data_1R70
# 
_entry.id   1R70 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1R70         
RCSB  RCSB020514   
WWPDB D_1000020514 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1vge 
;Human IgG1 TR1_9 Fab.  
Used as template for VL, CL and VH domains
;
unspecified 
PDB 2fbj 
;Mouse IgA JS39 Fab.  
Used as template for CH1 domain
;
unspecified 
PDB 1fc1 
;Human IgG Fc (Chain A).  
Used as template for CH2 and CH3 domains
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R70 
_pdbx_database_status.recvd_initial_deposition_date   2003-10-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Furtado, P.B.' 1 
'Whitty, P.W.'  2 
'Robertson, A.' 3 
'Eaton, J.T.'   4 
'Almogren, A.'  5 
'Kerr, M.A.'    6 
'Woof, J.M.'    7 
'Perkins, S.J.' 8 
# 
_citation.id                        primary 
_citation.title                     
;Solution Structure Determination of Monomeric Human IgA2 by X-ray and Neutron Scattering, Analytical Ultracentrifugation and Constrained Modelling: A Comparison with Monomeric Human IgA1.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            338 
_citation.page_first                921 
_citation.page_last                 941 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15111057 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.03.007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Furtado, P.B.' 1 
primary 'Whitty, P.W.'  2 
primary 'Robertson, A.' 3 
primary 'Eaton, J.T.'   4 
primary 'Almogren, A.'  5 
primary 'Kerr, M.A.'    6 
primary 'Woof, J.M.'    7 
primary 'Perkins, S.J.' 8 
# 
_cell.entry_id           1R70 
_cell.length_a           1.0 
_cell.length_b           1.0 
_cell.length_c           1.0 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              1 
# 
_symmetry.entry_id                         1R70 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Human IgA2(m1) Light Chain' 23216.770 2 ? ? ? ? 
2 polymer man 'Human IgA2(m1) Heavy Chain' 49922.031 2 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ELVMTQSPSSLSASVGDRVNIACRASQGISSALAWYQQKPGKAPRLLIYDASNLESGVPSRFSGSGSGTDFTLTISSLQP
EDFAIYYCQQFNSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;ELVMTQSPSSLSASVGDRVNIACRASQGISSALAWYQQKPGKAPRLLIYDASNLESGVPSRFSGSGSGTDFTLTISSLQP
EDFAIYYCQQFNSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
A,C ? 
2 'polypeptide(L)' no no 
;QVKLLEQSGAEVKKPGASVKVSCKASGYSFTSYGLHWVRQAPGQRLEWMGWISAGTGNTKYSQKFRGRVTFTRDTSATTA
YMGLSSLRPEDTAVYYCARDPYGGGKSEFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLS
VTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHR
PALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPEL
KTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTT
FAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
;
;QVKLLEQSGAEVKKPGASVKVSCKASGYSFTSYGLHWVRQAPGQRLEWMGWISAGTGNTKYSQKFRGRVTFTRDTSATTA
YMGLSSLRPEDTAVYYCARDPYGGGKSEFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLS
VTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHR
PALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPEL
KTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTT
FAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   LEU n 
1 3   VAL n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  VAL n 
1 16  GLY n 
1 17  ASP n 
1 18  ARG n 
1 19  VAL n 
1 20  ASN n 
1 21  ILE n 
1 22  ALA n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  GLY n 
1 29  ILE n 
1 30  SER n 
1 31  SER n 
1 32  ALA n 
1 33  LEU n 
1 34  ALA n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  PRO n 
1 41  GLY n 
1 42  LYS n 
1 43  ALA n 
1 44  PRO n 
1 45  ARG n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  TYR n 
1 50  ASP n 
1 51  ALA n 
1 52  SER n 
1 53  ASN n 
1 54  LEU n 
1 55  GLU n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  THR n 
1 73  LEU n 
1 74  THR n 
1 75  ILE n 
1 76  SER n 
1 77  SER n 
1 78  LEU n 
1 79  GLN n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  PHE n 
1 84  ALA n 
1 85  ILE n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  PHE n 
1 92  ASN n 
1 93  SER n 
1 94  TYR n 
1 95  PRO n 
1 96  LEU n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLY n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 VAL n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
1 108 ARG n 
1 109 THR n 
1 110 VAL n 
1 111 ALA n 
1 112 ALA n 
1 113 PRO n 
1 114 SER n 
1 115 VAL n 
1 116 PHE n 
1 117 ILE n 
1 118 PHE n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 ASP n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 LYS n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 VAL n 
1 134 CYS n 
1 135 LEU n 
1 136 LEU n 
1 137 ASN n 
1 138 ASN n 
1 139 PHE n 
1 140 TYR n 
1 141 PRO n 
1 142 ARG n 
1 143 GLU n 
1 144 ALA n 
1 145 LYS n 
1 146 VAL n 
1 147 GLN n 
1 148 TRP n 
1 149 LYS n 
1 150 VAL n 
1 151 ASP n 
1 152 ASN n 
1 153 ALA n 
1 154 LEU n 
1 155 GLN n 
1 156 SER n 
1 157 GLY n 
1 158 ASN n 
1 159 SER n 
1 160 GLN n 
1 161 GLU n 
1 162 SER n 
1 163 VAL n 
1 164 THR n 
1 165 GLU n 
1 166 GLN n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 THR n 
1 173 TYR n 
1 174 SER n 
1 175 LEU n 
1 176 SER n 
1 177 SER n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 SER n 
1 183 LYS n 
1 184 ALA n 
1 185 ASP n 
1 186 TYR n 
1 187 GLU n 
1 188 LYS n 
1 189 HIS n 
1 190 LYS n 
1 191 VAL n 
1 192 TYR n 
1 193 ALA n 
1 194 CYS n 
1 195 GLU n 
1 196 VAL n 
1 197 THR n 
1 198 HIS n 
1 199 GLN n 
1 200 GLY n 
1 201 LEU n 
1 202 SER n 
1 203 SER n 
1 204 PRO n 
1 205 VAL n 
1 206 THR n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 ASN n 
1 211 ARG n 
1 212 GLY n 
1 213 GLU n 
1 214 CYS n 
2 1   GLN n 
2 2   VAL n 
2 3   LYS n 
2 4   LEU n 
2 5   LEU n 
2 6   GLU n 
2 7   GLN n 
2 8   SER n 
2 9   GLY n 
2 10  ALA n 
2 11  GLU n 
2 12  VAL n 
2 13  LYS n 
2 14  LYS n 
2 15  PRO n 
2 16  GLY n 
2 17  ALA n 
2 18  SER n 
2 19  VAL n 
2 20  LYS n 
2 21  VAL n 
2 22  SER n 
2 23  CYS n 
2 24  LYS n 
2 25  ALA n 
2 26  SER n 
2 27  GLY n 
2 28  TYR n 
2 29  SER n 
2 30  PHE n 
2 31  THR n 
2 32  SER n 
2 33  TYR n 
2 34  GLY n 
2 35  LEU n 
2 36  HIS n 
2 37  TRP n 
2 38  VAL n 
2 39  ARG n 
2 40  GLN n 
2 41  ALA n 
2 42  PRO n 
2 43  GLY n 
2 44  GLN n 
2 45  ARG n 
2 46  LEU n 
2 47  GLU n 
2 48  TRP n 
2 49  MET n 
2 50  GLY n 
2 51  TRP n 
2 52  ILE n 
2 53  SER n 
2 54  ALA n 
2 55  GLY n 
2 56  THR n 
2 57  GLY n 
2 58  ASN n 
2 59  THR n 
2 60  LYS n 
2 61  TYR n 
2 62  SER n 
2 63  GLN n 
2 64  LYS n 
2 65  PHE n 
2 66  ARG n 
2 67  GLY n 
2 68  ARG n 
2 69  VAL n 
2 70  THR n 
2 71  PHE n 
2 72  THR n 
2 73  ARG n 
2 74  ASP n 
2 75  THR n 
2 76  SER n 
2 77  ALA n 
2 78  THR n 
2 79  THR n 
2 80  ALA n 
2 81  TYR n 
2 82  MET n 
2 83  GLY n 
2 84  LEU n 
2 85  SER n 
2 86  SER n 
2 87  LEU n 
2 88  ARG n 
2 89  PRO n 
2 90  GLU n 
2 91  ASP n 
2 92  THR n 
2 93  ALA n 
2 94  VAL n 
2 95  TYR n 
2 96  TYR n 
2 97  CYS n 
2 98  ALA n 
2 99  ARG n 
2 100 ASP n 
2 101 PRO n 
2 102 TYR n 
2 103 GLY n 
2 104 GLY n 
2 105 GLY n 
2 106 LYS n 
2 107 SER n 
2 108 GLU n 
2 109 PHE n 
2 110 ASP n 
2 111 TYR n 
2 112 TRP n 
2 113 GLY n 
2 114 GLN n 
2 115 GLY n 
2 116 THR n 
2 117 LEU n 
2 118 VAL n 
2 119 THR n 
2 120 VAL n 
2 121 SER n 
2 122 SER n 
2 123 ALA n 
2 124 SER n 
2 125 PRO n 
2 126 THR n 
2 127 SER n 
2 128 PRO n 
2 129 LYS n 
2 130 VAL n 
2 131 PHE n 
2 132 PRO n 
2 133 LEU n 
2 134 SER n 
2 135 LEU n 
2 136 ASP n 
2 137 SER n 
2 138 THR n 
2 139 PRO n 
2 140 GLN n 
2 141 ASP n 
2 142 GLY n 
2 143 ASN n 
2 144 VAL n 
2 145 VAL n 
2 146 VAL n 
2 147 ALA n 
2 148 CYS n 
2 149 LEU n 
2 150 VAL n 
2 151 GLN n 
2 152 GLY n 
2 153 PHE n 
2 154 PHE n 
2 155 PRO n 
2 156 GLN n 
2 157 GLU n 
2 158 PRO n 
2 159 LEU n 
2 160 SER n 
2 161 VAL n 
2 162 THR n 
2 163 TRP n 
2 164 SER n 
2 165 GLU n 
2 166 SER n 
2 167 GLY n 
2 168 GLN n 
2 169 ASN n 
2 170 VAL n 
2 171 THR n 
2 172 ALA n 
2 173 ARG n 
2 174 ASN n 
2 175 PHE n 
2 176 PRO n 
2 177 PRO n 
2 178 SER n 
2 179 GLN n 
2 180 ASP n 
2 181 ALA n 
2 182 SER n 
2 183 GLY n 
2 184 ASP n 
2 185 LEU n 
2 186 TYR n 
2 187 THR n 
2 188 THR n 
2 189 SER n 
2 190 SER n 
2 191 GLN n 
2 192 LEU n 
2 193 THR n 
2 194 LEU n 
2 195 PRO n 
2 196 ALA n 
2 197 THR n 
2 198 GLN n 
2 199 CYS n 
2 200 PRO n 
2 201 ASP n 
2 202 GLY n 
2 203 LYS n 
2 204 SER n 
2 205 VAL n 
2 206 THR n 
2 207 CYS n 
2 208 HIS n 
2 209 VAL n 
2 210 LYS n 
2 211 HIS n 
2 212 TYR n 
2 213 THR n 
2 214 ASN n 
2 215 PRO n 
2 216 SER n 
2 217 GLN n 
2 218 ASP n 
2 219 VAL n 
2 220 THR n 
2 221 VAL n 
2 222 PRO n 
2 223 CYS n 
2 224 PRO n 
2 225 VAL n 
2 226 PRO n 
2 227 PRO n 
2 228 PRO n 
2 229 PRO n 
2 230 PRO n 
2 231 CYS n 
2 232 CYS n 
2 233 HIS n 
2 234 PRO n 
2 235 ARG n 
2 236 LEU n 
2 237 SER n 
2 238 LEU n 
2 239 HIS n 
2 240 ARG n 
2 241 PRO n 
2 242 ALA n 
2 243 LEU n 
2 244 GLU n 
2 245 ASP n 
2 246 LEU n 
2 247 LEU n 
2 248 LEU n 
2 249 GLY n 
2 250 SER n 
2 251 GLU n 
2 252 ALA n 
2 253 ASN n 
2 254 LEU n 
2 255 THR n 
2 256 CYS n 
2 257 THR n 
2 258 LEU n 
2 259 THR n 
2 260 GLY n 
2 261 LEU n 
2 262 ARG n 
2 263 ASP n 
2 264 ALA n 
2 265 SER n 
2 266 GLY n 
2 267 ALA n 
2 268 THR n 
2 269 PHE n 
2 270 THR n 
2 271 TRP n 
2 272 THR n 
2 273 PRO n 
2 274 SER n 
2 275 SER n 
2 276 GLY n 
2 277 LYS n 
2 278 SER n 
2 279 ALA n 
2 280 VAL n 
2 281 GLN n 
2 282 GLY n 
2 283 PRO n 
2 284 PRO n 
2 285 GLU n 
2 286 ARG n 
2 287 ASP n 
2 288 LEU n 
2 289 CYS n 
2 290 GLY n 
2 291 CYS n 
2 292 TYR n 
2 293 SER n 
2 294 VAL n 
2 295 SER n 
2 296 SER n 
2 297 VAL n 
2 298 LEU n 
2 299 PRO n 
2 300 GLY n 
2 301 CYS n 
2 302 ALA n 
2 303 GLN n 
2 304 PRO n 
2 305 TRP n 
2 306 ASN n 
2 307 HIS n 
2 308 GLY n 
2 309 GLU n 
2 310 THR n 
2 311 PHE n 
2 312 THR n 
2 313 CYS n 
2 314 THR n 
2 315 ALA n 
2 316 ALA n 
2 317 HIS n 
2 318 PRO n 
2 319 GLU n 
2 320 LEU n 
2 321 LYS n 
2 322 THR n 
2 323 PRO n 
2 324 LEU n 
2 325 THR n 
2 326 ALA n 
2 327 ASN n 
2 328 ILE n 
2 329 THR n 
2 330 LYS n 
2 331 SER n 
2 332 GLY n 
2 333 ASN n 
2 334 THR n 
2 335 PHE n 
2 336 ARG n 
2 337 PRO n 
2 338 GLU n 
2 339 VAL n 
2 340 HIS n 
2 341 LEU n 
2 342 LEU n 
2 343 PRO n 
2 344 PRO n 
2 345 PRO n 
2 346 SER n 
2 347 GLU n 
2 348 GLU n 
2 349 LEU n 
2 350 ALA n 
2 351 LEU n 
2 352 ASN n 
2 353 GLU n 
2 354 LEU n 
2 355 VAL n 
2 356 THR n 
2 357 LEU n 
2 358 THR n 
2 359 CYS n 
2 360 LEU n 
2 361 ALA n 
2 362 ARG n 
2 363 GLY n 
2 364 PHE n 
2 365 SER n 
2 366 PRO n 
2 367 LYS n 
2 368 ASP n 
2 369 VAL n 
2 370 LEU n 
2 371 VAL n 
2 372 ARG n 
2 373 TRP n 
2 374 LEU n 
2 375 GLN n 
2 376 GLY n 
2 377 SER n 
2 378 GLN n 
2 379 GLU n 
2 380 LEU n 
2 381 PRO n 
2 382 ARG n 
2 383 GLU n 
2 384 LYS n 
2 385 TYR n 
2 386 LEU n 
2 387 THR n 
2 388 TRP n 
2 389 ALA n 
2 390 SER n 
2 391 ARG n 
2 392 GLN n 
2 393 GLU n 
2 394 PRO n 
2 395 SER n 
2 396 GLN n 
2 397 GLY n 
2 398 THR n 
2 399 THR n 
2 400 THR n 
2 401 PHE n 
2 402 ALA n 
2 403 VAL n 
2 404 THR n 
2 405 SER n 
2 406 ILE n 
2 407 LEU n 
2 408 ARG n 
2 409 VAL n 
2 410 ALA n 
2 411 ALA n 
2 412 GLU n 
2 413 ASP n 
2 414 TRP n 
2 415 LYS n 
2 416 LYS n 
2 417 GLY n 
2 418 ASP n 
2 419 THR n 
2 420 PHE n 
2 421 SER n 
2 422 CYS n 
2 423 MET n 
2 424 VAL n 
2 425 GLY n 
2 426 HIS n 
2 427 GLU n 
2 428 ALA n 
2 429 LEU n 
2 430 PRO n 
2 431 LEU n 
2 432 ALA n 
2 433 PHE n 
2 434 THR n 
2 435 GLN n 
2 436 LYS n 
2 437 THR n 
2 438 ILE n 
2 439 ASP n 
2 440 ARG n 
2 441 LEU n 
2 442 ALA n 
2 443 GLY n 
2 444 LYS n 
2 445 PRO n 
2 446 THR n 
2 447 HIS n 
2 448 VAL n 
2 449 ASN n 
2 450 VAL n 
2 451 SER n 
2 452 VAL n 
2 453 VAL n 
2 454 MET n 
2 455 ALA n 
2 456 GLU n 
2 457 VAL n 
2 458 ASP n 
2 459 GLY n 
2 460 THR n 
2 461 CYS n 
2 462 TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'human alpha 2 gene (light chain)' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 
'Cricetulus griseus' 10029 Cricetulus ? ovary ? ? ? K1 ? 'Chinese hamster ovary (CHO)' ? ? ? ? ? Plasmid ? ? ? pEE6.HCMV ? ? 
2 1 sample ? ? ? human Homo 'human alpha 2 gene (heavy chain)' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 
'Cricetulus griseus' 10029 Cricetulus ? ovary ? ? ? K1 ? 'Chinese hamster ovary (CHO)' ? ? ? ? ? Plasmid ? ? ? pEE6.HCMV ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 1 PDB 1R70 1R70 ? ? ? 
2 2 PDB 1R70 1R70 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1R70 A 1 ? 214 ? 1R70 1   ? 214  ? 1   214  
2 2 1R70 B 1 ? 462 ? 1R70 215 ? 676  ? 215 676  
3 1 1R70 C 1 ? 214 ? 1R70 677 ? 890  ? 677 890  
4 2 1R70 D 1 ? 462 ? 1R70 891 ? 1352 ? 891 1352 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1R70 
_exptl.method            'SOLUTION SCATTERING' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 288 ? 1 
2 288 ? 1 
3 288 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'QUADRANT DETECTOR' '500 CHANNEL'   2000-09-15 ? 
2 CCD                 FReLoN          2002-07-15 ? 
3 '3HE ORDELA'        'WIRE DETECTOR' 2000-11-15 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'single crystal' 'SINGLE WAVELENGTH' x-ray   
2 1 M 'single crystal' 'SINGLE WAVELENGTH' x-ray   
3 1 L time-of-flight   LAUE                neutron 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON       'SRS BEAMLINE'        SRS  ?   ? ? 
2 SYNCHROTRON       'ESRF BEAMLINE ID2'   ESRF ID2 ? ? 
3 'NUCLEAR REACTOR' 'ISIS INSTRUMENT LOQ' ?    ?   ? ? 
# 
_refine.entry_id                                 1R70 
_refine.ls_d_res_high                            30 
_refine.ls_d_res_low                             1300 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.066 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'CONSTRAINED MODEL FIT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'SOLUTION SCATTERING' 
_refine.pdbx_diffrn_id                           1,2,3 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'SOLUTION SCATTERING' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1352 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1352 
_refine_hist.d_res_high                       30 
_refine_hist.d_res_low                        1300 
# 
_struct.entry_id                  1R70 
_struct.title                     'Model of human IgA2 determined by solution scattering, curve fitting and homology modelling' 
_struct.pdbx_descriptor           'Human IgA2(m1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R70 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Immunology, antibody, IgA, glycoprotein, Ig fold, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
# 
_database_PDB_matrix.entry_id          1R70 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1R70 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_type.symbol   C 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    C CA . GLU A 1 1   ? -36.984 43.904  -107.669 1.00 20.00 ? 1    GLU A CA 1 
ATOM 2    C CA . LEU A 1 2   ? -40.319 42.216  -106.727 1.00 20.00 ? 2    LEU A CA 1 
ATOM 3    C CA . VAL A 1 3   ? -40.624 41.757  -102.901 1.00 20.00 ? 3    VAL A CA 1 
ATOM 4    C CA . MET A 1 4   ? -41.910 38.378  -101.558 1.00 20.00 ? 4    MET A CA 1 
ATOM 5    C CA . THR A 1 5   ? -43.149 38.449  -97.900  1.00 20.00 ? 5    THR A CA 1 
ATOM 6    C CA . GLN A 1 6   ? -43.987 35.145  -96.122  1.00 20.00 ? 6    GLN A CA 1 
ATOM 7    C CA . SER A 1 7   ? -45.742 34.767  -92.720  1.00 20.00 ? 7    SER A CA 1 
ATOM 8    C CA . PRO A 1 8   ? -45.456 33.756  -89.941  1.00 20.00 ? 8    PRO A CA 1 
ATOM 9    C CA . SER A 1 9   ? -41.687 33.826  -89.098  1.00 20.00 ? 9    SER A CA 1 
ATOM 10   C CA . SER A 1 10  ? -41.963 30.577  -87.028  1.00 20.00 ? 10   SER A CA 1 
ATOM 11   C CA . LEU A 1 11  ? -44.579 27.751  -86.734  1.00 20.00 ? 11   LEU A CA 1 
ATOM 12   C CA . SER A 1 12  ? -45.326 25.494  -83.696  1.00 20.00 ? 12   SER A CA 1 
ATOM 13   C CA . ALA A 1 13  ? -47.727 22.508  -84.183  1.00 20.00 ? 13   ALA A CA 1 
ATOM 14   C CA . SER A 1 14  ? -48.091 18.847  -83.065  1.00 20.00 ? 14   SER A CA 1 
ATOM 15   C CA . VAL A 1 15  ? -48.170 15.817  -85.432  1.00 20.00 ? 15   VAL A CA 1 
ATOM 16   C CA . GLY A 1 16  ? -51.538 15.877  -87.332  1.00 20.00 ? 16   GLY A CA 1 
ATOM 17   C CA . ASP A 1 17  ? -52.412 19.639  -87.324  1.00 20.00 ? 17   ASP A CA 1 
ATOM 18   C CA . ARG A 1 18  ? -52.962 21.400  -90.693  1.00 20.00 ? 18   ARG A CA 1 
ATOM 19   C CA . VAL A 1 19  ? -50.487 24.344  -91.058  1.00 20.00 ? 19   VAL A CA 1 
ATOM 20   C CA . ASN A 1 20  ? -50.999 27.302  -93.467  1.00 20.00 ? 20   ASN A CA 1 
ATOM 21   C CA . ILE A 1 21  ? -47.963 29.167  -94.948  1.00 20.00 ? 21   ILE A CA 1 
ATOM 22   C CA . ALA A 1 22  ? -48.633 32.417  -96.901  1.00 20.00 ? 22   ALA A CA 1 
ATOM 23   C CA . CYS A 1 23  ? -46.531 33.999  -99.702  1.00 20.00 ? 23   CYS A CA 1 
ATOM 24   C CA . ARG A 1 24  ? -47.691 37.475  -100.846 1.00 20.00 ? 24   ARG A CA 1 
ATOM 25   C CA . ALA A 1 25  ? -46.065 39.535  -103.656 1.00 20.00 ? 25   ALA A CA 1 
ATOM 26   C CA . SER A 1 26  ? -45.676 43.314  -104.389 1.00 20.00 ? 26   SER A CA 1 
ATOM 27   C CA . GLN A 1 27  ? -47.669 42.950  -107.677 1.00 20.00 ? 27   GLN A CA 1 
ATOM 28   C CA . GLY A 1 28  ? -49.556 40.223  -109.653 1.00 20.00 ? 28   GLY A CA 1 
ATOM 29   C CA . ILE A 1 29  ? -47.301 37.400  -111.040 1.00 20.00 ? 29   ILE A CA 1 
ATOM 30   C CA . SER A 1 30  ? -50.185 35.146  -112.329 1.00 20.00 ? 30   SER A CA 1 
ATOM 31   C CA . SER A 1 31  ? -49.434 31.392  -111.681 1.00 20.00 ? 31   SER A CA 1 
ATOM 32   C CA . ALA A 1 32  ? -45.579 31.772  -111.417 1.00 20.00 ? 32   ALA A CA 1 
ATOM 33   C CA . LEU A 1 33  ? -44.553 30.620  -107.869 1.00 20.00 ? 33   LEU A CA 1 
ATOM 34   C CA . ALA A 1 34  ? -42.465 27.607  -106.630 1.00 20.00 ? 34   ALA A CA 1 
ATOM 35   C CA . TRP A 1 35  ? -42.319 26.092  -103.080 1.00 20.00 ? 35   TRP A CA 1 
ATOM 36   C CA . TYR A 1 36  ? -39.126 24.557  -101.574 1.00 20.00 ? 36   TYR A CA 1 
ATOM 37   C CA . GLN A 1 37  ? -38.008 22.340  -98.642  1.00 20.00 ? 37   GLN A CA 1 
ATOM 38   C CA . GLN A 1 38  ? -34.561 23.021  -97.085  1.00 20.00 ? 38   GLN A CA 1 
ATOM 39   C CA . LYS A 1 39  ? -33.613 20.451  -94.415  1.00 20.00 ? 39   LYS A CA 1 
ATOM 40   C CA . PRO A 1 40  ? -31.013 22.232  -92.149  1.00 20.00 ? 40   PRO A CA 1 
ATOM 41   C CA . GLY A 1 41  ? -27.511 21.567  -93.641  1.00 20.00 ? 41   GLY A CA 1 
ATOM 42   C CA . LYS A 1 42  ? -28.846 20.456  -97.080  1.00 20.00 ? 42   LYS A CA 1 
ATOM 43   C CA . ALA A 1 43  ? -29.799 21.862  -100.502 1.00 20.00 ? 43   ALA A CA 1 
ATOM 44   C CA . PRO A 1 44  ? -33.418 22.980  -101.294 1.00 20.00 ? 44   PRO A CA 1 
ATOM 45   C CA . ARG A 1 45  ? -35.924 20.462  -102.715 1.00 20.00 ? 45   ARG A CA 1 
ATOM 46   C CA . LEU A 1 46  ? -38.713 21.419  -105.181 1.00 20.00 ? 46   LEU A CA 1 
ATOM 47   C CA . LEU A 1 47  ? -42.234 20.648  -103.839 1.00 20.00 ? 47   LEU A CA 1 
ATOM 48   C CA . ILE A 1 48  ? -44.746 22.574  -106.032 1.00 20.00 ? 48   ILE A CA 1 
ATOM 49   C CA . TYR A 1 49  ? -43.891 24.301  -109.411 1.00 20.00 ? 49   TYR A CA 1 
ATOM 50   C CA . ASP A 1 50  ? -46.836 25.903  -111.356 1.00 20.00 ? 50   ASP A CA 1 
ATOM 51   C CA . ALA A 1 51  ? -49.504 27.243  -108.876 1.00 20.00 ? 51   ALA A CA 1 
ATOM 52   C CA . SER A 1 52  ? -50.682 23.781  -107.553 1.00 20.00 ? 52   SER A CA 1 
ATOM 53   C CA . ASN A 1 53  ? -48.818 21.029  -109.535 1.00 20.00 ? 53   ASN A CA 1 
ATOM 54   C CA . LEU A 1 54  ? -46.793 18.560  -107.383 1.00 20.00 ? 54   LEU A CA 1 
ATOM 55   C CA . GLU A 1 55  ? -43.455 16.967  -108.407 1.00 20.00 ? 55   GLU A CA 1 
ATOM 56   C CA . SER A 1 56  ? -43.098 13.161  -108.937 1.00 20.00 ? 56   SER A CA 1 
ATOM 57   C CA . GLY A 1 57  ? -42.073 11.678  -105.510 1.00 20.00 ? 57   GLY A CA 1 
ATOM 58   C CA . VAL A 1 58  ? -43.420 14.502  -103.287 1.00 20.00 ? 58   VAL A CA 1 
ATOM 59   C CA . PRO A 1 59  ? -46.038 13.151  -100.769 1.00 20.00 ? 59   PRO A CA 1 
ATOM 60   C CA . SER A 1 60  ? -49.808 13.467  -101.578 1.00 20.00 ? 60   SER A CA 1 
ATOM 61   C CA . ARG A 1 61  ? -50.299 15.566  -98.345  1.00 20.00 ? 61   ARG A CA 1 
ATOM 62   C CA . PHE A 1 62  ? -48.487 18.652  -99.792  1.00 20.00 ? 62   PHE A CA 1 
ATOM 63   C CA . SER A 1 63  ? -50.561 21.094  -101.936 1.00 20.00 ? 63   SER A CA 1 
ATOM 64   C CA . GLY A 1 64  ? -51.665 24.762  -102.313 1.00 20.00 ? 64   GLY A CA 1 
ATOM 65   C CA . SER A 1 65  ? -53.367 27.337  -104.564 1.00 20.00 ? 65   SER A CA 1 
ATOM 66   C CA . GLY A 1 66  ? -53.629 31.150  -105.153 1.00 20.00 ? 66   GLY A CA 1 
ATOM 67   C CA . SER A 1 67  ? -53.951 33.371  -108.264 1.00 20.00 ? 67   SER A CA 1 
ATOM 68   C CA . GLY A 1 68  ? -52.035 36.713  -108.610 1.00 20.00 ? 68   GLY A CA 1 
ATOM 69   C CA . THR A 1 69  ? -51.136 38.155  -105.145 1.00 20.00 ? 69   THR A CA 1 
ATOM 70   C CA . ASP A 1 70  ? -52.237 35.822  -102.286 1.00 20.00 ? 70   ASP A CA 1 
ATOM 71   C CA . PHE A 1 71  ? -50.644 32.323  -102.178 1.00 20.00 ? 71   PHE A CA 1 
ATOM 72   C CA . THR A 1 72  ? -50.756 29.457  -99.626  1.00 20.00 ? 72   THR A CA 1 
ATOM 73   C CA . LEU A 1 73  ? -48.880 26.195  -98.859  1.00 20.00 ? 73   LEU A CA 1 
ATOM 74   C CA . THR A 1 74  ? -50.925 23.507  -96.988  1.00 20.00 ? 74   THR A CA 1 
ATOM 75   C CA . ILE A 1 75  ? -50.056 20.215  -95.194  1.00 20.00 ? 75   ILE A CA 1 
ATOM 76   C CA . SER A 1 76  ? -53.129 18.045  -94.215  1.00 20.00 ? 76   SER A CA 1 
ATOM 77   C CA . SER A 1 77  ? -51.089 15.706  -91.882  1.00 20.00 ? 77   SER A CA 1 
ATOM 78   C CA . LEU A 1 78  ? -47.931 17.119  -90.214  1.00 20.00 ? 78   LEU A CA 1 
ATOM 79   C CA . GLN A 1 79  ? -45.230 14.390  -89.713  1.00 20.00 ? 79   GLN A CA 1 
ATOM 80   C CA . PRO A 1 80  ? -41.846 14.602  -87.802  1.00 20.00 ? 80   PRO A CA 1 
ATOM 81   C CA . GLU A 1 81  ? -39.996 14.331  -91.200  1.00 20.00 ? 81   GLU A CA 1 
ATOM 82   C CA . ASP A 1 82  ? -41.334 17.818  -92.280  1.00 20.00 ? 82   ASP A CA 1 
ATOM 83   C CA . PHE A 1 83  ? -38.717 19.793  -90.207  1.00 20.00 ? 83   PHE A CA 1 
ATOM 84   C CA . ALA A 1 84  ? -37.455 22.303  -92.852  1.00 20.00 ? 84   ALA A CA 1 
ATOM 85   C CA . ILE A 1 85  ? -37.364 26.019  -93.750  1.00 20.00 ? 85   ILE A CA 1 
ATOM 86   C CA . TYR A 1 86  ? -39.806 26.485  -96.661  1.00 20.00 ? 86   TYR A CA 1 
ATOM 87   C CA . TYR A 1 87  ? -39.302 29.190  -99.344  1.00 20.00 ? 87   TYR A CA 1 
ATOM 88   C CA . CYS A 1 88  ? -41.353 30.647  -102.244 1.00 20.00 ? 88   CYS A CA 1 
ATOM 89   C CA . GLN A 1 89  ? -39.760 32.336  -105.310 1.00 20.00 ? 89   GLN A CA 1 
ATOM 90   C CA . GLN A 1 90  ? -41.339 33.951  -108.422 1.00 20.00 ? 90   GLN A CA 1 
ATOM 91   C CA . PHE A 1 91  ? -40.501 33.532  -112.167 1.00 20.00 ? 91   PHE A CA 1 
ATOM 92   C CA . ASN A 1 92  ? -42.386 36.251  -114.142 1.00 20.00 ? 92   ASN A CA 1 
ATOM 93   C CA . SER A 1 93  ? -39.593 38.909  -114.406 1.00 20.00 ? 93   SER A CA 1 
ATOM 94   C CA . TYR A 1 94  ? -35.924 39.522  -113.407 1.00 20.00 ? 94   TYR A CA 1 
ATOM 95   C CA . PRO A 1 95  ? -34.258 39.170  -111.027 1.00 20.00 ? 95   PRO A CA 1 
ATOM 96   C CA . LEU A 1 96  ? -35.807 36.022  -109.473 1.00 20.00 ? 96   LEU A CA 1 
ATOM 97   C CA . THR A 1 97  ? -36.464 36.660  -105.719 1.00 20.00 ? 97   THR A CA 1 
ATOM 98   C CA . PHE A 1 98  ? -37.050 34.309  -102.729 1.00 20.00 ? 98   PHE A CA 1 
ATOM 99   C CA . GLY A 1 99  ? -39.300 34.468  -99.652  1.00 20.00 ? 99   GLY A CA 1 
ATOM 100  C CA . GLY A 1 100 ? -38.145 35.256  -96.076  1.00 20.00 ? 100  GLY A CA 1 
ATOM 101  C CA . GLY A 1 101 ? -38.393 31.572  -94.981  1.00 20.00 ? 101  GLY A CA 1 
ATOM 102  C CA . THR A 1 102 ? -40.970 29.914  -92.653  1.00 20.00 ? 102  THR A CA 1 
ATOM 103  C CA . LYS A 1 103 ? -39.371 27.455  -90.166  1.00 20.00 ? 103  LYS A CA 1 
ATOM 104  C CA . VAL A 1 104 ? -41.607 24.541  -88.989  1.00 20.00 ? 104  VAL A CA 1 
ATOM 105  C CA . GLU A 1 105 ? -40.856 23.343  -85.410  1.00 20.00 ? 105  GLU A CA 1 
ATOM 106  C CA . ILE A 1 106 ? -42.557 20.044  -84.378  1.00 20.00 ? 106  ILE A CA 1 
ATOM 107  C CA . LYS A 1 107 ? -44.417 19.628  -81.033  1.00 20.00 ? 107  LYS A CA 1 
ATOM 108  C CA . ARG A 1 108 ? -44.433 16.524  -78.753  1.00 20.00 ? 108  ARG A CA 1 
ATOM 109  C CA . THR A 1 109 ? -44.254 15.511  -75.028  1.00 20.00 ? 109  THR A CA 1 
ATOM 110  C CA . VAL A 1 110 ? -41.433 16.255  -72.534  1.00 20.00 ? 110  VAL A CA 1 
ATOM 111  C CA . ALA A 1 111 ? -38.345 13.956  -72.599  1.00 20.00 ? 111  ALA A CA 1 
ATOM 112  C CA . ALA A 1 112 ? -35.688 13.518  -69.843  1.00 20.00 ? 112  ALA A CA 1 
ATOM 113  C CA . PRO A 1 113 ? -32.066 13.810  -71.209  1.00 20.00 ? 113  PRO A CA 1 
ATOM 114  C CA . SER A 1 114 ? -29.368 11.271  -70.275  1.00 20.00 ? 114  SER A CA 1 
ATOM 115  C CA . VAL A 1 115 ? -26.468 13.528  -69.173  1.00 20.00 ? 115  VAL A CA 1 
ATOM 116  C CA . PHE A 1 116 ? -22.845 12.406  -69.847  1.00 20.00 ? 116  PHE A CA 1 
ATOM 117  C CA . ILE A 1 117 ? -19.380 13.972  -69.318  1.00 20.00 ? 117  ILE A CA 1 
ATOM 118  C CA . PHE A 1 118 ? -15.974 13.650  -71.103  1.00 20.00 ? 118  PHE A CA 1 
ATOM 119  C CA . PRO A 1 119 ? -12.662 14.617  -69.405  1.00 20.00 ? 119  PRO A CA 1 
ATOM 120  C CA . PRO A 1 120 ? -9.642  15.834  -71.513  1.00 20.00 ? 120  PRO A CA 1 
ATOM 121  C CA . SER A 1 121 ? -7.654  13.050  -73.245  1.00 20.00 ? 121  SER A CA 1 
ATOM 122  C CA . ASP A 1 122 ? -3.991  12.129  -72.501  1.00 20.00 ? 122  ASP A CA 1 
ATOM 123  C CA . GLU A 1 123 ? -2.603  13.500  -75.846  1.00 20.00 ? 123  GLU A CA 1 
ATOM 124  C CA . GLN A 1 124 ? -4.660  16.785  -75.602  1.00 20.00 ? 124  GLN A CA 1 
ATOM 125  C CA . LEU A 1 125 ? -2.846  18.030  -72.442  1.00 20.00 ? 125  LEU A CA 1 
ATOM 126  C CA . LYS A 1 126 ? 0.599   17.886  -74.249  1.00 20.00 ? 126  LYS A CA 1 
ATOM 127  C CA . SER A 1 127 ? 0.016   21.192  -76.117  1.00 20.00 ? 127  SER A CA 1 
ATOM 128  C CA . GLY A 1 128 ? -1.122  22.968  -72.867  1.00 20.00 ? 128  GLY A CA 1 
ATOM 129  C CA . THR A 1 129 ? -4.966  22.928  -73.025  1.00 20.00 ? 129  THR A CA 1 
ATOM 130  C CA . ALA A 1 130 ? -7.989  21.021  -71.623  1.00 20.00 ? 130  ALA A CA 1 
ATOM 131  C CA . SER A 1 131 ? -11.671 20.703  -72.759  1.00 20.00 ? 131  SER A CA 1 
ATOM 132  C CA . VAL A 1 132 ? -14.359 19.032  -70.554  1.00 20.00 ? 132  VAL A CA 1 
ATOM 133  C CA . VAL A 1 133 ? -17.491 18.094  -72.604  1.00 20.00 ? 133  VAL A CA 1 
ATOM 134  C CA . CYS A 1 134 ? -20.957 17.520  -70.986  1.00 20.00 ? 134  CYS A CA 1 
ATOM 135  C CA . LEU A 1 135 ? -23.681 15.791  -73.110  1.00 20.00 ? 135  LEU A CA 1 
ATOM 136  C CA . LEU A 1 136 ? -27.504 16.129  -72.774  1.00 20.00 ? 136  LEU A CA 1 
ATOM 137  C CA . ASN A 1 137 ? -28.623 13.303  -75.171  1.00 20.00 ? 137  ASN A CA 1 
ATOM 138  C CA . ASN A 1 138 ? -32.340 13.278  -76.337  1.00 20.00 ? 138  ASN A CA 1 
ATOM 139  C CA . PHE A 1 139 ? -34.735 15.906  -74.848  1.00 20.00 ? 139  PHE A CA 1 
ATOM 140  C CA . TYR A 1 140 ? -37.715 18.227  -75.488  1.00 20.00 ? 140  TYR A CA 1 
ATOM 141  C CA . PRO A 1 141 ? -38.178 21.206  -75.464  1.00 20.00 ? 141  PRO A CA 1 
ATOM 142  C CA . ARG A 1 142 ? -34.806 22.876  -76.380  1.00 20.00 ? 142  ARG A CA 1 
ATOM 143  C CA . GLU A 1 143 ? -35.137 24.883  -73.074  1.00 20.00 ? 143  GLU A CA 1 
ATOM 144  C CA . ALA A 1 144 ? -32.316 23.495  -70.869  1.00 20.00 ? 144  ALA A CA 1 
ATOM 145  C CA . LYS A 1 145 ? -29.546 24.818  -68.577  1.00 20.00 ? 145  LYS A CA 1 
ATOM 146  C CA . VAL A 1 146 ? -25.956 23.681  -67.879  1.00 20.00 ? 146  VAL A CA 1 
ATOM 147  C CA . GLN A 1 147 ? -23.967 24.821  -64.801  1.00 20.00 ? 147  GLN A CA 1 
ATOM 148  C CA . TRP A 1 148 ? -20.295 23.717  -64.451  1.00 20.00 ? 148  TRP A CA 1 
ATOM 149  C CA . LYS A 1 149 ? -19.131 22.913  -60.894  1.00 20.00 ? 149  LYS A CA 1 
ATOM 150  C CA . VAL A 1 150 ? -15.326 23.036  -60.614  1.00 20.00 ? 150  VAL A CA 1 
ATOM 151  C CA . ASP A 1 151 ? -14.453 22.338  -56.935  1.00 20.00 ? 151  ASP A CA 1 
ATOM 152  C CA . ASN A 1 152 ? -17.971 22.127  -55.509  1.00 20.00 ? 152  ASN A CA 1 
ATOM 153  C CA . ALA A 1 153 ? -19.620 25.558  -55.163  1.00 20.00 ? 153  ALA A CA 1 
ATOM 154  C CA . LEU A 1 154 ? -17.070 27.419  -57.419  1.00 20.00 ? 154  LEU A CA 1 
ATOM 155  C CA . GLN A 1 155 ? -19.145 28.040  -60.580  1.00 20.00 ? 155  GLN A CA 1 
ATOM 156  C CA . SER A 1 156 ? -17.148 29.225  -63.655  1.00 20.00 ? 156  SER A CA 1 
ATOM 157  C CA . GLY A 1 157 ? -18.339 31.339  -66.658  1.00 20.00 ? 157  GLY A CA 1 
ATOM 158  C CA . ASN A 1 158 ? -16.195 30.497  -69.751  1.00 20.00 ? 158  ASN A CA 1 
ATOM 159  C CA . SER A 1 159 ? -18.268 27.805  -71.577  1.00 20.00 ? 159  SER A CA 1 
ATOM 160  C CA . GLN A 1 160 ? -19.797 27.468  -75.095  1.00 20.00 ? 160  GLN A CA 1 
ATOM 161  C CA . GLU A 1 161 ? -23.260 25.944  -75.810  1.00 20.00 ? 161  GLU A CA 1 
ATOM 162  C CA . SER A 1 162 ? -24.221 24.429  -79.205  1.00 20.00 ? 162  SER A CA 1 
ATOM 163  C CA . VAL A 1 163 ? -27.618 22.848  -80.140  1.00 20.00 ? 163  VAL A CA 1 
ATOM 164  C CA . THR A 1 164 ? -28.163 20.795  -83.327  1.00 20.00 ? 164  THR A CA 1 
ATOM 165  C CA . GLU A 1 165 ? -31.223 20.959  -85.594  1.00 20.00 ? 165  GLU A CA 1 
ATOM 166  C CA . GLN A 1 166 ? -34.267 18.735  -84.725  1.00 20.00 ? 166  GLN A CA 1 
ATOM 167  C CA . ASP A 1 167 ? -33.936 15.228  -86.317  1.00 20.00 ? 167  ASP A CA 1 
ATOM 168  C CA . SER A 1 168 ? -36.470 13.491  -88.666  1.00 20.00 ? 168  SER A CA 1 
ATOM 169  C CA . LYS A 1 169 ? -37.419 10.561  -86.273  1.00 20.00 ? 169  LYS A CA 1 
ATOM 170  C CA . ASP A 1 170 ? -38.554 11.223  -82.640  1.00 20.00 ? 170  ASP A CA 1 
ATOM 171  C CA . SER A 1 171 ? -38.580 15.106  -82.794  1.00 20.00 ? 171  SER A CA 1 
ATOM 172  C CA . THR A 1 172 ? -36.065 15.995  -79.998  1.00 20.00 ? 172  THR A CA 1 
ATOM 173  C CA . TYR A 1 173 ? -33.017 18.213  -79.238  1.00 20.00 ? 173  TYR A CA 1 
ATOM 174  C CA . SER A 1 174 ? -29.561 17.501  -77.749  1.00 20.00 ? 174  SER A CA 1 
ATOM 175  C CA . LEU A 1 175 ? -26.892 19.838  -76.240  1.00 20.00 ? 175  LEU A CA 1 
ATOM 176  C CA . SER A 1 176 ? -23.182 19.896  -75.276  1.00 20.00 ? 176  SER A CA 1 
ATOM 177  C CA . SER A 1 177 ? -21.016 22.140  -73.101  1.00 20.00 ? 177  SER A CA 1 
ATOM 178  C CA . THR A 1 178 ? -17.187 22.411  -73.428  1.00 20.00 ? 178  THR A CA 1 
ATOM 179  C CA . LEU A 1 179 ? -15.213 23.955  -70.499  1.00 20.00 ? 179  LEU A CA 1 
ATOM 180  C CA . THR A 1 180 ? -11.939 25.294  -72.056  1.00 20.00 ? 180  THR A CA 1 
ATOM 181  C CA . LEU A 1 181 ? -9.144  25.751  -69.438  1.00 20.00 ? 181  LEU A CA 1 
ATOM 182  C CA . SER A 1 182 ? -5.328  25.538  -69.921  1.00 20.00 ? 182  SER A CA 1 
ATOM 183  C CA . LYS A 1 183 ? -3.183  22.694  -68.425  1.00 20.00 ? 183  LYS A CA 1 
ATOM 184  C CA . ALA A 1 184 ? -1.984  25.014  -65.569  1.00 20.00 ? 184  ALA A CA 1 
ATOM 185  C CA . ASP A 1 185 ? -5.581  25.635  -64.320  1.00 20.00 ? 185  ASP A CA 1 
ATOM 186  C CA . TYR A 1 186 ? -6.548  21.939  -64.950  1.00 20.00 ? 186  TYR A CA 1 
ATOM 187  C CA . GLU A 1 187 ? -3.673  20.396  -62.858  1.00 20.00 ? 187  GLU A CA 1 
ATOM 188  C CA . LYS A 1 188 ? -4.964  22.466  -59.838  1.00 20.00 ? 188  LYS A CA 1 
ATOM 189  C CA . HIS A 1 189 ? -8.601  21.218  -59.308  1.00 20.00 ? 189  HIS A CA 1 
ATOM 190  C CA . LYS A 1 190 ? -10.203 17.767  -58.696  1.00 20.00 ? 190  LYS A CA 1 
ATOM 191  C CA . VAL A 1 191 ? -14.018 17.676  -58.823  1.00 20.00 ? 191  VAL A CA 1 
ATOM 192  C CA . TYR A 1 192 ? -15.736 18.487  -62.175  1.00 20.00 ? 192  TYR A CA 1 
ATOM 193  C CA . ALA A 1 193 ? -19.575 18.190  -62.159  1.00 20.00 ? 193  ALA A CA 1 
ATOM 194  C CA . CYS A 1 194 ? -22.217 19.470  -64.640  1.00 20.00 ? 194  CYS A CA 1 
ATOM 195  C CA . GLU A 1 195 ? -25.659 20.310  -63.135  1.00 20.00 ? 195  GLU A CA 1 
ATOM 196  C CA . VAL A 1 196 ? -28.588 20.095  -65.643  1.00 20.00 ? 196  VAL A CA 1 
ATOM 197  C CA . THR A 1 197 ? -32.116 21.591  -65.270  1.00 20.00 ? 197  THR A CA 1 
ATOM 198  C CA . HIS A 1 198 ? -34.984 20.406  -67.540  1.00 20.00 ? 198  HIS A CA 1 
ATOM 199  C CA . GLN A 1 199 ? -38.818 19.961  -67.286  1.00 20.00 ? 199  GLN A CA 1 
ATOM 200  C CA . GLY A 1 200 ? -38.472 16.159  -67.914  1.00 20.00 ? 200  GLY A CA 1 
ATOM 201  C CA . LEU A 1 201 ? -36.046 15.795  -64.945  1.00 20.00 ? 201  LEU A CA 1 
ATOM 202  C CA . SER A 1 202 ? -37.741 15.537  -61.484  1.00 20.00 ? 202  SER A CA 1 
ATOM 203  C CA . SER A 1 203 ? -34.475 16.862  -59.905  1.00 20.00 ? 203  SER A CA 1 
ATOM 204  C CA . PRO A 1 204 ? -31.114 18.250  -61.276  1.00 20.00 ? 204  PRO A CA 1 
ATOM 205  C CA . VAL A 1 205 ? -28.822 15.426  -62.529  1.00 20.00 ? 205  VAL A CA 1 
ATOM 206  C CA . THR A 1 206 ? -25.155 15.762  -61.414  1.00 20.00 ? 206  THR A CA 1 
ATOM 207  C CA . LYS A 1 207 ? -22.382 14.048  -63.498  1.00 20.00 ? 207  LYS A CA 1 
ATOM 208  C CA . SER A 1 208 ? -18.964 14.433  -61.761  1.00 20.00 ? 208  SER A CA 1 
ATOM 209  C CA . PHE A 1 209 ? -15.523 12.809  -62.094  1.00 20.00 ? 209  PHE A CA 1 
ATOM 210  C CA . ASN A 1 210 ? -12.379 13.042  -59.894  1.00 20.00 ? 210  ASN A CA 1 
ATOM 211  C CA . ARG A 1 211 ? -9.138  14.353  -61.497  1.00 20.00 ? 211  ARG A CA 1 
ATOM 212  C CA . GLY A 1 212 ? -6.134  12.247  -60.354  1.00 20.00 ? 212  GLY A CA 1 
ATOM 213  C CA . GLU A 1 213 ? -5.472  8.662   -61.485  1.00 20.00 ? 213  GLU A CA 1 
ATOM 214  C CA . CYS A 1 214 ? -3.024  5.830   -60.624  1.00 20.00 ? 214  CYS A CA 1 
ATOM 215  C CA . GLN B 2 1   ? -21.972 7.015   -111.157 1.00 20.00 ? 215  GLN B CA 1 
ATOM 216  C CA . VAL B 2 2   ? -22.043 10.409  -109.257 1.00 20.00 ? 216  VAL B CA 1 
ATOM 217  C CA . LYS B 2 3   ? -24.505 12.620  -107.237 1.00 20.00 ? 217  LYS B CA 1 
ATOM 218  C CA . LEU B 2 4   ? -27.337 14.553  -109.010 1.00 20.00 ? 218  LEU B CA 1 
ATOM 219  C CA . LEU B 2 5   ? -25.430 17.700  -110.270 1.00 20.00 ? 219  LEU B CA 1 
ATOM 220  C CA . GLU B 2 6   ? -22.061 17.664  -108.382 1.00 20.00 ? 220  GLU B CA 1 
ATOM 221  C CA . GLN B 2 7   ? -20.267 20.913  -107.324 1.00 20.00 ? 221  GLN B CA 1 
ATOM 222  C CA . SER B 2 8   ? -16.633 21.566  -106.234 1.00 20.00 ? 222  SER B CA 1 
ATOM 223  C CA . GLY B 2 9   ? -15.440 22.692  -102.714 1.00 20.00 ? 223  GLY B CA 1 
ATOM 224  C CA . ALA B 2 10  ? -15.314 25.691  -100.333 1.00 20.00 ? 224  ALA B CA 1 
ATOM 225  C CA . GLU B 2 11  ? -12.490 27.996  -101.583 1.00 20.00 ? 225  GLU B CA 1 
ATOM 226  C CA . VAL B 2 12  ? -11.056 30.373  -98.913  1.00 20.00 ? 226  VAL B CA 1 
ATOM 227  C CA . LYS B 2 13  ? -10.238 33.636  -100.761 1.00 20.00 ? 227  LYS B CA 1 
ATOM 228  C CA . LYS B 2 14  ? -8.601  36.767  -99.271  1.00 20.00 ? 228  LYS B CA 1 
ATOM 229  C CA . PRO B 2 15  ? -10.621 40.062  -99.827  1.00 20.00 ? 229  PRO B CA 1 
ATOM 230  C CA . GLY B 2 16  ? -9.805  41.324  -103.386 1.00 20.00 ? 230  GLY B CA 1 
ATOM 231  C CA . ALA B 2 17  ? -9.215  37.896  -105.043 1.00 20.00 ? 231  ALA B CA 1 
ATOM 232  C CA . SER B 2 18  ? -11.048 35.746  -107.668 1.00 20.00 ? 232  SER B CA 1 
ATOM 233  C CA . VAL B 2 19  ? -13.220 32.586  -107.202 1.00 20.00 ? 233  VAL B CA 1 
ATOM 234  C CA . LYS B 2 20  ? -14.289 29.986  -109.831 1.00 20.00 ? 234  LYS B CA 1 
ATOM 235  C CA . VAL B 2 21  ? -16.962 27.448  -108.730 1.00 20.00 ? 235  VAL B CA 1 
ATOM 236  C CA . SER B 2 22  ? -17.780 24.546  -111.124 1.00 20.00 ? 236  SER B CA 1 
ATOM 237  C CA . CYS B 2 23  ? -20.942 22.403  -111.597 1.00 20.00 ? 237  CYS B CA 1 
ATOM 238  C CA . LYS B 2 24  ? -20.472 18.898  -113.115 1.00 20.00 ? 238  LYS B CA 1 
ATOM 239  C CA . ALA B 2 25  ? -23.622 17.313  -114.652 1.00 20.00 ? 239  ALA B CA 1 
ATOM 240  C CA . SER B 2 26  ? -24.483 13.637  -115.423 1.00 20.00 ? 240  SER B CA 1 
ATOM 241  C CA . GLY B 2 27  ? -27.397 11.214  -116.167 1.00 20.00 ? 241  GLY B CA 1 
ATOM 242  C CA . TYR B 2 28  ? -29.145 13.730  -118.518 1.00 20.00 ? 242  TYR B CA 1 
ATOM 243  C CA . SER B 2 29  ? -28.374 15.630  -121.785 1.00 20.00 ? 243  SER B CA 1 
ATOM 244  C CA . PHE B 2 30  ? -26.262 18.774  -121.073 1.00 20.00 ? 244  PHE B CA 1 
ATOM 245  C CA . THR B 2 31  ? -27.108 20.772  -124.286 1.00 20.00 ? 245  THR B CA 1 
ATOM 246  C CA . SER B 2 32  ? -30.920 20.455  -123.588 1.00 20.00 ? 246  SER B CA 1 
ATOM 247  C CA . TYR B 2 33  ? -31.189 22.159  -120.128 1.00 20.00 ? 247  TYR B CA 1 
ATOM 248  C CA . GLY B 2 34  ? -29.935 25.451  -118.610 1.00 20.00 ? 248  GLY B CA 1 
ATOM 249  C CA . LEU B 2 35  ? -28.282 26.134  -115.214 1.00 20.00 ? 249  LEU B CA 1 
ATOM 250  C CA . HIS B 2 36  ? -29.130 28.943  -112.702 1.00 20.00 ? 250  HIS B CA 1 
ATOM 251  C CA . TRP B 2 37  ? -26.849 30.108  -109.845 1.00 20.00 ? 251  TRP B CA 1 
ATOM 252  C CA . VAL B 2 38  ? -28.343 30.888  -106.378 1.00 20.00 ? 252  VAL B CA 1 
ATOM 253  C CA . ARG B 2 39  ? -26.491 31.646  -103.096 1.00 20.00 ? 253  ARG B CA 1 
ATOM 254  C CA . GLN B 2 40  ? -27.365 32.090  -99.371  1.00 20.00 ? 254  GLN B CA 1 
ATOM 255  C CA . ALA B 2 41  ? -25.676 34.305  -96.727  1.00 20.00 ? 255  ALA B CA 1 
ATOM 256  C CA . PRO B 2 42  ? -25.434 32.797  -93.133  1.00 20.00 ? 256  PRO B CA 1 
ATOM 257  C CA . GLY B 2 43  ? -28.871 33.620  -91.584  1.00 20.00 ? 257  GLY B CA 1 
ATOM 258  C CA . GLN B 2 44  ? -30.398 35.291  -94.720  1.00 20.00 ? 258  GLN B CA 1 
ATOM 259  C CA . ARG B 2 45  ? -32.641 34.311  -97.690  1.00 20.00 ? 259  ARG B CA 1 
ATOM 260  C CA . LEU B 2 46  ? -31.566 32.794  -101.051 1.00 20.00 ? 260  LEU B CA 1 
ATOM 261  C CA . GLU B 2 47  ? -30.419 35.365  -103.707 1.00 20.00 ? 261  GLU B CA 1 
ATOM 262  C CA . TRP B 2 48  ? -30.453 34.654  -107.478 1.00 20.00 ? 262  TRP B CA 1 
ATOM 263  C CA . MET B 2 49  ? -27.121 35.532  -109.209 1.00 20.00 ? 263  MET B CA 1 
ATOM 264  C CA . GLY B 2 50  ? -27.747 34.502  -112.845 1.00 20.00 ? 264  GLY B CA 1 
ATOM 265  C CA . TRP B 2 51  ? -28.252 31.909  -115.580 1.00 20.00 ? 265  TRP B CA 1 
ATOM 266  C CA . ILE B 2 52  ? -26.446 30.435  -118.619 1.00 20.00 ? 266  ILE B CA 1 
ATOM 267  C CA . SER B 2 53  ? -27.819 28.294  -121.500 1.00 20.00 ? 267  SER B CA 1 
ATOM 268  C CA . ALA B 2 54  ? -25.723 25.117  -122.160 1.00 20.00 ? 268  ALA B CA 1 
ATOM 269  C CA . GLY B 2 55  ? -26.891 25.050  -125.875 1.00 20.00 ? 269  GLY B CA 1 
ATOM 270  C CA . THR B 2 56  ? -25.852 28.539  -127.191 1.00 20.00 ? 270  THR B CA 1 
ATOM 271  C CA . GLY B 2 57  ? -23.997 30.175  -124.204 1.00 20.00 ? 271  GLY B CA 1 
ATOM 272  C CA . ASN B 2 58  ? -26.224 33.247  -123.559 1.00 20.00 ? 272  ASN B CA 1 
ATOM 273  C CA . THR B 2 59  ? -25.633 35.080  -120.234 1.00 20.00 ? 273  THR B CA 1 
ATOM 274  C CA . LYS B 2 60  ? -28.486 36.543  -118.102 1.00 20.00 ? 274  LYS B CA 1 
ATOM 275  C CA . TYR B 2 61  ? -27.368 37.837  -114.665 1.00 20.00 ? 275  TYR B CA 1 
ATOM 276  C CA . SER B 2 62  ? -28.922 40.319  -112.225 1.00 20.00 ? 276  SER B CA 1 
ATOM 277  C CA . GLN B 2 63  ? -28.085 44.069  -111.945 1.00 20.00 ? 277  GLN B CA 1 
ATOM 278  C CA . LYS B 2 64  ? -26.670 43.412  -108.383 1.00 20.00 ? 278  LYS B CA 1 
ATOM 279  C CA . PHE B 2 65  ? -23.291 41.860  -109.425 1.00 20.00 ? 279  PHE B CA 1 
ATOM 280  C CA . ARG B 2 66  ? -23.041 44.022  -112.618 1.00 20.00 ? 280  ARG B CA 1 
ATOM 281  C CA . GLY B 2 67  ? -19.398 44.227  -113.869 1.00 20.00 ? 281  GLY B CA 1 
ATOM 282  C CA . ARG B 2 68  ? -17.845 41.454  -111.681 1.00 20.00 ? 282  ARG B CA 1 
ATOM 283  C CA . VAL B 2 69  ? -19.713 38.180  -112.598 1.00 20.00 ? 283  VAL B CA 1 
ATOM 284  C CA . THR B 2 70  ? -19.105 35.779  -115.532 1.00 20.00 ? 284  THR B CA 1 
ATOM 285  C CA . PHE B 2 71  ? -20.488 32.377  -116.642 1.00 20.00 ? 285  PHE B CA 1 
ATOM 286  C CA . THR B 2 72  ? -18.587 29.865  -118.828 1.00 20.00 ? 286  THR B CA 1 
ATOM 287  C CA . ARG B 2 73  ? -19.490 26.326  -120.013 1.00 20.00 ? 287  ARG B CA 1 
ATOM 288  C CA . ASP B 2 74  ? -17.413 23.483  -121.541 1.00 20.00 ? 288  ASP B CA 1 
ATOM 289  C CA . THR B 2 75  ? -19.489 21.430  -124.080 1.00 20.00 ? 289  THR B CA 1 
ATOM 290  C CA . SER B 2 76  ? -17.233 18.276  -124.238 1.00 20.00 ? 290  SER B CA 1 
ATOM 291  C CA . ALA B 2 77  ? -16.527 18.230  -120.417 1.00 20.00 ? 291  ALA B CA 1 
ATOM 292  C CA . THR B 2 78  ? -20.150 18.611  -119.105 1.00 20.00 ? 292  THR B CA 1 
ATOM 293  C CA . THR B 2 79  ? -19.322 21.270  -116.445 1.00 20.00 ? 293  THR B CA 1 
ATOM 294  C CA . ALA B 2 80  ? -20.630 24.821  -115.859 1.00 20.00 ? 294  ALA B CA 1 
ATOM 295  C CA . TYR B 2 81  ? -18.585 27.672  -114.286 1.00 20.00 ? 295  TYR B CA 1 
ATOM 296  C CA . MET B 2 82  ? -19.093 30.926  -112.339 1.00 20.00 ? 296  MET B CA 1 
ATOM 297  C CA . GLY B 2 83  ? -16.600 33.833  -111.868 1.00 20.00 ? 297  GLY B CA 1 
ATOM 298  C CA . LEU B 2 84  ? -16.618 36.632  -109.241 1.00 20.00 ? 298  LEU B CA 1 
ATOM 299  C CA . SER B 2 85  ? -13.814 39.297  -109.001 1.00 20.00 ? 299  SER B CA 1 
ATOM 300  C CA . SER B 2 86  ? -13.238 41.875  -106.176 1.00 20.00 ? 300  SER B CA 1 
ATOM 301  C CA . LEU B 2 87  ? -14.495 39.609  -103.336 1.00 20.00 ? 301  LEU B CA 1 
ATOM 302  C CA . ARG B 2 88  ? -15.717 41.323  -100.100 1.00 20.00 ? 302  ARG B CA 1 
ATOM 303  C CA . PRO B 2 89  ? -16.204 40.213  -96.389  1.00 20.00 ? 303  PRO B CA 1 
ATOM 304  C CA . GLU B 2 90  ? -20.024 40.090  -97.086  1.00 20.00 ? 304  GLU B CA 1 
ATOM 305  C CA . ASP B 2 91  ? -19.825 37.470  -99.932  1.00 20.00 ? 305  ASP B CA 1 
ATOM 306  C CA . THR B 2 92  ? -19.602 34.638  -97.306  1.00 20.00 ? 306  THR B CA 1 
ATOM 307  C CA . ALA B 2 93  ? -22.432 32.429  -98.646  1.00 20.00 ? 307  ALA B CA 1 
ATOM 308  C CA . VAL B 2 94  ? -23.372 28.921  -99.847  1.00 20.00 ? 308  VAL B CA 1 
ATOM 309  C CA . TYR B 2 95  ? -23.586 28.927  -103.693 1.00 20.00 ? 309  TYR B CA 1 
ATOM 310  C CA . TYR B 2 96  ? -25.744 26.387  -105.606 1.00 20.00 ? 310  TYR B CA 1 
ATOM 311  C CA . CYS B 2 97  ? -26.160 25.534  -109.327 1.00 20.00 ? 311  CYS B CA 1 
ATOM 312  C CA . ALA B 2 98  ? -29.811 24.633  -110.063 1.00 20.00 ? 312  ALA B CA 1 
ATOM 313  C CA . ARG B 2 99  ? -31.070 23.180  -113.410 1.00 20.00 ? 313  ARG B CA 1 
ATOM 314  C CA . ASP B 2 100 ? -33.525 24.728  -115.946 1.00 20.00 ? 314  ASP B CA 1 
ATOM 315  C CA . PRO B 2 101 ? -36.403 22.204  -116.710 1.00 20.00 ? 315  PRO B CA 1 
ATOM 316  C CA . TYR B 2 102 ? -37.385 24.269  -119.839 1.00 20.00 ? 316  TYR B CA 1 
ATOM 317  C CA . GLY B 2 103 ? -34.194 26.040  -121.133 1.00 20.00 ? 317  GLY B CA 1 
ATOM 318  C CA . GLY B 2 104 ? -35.939 29.490  -121.167 1.00 20.00 ? 318  GLY B CA 1 
ATOM 319  C CA . GLY B 2 105 ? -34.024 31.307  -118.342 1.00 20.00 ? 319  GLY B CA 1 
ATOM 320  C CA . LYS B 2 106 ? -37.136 31.974  -116.148 1.00 20.00 ? 320  LYS B CA 1 
ATOM 321  C CA . SER B 2 107 ? -38.698 29.036  -114.222 1.00 20.00 ? 321  SER B CA 1 
ATOM 322  C CA . GLU B 2 108 ? -38.415 26.822  -111.090 1.00 20.00 ? 322  GLU B CA 1 
ATOM 323  C CA . PHE B 2 109 ? -35.473 24.610  -109.950 1.00 20.00 ? 323  PHE B CA 1 
ATOM 324  C CA . ASP B 2 110 ? -35.990 20.785  -109.803 1.00 20.00 ? 324  ASP B CA 1 
ATOM 325  C CA . TYR B 2 111 ? -32.326 19.709  -109.158 1.00 20.00 ? 325  TYR B CA 1 
ATOM 326  C CA . TRP B 2 112 ? -29.980 21.426  -106.640 1.00 20.00 ? 326  TRP B CA 1 
ATOM 327  C CA . GLY B 2 113 ? -26.294 20.630  -105.930 1.00 20.00 ? 327  GLY B CA 1 
ATOM 328  C CA . GLN B 2 114 ? -24.507 20.149  -102.548 1.00 20.00 ? 328  GLN B CA 1 
ATOM 329  C CA . GLY B 2 115 ? -23.398 23.822  -102.271 1.00 20.00 ? 329  GLY B CA 1 
ATOM 330  C CA . THR B 2 116 ? -19.996 25.625  -102.006 1.00 20.00 ? 330  THR B CA 1 
ATOM 331  C CA . LEU B 2 117 ? -19.283 27.849  -98.927  1.00 20.00 ? 331  LEU B CA 1 
ATOM 332  C CA . VAL B 2 118 ? -16.811 30.541  -100.139 1.00 20.00 ? 332  VAL B CA 1 
ATOM 333  C CA . THR B 2 119 ? -15.598 32.423  -97.009  1.00 20.00 ? 333  THR B CA 1 
ATOM 334  C CA . VAL B 2 120 ? -13.839 35.751  -97.748  1.00 20.00 ? 334  VAL B CA 1 
ATOM 335  C CA . SER B 2 121 ? -11.568 36.692  -94.773  1.00 20.00 ? 335  SER B CA 1 
ATOM 336  C CA . SER B 2 122 ? -7.964  38.050  -94.494  1.00 20.00 ? 336  SER B CA 1 
ATOM 337  C CA . ALA B 2 123 ? -7.321  36.108  -91.204  1.00 20.00 ? 337  ALA B CA 1 
ATOM 338  C CA . SER B 2 124 ? -4.654  33.338  -91.500  1.00 20.00 ? 338  SER B CA 1 
ATOM 339  C CA . PRO B 2 125 ? -6.650  30.072  -92.035  1.00 20.00 ? 339  PRO B CA 1 
ATOM 340  C CA . THR B 2 126 ? -5.439  26.996  -90.076  1.00 20.00 ? 340  THR B CA 1 
ATOM 341  C CA . SER B 2 127 ? -5.974  23.217  -90.362  1.00 20.00 ? 341  SER B CA 1 
ATOM 342  C CA . PRO B 2 128 ? -8.083  21.511  -87.603  1.00 20.00 ? 342  PRO B CA 1 
ATOM 343  C CA . LYS B 2 129 ? -6.476  19.356  -84.851  1.00 20.00 ? 343  LYS B CA 1 
ATOM 344  C CA . VAL B 2 130 ? -8.675  16.234  -84.392  1.00 20.00 ? 344  VAL B CA 1 
ATOM 345  C CA . PHE B 2 131 ? -8.545  14.657  -80.881  1.00 20.00 ? 345  PHE B CA 1 
ATOM 346  C CA . PRO B 2 132 ? -9.989  11.276  -79.705  1.00 20.00 ? 346  PRO B CA 1 
ATOM 347  C CA . LEU B 2 133 ? -12.633 11.786  -76.935  1.00 20.00 ? 347  LEU B CA 1 
ATOM 348  C CA . SER B 2 134 ? -12.382 8.246   -75.494  1.00 20.00 ? 348  SER B CA 1 
ATOM 349  C CA . LEU B 2 135 ? -13.719 7.809   -71.915  1.00 20.00 ? 349  LEU B CA 1 
ATOM 350  C CA . ASP B 2 136 ? -12.279 6.322   -68.665  1.00 20.00 ? 350  ASP B CA 1 
ATOM 351  C CA . SER B 2 137 ? -15.394 4.354   -67.487  1.00 20.00 ? 351  SER B CA 1 
ATOM 352  C CA . THR B 2 138 ? -17.316 7.611   -66.600  1.00 20.00 ? 352  THR B CA 1 
ATOM 353  C CA . PRO B 2 139 ? -20.636 6.565   -68.351  1.00 20.00 ? 353  PRO B CA 1 
ATOM 354  C CA . GLN B 2 140 ? -22.871 3.575   -67.410  1.00 20.00 ? 354  GLN B CA 1 
ATOM 355  C CA . ASP B 2 141 ? -23.134 -0.161  -68.218  1.00 20.00 ? 355  ASP B CA 1 
ATOM 356  C CA . GLY B 2 142 ? -25.385 -0.467  -71.348  1.00 20.00 ? 356  GLY B CA 1 
ATOM 357  C CA . ASN B 2 143 ? -24.070 2.002   -73.979  1.00 20.00 ? 357  ASN B CA 1 
ATOM 358  C CA . VAL B 2 144 ? -20.579 3.345   -74.821  1.00 20.00 ? 358  VAL B CA 1 
ATOM 359  C CA . VAL B 2 145 ? -20.214 7.027   -75.815  1.00 20.00 ? 359  VAL B CA 1 
ATOM 360  C CA . VAL B 2 146 ? -17.176 7.903   -78.009  1.00 20.00 ? 360  VAL B CA 1 
ATOM 361  C CA . ALA B 2 147 ? -16.352 11.169  -79.864  1.00 20.00 ? 361  ALA B CA 1 
ATOM 362  C CA . CYS B 2 148 ? -13.820 13.123  -82.030  1.00 20.00 ? 362  CYS B CA 1 
ATOM 363  C CA . LEU B 2 149 ? -13.056 16.758  -81.034  1.00 20.00 ? 363  LEU B CA 1 
ATOM 364  C CA . VAL B 2 150 ? -12.038 18.691  -84.200  1.00 20.00 ? 364  VAL B CA 1 
ATOM 365  C CA . GLN B 2 151 ? -10.388 21.808  -82.618  1.00 20.00 ? 365  GLN B CA 1 
ATOM 366  C CA . GLY B 2 152 ? -9.022  25.052  -84.177  1.00 20.00 ? 366  GLY B CA 1 
ATOM 367  C CA . PHE B 2 153 ? -10.025 25.629  -87.816  1.00 20.00 ? 367  PHE B CA 1 
ATOM 368  C CA . PHE B 2 154 ? -10.750 29.082  -89.368  1.00 20.00 ? 368  PHE B CA 1 
ATOM 369  C CA . PRO B 2 155 ? -12.995 28.351  -92.396  1.00 20.00 ? 369  PRO B CA 1 
ATOM 370  C CA . GLN B 2 156 ? -16.464 27.724  -90.831  1.00 20.00 ? 370  GLN B CA 1 
ATOM 371  C CA . GLU B 2 157 ? -16.794 25.052  -93.526  1.00 20.00 ? 371  GLU B CA 1 
ATOM 372  C CA . PRO B 2 158 ? -18.899 22.075  -94.667  1.00 20.00 ? 372  PRO B CA 1 
ATOM 373  C CA . LEU B 2 159 ? -17.362 19.553  -92.173  1.00 20.00 ? 373  LEU B CA 1 
ATOM 374  C CA . SER B 2 160 ? -18.315 16.124  -93.609  1.00 20.00 ? 374  SER B CA 1 
ATOM 375  C CA . VAL B 2 161 ? -17.813 13.437  -90.913  1.00 20.00 ? 375  VAL B CA 1 
ATOM 376  C CA . THR B 2 162 ? -18.463 9.690   -91.472  1.00 20.00 ? 376  THR B CA 1 
ATOM 377  C CA . TRP B 2 163 ? -17.773 6.990   -88.827  1.00 20.00 ? 377  TRP B CA 1 
ATOM 378  C CA . SER B 2 164 ? -16.848 3.415   -89.927  1.00 20.00 ? 378  SER B CA 1 
ATOM 379  C CA . GLU B 2 165 ? -19.717 1.508   -88.156  1.00 20.00 ? 379  GLU B CA 1 
ATOM 380  C CA . SER B 2 166 ? -23.461 1.981   -88.937  1.00 20.00 ? 380  SER B CA 1 
ATOM 381  C CA . GLY B 2 167 ? -26.710 0.112   -88.042  1.00 20.00 ? 381  GLY B CA 1 
ATOM 382  C CA . GLN B 2 168 ? -30.019 0.535   -86.121  1.00 20.00 ? 382  GLN B CA 1 
ATOM 383  C CA . ASN B 2 169 ? -29.105 1.079   -82.406  1.00 20.00 ? 383  ASN B CA 1 
ATOM 384  C CA . VAL B 2 170 ? -26.147 3.432   -83.255  1.00 20.00 ? 384  VAL B CA 1 
ATOM 385  C CA . THR B 2 171 ? -26.599 7.244   -83.453  1.00 20.00 ? 385  THR B CA 1 
ATOM 386  C CA . ALA B 2 172 ? -24.134 9.877   -84.792  1.00 20.00 ? 386  ALA B CA 1 
ATOM 387  C CA . ARG B 2 173 ? -24.609 13.672  -84.256  1.00 20.00 ? 387  ARG B CA 1 
ATOM 388  C CA . ASN B 2 174 ? -22.657 16.469  -86.057  1.00 20.00 ? 388  ASN B CA 1 
ATOM 389  C CA . PHE B 2 175 ? -22.279 19.332  -83.510  1.00 20.00 ? 389  PHE B CA 1 
ATOM 390  C CA . PRO B 2 176 ? -22.622 22.922  -84.929  1.00 20.00 ? 390  PRO B CA 1 
ATOM 391  C CA . PRO B 2 177 ? -19.675 25.401  -85.340  1.00 20.00 ? 391  PRO B CA 1 
ATOM 392  C CA . SER B 2 178 ? -18.869 27.595  -82.290  1.00 20.00 ? 392  SER B CA 1 
ATOM 393  C CA . GLN B 2 179 ? -16.764 30.837  -82.140  1.00 20.00 ? 393  GLN B CA 1 
ATOM 394  C CA . ASP B 2 180 ? -14.627 31.726  -79.069  1.00 20.00 ? 394  ASP B CA 1 
ATOM 395  C CA . ALA B 2 181 ? -13.386 35.388  -78.845  1.00 20.00 ? 395  ALA B CA 1 
ATOM 396  C CA . SER B 2 182 ? -14.051 37.633  -81.929  1.00 20.00 ? 396  SER B CA 1 
ATOM 397  C CA . GLY B 2 183 ? -13.495 35.077  -84.746  1.00 20.00 ? 397  GLY B CA 1 
ATOM 398  C CA . ASP B 2 184 ? -9.942  33.814  -83.884  1.00 20.00 ? 398  ASP B CA 1 
ATOM 399  C CA . LEU B 2 185 ? -10.837 30.078  -84.337  1.00 20.00 ? 399  LEU B CA 1 
ATOM 400  C CA . TYR B 2 186 ? -13.786 27.635  -84.736  1.00 20.00 ? 400  TYR B CA 1 
ATOM 401  C CA . THR B 2 187 ? -14.275 24.250  -82.983  1.00 20.00 ? 401  THR B CA 1 
ATOM 402  C CA . THR B 2 188 ? -16.547 21.204  -83.657  1.00 20.00 ? 402  THR B CA 1 
ATOM 403  C CA . SER B 2 189 ? -17.054 17.596  -82.501  1.00 20.00 ? 403  SER B CA 1 
ATOM 404  C CA . SER B 2 190 ? -18.468 14.285  -83.790  1.00 20.00 ? 404  SER B CA 1 
ATOM 405  C CA . GLN B 2 191 ? -20.076 11.763  -81.361  1.00 20.00 ? 405  GLN B CA 1 
ATOM 406  C CA . LEU B 2 192 ? -21.209 8.122   -81.813  1.00 20.00 ? 406  LEU B CA 1 
ATOM 407  C CA . THR B 2 193 ? -23.432 6.582   -79.096  1.00 20.00 ? 407  THR B CA 1 
ATOM 408  C CA . LEU B 2 194 ? -23.445 2.768   -79.552  1.00 20.00 ? 408  LEU B CA 1 
ATOM 409  C CA . PRO B 2 195 ? -24.539 -0.265  -77.426  1.00 20.00 ? 409  PRO B CA 1 
ATOM 410  C CA . ALA B 2 196 ? -21.756 -2.063  -75.456  1.00 20.00 ? 410  ALA B CA 1 
ATOM 411  C CA . THR B 2 197 ? -22.450 -5.296  -77.463  1.00 20.00 ? 411  THR B CA 1 
ATOM 412  C CA . GLN B 2 198 ? -21.100 -3.514  -80.650  1.00 20.00 ? 412  GLN B CA 1 
ATOM 413  C CA . CYS B 2 199 ? -17.551 -2.238  -79.750  1.00 20.00 ? 413  CYS B CA 1 
ATOM 414  C CA . PRO B 2 200 ? -15.570 -5.589  -79.224  1.00 20.00 ? 414  PRO B CA 1 
ATOM 415  C CA . ASP B 2 201 ? -12.803 -5.909  -76.519  1.00 20.00 ? 415  ASP B CA 1 
ATOM 416  C CA . GLY B 2 202 ? -9.496  -5.061  -78.310  1.00 20.00 ? 416  GLY B CA 1 
ATOM 417  C CA . LYS B 2 203 ? -10.641 -2.971  -81.369  1.00 20.00 ? 417  LYS B CA 1 
ATOM 418  C CA . SER B 2 204 ? -11.516 0.702   -82.173  1.00 20.00 ? 418  SER B CA 1 
ATOM 419  C CA . VAL B 2 205 ? -13.794 2.824   -84.430  1.00 20.00 ? 419  VAL B CA 1 
ATOM 420  C CA . THR B 2 206 ? -12.348 5.333   -86.977  1.00 20.00 ? 420  THR B CA 1 
ATOM 421  C CA . CYS B 2 207 ? -13.837 8.871   -87.457  1.00 20.00 ? 421  CYS B CA 1 
ATOM 422  C CA . HIS B 2 208 ? -13.140 10.404  -90.927  1.00 20.00 ? 422  HIS B CA 1 
ATOM 423  C CA . VAL B 2 209 ? -13.267 14.260  -90.901  1.00 20.00 ? 423  VAL B CA 1 
ATOM 424  C CA . LYS B 2 210 ? -13.212 16.168  -94.251  1.00 20.00 ? 424  LYS B CA 1 
ATOM 425  C CA . HIS B 2 211 ? -12.873 20.005  -94.423  1.00 20.00 ? 425  HIS B CA 1 
ATOM 426  C CA . TYR B 2 212 ? -12.939 21.374  -98.039  1.00 20.00 ? 426  TYR B CA 1 
ATOM 427  C CA . THR B 2 213 ? -11.398 19.055  -100.735 1.00 20.00 ? 427  THR B CA 1 
ATOM 428  C CA . ASN B 2 214 ? -8.381  18.717  -98.346  1.00 20.00 ? 428  ASN B CA 1 
ATOM 429  C CA . PRO B 2 215 ? -7.222  15.099  -97.633  1.00 20.00 ? 429  PRO B CA 1 
ATOM 430  C CA . SER B 2 216 ? -9.565  13.243  -95.207  1.00 20.00 ? 430  SER B CA 1 
ATOM 431  C CA . GLN B 2 217 ? -7.958  13.070  -91.709  1.00 20.00 ? 431  GLN B CA 1 
ATOM 432  C CA . ASP B 2 218 ? -8.617  9.559   -90.268  1.00 20.00 ? 432  ASP B CA 1 
ATOM 433  C CA . VAL B 2 219 ? -8.284  8.954   -86.466  1.00 20.00 ? 433  VAL B CA 1 
ATOM 434  C CA . THR B 2 220 ? -8.432  5.590   -84.611  1.00 20.00 ? 434  THR B CA 1 
ATOM 435  C CA . VAL B 2 221 ? -10.944 6.097   -81.702  1.00 20.00 ? 435  VAL B CA 1 
ATOM 436  C CA . PRO B 2 222 ? -10.741 3.422   -78.880  1.00 20.00 ? 436  PRO B CA 1 
ATOM 437  C CA . CYS B 2 223 ? -13.152 1.694   -76.425  1.00 20.00 ? 437  CYS B CA 1 
ATOM 438  C CA . PRO B 2 224 ? -10.884 -1.371  -75.288  1.00 20.00 ? 438  PRO B CA 1 
ATOM 439  C CA . VAL B 2 225 ? -10.342 -2.652  -71.774  1.00 20.00 ? 439  VAL B CA 1 
ATOM 440  C CA . PRO B 2 226 ? -6.427  -2.352  -71.596  1.00 20.00 ? 440  PRO B CA 1 
ATOM 441  C CA . PRO B 2 227 ? -3.934  -5.053  -72.998  1.00 20.00 ? 441  PRO B CA 1 
ATOM 442  C CA . PRO B 2 228 ? -1.303  -4.801  -70.004  1.00 20.00 ? 442  PRO B CA 1 
ATOM 443  C CA . PRO B 2 229 ? 0.146   -7.495  -67.479  1.00 20.00 ? 443  PRO B CA 1 
ATOM 444  C CA . PRO B 2 230 ? -1.663  -8.962  -64.279  1.00 20.00 ? 444  PRO B CA 1 
ATOM 445  C CA . CYS B 2 231 ? -3.117  -7.210  -61.229  1.00 20.00 ? 445  CYS B CA 1 
ATOM 446  C CA . CYS B 2 232 ? -4.575  -3.777  -62.322  1.00 20.00 ? 446  CYS B CA 1 
ATOM 447  C CA . HIS B 2 233 ? -4.338  -5.079  -65.918  1.00 20.00 ? 447  HIS B CA 1 
ATOM 448  C CA . PRO B 2 234 ? -7.116  -7.006  -67.888  1.00 20.00 ? 448  PRO B CA 1 
ATOM 449  C CA . ARG B 2 235 ? -7.211  -10.824 -67.508  1.00 20.00 ? 449  ARG B CA 1 
ATOM 450  C CA . LEU B 2 236 ? -10.144 -13.221 -66.709  1.00 20.00 ? 450  LEU B CA 1 
ATOM 451  C CA . SER B 2 237 ? -9.511  -16.829 -65.490  1.00 20.00 ? 451  SER B CA 1 
ATOM 452  C CA . LEU B 2 238 ? -11.759 -19.646 -64.120  1.00 20.00 ? 452  LEU B CA 1 
ATOM 453  C CA . HIS B 2 239 ? -10.783 -22.017 -61.256  1.00 20.00 ? 453  HIS B CA 1 
ATOM 454  C CA . ARG B 2 240 ? -12.128 -25.593 -61.416  1.00 20.00 ? 454  ARG B CA 1 
ATOM 455  C CA . PRO B 2 241 ? -13.105 -27.172 -58.039  1.00 20.00 ? 455  PRO B CA 1 
ATOM 456  C CA . ALA B 2 242 ? -10.826 -29.784 -56.405  1.00 20.00 ? 456  ALA B CA 1 
ATOM 457  C CA . LEU B 2 243 ? -11.343 -33.522 -57.208  1.00 20.00 ? 457  LEU B CA 1 
ATOM 458  C CA . GLU B 2 244 ? -10.822 -34.866 -53.624  1.00 20.00 ? 458  GLU B CA 1 
ATOM 459  C CA . ASP B 2 245 ? -13.450 -32.440 -52.136  1.00 20.00 ? 459  ASP B CA 1 
ATOM 460  C CA . LEU B 2 246 ? -16.367 -33.016 -54.609  1.00 20.00 ? 460  LEU B CA 1 
ATOM 461  C CA . LEU B 2 247 ? -16.025 -36.881 -54.506  1.00 20.00 ? 461  LEU B CA 1 
ATOM 462  C CA . LEU B 2 248 ? -16.089 -37.337 -50.642  1.00 20.00 ? 462  LEU B CA 1 
ATOM 463  C CA . GLY B 2 249 ? -19.092 -35.114 -49.674  1.00 20.00 ? 463  GLY B CA 1 
ATOM 464  C CA . SER B 2 250 ? -20.569 -33.230 -52.706  1.00 20.00 ? 464  SER B CA 1 
ATOM 465  C CA . GLU B 2 251 ? -18.897 -29.928 -51.561  1.00 20.00 ? 465  GLU B CA 1 
ATOM 466  C CA . ALA B 2 252 ? -17.850 -28.242 -54.868  1.00 20.00 ? 466  ALA B CA 1 
ATOM 467  C CA . ASN B 2 253 ? -17.497 -24.600 -55.994  1.00 20.00 ? 467  ASN B CA 1 
ATOM 468  C CA . LEU B 2 254 ? -16.316 -22.922 -59.259  1.00 20.00 ? 468  LEU B CA 1 
ATOM 469  C CA . THR B 2 255 ? -14.558 -19.502 -58.872  1.00 20.00 ? 469  THR B CA 1 
ATOM 470  C CA . CYS B 2 256 ? -14.735 -16.710 -61.512  1.00 20.00 ? 470  CYS B CA 1 
ATOM 471  C CA . THR B 2 257 ? -11.995 -14.182 -60.602  1.00 20.00 ? 471  THR B CA 1 
ATOM 472  C CA . LEU B 2 258 ? -11.133 -11.091 -62.729  1.00 20.00 ? 472  LEU B CA 1 
ATOM 473  C CA . THR B 2 259 ? -7.461  -10.504 -61.670  1.00 20.00 ? 473  THR B CA 1 
ATOM 474  C CA . GLY B 2 260 ? -6.929  -7.400  -63.899  1.00 20.00 ? 474  GLY B CA 1 
ATOM 475  C CA . LEU B 2 261 ? -8.846  -4.049  -63.838  1.00 20.00 ? 475  LEU B CA 1 
ATOM 476  C CA . ARG B 2 262 ? -8.098  -0.321  -63.212  1.00 20.00 ? 476  ARG B CA 1 
ATOM 477  C CA . ASP B 2 263 ? -10.151 1.835   -60.717  1.00 20.00 ? 477  ASP B CA 1 
ATOM 478  C CA . ALA B 2 264 ? -13.625 0.224   -61.065  1.00 20.00 ? 478  ALA B CA 1 
ATOM 479  C CA . SER B 2 265 ? -17.317 1.337   -61.499  1.00 20.00 ? 479  SER B CA 1 
ATOM 480  C CA . GLY B 2 266 ? -18.522 -2.089  -60.140  1.00 20.00 ? 480  GLY B CA 1 
ATOM 481  C CA . ALA B 2 267 ? -18.635 -5.247  -62.369  1.00 20.00 ? 481  ALA B CA 1 
ATOM 482  C CA . THR B 2 268 ? -21.736 -7.597  -62.461  1.00 20.00 ? 482  THR B CA 1 
ATOM 483  C CA . PHE B 2 269 ? -22.203 -11.421 -62.884  1.00 20.00 ? 483  PHE B CA 1 
ATOM 484  C CA . THR B 2 270 ? -24.572 -13.662 -64.953  1.00 20.00 ? 484  THR B CA 1 
ATOM 485  C CA . TRP B 2 271 ? -24.078 -17.256 -63.675  1.00 20.00 ? 485  TRP B CA 1 
ATOM 486  C CA . THR B 2 272 ? -25.986 -20.187 -65.236  1.00 20.00 ? 486  THR B CA 1 
ATOM 487  C CA . PRO B 2 273 ? -27.924 -22.660 -62.978  1.00 20.00 ? 487  PRO B CA 1 
ATOM 488  C CA . SER B 2 274 ? -26.905 -26.354 -62.618  1.00 20.00 ? 488  SER B CA 1 
ATOM 489  C CA . SER B 2 275 ? -28.912 -29.536 -63.506  1.00 20.00 ? 489  SER B CA 1 
ATOM 490  C CA . GLY B 2 276 ? -30.804 -29.119 -60.151  1.00 20.00 ? 490  GLY B CA 1 
ATOM 491  C CA . LYS B 2 277 ? -31.920 -25.530 -61.104  1.00 20.00 ? 491  LYS B CA 1 
ATOM 492  C CA . SER B 2 278 ? -29.893 -23.642 -58.408  1.00 20.00 ? 492  SER B CA 1 
ATOM 493  C CA . ALA B 2 279 ? -27.892 -20.371 -58.747  1.00 20.00 ? 493  ALA B CA 1 
ATOM 494  C CA . VAL B 2 280 ? -26.172 -18.852 -55.642  1.00 20.00 ? 494  VAL B CA 1 
ATOM 495  C CA . GLN B 2 281 ? -23.479 -16.114 -55.736  1.00 20.00 ? 495  GLN B CA 1 
ATOM 496  C CA . GLY B 2 282 ? -21.955 -13.332 -53.564  1.00 20.00 ? 496  GLY B CA 1 
ATOM 497  C CA . PRO B 2 283 ? -19.017 -11.445 -55.207  1.00 20.00 ? 497  PRO B CA 1 
ATOM 498  C CA . PRO B 2 284 ? -17.150 -9.163  -52.688  1.00 20.00 ? 498  PRO B CA 1 
ATOM 499  C CA . GLU B 2 285 ? -14.525 -6.432  -53.353  1.00 20.00 ? 499  GLU B CA 1 
ATOM 500  C CA . ARG B 2 286 ? -10.908 -7.051  -52.090  1.00 20.00 ? 500  ARG B CA 1 
ATOM 501  C CA . ASP B 2 287 ? -7.897  -4.691  -52.582  1.00 20.00 ? 501  ASP B CA 1 
ATOM 502  C CA . LEU B 2 288 ? -4.958  -6.393  -54.444  1.00 20.00 ? 502  LEU B CA 1 
ATOM 503  C CA . CYS B 2 289 ? -1.846  -4.286  -55.426  1.00 20.00 ? 503  CYS B CA 1 
ATOM 504  C CA . GLY B 2 290 ? -3.928  -1.087  -54.752  1.00 20.00 ? 504  GLY B CA 1 
ATOM 505  C CA . CYS B 2 291 ? -6.682  -2.196  -57.225  1.00 20.00 ? 505  CYS B CA 1 
ATOM 506  C CA . TYR B 2 292 ? -10.275 -3.442  -56.401  1.00 20.00 ? 506  TYR B CA 1 
ATOM 507  C CA . SER B 2 293 ? -11.079 -7.157  -57.179  1.00 20.00 ? 507  SER B CA 1 
ATOM 508  C CA . VAL B 2 294 ? -14.472 -8.846  -58.009  1.00 20.00 ? 508  VAL B CA 1 
ATOM 509  C CA . SER B 2 295 ? -14.445 -12.683 -57.471  1.00 20.00 ? 509  SER B CA 1 
ATOM 510  C CA . SER B 2 296 ? -17.681 -14.782 -57.432  1.00 20.00 ? 510  SER B CA 1 
ATOM 511  C CA . VAL B 2 297 ? -18.102 -18.445 -56.362  1.00 20.00 ? 511  VAL B CA 1 
ATOM 512  C CA . LEU B 2 298 ? -20.983 -20.686 -57.621  1.00 20.00 ? 512  LEU B CA 1 
ATOM 513  C CA . PRO B 2 299 ? -21.512 -23.702 -55.223  1.00 20.00 ? 513  PRO B CA 1 
ATOM 514  C CA . GLY B 2 300 ? -22.402 -26.767 -57.405  1.00 20.00 ? 514  GLY B CA 1 
ATOM 515  C CA . CYS B 2 301 ? -23.378 -30.422 -56.740  1.00 20.00 ? 515  CYS B CA 1 
ATOM 516  C CA . ALA B 2 302 ? -21.431 -33.625 -57.736  1.00 20.00 ? 516  ALA B CA 1 
ATOM 517  C CA . GLN B 2 303 ? -24.054 -34.988 -60.257  1.00 20.00 ? 517  GLN B CA 1 
ATOM 518  C CA . PRO B 2 304 ? -23.807 -32.031 -62.792  1.00 20.00 ? 518  PRO B CA 1 
ATOM 519  C CA . TRP B 2 305 ? -19.961 -32.351 -62.770  1.00 20.00 ? 519  TRP B CA 1 
ATOM 520  C CA . ASN B 2 306 ? -20.136 -36.182 -63.184  1.00 20.00 ? 520  ASN B CA 1 
ATOM 521  C CA . HIS B 2 307 ? -22.749 -35.951 -66.011  1.00 20.00 ? 521  HIS B CA 1 
ATOM 522  C CA . GLY B 2 308 ? -21.045 -32.881 -67.655  1.00 20.00 ? 522  GLY B CA 1 
ATOM 523  C CA . GLU B 2 309 ? -22.959 -29.548 -67.442  1.00 20.00 ? 523  GLU B CA 1 
ATOM 524  C CA . THR B 2 310 ? -21.759 -26.261 -69.066  1.00 20.00 ? 524  THR B CA 1 
ATOM 525  C CA . PHE B 2 311 ? -20.681 -23.819 -66.292  1.00 20.00 ? 525  PHE B CA 1 
ATOM 526  C CA . THR B 2 312 ? -20.402 -20.345 -67.914  1.00 20.00 ? 526  THR B CA 1 
ATOM 527  C CA . CYS B 2 313 ? -19.550 -16.976 -66.266  1.00 20.00 ? 527  CYS B CA 1 
ATOM 528  C CA . THR B 2 314 ? -20.184 -13.595 -68.014  1.00 20.00 ? 528  THR B CA 1 
ATOM 529  C CA . ALA B 2 315 ? -18.730 -10.375 -66.473  1.00 20.00 ? 529  ALA B CA 1 
ATOM 530  C CA . ALA B 2 316 ? -20.021 -7.187  -68.200  1.00 20.00 ? 530  ALA B CA 1 
ATOM 531  C CA . HIS B 2 317 ? -18.679 -3.627  -67.639  1.00 20.00 ? 531  HIS B CA 1 
ATOM 532  C CA . PRO B 2 318 ? -18.929 -0.149  -69.376  1.00 20.00 ? 532  PRO B CA 1 
ATOM 533  C CA . GLU B 2 319 ? -15.290 -0.234  -70.708  1.00 20.00 ? 533  GLU B CA 1 
ATOM 534  C CA . LEU B 2 320 ? -15.382 -4.070  -70.880  1.00 20.00 ? 534  LEU B CA 1 
ATOM 535  C CA . LYS B 2 321 ? -17.976 -3.320  -73.652  1.00 20.00 ? 535  LYS B CA 1 
ATOM 536  C CA . THR B 2 322 ? -17.818 -6.961  -74.910  1.00 20.00 ? 536  THR B CA 1 
ATOM 537  C CA . PRO B 2 323 ? -18.940 -9.142  -71.947  1.00 20.00 ? 537  PRO B CA 1 
ATOM 538  C CA . LEU B 2 324 ? -16.200 -11.825 -71.654  1.00 20.00 ? 538  LEU B CA 1 
ATOM 539  C CA . THR B 2 325 ? -17.805 -15.303 -71.833  1.00 20.00 ? 539  THR B CA 1 
ATOM 540  C CA . ALA B 2 326 ? -15.945 -18.265 -70.243  1.00 20.00 ? 540  ALA B CA 1 
ATOM 541  C CA . ASN B 2 327 ? -17.206 -21.908 -70.246  1.00 20.00 ? 541  ASN B CA 1 
ATOM 542  C CA . ILE B 2 328 ? -15.628 -24.971 -68.549  1.00 20.00 ? 542  ILE B CA 1 
ATOM 543  C CA . THR B 2 329 ? -16.695 -28.675 -68.655  1.00 20.00 ? 543  THR B CA 1 
ATOM 544  C CA . LYS B 2 330 ? -15.030 -32.105 -68.314  1.00 20.00 ? 544  LYS B CA 1 
ATOM 545  C CA . SER B 2 331 ? -12.760 -33.453 -71.130  1.00 20.00 ? 545  SER B CA 1 
ATOM 546  C CA . GLY B 2 332 ? -12.635 -36.390 -73.596  1.00 20.00 ? 546  GLY B CA 1 
ATOM 547  C CA . ASN B 2 333 ? -15.087 -39.222 -74.349  1.00 20.00 ? 547  ASN B CA 1 
ATOM 548  C CA . THR B 2 334 ? -15.861 -42.316 -72.209  1.00 20.00 ? 548  THR B CA 1 
ATOM 549  C CA . PHE B 2 335 ? -13.586 -45.427 -72.126  1.00 20.00 ? 549  PHE B CA 1 
ATOM 550  C CA . ARG B 2 336 ? -14.352 -48.638 -70.140  1.00 20.00 ? 550  ARG B CA 1 
ATOM 551  C CA . PRO B 2 337 ? -11.667 -49.395 -67.445  1.00 20.00 ? 551  PRO B CA 1 
ATOM 552  C CA . GLU B 2 338 ? -9.926  -52.823 -67.565  1.00 20.00 ? 552  GLU B CA 1 
ATOM 553  C CA . VAL B 2 339 ? -9.065  -53.941 -63.984  1.00 20.00 ? 553  VAL B CA 1 
ATOM 554  C CA . HIS B 2 340 ? -6.165  -56.404 -63.538  1.00 20.00 ? 554  HIS B CA 1 
ATOM 555  C CA . LEU B 2 341 ? -5.448  -57.693 -59.948  1.00 20.00 ? 555  LEU B CA 1 
ATOM 556  C CA . LEU B 2 342 ? -1.742  -58.669 -59.637  1.00 20.00 ? 556  LEU B CA 1 
ATOM 557  C CA . PRO B 2 343 ? -0.460  -61.193 -57.032  1.00 20.00 ? 557  PRO B CA 1 
ATOM 558  C CA . PRO B 2 344 ? 2.699   -60.572 -54.883  1.00 20.00 ? 558  PRO B CA 1 
ATOM 559  C CA . PRO B 2 345 ? 6.032   -61.672 -56.547  1.00 20.00 ? 559  PRO B CA 1 
ATOM 560  C CA . SER B 2 346 ? 8.217   -64.616 -55.385  1.00 20.00 ? 560  SER B CA 1 
ATOM 561  C CA . GLU B 2 347 ? 10.989  -62.451 -53.764  1.00 20.00 ? 561  GLU B CA 1 
ATOM 562  C CA . GLU B 2 348 ? 8.395   -60.364 -51.760  1.00 20.00 ? 562  GLU B CA 1 
ATOM 563  C CA . LEU B 2 349 ? 7.310   -63.489 -49.764  1.00 20.00 ? 563  LEU B CA 1 
ATOM 564  C CA . ALA B 2 350 ? 10.699  -63.118 -47.909  1.00 20.00 ? 564  ALA B CA 1 
ATOM 565  C CA . LEU B 2 351 ? 9.375   -60.053 -45.910  1.00 20.00 ? 565  LEU B CA 1 
ATOM 566  C CA . ASN B 2 352 ? 7.052   -60.208 -42.806  1.00 20.00 ? 566  ASN B CA 1 
ATOM 567  C CA . GLU B 2 353 ? 4.970   -57.107 -41.839  1.00 20.00 ? 567  GLU B CA 1 
ATOM 568  C CA . LEU B 2 354 ? 3.810   -55.959 -45.367  1.00 20.00 ? 568  LEU B CA 1 
ATOM 569  C CA . VAL B 2 355 ? 2.649   -57.573 -48.676  1.00 20.00 ? 569  VAL B CA 1 
ATOM 570  C CA . THR B 2 356 ? 1.760   -55.417 -51.758  1.00 20.00 ? 570  THR B CA 1 
ATOM 571  C CA . LEU B 2 357 ? -1.464  -56.324 -53.652  1.00 20.00 ? 571  LEU B CA 1 
ATOM 572  C CA . THR B 2 358 ? -1.383  -54.400 -56.973  1.00 20.00 ? 572  THR B CA 1 
ATOM 573  C CA . CYS B 2 359 ? -4.658  -53.940 -58.973  1.00 20.00 ? 573  CYS B CA 1 
ATOM 574  C CA . LEU B 2 360 ? -4.000  -52.016 -62.215  1.00 20.00 ? 574  LEU B CA 1 
ATOM 575  C CA . ALA B 2 361 ? -6.966  -50.395 -64.030  1.00 20.00 ? 575  ALA B CA 1 
ATOM 576  C CA . ARG B 2 362 ? -5.974  -49.032 -67.480  1.00 20.00 ? 576  ARG B CA 1 
ATOM 577  C CA . GLY B 2 363 ? -7.884  -48.033 -70.659  1.00 20.00 ? 577  GLY B CA 1 
ATOM 578  C CA . PHE B 2 364 ? -10.188 -45.337 -69.136  1.00 20.00 ? 578  PHE B CA 1 
ATOM 579  C CA . SER B 2 365 ? -11.205 -41.699 -69.746  1.00 20.00 ? 579  SER B CA 1 
ATOM 580  C CA . PRO B 2 366 ? -11.741 -39.217 -68.176  1.00 20.00 ? 580  PRO B CA 1 
ATOM 581  C CA . LYS B 2 367 ? -9.178  -39.463 -65.301  1.00 20.00 ? 581  LYS B CA 1 
ATOM 582  C CA . ASP B 2 368 ? -12.025 -39.296 -62.660  1.00 20.00 ? 582  ASP B CA 1 
ATOM 583  C CA . VAL B 2 369 ? -11.963 -42.780 -61.013  1.00 20.00 ? 583  VAL B CA 1 
ATOM 584  C CA . LEU B 2 370 ? -12.570 -43.815 -57.358  1.00 20.00 ? 584  LEU B CA 1 
ATOM 585  C CA . VAL B 2 371 ? -10.588 -46.933 -56.270  1.00 20.00 ? 585  VAL B CA 1 
ATOM 586  C CA . ARG B 2 372 ? -11.160 -48.715 -52.904  1.00 20.00 ? 586  ARG B CA 1 
ATOM 587  C CA . TRP B 2 373 ? -10.292 -52.053 -51.205  1.00 20.00 ? 587  TRP B CA 1 
ATOM 588  C CA . LEU B 2 374 ? -12.238 -54.570 -49.059  1.00 20.00 ? 588  LEU B CA 1 
ATOM 589  C CA . GLN B 2 375 ? -11.614 -57.508 -46.677  1.00 20.00 ? 589  GLN B CA 1 
ATOM 590  C CA . GLY B 2 376 ? -13.119 -60.988 -47.426  1.00 20.00 ? 590  GLY B CA 1 
ATOM 591  C CA . SER B 2 377 ? -13.175 -62.507 -43.876  1.00 20.00 ? 591  SER B CA 1 
ATOM 592  C CA . GLN B 2 378 ? -14.164 -59.498 -41.696  1.00 20.00 ? 592  GLN B CA 1 
ATOM 593  C CA . GLU B 2 379 ? -16.383 -58.147 -44.614  1.00 20.00 ? 593  GLU B CA 1 
ATOM 594  C CA . LEU B 2 380 ? -15.104 -54.577 -43.785  1.00 20.00 ? 594  LEU B CA 1 
ATOM 595  C CA . PRO B 2 381 ? -13.228 -52.047 -46.017  1.00 20.00 ? 595  PRO B CA 1 
ATOM 596  C CA . ARG B 2 382 ? -9.403  -51.848 -45.788  1.00 20.00 ? 596  ARG B CA 1 
ATOM 597  C CA . GLU B 2 383 ? -7.359  -48.887 -44.384  1.00 20.00 ? 597  GLU B CA 1 
ATOM 598  C CA . LYS B 2 384 ? -3.719  -49.178 -45.681  1.00 20.00 ? 598  LYS B CA 1 
ATOM 599  C CA . TYR B 2 385 ? -3.699  -48.398 -49.455  1.00 20.00 ? 599  TYR B CA 1 
ATOM 600  C CA . LEU B 2 386 ? -2.493  -45.681 -51.903  1.00 20.00 ? 600  LEU B CA 1 
ATOM 601  C CA . THR B 2 387 ? -3.463  -44.235 -55.312  1.00 20.00 ? 601  THR B CA 1 
ATOM 602  C CA . TRP B 2 388 ? -1.218  -43.003 -58.178  1.00 20.00 ? 602  TRP B CA 1 
ATOM 603  C CA . ALA B 2 389 ? -1.903  -40.581 -61.084  1.00 20.00 ? 603  ALA B CA 1 
ATOM 604  C CA . SER B 2 390 ? -0.232  -39.618 -64.430  1.00 20.00 ? 604  SER B CA 1 
ATOM 605  C CA . ARG B 2 391 ? -1.638  -38.712 -67.922  1.00 20.00 ? 605  ARG B CA 1 
ATOM 606  C CA . GLN B 2 392 ? -0.509  -40.459 -71.175  1.00 20.00 ? 606  GLN B CA 1 
ATOM 607  C CA . GLU B 2 393 ? -0.095  -37.625 -73.770  1.00 20.00 ? 607  GLU B CA 1 
ATOM 608  C CA . PRO B 2 394 ? 2.327   -38.827 -76.541  1.00 20.00 ? 608  PRO B CA 1 
ATOM 609  C CA . SER B 2 395 ? 2.939   -37.174 -79.978  1.00 20.00 ? 609  SER B CA 1 
ATOM 610  C CA . GLN B 2 396 ? 0.495   -39.585 -81.789  1.00 20.00 ? 610  GLN B CA 1 
ATOM 611  C CA . GLY B 2 397 ? -3.377  -39.700 -81.611  1.00 20.00 ? 611  GLY B CA 1 
ATOM 612  C CA . THR B 2 398 ? -3.776  -42.078 -78.605  1.00 20.00 ? 612  THR B CA 1 
ATOM 613  C CA . THR B 2 399 ? -4.819  -40.855 -75.091  1.00 20.00 ? 613  THR B CA 1 
ATOM 614  C CA . THR B 2 400 ? -5.784  -43.186 -72.178  1.00 20.00 ? 614  THR B CA 1 
ATOM 615  C CA . PHE B 2 401 ? -5.572  -42.780 -68.364  1.00 20.00 ? 615  PHE B CA 1 
ATOM 616  C CA . ALA B 2 402 ? -4.441  -45.711 -66.178  1.00 20.00 ? 616  ALA B CA 1 
ATOM 617  C CA . VAL B 2 403 ? -4.060  -46.202 -62.391  1.00 20.00 ? 617  VAL B CA 1 
ATOM 618  C CA . THR B 2 404 ? -2.271  -48.453 -59.877  1.00 20.00 ? 618  THR B CA 1 
ATOM 619  C CA . SER B 2 405 ? -3.508  -49.430 -56.352  1.00 20.00 ? 619  SER B CA 1 
ATOM 620  C CA . ILE B 2 406 ? -1.280  -50.932 -53.573  1.00 20.00 ? 620  ILE B CA 1 
ATOM 621  C CA . LEU B 2 407 ? -2.902  -52.734 -50.578  1.00 20.00 ? 621  LEU B CA 1 
ATOM 622  C CA . ARG B 2 408 ? -0.272  -53.591 -47.894  1.00 20.00 ? 622  ARG B CA 1 
ATOM 623  C CA . VAL B 2 409 ? -1.533  -56.515 -45.692  1.00 20.00 ? 623  VAL B CA 1 
ATOM 624  C CA . ALA B 2 410 ? 0.335   -59.051 -43.480  1.00 20.00 ? 624  ALA B CA 1 
ATOM 625  C CA . ALA B 2 411 ? 2.423   -62.045 -44.714  1.00 20.00 ? 625  ALA B CA 1 
ATOM 626  C CA . GLU B 2 412 ? 0.644   -64.626 -42.489  1.00 20.00 ? 626  GLU B CA 1 
ATOM 627  C CA . ASP B 2 413 ? -2.891  -63.461 -43.601  1.00 20.00 ? 627  ASP B CA 1 
ATOM 628  C CA . TRP B 2 414 ? -2.136  -63.767 -47.384  1.00 20.00 ? 628  TRP B CA 1 
ATOM 629  C CA . LYS B 2 415 ? -1.341  -67.519 -46.825  1.00 20.00 ? 629  LYS B CA 1 
ATOM 630  C CA . LYS B 2 416 ? -4.522  -68.301 -44.741  1.00 20.00 ? 630  LYS B CA 1 
ATOM 631  C CA . GLY B 2 417 ? -6.773  -68.152 -47.889  1.00 20.00 ? 631  GLY B CA 1 
ATOM 632  C CA . ASP B 2 418 ? -8.497  -64.732 -47.546  1.00 20.00 ? 632  ASP B CA 1 
ATOM 633  C CA . THR B 2 419 ? -9.916  -63.012 -50.677  1.00 20.00 ? 633  THR B CA 1 
ATOM 634  C CA . PHE B 2 420 ? -9.193  -59.256 -51.302  1.00 20.00 ? 634  PHE B CA 1 
ATOM 635  C CA . SER B 2 421 ? -11.474 -57.049 -53.502  1.00 20.00 ? 635  SER B CA 1 
ATOM 636  C CA . CYS B 2 422 ? -10.351 -54.031 -55.614  1.00 20.00 ? 636  CYS B CA 1 
ATOM 637  C CA . MET B 2 423 ? -13.514 -52.025 -56.414  1.00 20.00 ? 637  MET B CA 1 
ATOM 638  C CA . VAL B 2 424 ? -13.178 -49.426 -59.218  1.00 20.00 ? 638  VAL B CA 1 
ATOM 639  C CA . GLY B 2 425 ? -15.852 -46.745 -59.994  1.00 20.00 ? 639  GLY B CA 1 
ATOM 640  C CA . HIS B 2 426 ? -15.969 -44.896 -63.373  1.00 20.00 ? 640  HIS B CA 1 
ATOM 641  C CA . GLU B 2 427 ? -18.748 -43.545 -65.688  1.00 20.00 ? 641  GLU B CA 1 
ATOM 642  C CA . ALA B 2 428 ? -18.143 -45.961 -68.655  1.00 20.00 ? 642  ALA B CA 1 
ATOM 643  C CA . LEU B 2 429 ? -18.692 -48.995 -66.316  1.00 20.00 ? 643  LEU B CA 1 
ATOM 644  C CA . PRO B 2 430 ? -21.902 -51.139 -66.608  1.00 20.00 ? 644  PRO B CA 1 
ATOM 645  C CA . LEU B 2 431 ? -23.368 -50.003 -63.213  1.00 20.00 ? 645  LEU B CA 1 
ATOM 646  C CA . ALA B 2 432 ? -20.794 -47.215 -62.491  1.00 20.00 ? 646  ALA B CA 1 
ATOM 647  C CA . PHE B 2 433 ? -19.052 -49.908 -60.339  1.00 20.00 ? 647  PHE B CA 1 
ATOM 648  C CA . THR B 2 434 ? -16.832 -52.968 -61.038  1.00 20.00 ? 648  THR B CA 1 
ATOM 649  C CA . GLN B 2 435 ? -15.037 -55.360 -58.643  1.00 20.00 ? 649  GLN B CA 1 
ATOM 650  C CA . LYS B 2 436 ? -12.241 -57.913 -59.305  1.00 20.00 ? 650  LYS B CA 1 
ATOM 651  C CA . THR B 2 437 ? -10.730 -60.237 -56.625  1.00 20.00 ? 651  THR B CA 1 
ATOM 652  C CA . ILE B 2 438 ? -7.416  -61.912 -55.724  1.00 20.00 ? 652  ILE B CA 1 
ATOM 653  C CA . ASP B 2 439 ? -6.891  -65.208 -53.879  1.00 20.00 ? 653  ASP B CA 1 
ATOM 654  C CA . ARG B 2 440 ? -3.830  -67.373 -53.032  1.00 20.00 ? 654  ARG B CA 1 
ATOM 655  C CA . LEU B 2 441 ? -5.982  -70.370 -54.109  1.00 20.00 ? 655  LEU B CA 1 
ATOM 656  C CA . ALA B 2 442 ? -5.346  -70.463 -57.907  1.00 20.00 ? 656  ALA B CA 1 
ATOM 657  C CA . GLY B 2 443 ? -7.255  -73.125 -59.861  1.00 20.00 ? 657  GLY B CA 1 
ATOM 658  C CA . LYS B 2 444 ? -6.387  -73.292 -63.611  1.00 20.00 ? 658  LYS B CA 1 
ATOM 659  C CA . PRO B 2 445 ? -9.915  -73.345 -65.347  1.00 20.00 ? 659  PRO B CA 1 
ATOM 660  C CA . THR B 2 446 ? -9.516  -69.755 -66.726  1.00 20.00 ? 660  THR B CA 1 
ATOM 661  C CA . HIS B 2 447 ? -10.140 -66.786 -64.310  1.00 20.00 ? 661  HIS B CA 1 
ATOM 662  C CA . VAL B 2 448 ? -13.579 -67.272 -62.627  1.00 20.00 ? 662  VAL B CA 1 
ATOM 663  C CA . ASN B 2 449 ? -15.321 -64.650 -60.413  1.00 20.00 ? 663  ASN B CA 1 
ATOM 664  C CA . VAL B 2 450 ? -17.314 -65.229 -57.166  1.00 20.00 ? 664  VAL B CA 1 
ATOM 665  C CA . SER B 2 451 ? -21.079 -66.030 -57.019  1.00 20.00 ? 665  SER B CA 1 
ATOM 666  C CA . VAL B 2 452 ? -23.949 -63.577 -56.202  1.00 20.00 ? 666  VAL B CA 1 
ATOM 667  C CA . VAL B 2 453 ? -24.571 -62.171 -52.650  1.00 20.00 ? 667  VAL B CA 1 
ATOM 668  C CA . MET B 2 454 ? -27.870 -60.176 -52.333  1.00 20.00 ? 668  MET B CA 1 
ATOM 669  C CA . ALA B 2 455 ? -30.928 -60.204 -54.663  1.00 20.00 ? 669  ALA B CA 1 
ATOM 670  C CA . GLU B 2 456 ? -34.411 -58.579 -55.037  1.00 20.00 ? 670  GLU B CA 1 
ATOM 671  C CA . VAL B 2 457 ? -33.113 -55.439 -53.153  1.00 20.00 ? 671  VAL B CA 1 
ATOM 672  C CA . ASP B 2 458 ? -31.638 -52.733 -55.487  1.00 20.00 ? 672  ASP B CA 1 
ATOM 673  C CA . GLY B 2 459 ? -33.166 -49.705 -53.583  1.00 20.00 ? 673  GLY B CA 1 
ATOM 674  C CA . THR B 2 460 ? -36.200 -48.640 -55.728  1.00 20.00 ? 674  THR B CA 1 
ATOM 675  C CA . CYS B 2 461 ? -38.204 -51.632 -54.292  1.00 20.00 ? 675  CYS B CA 1 
ATOM 676  C CA . TYR B 2 462 ? -37.491 -51.531 -50.493  1.00 20.00 ? 676  TYR B CA 1 
ATOM 677  C CA . GLU C 1 1   ? 27.988  43.532  -3.487   1.00 20.00 ? 677  GLU C CA 1 
ATOM 678  C CA . LEU C 1 2   ? 31.510  42.378  -4.534   1.00 20.00 ? 678  LEU C CA 1 
ATOM 679  C CA . VAL C 1 3   ? 31.887  42.378  -8.378   1.00 20.00 ? 679  VAL C CA 1 
ATOM 680  C CA . MET C 1 4   ? 33.632  39.362  -10.032  1.00 20.00 ? 680  MET C CA 1 
ATOM 681  C CA . THR C 1 5   ? 34.861  39.989  -13.638  1.00 20.00 ? 681  THR C CA 1 
ATOM 682  C CA . GLN C 1 6   ? 36.144  37.030  -15.734  1.00 20.00 ? 682  GLN C CA 1 
ATOM 683  C CA . SER C 1 7   ? 37.958  37.248  -19.121  1.00 20.00 ? 683  SER C CA 1 
ATOM 684  C CA . PRO C 1 8   ? 37.830  36.503  -21.993  1.00 20.00 ? 684  PRO C CA 1 
ATOM 685  C CA . SER C 1 9   ? 34.093  36.160  -22.894  1.00 20.00 ? 685  SER C CA 1 
ATOM 686  C CA . SER C 1 10  ? 34.813  33.211  -25.287  1.00 20.00 ? 686  SER C CA 1 
ATOM 687  C CA . LEU C 1 11  ? 37.783  30.800  -25.816  1.00 20.00 ? 687  LEU C CA 1 
ATOM 688  C CA . SER C 1 12  ? 38.852  28.997  -29.054  1.00 20.00 ? 688  SER C CA 1 
ATOM 689  C CA . ALA C 1 13  ? 41.634  26.330  -28.836  1.00 20.00 ? 689  ALA C CA 1 
ATOM 690  C CA . SER C 1 14  ? 42.507  22.893  -30.322  1.00 20.00 ? 690  SER C CA 1 
ATOM 691  C CA . VAL C 1 15  ? 42.976  19.667  -28.276  1.00 20.00 ? 691  VAL C CA 1 
ATOM 692  C CA . GLY C 1 16  ? 46.297  19.983  -26.318  1.00 20.00 ? 692  GLY C CA 1 
ATOM 693  C CA . ASP C 1 17  ? 46.652  23.808  -25.921  1.00 20.00 ? 693  ASP C CA 1 
ATOM 694  C CA . ARG C 1 18  ? 46.942  25.266  -22.380  1.00 20.00 ? 694  ARG C CA 1 
ATOM 695  C CA . VAL C 1 19  ? 44.086  27.793  -21.762  1.00 20.00 ? 695  VAL C CA 1 
ATOM 696  C CA . ASN C 1 20  ? 44.179  30.522  -19.049  1.00 20.00 ? 696  ASN C CA 1 
ATOM 697  C CA . ILE C 1 21  ? 40.912  31.797  -17.441  1.00 20.00 ? 697  ILE C CA 1 
ATOM 698  C CA . ALA C 1 22  ? 41.125  34.886  -15.152  1.00 20.00 ? 698  ALA C CA 1 
ATOM 699  C CA . CYS C 1 23  ? 38.814  35.873  -12.244  1.00 20.00 ? 699  CYS C CA 1 
ATOM 700  C CA . ARG C 1 24  ? 39.484  39.339  -10.733  1.00 20.00 ? 700  ARG C CA 1 
ATOM 701  C CA . ALA C 1 25  ? 37.579  40.848  -7.753   1.00 20.00 ? 701  ALA C CA 1 
ATOM 702  C CA . SER C 1 26  ? 36.676  44.443  -6.645   1.00 20.00 ? 702  SER C CA 1 
ATOM 703  C CA . GLN C 1 27  ? 38.688  44.012  -3.374   1.00 20.00 ? 703  GLN C CA 1 
ATOM 704  C CA . GLY C 1 28  ? 40.916  41.373  -1.652   1.00 20.00 ? 704  GLY C CA 1 
ATOM 705  C CA . ILE C 1 29  ? 39.066  38.140  -0.601   1.00 20.00 ? 705  ILE C CA 1 
ATOM 706  C CA . SER C 1 30  ? 42.227  36.167  0.476    1.00 20.00 ? 706  SER C CA 1 
ATOM 707  C CA . SER C 1 31  ? 41.989  32.434  -0.560   1.00 20.00 ? 707  SER C CA 1 
ATOM 708  C CA . ALA C 1 32  ? 38.119  32.318  -0.842   1.00 20.00 ? 708  ALA C CA 1 
ATOM 709  C CA . LEU C 1 33  ? 37.299  31.424  -4.518   1.00 20.00 ? 709  LEU C CA 1 
ATOM 710  C CA . ALA C 1 34  ? 35.644  28.293  -6.070   1.00 20.00 ? 710  ALA C CA 1 
ATOM 711  C CA . TRP C 1 35  ? 35.686  27.181  -9.759   1.00 20.00 ? 711  TRP C CA 1 
ATOM 712  C CA . TYR C 1 36  ? 32.758  25.368  -11.487  1.00 20.00 ? 712  TYR C CA 1 
ATOM 713  C CA . GLN C 1 37  ? 31.967  23.338  -14.651  1.00 20.00 ? 713  GLN C CA 1 
ATOM 714  C CA . GLN C 1 38  ? 28.465  23.704  -16.193  1.00 20.00 ? 714  GLN C CA 1 
ATOM 715  C CA . LYS C 1 39  ? 27.891  21.321  -19.129  1.00 20.00 ? 715  LYS C CA 1 
ATOM 716  C CA . PRO C 1 40  ? 25.080  22.960  -21.248  1.00 20.00 ? 716  PRO C CA 1 
ATOM 717  C CA . GLY C 1 41  ? 21.696  21.676  -19.895  1.00 20.00 ? 717  GLY C CA 1 
ATOM 718  C CA . LYS C 1 42  ? 23.158  20.404  -16.563  1.00 20.00 ? 718  LYS C CA 1 
ATOM 719  C CA . ALA C 1 43  ? 23.893  21.561  -13.000  1.00 20.00 ? 719  ALA C CA 1 
ATOM 720  C CA . PRO C 1 44  ? 27.321  23.071  -12.031  1.00 20.00 ? 720  PRO C CA 1 
ATOM 721  C CA . ARG C 1 45  ? 30.142  20.780  -10.831  1.00 20.00 ? 721  ARG C CA 1 
ATOM 722  C CA . LEU C 1 46  ? 32.764  21.845  -8.228   1.00 20.00 ? 722  LEU C CA 1 
ATOM 723  C CA . LEU C 1 47  ? 36.361  21.698  -9.579   1.00 20.00 ? 723  LEU C CA 1 
ATOM 724  C CA . ILE C 1 48  ? 38.633  23.776  -7.279   1.00 20.00 ? 724  ILE C CA 1 
ATOM 725  C CA . TYR C 1 49  ? 37.576  24.916  -3.712   1.00 20.00 ? 725  TYR C CA 1 
ATOM 726  C CA . ASP C 1 50  ? 40.204  27.154  -2.005   1.00 20.00 ? 726  ASP C CA 1 
ATOM 727  C CA . ALA C 1 51  ? 42.267  28.877  -4.801   1.00 20.00 ? 727  ALA C CA 1 
ATOM 728  C CA . SER C 1 52  ? 44.459  25.668  -5.177   1.00 20.00 ? 728  SER C CA 1 
ATOM 729  C CA . ASN C 1 53  ? 42.757  22.437  -3.738   1.00 20.00 ? 729  ASN C CA 1 
ATOM 730  C CA . LEU C 1 54  ? 41.139  19.915  -6.187   1.00 20.00 ? 730  LEU C CA 1 
ATOM 731  C CA . GLU C 1 55  ? 38.058  17.758  -5.393   1.00 20.00 ? 731  GLU C CA 1 
ATOM 732  C CA . SER C 1 56  ? 38.216  13.899  -5.255   1.00 20.00 ? 732  SER C CA 1 
ATOM 733  C CA . GLY C 1 57  ? 37.426  12.668  -8.841   1.00 20.00 ? 733  GLY C CA 1 
ATOM 734  C CA . VAL C 1 58  ? 38.380  15.865  -10.736  1.00 20.00 ? 734  VAL C CA 1 
ATOM 735  C CA . PRO C 1 59  ? 41.162  15.153  -13.333  1.00 20.00 ? 735  PRO C CA 1 
ATOM 736  C CA . SER C 1 60  ? 44.843  15.886  -12.417  1.00 20.00 ? 736  SER C CA 1 
ATOM 737  C CA . ARG C 1 61  ? 45.068  18.351  -15.414  1.00 20.00 ? 737  ARG C CA 1 
ATOM 738  C CA . PHE C 1 62  ? 42.851  21.008  -13.701  1.00 20.00 ? 738  PHE C CA 1 
ATOM 739  C CA . SER C 1 63  ? 44.564  23.467  -11.277  1.00 20.00 ? 739  SER C CA 1 
ATOM 740  C CA . GLY C 1 64  ? 45.146  27.190  -10.497  1.00 20.00 ? 740  GLY C CA 1 
ATOM 741  C CA . SER C 1 65  ? 46.478  29.722  -7.964   1.00 20.00 ? 741  SER C CA 1 
ATOM 742  C CA . GLY C 1 66  ? 46.205  33.454  -6.978   1.00 20.00 ? 742  GLY C CA 1 
ATOM 743  C CA . SER C 1 67  ? 46.225  35.369  -3.651   1.00 20.00 ? 743  SER C CA 1 
ATOM 744  C CA . GLY C 1 68  ? 43.859  38.362  -3.005   1.00 20.00 ? 744  GLY C CA 1 
ATOM 745  C CA . THR C 1 69  ? 42.789  40.022  -6.319   1.00 20.00 ? 745  THR C CA 1 
ATOM 746  C CA . ASP C 1 70  ? 44.202  38.166  -9.383   1.00 20.00 ? 746  ASP C CA 1 
ATOM 747  C CA . PHE C 1 71  ? 43.103  34.513  -9.877   1.00 20.00 ? 747  PHE C CA 1 
ATOM 748  C CA . THR C 1 72  ? 43.630  31.991  -12.721  1.00 20.00 ? 748  THR C CA 1 
ATOM 749  C CA . LEU C 1 73  ? 42.212  28.599  -13.845  1.00 20.00 ? 749  LEU C CA 1 
ATOM 750  C CA . THR C 1 74  ? 44.615  26.417  -15.934  1.00 20.00 ? 750  THR C CA 1 
ATOM 751  C CA . ILE C 1 75  ? 44.201  23.248  -18.083  1.00 20.00 ? 751  ILE C CA 1 
ATOM 752  C CA . SER C 1 76  ? 47.544  21.622  -19.211  1.00 20.00 ? 752  SER C CA 1 
ATOM 753  C CA . SER C 1 77  ? 45.866  19.281  -21.815  1.00 20.00 ? 753  SER C CA 1 
ATOM 754  C CA . LEU C 1 78  ? 42.547  20.417  -23.387  1.00 20.00 ? 754  LEU C CA 1 
ATOM 755  C CA . GLN C 1 79  ? 40.244  17.415  -24.215  1.00 20.00 ? 755  GLN C CA 1 
ATOM 756  C CA . PRO C 1 80  ? 36.871  17.364  -26.157  1.00 20.00 ? 756  PRO C CA 1 
ATOM 757  C CA . GLU C 1 81  ? 35.063  16.490  -22.840  1.00 20.00 ? 757  GLU C CA 1 
ATOM 758  C CA . ASP C 1 82  ? 35.911  19.992  -21.381  1.00 20.00 ? 758  ASP C CA 1 
ATOM 759  C CA . PHE C 1 83  ? 33.058  21.809  -23.284  1.00 20.00 ? 759  PHE C CA 1 
ATOM 760  C CA . ALA C 1 84  ? 31.445  23.828  -20.422  1.00 20.00 ? 760  ALA C CA 1 
ATOM 761  C CA . ILE C 1 85  ? 30.848  27.385  -19.151  1.00 20.00 ? 761  ILE C CA 1 
ATOM 762  C CA . TYR C 1 86  ? 33.192  27.871  -16.158  1.00 20.00 ? 762  TYR C CA 1 
ATOM 763  C CA . TYR C 1 87  ? 32.308  30.189  -13.227  1.00 20.00 ? 763  TYR C CA 1 
ATOM 764  C CA . CYS C 1 88  ? 34.131  31.600  -10.154  1.00 20.00 ? 764  CYS C CA 1 
ATOM 765  C CA . GLN C 1 89  ? 32.309  32.729  -6.960   1.00 20.00 ? 765  GLN C CA 1 
ATOM 766  C CA . GLN C 1 90  ? 33.640  34.210  -3.671   1.00 20.00 ? 766  GLN C CA 1 
ATOM 767  C CA . PHE C 1 91  ? 32.845  33.296  -0.005   1.00 20.00 ? 767  PHE C CA 1 
ATOM 768  C CA . ASN C 1 92  ? 34.343  36.016  2.272    1.00 20.00 ? 768  ASN C CA 1 
ATOM 769  C CA . SER C 1 93  ? 31.217  38.238  2.768    1.00 20.00 ? 769  SER C CA 1 
ATOM 770  C CA . TYR C 1 94  ? 27.493  38.447  1.765    1.00 20.00 ? 770  TYR C CA 1 
ATOM 771  C CA . PRO C 1 95  ? 25.926  38.111  -0.675   1.00 20.00 ? 771  PRO C CA 1 
ATOM 772  C CA . LEU C 1 96  ? 27.885  35.385  -2.519   1.00 20.00 ? 772  LEU C CA 1 
ATOM 773  C CA . THR C 1 97  ? 28.452  36.500  -6.174   1.00 20.00 ? 773  THR C CA 1 
ATOM 774  C CA . PHE C 1 98  ? 29.366  34.574  -9.375   1.00 20.00 ? 774  PHE C CA 1 
ATOM 775  C CA . GLY C 1 99  ? 31.584  35.361  -12.378  1.00 20.00 ? 775  GLY C CA 1 
ATOM 776  C CA . GLY C 1 100 ? 30.347  36.348  -15.875  1.00 20.00 ? 776  GLY C CA 1 
ATOM 777  C CA . GLY C 1 101 ? 31.107  32.866  -17.337  1.00 20.00 ? 777  GLY C CA 1 
ATOM 778  C CA . THR C 1 102 ? 33.907  31.843  -19.771  1.00 20.00 ? 778  THR C CA 1 
ATOM 779  C CA . LYS C 1 103 ? 32.656  29.454  -22.528  1.00 20.00 ? 779  LYS C CA 1 
ATOM 780  C CA . VAL C 1 104 ? 35.269  27.001  -23.959  1.00 20.00 ? 780  VAL C CA 1 
ATOM 781  C CA . GLU C 1 105 ? 34.706  26.092  -27.656  1.00 20.00 ? 781  GLU C CA 1 
ATOM 782  C CA . ILE C 1 106 ? 36.848  23.178  -28.988  1.00 20.00 ? 782  ILE C CA 1 
ATOM 783  C CA . LYS C 1 107 ? 38.773  23.370  -32.317  1.00 20.00 ? 783  LYS C CA 1 
ATOM 784  C CA . ARG C 1 108 ? 39.210  20.557  -34.908  1.00 20.00 ? 784  ARG C CA 1 
ATOM 785  C CA . THR C 1 109 ? 39.184  19.940  -38.721  1.00 20.00 ? 785  THR C CA 1 
ATOM 786  C CA . VAL C 1 110 ? 36.299  20.531  -41.181  1.00 20.00 ? 786  VAL C CA 1 
ATOM 787  C CA . ALA C 1 111 ? 33.556  17.837  -41.407  1.00 20.00 ? 787  ALA C CA 1 
ATOM 788  C CA . ALA C 1 112 ? 30.999  17.336  -44.245  1.00 20.00 ? 788  ALA C CA 1 
ATOM 789  C CA . PRO C 1 113 ? 27.366  16.976  -42.923  1.00 20.00 ? 789  PRO C CA 1 
ATOM 790  C CA . SER C 1 114 ? 25.038  14.213  -44.175  1.00 20.00 ? 790  SER C CA 1 
ATOM 791  C CA . VAL C 1 115 ? 21.853  16.157  -45.100  1.00 20.00 ? 791  VAL C CA 1 
ATOM 792  C CA . PHE C 1 116 ? 18.401  14.544  -44.577  1.00 20.00 ? 792  PHE C CA 1 
ATOM 793  C CA . ILE C 1 117 ? 14.778  15.756  -44.938  1.00 20.00 ? 793  ILE C CA 1 
ATOM 794  C CA . PHE C 1 118 ? 11.417  14.822  -43.291  1.00 20.00 ? 794  PHE C CA 1 
ATOM 795  C CA . PRO C 1 119 ? 8.057   15.515  -44.988  1.00 20.00 ? 795  PRO C CA 1 
ATOM 796  C CA . PRO C 1 120 ? 4.872   15.922  -42.829  1.00 20.00 ? 796  PRO C CA 1 
ATOM 797  C CA . SER C 1 121 ? 3.290   12.730  -41.444  1.00 20.00 ? 797  SER C CA 1 
ATOM 798  C CA . ASP C 1 122 ? -0.196  11.352  -42.311  1.00 20.00 ? 798  ASP C CA 1 
ATOM 799  C CA . GLU C 1 123 ? -1.793  12.199  -38.885  1.00 20.00 ? 799  GLU C CA 1 
ATOM 800  C CA . GLN C 1 124 ? -0.218  15.747  -38.753  1.00 20.00 ? 800  GLN C CA 1 
ATOM 801  C CA . LEU C 1 125 ? -2.181  17.058  -41.801  1.00 20.00 ? 801  LEU C CA 1 
ATOM 802  C CA . LYS C 1 126 ? -5.575  16.256  -40.064  1.00 20.00 ? 802  LYS C CA 1 
ATOM 803  C CA . SER C 1 127 ? -5.448  19.401  -37.857  1.00 20.00 ? 803  SER C CA 1 
ATOM 804  C CA . GLY C 1 128 ? -4.561  21.635  -40.902  1.00 20.00 ? 804  GLY C CA 1 
ATOM 805  C CA . THR C 1 129 ? -0.747  22.130  -40.660  1.00 20.00 ? 805  THR C CA 1 
ATOM 806  C CA . ALA C 1 130 ? 2.517   20.823  -42.207  1.00 20.00 ? 806  ALA C CA 1 
ATOM 807  C CA . SER C 1 131 ? 6.201   20.885  -41.036  1.00 20.00 ? 807  SER C CA 1 
ATOM 808  C CA . VAL C 1 132 ? 9.099   19.813  -43.358  1.00 20.00 ? 808  VAL C CA 1 
ATOM 809  C CA . VAL C 1 133 ? 12.328  19.126  -41.345  1.00 20.00 ? 809  VAL C CA 1 
ATOM 810  C CA . CYS C 1 134 ? 15.861  19.194  -42.935  1.00 20.00 ? 810  CYS C CA 1 
ATOM 811  C CA . LEU C 1 135 ? 18.782  17.608  -40.972  1.00 20.00 ? 811  LEU C CA 1 
ATOM 812  C CA . LEU C 1 136 ? 22.522  18.490  -41.211  1.00 20.00 ? 812  LEU C CA 1 
ATOM 813  C CA . ASN C 1 137 ? 24.005  15.611  -39.090  1.00 20.00 ? 813  ASN C CA 1 
ATOM 814  C CA . ASN C 1 138 ? 27.685  15.972  -37.870  1.00 20.00 ? 814  ASN C CA 1 
ATOM 815  C CA . PHE C 1 139 ? 29.703  19.039  -39.037  1.00 20.00 ? 815  PHE C CA 1 
ATOM 816  C CA . TYR C 1 140 ? 32.335  21.660  -38.108  1.00 20.00 ? 816  TYR C CA 1 
ATOM 817  C CA . PRO C 1 141 ? 32.386  24.660  -37.813  1.00 20.00 ? 817  PRO C CA 1 
ATOM 818  C CA . ARG C 1 142 ? 28.813  25.751  -36.795  1.00 20.00 ? 818  ARG C CA 1 
ATOM 819  C CA . GLU C 1 143 ? 28.883  28.119  -39.871  1.00 20.00 ? 819  GLU C CA 1 
ATOM 820  C CA . ALA C 1 144 ? 26.286  26.600  -42.258  1.00 20.00 ? 820  ALA C CA 1 
ATOM 821  C CA . LYS C 1 145 ? 23.370  27.765  -44.451  1.00 20.00 ? 821  LYS C CA 1 
ATOM 822  C CA . VAL C 1 146 ? 19.971  26.231  -45.327  1.00 20.00 ? 822  VAL C CA 1 
ATOM 823  C CA . GLN C 1 147 ? 17.858  27.409  -48.309  1.00 20.00 ? 823  GLN C CA 1 
ATOM 824  C CA . TRP C 1 148 ? 14.371  25.858  -48.830  1.00 20.00 ? 824  TRP C CA 1 
ATOM 825  C CA . LYS C 1 149 ? 13.377  25.255  -52.487  1.00 20.00 ? 825  LYS C CA 1 
ATOM 826  C CA . VAL C 1 150 ? 9.617   24.877  -53.049  1.00 20.00 ? 826  VAL C CA 1 
ATOM 827  C CA . ASP C 1 151 ? 9.407   24.181  -56.839  1.00 20.00 ? 827  ASP C CA 1 
ATOM 828  C CA . ASN C 1 152 ? 12.185  24.927  -59.380  1.00 20.00 ? 828  ASN C CA 1 
ATOM 829  C CA . ALA C 1 153 ? 13.312  28.404  -58.142  1.00 20.00 ? 829  ALA C CA 1 
ATOM 830  C CA . LEU C 1 154 ? 10.741  29.741  -55.550  1.00 20.00 ? 830  LEU C CA 1 
ATOM 831  C CA . GLN C 1 155 ? 12.658  30.381  -52.281  1.00 20.00 ? 831  GLN C CA 1 
ATOM 832  C CA . SER C 1 156 ? 10.503  30.938  -49.129  1.00 20.00 ? 832  SER C CA 1 
ATOM 833  C CA . GLY C 1 157 ? 11.387  32.871  -45.901  1.00 20.00 ? 833  GLY C CA 1 
ATOM 834  C CA . ASN C 1 158 ? 9.375   31.431  -42.948  1.00 20.00 ? 834  ASN C CA 1 
ATOM 835  C CA . SER C 1 159 ? 11.790  28.858  -41.375  1.00 20.00 ? 835  SER C CA 1 
ATOM 836  C CA . GLN C 1 160 ? 13.323  28.382  -37.873  1.00 20.00 ? 836  GLN C CA 1 
ATOM 837  C CA . GLU C 1 161 ? 16.959  27.278  -37.258  1.00 20.00 ? 837  GLU C CA 1 
ATOM 838  C CA . SER C 1 162 ? 18.111  25.555  -34.030  1.00 20.00 ? 838  SER C CA 1 
ATOM 839  C CA . VAL C 1 163 ? 21.682  24.356  -33.196  1.00 20.00 ? 839  VAL C CA 1 
ATOM 840  C CA . THR C 1 164 ? 22.487  22.086  -30.223  1.00 20.00 ? 840  THR C CA 1 
ATOM 841  C CA . GLU C 1 165 ? 25.485  22.414  -27.895  1.00 20.00 ? 841  GLU C CA 1 
ATOM 842  C CA . GLN C 1 166 ? 28.811  20.730  -28.928  1.00 20.00 ? 842  GLN C CA 1 
ATOM 843  C CA . ASP C 1 167 ? 28.958  17.065  -27.709  1.00 20.00 ? 843  ASP C CA 1 
ATOM 844  C CA . SER C 1 168 ? 31.707  15.463  -25.512  1.00 20.00 ? 844  SER C CA 1 
ATOM 845  C CA . LYS C 1 169 ? 33.044  12.942  -28.171  1.00 20.00 ? 845  LYS C CA 1 
ATOM 846  C CA . ASP C 1 170 ? 34.092  14.130  -31.697  1.00 20.00 ? 846  ASP C CA 1 
ATOM 847  C CA . SER C 1 171 ? 33.598  17.945  -31.140  1.00 20.00 ? 847  SER C CA 1 
ATOM 848  C CA . THR C 1 172 ? 30.988  18.759  -33.882  1.00 20.00 ? 848  THR C CA 1 
ATOM 849  C CA . TYR C 1 173 ? 27.668  20.612  -34.463  1.00 20.00 ? 849  TYR C CA 1 
ATOM 850  C CA . SER C 1 174 ? 24.352  19.585  -36.079  1.00 20.00 ? 850  SER C CA 1 
ATOM 851  C CA . LEU C 1 175 ? 21.401  21.696  -37.397  1.00 20.00 ? 851  LEU C CA 1 
ATOM 852  C CA . SER C 1 176 ? 17.720  21.362  -38.418  1.00 20.00 ? 852  SER C CA 1 
ATOM 853  C CA . SER C 1 177 ? 15.266  23.507  -40.395  1.00 20.00 ? 853  SER C CA 1 
ATOM 854  C CA . THR C 1 178 ? 11.436  23.220  -40.113  1.00 20.00 ? 854  THR C CA 1 
ATOM 855  C CA . LEU C 1 179 ? 9.279   24.778  -42.895  1.00 20.00 ? 855  LEU C CA 1 
ATOM 856  C CA . THR C 1 180 ? 5.847   25.486  -41.265  1.00 20.00 ? 856  THR C CA 1 
ATOM 857  C CA . LEU C 1 181 ? 3.034   25.837  -43.877  1.00 20.00 ? 857  LEU C CA 1 
ATOM 858  C CA . SER C 1 182 ? -0.723  25.065  -43.487  1.00 20.00 ? 858  SER C CA 1 
ATOM 859  C CA . LYS C 1 183 ? -2.447  22.118  -45.307  1.00 20.00 ? 859  LYS C CA 1 
ATOM 860  C CA . ALA C 1 184 ? -3.944  24.526  -47.940  1.00 20.00 ? 860  ALA C CA 1 
ATOM 861  C CA . ASP C 1 185 ? -0.459  25.749  -49.058  1.00 20.00 ? 861  ASP C CA 1 
ATOM 862  C CA . TYR C 1 186 ? 1.012   22.170  -48.803  1.00 20.00 ? 862  TYR C CA 1 
ATOM 863  C CA . GLU C 1 187 ? -1.637  20.470  -51.069  1.00 20.00 ? 863  GLU C CA 1 
ATOM 864  C CA . LYS C 1 188 ? -0.621  23.013  -53.818  1.00 20.00 ? 864  LYS C CA 1 
ATOM 865  C CA . HIS C 1 189 ? 3.151   22.266  -54.370  1.00 20.00 ? 865  HIS C CA 1 
ATOM 866  C CA . LYS C 1 190 ? 5.151   19.117  -55.331  1.00 20.00 ? 866  LYS C CA 1 
ATOM 867  C CA . VAL C 1 191 ? 8.953   19.589  -55.129  1.00 20.00 ? 867  VAL C CA 1 
ATOM 868  C CA . TYR C 1 192 ? 10.573  20.328  -51.711  1.00 20.00 ? 868  TYR C CA 1 
ATOM 869  C CA . ALA C 1 193 ? 14.411  20.546  -51.698  1.00 20.00 ? 869  ALA C CA 1 
ATOM 870  C CA . CYS C 1 194 ? 16.852  21.914  -49.057  1.00 20.00 ? 870  CYS C CA 1 
ATOM 871  C CA . GLU C 1 195 ? 20.154  23.368  -50.399  1.00 20.00 ? 871  GLU C CA 1 
ATOM 872  C CA . VAL C 1 196 ? 23.076  23.290  -47.874  1.00 20.00 ? 872  VAL C CA 1 
ATOM 873  C CA . THR C 1 197 ? 26.370  25.279  -48.025  1.00 20.00 ? 873  THR C CA 1 
ATOM 874  C CA . HIS C 1 198 ? 29.358  24.254  -45.833  1.00 20.00 ? 874  HIS C CA 1 
ATOM 875  C CA . GLN C 1 199 ? 33.219  24.372  -46.064  1.00 20.00 ? 875  GLN C CA 1 
ATOM 876  C CA . GLY C 1 200 ? 33.398  20.514  -45.837  1.00 20.00 ? 876  GLY C CA 1 
ATOM 877  C CA . LEU C 1 201 ? 31.055  20.140  -48.869  1.00 20.00 ? 877  LEU C CA 1 
ATOM 878  C CA . SER C 1 202 ? 32.779  20.483  -52.306  1.00 20.00 ? 878  SER C CA 1 
ATOM 879  C CA . SER C 1 203 ? 29.361  21.485  -53.798  1.00 20.00 ? 879  SER C CA 1 
ATOM 880  C CA . PRO C 1 204 ? 25.837  22.259  -52.351  1.00 20.00 ? 880  PRO C CA 1 
ATOM 881  C CA . VAL C 1 205 ? 23.946  19.040  -51.441  1.00 20.00 ? 881  VAL C CA 1 
ATOM 882  C CA . THR C 1 206 ? 20.271  18.981  -52.573  1.00 20.00 ? 882  THR C CA 1 
ATOM 883  C CA . LYS C 1 207 ? 17.705  16.714  -50.778  1.00 20.00 ? 883  LYS C CA 1 
ATOM 884  C CA . SER C 1 208 ? 14.271  16.788  -52.513  1.00 20.00 ? 884  SER C CA 1 
ATOM 885  C CA . PHE C 1 209 ? 11.111  14.658  -52.480  1.00 20.00 ? 885  PHE C CA 1 
ATOM 886  C CA . ASN C 1 210 ? 7.949   14.621  -54.649  1.00 20.00 ? 886  ASN C CA 1 
ATOM 887  C CA . ARG C 1 211 ? 4.392   15.012  -53.275  1.00 20.00 ? 887  ARG C CA 1 
ATOM 888  C CA . GLY C 1 212 ? 1.999   12.168  -54.252  1.00 20.00 ? 888  GLY C CA 1 
ATOM 889  C CA . GLU C 1 213 ? 2.606   8.672   -52.795  1.00 20.00 ? 889  GLU C CA 1 
ATOM 890  C CA . CYS C 1 214 ? -0.171  7.064   -54.921  1.00 20.00 ? 890  CYS C CA 1 
ATOM 891  C CA . GLN D 2 1   ? 24.102  4.677   -7.381   1.00 20.00 ? 891  GLN D CA 1 
ATOM 892  C CA . VAL D 2 2   ? 22.129  6.203   -4.512   1.00 20.00 ? 892  VAL D CA 1 
ATOM 893  C CA . LYS D 2 3   ? 19.948  9.319   -4.276   1.00 20.00 ? 893  LYS D CA 1 
ATOM 894  C CA . LEU D 2 4   ? 21.770  12.710  -3.796   1.00 20.00 ? 894  LEU D CA 1 
ATOM 895  C CA . LEU D 2 5   ? 19.778  16.024  -3.784   1.00 20.00 ? 895  LEU D CA 1 
ATOM 896  C CA . GLU D 2 6   ? 16.586  15.358  -5.831   1.00 20.00 ? 896  GLU D CA 1 
ATOM 897  C CA . GLN D 2 7   ? 14.561  18.599  -6.366   1.00 20.00 ? 897  GLN D CA 1 
ATOM 898  C CA . SER D 2 8   ? 10.942  19.138  -7.589   1.00 20.00 ? 898  SER D CA 1 
ATOM 899  C CA . GLY D 2 9   ? 9.552   20.186  -11.041  1.00 20.00 ? 899  GLY D CA 1 
ATOM 900  C CA . ALA D 2 10  ? 9.020   23.395  -13.049  1.00 20.00 ? 900  ALA D CA 1 
ATOM 901  C CA . GLU D 2 11  ? 5.903   25.150  -11.611  1.00 20.00 ? 901  GLU D CA 1 
ATOM 902  C CA . VAL D 2 12  ? 4.163   27.571  -14.053  1.00 20.00 ? 902  VAL D CA 1 
ATOM 903  C CA . LYS D 2 13  ? 2.906   30.485  -11.896  1.00 20.00 ? 903  LYS D CA 1 
ATOM 904  C CA . LYS D 2 14  ? 0.860   33.504  -13.082  1.00 20.00 ? 904  LYS D CA 1 
ATOM 905  C CA . PRO D 2 15  ? 2.410   36.966  -12.154  1.00 20.00 ? 905  PRO D CA 1 
ATOM 906  C CA . GLY D 2 16  ? 1.413   37.727  -8.499   1.00 20.00 ? 906  GLY D CA 1 
ATOM 907  C CA . ALA D 2 17  ? 1.293   34.098  -7.209   1.00 20.00 ? 907  ALA D CA 1 
ATOM 908  C CA . SER D 2 18  ? 3.407   31.957  -4.796   1.00 20.00 ? 908  SER D CA 1 
ATOM 909  C CA . VAL D 2 19  ? 5.979   29.179  -5.539   1.00 20.00 ? 909  VAL D CA 1 
ATOM 910  C CA . LYS D 2 20  ? 7.378   26.485  -3.177   1.00 20.00 ? 910  LYS D CA 1 
ATOM 911  C CA . VAL D 2 21  ? 10.388  24.475  -4.481   1.00 20.00 ? 911  VAL D CA 1 
ATOM 912  C CA . SER D 2 22  ? 11.576  21.472  -2.380   1.00 20.00 ? 912  SER D CA 1 
ATOM 913  C CA . CYS D 2 23  ? 14.997  19.738  -2.075   1.00 20.00 ? 913  CYS D CA 1 
ATOM 914  C CA . LYS D 2 24  ? 14.956  16.065  -0.903   1.00 20.00 ? 914  LYS D CA 1 
ATOM 915  C CA . ALA D 2 25  ? 18.324  14.883  0.549    1.00 20.00 ? 915  ALA D CA 1 
ATOM 916  C CA . SER D 2 26  ? 19.844  11.482  1.144    1.00 20.00 ? 916  SER D CA 1 
ATOM 917  C CA . GLY D 2 27  ? 22.903  9.145   1.446    1.00 20.00 ? 917  GLY D CA 1 
ATOM 918  C CA . TYR D 2 28  ? 24.314  11.590  4.092    1.00 20.00 ? 918  TYR D CA 1 
ATOM 919  C CA . SER D 2 29  ? 23.235  13.008  7.504    1.00 20.00 ? 919  SER D CA 1 
ATOM 920  C CA . PHE D 2 30  ? 20.727  15.901  7.069    1.00 20.00 ? 920  PHE D CA 1 
ATOM 921  C CA . THR D 2 31  ? 21.275  17.638  10.490   1.00 20.00 ? 921  THR D CA 1 
ATOM 922  C CA . SER D 2 32  ? 25.099  17.923  9.835    1.00 20.00 ? 922  SER D CA 1 
ATOM 923  C CA . TYR D 2 33  ? 25.149  19.996  6.574    1.00 20.00 ? 923  TYR D CA 1 
ATOM 924  C CA . GLY D 2 34  ? 23.464  23.226  5.377    1.00 20.00 ? 924  GLY D CA 1 
ATOM 925  C CA . LEU D 2 35  ? 21.745  24.031  2.041    1.00 20.00 ? 925  LEU D CA 1 
ATOM 926  C CA . HIS D 2 36  ? 22.212  27.177  -0.150   1.00 20.00 ? 926  HIS D CA 1 
ATOM 927  C CA . TRP D 2 37  ? 19.805  28.313  -2.915   1.00 20.00 ? 927  TRP D CA 1 
ATOM 928  C CA . VAL D 2 38  ? 21.193  29.644  -6.256   1.00 20.00 ? 928  VAL D CA 1 
ATOM 929  C CA . ARG D 2 39  ? 19.268  30.482  -9.477   1.00 20.00 ? 929  ARG D CA 1 
ATOM 930  C CA . GLN D 2 40  ? 20.089  31.427  -13.119  1.00 20.00 ? 930  GLN D CA 1 
ATOM 931  C CA . ALA D 2 41  ? 18.122  33.655  -15.552  1.00 20.00 ? 931  ALA D CA 1 
ATOM 932  C CA . PRO D 2 42  ? 18.103  32.512  -19.286  1.00 20.00 ? 932  PRO D CA 1 
ATOM 933  C CA . GLY D 2 43  ? 21.402  33.951  -20.679  1.00 20.00 ? 933  GLY D CA 1 
ATOM 934  C CA . GLN D 2 44  ? 22.675  35.477  -17.361  1.00 20.00 ? 934  GLN D CA 1 
ATOM 935  C CA . ARG D 2 45  ? 25.018  34.503  -14.467  1.00 20.00 ? 935  ARG D CA 1 
ATOM 936  C CA . LEU D 2 46  ? 24.148  32.514  -11.299  1.00 20.00 ? 936  LEU D CA 1 
ATOM 937  C CA . GLU D 2 47  ? 22.648  34.614  -8.414   1.00 20.00 ? 937  GLU D CA 1 
ATOM 938  C CA . TRP D 2 48  ? 22.764  33.526  -4.736   1.00 20.00 ? 938  TRP D CA 1 
ATOM 939  C CA . MET D 2 49  ? 19.336  33.760  -2.986   1.00 20.00 ? 939  MET D CA 1 
ATOM 940  C CA . GLY D 2 50  ? 20.083  32.450  0.535    1.00 20.00 ? 940  GLY D CA 1 
ATOM 941  C CA . TRP D 2 51  ? 20.925  29.679  2.998    1.00 20.00 ? 941  TRP D CA 1 
ATOM 942  C CA . ILE D 2 52  ? 19.324  27.667  5.838    1.00 20.00 ? 942  ILE D CA 1 
ATOM 943  C CA . SER D 2 53  ? 20.960  25.437  8.503    1.00 20.00 ? 943  SER D CA 1 
ATOM 944  C CA . ALA D 2 54  ? 19.319  21.954  8.796    1.00 20.00 ? 944  ALA D CA 1 
ATOM 945  C CA . GLY D 2 55  ? 20.468  21.661  12.507   1.00 20.00 ? 945  GLY D CA 1 
ATOM 946  C CA . THR D 2 56  ? 18.962  24.825  14.159   1.00 20.00 ? 946  THR D CA 1 
ATOM 947  C CA . GLY D 2 57  ? 16.910  26.495  11.322   1.00 20.00 ? 947  GLY D CA 1 
ATOM 948  C CA . ASN D 2 58  ? 18.702  29.891  11.036   1.00 20.00 ? 948  ASN D CA 1 
ATOM 949  C CA . THR D 2 59  ? 17.885  31.959  7.903    1.00 20.00 ? 949  THR D CA 1 
ATOM 950  C CA . LYS D 2 60  ? 20.513  34.013  5.986    1.00 20.00 ? 950  LYS D CA 1 
ATOM 951  C CA . TYR D 2 61  ? 19.234  35.492  2.671    1.00 20.00 ? 951  TYR D CA 1 
ATOM 952  C CA . SER D 2 62  ? 20.448  38.406  0.532    1.00 20.00 ? 952  SER D CA 1 
ATOM 953  C CA . GLN D 2 63  ? 19.108  42.017  0.630    1.00 20.00 ? 953  GLN D CA 1 
ATOM 954  C CA . LYS D 2 64  ? 17.820  41.547  -3.007   1.00 20.00 ? 954  LYS D CA 1 
ATOM 955  C CA . PHE D 2 65  ? 14.680  39.451  -2.191   1.00 20.00 ? 955  PHE D CA 1 
ATOM 956  C CA . ARG D 2 66  ? 14.120  41.215  1.202    1.00 20.00 ? 956  ARG D CA 1 
ATOM 957  C CA . GLY D 2 67  ? 10.478  40.793  2.402    1.00 20.00 ? 957  GLY D CA 1 
ATOM 958  C CA . ARG D 2 68  ? 9.328   38.079  -0.089   1.00 20.00 ? 958  ARG D CA 1 
ATOM 959  C CA . VAL D 2 69  ? 11.623  35.012  0.516    1.00 20.00 ? 959  VAL D CA 1 
ATOM 960  C CA . THR D 2 70  ? 11.341  32.256  3.177    1.00 20.00 ? 960  THR D CA 1 
ATOM 961  C CA . PHE D 2 71  ? 13.168  28.976  3.957    1.00 20.00 ? 961  PHE D CA 1 
ATOM 962  C CA . THR D 2 72  ? 11.630  26.010  5.842    1.00 20.00 ? 962  THR D CA 1 
ATOM 963  C CA . ARG D 2 73  ? 12.993  22.522  6.671    1.00 20.00 ? 963  ARG D CA 1 
ATOM 964  C CA . ASP D 2 74  ? 11.316  19.283  7.864    1.00 20.00 ? 964  ASP D CA 1 
ATOM 965  C CA . THR D 2 75  ? 13.651  17.281  10.217   1.00 20.00 ? 965  THR D CA 1 
ATOM 966  C CA . SER D 2 76  ? 11.831  13.864  10.011   1.00 20.00 ? 966  SER D CA 1 
ATOM 967  C CA . ALA D 2 77  ? 11.156  14.115  6.192    1.00 20.00 ? 967  ALA D CA 1 
ATOM 968  C CA . THR D 2 78  ? 14.709  15.117  4.992    1.00 20.00 ? 968  THR D CA 1 
ATOM 969  C CA . THR D 2 79  ? 13.521  17.885  2.595    1.00 20.00 ? 969  THR D CA 1 
ATOM 970  C CA . ALA D 2 80  ? 14.342  21.625  2.405    1.00 20.00 ? 970  ALA D CA 1 
ATOM 971  C CA . TYR D 2 81  ? 11.929  24.330  1.095    1.00 20.00 ? 971  TYR D CA 1 
ATOM 972  C CA . MET D 2 82  ? 12.000  27.807  -0.492   1.00 20.00 ? 972  MET D CA 1 
ATOM 973  C CA . GLY D 2 83  ? 9.134   30.383  -0.708   1.00 20.00 ? 973  GLY D CA 1 
ATOM 974  C CA . LEU D 2 84  ? 8.779   33.418  -3.033   1.00 20.00 ? 974  LEU D CA 1 
ATOM 975  C CA . SER D 2 85  ? 5.639   35.691  -3.057   1.00 20.00 ? 975  SER D CA 1 
ATOM 976  C CA . SER D 2 86  ? 4.733   38.448  -5.609   1.00 20.00 ? 976  SER D CA 1 
ATOM 977  C CA . LEU D 2 87  ? 6.295   36.678  -8.641   1.00 20.00 ? 977  LEU D CA 1 
ATOM 978  C CA . ARG D 2 88  ? 7.287   38.869  -11.659  1.00 20.00 ? 978  ARG D CA 1 
ATOM 979  C CA . PRO D 2 89  ? 7.932   38.225  -15.455  1.00 20.00 ? 979  PRO D CA 1 
ATOM 980  C CA . GLU D 2 90  ? 11.732  38.553  -14.704  1.00 20.00 ? 980  GLU D CA 1 
ATOM 981  C CA . ASP D 2 91  ? 11.881  35.648  -12.146  1.00 20.00 ? 981  ASP D CA 1 
ATOM 982  C CA . THR D 2 92  ? 12.051  33.099  -15.056  1.00 20.00 ? 982  THR D CA 1 
ATOM 983  C CA . ALA D 2 93  ? 15.154  31.166  -13.897  1.00 20.00 ? 983  ALA D CA 1 
ATOM 984  C CA . VAL D 2 94  ? 16.564  27.715  -13.045  1.00 20.00 ? 984  VAL D CA 1 
ATOM 985  C CA . TYR D 2 95  ? 16.758  27.350  -9.217   1.00 20.00 ? 985  TYR D CA 1 
ATOM 986  C CA . TYR D 2 96  ? 19.232  24.940  -7.541   1.00 20.00 ? 986  TYR D CA 1 
ATOM 987  C CA . CYS D 2 97  ? 19.739  23.830  -3.905   1.00 20.00 ? 987  CYS D CA 1 
ATOM 988  C CA . ALA D 2 98  ? 23.486  23.334  -3.206   1.00 20.00 ? 988  ALA D CA 1 
ATOM 989  C CA . ARG D 2 99  ? 24.915  21.691  -0.010   1.00 20.00 ? 989  ARG D CA 1 
ATOM 990  C CA . ASP D 2 100 ? 27.127  23.279  2.719    1.00 20.00 ? 990  ASP D CA 1 
ATOM 991  C CA . PRO D 2 101 ? 30.321  21.104  3.275    1.00 20.00 ? 991  PRO D CA 1 
ATOM 992  C CA . TYR D 2 102 ? 30.995  22.945  6.618    1.00 20.00 ? 992  TYR D CA 1 
ATOM 993  C CA . GLY D 2 103 ? 27.590  24.126  8.031    1.00 20.00 ? 993  GLY D CA 1 
ATOM 994  C CA . GLY D 2 104 ? 28.847  27.760  8.449    1.00 20.00 ? 994  GLY D CA 1 
ATOM 995  C CA . GLY D 2 105 ? 26.715  29.574  5.785    1.00 20.00 ? 995  GLY D CA 1 
ATOM 996  C CA . LYS D 2 106 ? 29.719  30.897  3.742    1.00 20.00 ? 996  LYS D CA 1 
ATOM 997  C CA . SER D 2 107 ? 31.666  28.416  1.536    1.00 20.00 ? 997  SER D CA 1 
ATOM 998  C CA . GLU D 2 108 ? 31.695  26.518  -1.809   1.00 20.00 ? 998  GLU D CA 1 
ATOM 999  C CA . PHE D 2 109 ? 29.098  24.053  -3.218   1.00 20.00 ? 999  PHE D CA 1 
ATOM 1000 C CA . ASP D 2 110 ? 30.144  20.378  -3.747   1.00 20.00 ? 1000 ASP D CA 1 
ATOM 1001 C CA . TYR D 2 111 ? 26.662  18.917  -4.583   1.00 20.00 ? 1001 TYR D CA 1 
ATOM 1002 C CA . TRP D 2 112 ? 24.095  20.519  -6.938   1.00 20.00 ? 1002 TRP D CA 1 
ATOM 1003 C CA . GLY D 2 113 ? 20.560  19.305  -7.795   1.00 20.00 ? 1003 GLY D CA 1 
ATOM 1004 C CA . GLN D 2 114 ? 18.878  18.940  -11.242  1.00 20.00 ? 1004 GLN D CA 1 
ATOM 1005 C CA . GLY D 2 115 ? 17.286  22.433  -11.165  1.00 20.00 ? 1005 GLY D CA 1 
ATOM 1006 C CA . THR D 2 116 ? 13.672  23.752  -11.329  1.00 20.00 ? 1006 THR D CA 1 
ATOM 1007 C CA . LEU D 2 117 ? 12.664  26.197  -14.145  1.00 20.00 ? 1007 LEU D CA 1 
ATOM 1008 C CA . VAL D 2 118 ? 9.840   28.390  -12.711  1.00 20.00 ? 1008 VAL D CA 1 
ATOM 1009 C CA . THR D 2 119 ? 8.405   30.416  -15.652  1.00 20.00 ? 1009 THR D CA 1 
ATOM 1010 C CA . VAL D 2 120 ? 6.207   33.376  -14.609  1.00 20.00 ? 1010 VAL D CA 1 
ATOM 1011 C CA . SER D 2 121 ? 3.827   34.298  -17.492  1.00 20.00 ? 1011 SER D CA 1 
ATOM 1012 C CA . SER D 2 122 ? 0.074   35.177  -17.708  1.00 20.00 ? 1012 SER D CA 1 
ATOM 1013 C CA . ALA D 2 123 ? -0.302  33.536  -21.190  1.00 20.00 ? 1013 ALA D CA 1 
ATOM 1014 C CA . SER D 2 124 ? -2.547  30.402  -21.235  1.00 20.00 ? 1014 SER D CA 1 
ATOM 1015 C CA . PRO D 2 125 ? -0.139  27.386  -20.986  1.00 20.00 ? 1015 PRO D CA 1 
ATOM 1016 C CA . THR D 2 126 ? -0.896  24.403  -23.279  1.00 20.00 ? 1016 THR D CA 1 
ATOM 1017 C CA . SER D 2 127 ? 0.150   20.723  -23.384  1.00 20.00 ? 1017 SER D CA 1 
ATOM 1018 C CA . PRO D 2 128 ? 2.475   19.645  -26.265  1.00 20.00 ? 1018 PRO D CA 1 
ATOM 1019 C CA . LYS D 2 129 ? 1.207   17.568  -29.249  1.00 20.00 ? 1019 LYS D CA 1 
ATOM 1020 C CA . VAL D 2 130 ? 3.803   14.834  -29.994  1.00 20.00 ? 1020 VAL D CA 1 
ATOM 1021 C CA . PHE D 2 131 ? 3.904   13.612  -33.642  1.00 20.00 ? 1021 PHE D CA 1 
ATOM 1022 C CA . PRO D 2 132 ? 5.823   10.633  -35.163  1.00 20.00 ? 1022 PRO D CA 1 
ATOM 1023 C CA . LEU D 2 133 ? 8.385   11.662  -37.861  1.00 20.00 ? 1023 LEU D CA 1 
ATOM 1024 C CA . SER D 2 134 ? 8.575   8.387   -39.818  1.00 20.00 ? 1024 SER D CA 1 
ATOM 1025 C CA . LEU D 2 135 ? 9.938   8.368   -43.424  1.00 20.00 ? 1025 LEU D CA 1 
ATOM 1026 C CA . ASP D 2 136 ? 9.138   6.741   -46.800  1.00 20.00 ? 1026 ASP D CA 1 
ATOM 1027 C CA . SER D 2 137 ? 12.191  6.390   -49.195  1.00 20.00 ? 1027 SER D CA 1 
ATOM 1028 C CA . THR D 2 138 ? 13.770  9.767   -48.158  1.00 20.00 ? 1028 THR D CA 1 
ATOM 1029 C CA . PRO D 2 139 ? 16.816  8.313   -46.222  1.00 20.00 ? 1029 PRO D CA 1 
ATOM 1030 C CA . GLN D 2 140 ? 19.865  6.664   -47.867  1.00 20.00 ? 1030 GLN D CA 1 
ATOM 1031 C CA . ASP D 2 141 ? 20.501  2.883   -48.224  1.00 20.00 ? 1031 ASP D CA 1 
ATOM 1032 C CA . GLY D 2 142 ? 22.428  1.985   -44.990  1.00 20.00 ? 1032 GLY D CA 1 
ATOM 1033 C CA . ASN D 2 143 ? 20.879  3.840   -41.997  1.00 20.00 ? 1033 ASN D CA 1 
ATOM 1034 C CA . VAL D 2 144 ? 17.393  4.712   -40.654  1.00 20.00 ? 1034 VAL D CA 1 
ATOM 1035 C CA . VAL D 2 145 ? 16.530  8.154   -39.212  1.00 20.00 ? 1035 VAL D CA 1 
ATOM 1036 C CA . VAL D 2 146 ? 13.380  8.400   -37.018  1.00 20.00 ? 1036 VAL D CA 1 
ATOM 1037 C CA . ALA D 2 147 ? 12.128  11.351  -34.902  1.00 20.00 ? 1037 ALA D CA 1 
ATOM 1038 C CA . CYS D 2 148 ? 9.347   12.688  -32.582  1.00 20.00 ? 1038 CYS D CA 1 
ATOM 1039 C CA . LEU D 2 149 ? 8.096   16.282  -33.197  1.00 20.00 ? 1039 LEU D CA 1 
ATOM 1040 C CA . VAL D 2 150 ? 6.794   17.721  -29.876  1.00 20.00 ? 1040 VAL D CA 1 
ATOM 1041 C CA . GLN D 2 151 ? 4.748   20.748  -31.144  1.00 20.00 ? 1041 GLN D CA 1 
ATOM 1042 C CA . GLY D 2 152 ? 2.992   23.615  -29.267  1.00 20.00 ? 1042 GLY D CA 1 
ATOM 1043 C CA . PHE D 2 153 ? 3.831   24.260  -25.561  1.00 20.00 ? 1043 PHE D CA 1 
ATOM 1044 C CA . PHE D 2 154 ? 3.855   27.798  -23.923  1.00 20.00 ? 1044 PHE D CA 1 
ATOM 1045 C CA . PRO D 2 155 ? 6.354   27.258  -20.979  1.00 20.00 ? 1045 PRO D CA 1 
ATOM 1046 C CA . GLN D 2 156 ? 9.783   26.009  -21.992  1.00 20.00 ? 1046 GLN D CA 1 
ATOM 1047 C CA . GLU D 2 157 ? 9.821   23.169  -19.459  1.00 20.00 ? 1047 GLU D CA 1 
ATOM 1048 C CA . PRO D 2 158 ? 12.686  20.739  -18.720  1.00 20.00 ? 1048 PRO D CA 1 
ATOM 1049 C CA . LEU D 2 159 ? 11.896  18.440  -21.705  1.00 20.00 ? 1049 LEU D CA 1 
ATOM 1050 C CA . SER D 2 160 ? 13.341  15.062  -20.654  1.00 20.00 ? 1050 SER D CA 1 
ATOM 1051 C CA . VAL D 2 161 ? 13.226  12.627  -23.614  1.00 20.00 ? 1051 VAL D CA 1 
ATOM 1052 C CA . THR D 2 162 ? 14.368  8.966   -23.456  1.00 20.00 ? 1052 THR D CA 1 
ATOM 1053 C CA . TRP D 2 163 ? 14.061  6.491   -26.370  1.00 20.00 ? 1053 TRP D CA 1 
ATOM 1054 C CA . SER D 2 164 ? 13.631  2.730   -25.659  1.00 20.00 ? 1054 SER D CA 1 
ATOM 1055 C CA . GLU D 2 165 ? 16.738  1.427   -27.570  1.00 20.00 ? 1055 GLU D CA 1 
ATOM 1056 C CA . SER D 2 166 ? 20.374  2.320   -26.652  1.00 20.00 ? 1056 SER D CA 1 
ATOM 1057 C CA . GLY D 2 167 ? 23.856  1.016   -27.669  1.00 20.00 ? 1057 GLY D CA 1 
ATOM 1058 C CA . GLN D 2 168 ? 27.096  2.075   -29.461  1.00 20.00 ? 1058 GLN D CA 1 
ATOM 1059 C CA . ASN D 2 169 ? 26.154  2.895   -33.120  1.00 20.00 ? 1059 ASN D CA 1 
ATOM 1060 C CA . VAL D 2 170 ? 22.878  4.700   -32.106  1.00 20.00 ? 1060 VAL D CA 1 
ATOM 1061 C CA . THR D 2 171 ? 22.799  8.501   -31.521  1.00 20.00 ? 1061 THR D CA 1 
ATOM 1062 C CA . ALA D 2 172 ? 19.992  10.622  -29.959  1.00 20.00 ? 1062 ALA D CA 1 
ATOM 1063 C CA . ARG D 2 173 ? 19.941  14.482  -30.093  1.00 20.00 ? 1063 ARG D CA 1 
ATOM 1064 C CA . ASN D 2 174 ? 17.616  16.781  -28.049  1.00 20.00 ? 1064 ASN D CA 1 
ATOM 1065 C CA . PHE D 2 175 ? 16.865  19.817  -30.293  1.00 20.00 ? 1065 PHE D CA 1 
ATOM 1066 C CA . PRO D 2 176 ? 16.722  23.243  -28.491  1.00 20.00 ? 1066 PRO D CA 1 
ATOM 1067 C CA . PRO D 2 177 ? 13.334  25.050  -28.022  1.00 20.00 ? 1067 PRO D CA 1 
ATOM 1068 C CA . SER D 2 178 ? 12.361  27.671  -30.694  1.00 20.00 ? 1068 SER D CA 1 
ATOM 1069 C CA . GLN D 2 179 ? 9.772   30.555  -30.610  1.00 20.00 ? 1069 GLN D CA 1 
ATOM 1070 C CA . ASP D 2 180 ? 7.427   31.417  -33.576  1.00 20.00 ? 1070 ASP D CA 1 
ATOM 1071 C CA . ALA D 2 181 ? 5.822   34.958  -33.408  1.00 20.00 ? 1071 ALA D CA 1 
ATOM 1072 C CA . SER D 2 182 ? 6.253   36.951  -30.124  1.00 20.00 ? 1072 SER D CA 1 
ATOM 1073 C CA . GLY D 2 183 ? 6.031   34.013  -27.672  1.00 20.00 ? 1073 GLY D CA 1 
ATOM 1074 C CA . ASP D 2 184 ? 2.679   32.383  -28.699  1.00 20.00 ? 1074 ASP D CA 1 
ATOM 1075 C CA . LEU D 2 185 ? 4.062   28.772  -28.588  1.00 20.00 ? 1075 LEU D CA 1 
ATOM 1076 C CA . TYR D 2 186 ? 7.324   26.741  -28.382  1.00 20.00 ? 1076 TYR D CA 1 
ATOM 1077 C CA . THR D 2 187 ? 8.261   23.646  -30.483  1.00 20.00 ? 1077 THR D CA 1 
ATOM 1078 C CA . THR D 2 188 ? 10.935  20.864  -30.072  1.00 20.00 ? 1078 THR D CA 1 
ATOM 1079 C CA . SER D 2 189 ? 11.922  17.493  -31.572  1.00 20.00 ? 1079 SER D CA 1 
ATOM 1080 C CA . SER D 2 190 ? 13.770  14.287  -30.607  1.00 20.00 ? 1080 SER D CA 1 
ATOM 1081 C CA . GLN D 2 191 ? 15.731  12.280  -33.250  1.00 20.00 ? 1081 GLN D CA 1 
ATOM 1082 C CA . LEU D 2 192 ? 17.344  8.796   -33.169  1.00 20.00 ? 1082 LEU D CA 1 
ATOM 1083 C CA . THR D 2 193 ? 19.773  7.930   -36.007  1.00 20.00 ? 1083 THR D CA 1 
ATOM 1084 C CA . LEU D 2 194 ? 20.261  4.120   -35.886  1.00 20.00 ? 1084 LEU D CA 1 
ATOM 1085 C CA . PRO D 2 195 ? 21.741  1.437   -38.222  1.00 20.00 ? 1085 PRO D CA 1 
ATOM 1086 C CA . ALA D 2 196 ? 19.276  -0.549  -40.400  1.00 20.00 ? 1086 ALA D CA 1 
ATOM 1087 C CA . THR D 2 197 ? 20.472  -3.835  -38.772  1.00 20.00 ? 1087 THR D CA 1 
ATOM 1088 C CA . GLN D 2 198 ? 18.985  -2.590  -35.393  1.00 20.00 ? 1088 GLN D CA 1 
ATOM 1089 C CA . CYS D 2 199 ? 15.172  -1.971  -35.845  1.00 20.00 ? 1089 CYS D CA 1 
ATOM 1090 C CA . PRO D 2 200 ? 13.281  -5.279  -36.658  1.00 20.00 ? 1090 PRO D CA 1 
ATOM 1091 C CA . ASP D 2 201 ? 10.984  -5.511  -39.747  1.00 20.00 ? 1091 ASP D CA 1 
ATOM 1092 C CA . GLY D 2 202 ? 7.467   -5.241  -38.239  1.00 20.00 ? 1092 GLY D CA 1 
ATOM 1093 C CA . LYS D 2 203 ? 8.124   -3.375  -34.920  1.00 20.00 ? 1093 LYS D CA 1 
ATOM 1094 C CA . SER D 2 204 ? 8.730   0.240   -33.749  1.00 20.00 ? 1094 SER D CA 1 
ATOM 1095 C CA . VAL D 2 205 ? 10.681  2.321   -31.189  1.00 20.00 ? 1095 VAL D CA 1 
ATOM 1096 C CA . THR D 2 206 ? 8.889   4.336   -28.430  1.00 20.00 ? 1096 THR D CA 1 
ATOM 1097 C CA . CYS D 2 207 ? 9.919   7.969   -27.594  1.00 20.00 ? 1097 CYS D CA 1 
ATOM 1098 C CA . HIS D 2 208 ? 9.000   9.014   -23.997  1.00 20.00 ? 1098 HIS D CA 1 
ATOM 1099 C CA . VAL D 2 209 ? 8.594   12.833  -23.634  1.00 20.00 ? 1099 VAL D CA 1 
ATOM 1100 C CA . LYS D 2 210 ? 8.258   14.352  -20.106  1.00 20.00 ? 1100 LYS D CA 1 
ATOM 1101 C CA . HIS D 2 211 ? 7.410   18.071  -19.550  1.00 20.00 ? 1101 HIS D CA 1 
ATOM 1102 C CA . TYR D 2 212 ? 7.276   19.062  -15.815  1.00 20.00 ? 1102 TYR D CA 1 
ATOM 1103 C CA . THR D 2 213 ? 6.036   16.296  -13.384  1.00 20.00 ? 1103 THR D CA 1 
ATOM 1104 C CA . ASN D 2 214 ? 3.113   15.784  -15.857  1.00 20.00 ? 1104 ASN D CA 1 
ATOM 1105 C CA . PRO D 2 215 ? 2.463   12.135  -16.960  1.00 20.00 ? 1105 PRO D CA 1 
ATOM 1106 C CA . SER D 2 216 ? 5.057   10.883  -19.515  1.00 20.00 ? 1106 SER D CA 1 
ATOM 1107 C CA . GLN D 2 217 ? 3.484   10.878  -23.031  1.00 20.00 ? 1107 GLN D CA 1 
ATOM 1108 C CA . ASP D 2 218 ? 4.629   7.645   -24.775  1.00 20.00 ? 1108 ASP D CA 1 
ATOM 1109 C CA . VAL D 2 219 ? 4.391   7.411   -28.619  1.00 20.00 ? 1109 VAL D CA 1 
ATOM 1110 C CA . THR D 2 220 ? 4.980   4.262   -30.750  1.00 20.00 ? 1110 THR D CA 1 
ATOM 1111 C CA . VAL D 2 221 ? 7.164   5.393   -33.739  1.00 20.00 ? 1111 VAL D CA 1 
ATOM 1112 C CA . PRO D 2 222 ? 6.948   3.182   -36.937  1.00 20.00 ? 1112 PRO D CA 1 
ATOM 1113 C CA . CYS D 2 223 ? 9.623   1.795   -39.201  1.00 20.00 ? 1113 CYS D CA 1 
ATOM 1114 C CA . PRO D 2 224 ? 6.977   0.647   -41.821  1.00 20.00 ? 1114 PRO D CA 1 
ATOM 1115 C CA . VAL D 2 225 ? 7.642   -3.027  -42.881  1.00 20.00 ? 1115 VAL D CA 1 
ATOM 1116 C CA . PRO D 2 226 ? 4.365   -4.874  -41.700  1.00 20.00 ? 1116 PRO D CA 1 
ATOM 1117 C CA . PRO D 2 227 ? 1.467   -4.113  -44.230  1.00 20.00 ? 1117 PRO D CA 1 
ATOM 1118 C CA . PRO D 2 228 ? -2.124  -4.112  -43.641  1.00 20.00 ? 1118 PRO D CA 1 
ATOM 1119 C CA . PRO D 2 229 ? -1.603  -1.595  -46.617  1.00 20.00 ? 1119 PRO D CA 1 
ATOM 1120 C CA . PRO D 2 230 ? -2.579  -2.359  -50.318  1.00 20.00 ? 1120 PRO D CA 1 
ATOM 1121 C CA . CYS D 2 231 ? 0.594   -3.537  -52.062  1.00 20.00 ? 1121 CYS D CA 1 
ATOM 1122 C CA . CYS D 2 232 ? 1.397   -6.960  -53.190  1.00 20.00 ? 1122 CYS D CA 1 
ATOM 1123 C CA . HIS D 2 233 ? 0.459   -9.389  -50.400  1.00 20.00 ? 1123 HIS D CA 1 
ATOM 1124 C CA . PRO D 2 234 ? 2.856   -10.850 -47.766  1.00 20.00 ? 1124 PRO D CA 1 
ATOM 1125 C CA . ARG D 2 235 ? 6.421   -11.965 -48.233  1.00 20.00 ? 1125 ARG D CA 1 
ATOM 1126 C CA . LEU D 2 236 ? 9.900   -12.427 -49.721  1.00 20.00 ? 1126 LEU D CA 1 
ATOM 1127 C CA . SER D 2 237 ? 9.457   -15.836 -51.481  1.00 20.00 ? 1127 SER D CA 1 
ATOM 1128 C CA . LEU D 2 238 ? 11.959  -18.428 -52.901  1.00 20.00 ? 1128 LEU D CA 1 
ATOM 1129 C CA . HIS D 2 239 ? 11.286  -20.582 -56.018  1.00 20.00 ? 1129 HIS D CA 1 
ATOM 1130 C CA . ARG D 2 240 ? 12.940  -24.031 -56.073  1.00 20.00 ? 1130 ARG D CA 1 
ATOM 1131 C CA . PRO D 2 241 ? 14.220  -25.211 -59.512  1.00 20.00 ? 1131 PRO D CA 1 
ATOM 1132 C CA . ALA D 2 242 ? 12.233  -27.832 -61.480  1.00 20.00 ? 1132 ALA D CA 1 
ATOM 1133 C CA . LEU D 2 243 ? 13.035  -31.574 -60.990  1.00 20.00 ? 1133 LEU D CA 1 
ATOM 1134 C CA . GLU D 2 244 ? 12.769  -32.648 -64.691  1.00 20.00 ? 1134 GLU D CA 1 
ATOM 1135 C CA . ASP D 2 245 ? 15.236  -29.888 -65.832  1.00 20.00 ? 1135 ASP D CA 1 
ATOM 1136 C CA . LEU D 2 246 ? 18.094  -30.433 -63.284  1.00 20.00 ? 1136 LEU D CA 1 
ATOM 1137 C CA . LEU D 2 247 ? 18.095  -34.287 -63.745  1.00 20.00 ? 1137 LEU D CA 1 
ATOM 1138 C CA . LEU D 2 248 ? 18.372  -34.379 -67.625  1.00 20.00 ? 1138 LEU D CA 1 
ATOM 1139 C CA . GLY D 2 249 ? 21.207  -31.832 -68.227  1.00 20.00 ? 1139 GLY D CA 1 
ATOM 1140 C CA . SER D 2 250 ? 22.409  -30.114 -64.977  1.00 20.00 ? 1140 SER D CA 1 
ATOM 1141 C CA . GLU D 2 251 ? 20.462  -26.894 -65.909  1.00 20.00 ? 1141 GLU D CA 1 
ATOM 1142 C CA . ALA D 2 252 ? 19.143  -25.584 -62.532  1.00 20.00 ? 1142 ALA D CA 1 
ATOM 1143 C CA . ASN D 2 253 ? 18.438  -22.101 -61.114  1.00 20.00 ? 1143 ASN D CA 1 
ATOM 1144 C CA . LEU D 2 254 ? 16.963  -20.819 -57.791  1.00 20.00 ? 1144 LEU D CA 1 
ATOM 1145 C CA . THR D 2 255 ? 14.912  -17.550 -57.944  1.00 20.00 ? 1145 THR D CA 1 
ATOM 1146 C CA . CYS D 2 256 ? 14.741  -14.967 -55.101  1.00 20.00 ? 1146 CYS D CA 1 
ATOM 1147 C CA . THR D 2 257 ? 11.902  -12.527 -55.951  1.00 20.00 ? 1147 THR D CA 1 
ATOM 1148 C CA . LEU D 2 258 ? 10.996  -9.579  -53.625  1.00 20.00 ? 1148 LEU D CA 1 
ATOM 1149 C CA . THR D 2 259 ? 7.250   -8.884  -54.244  1.00 20.00 ? 1149 THR D CA 1 
ATOM 1150 C CA . GLY D 2 260 ? 5.663   -6.940  -51.300  1.00 20.00 ? 1150 GLY D CA 1 
ATOM 1151 C CA . LEU D 2 261 ? 6.787   -3.536  -49.844  1.00 20.00 ? 1151 LEU D CA 1 
ATOM 1152 C CA . ARG D 2 262 ? 5.780   0.053   -50.995  1.00 20.00 ? 1152 ARG D CA 1 
ATOM 1153 C CA . ASP D 2 263 ? 7.557   2.510   -53.452  1.00 20.00 ? 1153 ASP D CA 1 
ATOM 1154 C CA . ALA D 2 264 ? 10.864  3.423   -55.258  1.00 20.00 ? 1154 ALA D CA 1 
ATOM 1155 C CA . SER D 2 265 ? 14.194  2.127   -53.800  1.00 20.00 ? 1155 SER D CA 1 
ATOM 1156 C CA . GLY D 2 266 ? 16.914  -0.305  -55.072  1.00 20.00 ? 1156 GLY D CA 1 
ATOM 1157 C CA . ALA D 2 267 ? 17.712  -3.766  -53.628  1.00 20.00 ? 1157 ALA D CA 1 
ATOM 1158 C CA . THR D 2 268 ? 21.129  -5.514  -53.376  1.00 20.00 ? 1158 THR D CA 1 
ATOM 1159 C CA . PHE D 2 269 ? 21.748  -9.299  -52.878  1.00 20.00 ? 1159 PHE D CA 1 
ATOM 1160 C CA . THR D 2 270 ? 24.223  -11.501 -50.959  1.00 20.00 ? 1160 THR D CA 1 
ATOM 1161 C CA . TRP D 2 271 ? 23.977  -14.980 -52.567  1.00 20.00 ? 1161 TRP D CA 1 
ATOM 1162 C CA . THR D 2 272 ? 26.065  -17.841 -51.121  1.00 20.00 ? 1162 THR D CA 1 
ATOM 1163 C CA . PRO D 2 273 ? 28.336  -19.914 -53.468  1.00 20.00 ? 1163 PRO D CA 1 
ATOM 1164 C CA . SER D 2 274 ? 27.676  -23.638 -54.194  1.00 20.00 ? 1164 SER D CA 1 
ATOM 1165 C CA . SER D 2 275 ? 29.917  -26.714 -53.507  1.00 20.00 ? 1165 SER D CA 1 
ATOM 1166 C CA . GLY D 2 276 ? 31.896  -25.832 -56.716  1.00 20.00 ? 1166 GLY D CA 1 
ATOM 1167 C CA . LYS D 2 277 ? 32.651  -22.259 -55.409  1.00 20.00 ? 1167 LYS D CA 1 
ATOM 1168 C CA . SER D 2 278 ? 30.571  -20.335 -58.040  1.00 20.00 ? 1168 SER D CA 1 
ATOM 1169 C CA . ALA D 2 279 ? 28.299  -17.269 -57.532  1.00 20.00 ? 1169 ALA D CA 1 
ATOM 1170 C CA . VAL D 2 280 ? 26.592  -15.632 -60.587  1.00 20.00 ? 1170 VAL D CA 1 
ATOM 1171 C CA . GLN D 2 281 ? 23.660  -13.149 -60.426  1.00 20.00 ? 1171 GLN D CA 1 
ATOM 1172 C CA . GLY D 2 282 ? 21.947  -10.329 -62.406  1.00 20.00 ? 1172 GLY D CA 1 
ATOM 1173 C CA . PRO D 2 283 ? 18.813  -8.859  -60.694  1.00 20.00 ? 1173 PRO D CA 1 
ATOM 1174 C CA . PRO D 2 284 ? 16.742  -6.475  -62.975  1.00 20.00 ? 1174 PRO D CA 1 
ATOM 1175 C CA . GLU D 2 285 ? 13.857  -4.013  -62.273  1.00 20.00 ? 1175 GLU D CA 1 
ATOM 1176 C CA . ARG D 2 286 ? 10.324  -4.592  -63.786  1.00 20.00 ? 1176 ARG D CA 1 
ATOM 1177 C CA . ASP D 2 287 ? 6.653   -3.407  -63.951  1.00 20.00 ? 1177 ASP D CA 1 
ATOM 1178 C CA . LEU D 2 288 ? 3.742   -5.888  -63.331  1.00 20.00 ? 1178 LEU D CA 1 
ATOM 1179 C CA . CYS D 2 289 ? 1.069   -4.193  -61.113  1.00 20.00 ? 1179 CYS D CA 1 
ATOM 1180 C CA . GLY D 2 290 ? 2.528   -0.640  -60.633  1.00 20.00 ? 1180 GLY D CA 1 
ATOM 1181 C CA . CYS D 2 291 ? 5.595   -0.699  -58.251  1.00 20.00 ? 1181 CYS D CA 1 
ATOM 1182 C CA . TYR D 2 292 ? 9.295   -1.428  -59.180  1.00 20.00 ? 1182 TYR D CA 1 
ATOM 1183 C CA . SER D 2 293 ? 10.339  -5.148  -58.797  1.00 20.00 ? 1183 SER D CA 1 
ATOM 1184 C CA . VAL D 2 294 ? 13.794  -6.745  -58.093  1.00 20.00 ? 1184 VAL D CA 1 
ATOM 1185 C CA . SER D 2 295 ? 14.316  -10.538 -58.747  1.00 20.00 ? 1185 SER D CA 1 
ATOM 1186 C CA . SER D 2 296 ? 17.631  -12.522 -58.835  1.00 20.00 ? 1186 SER D CA 1 
ATOM 1187 C CA . VAL D 2 297 ? 18.456  -16.005 -60.213  1.00 20.00 ? 1187 VAL D CA 1 
ATOM 1188 C CA . LEU D 2 298 ? 21.496  -18.061 -59.018  1.00 20.00 ? 1188 LEU D CA 1 
ATOM 1189 C CA . PRO D 2 299 ? 22.399  -20.780 -61.649  1.00 20.00 ? 1189 PRO D CA 1 
ATOM 1190 C CA . GLY D 2 300 ? 23.413  -23.943 -59.678  1.00 20.00 ? 1190 GLY D CA 1 
ATOM 1191 C CA . CYS D 2 301 ? 24.717  -27.436 -60.603  1.00 20.00 ? 1191 CYS D CA 1 
ATOM 1192 C CA . ALA D 2 302 ? 23.083  -30.896 -59.988  1.00 20.00 ? 1192 ALA D CA 1 
ATOM 1193 C CA . GLN D 2 303 ? 25.716  -32.236 -57.470  1.00 20.00 ? 1193 GLN D CA 1 
ATOM 1194 C CA . PRO D 2 304 ? 25.106  -29.535 -54.720  1.00 20.00 ? 1194 PRO D CA 1 
ATOM 1195 C CA . TRP D 2 305 ? 21.307  -30.174 -54.945  1.00 20.00 ? 1195 TRP D CA 1 
ATOM 1196 C CA . ASN D 2 306 ? 21.806  -33.999 -54.846  1.00 20.00 ? 1196 ASN D CA 1 
ATOM 1197 C CA . HIS D 2 307 ? 24.265  -33.787 -51.884  1.00 20.00 ? 1197 HIS D CA 1 
ATOM 1198 C CA . GLY D 2 308 ? 22.196  -31.049 -50.080  1.00 20.00 ? 1198 GLY D CA 1 
ATOM 1199 C CA . GLU D 2 309 ? 23.811  -27.559 -49.892  1.00 20.00 ? 1199 GLU D CA 1 
ATOM 1200 C CA . THR D 2 310 ? 22.256  -24.564 -48.014  1.00 20.00 ? 1200 THR D CA 1 
ATOM 1201 C CA . PHE D 2 311 ? 21.066  -21.989 -50.622  1.00 20.00 ? 1201 PHE D CA 1 
ATOM 1202 C CA . THR D 2 312 ? 20.430  -18.728 -48.685  1.00 20.00 ? 1202 THR D CA 1 
ATOM 1203 C CA . CYS D 2 313 ? 19.397  -15.322 -50.139  1.00 20.00 ? 1203 CYS D CA 1 
ATOM 1204 C CA . THR D 2 314 ? 19.932  -12.210 -47.933  1.00 20.00 ? 1204 THR D CA 1 
ATOM 1205 C CA . ALA D 2 315 ? 18.748  -8.747  -49.125  1.00 20.00 ? 1205 ALA D CA 1 
ATOM 1206 C CA . ALA D 2 316 ? 19.882  -5.520  -47.356  1.00 20.00 ? 1206 ALA D CA 1 
ATOM 1207 C CA . HIS D 2 317 ? 17.674  -2.369  -47.469  1.00 20.00 ? 1207 HIS D CA 1 
ATOM 1208 C CA . PRO D 2 318 ? 17.276  1.028   -45.620  1.00 20.00 ? 1208 PRO D CA 1 
ATOM 1209 C CA . GLU D 2 319 ? 13.562  0.590   -44.822  1.00 20.00 ? 1209 GLU D CA 1 
ATOM 1210 C CA . LEU D 2 320 ? 13.694  -3.236  -44.824  1.00 20.00 ? 1210 LEU D CA 1 
ATOM 1211 C CA . LYS D 2 321 ? 16.113  -2.613  -41.876  1.00 20.00 ? 1211 LYS D CA 1 
ATOM 1212 C CA . THR D 2 322 ? 16.458  -6.302  -40.849  1.00 20.00 ? 1212 THR D CA 1 
ATOM 1213 C CA . PRO D 2 323 ? 17.856  -8.015  -44.005  1.00 20.00 ? 1213 PRO D CA 1 
ATOM 1214 C CA . LEU D 2 324 ? 15.370  -10.886 -44.648  1.00 20.00 ? 1214 LEU D CA 1 
ATOM 1215 C CA . THR D 2 325 ? 17.264  -14.222 -44.601  1.00 20.00 ? 1215 THR D CA 1 
ATOM 1216 C CA . ALA D 2 326 ? 15.739  -17.186 -46.511  1.00 20.00 ? 1216 ALA D CA 1 
ATOM 1217 C CA . ASN D 2 327 ? 17.304  -20.697 -46.724  1.00 20.00 ? 1217 ASN D CA 1 
ATOM 1218 C CA . ILE D 2 328 ? 16.099  -23.713 -48.768  1.00 20.00 ? 1218 ILE D CA 1 
ATOM 1219 C CA . THR D 2 329 ? 17.474  -27.309 -48.931  1.00 20.00 ? 1219 THR D CA 1 
ATOM 1220 C CA . LYS D 2 330 ? 16.077  -30.804 -49.647  1.00 20.00 ? 1220 LYS D CA 1 
ATOM 1221 C CA . SER D 2 331 ? 13.964  -32.662 -47.005  1.00 20.00 ? 1221 SER D CA 1 
ATOM 1222 C CA . GLY D 2 332 ? 13.894  -35.846 -44.868  1.00 20.00 ? 1222 GLY D CA 1 
ATOM 1223 C CA . ASN D 2 333 ? 16.522  -38.534 -44.172  1.00 20.00 ? 1223 ASN D CA 1 
ATOM 1224 C CA . THR D 2 334 ? 17.702  -41.249 -46.615  1.00 20.00 ? 1224 THR D CA 1 
ATOM 1225 C CA . PHE D 2 335 ? 15.718  -44.530 -47.039  1.00 20.00 ? 1225 PHE D CA 1 
ATOM 1226 C CA . ARG D 2 336 ? 16.835  -47.487 -49.246  1.00 20.00 ? 1226 ARG D CA 1 
ATOM 1227 C CA . PRO D 2 337 ? 14.350  -48.201 -52.138  1.00 20.00 ? 1227 PRO D CA 1 
ATOM 1228 C CA . GLU D 2 338 ? 12.894  -51.758 -52.413  1.00 20.00 ? 1228 GLU D CA 1 
ATOM 1229 C CA . VAL D 2 339 ? 12.217  -52.722 -56.081  1.00 20.00 ? 1229 VAL D CA 1 
ATOM 1230 C CA . HIS D 2 340 ? 9.480   -55.358 -56.780  1.00 20.00 ? 1230 HIS D CA 1 
ATOM 1231 C CA . LEU D 2 341 ? 9.167   -56.371 -60.522  1.00 20.00 ? 1231 LEU D CA 1 
ATOM 1232 C CA . LEU D 2 342 ? 5.584   -57.669 -61.039  1.00 20.00 ? 1232 LEU D CA 1 
ATOM 1233 C CA . PRO D 2 343 ? 4.753   -59.980 -64.005  1.00 20.00 ? 1233 PRO D CA 1 
ATOM 1234 C CA . PRO D 2 344 ? 1.665   -59.455 -66.277  1.00 20.00 ? 1234 PRO D CA 1 
ATOM 1235 C CA . PRO D 2 345 ? -1.644  -60.988 -64.937  1.00 20.00 ? 1235 PRO D CA 1 
ATOM 1236 C CA . SER D 2 346 ? -3.538  -63.987 -66.460  1.00 20.00 ? 1236 SER D CA 1 
ATOM 1237 C CA . GLU D 2 347 ? -6.445  -62.029 -68.118  1.00 20.00 ? 1237 GLU D CA 1 
ATOM 1238 C CA . GLU D 2 348 ? -4.018  -59.434 -69.689  1.00 20.00 ? 1238 GLU D CA 1 
ATOM 1239 C CA . LEU D 2 349 ? -2.507  -62.196 -71.931  1.00 20.00 ? 1239 LEU D CA 1 
ATOM 1240 C CA . ALA D 2 350 ? -5.856  -62.081 -73.890  1.00 20.00 ? 1240 ALA D CA 1 
ATOM 1241 C CA . LEU D 2 351 ? -4.857  -58.742 -75.609  1.00 20.00 ? 1241 LEU D CA 1 
ATOM 1242 C CA . ASN D 2 352 ? -2.302  -58.373 -78.503  1.00 20.00 ? 1242 ASN D CA 1 
ATOM 1243 C CA . GLU D 2 353 ? -0.497  -55.012 -79.071  1.00 20.00 ? 1243 GLU D CA 1 
ATOM 1244 C CA . LEU D 2 354 ? 0.451   -54.067 -75.426  1.00 20.00 ? 1244 LEU D CA 1 
ATOM 1245 C CA . VAL D 2 355 ? 1.592   -55.872 -72.211  1.00 20.00 ? 1245 VAL D CA 1 
ATOM 1246 C CA . THR D 2 356 ? 2.202   -53.896 -68.946  1.00 20.00 ? 1246 THR D CA 1 
ATOM 1247 C CA . LEU D 2 357 ? 5.379   -54.715 -66.937  1.00 20.00 ? 1247 LEU D CA 1 
ATOM 1248 C CA . THR D 2 358 ? 4.950   -53.157 -63.444  1.00 20.00 ? 1248 THR D CA 1 
ATOM 1249 C CA . CYS D 2 359 ? 8.096   -52.569 -61.281  1.00 20.00 ? 1249 CYS D CA 1 
ATOM 1250 C CA . LEU D 2 360 ? 7.208   -50.998 -57.910  1.00 20.00 ? 1250 LEU D CA 1 
ATOM 1251 C CA . ALA D 2 361 ? 9.943   -49.274 -55.841  1.00 20.00 ? 1251 ALA D CA 1 
ATOM 1252 C CA . ARG D 2 362 ? 8.655   -48.435 -52.325  1.00 20.00 ? 1252 ARG D CA 1 
ATOM 1253 C CA . GLY D 2 363 ? 10.490  -47.523 -49.069  1.00 20.00 ? 1253 GLY D CA 1 
ATOM 1254 C CA . PHE D 2 364 ? 12.478  -44.425 -50.226  1.00 20.00 ? 1254 PHE D CA 1 
ATOM 1255 C CA . SER D 2 365 ? 13.131  -40.800 -49.207  1.00 20.00 ? 1255 SER D CA 1 
ATOM 1256 C CA . PRO D 2 366 ? 13.501  -38.137 -50.512  1.00 20.00 ? 1256 PRO D CA 1 
ATOM 1257 C CA . LYS D 2 367 ? 11.095  -38.344 -53.518  1.00 20.00 ? 1257 LYS D CA 1 
ATOM 1258 C CA . ASP D 2 368 ? 14.013  -37.746 -56.019  1.00 20.00 ? 1258 ASP D CA 1 
ATOM 1259 C CA . VAL D 2 369 ? 14.322  -41.069 -57.950  1.00 20.00 ? 1259 VAL D CA 1 
ATOM 1260 C CA . LEU D 2 370 ? 15.226  -41.715 -61.635  1.00 20.00 ? 1260 LEU D CA 1 
ATOM 1261 C CA . VAL D 2 371 ? 13.552  -44.895 -63.018  1.00 20.00 ? 1261 VAL D CA 1 
ATOM 1262 C CA . ARG D 2 372 ? 14.367  -46.321 -66.501  1.00 20.00 ? 1262 ARG D CA 1 
ATOM 1263 C CA . TRP D 2 373 ? 13.872  -49.545 -68.532  1.00 20.00 ? 1263 TRP D CA 1 
ATOM 1264 C CA . LEU D 2 374 ? 16.141  -51.663 -70.789  1.00 20.00 ? 1264 LEU D CA 1 
ATOM 1265 C CA . GLN D 2 375 ? 15.881  -54.397 -73.459  1.00 20.00 ? 1265 GLN D CA 1 
ATOM 1266 C CA . GLY D 2 376 ? 17.573  -57.832 -72.950  1.00 20.00 ? 1266 GLY D CA 1 
ATOM 1267 C CA . SER D 2 377 ? 17.942  -59.012 -76.612  1.00 20.00 ? 1267 SER D CA 1 
ATOM 1268 C CA . GLN D 2 378 ? 18.778  -55.750 -78.469  1.00 20.00 ? 1268 GLN D CA 1 
ATOM 1269 C CA . GLU D 2 379 ? 20.744  -54.496 -75.333  1.00 20.00 ? 1269 GLU D CA 1 
ATOM 1270 C CA . LEU D 2 380 ? 19.217  -50.975 -75.918  1.00 20.00 ? 1270 LEU D CA 1 
ATOM 1271 C CA . PRO D 2 381 ? 17.037  -48.801 -73.590  1.00 20.00 ? 1271 PRO D CA 1 
ATOM 1272 C CA . ARG D 2 382 ? 13.223  -48.928 -73.988  1.00 20.00 ? 1272 ARG D CA 1 
ATOM 1273 C CA . GLU D 2 383 ? 10.982  -46.065 -75.295  1.00 20.00 ? 1273 GLU D CA 1 
ATOM 1274 C CA . LYS D 2 384 ? 7.325   -46.756 -74.216  1.00 20.00 ? 1274 LYS D CA 1 
ATOM 1275 C CA . TYR D 2 385 ? 7.084   -46.265 -70.400  1.00 20.00 ? 1275 TYR D CA 1 
ATOM 1276 C CA . LEU D 2 386 ? 5.530   -43.799 -67.876  1.00 20.00 ? 1276 LEU D CA 1 
ATOM 1277 C CA . THR D 2 387 ? 6.331   -42.754 -64.265  1.00 20.00 ? 1277 THR D CA 1 
ATOM 1278 C CA . TRP D 2 388 ? 3.732   -42.341 -61.462  1.00 20.00 ? 1278 TRP D CA 1 
ATOM 1279 C CA . ALA D 2 389 ? 4.016   -40.328 -58.193  1.00 20.00 ? 1279 ALA D CA 1 
ATOM 1280 C CA . SER D 2 390 ? 2.236   -39.371 -54.901  1.00 20.00 ? 1280 SER D CA 1 
ATOM 1281 C CA . ARG D 2 391 ? 3.254   -38.550 -51.261  1.00 20.00 ? 1281 ARG D CA 1 
ATOM 1282 C CA . GLN D 2 392 ? 2.215   -40.544 -48.136  1.00 20.00 ? 1282 GLN D CA 1 
ATOM 1283 C CA . GLU D 2 393 ? 1.532   -38.002 -45.316  1.00 20.00 ? 1283 GLU D CA 1 
ATOM 1284 C CA . PRO D 2 394 ? -0.925  -39.665 -42.828  1.00 20.00 ? 1284 PRO D CA 1 
ATOM 1285 C CA . SER D 2 395 ? -1.798  -38.403 -39.291  1.00 20.00 ? 1285 SER D CA 1 
ATOM 1286 C CA . GLN D 2 396 ? 0.795   -40.737 -37.612  1.00 20.00 ? 1286 GLN D CA 1 
ATOM 1287 C CA . GLY D 2 397 ? 4.667   -40.525 -37.680  1.00 20.00 ? 1287 GLY D CA 1 
ATOM 1288 C CA . THR D 2 398 ? 5.341   -42.679 -40.804  1.00 20.00 ? 1288 THR D CA 1 
ATOM 1289 C CA . THR D 2 399 ? 6.507   -41.034 -44.096  1.00 20.00 ? 1289 THR D CA 1 
ATOM 1290 C CA . THR D 2 400 ? 7.717   -42.879 -47.208  1.00 20.00 ? 1290 THR D CA 1 
ATOM 1291 C CA . PHE D 2 401 ? 7.650   -42.183 -50.960  1.00 20.00 ? 1291 PHE D CA 1 
ATOM 1292 C CA . ALA D 2 402 ? 7.040   -45.006 -53.459  1.00 20.00 ? 1292 ALA D CA 1 
ATOM 1293 C CA . VAL D 2 403 ? 6.800   -45.200 -57.294  1.00 20.00 ? 1293 VAL D CA 1 
ATOM 1294 C CA . THR D 2 404 ? 5.265   -47.393 -60.022  1.00 20.00 ? 1294 THR D CA 1 
ATOM 1295 C CA . SER D 2 405 ? 6.678   -47.949 -63.575  1.00 20.00 ? 1295 SER D CA 1 
ATOM 1296 C CA . ILE D 2 406 ? 4.732   -49.342 -66.621  1.00 20.00 ? 1296 ILE D CA 1 
ATOM 1297 C CA . LEU D 2 407 ? 6.638   -50.771 -69.650  1.00 20.00 ? 1297 LEU D CA 1 
ATOM 1298 C CA . ARG D 2 408 ? 4.161   -51.614 -72.481  1.00 20.00 ? 1298 ARG D CA 1 
ATOM 1299 C CA . VAL D 2 409 ? 5.800   -54.204 -74.848  1.00 20.00 ? 1299 VAL D CA 1 
ATOM 1300 C CA . ALA D 2 410 ? 4.276   -56.693 -77.358  1.00 20.00 ? 1300 ALA D CA 1 
ATOM 1301 C CA . ALA D 2 411 ? 2.373   -59.932 -76.497  1.00 20.00 ? 1301 ALA D CA 1 
ATOM 1302 C CA . GLU D 2 412 ? 4.470   -62.159 -78.817  1.00 20.00 ? 1302 GLU D CA 1 
ATOM 1303 C CA . ASP D 2 413 ? 7.830   -60.779 -77.439  1.00 20.00 ? 1303 ASP D CA 1 
ATOM 1304 C CA . TRP D 2 414 ? 6.941   -61.480 -73.739  1.00 20.00 ? 1304 TRP D CA 1 
ATOM 1305 C CA . LYS D 2 415 ? 6.506   -65.222 -74.653  1.00 20.00 ? 1305 LYS D CA 1 
ATOM 1306 C CA . LYS D 2 416 ? 9.823   -65.541 -76.647  1.00 20.00 ? 1306 LYS D CA 1 
ATOM 1307 C CA . GLY D 2 417 ? 11.929  -65.490 -73.398  1.00 20.00 ? 1307 GLY D CA 1 
ATOM 1308 C CA . ASP D 2 418 ? 13.363  -61.921 -73.330  1.00 20.00 ? 1308 ASP D CA 1 
ATOM 1309 C CA . THR D 2 419 ? 14.489  -60.376 -69.984  1.00 20.00 ? 1309 THR D CA 1 
ATOM 1310 C CA . PHE D 2 420 ? 13.406  -56.755 -69.112  1.00 20.00 ? 1310 PHE D CA 1 
ATOM 1311 C CA . SER D 2 421 ? 15.393  -54.571 -66.629  1.00 20.00 ? 1311 SER D CA 1 
ATOM 1312 C CA . CYS D 2 422 ? 13.927  -51.870 -64.313  1.00 20.00 ? 1312 CYS D CA 1 
ATOM 1313 C CA . MET D 2 423 ? 16.883  -49.702 -63.205  1.00 20.00 ? 1313 MET D CA 1 
ATOM 1314 C CA . VAL D 2 424 ? 16.186  -47.398 -60.212  1.00 20.00 ? 1314 VAL D CA 1 
ATOM 1315 C CA . GLY D 2 425 ? 18.560  -44.554 -59.109  1.00 20.00 ? 1315 GLY D CA 1 
ATOM 1316 C CA . HIS D 2 426 ? 18.401  -42.998 -55.587  1.00 20.00 ? 1316 HIS D CA 1 
ATOM 1317 C CA . GLU D 2 427 ? 20.961  -41.630 -53.036  1.00 20.00 ? 1317 GLU D CA 1 
ATOM 1318 C CA . ALA D 2 428 ? 20.424  -44.336 -50.315  1.00 20.00 ? 1318 ALA D CA 1 
ATOM 1319 C CA . LEU D 2 429 ? 21.315  -47.112 -52.859  1.00 20.00 ? 1319 LEU D CA 1 
ATOM 1320 C CA . PRO D 2 430 ? 24.683  -49.000 -52.581  1.00 20.00 ? 1320 PRO D CA 1 
ATOM 1321 C CA . LEU D 2 431 ? 26.200  -47.496 -55.805  1.00 20.00 ? 1321 LEU D CA 1 
ATOM 1322 C CA . ALA D 2 432 ? 23.438  -44.864 -56.402  1.00 20.00 ? 1322 ALA D CA 1 
ATOM 1323 C CA . PHE D 2 433 ? 22.014  -47.477 -58.866  1.00 20.00 ? 1323 PHE D CA 1 
ATOM 1324 C CA . THR D 2 434 ? 20.036  -50.761 -58.520  1.00 20.00 ? 1324 THR D CA 1 
ATOM 1325 C CA . GLN D 2 435 ? 18.549  -53.069 -61.189  1.00 20.00 ? 1325 GLN D CA 1 
ATOM 1326 C CA . LYS D 2 436 ? 15.948  -55.879 -60.885  1.00 20.00 ? 1326 LYS D CA 1 
ATOM 1327 C CA . THR D 2 437 ? 14.782  -58.058 -63.845  1.00 20.00 ? 1327 THR D CA 1 
ATOM 1328 C CA . ILE D 2 438 ? 11.688  -59.931 -65.060  1.00 20.00 ? 1328 ILE D CA 1 
ATOM 1329 C CA . ASP D 2 439 ? 11.511  -63.079 -67.198  1.00 20.00 ? 1329 ASP D CA 1 
ATOM 1330 C CA . ARG D 2 440 ? 8.720   -65.441 -68.375  1.00 20.00 ? 1330 ARG D CA 1 
ATOM 1331 C CA . LEU D 2 441 ? 11.084  -68.325 -67.446  1.00 20.00 ? 1331 LEU D CA 1 
ATOM 1332 C CA . ALA D 2 442 ? 10.324  -68.827 -63.704  1.00 20.00 ? 1332 ALA D CA 1 
ATOM 1333 C CA . GLY D 2 443 ? 12.357  -71.514 -61.917  1.00 20.00 ? 1333 GLY D CA 1 
ATOM 1334 C CA . LYS D 2 444 ? 11.309  -72.105 -58.259  1.00 20.00 ? 1334 LYS D CA 1 
ATOM 1335 C CA . PRO D 2 445 ? 14.742  -72.033 -56.352  1.00 20.00 ? 1335 PRO D CA 1 
ATOM 1336 C CA . THR D 2 446 ? 13.917  -68.668 -54.654  1.00 20.00 ? 1336 THR D CA 1 
ATOM 1337 C CA . HIS D 2 447 ? 14.504  -65.602 -56.948  1.00 20.00 ? 1337 HIS D CA 1 
ATOM 1338 C CA . VAL D 2 448 ? 18.063  -65.379 -58.410  1.00 20.00 ? 1338 VAL D CA 1 
ATOM 1339 C CA . ASN D 2 449 ? 19.600  -62.385 -60.269  1.00 20.00 ? 1339 ASN D CA 1 
ATOM 1340 C CA . VAL D 2 450 ? 21.778  -62.540 -63.446  1.00 20.00 ? 1340 VAL D CA 1 
ATOM 1341 C CA . SER D 2 451 ? 25.595  -63.015 -63.456  1.00 20.00 ? 1341 SER D CA 1 
ATOM 1342 C CA . VAL D 2 452 ? 28.267  -60.275 -63.893  1.00 20.00 ? 1342 VAL D CA 1 
ATOM 1343 C CA . VAL D 2 453 ? 28.909  -58.514 -67.275  1.00 20.00 ? 1343 VAL D CA 1 
ATOM 1344 C CA . MET D 2 454 ? 32.030  -56.231 -67.245  1.00 20.00 ? 1344 MET D CA 1 
ATOM 1345 C CA . ALA D 2 455 ? 34.965  -56.152 -64.769  1.00 20.00 ? 1345 ALA D CA 1 
ATOM 1346 C CA . GLU D 2 456 ? 38.314  -54.335 -64.149  1.00 20.00 ? 1346 GLU D CA 1 
ATOM 1347 C CA . VAL D 2 457 ? 36.847  -51.144 -65.807  1.00 20.00 ? 1347 VAL D CA 1 
ATOM 1348 C CA . ASP D 2 458 ? 35.016  -48.824 -63.315  1.00 20.00 ? 1348 ASP D CA 1 
ATOM 1349 C CA . GLY D 2 459 ? 36.368  -45.513 -64.854  1.00 20.00 ? 1349 GLY D CA 1 
ATOM 1350 C CA . THR D 2 460 ? 39.199  -44.403 -62.470  1.00 20.00 ? 1350 THR D CA 1 
ATOM 1351 C CA . CYS D 2 461 ? 41.509  -47.068 -64.072  1.00 20.00 ? 1351 CYS D CA 1 
ATOM 1352 C CA . TYR D 2 462 ? 40.884  -46.642 -67.865  1.00 20.00 ? 1352 TYR D CA 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1    1    GLU GLU A . n 
A 1 2   LEU 2   2    2    LEU LEU A . n 
A 1 3   VAL 3   3    3    VAL VAL A . n 
A 1 4   MET 4   4    4    MET MET A . n 
A 1 5   THR 5   5    5    THR THR A . n 
A 1 6   GLN 6   6    6    GLN GLN A . n 
A 1 7   SER 7   7    7    SER SER A . n 
A 1 8   PRO 8   8    8    PRO PRO A . n 
A 1 9   SER 9   9    9    SER SER A . n 
A 1 10  SER 10  10   10   SER SER A . n 
A 1 11  LEU 11  11   11   LEU LEU A . n 
A 1 12  SER 12  12   12   SER SER A . n 
A 1 13  ALA 13  13   13   ALA ALA A . n 
A 1 14  SER 14  14   14   SER SER A . n 
A 1 15  VAL 15  15   15   VAL VAL A . n 
A 1 16  GLY 16  16   16   GLY GLY A . n 
A 1 17  ASP 17  17   17   ASP ASP A . n 
A 1 18  ARG 18  18   18   ARG ARG A . n 
A 1 19  VAL 19  19   19   VAL VAL A . n 
A 1 20  ASN 20  20   20   ASN ASN A . n 
A 1 21  ILE 21  21   21   ILE ILE A . n 
A 1 22  ALA 22  22   22   ALA ALA A . n 
A 1 23  CYS 23  23   23   CYS CYS A . n 
A 1 24  ARG 24  24   24   ARG ARG A . n 
A 1 25  ALA 25  25   25   ALA ALA A . n 
A 1 26  SER 26  26   26   SER SER A . n 
A 1 27  GLN 27  27   27   GLN GLN A . n 
A 1 28  GLY 28  28   28   GLY GLY A . n 
A 1 29  ILE 29  29   29   ILE ILE A . n 
A 1 30  SER 30  30   30   SER SER A . n 
A 1 31  SER 31  31   31   SER SER A . n 
A 1 32  ALA 32  32   32   ALA ALA A . n 
A 1 33  LEU 33  33   33   LEU LEU A . n 
A 1 34  ALA 34  34   34   ALA ALA A . n 
A 1 35  TRP 35  35   35   TRP TRP A . n 
A 1 36  TYR 36  36   36   TYR TYR A . n 
A 1 37  GLN 37  37   37   GLN GLN A . n 
A 1 38  GLN 38  38   38   GLN GLN A . n 
A 1 39  LYS 39  39   39   LYS LYS A . n 
A 1 40  PRO 40  40   40   PRO PRO A . n 
A 1 41  GLY 41  41   41   GLY GLY A . n 
A 1 42  LYS 42  42   42   LYS LYS A . n 
A 1 43  ALA 43  43   43   ALA ALA A . n 
A 1 44  PRO 44  44   44   PRO PRO A . n 
A 1 45  ARG 45  45   45   ARG ARG A . n 
A 1 46  LEU 46  46   46   LEU LEU A . n 
A 1 47  LEU 47  47   47   LEU LEU A . n 
A 1 48  ILE 48  48   48   ILE ILE A . n 
A 1 49  TYR 49  49   49   TYR TYR A . n 
A 1 50  ASP 50  50   50   ASP ASP A . n 
A 1 51  ALA 51  51   51   ALA ALA A . n 
A 1 52  SER 52  52   52   SER SER A . n 
A 1 53  ASN 53  53   53   ASN ASN A . n 
A 1 54  LEU 54  54   54   LEU LEU A . n 
A 1 55  GLU 55  55   55   GLU GLU A . n 
A 1 56  SER 56  56   56   SER SER A . n 
A 1 57  GLY 57  57   57   GLY GLY A . n 
A 1 58  VAL 58  58   58   VAL VAL A . n 
A 1 59  PRO 59  59   59   PRO PRO A . n 
A 1 60  SER 60  60   60   SER SER A . n 
A 1 61  ARG 61  61   61   ARG ARG A . n 
A 1 62  PHE 62  62   62   PHE PHE A . n 
A 1 63  SER 63  63   63   SER SER A . n 
A 1 64  GLY 64  64   64   GLY GLY A . n 
A 1 65  SER 65  65   65   SER SER A . n 
A 1 66  GLY 66  66   66   GLY GLY A . n 
A 1 67  SER 67  67   67   SER SER A . n 
A 1 68  GLY 68  68   68   GLY GLY A . n 
A 1 69  THR 69  69   69   THR THR A . n 
A 1 70  ASP 70  70   70   ASP ASP A . n 
A 1 71  PHE 71  71   71   PHE PHE A . n 
A 1 72  THR 72  72   72   THR THR A . n 
A 1 73  LEU 73  73   73   LEU LEU A . n 
A 1 74  THR 74  74   74   THR THR A . n 
A 1 75  ILE 75  75   75   ILE ILE A . n 
A 1 76  SER 76  76   76   SER SER A . n 
A 1 77  SER 77  77   77   SER SER A . n 
A 1 78  LEU 78  78   78   LEU LEU A . n 
A 1 79  GLN 79  79   79   GLN GLN A . n 
A 1 80  PRO 80  80   80   PRO PRO A . n 
A 1 81  GLU 81  81   81   GLU GLU A . n 
A 1 82  ASP 82  82   82   ASP ASP A . n 
A 1 83  PHE 83  83   83   PHE PHE A . n 
A 1 84  ALA 84  84   84   ALA ALA A . n 
A 1 85  ILE 85  85   85   ILE ILE A . n 
A 1 86  TYR 86  86   86   TYR TYR A . n 
A 1 87  TYR 87  87   87   TYR TYR A . n 
A 1 88  CYS 88  88   88   CYS CYS A . n 
A 1 89  GLN 89  89   89   GLN GLN A . n 
A 1 90  GLN 90  90   90   GLN GLN A . n 
A 1 91  PHE 91  91   91   PHE PHE A . n 
A 1 92  ASN 92  92   92   ASN ASN A . n 
A 1 93  SER 93  93   93   SER SER A . n 
A 1 94  TYR 94  94   94   TYR TYR A . n 
A 1 95  PRO 95  95   95   PRO PRO A . n 
A 1 96  LEU 96  96   96   LEU LEU A . n 
A 1 97  THR 97  97   97   THR THR A . n 
A 1 98  PHE 98  98   98   PHE PHE A . n 
A 1 99  GLY 99  99   99   GLY GLY A . n 
A 1 100 GLY 100 100  100  GLY GLY A . n 
A 1 101 GLY 101 101  101  GLY GLY A . n 
A 1 102 THR 102 102  102  THR THR A . n 
A 1 103 LYS 103 103  103  LYS LYS A . n 
A 1 104 VAL 104 104  104  VAL VAL A . n 
A 1 105 GLU 105 105  105  GLU GLU A . n 
A 1 106 ILE 106 106  106  ILE ILE A . n 
A 1 107 LYS 107 107  107  LYS LYS A . n 
A 1 108 ARG 108 108  108  ARG ARG A . n 
A 1 109 THR 109 109  109  THR THR A . n 
A 1 110 VAL 110 110  110  VAL VAL A . n 
A 1 111 ALA 111 111  111  ALA ALA A . n 
A 1 112 ALA 112 112  112  ALA ALA A . n 
A 1 113 PRO 113 113  113  PRO PRO A . n 
A 1 114 SER 114 114  114  SER SER A . n 
A 1 115 VAL 115 115  115  VAL VAL A . n 
A 1 116 PHE 116 116  116  PHE PHE A . n 
A 1 117 ILE 117 117  117  ILE ILE A . n 
A 1 118 PHE 118 118  118  PHE PHE A . n 
A 1 119 PRO 119 119  119  PRO PRO A . n 
A 1 120 PRO 120 120  120  PRO PRO A . n 
A 1 121 SER 121 121  121  SER SER A . n 
A 1 122 ASP 122 122  122  ASP ASP A . n 
A 1 123 GLU 123 123  123  GLU GLU A . n 
A 1 124 GLN 124 124  124  GLN GLN A . n 
A 1 125 LEU 125 125  125  LEU LEU A . n 
A 1 126 LYS 126 126  126  LYS LYS A . n 
A 1 127 SER 127 127  127  SER SER A . n 
A 1 128 GLY 128 128  128  GLY GLY A . n 
A 1 129 THR 129 129  129  THR THR A . n 
A 1 130 ALA 130 130  130  ALA ALA A . n 
A 1 131 SER 131 131  131  SER SER A . n 
A 1 132 VAL 132 132  132  VAL VAL A . n 
A 1 133 VAL 133 133  133  VAL VAL A . n 
A 1 134 CYS 134 134  134  CYS CYS A . n 
A 1 135 LEU 135 135  135  LEU LEU A . n 
A 1 136 LEU 136 136  136  LEU LEU A . n 
A 1 137 ASN 137 137  137  ASN ASN A . n 
A 1 138 ASN 138 138  138  ASN ASN A . n 
A 1 139 PHE 139 139  139  PHE PHE A . n 
A 1 140 TYR 140 140  140  TYR TYR A . n 
A 1 141 PRO 141 141  141  PRO PRO A . n 
A 1 142 ARG 142 142  142  ARG ARG A . n 
A 1 143 GLU 143 143  143  GLU GLU A . n 
A 1 144 ALA 144 144  144  ALA ALA A . n 
A 1 145 LYS 145 145  145  LYS LYS A . n 
A 1 146 VAL 146 146  146  VAL VAL A . n 
A 1 147 GLN 147 147  147  GLN GLN A . n 
A 1 148 TRP 148 148  148  TRP TRP A . n 
A 1 149 LYS 149 149  149  LYS LYS A . n 
A 1 150 VAL 150 150  150  VAL VAL A . n 
A 1 151 ASP 151 151  151  ASP ASP A . n 
A 1 152 ASN 152 152  152  ASN ASN A . n 
A 1 153 ALA 153 153  153  ALA ALA A . n 
A 1 154 LEU 154 154  154  LEU LEU A . n 
A 1 155 GLN 155 155  155  GLN GLN A . n 
A 1 156 SER 156 156  156  SER SER A . n 
A 1 157 GLY 157 157  157  GLY GLY A . n 
A 1 158 ASN 158 158  158  ASN ASN A . n 
A 1 159 SER 159 159  159  SER SER A . n 
A 1 160 GLN 160 160  160  GLN GLN A . n 
A 1 161 GLU 161 161  161  GLU GLU A . n 
A 1 162 SER 162 162  162  SER SER A . n 
A 1 163 VAL 163 163  163  VAL VAL A . n 
A 1 164 THR 164 164  164  THR THR A . n 
A 1 165 GLU 165 165  165  GLU GLU A . n 
A 1 166 GLN 166 166  166  GLN GLN A . n 
A 1 167 ASP 167 167  167  ASP ASP A . n 
A 1 168 SER 168 168  168  SER SER A . n 
A 1 169 LYS 169 169  169  LYS LYS A . n 
A 1 170 ASP 170 170  170  ASP ASP A . n 
A 1 171 SER 171 171  171  SER SER A . n 
A 1 172 THR 172 172  172  THR THR A . n 
A 1 173 TYR 173 173  173  TYR TYR A . n 
A 1 174 SER 174 174  174  SER SER A . n 
A 1 175 LEU 175 175  175  LEU LEU A . n 
A 1 176 SER 176 176  176  SER SER A . n 
A 1 177 SER 177 177  177  SER SER A . n 
A 1 178 THR 178 178  178  THR THR A . n 
A 1 179 LEU 179 179  179  LEU LEU A . n 
A 1 180 THR 180 180  180  THR THR A . n 
A 1 181 LEU 181 181  181  LEU LEU A . n 
A 1 182 SER 182 182  182  SER SER A . n 
A 1 183 LYS 183 183  183  LYS LYS A . n 
A 1 184 ALA 184 184  184  ALA ALA A . n 
A 1 185 ASP 185 185  185  ASP ASP A . n 
A 1 186 TYR 186 186  186  TYR TYR A . n 
A 1 187 GLU 187 187  187  GLU GLU A . n 
A 1 188 LYS 188 188  188  LYS LYS A . n 
A 1 189 HIS 189 189  189  HIS HIS A . n 
A 1 190 LYS 190 190  190  LYS LYS A . n 
A 1 191 VAL 191 191  191  VAL VAL A . n 
A 1 192 TYR 192 192  192  TYR TYR A . n 
A 1 193 ALA 193 193  193  ALA ALA A . n 
A 1 194 CYS 194 194  194  CYS CYS A . n 
A 1 195 GLU 195 195  195  GLU GLU A . n 
A 1 196 VAL 196 196  196  VAL VAL A . n 
A 1 197 THR 197 197  197  THR THR A . n 
A 1 198 HIS 198 198  198  HIS HIS A . n 
A 1 199 GLN 199 199  199  GLN GLN A . n 
A 1 200 GLY 200 200  200  GLY GLY A . n 
A 1 201 LEU 201 201  201  LEU LEU A . n 
A 1 202 SER 202 202  202  SER SER A . n 
A 1 203 SER 203 203  203  SER SER A . n 
A 1 204 PRO 204 204  204  PRO PRO A . n 
A 1 205 VAL 205 205  205  VAL VAL A . n 
A 1 206 THR 206 206  206  THR THR A . n 
A 1 207 LYS 207 207  207  LYS LYS A . n 
A 1 208 SER 208 208  208  SER SER A . n 
A 1 209 PHE 209 209  209  PHE PHE A . n 
A 1 210 ASN 210 210  210  ASN ASN A . n 
A 1 211 ARG 211 211  211  ARG ARG A . n 
A 1 212 GLY 212 212  212  GLY GLY A . n 
A 1 213 GLU 213 213  213  GLU GLU A . n 
A 1 214 CYS 214 214  214  CYS CYS A . n 
B 2 1   GLN 1   215  215  GLN GLN B . n 
B 2 2   VAL 2   216  216  VAL VAL B . n 
B 2 3   LYS 3   217  217  LYS LYS B . n 
B 2 4   LEU 4   218  218  LEU LEU B . n 
B 2 5   LEU 5   219  219  LEU LEU B . n 
B 2 6   GLU 6   220  220  GLU GLU B . n 
B 2 7   GLN 7   221  221  GLN GLN B . n 
B 2 8   SER 8   222  222  SER SER B . n 
B 2 9   GLY 9   223  223  GLY GLY B . n 
B 2 10  ALA 10  224  224  ALA ALA B . n 
B 2 11  GLU 11  225  225  GLU GLU B . n 
B 2 12  VAL 12  226  226  VAL VAL B . n 
B 2 13  LYS 13  227  227  LYS LYS B . n 
B 2 14  LYS 14  228  228  LYS LYS B . n 
B 2 15  PRO 15  229  229  PRO PRO B . n 
B 2 16  GLY 16  230  230  GLY GLY B . n 
B 2 17  ALA 17  231  231  ALA ALA B . n 
B 2 18  SER 18  232  232  SER SER B . n 
B 2 19  VAL 19  233  233  VAL VAL B . n 
B 2 20  LYS 20  234  234  LYS LYS B . n 
B 2 21  VAL 21  235  235  VAL VAL B . n 
B 2 22  SER 22  236  236  SER SER B . n 
B 2 23  CYS 23  237  237  CYS CYS B . n 
B 2 24  LYS 24  238  238  LYS LYS B . n 
B 2 25  ALA 25  239  239  ALA ALA B . n 
B 2 26  SER 26  240  240  SER SER B . n 
B 2 27  GLY 27  241  241  GLY GLY B . n 
B 2 28  TYR 28  242  242  TYR TYR B . n 
B 2 29  SER 29  243  243  SER SER B . n 
B 2 30  PHE 30  244  244  PHE PHE B . n 
B 2 31  THR 31  245  245  THR THR B . n 
B 2 32  SER 32  246  246  SER SER B . n 
B 2 33  TYR 33  247  247  TYR TYR B . n 
B 2 34  GLY 34  248  248  GLY GLY B . n 
B 2 35  LEU 35  249  249  LEU LEU B . n 
B 2 36  HIS 36  250  250  HIS HIS B . n 
B 2 37  TRP 37  251  251  TRP TRP B . n 
B 2 38  VAL 38  252  252  VAL VAL B . n 
B 2 39  ARG 39  253  253  ARG ARG B . n 
B 2 40  GLN 40  254  254  GLN GLN B . n 
B 2 41  ALA 41  255  255  ALA ALA B . n 
B 2 42  PRO 42  256  256  PRO PRO B . n 
B 2 43  GLY 43  257  257  GLY GLY B . n 
B 2 44  GLN 44  258  258  GLN GLN B . n 
B 2 45  ARG 45  259  259  ARG ARG B . n 
B 2 46  LEU 46  260  260  LEU LEU B . n 
B 2 47  GLU 47  261  261  GLU GLU B . n 
B 2 48  TRP 48  262  262  TRP TRP B . n 
B 2 49  MET 49  263  263  MET MET B . n 
B 2 50  GLY 50  264  264  GLY GLY B . n 
B 2 51  TRP 51  265  265  TRP TRP B . n 
B 2 52  ILE 52  266  266  ILE ILE B . n 
B 2 53  SER 53  267  267  SER SER B . n 
B 2 54  ALA 54  268  268  ALA ALA B . n 
B 2 55  GLY 55  269  269  GLY GLY B . n 
B 2 56  THR 56  270  270  THR THR B . n 
B 2 57  GLY 57  271  271  GLY GLY B . n 
B 2 58  ASN 58  272  272  ASN ASN B . n 
B 2 59  THR 59  273  273  THR THR B . n 
B 2 60  LYS 60  274  274  LYS LYS B . n 
B 2 61  TYR 61  275  275  TYR TYR B . n 
B 2 62  SER 62  276  276  SER SER B . n 
B 2 63  GLN 63  277  277  GLN GLN B . n 
B 2 64  LYS 64  278  278  LYS LYS B . n 
B 2 65  PHE 65  279  279  PHE PHE B . n 
B 2 66  ARG 66  280  280  ARG ARG B . n 
B 2 67  GLY 67  281  281  GLY GLY B . n 
B 2 68  ARG 68  282  282  ARG ARG B . n 
B 2 69  VAL 69  283  283  VAL VAL B . n 
B 2 70  THR 70  284  284  THR THR B . n 
B 2 71  PHE 71  285  285  PHE PHE B . n 
B 2 72  THR 72  286  286  THR THR B . n 
B 2 73  ARG 73  287  287  ARG ARG B . n 
B 2 74  ASP 74  288  288  ASP ASP B . n 
B 2 75  THR 75  289  289  THR THR B . n 
B 2 76  SER 76  290  290  SER SER B . n 
B 2 77  ALA 77  291  291  ALA ALA B . n 
B 2 78  THR 78  292  292  THR THR B . n 
B 2 79  THR 79  293  293  THR THR B . n 
B 2 80  ALA 80  294  294  ALA ALA B . n 
B 2 81  TYR 81  295  295  TYR TYR B . n 
B 2 82  MET 82  296  296  MET MET B . n 
B 2 83  GLY 83  297  297  GLY GLY B . n 
B 2 84  LEU 84  298  298  LEU LEU B . n 
B 2 85  SER 85  299  299  SER SER B . n 
B 2 86  SER 86  300  300  SER SER B . n 
B 2 87  LEU 87  301  301  LEU LEU B . n 
B 2 88  ARG 88  302  302  ARG ARG B . n 
B 2 89  PRO 89  303  303  PRO PRO B . n 
B 2 90  GLU 90  304  304  GLU GLU B . n 
B 2 91  ASP 91  305  305  ASP ASP B . n 
B 2 92  THR 92  306  306  THR THR B . n 
B 2 93  ALA 93  307  307  ALA ALA B . n 
B 2 94  VAL 94  308  308  VAL VAL B . n 
B 2 95  TYR 95  309  309  TYR TYR B . n 
B 2 96  TYR 96  310  310  TYR TYR B . n 
B 2 97  CYS 97  311  311  CYS CYS B . n 
B 2 98  ALA 98  312  312  ALA ALA B . n 
B 2 99  ARG 99  313  313  ARG ARG B . n 
B 2 100 ASP 100 314  314  ASP ASP B . n 
B 2 101 PRO 101 315  315  PRO PRO B . n 
B 2 102 TYR 102 316  316  TYR TYR B . n 
B 2 103 GLY 103 317  317  GLY GLY B . n 
B 2 104 GLY 104 318  318  GLY GLY B . n 
B 2 105 GLY 105 319  319  GLY GLY B . n 
B 2 106 LYS 106 320  320  LYS LYS B . n 
B 2 107 SER 107 321  321  SER SER B . n 
B 2 108 GLU 108 322  322  GLU GLU B . n 
B 2 109 PHE 109 323  323  PHE PHE B . n 
B 2 110 ASP 110 324  324  ASP ASP B . n 
B 2 111 TYR 111 325  325  TYR TYR B . n 
B 2 112 TRP 112 326  326  TRP TRP B . n 
B 2 113 GLY 113 327  327  GLY GLY B . n 
B 2 114 GLN 114 328  328  GLN GLN B . n 
B 2 115 GLY 115 329  329  GLY GLY B . n 
B 2 116 THR 116 330  330  THR THR B . n 
B 2 117 LEU 117 331  331  LEU LEU B . n 
B 2 118 VAL 118 332  332  VAL VAL B . n 
B 2 119 THR 119 333  333  THR THR B . n 
B 2 120 VAL 120 334  334  VAL VAL B . n 
B 2 121 SER 121 335  335  SER SER B . n 
B 2 122 SER 122 336  336  SER SER B . n 
B 2 123 ALA 123 337  337  ALA ALA B . n 
B 2 124 SER 124 338  338  SER SER B . n 
B 2 125 PRO 125 339  339  PRO PRO B . n 
B 2 126 THR 126 340  340  THR THR B . n 
B 2 127 SER 127 341  341  SER SER B . n 
B 2 128 PRO 128 342  342  PRO PRO B . n 
B 2 129 LYS 129 343  343  LYS LYS B . n 
B 2 130 VAL 130 344  344  VAL VAL B . n 
B 2 131 PHE 131 345  345  PHE PHE B . n 
B 2 132 PRO 132 346  346  PRO PRO B . n 
B 2 133 LEU 133 347  347  LEU LEU B . n 
B 2 134 SER 134 348  348  SER SER B . n 
B 2 135 LEU 135 349  349  LEU LEU B . n 
B 2 136 ASP 136 350  350  ASP ASP B . n 
B 2 137 SER 137 351  351  SER SER B . n 
B 2 138 THR 138 352  352  THR THR B . n 
B 2 139 PRO 139 353  353  PRO PRO B . n 
B 2 140 GLN 140 354  354  GLN GLN B . n 
B 2 141 ASP 141 355  355  ASP ASP B . n 
B 2 142 GLY 142 356  356  GLY GLY B . n 
B 2 143 ASN 143 357  357  ASN ASN B . n 
B 2 144 VAL 144 358  358  VAL VAL B . n 
B 2 145 VAL 145 359  359  VAL VAL B . n 
B 2 146 VAL 146 360  360  VAL VAL B . n 
B 2 147 ALA 147 361  361  ALA ALA B . n 
B 2 148 CYS 148 362  362  CYS CYS B . n 
B 2 149 LEU 149 363  363  LEU LEU B . n 
B 2 150 VAL 150 364  364  VAL VAL B . n 
B 2 151 GLN 151 365  365  GLN GLN B . n 
B 2 152 GLY 152 366  366  GLY GLY B . n 
B 2 153 PHE 153 367  367  PHE PHE B . n 
B 2 154 PHE 154 368  368  PHE PHE B . n 
B 2 155 PRO 155 369  369  PRO PRO B . n 
B 2 156 GLN 156 370  370  GLN GLN B . n 
B 2 157 GLU 157 371  371  GLU GLU B . n 
B 2 158 PRO 158 372  372  PRO PRO B . n 
B 2 159 LEU 159 373  373  LEU LEU B . n 
B 2 160 SER 160 374  374  SER SER B . n 
B 2 161 VAL 161 375  375  VAL VAL B . n 
B 2 162 THR 162 376  376  THR THR B . n 
B 2 163 TRP 163 377  377  TRP TRP B . n 
B 2 164 SER 164 378  378  SER SER B . n 
B 2 165 GLU 165 379  379  GLU GLU B . n 
B 2 166 SER 166 380  380  SER SER B . n 
B 2 167 GLY 167 381  381  GLY GLY B . n 
B 2 168 GLN 168 382  382  GLN GLN B . n 
B 2 169 ASN 169 383  383  ASN ASN B . n 
B 2 170 VAL 170 384  384  VAL VAL B . n 
B 2 171 THR 171 385  385  THR THR B . n 
B 2 172 ALA 172 386  386  ALA ALA B . n 
B 2 173 ARG 173 387  387  ARG ARG B . n 
B 2 174 ASN 174 388  388  ASN ASN B . n 
B 2 175 PHE 175 389  389  PHE PHE B . n 
B 2 176 PRO 176 390  390  PRO PRO B . n 
B 2 177 PRO 177 391  391  PRO PRO B . n 
B 2 178 SER 178 392  392  SER SER B . n 
B 2 179 GLN 179 393  393  GLN GLN B . n 
B 2 180 ASP 180 394  394  ASP ASP B . n 
B 2 181 ALA 181 395  395  ALA ALA B . n 
B 2 182 SER 182 396  396  SER SER B . n 
B 2 183 GLY 183 397  397  GLY GLY B . n 
B 2 184 ASP 184 398  398  ASP ASP B . n 
B 2 185 LEU 185 399  399  LEU LEU B . n 
B 2 186 TYR 186 400  400  TYR TYR B . n 
B 2 187 THR 187 401  401  THR THR B . n 
B 2 188 THR 188 402  402  THR THR B . n 
B 2 189 SER 189 403  403  SER SER B . n 
B 2 190 SER 190 404  404  SER SER B . n 
B 2 191 GLN 191 405  405  GLN GLN B . n 
B 2 192 LEU 192 406  406  LEU LEU B . n 
B 2 193 THR 193 407  407  THR THR B . n 
B 2 194 LEU 194 408  408  LEU LEU B . n 
B 2 195 PRO 195 409  409  PRO PRO B . n 
B 2 196 ALA 196 410  410  ALA ALA B . n 
B 2 197 THR 197 411  411  THR THR B . n 
B 2 198 GLN 198 412  412  GLN GLN B . n 
B 2 199 CYS 199 413  413  CYS CYS B . n 
B 2 200 PRO 200 414  414  PRO PRO B . n 
B 2 201 ASP 201 415  415  ASP ASP B . n 
B 2 202 GLY 202 416  416  GLY GLY B . n 
B 2 203 LYS 203 417  417  LYS LYS B . n 
B 2 204 SER 204 418  418  SER SER B . n 
B 2 205 VAL 205 419  419  VAL VAL B . n 
B 2 206 THR 206 420  420  THR THR B . n 
B 2 207 CYS 207 421  421  CYS CYS B . n 
B 2 208 HIS 208 422  422  HIS HIS B . n 
B 2 209 VAL 209 423  423  VAL VAL B . n 
B 2 210 LYS 210 424  424  LYS LYS B . n 
B 2 211 HIS 211 425  425  HIS HIS B . n 
B 2 212 TYR 212 426  426  TYR TYR B . n 
B 2 213 THR 213 427  427  THR THR B . n 
B 2 214 ASN 214 428  428  ASN ASN B . n 
B 2 215 PRO 215 429  429  PRO PRO B . n 
B 2 216 SER 216 430  430  SER SER B . n 
B 2 217 GLN 217 431  431  GLN GLN B . n 
B 2 218 ASP 218 432  432  ASP ASP B . n 
B 2 219 VAL 219 433  433  VAL VAL B . n 
B 2 220 THR 220 434  434  THR THR B . n 
B 2 221 VAL 221 435  435  VAL VAL B . n 
B 2 222 PRO 222 436  436  PRO PRO B . n 
B 2 223 CYS 223 437  437  CYS CYS B . n 
B 2 224 PRO 224 438  438  PRO PRO B . n 
B 2 225 VAL 225 439  439  VAL VAL B . n 
B 2 226 PRO 226 440  440  PRO PRO B . n 
B 2 227 PRO 227 441  441  PRO PRO B . n 
B 2 228 PRO 228 442  442  PRO PRO B . n 
B 2 229 PRO 229 443  443  PRO PRO B . n 
B 2 230 PRO 230 444  444  PRO PRO B . n 
B 2 231 CYS 231 445  445  CYS CYS B . n 
B 2 232 CYS 232 446  446  CYS CYS B . n 
B 2 233 HIS 233 447  447  HIS HIS B . n 
B 2 234 PRO 234 448  448  PRO PRO B . n 
B 2 235 ARG 235 449  449  ARG ARG B . n 
B 2 236 LEU 236 450  450  LEU LEU B . n 
B 2 237 SER 237 451  451  SER SER B . n 
B 2 238 LEU 238 452  452  LEU LEU B . n 
B 2 239 HIS 239 453  453  HIS HIS B . n 
B 2 240 ARG 240 454  454  ARG ARG B . n 
B 2 241 PRO 241 455  455  PRO PRO B . n 
B 2 242 ALA 242 456  456  ALA ALA B . n 
B 2 243 LEU 243 457  457  LEU LEU B . n 
B 2 244 GLU 244 458  458  GLU GLU B . n 
B 2 245 ASP 245 459  459  ASP ASP B . n 
B 2 246 LEU 246 460  460  LEU LEU B . n 
B 2 247 LEU 247 461  461  LEU LEU B . n 
B 2 248 LEU 248 462  462  LEU LEU B . n 
B 2 249 GLY 249 463  463  GLY GLY B . n 
B 2 250 SER 250 464  464  SER SER B . n 
B 2 251 GLU 251 465  465  GLU GLU B . n 
B 2 252 ALA 252 466  466  ALA ALA B . n 
B 2 253 ASN 253 467  467  ASN ASN B . n 
B 2 254 LEU 254 468  468  LEU LEU B . n 
B 2 255 THR 255 469  469  THR THR B . n 
B 2 256 CYS 256 470  470  CYS CYS B . n 
B 2 257 THR 257 471  471  THR THR B . n 
B 2 258 LEU 258 472  472  LEU LEU B . n 
B 2 259 THR 259 473  473  THR THR B . n 
B 2 260 GLY 260 474  474  GLY GLY B . n 
B 2 261 LEU 261 475  475  LEU LEU B . n 
B 2 262 ARG 262 476  476  ARG ARG B . n 
B 2 263 ASP 263 477  477  ASP ASP B . n 
B 2 264 ALA 264 478  478  ALA ALA B . n 
B 2 265 SER 265 479  479  SER SER B . n 
B 2 266 GLY 266 480  480  GLY GLY B . n 
B 2 267 ALA 267 481  481  ALA ALA B . n 
B 2 268 THR 268 482  482  THR THR B . n 
B 2 269 PHE 269 483  483  PHE PHE B . n 
B 2 270 THR 270 484  484  THR THR B . n 
B 2 271 TRP 271 485  485  TRP TRP B . n 
B 2 272 THR 272 486  486  THR THR B . n 
B 2 273 PRO 273 487  487  PRO PRO B . n 
B 2 274 SER 274 488  488  SER SER B . n 
B 2 275 SER 275 489  489  SER SER B . n 
B 2 276 GLY 276 490  490  GLY GLY B . n 
B 2 277 LYS 277 491  491  LYS LYS B . n 
B 2 278 SER 278 492  492  SER SER B . n 
B 2 279 ALA 279 493  493  ALA ALA B . n 
B 2 280 VAL 280 494  494  VAL VAL B . n 
B 2 281 GLN 281 495  495  GLN GLN B . n 
B 2 282 GLY 282 496  496  GLY GLY B . n 
B 2 283 PRO 283 497  497  PRO PRO B . n 
B 2 284 PRO 284 498  498  PRO PRO B . n 
B 2 285 GLU 285 499  499  GLU GLU B . n 
B 2 286 ARG 286 500  500  ARG ARG B . n 
B 2 287 ASP 287 501  501  ASP ASP B . n 
B 2 288 LEU 288 502  502  LEU LEU B . n 
B 2 289 CYS 289 503  503  CYS CYS B . n 
B 2 290 GLY 290 504  504  GLY GLY B . n 
B 2 291 CYS 291 505  505  CYS CYS B . n 
B 2 292 TYR 292 506  506  TYR TYR B . n 
B 2 293 SER 293 507  507  SER SER B . n 
B 2 294 VAL 294 508  508  VAL VAL B . n 
B 2 295 SER 295 509  509  SER SER B . n 
B 2 296 SER 296 510  510  SER SER B . n 
B 2 297 VAL 297 511  511  VAL VAL B . n 
B 2 298 LEU 298 512  512  LEU LEU B . n 
B 2 299 PRO 299 513  513  PRO PRO B . n 
B 2 300 GLY 300 514  514  GLY GLY B . n 
B 2 301 CYS 301 515  515  CYS CYS B . n 
B 2 302 ALA 302 516  516  ALA ALA B . n 
B 2 303 GLN 303 517  517  GLN GLN B . n 
B 2 304 PRO 304 518  518  PRO PRO B . n 
B 2 305 TRP 305 519  519  TRP TRP B . n 
B 2 306 ASN 306 520  520  ASN ASN B . n 
B 2 307 HIS 307 521  521  HIS HIS B . n 
B 2 308 GLY 308 522  522  GLY GLY B . n 
B 2 309 GLU 309 523  523  GLU GLU B . n 
B 2 310 THR 310 524  524  THR THR B . n 
B 2 311 PHE 311 525  525  PHE PHE B . n 
B 2 312 THR 312 526  526  THR THR B . n 
B 2 313 CYS 313 527  527  CYS CYS B . n 
B 2 314 THR 314 528  528  THR THR B . n 
B 2 315 ALA 315 529  529  ALA ALA B . n 
B 2 316 ALA 316 530  530  ALA ALA B . n 
B 2 317 HIS 317 531  531  HIS HIS B . n 
B 2 318 PRO 318 532  532  PRO PRO B . n 
B 2 319 GLU 319 533  533  GLU GLU B . n 
B 2 320 LEU 320 534  534  LEU LEU B . n 
B 2 321 LYS 321 535  535  LYS LYS B . n 
B 2 322 THR 322 536  536  THR THR B . n 
B 2 323 PRO 323 537  537  PRO PRO B . n 
B 2 324 LEU 324 538  538  LEU LEU B . n 
B 2 325 THR 325 539  539  THR THR B . n 
B 2 326 ALA 326 540  540  ALA ALA B . n 
B 2 327 ASN 327 541  541  ASN ASN B . n 
B 2 328 ILE 328 542  542  ILE ILE B . n 
B 2 329 THR 329 543  543  THR THR B . n 
B 2 330 LYS 330 544  544  LYS LYS B . n 
B 2 331 SER 331 545  545  SER SER B . n 
B 2 332 GLY 332 546  546  GLY GLY B . n 
B 2 333 ASN 333 547  547  ASN ASN B . n 
B 2 334 THR 334 548  548  THR THR B . n 
B 2 335 PHE 335 549  549  PHE PHE B . n 
B 2 336 ARG 336 550  550  ARG ARG B . n 
B 2 337 PRO 337 551  551  PRO PRO B . n 
B 2 338 GLU 338 552  552  GLU GLU B . n 
B 2 339 VAL 339 553  553  VAL VAL B . n 
B 2 340 HIS 340 554  554  HIS HIS B . n 
B 2 341 LEU 341 555  555  LEU LEU B . n 
B 2 342 LEU 342 556  556  LEU LEU B . n 
B 2 343 PRO 343 557  557  PRO PRO B . n 
B 2 344 PRO 344 558  558  PRO PRO B . n 
B 2 345 PRO 345 559  559  PRO PRO B . n 
B 2 346 SER 346 560  560  SER SER B . n 
B 2 347 GLU 347 561  561  GLU GLU B . n 
B 2 348 GLU 348 562  562  GLU GLU B . n 
B 2 349 LEU 349 563  563  LEU LEU B . n 
B 2 350 ALA 350 564  564  ALA ALA B . n 
B 2 351 LEU 351 565  565  LEU LEU B . n 
B 2 352 ASN 352 566  566  ASN ASN B . n 
B 2 353 GLU 353 567  567  GLU GLU B . n 
B 2 354 LEU 354 568  568  LEU LEU B . n 
B 2 355 VAL 355 569  569  VAL VAL B . n 
B 2 356 THR 356 570  570  THR THR B . n 
B 2 357 LEU 357 571  571  LEU LEU B . n 
B 2 358 THR 358 572  572  THR THR B . n 
B 2 359 CYS 359 573  573  CYS CYS B . n 
B 2 360 LEU 360 574  574  LEU LEU B . n 
B 2 361 ALA 361 575  575  ALA ALA B . n 
B 2 362 ARG 362 576  576  ARG ARG B . n 
B 2 363 GLY 363 577  577  GLY GLY B . n 
B 2 364 PHE 364 578  578  PHE PHE B . n 
B 2 365 SER 365 579  579  SER SER B . n 
B 2 366 PRO 366 580  580  PRO PRO B . n 
B 2 367 LYS 367 581  581  LYS LYS B . n 
B 2 368 ASP 368 582  582  ASP ASP B . n 
B 2 369 VAL 369 583  583  VAL VAL B . n 
B 2 370 LEU 370 584  584  LEU LEU B . n 
B 2 371 VAL 371 585  585  VAL VAL B . n 
B 2 372 ARG 372 586  586  ARG ARG B . n 
B 2 373 TRP 373 587  587  TRP TRP B . n 
B 2 374 LEU 374 588  588  LEU LEU B . n 
B 2 375 GLN 375 589  589  GLN GLN B . n 
B 2 376 GLY 376 590  590  GLY GLY B . n 
B 2 377 SER 377 591  591  SER SER B . n 
B 2 378 GLN 378 592  592  GLN GLN B . n 
B 2 379 GLU 379 593  593  GLU GLU B . n 
B 2 380 LEU 380 594  594  LEU LEU B . n 
B 2 381 PRO 381 595  595  PRO PRO B . n 
B 2 382 ARG 382 596  596  ARG ARG B . n 
B 2 383 GLU 383 597  597  GLU GLU B . n 
B 2 384 LYS 384 598  598  LYS LYS B . n 
B 2 385 TYR 385 599  599  TYR TYR B . n 
B 2 386 LEU 386 600  600  LEU LEU B . n 
B 2 387 THR 387 601  601  THR THR B . n 
B 2 388 TRP 388 602  602  TRP TRP B . n 
B 2 389 ALA 389 603  603  ALA ALA B . n 
B 2 390 SER 390 604  604  SER SER B . n 
B 2 391 ARG 391 605  605  ARG ARG B . n 
B 2 392 GLN 392 606  606  GLN GLN B . n 
B 2 393 GLU 393 607  607  GLU GLU B . n 
B 2 394 PRO 394 608  608  PRO PRO B . n 
B 2 395 SER 395 609  609  SER SER B . n 
B 2 396 GLN 396 610  610  GLN GLN B . n 
B 2 397 GLY 397 611  611  GLY GLY B . n 
B 2 398 THR 398 612  612  THR THR B . n 
B 2 399 THR 399 613  613  THR THR B . n 
B 2 400 THR 400 614  614  THR THR B . n 
B 2 401 PHE 401 615  615  PHE PHE B . n 
B 2 402 ALA 402 616  616  ALA ALA B . n 
B 2 403 VAL 403 617  617  VAL VAL B . n 
B 2 404 THR 404 618  618  THR THR B . n 
B 2 405 SER 405 619  619  SER SER B . n 
B 2 406 ILE 406 620  620  ILE ILE B . n 
B 2 407 LEU 407 621  621  LEU LEU B . n 
B 2 408 ARG 408 622  622  ARG ARG B . n 
B 2 409 VAL 409 623  623  VAL VAL B . n 
B 2 410 ALA 410 624  624  ALA ALA B . n 
B 2 411 ALA 411 625  625  ALA ALA B . n 
B 2 412 GLU 412 626  626  GLU GLU B . n 
B 2 413 ASP 413 627  627  ASP ASP B . n 
B 2 414 TRP 414 628  628  TRP TRP B . n 
B 2 415 LYS 415 629  629  LYS LYS B . n 
B 2 416 LYS 416 630  630  LYS LYS B . n 
B 2 417 GLY 417 631  631  GLY GLY B . n 
B 2 418 ASP 418 632  632  ASP ASP B . n 
B 2 419 THR 419 633  633  THR THR B . n 
B 2 420 PHE 420 634  634  PHE PHE B . n 
B 2 421 SER 421 635  635  SER SER B . n 
B 2 422 CYS 422 636  636  CYS CYS B . n 
B 2 423 MET 423 637  637  MET MET B . n 
B 2 424 VAL 424 638  638  VAL VAL B . n 
B 2 425 GLY 425 639  639  GLY GLY B . n 
B 2 426 HIS 426 640  640  HIS HIS B . n 
B 2 427 GLU 427 641  641  GLU GLU B . n 
B 2 428 ALA 428 642  642  ALA ALA B . n 
B 2 429 LEU 429 643  643  LEU LEU B . n 
B 2 430 PRO 430 644  644  PRO PRO B . n 
B 2 431 LEU 431 645  645  LEU LEU B . n 
B 2 432 ALA 432 646  646  ALA ALA B . n 
B 2 433 PHE 433 647  647  PHE PHE B . n 
B 2 434 THR 434 648  648  THR THR B . n 
B 2 435 GLN 435 649  649  GLN GLN B . n 
B 2 436 LYS 436 650  650  LYS LYS B . n 
B 2 437 THR 437 651  651  THR THR B . n 
B 2 438 ILE 438 652  652  ILE ILE B . n 
B 2 439 ASP 439 653  653  ASP ASP B . n 
B 2 440 ARG 440 654  654  ARG ARG B . n 
B 2 441 LEU 441 655  655  LEU LEU B . n 
B 2 442 ALA 442 656  656  ALA ALA B . n 
B 2 443 GLY 443 657  657  GLY GLY B . n 
B 2 444 LYS 444 658  658  LYS LYS B . n 
B 2 445 PRO 445 659  659  PRO PRO B . n 
B 2 446 THR 446 660  660  THR THR B . n 
B 2 447 HIS 447 661  661  HIS HIS B . n 
B 2 448 VAL 448 662  662  VAL VAL B . n 
B 2 449 ASN 449 663  663  ASN ASN B . n 
B 2 450 VAL 450 664  664  VAL VAL B . n 
B 2 451 SER 451 665  665  SER SER B . n 
B 2 452 VAL 452 666  666  VAL VAL B . n 
B 2 453 VAL 453 667  667  VAL VAL B . n 
B 2 454 MET 454 668  668  MET MET B . n 
B 2 455 ALA 455 669  669  ALA ALA B . n 
B 2 456 GLU 456 670  670  GLU GLU B . n 
B 2 457 VAL 457 671  671  VAL VAL B . n 
B 2 458 ASP 458 672  672  ASP ASP B . n 
B 2 459 GLY 459 673  673  GLY GLY B . n 
B 2 460 THR 460 674  674  THR THR B . n 
B 2 461 CYS 461 675  675  CYS CYS B . n 
B 2 462 TYR 462 676  676  TYR TYR B . n 
C 1 1   GLU 1   677  677  GLU GLU C . n 
C 1 2   LEU 2   678  678  LEU LEU C . n 
C 1 3   VAL 3   679  679  VAL VAL C . n 
C 1 4   MET 4   680  680  MET MET C . n 
C 1 5   THR 5   681  681  THR THR C . n 
C 1 6   GLN 6   682  682  GLN GLN C . n 
C 1 7   SER 7   683  683  SER SER C . n 
C 1 8   PRO 8   684  684  PRO PRO C . n 
C 1 9   SER 9   685  685  SER SER C . n 
C 1 10  SER 10  686  686  SER SER C . n 
C 1 11  LEU 11  687  687  LEU LEU C . n 
C 1 12  SER 12  688  688  SER SER C . n 
C 1 13  ALA 13  689  689  ALA ALA C . n 
C 1 14  SER 14  690  690  SER SER C . n 
C 1 15  VAL 15  691  691  VAL VAL C . n 
C 1 16  GLY 16  692  692  GLY GLY C . n 
C 1 17  ASP 17  693  693  ASP ASP C . n 
C 1 18  ARG 18  694  694  ARG ARG C . n 
C 1 19  VAL 19  695  695  VAL VAL C . n 
C 1 20  ASN 20  696  696  ASN ASN C . n 
C 1 21  ILE 21  697  697  ILE ILE C . n 
C 1 22  ALA 22  698  698  ALA ALA C . n 
C 1 23  CYS 23  699  699  CYS CYS C . n 
C 1 24  ARG 24  700  700  ARG ARG C . n 
C 1 25  ALA 25  701  701  ALA ALA C . n 
C 1 26  SER 26  702  702  SER SER C . n 
C 1 27  GLN 27  703  703  GLN GLN C . n 
C 1 28  GLY 28  704  704  GLY GLY C . n 
C 1 29  ILE 29  705  705  ILE ILE C . n 
C 1 30  SER 30  706  706  SER SER C . n 
C 1 31  SER 31  707  707  SER SER C . n 
C 1 32  ALA 32  708  708  ALA ALA C . n 
C 1 33  LEU 33  709  709  LEU LEU C . n 
C 1 34  ALA 34  710  710  ALA ALA C . n 
C 1 35  TRP 35  711  711  TRP TRP C . n 
C 1 36  TYR 36  712  712  TYR TYR C . n 
C 1 37  GLN 37  713  713  GLN GLN C . n 
C 1 38  GLN 38  714  714  GLN GLN C . n 
C 1 39  LYS 39  715  715  LYS LYS C . n 
C 1 40  PRO 40  716  716  PRO PRO C . n 
C 1 41  GLY 41  717  717  GLY GLY C . n 
C 1 42  LYS 42  718  718  LYS LYS C . n 
C 1 43  ALA 43  719  719  ALA ALA C . n 
C 1 44  PRO 44  720  720  PRO PRO C . n 
C 1 45  ARG 45  721  721  ARG ARG C . n 
C 1 46  LEU 46  722  722  LEU LEU C . n 
C 1 47  LEU 47  723  723  LEU LEU C . n 
C 1 48  ILE 48  724  724  ILE ILE C . n 
C 1 49  TYR 49  725  725  TYR TYR C . n 
C 1 50  ASP 50  726  726  ASP ASP C . n 
C 1 51  ALA 51  727  727  ALA ALA C . n 
C 1 52  SER 52  728  728  SER SER C . n 
C 1 53  ASN 53  729  729  ASN ASN C . n 
C 1 54  LEU 54  730  730  LEU LEU C . n 
C 1 55  GLU 55  731  731  GLU GLU C . n 
C 1 56  SER 56  732  732  SER SER C . n 
C 1 57  GLY 57  733  733  GLY GLY C . n 
C 1 58  VAL 58  734  734  VAL VAL C . n 
C 1 59  PRO 59  735  735  PRO PRO C . n 
C 1 60  SER 60  736  736  SER SER C . n 
C 1 61  ARG 61  737  737  ARG ARG C . n 
C 1 62  PHE 62  738  738  PHE PHE C . n 
C 1 63  SER 63  739  739  SER SER C . n 
C 1 64  GLY 64  740  740  GLY GLY C . n 
C 1 65  SER 65  741  741  SER SER C . n 
C 1 66  GLY 66  742  742  GLY GLY C . n 
C 1 67  SER 67  743  743  SER SER C . n 
C 1 68  GLY 68  744  744  GLY GLY C . n 
C 1 69  THR 69  745  745  THR THR C . n 
C 1 70  ASP 70  746  746  ASP ASP C . n 
C 1 71  PHE 71  747  747  PHE PHE C . n 
C 1 72  THR 72  748  748  THR THR C . n 
C 1 73  LEU 73  749  749  LEU LEU C . n 
C 1 74  THR 74  750  750  THR THR C . n 
C 1 75  ILE 75  751  751  ILE ILE C . n 
C 1 76  SER 76  752  752  SER SER C . n 
C 1 77  SER 77  753  753  SER SER C . n 
C 1 78  LEU 78  754  754  LEU LEU C . n 
C 1 79  GLN 79  755  755  GLN GLN C . n 
C 1 80  PRO 80  756  756  PRO PRO C . n 
C 1 81  GLU 81  757  757  GLU GLU C . n 
C 1 82  ASP 82  758  758  ASP ASP C . n 
C 1 83  PHE 83  759  759  PHE PHE C . n 
C 1 84  ALA 84  760  760  ALA ALA C . n 
C 1 85  ILE 85  761  761  ILE ILE C . n 
C 1 86  TYR 86  762  762  TYR TYR C . n 
C 1 87  TYR 87  763  763  TYR TYR C . n 
C 1 88  CYS 88  764  764  CYS CYS C . n 
C 1 89  GLN 89  765  765  GLN GLN C . n 
C 1 90  GLN 90  766  766  GLN GLN C . n 
C 1 91  PHE 91  767  767  PHE PHE C . n 
C 1 92  ASN 92  768  768  ASN ASN C . n 
C 1 93  SER 93  769  769  SER SER C . n 
C 1 94  TYR 94  770  770  TYR TYR C . n 
C 1 95  PRO 95  771  771  PRO PRO C . n 
C 1 96  LEU 96  772  772  LEU LEU C . n 
C 1 97  THR 97  773  773  THR THR C . n 
C 1 98  PHE 98  774  774  PHE PHE C . n 
C 1 99  GLY 99  775  775  GLY GLY C . n 
C 1 100 GLY 100 776  776  GLY GLY C . n 
C 1 101 GLY 101 777  777  GLY GLY C . n 
C 1 102 THR 102 778  778  THR THR C . n 
C 1 103 LYS 103 779  779  LYS LYS C . n 
C 1 104 VAL 104 780  780  VAL VAL C . n 
C 1 105 GLU 105 781  781  GLU GLU C . n 
C 1 106 ILE 106 782  782  ILE ILE C . n 
C 1 107 LYS 107 783  783  LYS LYS C . n 
C 1 108 ARG 108 784  784  ARG ARG C . n 
C 1 109 THR 109 785  785  THR THR C . n 
C 1 110 VAL 110 786  786  VAL VAL C . n 
C 1 111 ALA 111 787  787  ALA ALA C . n 
C 1 112 ALA 112 788  788  ALA ALA C . n 
C 1 113 PRO 113 789  789  PRO PRO C . n 
C 1 114 SER 114 790  790  SER SER C . n 
C 1 115 VAL 115 791  791  VAL VAL C . n 
C 1 116 PHE 116 792  792  PHE PHE C . n 
C 1 117 ILE 117 793  793  ILE ILE C . n 
C 1 118 PHE 118 794  794  PHE PHE C . n 
C 1 119 PRO 119 795  795  PRO PRO C . n 
C 1 120 PRO 120 796  796  PRO PRO C . n 
C 1 121 SER 121 797  797  SER SER C . n 
C 1 122 ASP 122 798  798  ASP ASP C . n 
C 1 123 GLU 123 799  799  GLU GLU C . n 
C 1 124 GLN 124 800  800  GLN GLN C . n 
C 1 125 LEU 125 801  801  LEU LEU C . n 
C 1 126 LYS 126 802  802  LYS LYS C . n 
C 1 127 SER 127 803  803  SER SER C . n 
C 1 128 GLY 128 804  804  GLY GLY C . n 
C 1 129 THR 129 805  805  THR THR C . n 
C 1 130 ALA 130 806  806  ALA ALA C . n 
C 1 131 SER 131 807  807  SER SER C . n 
C 1 132 VAL 132 808  808  VAL VAL C . n 
C 1 133 VAL 133 809  809  VAL VAL C . n 
C 1 134 CYS 134 810  810  CYS CYS C . n 
C 1 135 LEU 135 811  811  LEU LEU C . n 
C 1 136 LEU 136 812  812  LEU LEU C . n 
C 1 137 ASN 137 813  813  ASN ASN C . n 
C 1 138 ASN 138 814  814  ASN ASN C . n 
C 1 139 PHE 139 815  815  PHE PHE C . n 
C 1 140 TYR 140 816  816  TYR TYR C . n 
C 1 141 PRO 141 817  817  PRO PRO C . n 
C 1 142 ARG 142 818  818  ARG ARG C . n 
C 1 143 GLU 143 819  819  GLU GLU C . n 
C 1 144 ALA 144 820  820  ALA ALA C . n 
C 1 145 LYS 145 821  821  LYS LYS C . n 
C 1 146 VAL 146 822  822  VAL VAL C . n 
C 1 147 GLN 147 823  823  GLN GLN C . n 
C 1 148 TRP 148 824  824  TRP TRP C . n 
C 1 149 LYS 149 825  825  LYS LYS C . n 
C 1 150 VAL 150 826  826  VAL VAL C . n 
C 1 151 ASP 151 827  827  ASP ASP C . n 
C 1 152 ASN 152 828  828  ASN ASN C . n 
C 1 153 ALA 153 829  829  ALA ALA C . n 
C 1 154 LEU 154 830  830  LEU LEU C . n 
C 1 155 GLN 155 831  831  GLN GLN C . n 
C 1 156 SER 156 832  832  SER SER C . n 
C 1 157 GLY 157 833  833  GLY GLY C . n 
C 1 158 ASN 158 834  834  ASN ASN C . n 
C 1 159 SER 159 835  835  SER SER C . n 
C 1 160 GLN 160 836  836  GLN GLN C . n 
C 1 161 GLU 161 837  837  GLU GLU C . n 
C 1 162 SER 162 838  838  SER SER C . n 
C 1 163 VAL 163 839  839  VAL VAL C . n 
C 1 164 THR 164 840  840  THR THR C . n 
C 1 165 GLU 165 841  841  GLU GLU C . n 
C 1 166 GLN 166 842  842  GLN GLN C . n 
C 1 167 ASP 167 843  843  ASP ASP C . n 
C 1 168 SER 168 844  844  SER SER C . n 
C 1 169 LYS 169 845  845  LYS LYS C . n 
C 1 170 ASP 170 846  846  ASP ASP C . n 
C 1 171 SER 171 847  847  SER SER C . n 
C 1 172 THR 172 848  848  THR THR C . n 
C 1 173 TYR 173 849  849  TYR TYR C . n 
C 1 174 SER 174 850  850  SER SER C . n 
C 1 175 LEU 175 851  851  LEU LEU C . n 
C 1 176 SER 176 852  852  SER SER C . n 
C 1 177 SER 177 853  853  SER SER C . n 
C 1 178 THR 178 854  854  THR THR C . n 
C 1 179 LEU 179 855  855  LEU LEU C . n 
C 1 180 THR 180 856  856  THR THR C . n 
C 1 181 LEU 181 857  857  LEU LEU C . n 
C 1 182 SER 182 858  858  SER SER C . n 
C 1 183 LYS 183 859  859  LYS LYS C . n 
C 1 184 ALA 184 860  860  ALA ALA C . n 
C 1 185 ASP 185 861  861  ASP ASP C . n 
C 1 186 TYR 186 862  862  TYR TYR C . n 
C 1 187 GLU 187 863  863  GLU GLU C . n 
C 1 188 LYS 188 864  864  LYS LYS C . n 
C 1 189 HIS 189 865  865  HIS HIS C . n 
C 1 190 LYS 190 866  866  LYS LYS C . n 
C 1 191 VAL 191 867  867  VAL VAL C . n 
C 1 192 TYR 192 868  868  TYR TYR C . n 
C 1 193 ALA 193 869  869  ALA ALA C . n 
C 1 194 CYS 194 870  870  CYS CYS C . n 
C 1 195 GLU 195 871  871  GLU GLU C . n 
C 1 196 VAL 196 872  872  VAL VAL C . n 
C 1 197 THR 197 873  873  THR THR C . n 
C 1 198 HIS 198 874  874  HIS HIS C . n 
C 1 199 GLN 199 875  875  GLN GLN C . n 
C 1 200 GLY 200 876  876  GLY GLY C . n 
C 1 201 LEU 201 877  877  LEU LEU C . n 
C 1 202 SER 202 878  878  SER SER C . n 
C 1 203 SER 203 879  879  SER SER C . n 
C 1 204 PRO 204 880  880  PRO PRO C . n 
C 1 205 VAL 205 881  881  VAL VAL C . n 
C 1 206 THR 206 882  882  THR THR C . n 
C 1 207 LYS 207 883  883  LYS LYS C . n 
C 1 208 SER 208 884  884  SER SER C . n 
C 1 209 PHE 209 885  885  PHE PHE C . n 
C 1 210 ASN 210 886  886  ASN ASN C . n 
C 1 211 ARG 211 887  887  ARG ARG C . n 
C 1 212 GLY 212 888  888  GLY GLY C . n 
C 1 213 GLU 213 889  889  GLU GLU C . n 
C 1 214 CYS 214 890  890  CYS CYS C . n 
D 2 1   GLN 1   891  891  GLN GLN D . n 
D 2 2   VAL 2   892  892  VAL VAL D . n 
D 2 3   LYS 3   893  893  LYS LYS D . n 
D 2 4   LEU 4   894  894  LEU LEU D . n 
D 2 5   LEU 5   895  895  LEU LEU D . n 
D 2 6   GLU 6   896  896  GLU GLU D . n 
D 2 7   GLN 7   897  897  GLN GLN D . n 
D 2 8   SER 8   898  898  SER SER D . n 
D 2 9   GLY 9   899  899  GLY GLY D . n 
D 2 10  ALA 10  900  900  ALA ALA D . n 
D 2 11  GLU 11  901  901  GLU GLU D . n 
D 2 12  VAL 12  902  902  VAL VAL D . n 
D 2 13  LYS 13  903  903  LYS LYS D . n 
D 2 14  LYS 14  904  904  LYS LYS D . n 
D 2 15  PRO 15  905  905  PRO PRO D . n 
D 2 16  GLY 16  906  906  GLY GLY D . n 
D 2 17  ALA 17  907  907  ALA ALA D . n 
D 2 18  SER 18  908  908  SER SER D . n 
D 2 19  VAL 19  909  909  VAL VAL D . n 
D 2 20  LYS 20  910  910  LYS LYS D . n 
D 2 21  VAL 21  911  911  VAL VAL D . n 
D 2 22  SER 22  912  912  SER SER D . n 
D 2 23  CYS 23  913  913  CYS CYS D . n 
D 2 24  LYS 24  914  914  LYS LYS D . n 
D 2 25  ALA 25  915  915  ALA ALA D . n 
D 2 26  SER 26  916  916  SER SER D . n 
D 2 27  GLY 27  917  917  GLY GLY D . n 
D 2 28  TYR 28  918  918  TYR TYR D . n 
D 2 29  SER 29  919  919  SER SER D . n 
D 2 30  PHE 30  920  920  PHE PHE D . n 
D 2 31  THR 31  921  921  THR THR D . n 
D 2 32  SER 32  922  922  SER SER D . n 
D 2 33  TYR 33  923  923  TYR TYR D . n 
D 2 34  GLY 34  924  924  GLY GLY D . n 
D 2 35  LEU 35  925  925  LEU LEU D . n 
D 2 36  HIS 36  926  926  HIS HIS D . n 
D 2 37  TRP 37  927  927  TRP TRP D . n 
D 2 38  VAL 38  928  928  VAL VAL D . n 
D 2 39  ARG 39  929  929  ARG ARG D . n 
D 2 40  GLN 40  930  930  GLN GLN D . n 
D 2 41  ALA 41  931  931  ALA ALA D . n 
D 2 42  PRO 42  932  932  PRO PRO D . n 
D 2 43  GLY 43  933  933  GLY GLY D . n 
D 2 44  GLN 44  934  934  GLN GLN D . n 
D 2 45  ARG 45  935  935  ARG ARG D . n 
D 2 46  LEU 46  936  936  LEU LEU D . n 
D 2 47  GLU 47  937  937  GLU GLU D . n 
D 2 48  TRP 48  938  938  TRP TRP D . n 
D 2 49  MET 49  939  939  MET MET D . n 
D 2 50  GLY 50  940  940  GLY GLY D . n 
D 2 51  TRP 51  941  941  TRP TRP D . n 
D 2 52  ILE 52  942  942  ILE ILE D . n 
D 2 53  SER 53  943  943  SER SER D . n 
D 2 54  ALA 54  944  944  ALA ALA D . n 
D 2 55  GLY 55  945  945  GLY GLY D . n 
D 2 56  THR 56  946  946  THR THR D . n 
D 2 57  GLY 57  947  947  GLY GLY D . n 
D 2 58  ASN 58  948  948  ASN ASN D . n 
D 2 59  THR 59  949  949  THR THR D . n 
D 2 60  LYS 60  950  950  LYS LYS D . n 
D 2 61  TYR 61  951  951  TYR TYR D . n 
D 2 62  SER 62  952  952  SER SER D . n 
D 2 63  GLN 63  953  953  GLN GLN D . n 
D 2 64  LYS 64  954  954  LYS LYS D . n 
D 2 65  PHE 65  955  955  PHE PHE D . n 
D 2 66  ARG 66  956  956  ARG ARG D . n 
D 2 67  GLY 67  957  957  GLY GLY D . n 
D 2 68  ARG 68  958  958  ARG ARG D . n 
D 2 69  VAL 69  959  959  VAL VAL D . n 
D 2 70  THR 70  960  960  THR THR D . n 
D 2 71  PHE 71  961  961  PHE PHE D . n 
D 2 72  THR 72  962  962  THR THR D . n 
D 2 73  ARG 73  963  963  ARG ARG D . n 
D 2 74  ASP 74  964  964  ASP ASP D . n 
D 2 75  THR 75  965  965  THR THR D . n 
D 2 76  SER 76  966  966  SER SER D . n 
D 2 77  ALA 77  967  967  ALA ALA D . n 
D 2 78  THR 78  968  968  THR THR D . n 
D 2 79  THR 79  969  969  THR THR D . n 
D 2 80  ALA 80  970  970  ALA ALA D . n 
D 2 81  TYR 81  971  971  TYR TYR D . n 
D 2 82  MET 82  972  972  MET MET D . n 
D 2 83  GLY 83  973  973  GLY GLY D . n 
D 2 84  LEU 84  974  974  LEU LEU D . n 
D 2 85  SER 85  975  975  SER SER D . n 
D 2 86  SER 86  976  976  SER SER D . n 
D 2 87  LEU 87  977  977  LEU LEU D . n 
D 2 88  ARG 88  978  978  ARG ARG D . n 
D 2 89  PRO 89  979  979  PRO PRO D . n 
D 2 90  GLU 90  980  980  GLU GLU D . n 
D 2 91  ASP 91  981  981  ASP ASP D . n 
D 2 92  THR 92  982  982  THR THR D . n 
D 2 93  ALA 93  983  983  ALA ALA D . n 
D 2 94  VAL 94  984  984  VAL VAL D . n 
D 2 95  TYR 95  985  985  TYR TYR D . n 
D 2 96  TYR 96  986  986  TYR TYR D . n 
D 2 97  CYS 97  987  987  CYS CYS D . n 
D 2 98  ALA 98  988  988  ALA ALA D . n 
D 2 99  ARG 99  989  989  ARG ARG D . n 
D 2 100 ASP 100 990  990  ASP ASP D . n 
D 2 101 PRO 101 991  991  PRO PRO D . n 
D 2 102 TYR 102 992  992  TYR TYR D . n 
D 2 103 GLY 103 993  993  GLY GLY D . n 
D 2 104 GLY 104 994  994  GLY GLY D . n 
D 2 105 GLY 105 995  995  GLY GLY D . n 
D 2 106 LYS 106 996  996  LYS LYS D . n 
D 2 107 SER 107 997  997  SER SER D . n 
D 2 108 GLU 108 998  998  GLU GLU D . n 
D 2 109 PHE 109 999  999  PHE PHE D . n 
D 2 110 ASP 110 1000 1000 ASP ASP D . n 
D 2 111 TYR 111 1001 1001 TYR TYR D . n 
D 2 112 TRP 112 1002 1002 TRP TRP D . n 
D 2 113 GLY 113 1003 1003 GLY GLY D . n 
D 2 114 GLN 114 1004 1004 GLN GLN D . n 
D 2 115 GLY 115 1005 1005 GLY GLY D . n 
D 2 116 THR 116 1006 1006 THR THR D . n 
D 2 117 LEU 117 1007 1007 LEU LEU D . n 
D 2 118 VAL 118 1008 1008 VAL VAL D . n 
D 2 119 THR 119 1009 1009 THR THR D . n 
D 2 120 VAL 120 1010 1010 VAL VAL D . n 
D 2 121 SER 121 1011 1011 SER SER D . n 
D 2 122 SER 122 1012 1012 SER SER D . n 
D 2 123 ALA 123 1013 1013 ALA ALA D . n 
D 2 124 SER 124 1014 1014 SER SER D . n 
D 2 125 PRO 125 1015 1015 PRO PRO D . n 
D 2 126 THR 126 1016 1016 THR THR D . n 
D 2 127 SER 127 1017 1017 SER SER D . n 
D 2 128 PRO 128 1018 1018 PRO PRO D . n 
D 2 129 LYS 129 1019 1019 LYS LYS D . n 
D 2 130 VAL 130 1020 1020 VAL VAL D . n 
D 2 131 PHE 131 1021 1021 PHE PHE D . n 
D 2 132 PRO 132 1022 1022 PRO PRO D . n 
D 2 133 LEU 133 1023 1023 LEU LEU D . n 
D 2 134 SER 134 1024 1024 SER SER D . n 
D 2 135 LEU 135 1025 1025 LEU LEU D . n 
D 2 136 ASP 136 1026 1026 ASP ASP D . n 
D 2 137 SER 137 1027 1027 SER SER D . n 
D 2 138 THR 138 1028 1028 THR THR D . n 
D 2 139 PRO 139 1029 1029 PRO PRO D . n 
D 2 140 GLN 140 1030 1030 GLN GLN D . n 
D 2 141 ASP 141 1031 1031 ASP ASP D . n 
D 2 142 GLY 142 1032 1032 GLY GLY D . n 
D 2 143 ASN 143 1033 1033 ASN ASN D . n 
D 2 144 VAL 144 1034 1034 VAL VAL D . n 
D 2 145 VAL 145 1035 1035 VAL VAL D . n 
D 2 146 VAL 146 1036 1036 VAL VAL D . n 
D 2 147 ALA 147 1037 1037 ALA ALA D . n 
D 2 148 CYS 148 1038 1038 CYS CYS D . n 
D 2 149 LEU 149 1039 1039 LEU LEU D . n 
D 2 150 VAL 150 1040 1040 VAL VAL D . n 
D 2 151 GLN 151 1041 1041 GLN GLN D . n 
D 2 152 GLY 152 1042 1042 GLY GLY D . n 
D 2 153 PHE 153 1043 1043 PHE PHE D . n 
D 2 154 PHE 154 1044 1044 PHE PHE D . n 
D 2 155 PRO 155 1045 1045 PRO PRO D . n 
D 2 156 GLN 156 1046 1046 GLN GLN D . n 
D 2 157 GLU 157 1047 1047 GLU GLU D . n 
D 2 158 PRO 158 1048 1048 PRO PRO D . n 
D 2 159 LEU 159 1049 1049 LEU LEU D . n 
D 2 160 SER 160 1050 1050 SER SER D . n 
D 2 161 VAL 161 1051 1051 VAL VAL D . n 
D 2 162 THR 162 1052 1052 THR THR D . n 
D 2 163 TRP 163 1053 1053 TRP TRP D . n 
D 2 164 SER 164 1054 1054 SER SER D . n 
D 2 165 GLU 165 1055 1055 GLU GLU D . n 
D 2 166 SER 166 1056 1056 SER SER D . n 
D 2 167 GLY 167 1057 1057 GLY GLY D . n 
D 2 168 GLN 168 1058 1058 GLN GLN D . n 
D 2 169 ASN 169 1059 1059 ASN ASN D . n 
D 2 170 VAL 170 1060 1060 VAL VAL D . n 
D 2 171 THR 171 1061 1061 THR THR D . n 
D 2 172 ALA 172 1062 1062 ALA ALA D . n 
D 2 173 ARG 173 1063 1063 ARG ARG D . n 
D 2 174 ASN 174 1064 1064 ASN ASN D . n 
D 2 175 PHE 175 1065 1065 PHE PHE D . n 
D 2 176 PRO 176 1066 1066 PRO PRO D . n 
D 2 177 PRO 177 1067 1067 PRO PRO D . n 
D 2 178 SER 178 1068 1068 SER SER D . n 
D 2 179 GLN 179 1069 1069 GLN GLN D . n 
D 2 180 ASP 180 1070 1070 ASP ASP D . n 
D 2 181 ALA 181 1071 1071 ALA ALA D . n 
D 2 182 SER 182 1072 1072 SER SER D . n 
D 2 183 GLY 183 1073 1073 GLY GLY D . n 
D 2 184 ASP 184 1074 1074 ASP ASP D . n 
D 2 185 LEU 185 1075 1075 LEU LEU D . n 
D 2 186 TYR 186 1076 1076 TYR TYR D . n 
D 2 187 THR 187 1077 1077 THR THR D . n 
D 2 188 THR 188 1078 1078 THR THR D . n 
D 2 189 SER 189 1079 1079 SER SER D . n 
D 2 190 SER 190 1080 1080 SER SER D . n 
D 2 191 GLN 191 1081 1081 GLN GLN D . n 
D 2 192 LEU 192 1082 1082 LEU LEU D . n 
D 2 193 THR 193 1083 1083 THR THR D . n 
D 2 194 LEU 194 1084 1084 LEU LEU D . n 
D 2 195 PRO 195 1085 1085 PRO PRO D . n 
D 2 196 ALA 196 1086 1086 ALA ALA D . n 
D 2 197 THR 197 1087 1087 THR THR D . n 
D 2 198 GLN 198 1088 1088 GLN GLN D . n 
D 2 199 CYS 199 1089 1089 CYS CYS D . n 
D 2 200 PRO 200 1090 1090 PRO PRO D . n 
D 2 201 ASP 201 1091 1091 ASP ASP D . n 
D 2 202 GLY 202 1092 1092 GLY GLY D . n 
D 2 203 LYS 203 1093 1093 LYS LYS D . n 
D 2 204 SER 204 1094 1094 SER SER D . n 
D 2 205 VAL 205 1095 1095 VAL VAL D . n 
D 2 206 THR 206 1096 1096 THR THR D . n 
D 2 207 CYS 207 1097 1097 CYS CYS D . n 
D 2 208 HIS 208 1098 1098 HIS HIS D . n 
D 2 209 VAL 209 1099 1099 VAL VAL D . n 
D 2 210 LYS 210 1100 1100 LYS LYS D . n 
D 2 211 HIS 211 1101 1101 HIS HIS D . n 
D 2 212 TYR 212 1102 1102 TYR TYR D . n 
D 2 213 THR 213 1103 1103 THR THR D . n 
D 2 214 ASN 214 1104 1104 ASN ASN D . n 
D 2 215 PRO 215 1105 1105 PRO PRO D . n 
D 2 216 SER 216 1106 1106 SER SER D . n 
D 2 217 GLN 217 1107 1107 GLN GLN D . n 
D 2 218 ASP 218 1108 1108 ASP ASP D . n 
D 2 219 VAL 219 1109 1109 VAL VAL D . n 
D 2 220 THR 220 1110 1110 THR THR D . n 
D 2 221 VAL 221 1111 1111 VAL VAL D . n 
D 2 222 PRO 222 1112 1112 PRO PRO D . n 
D 2 223 CYS 223 1113 1113 CYS CYS D . n 
D 2 224 PRO 224 1114 1114 PRO PRO D . n 
D 2 225 VAL 225 1115 1115 VAL VAL D . n 
D 2 226 PRO 226 1116 1116 PRO PRO D . n 
D 2 227 PRO 227 1117 1117 PRO PRO D . n 
D 2 228 PRO 228 1118 1118 PRO PRO D . n 
D 2 229 PRO 229 1119 1119 PRO PRO D . n 
D 2 230 PRO 230 1120 1120 PRO PRO D . n 
D 2 231 CYS 231 1121 1121 CYS CYS D . n 
D 2 232 CYS 232 1122 1122 CYS CYS D . n 
D 2 233 HIS 233 1123 1123 HIS HIS D . n 
D 2 234 PRO 234 1124 1124 PRO PRO D . n 
D 2 235 ARG 235 1125 1125 ARG ARG D . n 
D 2 236 LEU 236 1126 1126 LEU LEU D . n 
D 2 237 SER 237 1127 1127 SER SER D . n 
D 2 238 LEU 238 1128 1128 LEU LEU D . n 
D 2 239 HIS 239 1129 1129 HIS HIS D . n 
D 2 240 ARG 240 1130 1130 ARG ARG D . n 
D 2 241 PRO 241 1131 1131 PRO PRO D . n 
D 2 242 ALA 242 1132 1132 ALA ALA D . n 
D 2 243 LEU 243 1133 1133 LEU LEU D . n 
D 2 244 GLU 244 1134 1134 GLU GLU D . n 
D 2 245 ASP 245 1135 1135 ASP ASP D . n 
D 2 246 LEU 246 1136 1136 LEU LEU D . n 
D 2 247 LEU 247 1137 1137 LEU LEU D . n 
D 2 248 LEU 248 1138 1138 LEU LEU D . n 
D 2 249 GLY 249 1139 1139 GLY GLY D . n 
D 2 250 SER 250 1140 1140 SER SER D . n 
D 2 251 GLU 251 1141 1141 GLU GLU D . n 
D 2 252 ALA 252 1142 1142 ALA ALA D . n 
D 2 253 ASN 253 1143 1143 ASN ASN D . n 
D 2 254 LEU 254 1144 1144 LEU LEU D . n 
D 2 255 THR 255 1145 1145 THR THR D . n 
D 2 256 CYS 256 1146 1146 CYS CYS D . n 
D 2 257 THR 257 1147 1147 THR THR D . n 
D 2 258 LEU 258 1148 1148 LEU LEU D . n 
D 2 259 THR 259 1149 1149 THR THR D . n 
D 2 260 GLY 260 1150 1150 GLY GLY D . n 
D 2 261 LEU 261 1151 1151 LEU LEU D . n 
D 2 262 ARG 262 1152 1152 ARG ARG D . n 
D 2 263 ASP 263 1153 1153 ASP ASP D . n 
D 2 264 ALA 264 1154 1154 ALA ALA D . n 
D 2 265 SER 265 1155 1155 SER SER D . n 
D 2 266 GLY 266 1156 1156 GLY GLY D . n 
D 2 267 ALA 267 1157 1157 ALA ALA D . n 
D 2 268 THR 268 1158 1158 THR THR D . n 
D 2 269 PHE 269 1159 1159 PHE PHE D . n 
D 2 270 THR 270 1160 1160 THR THR D . n 
D 2 271 TRP 271 1161 1161 TRP TRP D . n 
D 2 272 THR 272 1162 1162 THR THR D . n 
D 2 273 PRO 273 1163 1163 PRO PRO D . n 
D 2 274 SER 274 1164 1164 SER SER D . n 
D 2 275 SER 275 1165 1165 SER SER D . n 
D 2 276 GLY 276 1166 1166 GLY GLY D . n 
D 2 277 LYS 277 1167 1167 LYS LYS D . n 
D 2 278 SER 278 1168 1168 SER SER D . n 
D 2 279 ALA 279 1169 1169 ALA ALA D . n 
D 2 280 VAL 280 1170 1170 VAL VAL D . n 
D 2 281 GLN 281 1171 1171 GLN GLN D . n 
D 2 282 GLY 282 1172 1172 GLY GLY D . n 
D 2 283 PRO 283 1173 1173 PRO PRO D . n 
D 2 284 PRO 284 1174 1174 PRO PRO D . n 
D 2 285 GLU 285 1175 1175 GLU GLU D . n 
D 2 286 ARG 286 1176 1176 ARG ARG D . n 
D 2 287 ASP 287 1177 1177 ASP ASP D . n 
D 2 288 LEU 288 1178 1178 LEU LEU D . n 
D 2 289 CYS 289 1179 1179 CYS CYS D . n 
D 2 290 GLY 290 1180 1180 GLY GLY D . n 
D 2 291 CYS 291 1181 1181 CYS CYS D . n 
D 2 292 TYR 292 1182 1182 TYR TYR D . n 
D 2 293 SER 293 1183 1183 SER SER D . n 
D 2 294 VAL 294 1184 1184 VAL VAL D . n 
D 2 295 SER 295 1185 1185 SER SER D . n 
D 2 296 SER 296 1186 1186 SER SER D . n 
D 2 297 VAL 297 1187 1187 VAL VAL D . n 
D 2 298 LEU 298 1188 1188 LEU LEU D . n 
D 2 299 PRO 299 1189 1189 PRO PRO D . n 
D 2 300 GLY 300 1190 1190 GLY GLY D . n 
D 2 301 CYS 301 1191 1191 CYS CYS D . n 
D 2 302 ALA 302 1192 1192 ALA ALA D . n 
D 2 303 GLN 303 1193 1193 GLN GLN D . n 
D 2 304 PRO 304 1194 1194 PRO PRO D . n 
D 2 305 TRP 305 1195 1195 TRP TRP D . n 
D 2 306 ASN 306 1196 1196 ASN ASN D . n 
D 2 307 HIS 307 1197 1197 HIS HIS D . n 
D 2 308 GLY 308 1198 1198 GLY GLY D . n 
D 2 309 GLU 309 1199 1199 GLU GLU D . n 
D 2 310 THR 310 1200 1200 THR THR D . n 
D 2 311 PHE 311 1201 1201 PHE PHE D . n 
D 2 312 THR 312 1202 1202 THR THR D . n 
D 2 313 CYS 313 1203 1203 CYS CYS D . n 
D 2 314 THR 314 1204 1204 THR THR D . n 
D 2 315 ALA 315 1205 1205 ALA ALA D . n 
D 2 316 ALA 316 1206 1206 ALA ALA D . n 
D 2 317 HIS 317 1207 1207 HIS HIS D . n 
D 2 318 PRO 318 1208 1208 PRO PRO D . n 
D 2 319 GLU 319 1209 1209 GLU GLU D . n 
D 2 320 LEU 320 1210 1210 LEU LEU D . n 
D 2 321 LYS 321 1211 1211 LYS LYS D . n 
D 2 322 THR 322 1212 1212 THR THR D . n 
D 2 323 PRO 323 1213 1213 PRO PRO D . n 
D 2 324 LEU 324 1214 1214 LEU LEU D . n 
D 2 325 THR 325 1215 1215 THR THR D . n 
D 2 326 ALA 326 1216 1216 ALA ALA D . n 
D 2 327 ASN 327 1217 1217 ASN ASN D . n 
D 2 328 ILE 328 1218 1218 ILE ILE D . n 
D 2 329 THR 329 1219 1219 THR THR D . n 
D 2 330 LYS 330 1220 1220 LYS LYS D . n 
D 2 331 SER 331 1221 1221 SER SER D . n 
D 2 332 GLY 332 1222 1222 GLY GLY D . n 
D 2 333 ASN 333 1223 1223 ASN ASN D . n 
D 2 334 THR 334 1224 1224 THR THR D . n 
D 2 335 PHE 335 1225 1225 PHE PHE D . n 
D 2 336 ARG 336 1226 1226 ARG ARG D . n 
D 2 337 PRO 337 1227 1227 PRO PRO D . n 
D 2 338 GLU 338 1228 1228 GLU GLU D . n 
D 2 339 VAL 339 1229 1229 VAL VAL D . n 
D 2 340 HIS 340 1230 1230 HIS HIS D . n 
D 2 341 LEU 341 1231 1231 LEU LEU D . n 
D 2 342 LEU 342 1232 1232 LEU LEU D . n 
D 2 343 PRO 343 1233 1233 PRO PRO D . n 
D 2 344 PRO 344 1234 1234 PRO PRO D . n 
D 2 345 PRO 345 1235 1235 PRO PRO D . n 
D 2 346 SER 346 1236 1236 SER SER D . n 
D 2 347 GLU 347 1237 1237 GLU GLU D . n 
D 2 348 GLU 348 1238 1238 GLU GLU D . n 
D 2 349 LEU 349 1239 1239 LEU LEU D . n 
D 2 350 ALA 350 1240 1240 ALA ALA D . n 
D 2 351 LEU 351 1241 1241 LEU LEU D . n 
D 2 352 ASN 352 1242 1242 ASN ASN D . n 
D 2 353 GLU 353 1243 1243 GLU GLU D . n 
D 2 354 LEU 354 1244 1244 LEU LEU D . n 
D 2 355 VAL 355 1245 1245 VAL VAL D . n 
D 2 356 THR 356 1246 1246 THR THR D . n 
D 2 357 LEU 357 1247 1247 LEU LEU D . n 
D 2 358 THR 358 1248 1248 THR THR D . n 
D 2 359 CYS 359 1249 1249 CYS CYS D . n 
D 2 360 LEU 360 1250 1250 LEU LEU D . n 
D 2 361 ALA 361 1251 1251 ALA ALA D . n 
D 2 362 ARG 362 1252 1252 ARG ARG D . n 
D 2 363 GLY 363 1253 1253 GLY GLY D . n 
D 2 364 PHE 364 1254 1254 PHE PHE D . n 
D 2 365 SER 365 1255 1255 SER SER D . n 
D 2 366 PRO 366 1256 1256 PRO PRO D . n 
D 2 367 LYS 367 1257 1257 LYS LYS D . n 
D 2 368 ASP 368 1258 1258 ASP ASP D . n 
D 2 369 VAL 369 1259 1259 VAL VAL D . n 
D 2 370 LEU 370 1260 1260 LEU LEU D . n 
D 2 371 VAL 371 1261 1261 VAL VAL D . n 
D 2 372 ARG 372 1262 1262 ARG ARG D . n 
D 2 373 TRP 373 1263 1263 TRP TRP D . n 
D 2 374 LEU 374 1264 1264 LEU LEU D . n 
D 2 375 GLN 375 1265 1265 GLN GLN D . n 
D 2 376 GLY 376 1266 1266 GLY GLY D . n 
D 2 377 SER 377 1267 1267 SER SER D . n 
D 2 378 GLN 378 1268 1268 GLN GLN D . n 
D 2 379 GLU 379 1269 1269 GLU GLU D . n 
D 2 380 LEU 380 1270 1270 LEU LEU D . n 
D 2 381 PRO 381 1271 1271 PRO PRO D . n 
D 2 382 ARG 382 1272 1272 ARG ARG D . n 
D 2 383 GLU 383 1273 1273 GLU GLU D . n 
D 2 384 LYS 384 1274 1274 LYS LYS D . n 
D 2 385 TYR 385 1275 1275 TYR TYR D . n 
D 2 386 LEU 386 1276 1276 LEU LEU D . n 
D 2 387 THR 387 1277 1277 THR THR D . n 
D 2 388 TRP 388 1278 1278 TRP TRP D . n 
D 2 389 ALA 389 1279 1279 ALA ALA D . n 
D 2 390 SER 390 1280 1280 SER SER D . n 
D 2 391 ARG 391 1281 1281 ARG ARG D . n 
D 2 392 GLN 392 1282 1282 GLN GLN D . n 
D 2 393 GLU 393 1283 1283 GLU GLU D . n 
D 2 394 PRO 394 1284 1284 PRO PRO D . n 
D 2 395 SER 395 1285 1285 SER SER D . n 
D 2 396 GLN 396 1286 1286 GLN GLN D . n 
D 2 397 GLY 397 1287 1287 GLY GLY D . n 
D 2 398 THR 398 1288 1288 THR THR D . n 
D 2 399 THR 399 1289 1289 THR THR D . n 
D 2 400 THR 400 1290 1290 THR THR D . n 
D 2 401 PHE 401 1291 1291 PHE PHE D . n 
D 2 402 ALA 402 1292 1292 ALA ALA D . n 
D 2 403 VAL 403 1293 1293 VAL VAL D . n 
D 2 404 THR 404 1294 1294 THR THR D . n 
D 2 405 SER 405 1295 1295 SER SER D . n 
D 2 406 ILE 406 1296 1296 ILE ILE D . n 
D 2 407 LEU 407 1297 1297 LEU LEU D . n 
D 2 408 ARG 408 1298 1298 ARG ARG D . n 
D 2 409 VAL 409 1299 1299 VAL VAL D . n 
D 2 410 ALA 410 1300 1300 ALA ALA D . n 
D 2 411 ALA 411 1301 1301 ALA ALA D . n 
D 2 412 GLU 412 1302 1302 GLU GLU D . n 
D 2 413 ASP 413 1303 1303 ASP ASP D . n 
D 2 414 TRP 414 1304 1304 TRP TRP D . n 
D 2 415 LYS 415 1305 1305 LYS LYS D . n 
D 2 416 LYS 416 1306 1306 LYS LYS D . n 
D 2 417 GLY 417 1307 1307 GLY GLY D . n 
D 2 418 ASP 418 1308 1308 ASP ASP D . n 
D 2 419 THR 419 1309 1309 THR THR D . n 
D 2 420 PHE 420 1310 1310 PHE PHE D . n 
D 2 421 SER 421 1311 1311 SER SER D . n 
D 2 422 CYS 422 1312 1312 CYS CYS D . n 
D 2 423 MET 423 1313 1313 MET MET D . n 
D 2 424 VAL 424 1314 1314 VAL VAL D . n 
D 2 425 GLY 425 1315 1315 GLY GLY D . n 
D 2 426 HIS 426 1316 1316 HIS HIS D . n 
D 2 427 GLU 427 1317 1317 GLU GLU D . n 
D 2 428 ALA 428 1318 1318 ALA ALA D . n 
D 2 429 LEU 429 1319 1319 LEU LEU D . n 
D 2 430 PRO 430 1320 1320 PRO PRO D . n 
D 2 431 LEU 431 1321 1321 LEU LEU D . n 
D 2 432 ALA 432 1322 1322 ALA ALA D . n 
D 2 433 PHE 433 1323 1323 PHE PHE D . n 
D 2 434 THR 434 1324 1324 THR THR D . n 
D 2 435 GLN 435 1325 1325 GLN GLN D . n 
D 2 436 LYS 436 1326 1326 LYS LYS D . n 
D 2 437 THR 437 1327 1327 THR THR D . n 
D 2 438 ILE 438 1328 1328 ILE ILE D . n 
D 2 439 ASP 439 1329 1329 ASP ASP D . n 
D 2 440 ARG 440 1330 1330 ARG ARG D . n 
D 2 441 LEU 441 1331 1331 LEU LEU D . n 
D 2 442 ALA 442 1332 1332 ALA ALA D . n 
D 2 443 GLY 443 1333 1333 GLY GLY D . n 
D 2 444 LYS 444 1334 1334 LYS LYS D . n 
D 2 445 PRO 445 1335 1335 PRO PRO D . n 
D 2 446 THR 446 1336 1336 THR THR D . n 
D 2 447 HIS 447 1337 1337 HIS HIS D . n 
D 2 448 VAL 448 1338 1338 VAL VAL D . n 
D 2 449 ASN 449 1339 1339 ASN ASN D . n 
D 2 450 VAL 450 1340 1340 VAL VAL D . n 
D 2 451 SER 451 1341 1341 SER SER D . n 
D 2 452 VAL 452 1342 1342 VAL VAL D . n 
D 2 453 VAL 453 1343 1343 VAL VAL D . n 
D 2 454 MET 454 1344 1344 MET MET D . n 
D 2 455 ALA 455 1345 1345 ALA ALA D . n 
D 2 456 GLU 456 1346 1346 GLU GLU D . n 
D 2 457 VAL 457 1347 1347 VAL VAL D . n 
D 2 458 ASP 458 1348 1348 ASP ASP D . n 
D 2 459 GLY 459 1349 1349 GLY GLY D . n 
D 2 460 THR 460 1350 1350 THR THR D . n 
D 2 461 CYS 461 1351 1351 CYS CYS D . n 
D 2 462 TYR 462 1352 1352 TYR TYR D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-10-19 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2018-04-25 
6 'Structure model' 1 5 2018-06-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Data collection'           
5 6 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software         
2 5 'Structure model' diffrn_radiation 
3 5 'Structure model' diffrn_source    
4 6 'Structure model' diffrn_radiation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_diffrn_radiation.pdbx_scattering_type'           
2 5 'Structure model' '_diffrn_source.source'                            
3 6 'Structure model' '_diffrn_radiation.pdbx_diffrn_protocol'           
4 6 'Structure model' '_diffrn_radiation.pdbx_monochromatic_or_laue_m_l' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
DETECTOR     'data collection' .                   ? 1  ? ? ? ? 
OTOKO        'data reduction'  .                   ? 2  ? ? ? ? 
COLLETTE     'data reduction'  .                   ? 3  ? ? ? ? 
SCTPL5       'model building'  .                   ? 4  ? ? ? ? 
SCTPL7       'model building'  .                   ? 5  ? ? ? ? 
GNOM         'model building'  .                   ? 6  ? ? ? ? 
'Insight II' 'model building'  II                  ? 7  ? ? ? ? 
DISCOVER     refinement        .                   ? 8  ? ? ? ? 
O            'model building'  .                   ? 9  ? ? ? ? 
DETECTOR     'data reduction'  'SUPPLIED SOFTWARE' ? 10 ? ? ? ? 
OTOKO        'data scaling'    .                   ? 11 ? ? ? ? 
COLLETTE     'data scaling'    .                   ? 12 ? ? ? ? 
SCTPL        phasing           'VERSION 5'         ? 13 ? ? ? ? 
GNOM         phasing           .                   ? 14 ? ? ? ? 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
At the time of processing, there were no
suitable sequence database references for 
the proteins in this entry.
;
# 
loop_
_pdbx_coordinate_model.asym_id 
_pdbx_coordinate_model.type 
A 'CA ATOMS ONLY' 
B 'CA ATOMS ONLY' 
C 'CA ATOMS ONLY' 
D 'CA ATOMS ONLY' 
# 
loop_
_pdbx_soln_scatter.id 
_pdbx_soln_scatter.type 
_pdbx_soln_scatter.source_type 
_pdbx_soln_scatter.source_class 
_pdbx_soln_scatter.source_beamline 
_pdbx_soln_scatter.source_beamline_instrument 
_pdbx_soln_scatter.detector_type 
_pdbx_soln_scatter.detector_specific 
_pdbx_soln_scatter.temperature 
_pdbx_soln_scatter.sample_pH 
_pdbx_soln_scatter.num_time_frames 
_pdbx_soln_scatter.concentration_range 
_pdbx_soln_scatter.buffer_name 
_pdbx_soln_scatter.data_reduction_software_list 
_pdbx_soln_scatter.data_analysis_software_list 
_pdbx_soln_scatter.mean_guiner_radius 
_pdbx_soln_scatter.mean_guiner_radius_esd 
_pdbx_soln_scatter.min_mean_cross_sectional_radii_gyration 
_pdbx_soln_scatter.min_mean_cross_sectional_radii_gyration_esd 
_pdbx_soln_scatter.max_mean_cross_sectional_radii_gyration 
_pdbx_soln_scatter.max_mean_cross_sectional_radii_gyration_esd 
_pdbx_soln_scatter.protein_length 
_pdbx_soln_scatter.entry_id 
1 x-ray   'SRS BEAMLINE 2.1'   Y 2.1              ?   '500-CHANNEL QUADRANT'  ? 288 7.4 10 2-15      'DULBECCO PBS'     OTOKO    
'SCTPL7, GNOM' 5.17 0.11 2.39 0.10 1.37 0.16 1  1R70 
2 x-ray   'ESRF BEAMLINE ID02' Y ID02             ?   'FRELON CCD CAMERA'     ? 288 7.4 10 0.55-1.12 'DULBECCO PBS'     MULTICCD 
'SCTPL7, GNOM' 5.18 0.09 2.47 0.09 1.47 0.08 16 1R70 
3 neutron ISIS                 N 'PULSED NEUTRON' LOQ 'AREA (TIME-OF-FLIGHT)' ? 288 7.4 ?  2.0-3.0   'PBS IN 99.9% D2O' COLLETTE 
'SCTPL7, GNOM' 5.03 0.01 2.21 0.10 1.04 0.06 1  1R70 
# 
_pdbx_soln_scatter_model.scatter_id                     1 
_pdbx_soln_scatter_model.id                             1 
_pdbx_soln_scatter_model.method                         'CONSTRAINED SCATTERING FITTING OF HOMOLOGY MODELS' 
_pdbx_soln_scatter_model.software_list                  'INSIGHT II, HOMOLOGY, DISCOVERY, BIOPOLYMER, DELPHI, O, SCTPL7, GNOM' 
_pdbx_soln_scatter_model.software_author_list           ACCELRYS 
_pdbx_soln_scatter_model.entry_fitting_list             ? 
_pdbx_soln_scatter_model.details                        
;HOMOLOGY MODELS WERE BUILT FOR
THE IGA2 FAB AND FC FRAGMENTS STARTING FROM THE IGA1
MODEL (PDB ENTRY 1IGA). THE POSITIONS OF THE FAB
FRAGMENTS RELATIVE TO THE FC FRAGMENT WERE DETERMINED
BY AN APPROACH THAT COMBINED RANDOM HINGE PEPTIDE
STRUCTURES PRODUCED BY MOLECULAR DYNAMICS SIMULATIONS
WITH CURVE-FITTING TO EXPERIMENTAL SOLUTION SCATTERING
DATA. THE X-RAY AND NEUTRON SCATTERING CURVE I(Q)
WAS CALCULATED ASSUMING A UNIFORM SCATTERING DENSITY
FOR THE SPHERES USING THE DEBYE EQUATION AS ADAPTED TO
SPHERES. X-RAY CURVES WERE CALCULATED FROM THE HYDRATED
SPHERE MODELS WITHOUT CORRECTIONS FOR WAVELENGTH
SPREAD OR BEAM DIVERGENCE, WHILE THESE CORRECTIONS
WERE APPLIED FOR THE NEUTRON CURVES BUT NOW USING
UNHYDRATED MODELS. A SINGLE ARRANGEMENT OF THE FAB
FRAGMENTS IS PRESENTED, WHICH IS REPRESENTATIVE OF A
FAMILY OF STRUCTURES THAT FIT THE SCATTERING DATA. MORE
DETAILS ON THE MODELLING STRATEGY ARE CONTAINED IN
THE PRIMARY REFERENCE.
;
_pdbx_soln_scatter_model.num_conformers_calculated      10000 
_pdbx_soln_scatter_model.num_conformers_submitted       1 
_pdbx_soln_scatter_model.conformer_selection_criteria   
;THE MODELLED SCATTERING CURVES WERE ASSESSED BY CALCULATION OF THE
RG, RSX-1 AND VALUES IN THE SAME Q RANGES
USED IN THE EXPERIMENTAL GUINIER FITS. MODELS WERE
THEN RANKED USING A GOODNESS-OF-FIT R-FACTOR
DEFINED BY ANALOGY WITH PROTEIN CRYSTALLOGRAPHY
AND BASED ON THE EXPERIMENTAL CURVES IN THE Q RANGE
EXTENDING TO 2.2 NM-1 (ESRF X-RAYS) AND 2.2 NM-1
(ISIS NEUTRONS).
;
_pdbx_soln_scatter_model.representative_conformer       1 
#