C 3 HOH 70  344 70  HOH HOH A . 
C 3 HOH 71  345 71  HOH HOH A . 
C 3 HOH 72  346 72  HOH HOH A . 
C 3 HOH 73  347 73  HOH HOH A . 
C 3 HOH 74  348 74  HOH HOH A . 
C 3 HOH 75  349 75  HOH HOH A . 
C 3 HOH 76  350 76  HOH HOH A . 
C 3 HOH 77  351 77  HOH HOH A . 
C 3 HOH 78  352 78  HOH HOH A . 
C 3 HOH 79  353 79  HOH HOH A . 
C 3 HOH 80  354 80  HOH HOH A . 
C 3 HOH 81  355 81  HOH HOH A . 
C 3 HOH 82  356 82  HOH HOH A . 
C 3 HOH 83  357 83  HOH HOH A . 
C 3 HOH 84  358 84  HOH HOH A . 
C 3 HOH 85  359 85  HOH HOH A . 
C 3 HOH 86  360 86  HOH HOH A . 
C 3 HOH 87  361 87  HOH HOH A . 
C 3 HOH 88  362 88  HOH HOH A . 
C 3 HOH 89  363 89  HOH HOH A . 
C 3 HOH 90  364 90  HOH HOH A . 
C 3 HOH 91  365 91  HOH HOH A . 
C 3 HOH 92  366 92  HOH HOH A . 
C 3 HOH 93  367 93  HOH HOH A . 
C 3 HOH 94  368 94  HOH HOH A . 
C 3 HOH 95  369 95  HOH HOH A . 
C 3 HOH 96  370 96  HOH HOH A . 
C 3 HOH 97  371 97  HOH HOH A . 
C 3 HOH 98  372 98  HOH HOH A . 
C 3 HOH 99  373 99  HOH HOH A . 
C 3 HOH 100 374 100 HOH HOH A . 
C 3 HOH 101 375 101 HOH HOH A . 
C 3 HOH 102 376 102 HOH HOH A . 
C 3 HOH 103 377 103 HOH HOH A . 
C 3 HOH 104 378 104 HOH HOH A . 
C 3 HOH 105 379 105 HOH HOH A . 
C 3 HOH 106 380 106 HOH HOH A . 
C 3 HOH 107 381 107 HOH HOH A . 
C 3 HOH 108 382 108 HOH HOH A . 
C 3 HOH 109 383 109 HOH HOH A . 
C 3 HOH 110 384 110 HOH HOH A . 
C 3 HOH 111 385 111 HOH HOH A . 
C 3 HOH 112 386 112 HOH HOH A . 
C 3 HOH 113 387 113 HOH HOH A . 
C 3 HOH 114 388 114 HOH HOH A . 
C 3 HOH 115 389 115 HOH HOH A . 
C 3 HOH 116 390 116 HOH HOH A . 
C 3 HOH 117 391 117 HOH HOH A . 
C 3 HOH 118 392 118 HOH HOH A . 
C 3 HOH 119 393 119 HOH HOH A . 
C 3 HOH 120 394 120 HOH HOH A . 
C 3 HOH 121 395 121 HOH HOH A . 
C 3 HOH 122 396 122 HOH HOH A . 
C 3 HOH 123 397 123 HOH HOH A . 
C 3 HOH 124 398 124 HOH HOH A . 
C 3 HOH 125 399 125 HOH HOH A . 
C 3 HOH 126 400 126 HOH HOH A . 
C 3 HOH 127 401 127 HOH HOH A . 
C 3 HOH 128 402 128 HOH HOH A . 
C 3 HOH 129 403 129 HOH HOH A . 
C 3 HOH 130 404 130 HOH HOH A . 
C 3 HOH 131 405 131 HOH HOH A . 
C 3 HOH 132 406 132 HOH HOH A . 
C 3 HOH 133 407 133 HOH HOH A . 
C 3 HOH 134 408 134 HOH HOH A . 
C 3 HOH 135 409 135 HOH HOH A . 
C 3 HOH 136 410 136 HOH HOH A . 
C 3 HOH 137 411 137 HOH HOH A . 
C 3 HOH 138 412 138 HOH HOH A . 
C 3 HOH 139 413 139 HOH HOH A . 
C 3 HOH 140 414 140 HOH HOH A . 
C 3 HOH 141 415 141 HOH HOH A . 
C 3 HOH 142 416 142 HOH HOH A . 
C 3 HOH 143 417 143 HOH HOH A . 
C 3 HOH 144 418 144 HOH HOH A . 
C 3 HOH 145 419 145 HOH HOH A . 
C 3 HOH 146 420 146 HOH HOH A . 
C 3 HOH 147 421 147 HOH HOH A . 
C 3 HOH 148 422 148 HOH HOH A . 
C 3 HOH 149 423 149 HOH HOH A . 
C 3 HOH 150 424 150 HOH HOH A . 
C 3 HOH 151 425 151 HOH HOH A . 
C 3 HOH 152 426 152 HOH HOH A . 
C 3 HOH 153 427 153 HOH HOH A . 
C 3 HOH 154 428 154 HOH HOH A . 
C 3 HOH 155 429 155 HOH HOH A . 
C 3 HOH 156 430 156 HOH HOH A . 
C 3 HOH 157 431 157 HOH HOH A . 
C 3 HOH 158 432 158 HOH HOH A . 
C 3 HOH 159 433 159 HOH HOH A . 
C 3 HOH 160 434 160 HOH HOH A . 
C 3 HOH 161 435 161 HOH HOH A . 
C 3 HOH 162 436 162 HOH HOH A . 
C 3 HOH 163 437 163 HOH HOH A . 
C 3 HOH 164 438 164 HOH HOH A . 
C 3 HOH 165 439 165 HOH HOH A . 
C 3 HOH 166 440 166 HOH HOH A . 
C 3 HOH 167 441 167 HOH HOH A . 
C 3 HOH 168 442 168 HOH HOH A . 
C 3 HOH 169 443 169 HOH HOH A . 
C 3 HOH 170 444 170 HOH HOH A . 
C 3 HOH 171 445 171 HOH HOH A . 
C 3 HOH 172 446 172 HOH HOH A . 
C 3 HOH 173 447 173 HOH HOH A . 
C 3 HOH 174 448 174 HOH HOH A . 
C 3 HOH 175 449 175 HOH HOH A . 
C 3 HOH 176 450 176 HOH HOH A . 
C 3 HOH 177 451 177 HOH HOH A . 
C 3 HOH 178 452 178 HOH HOH A . 
C 3 HOH 179 453 179 HOH HOH A . 
C 3 HOH 180 454 180 HOH HOH A . 
C 3 HOH 181 455 181 HOH HOH A . 
C 3 HOH 182 456 182 HOH HOH A . 
C 3 HOH 183 457 183 HOH HOH A . 
C 3 HOH 184 458 184 HOH HOH A . 
C 3 HOH 185 459 185 HOH HOH A . 
C 3 HOH 186 460 186 HOH HOH A . 
C 3 HOH 187 461 187 HOH HOH A . 
C 3 HOH 188 462 188 HOH HOH A . 
C 3 HOH 189 463 189 HOH HOH A . 
C 3 HOH 190 464 190 HOH HOH A . 
C 3 HOH 191 465 191 HOH HOH A . 
C 3 HOH 192 466 192 HOH HOH A . 
C 3 HOH 193 467 193 HOH HOH A . 
C 3 HOH 194 468 194 HOH HOH A . 
C 3 HOH 195 469 195 HOH HOH A . 
C 3 HOH 196 470 196 HOH HOH A . 
C 3 HOH 197 471 197 HOH HOH A . 
C 3 HOH 198 472 198 HOH HOH A . 
C 3 HOH 199 473 199 HOH HOH A . 
C 3 HOH 200 474 200 HOH HOH A . 
C 3 HOH 201 475 201 HOH HOH A . 
C 3 HOH 202 476 202 HOH HOH A . 
C 3 HOH 203 477 203 HOH HOH A . 
C 3 HOH 204 478 204 HOH HOH A . 
C 3 HOH 205 479 205 HOH HOH A . 
C 3 HOH 206 480 206 HOH HOH A . 
C 3 HOH 207 481 207 HOH HOH A . 
C 3 HOH 208 482 208 HOH HOH A . 
C 3 HOH 209 483 209 HOH HOH A . 
C 3 HOH 210 484 210 HOH HOH A . 
C 3 HOH 211 485 211 HOH HOH A . 
C 3 HOH 212 486 212 HOH HOH A . 
C 3 HOH 213 487 213 HOH HOH A . 
C 3 HOH 214 488 214 HOH HOH A . 
C 3 HOH 215 489 215 HOH HOH A . 
C 3 HOH 216 490 216 HOH HOH A . 
C 3 HOH 217 491 217 HOH HOH A . 
C 3 HOH 218 492 218 HOH HOH A . 
C 3 HOH 219 493 219 HOH HOH A . 
C 3 HOH 220 494 220 HOH HOH A . 
C 3 HOH 221 495 221 HOH HOH A . 
C 3 HOH 222 496 222 HOH HOH A . 
C 3 HOH 223 497 223 HOH HOH A . 
C 3 HOH 224 498 224 HOH HOH A . 
C 3 HOH 225 499 225 HOH HOH A . 
C 3 HOH 226 500 226 HOH HOH A . 
C 3 HOH 227 501 227 HOH HOH A . 
C 3 HOH 228 502 228 HOH HOH A . 
C 3 HOH 229 503 229 HOH HOH A . 
C 3 HOH 230 504 230 HOH HOH A . 
C 3 HOH 231 505 231 HOH HOH A . 
C 3 HOH 232 506 232 HOH HOH A . 
C 3 HOH 233 507 233 HOH HOH A . 
C 3 HOH 234 508 234 HOH HOH A . 
C 3 HOH 235 509 235 HOH HOH A . 
C 3 HOH 236 510 236 HOH HOH A . 
C 3 HOH 237 511 237 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-04 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELX     'model building' . ? 1 
SHELXL-97 refinement       . ? 2 
HKL-2000  'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
SHELX     phasing          . ? 5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CB A ALA 193 ? B 1_555 O   A HOH 352 ? ? 2_555 1.05 
2 1 CA A ALA 193 ? B 1_555 O   A HOH 352 ? ? 2_555 1.57 
3 1 CA A ASP 195 ? B 1_555 NH2 A ARG 229 ? ? 2_556 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             270 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             270 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            B 
_pdbx_validate_rmsd_bond.bond_value                1.624 
_pdbx_validate_rmsd_bond.bond_target_value         1.807 
_pdbx_validate_rmsd_bond.bond_deviation            -0.183 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.026 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              270 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SD 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_2              270 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             B 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_3              270 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             B 
_pdbx_validate_rmsd_angle.angle_value                113.50 
_pdbx_validate_rmsd_angle.angle_target_value         100.20 
_pdbx_validate_rmsd_angle.angle_deviation            13.30 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#