data_1RB4
# 
_entry.id   1RB4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RB4         
RCSB  RCSB020632   
WWPDB D_1000020632 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RB1 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TRIGONAL AUTOMATIC 
SOLUTION
;
unspecified 
PDB 1RB5 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A 
TRIGONAL FORM
;
unspecified 
PDB 1RB6 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A 
TETRAGONAL FORM
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RB4 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Holton, J.' 1 
'Alber, T.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Automated protein crystal structure determination using ELVES.'                               Proc.Natl.Acad.Sci.USA 101 
1537 1542 2004 PNASA6 US 0027-8424 0040 ? 14752198 10.1073/pnas.0306241101 
1       'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization'                            Nat.Struct.Biol.       3   
510  515  1996 NSBIEW US 1072-8368 2024 ? ?        ?                       
2       'Crystal Structure of an Isoleucine-Zipper Trimer'                                             Nature                 371 
80   83   1994 NATUAS UK 0028-0836 0006 ? ?        10.1038/371080a0        
3       'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science                262 
1401 1407 1993 SCIEAS US 0036-8075 0038 ? ?        ?                       
4       'X-Ray Structure of the GCN4 Leucine Zipper, a two-stranded, parallel coiled coil.'            Science                254 
539  544  1991 SCIEAS US 0036-8075 0038 ? ?        ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Holton, J.'       1  
primary 'Alber, T.'        2  
1       'Gonzalez Jr., L.' 3  
1       'Plecs, J.J.'      4  
1       'Alber, T.'        5  
2       'Harbury, P.B.'    6  
2       'Kim, P.S.'        7  
2       'Alber, T.'        8  
3       'Harbury, P.B.'    9  
3       'Zhang, T.'        10 
3       'Kim, P.S.'        11 
3       'Alber, T.'        12 
4       
;O'Shea, E.K.
;
13 
4       'Klemm, J.D.'      14 
4       'Kim, P.S.'        15 
4       'Alber, T.'        16 
# 
_cell.entry_id           1RB4 
_cell.length_a           64.947 
_cell.length_b           64.947 
_cell.length_c           78.012 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RB4 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'General control protein GCN4' 3962.639 3   ? N16A 'LEUCINE-ZIPPER (RESIDUES 249-281)' ? 
2 water   nat water                          18.015   157 ? ?    ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Amino acid biosynthesis regulatory protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RMKQLEDKVEELLSKAYHLENEVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   RMKQLEDKVEELLSKAYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  MET n 
1 3  LYS n 
1 4  GLN n 
1 5  LEU n 
1 6  GLU n 
1 7  ASP n 
1 8  LYS n 
1 9  VAL n 
1 10 GLU n 
1 11 GLU n 
1 12 LEU n 
1 13 LEU n 
1 14 SER n 
1 15 LYS n 
1 16 ALA n 
1 17 TYR n 
1 18 HIS n 
1 19 LEU n 
1 20 GLU n 
1 21 ASN n 
1 22 GLU n 
1 23 VAL n 
1 24 ALA n 
1 25 ARG n 
1 26 LEU n 
1 27 LYS n 
1 28 LYS n 
1 29 LEU n 
1 30 VAL n 
1 31 GLY n 
1 32 GLU n 
1 33 ARG n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN SACCHAROMYCES CEREVISIAE. THE PEPTIDE WAS CHEMICALLY SYNTHESIZED.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RB4 A 1 ? 33 ? P03069 249 ? 281 ? 1 33 
2 1 1RB4 B 1 ? 33 ? P03069 249 ? 281 ? 1 33 
3 1 1RB4 C 1 ? 33 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RB4 ALA A 16 ? UNP P03069 ASN 264 ENGINEERED 16 1 
2 1RB4 ALA B 16 ? UNP P03069 ASN 264 ENGINEERED 16 2 
3 1RB4 ALA C 16 ? UNP P03069 ASN 264 ENGINEERED 16 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RB4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   75. 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.44 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
'25 mM phosphate pH 7.3 400 mM NaCl 15% PEG8000, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1998-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9795 1.0 
2 1.0688 1.0 
3 0.9800 1.0 
4 0.9797 1.0 
5 0.9322 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL1-5' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL1-5 
_diffrn_source.pdbx_wavelength             0.9795 
_diffrn_source.pdbx_wavelength_list        '1.0688, 0.9800, 0.9797, 0.9795, 0.9322' 
# 
_reflns.entry_id                     1RB4 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             45 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   15956 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.9 
_reflns_shell.percent_possible_all   74.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RB4 
_refine.ls_number_reflns_obs                     13638 
_refine.ls_number_reflns_all                     13638 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.204 
_refine.ls_R_factor_all                          0.206 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.307 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  809 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               44. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        762 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             157 
_refine_hist.number_atoms_total               919 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.8   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RB4 
_struct.title                     'ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TETRAGONAL AUTOMATIC SOLUTION' 
_struct.pdbx_descriptor           'General control protein GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RB4 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'COILED COIL, LEUCINE ZIPPER, AUTOMATION, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 1 ? VAL A 30 ? ARG A 1 VAL A 30 1 ? 30 
HELX_P HELX_P2 2 ARG B 1 ? GLU B 32 ? ARG B 1 GLU B 32 1 ? 32 
HELX_P HELX_P3 3 ARG C 1 ? LEU C 29 ? ARG C 1 LEU C 29 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1RB4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RB4 
_atom_sites.fract_transf_matrix[1][1]   0.015397 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015397 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012819 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ARG A 1 1  ? -16.331 35.431 11.492 1.00 34.33 ? 1   ARG A N   1 
ATOM   2   C CA  . ARG A 1 1  ? -14.875 35.589 11.673 1.00 33.04 ? 1   ARG A CA  1 
ATOM   3   C C   . ARG A 1 1  ? -14.421 35.250 13.087 1.00 30.47 ? 1   ARG A C   1 
ATOM   4   O O   . ARG A 1 1  ? -13.401 34.549 13.181 1.00 30.67 ? 1   ARG A O   1 
ATOM   5   C CB  . ARG A 1 1  ? -14.317 36.989 11.409 1.00 33.62 ? 1   ARG A CB  1 
ATOM   6   C CG  . ARG A 1 1  ? -13.879 37.226 9.985  1.00 35.51 ? 1   ARG A CG  1 
ATOM   7   C CD  . ARG A 1 1  ? -13.635 38.694 9.798  1.00 35.28 ? 1   ARG A CD  1 
ATOM   8   N NE  . ARG A 1 1  ? -12.247 39.100 9.845  1.00 34.43 ? 1   ARG A NE  1 
ATOM   9   C CZ  . ARG A 1 1  ? -11.888 40.373 9.774  1.00 34.58 ? 1   ARG A CZ  1 
ATOM   10  N NH1 . ARG A 1 1  ? -12.866 41.284 9.723  1.00 35.25 ? 1   ARG A NH1 1 
ATOM   11  N NH2 . ARG A 1 1  ? -10.600 40.658 9.780  1.00 33.82 ? 1   ARG A NH2 1 
ATOM   12  N N   . MET A 1 2  ? -15.129 35.748 14.102 1.00 29.12 ? 2   MET A N   1 
ATOM   13  C CA  . MET A 1 2  ? -14.638 35.448 15.448 1.00 28.55 ? 2   MET A CA  1 
ATOM   14  C C   . MET A 1 2  ? -14.577 33.966 15.732 1.00 26.64 ? 2   MET A C   1 
ATOM   15  O O   . MET A 1 2  ? -13.594 33.497 16.304 1.00 24.21 ? 2   MET A O   1 
ATOM   16  C CB  . MET A 1 2  ? -15.418 36.152 16.569 1.00 27.93 ? 2   MET A CB  1 
ATOM   17  C CG  . MET A 1 2  ? -14.874 35.836 17.962 1.00 28.02 ? 2   MET A CG  1 
ATOM   18  S SD  . MET A 1 2  ? -13.120 36.300 18.297 1.00 28.18 ? 2   MET A SD  1 
ATOM   19  C CE  . MET A 1 2  ? -13.178 37.795 17.269 1.00 17.90 ? 2   MET A CE  1 
ATOM   20  N N   . LYS A 1 3  ? -15.670 33.230 15.453 1.00 27.66 ? 3   LYS A N   1 
ATOM   21  C CA  . LYS A 1 3  ? -15.705 31.812 15.764 1.00 28.20 ? 3   LYS A CA  1 
ATOM   22  C C   . LYS A 1 3  ? -14.640 31.042 14.977 1.00 25.36 ? 3   LYS A C   1 
ATOM   23  O O   . LYS A 1 3  ? -13.990 30.169 15.577 1.00 23.31 ? 3   LYS A O   1 
ATOM   24  C CB  . LYS A 1 3  ? -17.086 31.175 15.563 1.00 29.90 ? 3   LYS A CB  1 
ATOM   25  C CG  . LYS A 1 3  ? -17.095 29.713 16.006 1.00 32.55 ? 3   LYS A CG  1 
ATOM   26  C CD  . LYS A 1 3  ? -16.816 29.596 17.503 1.00 33.68 ? 3   LYS A CD  1 
ATOM   27  C CE  . LYS A 1 3  ? -16.899 28.205 18.061 1.00 36.59 ? 3   LYS A CE  1 
ATOM   28  N NZ  . LYS A 1 3  ? -16.726 27.127 17.048 1.00 38.44 ? 3   LYS A NZ  1 
ATOM   29  N N   . GLN A 1 4  ? -14.397 31.389 13.721 1.00 26.25 ? 4   GLN A N   1 
ATOM   30  C CA  . GLN A 1 4  ? -13.304 30.728 12.986 1.00 26.07 ? 4   GLN A CA  1 
ATOM   31  C C   . GLN A 1 4  ? -11.937 31.039 13.581 1.00 23.23 ? 4   GLN A C   1 
ATOM   32  O O   . GLN A 1 4  ? -11.010 30.198 13.581 1.00 24.29 ? 4   GLN A O   1 
ATOM   33  C CB  . GLN A 1 4  ? -13.356 31.157 11.499 1.00 28.63 ? 4   GLN A CB  1 
ATOM   34  C CG  . GLN A 1 4  ? -14.600 30.584 10.860 1.00 33.54 ? 4   GLN A CG  1 
ATOM   35  C CD  . GLN A 1 4  ? -15.042 31.070 9.512  1.00 37.53 ? 4   GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 4  ? -15.958 30.486 8.891  1.00 41.29 ? 4   GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 4  ? -14.428 32.119 8.995  1.00 39.71 ? 4   GLN A NE2 1 
ATOM   38  N N   . LEU A 1 5  ? -11.745 32.235 14.097 1.00 20.30 ? 5   LEU A N   1 
ATOM   39  C CA  . LEU A 1 5  ? -10.491 32.648 14.716 1.00 20.26 ? 5   LEU A CA  1 
ATOM   40  C C   . LEU A 1 5  ? -10.299 31.838 16.005 1.00 20.40 ? 5   LEU A C   1 
ATOM   41  O O   . LEU A 1 5  ? -9.189  31.327 16.201 1.00 20.76 ? 5   LEU A O   1 
ATOM   42  C CB  . LEU A 1 5  ? -10.440 34.135 15.003 1.00 20.66 ? 5   LEU A CB  1 
ATOM   43  C CG  . LEU A 1 5  ? -9.198  34.678 15.698 1.00 20.82 ? 5   LEU A CG  1 
ATOM   44  C CD1 . LEU A 1 5  ? -7.841  34.317 15.068 1.00 19.88 ? 5   LEU A CD1 1 
ATOM   45  C CD2 . LEU A 1 5  ? -9.278  36.193 15.835 1.00 18.90 ? 5   LEU A CD2 1 
ATOM   46  N N   . GLU A 1 6  ? -11.351 31.837 16.836 1.00 20.33 ? 6   GLU A N   1 
ATOM   47  C CA  . GLU A 1 6  ? -11.270 31.033 18.059 1.00 21.95 ? 6   GLU A CA  1 
ATOM   48  C C   . GLU A 1 6  ? -10.968 29.572 17.788 1.00 21.10 ? 6   GLU A C   1 
ATOM   49  O O   . GLU A 1 6  ? -10.118 28.931 18.428 1.00 20.53 ? 6   GLU A O   1 
ATOM   50  C CB  . GLU A 1 6  ? -12.564 31.121 18.892 1.00 22.73 ? 6   GLU A CB  1 
ATOM   51  C CG  . GLU A 1 6  ? -12.803 32.586 19.314 1.00 26.63 ? 6   GLU A CG  1 
ATOM   52  C CD  . GLU A 1 6  ? -14.188 32.595 19.993 1.00 31.79 ? 6   GLU A CD  1 
ATOM   53  O OE1 . GLU A 1 6  ? -15.169 32.421 19.262 1.00 30.73 ? 6   GLU A OE1 1 
ATOM   54  O OE2 . GLU A 1 6  ? -14.265 32.717 21.238 1.00 35.55 ? 6   GLU A OE2 1 
ATOM   55  N N   . ASP A 1 7  ? -11.607 29.005 16.757 1.00 20.73 ? 7   ASP A N   1 
ATOM   56  C CA  . ASP A 1 7  ? -11.370 27.610 16.403 1.00 22.06 ? 7   ASP A CA  1 
ATOM   57  C C   . ASP A 1 7  ? -9.898  27.383 16.047 1.00 19.62 ? 7   ASP A C   1 
ATOM   58  O O   . ASP A 1 7  ? -9.276  26.421 16.515 1.00 21.19 ? 7   ASP A O   1 
ATOM   59  C CB  . ASP A 1 7  ? -12.233 27.171 15.201 1.00 23.63 ? 7   ASP A CB  1 
ATOM   60  C CG  . ASP A 1 7  ? -13.651 26.869 15.656 1.00 26.62 ? 7   ASP A CG  1 
ATOM   61  O OD1 . ASP A 1 7  ? -13.945 26.906 16.867 1.00 29.92 ? 7   ASP A OD1 1 
ATOM   62  O OD2 . ASP A 1 7  ? -14.515 26.622 14.801 1.00 29.29 ? 7   ASP A OD2 1 
ATOM   63  N N   . LYS A 1 8  ? -9.332  28.320 15.292 1.00 18.84 ? 8   LYS A N   1 
ATOM   64  C CA  . LYS A 1 8  ? -7.927  28.186 14.924 1.00 18.98 ? 8   LYS A CA  1 
ATOM   65  C C   . LYS A 1 8  ? -7.000  28.319 16.131 1.00 16.82 ? 8   LYS A C   1 
ATOM   66  O O   . LYS A 1 8  ? -5.949  27.687 16.176 1.00 17.27 ? 8   LYS A O   1 
ATOM   67  C CB  . LYS A 1 8  ? -7.512  29.180 13.826 1.00 20.01 ? 8   LYS A CB  1 
ATOM   68  C CG  . LYS A 1 8  ? -8.258  28.745 12.527 1.00 19.33 ? 8   LYS A CG  1 
ATOM   69  C CD  . LYS A 1 8  ? -7.752  29.686 11.426 1.00 21.81 ? 8   LYS A CD  1 
ATOM   70  C CE  . LYS A 1 8  ? -8.523  29.476 10.121 1.00 24.64 ? 8   LYS A CE  1 
ATOM   71  N NZ  . LYS A 1 8  ? -9.960  29.831 10.314 1.00 25.63 ? 8   LYS A NZ  1 
ATOM   72  N N   . VAL A 1 9  ? -7.292  29.273 17.007 1.00 16.57 ? 9   VAL A N   1 
ATOM   73  C CA  . VAL A 1 9  ? -6.450  29.392 18.220 1.00 19.21 ? 9   VAL A CA  1 
ATOM   74  C C   . VAL A 1 9  ? -6.516  28.142 19.055 1.00 18.83 ? 9   VAL A C   1 
ATOM   75  O O   . VAL A 1 9  ? -5.478  27.695 19.590 1.00 17.12 ? 9   VAL A O   1 
ATOM   76  C CB  . VAL A 1 9  ? -6.898  30.617 19.056 1.00 20.56 ? 9   VAL A CB  1 
ATOM   77  C CG1 . VAL A 1 9  ? -6.040  30.667 20.343 1.00 23.68 ? 9   VAL A CG1 1 
ATOM   78  C CG2 . VAL A 1 9  ? -6.696  31.852 18.227 1.00 21.18 ? 9   VAL A CG2 1 
ATOM   79  N N   . GLU A 1 10 ? -7.677  27.500 19.183 1.00 17.31 ? 10  GLU A N   1 
ATOM   80  C CA  . GLU A 1 10 ? -7.713  26.258 19.977 1.00 18.17 ? 10  GLU A CA  1 
ATOM   81  C C   . GLU A 1 10 ? -6.904  25.153 19.305 1.00 17.27 ? 10  GLU A C   1 
ATOM   82  O O   . GLU A 1 10 ? -6.276  24.320 19.939 1.00 18.61 ? 10  GLU A O   1 
ATOM   83  C CB  . GLU A 1 10 ? -9.141  25.851 20.302 1.00 19.37 ? 10  GLU A CB  1 
ATOM   84  C CG  . GLU A 1 10 ? -9.794  26.982 21.116 1.00 22.42 ? 10  GLU A CG  1 
ATOM   85  C CD  . GLU A 1 10 ? -8.978  27.345 22.363 1.00 26.42 ? 10  GLU A CD  1 
ATOM   86  O OE1 . GLU A 1 10 ? -8.664  28.533 22.588 1.00 26.89 ? 10  GLU A OE1 1 
ATOM   87  O OE2 . GLU A 1 10 ? -8.609  26.396 23.076 1.00 29.04 ? 10  GLU A OE2 1 
ATOM   88  N N   . GLU A 1 11 ? -7.060  25.097 17.980 1.00 18.41 ? 11  GLU A N   1 
ATOM   89  C CA  . GLU A 1 11 ? -6.305  24.135 17.165 1.00 18.60 ? 11  GLU A CA  1 
ATOM   90  C C   . GLU A 1 11 ? -4.816  24.316 17.454 1.00 16.21 ? 11  GLU A C   1 
ATOM   91  O O   . GLU A 1 11 ? -4.040  23.364 17.652 1.00 17.75 ? 11  GLU A O   1 
ATOM   92  C CB  . GLU A 1 11 ? -6.600  24.346 15.666 1.00 17.49 ? 11  GLU A CB  1 
ATOM   93  C CG  . GLU A 1 11 ? -5.589  23.614 14.754 1.00 21.34 ? 11  GLU A CG  1 
ATOM   94  C CD  . GLU A 1 11 ? -5.771  23.924 13.279 1.00 22.65 ? 11  GLU A CD  1 
ATOM   95  O OE1 . GLU A 1 11 ? -6.642  24.736 12.922 1.00 22.99 ? 11  GLU A OE1 1 
ATOM   96  O OE2 . GLU A 1 11 ? -4.972  23.340 12.465 1.00 23.75 ? 11  GLU A OE2 1 
ATOM   97  N N   . LEU A 1 12 ? -4.322  25.539 17.355 1.00 15.15 ? 12  LEU A N   1 
ATOM   98  C CA  . LEU A 1 12 ? -2.967  25.918 17.571 1.00 15.96 ? 12  LEU A CA  1 
ATOM   99  C C   . LEU A 1 12 ? -2.525  25.470 18.968 1.00 16.19 ? 12  LEU A C   1 
ATOM   100 O O   . LEU A 1 12 ? -1.458  24.861 19.169 1.00 15.68 ? 12  LEU A O   1 
ATOM   101 C CB  . LEU A 1 12 ? -2.762  27.430 17.469 1.00 16.64 ? 12  LEU A CB  1 
ATOM   102 C CG  . LEU A 1 12 ? -1.373  27.955 17.874 1.00 16.87 ? 12  LEU A CG  1 
ATOM   103 C CD1 . LEU A 1 12 ? -0.249  27.382 17.004 1.00 16.48 ? 12  LEU A CD1 1 
ATOM   104 C CD2 . LEU A 1 12 ? -1.394  29.455 17.823 1.00 17.33 ? 12  LEU A CD2 1 
ATOM   105 N N   . LEU A 1 13 ? -3.266  25.871 20.024 1.00 16.45 ? 13  LEU A N   1 
ATOM   106 C CA  . LEU A 1 13 ? -2.854  25.445 21.374 1.00 18.43 ? 13  LEU A CA  1 
ATOM   107 C C   . LEU A 1 13 ? -2.819  23.945 21.545 1.00 19.41 ? 13  LEU A C   1 
ATOM   108 O O   . LEU A 1 13 ? -1.839  23.456 22.133 1.00 19.48 ? 13  LEU A O   1 
ATOM   109 C CB  . LEU A 1 13 ? -3.857  26.077 22.374 1.00 18.61 ? 13  LEU A CB  1 
ATOM   110 C CG  . LEU A 1 13 ? -3.479  25.892 23.857 1.00 22.53 ? 13  LEU A CG  1 
ATOM   111 C CD1 . LEU A 1 13 ? -2.202  26.720 24.073 1.00 21.65 ? 13  LEU A CD1 1 
ATOM   112 C CD2 . LEU A 1 13 ? -4.633  26.353 24.729 1.00 25.84 ? 13  LEU A CD2 1 
ATOM   113 N N   . SER A 1 14 ? -3.740  23.177 20.927 1.00 18.60 ? 14  SER A N   1 
ATOM   114 C CA  . SER A 1 14 ? -3.678  21.718 21.071 1.00 18.77 ? 14  SER A CA  1 
ATOM   115 C C   . SER A 1 14 ? -2.422  21.200 20.399 1.00 20.22 ? 14  SER A C   1 
ATOM   116 O O   . SER A 1 14 ? -1.768  20.283 20.904 1.00 20.04 ? 14  SER A O   1 
ATOM   117 C CB  . SER A 1 14 ? -4.974  21.080 20.515 1.00 23.61 ? 14  SER A CB  1 
ATOM   118 O OG  . SER A 1 14 ? -4.813  19.661 20.362 1.00 29.52 ? 14  SER A OG  1 
ATOM   119 N N   . LYS A 1 15 ? -2.030  21.803 19.258 1.00 17.89 ? 15  LYS A N   1 
ATOM   120 C CA  . LYS A 1 15 ? -0.800  21.372 18.566 1.00 17.87 ? 15  LYS A CA  1 
ATOM   121 C C   . LYS A 1 15 ? 0.464   21.722 19.332 1.00 19.95 ? 15  LYS A C   1 
ATOM   122 O O   . LYS A 1 15 ? 1.434   20.948 19.426 1.00 20.60 ? 15  LYS A O   1 
ATOM   123 C CB  . LYS A 1 15 ? -0.753  21.999 17.160 1.00 17.68 ? 15  LYS A CB  1 
ATOM   124 C CG  . LYS A 1 15 ? -1.775  21.356 16.233 1.00 17.75 ? 15  LYS A CG  1 
ATOM   125 C CD  . LYS A 1 15 ? -1.728  22.040 14.861 1.00 21.62 ? 15  LYS A CD  1 
ATOM   126 C CE  . LYS A 1 15 ? -2.663  21.292 13.903 1.00 21.75 ? 15  LYS A CE  1 
ATOM   127 N NZ  . LYS A 1 15 ? -2.169  21.455 12.512 1.00 25.44 ? 15  LYS A NZ  1 
ATOM   128 N N   . ALA A 1 16 ? 0.469   22.919 19.962 1.00 18.28 ? 16  ALA A N   1 
ATOM   129 C CA  . ALA A 1 16 ? 1.640   23.309 20.761 1.00 19.40 ? 16  ALA A CA  1 
ATOM   130 C C   . ALA A 1 16 ? 1.773   22.342 21.948 1.00 20.48 ? 16  ALA A C   1 
ATOM   131 O O   . ALA A 1 16 ? 2.906   21.988 22.324 1.00 20.23 ? 16  ALA A O   1 
ATOM   132 C CB  . ALA A 1 16 ? 1.510   24.738 21.273 1.00 18.45 ? 16  ALA A CB  1 
ATOM   133 N N   . TYR A 1 17 ? 0.645   22.037 22.609 1.00 18.29 ? 17  TYR A N   1 
ATOM   134 C CA  . TYR A 1 17 ? 0.785   21.071 23.742 1.00 20.91 ? 17  TYR A CA  1 
ATOM   135 C C   . TYR A 1 17 ? 1.245   19.694 23.251 1.00 20.18 ? 17  TYR A C   1 
ATOM   136 O O   . TYR A 1 17 ? 2.113   19.087 23.908 1.00 23.03 ? 17  TYR A O   1 
ATOM   137 C CB  . TYR A 1 17 ? -0.507  20.947 24.492 1.00 19.42 ? 17  TYR A CB  1 
ATOM   138 C CG  . TYR A 1 17 ? -0.784  21.998 25.538 1.00 18.97 ? 17  TYR A CG  1 
ATOM   139 C CD1 . TYR A 1 17 ? 0.092   22.198 26.594 1.00 18.78 ? 17  TYR A CD1 1 
ATOM   140 C CD2 . TYR A 1 17 ? -1.958  22.748 25.482 1.00 20.33 ? 17  TYR A CD2 1 
ATOM   141 C CE1 . TYR A 1 17 ? -0.199  23.127 27.607 1.00 20.04 ? 17  TYR A CE1 1 
ATOM   142 C CE2 . TYR A 1 17 ? -2.237  23.682 26.463 1.00 19.95 ? 17  TYR A CE2 1 
ATOM   143 C CZ  . TYR A 1 17 ? -1.366  23.860 27.514 1.00 20.59 ? 17  TYR A CZ  1 
ATOM   144 O OH  . TYR A 1 17 ? -1.667  24.773 28.496 1.00 22.16 ? 17  TYR A OH  1 
ATOM   145 N N   . HIS A 1 18 ? 0.768   19.218 22.113 1.00 19.30 ? 18  HIS A N   1 
ATOM   146 C CA  . HIS A 1 18 ? 1.165   17.936 21.561 1.00 21.91 ? 18  HIS A CA  1 
ATOM   147 C C   . HIS A 1 18 ? 2.668   17.966 21.271 1.00 22.54 ? 18  HIS A C   1 
ATOM   148 O O   . HIS A 1 18 ? 3.393   17.062 21.691 1.00 21.92 ? 18  HIS A O   1 
ATOM   149 C CB  . HIS A 1 18 ? 0.345   17.624 20.314 1.00 24.40 ? 18  HIS A CB  1 
ATOM   150 C CG  . HIS A 1 18 ? 0.754   16.300 19.721 1.00 27.35 ? 18  HIS A CG  1 
ATOM   151 N ND1 . HIS A 1 18 ? 1.179   16.220 18.419 1.00 29.62 ? 18  HIS A ND1 1 
ATOM   152 C CD2 . HIS A 1 18 ? 0.801   15.055 20.244 1.00 28.80 ? 18  HIS A CD2 1 
ATOM   153 C CE1 . HIS A 1 18 ? 1.469   14.950 18.138 1.00 30.55 ? 18  HIS A CE1 1 
ATOM   154 N NE2 . HIS A 1 18 ? 1.288   14.242 19.229 1.00 31.93 ? 18  HIS A NE2 1 
ATOM   155 N N   . LEU A 1 19 ? 3.145   19.031 20.619 1.00 19.19 ? 19  LEU A N   1 
ATOM   156 C CA  . LEU A 1 19 ? 4.577   19.202 20.381 1.00 20.55 ? 19  LEU A CA  1 
ATOM   157 C C   . LEU A 1 19 ? 5.382   19.238 21.681 1.00 22.74 ? 19  LEU A C   1 
ATOM   158 O O   . LEU A 1 19 ? 6.441   18.594 21.790 1.00 21.47 ? 19  LEU A O   1 
ATOM   159 C CB  . LEU A 1 19 ? 4.886   20.493 19.596 1.00 19.68 ? 19  LEU A CB  1 
ATOM   160 C CG  . LEU A 1 19 ? 4.495   20.515 18.119 1.00 20.49 ? 19  LEU A CG  1 
ATOM   161 C CD1 . LEU A 1 19 ? 4.456   21.980 17.676 1.00 19.88 ? 19  LEU A CD1 1 
ATOM   162 C CD2 . LEU A 1 19 ? 5.545   19.778 17.294 1.00 22.53 ? 19  LEU A CD2 1 
ATOM   163 N N   . GLU A 1 20 ? 4.901   19.939 22.717 1.00 20.88 ? 20  GLU A N   1 
ATOM   164 C CA  . GLU A 1 20 ? 5.597   19.938 24.006 1.00 23.83 ? 20  GLU A CA  1 
ATOM   165 C C   . GLU A 1 20 ? 5.759   18.512 24.515 1.00 23.52 ? 20  GLU A C   1 
ATOM   166 O O   . GLU A 1 20 ? 6.900   18.108 24.909 1.00 26.14 ? 20  GLU A O   1 
ATOM   167 C CB  . GLU A 1 20 ? 4.829   20.769 25.033 1.00 25.38 ? 20  GLU A CB  1 
ATOM   168 C CG  . GLU A 1 20 ? 5.569   20.956 26.338 1.00 29.67 ? 20  GLU A CG  1 
ATOM   169 C CD  . GLU A 1 20 ? 4.896   22.022 27.193 1.00 33.59 ? 20  GLU A CD  1 
ATOM   170 O OE1 . GLU A 1 20 ? 3.701   21.855 27.537 1.00 35.61 ? 20  GLU A OE1 1 
ATOM   171 O OE2 . GLU A 1 20 ? 5.614   23.006 27.487 1.00 36.56 ? 20  GLU A OE2 1 
ATOM   172 N N   . ASN A 1 21 ? 4.707   17.720 24.499 1.00 22.73 ? 21  ASN A N   1 
ATOM   173 C CA  . ASN A 1 21 ? 4.798   16.344 24.980 1.00 25.40 ? 21  ASN A CA  1 
ATOM   174 C C   . ASN A 1 21 ? 5.738   15.501 24.128 1.00 25.73 ? 21  ASN A C   1 
ATOM   175 O O   . ASN A 1 21 ? 6.543   14.690 24.621 1.00 24.68 ? 21  ASN A O   1 
ATOM   176 C CB  . ASN A 1 21 ? 3.400   15.729 25.047 1.00 29.82 ? 21  ASN A CB  1 
ATOM   177 C CG  . ASN A 1 21 ? 2.604   16.401 26.164 1.00 33.73 ? 21  ASN A CG  1 
ATOM   178 O OD1 . ASN A 1 21 ? 3.139   16.930 27.145 1.00 37.13 ? 21  ASN A OD1 1 
ATOM   179 N ND2 . ASN A 1 21 ? 1.294   16.363 26.000 1.00 36.26 ? 21  ASN A ND2 1 
ATOM   180 N N   . GLU A 1 22 ? 5.680   15.677 22.801 1.00 24.64 ? 22  GLU A N   1 
ATOM   181 C CA  . GLU A 1 22 ? 6.573   14.942 21.916 1.00 23.14 ? 22  GLU A CA  1 
ATOM   182 C C   . GLU A 1 22 ? 8.035   15.313 22.144 1.00 25.26 ? 22  GLU A C   1 
ATOM   183 O O   . GLU A 1 22 ? 8.891   14.406 22.072 1.00 26.10 ? 22  GLU A O   1 
ATOM   184 C CB  . GLU A 1 22 ? 6.238   15.247 20.447 1.00 26.34 ? 22  GLU A CB  1 
ATOM   185 C CG  . GLU A 1 22 ? 4.892   14.708 20.007 1.00 26.21 ? 22  GLU A CG  1 
ATOM   186 C CD  . GLU A 1 22 ? 4.772   14.986 18.509 1.00 29.30 ? 22  GLU A CD  1 
ATOM   187 O OE1 . GLU A 1 22 ? 4.746   16.204 18.161 1.00 27.78 ? 22  GLU A OE1 1 
ATOM   188 O OE2 . GLU A 1 22 ? 4.749   13.997 17.761 1.00 30.05 ? 22  GLU A OE2 1 
ATOM   189 N N   . VAL A 1 23 ? 8.336   16.577 22.399 1.00 22.12 ? 23  VAL A N   1 
ATOM   190 C CA  . VAL A 1 23 ? 9.706   17.005 22.603 1.00 24.69 ? 23  VAL A CA  1 
ATOM   191 C C   . VAL A 1 23 ? 10.208  16.370 23.911 1.00 24.96 ? 23  VAL A C   1 
ATOM   192 O O   . VAL A 1 23 ? 11.356  15.927 24.006 1.00 23.77 ? 23  VAL A O   1 
ATOM   193 C CB  . VAL A 1 23 ? 9.839   18.537 22.589 1.00 25.30 ? 23  VAL A CB  1 
ATOM   194 C CG1 . VAL A 1 23 ? 11.153  19.044 23.155 1.00 27.75 ? 23  VAL A CG1 1 
ATOM   195 C CG2 . VAL A 1 23 ? 9.650   19.020 21.145 1.00 27.71 ? 23  VAL A CG2 1 
ATOM   196 N N   . ALA A 1 24 ? 9.329   16.305 24.908 1.00 24.09 ? 24  ALA A N   1 
ATOM   197 C CA  . ALA A 1 24 ? 9.776   15.700 26.189 1.00 25.16 ? 24  ALA A CA  1 
ATOM   198 C C   . ALA A 1 24 ? 10.074  14.238 25.992 1.00 23.83 ? 24  ALA A C   1 
ATOM   199 O O   . ALA A 1 24 ? 11.082  13.704 26.510 1.00 27.59 ? 24  ALA A O   1 
ATOM   200 C CB  . ALA A 1 24 ? 8.602   15.893 27.165 1.00 23.80 ? 24  ALA A CB  1 
ATOM   201 N N   . ARG A 1 25 ? 9.273   13.520 25.216 1.00 24.38 ? 25  ARG A N   1 
ATOM   202 C CA  . ARG A 1 25 ? 9.502   12.118 24.965 1.00 26.79 ? 25  ARG A CA  1 
ATOM   203 C C   . ARG A 1 25 ? 10.819  11.919 24.199 1.00 27.18 ? 25  ARG A C   1 
ATOM   204 O O   . ARG A 1 25 ? 11.640  11.064 24.545 1.00 25.65 ? 25  ARG A O   1 
ATOM   205 C CB  . ARG A 1 25 ? 8.348   11.461 24.237 1.00 29.32 ? 25  ARG A CB  1 
ATOM   206 C CG  . ARG A 1 25 ? 7.089   11.308 25.121 1.00 32.64 ? 25  ARG A CG  1 
ATOM   207 C CD  . ARG A 1 25 ? 6.073   10.420 24.406 1.00 36.28 ? 25  ARG A CD  1 
ATOM   208 N NE  . ARG A 1 25 ? 5.241   11.032 23.408 1.00 39.08 ? 25  ARG A NE  1 
ATOM   209 C CZ  . ARG A 1 25 ? 4.323   11.985 23.418 1.00 40.07 ? 25  ARG A CZ  1 
ATOM   210 N NH1 . ARG A 1 25 ? 3.962   12.661 24.501 1.00 42.96 ? 25  ARG A NH1 1 
ATOM   211 N NH2 . ARG A 1 25 ? 3.700   12.330 22.295 1.00 40.65 ? 25  ARG A NH2 1 
ATOM   212 N N   . LEU A 1 26 ? 11.039  12.759 23.192 1.00 23.09 ? 26  LEU A N   1 
ATOM   213 C CA  . LEU A 1 26 ? 12.298  12.619 22.408 1.00 24.74 ? 26  LEU A CA  1 
ATOM   214 C C   . LEU A 1 26 ? 13.509  12.917 23.259 1.00 24.93 ? 26  LEU A C   1 
ATOM   215 O O   . LEU A 1 26 ? 14.566  12.244 23.176 1.00 24.44 ? 26  LEU A O   1 
ATOM   216 C CB  . LEU A 1 26 ? 12.134  13.583 21.230 1.00 26.40 ? 26  LEU A CB  1 
ATOM   217 C CG  . LEU A 1 26 ? 11.735  13.116 19.848 1.00 29.57 ? 26  LEU A CG  1 
ATOM   218 C CD1 . LEU A 1 26 ? 11.647  14.354 18.943 1.00 29.40 ? 26  LEU A CD1 1 
ATOM   219 C CD2 . LEU A 1 26 ? 12.695  12.105 19.218 1.00 29.88 ? 26  LEU A CD2 1 
ATOM   220 N N   . LYS A 1 27 ? 13.471  13.974 24.084 1.00 23.40 ? 27  LYS A N   1 
ATOM   221 C CA  . LYS A 1 27 ? 14.545  14.334 24.988 1.00 27.19 ? 27  LYS A CA  1 
ATOM   222 C C   . LYS A 1 27 ? 14.940  13.155 25.898 1.00 28.10 ? 27  LYS A C   1 
ATOM   223 O O   . LYS A 1 27 ? 16.139  12.909 26.096 1.00 27.95 ? 27  LYS A O   1 
ATOM   224 C CB  . LYS A 1 27 ? 14.193  15.553 25.815 1.00 28.42 ? 27  LYS A CB  1 
ATOM   225 C CG  . LYS A 1 27 ? 15.276  16.148 26.685 1.00 32.25 ? 27  LYS A CG  1 
ATOM   226 C CD  . LYS A 1 27 ? 14.799  17.427 27.371 1.00 35.15 ? 27  LYS A CD  1 
ATOM   227 C CE  . LYS A 1 27 ? 15.861  17.937 28.332 1.00 37.94 ? 27  LYS A CE  1 
ATOM   228 N NZ  . LYS A 1 27 ? 15.787  19.398 28.546 1.00 40.07 ? 27  LYS A NZ  1 
ATOM   229 N N   . LYS A 1 28 ? 13.975  12.392 26.370 1.00 29.22 ? 28  LYS A N   1 
ATOM   230 C CA  . LYS A 1 28 ? 14.268  11.201 27.190 1.00 30.25 ? 28  LYS A CA  1 
ATOM   231 C C   . LYS A 1 28 ? 14.893  10.111 26.328 1.00 31.29 ? 28  LYS A C   1 
ATOM   232 O O   . LYS A 1 28 ? 15.770  9.362  26.798 1.00 30.72 ? 28  LYS A O   1 
ATOM   233 C CB  . LYS A 1 28 ? 12.969  10.646 27.795 1.00 33.96 ? 28  LYS A CB  1 
ATOM   234 C CG  . LYS A 1 28 ? 13.171  9.334  28.558 1.00 36.23 ? 28  LYS A CG  1 
ATOM   235 C CD  . LYS A 1 28 ? 13.315  9.643  30.043 1.00 39.32 ? 28  LYS A CD  1 
ATOM   236 C CE  . LYS A 1 28 ? 13.932  8.487  30.822 1.00 40.34 ? 28  LYS A CE  1 
ATOM   237 N NZ  . LYS A 1 28 ? 15.341  8.831  31.203 1.00 42.08 ? 28  LYS A NZ  1 
ATOM   238 N N   . LEU A 1 29 ? 14.444  9.971  25.079 1.00 28.50 ? 29  LEU A N   1 
ATOM   239 C CA  . LEU A 1 29 ? 15.020  8.964  24.187 1.00 28.84 ? 29  LEU A CA  1 
ATOM   240 C C   . LEU A 1 29 ? 16.466  9.328  23.862 1.00 30.21 ? 29  LEU A C   1 
ATOM   241 O O   . LEU A 1 29 ? 17.365  8.458  23.869 1.00 30.93 ? 29  LEU A O   1 
ATOM   242 C CB  . LEU A 1 29 ? 14.232  8.845  22.881 1.00 30.15 ? 29  LEU A CB  1 
ATOM   243 C CG  . LEU A 1 29 ? 12.917  8.047  22.963 1.00 31.75 ? 29  LEU A CG  1 
ATOM   244 C CD1 . LEU A 1 29 ? 12.237  8.025  21.608 1.00 33.19 ? 29  LEU A CD1 1 
ATOM   245 C CD2 . LEU A 1 29 ? 13.226  6.628  23.446 1.00 33.32 ? 29  LEU A CD2 1 
ATOM   246 N N   . VAL A 1 30 ? 16.728  10.589 23.585 1.00 29.19 ? 30  VAL A N   1 
ATOM   247 C CA  . VAL A 1 30 ? 18.076  11.043 23.257 1.00 31.37 ? 30  VAL A CA  1 
ATOM   248 C C   . VAL A 1 30 ? 18.980  10.977 24.497 1.00 32.03 ? 30  VAL A C   1 
ATOM   249 O O   . VAL A 1 30 ? 20.176  10.645 24.252 1.00 32.50 ? 30  VAL A O   1 
ATOM   250 C CB  . VAL A 1 30 ? 18.040  12.437 22.633 1.00 31.73 ? 30  VAL A CB  1 
ATOM   251 C CG1 . VAL A 1 30 ? 19.432  13.007 22.400 1.00 32.83 ? 30  VAL A CG1 1 
ATOM   252 C CG2 . VAL A 1 30 ? 17.279  12.323 21.303 1.00 31.46 ? 30  VAL A CG2 1 
ATOM   253 N N   . ARG B 1 1  ? -7.524  45.157 14.248 1.00 27.24 ? 1   ARG B N   1 
ATOM   254 C CA  . ARG B 1 1  ? -7.109  44.120 15.211 1.00 26.32 ? 1   ARG B CA  1 
ATOM   255 C C   . ARG B 1 1  ? -7.478  42.702 14.780 1.00 25.77 ? 1   ARG B C   1 
ATOM   256 O O   . ARG B 1 1  ? -6.656  41.778 14.951 1.00 24.98 ? 1   ARG B O   1 
ATOM   257 C CB  . ARG B 1 1  ? -7.783  44.401 16.563 1.00 27.48 ? 1   ARG B CB  1 
ATOM   258 C CG  . ARG B 1 1  ? -7.257  43.494 17.666 1.00 28.65 ? 1   ARG B CG  1 
ATOM   259 C CD  . ARG B 1 1  ? -5.759  43.724 17.837 1.00 30.85 ? 1   ARG B CD  1 
ATOM   260 N NE  . ARG B 1 1  ? -5.309  43.149 19.090 1.00 33.39 ? 1   ARG B NE  1 
ATOM   261 C CZ  . ARG B 1 1  ? -4.071  42.897 19.434 1.00 34.50 ? 1   ARG B CZ  1 
ATOM   262 N NH1 . ARG B 1 1  ? -3.044  43.131 18.615 1.00 35.92 ? 1   ARG B NH1 1 
ATOM   263 N NH2 . ARG B 1 1  ? -3.879  42.370 20.632 1.00 36.43 ? 1   ARG B NH2 1 
ATOM   264 N N   . MET B 1 2  ? -8.640  42.550 14.142 1.00 23.75 ? 2   MET B N   1 
ATOM   265 C CA  . MET B 1 2  ? -9.061  41.204 13.804 1.00 25.58 ? 2   MET B CA  1 
ATOM   266 C C   . MET B 1 2  ? -8.168  40.507 12.777 1.00 25.00 ? 2   MET B C   1 
ATOM   267 O O   . MET B 1 2  ? -7.780  39.323 12.951 1.00 24.23 ? 2   MET B O   1 
ATOM   268 C CB  . MET B 1 2  ? -10.524 41.196 13.330 1.00 27.08 ? 2   MET B CB  1 
ATOM   269 C CG  . MET B 1 2  ? -10.770 39.750 12.855 1.00 30.37 ? 2   MET B CG  1 
ATOM   270 S SD  . MET B 1 2  ? -11.666 38.810 14.127 1.00 33.60 ? 2   MET B SD  1 
ATOM   271 C CE  . MET B 1 2  ? -13.168 39.823 13.626 1.00 23.29 ? 2   MET B CE  1 
ATOM   272 N N   . LYS B 1 3  ? -7.827  41.280 11.733 1.00 23.44 ? 3   LYS B N   1 
ATOM   273 C CA  . LYS B 1 3  ? -6.926  40.756 10.704 1.00 24.80 ? 3   LYS B CA  1 
ATOM   274 C C   . LYS B 1 3  ? -5.533  40.541 11.303 1.00 22.57 ? 3   LYS B C   1 
ATOM   275 O O   . LYS B 1 3  ? -4.840  39.583 10.906 1.00 22.83 ? 3   LYS B O   1 
ATOM   276 C CB  . LYS B 1 3  ? -6.831  41.715 9.521  1.00 25.01 ? 3   LYS B CB  1 
ATOM   277 C CG  . LYS B 1 3  ? -5.875  41.341 8.395  1.00 27.61 ? 3   LYS B CG  1 
ATOM   278 C CD  . LYS B 1 3  ? -6.418  40.188 7.552  1.00 32.20 ? 3   LYS B CD  1 
ATOM   279 C CE  . LYS B 1 3  ? -5.587  40.068 6.256  1.00 34.27 ? 3   LYS B CE  1 
ATOM   280 N NZ  . LYS B 1 3  ? -6.483  39.419 5.244  1.00 36.44 ? 3   LYS B NZ  1 
ATOM   281 N N   . GLN B 1 4  ? -5.088  41.332 12.261 1.00 21.88 ? 4   GLN B N   1 
ATOM   282 C CA  . GLN B 1 4  ? -3.783  41.169 12.875 1.00 23.07 ? 4   GLN B CA  1 
ATOM   283 C C   . GLN B 1 4  ? -3.755  39.783 13.560 1.00 19.88 ? 4   GLN B C   1 
ATOM   284 O O   . GLN B 1 4  ? -2.739  39.083 13.461 1.00 20.60 ? 4   GLN B O   1 
ATOM   285 C CB  . GLN B 1 4  ? -3.458  42.229 13.920 1.00 24.36 ? 4   GLN B CB  1 
ATOM   286 C CG  . GLN B 1 4  ? -2.086  42.210 14.515 1.00 27.94 ? 4   GLN B CG  1 
ATOM   287 C CD  . GLN B 1 4  ? -1.760  43.430 15.360 1.00 32.24 ? 4   GLN B CD  1 
ATOM   288 O OE1 . GLN B 1 4  ? -2.649  44.085 15.912 1.00 33.74 ? 4   GLN B OE1 1 
ATOM   289 N NE2 . GLN B 1 4  ? -0.470  43.732 15.468 1.00 35.72 ? 4   GLN B NE2 1 
ATOM   290 N N   . LEU B 1 5  ? -4.848  39.449 14.242 1.00 17.86 ? 5   LEU B N   1 
ATOM   291 C CA  . LEU B 1 5  ? -4.862  38.183 14.997 1.00 19.59 ? 5   LEU B CA  1 
ATOM   292 C C   . LEU B 1 5  ? -5.077  36.977 14.096 1.00 17.69 ? 5   LEU B C   1 
ATOM   293 O O   . LEU B 1 5  ? -4.446  35.910 14.285 1.00 19.12 ? 5   LEU B O   1 
ATOM   294 C CB  . LEU B 1 5  ? -5.930  38.197 16.083 1.00 20.98 ? 5   LEU B CB  1 
ATOM   295 C CG  . LEU B 1 5  ? -5.680  39.327 17.087 1.00 21.29 ? 5   LEU B CG  1 
ATOM   296 C CD1 . LEU B 1 5  ? -6.835  39.298 18.102 1.00 24.23 ? 5   LEU B CD1 1 
ATOM   297 C CD2 . LEU B 1 5  ? -4.328  39.260 17.754 1.00 22.63 ? 5   LEU B CD2 1 
ATOM   298 N N   . GLU B 1 6  ? -5.826  37.195 13.014 1.00 19.29 ? 6   GLU B N   1 
ATOM   299 C CA  . GLU B 1 6  ? -6.008  36.113 12.012 1.00 19.25 ? 6   GLU B CA  1 
ATOM   300 C C   . GLU B 1 6  ? -4.653  35.814 11.382 1.00 17.65 ? 6   GLU B C   1 
ATOM   301 O O   . GLU B 1 6  ? -4.268  34.676 11.087 1.00 18.87 ? 6   GLU B O   1 
ATOM   302 C CB  . GLU B 1 6  ? -7.031  36.565 10.952 1.00 19.92 ? 6   GLU B CB  1 
ATOM   303 C CG  . GLU B 1 6  ? -8.479  36.521 11.370 1.00 22.38 ? 6   GLU B CG  1 
ATOM   304 C CD  . GLU B 1 6  ? -9.472  37.187 10.437 1.00 23.64 ? 6   GLU B CD  1 
ATOM   305 O OE1 . GLU B 1 6  ? -9.084  38.067 9.648  1.00 24.14 ? 6   GLU B OE1 1 
ATOM   306 O OE2 . GLU B 1 6  ? -10.666 36.833 10.507 1.00 26.06 ? 6   GLU B OE2 1 
ATOM   307 N N   . ASP B 1 7  ? -3.871  36.859 11.042 1.00 18.23 ? 7   ASP B N   1 
ATOM   308 C CA  . ASP B 1 7  ? -2.544  36.693 10.439 1.00 18.59 ? 7   ASP B CA  1 
ATOM   309 C C   . ASP B 1 7  ? -1.599  35.973 11.414 1.00 19.36 ? 7   ASP B C   1 
ATOM   310 O O   . ASP B 1 7  ? -0.859  35.037 11.024 1.00 18.62 ? 7   ASP B O   1 
ATOM   311 C CB  . ASP B 1 7  ? -1.951  38.076 10.115 1.00 20.90 ? 7   ASP B CB  1 
ATOM   312 C CG  . ASP B 1 7  ? -2.501  38.709 8.834  1.00 23.37 ? 7   ASP B CG  1 
ATOM   313 O OD1 . ASP B 1 7  ? -3.266  38.101 8.097  1.00 23.48 ? 7   ASP B OD1 1 
ATOM   314 O OD2 . ASP B 1 7  ? -2.077  39.876 8.631  1.00 23.93 ? 7   ASP B OD2 1 
ATOM   315 N N   . LYS B 1 8  ? -1.682  36.379 12.679 1.00 18.06 ? 8   LYS B N   1 
ATOM   316 C CA  . LYS B 1 8  ? -0.818  35.727 13.680 1.00 16.96 ? 8   LYS B CA  1 
ATOM   317 C C   . LYS B 1 8  ? -1.154  34.257 13.835 1.00 15.21 ? 8   LYS B C   1 
ATOM   318 O O   . LYS B 1 8  ? -0.231  33.415 13.985 1.00 15.99 ? 8   LYS B O   1 
ATOM   319 C CB  . LYS B 1 8  ? -1.019  36.459 15.026 1.00 16.64 ? 8   LYS B CB  1 
ATOM   320 C CG  . LYS B 1 8  ? -0.088  35.829 16.082 1.00 19.98 ? 8   LYS B CG  1 
ATOM   321 C CD  . LYS B 1 8  ? 1.378   35.964 15.811 1.00 20.49 ? 8   LYS B CD  1 
ATOM   322 C CE  . LYS B 1 8  ? 1.938   37.371 15.596 1.00 22.21 ? 8   LYS B CE  1 
ATOM   323 N NZ  . LYS B 1 8  ? 3.437   37.213 15.505 1.00 23.07 ? 8   LYS B NZ  1 
ATOM   324 N N   . VAL B 1 9  ? -2.459  33.902 13.915 1.00 14.73 ? 9   VAL B N   1 
ATOM   325 C CA  . VAL B 1 9  ? -2.755  32.486 14.104 1.00 15.64 ? 9   VAL B CA  1 
ATOM   326 C C   . VAL B 1 9  ? -2.331  31.687 12.869 1.00 14.87 ? 9   VAL B C   1 
ATOM   327 O O   . VAL B 1 9  ? -1.901  30.537 13.028 1.00 15.56 ? 9   VAL B O   1 
ATOM   328 C CB  . VAL B 1 9  ? -4.231  32.220 14.426 1.00 18.18 ? 9   VAL B CB  1 
ATOM   329 C CG1 . VAL B 1 9  ? -5.141  32.174 13.195 1.00 19.47 ? 9   VAL B CG1 1 
ATOM   330 C CG2 . VAL B 1 9  ? -4.365  30.891 15.151 1.00 18.65 ? 9   VAL B CG2 1 
ATOM   331 N N   . GLU B 1 10 ? -2.415  32.251 11.658 1.00 15.08 ? 10  GLU B N   1 
ATOM   332 C CA  . GLU B 1 10 ? -1.903  31.448 10.508 1.00 17.19 ? 10  GLU B CA  1 
ATOM   333 C C   . GLU B 1 10 ? -0.386  31.328 10.540 1.00 14.23 ? 10  GLU B C   1 
ATOM   334 O O   . GLU B 1 10 ? 0.175   30.253 10.252 1.00 16.89 ? 10  GLU B O   1 
ATOM   335 C CB  . GLU B 1 10 ? -2.274  32.217 9.229  1.00 18.47 ? 10  GLU B CB  1 
ATOM   336 C CG  . GLU B 1 10 ? -3.780  32.177 9.076  1.00 20.13 ? 10  GLU B CG  1 
ATOM   337 C CD  . GLU B 1 10 ? -4.353  33.060 7.976  1.00 24.18 ? 10  GLU B CD  1 
ATOM   338 O OE1 . GLU B 1 10 ? -3.662  33.974 7.538  1.00 23.83 ? 10  GLU B OE1 1 
ATOM   339 O OE2 . GLU B 1 10 ? -5.522  32.652 7.682  1.00 27.36 ? 10  GLU B OE2 1 
ATOM   340 N N   . GLU B 1 11 ? 0.350   32.363 10.969 1.00 16.15 ? 11  GLU B N   1 
ATOM   341 C CA  . GLU B 1 11 ? 1.798   32.251 11.109 1.00 16.35 ? 11  GLU B CA  1 
ATOM   342 C C   . GLU B 1 11 ? 2.133   31.141 12.116 1.00 16.98 ? 11  GLU B C   1 
ATOM   343 O O   . GLU B 1 11 ? 3.004   30.260 11.888 1.00 17.07 ? 11  GLU B O   1 
ATOM   344 C CB  . GLU B 1 11 ? 2.363   33.549 11.719 1.00 19.20 ? 11  GLU B CB  1 
ATOM   345 C CG  . GLU B 1 11 ? 3.811   33.488 12.150 1.00 17.74 ? 11  GLU B CG  1 
ATOM   346 C CD  . GLU B 1 11 ? 4.220   34.702 12.979 1.00 25.24 ? 11  GLU B CD  1 
ATOM   347 O OE1 . GLU B 1 11 ? 3.561   35.764 12.966 1.00 24.58 ? 11  GLU B OE1 1 
ATOM   348 O OE2 . GLU B 1 11 ? 5.227   34.503 13.702 1.00 29.26 ? 11  GLU B OE2 1 
ATOM   349 N N   . LEU B 1 12 ? 1.475   31.193 13.299 1.00 15.05 ? 12  LEU B N   1 
ATOM   350 C CA  . LEU B 1 12 ? 1.778   30.181 14.326 1.00 15.62 ? 12  LEU B CA  1 
ATOM   351 C C   . LEU B 1 12 ? 1.406   28.764 13.909 1.00 15.22 ? 12  LEU B C   1 
ATOM   352 O O   . LEU B 1 12 ? 2.128   27.754 14.216 1.00 16.24 ? 12  LEU B O   1 
ATOM   353 C CB  . LEU B 1 12 ? 1.180   30.598 15.667 1.00 15.77 ? 12  LEU B CB  1 
ATOM   354 C CG  . LEU B 1 12 ? 1.757   31.946 16.146 1.00 16.29 ? 12  LEU B CG  1 
ATOM   355 C CD1 . LEU B 1 12 ? 1.110   32.283 17.507 1.00 14.84 ? 12  LEU B CD1 1 
ATOM   356 C CD2 . LEU B 1 12 ? 3.242   31.881 16.289 1.00 18.13 ? 12  LEU B CD2 1 
ATOM   357 N N   . LEU B 1 13 ? 0.285   28.590 13.171 1.00 14.92 ? 13  LEU B N   1 
ATOM   358 C CA  . LEU B 1 13 ? -0.084  27.298 12.685 1.00 15.13 ? 13  LEU B CA  1 
ATOM   359 C C   . LEU B 1 13 ? 0.941   26.722 11.691 1.00 15.68 ? 13  LEU B C   1 
ATOM   360 O O   . LEU B 1 13 ? 1.253   25.534 11.757 1.00 17.47 ? 13  LEU B O   1 
ATOM   361 C CB  . LEU B 1 13 ? -1.471  27.276 12.018 1.00 16.61 ? 13  LEU B CB  1 
ATOM   362 C CG  . LEU B 1 13 ? -2.588  27.325 13.071 1.00 16.82 ? 13  LEU B CG  1 
ATOM   363 C CD1 . LEU B 1 13 ? -3.917  27.680 12.378 1.00 18.03 ? 13  LEU B CD1 1 
ATOM   364 C CD2 . LEU B 1 13 ? -2.775  25.986 13.797 1.00 20.21 ? 13  LEU B CD2 1 
ATOM   365 N N   . SER B 1 14 ? 1.491   27.642 10.867 1.00 15.96 ? 14  SER B N   1 
ATOM   366 C CA  . SER B 1 14 ? 2.523   27.192 9.933  1.00 16.97 ? 14  SER B CA  1 
ATOM   367 C C   . SER B 1 14 ? 3.771   26.752 10.712 1.00 18.34 ? 14  SER B C   1 
ATOM   368 O O   . SER B 1 14 ? 4.300   25.665 10.448 1.00 19.28 ? 14  SER B O   1 
ATOM   369 C CB  . SER B 1 14 ? 2.890   28.350 9.005  1.00 18.30 ? 14  SER B CB  1 
ATOM   370 O OG  . SER B 1 14 ? 3.975   28.011 8.167  1.00 17.41 ? 14  SER B OG  1 
ATOM   371 N N   . LYS B 1 15 ? 4.144   27.587 11.695 1.00 15.38 ? 15  LYS B N   1 
ATOM   372 C CA  . LYS B 1 15 ? 5.345   27.171 12.492 1.00 18.56 ? 15  LYS B CA  1 
ATOM   373 C C   . LYS B 1 15 ? 5.043   25.846 13.179 1.00 17.96 ? 15  LYS B C   1 
ATOM   374 O O   . LYS B 1 15 ? 5.956   25.005 13.228 1.00 17.69 ? 15  LYS B O   1 
ATOM   375 C CB  . LYS B 1 15 ? 5.698   28.256 13.478 1.00 21.48 ? 15  LYS B CB  1 
ATOM   376 C CG  . LYS B 1 15 ? 6.310   29.515 12.826 1.00 25.79 ? 15  LYS B CG  1 
ATOM   377 C CD  . LYS B 1 15 ? 6.508   30.555 13.903 1.00 29.18 ? 15  LYS B CD  1 
ATOM   378 C CE  . LYS B 1 15 ? 7.064   31.901 13.440 1.00 32.37 ? 15  LYS B CE  1 
ATOM   379 N NZ  . LYS B 1 15 ? 7.682   31.740 12.101 1.00 32.90 ? 15  LYS B NZ  1 
ATOM   380 N N   . ALA B 1 16 ? 3.856   25.645 13.719 1.00 15.62 ? 16  ALA B N   1 
ATOM   381 C CA  . ALA B 1 16 ? 3.492   24.390 14.374 1.00 16.79 ? 16  ALA B CA  1 
ATOM   382 C C   . ALA B 1 16 ? 3.611   23.192 13.429 1.00 18.34 ? 16  ALA B C   1 
ATOM   383 O O   . ALA B 1 16 ? 4.158   22.127 13.798 1.00 19.73 ? 16  ALA B O   1 
ATOM   384 C CB  . ALA B 1 16 ? 2.116   24.432 15.031 1.00 18.02 ? 16  ALA B CB  1 
ATOM   385 N N   . TYR B 1 17 ? 3.085   23.314 12.214 1.00 16.72 ? 17  TYR B N   1 
ATOM   386 C CA  . TYR B 1 17 ? 3.213   22.246 11.216 1.00 18.37 ? 17  TYR B CA  1 
ATOM   387 C C   . TYR B 1 17 ? 4.671   21.913 10.914 1.00 16.87 ? 17  TYR B C   1 
ATOM   388 O O   . TYR B 1 17 ? 5.009   20.701 10.856 1.00 19.23 ? 17  TYR B O   1 
ATOM   389 C CB  . TYR B 1 17 ? 2.513   22.734 9.956  1.00 19.32 ? 17  TYR B CB  1 
ATOM   390 C CG  . TYR B 1 17 ? 2.579   21.803 8.767  1.00 21.12 ? 17  TYR B CG  1 
ATOM   391 C CD1 . TYR B 1 17 ? 1.943   20.585 8.804  1.00 24.17 ? 17  TYR B CD1 1 
ATOM   392 C CD2 . TYR B 1 17 ? 3.229   22.224 7.605  1.00 24.19 ? 17  TYR B CD2 1 
ATOM   393 C CE1 . TYR B 1 17 ? 1.984   19.731 7.709  1.00 25.96 ? 17  TYR B CE1 1 
ATOM   394 C CE2 . TYR B 1 17 ? 3.278   21.367 6.495  1.00 25.88 ? 17  TYR B CE2 1 
ATOM   395 C CZ  . TYR B 1 17 ? 2.643   20.157 6.568  1.00 28.19 ? 17  TYR B CZ  1 
ATOM   396 O OH  . TYR B 1 17 ? 2.652   19.286 5.477  1.00 31.05 ? 17  TYR B OH  1 
ATOM   397 N N   . HIS B 1 18 ? 5.518   22.918 10.679 1.00 17.79 ? 18  HIS B N   1 
ATOM   398 C CA  . HIS B 1 18 ? 6.925   22.623 10.377 1.00 18.49 ? 18  HIS B CA  1 
ATOM   399 C C   . HIS B 1 18 ? 7.639   22.015 11.568 1.00 19.46 ? 18  HIS B C   1 
ATOM   400 O O   . HIS B 1 18 ? 8.531   21.157 11.388 1.00 19.85 ? 18  HIS B O   1 
ATOM   401 C CB  . HIS B 1 18 ? 7.627   23.873 9.832  1.00 17.71 ? 18  HIS B CB  1 
ATOM   402 C CG  . HIS B 1 18 ? 6.978   24.194 8.511  1.00 20.72 ? 18  HIS B CG  1 
ATOM   403 N ND1 . HIS B 1 18 ? 7.489   23.617 7.343  1.00 24.35 ? 18  HIS B ND1 1 
ATOM   404 C CD2 . HIS B 1 18 ? 5.926   24.935 8.122  1.00 21.16 ? 18  HIS B CD2 1 
ATOM   405 C CE1 . HIS B 1 18 ? 6.784   24.033 6.318  1.00 22.74 ? 18  HIS B CE1 1 
ATOM   406 N NE2 . HIS B 1 18 ? 5.801   24.819 6.738  1.00 22.37 ? 18  HIS B NE2 1 
ATOM   407 N N   . LEU B 1 19 ? 7.295   22.409 12.801 1.00 18.31 ? 19  LEU B N   1 
ATOM   408 C CA  . LEU B 1 19 ? 7.920   21.765 13.971 1.00 17.30 ? 19  LEU B CA  1 
ATOM   409 C C   . LEU B 1 19 ? 7.504   20.315 14.089 1.00 19.41 ? 19  LEU B C   1 
ATOM   410 O O   . LEU B 1 19 ? 8.316   19.431 14.466 1.00 20.94 ? 19  LEU B O   1 
ATOM   411 C CB  . LEU B 1 19 ? 7.568   22.555 15.262 1.00 17.09 ? 19  LEU B CB  1 
ATOM   412 C CG  . LEU B 1 19 ? 8.337   23.878 15.348 1.00 18.80 ? 19  LEU B CG  1 
ATOM   413 C CD1 . LEU B 1 19 ? 7.703   24.663 16.528 1.00 21.26 ? 19  LEU B CD1 1 
ATOM   414 C CD2 . LEU B 1 19 ? 9.810   23.698 15.623 1.00 20.62 ? 19  LEU B CD2 1 
ATOM   415 N N   . GLU B 1 20 ? 6.229   20.021 13.766 1.00 20.72 ? 20  GLU B N   1 
ATOM   416 C CA  . GLU B 1 20 ? 5.773   18.625 13.786 1.00 23.66 ? 20  GLU B CA  1 
ATOM   417 C C   . GLU B 1 20 ? 6.581   17.821 12.755 1.00 23.64 ? 20  GLU B C   1 
ATOM   418 O O   . GLU B 1 20 ? 6.903   16.654 13.018 1.00 25.00 ? 20  GLU B O   1 
ATOM   419 C CB  . GLU B 1 20 ? 4.283   18.583 13.466 1.00 25.52 ? 20  GLU B CB  1 
ATOM   420 C CG  . GLU B 1 20 ? 3.592   17.242 13.463 1.00 30.57 ? 20  GLU B CG  1 
ATOM   421 C CD  . GLU B 1 20 ? 3.211   16.700 14.833 1.00 35.27 ? 20  GLU B CD  1 
ATOM   422 O OE1 . GLU B 1 20 ? 4.014   16.765 15.795 1.00 33.01 ? 20  GLU B OE1 1 
ATOM   423 O OE2 . GLU B 1 20 ? 2.064   16.148 14.907 1.00 39.66 ? 20  GLU B OE2 1 
ATOM   424 N N   . ASN B 1 21 ? 6.876   18.426 11.599 1.00 21.85 ? 21  ASN B N   1 
ATOM   425 C CA  . ASN B 1 21 ? 7.675   17.666 10.615 1.00 23.15 ? 21  ASN B CA  1 
ATOM   426 C C   . ASN B 1 21 ? 9.065   17.374 11.154 1.00 23.24 ? 21  ASN B C   1 
ATOM   427 O O   . ASN B 1 21 ? 9.616   16.286 10.910 1.00 23.86 ? 21  ASN B O   1 
ATOM   428 C CB  . ASN B 1 21 ? 7.839   18.451 9.320  1.00 24.92 ? 21  ASN B CB  1 
ATOM   429 C CG  . ASN B 1 21 ? 6.585   18.527 8.489  1.00 27.82 ? 21  ASN B CG  1 
ATOM   430 O OD1 . ASN B 1 21 ? 5.617   17.800 8.716  1.00 31.87 ? 21  ASN B OD1 1 
ATOM   431 N ND2 . ASN B 1 21 ? 6.664   19.418 7.501  1.00 31.86 ? 21  ASN B ND2 1 
ATOM   432 N N   . GLU B 1 22 ? 9.634   18.319 11.883 1.00 21.39 ? 22  GLU B N   1 
ATOM   433 C CA  . GLU B 1 22 ? 10.964  18.170 12.447 1.00 22.87 ? 22  GLU B CA  1 
ATOM   434 C C   . GLU B 1 22 ? 10.951  17.090 13.521 1.00 25.03 ? 22  GLU B C   1 
ATOM   435 O O   . GLU B 1 22 ? 11.885  16.279 13.643 1.00 24.23 ? 22  GLU B O   1 
ATOM   436 C CB  . GLU B 1 22 ? 11.511  19.495 12.933 1.00 26.24 ? 22  GLU B CB  1 
ATOM   437 C CG  . GLU B 1 22 ? 12.762  19.283 13.750 1.00 30.44 ? 22  GLU B CG  1 
ATOM   438 C CD  . GLU B 1 22 ? 13.425  20.535 14.240 1.00 34.62 ? 22  GLU B CD  1 
ATOM   439 O OE1 . GLU B 1 22 ? 12.835  21.628 14.153 1.00 37.18 ? 22  GLU B OE1 1 
ATOM   440 O OE2 . GLU B 1 22 ? 14.563  20.376 14.752 1.00 37.11 ? 22  GLU B OE2 1 
ATOM   441 N N   . VAL B 1 23 ? 9.910   17.099 14.344 1.00 21.63 ? 23  VAL B N   1 
ATOM   442 C CA  . VAL B 1 23 ? 9.773   16.068 15.389 1.00 23.80 ? 23  VAL B CA  1 
ATOM   443 C C   . VAL B 1 23 ? 9.708   14.688 14.765 1.00 26.81 ? 23  VAL B C   1 
ATOM   444 O O   . VAL B 1 23 ? 10.416  13.753 15.206 1.00 26.38 ? 23  VAL B O   1 
ATOM   445 C CB  . VAL B 1 23 ? 8.465   16.304 16.192 1.00 24.83 ? 23  VAL B CB  1 
ATOM   446 C CG1 . VAL B 1 23 ? 8.079   15.056 16.993 1.00 25.73 ? 23  VAL B CG1 1 
ATOM   447 C CG2 . VAL B 1 23 ? 8.702   17.525 17.068 1.00 24.86 ? 23  VAL B CG2 1 
ATOM   448 N N   . ALA B 1 24 ? 8.869   14.585 13.734 1.00 27.04 ? 24  ALA B N   1 
ATOM   449 C CA  . ALA B 1 24 ? 8.725   13.312 13.028 1.00 29.38 ? 24  ALA B CA  1 
ATOM   450 C C   . ALA B 1 24 ? 10.082  12.808 12.510 1.00 30.64 ? 24  ALA B C   1 
ATOM   451 O O   . ALA B 1 24 ? 10.346  11.599 12.586 1.00 30.04 ? 24  ALA B O   1 
ATOM   452 C CB  . ALA B 1 24 ? 7.825   13.499 11.825 1.00 28.83 ? 24  ALA B CB  1 
ATOM   453 N N   . ARG B 1 25 ? 10.857  13.701 11.908 1.00 29.50 ? 25  ARG B N   1 
ATOM   454 C CA  . ARG B 1 25 ? 12.152  13.348 11.374 1.00 30.20 ? 25  ARG B CA  1 
ATOM   455 C C   . ARG B 1 25 ? 13.095  12.888 12.502 1.00 29.30 ? 25  ARG B C   1 
ATOM   456 O O   . ARG B 1 25 ? 13.765  11.856 12.293 1.00 27.87 ? 25  ARG B O   1 
ATOM   457 C CB  . ARG B 1 25 ? 12.849  14.487 10.664 1.00 30.83 ? 25  ARG B CB  1 
ATOM   458 C CG  . ARG B 1 25 ? 12.320  14.893 9.295  1.00 33.86 ? 25  ARG B CG  1 
ATOM   459 C CD  . ARG B 1 25 ? 13.267  15.919 8.689  1.00 34.63 ? 25  ARG B CD  1 
ATOM   460 N NE  . ARG B 1 25 ? 13.159  17.281 9.139  1.00 37.16 ? 25  ARG B NE  1 
ATOM   461 C CZ  . ARG B 1 25 ? 12.197  18.178 8.912  1.00 35.32 ? 25  ARG B CZ  1 
ATOM   462 N NH1 . ARG B 1 25 ? 11.134  17.873 8.192  1.00 37.34 ? 25  ARG B NH1 1 
ATOM   463 N NH2 . ARG B 1 25 ? 12.318  19.397 9.424  1.00 34.35 ? 25  ARG B NH2 1 
ATOM   464 N N   . LEU B 1 26 ? 13.113  13.647 13.609 1.00 25.77 ? 26  LEU B N   1 
ATOM   465 C CA  . LEU B 1 26 ? 14.050  13.259 14.682 1.00 26.78 ? 26  LEU B CA  1 
ATOM   466 C C   . LEU B 1 26 ? 13.625  11.973 15.364 1.00 27.97 ? 26  LEU B C   1 
ATOM   467 O O   . LEU B 1 26 ? 14.479  11.167 15.780 1.00 28.75 ? 26  LEU B O   1 
ATOM   468 C CB  . LEU B 1 26 ? 14.206  14.409 15.672 1.00 26.77 ? 26  LEU B CB  1 
ATOM   469 C CG  . LEU B 1 26 ? 14.728  15.716 15.073 1.00 28.04 ? 26  LEU B CG  1 
ATOM   470 C CD1 . LEU B 1 26 ? 14.887  16.797 16.139 1.00 29.53 ? 26  LEU B CD1 1 
ATOM   471 C CD2 . LEU B 1 26 ? 16.054  15.480 14.342 1.00 29.57 ? 26  LEU B CD2 1 
ATOM   472 N N   . LYS B 1 27 ? 12.319  11.724 15.459 1.00 29.28 ? 27  LYS B N   1 
ATOM   473 C CA  . LYS B 1 27 ? 11.858  10.463 16.077 1.00 31.40 ? 27  LYS B CA  1 
ATOM   474 C C   . LYS B 1 27 ? 12.353  9.278  15.251 1.00 32.91 ? 27  LYS B C   1 
ATOM   475 O O   . LYS B 1 27 ? 12.786  8.255  15.804 1.00 32.52 ? 27  LYS B O   1 
ATOM   476 C CB  . LYS B 1 27 ? 10.342  10.411 16.177 1.00 33.54 ? 27  LYS B CB  1 
ATOM   477 C CG  . LYS B 1 27 ? 9.784   11.468 17.151 1.00 36.44 ? 27  LYS B CG  1 
ATOM   478 C CD  . LYS B 1 27 ? 8.327   11.733 16.782 1.00 39.56 ? 27  LYS B CD  1 
ATOM   479 C CE  . LYS B 1 27 ? 7.388   10.655 17.271 1.00 40.05 ? 27  LYS B CE  1 
ATOM   480 N NZ  . LYS B 1 27 ? 6.065   11.216 17.706 1.00 42.01 ? 27  LYS B NZ  1 
ATOM   481 N N   . LYS B 1 28 ? 12.294  9.411  13.923 1.00 31.57 ? 28  LYS B N   1 
ATOM   482 C CA  . LYS B 1 28 ? 12.756  8.375  13.020 1.00 32.74 ? 28  LYS B CA  1 
ATOM   483 C C   . LYS B 1 28 ? 14.248  8.145  13.224 1.00 32.02 ? 28  LYS B C   1 
ATOM   484 O O   . LYS B 1 28 ? 14.702  6.995  13.233 1.00 32.67 ? 28  LYS B O   1 
ATOM   485 C CB  . LYS B 1 28 ? 12.538  8.793  11.569 1.00 35.52 ? 28  LYS B CB  1 
ATOM   486 C CG  . LYS B 1 28 ? 12.181  7.693  10.587 1.00 37.78 ? 28  LYS B CG  1 
ATOM   487 C CD  . LYS B 1 28 ? 12.386  8.201  9.148  1.00 40.28 ? 28  LYS B CD  1 
ATOM   488 C CE  . LYS B 1 28 ? 12.839  7.028  8.285  1.00 41.80 ? 28  LYS B CE  1 
ATOM   489 N NZ  . LYS B 1 28 ? 13.625  7.444  7.099  1.00 44.37 ? 28  LYS B NZ  1 
ATOM   490 N N   . LEU B 1 29 ? 15.010  9.229  13.266 1.00 31.16 ? 29  LEU B N   1 
ATOM   491 C CA  . LEU B 1 29 ? 16.451  9.182  13.437 1.00 30.59 ? 29  LEU B CA  1 
ATOM   492 C C   . LEU B 1 29 ? 16.859  8.497  14.733 1.00 31.03 ? 29  LEU B C   1 
ATOM   493 O O   . LEU B 1 29 ? 17.691  7.580  14.690 1.00 32.12 ? 29  LEU B O   1 
ATOM   494 C CB  . LEU B 1 29 ? 17.111  10.545 13.401 1.00 31.72 ? 29  LEU B CB  1 
ATOM   495 C CG  . LEU B 1 29 ? 18.088  10.917 12.293 1.00 36.53 ? 29  LEU B CG  1 
ATOM   496 C CD1 . LEU B 1 29 ? 17.659  10.374 10.934 1.00 36.05 ? 29  LEU B CD1 1 
ATOM   497 C CD2 . LEU B 1 29 ? 18.310  12.434 12.272 1.00 36.09 ? 29  LEU B CD2 1 
ATOM   498 N N   . VAL B 1 30 ? 16.254  8.888  15.863 1.00 30.54 ? 30  VAL B N   1 
ATOM   499 C CA  . VAL B 1 30 ? 16.670  8.248  17.118 1.00 32.24 ? 30  VAL B CA  1 
ATOM   500 C C   . VAL B 1 30 ? 16.170  6.824  17.226 1.00 32.89 ? 30  VAL B C   1 
ATOM   501 O O   . VAL B 1 30 ? 16.753  6.062  18.033 1.00 33.90 ? 30  VAL B O   1 
ATOM   502 C CB  . VAL B 1 30 ? 16.309  9.109  18.344 1.00 34.00 ? 30  VAL B CB  1 
ATOM   503 C CG1 . VAL B 1 30 ? 14.808  9.128  18.556 1.00 33.75 ? 30  VAL B CG1 1 
ATOM   504 C CG2 . VAL B 1 30 ? 17.067  8.650  19.585 1.00 33.59 ? 30  VAL B CG2 1 
ATOM   505 N N   . GLY B 1 31 ? 15.193  6.357  16.466 1.00 34.50 ? 31  GLY B N   1 
ATOM   506 C CA  . GLY B 1 31 ? 14.799  4.957  16.610 1.00 38.17 ? 31  GLY B CA  1 
ATOM   507 C C   . GLY B 1 31 ? 15.464  3.982  15.661 1.00 40.20 ? 31  GLY B C   1 
ATOM   508 O O   . GLY B 1 31 ? 15.181  2.780  15.810 1.00 39.11 ? 31  GLY B O   1 
ATOM   509 N N   . GLU B 1 32 ? 16.281  4.380  14.684 1.00 42.17 ? 32  GLU B N   1 
ATOM   510 C CA  . GLU B 1 32 ? 16.696  3.407  13.666 1.00 44.45 ? 32  GLU B CA  1 
ATOM   511 C C   . GLU B 1 32 ? 17.825  2.427  13.870 1.00 46.88 ? 32  GLU B C   1 
ATOM   512 O O   . GLU B 1 32 ? 18.950  2.576  13.333 1.00 47.42 ? 32  GLU B O   1 
ATOM   513 C CB  . GLU B 1 32 ? 16.890  4.139  12.328 1.00 45.85 ? 32  GLU B CB  1 
ATOM   514 C CG  . GLU B 1 32 ? 17.832  5.261  12.302 1.00 46.96 ? 32  GLU B CG  1 
ATOM   515 C CD  . GLU B 1 32 ? 18.838  5.444  11.198 1.00 47.96 ? 32  GLU B CD  1 
ATOM   516 O OE1 . GLU B 1 32 ? 19.596  4.521  10.855 1.00 46.64 ? 32  GLU B OE1 1 
ATOM   517 O OE2 . GLU B 1 32 ? 18.916  6.611  10.747 1.00 47.93 ? 32  GLU B OE2 1 
ATOM   518 N N   . ARG C 1 1  ? 20.359  20.273 17.131 1.00 38.48 ? 1   ARG C N   1 
ATOM   519 C CA  . ARG C 1 1  ? 18.962  20.297 16.624 1.00 38.18 ? 1   ARG C CA  1 
ATOM   520 C C   . ARG C 1 1  ? 17.987  20.063 17.778 1.00 37.35 ? 1   ARG C C   1 
ATOM   521 O O   . ARG C 1 1  ? 16.884  20.634 17.789 1.00 35.22 ? 1   ARG C O   1 
ATOM   522 C CB  . ARG C 1 1  ? 18.735  19.248 15.536 1.00 39.21 ? 1   ARG C CB  1 
ATOM   523 C CG  . ARG C 1 1  ? 19.136  19.637 14.120 1.00 41.54 ? 1   ARG C CG  1 
ATOM   524 C CD  . ARG C 1 1  ? 19.119  18.431 13.200 1.00 43.75 ? 1   ARG C CD  1 
ATOM   525 N NE  . ARG C 1 1  ? 17.826  18.206 12.554 1.00 45.37 ? 1   ARG C NE  1 
ATOM   526 C CZ  . ARG C 1 1  ? 17.622  17.222 11.676 1.00 45.63 ? 1   ARG C CZ  1 
ATOM   527 N NH1 . ARG C 1 1  ? 18.645  16.414 11.384 1.00 46.74 ? 1   ARG C NH1 1 
ATOM   528 N NH2 . ARG C 1 1  ? 16.437  17.061 11.110 1.00 44.07 ? 1   ARG C NH2 1 
ATOM   529 N N   . MET C 1 2  ? 18.373  19.227 18.760 1.00 35.07 ? 2   MET C N   1 
ATOM   530 C CA  . MET C 1 2  ? 17.409  18.966 19.840 1.00 34.91 ? 2   MET C CA  1 
ATOM   531 C C   . MET C 1 2  ? 17.177  20.213 20.679 1.00 35.06 ? 2   MET C C   1 
ATOM   532 O O   . MET C 1 2  ? 16.047  20.527 21.102 1.00 35.03 ? 2   MET C O   1 
ATOM   533 C CB  . MET C 1 2  ? 17.799  17.758 20.703 1.00 34.41 ? 2   MET C CB  1 
ATOM   534 C CG  . MET C 1 2  ? 16.567  17.074 21.301 1.00 33.51 ? 2   MET C CG  1 
ATOM   535 S SD  . MET C 1 2  ? 15.656  16.122 20.063 1.00 28.89 ? 2   MET C SD  1 
ATOM   536 C CE  . MET C 1 2  ? 14.572  15.315 21.242 1.00 36.10 ? 2   MET C CE  1 
ATOM   537 N N   . LYS C 1 3  ? 18.226  20.952 20.967 1.00 33.94 ? 3   LYS C N   1 
ATOM   538 C CA  . LYS C 1 3  ? 18.230  22.188 21.718 1.00 35.31 ? 3   LYS C CA  1 
ATOM   539 C C   . LYS C 1 3  ? 17.400  23.283 21.040 1.00 34.64 ? 3   LYS C C   1 
ATOM   540 O O   . LYS C 1 3  ? 16.564  23.953 21.643 1.00 33.06 ? 3   LYS C O   1 
ATOM   541 C CB  . LYS C 1 3  ? 19.669  22.700 21.839 1.00 36.38 ? 3   LYS C CB  1 
ATOM   542 C CG  . LYS C 1 3  ? 20.379  22.924 20.516 1.00 38.28 ? 3   LYS C CG  1 
ATOM   543 C CD  . LYS C 1 3  ? 20.774  21.678 19.753 1.00 39.28 ? 3   LYS C CD  1 
ATOM   544 C CE  . LYS C 1 3  ? 21.575  20.709 20.592 1.00 38.74 ? 3   LYS C CE  1 
ATOM   545 N NZ  . LYS C 1 3  ? 20.866  19.627 21.307 1.00 35.53 ? 3   LYS C NZ  1 
ATOM   546 N N   . GLN C 1 4  ? 17.591  23.410 19.727 1.00 34.12 ? 4   GLN C N   1 
ATOM   547 C CA  . GLN C 1 4  ? 16.835  24.386 18.947 1.00 34.93 ? 4   GLN C CA  1 
ATOM   548 C C   . GLN C 1 4  ? 15.347  24.013 18.989 1.00 32.93 ? 4   GLN C C   1 
ATOM   549 O O   . GLN C 1 4  ? 14.490  24.901 19.125 1.00 31.64 ? 4   GLN C O   1 
ATOM   550 C CB  . GLN C 1 4  ? 17.302  24.435 17.489 1.00 37.79 ? 4   GLN C CB  1 
ATOM   551 C CG  . GLN C 1 4  ? 16.875  25.687 16.729 1.00 41.51 ? 4   GLN C CG  1 
ATOM   552 C CD  . GLN C 1 4  ? 16.570  25.511 15.259 1.00 44.34 ? 4   GLN C CD  1 
ATOM   553 O OE1 . GLN C 1 4  ? 15.507  25.929 14.748 1.00 46.48 ? 4   GLN C OE1 1 
ATOM   554 N NE2 . GLN C 1 4  ? 17.468  24.893 14.487 1.00 44.85 ? 4   GLN C NE2 1 
ATOM   555 N N   . LEU C 1 5  ? 15.057  22.732 18.863 1.00 29.03 ? 5   LEU C N   1 
ATOM   556 C CA  . LEU C 1 5  ? 13.664  22.282 18.820 1.00 28.67 ? 5   LEU C CA  1 
ATOM   557 C C   . LEU C 1 5  ? 12.909  22.583 20.102 1.00 29.41 ? 5   LEU C C   1 
ATOM   558 O O   . LEU C 1 5  ? 11.806  23.167 20.140 1.00 26.98 ? 5   LEU C O   1 
ATOM   559 C CB  . LEU C 1 5  ? 13.633  20.803 18.516 1.00 27.45 ? 5   LEU C CB  1 
ATOM   560 C CG  . LEU C 1 5  ? 12.263  20.149 18.416 1.00 27.31 ? 5   LEU C CG  1 
ATOM   561 C CD1 . LEU C 1 5  ? 11.391  20.818 17.362 1.00 27.15 ? 5   LEU C CD1 1 
ATOM   562 C CD2 . LEU C 1 5  ? 12.453  18.661 18.193 1.00 28.96 ? 5   LEU C CD2 1 
ATOM   563 N N   . GLU C 1 6  ? 13.541  22.203 21.227 1.00 28.30 ? 6   GLU C N   1 
ATOM   564 C CA  . GLU C 1 6  ? 12.918  22.524 22.514 1.00 29.54 ? 6   GLU C CA  1 
ATOM   565 C C   . GLU C 1 6  ? 12.671  24.022 22.678 1.00 29.48 ? 6   GLU C C   1 
ATOM   566 O O   . GLU C 1 6  ? 11.617  24.457 23.171 1.00 28.42 ? 6   GLU C O   1 
ATOM   567 C CB  . GLU C 1 6  ? 13.805  22.090 23.674 1.00 33.55 ? 6   GLU C CB  1 
ATOM   568 C CG  . GLU C 1 6  ? 14.208  20.621 23.691 1.00 36.87 ? 6   GLU C CG  1 
ATOM   569 C CD  . GLU C 1 6  ? 15.430  20.500 24.595 1.00 39.36 ? 6   GLU C CD  1 
ATOM   570 O OE1 . GLU C 1 6  ? 16.398  19.880 24.133 1.00 42.96 ? 6   GLU C OE1 1 
ATOM   571 O OE2 . GLU C 1 6  ? 15.425  21.037 25.720 1.00 40.76 ? 6   GLU C OE2 1 
ATOM   572 N N   . ASP C 1 7  ? 13.603  24.870 22.265 1.00 29.04 ? 7   ASP C N   1 
ATOM   573 C CA  . ASP C 1 7  ? 13.489  26.306 22.365 1.00 28.87 ? 7   ASP C CA  1 
ATOM   574 C C   . ASP C 1 7  ? 12.333  26.819 21.491 1.00 27.26 ? 7   ASP C C   1 
ATOM   575 O O   . ASP C 1 7  ? 11.561  27.656 21.990 1.00 27.09 ? 7   ASP C O   1 
ATOM   576 C CB  . ASP C 1 7  ? 14.781  27.016 21.967 1.00 32.82 ? 7   ASP C CB  1 
ATOM   577 C CG  . ASP C 1 7  ? 15.862  26.907 23.042 1.00 35.54 ? 7   ASP C CG  1 
ATOM   578 O OD1 . ASP C 1 7  ? 15.563  26.487 24.184 1.00 38.08 ? 7   ASP C OD1 1 
ATOM   579 O OD2 . ASP C 1 7  ? 17.025  27.243 22.714 1.00 37.74 ? 7   ASP C OD2 1 
ATOM   580 N N   . LYS C 1 8  ? 12.237  26.333 20.267 1.00 25.14 ? 8   LYS C N   1 
ATOM   581 C CA  . LYS C 1 8  ? 11.184  26.801 19.356 1.00 23.82 ? 8   LYS C CA  1 
ATOM   582 C C   . LYS C 1 8  ? 9.817   26.344 19.837 1.00 23.16 ? 8   LYS C C   1 
ATOM   583 O O   . LYS C 1 8  ? 8.856   27.118 19.660 1.00 21.69 ? 8   LYS C O   1 
ATOM   584 C CB  . LYS C 1 8  ? 11.399  26.305 17.919 1.00 25.12 ? 8   LYS C CB  1 
ATOM   585 C CG  . LYS C 1 8  ? 12.595  27.059 17.304 1.00 30.26 ? 8   LYS C CG  1 
ATOM   586 C CD  . LYS C 1 8  ? 12.123  28.508 17.092 1.00 34.79 ? 8   LYS C CD  1 
ATOM   587 C CE  . LYS C 1 8  ? 13.297  29.474 17.216 1.00 38.04 ? 8   LYS C CE  1 
ATOM   588 N NZ  . LYS C 1 8  ? 12.970  30.778 16.571 1.00 39.78 ? 8   LYS C NZ  1 
ATOM   589 N N   . VAL C 1 9  ? 9.743   25.106 20.339 1.00 21.82 ? 9   VAL C N   1 
ATOM   590 C CA  . VAL C 1 9  ? 8.456   24.652 20.873 1.00 21.92 ? 9   VAL C CA  1 
ATOM   591 C C   . VAL C 1 9  ? 8.003   25.476 22.073 1.00 22.16 ? 9   VAL C C   1 
ATOM   592 O O   . VAL C 1 9  ? 6.826   25.874 22.174 1.00 21.12 ? 9   VAL C O   1 
ATOM   593 C CB  . VAL C 1 9  ? 8.458   23.147 21.135 1.00 21.65 ? 9   VAL C CB  1 
ATOM   594 C CG1 . VAL C 1 9  ? 7.206   22.638 21.811 1.00 23.59 ? 9   VAL C CG1 1 
ATOM   595 C CG2 . VAL C 1 9  ? 8.601   22.500 19.738 1.00 21.57 ? 9   VAL C CG2 1 
ATOM   596 N N   . GLU C 1 10 ? 8.942   25.754 23.003 1.00 21.65 ? 10  GLU C N   1 
ATOM   597 C CA  . GLU C 1 10 ? 8.537   26.583 24.153 1.00 21.23 ? 10  GLU C CA  1 
ATOM   598 C C   . GLU C 1 10 ? 8.103   27.981 23.732 1.00 23.03 ? 10  GLU C C   1 
ATOM   599 O O   . GLU C 1 10 ? 7.097   28.522 24.242 1.00 22.63 ? 10  GLU C O   1 
ATOM   600 C CB  . GLU C 1 10 ? 9.649   26.605 25.221 1.00 25.67 ? 10  GLU C CB  1 
ATOM   601 C CG  . GLU C 1 10 ? 9.744   25.292 25.977 1.00 31.89 ? 10  GLU C CG  1 
ATOM   602 C CD  . GLU C 1 10 ? 8.483   24.801 26.637 1.00 35.29 ? 10  GLU C CD  1 
ATOM   603 O OE1 . GLU C 1 10 ? 7.837   25.411 27.523 1.00 35.65 ? 10  GLU C OE1 1 
ATOM   604 O OE2 . GLU C 1 10 ? 8.061   23.685 26.227 1.00 39.53 ? 10  GLU C OE2 1 
ATOM   605 N N   . GLU C 1 11 ? 8.759   28.592 22.742 1.00 20.04 ? 11  GLU C N   1 
ATOM   606 C CA  . GLU C 1 11 ? 8.407   29.896 22.206 1.00 21.72 ? 11  GLU C CA  1 
ATOM   607 C C   . GLU C 1 11 ? 7.031   29.823 21.535 1.00 19.97 ? 11  GLU C C   1 
ATOM   608 O O   . GLU C 1 11 ? 6.227   30.754 21.724 1.00 20.44 ? 11  GLU C O   1 
ATOM   609 C CB  . GLU C 1 11 ? 9.473   30.332 21.192 1.00 21.79 ? 11  GLU C CB  1 
ATOM   610 C CG  . GLU C 1 11 ? 9.253   31.671 20.540 1.00 27.63 ? 11  GLU C CG  1 
ATOM   611 C CD  . GLU C 1 11 ? 10.406  32.159 19.687 1.00 31.48 ? 11  GLU C CD  1 
ATOM   612 O OE1 . GLU C 1 11 ? 11.352  31.397 19.384 1.00 33.31 ? 11  GLU C OE1 1 
ATOM   613 O OE2 . GLU C 1 11 ? 10.357  33.358 19.294 1.00 35.47 ? 11  GLU C OE2 1 
ATOM   614 N N   . LEU C 1 12 ? 6.786   28.750 20.778 1.00 17.88 ? 12  LEU C N   1 
ATOM   615 C CA  . LEU C 1 12 ? 5.474   28.631 20.123 1.00 18.24 ? 12  LEU C CA  1 
ATOM   616 C C   . LEU C 1 12 ? 4.339   28.592 21.152 1.00 18.59 ? 12  LEU C C   1 
ATOM   617 O O   . LEU C 1 12 ? 3.288   29.275 21.020 1.00 18.29 ? 12  LEU C O   1 
ATOM   618 C CB  . LEU C 1 12 ? 5.431   27.337 19.286 1.00 18.26 ? 12  LEU C CB  1 
ATOM   619 C CG  . LEU C 1 12 ? 4.085   27.029 18.669 1.00 19.67 ? 12  LEU C CG  1 
ATOM   620 C CD1 . LEU C 1 12 ? 3.778   28.012 17.526 1.00 17.65 ? 12  LEU C CD1 1 
ATOM   621 C CD2 . LEU C 1 12 ? 3.959   25.598 18.205 1.00 20.97 ? 12  LEU C CD2 1 
ATOM   622 N N   . LEU C 1 13 ? 4.550   27.824 22.207 1.00 16.76 ? 13  LEU C N   1 
ATOM   623 C CA  . LEU C 1 13 ? 3.528   27.723 23.270 1.00 19.19 ? 13  LEU C CA  1 
ATOM   624 C C   . LEU C 1 13 ? 3.292   29.083 23.884 1.00 17.91 ? 13  LEU C C   1 
ATOM   625 O O   . LEU C 1 13 ? 2.156   29.473 24.161 1.00 18.40 ? 13  LEU C O   1 
ATOM   626 C CB  . LEU C 1 13 ? 3.917   26.609 24.252 1.00 18.74 ? 13  LEU C CB  1 
ATOM   627 C CG  . LEU C 1 13 ? 2.911   26.342 25.360 1.00 20.52 ? 13  LEU C CG  1 
ATOM   628 C CD1 . LEU C 1 13 ? 1.568   25.939 24.770 1.00 21.49 ? 13  LEU C CD1 1 
ATOM   629 C CD2 . LEU C 1 13 ? 3.440   25.293 26.339 1.00 21.39 ? 13  LEU C CD2 1 
ATOM   630 N N   . SER C 1 14 ? 4.321   29.832 24.244 1.00 18.70 ? 14  SER C N   1 
ATOM   631 C CA  . SER C 1 14 ? 4.162   31.168 24.862 1.00 20.09 ? 14  SER C CA  1 
ATOM   632 C C   . SER C 1 14 ? 3.480   32.124 23.916 1.00 20.35 ? 14  SER C C   1 
ATOM   633 O O   . SER C 1 14 ? 2.557   32.849 24.309 1.00 19.19 ? 14  SER C O   1 
ATOM   634 C CB  . SER C 1 14 ? 5.575   31.615 25.263 1.00 22.65 ? 14  SER C CB  1 
ATOM   635 O OG  . SER C 1 14 ? 5.617   32.988 25.483 1.00 28.26 ? 14  SER C OG  1 
ATOM   636 N N   . LYS C 1 15 ? 3.752   32.023 22.605 1.00 19.06 ? 15  LYS C N   1 
ATOM   637 C CA  . LYS C 1 15 ? 3.037   32.856 21.631 1.00 17.91 ? 15  LYS C CA  1 
ATOM   638 C C   . LYS C 1 15 ? 1.575   32.479 21.469 1.00 17.48 ? 15  LYS C C   1 
ATOM   639 O O   . LYS C 1 15 ? 0.710   33.345 21.232 1.00 16.96 ? 15  LYS C O   1 
ATOM   640 C CB  . LYS C 1 15 ? 3.757   32.874 20.271 1.00 18.36 ? 15  LYS C CB  1 
ATOM   641 C CG  . LYS C 1 15 ? 5.065   33.660 20.305 1.00 20.66 ? 15  LYS C CG  1 
ATOM   642 C CD  . LYS C 1 15 ? 5.725   33.647 18.906 1.00 22.14 ? 15  LYS C CD  1 
ATOM   643 C CE  . LYS C 1 15 ? 7.089   34.362 19.104 1.00 25.39 ? 15  LYS C CE  1 
ATOM   644 N NZ  . LYS C 1 15 ? 7.714   34.546 17.766 1.00 28.43 ? 15  LYS C NZ  1 
ATOM   645 N N   . ALA C 1 16 ? 1.251   31.190 21.559 1.00 15.76 ? 16  ALA C N   1 
ATOM   646 C CA  . ALA C 1 16 ? -0.087  30.661 21.518 1.00 17.26 ? 16  ALA C CA  1 
ATOM   647 C C   . ALA C 1 16 ? -0.852  31.161 22.780 1.00 16.30 ? 16  ALA C C   1 
ATOM   648 O O   . ALA C 1 16 ? -2.001  31.556 22.599 1.00 17.24 ? 16  ALA C O   1 
ATOM   649 C CB  . ALA C 1 16 ? -0.089  29.141 21.575 1.00 16.47 ? 16  ALA C CB  1 
ATOM   650 N N   . TYR C 1 17 ? -0.185  31.124 23.943 1.00 16.06 ? 17  TYR C N   1 
ATOM   651 C CA  . TYR C 1 17 ? -0.943  31.656 25.117 1.00 16.71 ? 17  TYR C CA  1 
ATOM   652 C C   . TYR C 1 17 ? -1.197  33.133 24.947 1.00 16.75 ? 17  TYR C C   1 
ATOM   653 O O   . TYR C 1 17 ? -2.269  33.658 25.354 1.00 17.79 ? 17  TYR C O   1 
ATOM   654 C CB  . TYR C 1 17 ? -0.160  31.416 26.375 1.00 18.23 ? 17  TYR C CB  1 
ATOM   655 C CG  . TYR C 1 17 ? -0.045  30.023 26.927 1.00 17.66 ? 17  TYR C CG  1 
ATOM   656 C CD1 . TYR C 1 17 ? -1.151  29.151 27.005 1.00 16.50 ? 17  TYR C CD1 1 
ATOM   657 C CD2 . TYR C 1 17 ? 1.188   29.586 27.400 1.00 17.80 ? 17  TYR C CD2 1 
ATOM   658 C CE1 . TYR C 1 17 ? -0.992  27.899 27.599 1.00 18.99 ? 17  TYR C CE1 1 
ATOM   659 C CE2 . TYR C 1 17 ? 1.361   28.335 27.977 1.00 19.22 ? 17  TYR C CE2 1 
ATOM   660 C CZ  . TYR C 1 17 ? 0.247   27.497 28.060 1.00 19.66 ? 17  TYR C CZ  1 
ATOM   661 O OH  . TYR C 1 17 ? 0.394   26.268 28.650 1.00 23.35 ? 17  TYR C OH  1 
ATOM   662 N N   . HIS C 1 18 ? -0.214  33.863 24.410 1.00 16.11 ? 18  HIS C N   1 
ATOM   663 C CA  . HIS C 1 18 ? -0.433  35.295 24.222 1.00 16.84 ? 18  HIS C CA  1 
ATOM   664 C C   . HIS C 1 18 ? -1.570  35.582 23.263 1.00 17.97 ? 18  HIS C C   1 
ATOM   665 O O   . HIS C 1 18 ? -2.487  36.357 23.520 1.00 18.46 ? 18  HIS C O   1 
ATOM   666 C CB  . HIS C 1 18 ? 0.854   35.963 23.761 1.00 18.30 ? 18  HIS C CB  1 
ATOM   667 C CG  . HIS C 1 18 ? 0.824   37.438 23.648 1.00 22.25 ? 18  HIS C CG  1 
ATOM   668 N ND1 . HIS C 1 18 ? 1.280   38.113 22.523 1.00 26.83 ? 18  HIS C ND1 1 
ATOM   669 C CD2 . HIS C 1 18 ? 0.431   38.375 24.557 1.00 22.86 ? 18  HIS C CD2 1 
ATOM   670 C CE1 . HIS C 1 18 ? 1.148   39.406 22.759 1.00 26.26 ? 18  HIS C CE1 1 
ATOM   671 N NE2 . HIS C 1 18 ? 0.648   39.600 23.972 1.00 26.85 ? 18  HIS C NE2 1 
ATOM   672 N N   . LEU C 1 19 ? -1.557  34.890 22.112 1.00 16.69 ? 19  LEU C N   1 
ATOM   673 C CA  . LEU C 1 19 ? -2.649  35.053 21.147 1.00 17.02 ? 19  LEU C CA  1 
ATOM   674 C C   . LEU C 1 19 ? -3.987  34.642 21.724 1.00 17.31 ? 19  LEU C C   1 
ATOM   675 O O   . LEU C 1 19 ? -4.974  35.375 21.504 1.00 18.68 ? 19  LEU C O   1 
ATOM   676 C CB  . LEU C 1 19 ? -2.222  34.190 19.935 1.00 16.61 ? 19  LEU C CB  1 
ATOM   677 C CG  . LEU C 1 19 ? -3.328  34.141 18.856 1.00 15.40 ? 19  LEU C CG  1 
ATOM   678 C CD1 . LEU C 1 19 ? -3.621  35.537 18.357 1.00 16.31 ? 19  LEU C CD1 1 
ATOM   679 C CD2 . LEU C 1 19 ? -2.934  33.215 17.686 1.00 20.01 ? 19  LEU C CD2 1 
ATOM   680 N N   . GLU C 1 20 ? -4.120  33.548 22.477 1.00 17.30 ? 20  GLU C N   1 
ATOM   681 C CA  . GLU C 1 20 ? -5.380  33.187 23.094 1.00 16.93 ? 20  GLU C CA  1 
ATOM   682 C C   . GLU C 1 20 ? -5.900  34.352 23.952 1.00 17.54 ? 20  GLU C C   1 
ATOM   683 O O   . GLU C 1 20 ? -7.134  34.570 23.928 1.00 19.24 ? 20  GLU C O   1 
ATOM   684 C CB  . GLU C 1 20 ? -5.262  31.891 23.940 1.00 18.23 ? 20  GLU C CB  1 
ATOM   685 C CG  . GLU C 1 20 ? -6.668  31.303 24.212 1.00 19.54 ? 20  GLU C CG  1 
ATOM   686 C CD  . GLU C 1 20 ? -6.731  30.008 24.988 1.00 24.09 ? 20  GLU C CD  1 
ATOM   687 O OE1 . GLU C 1 20 ? -6.091  30.035 26.049 1.00 23.58 ? 20  GLU C OE1 1 
ATOM   688 O OE2 . GLU C 1 20 ? -7.346  28.946 24.623 1.00 26.22 ? 20  GLU C OE2 1 
ATOM   689 N N   . ASN C 1 21 ? -5.027  34.964 24.789 1.00 17.32 ? 21  ASN C N   1 
ATOM   690 C CA  . ASN C 1 21 ? -5.604  36.077 25.617 1.00 18.95 ? 21  ASN C CA  1 
ATOM   691 C C   . ASN C 1 21 ? -5.916  37.296 24.772 1.00 19.38 ? 21  ASN C C   1 
ATOM   692 O O   . ASN C 1 21 ? -6.926  37.979 25.056 1.00 21.41 ? 21  ASN C O   1 
ATOM   693 C CB  . ASN C 1 21 ? -4.699  36.391 26.810 1.00 21.07 ? 21  ASN C CB  1 
ATOM   694 C CG  . ASN C 1 21 ? -5.551  37.092 27.898 1.00 23.63 ? 21  ASN C CG  1 
ATOM   695 O OD1 . ASN C 1 21 ? -6.584  36.564 28.308 1.00 23.94 ? 21  ASN C OD1 1 
ATOM   696 N ND2 . ASN C 1 21 ? -5.085  38.271 28.186 1.00 22.27 ? 21  ASN C ND2 1 
ATOM   697 N N   . GLU C 1 22 ? -5.151  37.590 23.723 1.00 18.87 ? 22  GLU C N   1 
ATOM   698 C CA  . GLU C 1 22 ? -5.462  38.698 22.817 1.00 20.51 ? 22  GLU C CA  1 
ATOM   699 C C   . GLU C 1 22 ? -6.810  38.461 22.150 1.00 18.92 ? 22  GLU C C   1 
ATOM   700 O O   . GLU C 1 22 ? -7.610  39.381 22.000 1.00 19.88 ? 22  GLU C O   1 
ATOM   701 C CB  . GLU C 1 22 ? -4.405  38.893 21.714 1.00 22.12 ? 22  GLU C CB  1 
ATOM   702 C CG  . GLU C 1 22 ? -3.002  39.293 22.163 1.00 28.44 ? 22  GLU C CG  1 
ATOM   703 C CD  . GLU C 1 22 ? -2.206  40.033 21.125 1.00 33.59 ? 22  GLU C CD  1 
ATOM   704 O OE1 . GLU C 1 22 ? -2.628  40.557 20.056 1.00 37.69 ? 22  GLU C OE1 1 
ATOM   705 O OE2 . GLU C 1 22 ? -0.986  40.243 21.271 1.00 36.88 ? 22  GLU C OE2 1 
ATOM   706 N N   . VAL C 1 23 ? -7.069  37.211 21.759 1.00 20.00 ? 23  VAL C N   1 
ATOM   707 C CA  . VAL C 1 23 ? -8.382  36.888 21.182 1.00 18.88 ? 23  VAL C CA  1 
ATOM   708 C C   . VAL C 1 23 ? -9.506  37.069 22.212 1.00 20.16 ? 23  VAL C C   1 
ATOM   709 O O   . VAL C 1 23 ? -10.581 37.588 21.884 1.00 21.37 ? 23  VAL C O   1 
ATOM   710 C CB  . VAL C 1 23 ? -8.416  35.485 20.588 1.00 19.61 ? 23  VAL C CB  1 
ATOM   711 C CG1 . VAL C 1 23 ? -9.839  35.139 20.149 1.00 19.76 ? 23  VAL C CG1 1 
ATOM   712 C CG2 . VAL C 1 23 ? -7.465  35.441 19.378 1.00 18.71 ? 23  VAL C CG2 1 
ATOM   713 N N   . ALA C 1 24 ? -9.275  36.653 23.444 1.00 17.40 ? 24  ALA C N   1 
ATOM   714 C CA  . ALA C 1 24 ? -10.307 36.859 24.491 1.00 19.87 ? 24  ALA C CA  1 
ATOM   715 C C   . ALA C 1 24 ? -10.578 38.340 24.723 1.00 20.08 ? 24  ALA C C   1 
ATOM   716 O O   . ALA C 1 24 ? -11.772 38.706 24.849 1.00 23.03 ? 24  ALA C O   1 
ATOM   717 C CB  . ALA C 1 24 ? -9.904  36.231 25.817 1.00 19.19 ? 24  ALA C CB  1 
ATOM   718 N N   . ARG C 1 25 ? -9.549  39.183 24.722 1.00 22.77 ? 25  ARG C N   1 
ATOM   719 C CA  . ARG C 1 25 ? -9.690  40.611 24.890 1.00 25.26 ? 25  ARG C CA  1 
ATOM   720 C C   . ARG C 1 25 ? -10.443 41.190 23.691 1.00 26.22 ? 25  ARG C C   1 
ATOM   721 O O   . ARG C 1 25 ? -11.337 42.013 23.894 1.00 27.51 ? 25  ARG C O   1 
ATOM   722 C CB  . ARG C 1 25 ? -8.379  41.353 25.132 1.00 26.61 ? 25  ARG C CB  1 
ATOM   723 C CG  . ARG C 1 25 ? -7.671  40.908 26.415 1.00 28.53 ? 25  ARG C CG  1 
ATOM   724 C CD  . ARG C 1 25 ? -6.457  41.780 26.730 1.00 32.58 ? 25  ARG C CD  1 
ATOM   725 N NE  . ARG C 1 25 ? -6.896  43.179 26.595 1.00 37.03 ? 25  ARG C NE  1 
ATOM   726 C CZ  . ARG C 1 25 ? -6.516  43.999 25.609 1.00 37.52 ? 25  ARG C CZ  1 
ATOM   727 N NH1 . ARG C 1 25 ? -5.667  43.562 24.695 1.00 36.08 ? 25  ARG C NH1 1 
ATOM   728 N NH2 . ARG C 1 25 ? -6.992  45.233 25.585 1.00 38.40 ? 25  ARG C NH2 1 
ATOM   729 N N   . LEU C 1 26 ? -10.185 40.689 22.468 1.00 25.73 ? 26  LEU C N   1 
ATOM   730 C CA  . LEU C 1 26 ? -10.957 41.166 21.310 1.00 26.09 ? 26  LEU C CA  1 
ATOM   731 C C   . LEU C 1 26 ? -12.423 40.764 21.403 1.00 28.28 ? 26  LEU C C   1 
ATOM   732 O O   . LEU C 1 26 ? -13.372 41.533 21.096 1.00 29.54 ? 26  LEU C O   1 
ATOM   733 C CB  . LEU C 1 26 ? -10.360 40.642 20.015 1.00 24.51 ? 26  LEU C CB  1 
ATOM   734 C CG  . LEU C 1 26 ? -10.883 41.152 18.676 1.00 26.08 ? 26  LEU C CG  1 
ATOM   735 C CD1 . LEU C 1 26 ? -10.864 42.677 18.587 1.00 25.43 ? 26  LEU C CD1 1 
ATOM   736 C CD2 . LEU C 1 26 ? -10.061 40.561 17.534 1.00 26.98 ? 26  LEU C CD2 1 
ATOM   737 N N   . LYS C 1 27 ? -12.696 39.568 21.904 1.00 28.68 ? 27  LYS C N   1 
ATOM   738 C CA  . LYS C 1 27 ? -14.059 39.072 22.071 1.00 32.62 ? 27  LYS C CA  1 
ATOM   739 C C   . LYS C 1 27 ? -14.798 40.010 23.021 1.00 32.56 ? 27  LYS C C   1 
ATOM   740 O O   . LYS C 1 27 ? -16.003 40.198 22.814 1.00 32.79 ? 27  LYS C O   1 
ATOM   741 C CB  . LYS C 1 27 ? -14.074 37.613 22.464 1.00 34.33 ? 27  LYS C CB  1 
ATOM   742 C CG  . LYS C 1 27 ? -15.368 36.842 22.468 1.00 37.13 ? 27  LYS C CG  1 
ATOM   743 C CD  . LYS C 1 27 ? -16.020 36.754 21.098 1.00 40.09 ? 27  LYS C CD  1 
ATOM   744 C CE  . LYS C 1 27 ? -16.915 35.513 20.997 1.00 41.14 ? 27  LYS C CE  1 
ATOM   745 N NZ  . LYS C 1 27 ? -17.730 35.368 22.249 1.00 42.09 ? 27  LYS C NZ  1 
ATOM   746 N N   . LYS C 1 28 ? -14.118 40.576 24.018 1.00 34.99 ? 28  LYS C N   1 
ATOM   747 C CA  . LYS C 1 28 ? -14.712 41.548 24.931 1.00 38.20 ? 28  LYS C CA  1 
ATOM   748 C C   . LYS C 1 28 ? -15.172 42.790 24.162 1.00 38.97 ? 28  LYS C C   1 
ATOM   749 O O   . LYS C 1 28 ? -16.265 43.300 24.437 1.00 41.13 ? 28  LYS C O   1 
ATOM   750 C CB  . LYS C 1 28 ? -13.737 42.097 25.976 1.00 39.69 ? 28  LYS C CB  1 
ATOM   751 C CG  . LYS C 1 28 ? -13.248 41.135 27.023 1.00 42.39 ? 28  LYS C CG  1 
ATOM   752 C CD  . LYS C 1 28 ? -14.288 40.710 28.036 1.00 44.24 ? 28  LYS C CD  1 
ATOM   753 C CE  . LYS C 1 28 ? -14.526 41.811 29.062 1.00 46.64 ? 28  LYS C CE  1 
ATOM   754 N NZ  . LYS C 1 28 ? -15.601 41.379 30.007 1.00 47.98 ? 28  LYS C NZ  1 
ATOM   755 N N   . LEU C 1 29 ? -14.310 43.263 23.257 1.00 37.98 ? 29  LEU C N   1 
ATOM   756 C CA  . LEU C 1 29 ? -14.714 44.409 22.439 1.00 39.10 ? 29  LEU C CA  1 
ATOM   757 C C   . LEU C 1 29 ? -15.902 43.954 21.634 1.00 38.96 ? 29  LEU C C   1 
ATOM   758 O O   . LEU C 1 29 ? -15.909 43.050 20.796 1.00 40.27 ? 29  LEU C O   1 
ATOM   759 C CB  . LEU C 1 29 ? -13.609 44.948 21.526 1.00 38.59 ? 29  LEU C CB  1 
ATOM   760 C CG  . LEU C 1 29 ? -12.367 45.419 22.299 1.00 40.09 ? 29  LEU C CG  1 
ATOM   761 C CD1 . LEU C 1 29 ? -11.233 45.826 21.374 1.00 38.91 ? 29  LEU C CD1 1 
ATOM   762 C CD2 . LEU C 1 29 ? -12.694 46.596 23.204 1.00 39.33 ? 29  LEU C CD2 1 
HETATM 763 O O   . HOH D 2 .  ? 0.553   19.364 12.292 1.00 15.10 ? 34  HOH A O   1 
HETATM 764 O O   . HOH D 2 .  ? -0.785  23.649 11.555 1.00 24.66 ? 35  HOH A O   1 
HETATM 765 O O   . HOH D 2 .  ? -7.425  25.662 10.511 1.00 24.17 ? 36  HOH A O   1 
HETATM 766 O O   . HOH D 2 .  ? -9.361  32.756 11.318 1.00 22.70 ? 37  HOH A O   1 
HETATM 767 O O   . HOH D 2 .  ? -7.206  23.878 22.670 1.00 23.78 ? 38  HOH A O   1 
HETATM 768 O O   . HOH D 2 .  ? -3.457  18.403 18.082 1.00 32.83 ? 39  HOH A O   1 
HETATM 769 O O   . HOH D 2 .  ? -5.465  22.530 24.604 1.00 24.40 ? 40  HOH A O   1 
HETATM 770 O O   . HOH D 2 .  ? -10.487 23.976 17.102 1.00 29.44 ? 41  HOH A O   1 
HETATM 771 O O   . HOH D 2 .  ? -4.912  23.578 9.978  1.00 23.63 ? 42  HOH A O   1 
HETATM 772 O O   . HOH D 2 .  ? 5.206   10.941 20.749 1.00 37.60 ? 43  HOH A O   1 
HETATM 773 O O   . HOH D 2 .  ? -2.852  18.472 22.587 1.00 29.62 ? 44  HOH A O   1 
HETATM 774 O O   . HOH D 2 .  ? -16.682 33.066 12.154 1.00 34.97 ? 45  HOH A O   1 
HETATM 775 O O   . HOH D 2 .  ? -18.631 34.306 14.948 1.00 31.22 ? 46  HOH A O   1 
HETATM 776 O O   . HOH D 2 .  ? 20.030  12.486 27.231 1.00 54.13 ? 47  HOH A O   1 
HETATM 777 O O   . HOH D 2 .  ? -1.062  16.840 24.406 1.00 37.80 ? 48  HOH A O   1 
HETATM 778 O O   . HOH D 2 .  ? -1.283  17.762 16.917 1.00 41.54 ? 49  HOH A O   1 
HETATM 779 O O   . HOH D 2 .  ? 17.102  9.822  29.296 1.00 43.07 ? 50  HOH A O   1 
HETATM 780 O O   . HOH D 2 .  ? -9.496  25.063 13.445 1.00 31.90 ? 51  HOH A O   1 
HETATM 781 O O   . HOH D 2 .  ? -10.004 30.989 21.635 1.00 36.66 ? 52  HOH A O   1 
HETATM 782 O O   . HOH D 2 .  ? 0.302   14.402 23.479 1.00 33.46 ? 53  HOH A O   1 
HETATM 783 O O   . HOH D 2 .  ? 8.726   19.507 26.172 1.00 41.85 ? 54  HOH A O   1 
HETATM 784 O O   . HOH D 2 .  ? -5.162  19.841 24.016 1.00 41.34 ? 55  HOH A O   1 
HETATM 785 O O   . HOH D 2 .  ? -12.230 33.697 8.652  1.00 36.66 ? 56  HOH A O   1 
HETATM 786 O O   . HOH D 2 .  ? 11.912  14.713 29.000 1.00 38.28 ? 57  HOH A O   1 
HETATM 787 O O   . HOH D 2 .  ? 14.710  14.238 30.148 1.00 38.22 ? 58  HOH A O   1 
HETATM 788 O O   . HOH D 2 .  ? -17.670 37.469 14.085 1.00 38.42 ? 59  HOH A O   1 
HETATM 789 O O   . HOH D 2 .  ? -14.153 26.929 12.406 1.00 37.52 ? 60  HOH A O   1 
HETATM 790 O O   . HOH D 2 .  ? -10.231 25.771 11.058 1.00 34.13 ? 61  HOH A O   1 
HETATM 791 O O   . HOH D 2 .  ? -18.024 30.897 12.060 1.00 41.27 ? 62  HOH A O   1 
HETATM 792 O O   . HOH D 2 .  ? 9.833   13.285 30.246 1.00 61.42 ? 63  HOH A O   1 
HETATM 793 O O   . HOH D 2 .  ? -5.169  20.525 16.691 1.00 41.94 ? 64  HOH A O   1 
HETATM 794 O O   . HOH D 2 .  ? 17.117  5.935  23.764 1.00 40.20 ? 65  HOH A O   1 
HETATM 795 O O   . HOH D 2 .  ? 8.308   11.960 20.461 1.00 40.32 ? 66  HOH A O   1 
HETATM 796 O O   . HOH D 2 .  ? 11.254  17.281 29.464 1.00 38.15 ? 67  HOH A O   1 
HETATM 797 O O   . HOH D 2 .  ? -1.434  20.200 8.039  1.00 41.27 ? 68  HOH A O   1 
HETATM 798 O O   . HOH D 2 .  ? 9.735   9.764  20.890 1.00 49.22 ? 69  HOH A O   1 
HETATM 799 O O   . HOH D 2 .  ? 8.010   11.981 28.436 1.00 43.09 ? 70  HOH A O   1 
HETATM 800 O O   . HOH D 2 .  ? 17.214  13.406 29.392 1.00 50.79 ? 71  HOH A O   1 
HETATM 801 O O   . HOH D 2 .  ? 7.214   19.353 29.032 1.00 48.73 ? 72  HOH A O   1 
HETATM 802 O O   . HOH D 2 .  ? -3.286  22.020 29.894 1.00 40.28 ? 73  HOH A O   1 
HETATM 803 O O   . HOH D 2 .  ? -4.648  20.528 9.744  1.00 55.32 ? 74  HOH A O   1 
HETATM 804 O O   . HOH D 2 .  ? -8.909  21.972 18.416 1.00 45.74 ? 75  HOH A O   1 
HETATM 805 O O   . HOH D 2 .  ? 5.244   17.758 28.693 1.00 44.46 ? 76  HOH A O   1 
HETATM 806 O O   . HOH D 2 .  ? 9.016   7.541  18.889 1.00 47.98 ? 77  HOH A O   1 
HETATM 807 O O   . HOH D 2 .  ? 1.225   18.913 16.972 1.00 36.15 ? 78  HOH A O   1 
HETATM 808 O O   . HOH D 2 .  ? 10.521  8.534  25.685 1.00 39.91 ? 79  HOH A O   1 
HETATM 809 O O   . HOH D 2 .  ? -12.127 34.240 22.915 1.00 39.43 ? 80  HOH A O   1 
HETATM 810 O O   . HOH D 2 .  ? 11.082  18.444 27.009 1.00 40.64 ? 81  HOH A O   1 
HETATM 811 O O   . HOH D 2 .  ? -18.715 34.274 11.838 1.00 51.06 ? 82  HOH A O   1 
HETATM 812 O O   . HOH D 2 .  ? -0.875  18.584 27.481 1.00 48.19 ? 83  HOH A O   1 
HETATM 813 O O   . HOH D 2 .  ? -12.623 24.666 19.286 1.00 47.15 ? 84  HOH A O   1 
HETATM 814 O O   . HOH D 2 .  ? -11.515 36.456 7.081  1.00 47.47 ? 85  HOH A O   1 
HETATM 815 O O   . HOH D 2 .  ? -15.812 43.949 10.305 1.00 51.35 ? 86  HOH A O   1 
HETATM 816 O O   . HOH D 2 .  ? -13.220 27.287 19.408 1.00 52.65 ? 87  HOH A O   1 
HETATM 817 O O   . HOH D 2 .  ? 12.457  6.813  27.005 1.00 45.37 ? 88  HOH A O   1 
HETATM 818 O O   . HOH D 2 .  ? -17.673 32.688 19.912 1.00 46.70 ? 89  HOH A O   1 
HETATM 819 O O   . HOH D 2 .  ? -13.882 33.005 23.826 1.00 49.65 ? 90  HOH A O   1 
HETATM 820 O O   . HOH D 2 .  ? 2.344   19.268 26.787 1.00 51.39 ? 91  HOH A O   1 
HETATM 821 O O   . HOH D 2 .  ? 0.302   16.174 29.282 1.00 54.33 ? 92  HOH A O   1 
HETATM 822 O O   . HOH D 2 .  ? -7.514  20.295 16.812 1.00 44.08 ? 93  HOH A O   1 
HETATM 823 O O   . HOH D 2 .  ? -0.105  11.888 22.618 1.00 64.41 ? 94  HOH A O   1 
HETATM 824 O O   . HOH D 2 .  ? 8.676   16.191 31.131 1.00 48.78 ? 95  HOH A O   1 
HETATM 825 O O   . HOH D 2 .  ? 5.913   13.717 27.225 1.00 48.05 ? 96  HOH A O   1 
HETATM 826 O O   . HOH D 2 .  ? 2.898   22.995 29.692 1.00 55.70 ? 97  HOH A O   1 
HETATM 827 O O   . HOH D 2 .  ? -3.744  19.502 27.171 1.00 63.96 ? 98  HOH A O   1 
HETATM 828 O O   . HOH D 2 .  ? -2.384  14.253 19.086 1.00 54.65 ? 99  HOH A O   1 
HETATM 829 O O   . HOH D 2 .  ? -3.303  16.342 21.187 1.00 56.57 ? 100 HOH A O   1 
HETATM 830 O O   . HOH D 2 .  ? 8.817   7.531  23.852 1.00 56.66 ? 101 HOH A O   1 
HETATM 831 O O   . HOH D 2 .  ? 18.592  15.291 24.935 1.00 42.10 ? 102 HOH A O   1 
HETATM 832 O O   . HOH D 2 .  ? 3.140   11.516 19.218 1.00 72.04 ? 103 HOH A O   1 
HETATM 833 O O   . HOH D 2 .  ? -16.195 40.887 11.450 1.00 33.99 ? 104 HOH A O   1 
HETATM 834 O O   . HOH D 2 .  ? 18.739  15.036 27.928 1.00 60.31 ? 105 HOH A O   1 
HETATM 835 O O   . HOH D 2 .  ? -8.638  21.657 12.639 1.00 46.36 ? 106 HOH A O   1 
HETATM 836 O O   . HOH D 2 .  ? 15.858  7.565  28.699 1.00 69.53 ? 107 HOH A O   1 
HETATM 837 O O   . HOH D 2 .  ? -6.027  19.574 13.540 1.00 53.19 ? 108 HOH A O   1 
HETATM 838 O O   . HOH E 2 .  ? -0.774  28.752 8.166  1.00 16.67 ? 34  HOH B O   1 
HETATM 839 O O   . HOH E 2 .  ? 6.552   28.310 8.935  1.00 24.15 ? 35  HOH B O   1 
HETATM 840 O O   . HOH E 2 .  ? -6.371  44.320 12.539 1.00 27.84 ? 36  HOH B O   1 
HETATM 841 O O   . HOH E 2 .  ? 1.605   37.549 11.737 1.00 29.27 ? 37  HOH B O   1 
HETATM 842 O O   . HOH E 2 .  ? 9.374   21.037 7.395  1.00 32.22 ? 38  HOH B O   1 
HETATM 843 O O   . HOH E 2 .  ? 3.884   36.786 18.674 1.00 25.31 ? 39  HOH B O   1 
HETATM 844 O O   . HOH E 2 .  ? -11.552 34.438 11.208 1.00 25.52 ? 40  HOH B O   1 
HETATM 845 O O   . HOH E 2 .  ? 0.245   35.852 8.563  1.00 29.14 ? 41  HOH B O   1 
HETATM 846 O O   . HOH E 2 .  ? 0.014   39.418 12.936 1.00 30.43 ? 42  HOH B O   1 
HETATM 847 O O   . HOH E 2 .  ? -9.584  43.541 10.493 1.00 30.66 ? 43  HOH B O   1 
HETATM 848 O O   . HOH E 2 .  ? 6.672   20.486 4.321  1.00 28.79 ? 44  HOH B O   1 
HETATM 849 O O   . HOH E 2 .  ? 6.268   35.725 15.717 1.00 37.78 ? 45  HOH B O   1 
HETATM 850 O O   . HOH E 2 .  ? 8.746   26.167 12.490 1.00 28.25 ? 46  HOH B O   1 
HETATM 851 O O   . HOH E 2 .  ? -7.307  46.257 12.050 1.00 43.24 ? 47  HOH B O   1 
HETATM 852 O O   . HOH E 2 .  ? 2.833   20.273 2.943  1.00 38.35 ? 48  HOH B O   1 
HETATM 853 O O   . HOH E 2 .  ? -5.015  36.306 7.257  1.00 31.68 ? 49  HOH B O   1 
HETATM 854 O O   . HOH E 2 .  ? 8.572   27.174 10.060 1.00 24.19 ? 50  HOH B O   1 
HETATM 855 O O   . HOH E 2 .  ? -4.533  44.720 10.467 1.00 34.37 ? 51  HOH B O   1 
HETATM 856 O O   . HOH E 2 .  ? -6.130  44.960 21.405 1.00 48.37 ? 52  HOH B O   1 
HETATM 857 O O   . HOH E 2 .  ? -1.631  44.601 21.260 1.00 57.99 ? 53  HOH B O   1 
HETATM 858 O O   . HOH E 2 .  ? 10.802  24.348 11.994 1.00 39.52 ? 54  HOH B O   1 
HETATM 859 O O   . HOH E 2 .  ? 10.709  21.561 9.487  1.00 33.64 ? 55  HOH B O   1 
HETATM 860 O O   . HOH E 2 .  ? 14.563  11.154 9.654  1.00 36.38 ? 56  HOH B O   1 
HETATM 861 O O   . HOH E 2 .  ? 20.882  1.353  15.060 1.00 50.76 ? 57  HOH B O   1 
HETATM 862 O O   . HOH E 2 .  ? -8.530  44.876 8.361  1.00 42.63 ? 58  HOH B O   1 
HETATM 863 O O   . HOH E 2 .  ? 20.838  2.522  11.410 1.00 34.13 ? 59  HOH B O   1 
HETATM 864 O O   . HOH E 2 .  ? 20.536  8.434  9.775  1.00 40.85 ? 60  HOH B O   1 
HETATM 865 O O   . HOH E 2 .  ? 1.654   20.208 14.902 1.00 34.63 ? 61  HOH B O   1 
HETATM 866 O O   . HOH E 2 .  ? 19.364  4.213  15.496 1.00 43.01 ? 62  HOH B O   1 
HETATM 867 O O   . HOH E 2 .  ? -10.449 32.024 7.338  1.00 43.43 ? 63  HOH B O   1 
HETATM 868 O O   . HOH E 2 .  ? 13.726  23.799 15.088 1.00 44.89 ? 64  HOH B O   1 
HETATM 869 O O   . HOH E 2 .  ? 16.069  4.560  20.623 1.00 38.93 ? 65  HOH B O   1 
HETATM 870 O O   . HOH E 2 .  ? -2.117  42.935 10.148 1.00 42.60 ? 66  HOH B O   1 
HETATM 871 O O   . HOH E 2 .  ? 5.167   14.748 14.515 1.00 37.83 ? 67  HOH B O   1 
HETATM 872 O O   . HOH E 2 .  ? 2.762   17.460 10.270 1.00 46.36 ? 68  HOH B O   1 
HETATM 873 O O   . HOH E 2 .  ? 8.852   14.650 8.657  1.00 33.39 ? 69  HOH B O   1 
HETATM 874 O O   . HOH E 2 .  ? 13.378  4.824  20.018 1.00 38.73 ? 70  HOH B O   1 
HETATM 875 O O   . HOH E 2 .  ? 10.027  11.974 8.753  1.00 43.18 ? 71  HOH B O   1 
HETATM 876 O O   . HOH E 2 .  ? 16.005  22.143 15.547 1.00 43.18 ? 72  HOH B O   1 
HETATM 877 O O   . HOH E 2 .  ? 20.790  4.835  8.447  1.00 35.73 ? 73  HOH B O   1 
HETATM 878 O O   . HOH E 2 .  ? 11.992  6.701  17.858 1.00 47.80 ? 74  HOH B O   1 
HETATM 879 O O   . HOH E 2 .  ? 15.572  4.441  7.472  1.00 54.76 ? 75  HOH B O   1 
HETATM 880 O O   . HOH E 2 .  ? -0.144  22.718 6.669  1.00 47.58 ? 76  HOH B O   1 
HETATM 881 O O   . HOH E 2 .  ? 9.838   26.366 7.665  1.00 43.14 ? 77  HOH B O   1 
HETATM 882 O O   . HOH E 2 .  ? -7.110  33.135 10.107 1.00 34.44 ? 78  HOH B O   1 
HETATM 883 O O   . HOH E 2 .  ? -2.443  46.671 19.549 1.00 60.26 ? 79  HOH B O   1 
HETATM 884 O O   . HOH E 2 .  ? -5.099  40.085 2.219  1.00 47.27 ? 80  HOH B O   1 
HETATM 885 O O   . HOH E 2 .  ? -5.903  45.770 8.422  1.00 53.04 ? 81  HOH B O   1 
HETATM 886 O O   . HOH E 2 .  ? -7.834  36.815 7.058  1.00 58.73 ? 82  HOH B O   1 
HETATM 887 O O   . HOH E 2 .  ? -4.694  44.813 5.853  1.00 51.36 ? 83  HOH B O   1 
HETATM 888 O O   . HOH E 2 .  ? 4.101   39.880 14.930 1.00 52.26 ? 84  HOH B O   1 
HETATM 889 O O   . HOH E 2 .  ? 0.643   15.844 8.285  1.00 58.47 ? 85  HOH B O   1 
HETATM 890 O O   . HOH E 2 .  ? 7.855   9.698  9.745  1.00 45.42 ? 86  HOH B O   1 
HETATM 891 O O   . HOH E 2 .  ? -3.752  46.124 15.012 1.00 49.03 ? 87  HOH B O   1 
HETATM 892 O O   . HOH E 2 .  ? 10.814  33.042 11.617 1.00 47.92 ? 88  HOH B O   1 
HETATM 893 O O   . HOH E 2 .  ? 8.596   9.687  12.255 1.00 47.22 ? 89  HOH B O   1 
HETATM 894 O O   . HOH E 2 .  ? -8.944  38.596 5.028  1.00 52.34 ? 90  HOH B O   1 
HETATM 895 O O   . HOH E 2 .  ? 9.106   6.699  13.385 1.00 43.14 ? 91  HOH B O   1 
HETATM 896 O O   . HOH E 2 .  ? 1.993   13.512 15.748 1.00 52.63 ? 92  HOH B O   1 
HETATM 897 O O   . HOH E 2 .  ? 15.218  18.887 12.831 1.00 54.95 ? 93  HOH B O   1 
HETATM 898 O O   . HOH E 2 .  ? -8.085  32.947 7.979  1.00 51.15 ? 94  HOH B O   1 
HETATM 899 O O   . HOH E 2 .  ? 12.364  11.285 7.868  1.00 47.60 ? 95  HOH B O   1 
HETATM 900 O O   . HOH E 2 .  ? 14.308  4.988  9.984  1.00 59.81 ? 96  HOH B O   1 
HETATM 901 O O   . HOH E 2 .  ? 2.382   16.603 5.432  1.00 52.51 ? 97  HOH B O   1 
HETATM 902 O O   . HOH E 2 .  ? -1.003  16.856 6.049  1.00 48.44 ? 98  HOH B O   1 
HETATM 903 O O   . HOH E 2 .  ? 16.467  6.545  9.931  1.00 50.52 ? 99  HOH B O   1 
HETATM 904 O O   . HOH E 2 .  ? -6.994  42.118 2.839  1.00 53.43 ? 100 HOH B O   1 
HETATM 905 O O   . HOH E 2 .  ? 5.865   41.426 15.467 1.00 47.25 ? 101 HOH B O   1 
HETATM 906 O O   . HOH E 2 .  ? 2.735   40.977 17.080 1.00 65.76 ? 102 HOH B O   1 
HETATM 907 O O   . HOH E 2 .  ? -0.030  44.338 18.099 1.00 55.88 ? 103 HOH B O   1 
HETATM 908 O O   . HOH E 2 .  ? 5.978   10.392 13.331 1.00 56.26 ? 104 HOH B O   1 
HETATM 909 O O   . HOH E 2 .  ? 18.819  5.759  19.431 1.00 52.32 ? 105 HOH B O   1 
HETATM 910 O O   . HOH E 2 .  ? -9.116  42.184 6.271  1.00 54.89 ? 106 HOH B O   1 
HETATM 911 O O   . HOH F 2 .  ? -9.614  33.024 23.344 1.00 28.03 ? 34  HOH C O   1 
HETATM 912 O O   . HOH F 2 .  ? 9.758   36.549 17.996 1.00 35.15 ? 35  HOH C O   1 
HETATM 913 O O   . HOH F 2 .  ? 12.903  20.950 27.123 1.00 52.61 ? 36  HOH C O   1 
HETATM 914 O O   . HOH F 2 .  ? 2.641   25.328 30.011 1.00 32.28 ? 37  HOH C O   1 
HETATM 915 O O   . HOH F 2 .  ? 9.457   22.048 24.833 1.00 45.26 ? 38  HOH C O   1 
HETATM 916 O O   . HOH F 2 .  ? -19.138 32.608 23.022 1.00 54.22 ? 39  HOH C O   1 
HETATM 917 O O   . HOH F 2 .  ? 12.581  33.614 17.046 1.00 53.66 ? 40  HOH C O   1 
HETATM 918 O O   . HOH F 2 .  ? -20.486 36.940 22.738 1.00 51.50 ? 41  HOH C O   1 
HETATM 919 O O   . HOH F 2 .  ? 15.171  30.127 14.488 1.00 60.10 ? 42  HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  1  1  ARG ARG A . n 
A 1 2  MET 2  2  2  MET MET A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  GLN 4  4  4  GLN GLN A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 TYR 17 17 17 TYR TYR A . n 
A 1 18 HIS 18 18 18 HIS HIS A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 GLY 31 31 ?  ?   ?   A . n 
A 1 32 GLU 32 32 ?  ?   ?   A . n 
A 1 33 ARG 33 33 ?  ?   ?   A . n 
B 1 1  ARG 1  1  1  ARG ARG B . n 
B 1 2  MET 2  2  2  MET MET B . n 
B 1 3  LYS 3  3  3  LYS LYS B . n 
B 1 4  GLN 4  4  4  GLN GLN B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  GLU 6  6  6  GLU GLU B . n 
B 1 7  ASP 7  7  7  ASP ASP B . n 
B 1 8  LYS 8  8  8  LYS LYS B . n 
B 1 9  VAL 9  9  9  VAL VAL B . n 
B 1 10 GLU 10 10 10 GLU GLU B . n 
B 1 11 GLU 11 11 11 GLU GLU B . n 
B 1 12 LEU 12 12 12 LEU LEU B . n 
B 1 13 LEU 13 13 13 LEU LEU B . n 
B 1 14 SER 14 14 14 SER SER B . n 
B 1 15 LYS 15 15 15 LYS LYS B . n 
B 1 16 ALA 16 16 16 ALA ALA B . n 
B 1 17 TYR 17 17 17 TYR TYR B . n 
B 1 18 HIS 18 18 18 HIS HIS B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 GLU 20 20 20 GLU GLU B . n 
B 1 21 ASN 21 21 21 ASN ASN B . n 
B 1 22 GLU 22 22 22 GLU GLU B . n 
B 1 23 VAL 23 23 23 VAL VAL B . n 
B 1 24 ALA 24 24 24 ALA ALA B . n 
B 1 25 ARG 25 25 25 ARG ARG B . n 
B 1 26 LEU 26 26 26 LEU LEU B . n 
B 1 27 LYS 27 27 27 LYS LYS B . n 
B 1 28 LYS 28 28 28 LYS LYS B . n 
B 1 29 LEU 29 29 29 LEU LEU B . n 
B 1 30 VAL 30 30 30 VAL VAL B . n 
B 1 31 GLY 31 31 31 GLY GLY B . n 
B 1 32 GLU 32 32 32 GLU GLU B . n 
B 1 33 ARG 33 33 ?  ?   ?   B . n 
C 1 1  ARG 1  1  1  ARG ARG C . n 
C 1 2  MET 2  2  2  MET MET C . n 
C 1 3  LYS 3  3  3  LYS LYS C . n 
C 1 4  GLN 4  4  4  GLN GLN C . n 
C 1 5  LEU 5  5  5  LEU LEU C . n 
C 1 6  GLU 6  6  6  GLU GLU C . n 
C 1 7  ASP 7  7  7  ASP ASP C . n 
C 1 8  LYS 8  8  8  LYS LYS C . n 
C 1 9  VAL 9  9  9  VAL VAL C . n 
C 1 10 GLU 10 10 10 GLU GLU C . n 
C 1 11 GLU 11 11 11 GLU GLU C . n 
C 1 12 LEU 12 12 12 LEU LEU C . n 
C 1 13 LEU 13 13 13 LEU LEU C . n 
C 1 14 SER 14 14 14 SER SER C . n 
C 1 15 LYS 15 15 15 LYS LYS C . n 
C 1 16 ALA 16 16 16 ALA ALA C . n 
C 1 17 TYR 17 17 17 TYR TYR C . n 
C 1 18 HIS 18 18 18 HIS HIS C . n 
C 1 19 LEU 19 19 19 LEU LEU C . n 
C 1 20 GLU 20 20 20 GLU GLU C . n 
C 1 21 ASN 21 21 21 ASN ASN C . n 
C 1 22 GLU 22 22 22 GLU GLU C . n 
C 1 23 VAL 23 23 23 VAL VAL C . n 
C 1 24 ALA 24 24 24 ALA ALA C . n 
C 1 25 ARG 25 25 25 ARG ARG C . n 
C 1 26 LEU 26 26 26 LEU LEU C . n 
C 1 27 LYS 27 27 27 LYS LYS C . n 
C 1 28 LYS 28 28 28 LYS LYS C . n 
C 1 29 LEU 29 29 29 LEU LEU C . n 
C 1 30 VAL 30 30 ?  ?   ?   C . n 
C 1 31 GLY 31 31 ?  ?   ?   C . n 
C 1 32 GLU 32 32 ?  ?   ?   C . n 
C 1 33 ARG 33 33 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1  34  3   HOH HOH A . 
D 2 HOH 2  35  8   HOH HOH A . 
D 2 HOH 3  36  10  HOH HOH A . 
D 2 HOH 4  37  16  HOH HOH A . 
D 2 HOH 5  38  17  HOH HOH A . 
D 2 HOH 6  39  19  HOH HOH A . 
D 2 HOH 7  40  20  HOH HOH A . 
D 2 HOH 8  41  22  HOH HOH A . 
D 2 HOH 9  42  26  HOH HOH A . 
D 2 HOH 10 43  28  HOH HOH A . 
D 2 HOH 11 44  29  HOH HOH A . 
D 2 HOH 12 45  35  HOH HOH A . 
D 2 HOH 13 46  37  HOH HOH A . 
D 2 HOH 14 47  38  HOH HOH A . 
D 2 HOH 15 48  40  HOH HOH A . 
D 2 HOH 16 49  42  HOH HOH A . 
D 2 HOH 17 50  44  HOH HOH A . 
D 2 HOH 18 51  45  HOH HOH A . 
D 2 HOH 19 52  49  HOH HOH A . 
D 2 HOH 20 53  59  HOH HOH A . 
D 2 HOH 21 54  61  HOH HOH A . 
D 2 HOH 22 55  64  HOH HOH A . 
D 2 HOH 23 56  65  HOH HOH A . 
D 2 HOH 24 57  70  HOH HOH A . 
D 2 HOH 25 58  75  HOH HOH A . 
D 2 HOH 26 59  76  HOH HOH A . 
D 2 HOH 27 60  77  HOH HOH A . 
D 2 HOH 28 61  80  HOH HOH A . 
D 2 HOH 29 62  85  HOH HOH A . 
D 2 HOH 30 63  91  HOH HOH A . 
D 2 HOH 31 64  92  HOH HOH A . 
D 2 HOH 32 65  93  HOH HOH A . 
D 2 HOH 33 66  94  HOH HOH A . 
D 2 HOH 34 67  95  HOH HOH A . 
D 2 HOH 35 68  98  HOH HOH A . 
D 2 HOH 36 69  99  HOH HOH A . 
D 2 HOH 37 70  100 HOH HOH A . 
D 2 HOH 38 71  101 HOH HOH A . 
D 2 HOH 39 72  102 HOH HOH A . 
D 2 HOH 40 73  105 HOH HOH A . 
D 2 HOH 41 74  111 HOH HOH A . 
D 2 HOH 42 75  113 HOH HOH A . 
D 2 HOH 43 76  114 HOH HOH A . 
D 2 HOH 44 77  115 HOH HOH A . 
D 2 HOH 45 78  116 HOH HOH A . 
D 2 HOH 46 79  119 HOH HOH A . 
D 2 HOH 47 80  120 HOH HOH A . 
D 2 HOH 48 81  123 HOH HOH A . 
D 2 HOH 49 82  124 HOH HOH A . 
D 2 HOH 50 83  129 HOH HOH A . 
D 2 HOH 51 84  131 HOH HOH A . 
D 2 HOH 52 85  134 HOH HOH A . 
D 2 HOH 53 86  135 HOH HOH A . 
D 2 HOH 54 87  139 HOH HOH A . 
D 2 HOH 55 88  140 HOH HOH A . 
D 2 HOH 56 89  141 HOH HOH A . 
D 2 HOH 57 90  144 HOH HOH A . 
D 2 HOH 58 91  148 HOH HOH A . 
D 2 HOH 59 92  149 HOH HOH A . 
D 2 HOH 60 93  150 HOH HOH A . 
D 2 HOH 61 94  155 HOH HOH A . 
D 2 HOH 62 95  161 HOH HOH A . 
D 2 HOH 63 96  162 HOH HOH A . 
D 2 HOH 64 97  170 HOH HOH A . 
D 2 HOH 65 98  171 HOH HOH A . 
D 2 HOH 66 99  175 HOH HOH A . 
D 2 HOH 67 100 179 HOH HOH A . 
D 2 HOH 68 101 180 HOH HOH A . 
D 2 HOH 69 102 182 HOH HOH A . 
D 2 HOH 70 103 186 HOH HOH A . 
D 2 HOH 71 104 188 HOH HOH A . 
D 2 HOH 72 105 190 HOH HOH A . 
D 2 HOH 73 106 191 HOH HOH A . 
D 2 HOH 74 107 196 HOH HOH A . 
D 2 HOH 75 108 198 HOH HOH A . 
E 2 HOH 1  34  5   HOH HOH B . 
E 2 HOH 2  35  6   HOH HOH B . 
E 2 HOH 3  36  7   HOH HOH B . 
E 2 HOH 4  37  9   HOH HOH B . 
E 2 HOH 5  38  12  HOH HOH B . 
E 2 HOH 6  39  14  HOH HOH B . 
E 2 HOH 7  40  15  HOH HOH B . 
E 2 HOH 8  41  21  HOH HOH B . 
E 2 HOH 9  42  23  HOH HOH B . 
E 2 HOH 10 43  24  HOH HOH B . 
E 2 HOH 11 44  32  HOH HOH B . 
E 2 HOH 12 45  39  HOH HOH B . 
E 2 HOH 13 46  41  HOH HOH B . 
E 2 HOH 14 47  43  HOH HOH B . 
E 2 HOH 15 48  46  HOH HOH B . 
E 2 HOH 16 49  47  HOH HOH B . 
E 2 HOH 17 50  50  HOH HOH B . 
E 2 HOH 18 51  51  HOH HOH B . 
E 2 HOH 19 52  52  HOH HOH B . 
E 2 HOH 20 53  55  HOH HOH B . 
E 2 HOH 21 54  58  HOH HOH B . 
E 2 HOH 22 55  60  HOH HOH B . 
E 2 HOH 23 56  62  HOH HOH B . 
E 2 HOH 24 57  66  HOH HOH B . 
E 2 HOH 25 58  67  HOH HOH B . 
E 2 HOH 26 59  71  HOH HOH B . 
E 2 HOH 27 60  72  HOH HOH B . 
E 2 HOH 28 61  73  HOH HOH B . 
E 2 HOH 29 62  74  HOH HOH B . 
E 2 HOH 30 63  79  HOH HOH B . 
E 2 HOH 31 64  81  HOH HOH B . 
E 2 HOH 32 65  82  HOH HOH B . 
E 2 HOH 33 66  83  HOH HOH B . 
E 2 HOH 34 67  86  HOH HOH B . 
E 2 HOH 35 68  88  HOH HOH B . 
E 2 HOH 36 69  90  HOH HOH B . 
E 2 HOH 37 70  96  HOH HOH B . 
E 2 HOH 38 71  97  HOH HOH B . 
E 2 HOH 39 72  103 HOH HOH B . 
E 2 HOH 40 73  104 HOH HOH B . 
E 2 HOH 41 74  106 HOH HOH B . 
E 2 HOH 42 75  107 HOH HOH B . 
E 2 HOH 43 76  108 HOH HOH B . 
E 2 HOH 44 77  109 HOH HOH B . 
E 2 HOH 45 78  117 HOH HOH B . 
E 2 HOH 46 79  118 HOH HOH B . 
E 2 HOH 47 80  122 HOH HOH B . 
E 2 HOH 48 81  127 HOH HOH B . 
E 2 HOH 49 82  128 HOH HOH B . 
E 2 HOH 50 83  136 HOH HOH B . 
E 2 HOH 51 84  138 HOH HOH B . 
E 2 HOH 52 85  142 HOH HOH B . 
E 2 HOH 53 86  143 HOH HOH B . 
E 2 HOH 54 87  145 HOH HOH B . 
E 2 HOH 55 88  147 HOH HOH B . 
E 2 HOH 56 89  152 HOH HOH B . 
E 2 HOH 57 90  153 HOH HOH B . 
E 2 HOH 58 91  154 HOH HOH B . 
E 2 HOH 59 92  158 HOH HOH B . 
E 2 HOH 60 93  159 HOH HOH B . 
E 2 HOH 61 94  160 HOH HOH B . 
E 2 HOH 62 95  163 HOH HOH B . 
E 2 HOH 63 96  164 HOH HOH B . 
E 2 HOH 64 97  167 HOH HOH B . 
E 2 HOH 65 98  169 HOH HOH B . 
E 2 HOH 66 99  176 HOH HOH B . 
E 2 HOH 67 100 177 HOH HOH B . 
E 2 HOH 68 101 178 HOH HOH B . 
E 2 HOH 69 102 189 HOH HOH B . 
E 2 HOH 70 103 192 HOH HOH B . 
E 2 HOH 71 104 193 HOH HOH B . 
E 2 HOH 72 105 197 HOH HOH B . 
E 2 HOH 73 106 199 HOH HOH B . 
F 2 HOH 1  34  18  HOH HOH C . 
F 2 HOH 2  35  31  HOH HOH C . 
F 2 HOH 3  36  78  HOH HOH C . 
F 2 HOH 4  37  84  HOH HOH C . 
F 2 HOH 5  38  126 HOH HOH C . 
F 2 HOH 6  39  165 HOH HOH C . 
F 2 HOH 7  40  168 HOH HOH C . 
F 2 HOH 8  41  173 HOH HOH C . 
F 2 HOH 9  42  185 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3820 ? 
1 MORE         -39  ? 
1 'SSA (A^2)'  6170 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
REFMAC refinement       26/11/99  ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
ELVES  phasing          .         ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE  A ARG 1  ? ? CZ A ARG 1  ? ? NH1 A ARG 1  ? ? 117.29 120.30 -3.01  0.50 N 
2 1 CD  A ARG 25 ? ? NE A ARG 25 ? ? CZ  A ARG 25 ? ? 134.71 123.60 11.11  1.40 N 
3 1 NE  A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 124.19 120.30 3.89   0.50 N 
4 1 NE  B ARG 1  ? ? CZ B ARG 1  ? ? NH2 B ARG 1  ? ? 116.86 120.30 -3.44  0.50 N 
5 1 CG  B MET 2  ? ? SD B MET 2  ? ? CE  B MET 2  ? ? 85.91  100.20 -14.29 1.60 N 
6 1 OE1 B GLU 10 ? ? CD B GLU 10 ? ? OE2 B GLU 10 ? ? 132.37 123.30 9.07   1.20 N 
7 1 OE1 C GLU 22 ? ? CD C GLU 22 ? ? OE2 C GLU 22 ? ? 110.87 123.30 -12.43 1.20 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 31 ? A GLY 31 
2 1 Y 1 A GLU 32 ? A GLU 32 
3 1 Y 1 A ARG 33 ? A ARG 33 
4 1 Y 1 B ARG 33 ? B ARG 33 
5 1 Y 1 C VAL 30 ? C VAL 30 
6 1 Y 1 C GLY 31 ? C GLY 31 
7 1 Y 1 C GLU 32 ? C GLU 32 
8 1 Y 1 C ARG 33 ? C ARG 33 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#