data_1R9F
# 
_entry.id   1R9F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1R9F         
NDB   PR0106       
RCSB  RCSB020601   
WWPDB D_1000020601 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1R9F 
_pdbx_database_status.recvd_initial_deposition_date   2003-10-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ye, K.'       1 
'Malinina, L.' 2 
'Patel, D.J.'  3 
# 
_citation.id                        primary 
_citation.title                     'Recognition of small interfering RNA by a viral suppressor of RNA' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            426 
_citation.page_first                874 
_citation.page_last                 878 
_citation.year                      2003 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14661029 
_citation.pdbx_database_id_DOI      10.1038/nature02213 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ye, K.'       1 
primary 'Malinina, L.' 2 
primary 'Patel, D.J.'  3 
# 
_cell.entry_id           1R9F 
_cell.length_a           91.249 
_cell.length_b           91.249 
_cell.length_c           148.630 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1R9F 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(*CP*GP*UP*AP*CP*GP*CP*GP*GP*AP*AP*UP*AP*CP*UP*UP*CP*GP*AP*UP*U)-3'" 6690.004  1  ? ?              ? ? 
2 polymer     syn "5'-R(*UP*CP*GP*AP*AP*GP*UP*AP*UP*UP*CP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'" 6666.964  1  ? ?              ? ? 
3 polymer     man 'Core protein P19'                                                        15751.966 1  ? 'L144M, L147M' 
'Residues 27-158' ? 
4 non-polymer syn 'SULFATE ION'                                                             96.063    2  ? ?              ? ? 
5 water       nat water                                                                     18.015    70 ? ?              ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no  CGUACGCGGAAUACUUCGAUU CGUACGCGGAAUACUUCGAUU B ? 
2 polyribonucleotide no no  UCGAAGUAUUCCGCGUACGUU UCGAAGUAUUCCGCGUACGUU C ? 
3 'polypeptide(L)'   no yes 
;GSH(MSE)TSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYA
ASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCE(MSE)AIRSKQE(MSE)LQ(MSE)APIEVESNVSR
;
;GSHMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRF
FGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMAPIEVESNVSR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   C   n 
1 2   G   n 
1 3   U   n 
1 4   A   n 
1 5   C   n 
1 6   G   n 
1 7   C   n 
1 8   G   n 
1 9   G   n 
1 10  A   n 
1 11  A   n 
1 12  U   n 
1 13  A   n 
1 14  C   n 
1 15  U   n 
1 16  U   n 
1 17  C   n 
1 18  G   n 
1 19  A   n 
1 20  U   n 
1 21  U   n 
2 1   U   n 
2 2   C   n 
2 3   G   n 
2 4   A   n 
2 5   A   n 
2 6   G   n 
2 7   U   n 
2 8   A   n 
2 9   U   n 
2 10  U   n 
2 11  C   n 
2 12  C   n 
2 13  G   n 
2 14  C   n 
2 15  G   n 
2 16  U   n 
2 17  A   n 
2 18  C   n 
2 19  G   n 
2 20  U   n 
2 21  U   n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MSE n 
3 5   THR n 
3 6   SER n 
3 7   PRO n 
3 8   PHE n 
3 9   LYS n 
3 10  LEU n 
3 11  PRO n 
3 12  ASP n 
3 13  GLU n 
3 14  SER n 
3 15  PRO n 
3 16  SER n 
3 17  TRP n 
3 18  THR n 
3 19  GLU n 
3 20  TRP n 
3 21  ARG n 
3 22  LEU n 
3 23  HIS n 
3 24  ASN n 
3 25  ASP n 
3 26  GLU n 
3 27  THR n 
3 28  ASN n 
3 29  SER n 
3 30  ASN n 
3 31  GLN n 
3 32  ASP n 
3 33  ASN n 
3 34  PRO n 
3 35  LEU n 
3 36  GLY n 
3 37  PHE n 
3 38  LYS n 
3 39  GLU n 
3 40  SER n 
3 41  TRP n 
3 42  GLY n 
3 43  PHE n 
3 44  GLY n 
3 45  LYS n 
3 46  VAL n 
3 47  VAL n 
3 48  PHE n 
3 49  LYS n 
3 50  ARG n 
3 51  TYR n 
3 52  LEU n 
3 53  ARG n 
3 54  TYR n 
3 55  ASP n 
3 56  ARG n 
3 57  THR n 
3 58  GLU n 
3 59  ALA n 
3 60  SER n 
3 61  LEU n 
3 62  HIS n 
3 63  ARG n 
3 64  VAL n 
3 65  LEU n 
3 66  GLY n 
3 67  SER n 
3 68  TRP n 
3 69  THR n 
3 70  GLY n 
3 71  ASP n 
3 72  SER n 
3 73  VAL n 
3 74  ASN n 
3 75  TYR n 
3 76  ALA n 
3 77  ALA n 
3 78  SER n 
3 79  ARG n 
3 80  PHE n 
3 81  PHE n 
3 82  GLY n 
3 83  PHE n 
3 84  ASP n 
3 85  GLN n 
3 86  ILE n 
3 87  GLY n 
3 88  CYS n 
3 89  THR n 
3 90  TYR n 
3 91  SER n 
3 92  ILE n 
3 93  ARG n 
3 94  PHE n 
3 95  ARG n 
3 96  GLY n 
3 97  VAL n 
3 98  SER n 
3 99  ILE n 
3 100 THR n 
3 101 VAL n 
3 102 SER n 
3 103 GLY n 
3 104 GLY n 
3 105 SER n 
3 106 ARG n 
3 107 THR n 
3 108 LEU n 
3 109 GLN n 
3 110 HIS n 
3 111 LEU n 
3 112 CYS n 
3 113 GLU n 
3 114 MSE n 
3 115 ALA n 
3 116 ILE n 
3 117 ARG n 
3 118 SER n 
3 119 LYS n 
3 120 GLN n 
3 121 GLU n 
3 122 MSE n 
3 123 LEU n 
3 124 GLN n 
3 125 MSE n 
3 126 ALA n 
3 127 PRO n 
3 128 ILE n 
3 129 GLU n 
3 130 VAL n 
3 131 GLU n 
3 132 SER n 
3 133 ASN n 
3 134 VAL n 
3 135 SER n 
3 136 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Tombusvirus 
_entity_src_gen.pdbx_gene_src_gene                 p19 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Tomato bushy stunt virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12145 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 
;5'-OH and 3'-OH
;
2 1 sample ? ? ? ? ? 
;5'-OH and 3'-OH
;
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VP19_TBSVC P11690 3 
;TSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFD
QIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSR
;
27 ? 
2 PDB 1R9F       1R9F   1 ? ?  ? 
3 PDB 1R9F       1R9F   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1R9F A 5 ? 136 ? P11690 27 ? 158 ? 27 158 
2 2 1R9F B 1 ? 21  ? 1R9F   1  ? 21  ? 1  21  
3 3 1R9F C 1 ? 21  ? 1R9F   1  ? 21  ? 1  21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1R9F GLY A 1   ? UNP P11690 ?   ?   'CLONING ARTIFACT' 23  1 
1 1R9F SER A 2   ? UNP P11690 ?   ?   'CLONING ARTIFACT' 24  2 
1 1R9F HIS A 3   ? UNP P11690 ?   ?   'CLONING ARTIFACT' 25  3 
1 1R9F MSE A 4   ? UNP P11690 ?   ?   'CLONING ARTIFACT' 26  4 
1 1R9F MSE A 114 ? UNP P11690 MET 136 'MODIFIED RESIDUE' 136 5 
1 1R9F MSE A 122 ? UNP P11690 LEU 144 ENGINEERED         144 6 
1 1R9F MSE A 125 ? UNP P11690 LEU 147 ENGINEERED         147 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE             ? 'C5 H11 N O2 Se'  196.106 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1R9F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   39.86 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, potassium chloride, HEPES-NaOH, dithiothreitol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate'   ? ? ? 
1 2 1 'potassium chloride' ? ? ? 
1 3 1 HEPES-NaOH           ? ? ? 
1 4 1 dithiothreitol       ? ? ? 
1 5 1 H2O                  ? ? ? 
1 6 2 'ammonium sulfate'   ? ? ? 
1 7 2 'potassium chloride' ? ? ? 
1 8 2 H2O                  ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-07-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DIAMOND (111) DOUBLE-CRYSTAL MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9791 1.0 
2 0.9789 1.0 
3 0.9562 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9791,0.9789,0.9562 
# 
_reflns.entry_id                     1R9F 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.850 
_reflns.number_obs                   39408 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        44.8000 
_reflns.B_iso_Wilson_estimate        21.80 
_reflns.pdbx_redundancy              9.500 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.92 
_reflns_shell.percent_possible_all   93.2 
_reflns_shell.Rmerge_I_obs           0.725 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1R9F 
_refine.ls_number_reflns_obs                     36309 
_refine.ls_number_reflns_all                     36309 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             14.86 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    92.3 
_refine.ls_R_factor_obs                          0.212 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.23 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  1772 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.40 
_refine.aniso_B[1][1]                            5.46000 
_refine.aniso_B[2][2]                            5.46000 
_refine.aniso_B[3][3]                            -10.91000 
_refine.aniso_B[1][2]                            4.19000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 44.85 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1R9F 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        972 
_refine_hist.pdbx_number_atoms_nucleic_acid   810 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             70 
_refine_hist.number_atoms_total               1862 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        14.86 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.004 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             0.90  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      16.30 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.02  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.420 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.210 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.110 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.150 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.86 
_refine_ls_shell.d_res_low                        1.97 
_refine_ls_shell.number_reflns_R_work             4623 
_refine_ls_shell.R_factor_R_work                  0.324 
_refine_ls_shell.percent_reflns_obs               74.20 
_refine_ls_shell.R_factor_R_free                  0.355 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            4.50 
_refine_ls_shell.number_reflns_R_free             220 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1R9F 
_struct.title                     'Crystal structure of p19 complexed with 19-bp small interfering RNA' 
_struct.pdbx_descriptor           'Crystal structure of p19 complexed with 19-bp small interfering RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1R9F 
_struct_keywords.pdbx_keywords   'Viral protein/RNA' 
_struct_keywords.text            'Protein-RNA complex, Dimer, double helix, Viral protein-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assemble is a p19 dimer in complex with one siRNA duplex generated from 
the protein monomer and half RNA (19-bp duplex in half occupancy) in the asymmetric unit  
by the operation: Y+2/3,X-2/3,-Z+1/3.  The 2-fold symmetry operation generates another overlapping  
half RNA in opposite orientation, compensating the lack of symmetry in RNA duplex itself.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER C 16  ? THR C 27  ? SER A 38  THR A 49  1 ? 12 
HELX_P HELX_P2 2 THR C 57  ? GLY C 66  ? THR A 79  GLY A 88  1 ? 10 
HELX_P HELX_P3 3 THR C 69  ? ARG C 79  ? THR A 91  ARG A 101 1 ? 11 
HELX_P HELX_P4 4 THR C 107 ? GLN C 124 ? THR A 129 GLN A 146 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C HIS 3   C  ? ? ? 1_555 C MSE 4   N  ? ? A HIS 25  A MSE 26  1_555 ? ? ? ? ? ? ?            1.329 ? 
covale2  covale ? ? C MSE 4   C  ? ? ? 1_555 C THR 5   N  ? ? A MSE 26  A THR 27  1_555 ? ? ? ? ? ? ?            1.328 ? 
covale3  covale ? ? C GLU 113 C  ? ? ? 1_555 C MSE 114 N  ? ? A GLU 135 A MSE 136 1_555 ? ? ? ? ? ? ?            1.329 ? 
covale4  covale ? ? C MSE 114 C  ? ? ? 1_555 C ALA 115 N  ? ? A MSE 136 A ALA 137 1_555 ? ? ? ? ? ? ?            1.331 ? 
covale5  covale ? ? C GLU 121 C  ? ? ? 1_555 C MSE 122 N  ? ? A GLU 143 A MSE 144 1_555 ? ? ? ? ? ? ?            1.327 ? 
covale6  covale ? ? C MSE 122 C  ? ? ? 1_555 C LEU 123 N  ? ? A MSE 144 A LEU 145 1_555 ? ? ? ? ? ? ?            1.326 ? 
covale7  covale ? ? C GLN 124 C  ? ? ? 1_555 C MSE 125 N  ? ? A GLN 146 A MSE 147 1_555 ? ? ? ? ? ? ?            1.330 ? 
covale8  covale ? ? C MSE 125 C  ? ? ? 1_555 C ALA 126 N  ? ? A MSE 147 A ALA 148 1_555 ? ? ? ? ? ? ?            1.329 ? 
hydrog1  hydrog ? ? A C   1   N3 ? ? ? 1_555 B G   19  N1 ? ? B C   1   C G   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A C   1   N4 ? ? ? 1_555 B G   19  O6 ? ? B C   1   C G   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A C   1   O2 ? ? ? 1_555 B G   19  N2 ? ? B C   1   C G   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A G   2   N1 ? ? ? 1_555 B C   18  N3 ? ? B G   2   C C   18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A G   2   N2 ? ? ? 1_555 B C   18  O2 ? ? B G   2   C C   18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A G   2   O6 ? ? ? 1_555 B C   18  N4 ? ? B G   2   C C   18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A U   3   N3 ? ? ? 1_555 B A   17  N1 ? ? B U   3   C A   17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A U   3   O4 ? ? ? 1_555 B A   17  N6 ? ? B U   3   C A   17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A A   4   N1 ? ? ? 1_555 B U   16  N3 ? ? B A   4   C U   16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A A   4   N6 ? ? ? 1_555 B U   16  O4 ? ? B A   4   C U   16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A C   5   N3 ? ? ? 1_555 B G   15  N1 ? ? B C   5   C G   15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A C   5   N4 ? ? ? 1_555 B G   15  O6 ? ? B C   5   C G   15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A C   5   O2 ? ? ? 1_555 B G   15  N2 ? ? B C   5   C G   15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A G   6   N1 ? ? ? 1_555 B C   14  N3 ? ? B G   6   C C   14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A G   6   N2 ? ? ? 1_555 B C   14  O2 ? ? B G   6   C C   14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A G   6   O6 ? ? ? 1_555 B C   14  N4 ? ? B G   6   C C   14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A C   7   N3 ? ? ? 1_555 B G   13  N1 ? ? B C   7   C G   13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A C   7   N4 ? ? ? 1_555 B G   13  O6 ? ? B C   7   C G   13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A C   7   O2 ? ? ? 1_555 B G   13  N2 ? ? B C   7   C G   13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A G   8   N1 ? ? ? 1_555 B C   12  N3 ? ? B G   8   C C   12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A G   8   N2 ? ? ? 1_555 B C   12  O2 ? ? B G   8   C C   12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A G   8   O6 ? ? ? 1_555 B C   12  N4 ? ? B G   8   C C   12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A G   9   N1 ? ? ? 1_555 B C   11  N3 ? ? B G   9   C C   11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A G   9   N2 ? ? ? 1_555 B C   11  O2 ? ? B G   9   C C   11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A G   9   O6 ? ? ? 1_555 B C   11  N4 ? ? B G   9   C C   11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A A   10  N1 ? ? ? 1_555 B U   10  N3 ? ? B A   10  C U   10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A A   10  N6 ? ? ? 1_555 B U   10  O4 ? ? B A   10  C U   10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A A   11  N1 ? ? ? 1_555 B U   9   N3 ? ? B A   11  C U   9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A A   11  N6 ? ? ? 1_555 B U   9   O4 ? ? B A   11  C U   9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A U   12  N3 ? ? ? 1_555 B A   8   N1 ? ? B U   12  C A   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A U   12  O4 ? ? ? 1_555 B A   8   N6 ? ? B U   12  C A   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A A   13  N1 ? ? ? 1_555 B U   7   N3 ? ? B A   13  C U   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A A   13  N6 ? ? ? 1_555 B U   7   O4 ? ? B A   13  C U   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A C   14  N3 ? ? ? 1_555 B G   6   N1 ? ? B C   14  C G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A C   14  N4 ? ? ? 1_555 B G   6   O6 ? ? B C   14  C G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A C   14  O2 ? ? ? 1_555 B G   6   N2 ? ? B C   14  C G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A U   15  N3 ? ? ? 1_555 B A   5   N1 ? ? B U   15  C A   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A U   15  O4 ? ? ? 1_555 B A   5   N6 ? ? B U   15  C A   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A U   16  N3 ? ? ? 1_555 B A   4   N1 ? ? B U   16  C A   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A U   16  O4 ? ? ? 1_555 B A   4   N6 ? ? B U   16  C A   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A C   17  N3 ? ? ? 1_555 B G   3   N1 ? ? B C   17  C G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A C   17  N4 ? ? ? 1_555 B G   3   O6 ? ? B C   17  C G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A C   17  O2 ? ? ? 1_555 B G   3   N2 ? ? B C   17  C G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A G   18  N1 ? ? ? 1_555 B C   2   N3 ? ? B G   18  C C   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A G   18  N2 ? ? ? 1_555 B C   2   O2 ? ? B G   18  C C   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A G   18  O6 ? ? ? 1_555 B C   2   N4 ? ? B G   18  C C   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? A A   19  N1 ? ? ? 1_555 B U   1   N3 ? ? B A   19  C U   1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? A A   19  N6 ? ? ? 1_555 B U   1   O4 ? ? B A   19  C U   1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL C 46 ? ARG C 53  ? VAL A 68  ARG A 75  
A 2 GLY C 36 ? PHE C 43  ? GLY A 58  PHE A 65  
A 3 GLY C 87 ? PHE C 94  ? GLY A 109 PHE A 116 
A 4 VAL C 97 ? GLY C 104 ? VAL A 119 GLY A 126 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL C 46 ? O VAL A 68  N PHE C 43  ? N PHE A 65  
A 2 3 N GLY C 42 ? N GLY A 64  O THR C 89  ? O THR A 111 
A 3 4 N CYS C 88 ? N CYS A 110 O GLY C 103 ? O GLY A 125 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 159' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 160' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 SER C 6  ? SER A 28  . ? 1_555 ? 
2  AC1 5 PHE C 48 ? PHE A 70  . ? 1_555 ? 
3  AC1 5 ARG C 50 ? ARG A 72  . ? 1_555 ? 
4  AC1 5 HOH H .  ? HOH A 168 . ? 1_555 ? 
5  AC1 5 HOH H .  ? HOH A 208 . ? 1_555 ? 
6  AC2 5 SER C 16 ? SER A 38  . ? 1_555 ? 
7  AC2 5 THR C 18 ? THR A 40  . ? 1_555 ? 
8  AC2 5 HIS C 62 ? HIS A 84  . ? 5_555 ? 
9  AC2 5 HOH H .  ? HOH A 167 . ? 1_555 ? 
10 AC2 5 HOH H .  ? HOH A 174 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1R9F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1R9F 
_atom_sites.fract_transf_matrix[1][1]   0.010959 
_atom_sites.fract_transf_matrix[1][2]   0.006327 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012654 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006728 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . C   A 1 1   ? 63.234 13.945  5.391  0.50 53.75 ? 1   C   B "O5'" 1 
ATOM   2    C  "C5'" . C   A 1 1   ? 63.771 12.648  5.111  0.50 53.43 ? 1   C   B "C5'" 1 
ATOM   3    C  "C4'" . C   A 1 1   ? 64.991 12.703  4.220  0.50 52.84 ? 1   C   B "C4'" 1 
ATOM   4    O  "O4'" . C   A 1 1   ? 64.639 13.305  2.944  0.50 52.13 ? 1   C   B "O4'" 1 
ATOM   5    C  "C3'" . C   A 1 1   ? 66.133 13.563  4.733  0.50 53.07 ? 1   C   B "C3'" 1 
ATOM   6    O  "O3'" . C   A 1 1   ? 66.948 12.849  5.653  0.50 54.48 ? 1   C   B "O3'" 1 
ATOM   7    C  "C2'" . C   A 1 1   ? 66.879 13.892  3.447  0.50 52.33 ? 1   C   B "C2'" 1 
ATOM   8    O  "O2'" . C   A 1 1   ? 67.685 12.822  2.999  0.50 52.08 ? 1   C   B "O2'" 1 
ATOM   9    C  "C1'" . C   A 1 1   ? 65.715 14.107  2.479  0.50 52.00 ? 1   C   B "C1'" 1 
ATOM   10   N  N1    . C   A 1 1   ? 65.264 15.509  2.451  0.50 51.57 ? 1   C   B N1    1 
ATOM   11   C  C2    . C   A 1 1   ? 66.055 16.462  1.798  0.50 51.22 ? 1   C   B C2    1 
ATOM   12   O  O2    . C   A 1 1   ? 67.103 16.096  1.246  0.50 50.90 ? 1   C   B O2    1 
ATOM   13   N  N3    . C   A 1 1   ? 65.656 17.757  1.787  0.50 50.42 ? 1   C   B N3    1 
ATOM   14   C  C4    . C   A 1 1   ? 64.517 18.109  2.391  0.50 50.94 ? 1   C   B C4    1 
ATOM   15   N  N4    . C   A 1 1   ? 64.163 19.397  2.359  0.50 51.02 ? 1   C   B N4    1 
ATOM   16   C  C5    . C   A 1 1   ? 63.691 17.157  3.056  0.50 51.14 ? 1   C   B C5    1 
ATOM   17   C  C6    . C   A 1 1   ? 64.097 15.881  3.060  0.50 51.45 ? 1   C   B C6    1 
ATOM   18   P  P     . G   A 1 2   ? 67.736 13.649  6.802  0.50 55.90 ? 2   G   B P     1 
ATOM   19   O  OP1   . G   A 1 2   ? 68.535 12.650  7.554  0.50 56.24 ? 2   G   B OP1   1 
ATOM   20   O  OP2   . G   A 1 2   ? 66.768 14.510  7.529  0.50 56.11 ? 2   G   B OP2   1 
ATOM   21   O  "O5'" . G   A 1 2   ? 68.740 14.589  5.997  0.50 56.75 ? 2   G   B "O5'" 1 
ATOM   22   C  "C5'" . G   A 1 2   ? 69.753 14.027  5.171  0.50 58.44 ? 2   G   B "C5'" 1 
ATOM   23   C  "C4'" . G   A 1 2   ? 70.509 15.113  4.443  0.50 59.56 ? 2   G   B "C4'" 1 
ATOM   24   O  "O4'" . G   A 1 2   ? 69.617 15.817  3.540  0.50 59.28 ? 2   G   B "O4'" 1 
ATOM   25   C  "C3'" . G   A 1 2   ? 71.084 16.225  5.300  0.50 60.76 ? 2   G   B "C3'" 1 
ATOM   26   O  "O3'" . G   A 1 2   ? 72.307 15.839  5.912  0.50 63.52 ? 2   G   B "O3'" 1 
ATOM   27   C  "C2'" . G   A 1 2   ? 71.299 17.330  4.274  0.50 60.04 ? 2   G   B "C2'" 1 
ATOM   28   O  "O2'" . G   A 1 2   ? 72.474 17.155  3.509  0.50 60.00 ? 2   G   B "O2'" 1 
ATOM   29   C  "C1'" . G   A 1 2   ? 70.070 17.153  3.381  0.50 59.12 ? 2   G   B "C1'" 1 
ATOM   30   N  N9    . G   A 1 2   ? 68.992 18.066  3.746  0.50 57.87 ? 2   G   B N9    1 
ATOM   31   C  C8    . G   A 1 2   ? 67.816 17.770  4.393  0.50 57.50 ? 2   G   B C8    1 
ATOM   32   N  N7    . G   A 1 2   ? 67.057 18.817  4.578  0.50 56.99 ? 2   G   B N7    1 
ATOM   33   C  C5    . G   A 1 2   ? 67.777 19.865  4.019  0.50 56.89 ? 2   G   B C5    1 
ATOM   34   C  C6    . G   A 1 2   ? 67.466 21.251  3.914  0.50 56.74 ? 2   G   B C6    1 
ATOM   35   O  O6    . G   A 1 2   ? 66.454 21.851  4.306  0.50 56.10 ? 2   G   B O6    1 
ATOM   36   N  N1    . G   A 1 2   ? 68.483 21.953  3.272  0.50 56.51 ? 2   G   B N1    1 
ATOM   37   C  C2    . G   A 1 2   ? 69.645 21.397  2.793  0.50 56.73 ? 2   G   B C2    1 
ATOM   38   N  N2    . G   A 1 2   ? 70.507 22.232  2.203  0.50 57.07 ? 2   G   B N2    1 
ATOM   39   N  N3    . G   A 1 2   ? 69.942 20.116  2.885  0.50 57.19 ? 2   G   B N3    1 
ATOM   40   C  C4    . G   A 1 2   ? 68.972 19.415  3.503  0.50 57.06 ? 2   G   B C4    1 
ATOM   41   P  P     . U   A 1 3   ? 72.882 16.698  7.142  0.50 65.41 ? 3   U   B P     1 
ATOM   42   O  OP1   . U   A 1 3   ? 74.113 16.016  7.620  0.50 65.41 ? 3   U   B OP1   1 
ATOM   43   O  OP2   . U   A 1 3   ? 71.772 16.965  8.093  0.50 64.75 ? 3   U   B OP2   1 
ATOM   44   O  "O5'" . U   A 1 3   ? 73.305 18.082  6.475  0.50 66.63 ? 3   U   B "O5'" 1 
ATOM   45   C  "C5'" . U   A 1 3   ? 74.392 18.150  5.558  0.50 69.03 ? 3   U   B "C5'" 1 
ATOM   46   C  "C4'" . U   A 1 3   ? 74.719 19.589  5.247  0.50 70.65 ? 3   U   B "C4'" 1 
ATOM   47   O  "O4'" . U   A 1 3   ? 73.608 20.193  4.533  0.50 70.93 ? 3   U   B "O4'" 1 
ATOM   48   C  "C3'" . U   A 1 3   ? 74.903 20.480  6.463  0.50 71.94 ? 3   U   B "C3'" 1 
ATOM   49   O  "O3'" . U   A 1 3   ? 76.223 20.373  6.983  0.50 73.84 ? 3   U   B "O3'" 1 
ATOM   50   C  "C2'" . U   A 1 3   ? 74.612 21.863  5.896  0.50 71.82 ? 3   U   B "C2'" 1 
ATOM   51   O  "O2'" . U   A 1 3   ? 75.712 22.420  5.203  0.50 71.73 ? 3   U   B "O2'" 1 
ATOM   52   C  "C1'" . U   A 1 3   ? 73.479 21.553  4.915  0.50 71.42 ? 3   U   B "C1'" 1 
ATOM   53   N  N1    . U   A 1 3   ? 72.143 21.747  5.496  0.50 71.29 ? 3   U   B N1    1 
ATOM   54   C  C2    . U   A 1 3   ? 71.664 23.039  5.573  0.50 71.29 ? 3   U   B C2    1 
ATOM   55   O  O2    . U   A 1 3   ? 72.301 24.004  5.185  0.50 71.15 ? 3   U   B O2    1 
ATOM   56   N  N3    . U   A 1 3   ? 70.411 23.163  6.123  0.50 71.02 ? 3   U   B N3    1 
ATOM   57   C  C4    . U   A 1 3   ? 69.605 22.148  6.594  0.50 70.93 ? 3   U   B C4    1 
ATOM   58   O  O4    . U   A 1 3   ? 68.496 22.423  7.061  0.50 71.18 ? 3   U   B O4    1 
ATOM   59   C  C5    . U   A 1 3   ? 70.171 20.837  6.480  0.50 70.98 ? 3   U   B C5    1 
ATOM   60   C  C6    . U   A 1 3   ? 71.391 20.685  5.948  0.50 71.24 ? 3   U   B C6    1 
ATOM   61   P  P     . A   A 1 4   ? 76.471 20.549  8.561  0.50 75.15 ? 4   A   B P     1 
ATOM   62   O  OP1   . A   A 1 4   ? 77.847 20.071  8.853  0.50 75.06 ? 4   A   B OP1   1 
ATOM   63   O  OP2   . A   A 1 4   ? 75.317 19.955  9.284  0.50 75.32 ? 4   A   B OP2   1 
ATOM   64   O  "O5'" . A   A 1 4   ? 76.430 22.127  8.773  0.50 75.79 ? 4   A   B "O5'" 1 
ATOM   65   C  "C5'" . A   A 1 4   ? 77.432 22.959  8.201  0.50 76.99 ? 4   A   B "C5'" 1 
ATOM   66   C  "C4'" . A   A 1 4   ? 77.055 24.413  8.350  0.50 77.80 ? 4   A   B "C4'" 1 
ATOM   67   O  "O4'" . A   A 1 4   ? 75.887 24.707  7.537  0.50 77.91 ? 4   A   B "O4'" 1 
ATOM   68   C  "C3'" . A   A 1 4   ? 76.635 24.849  9.742  0.50 78.28 ? 4   A   B "C3'" 1 
ATOM   69   O  "O3'" . A   A 1 4   ? 77.757 25.084  10.586 0.50 78.58 ? 4   A   B "O3'" 1 
ATOM   70   C  "C2'" . A   A 1 4   ? 75.859 26.125  9.443  0.50 78.28 ? 4   A   B "C2'" 1 
ATOM   71   O  "O2'" . A   A 1 4   ? 76.702 27.234  9.198  0.50 78.37 ? 4   A   B "O2'" 1 
ATOM   72   C  "C1'" . A   A 1 4   ? 75.128 25.736  8.156  0.50 78.14 ? 4   A   B "C1'" 1 
ATOM   73   N  N9    . A   A 1 4   ? 73.780 25.230  8.417  0.50 78.31 ? 4   A   B N9    1 
ATOM   74   C  C8    . A   A 1 4   ? 73.382 23.934  8.639  0.50 78.27 ? 4   A   B C8    1 
ATOM   75   N  N7    . A   A 1 4   ? 72.096 23.808  8.867  0.50 78.10 ? 4   A   B N7    1 
ATOM   76   C  C5    . A   A 1 4   ? 71.614 25.108  8.786  0.50 78.23 ? 4   A   B C5    1 
ATOM   77   C  C6    . A   A 1 4   ? 70.324 25.653  8.933  0.50 78.16 ? 4   A   B C6    1 
ATOM   78   N  N6    . A   A 1 4   ? 69.237 24.929  9.206  0.50 78.05 ? 4   A   B N6    1 
ATOM   79   N  N1    . A   A 1 4   ? 70.188 26.990  8.789  0.50 78.22 ? 4   A   B N1    1 
ATOM   80   C  C2    . A   A 1 4   ? 71.277 27.719  8.516  0.50 78.39 ? 4   A   B C2    1 
ATOM   81   N  N3    . A   A 1 4   ? 72.538 27.324  8.356  0.50 78.38 ? 4   A   B N3    1 
ATOM   82   C  C4    . A   A 1 4   ? 72.641 25.992  8.505  0.50 78.32 ? 4   A   B C4    1 
ATOM   83   P  P     . C   A 1 5   ? 77.588 24.965  12.180 0.50 78.90 ? 5   C   B P     1 
ATOM   84   O  OP1   . C   A 1 5   ? 78.927 25.168  12.790 0.50 78.92 ? 5   C   B OP1   1 
ATOM   85   O  OP2   . C   A 1 5   ? 76.826 23.727  12.481 0.50 78.99 ? 5   C   B OP2   1 
ATOM   86   O  "O5'" . C   A 1 5   ? 76.674 26.216  12.553 0.50 78.96 ? 5   C   B "O5'" 1 
ATOM   87   C  "C5'" . C   A 1 5   ? 77.080 27.533  12.202 0.50 78.78 ? 5   C   B "C5'" 1 
ATOM   88   C  "C4'" . C   A 1 5   ? 75.976 28.525  12.483 0.50 78.91 ? 5   C   B "C4'" 1 
ATOM   89   O  "O4'" . C   A 1 5   ? 74.838 28.272  11.620 0.50 78.87 ? 5   C   B "O4'" 1 
ATOM   90   C  "C3'" . C   A 1 5   ? 75.365 28.489  13.872 0.50 78.77 ? 5   C   B "C3'" 1 
ATOM   91   O  "O3'" . C   A 1 5   ? 76.198 29.148  14.818 0.50 78.45 ? 5   C   B "O3'" 1 
ATOM   92   C  "C2'" . C   A 1 5   ? 74.055 29.239  13.650 0.50 78.82 ? 5   C   B "C2'" 1 
ATOM   93   O  "O2'" . C   A 1 5   ? 74.224 30.643  13.643 0.50 78.91 ? 5   C   B "O2'" 1 
ATOM   94   C  "C1'" . C   A 1 5   ? 73.663 28.766  12.246 0.50 78.97 ? 5   C   B "C1'" 1 
ATOM   95   N  N1    . C   A 1 5   ? 72.634 27.712  12.254 0.50 79.11 ? 5   C   B N1    1 
ATOM   96   C  C2    . C   A 1 5   ? 71.290 28.100  12.244 0.50 79.41 ? 5   C   B C2    1 
ATOM   97   O  O2    . C   A 1 5   ? 71.017 29.311  12.212 0.50 79.79 ? 5   C   B O2    1 
ATOM   98   N  N3    . C   A 1 5   ? 70.324 27.154  12.269 0.50 79.42 ? 5   C   B N3    1 
ATOM   99   C  C4    . C   A 1 5   ? 70.657 25.863  12.301 0.50 79.40 ? 5   C   B C4    1 
ATOM   100  N  N4    . C   A 1 5   ? 69.664 24.966  12.329 0.50 79.32 ? 5   C   B N4    1 
ATOM   101  C  C5    . C   A 1 5   ? 72.020 25.435  12.306 0.50 79.13 ? 5   C   B C5    1 
ATOM   102  C  C6    . C   A 1 5   ? 72.968 26.386  12.280 0.50 79.11 ? 5   C   B C6    1 
ATOM   103  P  P     . G   A 1 6   ? 76.012 28.847  16.386 0.50 78.05 ? 6   G   B P     1 
ATOM   104  O  OP1   . G   A 1 6   ? 77.167 29.451  17.098 0.50 77.83 ? 6   G   B OP1   1 
ATOM   105  O  OP2   . G   A 1 6   ? 75.720 27.401  16.553 0.50 77.96 ? 6   G   B OP2   1 
ATOM   106  O  "O5'" . G   A 1 6   ? 74.706 29.672  16.773 0.50 77.38 ? 6   G   B "O5'" 1 
ATOM   107  C  "C5'" . G   A 1 6   ? 74.683 31.090  16.650 0.50 76.38 ? 6   G   B "C5'" 1 
ATOM   108  C  "C4'" . G   A 1 6   ? 73.315 31.624  16.997 0.50 75.53 ? 6   G   B "C4'" 1 
ATOM   109  O  "O4'" . G   A 1 6   ? 72.349 31.174  16.010 0.50 75.46 ? 6   G   B "O4'" 1 
ATOM   110  C  "C3'" . G   A 1 6   ? 72.740 31.137  18.315 0.50 74.83 ? 6   G   B "C3'" 1 
ATOM   111  O  "O3'" . G   A 1 6   ? 73.252 31.886  19.409 0.50 73.37 ? 6   G   B "O3'" 1 
ATOM   112  C  "C2'" . G   A 1 6   ? 71.248 31.365  18.108 0.50 74.92 ? 6   G   B "C2'" 1 
ATOM   113  O  "O2'" . G   A 1 6   ? 70.872 32.715  18.294 0.50 74.69 ? 6   G   B "O2'" 1 
ATOM   114  C  "C1'" . G   A 1 6   ? 71.089 30.984  16.634 0.50 75.31 ? 6   G   B "C1'" 1 
ATOM   115  N  N9    . G   A 1 6   ? 70.683 29.595  16.442 0.50 75.27 ? 6   G   B N9    1 
ATOM   116  C  C8    . G   A 1 6   ? 71.489 28.528  16.125 0.50 75.36 ? 6   G   B C8    1 
ATOM   117  N  N7    . G   A 1 6   ? 70.833 27.404  16.017 0.50 75.48 ? 6   G   B N7    1 
ATOM   118  C  C5    . G   A 1 6   ? 69.514 27.748  16.279 0.50 75.65 ? 6   G   B C5    1 
ATOM   119  C  C6    . G   A 1 6   ? 68.339 26.947  16.308 0.50 75.62 ? 6   G   B C6    1 
ATOM   120  O  O6    . G   A 1 6   ? 68.225 25.731  16.098 0.50 75.33 ? 6   G   B O6    1 
ATOM   121  N  N1    . G   A 1 6   ? 67.213 27.704  16.620 0.50 75.64 ? 6   G   B N1    1 
ATOM   122  C  C2    . G   A 1 6   ? 67.213 29.056  16.869 0.50 75.74 ? 6   G   B C2    1 
ATOM   123  N  N2    . G   A 1 6   ? 66.023 29.607  17.151 0.50 75.73 ? 6   G   B N2    1 
ATOM   124  N  N3    . G   A 1 6   ? 68.298 29.812  16.843 0.50 75.57 ? 6   G   B N3    1 
ATOM   125  C  C4    . G   A 1 6   ? 69.405 29.098  16.544 0.50 75.56 ? 6   G   B C4    1 
ATOM   126  P  P     . C   A 1 7   ? 73.287 31.227  20.873 0.50 72.30 ? 7   C   B P     1 
ATOM   127  O  OP1   . C   A 1 7   ? 73.991 32.176  21.772 0.50 72.10 ? 7   C   B OP1   1 
ATOM   128  O  OP2   . C   A 1 7   ? 73.777 29.832  20.750 0.50 72.12 ? 7   C   B OP2   1 
ATOM   129  O  "O5'" . C   A 1 7   ? 71.753 31.185  21.300 0.50 71.21 ? 7   C   B "O5'" 1 
ATOM   130  C  "C5'" . C   A 1 7   ? 71.024 32.392  21.493 0.50 69.77 ? 7   C   B "C5'" 1 
ATOM   131  C  "C4'" . C   A 1 7   ? 69.584 32.086  21.819 0.50 68.59 ? 7   C   B "C4'" 1 
ATOM   132  O  "O4'" . C   A 1 7   ? 68.947 31.465  20.672 0.50 68.47 ? 7   C   B "O4'" 1 
ATOM   133  C  "C3'" . C   A 1 7   ? 69.366 31.084  22.939 0.50 67.59 ? 7   C   B "C3'" 1 
ATOM   134  O  "O3'" . C   A 1 7   ? 69.469 31.695  24.218 0.50 66.01 ? 7   C   B "O3'" 1 
ATOM   135  C  "C2'" . C   A 1 7   ? 67.956 30.591  22.646 0.50 67.71 ? 7   C   B "C2'" 1 
ATOM   136  O  "O2'" . C   A 1 7   ? 66.959 31.494  23.083 0.50 67.27 ? 7   C   B "O2'" 1 
ATOM   137  C  "C1'" . C   A 1 7   ? 67.976 30.529  21.117 0.50 68.17 ? 7   C   B "C1'" 1 
ATOM   138  N  N1    . C   A 1 7   ? 68.347 29.197  20.611 0.50 68.28 ? 7   C   B N1    1 
ATOM   139  C  C2    . C   A 1 7   ? 67.332 28.271  20.365 0.50 68.05 ? 7   C   B C2    1 
ATOM   140  O  O2    . C   A 1 7   ? 66.158 28.605  20.574 0.50 67.77 ? 7   C   B O2    1 
ATOM   141  N  N3    . C   A 1 7   ? 67.655 27.040  19.908 0.50 68.06 ? 7   C   B N3    1 
ATOM   142  C  C4    . C   A 1 7   ? 68.932 26.720  19.698 0.50 67.99 ? 7   C   B C4    1 
ATOM   143  N  N4    . C   A 1 7   ? 69.201 25.491  19.248 0.50 67.43 ? 7   C   B N4    1 
ATOM   144  C  C5    . C   A 1 7   ? 69.990 27.645  19.939 0.50 68.13 ? 7   C   B C5    1 
ATOM   145  C  C6    . C   A 1 7   ? 69.655 28.862  20.389 0.50 68.30 ? 7   C   B C6    1 
ATOM   146  P  P     . G   A 1 8   ? 69.879 30.802  25.487 0.50 64.66 ? 8   G   B P     1 
ATOM   147  O  OP1   . G   A 1 8   ? 69.989 31.712  26.655 0.50 64.79 ? 8   G   B OP1   1 
ATOM   148  O  OP2   . G   A 1 8   ? 71.032 29.946  25.112 0.50 64.52 ? 8   G   B OP2   1 
ATOM   149  O  "O5'" . G   A 1 8   ? 68.611 29.864  25.706 0.50 64.48 ? 8   G   B "O5'" 1 
ATOM   150  C  "C5'" . G   A 1 8   ? 67.360 30.418  26.096 0.50 63.24 ? 8   G   B "C5'" 1 
ATOM   151  C  "C4'" . G   A 1 8   ? 66.301 29.345  26.145 0.50 62.33 ? 8   G   B "C4'" 1 
ATOM   152  O  "O4'" . G   A 1 8   ? 66.019 28.863  24.805 0.50 62.19 ? 8   G   B "O4'" 1 
ATOM   153  C  "C3'" . G   A 1 8   ? 66.676 28.085  26.900 0.50 61.97 ? 8   G   B "C3'" 1 
ATOM   154  O  "O3'" . G   A 1 8   ? 66.534 28.256  28.303 0.50 61.36 ? 8   G   B "O3'" 1 
ATOM   155  C  "C2'" . G   A 1 8   ? 65.678 27.082  26.337 0.50 61.91 ? 8   G   B "C2'" 1 
ATOM   156  O  "O2'" . G   A 1 8   ? 64.390 27.216  26.905 0.50 61.76 ? 8   G   B "O2'" 1 
ATOM   157  C  "C1'" . G   A 1 8   ? 65.635 27.497  24.865 0.50 62.02 ? 8   G   B "C1'" 1 
ATOM   158  N  N9    . G   A 1 8   ? 66.551 26.719  24.036 0.50 62.00 ? 8   G   B N9    1 
ATOM   159  C  C8    . G   A 1 8   ? 67.847 27.035  23.707 0.50 62.01 ? 8   G   B C8    1 
ATOM   160  N  N7    . G   A 1 8   ? 68.420 26.134  22.955 0.50 61.74 ? 8   G   B N7    1 
ATOM   161  C  C5    . G   A 1 8   ? 67.441 25.165  22.773 0.50 61.32 ? 8   G   B C5    1 
ATOM   162  C  C6    . G   A 1 8   ? 67.478 23.946  22.045 0.50 61.04 ? 8   G   B C6    1 
ATOM   163  O  O6    . G   A 1 8   ? 68.413 23.463  21.396 0.50 59.66 ? 8   G   B O6    1 
ATOM   164  N  N1    . G   A 1 8   ? 66.267 23.264  22.126 0.50 60.87 ? 8   G   B N1    1 
ATOM   165  C  C2    . G   A 1 8   ? 65.161 23.698  22.816 0.50 61.52 ? 8   G   B C2    1 
ATOM   166  N  N2    . G   A 1 8   ? 64.083 22.895  22.773 0.50 60.62 ? 8   G   B N2    1 
ATOM   167  N  N3    . G   A 1 8   ? 65.113 24.833  23.498 0.50 61.43 ? 8   G   B N3    1 
ATOM   168  C  C4    . G   A 1 8   ? 66.281 25.511  23.433 0.50 61.63 ? 8   G   B C4    1 
ATOM   169  P  P     . G   A 1 9   ? 67.356 27.303  29.303 0.50 61.26 ? 9   G   B P     1 
ATOM   170  O  OP1   . G   A 1 9   ? 67.046 27.730  30.693 0.50 60.91 ? 9   G   B OP1   1 
ATOM   171  O  OP2   . G   A 1 9   ? 68.770 27.243  28.849 0.50 61.37 ? 9   G   B OP2   1 
ATOM   172  O  "O5'" . G   A 1 9   ? 66.703 25.872  29.065 0.50 60.54 ? 9   G   B "O5'" 1 
ATOM   173  C  "C5'" . G   A 1 9   ? 65.318 25.664  29.306 0.50 59.83 ? 9   G   B "C5'" 1 
ATOM   174  C  "C4'" . G   A 1 9   ? 64.909 24.291  28.840 0.50 59.34 ? 9   G   B "C4'" 1 
ATOM   175  O  "O4'" . G   A 1 9   ? 64.957 24.216  27.391 0.50 59.78 ? 9   G   B "O4'" 1 
ATOM   176  C  "C3'" . G   A 1 9   ? 65.821 23.162  29.271 0.50 58.92 ? 9   G   B "C3'" 1 
ATOM   177  O  "O3'" . G   A 1 9   ? 65.585 22.781  30.617 0.50 57.54 ? 9   G   B "O3'" 1 
ATOM   178  C  "C2'" . G   A 1 9   ? 65.442 22.069  28.282 0.50 59.47 ? 9   G   B "C2'" 1 
ATOM   179  O  "O2'" . G   A 1 9   ? 64.228 21.429  28.620 0.50 59.92 ? 9   G   B "O2'" 1 
ATOM   180  C  "C1'" . G   A 1 9   ? 65.255 22.883  27.001 0.50 59.55 ? 9   G   B "C1'" 1 
ATOM   181  N  N9    . G   A 1 9   ? 66.456 22.891  26.171 0.50 60.27 ? 9   G   B N9    1 
ATOM   182  C  C8    . G   A 1 9   ? 67.407 23.879  26.079 0.50 60.17 ? 9   G   B C8    1 
ATOM   183  N  N7    . G   A 1 9   ? 68.371 23.585  25.247 0.50 60.36 ? 9   G   B N7    1 
ATOM   184  C  C5    . G   A 1 9   ? 68.036 22.327  24.762 0.50 59.80 ? 9   G   B C5    1 
ATOM   185  C  C6    . G   A 1 9   ? 68.703 21.488  23.824 0.50 59.78 ? 9   G   B C6    1 
ATOM   186  O  O6    . G   A 1 9   ? 69.762 21.696  23.211 0.50 59.39 ? 9   G   B O6    1 
ATOM   187  N  N1    . G   A 1 9   ? 68.011 20.298  23.624 0.50 59.28 ? 9   G   B N1    1 
ATOM   188  C  C2    . G   A 1 9   ? 66.833 19.955  24.241 0.50 59.72 ? 9   G   B C2    1 
ATOM   189  N  N2    . G   A 1 9   ? 66.319 18.760  23.919 0.50 58.65 ? 9   G   B N2    1 
ATOM   190  N  N3    . G   A 1 9   ? 66.204 20.725  25.111 0.50 59.70 ? 9   G   B N3    1 
ATOM   191  C  C4    . G   A 1 9   ? 66.856 21.887  25.322 0.50 59.79 ? 9   G   B C4    1 
ATOM   192  P  P     . A   A 1 10  ? 66.756 22.064  31.447 0.50 56.69 ? 10  A   B P     1 
ATOM   193  O  OP1   . A   A 1 10  ? 66.294 21.928  32.851 0.50 57.31 ? 10  A   B OP1   1 
ATOM   194  O  OP2   . A   A 1 10  ? 68.032 22.762  31.156 0.50 57.02 ? 10  A   B OP2   1 
ATOM   195  O  "O5'" . A   A 1 10  ? 66.823 20.613  30.801 0.50 55.71 ? 10  A   B "O5'" 1 
ATOM   196  C  "C5'" . A   A 1 10  ? 65.654 19.812  30.716 0.50 53.32 ? 10  A   B "C5'" 1 
ATOM   197  C  "C4'" . A   A 1 10  ? 65.892 18.634  29.809 0.50 51.52 ? 10  A   B "C4'" 1 
ATOM   198  O  "O4'" . A   A 1 10  ? 66.094 19.086  28.444 0.50 51.47 ? 10  A   B "O4'" 1 
ATOM   199  C  "C3'" . A   A 1 10  ? 67.150 17.837  30.090 0.50 50.40 ? 10  A   B "C3'" 1 
ATOM   200  O  "O3'" . A   A 1 10  ? 66.977 16.965  31.193 0.50 47.97 ? 10  A   B "O3'" 1 
ATOM   201  C  "C2'" . A   A 1 10  ? 67.333 17.088  28.778 0.50 50.76 ? 10  A   B "C2'" 1 
ATOM   202  O  "O2'" . A   A 1 10  ? 66.455 15.987  28.650 0.50 50.59 ? 10  A   B "O2'" 1 
ATOM   203  C  "C1'" . A   A 1 10  ? 66.943 18.168  27.768 0.50 50.95 ? 10  A   B "C1'" 1 
ATOM   204  N  N9    . A   A 1 10  ? 68.106 18.888  27.251 0.50 50.26 ? 10  A   B N9    1 
ATOM   205  C  C8    . A   A 1 10  ? 68.539 20.158  27.542 0.50 50.42 ? 10  A   B C8    1 
ATOM   206  N  N7    . A   A 1 10  ? 69.633 20.503  26.904 0.50 49.25 ? 10  A   B N7    1 
ATOM   207  C  C5    . A   A 1 10  ? 69.941 19.384  26.142 0.50 48.86 ? 10  A   B C5    1 
ATOM   208  C  C6    . A   A 1 10  ? 70.987 19.105  25.239 0.50 48.31 ? 10  A   B C6    1 
ATOM   209  N  N6    . A   A 1 10  ? 71.960 19.968  24.932 0.50 45.74 ? 10  A   B N6    1 
ATOM   210  N  N1    . A   A 1 10  ? 70.998 17.888  24.652 0.50 47.84 ? 10  A   B N1    1 
ATOM   211  C  C2    . A   A 1 10  ? 70.025 17.021  24.952 0.50 48.17 ? 10  A   B C2    1 
ATOM   212  N  N3    . A   A 1 10  ? 68.992 17.166  25.778 0.50 49.23 ? 10  A   B N3    1 
ATOM   213  C  C4    . A   A 1 10  ? 69.008 18.383  26.347 0.50 49.90 ? 10  A   B C4    1 
ATOM   214  P  P     . A   A 1 11  ? 68.261 16.475  32.017 0.50 47.52 ? 11  A   B P     1 
ATOM   215  O  OP1   . A   A 1 11  ? 67.790 15.908  33.306 0.50 46.76 ? 11  A   B OP1   1 
ATOM   216  O  OP2   . A   A 1 11  ? 69.254 17.581  32.021 0.50 45.97 ? 11  A   B OP2   1 
ATOM   217  O  "O5'" . A   A 1 11  ? 68.831 15.285  31.127 0.50 45.83 ? 11  A   B "O5'" 1 
ATOM   218  C  "C5'" . A   A 1 11  ? 67.977 14.231  30.693 0.50 45.19 ? 11  A   B "C5'" 1 
ATOM   219  C  "C4'" . A   A 1 11  ? 68.701 13.355  29.704 0.50 44.48 ? 11  A   B "C4'" 1 
ATOM   220  O  "O4'" . A   A 1 11  ? 68.919 14.083  28.466 0.50 44.03 ? 11  A   B "O4'" 1 
ATOM   221  C  "C3'" . A   A 1 11  ? 70.088 12.934  30.147 0.50 44.11 ? 11  A   B "C3'" 1 
ATOM   222  O  "O3'" . A   A 1 11  ? 70.012 11.794  30.989 0.50 43.02 ? 11  A   B "O3'" 1 
ATOM   223  C  "C2'" . A   A 1 11  ? 70.771 12.648  28.818 0.50 44.18 ? 11  A   B "C2'" 1 
ATOM   224  O  "O2'" . A   A 1 11  ? 70.397 11.401  28.267 0.50 44.11 ? 11  A   B "O2'" 1 
ATOM   225  C  "C1'" . A   A 1 11  ? 70.203 13.772  27.951 0.50 44.82 ? 11  A   B "C1'" 1 
ATOM   226  N  N9    . A   A 1 11  ? 71.009 14.991  27.992 0.50 45.34 ? 11  A   B N9    1 
ATOM   227  C  C8    . A   A 1 11  ? 70.833 16.084  28.805 0.50 45.78 ? 11  A   B C8    1 
ATOM   228  N  N7    . A   A 1 11  ? 71.706 17.040  28.602 0.50 46.19 ? 11  A   B N7    1 
ATOM   229  C  C5    . A   A 1 11  ? 72.515 16.544  27.591 0.50 45.80 ? 11  A   B C5    1 
ATOM   230  C  C6    . A   A 1 11  ? 73.629 17.079  26.921 0.50 46.17 ? 11  A   B C6    1 
ATOM   231  N  N6    . A   A 1 11  ? 74.142 18.289  27.177 0.50 46.53 ? 11  A   B N6    1 
ATOM   232  N  N1    . A   A 1 11  ? 74.206 16.322  25.963 0.50 45.14 ? 11  A   B N1    1 
ATOM   233  C  C2    . A   A 1 11  ? 73.692 15.113  25.703 0.50 45.30 ? 11  A   B C2    1 
ATOM   234  N  N3    . A   A 1 11  ? 72.652 14.503  26.261 0.50 44.79 ? 11  A   B N3    1 
ATOM   235  C  C4    . A   A 1 11  ? 72.100 15.279  27.208 0.50 45.55 ? 11  A   B C4    1 
ATOM   236  P  P     . U   A 1 12  ? 71.008 11.666  32.240 0.50 42.96 ? 12  U   B P     1 
ATOM   237  O  OP1   . U   A 1 12  ? 70.427 10.645  33.152 0.50 42.44 ? 12  U   B OP1   1 
ATOM   238  O  OP2   . U   A 1 12  ? 71.299 13.029  32.753 0.50 41.82 ? 12  U   B OP2   1 
ATOM   239  O  "O5'" . U   A 1 12  ? 72.337 11.071  31.593 0.50 42.18 ? 12  U   B "O5'" 1 
ATOM   240  C  "C5'" . U   A 1 12  ? 72.290 9.879   30.817 0.50 41.29 ? 12  U   B "C5'" 1 
ATOM   241  C  "C4'" . U   A 1 12  ? 73.498 9.785   29.920 0.50 41.35 ? 12  U   B "C4'" 1 
ATOM   242  O  "O4'" . U   A 1 12  ? 73.488 10.881  28.968 0.50 41.37 ? 12  U   B "O4'" 1 
ATOM   243  C  "C3'" . U   A 1 12  ? 74.847 9.920   30.604 0.50 41.31 ? 12  U   B "C3'" 1 
ATOM   244  O  "O3'" . U   A 1 12  ? 75.248 8.695   31.197 0.50 41.82 ? 12  U   B "O3'" 1 
ATOM   245  C  "C2'" . U   A 1 12  ? 75.743 10.310  29.437 0.50 41.23 ? 12  U   B "C2'" 1 
ATOM   246  O  "O2'" . U   A 1 12  ? 76.084 9.210   28.616 0.50 40.74 ? 12  U   B "O2'" 1 
ATOM   247  C  "C1'" . U   A 1 12  ? 74.824 11.257  28.665 0.50 40.67 ? 12  U   B "C1'" 1 
ATOM   248  N  N1    . U   A 1 12  ? 75.014 12.664  29.048 0.50 40.30 ? 12  U   B N1    1 
ATOM   249  C  C2    . U   A 1 12  ? 76.091 13.331  28.497 0.50 39.85 ? 12  U   B C2    1 
ATOM   250  O  O2    . U   A 1 12  ? 76.872 12.801  27.729 0.50 39.95 ? 12  U   B O2    1 
ATOM   251  N  N3    . U   A 1 12  ? 76.220 14.643  28.880 0.50 39.71 ? 12  U   B N3    1 
ATOM   252  C  C4    . U   A 1 12  ? 75.402 15.342  29.741 0.50 38.50 ? 12  U   B C4    1 
ATOM   253  O  O4    . U   A 1 12  ? 75.652 16.524  29.984 0.50 37.00 ? 12  U   B O4    1 
ATOM   254  C  C5    . U   A 1 12  ? 74.311 14.583  30.275 0.50 38.52 ? 12  U   B C5    1 
ATOM   255  C  C6    . U   A 1 12  ? 74.158 13.300  29.919 0.50 39.11 ? 12  U   B C6    1 
ATOM   256  P  P     . A   A 1 13  ? 76.209 8.713   32.483 0.50 42.32 ? 13  A   B P     1 
ATOM   257  O  OP1   . A   A 1 13  ? 76.291 7.317   32.985 0.50 41.63 ? 13  A   B OP1   1 
ATOM   258  O  OP2   . A   A 1 13  ? 75.767 9.800   33.394 0.50 42.43 ? 13  A   B OP2   1 
ATOM   259  O  "O5'" . A   A 1 13  ? 77.632 9.105   31.889 0.50 42.08 ? 13  A   B "O5'" 1 
ATOM   260  C  "C5'" . A   A 1 13  ? 78.293 8.244   30.971 0.50 42.20 ? 13  A   B "C5'" 1 
ATOM   261  C  "C4'" . A   A 1 13  ? 79.555 8.896   30.464 0.50 43.45 ? 13  A   B "C4'" 1 
ATOM   262  O  "O4'" . A   A 1 13  ? 79.221 10.043  29.639 0.50 43.13 ? 13  A   B "O4'" 1 
ATOM   263  C  "C3'" . A   A 1 13  ? 80.468 9.470   31.534 0.50 43.86 ? 13  A   B "C3'" 1 
ATOM   264  O  "O3'" . A   A 1 13  ? 81.281 8.450   32.106 0.50 45.18 ? 13  A   B "O3'" 1 
ATOM   265  C  "C2'" . A   A 1 13  ? 81.283 10.477  30.733 0.50 43.84 ? 13  A   B "C2'" 1 
ATOM   266  O  "O2'" . A   A 1 13  ? 82.294 9.852   29.968 0.50 43.71 ? 13  A   B "O2'" 1 
ATOM   267  C  "C1'" . A   A 1 13  ? 80.217 11.042  29.790 0.50 43.83 ? 13  A   B "C1'" 1 
ATOM   268  N  N9    . A   A 1 13  ? 79.578 12.257  30.296 0.50 43.91 ? 13  A   B N9    1 
ATOM   269  C  C8    . A   A 1 13  ? 78.396 12.369  30.985 0.50 44.09 ? 13  A   B C8    1 
ATOM   270  N  N7    . A   A 1 13  ? 78.081 13.603  31.301 0.50 43.81 ? 13  A   B N7    1 
ATOM   271  C  C5    . A   A 1 13  ? 79.128 14.355  30.786 0.50 44.57 ? 13  A   B C5    1 
ATOM   272  C  C6    . A   A 1 13  ? 79.395 15.739  30.789 0.50 45.28 ? 13  A   B C6    1 
ATOM   273  N  N6    . A   A 1 13  ? 78.593 16.652  31.347 0.50 45.81 ? 13  A   B N6    1 
ATOM   274  N  N1    . A   A 1 13  ? 80.530 16.159  30.190 0.50 45.46 ? 13  A   B N1    1 
ATOM   275  C  C2    . A   A 1 13  ? 81.336 15.247  29.632 0.50 45.79 ? 13  A   B C2    1 
ATOM   276  N  N3    . A   A 1 13  ? 81.196 13.925  29.565 0.50 44.78 ? 13  A   B N3    1 
ATOM   277  C  C4    . A   A 1 13  ? 80.058 13.538  30.167 0.50 44.29 ? 13  A   B C4    1 
ATOM   278  P  P     . C   A 1 14  ? 81.793 8.594   33.625 0.50 46.15 ? 14  C   B P     1 
ATOM   279  O  OP1   . C   A 1 14  ? 82.464 7.319   33.981 0.50 46.13 ? 14  C   B OP1   1 
ATOM   280  O  OP2   . C   A 1 14  ? 80.675 9.092   34.464 0.50 46.01 ? 14  C   B OP2   1 
ATOM   281  O  "O5'" . C   A 1 14  ? 82.907 9.727   33.539 0.50 47.63 ? 14  C   B "O5'" 1 
ATOM   282  C  "C5'" . C   A 1 14  ? 84.122 9.490   32.840 0.50 50.41 ? 14  C   B "C5'" 1 
ATOM   283  C  "C4'" . C   A 1 14  ? 84.924 10.763  32.725 0.50 52.65 ? 14  C   B "C4'" 1 
ATOM   284  O  "O4'" . C   A 1 14  ? 84.207 11.728  31.907 0.50 52.86 ? 14  C   B "O4'" 1 
ATOM   285  C  "C3'" . C   A 1 14  ? 85.165 11.525  34.016 0.50 54.10 ? 14  C   B "C3'" 1 
ATOM   286  O  "O3'" . C   A 1 14  ? 86.210 10.960  34.794 0.50 56.66 ? 14  C   B "O3'" 1 
ATOM   287  C  "C2'" . C   A 1 14  ? 85.535 12.902  33.484 0.50 53.83 ? 14  C   B "C2'" 1 
ATOM   288  O  "O2'" . C   A 1 14  ? 86.857 12.953  32.985 0.50 53.35 ? 14  C   B "O2'" 1 
ATOM   289  C  "C1'" . C   A 1 14  ? 84.541 13.044  32.330 0.50 53.77 ? 14  C   B "C1'" 1 
ATOM   290  N  N1    . C   A 1 14  ? 83.315 13.739  32.755 0.50 53.44 ? 14  C   B N1    1 
ATOM   291  C  C2    . C   A 1 14  ? 83.335 15.133  32.815 0.50 54.49 ? 14  C   B C2    1 
ATOM   292  O  O2    . C   A 1 14  ? 84.375 15.728  32.496 0.50 54.87 ? 14  C   B O2    1 
ATOM   293  N  N3    . C   A 1 14  ? 82.226 15.797  33.217 0.50 53.96 ? 14  C   B N3    1 
ATOM   294  C  C4    . C   A 1 14  ? 81.128 15.118  33.552 0.50 53.72 ? 14  C   B C4    1 
ATOM   295  N  N4    . C   A 1 14  ? 80.058 15.818  33.943 0.50 53.38 ? 14  C   B N4    1 
ATOM   296  C  C5    . C   A 1 14  ? 81.078 13.693  33.499 0.50 53.28 ? 14  C   B C5    1 
ATOM   297  C  C6    . C   A 1 14  ? 82.184 13.049  33.096 0.50 53.74 ? 14  C   B C6    1 
ATOM   298  P  P     . U   A 1 15  ? 86.231 11.208  36.382 0.50 58.41 ? 15  U   B P     1 
ATOM   299  O  OP1   . U   A 1 15  ? 87.431 10.517  36.918 0.50 58.34 ? 15  U   B OP1   1 
ATOM   300  O  OP2   . U   A 1 15  ? 84.891 10.879  36.930 0.50 58.36 ? 15  U   B OP2   1 
ATOM   301  O  "O5'" . U   A 1 15  ? 86.450 12.780  36.515 0.50 60.48 ? 15  U   B "O5'" 1 
ATOM   302  C  "C5'" . U   A 1 15  ? 87.645 13.385  36.039 0.50 64.06 ? 15  U   B "C5'" 1 
ATOM   303  C  "C4'" . U   A 1 15  ? 87.616 14.877  36.279 0.50 66.87 ? 15  U   B "C4'" 1 
ATOM   304  O  "O4'" . U   A 1 15  ? 86.571 15.488  35.477 0.50 67.16 ? 15  U   B "O4'" 1 
ATOM   305  C  "C3'" . U   A 1 15  ? 87.275 15.333  37.686 0.50 68.44 ? 15  U   B "C3'" 1 
ATOM   306  O  "O3'" . U   A 1 15  ? 88.386 15.226  38.569 0.50 70.82 ? 15  U   B "O3'" 1 
ATOM   307  C  "C2'" . U   A 1 15  ? 86.876 16.783  37.446 0.50 68.27 ? 15  U   B "C2'" 1 
ATOM   308  O  "O2'" . U   A 1 15  ? 87.990 17.639  37.287 0.50 68.33 ? 15  U   B "O2'" 1 
ATOM   309  C  "C1'" . U   A 1 15  ? 86.121 16.673  36.119 0.50 67.66 ? 15  U   B "C1'" 1 
ATOM   310  N  N1    . U   A 1 15  ? 84.665 16.598  36.306 0.50 67.30 ? 15  U   B N1    1 
ATOM   311  C  C2    . U   A 1 15  ? 83.975 17.793  36.380 0.50 67.51 ? 15  U   B C2    1 
ATOM   312  O  O2    . U   A 1 15  ? 84.522 18.879  36.282 0.50 68.11 ? 15  U   B O2    1 
ATOM   313  N  N3    . U   A 1 15  ? 82.622 17.674  36.573 0.50 67.28 ? 15  U   B N3    1 
ATOM   314  C  C4    . U   A 1 15  ? 81.900 16.507  36.696 0.50 67.05 ? 15  U   B C4    1 
ATOM   315  O  O4    . U   A 1 15  ? 80.680 16.568  36.870 0.50 66.58 ? 15  U   B O4    1 
ATOM   316  C  C5    . U   A 1 15  ? 82.682 15.309  36.605 0.50 66.88 ? 15  U   B C5    1 
ATOM   317  C  C6    . U   A 1 15  ? 84.007 15.394  36.415 0.50 67.14 ? 15  U   B C6    1 
ATOM   318  P  P     . U   A 1 16  ? 88.129 15.096  40.151 0.50 72.91 ? 16  U   B P     1 
ATOM   319  O  OP1   . U   A 1 16  ? 89.447 14.866  40.795 0.50 72.75 ? 16  U   B OP1   1 
ATOM   320  O  OP2   . U   A 1 16  ? 87.029 14.124  40.369 0.50 72.95 ? 16  U   B OP2   1 
ATOM   321  O  "O5'" . U   A 1 16  ? 87.607 16.543  40.572 0.50 74.53 ? 16  U   B "O5'" 1 
ATOM   322  C  "C5'" . U   A 1 16  ? 88.441 17.687  40.412 0.50 77.22 ? 16  U   B "C5'" 1 
ATOM   323  C  "C4'" . U   A 1 16  ? 87.661 18.961  40.655 0.50 78.99 ? 16  U   B "C4'" 1 
ATOM   324  O  "O4'" . U   A 1 16  ? 86.594 19.084  39.679 0.50 79.57 ? 16  U   B "O4'" 1 
ATOM   325  C  "C3'" . U   A 1 16  ? 86.932 19.086  41.982 0.50 80.00 ? 16  U   B "C3'" 1 
ATOM   326  O  "O3'" . U   A 1 16  ? 87.815 19.476  43.028 0.50 81.12 ? 16  U   B "O3'" 1 
ATOM   327  C  "C2'" . U   A 1 16  ? 85.923 20.188  41.677 0.50 80.09 ? 16  U   B "C2'" 1 
ATOM   328  O  "O2'" . U   A 1 16  ? 86.491 21.481  41.731 0.50 80.12 ? 16  U   B "O2'" 1 
ATOM   329  C  "C1'" . U   A 1 16  ? 85.540 19.857  40.232 0.50 80.10 ? 16  U   B "C1'" 1 
ATOM   330  N  N1    . U   A 1 16  ? 84.287 19.095  40.141 0.50 80.47 ? 16  U   B N1    1 
ATOM   331  C  C2    . U   A 1 16  ? 83.107 19.813  40.173 0.50 80.85 ? 16  U   B C2    1 
ATOM   332  O  O2    . U   A 1 16  ? 83.077 21.029  40.263 0.50 81.22 ? 16  U   B O2    1 
ATOM   333  N  N3    . U   A 1 16  ? 81.964 19.058  40.095 0.50 80.97 ? 16  U   B N3    1 
ATOM   334  C  C4    . U   A 1 16  ? 81.881 17.686  39.991 0.50 80.94 ? 16  U   B C4    1 
ATOM   335  O  O4    . U   A 1 16  ? 80.772 17.150  39.931 0.50 80.95 ? 16  U   B O4    1 
ATOM   336  C  C5    . U   A 1 16  ? 83.146 17.013  39.961 0.50 80.89 ? 16  U   B C5    1 
ATOM   337  C  C6    . U   A 1 16  ? 84.278 17.724  40.034 0.50 80.61 ? 16  U   B C6    1 
ATOM   338  P  P     . C   A 1 17  ? 87.364 19.291  44.561 0.50 81.52 ? 17  C   B P     1 
ATOM   339  O  OP1   . C   A 1 17  ? 88.535 19.640  45.403 0.50 81.67 ? 17  C   B OP1   1 
ATOM   340  O  OP2   . C   A 1 17  ? 86.726 17.957  44.709 0.50 81.63 ? 17  C   B OP2   1 
ATOM   341  O  "O5'" . C   A 1 17  ? 86.247 20.409  44.770 0.50 81.80 ? 17  C   B "O5'" 1 
ATOM   342  C  "C5'" . C   A 1 17  ? 86.589 21.792  44.730 0.50 82.30 ? 17  C   B "C5'" 1 
ATOM   343  C  "C4'" . C   A 1 17  ? 85.348 22.649  44.835 0.50 82.63 ? 17  C   B "C4'" 1 
ATOM   344  O  "O4'" . C   A 1 17  ? 84.484 22.401  43.694 0.50 82.76 ? 17  C   B "O4'" 1 
ATOM   345  C  "C3'" . C   A 1 17  ? 84.446 22.389  46.031 0.50 82.71 ? 17  C   B "C3'" 1 
ATOM   346  O  "O3'" . C   A 1 17  ? 84.920 23.055  47.197 0.50 82.68 ? 17  C   B "O3'" 1 
ATOM   347  C  "C2'" . C   A 1 17  ? 83.122 22.976  45.558 0.50 82.71 ? 17  C   B "C2'" 1 
ATOM   348  O  "O2'" . C   A 1 17  ? 83.065 24.382  45.688 0.50 82.51 ? 17  C   B "O2'" 1 
ATOM   349  C  "C1'" . C   A 1 17  ? 83.131 22.592  44.076 0.50 82.69 ? 17  C   B "C1'" 1 
ATOM   350  N  N1    . C   A 1 17  ? 82.382 21.354  43.808 0.50 82.60 ? 17  C   B N1    1 
ATOM   351  C  C2    . C   A 1 17  ? 80.990 21.424  43.726 0.50 82.50 ? 17  C   B C2    1 
ATOM   352  O  O2    . C   A 1 17  ? 80.436 22.525  43.873 0.50 82.08 ? 17  C   B O2    1 
ATOM   353  N  N3    . C   A 1 17  ? 80.281 20.295  43.491 0.50 82.47 ? 17  C   B N3    1 
ATOM   354  C  C4    . C   A 1 17  ? 80.914 19.130  43.338 0.50 82.38 ? 17  C   B C4    1 
ATOM   355  N  N4    . C   A 1 17  ? 80.171 18.044  43.108 0.50 82.12 ? 17  C   B N4    1 
ATOM   356  C  C5    . C   A 1 17  ? 82.336 19.029  43.413 0.50 82.40 ? 17  C   B C5    1 
ATOM   357  C  C6    . C   A 1 17  ? 83.024 20.156  43.647 0.50 82.56 ? 17  C   B C6    1 
ATOM   358  P  P     . G   A 1 18  ? 84.572 22.458  48.649 0.50 82.58 ? 18  G   B P     1 
ATOM   359  O  OP1   . G   A 1 18  ? 85.224 23.339  49.652 0.50 82.61 ? 18  G   B OP1   1 
ATOM   360  O  OP2   . G   A 1 18  ? 84.874 21.003  48.646 0.50 82.89 ? 18  G   B OP2   1 
ATOM   361  O  "O5'" . G   A 1 18  ? 82.994 22.641  48.777 0.50 82.13 ? 18  G   B "O5'" 1 
ATOM   362  C  "C5'" . G   A 1 18  ? 82.433 23.933  48.972 0.50 81.61 ? 18  G   B "C5'" 1 
ATOM   363  C  "C4'" . G   A 1 18  ? 80.923 23.863  49.013 0.50 81.29 ? 18  G   B "C4'" 1 
ATOM   364  O  "O4'" . G   A 1 18  ? 80.415 23.374  47.742 0.50 80.97 ? 18  G   B "O4'" 1 
ATOM   365  C  "C3'" . G   A 1 18  ? 80.288 22.906  50.008 0.50 81.09 ? 18  G   B "C3'" 1 
ATOM   366  O  "O3'" . G   A 1 18  ? 80.269 23.421  51.332 0.50 81.18 ? 18  G   B "O3'" 1 
ATOM   367  C  "C2'" . G   A 1 18  ? 78.873 22.800  49.456 0.50 80.93 ? 18  G   B "C2'" 1 
ATOM   368  O  "O2'" . G   A 1 18  ? 78.073 23.917  49.786 0.50 80.93 ? 18  G   B "O2'" 1 
ATOM   369  C  "C1'" . G   A 1 18  ? 79.140 22.785  47.950 0.50 80.66 ? 18  G   B "C1'" 1 
ATOM   370  N  N9    . G   A 1 18  ? 79.137 21.423  47.426 0.50 80.16 ? 18  G   B N9    1 
ATOM   371  C  C8    . G   A 1 18  ? 80.202 20.678  46.977 0.50 79.97 ? 18  G   B C8    1 
ATOM   372  N  N7    . G   A 1 18  ? 79.859 19.477  46.591 0.50 79.64 ? 18  G   B N7    1 
ATOM   373  C  C5    . G   A 1 18  ? 78.485 19.431  46.795 0.50 79.41 ? 18  G   B C5    1 
ATOM   374  C  C6    . G   A 1 18  ? 77.546 18.384  46.563 0.50 78.84 ? 18  G   B C6    1 
ATOM   375  O  O6    . G   A 1 18  ? 77.748 17.248  46.113 0.50 77.75 ? 18  G   B O6    1 
ATOM   376  N  N1    . G   A 1 18  ? 76.255 18.771  46.912 0.50 79.00 ? 18  G   B N1    1 
ATOM   377  C  C2    . G   A 1 18  ? 75.908 20.001  47.419 0.50 79.38 ? 18  G   B C2    1 
ATOM   378  N  N2    . G   A 1 18  ? 74.610 20.191  47.697 0.50 79.17 ? 18  G   B N2    1 
ATOM   379  N  N3    . G   A 1 18  ? 76.768 20.977  47.637 0.50 79.24 ? 18  G   B N3    1 
ATOM   380  C  C4    . G   A 1 18  ? 78.027 20.626  47.306 0.50 79.64 ? 18  G   B C4    1 
ATOM   381  P  P     . A   A 1 19  ? 80.122 22.407  52.573 0.50 81.25 ? 19  A   B P     1 
ATOM   382  O  OP1   . A   A 1 19  ? 80.094 23.226  53.811 0.50 81.03 ? 19  A   B OP1   1 
ATOM   383  O  OP2   . A   A 1 19  ? 81.139 21.332  52.426 0.50 81.27 ? 19  A   B OP2   1 
ATOM   384  O  "O5'" . A   A 1 19  ? 78.680 21.753  52.377 0.50 81.08 ? 19  A   B "O5'" 1 
ATOM   385  C  "C5'" . A   A 1 19  ? 77.506 22.443  52.795 0.50 80.96 ? 19  A   B "C5'" 1 
ATOM   386  C  "C4'" . A   A 1 19  ? 76.357 21.477  52.983 0.50 80.86 ? 19  A   B "C4'" 1 
ATOM   387  O  "O4'" . A   A 1 19  ? 75.939 20.940  51.701 0.50 80.83 ? 19  A   B "O4'" 1 
ATOM   388  C  "C3'" . A   A 1 19  ? 76.633 20.234  53.813 0.50 80.81 ? 19  A   B "C3'" 1 
ATOM   389  O  "O3'" . A   A 1 19  ? 76.570 20.519  55.208 0.50 80.93 ? 19  A   B "O3'" 1 
ATOM   390  C  "C2'" . A   A 1 19  ? 75.496 19.313  53.384 0.50 80.58 ? 19  A   B "C2'" 1 
ATOM   391  O  "O2'" . A   A 1 19  ? 74.281 19.598  54.049 0.50 80.50 ? 19  A   B "O2'" 1 
ATOM   392  C  "C1'" . A   A 1 19  ? 75.357 19.660  51.898 0.50 80.47 ? 19  A   B "C1'" 1 
ATOM   393  N  N9    . A   A 1 19  ? 76.017 18.697  51.016 0.50 79.78 ? 19  A   B N9    1 
ATOM   394  C  C8    . A   A 1 19  ? 77.349 18.607  50.694 0.50 79.50 ? 19  A   B C8    1 
ATOM   395  N  N7    . A   A 1 19  ? 77.631 17.614  49.885 0.50 79.03 ? 19  A   B N7    1 
ATOM   396  C  C5    . A   A 1 19  ? 76.401 17.012  49.654 0.50 78.67 ? 19  A   B C5    1 
ATOM   397  C  C6    . A   A 1 19  ? 76.020 15.902  48.880 0.50 78.32 ? 19  A   B C6    1 
ATOM   398  N  N6    . A   A 1 19  ? 76.876 15.169  48.165 0.50 77.75 ? 19  A   B N6    1 
ATOM   399  N  N1    . A   A 1 19  ? 74.712 15.565  48.865 0.50 78.50 ? 19  A   B N1    1 
ATOM   400  C  C2    . A   A 1 19  ? 73.854 16.300  49.584 0.50 78.51 ? 19  A   B C2    1 
ATOM   401  N  N3    . A   A 1 19  ? 74.090 17.363  50.349 0.50 78.51 ? 19  A   B N3    1 
ATOM   402  C  C4    . A   A 1 19  ? 75.398 17.671  50.342 0.50 79.09 ? 19  A   B C4    1 
ATOM   403  P  P     . U   A 1 20  ? 77.522 19.719  56.229 0.50 80.91 ? 20  U   B P     1 
ATOM   404  O  OP1   . U   A 1 20  ? 77.286 20.282  57.583 0.50 80.64 ? 20  U   B OP1   1 
ATOM   405  O  OP2   . U   A 1 20  ? 78.899 19.701  55.672 0.50 80.54 ? 20  U   B OP2   1 
ATOM   406  O  "O5'" . U   A 1 20  ? 76.954 18.230  56.208 0.50 80.53 ? 20  U   B "O5'" 1 
ATOM   407  O  "O5'" . U   B 2 1   ? 71.421 9.385   43.937 0.50 41.56 ? 1   U   C "O5'" 1 
ATOM   408  C  "C5'" . U   B 2 1   ? 70.077 9.124   44.334 0.50 41.68 ? 1   U   C "C5'" 1 
ATOM   409  C  "C4'" . U   B 2 1   ? 69.584 10.212  45.259 0.50 41.12 ? 1   U   C "C4'" 1 
ATOM   410  O  "O4'" . U   B 2 1   ? 70.323 10.172  46.512 0.50 40.10 ? 1   U   C "O4'" 1 
ATOM   411  C  "C3'" . U   B 2 1   ? 69.787 11.630  44.760 0.50 41.87 ? 1   U   C "C3'" 1 
ATOM   412  O  "O3'" . U   B 2 1   ? 68.758 12.021  43.861 0.50 43.44 ? 1   U   C "O3'" 1 
ATOM   413  C  "C2'" . U   B 2 1   ? 69.748 12.426  46.057 0.50 40.87 ? 1   U   C "C2'" 1 
ATOM   414  O  "O2'" . U   B 2 1   ? 68.433 12.616  46.534 0.50 41.24 ? 1   U   C "O2'" 1 
ATOM   415  C  "C1'" . U   B 2 1   ? 70.514 11.495  46.998 0.50 40.43 ? 1   U   C "C1'" 1 
ATOM   416  N  N1    . U   B 2 1   ? 71.958 11.779  47.006 0.50 40.18 ? 1   U   C N1    1 
ATOM   417  C  C2    . U   B 2 1   ? 72.398 12.878  47.726 0.50 40.39 ? 1   U   C C2    1 
ATOM   418  O  O2    . U   B 2 1   ? 71.648 13.597  48.358 0.50 40.36 ? 1   U   C O2    1 
ATOM   419  N  N3    . U   B 2 1   ? 73.755 13.102  47.674 0.50 39.41 ? 1   U   C N3    1 
ATOM   420  C  C4    . U   B 2 1   ? 74.695 12.351  46.994 0.50 40.08 ? 1   U   C C4    1 
ATOM   421  O  O4    . U   B 2 1   ? 75.883 12.677  47.042 0.50 40.60 ? 1   U   C O4    1 
ATOM   422  C  C5    . U   B 2 1   ? 74.162 11.228  46.282 0.50 40.62 ? 1   U   C C5    1 
ATOM   423  C  C6    . U   B 2 1   ? 72.845 10.986  46.312 0.50 40.55 ? 1   U   C C6    1 
ATOM   424  P  P     . C   B 2 2   ? 69.024 13.218  42.825 0.50 45.76 ? 2   C   C P     1 
ATOM   425  O  OP1   . C   B 2 2   ? 67.794 13.369  42.007 0.50 45.94 ? 2   C   C OP1   1 
ATOM   426  O  OP2   . C   B 2 2   ? 70.329 12.994  42.153 0.50 45.02 ? 2   C   C OP2   1 
ATOM   427  O  "O5'" . C   B 2 2   ? 69.162 14.503  43.756 0.50 46.65 ? 2   C   C "O5'" 1 
ATOM   428  C  "C5'" . C   B 2 2   ? 68.059 14.957  44.532 0.50 50.02 ? 2   C   C "C5'" 1 
ATOM   429  C  "C4'" . C   B 2 2   ? 68.425 16.219  45.270 0.50 51.49 ? 2   C   C "C4'" 1 
ATOM   430  O  "O4'" . C   B 2 2   ? 69.437 15.928  46.270 0.50 51.63 ? 2   C   C "O4'" 1 
ATOM   431  C  "C3'" . C   B 2 2   ? 69.064 17.305  44.424 0.50 52.85 ? 2   C   C "C3'" 1 
ATOM   432  O  "O3'" . C   B 2 2   ? 68.095 18.057  43.706 0.50 55.35 ? 2   C   C "O3'" 1 
ATOM   433  C  "C2'" . C   B 2 2   ? 69.771 18.140  45.481 0.50 52.26 ? 2   C   C "C2'" 1 
ATOM   434  O  "O2'" . C   B 2 2   ? 68.881 18.983  46.185 0.50 51.70 ? 2   C   C "O2'" 1 
ATOM   435  C  "C1'" . C   B 2 2   ? 70.301 17.046  46.410 0.50 51.74 ? 2   C   C "C1'" 1 
ATOM   436  N  N1    . C   B 2 2   ? 71.664 16.628  46.051 0.50 51.44 ? 2   C   C N1    1 
ATOM   437  C  C2    . C   B 2 2   ? 72.729 17.449  46.412 0.50 51.49 ? 2   C   C C2    1 
ATOM   438  O  O2    . C   B 2 2   ? 72.491 18.497  47.031 0.50 51.57 ? 2   C   C O2    1 
ATOM   439  N  N3    . C   B 2 2   ? 73.988 17.085  46.080 0.50 51.02 ? 2   C   C N3    1 
ATOM   440  C  C4    . C   B 2 2   ? 74.201 15.951  45.414 0.50 51.08 ? 2   C   C C4    1 
ATOM   441  N  N4    . C   B 2 2   ? 75.462 15.636  45.106 0.50 51.59 ? 2   C   C N4    1 
ATOM   442  C  C5    . C   B 2 2   ? 73.132 15.089  45.035 0.50 51.14 ? 2   C   C C5    1 
ATOM   443  C  C6    . C   B 2 2   ? 71.890 15.463  45.371 0.50 51.56 ? 2   C   C C6    1 
ATOM   444  P  P     . G   B 2 3   ? 68.501 18.731  42.305 0.50 57.20 ? 3   G   C P     1 
ATOM   445  O  OP1   . G   B 2 3   ? 67.283 19.374  41.751 0.50 56.95 ? 3   G   C OP1   1 
ATOM   446  O  OP2   . G   B 2 3   ? 69.234 17.724  41.495 0.50 57.02 ? 3   G   C OP2   1 
ATOM   447  O  "O5'" . G   B 2 3   ? 69.530 19.877  42.716 0.50 58.25 ? 3   G   C "O5'" 1 
ATOM   448  C  "C5'" . G   B 2 3   ? 69.088 21.027  43.429 0.50 59.87 ? 3   G   C "C5'" 1 
ATOM   449  C  "C4'" . G   B 2 3   ? 70.245 21.963  43.695 0.50 61.27 ? 3   G   C "C4'" 1 
ATOM   450  O  "O4'" . G   B 2 3   ? 71.200 21.325  44.585 0.50 60.93 ? 3   G   C "O4'" 1 
ATOM   451  C  "C3'" . G   B 2 3   ? 71.101 22.350  42.500 0.50 62.17 ? 3   G   C "C3'" 1 
ATOM   452  O  "O3'" . G   B 2 3   ? 70.507 23.370  41.705 0.50 63.88 ? 3   G   C "O3'" 1 
ATOM   453  C  "C2'" . G   B 2 3   ? 72.367 22.846  43.183 0.50 61.94 ? 3   G   C "C2'" 1 
ATOM   454  O  "O2'" . G   B 2 3   ? 72.238 24.158  43.696 0.50 61.82 ? 3   G   C "O2'" 1 
ATOM   455  C  "C1'" . G   B 2 3   ? 72.496 21.848  44.334 0.50 61.44 ? 3   G   C "C1'" 1 
ATOM   456  N  N9    . G   B 2 3   ? 73.396 20.751  43.991 0.50 60.95 ? 3   G   C N9    1 
ATOM   457  C  C8    . G   B 2 3   ? 73.063 19.480  43.587 0.50 60.70 ? 3   G   C C8    1 
ATOM   458  N  N7    . G   B 2 3   ? 74.106 18.736  43.327 0.50 60.60 ? 3   G   C N7    1 
ATOM   459  C  C5    . G   B 2 3   ? 75.191 19.566  43.581 0.50 60.43 ? 3   G   C C5    1 
ATOM   460  C  C6    . G   B 2 3   ? 76.590 19.320  43.477 0.50 60.31 ? 3   G   C C6    1 
ATOM   461  O  O6    . G   B 2 3   ? 77.172 18.284  43.126 0.50 60.44 ? 3   G   C O6    1 
ATOM   462  N  N1    . G   B 2 3   ? 77.333 20.443  43.832 0.50 60.55 ? 3   G   C N1    1 
ATOM   463  C  C2    . G   B 2 3   ? 76.805 21.646  44.234 0.50 60.79 ? 3   G   C C2    1 
ATOM   464  N  N2    . G   B 2 3   ? 77.687 22.611  44.535 0.50 61.10 ? 3   G   C N2    1 
ATOM   465  N  N3    . G   B 2 3   ? 75.509 21.887  44.335 0.50 60.54 ? 3   G   C N3    1 
ATOM   466  C  C4    . G   B 2 3   ? 74.767 20.811  43.996 0.50 60.74 ? 3   G   C C4    1 
ATOM   467  P  P     . A   B 2 4   ? 70.977 23.556  40.178 0.50 65.10 ? 4   A   C P     1 
ATOM   468  O  OP1   . A   B 2 4   ? 70.157 24.646  39.589 0.50 65.17 ? 4   A   C OP1   1 
ATOM   469  O  OP2   . A   B 2 4   ? 70.996 22.219  39.530 0.50 65.18 ? 4   A   C OP2   1 
ATOM   470  O  "O5'" . A   B 2 4   ? 72.481 24.068  40.296 0.50 65.23 ? 4   A   C "O5'" 1 
ATOM   471  C  "C5'" . A   B 2 4   ? 72.776 25.317  40.909 0.50 65.90 ? 4   A   C "C5'" 1 
ATOM   472  C  "C4'" . A   B 2 4   ? 74.269 25.547  40.954 0.50 66.31 ? 4   A   C "C4'" 1 
ATOM   473  O  "O4'" . A   B 2 4   ? 74.900 24.518  41.762 0.50 66.16 ? 4   A   C "O4'" 1 
ATOM   474  C  "C3'" . A   B 2 4   ? 75.008 25.460  39.629 0.50 66.59 ? 4   A   C "C3'" 1 
ATOM   475  O  "O3'" . A   B 2 4   ? 74.896 26.670  38.886 0.50 67.24 ? 4   A   C "O3'" 1 
ATOM   476  C  "C2'" . A   B 2 4   ? 76.441 25.213  40.088 0.50 66.21 ? 4   A   C "C2'" 1 
ATOM   477  O  "O2'" . A   B 2 4   ? 77.095 26.392  40.511 0.50 65.74 ? 4   A   C "O2'" 1 
ATOM   478  C  "C1'" . A   B 2 4   ? 76.220 24.293  41.292 0.50 65.97 ? 4   A   C "C1'" 1 
ATOM   479  N  N9    . A   B 2 4   ? 76.369 22.876  40.958 0.50 65.74 ? 4   A   C N9    1 
ATOM   480  C  C8    . A   B 2 4   ? 75.393 21.937  40.727 0.50 65.20 ? 4   A   C C8    1 
ATOM   481  N  N7    . A   B 2 4   ? 75.864 20.746  40.440 0.50 64.88 ? 4   A   C N7    1 
ATOM   482  C  C5    . A   B 2 4   ? 77.242 20.911  40.487 0.50 65.17 ? 4   A   C C5    1 
ATOM   483  C  C6    . A   B 2 4   ? 78.316 20.022  40.275 0.50 65.07 ? 4   A   C C6    1 
ATOM   484  N  N6    . A   B 2 4   ? 78.167 18.732  39.962 0.50 65.34 ? 4   A   C N6    1 
ATOM   485  N  N1    . A   B 2 4   ? 79.569 20.512  40.400 0.50 65.14 ? 4   A   C N1    1 
ATOM   486  C  C2    . A   B 2 4   ? 79.724 21.803  40.715 0.50 65.16 ? 4   A   C C2    1 
ATOM   487  N  N3    . A   B 2 4   ? 78.800 22.733  40.939 0.50 65.34 ? 4   A   C N3    1 
ATOM   488  C  C4    . A   B 2 4   ? 77.566 22.217  40.807 0.50 65.31 ? 4   A   C C4    1 
ATOM   489  P  P     . A   B 2 5   ? 75.209 26.667  37.307 0.50 67.78 ? 5   A   C P     1 
ATOM   490  O  OP1   . A   B 2 5   ? 74.877 28.016  36.783 0.50 67.86 ? 5   A   C OP1   1 
ATOM   491  O  OP2   . A   B 2 5   ? 74.575 25.467  36.700 0.50 67.28 ? 5   A   C OP2   1 
ATOM   492  O  "O5'" . A   B 2 5   ? 76.789 26.488  37.234 0.50 67.25 ? 5   A   C "O5'" 1 
ATOM   493  C  "C5'" . A   B 2 5   ? 77.659 27.512  37.705 0.50 66.84 ? 5   A   C "C5'" 1 
ATOM   494  C  "C4'" . A   B 2 5   ? 79.098 27.068  37.602 0.50 66.42 ? 5   A   C "C4'" 1 
ATOM   495  O  "O4'" . A   B 2 5   ? 79.319 25.933  38.481 0.50 66.38 ? 5   A   C "O4'" 1 
ATOM   496  C  "C3'" . A   B 2 5   ? 79.537 26.550  36.243 0.50 66.36 ? 5   A   C "C3'" 1 
ATOM   497  O  "O3'" . A   B 2 5   ? 79.856 27.603  35.343 0.50 66.16 ? 5   A   C "O3'" 1 
ATOM   498  C  "C2'" . A   B 2 5   ? 80.763 25.728  36.610 0.50 66.36 ? 5   A   C "C2'" 1 
ATOM   499  O  "O2'" . A   B 2 5   ? 81.906 26.525  36.850 0.50 65.84 ? 5   A   C "O2'" 1 
ATOM   500  C  "C1'" . A   B 2 5   ? 80.299 25.077  37.913 0.50 66.47 ? 5   A   C "C1'" 1 
ATOM   501  N  N9    . A   B 2 5   ? 79.698 23.761  37.688 0.50 66.49 ? 5   A   C N9    1 
ATOM   502  C  C8    . A   B 2 5   ? 78.370 23.412  37.663 0.50 66.40 ? 5   A   C C8    1 
ATOM   503  N  N7    . A   B 2 5   ? 78.162 22.139  37.421 0.50 66.47 ? 5   A   C N7    1 
ATOM   504  C  C5    . A   B 2 5   ? 79.440 21.614  37.279 0.50 66.64 ? 5   A   C C5    1 
ATOM   505  C  C6    . A   B 2 5   ? 79.911 20.312  37.010 0.50 66.50 ? 5   A   C C6    1 
ATOM   506  N  N6    . A   B 2 5   ? 79.119 19.250  36.830 0.50 65.96 ? 5   A   C N6    1 
ATOM   507  N  N1    . A   B 2 5   ? 81.247 20.134  36.933 0.50 66.92 ? 5   A   C N1    1 
ATOM   508  C  C2    . A   B 2 5   ? 82.048 21.191  37.114 0.50 67.18 ? 5   A   C C2    1 
ATOM   509  N  N3    . A   B 2 5   ? 81.728 22.456  37.372 0.50 67.33 ? 5   A   C N3    1 
ATOM   510  C  C4    . A   B 2 5   ? 80.394 22.602  37.442 0.50 66.84 ? 5   A   C C4    1 
ATOM   511  P  P     . G   B 2 6   ? 79.813 27.327  33.761 0.50 66.06 ? 6   G   C P     1 
ATOM   512  O  OP1   . G   B 2 6   ? 79.993 28.633  33.074 0.50 66.30 ? 6   G   C OP1   1 
ATOM   513  O  OP2   . G   B 2 6   ? 78.615 26.501  33.464 0.50 65.96 ? 6   G   C OP2   1 
ATOM   514  O  "O5'" . G   B 2 6   ? 81.108 26.438  33.499 0.50 64.98 ? 6   G   C "O5'" 1 
ATOM   515  C  "C5'" . G   B 2 6   ? 82.409 26.970  33.726 0.50 63.53 ? 6   G   C "C5'" 1 
ATOM   516  C  "C4'" . G   B 2 6   ? 83.463 25.936  33.412 0.50 62.22 ? 6   G   C "C4'" 1 
ATOM   517  O  "O4'" . G   B 2 6   ? 83.382 24.843  34.366 0.50 61.93 ? 6   G   C "O4'" 1 
ATOM   518  C  "C3'" . G   B 2 6   ? 83.333 25.241  32.068 0.50 61.49 ? 6   G   C "C3'" 1 
ATOM   519  O  "O3'" . G   B 2 6   ? 83.856 26.028  31.009 0.50 60.72 ? 6   G   C "O3'" 1 
ATOM   520  C  "C2'" . G   B 2 6   ? 84.157 23.982  32.293 0.50 61.26 ? 6   G   C "C2'" 1 
ATOM   521  O  "O2'" . G   B 2 6   ? 85.546 24.224  32.209 0.50 61.08 ? 6   G   C "O2'" 1 
ATOM   522  C  "C1'" . G   B 2 6   ? 83.779 23.634  33.734 0.50 61.28 ? 6   G   C "C1'" 1 
ATOM   523  N  N9    . G   B 2 6   ? 82.670 22.687  33.802 0.50 60.81 ? 6   G   C N9    1 
ATOM   524  C  C8    . G   B 2 6   ? 81.349 22.964  34.065 0.50 60.57 ? 6   G   C C8    1 
ATOM   525  N  N7    . G   B 2 6   ? 80.591 21.901  34.054 0.50 60.51 ? 6   G   C N7    1 
ATOM   526  C  C5    . G   B 2 6   ? 81.463 20.858  33.768 0.50 60.24 ? 6   G   C C5    1 
ATOM   527  C  C6    . G   B 2 6   ? 81.222 19.461  33.627 0.50 59.72 ? 6   G   C C6    1 
ATOM   528  O  O6    . G   B 2 6   ? 80.152 18.844  33.732 0.50 59.00 ? 6   G   C O6    1 
ATOM   529  N  N1    . G   B 2 6   ? 82.393 18.769  33.333 0.50 59.38 ? 6   G   C N1    1 
ATOM   530  C  C2    . G   B 2 6   ? 83.635 19.341  33.193 0.50 59.45 ? 6   G   C C2    1 
ATOM   531  N  N2    . G   B 2 6   ? 84.643 18.504  32.908 0.50 58.79 ? 6   G   C N2    1 
ATOM   532  N  N3    . G   B 2 6   ? 83.872 20.636  33.323 0.50 59.40 ? 6   G   C N3    1 
ATOM   533  C  C4    . G   B 2 6   ? 82.751 21.329  33.609 0.50 60.08 ? 6   G   C C4    1 
ATOM   534  P  P     . U   B 2 7   ? 83.333 25.782  29.511 0.50 60.55 ? 7   U   C P     1 
ATOM   535  O  OP1   . U   B 2 7   ? 84.051 26.738  28.629 0.50 61.04 ? 7   U   C OP1   1 
ATOM   536  O  OP2   . U   B 2 7   ? 81.848 25.766  29.522 0.50 60.66 ? 7   U   C OP2   1 
ATOM   537  O  "O5'" . U   B 2 7   ? 83.845 24.313  29.168 0.50 59.85 ? 7   U   C "O5'" 1 
ATOM   538  C  "C5'" . U   B 2 7   ? 85.237 24.041  29.053 0.50 58.64 ? 7   U   C "C5'" 1 
ATOM   539  C  "C4'" . U   B 2 7   ? 85.461 22.593  28.689 0.50 57.95 ? 7   U   C "C4'" 1 
ATOM   540  O  "O4'" . U   B 2 7   ? 85.034 21.737  29.783 0.50 57.76 ? 7   U   C "O4'" 1 
ATOM   541  C  "C3'" . U   B 2 7   ? 84.668 22.069  27.504 0.50 57.52 ? 7   U   C "C3'" 1 
ATOM   542  O  "O3'" . U   B 2 7   ? 85.265 22.430  26.266 0.50 57.00 ? 7   U   C "O3'" 1 
ATOM   543  C  "C2'" . U   B 2 7   ? 84.730 20.567  27.738 0.50 57.33 ? 7   U   C "C2'" 1 
ATOM   544  O  "O2'" . U   B 2 7   ? 85.969 20.014  27.344 0.50 57.50 ? 7   U   C "O2'" 1 
ATOM   545  C  "C1'" . U   B 2 7   ? 84.587 20.495  29.261 0.50 57.12 ? 7   U   C "C1'" 1 
ATOM   546  N  N1    . U   B 2 7   ? 83.194 20.277  29.682 0.50 56.36 ? 7   U   C N1    1 
ATOM   547  C  C2    . U   B 2 7   ? 82.747 18.972  29.748 0.50 55.64 ? 7   U   C C2    1 
ATOM   548  O  O2    . U   B 2 7   ? 83.459 18.016  29.492 0.50 55.17 ? 7   U   C O2    1 
ATOM   549  N  N3    . U   B 2 7   ? 81.434 18.825  30.123 0.50 55.13 ? 7   U   C N3    1 
ATOM   550  C  C4    . U   B 2 7   ? 80.542 19.826  30.435 0.50 54.76 ? 7   U   C C4    1 
ATOM   551  O  O4    . U   B 2 7   ? 79.387 19.531  30.752 0.50 53.16 ? 7   U   C O4    1 
ATOM   552  C  C5    . U   B 2 7   ? 81.080 21.151  30.351 0.50 55.41 ? 7   U   C C5    1 
ATOM   553  C  C6    . U   B 2 7   ? 82.358 21.327  29.988 0.50 56.02 ? 7   U   C C6    1 
ATOM   554  P  P     . A   B 2 8   ? 84.361 22.496  24.940 0.50 56.49 ? 8   A   C P     1 
ATOM   555  O  OP1   . A   B 2 8   ? 85.254 22.902  23.825 0.50 56.47 ? 8   A   C OP1   1 
ATOM   556  O  OP2   . A   B 2 8   ? 83.141 23.291  25.228 0.50 56.23 ? 8   A   C OP2   1 
ATOM   557  O  "O5'" . A   B 2 8   ? 83.921 20.981  24.707 0.50 56.47 ? 8   A   C "O5'" 1 
ATOM   558  C  "C5'" . A   B 2 8   ? 84.878 20.003  24.314 0.50 55.82 ? 8   A   C "C5'" 1 
ATOM   559  C  "C4'" . A   B 2 8   ? 84.236 18.637  24.210 0.50 55.21 ? 8   A   C "C4'" 1 
ATOM   560  O  "O4'" . A   B 2 8   ? 83.817 18.177  25.525 0.50 55.03 ? 8   A   C "O4'" 1 
ATOM   561  C  "C3'" . A   B 2 8   ? 82.960 18.531  23.394 0.50 55.00 ? 8   A   C "C3'" 1 
ATOM   562  O  "O3'" . A   B 2 8   ? 83.205 18.488  21.995 0.50 55.29 ? 8   A   C "O3'" 1 
ATOM   563  C  "C2'" . A   B 2 8   ? 82.401 17.204  23.887 0.50 54.49 ? 8   A   C "C2'" 1 
ATOM   564  O  "O2'" . A   B 2 8   ? 83.064 16.097  23.313 0.50 53.78 ? 8   A   C "O2'" 1 
ATOM   565  C  "C1'" . A   B 2 8   ? 82.721 17.284  25.381 0.50 54.46 ? 8   A   C "C1'" 1 
ATOM   566  N  N9    . A   B 2 8   ? 81.582 17.801  26.139 0.50 54.45 ? 8   A   C N9    1 
ATOM   567  C  C8    . A   B 2 8   ? 81.353 19.079  26.587 0.50 54.71 ? 8   A   C C8    1 
ATOM   568  N  N7    . A   B 2 8   ? 80.208 19.222  27.212 0.50 54.77 ? 8   A   C N7    1 
ATOM   569  C  C5    . A   B 2 8   ? 79.649 17.951  27.180 0.50 54.02 ? 8   A   C C5    1 
ATOM   570  C  C6    . A   B 2 8   ? 78.435 17.434  27.674 0.50 53.66 ? 8   A   C C6    1 
ATOM   571  N  N6    . A   B 2 8   ? 77.525 18.165  28.322 0.50 52.03 ? 8   A   C N6    1 
ATOM   572  N  N1    . A   B 2 8   ? 78.185 16.121  27.475 0.50 52.87 ? 8   A   C N1    1 
ATOM   573  C  C2    . A   B 2 8   ? 79.096 15.386  26.825 0.50 53.97 ? 8   A   C C2    1 
ATOM   574  N  N3    . A   B 2 8   ? 80.270 15.756  26.314 0.50 53.75 ? 8   A   C N3    1 
ATOM   575  C  C4    . A   B 2 8   ? 80.488 17.065  26.528 0.50 54.13 ? 8   A   C C4    1 
ATOM   576  P  P     . U   B 2 9   ? 82.044 18.936  20.978 0.50 55.75 ? 9   U   C P     1 
ATOM   577  O  OP1   . U   B 2 9   ? 82.641 19.003  19.619 0.50 56.10 ? 9   U   C OP1   1 
ATOM   578  O  OP2   . U   B 2 9   ? 81.387 20.138  21.553 0.50 55.80 ? 9   U   C OP2   1 
ATOM   579  O  "O5'" . U   B 2 9   ? 80.998 17.730  21.008 0.50 55.85 ? 9   U   C "O5'" 1 
ATOM   580  C  "C5'" . U   B 2 9   ? 81.321 16.473  20.418 0.50 55.62 ? 9   U   C "C5'" 1 
ATOM   581  C  "C4'" . U   B 2 9   ? 80.289 15.427  20.781 0.50 55.48 ? 9   U   C "C4'" 1 
ATOM   582  O  "O4'" . U   B 2 9   ? 80.157 15.370  22.227 0.50 55.89 ? 9   U   C "O4'" 1 
ATOM   583  C  "C3'" . U   B 2 9   ? 78.861 15.654  20.305 0.50 55.43 ? 9   U   C "C3'" 1 
ATOM   584  O  "O3'" . U   B 2 9   ? 78.672 15.221  18.964 0.50 55.07 ? 9   U   C "O3'" 1 
ATOM   585  C  "C2'" . U   B 2 9   ? 78.078 14.767  21.261 0.50 55.71 ? 9   U   C "C2'" 1 
ATOM   586  O  "O2'" . U   B 2 9   ? 78.151 13.398  20.915 0.50 55.70 ? 9   U   C "O2'" 1 
ATOM   587  C  "C1'" . U   B 2 9   ? 78.826 15.014  22.569 0.50 55.76 ? 9   U   C "C1'" 1 
ATOM   588  N  N1    . U   B 2 9   ? 78.223 16.122  23.320 0.50 56.42 ? 9   U   C N1    1 
ATOM   589  C  C2    . U   B 2 9   ? 77.074 15.850  24.035 0.50 56.25 ? 9   U   C C2    1 
ATOM   590  O  O2    . U   B 2 9   ? 76.570 14.740  24.075 0.50 56.58 ? 9   U   C O2    1 
ATOM   591  N  N3    . U   B 2 9   ? 76.538 16.924  24.699 0.50 55.64 ? 9   U   C N3    1 
ATOM   592  C  C4    . U   B 2 9   ? 77.023 18.214  24.720 0.50 56.07 ? 9   U   C C4    1 
ATOM   593  O  O4    . U   B 2 9   ? 76.419 19.076  25.359 0.50 55.98 ? 9   U   C O4    1 
ATOM   594  C  C5    . U   B 2 9   ? 78.220 18.414  23.960 0.50 56.11 ? 9   U   C C5    1 
ATOM   595  C  C6    . U   B 2 9   ? 78.767 17.385  23.304 0.50 56.37 ? 9   U   C C6    1 
ATOM   596  P  P     . U   B 2 10  ? 77.419 15.771  18.121 0.50 54.94 ? 10  U   C P     1 
ATOM   597  O  OP1   . U   B 2 10  ? 77.624 15.370  16.706 0.50 55.35 ? 10  U   C OP1   1 
ATOM   598  O  OP2   . U   B 2 10  ? 77.231 17.203  18.460 0.50 54.80 ? 10  U   C OP2   1 
ATOM   599  O  "O5'" . U   B 2 10  ? 76.167 14.967  18.691 0.50 54.46 ? 10  U   C "O5'" 1 
ATOM   600  C  "C5'" . U   B 2 10  ? 76.087 13.549  18.576 0.50 52.62 ? 10  U   C "C5'" 1 
ATOM   601  C  "C4'" . U   B 2 10  ? 74.914 13.028  19.374 0.50 51.49 ? 10  U   C "C4'" 1 
ATOM   602  O  "O4'" . U   B 2 10  ? 75.043 13.509  20.737 0.50 50.68 ? 10  U   C "O4'" 1 
ATOM   603  C  "C3'" . U   B 2 10  ? 73.540 13.513  18.931 0.50 50.78 ? 10  U   C "C3'" 1 
ATOM   604  O  "O3'" . U   B 2 10  ? 73.005 12.666  17.919 0.50 50.50 ? 10  U   C "O3'" 1 
ATOM   605  C  "C2'" . U   B 2 10  ? 72.729 13.404  20.214 0.50 50.81 ? 10  U   C "C2'" 1 
ATOM   606  O  "O2'" . U   B 2 10  ? 72.286 12.087  20.479 0.50 50.70 ? 10  U   C "O2'" 1 
ATOM   607  C  "C1'" . U   B 2 10  ? 73.763 13.822  21.259 0.50 50.67 ? 10  U   C "C1'" 1 
ATOM   608  N  N1    . U   B 2 10  ? 73.727 15.260  21.557 0.50 49.40 ? 10  U   C N1    1 
ATOM   609  C  C2    . U   B 2 10  ? 72.788 15.700  22.466 0.50 49.26 ? 10  U   C C2    1 
ATOM   610  O  O2    . U   B 2 10  ? 72.000 14.948  23.018 0.50 47.67 ? 10  U   C O2    1 
ATOM   611  N  N3    . U   B 2 10  ? 72.803 17.052  22.707 0.50 48.62 ? 10  U   C N3    1 
ATOM   612  C  C4    . U   B 2 10  ? 73.644 17.987  22.143 0.50 48.59 ? 10  U   C C4    1 
ATOM   613  O  O4    . U   B 2 10  ? 73.538 19.171  22.466 0.50 48.06 ? 10  U   C O4    1 
ATOM   614  C  C5    . U   B 2 10  ? 74.587 17.453  21.209 0.50 49.02 ? 10  U   C C5    1 
ATOM   615  C  C6    . U   B 2 10  ? 74.596 16.140  20.955 0.50 49.52 ? 10  U   C C6    1 
ATOM   616  P  P     . C   B 2 11  ? 71.887 13.233  16.910 0.50 48.80 ? 11  C   C P     1 
ATOM   617  O  OP1   . C   B 2 11  ? 71.495 12.093  16.040 0.50 49.85 ? 11  C   C OP1   1 
ATOM   618  O  OP2   . C   B 2 11  ? 72.388 14.488  16.294 0.50 49.61 ? 11  C   C OP2   1 
ATOM   619  O  "O5'" . C   B 2 11  ? 70.652 13.585  17.856 0.50 48.44 ? 11  C   C "O5'" 1 
ATOM   620  C  "C5'" . C   B 2 11  ? 69.847 12.546  18.405 0.50 45.89 ? 11  C   C "C5'" 1 
ATOM   621  C  "C4'" . C   B 2 11  ? 68.789 13.110  19.328 0.50 45.10 ? 11  C   C "C4'" 1 
ATOM   622  O  "O4'" . C   B 2 11  ? 69.409 13.774  20.461 0.50 44.89 ? 11  C   C "O4'" 1 
ATOM   623  C  "C3'" . C   B 2 11  ? 67.872 14.187  18.777 0.50 44.08 ? 11  C   C "C3'" 1 
ATOM   624  O  "O3'" . C   B 2 11  ? 66.844 13.652  17.959 0.50 42.32 ? 11  C   C "O3'" 1 
ATOM   625  C  "C2'" . C   B 2 11  ? 67.293 14.769  20.059 0.50 44.38 ? 11  C   C "C2'" 1 
ATOM   626  O  "O2'" . C   B 2 11  ? 66.284 13.952  20.618 0.50 44.45 ? 11  C   C "O2'" 1 
ATOM   627  C  "C1'" . C   B 2 11  ? 68.519 14.756  20.972 0.50 44.92 ? 11  C   C "C1'" 1 
ATOM   628  N  N1    . C   B 2 11  ? 69.193 16.063  20.991 0.50 45.57 ? 11  C   C N1    1 
ATOM   629  C  C2    . C   B 2 11  ? 68.738 17.024  21.896 0.50 45.66 ? 11  C   C C2    1 
ATOM   630  O  O2    . C   B 2 11  ? 67.800 16.734  22.651 0.50 44.71 ? 11  C   C O2    1 
ATOM   631  N  N3    . C   B 2 11  ? 69.328 18.241  21.926 0.50 46.01 ? 11  C   C N3    1 
ATOM   632  C  C4    . C   B 2 11  ? 70.334 18.515  21.095 0.50 46.30 ? 11  C   C C4    1 
ATOM   633  N  N4    . C   B 2 11  ? 70.881 19.735  21.161 0.50 46.69 ? 11  C   C N4    1 
ATOM   634  C  C5    . C   B 2 11  ? 70.823 17.552  20.159 0.50 46.84 ? 11  C   C C5    1 
ATOM   635  C  C6    . C   B 2 11  ? 70.229 16.347  20.144 0.50 45.56 ? 11  C   C C6    1 
ATOM   636  P  P     . C   B 2 12  ? 66.004 14.633  17.007 0.50 41.25 ? 12  C   C P     1 
ATOM   637  O  OP1   . C   B 2 12  ? 65.125 13.780  16.163 0.50 40.91 ? 12  C   C OP1   1 
ATOM   638  O  OP2   . C   B 2 12  ? 66.950 15.575  16.362 0.50 39.90 ? 12  C   C OP2   1 
ATOM   639  O  "O5'" . C   B 2 12  ? 65.091 15.461  18.019 0.50 39.92 ? 12  C   C "O5'" 1 
ATOM   640  C  "C5'" . C   B 2 12  ? 64.004 14.839  18.696 0.50 37.55 ? 12  C   C "C5'" 1 
ATOM   641  C  "C4'" . C   B 2 12  ? 63.269 15.845  19.549 0.50 36.40 ? 12  C   C "C4'" 1 
ATOM   642  O  "O4'" . C   B 2 12  ? 64.121 16.286  20.641 0.50 36.57 ? 12  C   C "O4'" 1 
ATOM   643  C  "C3'" . C   B 2 12  ? 62.874 17.141  18.865 0.50 35.96 ? 12  C   C "C3'" 1 
ATOM   644  O  "O3'" . C   B 2 12  ? 61.699 17.006  18.079 0.50 34.85 ? 12  C   C "O3'" 1 
ATOM   645  C  "C2'" . C   B 2 12  ? 62.662 18.061  20.058 0.50 36.02 ? 12  C   C "C2'" 1 
ATOM   646  O  "O2'" . C   B 2 12  ? 61.434 17.822  20.720 0.50 36.07 ? 12  C   C "O2'" 1 
ATOM   647  C  "C1'" . C   B 2 12  ? 63.821 17.640  20.961 0.50 36.10 ? 12  C   C "C1'" 1 
ATOM   648  N  N1    . C   B 2 12  ? 65.027 18.455  20.732 0.50 36.24 ? 12  C   C N1    1 
ATOM   649  C  C2    . C   B 2 12  ? 65.141 19.685  21.390 0.50 35.73 ? 12  C   C C2    1 
ATOM   650  O  O2    . C   B 2 12  ? 64.222 20.056  22.132 0.50 36.27 ? 12  C   C O2    1 
ATOM   651  N  N3    . C   B 2 12  ? 66.248 20.439  21.199 0.50 35.66 ? 12  C   C N3    1 
ATOM   652  C  C4    . C   B 2 12  ? 67.214 20.010  20.386 0.50 34.74 ? 12  C   C C4    1 
ATOM   653  N  N4    . C   B 2 12  ? 68.287 20.787  20.232 0.50 32.57 ? 12  C   C N4    1 
ATOM   654  C  C5    . C   B 2 12  ? 67.121 18.766  19.695 0.50 34.77 ? 12  C   C C5    1 
ATOM   655  C  C6    . C   B 2 12  ? 66.021 18.026  19.896 0.50 35.64 ? 12  C   C C6    1 
ATOM   656  P  P     . G   B 2 13  ? 61.431 18.039  16.878 0.50 34.83 ? 13  G   C P     1 
ATOM   657  O  OP1   . G   B 2 13  ? 60.259 17.548  16.113 0.50 34.46 ? 13  G   C OP1   1 
ATOM   658  O  OP2   . G   B 2 13  ? 62.717 18.286  16.177 0.50 34.41 ? 13  G   C OP2   1 
ATOM   659  O  "O5'" . G   B 2 13  ? 61.006 19.378  17.619 0.50 34.21 ? 13  G   C "O5'" 1 
ATOM   660  C  "C5'" . G   B 2 13  ? 59.837 19.422  18.427 0.50 34.20 ? 13  G   C "C5'" 1 
ATOM   661  C  "C4'" . G   B 2 13  ? 59.717 20.776  19.078 0.50 34.26 ? 13  G   C "C4'" 1 
ATOM   662  O  "O4'" . G   B 2 13  ? 60.816 20.964  20.011 0.50 34.07 ? 13  G   C "O4'" 1 
ATOM   663  C  "C3'" . G   B 2 13  ? 59.850 21.949  18.122 0.50 34.18 ? 13  G   C "C3'" 1 
ATOM   664  O  "O3'" . G   B 2 13  ? 58.623 22.214  17.456 0.50 35.07 ? 13  G   C "O3'" 1 
ATOM   665  C  "C2'" . G   B 2 13  ? 60.271 23.067  19.064 0.50 34.15 ? 13  G   C "C2'" 1 
ATOM   666  O  "O2'" . G   B 2 13  ? 59.196 23.558  19.839 0.50 33.80 ? 13  G   C "O2'" 1 
ATOM   667  C  "C1'" . G   B 2 13  ? 61.237 22.320  19.985 0.50 33.93 ? 13  G   C "C1'" 1 
ATOM   668  N  N9    . G   B 2 13  ? 62.621 22.358  19.521 0.50 33.56 ? 13  G   C N9    1 
ATOM   669  C  C8    . G   B 2 13  ? 63.316 21.347  18.902 0.50 34.61 ? 13  G   C C8    1 
ATOM   670  N  N7    . G   B 2 13  ? 64.552 21.666  18.629 0.50 33.94 ? 13  G   C N7    1 
ATOM   671  C  C5    . G   B 2 13  ? 64.679 22.970  19.089 0.50 34.82 ? 13  G   C C5    1 
ATOM   672  C  C6    . G   B 2 13  ? 65.799 23.849  19.074 0.50 35.29 ? 13  G   C C6    1 
ATOM   673  O  O6    . G   B 2 13  ? 66.941 23.640  18.641 0.50 36.33 ? 13  G   C O6    1 
ATOM   674  N  N1    . G   B 2 13  ? 65.486 25.082  19.639 0.50 35.02 ? 13  G   C N1    1 
ATOM   675  C  C2    . G   B 2 13  ? 64.259 25.427  20.152 0.50 36.44 ? 13  G   C C2    1 
ATOM   676  N  N2    . G   B 2 13  ? 64.150 26.668  20.650 0.50 37.08 ? 13  G   C N2    1 
ATOM   677  N  N3    . G   B 2 13  ? 63.213 24.616  20.176 0.50 34.97 ? 13  G   C N3    1 
ATOM   678  C  C4    . G   B 2 13  ? 63.492 23.414  19.633 0.50 34.17 ? 13  G   C C4    1 
ATOM   679  P  P     . C   B 2 14  ? 58.645 22.821  15.964 0.50 35.94 ? 14  C   C P     1 
ATOM   680  O  OP1   . C   B 2 14  ? 57.257 22.779  15.445 0.50 35.68 ? 14  C   C OP1   1 
ATOM   681  O  OP2   . C   B 2 14  ? 59.737 22.162  15.203 0.50 36.07 ? 14  C   C OP2   1 
ATOM   682  O  "O5'" . C   B 2 14  ? 59.055 24.340  16.189 0.50 37.75 ? 14  C   C "O5'" 1 
ATOM   683  C  "C5'" . C   B 2 14  ? 58.225 25.210  16.947 0.50 39.47 ? 14  C   C "C5'" 1 
ATOM   684  C  "C4'" . C   B 2 14  ? 58.928 26.523  17.177 0.50 41.12 ? 14  C   C "C4'" 1 
ATOM   685  O  "O4'" . C   B 2 14  ? 60.095 26.304  18.017 0.50 41.42 ? 14  C   C "O4'" 1 
ATOM   686  C  "C3'" . C   B 2 14  ? 59.508 27.178  15.936 0.50 42.35 ? 14  C   C "C3'" 1 
ATOM   687  O  "O3'" . C   B 2 14  ? 58.524 27.883  15.192 0.50 45.12 ? 14  C   C "O3'" 1 
ATOM   688  C  "C2'" . C   B 2 14  ? 60.548 28.104  16.547 0.50 41.70 ? 14  C   C "C2'" 1 
ATOM   689  O  "O2'" . C   B 2 14  ? 59.962 29.246  17.139 0.50 41.41 ? 14  C   C "O2'" 1 
ATOM   690  C  "C1'" . C   B 2 14  ? 61.130 27.203  17.637 0.50 41.18 ? 14  C   C "C1'" 1 
ATOM   691  N  N1    . C   B 2 14  ? 62.278 26.421  17.146 0.50 40.30 ? 14  C   C N1    1 
ATOM   692  C  C2    . C   B 2 14  ? 63.562 26.976  17.250 0.50 41.03 ? 14  C   C C2    1 
ATOM   693  O  O2    . C   B 2 14  ? 63.694 28.095  17.771 0.50 39.67 ? 14  C   C O2    1 
ATOM   694  N  N3    . C   B 2 14  ? 64.623 26.280  16.781 0.50 39.74 ? 14  C   C N3    1 
ATOM   695  C  C4    . C   B 2 14  ? 64.443 25.078  16.229 0.50 40.28 ? 14  C   C C4    1 
ATOM   696  N  N4    . C   B 2 14  ? 65.523 24.432  15.779 0.50 39.30 ? 14  C   C N4    1 
ATOM   697  C  C5    . C   B 2 14  ? 63.149 24.486  16.115 0.50 39.50 ? 14  C   C C5    1 
ATOM   698  C  C6    . C   B 2 14  ? 62.104 25.186  16.585 0.50 40.66 ? 14  C   C C6    1 
ATOM   699  P  P     . G   B 2 15  ? 58.758 28.155  13.624 0.50 46.90 ? 15  G   C P     1 
ATOM   700  O  OP1   . G   B 2 15  ? 57.559 28.872  13.130 0.50 47.44 ? 15  G   C OP1   1 
ATOM   701  O  OP2   . G   B 2 15  ? 59.183 26.894  12.965 0.50 47.05 ? 15  G   C OP2   1 
ATOM   702  O  "O5'" . G   B 2 15  ? 59.985 29.168  13.595 0.50 48.76 ? 15  G   C "O5'" 1 
ATOM   703  C  "C5'" . G   B 2 15  ? 59.853 30.477  14.138 0.50 52.37 ? 15  G   C "C5'" 1 
ATOM   704  C  "C4'" . G   B 2 15  ? 61.170 31.210  14.065 0.50 54.91 ? 15  G   C "C4'" 1 
ATOM   705  O  "O4'" . G   B 2 15  ? 62.152 30.509  14.874 0.50 55.35 ? 15  G   C "O4'" 1 
ATOM   706  C  "C3'" . G   B 2 15  ? 61.827 31.266  12.697 0.50 56.55 ? 15  G   C "C3'" 1 
ATOM   707  O  "O3'" . G   B 2 15  ? 61.280 32.282  11.868 0.50 58.90 ? 15  G   C "O3'" 1 
ATOM   708  C  "C2'" . G   B 2 15  ? 63.274 31.554  13.067 0.50 56.52 ? 15  G   C "C2'" 1 
ATOM   709  O  "O2'" . G   B 2 15  ? 63.498 32.904  13.421 0.50 56.30 ? 15  G   C "O2'" 1 
ATOM   710  C  "C1'" . G   B 2 15  ? 63.440 30.666  14.298 0.50 56.15 ? 15  G   C "C1'" 1 
ATOM   711  N  N9    . G   B 2 15  ? 63.962 29.350  13.945 0.50 56.44 ? 15  G   C N9    1 
ATOM   712  C  C8    . G   B 2 15  ? 63.260 28.179  13.785 0.50 56.64 ? 15  G   C C8    1 
ATOM   713  N  N7    . G   B 2 15  ? 64.021 27.168  13.452 0.50 57.16 ? 15  G   C N7    1 
ATOM   714  C  C5    . G   B 2 15  ? 65.300 27.707  13.391 0.50 57.34 ? 15  G   C C5    1 
ATOM   715  C  C6    . G   B 2 15  ? 66.550 27.097  13.080 0.50 57.69 ? 15  G   C C6    1 
ATOM   716  O  O6    . G   B 2 15  ? 66.786 25.915  12.785 0.50 57.76 ? 15  G   C O6    1 
ATOM   717  N  N1    . G   B 2 15  ? 67.593 28.017  13.135 0.50 58.03 ? 15  G   C N1    1 
ATOM   718  C  C2    . G   B 2 15  ? 67.458 29.349  13.449 0.50 58.17 ? 15  G   C C2    1 
ATOM   719  N  N2    . G   B 2 15  ? 68.583 30.078  13.451 0.50 58.74 ? 15  G   C N2    1 
ATOM   720  N  N3    . G   B 2 15  ? 66.306 29.925  13.740 0.50 57.84 ? 15  G   C N3    1 
ATOM   721  C  C4    . G   B 2 15  ? 65.278 29.052  13.693 0.50 57.35 ? 15  G   C C4    1 
ATOM   722  P  P     . U   B 2 16  ? 61.442 32.169  10.271 0.50 60.76 ? 16  U   C P     1 
ATOM   723  O  OP1   . U   B 2 16  ? 60.774 33.356  9.677  0.50 60.96 ? 16  U   C OP1   1 
ATOM   724  O  OP2   . U   B 2 16  ? 61.027 30.806  9.850  0.50 60.62 ? 16  U   C OP2   1 
ATOM   725  O  "O5'" . U   B 2 16  ? 63.013 32.306  10.032 0.50 61.85 ? 16  U   C "O5'" 1 
ATOM   726  C  "C5'" . U   B 2 16  ? 63.687 33.529  10.315 0.50 63.80 ? 16  U   C "C5'" 1 
ATOM   727  C  "C4'" . U   B 2 16  ? 65.120 33.476  9.834  0.50 65.20 ? 16  U   C "C4'" 1 
ATOM   728  O  "O4'" . U   B 2 16  ? 65.870 32.500  10.605 0.50 65.41 ? 16  U   C "O4'" 1 
ATOM   729  C  "C3'" . U   B 2 16  ? 65.343 33.037  8.397  0.50 66.07 ? 16  U   C "C3'" 1 
ATOM   730  O  "O3'" . U   B 2 16  ? 65.122 34.107  7.485  0.50 67.45 ? 16  U   C "O3'" 1 
ATOM   731  C  "C2'" . U   B 2 16  ? 66.811 32.623  8.422  0.50 65.96 ? 16  U   C "C2'" 1 
ATOM   732  O  "O2'" . U   B 2 16  ? 67.692 33.724  8.331  0.50 65.83 ? 16  U   C "O2'" 1 
ATOM   733  C  "C1'" . U   B 2 16  ? 66.928 31.987  9.809  0.50 65.78 ? 16  U   C "C1'" 1 
ATOM   734  N  N1    . U   B 2 16  ? 66.830 30.520  9.775  0.50 65.97 ? 16  U   C N1    1 
ATOM   735  C  C2    . U   B 2 16  ? 67.999 29.813  9.567  0.50 66.11 ? 16  U   C C2    1 
ATOM   736  O  O2    . U   B 2 16  ? 69.081 30.355  9.423  0.50 66.35 ? 16  U   C O2    1 
ATOM   737  N  N3    . U   B 2 16  ? 67.854 28.447  9.534  0.50 65.93 ? 16  U   C N3    1 
ATOM   738  C  C4    . U   B 2 16  ? 66.683 27.733  9.685  0.50 65.99 ? 16  U   C C4    1 
ATOM   739  O  O4    . U   B 2 16  ? 66.715 26.501  9.633  0.50 65.98 ? 16  U   C O4    1 
ATOM   740  C  C5    . U   B 2 16  ? 65.517 28.537  9.898  0.50 65.82 ? 16  U   C C5    1 
ATOM   741  C  C6    . U   B 2 16  ? 65.628 29.871  9.935  0.50 65.92 ? 16  U   C C6    1 
ATOM   742  P  P     . A   B 2 17  ? 64.633 33.789  5.985  0.50 68.72 ? 17  A   C P     1 
ATOM   743  O  OP1   . A   B 2 17  ? 64.492 35.096  5.293  0.50 68.42 ? 17  A   C OP1   1 
ATOM   744  O  OP2   . A   B 2 17  ? 63.474 32.861  6.041  0.50 68.63 ? 17  A   C OP2   1 
ATOM   745  O  "O5'" . A   B 2 17  ? 65.865 33.018  5.331  0.50 68.78 ? 17  A   C "O5'" 1 
ATOM   746  C  "C5'" . A   B 2 17  ? 67.017 33.735  4.905  0.50 69.59 ? 17  A   C "C5'" 1 
ATOM   747  C  "C4'" . A   B 2 17  ? 68.074 32.790  4.382  0.50 70.02 ? 17  A   C "C4'" 1 
ATOM   748  O  "O4'" . A   B 2 17  ? 68.507 31.900  5.444  0.50 70.17 ? 17  A   C "O4'" 1 
ATOM   749  C  "C3'" . A   B 2 17  ? 67.669 31.829  3.276  0.50 70.14 ? 17  A   C "C3'" 1 
ATOM   750  O  "O3'" . A   B 2 17  ? 67.652 32.459  1.998  0.50 70.36 ? 17  A   C "O3'" 1 
ATOM   751  C  "C2'" . A   B 2 17  ? 68.778 30.787  3.360  0.50 70.21 ? 17  A   C "C2'" 1 
ATOM   752  O  "O2'" . A   B 2 17  ? 69.975 31.204  2.732  0.50 70.27 ? 17  A   C "O2'" 1 
ATOM   753  C  "C1'" . A   B 2 17  ? 69.000 30.699  4.872  0.50 70.03 ? 17  A   C "C1'" 1 
ATOM   754  N  N9    . A   B 2 17  ? 68.305 29.558  5.468  0.50 69.50 ? 17  A   C N9    1 
ATOM   755  C  C8    . A   B 2 17  ? 67.047 29.487  6.017  0.50 69.12 ? 17  A   C C8    1 
ATOM   756  N  N7    . A   B 2 17  ? 66.720 28.286  6.435  0.50 68.95 ? 17  A   C N7    1 
ATOM   757  C  C5    . A   B 2 17  ? 67.842 27.517  6.148  0.50 68.68 ? 17  A   C C5    1 
ATOM   758  C  C6    . A   B 2 17  ? 68.139 26.152  6.344  0.50 68.05 ? 17  A   C C6    1 
ATOM   759  N  N6    . A   B 2 17  ? 67.299 25.274  6.898  0.50 67.86 ? 17  A   C N6    1 
ATOM   760  N  N1    . A   B 2 17  ? 69.352 25.713  5.942  0.50 67.84 ? 17  A   C N1    1 
ATOM   761  C  C2    . A   B 2 17  ? 70.200 26.585  5.387  0.50 67.85 ? 17  A   C C2    1 
ATOM   762  N  N3    . A   B 2 17  ? 70.039 27.882  5.150  0.50 68.29 ? 17  A   C N3    1 
ATOM   763  C  C4    . A   B 2 17  ? 68.825 28.290  5.558  0.50 68.85 ? 17  A   C C4    1 
ATOM   764  P  P     . C   B 2 18  ? 66.858 31.769  0.779  0.50 70.48 ? 18  C   C P     1 
ATOM   765  O  OP1   . C   B 2 18  ? 66.861 32.732  -0.353 0.50 70.39 ? 18  C   C OP1   1 
ATOM   766  O  OP2   . C   B 2 18  ? 65.565 31.251  1.298  0.50 70.66 ? 18  C   C OP2   1 
ATOM   767  O  "O5'" . C   B 2 18  ? 67.774 30.527  0.374  0.50 69.84 ? 18  C   C "O5'" 1 
ATOM   768  C  "C5'" . C   B 2 18  ? 69.108 30.735  -0.081 0.50 69.12 ? 18  C   C "C5'" 1 
ATOM   769  C  "C4'" . C   B 2 18  ? 69.921 29.463  0.023  0.50 68.44 ? 18  C   C "C4'" 1 
ATOM   770  O  "O4'" . C   B 2 18  ? 69.821 28.931  1.370  0.50 68.28 ? 18  C   C "O4'" 1 
ATOM   771  C  "C3'" . C   B 2 18  ? 69.499 28.279  -0.832 0.50 68.28 ? 18  C   C "C3'" 1 
ATOM   772  O  "O3'" . C   B 2 18  ? 69.962 28.398  -2.171 0.50 68.19 ? 18  C   C "O3'" 1 
ATOM   773  C  "C2'" . C   B 2 18  ? 70.213 27.133  -0.130 0.50 68.18 ? 18  C   C "C2'" 1 
ATOM   774  O  "O2'" . C   B 2 18  ? 71.588 27.075  -0.452 0.50 68.43 ? 18  C   C "O2'" 1 
ATOM   775  C  "C1'" . C   B 2 18  ? 70.050 27.531  1.337  0.50 68.04 ? 18  C   C "C1'" 1 
ATOM   776  N  N1    . C   B 2 18  ? 68.916 26.833  1.963  0.50 67.45 ? 18  C   C N1    1 
ATOM   777  C  C2    . C   B 2 18  ? 69.087 25.495  2.315  0.50 67.52 ? 18  C   C C2    1 
ATOM   778  O  O2    . C   B 2 18  ? 70.191 24.965  2.113  0.50 66.62 ? 18  C   C O2    1 
ATOM   779  N  N3    . C   B 2 18  ? 68.055 24.814  2.864  0.50 67.03 ? 18  C   C N3    1 
ATOM   780  C  C4    . C   B 2 18  ? 66.887 25.426  3.068  0.50 67.04 ? 18  C   C C4    1 
ATOM   781  N  N4    . C   B 2 18  ? 65.896 24.710  3.607  0.50 67.00 ? 18  C   C N4    1 
ATOM   782  C  C5    . C   B 2 18  ? 66.686 26.797  2.728  0.50 66.80 ? 18  C   C C5    1 
ATOM   783  C  C6    . C   B 2 18  ? 67.719 27.458  2.184  0.50 67.41 ? 18  C   C C6    1 
ATOM   784  P  P     . G   B 2 19  ? 69.352 27.440  -3.310 0.50 67.75 ? 19  G   C P     1 
ATOM   785  O  OP1   . G   B 2 19  ? 69.862 27.927  -4.617 0.50 67.96 ? 19  G   C OP1   1 
ATOM   786  O  OP2   . G   B 2 19  ? 67.887 27.337  -3.086 0.50 67.47 ? 19  G   C OP2   1 
ATOM   787  O  "O5'" . G   B 2 19  ? 70.009 26.015  -3.019 0.50 67.17 ? 19  G   C "O5'" 1 
ATOM   788  C  "C5'" . G   B 2 19  ? 71.410 25.803  -3.197 0.50 66.22 ? 19  G   C "C5'" 1 
ATOM   789  C  "C4'" . G   B 2 19  ? 71.765 24.352  -2.943 0.50 65.59 ? 19  G   C "C4'" 1 
ATOM   790  O  "O4'" . G   B 2 19  ? 71.460 24.012  -1.564 0.50 64.79 ? 19  G   C "O4'" 1 
ATOM   791  C  "C3'" . G   B 2 19  ? 71.002 23.321  -3.762 0.50 65.55 ? 19  G   C "C3'" 1 
ATOM   792  O  "O3'" . G   B 2 19  ? 71.614 23.128  -5.034 0.50 66.49 ? 19  G   C "O3'" 1 
ATOM   793  C  "C2'" . G   B 2 19  ? 71.122 22.071  -2.899 0.50 64.85 ? 19  G   C "C2'" 1 
ATOM   794  O  "O2'" . G   B 2 19  ? 72.362 21.409  -3.059 0.50 64.79 ? 19  G   C "O2'" 1 
ATOM   795  C  "C1'" . G   B 2 19  ? 71.030 22.662  -1.490 0.50 63.76 ? 19  G   C "C1'" 1 
ATOM   796  N  N9    . G   B 2 19  ? 69.676 22.644  -0.944 0.50 61.44 ? 19  G   C N9    1 
ATOM   797  C  C8    . G   B 2 19  ? 68.835 23.718  -0.780 0.50 60.82 ? 19  G   C C8    1 
ATOM   798  N  N7    . G   B 2 19  ? 67.684 23.393  -0.258 0.50 59.51 ? 19  G   C N7    1 
ATOM   799  C  C5    . G   B 2 19  ? 67.769 22.021  -0.067 0.50 58.44 ? 19  G   C C5    1 
ATOM   800  C  C6    . G   B 2 19  ? 66.825 21.109  0.469  0.50 57.38 ? 19  G   C C6    1 
ATOM   801  O  O6    . G   B 2 19  ? 65.687 21.340  0.898  0.50 55.63 ? 19  G   C O6    1 
ATOM   802  N  N1    . G   B 2 19  ? 67.321 19.809  0.480  0.50 57.36 ? 19  G   C N1    1 
ATOM   803  C  C2    . G   B 2 19  ? 68.564 19.432  0.034  0.50 57.43 ? 19  G   C C2    1 
ATOM   804  N  N2    . G   B 2 19  ? 68.858 18.125  0.128  0.50 56.50 ? 19  G   C N2    1 
ATOM   805  N  N3    . G   B 2 19  ? 69.453 20.273  -0.467 0.50 57.61 ? 19  G   C N3    1 
ATOM   806  C  C4    . G   B 2 19  ? 68.992 21.542  -0.487 0.50 59.57 ? 19  G   C C4    1 
ATOM   807  P  P     . U   B 2 20  ? 70.731 22.610  -6.275 0.50 67.05 ? 20  U   C P     1 
ATOM   808  O  OP1   . U   B 2 20  ? 71.666 22.363  -7.401 0.50 67.16 ? 20  U   C OP1   1 
ATOM   809  O  OP2   . U   B 2 20  ? 69.583 23.534  -6.464 0.50 67.26 ? 20  U   C OP2   1 
ATOM   810  O  "O5'" . U   B 2 20  ? 70.163 21.204  -5.785 0.50 67.32 ? 20  U   C "O5'" 1 
ATOM   811  N  N     . HIS C 3 3   ? 89.023 5.942   7.421  1.00 56.84 ? 25  HIS A N     1 
ATOM   812  C  CA    . HIS C 3 3   ? 87.812 5.075   7.378  1.00 56.21 ? 25  HIS A CA    1 
ATOM   813  C  C     . HIS C 3 3   ? 87.605 4.356   8.710  1.00 55.87 ? 25  HIS A C     1 
ATOM   814  O  O     . HIS C 3 3   ? 88.227 3.325   8.978  1.00 55.65 ? 25  HIS A O     1 
ATOM   815  C  CB    . HIS C 3 3   ? 87.943 4.043   6.252  1.00 56.72 ? 25  HIS A CB    1 
HETATM 816  N  N     . MSE C 3 4   ? 86.730 4.907   9.545  1.00 53.01 ? 26  MSE A N     1 
HETATM 817  C  CA    . MSE C 3 4   ? 86.446 4.313   10.843 1.00 50.16 ? 26  MSE A CA    1 
HETATM 818  C  C     . MSE C 3 4   ? 85.496 3.136   10.682 1.00 46.05 ? 26  MSE A C     1 
HETATM 819  O  O     . MSE C 3 4   ? 84.795 3.029   9.678  1.00 44.54 ? 26  MSE A O     1 
HETATM 820  C  CB    . MSE C 3 4   ? 85.833 5.356   11.774 1.00 53.77 ? 26  MSE A CB    1 
HETATM 821  C  CG    . MSE C 3 4   ? 86.710 6.576   11.969 1.00 57.56 ? 26  MSE A CG    1 
HETATM 822  SE SE    . MSE C 3 4   ? 85.973 7.800   13.246 1.00 65.73 ? 26  MSE A SE    1 
HETATM 823  C  CE    . MSE C 3 4   ? 84.745 8.740   12.080 1.00 63.97 ? 26  MSE A CE    1 
ATOM   824  N  N     . THR C 3 5   ? 85.481 2.250   11.671 1.00 41.50 ? 27  THR A N     1 
ATOM   825  C  CA    . THR C 3 5   ? 84.612 1.083   11.621 1.00 38.83 ? 27  THR A CA    1 
ATOM   826  C  C     . THR C 3 5   ? 83.227 1.427   12.160 1.00 34.76 ? 27  THR A C     1 
ATOM   827  O  O     . THR C 3 5   ? 83.070 1.808   13.317 1.00 31.01 ? 27  THR A O     1 
ATOM   828  C  CB    . THR C 3 5   ? 85.202 -0.081  12.432 1.00 40.72 ? 27  THR A CB    1 
ATOM   829  O  OG1   . THR C 3 5   ? 86.495 -0.413  11.907 1.00 44.92 ? 27  THR A OG1   1 
ATOM   830  C  CG2   . THR C 3 5   ? 84.303 -1.303  12.338 1.00 41.74 ? 27  THR A CG2   1 
ATOM   831  N  N     . SER C 3 6   ? 82.228 1.286   11.299 1.00 33.34 ? 28  SER A N     1 
ATOM   832  C  CA    . SER C 3 6   ? 80.846 1.588   11.650 1.00 32.02 ? 28  SER A CA    1 
ATOM   833  C  C     . SER C 3 6   ? 80.162 0.471   12.430 1.00 29.51 ? 28  SER A C     1 
ATOM   834  O  O     . SER C 3 6   ? 80.480 -0.706  12.268 1.00 29.17 ? 28  SER A O     1 
ATOM   835  C  CB    . SER C 3 6   ? 80.047 1.862   10.373 1.00 34.50 ? 28  SER A CB    1 
ATOM   836  O  OG    . SER C 3 6   ? 78.661 1.932   10.640 1.00 33.04 ? 28  SER A OG    1 
ATOM   837  N  N     . PRO C 3 7   ? 79.216 0.833   13.307 1.00 27.24 ? 29  PRO A N     1 
ATOM   838  C  CA    . PRO C 3 7   ? 78.508 -0.187  14.079 1.00 25.56 ? 29  PRO A CA    1 
ATOM   839  C  C     . PRO C 3 7   ? 77.394 -0.792  13.221 1.00 24.33 ? 29  PRO A C     1 
ATOM   840  O  O     . PRO C 3 7   ? 76.799 -1.803  13.590 1.00 27.49 ? 29  PRO A O     1 
ATOM   841  C  CB    . PRO C 3 7   ? 77.966 0.601   15.269 1.00 25.45 ? 29  PRO A CB    1 
ATOM   842  C  CG    . PRO C 3 7   ? 77.686 1.940   14.666 1.00 26.93 ? 29  PRO A CG    1 
ATOM   843  C  CD    . PRO C 3 7   ? 78.926 2.180   13.829 1.00 27.93 ? 29  PRO A CD    1 
ATOM   844  N  N     . PHE C 3 8   ? 77.127 -0.173  12.071 1.00 24.26 ? 30  PHE A N     1 
ATOM   845  C  CA    . PHE C 3 8   ? 76.069 -0.637  11.171 1.00 24.58 ? 30  PHE A CA    1 
ATOM   846  C  C     . PHE C 3 8   ? 76.485 -1.722  10.188 1.00 26.92 ? 30  PHE A C     1 
ATOM   847  O  O     . PHE C 3 8   ? 77.619 -1.747  9.708  1.00 25.03 ? 30  PHE A O     1 
ATOM   848  C  CB    . PHE C 3 8   ? 75.476 0.541   10.398 1.00 24.82 ? 30  PHE A CB    1 
ATOM   849  C  CG    . PHE C 3 8   ? 74.839 1.572   11.278 1.00 26.18 ? 30  PHE A CG    1 
ATOM   850  C  CD1   . PHE C 3 8   ? 75.444 2.803   11.475 1.00 24.22 ? 30  PHE A CD1   1 
ATOM   851  C  CD2   . PHE C 3 8   ? 73.646 1.294   11.942 1.00 23.33 ? 30  PHE A CD2   1 
ATOM   852  C  CE1   . PHE C 3 8   ? 74.874 3.747   12.323 1.00 24.65 ? 30  PHE A CE1   1 
ATOM   853  C  CE2   . PHE C 3 8   ? 73.069 2.228   12.791 1.00 25.10 ? 30  PHE A CE2   1 
ATOM   854  C  CZ    . PHE C 3 8   ? 73.684 3.457   12.982 1.00 24.46 ? 30  PHE A CZ    1 
ATOM   855  N  N     . LYS C 3 9   ? 75.543 -2.608  9.878  1.00 26.37 ? 31  LYS A N     1 
ATOM   856  C  CA    . LYS C 3 9   ? 75.795 -3.717  8.968  1.00 29.11 ? 31  LYS A CA    1 
ATOM   857  C  C     . LYS C 3 9   ? 75.127 -3.518  7.609  1.00 30.39 ? 31  LYS A C     1 
ATOM   858  O  O     . LYS C 3 9   ? 75.283 -4.340  6.707  1.00 31.56 ? 31  LYS A O     1 
ATOM   859  C  CB    . LYS C 3 9   ? 75.314 -5.022  9.608  1.00 29.36 ? 31  LYS A CB    1 
ATOM   860  C  CG    . LYS C 3 9   ? 75.967 -5.306  10.955 1.00 30.26 ? 31  LYS A CG    1 
ATOM   861  C  CD    . LYS C 3 9   ? 75.381 -6.538  11.631 1.00 32.38 ? 31  LYS A CD    1 
ATOM   862  C  CE    . LYS C 3 9   ? 75.745 -7.812  10.883 1.00 36.97 ? 31  LYS A CE    1 
ATOM   863  N  NZ    . LYS C 3 9   ? 75.196 -9.021  11.557 1.00 39.12 ? 31  LYS A NZ    1 
ATOM   864  N  N     . LEU C 3 10  ? 74.372 -2.431  7.479  1.00 29.36 ? 32  LEU A N     1 
ATOM   865  C  CA    . LEU C 3 10  ? 73.692 -2.088  6.232  1.00 29.27 ? 32  LEU A CA    1 
ATOM   866  C  C     . LEU C 3 10  ? 74.090 -0.657  5.874  1.00 28.50 ? 32  LEU A C     1 
ATOM   867  O  O     . LEU C 3 10  ? 74.286 0.178   6.756  1.00 28.76 ? 32  LEU A O     1 
ATOM   868  C  CB    . LEU C 3 10  ? 72.168 -2.154  6.396  1.00 29.95 ? 32  LEU A CB    1 
ATOM   869  C  CG    . LEU C 3 10  ? 71.528 -3.510  6.699  1.00 33.45 ? 32  LEU A CG    1 
ATOM   870  C  CD1   . LEU C 3 10  ? 70.032 -3.325  6.874  1.00 33.92 ? 32  LEU A CD1   1 
ATOM   871  C  CD2   . LEU C 3 10  ? 71.818 -4.489  5.567  1.00 35.43 ? 32  LEU A CD2   1 
ATOM   872  N  N     . PRO C 3 11  ? 74.211 -0.355  4.577  1.00 28.60 ? 33  PRO A N     1 
ATOM   873  C  CA    . PRO C 3 11  ? 74.590 0.998   4.170  1.00 27.49 ? 33  PRO A CA    1 
ATOM   874  C  C     . PRO C 3 11  ? 73.442 1.990   4.316  1.00 27.99 ? 33  PRO A C     1 
ATOM   875  O  O     . PRO C 3 11  ? 72.277 1.599   4.445  1.00 24.79 ? 33  PRO A O     1 
ATOM   876  C  CB    . PRO C 3 11  ? 75.017 0.806   2.719  1.00 30.05 ? 33  PRO A CB    1 
ATOM   877  C  CG    . PRO C 3 11  ? 74.091 -0.270  2.252  1.00 30.11 ? 33  PRO A CG    1 
ATOM   878  C  CD    . PRO C 3 11  ? 74.105 -1.247  3.408  1.00 30.41 ? 33  PRO A CD    1 
ATOM   879  N  N     . ASP C 3 12  ? 73.782 3.276   4.297  1.00 25.98 ? 34  ASP A N     1 
ATOM   880  C  CA    . ASP C 3 12  ? 72.798 4.337   4.416  1.00 24.33 ? 34  ASP A CA    1 
ATOM   881  C  C     . ASP C 3 12  ? 71.867 4.357   3.211  1.00 26.19 ? 34  ASP A C     1 
ATOM   882  O  O     . ASP C 3 12  ? 72.275 4.028   2.093  1.00 23.57 ? 34  ASP A O     1 
ATOM   883  C  CB    . ASP C 3 12  ? 73.499 5.689   4.546  1.00 25.94 ? 34  ASP A CB    1 
ATOM   884  C  CG    . ASP C 3 12  ? 72.520 6.826   4.725  1.00 27.67 ? 34  ASP A CG    1 
ATOM   885  O  OD1   . ASP C 3 12  ? 72.263 7.562   3.753  1.00 27.23 ? 34  ASP A OD1   1 
ATOM   886  O  OD2   . ASP C 3 12  ? 71.993 6.969   5.843  1.00 27.20 ? 34  ASP A OD2   1 
ATOM   887  N  N     . GLU C 3 13  ? 70.619 4.759   3.435  1.00 22.89 ? 35  GLU A N     1 
ATOM   888  C  CA    . GLU C 3 13  ? 69.636 4.799   2.359  1.00 25.11 ? 35  GLU A CA    1 
ATOM   889  C  C     . GLU C 3 13  ? 68.919 6.147   2.271  1.00 26.80 ? 35  GLU A C     1 
ATOM   890  O  O     . GLU C 3 13  ? 67.743 6.211   1.900  1.00 26.48 ? 35  GLU A O     1 
ATOM   891  C  CB    . GLU C 3 13  ? 68.616 3.662   2.555  1.00 27.94 ? 35  GLU A CB    1 
ATOM   892  C  CG    . GLU C 3 13  ? 69.246 2.258   2.505  1.00 27.65 ? 35  GLU A CG    1 
ATOM   893  C  CD    . GLU C 3 13  ? 68.302 1.132   2.940  1.00 32.69 ? 35  GLU A CD    1 
ATOM   894  O  OE1   . GLU C 3 13  ? 68.661 -0.052  2.749  1.00 36.26 ? 35  GLU A OE1   1 
ATOM   895  O  OE2   . GLU C 3 13  ? 67.215 1.409   3.485  1.00 26.26 ? 35  GLU A OE2   1 
ATOM   896  N  N     . SER C 3 14  ? 69.632 7.224   2.599  1.00 25.82 ? 36  SER A N     1 
ATOM   897  C  CA    . SER C 3 14  ? 69.048 8.564   2.554  1.00 28.33 ? 36  SER A CA    1 
ATOM   898  C  C     . SER C 3 14  ? 68.533 8.898   1.162  1.00 27.94 ? 36  SER A C     1 
ATOM   899  O  O     . SER C 3 14  ? 69.247 8.748   0.175  1.00 28.23 ? 36  SER A O     1 
ATOM   900  C  CB    . SER C 3 14  ? 70.080 9.631   2.951  1.00 28.05 ? 36  SER A CB    1 
ATOM   901  O  OG    . SER C 3 14  ? 70.464 9.514   4.306  1.00 30.84 ? 36  SER A OG    1 
ATOM   902  N  N     . PRO C 3 15  ? 67.276 9.351   1.064  1.00 26.44 ? 37  PRO A N     1 
ATOM   903  C  CA    . PRO C 3 15  ? 66.730 9.697   -0.250 1.00 27.60 ? 37  PRO A CA    1 
ATOM   904  C  C     . PRO C 3 15  ? 67.287 11.039  -0.708 1.00 28.68 ? 37  PRO A C     1 
ATOM   905  O  O     . PRO C 3 15  ? 67.611 11.895  0.116  1.00 28.00 ? 37  PRO A O     1 
ATOM   906  C  CB    . PRO C 3 15  ? 65.230 9.770   0.010  1.00 28.64 ? 37  PRO A CB    1 
ATOM   907  C  CG    . PRO C 3 15  ? 65.171 10.290  1.411  1.00 28.89 ? 37  PRO A CG    1 
ATOM   908  C  CD    . PRO C 3 15  ? 66.243 9.466   2.109  1.00 27.16 ? 37  PRO A CD    1 
ATOM   909  N  N     . SER C 3 16  ? 67.411 11.217  -2.017 1.00 28.81 ? 38  SER A N     1 
ATOM   910  C  CA    . SER C 3 16  ? 67.899 12.478  -2.548 1.00 31.67 ? 38  SER A CA    1 
ATOM   911  C  C     . SER C 3 16  ? 66.784 13.494  -2.313 1.00 33.20 ? 38  SER A C     1 
ATOM   912  O  O     . SER C 3 16  ? 65.641 13.121  -2.031 1.00 30.42 ? 38  SER A O     1 
ATOM   913  C  CB    . SER C 3 16  ? 68.167 12.358  -4.047 1.00 30.58 ? 38  SER A CB    1 
ATOM   914  O  OG    . SER C 3 16  ? 66.955 12.122  -4.744 1.00 33.25 ? 38  SER A OG    1 
ATOM   915  N  N     . TRP C 3 17  ? 67.110 14.774  -2.430 1.00 34.88 ? 39  TRP A N     1 
ATOM   916  C  CA    . TRP C 3 17  ? 66.109 15.811  -2.236 1.00 36.10 ? 39  TRP A CA    1 
ATOM   917  C  C     . TRP C 3 17  ? 64.965 15.583  -3.223 1.00 35.47 ? 39  TRP A C     1 
ATOM   918  O  O     . TRP C 3 17  ? 63.793 15.755  -2.886 1.00 35.34 ? 39  TRP A O     1 
ATOM   919  C  CB    . TRP C 3 17  ? 66.743 17.190  -2.449 1.00 39.04 ? 39  TRP A CB    1 
ATOM   920  C  CG    . TRP C 3 17  ? 65.826 18.341  -2.154 1.00 43.59 ? 39  TRP A CG    1 
ATOM   921  C  CD1   . TRP C 3 17  ? 64.683 18.313  -1.405 1.00 43.51 ? 39  TRP A CD1   1 
ATOM   922  C  CD2   . TRP C 3 17  ? 65.997 19.700  -2.575 1.00 44.78 ? 39  TRP A CD2   1 
ATOM   923  N  NE1   . TRP C 3 17  ? 64.132 19.571  -1.334 1.00 44.75 ? 39  TRP A NE1   1 
ATOM   924  C  CE2   . TRP C 3 17  ? 64.918 20.441  -2.043 1.00 45.76 ? 39  TRP A CE2   1 
ATOM   925  C  CE3   . TRP C 3 17  ? 66.959 20.364  -3.349 1.00 46.21 ? 39  TRP A CE3   1 
ATOM   926  C  CZ2   . TRP C 3 17  ? 64.773 21.816  -2.261 1.00 46.97 ? 39  TRP A CZ2   1 
ATOM   927  C  CZ3   . TRP C 3 17  ? 66.814 21.734  -3.566 1.00 47.05 ? 39  TRP A CZ3   1 
ATOM   928  C  CH2   . TRP C 3 17  ? 65.728 22.442  -3.023 1.00 47.52 ? 39  TRP A CH2   1 
ATOM   929  N  N     . THR C 3 18  ? 65.308 15.165  -4.437 1.00 36.28 ? 40  THR A N     1 
ATOM   930  C  CA    . THR C 3 18  ? 64.301 14.915  -5.460 1.00 35.18 ? 40  THR A CA    1 
ATOM   931  C  C     . THR C 3 18  ? 63.374 13.759  -5.097 1.00 34.43 ? 40  THR A C     1 
ATOM   932  O  O     . THR C 3 18  ? 62.154 13.878  -5.220 1.00 34.03 ? 40  THR A O     1 
ATOM   933  C  CB    . THR C 3 18  ? 64.951 14.617  -6.827 1.00 38.06 ? 40  THR A CB    1 
ATOM   934  O  OG1   . THR C 3 18  ? 65.694 15.764  -7.263 1.00 39.30 ? 40  THR A OG1   1 
ATOM   935  C  CG2   . THR C 3 18  ? 63.884 14.289  -7.861 1.00 37.22 ? 40  THR A CG2   1 
ATOM   936  N  N     . GLU C 3 19  ? 63.941 12.638  -4.655 1.00 32.88 ? 41  GLU A N     1 
ATOM   937  C  CA    . GLU C 3 19  ? 63.109 11.494  -4.290 1.00 31.28 ? 41  GLU A CA    1 
ATOM   938  C  C     . GLU C 3 19  ? 62.181 11.879  -3.141 1.00 31.52 ? 41  GLU A C     1 
ATOM   939  O  O     . GLU C 3 19  ? 60.993 11.556  -3.153 1.00 33.07 ? 41  GLU A O     1 
ATOM   940  C  CB    . GLU C 3 19  ? 63.963 10.288  -3.870 1.00 29.72 ? 41  GLU A CB    1 
ATOM   941  C  CG    . GLU C 3 19  ? 63.148 9.000   -3.793 1.00 28.77 ? 41  GLU A CG    1 
ATOM   942  C  CD    . GLU C 3 19  ? 63.857 7.852   -3.081 1.00 28.66 ? 41  GLU A CD    1 
ATOM   943  O  OE1   . GLU C 3 19  ? 65.086 7.928   -2.864 1.00 27.98 ? 41  GLU A OE1   1 
ATOM   944  O  OE2   . GLU C 3 19  ? 63.170 6.862   -2.747 1.00 29.65 ? 41  GLU A OE2   1 
ATOM   945  N  N     . TRP C 3 20  ? 62.733 12.569  -2.148 1.00 32.77 ? 42  TRP A N     1 
ATOM   946  C  CA    . TRP C 3 20  ? 61.959 13.006  -0.991 1.00 35.06 ? 42  TRP A CA    1 
ATOM   947  C  C     . TRP C 3 20  ? 60.773 13.862  -1.435 1.00 35.43 ? 42  TRP A C     1 
ATOM   948  O  O     . TRP C 3 20  ? 59.649 13.663  -0.973 1.00 36.14 ? 42  TRP A O     1 
ATOM   949  C  CB    . TRP C 3 20  ? 62.844 13.811  -0.038 1.00 37.68 ? 42  TRP A CB    1 
ATOM   950  C  CG    . TRP C 3 20  ? 62.107 14.350  1.148  1.00 41.66 ? 42  TRP A CG    1 
ATOM   951  C  CD1   . TRP C 3 20  ? 61.763 13.672  2.283  1.00 42.24 ? 42  TRP A CD1   1 
ATOM   952  C  CD2   . TRP C 3 20  ? 61.598 15.680  1.304  1.00 43.36 ? 42  TRP A CD2   1 
ATOM   953  N  NE1   . TRP C 3 20  ? 61.070 14.499  3.139  1.00 43.83 ? 42  TRP A NE1   1 
ATOM   954  C  CE2   . TRP C 3 20  ? 60.954 15.736  2.562  1.00 45.15 ? 42  TRP A CE2   1 
ATOM   955  C  CE3   . TRP C 3 20  ? 61.622 16.829  0.502  1.00 43.71 ? 42  TRP A CE3   1 
ATOM   956  C  CZ2   . TRP C 3 20  ? 60.340 16.901  3.038  1.00 45.82 ? 42  TRP A CZ2   1 
ATOM   957  C  CZ3   . TRP C 3 20  ? 61.010 17.988  0.976  1.00 45.48 ? 42  TRP A CZ3   1 
ATOM   958  C  CH2   . TRP C 3 20  ? 60.378 18.013  2.233  1.00 45.86 ? 42  TRP A CH2   1 
ATOM   959  N  N     . ARG C 3 21  ? 61.032 14.814  -2.328 1.00 36.48 ? 43  ARG A N     1 
ATOM   960  C  CA    . ARG C 3 21  ? 59.979 15.689  -2.838 1.00 39.49 ? 43  ARG A CA    1 
ATOM   961  C  C     . ARG C 3 21  ? 58.910 14.893  -3.571 1.00 39.81 ? 43  ARG A C     1 
ATOM   962  O  O     . ARG C 3 21  ? 57.716 15.145  -3.408 1.00 40.39 ? 43  ARG A O     1 
ATOM   963  C  CB    . ARG C 3 21  ? 60.567 16.744  -3.779 1.00 42.57 ? 43  ARG A CB    1 
ATOM   964  C  CG    . ARG C 3 21  ? 61.276 17.881  -3.062 1.00 48.02 ? 43  ARG A CG    1 
ATOM   965  C  CD    . ARG C 3 21  ? 61.835 18.916  -4.035 1.00 52.84 ? 43  ARG A CD    1 
ATOM   966  N  NE    . ARG C 3 21  ? 63.011 18.431  -4.755 1.00 57.04 ? 43  ARG A NE    1 
ATOM   967  C  CZ    . ARG C 3 21  ? 63.726 19.169  -5.599 1.00 60.15 ? 43  ARG A CZ    1 
ATOM   968  N  NH1   . ARG C 3 21  ? 63.386 20.430  -5.835 1.00 61.82 ? 43  ARG A NH1   1 
ATOM   969  N  NH2   . ARG C 3 21  ? 64.786 18.650  -6.204 1.00 61.40 ? 43  ARG A NH2   1 
ATOM   970  N  N     . LEU C 3 22  ? 59.341 13.930  -4.382 1.00 38.61 ? 44  LEU A N     1 
ATOM   971  C  CA    . LEU C 3 22  ? 58.409 13.101  -5.133 1.00 37.44 ? 44  LEU A CA    1 
ATOM   972  C  C     . LEU C 3 22  ? 57.524 12.309  -4.187 1.00 37.95 ? 44  LEU A C     1 
ATOM   973  O  O     . LEU C 3 22  ? 56.329 12.149  -4.433 1.00 37.82 ? 44  LEU A O     1 
ATOM   974  C  CB    . LEU C 3 22  ? 59.162 12.138  -6.057 1.00 37.55 ? 44  LEU A CB    1 
ATOM   975  C  CG    . LEU C 3 22  ? 59.954 12.774  -7.200 1.00 39.03 ? 44  LEU A CG    1 
ATOM   976  C  CD1   . LEU C 3 22  ? 60.655 11.688  -8.012 1.00 37.96 ? 44  LEU A CD1   1 
ATOM   977  C  CD2   . LEU C 3 22  ? 59.008 13.579  -8.082 1.00 40.84 ? 44  LEU A CD2   1 
ATOM   978  N  N     . HIS C 3 23  ? 58.116 11.807  -3.106 1.00 37.81 ? 45  HIS A N     1 
ATOM   979  C  CA    . HIS C 3 23  ? 57.368 11.037  -2.122 1.00 38.56 ? 45  HIS A CA    1 
ATOM   980  C  C     . HIS C 3 23  ? 56.342 11.934  -1.439 1.00 40.34 ? 45  HIS A C     1 
ATOM   981  O  O     . HIS C 3 23  ? 55.215 11.518  -1.186 1.00 39.12 ? 45  HIS A O     1 
ATOM   982  C  CB    . HIS C 3 23  ? 58.303 10.452  -1.063 1.00 36.29 ? 45  HIS A CB    1 
ATOM   983  C  CG    . HIS C 3 23  ? 57.590 9.689   0.010  1.00 35.83 ? 45  HIS A CG    1 
ATOM   984  N  ND1   . HIS C 3 23  ? 56.869 8.542   -0.246 1.00 37.28 ? 45  HIS A ND1   1 
ATOM   985  C  CD2   . HIS C 3 23  ? 57.469 9.919   1.339  1.00 34.87 ? 45  HIS A CD2   1 
ATOM   986  C  CE1   . HIS C 3 23  ? 56.335 8.099   0.878  1.00 35.60 ? 45  HIS A CE1   1 
ATOM   987  N  NE2   . HIS C 3 23  ? 56.685 8.916   1.855  1.00 36.28 ? 45  HIS A NE2   1 
ATOM   988  N  N     . ASN C 3 24  ? 56.743 13.164  -1.140 1.00 43.37 ? 46  ASN A N     1 
ATOM   989  C  CA    . ASN C 3 24  ? 55.853 14.117  -0.487 1.00 49.87 ? 46  ASN A CA    1 
ATOM   990  C  C     . ASN C 3 24  ? 54.595 14.383  -1.298 1.00 52.06 ? 46  ASN A C     1 
ATOM   991  O  O     . ASN C 3 24  ? 53.495 14.428  -0.750 1.00 53.50 ? 46  ASN A O     1 
ATOM   992  C  CB    . ASN C 3 24  ? 56.579 15.438  -0.244 1.00 52.09 ? 46  ASN A CB    1 
ATOM   993  C  CG    . ASN C 3 24  ? 57.591 15.345  0.872  1.00 55.66 ? 46  ASN A CG    1 
ATOM   994  O  OD1   . ASN C 3 24  ? 58.328 16.293  1.131  1.00 60.36 ? 46  ASN A OD1   1 
ATOM   995  N  ND2   . ASN C 3 24  ? 57.630 14.202  1.547  1.00 57.92 ? 46  ASN A ND2   1 
ATOM   996  N  N     . ASP C 3 25  ? 54.761 14.558  -2.605 1.00 55.00 ? 47  ASP A N     1 
ATOM   997  C  CA    . ASP C 3 25  ? 53.633 14.831  -3.485 1.00 57.77 ? 47  ASP A CA    1 
ATOM   998  C  C     . ASP C 3 25  ? 52.761 13.598  -3.694 1.00 59.89 ? 47  ASP A C     1 
ATOM   999  O  O     . ASP C 3 25  ? 51.663 13.692  -4.243 1.00 61.12 ? 47  ASP A O     1 
ATOM   1000 C  CB    . ASP C 3 25  ? 54.132 15.332  -4.842 1.00 58.39 ? 47  ASP A CB    1 
ATOM   1001 C  CG    . ASP C 3 25  ? 55.172 16.428  -4.712 1.00 60.10 ? 47  ASP A CG    1 
ATOM   1002 O  OD1   . ASP C 3 25  ? 54.985 17.334  -3.873 1.00 60.25 ? 47  ASP A OD1   1 
ATOM   1003 O  OD2   . ASP C 3 25  ? 56.173 16.389  -5.459 1.00 62.29 ? 47  ASP A OD2   1 
ATOM   1004 N  N     . GLU C 3 26  ? 53.252 12.445  -3.252 1.00 61.11 ? 48  GLU A N     1 
ATOM   1005 C  CA    . GLU C 3 26  ? 52.521 11.190  -3.402 1.00 63.62 ? 48  GLU A CA    1 
ATOM   1006 C  C     . GLU C 3 26  ? 51.691 10.842  -2.171 1.00 64.94 ? 48  GLU A C     1 
ATOM   1007 O  O     . GLU C 3 26  ? 50.729 10.080  -2.262 1.00 66.32 ? 48  GLU A O     1 
ATOM   1008 C  CB    . GLU C 3 26  ? 53.497 10.046  -3.688 1.00 64.09 ? 48  GLU A CB    1 
ATOM   1009 C  CG    . GLU C 3 26  ? 54.282 10.195  -4.976 1.00 64.69 ? 48  GLU A CG    1 
ATOM   1010 C  CD    . GLU C 3 26  ? 55.357 9.137   -5.117 1.00 64.41 ? 48  GLU A CD    1 
ATOM   1011 O  OE1   . GLU C 3 26  ? 55.017 7.939   -5.105 1.00 65.37 ? 48  GLU A OE1   1 
ATOM   1012 O  OE2   . GLU C 3 26  ? 56.543 9.502   -5.236 1.00 65.11 ? 48  GLU A OE2   1 
ATOM   1013 N  N     . THR C 3 27  ? 52.067 11.391  -1.021 1.00 66.90 ? 49  THR A N     1 
ATOM   1014 C  CA    . THR C 3 27  ? 51.346 11.122  0.220  1.00 67.86 ? 49  THR A CA    1 
ATOM   1015 C  C     . THR C 3 27  ? 50.600 12.357  0.713  1.00 68.11 ? 49  THR A C     1 
ATOM   1016 O  O     . THR C 3 27  ? 51.144 13.461  0.719  1.00 68.99 ? 49  THR A O     1 
ATOM   1017 C  CB    . THR C 3 27  ? 52.307 10.654  1.330  1.00 68.46 ? 49  THR A CB    1 
ATOM   1018 O  OG1   . THR C 3 27  ? 53.241 11.699  1.630  1.00 69.00 ? 49  THR A OG1   1 
ATOM   1019 C  CG2   . THR C 3 27  ? 53.067 9.412   0.885  1.00 67.26 ? 49  THR A CG2   1 
ATOM   1020 N  N     . GLN C 3 31  ? 54.160 13.910  8.079  1.00 63.89 ? 53  GLN A N     1 
ATOM   1021 C  CA    . GLN C 3 31  ? 53.463 12.698  7.665  1.00 62.80 ? 53  GLN A CA    1 
ATOM   1022 C  C     . GLN C 3 31  ? 53.797 11.495  8.540  1.00 61.88 ? 53  GLN A C     1 
ATOM   1023 O  O     . GLN C 3 31  ? 54.860 11.434  9.166  1.00 61.33 ? 53  GLN A O     1 
ATOM   1024 C  CB    . GLN C 3 31  ? 53.788 12.375  6.203  1.00 64.02 ? 53  GLN A CB    1 
ATOM   1025 C  CG    . GLN C 3 31  ? 52.821 12.994  5.205  1.00 65.63 ? 53  GLN A CG    1 
ATOM   1026 C  CD    . GLN C 3 31  ? 51.495 12.256  5.150  1.00 67.05 ? 53  GLN A CD    1 
ATOM   1027 O  OE1   . GLN C 3 31  ? 50.893 11.959  6.183  1.00 68.29 ? 53  GLN A OE1   1 
ATOM   1028 N  NE2   . GLN C 3 31  ? 51.032 11.961  3.941  1.00 66.70 ? 53  GLN A NE2   1 
ATOM   1029 N  N     . ASP C 3 32  ? 52.872 10.541  8.579  1.00 59.38 ? 54  ASP A N     1 
ATOM   1030 C  CA    . ASP C 3 32  ? 53.047 9.325   9.356  1.00 55.94 ? 54  ASP A CA    1 
ATOM   1031 C  C     . ASP C 3 32  ? 53.417 8.202   8.398  1.00 54.73 ? 54  ASP A C     1 
ATOM   1032 O  O     . ASP C 3 32  ? 53.415 7.028   8.765  1.00 53.77 ? 54  ASP A O     1 
ATOM   1033 C  CB    . ASP C 3 32  ? 51.753 8.977   10.096 1.00 57.13 ? 54  ASP A CB    1 
ATOM   1034 N  N     . ASN C 3 33  ? 53.729 8.577   7.161  1.00 51.97 ? 55  ASN A N     1 
ATOM   1035 C  CA    . ASN C 3 33  ? 54.110 7.612   6.137  1.00 49.57 ? 55  ASN A CA    1 
ATOM   1036 C  C     . ASN C 3 33  ? 55.384 8.066   5.424  1.00 44.44 ? 55  ASN A C     1 
ATOM   1037 O  O     . ASN C 3 33  ? 55.388 8.280   4.212  1.00 44.00 ? 55  ASN A O     1 
ATOM   1038 C  CB    . ASN C 3 33  ? 52.979 7.452   5.117  1.00 52.20 ? 55  ASN A CB    1 
ATOM   1039 C  CG    . ASN C 3 33  ? 53.263 6.365   4.097  1.00 57.12 ? 55  ASN A CG    1 
ATOM   1040 O  OD1   . ASN C 3 33  ? 52.571 6.253   3.083  1.00 59.40 ? 55  ASN A OD1   1 
ATOM   1041 N  ND2   . ASN C 3 33  ? 54.282 5.551   4.364  1.00 59.14 ? 55  ASN A ND2   1 
ATOM   1042 N  N     . PRO C 3 34  ? 56.484 8.229   6.174  1.00 39.73 ? 56  PRO A N     1 
ATOM   1043 C  CA    . PRO C 3 34  ? 57.747 8.658   5.571  1.00 36.48 ? 56  PRO A CA    1 
ATOM   1044 C  C     . PRO C 3 34  ? 58.395 7.487   4.835  1.00 32.38 ? 56  PRO A C     1 
ATOM   1045 O  O     . PRO C 3 34  ? 57.923 6.353   4.930  1.00 30.70 ? 56  PRO A O     1 
ATOM   1046 C  CB    . PRO C 3 34  ? 58.560 9.109   6.777  1.00 37.71 ? 56  PRO A CB    1 
ATOM   1047 C  CG    . PRO C 3 34  ? 58.145 8.116   7.819  1.00 39.14 ? 56  PRO A CG    1 
ATOM   1048 C  CD    . PRO C 3 34  ? 56.635 8.038   7.629  1.00 39.41 ? 56  PRO A CD    1 
ATOM   1049 N  N     . LEU C 3 35  ? 59.470 7.763   4.105  1.00 30.63 ? 57  LEU A N     1 
ATOM   1050 C  CA    . LEU C 3 35  ? 60.167 6.715   3.363  1.00 30.58 ? 57  LEU A CA    1 
ATOM   1051 C  C     . LEU C 3 35  ? 60.839 5.741   4.320  1.00 28.49 ? 57  LEU A C     1 
ATOM   1052 O  O     . LEU C 3 35  ? 60.984 4.558   4.017  1.00 27.60 ? 57  LEU A O     1 
ATOM   1053 C  CB    . LEU C 3 35  ? 61.209 7.334   2.426  1.00 29.85 ? 57  LEU A CB    1 
ATOM   1054 C  CG    . LEU C 3 35  ? 60.636 8.058   1.203  1.00 31.73 ? 57  LEU A CG    1 
ATOM   1055 C  CD1   . LEU C 3 35  ? 61.703 8.918   0.557  1.00 32.20 ? 57  LEU A CD1   1 
ATOM   1056 C  CD2   . LEU C 3 35  ? 60.089 7.036   0.215  1.00 30.96 ? 57  LEU A CD2   1 
ATOM   1057 N  N     . GLY C 3 36  ? 61.244 6.243   5.481  1.00 28.48 ? 58  GLY A N     1 
ATOM   1058 C  CA    . GLY C 3 36  ? 61.893 5.390   6.462  1.00 26.42 ? 58  GLY A CA    1 
ATOM   1059 C  C     . GLY C 3 36  ? 62.116 6.098   7.781  1.00 29.36 ? 58  GLY A C     1 
ATOM   1060 O  O     . GLY C 3 36  ? 61.389 7.033   8.128  1.00 28.83 ? 58  GLY A O     1 
ATOM   1061 N  N     . PHE C 3 37  ? 63.129 5.654   8.517  1.00 27.41 ? 59  PHE A N     1 
ATOM   1062 C  CA    . PHE C 3 37  ? 63.447 6.243   9.810  1.00 26.39 ? 59  PHE A CA    1 
ATOM   1063 C  C     . PHE C 3 37  ? 64.937 6.536   9.895  1.00 27.42 ? 59  PHE A C     1 
ATOM   1064 O  O     . PHE C 3 37  ? 65.723 6.057   9.073  1.00 25.90 ? 59  PHE A O     1 
ATOM   1065 C  CB    . PHE C 3 37  ? 63.039 5.284   10.937 1.00 26.45 ? 59  PHE A CB    1 
ATOM   1066 C  CG    . PHE C 3 37  ? 63.865 4.025   10.998 1.00 25.70 ? 59  PHE A CG    1 
ATOM   1067 C  CD1   . PHE C 3 37  ? 64.991 3.955   11.813 1.00 25.88 ? 59  PHE A CD1   1 
ATOM   1068 C  CD2   . PHE C 3 37  ? 63.528 2.917   10.226 1.00 26.19 ? 59  PHE A CD2   1 
ATOM   1069 C  CE1   . PHE C 3 37  ? 65.772 2.798   11.860 1.00 26.51 ? 59  PHE A CE1   1 
ATOM   1070 C  CE2   . PHE C 3 37  ? 64.304 1.753   10.265 1.00 25.50 ? 59  PHE A CE2   1 
ATOM   1071 C  CZ    . PHE C 3 37  ? 65.424 1.694   11.082 1.00 26.02 ? 59  PHE A CZ    1 
ATOM   1072 N  N     . LYS C 3 38  ? 65.317 7.328   10.889 1.00 26.24 ? 60  LYS A N     1 
ATOM   1073 C  CA    . LYS C 3 38  ? 66.711 7.689   11.102 1.00 28.01 ? 60  LYS A CA    1 
ATOM   1074 C  C     . LYS C 3 38  ? 67.163 7.147   12.446 1.00 27.19 ? 60  LYS A C     1 
ATOM   1075 O  O     . LYS C 3 38  ? 66.438 7.246   13.437 1.00 25.90 ? 60  LYS A O     1 
ATOM   1076 C  CB    . LYS C 3 38  ? 66.872 9.209   11.102 1.00 31.90 ? 60  LYS A CB    1 
ATOM   1077 C  CG    . LYS C 3 38  ? 66.584 9.871   9.769  1.00 41.05 ? 60  LYS A CG    1 
ATOM   1078 C  CD    . LYS C 3 38  ? 66.312 11.365  9.922  1.00 46.20 ? 60  LYS A CD    1 
ATOM   1079 C  CE    . LYS C 3 38  ? 67.447 12.086  10.632 1.00 49.94 ? 60  LYS A CE    1 
ATOM   1080 N  NZ    . LYS C 3 38  ? 67.129 13.531  10.838 1.00 54.24 ? 60  LYS A NZ    1 
ATOM   1081 N  N     . GLU C 3 39  ? 68.359 6.571   12.481 1.00 23.72 ? 61  GLU A N     1 
ATOM   1082 C  CA    . GLU C 3 39  ? 68.899 6.047   13.722 1.00 21.77 ? 61  GLU A CA    1 
ATOM   1083 C  C     . GLU C 3 39  ? 70.374 6.410   13.736 1.00 24.23 ? 61  GLU A C     1 
ATOM   1084 O  O     . GLU C 3 39  ? 70.976 6.621   12.683 1.00 21.91 ? 61  GLU A O     1 
ATOM   1085 C  CB    . GLU C 3 39  ? 68.719 4.522   13.802 1.00 24.56 ? 61  GLU A CB    1 
ATOM   1086 C  CG    . GLU C 3 39  ? 69.625 3.721   12.875 1.00 24.05 ? 61  GLU A CG    1 
ATOM   1087 C  CD    . GLU C 3 39  ? 69.400 2.216   12.973 1.00 27.12 ? 61  GLU A CD    1 
ATOM   1088 O  OE1   . GLU C 3 39  ? 68.862 1.742   13.998 1.00 26.43 ? 61  GLU A OE1   1 
ATOM   1089 O  OE2   . GLU C 3 39  ? 69.779 1.500   12.024 1.00 27.49 ? 61  GLU A OE2   1 
ATOM   1090 N  N     . SER C 3 40  ? 70.953 6.498   14.926 1.00 22.16 ? 62  SER A N     1 
ATOM   1091 C  CA    . SER C 3 40  ? 72.364 6.835   15.037 1.00 23.09 ? 62  SER A CA    1 
ATOM   1092 C  C     . SER C 3 40  ? 72.983 6.215   16.277 1.00 23.22 ? 62  SER A C     1 
ATOM   1093 O  O     . SER C 3 40  ? 72.288 5.900   17.247 1.00 22.35 ? 62  SER A O     1 
ATOM   1094 C  CB    . SER C 3 40  ? 72.542 8.355   15.089 1.00 24.95 ? 62  SER A CB    1 
ATOM   1095 O  OG    . SER C 3 40  ? 71.978 8.877   16.276 1.00 28.64 ? 62  SER A OG    1 
ATOM   1096 N  N     . TRP C 3 41  ? 74.298 6.033   16.222 1.00 22.78 ? 63  TRP A N     1 
ATOM   1097 C  CA    . TRP C 3 41  ? 75.072 5.481   17.324 1.00 23.33 ? 63  TRP A CA    1 
ATOM   1098 C  C     . TRP C 3 41  ? 76.233 6.427   17.568 1.00 24.53 ? 63  TRP A C     1 
ATOM   1099 O  O     . TRP C 3 41  ? 76.998 6.717   16.649 1.00 24.89 ? 63  TRP A O     1 
ATOM   1100 C  CB    . TRP C 3 41  ? 75.637 4.109   16.969 1.00 23.78 ? 63  TRP A CB    1 
ATOM   1101 C  CG    . TRP C 3 41  ? 74.788 2.967   17.404 1.00 24.70 ? 63  TRP A CG    1 
ATOM   1102 C  CD1   . TRP C 3 41  ? 74.072 2.126   16.604 1.00 24.73 ? 63  TRP A CD1   1 
ATOM   1103 C  CD2   . TRP C 3 41  ? 74.565 2.535   18.749 1.00 23.99 ? 63  TRP A CD2   1 
ATOM   1104 N  NE1   . TRP C 3 41  ? 73.415 1.192   17.369 1.00 25.14 ? 63  TRP A NE1   1 
ATOM   1105 C  CE2   . TRP C 3 41  ? 73.700 1.420   18.690 1.00 24.20 ? 63  TRP A CE2   1 
ATOM   1106 C  CE3   . TRP C 3 41  ? 75.012 2.981   20.000 1.00 22.59 ? 63  TRP A CE3   1 
ATOM   1107 C  CZ2   . TRP C 3 41  ? 73.271 0.744   19.836 1.00 24.29 ? 63  TRP A CZ2   1 
ATOM   1108 C  CZ3   . TRP C 3 41  ? 74.585 2.309   21.143 1.00 25.77 ? 63  TRP A CZ3   1 
ATOM   1109 C  CH2   . TRP C 3 41  ? 73.721 1.200   21.051 1.00 24.99 ? 63  TRP A CH2   1 
ATOM   1110 N  N     . GLY C 3 42  ? 76.361 6.907   18.799 1.00 24.84 ? 64  GLY A N     1 
ATOM   1111 C  CA    . GLY C 3 42  ? 77.446 7.814   19.122 1.00 27.20 ? 64  GLY A CA    1 
ATOM   1112 C  C     . GLY C 3 42  ? 78.352 7.245   20.196 1.00 27.10 ? 64  GLY A C     1 
ATOM   1113 O  O     . GLY C 3 42  ? 77.881 6.711   21.200 1.00 26.89 ? 64  GLY A O     1 
ATOM   1114 N  N     . PHE C 3 43  ? 79.658 7.345   19.977 1.00 28.59 ? 65  PHE A N     1 
ATOM   1115 C  CA    . PHE C 3 43  ? 80.639 6.853   20.938 1.00 28.39 ? 65  PHE A CA    1 
ATOM   1116 C  C     . PHE C 3 43  ? 81.609 8.000   21.181 1.00 30.78 ? 65  PHE A C     1 
ATOM   1117 O  O     . PHE C 3 43  ? 82.414 8.328   20.314 1.00 28.96 ? 65  PHE A O     1 
ATOM   1118 C  CB    . PHE C 3 43  ? 81.388 5.651   20.364 1.00 28.48 ? 65  PHE A CB    1 
ATOM   1119 C  CG    . PHE C 3 43  ? 80.486 4.590   19.805 1.00 27.10 ? 65  PHE A CG    1 
ATOM   1120 C  CD1   . PHE C 3 43  ? 80.530 4.265   18.453 1.00 27.48 ? 65  PHE A CD1   1 
ATOM   1121 C  CD2   . PHE C 3 43  ? 79.575 3.931   20.625 1.00 28.47 ? 65  PHE A CD2   1 
ATOM   1122 C  CE1   . PHE C 3 43  ? 79.676 3.296   17.922 1.00 27.77 ? 65  PHE A CE1   1 
ATOM   1123 C  CE2   . PHE C 3 43  ? 78.718 2.963   20.103 1.00 28.13 ? 65  PHE A CE2   1 
ATOM   1124 C  CZ    . PHE C 3 43  ? 78.769 2.646   18.751 1.00 27.35 ? 65  PHE A CZ    1 
ATOM   1125 N  N     . GLY C 3 44  ? 81.526 8.612   22.356 1.00 32.67 ? 66  GLY A N     1 
ATOM   1126 C  CA    . GLY C 3 44  ? 82.400 9.732   22.641 1.00 35.28 ? 66  GLY A CA    1 
ATOM   1127 C  C     . GLY C 3 44  ? 82.021 10.881  21.726 1.00 37.12 ? 66  GLY A C     1 
ATOM   1128 O  O     . GLY C 3 44  ? 80.867 11.309  21.713 1.00 37.71 ? 66  GLY A O     1 
ATOM   1129 N  N     . LYS C 3 45  ? 82.979 11.363  20.939 1.00 36.26 ? 67  LYS A N     1 
ATOM   1130 C  CA    . LYS C 3 45  ? 82.735 12.477  20.029 1.00 39.46 ? 67  LYS A CA    1 
ATOM   1131 C  C     . LYS C 3 45  ? 82.355 12.044  18.617 1.00 37.51 ? 67  LYS A C     1 
ATOM   1132 O  O     . LYS C 3 45  ? 82.114 12.886  17.752 1.00 38.15 ? 67  LYS A O     1 
ATOM   1133 C  CB    . LYS C 3 45  ? 83.978 13.370  19.942 1.00 43.98 ? 67  LYS A CB    1 
ATOM   1134 C  CG    . LYS C 3 45  ? 84.404 13.997  21.255 1.00 49.59 ? 67  LYS A CG    1 
ATOM   1135 C  CD    . LYS C 3 45  ? 85.571 14.952  21.038 1.00 54.70 ? 67  LYS A CD    1 
ATOM   1136 C  CE    . LYS C 3 45  ? 85.988 15.624  22.336 1.00 58.03 ? 67  LYS A CE    1 
ATOM   1137 N  NZ    . LYS C 3 45  ? 87.117 16.575  22.126 1.00 60.47 ? 67  LYS A NZ    1 
ATOM   1138 N  N     . VAL C 3 46  ? 82.299 10.740  18.380 1.00 33.54 ? 68  VAL A N     1 
ATOM   1139 C  CA    . VAL C 3 46  ? 81.973 10.241  17.050 1.00 33.16 ? 68  VAL A CA    1 
ATOM   1140 C  C     . VAL C 3 46  ? 80.553 9.700   16.949 1.00 31.82 ? 68  VAL A C     1 
ATOM   1141 O  O     . VAL C 3 46  ? 80.084 8.988   17.837 1.00 30.66 ? 68  VAL A O     1 
ATOM   1142 C  CB    . VAL C 3 46  ? 82.961 9.136   16.628 1.00 34.40 ? 68  VAL A CB    1 
ATOM   1143 C  CG1   . VAL C 3 46  ? 82.620 8.629   15.241 1.00 36.62 ? 68  VAL A CG1   1 
ATOM   1144 C  CG2   . VAL C 3 46  ? 84.382 9.681   16.659 1.00 38.47 ? 68  VAL A CG2   1 
ATOM   1145 N  N     . VAL C 3 47  ? 79.872 10.045  15.861 1.00 30.08 ? 69  VAL A N     1 
ATOM   1146 C  CA    . VAL C 3 47  ? 78.509 9.584   15.641 1.00 30.29 ? 69  VAL A CA    1 
ATOM   1147 C  C     . VAL C 3 47  ? 78.371 8.975   14.247 1.00 30.40 ? 69  VAL A C     1 
ATOM   1148 O  O     . VAL C 3 47  ? 78.911 9.503   13.270 1.00 30.65 ? 69  VAL A O     1 
ATOM   1149 C  CB    . VAL C 3 47  ? 77.488 10.742  15.797 1.00 31.99 ? 69  VAL A CB    1 
ATOM   1150 C  CG1   . VAL C 3 47  ? 77.689 11.771  14.696 1.00 36.33 ? 69  VAL A CG1   1 
ATOM   1151 C  CG2   . VAL C 3 47  ? 76.066 10.193  15.762 1.00 33.95 ? 69  VAL A CG2   1 
ATOM   1152 N  N     . PHE C 3 48  ? 77.669 7.847   14.171 1.00 26.60 ? 70  PHE A N     1 
ATOM   1153 C  CA    . PHE C 3 48  ? 77.431 7.158   12.907 1.00 22.93 ? 70  PHE A CA    1 
ATOM   1154 C  C     . PHE C 3 48  ? 75.929 7.222   12.691 1.00 23.93 ? 70  PHE A C     1 
ATOM   1155 O  O     . PHE C 3 48  ? 75.163 7.005   13.629 1.00 22.40 ? 70  PHE A O     1 
ATOM   1156 C  CB    . PHE C 3 48  ? 77.892 5.702   12.991 1.00 22.31 ? 70  PHE A CB    1 
ATOM   1157 C  CG    . PHE C 3 48  ? 79.356 5.544   13.306 1.00 24.75 ? 70  PHE A CG    1 
ATOM   1158 C  CD1   . PHE C 3 48  ? 79.805 5.533   14.624 1.00 27.26 ? 70  PHE A CD1   1 
ATOM   1159 C  CD2   . PHE C 3 48  ? 80.288 5.406   12.281 1.00 25.72 ? 70  PHE A CD2   1 
ATOM   1160 C  CE1   . PHE C 3 48  ? 81.164 5.384   14.916 1.00 26.83 ? 70  PHE A CE1   1 
ATOM   1161 C  CE2   . PHE C 3 48  ? 81.647 5.257   12.562 1.00 25.96 ? 70  PHE A CE2   1 
ATOM   1162 C  CZ    . PHE C 3 48  ? 82.084 5.246   13.880 1.00 24.72 ? 70  PHE A CZ    1 
ATOM   1163 N  N     . LYS C 3 49  ? 75.501 7.517   11.468 1.00 23.47 ? 71  LYS A N     1 
ATOM   1164 C  CA    . LYS C 3 49  ? 74.074 7.648   11.199 1.00 26.45 ? 71  LYS A CA    1 
ATOM   1165 C  C     . LYS C 3 49  ? 73.589 6.825   10.025 1.00 24.76 ? 71  LYS A C     1 
ATOM   1166 O  O     . LYS C 3 49  ? 74.350 6.505   9.114  1.00 23.07 ? 71  LYS A O     1 
ATOM   1167 C  CB    . LYS C 3 49  ? 73.724 9.118   10.934 1.00 28.07 ? 71  LYS A CB    1 
ATOM   1168 C  CG    . LYS C 3 49  ? 74.096 10.072  12.062 1.00 38.12 ? 71  LYS A CG    1 
ATOM   1169 C  CD    . LYS C 3 49  ? 73.768 11.519  11.687 1.00 43.55 ? 71  LYS A CD    1 
ATOM   1170 C  CE    . LYS C 3 49  ? 74.082 12.484  12.824 1.00 47.40 ? 71  LYS A CE    1 
ATOM   1171 N  NZ    . LYS C 3 49  ? 73.263 12.214  14.049 1.00 52.41 ? 71  LYS A NZ    1 
ATOM   1172 N  N     . ARG C 3 50  ? 72.298 6.512   10.046 1.00 23.88 ? 72  ARG A N     1 
ATOM   1173 C  CA    . ARG C 3 50  ? 71.674 5.749   8.981  1.00 23.14 ? 72  ARG A CA    1 
ATOM   1174 C  C     . ARG C 3 50  ? 70.222 6.141   8.815  1.00 25.05 ? 72  ARG A C     1 
ATOM   1175 O  O     . ARG C 3 50  ? 69.514 6.362   9.798  1.00 26.31 ? 72  ARG A O     1 
ATOM   1176 C  CB    . ARG C 3 50  ? 71.710 4.244   9.289  1.00 24.91 ? 72  ARG A CB    1 
ATOM   1177 C  CG    . ARG C 3 50  ? 73.059 3.571   9.136  1.00 24.70 ? 72  ARG A CG    1 
ATOM   1178 C  CD    . ARG C 3 50  ? 73.418 3.384   7.673  1.00 24.91 ? 72  ARG A CD    1 
ATOM   1179 N  NE    . ARG C 3 50  ? 74.684 2.672   7.524  1.00 24.75 ? 72  ARG A NE    1 
ATOM   1180 C  CZ    . ARG C 3 50  ? 75.875 3.206   7.764  1.00 25.96 ? 72  ARG A CZ    1 
ATOM   1181 N  NH1   . ARG C 3 50  ? 75.974 4.472   8.162  1.00 24.42 ? 72  ARG A NH1   1 
ATOM   1182 N  NH2   . ARG C 3 50  ? 76.970 2.471   7.618  1.00 23.51 ? 72  ARG A NH2   1 
ATOM   1183 N  N     . TYR C 3 51  ? 69.794 6.257   7.563  1.00 23.03 ? 73  TYR A N     1 
ATOM   1184 C  CA    . TYR C 3 51  ? 68.396 6.506   7.250  1.00 23.39 ? 73  TYR A CA    1 
ATOM   1185 C  C     . TYR C 3 51  ? 68.076 5.194   6.539  1.00 24.46 ? 73  TYR A C     1 
ATOM   1186 O  O     . TYR C 3 51  ? 68.758 4.830   5.578  1.00 23.77 ? 73  TYR A O     1 
ATOM   1187 C  CB    . TYR C 3 51  ? 68.211 7.666   6.272  1.00 23.08 ? 73  TYR A CB    1 
ATOM   1188 C  CG    . TYR C 3 51  ? 66.745 7.982   6.016  1.00 26.65 ? 73  TYR A CG    1 
ATOM   1189 C  CD1   . TYR C 3 51  ? 66.070 8.926   6.788  1.00 27.79 ? 73  TYR A CD1   1 
ATOM   1190 C  CD2   . TYR C 3 51  ? 66.026 7.304   5.032  1.00 24.94 ? 73  TYR A CD2   1 
ATOM   1191 C  CE1   . TYR C 3 51  ? 64.708 9.191   6.588  1.00 31.06 ? 73  TYR A CE1   1 
ATOM   1192 C  CE2   . TYR C 3 51  ? 64.667 7.558   4.822  1.00 29.76 ? 73  TYR A CE2   1 
ATOM   1193 C  CZ    . TYR C 3 51  ? 64.015 8.502   5.604  1.00 31.32 ? 73  TYR A CZ    1 
ATOM   1194 O  OH    . TYR C 3 51  ? 62.674 8.752   5.405  1.00 33.16 ? 73  TYR A OH    1 
ATOM   1195 N  N     . LEU C 3 52  ? 67.078 4.464   7.018  1.00 22.24 ? 74  LEU A N     1 
ATOM   1196 C  CA    . LEU C 3 52  ? 66.734 3.192   6.397  1.00 23.37 ? 74  LEU A CA    1 
ATOM   1197 C  C     . LEU C 3 52  ? 65.278 3.171   5.963  1.00 26.17 ? 74  LEU A C     1 
ATOM   1198 O  O     . LEU C 3 52  ? 64.400 3.639   6.691  1.00 24.28 ? 74  LEU A O     1 
ATOM   1199 C  CB    . LEU C 3 52  ? 67.008 2.047   7.375  1.00 23.36 ? 74  LEU A CB    1 
ATOM   1200 C  CG    . LEU C 3 52  ? 68.472 1.903   7.795  1.00 23.63 ? 74  LEU A CG    1 
ATOM   1201 C  CD1   . LEU C 3 52  ? 68.608 0.880   8.919  1.00 24.86 ? 74  LEU A CD1   1 
ATOM   1202 C  CD2   . LEU C 3 52  ? 69.289 1.488   6.582  1.00 22.56 ? 74  LEU A CD2   1 
ATOM   1203 N  N     . ARG C 3 53  ? 65.030 2.634   4.770  1.00 25.42 ? 75  ARG A N     1 
ATOM   1204 C  CA    . ARG C 3 53  ? 63.677 2.551   4.239  1.00 24.59 ? 75  ARG A CA    1 
ATOM   1205 C  C     . ARG C 3 53  ? 62.902 1.526   5.059  1.00 25.20 ? 75  ARG A C     1 
ATOM   1206 O  O     . ARG C 3 53  ? 63.434 0.469   5.397  1.00 23.64 ? 75  ARG A O     1 
ATOM   1207 C  CB    . ARG C 3 53  ? 63.712 2.138   2.761  1.00 25.88 ? 75  ARG A CB    1 
ATOM   1208 C  CG    . ARG C 3 53  ? 64.643 2.983   1.891  1.00 27.04 ? 75  ARG A CG    1 
ATOM   1209 C  CD    . ARG C 3 53  ? 64.414 4.474   2.100  1.00 28.18 ? 75  ARG A CD    1 
ATOM   1210 N  NE    . ARG C 3 53  ? 65.312 5.291   1.286  1.00 25.74 ? 75  ARG A NE    1 
ATOM   1211 C  CZ    . ARG C 3 53  ? 65.041 5.701   0.052  1.00 25.71 ? 75  ARG A CZ    1 
ATOM   1212 N  NH1   . ARG C 3 53  ? 63.889 5.376   -0.521 1.00 24.09 ? 75  ARG A NH1   1 
ATOM   1213 N  NH2   . ARG C 3 53  ? 65.924 6.434   -0.613 1.00 25.35 ? 75  ARG A NH2   1 
ATOM   1214 N  N     . TYR C 3 54  ? 61.647 1.843   5.374  1.00 25.23 ? 76  TYR A N     1 
ATOM   1215 C  CA    . TYR C 3 54  ? 60.799 0.961   6.176  1.00 28.49 ? 76  TYR A CA    1 
ATOM   1216 C  C     . TYR C 3 54  ? 59.338 1.163   5.758  1.00 30.87 ? 76  TYR A C     1 
ATOM   1217 O  O     . TYR C 3 54  ? 58.854 2.297   5.702  1.00 29.15 ? 76  TYR A O     1 
ATOM   1218 C  CB    . TYR C 3 54  ? 60.982 1.296   7.665  1.00 27.43 ? 76  TYR A CB    1 
ATOM   1219 C  CG    . TYR C 3 54  ? 60.105 0.509   8.615  1.00 29.70 ? 76  TYR A CG    1 
ATOM   1220 C  CD1   . TYR C 3 54  ? 60.202 -0.879  8.700  1.00 30.71 ? 76  TYR A CD1   1 
ATOM   1221 C  CD2   . TYR C 3 54  ? 59.176 1.157   9.433  1.00 31.05 ? 76  TYR A CD2   1 
ATOM   1222 C  CE1   . TYR C 3 54  ? 59.391 -1.607  9.577  1.00 30.23 ? 76  TYR A CE1   1 
ATOM   1223 C  CE2   . TYR C 3 54  ? 58.361 0.440   10.312 1.00 30.65 ? 76  TYR A CE2   1 
ATOM   1224 C  CZ    . TYR C 3 54  ? 58.473 -0.942  10.375 1.00 30.43 ? 76  TYR A CZ    1 
ATOM   1225 O  OH    . TYR C 3 54  ? 57.653 -1.662  11.217 1.00 29.31 ? 76  TYR A OH    1 
ATOM   1226 N  N     . ASP C 3 55  ? 58.633 0.074   5.465  1.00 30.93 ? 77  ASP A N     1 
ATOM   1227 C  CA    . ASP C 3 55  ? 57.244 0.203   5.033  1.00 34.58 ? 77  ASP A CA    1 
ATOM   1228 C  C     . ASP C 3 55  ? 56.217 -0.435  5.956  1.00 36.28 ? 77  ASP A C     1 
ATOM   1229 O  O     . ASP C 3 55  ? 55.072 -0.658  5.556  1.00 37.06 ? 77  ASP A O     1 
ATOM   1230 C  CB    . ASP C 3 55  ? 57.074 -0.345  3.610  1.00 33.79 ? 77  ASP A CB    1 
ATOM   1231 C  CG    . ASP C 3 55  ? 57.346 -1.829  3.515  1.00 32.78 ? 77  ASP A CG    1 
ATOM   1232 O  OD1   . ASP C 3 55  ? 57.565 -2.472  4.561  1.00 34.68 ? 77  ASP A OD1   1 
ATOM   1233 O  OD2   . ASP C 3 55  ? 57.334 -2.358  2.385  1.00 36.59 ? 77  ASP A OD2   1 
ATOM   1234 N  N     . ARG C 3 56  ? 56.633 -0.730  7.184  1.00 36.15 ? 78  ARG A N     1 
ATOM   1235 C  CA    . ARG C 3 56  ? 55.762 -1.313  8.201  1.00 39.33 ? 78  ARG A CA    1 
ATOM   1236 C  C     . ARG C 3 56  ? 55.390 -2.780  8.017  1.00 39.12 ? 78  ARG A C     1 
ATOM   1237 O  O     . ARG C 3 56  ? 54.530 -3.296  8.730  1.00 41.41 ? 78  ARG A O     1 
ATOM   1238 C  CB    . ARG C 3 56  ? 54.477 -0.491  8.324  1.00 42.98 ? 78  ARG A CB    1 
ATOM   1239 C  CG    . ARG C 3 56  ? 54.686 0.957   8.722  1.00 48.22 ? 78  ARG A CG    1 
ATOM   1240 C  CD    . ARG C 3 56  ? 53.343 1.646   8.880  1.00 54.85 ? 78  ARG A CD    1 
ATOM   1241 N  NE    . ARG C 3 56  ? 53.465 3.018   9.362  1.00 60.22 ? 78  ARG A NE    1 
ATOM   1242 C  CZ    . ARG C 3 56  ? 52.428 3.791   9.671  1.00 62.69 ? 78  ARG A CZ    1 
ATOM   1243 N  NH1   . ARG C 3 56  ? 51.190 3.326   9.549  1.00 62.78 ? 78  ARG A NH1   1 
ATOM   1244 N  NH2   . ARG C 3 56  ? 52.627 5.027   10.106 1.00 64.72 ? 78  ARG A NH2   1 
ATOM   1245 N  N     . THR C 3 57  ? 56.023 -3.460  7.071  1.00 37.42 ? 79  THR A N     1 
ATOM   1246 C  CA    . THR C 3 57  ? 55.720 -4.869  6.859  1.00 34.13 ? 79  THR A CA    1 
ATOM   1247 C  C     . THR C 3 57  ? 56.634 -5.728  7.721  1.00 33.57 ? 79  THR A C     1 
ATOM   1248 O  O     . THR C 3 57  ? 57.642 -5.246  8.242  1.00 31.73 ? 79  THR A O     1 
ATOM   1249 C  CB    . THR C 3 57  ? 55.905 -5.267  5.382  1.00 36.20 ? 79  THR A CB    1 
ATOM   1250 O  OG1   . THR C 3 57  ? 57.249 -4.981  4.972  1.00 33.74 ? 79  THR A OG1   1 
ATOM   1251 C  CG2   . THR C 3 57  ? 54.924 -4.499  4.496  1.00 34.08 ? 79  THR A CG2   1 
ATOM   1252 N  N     . GLU C 3 58  ? 56.278 -6.998  7.880  1.00 30.34 ? 80  GLU A N     1 
ATOM   1253 C  CA    . GLU C 3 58  ? 57.085 -7.913  8.673  1.00 32.27 ? 80  GLU A CA    1 
ATOM   1254 C  C     . GLU C 3 58  ? 58.445 -8.104  8.003  1.00 31.52 ? 80  GLU A C     1 
ATOM   1255 O  O     . GLU C 3 58  ? 59.474 -8.169  8.672  1.00 30.33 ? 80  GLU A O     1 
ATOM   1256 C  CB    . GLU C 3 58  ? 56.382 -9.268  8.811  1.00 32.83 ? 80  GLU A CB    1 
ATOM   1257 N  N     . ALA C 3 59  ? 58.444 -8.193  6.677  1.00 30.48 ? 81  ALA A N     1 
ATOM   1258 C  CA    . ALA C 3 59  ? 59.686 -8.370  5.935  1.00 29.88 ? 81  ALA A CA    1 
ATOM   1259 C  C     . ALA C 3 59  ? 60.605 -7.170  6.169  1.00 28.28 ? 81  ALA A C     1 
ATOM   1260 O  O     . ALA C 3 59  ? 61.783 -7.332  6.479  1.00 29.73 ? 81  ALA A O     1 
ATOM   1261 C  CB    . ALA C 3 59  ? 59.390 -8.517  4.452  1.00 27.93 ? 81  ALA A CB    1 
ATOM   1262 N  N     . SER C 3 60  ? 60.054 -5.970  6.021  1.00 27.51 ? 82  SER A N     1 
ATOM   1263 C  CA    . SER C 3 60  ? 60.825 -4.740  6.205  1.00 27.85 ? 82  SER A CA    1 
ATOM   1264 C  C     . SER C 3 60  ? 61.351 -4.595  7.632  1.00 27.31 ? 82  SER A C     1 
ATOM   1265 O  O     . SER C 3 60  ? 62.497 -4.199  7.842  1.00 26.98 ? 82  SER A O     1 
ATOM   1266 C  CB    . SER C 3 60  ? 59.964 -3.529  5.843  1.00 25.65 ? 82  SER A CB    1 
ATOM   1267 O  OG    . SER C 3 60  ? 60.727 -2.335  5.829  1.00 28.15 ? 82  SER A OG    1 
ATOM   1268 N  N     . LEU C 3 61  ? 60.514 -4.913  8.614  1.00 26.08 ? 83  LEU A N     1 
ATOM   1269 C  CA    . LEU C 3 61  ? 60.921 -4.816  10.012 1.00 25.82 ? 83  LEU A CA    1 
ATOM   1270 C  C     . LEU C 3 61  ? 62.101 -5.746  10.266 1.00 27.61 ? 83  LEU A C     1 
ATOM   1271 O  O     . LEU C 3 61  ? 63.072 -5.369  10.922 1.00 26.07 ? 83  LEU A O     1 
ATOM   1272 C  CB    . LEU C 3 61  ? 59.759 -5.193  10.942 1.00 25.68 ? 83  LEU A CB    1 
ATOM   1273 C  CG    . LEU C 3 61  ? 60.084 -5.181  12.442 1.00 27.39 ? 83  LEU A CG    1 
ATOM   1274 C  CD1   . LEU C 3 61  ? 60.529 -3.785  12.872 1.00 27.79 ? 83  LEU A CD1   1 
ATOM   1275 C  CD2   . LEU C 3 61  ? 58.864 -5.612  13.241 1.00 28.88 ? 83  LEU A CD2   1 
ATOM   1276 N  N     . HIS C 3 62  ? 62.015 -6.967  9.745  1.00 26.85 ? 84  HIS A N     1 
ATOM   1277 C  CA    . HIS C 3 62  ? 63.094 -7.931  9.921  1.00 25.86 ? 84  HIS A CA    1 
ATOM   1278 C  C     . HIS C 3 62  ? 64.378 -7.385  9.305  1.00 24.85 ? 84  HIS A C     1 
ATOM   1279 O  O     . HIS C 3 62  ? 65.445 -7.461  9.905  1.00 25.19 ? 84  HIS A O     1 
ATOM   1280 C  CB    . HIS C 3 62  ? 62.760 -9.261  9.248  1.00 28.23 ? 84  HIS A CB    1 
ATOM   1281 C  CG    . HIS C 3 62  ? 63.882 -10.252 9.301  1.00 30.34 ? 84  HIS A CG    1 
ATOM   1282 N  ND1   . HIS C 3 62  ? 64.224 -10.925 10.454 1.00 32.41 ? 84  HIS A ND1   1 
ATOM   1283 C  CD2   . HIS C 3 62  ? 64.785 -10.628 8.364  1.00 31.66 ? 84  HIS A CD2   1 
ATOM   1284 C  CE1   . HIS C 3 62  ? 65.290 -11.672 10.226 1.00 32.44 ? 84  HIS A CE1   1 
ATOM   1285 N  NE2   . HIS C 3 62  ? 65.650 -11.509 8.966  1.00 35.38 ? 84  HIS A NE2   1 
ATOM   1286 N  N     . ARG C 3 63  ? 64.266 -6.833  8.102  1.00 24.04 ? 85  ARG A N     1 
ATOM   1287 C  CA    . ARG C 3 63  ? 65.430 -6.289  7.408  1.00 24.81 ? 85  ARG A CA    1 
ATOM   1288 C  C     . ARG C 3 63  ? 66.132 -5.181  8.198  1.00 24.86 ? 85  ARG A C     1 
ATOM   1289 O  O     . ARG C 3 63  ? 67.338 -5.256  8.437  1.00 24.53 ? 85  ARG A O     1 
ATOM   1290 C  CB    . ARG C 3 63  ? 65.028 -5.749  6.031  1.00 24.50 ? 85  ARG A CB    1 
ATOM   1291 C  CG    . ARG C 3 63  ? 66.221 -5.352  5.144  1.00 25.91 ? 85  ARG A CG    1 
ATOM   1292 C  CD    . ARG C 3 63  ? 65.761 -4.643  3.883  1.00 22.28 ? 85  ARG A CD    1 
ATOM   1293 N  NE    . ARG C 3 63  ? 65.347 -3.267  4.153  1.00 24.85 ? 85  ARG A NE    1 
ATOM   1294 C  CZ    . ARG C 3 63  ? 66.173 -2.225  4.154  1.00 26.43 ? 85  ARG A CZ    1 
ATOM   1295 N  NH1   . ARG C 3 63  ? 67.463 -2.396  3.895  1.00 23.56 ? 85  ARG A NH1   1 
ATOM   1296 N  NH2   . ARG C 3 63  ? 65.710 -1.011  4.408  1.00 24.66 ? 85  ARG A NH2   1 
ATOM   1297 N  N     . VAL C 3 64  ? 65.387 -4.161  8.615  1.00 23.75 ? 86  VAL A N     1 
ATOM   1298 C  CA    . VAL C 3 64  ? 65.997 -3.044  9.339  1.00 23.13 ? 86  VAL A CA    1 
ATOM   1299 C  C     . VAL C 3 64  ? 66.483 -3.362  10.751 1.00 24.91 ? 86  VAL A C     1 
ATOM   1300 O  O     . VAL C 3 64  ? 67.403 -2.712  11.249 1.00 24.05 ? 86  VAL A O     1 
ATOM   1301 C  CB    . VAL C 3 64  ? 65.056 -1.813  9.378  1.00 22.82 ? 86  VAL A CB    1 
ATOM   1302 C  CG1   . VAL C 3 64  ? 64.701 -1.409  7.970  1.00 22.15 ? 86  VAL A CG1   1 
ATOM   1303 C  CG2   . VAL C 3 64  ? 63.798 -2.118  10.191 1.00 26.37 ? 86  VAL A CG2   1 
ATOM   1304 N  N     . LEU C 3 65  ? 65.879 -4.354  11.404 1.00 24.45 ? 87  LEU A N     1 
ATOM   1305 C  CA    . LEU C 3 65  ? 66.339 -4.732  12.736 1.00 25.04 ? 87  LEU A CA    1 
ATOM   1306 C  C     . LEU C 3 65  ? 67.732 -5.347  12.599 1.00 24.95 ? 87  LEU A C     1 
ATOM   1307 O  O     . LEU C 3 65  ? 68.448 -5.519  13.579 1.00 24.71 ? 87  LEU A O     1 
ATOM   1308 C  CB    . LEU C 3 65  ? 65.378 -5.733  13.393 1.00 25.79 ? 87  LEU A CB    1 
ATOM   1309 C  CG    . LEU C 3 65  ? 64.070 -5.133  13.935 1.00 26.34 ? 87  LEU A CG    1 
ATOM   1310 C  CD1   . LEU C 3 65  ? 63.157 -6.236  14.465 1.00 28.38 ? 87  LEU A CD1   1 
ATOM   1311 C  CD2   . LEU C 3 65  ? 64.397 -4.138  15.046 1.00 27.40 ? 87  LEU A CD2   1 
ATOM   1312 N  N     . GLY C 3 66  ? 68.119 -5.668  11.370 1.00 27.07 ? 88  GLY A N     1 
ATOM   1313 C  CA    . GLY C 3 66  ? 69.437 -6.242  11.158 1.00 26.98 ? 88  GLY A CA    1 
ATOM   1314 C  C     . GLY C 3 66  ? 70.510 -5.203  10.862 1.00 27.63 ? 88  GLY A C     1 
ATOM   1315 O  O     . GLY C 3 66  ? 71.647 -5.561  10.562 1.00 27.87 ? 88  GLY A O     1 
ATOM   1316 N  N     . SER C 3 67  ? 70.171 -3.917  10.960 1.00 25.23 ? 89  SER A N     1 
ATOM   1317 C  CA    . SER C 3 67  ? 71.144 -2.865  10.653 1.00 23.28 ? 89  SER A CA    1 
ATOM   1318 C  C     . SER C 3 67  ? 72.325 -2.815  11.614 1.00 23.65 ? 89  SER A C     1 
ATOM   1319 O  O     . SER C 3 67  ? 73.373 -2.272  11.275 1.00 24.77 ? 89  SER A O     1 
ATOM   1320 C  CB    . SER C 3 67  ? 70.462 -1.495  10.603 1.00 22.29 ? 89  SER A CB    1 
ATOM   1321 O  OG    . SER C 3 67  ? 69.957 -1.131  11.869 1.00 22.46 ? 89  SER A OG    1 
ATOM   1322 N  N     . TRP C 3 68  ? 72.145 -3.358  12.815 1.00 23.53 ? 90  TRP A N     1 
ATOM   1323 C  CA    . TRP C 3 68  ? 73.210 -3.418  13.816 1.00 24.59 ? 90  TRP A CA    1 
ATOM   1324 C  C     . TRP C 3 68  ? 72.864 -4.459  14.869 1.00 25.85 ? 90  TRP A C     1 
ATOM   1325 O  O     . TRP C 3 68  ? 71.691 -4.789  15.066 1.00 25.43 ? 90  TRP A O     1 
ATOM   1326 C  CB    . TRP C 3 68  ? 73.441 -2.058  14.498 1.00 23.72 ? 90  TRP A CB    1 
ATOM   1327 C  CG    . TRP C 3 68  ? 72.253 -1.500  15.236 1.00 23.76 ? 90  TRP A CG    1 
ATOM   1328 C  CD1   . TRP C 3 68  ? 71.349 -0.589  14.762 1.00 26.31 ? 90  TRP A CD1   1 
ATOM   1329 C  CD2   . TRP C 3 68  ? 71.846 -1.804  16.579 1.00 24.75 ? 90  TRP A CD2   1 
ATOM   1330 N  NE1   . TRP C 3 68  ? 70.409 -0.307  15.726 1.00 25.20 ? 90  TRP A NE1   1 
ATOM   1331 C  CE2   . TRP C 3 68  ? 70.688 -1.039  16.849 1.00 23.24 ? 90  TRP A CE2   1 
ATOM   1332 C  CE3   . TRP C 3 68  ? 72.347 -2.648  17.580 1.00 22.36 ? 90  TRP A CE3   1 
ATOM   1333 C  CZ2   . TRP C 3 68  ? 70.022 -1.091  18.081 1.00 23.65 ? 90  TRP A CZ2   1 
ATOM   1334 C  CZ3   . TRP C 3 68  ? 71.683 -2.699  18.808 1.00 27.17 ? 90  TRP A CZ3   1 
ATOM   1335 C  CH2   . TRP C 3 68  ? 70.532 -1.923  19.044 1.00 24.50 ? 90  TRP A CH2   1 
ATOM   1336 N  N     . THR C 3 69  ? 73.895 -4.974  15.533 1.00 24.95 ? 91  THR A N     1 
ATOM   1337 C  CA    . THR C 3 69  ? 73.743 -5.982  16.578 1.00 26.19 ? 91  THR A CA    1 
ATOM   1338 C  C     . THR C 3 69  ? 74.597 -5.589  17.777 1.00 27.19 ? 91  THR A C     1 
ATOM   1339 O  O     . THR C 3 69  ? 75.394 -4.652  17.701 1.00 25.94 ? 91  THR A O     1 
ATOM   1340 C  CB    . THR C 3 69  ? 74.235 -7.362  16.101 1.00 27.82 ? 91  THR A CB    1 
ATOM   1341 O  OG1   . THR C 3 69  ? 75.624 -7.268  15.747 1.00 26.40 ? 91  THR A OG1   1 
ATOM   1342 C  CG2   . THR C 3 69  ? 73.439 -7.832  14.895 1.00 26.53 ? 91  THR A CG2   1 
ATOM   1343 N  N     . GLY C 3 70  ? 74.440 -6.310  18.881 1.00 26.07 ? 92  GLY A N     1 
ATOM   1344 C  CA    . GLY C 3 70  ? 75.237 -6.010  20.056 1.00 27.64 ? 92  GLY A CA    1 
ATOM   1345 C  C     . GLY C 3 70  ? 76.712 -6.149  19.718 1.00 28.60 ? 92  GLY A C     1 
ATOM   1346 O  O     . GLY C 3 70  ? 77.544 -5.351  20.166 1.00 27.62 ? 92  GLY A O     1 
ATOM   1347 N  N     . ASP C 3 71  ? 77.036 -7.162  18.918 1.00 28.24 ? 93  ASP A N     1 
ATOM   1348 C  CA    . ASP C 3 71  ? 78.419 -7.407  18.518 1.00 30.88 ? 93  ASP A CA    1 
ATOM   1349 C  C     . ASP C 3 71  ? 78.978 -6.319  17.604 1.00 29.15 ? 93  ASP A C     1 
ATOM   1350 O  O     . ASP C 3 71  ? 80.104 -5.861  17.807 1.00 29.55 ? 93  ASP A O     1 
ATOM   1351 C  CB    . ASP C 3 71  ? 78.556 -8.763  17.818 1.00 32.44 ? 93  ASP A CB    1 
ATOM   1352 C  CG    . ASP C 3 71  ? 78.437 -9.939  18.776 1.00 35.56 ? 93  ASP A CG    1 
ATOM   1353 O  OD1   . ASP C 3 71  ? 78.503 -9.732  20.006 1.00 35.40 ? 93  ASP A OD1   1 
ATOM   1354 O  OD2   . ASP C 3 71  ? 78.292 -11.077 18.288 1.00 36.45 ? 93  ASP A OD2   1 
ATOM   1355 N  N     . SER C 3 72  ? 78.211 -5.900  16.601 1.00 27.41 ? 94  SER A N     1 
ATOM   1356 C  CA    . SER C 3 72  ? 78.715 -4.871  15.698 1.00 27.30 ? 94  SER A CA    1 
ATOM   1357 C  C     . SER C 3 72  ? 78.877 -3.536  16.425 1.00 28.18 ? 94  SER A C     1 
ATOM   1358 O  O     . SER C 3 72  ? 79.798 -2.772  16.132 1.00 27.97 ? 94  SER A O     1 
ATOM   1359 C  CB    . SER C 3 72  ? 77.809 -4.718  14.463 1.00 26.86 ? 94  SER A CB    1 
ATOM   1360 O  OG    . SER C 3 72  ? 76.548 -4.150  14.773 1.00 26.62 ? 94  SER A OG    1 
ATOM   1361 N  N     . VAL C 3 73  ? 77.998 -3.257  17.382 1.00 25.48 ? 95  VAL A N     1 
ATOM   1362 C  CA    . VAL C 3 73  ? 78.097 -2.013  18.142 1.00 26.15 ? 95  VAL A CA    1 
ATOM   1363 C  C     . VAL C 3 73  ? 79.309 -2.055  19.078 1.00 27.67 ? 95  VAL A C     1 
ATOM   1364 O  O     . VAL C 3 73  ? 80.066 -1.086  19.181 1.00 25.20 ? 95  VAL A O     1 
ATOM   1365 C  CB    . VAL C 3 73  ? 76.815 -1.759  18.970 1.00 26.87 ? 95  VAL A CB    1 
ATOM   1366 C  CG1   . VAL C 3 73  ? 77.045 -0.623  19.964 1.00 26.74 ? 95  VAL A CG1   1 
ATOM   1367 C  CG2   . VAL C 3 73  ? 75.663 -1.403  18.032 1.00 23.27 ? 95  VAL A CG2   1 
ATOM   1368 N  N     . ASN C 3 74  ? 79.505 -3.185  19.748 1.00 29.78 ? 96  ASN A N     1 
ATOM   1369 C  CA    . ASN C 3 74  ? 80.632 -3.316  20.663 1.00 31.82 ? 96  ASN A CA    1 
ATOM   1370 C  C     . ASN C 3 74  ? 81.966 -3.207  19.929 1.00 31.89 ? 96  ASN A C     1 
ATOM   1371 O  O     . ASN C 3 74  ? 82.910 -2.583  20.428 1.00 31.55 ? 96  ASN A O     1 
ATOM   1372 C  CB    . ASN C 3 74  ? 80.573 -4.649  21.407 1.00 36.77 ? 96  ASN A CB    1 
ATOM   1373 C  CG    . ASN C 3 74  ? 81.738 -4.827  22.359 1.00 43.04 ? 96  ASN A CG    1 
ATOM   1374 O  OD1   . ASN C 3 74  ? 81.953 -4.006  23.255 1.00 47.02 ? 96  ASN A OD1   1 
ATOM   1375 N  ND2   . ASN C 3 74  ? 82.503 -5.896  22.169 1.00 44.81 ? 96  ASN A ND2   1 
ATOM   1376 N  N     . TYR C 3 75  ? 82.049 -3.811  18.748 1.00 29.85 ? 97  TYR A N     1 
ATOM   1377 C  CA    . TYR C 3 75  ? 83.289 -3.758  17.981 1.00 30.65 ? 97  TYR A CA    1 
ATOM   1378 C  C     . TYR C 3 75  ? 83.596 -2.330  17.541 1.00 30.83 ? 97  TYR A C     1 
ATOM   1379 O  O     . TYR C 3 75  ? 84.741 -1.882  17.600 1.00 30.97 ? 97  TYR A O     1 
ATOM   1380 C  CB    . TYR C 3 75  ? 83.209 -4.667  16.753 1.00 31.61 ? 97  TYR A CB    1 
ATOM   1381 C  CG    . TYR C 3 75  ? 84.488 -4.681  15.945 1.00 32.49 ? 97  TYR A CG    1 
ATOM   1382 C  CD1   . TYR C 3 75  ? 85.662 -5.219  16.472 1.00 34.15 ? 97  TYR A CD1   1 
ATOM   1383 C  CD2   . TYR C 3 75  ? 84.535 -4.125  14.667 1.00 35.46 ? 97  TYR A CD2   1 
ATOM   1384 C  CE1   . TYR C 3 75  ? 86.855 -5.199  15.745 1.00 34.71 ? 97  TYR A CE1   1 
ATOM   1385 C  CE2   . TYR C 3 75  ? 85.721 -4.100  13.933 1.00 35.75 ? 97  TYR A CE2   1 
ATOM   1386 C  CZ    . TYR C 3 75  ? 86.876 -4.637  14.479 1.00 36.60 ? 97  TYR A CZ    1 
ATOM   1387 O  OH    . TYR C 3 75  ? 88.051 -4.604  13.760 1.00 35.15 ? 97  TYR A OH    1 
ATOM   1388 N  N     . ALA C 3 76  ? 82.571 -1.612  17.098 1.00 30.41 ? 98  ALA A N     1 
ATOM   1389 C  CA    . ALA C 3 76  ? 82.758 -0.235  16.658 1.00 29.91 ? 98  ALA A CA    1 
ATOM   1390 C  C     . ALA C 3 76  ? 83.078 0.674   17.842 1.00 30.85 ? 98  ALA A C     1 
ATOM   1391 O  O     . ALA C 3 76  ? 83.967 1.523   17.768 1.00 30.62 ? 98  ALA A O     1 
ATOM   1392 C  CB    . ALA C 3 76  ? 81.501 0.261   15.945 1.00 29.47 ? 98  ALA A CB    1 
ATOM   1393 N  N     . ALA C 3 77  ? 82.351 0.485   18.936 1.00 30.57 ? 99  ALA A N     1 
ATOM   1394 C  CA    . ALA C 3 77  ? 82.532 1.295   20.135 1.00 33.38 ? 99  ALA A CA    1 
ATOM   1395 C  C     . ALA C 3 77  ? 83.865 1.091   20.847 1.00 33.04 ? 99  ALA A C     1 
ATOM   1396 O  O     . ALA C 3 77  ? 84.449 2.051   21.346 1.00 31.99 ? 99  ALA A O     1 
ATOM   1397 C  CB    . ALA C 3 77  ? 81.392 1.034   21.114 1.00 31.96 ? 99  ALA A CB    1 
ATOM   1398 N  N     . SER C 3 78  ? 84.336 -0.152  20.897 1.00 32.33 ? 100 SER A N     1 
ATOM   1399 C  CA    . SER C 3 78  ? 85.587 -0.462  21.586 1.00 36.25 ? 100 SER A CA    1 
ATOM   1400 C  C     . SER C 3 78  ? 86.785 0.311   21.043 1.00 37.23 ? 100 SER A C     1 
ATOM   1401 O  O     . SER C 3 78  ? 87.761 0.535   21.757 1.00 39.25 ? 100 SER A O     1 
ATOM   1402 C  CB    . SER C 3 78  ? 85.873 -1.971  21.534 1.00 33.62 ? 100 SER A CB    1 
ATOM   1403 O  OG    . SER C 3 78  ? 86.007 -2.438  20.206 1.00 37.54 ? 100 SER A OG    1 
ATOM   1404 N  N     . ARG C 3 79  ? 86.703 0.723   19.784 1.00 36.01 ? 101 ARG A N     1 
ATOM   1405 C  CA    . ARG C 3 79  ? 87.780 1.475   19.158 1.00 35.77 ? 101 ARG A CA    1 
ATOM   1406 C  C     . ARG C 3 79  ? 88.027 2.796   19.881 1.00 37.95 ? 101 ARG A C     1 
ATOM   1407 O  O     . ARG C 3 79  ? 89.127 3.346   19.819 1.00 40.07 ? 101 ARG A O     1 
ATOM   1408 C  CB    . ARG C 3 79  ? 87.437 1.758   17.693 1.00 32.87 ? 101 ARG A CB    1 
ATOM   1409 C  CG    . ARG C 3 79  ? 88.464 2.618   16.957 1.00 31.14 ? 101 ARG A CG    1 
ATOM   1410 C  CD    . ARG C 3 79  ? 89.811 1.907   16.822 1.00 30.47 ? 101 ARG A CD    1 
ATOM   1411 N  NE    . ARG C 3 79  ? 90.770 2.721   16.077 1.00 28.03 ? 101 ARG A NE    1 
ATOM   1412 C  CZ    . ARG C 3 79  ? 91.395 3.785   16.576 1.00 27.40 ? 101 ARG A CZ    1 
ATOM   1413 N  NH1   . ARG C 3 79  ? 91.171 4.165   17.829 1.00 24.10 ? 101 ARG A NH1   1 
ATOM   1414 N  NH2   . ARG C 3 79  ? 92.243 4.473   15.819 1.00 26.20 ? 101 ARG A NH2   1 
ATOM   1415 N  N     . PHE C 3 80  ? 87.007 3.297   20.572 1.00 37.32 ? 102 PHE A N     1 
ATOM   1416 C  CA    . PHE C 3 80  ? 87.119 4.571   21.275 1.00 39.53 ? 102 PHE A CA    1 
ATOM   1417 C  C     . PHE C 3 80  ? 87.287 4.465   22.787 1.00 41.24 ? 102 PHE A C     1 
ATOM   1418 O  O     . PHE C 3 80  ? 87.304 5.483   23.479 1.00 41.15 ? 102 PHE A O     1 
ATOM   1419 C  CB    . PHE C 3 80  ? 85.898 5.443   20.969 1.00 38.34 ? 102 PHE A CB    1 
ATOM   1420 C  CG    . PHE C 3 80  ? 85.569 5.531   19.504 1.00 38.11 ? 102 PHE A CG    1 
ATOM   1421 C  CD1   . PHE C 3 80  ? 84.809 4.540   18.888 1.00 36.18 ? 102 PHE A CD1   1 
ATOM   1422 C  CD2   . PHE C 3 80  ? 86.045 6.585   18.734 1.00 36.51 ? 102 PHE A CD2   1 
ATOM   1423 C  CE1   . PHE C 3 80  ? 84.530 4.597   17.528 1.00 36.33 ? 102 PHE A CE1   1 
ATOM   1424 C  CE2   . PHE C 3 80  ? 85.771 6.651   17.370 1.00 38.34 ? 102 PHE A CE2   1 
ATOM   1425 C  CZ    . PHE C 3 80  ? 85.013 5.655   16.766 1.00 37.60 ? 102 PHE A CZ    1 
ATOM   1426 N  N     . PHE C 3 81  ? 87.412 3.247   23.303 1.00 43.64 ? 103 PHE A N     1 
ATOM   1427 C  CA    . PHE C 3 81  ? 87.569 3.063   24.741 1.00 46.74 ? 103 PHE A CA    1 
ATOM   1428 C  C     . PHE C 3 81  ? 88.948 3.483   25.245 1.00 48.77 ? 103 PHE A C     1 
ATOM   1429 O  O     . PHE C 3 81  ? 89.954 3.333   24.546 1.00 47.60 ? 103 PHE A O     1 
ATOM   1430 C  CB    . PHE C 3 81  ? 87.302 1.605   25.132 1.00 49.11 ? 103 PHE A CB    1 
ATOM   1431 C  CG    . PHE C 3 81  ? 85.876 1.168   24.923 1.00 51.06 ? 103 PHE A CG    1 
ATOM   1432 C  CD1   . PHE C 3 81  ? 84.860 2.105   24.750 1.00 51.45 ? 103 PHE A CD1   1 
ATOM   1433 C  CD2   . PHE C 3 81  ? 85.546 -0.183  24.922 1.00 52.24 ? 103 PHE A CD2   1 
ATOM   1434 C  CE1   . PHE C 3 81  ? 83.537 1.703   24.579 1.00 52.21 ? 103 PHE A CE1   1 
ATOM   1435 C  CE2   . PHE C 3 81  ? 84.225 -0.596  24.752 1.00 52.51 ? 103 PHE A CE2   1 
ATOM   1436 C  CZ    . PHE C 3 81  ? 83.219 0.350   24.580 1.00 52.33 ? 103 PHE A CZ    1 
ATOM   1437 N  N     . GLY C 3 82  ? 88.977 4.014   26.464 1.00 49.43 ? 104 GLY A N     1 
ATOM   1438 C  CA    . GLY C 3 82  ? 90.224 4.455   27.064 1.00 51.74 ? 104 GLY A CA    1 
ATOM   1439 C  C     . GLY C 3 82  ? 90.225 4.227   28.564 1.00 53.18 ? 104 GLY A C     1 
ATOM   1440 O  O     . GLY C 3 82  ? 89.453 3.412   29.076 1.00 53.56 ? 104 GLY A O     1 
ATOM   1441 N  N     . PHE C 3 83  ? 91.091 4.944   29.275 1.00 52.67 ? 105 PHE A N     1 
ATOM   1442 C  CA    . PHE C 3 83  ? 91.176 4.805   30.723 1.00 52.66 ? 105 PHE A CA    1 
ATOM   1443 C  C     . PHE C 3 83  ? 89.841 5.182   31.356 1.00 52.70 ? 105 PHE A C     1 
ATOM   1444 O  O     . PHE C 3 83  ? 89.291 4.430   32.161 1.00 52.01 ? 105 PHE A O     1 
ATOM   1445 C  CB    . PHE C 3 83  ? 92.289 5.701   31.279 1.00 52.65 ? 105 PHE A CB    1 
ATOM   1446 N  N     . ASP C 3 84  ? 89.321 6.347   30.982 1.00 52.31 ? 106 ASP A N     1 
ATOM   1447 C  CA    . ASP C 3 84  ? 88.049 6.817   31.516 1.00 52.16 ? 106 ASP A CA    1 
ATOM   1448 C  C     . ASP C 3 84  ? 86.880 6.312   30.678 1.00 50.35 ? 106 ASP A C     1 
ATOM   1449 O  O     . ASP C 3 84  ? 87.048 5.913   29.526 1.00 49.14 ? 106 ASP A O     1 
ATOM   1450 C  CB    . ASP C 3 84  ? 88.018 8.347   31.561 1.00 55.27 ? 106 ASP A CB    1 
ATOM   1451 C  CG    . ASP C 3 84  ? 89.126 8.928   32.417 1.00 59.13 ? 106 ASP A CG    1 
ATOM   1452 O  OD1   . ASP C 3 84  ? 89.280 8.482   33.573 1.00 60.93 ? 106 ASP A OD1   1 
ATOM   1453 O  OD2   . ASP C 3 84  ? 89.840 9.834   31.937 1.00 61.86 ? 106 ASP A OD2   1 
ATOM   1454 N  N     . GLN C 3 85  ? 85.693 6.332   31.270 1.00 48.07 ? 107 GLN A N     1 
ATOM   1455 C  CA    . GLN C 3 85  ? 84.492 5.884   30.584 1.00 44.88 ? 107 GLN A CA    1 
ATOM   1456 C  C     . GLN C 3 85  ? 84.055 6.978   29.619 1.00 42.55 ? 107 GLN A C     1 
ATOM   1457 O  O     . GLN C 3 85  ? 84.268 8.163   29.881 1.00 44.73 ? 107 GLN A O     1 
ATOM   1458 C  CB    . GLN C 3 85  ? 83.384 5.616   31.605 1.00 45.14 ? 107 GLN A CB    1 
ATOM   1459 C  CG    . GLN C 3 85  ? 82.214 4.825   31.059 1.00 42.89 ? 107 GLN A CG    1 
ATOM   1460 C  CD    . GLN C 3 85  ? 81.154 4.554   32.106 1.00 40.08 ? 107 GLN A CD    1 
ATOM   1461 O  OE1   . GLN C 3 85  ? 80.312 3.679   31.931 1.00 40.02 ? 107 GLN A OE1   1 
ATOM   1462 N  NE2   . GLN C 3 85  ? 81.185 5.309   33.199 1.00 39.02 ? 107 GLN A NE2   1 
ATOM   1463 N  N     . ILE C 3 86  ? 83.461 6.584   28.497 1.00 40.47 ? 108 ILE A N     1 
ATOM   1464 C  CA    . ILE C 3 86  ? 82.987 7.554   27.516 1.00 37.70 ? 108 ILE A CA    1 
ATOM   1465 C  C     . ILE C 3 86  ? 81.473 7.452   27.367 1.00 37.29 ? 108 ILE A C     1 
ATOM   1466 O  O     . ILE C 3 86  ? 80.879 6.422   27.689 1.00 35.74 ? 108 ILE A O     1 
ATOM   1467 C  CB    . ILE C 3 86  ? 83.649 7.342   26.130 1.00 38.65 ? 108 ILE A CB    1 
ATOM   1468 C  CG1   . ILE C 3 86  ? 83.281 5.968   25.568 1.00 37.83 ? 108 ILE A CG1   1 
ATOM   1469 C  CG2   . ILE C 3 86  ? 85.163 7.470   26.254 1.00 38.88 ? 108 ILE A CG2   1 
ATOM   1470 C  CD1   . ILE C 3 86  ? 83.716 5.766   24.122 1.00 39.15 ? 108 ILE A CD1   1 
ATOM   1471 N  N     . GLY C 3 87  ? 80.852 8.527   26.892 1.00 35.95 ? 109 GLY A N     1 
ATOM   1472 C  CA    . GLY C 3 87  ? 79.412 8.525   26.715 1.00 35.97 ? 109 GLY A CA    1 
ATOM   1473 C  C     . GLY C 3 87  ? 78.994 7.837   25.428 1.00 36.01 ? 109 GLY A C     1 
ATOM   1474 O  O     . GLY C 3 87  ? 79.565 8.093   24.365 1.00 34.85 ? 109 GLY A O     1 
ATOM   1475 N  N     . CYS C 3 88  ? 78.000 6.958   25.527 1.00 32.50 ? 110 CYS A N     1 
ATOM   1476 C  CA    . CYS C 3 88  ? 77.490 6.229   24.370 1.00 29.97 ? 110 CYS A CA    1 
ATOM   1477 C  C     . CYS C 3 88  ? 76.008 6.529   24.216 1.00 29.10 ? 110 CYS A C     1 
ATOM   1478 O  O     . CYS C 3 88  ? 75.285 6.650   25.209 1.00 27.85 ? 110 CYS A O     1 
ATOM   1479 C  CB    . CYS C 3 88  ? 77.689 4.726   24.554 1.00 28.99 ? 110 CYS A CB    1 
ATOM   1480 S  SG    . CYS C 3 88  ? 79.424 4.206   24.639 1.00 38.01 ? 110 CYS A SG    1 
ATOM   1481 N  N     . THR C 3 89  ? 75.552 6.642   22.975 1.00 27.91 ? 111 THR A N     1 
ATOM   1482 C  CA    . THR C 3 89  ? 74.152 6.943   22.738 1.00 26.90 ? 111 THR A CA    1 
ATOM   1483 C  C     . THR C 3 89  ? 73.587 6.353   21.452 1.00 27.21 ? 111 THR A C     1 
ATOM   1484 O  O     . THR C 3 89  ? 74.249 6.332   20.409 1.00 26.00 ? 111 THR A O     1 
ATOM   1485 C  CB    . THR C 3 89  ? 73.919 8.466   22.686 1.00 28.60 ? 111 THR A CB    1 
ATOM   1486 O  OG1   A THR C 3 89  ? 72.513 8.733   22.677 0.50 30.99 ? 111 THR A OG1   1 
ATOM   1487 O  OG1   B THR C 3 89  ? 74.437 9.083   23.872 0.50 28.38 ? 111 THR A OG1   1 
ATOM   1488 C  CG2   A THR C 3 89  ? 74.537 9.052   21.431 0.50 26.44 ? 111 THR A CG2   1 
ATOM   1489 C  CG2   B THR C 3 89  ? 72.443 8.757   22.572 0.50 30.19 ? 111 THR A CG2   1 
ATOM   1490 N  N     . TYR C 3 90  ? 72.356 5.862   21.544 1.00 24.70 ? 112 TYR A N     1 
ATOM   1491 C  CA    . TYR C 3 90  ? 71.658 5.335   20.384 1.00 22.60 ? 112 TYR A CA    1 
ATOM   1492 C  C     . TYR C 3 90  ? 70.404 6.185   20.269 1.00 24.10 ? 112 TYR A C     1 
ATOM   1493 O  O     . TYR C 3 90  ? 69.719 6.412   21.267 1.00 24.34 ? 112 TYR A O     1 
ATOM   1494 C  CB    . TYR C 3 90  ? 71.236 3.876   20.572 1.00 21.97 ? 112 TYR A CB    1 
ATOM   1495 C  CG    . TYR C 3 90  ? 70.304 3.410   19.467 1.00 24.46 ? 112 TYR A CG    1 
ATOM   1496 C  CD1   . TYR C 3 90  ? 70.784 3.175   18.176 1.00 23.50 ? 112 TYR A CD1   1 
ATOM   1497 C  CD2   . TYR C 3 90  ? 68.935 3.268   19.694 1.00 25.77 ? 112 TYR A CD2   1 
ATOM   1498 C  CE1   . TYR C 3 90  ? 69.925 2.816   17.136 1.00 24.91 ? 112 TYR A CE1   1 
ATOM   1499 C  CE2   . TYR C 3 90  ? 68.063 2.908   18.657 1.00 26.86 ? 112 TYR A CE2   1 
ATOM   1500 C  CZ    . TYR C 3 90  ? 68.565 2.686   17.383 1.00 25.13 ? 112 TYR A CZ    1 
ATOM   1501 O  OH    . TYR C 3 90  ? 67.715 2.350   16.352 1.00 23.26 ? 112 TYR A OH    1 
ATOM   1502 N  N     . SER C 3 91  ? 70.109 6.663   19.065 1.00 23.32 ? 113 SER A N     1 
ATOM   1503 C  CA    . SER C 3 91  ? 68.915 7.467   18.846 1.00 26.26 ? 113 SER A CA    1 
ATOM   1504 C  C     . SER C 3 91  ? 68.148 6.952   17.644 1.00 25.99 ? 113 SER A C     1 
ATOM   1505 O  O     . SER C 3 91  ? 68.738 6.471   16.677 1.00 26.26 ? 113 SER A O     1 
ATOM   1506 C  CB    . SER C 3 91  ? 69.278 8.934   18.595 1.00 27.45 ? 113 SER A CB    1 
ATOM   1507 O  OG    . SER C 3 91  ? 69.867 9.525   19.736 1.00 36.93 ? 113 SER A OG    1 
ATOM   1508 N  N     . ILE C 3 92  ? 66.829 7.041   17.709 1.00 23.85 ? 114 ILE A N     1 
ATOM   1509 C  CA    . ILE C 3 92  ? 66.002 6.625   16.590 1.00 24.27 ? 114 ILE A CA    1 
ATOM   1510 C  C     . ILE C 3 92  ? 64.812 7.564   16.526 1.00 26.47 ? 114 ILE A C     1 
ATOM   1511 O  O     . ILE C 3 92  ? 64.176 7.851   17.543 1.00 24.95 ? 114 ILE A O     1 
ATOM   1512 C  CB    . ILE C 3 92  ? 65.506 5.159   16.727 1.00 23.97 ? 114 ILE A CB    1 
ATOM   1513 C  CG1   . ILE C 3 92  ? 64.624 4.800   15.523 1.00 23.47 ? 114 ILE A CG1   1 
ATOM   1514 C  CG2   . ILE C 3 92  ? 64.732 4.970   18.027 1.00 25.39 ? 114 ILE A CG2   1 
ATOM   1515 C  CD1   . ILE C 3 92  ? 64.268 3.318   15.429 1.00 24.97 ? 114 ILE A CD1   1 
ATOM   1516 N  N     . ARG C 3 93  ? 64.543 8.073   15.331 1.00 25.75 ? 115 ARG A N     1 
ATOM   1517 C  CA    . ARG C 3 93  ? 63.415 8.964   15.129 1.00 28.65 ? 115 ARG A CA    1 
ATOM   1518 C  C     . ARG C 3 93  ? 62.503 8.380   14.063 1.00 29.94 ? 115 ARG A C     1 
ATOM   1519 O  O     . ARG C 3 93  ? 62.965 7.953   13.003 1.00 27.66 ? 115 ARG A O     1 
ATOM   1520 C  CB    . ARG C 3 93  ? 63.881 10.351  14.702 1.00 31.20 ? 115 ARG A CB    1 
ATOM   1521 C  CG    . ARG C 3 93  ? 62.722 11.232  14.270 1.00 38.99 ? 115 ARG A CG    1 
ATOM   1522 C  CD    . ARG C 3 93  ? 63.052 12.704  14.332 1.00 42.65 ? 115 ARG A CD    1 
ATOM   1523 N  NE    . ARG C 3 93  ? 61.860 13.506  14.062 1.00 47.76 ? 115 ARG A NE    1 
ATOM   1524 C  CZ    . ARG C 3 93  ? 61.755 14.804  14.325 1.00 49.21 ? 115 ARG A CZ    1 
ATOM   1525 N  NH1   . ARG C 3 93  ? 60.631 15.450  14.043 1.00 48.01 ? 115 ARG A NH1   1 
ATOM   1526 N  NH2   . ARG C 3 93  ? 62.771 15.454  14.880 1.00 51.20 ? 115 ARG A NH2   1 
ATOM   1527 N  N     . PHE C 3 94  ? 61.208 8.356   14.356 1.00 30.02 ? 116 PHE A N     1 
ATOM   1528 C  CA    . PHE C 3 94  ? 60.232 7.819   13.425 1.00 31.47 ? 116 PHE A CA    1 
ATOM   1529 C  C     . PHE C 3 94  ? 58.867 8.433   13.697 1.00 32.97 ? 116 PHE A C     1 
ATOM   1530 O  O     . PHE C 3 94  ? 58.359 8.364   14.816 1.00 31.13 ? 116 PHE A O     1 
ATOM   1531 C  CB    . PHE C 3 94  ? 60.154 6.297   13.577 1.00 30.87 ? 116 PHE A CB    1 
ATOM   1532 C  CG    . PHE C 3 94  ? 59.243 5.627   12.586 1.00 30.86 ? 116 PHE A CG    1 
ATOM   1533 C  CD1   . PHE C 3 94  ? 59.409 5.828   11.218 1.00 30.10 ? 116 PHE A CD1   1 
ATOM   1534 C  CD2   . PHE C 3 94  ? 58.248 4.758   13.019 1.00 32.13 ? 116 PHE A CD2   1 
ATOM   1535 C  CE1   . PHE C 3 94  ? 58.601 5.169   10.297 1.00 31.09 ? 116 PHE A CE1   1 
ATOM   1536 C  CE2   . PHE C 3 94  ? 57.434 4.094   12.107 1.00 30.99 ? 116 PHE A CE2   1 
ATOM   1537 C  CZ    . PHE C 3 94  ? 57.610 4.298   10.745 1.00 31.08 ? 116 PHE A CZ    1 
ATOM   1538 N  N     . ARG C 3 95  ? 58.294 9.051   12.670 1.00 34.44 ? 117 ARG A N     1 
ATOM   1539 C  CA    . ARG C 3 95  ? 56.978 9.665   12.774 1.00 36.98 ? 117 ARG A CA    1 
ATOM   1540 C  C     . ARG C 3 95  ? 56.853 10.722  13.870 1.00 37.84 ? 117 ARG A C     1 
ATOM   1541 O  O     . ARG C 3 95  ? 55.922 10.685  14.671 1.00 37.69 ? 117 ARG A O     1 
ATOM   1542 C  CB    . ARG C 3 95  ? 55.927 8.576   12.993 1.00 39.65 ? 117 ARG A CB    1 
ATOM   1543 C  CG    . ARG C 3 95  ? 55.876 7.548   11.875 1.00 43.88 ? 117 ARG A CG    1 
ATOM   1544 C  CD    . ARG C 3 95  ? 55.014 6.365   12.259 1.00 49.01 ? 117 ARG A CD    1 
ATOM   1545 N  NE    . ARG C 3 95  ? 53.671 6.778   12.649 1.00 54.56 ? 117 ARG A NE    1 
ATOM   1546 C  CZ    . ARG C 3 95  ? 52.745 5.949   13.119 1.00 57.73 ? 117 ARG A CZ    1 
ATOM   1547 N  NH1   . ARG C 3 95  ? 53.021 4.658   13.258 1.00 58.74 ? 117 ARG A NH1   1 
ATOM   1548 N  NH2   . ARG C 3 95  ? 51.546 6.410   13.449 1.00 58.41 ? 117 ARG A NH2   1 
ATOM   1549 N  N     . GLY C 3 96  ? 57.795 11.658  13.903 1.00 38.12 ? 118 GLY A N     1 
ATOM   1550 C  CA    . GLY C 3 96  ? 57.739 12.728  14.883 1.00 37.41 ? 118 GLY A CA    1 
ATOM   1551 C  C     . GLY C 3 96  ? 58.191 12.410  16.296 1.00 36.69 ? 118 GLY A C     1 
ATOM   1552 O  O     . GLY C 3 96  ? 58.317 13.320  17.116 1.00 36.29 ? 118 GLY A O     1 
ATOM   1553 N  N     . VAL C 3 97  ? 58.426 11.135  16.596 1.00 35.18 ? 119 VAL A N     1 
ATOM   1554 C  CA    . VAL C 3 97  ? 58.865 10.751  17.933 1.00 32.99 ? 119 VAL A CA    1 
ATOM   1555 C  C     . VAL C 3 97  ? 60.308 10.275  17.912 1.00 32.56 ? 119 VAL A C     1 
ATOM   1556 O  O     . VAL C 3 97  ? 60.743 9.604   16.974 1.00 32.87 ? 119 VAL A O     1 
ATOM   1557 C  CB    . VAL C 3 97  ? 57.982 9.631   18.527 1.00 34.91 ? 119 VAL A CB    1 
ATOM   1558 C  CG1   . VAL C 3 97  ? 58.450 9.294   19.938 1.00 33.92 ? 119 VAL A CG1   1 
ATOM   1559 C  CG2   . VAL C 3 97  ? 56.527 10.077  18.552 1.00 38.57 ? 119 VAL A CG2   1 
ATOM   1560 N  N     . SER C 3 98  ? 61.044 10.626  18.956 1.00 28.81 ? 120 SER A N     1 
ATOM   1561 C  CA    . SER C 3 98  ? 62.442 10.251  19.070 1.00 28.66 ? 120 SER A CA    1 
ATOM   1562 C  C     . SER C 3 98  ? 62.719 9.562   20.396 1.00 28.71 ? 120 SER A C     1 
ATOM   1563 O  O     . SER C 3 98  ? 62.206 9.970   21.435 1.00 26.79 ? 120 SER A O     1 
ATOM   1564 C  CB    . SER C 3 98  ? 63.317 11.500  18.956 1.00 33.52 ? 120 SER A CB    1 
ATOM   1565 O  OG    . SER C 3 98  ? 64.622 11.249  19.440 1.00 40.01 ? 120 SER A OG    1 
ATOM   1566 N  N     . ILE C 3 99  ? 63.523 8.507   20.353 1.00 26.31 ? 121 ILE A N     1 
ATOM   1567 C  CA    . ILE C 3 99  ? 63.898 7.791   21.559 1.00 25.32 ? 121 ILE A CA    1 
ATOM   1568 C  C     . ILE C 3 99  ? 65.411 7.739   21.556 1.00 27.03 ? 121 ILE A C     1 
ATOM   1569 O  O     . ILE C 3 99  ? 66.027 7.427   20.536 1.00 26.36 ? 121 ILE A O     1 
ATOM   1570 C  CB    . ILE C 3 99  ? 63.353 6.349   21.593 1.00 25.75 ? 121 ILE A CB    1 
ATOM   1571 C  CG1   . ILE C 3 99  ? 61.826 6.364   21.709 1.00 29.17 ? 121 ILE A CG1   1 
ATOM   1572 C  CG2   . ILE C 3 99  ? 63.958 5.595   22.779 1.00 27.21 ? 121 ILE A CG2   1 
ATOM   1573 C  CD1   . ILE C 3 99  ? 61.203 4.974   21.824 1.00 31.42 ? 121 ILE A CD1   1 
ATOM   1574 N  N     . THR C 3 100 ? 66.007 8.072   22.692 1.00 24.73 ? 122 THR A N     1 
ATOM   1575 C  CA    . THR C 3 100 ? 67.454 8.059   22.821 1.00 27.11 ? 122 THR A CA    1 
ATOM   1576 C  C     . THR C 3 100 ? 67.824 7.255   24.052 1.00 25.21 ? 122 THR A C     1 
ATOM   1577 O  O     . THR C 3 100 ? 67.279 7.475   25.132 1.00 26.81 ? 122 THR A O     1 
ATOM   1578 C  CB    . THR C 3 100 ? 68.003 9.489   22.969 1.00 28.57 ? 122 THR A CB    1 
ATOM   1579 O  OG1   . THR C 3 100 ? 67.715 10.232  21.778 1.00 33.01 ? 122 THR A OG1   1 
ATOM   1580 C  CG2   . THR C 3 100 ? 69.503 9.473   23.194 1.00 31.66 ? 122 THR A CG2   1 
ATOM   1581 N  N     . VAL C 3 101 ? 68.741 6.312   23.879 1.00 23.42 ? 123 VAL A N     1 
ATOM   1582 C  CA    . VAL C 3 101 ? 69.202 5.479   24.975 1.00 23.35 ? 123 VAL A CA    1 
ATOM   1583 C  C     . VAL C 3 101 ? 70.649 5.907   25.192 1.00 26.72 ? 123 VAL A C     1 
ATOM   1584 O  O     . VAL C 3 101 ? 71.459 5.831   24.272 1.00 26.82 ? 123 VAL A O     1 
ATOM   1585 C  CB    . VAL C 3 101 ? 69.156 3.987   24.592 1.00 25.33 ? 123 VAL A CB    1 
ATOM   1586 C  CG1   . VAL C 3 101 ? 69.561 3.130   25.779 1.00 24.14 ? 123 VAL A CG1   1 
ATOM   1587 C  CG2   . VAL C 3 101 ? 67.753 3.618   24.119 1.00 26.03 ? 123 VAL A CG2   1 
ATOM   1588 N  N     . SER C 3 102 ? 70.976 6.371   26.394 1.00 26.79 ? 124 SER A N     1 
ATOM   1589 C  CA    . SER C 3 102 ? 72.336 6.832   26.663 1.00 26.50 ? 124 SER A CA    1 
ATOM   1590 C  C     . SER C 3 102 ? 72.904 6.297   27.967 1.00 27.76 ? 124 SER A C     1 
ATOM   1591 O  O     . SER C 3 102 ? 72.163 5.899   28.870 1.00 26.72 ? 124 SER A O     1 
ATOM   1592 C  CB    . SER C 3 102 ? 72.380 8.367   26.689 1.00 25.89 ? 124 SER A CB    1 
ATOM   1593 O  OG    A SER C 3 102 ? 71.426 8.899   27.581 0.50 25.72 ? 124 SER A OG    1 
ATOM   1594 O  OG    B SER C 3 102 ? 71.773 8.927   25.545 0.50 27.93 ? 124 SER A OG    1 
ATOM   1595 N  N     . GLY C 3 103 ? 74.229 6.304   28.055 1.00 26.85 ? 125 GLY A N     1 
ATOM   1596 C  CA    . GLY C 3 103 ? 74.905 5.824   29.248 1.00 29.06 ? 125 GLY A CA    1 
ATOM   1597 C  C     . GLY C 3 103 ? 76.405 5.741   29.030 1.00 30.95 ? 125 GLY A C     1 
ATOM   1598 O  O     . GLY C 3 103 ? 76.893 6.026   27.936 1.00 30.32 ? 125 GLY A O     1 
ATOM   1599 N  N     . GLY C 3 104 ? 77.138 5.356   30.070 1.00 33.08 ? 126 GLY A N     1 
ATOM   1600 C  CA    . GLY C 3 104 ? 78.580 5.240   29.954 1.00 32.99 ? 126 GLY A CA    1 
ATOM   1601 C  C     . GLY C 3 104 ? 78.957 3.957   29.243 1.00 33.63 ? 126 GLY A C     1 
ATOM   1602 O  O     . GLY C 3 104 ? 78.184 3.000   29.234 1.00 32.94 ? 126 GLY A O     1 
ATOM   1603 N  N     . SER C 3 105 ? 80.148 3.934   28.654 1.00 34.26 ? 127 SER A N     1 
ATOM   1604 C  CA    . SER C 3 105 ? 80.625 2.766   27.922 1.00 35.00 ? 127 SER A CA    1 
ATOM   1605 C  C     . SER C 3 105 ? 80.628 1.479   28.738 1.00 35.58 ? 127 SER A C     1 
ATOM   1606 O  O     . SER C 3 105 ? 80.574 0.386   28.176 1.00 36.37 ? 127 SER A O     1 
ATOM   1607 C  CB    . SER C 3 105 ? 82.030 3.032   27.370 1.00 36.84 ? 127 SER A CB    1 
ATOM   1608 O  OG    . SER C 3 105 ? 82.906 3.479   28.390 1.00 37.43 ? 127 SER A OG    1 
ATOM   1609 N  N     . ARG C 3 106 ? 80.689 1.592   30.059 1.00 36.58 ? 128 ARG A N     1 
ATOM   1610 C  CA    . ARG C 3 106 ? 80.692 0.391   30.885 1.00 39.56 ? 128 ARG A CA    1 
ATOM   1611 C  C     . ARG C 3 106 ? 79.339 -0.309  30.889 1.00 39.51 ? 128 ARG A C     1 
ATOM   1612 O  O     . ARG C 3 106 ? 79.242 -1.481  31.246 1.00 41.03 ? 128 ARG A O     1 
ATOM   1613 C  CB    . ARG C 3 106 ? 81.118 0.728   32.315 1.00 43.61 ? 128 ARG A CB    1 
ATOM   1614 C  CG    . ARG C 3 106 ? 82.616 0.954   32.449 1.00 49.11 ? 128 ARG A CG    1 
ATOM   1615 C  CD    . ARG C 3 106 ? 82.980 1.557   33.791 1.00 54.90 ? 128 ARG A CD    1 
ATOM   1616 N  NE    . ARG C 3 106 ? 84.423 1.710   33.936 1.00 58.65 ? 128 ARG A NE    1 
ATOM   1617 C  CZ    . ARG C 3 106 ? 85.006 2.417   34.899 1.00 61.47 ? 128 ARG A CZ    1 
ATOM   1618 N  NH1   . ARG C 3 106 ? 84.266 3.044   35.807 1.00 62.15 ? 128 ARG A NH1   1 
ATOM   1619 N  NH2   . ARG C 3 106 ? 86.329 2.496   34.956 1.00 62.41 ? 128 ARG A NH2   1 
ATOM   1620 N  N     . THR C 3 107 ? 78.295 0.403   30.476 1.00 38.98 ? 129 THR A N     1 
ATOM   1621 C  CA    . THR C 3 107 ? 76.955 -0.178  30.445 1.00 39.25 ? 129 THR A CA    1 
ATOM   1622 C  C     . THR C 3 107 ? 76.504 -0.497  29.026 1.00 37.96 ? 129 THR A C     1 
ATOM   1623 O  O     . THR C 3 107 ? 75.333 -0.791  28.803 1.00 37.64 ? 129 THR A O     1 
ATOM   1624 C  CB    . THR C 3 107 ? 75.917 0.782   31.041 1.00 40.48 ? 129 THR A CB    1 
ATOM   1625 O  OG1   . THR C 3 107 ? 75.776 1.923   30.181 1.00 40.73 ? 129 THR A OG1   1 
ATOM   1626 C  CG2   . THR C 3 107 ? 76.342 1.233   32.426 1.00 41.66 ? 129 THR A CG2   1 
ATOM   1627 N  N     . LEU C 3 108 ? 77.432 -0.447  28.074 1.00 36.87 ? 130 LEU A N     1 
ATOM   1628 C  CA    . LEU C 3 108 ? 77.100 -0.693  26.676 1.00 34.96 ? 130 LEU A CA    1 
ATOM   1629 C  C     . LEU C 3 108 ? 76.219 -1.912  26.431 1.00 35.00 ? 130 LEU A C     1 
ATOM   1630 O  O     . LEU C 3 108 ? 75.298 -1.851  25.624 1.00 34.10 ? 130 LEU A O     1 
ATOM   1631 C  CB    . LEU C 3 108 ? 78.374 -0.807  25.832 1.00 35.74 ? 130 LEU A CB    1 
ATOM   1632 C  CG    . LEU C 3 108 ? 78.126 -0.825  24.317 1.00 33.12 ? 130 LEU A CG    1 
ATOM   1633 C  CD1   . LEU C 3 108 ? 77.343 0.419   23.914 1.00 31.94 ? 130 LEU A CD1   1 
ATOM   1634 C  CD2   . LEU C 3 108 ? 79.450 -0.883  23.568 1.00 33.24 ? 130 LEU A CD2   1 
ATOM   1635 N  N     . GLN C 3 109 ? 76.497 -3.016  27.116 1.00 35.42 ? 131 GLN A N     1 
ATOM   1636 C  CA    . GLN C 3 109 ? 75.702 -4.228  26.940 1.00 34.40 ? 131 GLN A CA    1 
ATOM   1637 C  C     . GLN C 3 109 ? 74.224 -3.946  27.216 1.00 34.59 ? 131 GLN A C     1 
ATOM   1638 O  O     . GLN C 3 109 ? 73.363 -4.273  26.398 1.00 32.35 ? 131 GLN A O     1 
ATOM   1639 C  CB    . GLN C 3 109 ? 76.201 -5.335  27.871 1.00 36.95 ? 131 GLN A CB    1 
ATOM   1640 N  N     . HIS C 3 110 ? 73.938 -3.341  28.366 1.00 34.07 ? 132 HIS A N     1 
ATOM   1641 C  CA    . HIS C 3 110 ? 72.565 -3.008  28.740 1.00 35.41 ? 132 HIS A CA    1 
ATOM   1642 C  C     . HIS C 3 110 ? 72.009 -1.961  27.788 1.00 33.63 ? 132 HIS A C     1 
ATOM   1643 O  O     . HIS C 3 110 ? 70.837 -2.003  27.415 1.00 32.53 ? 132 HIS A O     1 
ATOM   1644 C  CB    . HIS C 3 110 ? 72.505 -2.460  30.169 1.00 39.78 ? 132 HIS A CB    1 
ATOM   1645 C  CG    . HIS C 3 110 ? 72.743 -3.492  31.227 1.00 46.27 ? 132 HIS A CG    1 
ATOM   1646 N  ND1   . HIS C 3 110 ? 72.000 -4.649  31.321 1.00 49.43 ? 132 HIS A ND1   1 
ATOM   1647 C  CD2   . HIS C 3 110 ? 73.627 -3.529  32.253 1.00 49.20 ? 132 HIS A CD2   1 
ATOM   1648 C  CE1   . HIS C 3 110 ? 72.414 -5.354  32.359 1.00 51.16 ? 132 HIS A CE1   1 
ATOM   1649 N  NE2   . HIS C 3 110 ? 73.401 -4.697  32.942 1.00 51.49 ? 132 HIS A NE2   1 
ATOM   1650 N  N     . LEU C 3 111 ? 72.855 -1.010  27.407 1.00 30.32 ? 133 LEU A N     1 
ATOM   1651 C  CA    . LEU C 3 111 ? 72.442 0.050   26.493 1.00 29.84 ? 133 LEU A CA    1 
ATOM   1652 C  C     . LEU C 3 111 ? 71.918 -0.568  25.195 1.00 29.58 ? 133 LEU A C     1 
ATOM   1653 O  O     . LEU C 3 111 ? 70.868 -0.171  24.689 1.00 27.99 ? 133 LEU A O     1 
ATOM   1654 C  CB    . LEU C 3 111 ? 73.625 0.971   26.186 1.00 28.52 ? 133 LEU A CB    1 
ATOM   1655 C  CG    A LEU C 3 111 ? 74.078 1.974   27.247 0.50 23.91 ? 133 LEU A CG    1 
ATOM   1656 C  CG    B LEU C 3 111 ? 73.408 2.459   25.928 0.50 30.73 ? 133 LEU A CG    1 
ATOM   1657 C  CD1   A LEU C 3 111 ? 75.176 2.853   26.657 0.50 20.37 ? 133 LEU A CD1   1 
ATOM   1658 C  CD1   B LEU C 3 111 ? 72.656 3.082   27.088 0.50 32.06 ? 133 LEU A CD1   1 
ATOM   1659 C  CD2   A LEU C 3 111 ? 72.904 2.829   27.686 0.50 25.54 ? 133 LEU A CD2   1 
ATOM   1660 C  CD2   B LEU C 3 111 ? 74.765 3.138   25.765 0.50 31.14 ? 133 LEU A CD2   1 
ATOM   1661 N  N     . CYS C 3 112 ? 72.650 -1.545  24.667 1.00 29.10 ? 134 CYS A N     1 
ATOM   1662 C  CA    . CYS C 3 112 ? 72.253 -2.208  23.428 1.00 29.29 ? 134 CYS A CA    1 
ATOM   1663 C  C     . CYS C 3 112 ? 70.949 -2.981  23.585 1.00 29.10 ? 134 CYS A C     1 
ATOM   1664 O  O     . CYS C 3 112 ? 70.139 -3.027  22.658 1.00 28.06 ? 134 CYS A O     1 
ATOM   1665 C  CB    . CYS C 3 112 ? 73.358 -3.160  22.950 1.00 29.87 ? 134 CYS A CB    1 
ATOM   1666 S  SG    . CYS C 3 112 ? 74.807 -2.335  22.231 1.00 32.48 ? 134 CYS A SG    1 
ATOM   1667 N  N     . GLU C 3 113 ? 70.754 -3.597  24.748 1.00 30.32 ? 135 GLU A N     1 
ATOM   1668 C  CA    . GLU C 3 113 ? 69.535 -4.367  25.002 1.00 33.31 ? 135 GLU A CA    1 
ATOM   1669 C  C     . GLU C 3 113 ? 68.341 -3.426  24.986 1.00 30.43 ? 135 GLU A C     1 
ATOM   1670 O  O     . GLU C 3 113 ? 67.314 -3.718  24.379 1.00 29.78 ? 135 GLU A O     1 
ATOM   1671 C  CB    . GLU C 3 113 ? 69.616 -5.068  26.359 1.00 37.67 ? 135 GLU A CB    1 
ATOM   1672 C  CG    . GLU C 3 113 ? 70.847 -5.939  26.538 1.00 44.69 ? 135 GLU A CG    1 
ATOM   1673 C  CD    . GLU C 3 113 ? 70.878 -6.630  27.892 1.00 48.41 ? 135 GLU A CD    1 
ATOM   1674 O  OE1   . GLU C 3 113 ? 70.591 -5.963  28.911 1.00 49.51 ? 135 GLU A OE1   1 
ATOM   1675 O  OE2   . GLU C 3 113 ? 71.197 -7.837  27.937 1.00 51.99 ? 135 GLU A OE2   1 
HETATM 1676 N  N     . MSE C 3 114 ? 68.486 -2.286  25.653 1.00 30.06 ? 136 MSE A N     1 
HETATM 1677 C  CA    . MSE C 3 114 ? 67.418 -1.294  25.697 1.00 31.66 ? 136 MSE A CA    1 
HETATM 1678 C  C     . MSE C 3 114 ? 67.226 -0.667  24.325 1.00 30.27 ? 136 MSE A C     1 
HETATM 1679 O  O     . MSE C 3 114 ? 66.099 -0.381  23.913 1.00 30.55 ? 136 MSE A O     1 
HETATM 1680 C  CB    . MSE C 3 114 ? 67.747 -0.194  26.709 1.00 32.26 ? 136 MSE A CB    1 
HETATM 1681 C  CG    . MSE C 3 114 ? 67.679 -0.639  28.157 1.00 40.96 ? 136 MSE A CG    1 
HETATM 1682 SE SE    . MSE C 3 114 ? 65.924 -1.312  28.595 1.00 51.27 ? 136 MSE A SE    1 
HETATM 1683 C  CE    . MSE C 3 114 ? 66.345 -3.201  28.661 1.00 47.64 ? 136 MSE A CE    1 
ATOM   1684 N  N     . ALA C 3 115 ? 68.330 -0.456  23.613 1.00 27.86 ? 137 ALA A N     1 
ATOM   1685 C  CA    . ALA C 3 115 ? 68.264 0.150   22.290 1.00 27.56 ? 137 ALA A CA    1 
ATOM   1686 C  C     . ALA C 3 115 ? 67.479 -0.698  21.296 1.00 25.41 ? 137 ALA A C     1 
ATOM   1687 O  O     . ALA C 3 115 ? 66.604 -0.195  20.590 1.00 24.53 ? 137 ALA A O     1 
ATOM   1688 C  CB    . ALA C 3 115 ? 69.680 0.407   21.755 1.00 26.93 ? 137 ALA A CB    1 
ATOM   1689 N  N     . ILE C 3 116 ? 67.782 -1.988  21.240 1.00 25.66 ? 138 ILE A N     1 
ATOM   1690 C  CA    . ILE C 3 116 ? 67.097 -2.859  20.293 1.00 27.68 ? 138 ILE A CA    1 
ATOM   1691 C  C     . ILE C 3 116 ? 65.614 -2.988  20.632 1.00 27.60 ? 138 ILE A C     1 
ATOM   1692 O  O     . ILE C 3 116 ? 64.776 -3.091  19.737 1.00 27.39 ? 138 ILE A O     1 
ATOM   1693 C  CB    . ILE C 3 116 ? 67.766 -4.262  20.231 1.00 29.42 ? 138 ILE A CB    1 
ATOM   1694 C  CG1   . ILE C 3 116 ? 67.219 -5.046  19.034 1.00 31.51 ? 138 ILE A CG1   1 
ATOM   1695 C  CG2   . ILE C 3 116 ? 67.537 -5.027  21.523 1.00 30.92 ? 138 ILE A CG2   1 
ATOM   1696 C  CD1   . ILE C 3 116 ? 67.584 -4.443  17.687 1.00 31.40 ? 138 ILE A CD1   1 
ATOM   1697 N  N     . ARG C 3 117 ? 65.284 -2.965  21.919 1.00 28.65 ? 139 ARG A N     1 
ATOM   1698 C  CA    . ARG C 3 117 ? 63.885 -3.065  22.324 1.00 32.13 ? 139 ARG A CA    1 
ATOM   1699 C  C     . ARG C 3 117 ? 63.136 -1.789  21.960 1.00 29.79 ? 139 ARG A C     1 
ATOM   1700 O  O     . ARG C 3 117 ? 61.997 -1.844  21.498 1.00 31.38 ? 139 ARG A O     1 
ATOM   1701 C  CB    . ARG C 3 117 ? 63.779 -3.339  23.825 1.00 34.25 ? 139 ARG A CB    1 
ATOM   1702 C  CG    . ARG C 3 117 ? 64.215 -4.744  24.196 1.00 42.28 ? 139 ARG A CG    1 
ATOM   1703 C  CD    . ARG C 3 117 ? 64.243 -4.964  25.694 1.00 49.26 ? 139 ARG A CD    1 
ATOM   1704 N  NE    . ARG C 3 117 ? 64.640 -6.331  26.024 1.00 56.01 ? 139 ARG A NE    1 
ATOM   1705 C  CZ    . ARG C 3 117 ? 64.858 -6.772  27.259 1.00 61.60 ? 139 ARG A CZ    1 
ATOM   1706 N  NH1   . ARG C 3 117 ? 64.718 -5.952  28.295 1.00 63.61 ? 139 ARG A NH1   1 
ATOM   1707 N  NH2   . ARG C 3 117 ? 65.214 -8.034  27.462 1.00 63.39 ? 139 ARG A NH2   1 
ATOM   1708 N  N     . SER C 3 118 ? 63.781 -0.642  22.153 1.00 28.67 ? 140 SER A N     1 
ATOM   1709 C  CA    . SER C 3 118 ? 63.166 0.641   21.825 1.00 27.20 ? 140 SER A CA    1 
ATOM   1710 C  C     . SER C 3 118 ? 62.947 0.729   20.315 1.00 27.35 ? 140 SER A C     1 
ATOM   1711 O  O     . SER C 3 118 ? 61.936 1.252   19.845 1.00 25.34 ? 140 SER A O     1 
ATOM   1712 C  CB    . SER C 3 118 ? 64.067 1.796   22.270 1.00 27.68 ? 140 SER A CB    1 
ATOM   1713 O  OG    . SER C 3 118 ? 64.360 1.719   23.653 1.00 28.24 ? 140 SER A OG    1 
ATOM   1714 N  N     . LYS C 3 119 ? 63.911 0.221   19.557 1.00 25.16 ? 141 LYS A N     1 
ATOM   1715 C  CA    . LYS C 3 119 ? 63.820 0.241   18.102 1.00 24.10 ? 141 LYS A CA    1 
ATOM   1716 C  C     . LYS C 3 119 ? 62.608 -0.564  17.640 1.00 26.15 ? 141 LYS A C     1 
ATOM   1717 O  O     . LYS C 3 119 ? 61.802 -0.092  16.832 1.00 25.83 ? 141 LYS A O     1 
ATOM   1718 C  CB    . LYS C 3 119 ? 65.104 -0.335  17.493 1.00 23.59 ? 141 LYS A CB    1 
ATOM   1719 C  CG    . LYS C 3 119 ? 65.149 -0.304  15.972 1.00 24.39 ? 141 LYS A CG    1 
ATOM   1720 C  CD    . LYS C 3 119 ? 66.525 -0.723  15.468 1.00 23.07 ? 141 LYS A CD    1 
ATOM   1721 C  CE    . LYS C 3 119 ? 66.577 -0.705  13.953 1.00 24.57 ? 141 LYS A CE    1 
ATOM   1722 N  NZ    . LYS C 3 119 ? 67.941 -0.991  13.445 1.00 23.94 ? 141 LYS A NZ    1 
ATOM   1723 N  N     . GLN C 3 120 ? 62.474 -1.779  18.160 1.00 27.48 ? 142 GLN A N     1 
ATOM   1724 C  CA    . GLN C 3 120 ? 61.358 -2.638  17.785 1.00 31.28 ? 142 GLN A CA    1 
ATOM   1725 C  C     . GLN C 3 120 ? 60.020 -2.002  18.151 1.00 31.56 ? 142 GLN A C     1 
ATOM   1726 O  O     . GLN C 3 120 ? 59.083 -2.025  17.361 1.00 31.58 ? 142 GLN A O     1 
ATOM   1727 C  CB    . GLN C 3 120 ? 61.483 -4.011  18.458 1.00 33.43 ? 142 GLN A CB    1 
ATOM   1728 C  CG    A GLN C 3 120 ? 60.453 -5.006  17.914 0.50 38.09 ? 142 GLN A CG    1 
ATOM   1729 C  CG    B GLN C 3 120 ? 62.874 -4.624  18.343 0.50 33.39 ? 142 GLN A CG    1 
ATOM   1730 C  CD    A GLN C 3 120 ? 60.877 -6.460  18.039 0.50 39.83 ? 142 GLN A CD    1 
ATOM   1731 C  CD    B GLN C 3 120 ? 63.084 -5.824  19.255 0.50 35.58 ? 142 GLN A CD    1 
ATOM   1732 O  OE1   A GLN C 3 120 ? 60.176 -7.362  17.578 0.50 42.15 ? 142 GLN A OE1   1 
ATOM   1733 O  OE1   B GLN C 3 120 ? 62.648 -5.829  20.406 0.50 37.69 ? 142 GLN A OE1   1 
ATOM   1734 N  NE2   A GLN C 3 120 ? 62.026 -6.693  18.661 0.50 39.90 ? 142 GLN A NE2   1 
ATOM   1735 N  NE2   B GLN C 3 120 ? 63.771 -6.839  18.748 0.50 36.59 ? 142 GLN A NE2   1 
ATOM   1736 N  N     . GLU C 3 121 ? 59.928 -1.429  19.346 1.00 32.95 ? 143 GLU A N     1 
ATOM   1737 C  CA    . GLU C 3 121 ? 58.680 -0.802  19.769 1.00 34.86 ? 143 GLU A CA    1 
ATOM   1738 C  C     . GLU C 3 121 ? 58.366 0.425   18.929 1.00 34.53 ? 143 GLU A C     1 
ATOM   1739 O  O     . GLU C 3 121 ? 57.216 0.673   18.580 1.00 33.89 ? 143 GLU A O     1 
ATOM   1740 C  CB    . GLU C 3 121 ? 58.752 -0.408  21.246 1.00 39.54 ? 143 GLU A CB    1 
ATOM   1741 C  CG    . GLU C 3 121 ? 58.600 -1.577  22.206 1.00 46.93 ? 143 GLU A CG    1 
ATOM   1742 C  CD    . GLU C 3 121 ? 57.255 -2.275  22.068 1.00 52.45 ? 143 GLU A CD    1 
ATOM   1743 O  OE1   . GLU C 3 121 ? 56.211 -1.597  22.190 1.00 54.37 ? 143 GLU A OE1   1 
ATOM   1744 O  OE2   . GLU C 3 121 ? 57.243 -3.503  21.837 1.00 55.70 ? 143 GLU A OE2   1 
HETATM 1745 N  N     . MSE C 3 122 ? 59.399 1.191   18.601 1.00 33.97 ? 144 MSE A N     1 
HETATM 1746 C  CA    . MSE C 3 122 ? 59.235 2.397   17.803 1.00 36.08 ? 144 MSE A CA    1 
HETATM 1747 C  C     . MSE C 3 122 ? 58.677 2.075   16.416 1.00 33.64 ? 144 MSE A C     1 
HETATM 1748 O  O     . MSE C 3 122 ? 57.748 2.726   15.934 1.00 31.03 ? 144 MSE A O     1 
HETATM 1749 C  CB    . MSE C 3 122 ? 60.585 3.108   17.655 1.00 39.64 ? 144 MSE A CB    1 
HETATM 1750 C  CG    . MSE C 3 122 ? 60.506 4.444   16.944 1.00 48.05 ? 144 MSE A CG    1 
HETATM 1751 SE SE    . MSE C 3 122 ? 59.844 5.847   18.105 1.00 62.71 ? 144 MSE A SE    1 
HETATM 1752 C  CE    . MSE C 3 122 ? 61.448 6.912   18.190 1.00 57.82 ? 144 MSE A CE    1 
ATOM   1753 N  N     . LEU C 3 123 ? 59.254 1.065   15.779 1.00 31.29 ? 145 LEU A N     1 
ATOM   1754 C  CA    . LEU C 3 123 ? 58.835 0.669   14.440 1.00 32.49 ? 145 LEU A CA    1 
ATOM   1755 C  C     . LEU C 3 123 ? 57.496 -0.057  14.407 1.00 36.37 ? 145 LEU A C     1 
ATOM   1756 O  O     . LEU C 3 123 ? 56.853 -0.138  13.359 1.00 34.38 ? 145 LEU A O     1 
ATOM   1757 C  CB    . LEU C 3 123 ? 59.923 -0.194  13.796 1.00 29.20 ? 145 LEU A CB    1 
ATOM   1758 C  CG    . LEU C 3 123 ? 61.259 0.552   13.689 1.00 26.75 ? 145 LEU A CG    1 
ATOM   1759 C  CD1   . LEU C 3 123 ? 62.297 -0.307  12.967 1.00 28.85 ? 145 LEU A CD1   1 
ATOM   1760 C  CD2   . LEU C 3 123 ? 61.040 1.857   12.940 1.00 25.47 ? 145 LEU A CD2   1 
ATOM   1761 N  N     . GLN C 3 124 ? 57.072 -0.582  15.551 1.00 41.81 ? 146 GLN A N     1 
ATOM   1762 C  CA    . GLN C 3 124 ? 55.795 -1.281  15.616 1.00 49.55 ? 146 GLN A CA    1 
ATOM   1763 C  C     . GLN C 3 124 ? 54.753 -0.418  16.316 1.00 54.55 ? 146 GLN A C     1 
ATOM   1764 O  O     . GLN C 3 124 ? 53.891 -0.923  17.034 1.00 55.45 ? 146 GLN A O     1 
ATOM   1765 C  CB    . GLN C 3 124 ? 55.947 -2.614  16.348 1.00 49.24 ? 146 GLN A CB    1 
ATOM   1766 C  CG    . GLN C 3 124 ? 57.015 -3.515  15.756 1.00 51.47 ? 146 GLN A CG    1 
ATOM   1767 C  CD    . GLN C 3 124 ? 56.896 -4.949  16.229 1.00 54.32 ? 146 GLN A CD    1 
ATOM   1768 O  OE1   . GLN C 3 124 ? 56.039 -5.700  15.758 1.00 54.59 ? 146 GLN A OE1   1 
ATOM   1769 N  NE2   . GLN C 3 124 ? 57.748 -5.335  17.172 1.00 54.64 ? 146 GLN A NE2   1 
HETATM 1770 N  N     . MSE C 3 125 ? 54.848 0.891   16.103 1.00 60.89 ? 147 MSE A N     1 
HETATM 1771 C  CA    . MSE C 3 125 ? 53.914 1.846   16.689 1.00 67.38 ? 147 MSE A CA    1 
HETATM 1772 C  C     . MSE C 3 125 ? 52.739 2.011   15.727 1.00 68.59 ? 147 MSE A C     1 
HETATM 1773 O  O     . MSE C 3 125 ? 52.935 2.290   14.544 1.00 69.22 ? 147 MSE A O     1 
HETATM 1774 C  CB    . MSE C 3 125 ? 54.615 3.194   16.911 1.00 72.10 ? 147 MSE A CB    1 
HETATM 1775 C  CG    . MSE C 3 125 ? 53.719 4.295   17.468 1.00 79.45 ? 147 MSE A CG    1 
HETATM 1776 SE SE    . MSE C 3 125 ? 54.669 5.946   17.846 1.00 90.77 ? 147 MSE A SE    1 
HETATM 1777 C  CE    . MSE C 3 125 ? 54.685 6.709   16.069 1.00 84.97 ? 147 MSE A CE    1 
ATOM   1778 N  N     . ALA C 3 126 ? 51.523 1.830   16.233 1.00 70.39 ? 148 ALA A N     1 
ATOM   1779 C  CA    . ALA C 3 126 ? 50.326 1.950   15.405 1.00 71.58 ? 148 ALA A CA    1 
ATOM   1780 C  C     . ALA C 3 126 ? 50.075 3.394   14.984 1.00 72.22 ? 148 ALA A C     1 
ATOM   1781 O  O     . ALA C 3 126 ? 50.812 4.284   15.461 1.00 72.78 ? 148 ALA A O     1 
ATOM   1782 C  CB    . ALA C 3 126 ? 49.115 1.408   16.160 1.00 71.54 ? 148 ALA A CB    1 
HETATM 1783 S  S     . SO4 D 4 .   ? 79.636 4.849   8.310  1.00 43.15 ? 159 SO4 A S     1 
HETATM 1784 O  O1    . SO4 D 4 .   ? 78.627 4.678   9.374  1.00 40.87 ? 159 SO4 A O1    1 
HETATM 1785 O  O2    . SO4 D 4 .   ? 80.986 4.925   8.906  1.00 42.75 ? 159 SO4 A O2    1 
HETATM 1786 O  O3    . SO4 D 4 .   ? 79.353 6.089   7.566  1.00 44.78 ? 159 SO4 A O3    1 
HETATM 1787 O  O4    . SO4 D 4 .   ? 79.574 3.700   7.388  1.00 42.36 ? 159 SO4 A O4    1 
HETATM 1788 S  S     . SO4 E 4 .   ? 68.933 12.634  -7.913 1.00 53.50 ? 160 SO4 A S     1 
HETATM 1789 O  O1    . SO4 E 4 .   ? 69.485 13.821  -7.230 1.00 53.53 ? 160 SO4 A O1    1 
HETATM 1790 O  O2    . SO4 E 4 .   ? 69.880 11.511  -7.774 1.00 55.78 ? 160 SO4 A O2    1 
HETATM 1791 O  O3    . SO4 E 4 .   ? 68.736 12.935  -9.345 1.00 55.43 ? 160 SO4 A O3    1 
HETATM 1792 O  O4    . SO4 E 4 .   ? 67.638 12.265  -7.310 1.00 50.47 ? 160 SO4 A O4    1 
HETATM 1793 O  O     . HOH F 5 .   ? 69.788 10.635  6.729  1.00 47.54 ? 31  HOH B O     1 
HETATM 1794 O  O     . HOH F 5 .   ? 76.180 9.385   26.221 1.00 41.75 ? 39  HOH B O     1 
HETATM 1795 O  O     . HOH F 5 .   ? 69.522 14.730  0.548  1.00 51.27 ? 43  HOH B O     1 
HETATM 1796 O  O     . HOH F 5 .   ? 60.163 13.464  6.421  1.00 64.66 ? 62  HOH B O     1 
HETATM 1797 O  O     . HOH G 5 .   ? 69.925 10.800  13.769 1.00 42.33 ? 22  HOH C O     1 
HETATM 1798 O  O     . HOH G 5 .   ? 66.687 10.981  16.940 1.00 42.60 ? 23  HOH C O     1 
HETATM 1799 O  O     . HOH G 5 .   ? 76.374 11.154  21.184 1.00 51.98 ? 24  HOH C O     1 
HETATM 1800 O  O     . HOH G 5 .   ? 71.025 12.417  23.650 1.00 47.54 ? 25  HOH C O     1 
HETATM 1801 O  O     . HOH H 5 .   ? 60.054 3.094   1.953  1.00 27.46 ? 161 HOH A O     1 
HETATM 1802 O  O     . HOH H 5 .   ? 72.931 -2.475  -0.034 1.00 31.04 ? 162 HOH A O     1 
HETATM 1803 O  O     . HOH H 5 .   ? 58.350 -4.943  2.136  1.00 36.97 ? 163 HOH A O     1 
HETATM 1804 O  O     . HOH H 5 .   ? 67.201 8.955   -3.696 1.00 26.56 ? 164 HOH A O     1 
HETATM 1805 O  O     . HOH H 5 .   ? 61.045 5.000   -2.710 1.00 27.56 ? 165 HOH A O     1 
HETATM 1806 O  O     . HOH H 5 .   ? 67.679 9.870   14.839 1.00 39.08 ? 166 HOH A O     1 
HETATM 1807 O  O     . HOH H 5 .   ? 67.330 9.407   -6.414 1.00 36.47 ? 167 HOH A O     1 
HETATM 1808 O  O     . HOH H 5 .   ? 77.443 6.157   5.471  1.00 32.63 ? 168 HOH A O     1 
HETATM 1809 O  O     . HOH H 5 .   ? 84.900 2.065   15.257 1.00 32.94 ? 169 HOH A O     1 
HETATM 1810 O  O     . HOH H 5 .   ? 69.077 -3.168  14.808 1.00 27.88 ? 170 HOH A O     1 
HETATM 1811 O  O     . HOH H 5 .   ? 81.128 12.120  14.019 1.00 35.69 ? 171 HOH A O     1 
HETATM 1812 O  O     . HOH H 5 .   ? 61.733 3.490   -0.221 1.00 27.61 ? 172 HOH A O     1 
HETATM 1813 O  O     . HOH H 5 .   ? 62.578 -1.345  1.606  1.00 32.17 ? 173 HOH A O     1 
HETATM 1814 O  O     . HOH H 5 .   ? 68.069 15.563  -5.716 1.00 35.30 ? 174 HOH A O     1 
HETATM 1815 O  O     . HOH H 5 .   ? 77.431 7.926   9.402  1.00 33.23 ? 175 HOH A O     1 
HETATM 1816 O  O     . HOH H 5 .   ? 73.027 8.713   18.792 1.00 33.38 ? 176 HOH A O     1 
HETATM 1817 O  O     . HOH H 5 .   ? 68.969 -7.320  7.390  1.00 30.09 ? 177 HOH A O     1 
HETATM 1818 O  O     . HOH H 5 .   ? 65.768 -7.911  17.056 1.00 39.29 ? 178 HOH A O     1 
HETATM 1819 O  O     . HOH H 5 .   ? 76.462 3.933   4.097  1.00 31.59 ? 179 HOH A O     1 
HETATM 1820 O  O     . HOH H 5 .   ? 60.372 0.403   2.000  1.00 40.76 ? 180 HOH A O     1 
HETATM 1821 O  O     . HOH H 5 .   ? 75.477 -3.095  0.348  1.00 32.93 ? 181 HOH A O     1 
HETATM 1822 O  O     . HOH H 5 .   ? 59.190 -9.226  11.146 1.00 39.45 ? 182 HOH A O     1 
HETATM 1823 O  O     . HOH H 5 .   ? 68.851 -4.481  2.158  1.00 43.32 ? 183 HOH A O     1 
HETATM 1824 O  O     . HOH H 5 .   ? 66.476 -8.953  11.875 1.00 36.91 ? 184 HOH A O     1 
HETATM 1825 O  O     . HOH H 5 .   ? 56.657 7.015   -2.406 1.00 46.72 ? 185 HOH A O     1 
HETATM 1826 O  O     . HOH H 5 .   ? 72.081 9.119   7.318  1.00 37.01 ? 186 HOH A O     1 
HETATM 1827 O  O     . HOH H 5 .   ? 60.036 12.043  12.245 1.00 50.38 ? 187 HOH A O     1 
HETATM 1828 O  O     . HOH H 5 .   ? 69.777 15.502  -2.889 1.00 39.33 ? 188 HOH A O     1 
HETATM 1829 O  O     . HOH H 5 .   ? 70.960 -0.540  3.530  1.00 38.57 ? 189 HOH A O     1 
HETATM 1830 O  O     . HOH H 5 .   ? 68.794 9.045   26.798 1.00 33.38 ? 190 HOH A O     1 
HETATM 1831 O  O     . HOH H 5 .   ? 81.156 -2.914  13.926 1.00 28.97 ? 191 HOH A O     1 
HETATM 1832 O  O     . HOH H 5 .   ? 57.653 15.794  16.866 1.00 31.50 ? 192 HOH A O     1 
HETATM 1833 O  O     . HOH H 5 .   ? 57.817 4.437   6.923  1.00 39.14 ? 193 HOH A O     1 
HETATM 1834 O  O     . HOH H 5 .   ? 65.436 -0.567  1.068  1.00 41.82 ? 194 HOH A O     1 
HETATM 1835 O  O     . HOH H 5 .   ? 57.509 3.876   1.284  1.00 43.81 ? 195 HOH A O     1 
HETATM 1836 O  O     . HOH H 5 .   ? 62.461 -2.818  3.849  1.00 30.34 ? 196 HOH A O     1 
HETATM 1837 O  O     . HOH H 5 .   ? 71.106 10.768  -0.954 1.00 50.16 ? 197 HOH A O     1 
HETATM 1838 O  O     . HOH H 5 .   ? 84.747 1.613   29.338 1.00 43.59 ? 198 HOH A O     1 
HETATM 1839 O  O     . HOH H 5 .   ? 69.855 -7.275  15.077 1.00 40.77 ? 199 HOH A O     1 
HETATM 1840 O  O     . HOH H 5 .   ? 88.383 0.536   28.436 1.00 59.00 ? 200 HOH A O     1 
HETATM 1841 O  O     . HOH H 5 .   ? 75.659 7.983   7.058  1.00 35.86 ? 201 HOH A O     1 
HETATM 1842 O  O     . HOH H 5 .   ? 71.517 -3.275  2.407  1.00 43.85 ? 202 HOH A O     1 
HETATM 1843 O  O     . HOH H 5 .   ? 78.321 2.002   3.990  1.00 39.30 ? 203 HOH A O     1 
HETATM 1844 O  O     . HOH H 5 .   ? 88.192 0.495   13.775 1.00 47.21 ? 204 HOH A O     1 
HETATM 1845 O  O     . HOH H 5 .   ? 80.188 14.077  16.524 1.00 49.25 ? 205 HOH A O     1 
HETATM 1846 O  O     . HOH H 5 .   ? 71.430 7.001   -0.177 1.00 53.04 ? 206 HOH A O     1 
HETATM 1847 O  O     . HOH H 5 .   ? 82.527 0.174   8.516  1.00 48.06 ? 207 HOH A O     1 
HETATM 1848 O  O     . HOH H 5 .   ? 82.240 7.583   9.616  1.00 46.71 ? 208 HOH A O     1 
HETATM 1849 O  O     . HOH H 5 .   ? 81.949 11.047  26.074 1.00 44.03 ? 209 HOH A O     1 
HETATM 1850 O  O     . HOH H 5 .   ? 60.136 10.583  3.731  1.00 31.78 ? 210 HOH A O     1 
HETATM 1851 O  O     . HOH H 5 .   ? 62.893 10.008  11.066 1.00 41.07 ? 211 HOH A O     1 
HETATM 1852 O  O     . HOH H 5 .   ? 60.956 9.282   9.515  1.00 42.87 ? 212 HOH A O     1 
HETATM 1853 O  O     . HOH H 5 .   ? 59.486 14.501  11.780 1.00 56.52 ? 213 HOH A O     1 
HETATM 1854 O  O     . HOH H 5 .   ? 61.542 11.401  7.068  1.00 45.10 ? 214 HOH A O     1 
HETATM 1855 O  O     . HOH H 5 .   ? 75.167 -9.576  18.837 1.00 37.27 ? 215 HOH A O     1 
HETATM 1856 O  O     . HOH H 5 .   ? 71.857 -7.815  19.220 1.00 50.06 ? 216 HOH A O     1 
HETATM 1857 O  O     . HOH H 5 .   ? 78.365 9.602   22.185 1.00 50.22 ? 217 HOH A O     1 
HETATM 1858 O  O     . HOH H 5 .   ? 77.333 -1.521  0.061  1.00 47.04 ? 218 HOH A O     1 
HETATM 1859 O  O     . HOH H 5 .   ? 71.447 -6.452  21.745 1.00 51.10 ? 219 HOH A O     1 
HETATM 1860 O  O     . HOH H 5 .   ? 76.103 -5.046  -1.546 1.00 50.69 ? 220 HOH A O     1 
HETATM 1861 O  O     . HOH H 5 .   ? 77.066 -9.226  14.147 1.00 40.24 ? 221 HOH A O     1 
HETATM 1862 O  O     . HOH H 5 .   ? 90.651 1.380   13.413 1.00 50.77 ? 222 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   C   1   1   1   C   C   B . n 
A 1 2   G   2   2   2   G   G   B . n 
A 1 3   U   3   3   3   U   U   B . n 
A 1 4   A   4   4   4   A   A   B . n 
A 1 5   C   5   5   5   C   C   B . n 
A 1 6   G   6   6   6   G   G   B . n 
A 1 7   C   7   7   7   C   C   B . n 
A 1 8   G   8   8   8   G   G   B . n 
A 1 9   G   9   9   9   G   G   B . n 
A 1 10  A   10  10  10  A   A   B . n 
A 1 11  A   11  11  11  A   A   B . n 
A 1 12  U   12  12  12  U   U   B . n 
A 1 13  A   13  13  13  A   A   B . n 
A 1 14  C   14  14  14  C   C   B . n 
A 1 15  U   15  15  15  U   U   B . n 
A 1 16  U   16  16  16  U   U   B . n 
A 1 17  C   17  17  17  C   C   B . n 
A 1 18  G   18  18  18  G   G   B . n 
A 1 19  A   19  19  19  A   A   B . n 
A 1 20  U   20  20  20  U   U   B . n 
A 1 21  U   21  21  ?   ?   ?   B . n 
B 2 1   U   1   1   1   U   U   C . n 
B 2 2   C   2   2   2   C   C   C . n 
B 2 3   G   3   3   3   G   G   C . n 
B 2 4   A   4   4   4   A   A   C . n 
B 2 5   A   5   5   5   A   A   C . n 
B 2 6   G   6   6   6   G   G   C . n 
B 2 7   U   7   7   7   U   U   C . n 
B 2 8   A   8   8   8   A   A   C . n 
B 2 9   U   9   9   9   U   U   C . n 
B 2 10  U   10  10  10  U   U   C . n 
B 2 11  C   11  11  11  C   C   C . n 
B 2 12  C   12  12  12  C   C   C . n 
B 2 13  G   13  13  13  G   G   C . n 
B 2 14  C   14  14  14  C   C   C . n 
B 2 15  G   15  15  15  G   G   C . n 
B 2 16  U   16  16  16  U   U   C . n 
B 2 17  A   17  17  17  A   A   C . n 
B 2 18  C   18  18  18  C   C   C . n 
B 2 19  G   19  19  19  G   G   C . n 
B 2 20  U   20  20  20  U   U   C . n 
B 2 21  U   21  21  ?   ?   ?   C . n 
C 3 1   GLY 1   23  ?   ?   ?   A . n 
C 3 2   SER 2   24  ?   ?   ?   A . n 
C 3 3   HIS 3   25  25  HIS HIS A . n 
C 3 4   MSE 4   26  26  MSE MSE A . n 
C 3 5   THR 5   27  27  THR THR A . n 
C 3 6   SER 6   28  28  SER SER A . n 
C 3 7   PRO 7   29  29  PRO PRO A . n 
C 3 8   PHE 8   30  30  PHE PHE A . n 
C 3 9   LYS 9   31  31  LYS LYS A . n 
C 3 10  LEU 10  32  32  LEU LEU A . n 
C 3 11  PRO 11  33  33  PRO PRO A . n 
C 3 12  ASP 12  34  34  ASP ASP A . n 
C 3 13  GLU 13  35  35  GLU GLU A . n 
C 3 14  SER 14  36  36  SER SER A . n 
C 3 15  PRO 15  37  37  PRO PRO A . n 
C 3 16  SER 16  38  38  SER SER A . n 
C 3 17  TRP 17  39  39  TRP TRP A . n 
C 3 18  THR 18  40  40  THR THR A . n 
C 3 19  GLU 19  41  41  GLU GLU A . n 
C 3 20  TRP 20  42  42  TRP TRP A . n 
C 3 21  ARG 21  43  43  ARG ARG A . n 
C 3 22  LEU 22  44  44  LEU LEU A . n 
C 3 23  HIS 23  45  45  HIS HIS A . n 
C 3 24  ASN 24  46  46  ASN ASN A . n 
C 3 25  ASP 25  47  47  ASP ASP A . n 
C 3 26  GLU 26  48  48  GLU GLU A . n 
C 3 27  THR 27  49  49  THR THR A . n 
C 3 28  ASN 28  50  ?   ?   ?   A . n 
C 3 29  SER 29  51  ?   ?   ?   A . n 
C 3 30  ASN 30  52  ?   ?   ?   A . n 
C 3 31  GLN 31  53  53  GLN GLN A . n 
C 3 32  ASP 32  54  54  ASP ASP A . n 
C 3 33  ASN 33  55  55  ASN ASN A . n 
C 3 34  PRO 34  56  56  PRO PRO A . n 
C 3 35  LEU 35  57  57  LEU LEU A . n 
C 3 36  GLY 36  58  58  GLY GLY A . n 
C 3 37  PHE 37  59  59  PHE PHE A . n 
C 3 38  LYS 38  60  60  LYS LYS A . n 
C 3 39  GLU 39  61  61  GLU GLU A . n 
C 3 40  SER 40  62  62  SER SER A . n 
C 3 41  TRP 41  63  63  TRP TRP A . n 
C 3 42  GLY 42  64  64  GLY GLY A . n 
C 3 43  PHE 43  65  65  PHE PHE A . n 
C 3 44  GLY 44  66  66  GLY GLY A . n 
C 3 45  LYS 45  67  67  LYS LYS A . n 
C 3 46  VAL 46  68  68  VAL VAL A . n 
C 3 47  VAL 47  69  69  VAL VAL A . n 
C 3 48  PHE 48  70  70  PHE PHE A . n 
C 3 49  LYS 49  71  71  LYS LYS A . n 
C 3 50  ARG 50  72  72  ARG ARG A . n 
C 3 51  TYR 51  73  73  TYR TYR A . n 
C 3 52  LEU 52  74  74  LEU LEU A . n 
C 3 53  ARG 53  75  75  ARG ARG A . n 
C 3 54  TYR 54  76  76  TYR TYR A . n 
C 3 55  ASP 55  77  77  ASP ASP A . n 
C 3 56  ARG 56  78  78  ARG ARG A . n 
C 3 57  THR 57  79  79  THR THR A . n 
C 3 58  GLU 58  80  80  GLU GLU A . n 
C 3 59  ALA 59  81  81  ALA ALA A . n 
C 3 60  SER 60  82  82  SER SER A . n 
C 3 61  LEU 61  83  83  LEU LEU A . n 
C 3 62  HIS 62  84  84  HIS HIS A . n 
C 3 63  ARG 63  85  85  ARG ARG A . n 
C 3 64  VAL 64  86  86  VAL VAL A . n 
C 3 65  LEU 65  87  87  LEU LEU A . n 
C 3 66  GLY 66  88  88  GLY GLY A . n 
C 3 67  SER 67  89  89  SER SER A . n 
C 3 68  TRP 68  90  90  TRP TRP A . n 
C 3 69  THR 69  91  91  THR THR A . n 
C 3 70  GLY 70  92  92  GLY GLY A . n 
C 3 71  ASP 71  93  93  ASP ASP A . n 
C 3 72  SER 72  94  94  SER SER A . n 
C 3 73  VAL 73  95  95  VAL VAL A . n 
C 3 74  ASN 74  96  96  ASN ASN A . n 
C 3 75  TYR 75  97  97  TYR TYR A . n 
C 3 76  ALA 76  98  98  ALA ALA A . n 
C 3 77  ALA 77  99  99  ALA ALA A . n 
C 3 78  SER 78  100 100 SER SER A . n 
C 3 79  ARG 79  101 101 ARG ARG A . n 
C 3 80  PHE 80  102 102 PHE PHE A . n 
C 3 81  PHE 81  103 103 PHE PHE A . n 
C 3 82  GLY 82  104 104 GLY GLY A . n 
C 3 83  PHE 83  105 105 PHE PHE A . n 
C 3 84  ASP 84  106 106 ASP ASP A . n 
C 3 85  GLN 85  107 107 GLN GLN A . n 
C 3 86  ILE 86  108 108 ILE ILE A . n 
C 3 87  GLY 87  109 109 GLY GLY A . n 
C 3 88  CYS 88  110 110 CYS CYS A . n 
C 3 89  THR 89  111 111 THR THR A . n 
C 3 90  TYR 90  112 112 TYR TYR A . n 
C 3 91  SER 91  113 113 SER SER A . n 
C 3 92  ILE 92  114 114 ILE ILE A . n 
C 3 93  ARG 93  115 115 ARG ARG A . n 
C 3 94  PHE 94  116 116 PHE PHE A . n 
C 3 95  ARG 95  117 117 ARG ARG A . n 
C 3 96  GLY 96  118 118 GLY GLY A . n 
C 3 97  VAL 97  119 119 VAL VAL A . n 
C 3 98  SER 98  120 120 SER SER A . n 
C 3 99  ILE 99  121 121 ILE ILE A . n 
C 3 100 THR 100 122 122 THR THR A . n 
C 3 101 VAL 101 123 123 VAL VAL A . n 
C 3 102 SER 102 124 124 SER SER A . n 
C 3 103 GLY 103 125 125 GLY GLY A . n 
C 3 104 GLY 104 126 126 GLY GLY A . n 
C 3 105 SER 105 127 127 SER SER A . n 
C 3 106 ARG 106 128 128 ARG ARG A . n 
C 3 107 THR 107 129 129 THR THR A . n 
C 3 108 LEU 108 130 130 LEU LEU A . n 
C 3 109 GLN 109 131 131 GLN GLN A . n 
C 3 110 HIS 110 132 132 HIS HIS A . n 
C 3 111 LEU 111 133 133 LEU LEU A . n 
C 3 112 CYS 112 134 134 CYS CYS A . n 
C 3 113 GLU 113 135 135 GLU GLU A . n 
C 3 114 MSE 114 136 136 MSE MSE A . n 
C 3 115 ALA 115 137 137 ALA ALA A . n 
C 3 116 ILE 116 138 138 ILE ILE A . n 
C 3 117 ARG 117 139 139 ARG ARG A . n 
C 3 118 SER 118 140 140 SER SER A . n 
C 3 119 LYS 119 141 141 LYS LYS A . n 
C 3 120 GLN 120 142 142 GLN GLN A . n 
C 3 121 GLU 121 143 143 GLU GLU A . n 
C 3 122 MSE 122 144 144 MSE MSE A . n 
C 3 123 LEU 123 145 145 LEU LEU A . n 
C 3 124 GLN 124 146 146 GLN GLN A . n 
C 3 125 MSE 125 147 147 MSE MSE A . n 
C 3 126 ALA 126 148 148 ALA ALA A . n 
C 3 127 PRO 127 149 ?   ?   ?   A . n 
C 3 128 ILE 128 150 ?   ?   ?   A . n 
C 3 129 GLU 129 151 ?   ?   ?   A . n 
C 3 130 VAL 130 152 ?   ?   ?   A . n 
C 3 131 GLU 131 153 ?   ?   ?   A . n 
C 3 132 SER 132 154 ?   ?   ?   A . n 
C 3 133 ASN 133 155 ?   ?   ?   A . n 
C 3 134 VAL 134 156 ?   ?   ?   A . n 
C 3 135 SER 135 157 ?   ?   ?   A . n 
C 3 136 ARG 136 158 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SO4 1  159 101 SO4 SO4 A . 
E 4 SO4 1  160 102 SO4 SO4 A . 
F 5 HOH 1  31  31  HOH HOH B . 
F 5 HOH 2  39  39  HOH HOH B . 
F 5 HOH 3  43  43  HOH HOH B . 
F 5 HOH 4  62  62  HOH HOH B . 
G 5 HOH 1  22  17  HOH HOH C . 
G 5 HOH 2  23  27  HOH HOH C . 
G 5 HOH 3  24  40  HOH HOH C . 
G 5 HOH 4  25  46  HOH HOH C . 
H 5 HOH 1  161 1   HOH HOH A . 
H 5 HOH 2  162 2   HOH HOH A . 
H 5 HOH 3  163 3   HOH HOH A . 
H 5 HOH 4  164 4   HOH HOH A . 
H 5 HOH 5  165 5   HOH HOH A . 
H 5 HOH 6  166 6   HOH HOH A . 
H 5 HOH 7  167 7   HOH HOH A . 
H 5 HOH 8  168 8   HOH HOH A . 
H 5 HOH 9  169 9   HOH HOH A . 
H 5 HOH 10 170 10  HOH HOH A . 
H 5 HOH 11 171 11  HOH HOH A . 
H 5 HOH 12 172 12  HOH HOH A . 
H 5 HOH 13 173 13  HOH HOH A . 
H 5 HOH 14 174 14  HOH HOH A . 
H 5 HOH 15 175 15  HOH HOH A . 
H 5 HOH 16 176 16  HOH HOH A . 
H 5 HOH 17 177 18  HOH HOH A . 
H 5 HOH 18 178 19  HOH HOH A . 
H 5 HOH 19 179 20  HOH HOH A . 
H 5 HOH 20 180 21  HOH HOH A . 
H 5 HOH 21 181 22  HOH HOH A . 
H 5 HOH 22 182 23  HOH HOH A . 
H 5 HOH 23 183 24  HOH HOH A . 
H 5 HOH 24 184 25  HOH HOH A . 
H 5 HOH 25 185 26  HOH HOH A . 
H 5 HOH 26 186 28  HOH HOH A . 
H 5 HOH 27 187 29  HOH HOH A . 
H 5 HOH 28 188 30  HOH HOH A . 
H 5 HOH 29 189 32  HOH HOH A . 
H 5 HOH 30 190 33  HOH HOH A . 
H 5 HOH 31 191 34  HOH HOH A . 
H 5 HOH 32 192 35  HOH HOH A . 
H 5 HOH 33 193 36  HOH HOH A . 
H 5 HOH 34 194 37  HOH HOH A . 
H 5 HOH 35 195 38  HOH HOH A . 
H 5 HOH 36 196 41  HOH HOH A . 
H 5 HOH 37 197 42  HOH HOH A . 
H 5 HOH 38 198 44  HOH HOH A . 
H 5 HOH 39 199 45  HOH HOH A . 
H 5 HOH 40 200 47  HOH HOH A . 
H 5 HOH 41 201 48  HOH HOH A . 
H 5 HOH 42 202 49  HOH HOH A . 
H 5 HOH 43 203 50  HOH HOH A . 
H 5 HOH 44 204 51  HOH HOH A . 
H 5 HOH 45 205 52  HOH HOH A . 
H 5 HOH 46 206 53  HOH HOH A . 
H 5 HOH 47 207 54  HOH HOH A . 
H 5 HOH 48 208 55  HOH HOH A . 
H 5 HOH 49 209 56  HOH HOH A . 
H 5 HOH 50 210 57  HOH HOH A . 
H 5 HOH 51 211 58  HOH HOH A . 
H 5 HOH 52 212 59  HOH HOH A . 
H 5 HOH 53 213 60  HOH HOH A . 
H 5 HOH 54 214 61  HOH HOH A . 
H 5 HOH 55 215 63  HOH HOH A . 
H 5 HOH 56 216 64  HOH HOH A . 
H 5 HOH 57 217 65  HOH HOH A . 
H 5 HOH 58 218 66  HOH HOH A . 
H 5 HOH 59 219 67  HOH HOH A . 
H 5 HOH 60 220 68  HOH HOH A . 
H 5 HOH 61 221 69  HOH HOH A . 
H 5 HOH 62 222 70  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C MSE 4   A MSE 26  ? MET SELENOMETHIONINE 
2 C MSE 114 A MSE 136 ? MET SELENOMETHIONINE 
3 C MSE 122 A MSE 144 ? MET SELENOMETHIONINE 
4 C MSE 125 A MSE 147 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z              1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 10_545 y+2/3,x-2/3,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 91.2490000000 0.8660254038 
0.5000000000 0.0000000000 -52.6826347133 0.0000000000 0.0000000000 -1.0000000000 49.5433333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-27 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          1.1 ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B U   20  ? "C5'" ? A U   20  "C5'" 
2  1 Y 1 B U   20  ? "C4'" ? A U   20  "C4'" 
3  1 Y 1 B U   20  ? "O4'" ? A U   20  "O4'" 
4  1 Y 1 B U   20  ? "C3'" ? A U   20  "C3'" 
5  1 Y 1 B U   20  ? "O3'" ? A U   20  "O3'" 
6  1 Y 1 B U   20  ? "C2'" ? A U   20  "C2'" 
7  1 Y 1 B U   20  ? "O2'" ? A U   20  "O2'" 
8  1 Y 1 B U   20  ? "C1'" ? A U   20  "C1'" 
9  1 Y 1 B U   20  ? N1    ? A U   20  N1    
10 1 Y 1 B U   20  ? C2    ? A U   20  C2    
11 1 Y 1 B U   20  ? O2    ? A U   20  O2    
12 1 Y 1 B U   20  ? N3    ? A U   20  N3    
13 1 Y 1 B U   20  ? C4    ? A U   20  C4    
14 1 Y 1 B U   20  ? O4    ? A U   20  O4    
15 1 Y 1 B U   20  ? C5    ? A U   20  C5    
16 1 Y 1 B U   20  ? C6    ? A U   20  C6    
17 1 Y 1 C U   20  ? "C5'" ? B U   20  "C5'" 
18 1 Y 1 C U   20  ? "C4'" ? B U   20  "C4'" 
19 1 Y 1 C U   20  ? "O4'" ? B U   20  "O4'" 
20 1 Y 1 C U   20  ? "C3'" ? B U   20  "C3'" 
21 1 Y 1 C U   20  ? "O3'" ? B U   20  "O3'" 
22 1 Y 1 C U   20  ? "C2'" ? B U   20  "C2'" 
23 1 Y 1 C U   20  ? "O2'" ? B U   20  "O2'" 
24 1 Y 1 C U   20  ? "C1'" ? B U   20  "C1'" 
25 1 Y 1 C U   20  ? N1    ? B U   20  N1    
26 1 Y 1 C U   20  ? C2    ? B U   20  C2    
27 1 Y 1 C U   20  ? O2    ? B U   20  O2    
28 1 Y 1 C U   20  ? N3    ? B U   20  N3    
29 1 Y 1 C U   20  ? C4    ? B U   20  C4    
30 1 Y 1 C U   20  ? O4    ? B U   20  O4    
31 1 Y 1 C U   20  ? C5    ? B U   20  C5    
32 1 Y 1 C U   20  ? C6    ? B U   20  C6    
33 1 Y 1 A HIS 25  ? CG    ? C HIS 3   CG    
34 1 Y 1 A HIS 25  ? ND1   ? C HIS 3   ND1   
35 1 Y 1 A HIS 25  ? CD2   ? C HIS 3   CD2   
36 1 Y 1 A HIS 25  ? CE1   ? C HIS 3   CE1   
37 1 Y 1 A HIS 25  ? NE2   ? C HIS 3   NE2   
38 1 Y 1 A ASP 54  ? CG    ? C ASP 32  CG    
39 1 Y 1 A ASP 54  ? OD1   ? C ASP 32  OD1   
40 1 Y 1 A ASP 54  ? OD2   ? C ASP 32  OD2   
41 1 Y 1 A GLU 80  ? CG    ? C GLU 58  CG    
42 1 Y 1 A GLU 80  ? CD    ? C GLU 58  CD    
43 1 Y 1 A GLU 80  ? OE1   ? C GLU 58  OE1   
44 1 Y 1 A GLU 80  ? OE2   ? C GLU 58  OE2   
45 1 Y 1 A PHE 105 ? CG    ? C PHE 83  CG    
46 1 Y 1 A PHE 105 ? CD1   ? C PHE 83  CD1   
47 1 Y 1 A PHE 105 ? CD2   ? C PHE 83  CD2   
48 1 Y 1 A PHE 105 ? CE1   ? C PHE 83  CE1   
49 1 Y 1 A PHE 105 ? CE2   ? C PHE 83  CE2   
50 1 Y 1 A PHE 105 ? CZ    ? C PHE 83  CZ    
51 1 Y 1 A GLN 131 ? CG    ? C GLN 109 CG    
52 1 Y 1 A GLN 131 ? CD    ? C GLN 109 CD    
53 1 Y 1 A GLN 131 ? OE1   ? C GLN 109 OE1   
54 1 Y 1 A GLN 131 ? NE2   ? C GLN 109 NE2   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B U   21  ? A U   21  
2  1 Y 1 C U   21  ? B U   21  
3  1 Y 1 A GLY 23  ? C GLY 1   
4  1 Y 1 A SER 24  ? C SER 2   
5  1 Y 1 A ASN 50  ? C ASN 28  
6  1 Y 1 A SER 51  ? C SER 29  
7  1 Y 1 A ASN 52  ? C ASN 30  
8  1 Y 1 A PRO 149 ? C PRO 127 
9  1 Y 1 A ILE 150 ? C ILE 128 
10 1 Y 1 A GLU 151 ? C GLU 129 
11 1 Y 1 A VAL 152 ? C VAL 130 
12 1 Y 1 A GLU 153 ? C GLU 131 
13 1 Y 1 A SER 154 ? C SER 132 
14 1 Y 1 A ASN 155 ? C ASN 133 
15 1 Y 1 A VAL 156 ? C VAL 134 
16 1 Y 1 A SER 157 ? C SER 135 
17 1 Y 1 A ARG 158 ? C ARG 136 
# 
_ndb_struct_conf_na.entry_id   1R9F 
_ndb_struct_conf_na.feature    'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A C 1  1_555 B G 19 1_555 0.066  -0.086 0.082  5.457  -6.116  -2.394 1  B_C1:G19_C  B 1  ? C 19 ? 19 1 
1 A G 2  1_555 B C 18 1_555 -0.239 -0.084 -0.100 -5.597 -8.483  2.281  2  B_G2:C18_C  B 2  ? C 18 ? 19 1 
1 A U 3  1_555 B A 17 1_555 -0.030 -0.105 0.281  -6.762 1.225   7.195  3  B_U3:A17_C  B 3  ? C 17 ? 20 1 
1 A A 4  1_555 B U 16 1_555 0.033  -0.092 -0.274 5.047  -7.830  3.058  4  B_A4:U16_C  B 4  ? C 16 ? 20 1 
1 A C 5  1_555 B G 15 1_555 0.170  -0.026 -0.610 10.192 -12.108 3.855  5  B_C5:G15_C  B 5  ? C 15 ? 19 1 
1 A G 6  1_555 B C 14 1_555 -0.199 -0.049 -0.200 -6.134 -13.726 1.722  6  B_G6:C14_C  B 6  ? C 14 ? 19 1 
1 A C 7  1_555 B G 13 1_555 0.174  -0.070 -0.016 6.740  -10.400 1.097  7  B_C7:G13_C  B 7  ? C 13 ? 19 1 
1 A G 8  1_555 B C 12 1_555 -0.081 -0.094 -0.488 1.369  -7.596  -0.094 8  B_G8:C12_C  B 8  ? C 12 ? 19 1 
1 A G 9  1_555 B C 11 1_555 -0.232 -0.041 -0.233 -0.223 -10.230 2.986  9  B_G9:C11_C  B 9  ? C 11 ? 19 1 
1 A A 10 1_555 B U 10 1_555 0.024  -0.140 0.300  1.069  -13.918 3.045  10 B_A10:U10_C B 10 ? C 10 ? 20 1 
1 A A 11 1_555 B U 9  1_555 -0.056 -0.184 -0.015 5.075  -11.956 5.863  11 B_A11:U9_C  B 11 ? C 9  ? 20 1 
1 A U 12 1_555 B A 8  1_555 -0.066 -0.146 0.509  5.054  -8.394  0.937  12 B_U12:A8_C  B 12 ? C 8  ? 20 1 
1 A A 13 1_555 B U 7  1_555 0.009  -0.097 0.080  3.034  -13.191 3.590  13 B_A13:U7_C  B 13 ? C 7  ? 20 1 
1 A C 14 1_555 B G 6  1_555 0.194  -0.033 0.144  3.689  -9.158  1.096  14 B_C14:G6_C  B 14 ? C 6  ? 19 1 
1 A U 15 1_555 B A 5  1_555 -0.019 -0.050 -0.013 6.312  -11.918 4.821  15 B_U15:A5_C  B 15 ? C 5  ? 20 1 
1 A U 16 1_555 B A 4  1_555 -0.016 -0.081 -0.102 4.769  -8.047  4.348  16 B_U16:A4_C  B 16 ? C 4  ? 20 1 
1 A C 17 1_555 B G 3  1_555 0.181  -0.049 -0.339 3.867  -8.897  1.989  17 B_C17:G3_C  B 17 ? C 3  ? 19 1 
1 A G 18 1_555 B C 2  1_555 -0.055 -0.067 0.250  -8.086 -5.846  0.574  18 B_G18:C2_C  B 18 ? C 2  ? 19 1 
1 A A 19 1_555 B U 1  1_555 0.079  -0.081 -0.365 1.150  2.002   -1.833 19 B_A19:U1_C  B 19 ? C 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A C 1  1_555 B G 19 1_555 A G 2  1_555 B C 18 1_555 0.752  -2.141 3.462 2.182  4.669  30.644 -4.910 -0.978 3.153 8.757  -4.092  
31.064 1  BB_C1G2:C18G19_CC  B 1  ? C 19 ? B 2  ? C 18 ? 
1 A G 2  1_555 B C 18 1_555 A U 3  1_555 B A 17 1_555 -0.361 -1.789 3.507 -3.887 -0.117 29.183 -3.493 -0.187 3.531 -0.230 7.671   
29.436 2  BB_G2U3:A17C18_CC  B 2  ? C 18 ? B 3  ? C 17 ? 
1 A U 3  1_555 B A 17 1_555 A A 4  1_555 B U 16 1_555 -0.588 -1.310 2.856 3.771  15.234 28.327 -4.428 1.570  1.840 28.528 -7.061  
32.306 3  BB_U3A4:U16A17_CC  B 3  ? C 17 ? B 4  ? C 16 ? 
1 A A 4  1_555 B U 16 1_555 A C 5  1_555 B G 15 1_555 0.257  -1.900 3.304 1.472  9.235  26.422 -5.932 -0.211 2.519 19.445 -3.099  
28.000 4  BB_A4C5:G15U16_CC  B 4  ? C 16 ? B 5  ? C 15 ? 
1 A C 5  1_555 B G 15 1_555 A G 6  1_555 B C 14 1_555 -0.464 -1.472 3.866 -2.874 12.540 29.038 -5.238 0.266  3.019 23.602 5.410   
31.704 5  BB_C5G6:C14G15_CC  B 5  ? C 15 ? B 6  ? C 14 ? 
1 A G 6  1_555 B C 14 1_555 A C 7  1_555 B G 13 1_555 -0.027 -1.126 3.030 -1.173 3.224  33.450 -2.427 -0.127 2.911 5.583  2.032   
33.621 6  BB_G6C7:G13C14_CC  B 6  ? C 14 ? B 7  ? C 13 ? 
1 A C 7  1_555 B G 13 1_555 A G 8  1_555 B C 12 1_555 0.129  -1.339 3.270 3.581  15.464 29.929 -4.581 0.305  2.320 27.633 -6.400  
33.793 7  BB_C7G8:C12G13_CC  B 7  ? C 13 ? B 8  ? C 12 ? 
1 A G 8  1_555 B C 12 1_555 A G 9  1_555 B C 11 1_555 0.540  -1.456 3.000 -1.671 13.220 29.821 -4.490 -1.202 2.146 24.224 3.061   
32.601 8  BB_G8G9:C11C12_CC  B 8  ? C 12 ? B 9  ? C 11 ? 
1 A G 9  1_555 B C 11 1_555 A A 10 1_555 B U 10 1_555 0.079  -1.665 3.028 -5.190 5.768  29.581 -4.162 -1.053 2.613 11.060 9.950   
30.560 9  BB_G9A10:U10C11_CC B 9  ? C 11 ? B 10 ? C 10 ? 
1 A A 10 1_555 B U 10 1_555 A A 11 1_555 B U 9  1_555 -0.090 -1.344 3.521 -0.495 -4.006 33.526 -1.600 0.067  3.653 -6.913 0.854   
33.762 10 BB_A10A11:U9U10_CC B 10 ? C 10 ? B 11 ? C 9  ? 
1 A A 11 1_555 B U 9  1_555 A U 12 1_555 B A 8  1_555 -0.228 -1.351 3.494 -3.782 5.782  29.380 -3.813 -0.358 3.180 11.206 7.330   
30.164 11 BB_A11U12:A8U9_CC  B 11 ? C 9  ? B 12 ? C 8  ? 
1 A U 12 1_555 B A 8  1_555 A A 13 1_555 B U 7  1_555 -0.198 -1.521 3.104 2.382  13.284 31.713 -4.352 0.655  2.282 23.047 -4.133  
34.398 12 BB_U12A13:U7A8_CC  B 12 ? C 8  ? B 13 ? C 7  ? 
1 A A 13 1_555 B U 7  1_555 A C 14 1_555 B G 6  1_555 -0.248 -1.538 3.230 -2.083 8.580  31.443 -4.123 0.105  2.737 15.454 3.752   
32.629 13 BB_A13C14:G6U7_CC  B 13 ? C 7  ? B 14 ? C 6  ? 
1 A C 14 1_555 B G 6  1_555 A U 15 1_555 B A 5  1_555 0.627  -1.926 3.047 3.247  8.566  28.847 -5.185 -0.637 2.441 16.672 -6.319  
30.238 14 BB_C14U15:A5G6_CC  B 14 ? C 6  ? B 15 ? C 5  ? 
1 A U 15 1_555 B A 5  1_555 A U 16 1_555 B A 4  1_555 0.328  -1.550 3.252 1.618  6.623  29.611 -4.217 -0.318 2.859 12.747 -3.113  
30.368 15 BB_U15U16:A4A5_CC  B 15 ? C 5  ? B 16 ? C 4  ? 
1 A U 16 1_555 B A 4  1_555 A C 17 1_555 B G 3  1_555 -0.372 -1.725 3.233 -0.131 4.861  30.621 -4.116 0.672  2.932 9.131  0.246   
30.996 16 BB_U16C17:G3A4_CC  B 16 ? C 4  ? B 17 ? C 3  ? 
1 A C 17 1_555 B G 3  1_555 A G 18 1_555 B C 2  1_555 0.028  -2.145 3.401 -4.202 13.089 28.955 -6.034 -0.738 2.223 24.510 7.868   
31.989 17 BB_C17G18:C2G3_CC  B 17 ? C 3  ? B 18 ? C 2  ? 
1 A G 18 1_555 B C 2  1_555 A A 19 1_555 B U 1  1_555 -0.070 -2.164 3.132 7.831  8.357  31.439 -4.974 1.255  2.408 14.821 -13.888 
33.410 18 BB_G18A19:U1C2_CC  B 18 ? C 2  ? B 19 ? C 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SULFATE ION' SO4 
5 water         HOH 
#