data_1RB5
# 
_entry.id   1RB5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RB5         
RCSB  RCSB020633   
WWPDB D_1000020633 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1rb1 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TRIGONAL AUTOMATIC 
SOLUTION
;
unspecified 
PDB 1rb4 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TETRAGONAL AUTOMATIC 
SOLUTION
;
unspecified 
PDB 1rb6 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A 
TETRAGONAL FORM
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RB5 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Holton, J.' 1 
'Alber, T.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Automated protein crystal structure determination using ELVES.'                               Proc.Natl.Acad.Sci.USA 101 
1537 1542 2004 PNASA6 US 0027-8424 0040 ? 14752198 10.1073/pnas.0306241101 
1       'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization'                            Nat.Struct.Biol.       3   
510  515  1996 NSBIEW US 1072-8368 2024 ? ?        ?                       
2       'Crystal Structure of an Isoleucine-Zipper Trimer'                                             Nature                 371 
80   83   1994 NATUAS UK 0028-0836 0006 ? ?        10.1038/371080a0        
3       'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science                262 
1401 1407 1993 SCIEAS US 0036-8075 0038 ? ?        ?                       
4       'X-Ray Structure of the GCN4 Leucine Zipper, a two-stranded, parallel coiled coil.'            Science                254 
539  544  1991 SCIEAS US 0036-8075 0038 ? ?        ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Holton, J.'       1  
primary 'Alber, T.'        2  
1       'Gonzalez Jr., L.' 3  
1       'Plecs, J.J.'      4  
1       'Alber, T.'        5  
2       'Harbury, P.B.'    6  
2       'Kim, P.S.'        7  
2       'Alber, T.'        8  
3       'Harbury, P.B.'    9  
3       'Zhang, T.'        10 
3       'Kim, P.S.'        11 
3       'Alber, T.'        12 
4       
;O'Shea, E.K.
;
13 
4       'Klemm, J.D.'      14 
4       'Kim, P.S.'        15 
4       'Alber, T.'        16 
# 
_cell.entry_id           1RB5 
_cell.length_a           89.943 
_cell.length_b           89.943 
_cell.length_c           46.481 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RB5 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'General control protein GCN4' 3988.677 3   ? N16A 'LEUCINE-ZIPPER (RESIDUES 249-281)' ? 
2 water   nat water                          18.015   189 ? ?    ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Amino acid biosynthesis regulatory protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)RMKQLEDKVEELLSKAYHLENEVARLKKLVGER' 
_entity_poly.pdbx_seq_one_letter_code_can   XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  ARG n 
1 3  MET n 
1 4  LYS n 
1 5  GLN n 
1 6  LEU n 
1 7  GLU n 
1 8  ASP n 
1 9  LYS n 
1 10 VAL n 
1 11 GLU n 
1 12 GLU n 
1 13 LEU n 
1 14 LEU n 
1 15 SER n 
1 16 LYS n 
1 17 ALA n 
1 18 TYR n 
1 19 HIS n 
1 20 LEU n 
1 21 GLU n 
1 22 ASN n 
1 23 GLU n 
1 24 VAL n 
1 25 ALA n 
1 26 ARG n 
1 27 LEU n 
1 28 LYS n 
1 29 LYS n 
1 30 LEU n 
1 31 VAL n 
1 32 GLY n 
1 33 GLU n 
1 34 ARG n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'THE SEQUENCE OF THE PROTEIN IS NATURALLY FOUND IN SACCHAROMYCES CEREVISIAE. THE PROTEIN WAS CHEMICALLY SYNTHESIZED.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RB5 A 2 ? 34 ? P03069 249 ? 281 ? 1 33 
2 1 1RB5 B 2 ? 34 ? P03069 249 ? 281 ? 1 33 
3 1 1RB5 C 2 ? 34 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RB5 ALA A 17 ? UNP P03069 ASN 264 ENGINEERED 16 1 
2 1RB5 ALA B 17 ? UNP P03069 ASN 264 ENGINEERED 16 2 
3 1RB5 ALA C 17 ? UNP P03069 ASN 264 ENGINEERED 16 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RB5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   75. 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      4.54 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    '100mM bis-tris, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1997-12-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0688 1.0 
2 0.9800 1.0 
3 0.9795 1.0 
4 0.9322 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL1-5' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL1-5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '1.0688, 0.9800, 0.9795, 0.9322' 
# 
_reflns.entry_id                     1RB5 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             45 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   20106 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.9 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RB5 
_refine.ls_number_reflns_obs                     17327 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  861 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        870 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             189 
_refine_hist.number_atoms_total               1059 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 2     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RB5 
_struct.title                     'ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TRIGONAL FORM' 
_struct.pdbx_descriptor           'GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RB5 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'COILED COIL, LEUCINE ZIPPER, AUTOMATION, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 2 ? GLY A 32 ? ARG A 1 GLY A 31 1 ? 31 
HELX_P HELX_P2 2 ARG B 2 ? GLY B 32 ? ARG B 1 GLY B 31 1 ? 31 
HELX_P HELX_P3 3 ARG C 2 ? GLY C 32 ? ARG C 1 GLY C 31 1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ACE 1 C ? ? ? 1_555 A ARG 2 N ? ? A ACE 0 A ARG 1 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? B ACE 1 C ? ? ? 1_555 B ARG 2 N ? ? B ACE 0 B ARG 1 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale3 covale ? ? C ACE 1 C ? ? ? 1_555 C ARG 2 N ? ? C ACE 0 C ARG 1 1_555 ? ? ? ? ? ? ? 1.345 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1RB5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RB5 
_atom_sites.fract_transf_matrix[1][1]   0.011118 
_atom_sites.fract_transf_matrix[1][2]   0.006419 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012838 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021514 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    C C   . ACE A 1 1  ? 70.215 24.714 20.953 1.00 54.92  ? 0   ACE A C   1 
HETATM 2    O O   . ACE A 1 1  ? 69.490 24.015 20.219 1.00 51.68  ? 0   ACE A O   1 
HETATM 3    C CH3 . ACE A 1 1  ? 71.684 24.902 20.794 1.00 61.50  ? 0   ACE A CH3 1 
ATOM   4    N N   . ARG A 1 2  ? 69.884 25.434 22.020 1.00 57.98  ? 1   ARG A N   1 
ATOM   5    C CA  . ARG A 1 2  ? 69.823 26.872 22.014 1.00 57.49  ? 1   ARG A CA  1 
ATOM   6    C C   . ARG A 1 2  ? 69.606 27.429 20.609 1.00 52.74  ? 1   ARG A C   1 
ATOM   7    O O   . ARG A 1 2  ? 68.421 27.727 20.303 1.00 52.16  ? 1   ARG A O   1 
ATOM   8    C CB  . ARG A 1 2  ? 70.892 27.594 22.811 1.00 48.00  ? 1   ARG A CB  1 
ATOM   9    C CG  . ARG A 1 2  ? 70.341 28.053 24.162 1.00 55.48  ? 1   ARG A CG  1 
ATOM   10   C CD  . ARG A 1 2  ? 71.316 28.967 24.883 1.00 58.09  ? 1   ARG A CD  1 
ATOM   11   N NE  . ARG A 1 2  ? 70.615 30.128 25.431 1.00 46.99  ? 1   ARG A NE  1 
ATOM   12   C CZ  . ARG A 1 2  ? 71.238 31.217 25.853 1.00 53.24  ? 1   ARG A CZ  1 
ATOM   13   N NH1 . ARG A 1 2  ? 70.501 32.209 26.311 1.00 43.22  ? 1   ARG A NH1 1 
ATOM   14   N NH2 . ARG A 1 2  ? 72.563 31.303 25.801 1.00 58.47  ? 1   ARG A NH2 1 
ATOM   15   N N   . MET A 1 3  ? 70.590 27.563 19.750 1.00 53.70  ? 2   MET A N   1 
ATOM   16   C CA  . MET A 1 3  ? 70.361 28.156 18.433 1.00 50.12  ? 2   MET A CA  1 
ATOM   17   C C   . MET A 1 3  ? 69.272 27.448 17.645 1.00 47.01  ? 2   MET A C   1 
ATOM   18   O O   . MET A 1 3  ? 68.309 28.094 17.166 1.00 38.30  ? 2   MET A O   1 
ATOM   19   C CB  . MET A 1 3  ? 71.683 28.299 17.690 1.00 43.69  ? 2   MET A CB  1 
ATOM   20   C CG  A MET A 1 3  ? 71.758 29.259 16.519 0.80 30.51  ? 2   MET A CG  1 
ATOM   21   C CG  B MET A 1 3  ? 71.888 29.664 17.052 0.20 39.18  ? 2   MET A CG  1 
ATOM   22   S SD  A MET A 1 3  ? 71.633 30.996 17.007 0.80 37.06  ? 2   MET A SD  1 
ATOM   23   S SD  B MET A 1 3  ? 70.422 30.239 16.175 0.20 36.72  ? 2   MET A SD  1 
ATOM   24   C CE  A MET A 1 3  ? 70.048 31.377 16.239 0.80 34.15  ? 2   MET A CE  1 
ATOM   25   C CE  B MET A 1 3  ? 70.870 31.944 15.863 0.20 37.87  ? 2   MET A CE  1 
ATOM   26   N N   . LYS A 1 4  ? 69.346 26.142 17.455 1.00 41.46  ? 3   LYS A N   1 
ATOM   27   C CA  . LYS A 1 4  ? 68.366 25.402 16.690 1.00 46.40  ? 3   LYS A CA  1 
ATOM   28   C C   . LYS A 1 4  ? 66.952 25.503 17.277 1.00 48.90  ? 3   LYS A C   1 
ATOM   29   O O   . LYS A 1 4  ? 65.942 25.461 16.568 1.00 39.49  ? 3   LYS A O   1 
ATOM   30   C CB  . LYS A 1 4  ? 68.709 23.917 16.543 1.00 45.95  ? 3   LYS A CB  1 
ATOM   31   C CG  A LYS A 1 4  ? 67.694 23.073 15.790 0.50 41.67  ? 3   LYS A CG  1 
ATOM   32   C CG  B LYS A 1 4  ? 67.897 23.291 15.412 0.50 39.67  ? 3   LYS A CG  1 
ATOM   33   C CD  A LYS A 1 4  ? 67.394 23.609 14.407 0.50 42.92  ? 3   LYS A CD  1 
ATOM   34   C CD  B LYS A 1 4  ? 67.740 21.792 15.585 0.50 44.48  ? 3   LYS A CD  1 
ATOM   35   C CE  A LYS A 1 4  ? 66.558 22.671 13.563 0.50 50.48  ? 3   LYS A CE  1 
ATOM   36   C CE  B LYS A 1 4  ? 67.205 21.172 14.303 0.50 43.61  ? 3   LYS A CE  1 
ATOM   37   N NZ  A LYS A 1 4  ? 65.477 21.998 14.324 0.50 48.16  ? 3   LYS A NZ  1 
ATOM   38   N NZ  B LYS A 1 4  ? 66.435 19.924 14.572 0.50 56.23  ? 3   LYS A NZ  1 
ATOM   39   N N   . GLN A 1 5  ? 66.882 25.567 18.590 1.00 38.52  ? 4   GLN A N   1 
ATOM   40   C CA  . GLN A 1 5  ? 65.647 25.661 19.338 1.00 43.73  ? 4   GLN A CA  1 
ATOM   41   C C   . GLN A 1 5  ? 65.008 27.023 19.086 1.00 37.48  ? 4   GLN A C   1 
ATOM   42   O O   . GLN A 1 5  ? 63.787 27.173 19.007 1.00 40.69  ? 4   GLN A O   1 
ATOM   43   C CB  . GLN A 1 5  ? 65.981 25.502 20.832 1.00 44.42  ? 4   GLN A CB  1 
ATOM   44   N N   . LEU A 1 6  ? 65.841 28.055 19.095 1.00 32.11  ? 5   LEU A N   1 
ATOM   45   C CA  . LEU A 1 6  ? 65.408 29.425 18.834 1.00 35.49  ? 5   LEU A CA  1 
ATOM   46   C C   . LEU A 1 6  ? 64.912 29.446 17.391 1.00 35.67  ? 5   LEU A C   1 
ATOM   47   O O   . LEU A 1 6  ? 63.799 29.936 17.157 1.00 33.69  ? 5   LEU A O   1 
ATOM   48   C CB  . LEU A 1 6  ? 66.496 30.420 19.130 1.00 31.21  ? 5   LEU A CB  1 
ATOM   49   C CG  . LEU A 1 6  ? 66.361 31.871 18.742 1.00 28.63  ? 5   LEU A CG  1 
ATOM   50   C CD1 . LEU A 1 6  ? 65.113 32.483 19.387 1.00 32.52  ? 5   LEU A CD1 1 
ATOM   51   C CD2 . LEU A 1 6  ? 67.589 32.666 19.183 1.00 32.08  ? 5   LEU A CD2 1 
ATOM   52   N N   . GLU A 1 7  ? 65.659 28.888 16.442 1.00 31.21  ? 6   GLU A N   1 
ATOM   53   C CA  . GLU A 1 7  ? 65.206 28.860 15.051 1.00 37.84  ? 6   GLU A CA  1 
ATOM   54   C C   . GLU A 1 7  ? 63.889 28.112 14.901 1.00 37.88  ? 6   GLU A C   1 
ATOM   55   O O   . GLU A 1 7  ? 62.965 28.567 14.192 1.00 33.81  ? 6   GLU A O   1 
ATOM   56   C CB  . GLU A 1 7  ? 66.297 28.243 14.148 1.00 32.10  ? 6   GLU A CB  1 
ATOM   57   C CG  . GLU A 1 7  ? 67.514 29.168 14.070 1.00 34.00  ? 6   GLU A CG  1 
ATOM   58   C CD  . GLU A 1 7  ? 68.510 28.591 13.059 1.00 43.68  ? 6   GLU A CD  1 
ATOM   59   O OE1 . GLU A 1 7  ? 69.196 27.628 13.407 1.00 43.81  ? 6   GLU A OE1 1 
ATOM   60   O OE2 . GLU A 1 7  ? 68.572 29.086 11.922 1.00 51.80  ? 6   GLU A OE2 1 
ATOM   61   N N   . ASP A 1 8  ? 63.712 26.982 15.583 1.00 33.71  ? 7   ASP A N   1 
ATOM   62   C CA  . ASP A 1 8  ? 62.461 26.223 15.447 1.00 31.65  ? 7   ASP A CA  1 
ATOM   63   C C   . ASP A 1 8  ? 61.267 27.017 16.006 1.00 28.53  ? 7   ASP A C   1 
ATOM   64   O O   . ASP A 1 8  ? 60.168 26.926 15.430 1.00 32.98  ? 7   ASP A O   1 
ATOM   65   C CB  . ASP A 1 8  ? 62.567 24.887 16.146 1.00 34.76  ? 7   ASP A CB  1 
ATOM   66   C CG  . ASP A 1 8  ? 63.518 23.911 15.471 1.00 44.18  ? 7   ASP A CG  1 
ATOM   67   O OD1 . ASP A 1 8  ? 63.822 24.043 14.274 1.00 47.62  ? 7   ASP A OD1 1 
ATOM   68   O OD2 . ASP A 1 8  ? 63.954 22.975 16.160 1.00 56.58  ? 7   ASP A OD2 1 
ATOM   69   N N   . LYS A 1 9  ? 61.503 27.756 17.077 1.00 26.21  ? 8   LYS A N   1 
ATOM   70   C CA  . LYS A 1 9  ? 60.420 28.560 17.653 1.00 35.72  ? 8   LYS A CA  1 
ATOM   71   C C   . LYS A 1 9  ? 60.071 29.715 16.725 1.00 32.44  ? 8   LYS A C   1 
ATOM   72   O O   . LYS A 1 9  ? 58.925 30.189 16.647 1.00 24.54  ? 8   LYS A O   1 
ATOM   73   C CB  . LYS A 1 9  ? 60.799 29.086 19.013 1.00 32.67  ? 8   LYS A CB  1 
ATOM   74   C CG  . LYS A 1 9  ? 60.764 28.011 20.115 1.00 32.70  ? 8   LYS A CG  1 
ATOM   75   C CD  . LYS A 1 9  ? 61.167 28.733 21.406 1.00 38.34  ? 8   LYS A CD  1 
ATOM   76   C CE  . LYS A 1 9  ? 61.188 27.773 22.600 1.00 49.46  ? 8   LYS A CE  1 
ATOM   77   N NZ  . LYS A 1 9  ? 59.802 27.483 23.039 1.00 52.09  ? 8   LYS A NZ  1 
ATOM   78   N N   . VAL A 1 10 ? 61.086 30.277 16.052 1.00 27.57  ? 9   VAL A N   1 
ATOM   79   C CA  . VAL A 1 10 ? 60.794 31.354 15.104 1.00 23.49  ? 9   VAL A CA  1 
ATOM   80   C C   . VAL A 1 10 ? 59.913 30.796 13.984 1.00 23.31  ? 9   VAL A C   1 
ATOM   81   O O   . VAL A 1 10 ? 59.002 31.488 13.507 1.00 22.70  ? 9   VAL A O   1 
ATOM   82   C CB  . VAL A 1 10 ? 62.076 31.968 14.493 1.00 25.51  ? 9   VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 10 ? 61.736 32.899 13.336 1.00 24.29  ? 9   VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 10 ? 62.806 32.784 15.556 1.00 25.88  ? 9   VAL A CG2 1 
ATOM   85   N N   . GLU A 1 11 ? 60.209 29.579 13.490 1.00 23.37  ? 10  GLU A N   1 
ATOM   86   C CA  . GLU A 1 11 ? 59.420 28.991 12.398 1.00 23.49  ? 10  GLU A CA  1 
ATOM   87   C C   . GLU A 1 11 ? 57.995 28.696 12.874 1.00 26.44  ? 10  GLU A C   1 
ATOM   88   O O   . GLU A 1 11 ? 57.034 28.966 12.151 1.00 24.89  ? 10  GLU A O   1 
ATOM   89   C CB  . GLU A 1 11 ? 60.072 27.686 11.891 1.00 26.97  ? 10  GLU A CB  1 
ATOM   90   C CG  . GLU A 1 11 ? 61.262 27.976 10.949 1.00 29.04  ? 10  GLU A CG  1 
ATOM   91   C CD  . GLU A 1 11 ? 60.875 28.529 9.625  1.00 30.24  ? 10  GLU A CD  1 
ATOM   92   O OE1 . GLU A 1 11 ? 59.720 28.338 9.137  1.00 30.84  ? 10  GLU A OE1 1 
ATOM   93   O OE2 . GLU A 1 11 ? 61.708 29.206 8.978  1.00 35.36  ? 10  GLU A OE2 1 
ATOM   94   N N   . GLU A 1 12 ? 57.862 28.168 14.085 1.00 28.65  ? 11  GLU A N   1 
ATOM   95   C CA  . GLU A 1 12 ? 56.552 27.947 14.692 1.00 28.61  ? 11  GLU A CA  1 
ATOM   96   C C   . GLU A 1 12 ? 55.757 29.276 14.729 1.00 24.31  ? 11  GLU A C   1 
ATOM   97   O O   . GLU A 1 12 ? 54.617 29.288 14.285 1.00 23.70  ? 11  GLU A O   1 
ATOM   98   C CB  . GLU A 1 12 ? 56.715 27.491 16.146 1.00 27.27  ? 11  GLU A CB  1 
ATOM   99   C CG  . GLU A 1 12 ? 55.382 27.406 16.901 1.00 42.80  ? 11  GLU A CG  1 
ATOM   100  C CD  . GLU A 1 12 ? 55.548 26.915 18.333 1.00 47.06  ? 11  GLU A CD  1 
ATOM   101  O OE1 . GLU A 1 12 ? 56.696 26.672 18.766 1.00 48.27  ? 11  GLU A OE1 1 
ATOM   102  O OE2 . GLU A 1 12 ? 54.540 26.774 19.052 1.00 54.73  ? 11  GLU A OE2 1 
ATOM   103  N N   . LEU A 1 13 ? 56.392 30.336 15.198 1.00 24.21  ? 12  LEU A N   1 
ATOM   104  C CA  . LEU A 1 13 ? 55.826 31.680 15.271 1.00 22.09  ? 12  LEU A CA  1 
ATOM   105  C C   . LEU A 1 13 ? 55.360 32.208 13.918 1.00 31.23  ? 12  LEU A C   1 
ATOM   106  O O   . LEU A 1 13 ? 54.226 32.726 13.762 1.00 22.60  ? 12  LEU A O   1 
ATOM   107  C CB  . LEU A 1 13 ? 56.803 32.680 15.942 1.00 20.99  ? 12  LEU A CB  1 
ATOM   108  C CG  . LEU A 1 13 ? 56.374 34.160 15.781 1.00 17.55  ? 12  LEU A CG  1 
ATOM   109  C CD1 . LEU A 1 13 ? 55.145 34.427 16.682 1.00 19.75  ? 12  LEU A CD1 1 
ATOM   110  C CD2 . LEU A 1 13 ? 57.484 35.139 16.225 1.00 25.55  ? 12  LEU A CD2 1 
ATOM   111  N N   . LEU A 1 14 ? 56.180 32.118 12.881 1.00 24.71  ? 13  LEU A N   1 
ATOM   112  C CA  . LEU A 1 14 ? 55.898 32.575 11.547 1.00 25.69  ? 13  LEU A CA  1 
ATOM   113  C C   . LEU A 1 14 ? 54.733 31.809 10.926 1.00 26.60  ? 13  LEU A C   1 
ATOM   114  O O   . LEU A 1 14 ? 53.887 32.447 10.324 1.00 23.25  ? 13  LEU A O   1 
ATOM   115  C CB  . LEU A 1 14 ? 57.131 32.546 10.616 1.00 24.52  ? 13  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 14 ? 58.201 33.582 10.955 1.00 27.77  ? 13  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 14 ? 59.532 33.282 10.266 1.00 29.28  ? 13  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 14 ? 57.737 34.995 10.631 1.00 29.10  ? 13  LEU A CD2 1 
ATOM   119  N N   . SER A 1 15 ? 54.639 30.494 11.100 1.00 22.04  ? 14  SER A N   1 
ATOM   120  C CA  . SER A 1 15 ? 53.479 29.788 10.559 1.00 27.30  ? 14  SER A CA  1 
ATOM   121  C C   . SER A 1 15 ? 52.227 30.232 11.378 1.00 18.87  ? 14  SER A C   1 
ATOM   122  O O   . SER A 1 15 ? 51.250 30.384 10.659 1.00 25.43  ? 14  SER A O   1 
ATOM   123  C CB  . SER A 1 15 ? 53.777 28.298 10.634 1.00 34.86  ? 14  SER A CB  1 
ATOM   124  O OG  . SER A 1 15 ? 54.845 28.007 9.690  1.00 34.10  ? 14  SER A OG  1 
ATOM   125  N N   . LYS A 1 16 ? 52.379 30.382 12.687 1.00 23.90  ? 15  LYS A N   1 
ATOM   126  C CA  . LYS A 1 16 ? 51.190 30.853 13.423 1.00 23.86  ? 15  LYS A CA  1 
ATOM   127  C C   . LYS A 1 16 ? 50.733 32.193 12.904 1.00 26.26  ? 15  LYS A C   1 
ATOM   128  O O   . LYS A 1 16 ? 49.506 32.428 12.786 1.00 21.31  ? 15  LYS A O   1 
ATOM   129  C CB  . LYS A 1 16 ? 51.399 30.896 14.922 1.00 20.58  ? 15  LYS A CB  1 
ATOM   130  C CG  . LYS A 1 16 ? 51.406 29.453 15.512 1.00 22.44  ? 15  LYS A CG  1 
ATOM   131  C CD  . LYS A 1 16 ? 51.652 29.647 17.011 1.00 25.48  ? 15  LYS A CD  1 
ATOM   132  C CE  . LYS A 1 16 ? 51.905 28.273 17.674 1.00 34.18  ? 15  LYS A CE  1 
ATOM   133  N NZ  . LYS A 1 16 ? 50.595 27.596 17.696 1.00 41.10  ? 15  LYS A NZ  1 
ATOM   134  N N   . ALA A 1 17 ? 51.666 33.138 12.740 1.00 25.34  ? 16  ALA A N   1 
ATOM   135  C CA  . ALA A 1 17 ? 51.321 34.477 12.252 1.00 25.47  ? 16  ALA A CA  1 
ATOM   136  C C   . ALA A 1 17 ? 50.677 34.464 10.881 1.00 24.28  ? 16  ALA A C   1 
ATOM   137  O O   . ALA A 1 17 ? 49.719 35.222 10.608 1.00 23.71  ? 16  ALA A O   1 
ATOM   138  C CB  . ALA A 1 17 ? 52.593 35.324 12.267 1.00 23.45  ? 16  ALA A CB  1 
ATOM   139  N N   . TYR A 1 18 ? 51.166 33.670 9.950  1.00 21.00  ? 17  TYR A N   1 
ATOM   140  C CA  . TYR A 1 18 ? 50.599 33.521 8.608  1.00 23.03  ? 17  TYR A CA  1 
ATOM   141  C C   . TYR A 1 18 ? 49.177 32.925 8.692  1.00 22.92  ? 17  TYR A C   1 
ATOM   142  O O   . TYR A 1 18 ? 48.275 33.465 7.995  1.00 26.97  ? 17  TYR A O   1 
ATOM   143  C CB  . TYR A 1 18 ? 51.442 32.581 7.735  1.00 26.30  ? 17  TYR A CB  1 
ATOM   144  C CG  A TYR A 1 18 ? 50.777 31.912 6.556  0.50 18.82  ? 17  TYR A CG  1 
ATOM   145  C CG  B TYR A 1 18 ? 52.873 33.000 7.501  0.50 27.46  ? 17  TYR A CG  1 
ATOM   146  C CD1 A TYR A 1 18 ? 50.227 30.650 6.637  0.50 24.02  ? 17  TYR A CD1 1 
ATOM   147  C CD1 B TYR A 1 18 ? 53.771 32.082 6.975  0.50 35.62  ? 17  TYR A CD1 1 
ATOM   148  C CD2 A TYR A 1 18 ? 50.785 32.505 5.308  0.50 27.03  ? 17  TYR A CD2 1 
ATOM   149  C CD2 B TYR A 1 18 ? 53.363 34.254 7.855  0.50 26.72  ? 17  TYR A CD2 1 
ATOM   150  C CE1 A TYR A 1 18 ? 49.614 30.002 5.582  0.50 13.48  ? 17  TYR A CE1 1 
ATOM   151  C CE1 B TYR A 1 18 ? 55.090 32.436 6.763  0.50 34.08  ? 17  TYR A CE1 1 
ATOM   152  C CE2 A TYR A 1 18 ? 50.171 31.907 4.226  0.50 23.89  ? 17  TYR A CE2 1 
ATOM   153  C CE2 B TYR A 1 18 ? 54.681 34.601 7.683  0.50 26.95  ? 17  TYR A CE2 1 
ATOM   154  C CZ  A TYR A 1 18 ? 49.562 30.669 4.379  0.50 19.50  ? 17  TYR A CZ  1 
ATOM   155  C CZ  B TYR A 1 18 ? 55.546 33.676 7.129  0.50 34.87  ? 17  TYR A CZ  1 
ATOM   156  O OH  A TYR A 1 18 ? 49.045 30.106 3.246  0.50 31.10  ? 17  TYR A OH  1 
ATOM   157  O OH  B TYR A 1 18 ? 56.880 33.985 6.955  0.50 35.19  ? 17  TYR A OH  1 
ATOM   158  N N   . HIS A 1 19 ? 48.941 31.939 9.552  1.00 23.56  ? 18  HIS A N   1 
ATOM   159  C CA  . HIS A 1 19 ? 47.565 31.429 9.726  1.00 23.52  ? 18  HIS A CA  1 
ATOM   160  C C   . HIS A 1 19 ? 46.657 32.504 10.345 1.00 27.99  ? 18  HIS A C   1 
ATOM   161  O O   . HIS A 1 19 ? 45.507 32.665 9.880  1.00 26.77  ? 18  HIS A O   1 
ATOM   162  C CB  . HIS A 1 19 ? 47.525 30.129 10.543 1.00 29.65  ? 18  HIS A CB  1 
ATOM   163  C CG  A HIS A 1 19 ? 47.937 28.964 9.654  0.50 25.60  ? 18  HIS A CG  1 
ATOM   164  N ND1 A HIS A 1 19 ? 47.230 28.607 8.532  0.50 27.97  ? 18  HIS A ND1 1 
ATOM   165  C CD2 A HIS A 1 19 ? 48.955 28.083 9.714  0.50 18.04  ? 18  HIS A CD2 1 
ATOM   166  C CE1 A HIS A 1 19 ? 47.792 27.573 7.930  0.50 27.24  ? 18  HIS A CE1 1 
ATOM   167  N NE2 A HIS A 1 19 ? 48.858 27.233 8.638  0.50 22.56  ? 18  HIS A NE2 1 
ATOM   168  N N   . LEU A 1 20 ? 47.148 33.283 11.295 1.00 27.23  ? 19  LEU A N   1 
ATOM   169  C CA  . LEU A 1 20 ? 46.367 34.392 11.843 1.00 26.54  ? 19  LEU A CA  1 
ATOM   170  C C   . LEU A 1 20 ? 46.013 35.373 10.747 1.00 27.85  ? 19  LEU A C   1 
ATOM   171  O O   . LEU A 1 20 ? 44.882 35.907 10.652 1.00 26.97  ? 19  LEU A O   1 
ATOM   172  C CB  . LEU A 1 20 ? 47.087 35.056 13.011 1.00 17.80  ? 19  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 20 ? 47.080 34.325 14.361 1.00 20.46  ? 19  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 20 ? 48.061 34.983 15.361 1.00 20.13  ? 19  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 20 ? 45.637 34.456 14.938 1.00 21.71  ? 19  LEU A CD2 1 
ATOM   176  N N   . GLU A 1 21 ? 46.947 35.733 9.863  1.00 23.73  ? 20  GLU A N   1 
ATOM   177  C CA  . GLU A 1 21 ? 46.730 36.633 8.749  1.00 27.26  ? 20  GLU A CA  1 
ATOM   178  C C   . GLU A 1 21 ? 45.625 36.111 7.836  1.00 29.36  ? 20  GLU A C   1 
ATOM   179  O O   . GLU A 1 21 ? 44.720 36.876 7.445  1.00 29.06  ? 20  GLU A O   1 
ATOM   180  C CB  . GLU A 1 21 ? 48.068 36.903 8.040  1.00 29.21  ? 20  GLU A CB  1 
ATOM   181  C CG  . GLU A 1 21 ? 47.977 37.742 6.763  1.00 35.96  ? 20  GLU A CG  1 
ATOM   182  C CD  . GLU A 1 21 ? 49.377 37.805 6.132  1.00 36.29  ? 20  GLU A CD  1 
ATOM   183  O OE1 . GLU A 1 21 ? 50.068 36.787 6.028  1.00 36.84  ? 20  GLU A OE1 1 
ATOM   184  O OE2 . GLU A 1 21 ? 49.783 38.915 5.794  1.00 35.12  ? 20  GLU A OE2 1 
ATOM   185  N N   . ASN A 1 22 ? 45.612 34.822 7.542  1.00 27.05  ? 21  ASN A N   1 
ATOM   186  C CA  . ASN A 1 22 ? 44.578 34.231 6.695  1.00 26.64  ? 21  ASN A CA  1 
ATOM   187  C C   . ASN A 1 22 ? 43.213 34.266 7.416  1.00 31.24  ? 21  ASN A C   1 
ATOM   188  O O   . ASN A 1 22 ? 42.216 34.602 6.771  1.00 31.21  ? 21  ASN A O   1 
ATOM   189  C CB  . ASN A 1 22 ? 44.912 32.803 6.338  1.00 26.96  ? 21  ASN A CB  1 
ATOM   190  C CG  . ASN A 1 22 ? 46.183 32.669 5.469  1.00 32.95  ? 21  ASN A CG  1 
ATOM   191  O OD1 . ASN A 1 22 ? 46.538 33.639 4.810  1.00 35.33  ? 21  ASN A OD1 1 
ATOM   192  N ND2 . ASN A 1 22 ? 46.781 31.496 5.536  1.00 36.71  ? 21  ASN A ND2 1 
ATOM   193  N N   . GLU A 1 23 ? 43.181 33.971 8.707  1.00 28.28  ? 22  GLU A N   1 
ATOM   194  C CA  . GLU A 1 23 ? 41.931 33.993 9.480  1.00 27.81  ? 22  GLU A CA  1 
ATOM   195  C C   . GLU A 1 23 ? 41.322 35.388 9.564  1.00 28.09  ? 22  GLU A C   1 
ATOM   196  O O   . GLU A 1 23 ? 40.085 35.537 9.457  1.00 27.15  ? 22  GLU A O   1 
ATOM   197  C CB  . GLU A 1 23 ? 42.175 33.529 10.932 1.00 28.45  ? 22  GLU A CB  1 
ATOM   198  C CG  . GLU A 1 23 ? 42.519 32.065 11.067 1.00 30.10  ? 22  GLU A CG  1 
ATOM   199  C CD  . GLU A 1 23 ? 41.315 31.142 11.013 1.00 35.79  ? 22  GLU A CD  1 
ATOM   200  O OE1 . GLU A 1 23 ? 40.450 31.381 10.153 1.00 39.11  ? 22  GLU A OE1 1 
ATOM   201  O OE2 . GLU A 1 23 ? 41.222 30.241 11.857 1.00 44.76  ? 22  GLU A OE2 1 
ATOM   202  N N   . VAL A 1 24 ? 42.199 36.389 9.726  1.00 27.03  ? 23  VAL A N   1 
ATOM   203  C CA  . VAL A 1 24 ? 41.731 37.776 9.765  1.00 28.98  ? 23  VAL A CA  1 
ATOM   204  C C   . VAL A 1 24 ? 41.045 38.133 8.458  1.00 34.60  ? 23  VAL A C   1 
ATOM   205  O O   . VAL A 1 24 ? 39.962 38.730 8.456  1.00 31.52  ? 23  VAL A O   1 
ATOM   206  C CB  . VAL A 1 24 ? 42.847 38.776 10.089 1.00 29.79  ? 23  VAL A CB  1 
ATOM   207  C CG1 . VAL A 1 24 ? 42.437 40.209 9.734  1.00 30.67  ? 23  VAL A CG1 1 
ATOM   208  C CG2 . VAL A 1 24 ? 43.194 38.652 11.584 1.00 31.12  ? 23  VAL A CG2 1 
ATOM   209  N N   . ALA A 1 25 ? 41.679 37.767 7.331  1.00 26.39  ? 24  ALA A N   1 
ATOM   210  C CA  . ALA A 1 25 ? 41.085 38.047 6.024  1.00 37.11  ? 24  ALA A CA  1 
ATOM   211  C C   . ALA A 1 25 ? 39.714 37.384 5.863  1.00 27.39  ? 24  ALA A C   1 
ATOM   212  O O   . ALA A 1 25 ? 38.762 37.996 5.366  1.00 37.01  ? 24  ALA A O   1 
ATOM   213  C CB  . ALA A 1 25 ? 42.030 37.558 4.919  1.00 34.63  ? 24  ALA A CB  1 
ATOM   214  N N   A ARG A 1 26 ? 39.601 36.108 6.229  0.50 28.92  ? 25  ARG A N   1 
ATOM   215  N N   B ARG A 1 26 ? 39.604 36.133 6.274  0.50 30.93  ? 25  ARG A N   1 
ATOM   216  C CA  A ARG A 1 26 ? 38.313 35.434 6.137  0.50 32.18  ? 25  ARG A CA  1 
ATOM   217  C CA  B ARG A 1 26 ? 38.388 35.350 6.206  0.50 33.56  ? 25  ARG A CA  1 
ATOM   218  C C   A ARG A 1 26 ? 37.260 36.167 6.982  0.50 30.08  ? 25  ARG A C   1 
ATOM   219  C C   B ARG A 1 26 ? 37.249 35.859 7.096  0.50 31.47  ? 25  ARG A C   1 
ATOM   220  O O   A ARG A 1 26 ? 36.181 36.528 6.473  0.50 25.09  ? 25  ARG A O   1 
ATOM   221  O O   B ARG A 1 26 ? 36.081 35.473 6.921  0.50 28.67  ? 25  ARG A O   1 
ATOM   222  C CB  A ARG A 1 26 ? 38.434 33.994 6.619  0.50 24.73  ? 25  ARG A CB  1 
ATOM   223  C CB  B ARG A 1 26 ? 38.754 33.934 6.651  0.50 34.67  ? 25  ARG A CB  1 
ATOM   224  C CG  A ARG A 1 26 ? 39.391 33.147 5.785  0.50 35.61  ? 25  ARG A CG  1 
ATOM   225  C CG  B ARG A 1 26 ? 38.282 32.863 5.674  0.50 53.00  ? 25  ARG A CG  1 
ATOM   226  C CD  A ARG A 1 26 ? 39.662 31.806 6.466  0.50 31.75  ? 25  ARG A CD  1 
ATOM   227  C CD  B ARG A 1 26 ? 38.104 31.559 6.455  0.50 44.73  ? 25  ARG A CD  1 
ATOM   228  N NE  A ARG A 1 26 ? 40.751 31.105 5.779  0.50 35.32  ? 25  ARG A NE  1 
ATOM   229  N NE  B ARG A 1 26 ? 37.097 31.817 7.481  0.50 55.95  ? 25  ARG A NE  1 
ATOM   230  C CZ  A ARG A 1 26 ? 41.772 30.524 6.402  0.50 38.31  ? 25  ARG A CZ  1 
ATOM   231  C CZ  B ARG A 1 26 ? 36.996 31.136 8.612  0.50 57.32  ? 25  ARG A CZ  1 
ATOM   232  N NH1 A ARG A 1 26 ? 41.877 30.543 7.722  0.50 24.80  ? 25  ARG A NH1 1 
ATOM   233  N NH1 B ARG A 1 26 ? 37.824 30.147 8.909  0.50 55.86  ? 25  ARG A NH1 1 
ATOM   234  N NH2 A ARG A 1 26 ? 42.704 29.912 5.687  0.50 40.19  ? 25  ARG A NH2 1 
ATOM   235  N NH2 B ARG A 1 26 ? 36.038 31.515 9.426  0.50 40.32  ? 25  ARG A NH2 1 
ATOM   236  N N   . LEU A 1 27 ? 37.601 36.390 8.255  1.00 29.08  ? 26  LEU A N   1 
ATOM   237  C CA  . LEU A 1 27 ? 36.677 37.053 9.165  1.00 29.21  ? 26  LEU A CA  1 
ATOM   238  C C   . LEU A 1 27 ? 36.188 38.386 8.631  1.00 36.53  ? 26  LEU A C   1 
ATOM   239  O O   . LEU A 1 27 ? 34.984 38.692 8.682  1.00 32.11  ? 26  LEU A O   1 
ATOM   240  C CB  . LEU A 1 27 ? 37.309 37.273 10.538 1.00 25.07  ? 26  LEU A CB  1 
ATOM   241  C CG  . LEU A 1 27 ? 37.304 36.048 11.454 1.00 29.53  ? 26  LEU A CG  1 
ATOM   242  C CD1 . LEU A 1 27 ? 38.151 36.351 12.688 1.00 30.68  ? 26  LEU A CD1 1 
ATOM   243  C CD2 . LEU A 1 27 ? 35.877 35.754 11.911 1.00 41.51  ? 26  LEU A CD2 1 
ATOM   244  N N   . LYS A 1 28 ? 37.090 39.213 8.101  1.00 30.85  ? 27  LYS A N   1 
ATOM   245  C CA  . LYS A 1 28 ? 36.700 40.483 7.516  1.00 35.96  ? 27  LYS A CA  1 
ATOM   246  C C   . LYS A 1 28 ? 35.608 40.239 6.456  1.00 38.60  ? 27  LYS A C   1 
ATOM   247  O O   . LYS A 1 28 ? 34.655 41.017 6.404  1.00 38.01  ? 27  LYS A O   1 
ATOM   248  C CB  . LYS A 1 28 ? 37.826 41.236 6.838  1.00 35.09  ? 27  LYS A CB  1 
ATOM   249  C CG  . LYS A 1 28 ? 38.915 41.827 7.688  1.00 56.62  ? 27  LYS A CG  1 
ATOM   250  C CD  . LYS A 1 28 ? 39.954 42.548 6.840  1.00 58.62  ? 27  LYS A CD  1 
ATOM   251  C CE  . LYS A 1 28 ? 39.322 43.674 6.037  1.00 58.78  ? 27  LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 28 ? 38.420 44.473 6.914  1.00 69.46  ? 27  LYS A NZ  1 
ATOM   253  N N   . LYS A 1 29 ? 35.741 39.210 5.643  1.00 36.38  ? 28  LYS A N   1 
ATOM   254  C CA  . LYS A 1 29 ? 34.775 38.838 4.638  1.00 47.41  ? 28  LYS A CA  1 
ATOM   255  C C   . LYS A 1 29 ? 33.480 38.367 5.301  1.00 43.62  ? 28  LYS A C   1 
ATOM   256  O O   . LYS A 1 29 ? 32.405 38.712 4.828  1.00 50.55  ? 28  LYS A O   1 
ATOM   257  C CB  . LYS A 1 29 ? 35.312 37.723 3.732  1.00 47.92  ? 28  LYS A CB  1 
ATOM   258  C CG  . LYS A 1 29 ? 34.775 37.769 2.315  1.00 60.73  ? 28  LYS A CG  1 
ATOM   259  N N   . LEU A 1 30 ? 33.553 37.583 6.362  1.00 41.89  ? 29  LEU A N   1 
ATOM   260  C CA  . LEU A 1 30 ? 32.357 37.143 7.077  1.00 37.34  ? 29  LEU A CA  1 
ATOM   261  C C   . LEU A 1 30 ? 31.609 38.332 7.698  1.00 34.27  ? 29  LEU A C   1 
ATOM   262  O O   . LEU A 1 30 ? 30.375 38.264 7.709  1.00 36.24  ? 29  LEU A O   1 
ATOM   263  C CB  . LEU A 1 30 ? 32.642 36.124 8.159  1.00 35.85  ? 29  LEU A CB  1 
ATOM   264  C CG  . LEU A 1 30 ? 33.128 34.749 7.719  1.00 42.19  ? 29  LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 30 ? 33.537 33.881 8.896  1.00 38.02  ? 29  LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 30 ? 32.068 34.001 6.917  1.00 53.75  ? 29  LEU A CD2 1 
ATOM   267  N N   . VAL A 1 31 ? 32.305 39.384 8.131  1.00 29.95  ? 30  VAL A N   1 
ATOM   268  C CA  . VAL A 1 31 ? 31.659 40.523 8.773  1.00 41.58  ? 30  VAL A CA  1 
ATOM   269  C C   . VAL A 1 31 ? 30.870 41.278 7.717  1.00 54.66  ? 30  VAL A C   1 
ATOM   270  O O   . VAL A 1 31 ? 29.720 41.643 7.984  1.00 44.36  ? 30  VAL A O   1 
ATOM   271  C CB  . VAL A 1 31 ? 32.623 41.406 9.572  1.00 36.01  ? 30  VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 31 ? 32.036 42.731 10.028 1.00 33.88  ? 30  VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 31 ? 33.199 40.636 10.773 1.00 37.22  ? 30  VAL A CG2 1 
ATOM   274  N N   . GLY A 1 32 ? 31.439 41.498 6.539  1.00 49.82  ? 31  GLY A N   1 
ATOM   275  C CA  . GLY A 1 32 ? 30.713 42.182 5.482  1.00 43.99  ? 31  GLY A CA  1 
ATOM   276  C C   . GLY A 1 32 ? 30.513 43.668 5.663  1.00 50.91  ? 31  GLY A C   1 
ATOM   277  O O   . GLY A 1 32 ? 29.487 44.273 5.306  1.00 46.78  ? 31  GLY A O   1 
ATOM   278  N N   . GLU A 1 33 ? 31.515 44.322 6.225  1.00 45.40  ? 32  GLU A N   1 
ATOM   279  C CA  . GLU A 1 33 ? 31.469 45.781 6.359  1.00 53.15  ? 32  GLU A CA  1 
ATOM   280  C C   . GLU A 1 33 ? 31.700 46.365 4.960  1.00 59.66  ? 32  GLU A C   1 
ATOM   281  O O   . GLU A 1 33 ? 32.138 45.622 4.069  1.00 57.74  ? 32  GLU A O   1 
ATOM   282  C CB  . GLU A 1 33 ? 32.560 46.273 7.295  1.00 49.05  ? 32  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 33 ? 32.192 46.275 8.756  1.00 41.13  ? 32  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 33 ? 32.834 47.394 9.542  1.00 48.73  ? 32  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 33 ? 33.870 47.139 10.183 1.00 52.80  ? 32  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 33 ? 32.255 48.498 9.530  1.00 56.79  ? 32  GLU A OE2 1 
ATOM   287  N N   . ARG A 1 34 ? 31.524 47.671 4.839  1.00 65.90  ? 33  ARG A N   1 
ATOM   288  C CA  . ARG A 1 34 ? 31.782 48.360 3.571  1.00 68.99  ? 33  ARG A CA  1 
ATOM   289  C C   . ARG A 1 34 ? 32.683 49.578 3.844  1.00 64.02  ? 33  ARG A C   1 
ATOM   290  N NE  . ARG A 1 34 ? 74.314 26.703 25.697 1.00 78.21  ? 33  ARG A NE  1 
ATOM   291  C CZ  . ARG A 1 34 ? 74.510 27.252 24.499 1.00 81.90  ? 33  ARG A CZ  1 
ATOM   292  N NH1 . ARG A 1 34 ? 74.365 26.513 23.403 1.00 80.42  ? 33  ARG A NH1 1 
ATOM   293  N NH2 . ARG A 1 34 ? 74.846 28.535 24.410 1.00 69.05  ? 33  ARG A NH2 1 
HETATM 294  C C   . ACE B 1 1  ? 72.011 38.535 24.854 1.00 47.59  ? 0   ACE B C   1 
HETATM 295  O O   . ACE B 1 1  ? 70.992 38.046 25.371 1.00 43.79  ? 0   ACE B O   1 
HETATM 296  C CH3 . ACE B 1 1  ? 72.955 39.439 25.551 1.00 42.44  ? 0   ACE B CH3 1 
ATOM   297  N N   . ARG B 1 2  ? 72.631 38.449 23.665 1.00 39.99  ? 1   ARG B N   1 
ATOM   298  C CA  . ARG B 1 2  ? 71.895 38.777 22.477 1.00 40.91  ? 1   ARG B CA  1 
ATOM   299  C C   . ARG B 1 2  ? 70.987 37.517 22.401 1.00 31.45  ? 1   ARG B C   1 
ATOM   300  O O   . ARG B 1 2  ? 69.777 37.556 22.118 1.00 35.24  ? 1   ARG B O   1 
ATOM   301  C CB  . ARG B 1 2  ? 72.634 38.930 21.153 1.00 36.98  ? 1   ARG B CB  1 
ATOM   302  C CG  . ARG B 1 2  ? 71.731 38.931 19.891 1.00 26.02  ? 1   ARG B CG  1 
ATOM   303  C CD  . ARG B 1 2  ? 70.834 40.132 19.950 1.00 26.22  ? 1   ARG B CD  1 
ATOM   304  N NE  . ARG B 1 2  ? 70.382 40.647 18.695 1.00 29.61  ? 1   ARG B NE  1 
ATOM   305  C CZ  . ARG B 1 2  ? 69.712 41.762 18.476 1.00 41.35  ? 1   ARG B CZ  1 
ATOM   306  N NH1 . ARG B 1 2  ? 69.344 42.583 19.458 1.00 42.46  ? 1   ARG B NH1 1 
ATOM   307  N NH2 . ARG B 1 2  ? 69.429 42.079 17.215 1.00 35.11  ? 1   ARG B NH2 1 
ATOM   308  N N   . MET B 1 3  ? 71.588 36.352 22.715 1.00 30.89  ? 2   MET B N   1 
ATOM   309  C CA  . MET B 1 3  ? 70.848 35.091 22.596 1.00 27.23  ? 2   MET B CA  1 
ATOM   310  C C   . MET B 1 3  ? 69.618 35.028 23.503 1.00 51.48  ? 2   MET B C   1 
ATOM   311  O O   . MET B 1 3  ? 68.546 34.541 23.080 1.00 36.13  ? 2   MET B O   1 
ATOM   312  C CB  . MET B 1 3  ? 71.692 33.849 22.780 1.00 32.64  ? 2   MET B CB  1 
ATOM   313  C CG  A MET B 1 3  ? 70.929 32.530 22.755 0.50 30.51  ? 2   MET B CG  1 
ATOM   314  C CG  B MET B 1 3  ? 71.250 32.596 22.058 0.50 46.80  ? 2   MET B CG  1 
ATOM   315  S SD  A MET B 1 3  ? 70.615 31.756 21.158 0.50 35.97  ? 2   MET B SD  1 
ATOM   316  S SD  B MET B 1 3  ? 72.469 31.274 21.968 0.50 44.60  ? 2   MET B SD  1 
ATOM   317  C CE  A MET B 1 3  ? 72.306 31.453 20.609 0.50 29.72  ? 2   MET B CE  1 
ATOM   318  C CE  B MET B 1 3  ? 74.021 32.152 21.966 0.50 29.54  ? 2   MET B CE  1 
ATOM   319  N N   . LYS B 1 4  ? 69.768 35.505 24.739 1.00 39.41  ? 3   LYS B N   1 
ATOM   320  C CA  . LYS B 1 4  ? 68.617 35.446 25.654 1.00 35.28  ? 3   LYS B CA  1 
ATOM   321  C C   . LYS B 1 4  ? 67.693 36.584 25.312 1.00 27.65  ? 3   LYS B C   1 
ATOM   322  O O   . LYS B 1 4  ? 66.467 36.403 25.420 1.00 37.14  ? 3   LYS B O   1 
ATOM   323  C CB  . LYS B 1 4  ? 69.074 35.430 27.112 1.00 40.40  ? 3   LYS B CB  1 
ATOM   324  C CG  A LYS B 1 4  ? 67.962 35.351 28.151 0.50 30.96  ? 3   LYS B CG  1 
ATOM   325  C CG  B LYS B 1 4  ? 69.927 36.573 27.543 0.50 39.39  ? 3   LYS B CG  1 
ATOM   326  C CD  A LYS B 1 4  ? 67.814 33.946 28.689 0.50 39.35  ? 3   LYS B CD  1 
ATOM   327  C CD  B LYS B 1 4  ? 69.279 37.923 27.700 0.50 48.04  ? 3   LYS B CD  1 
ATOM   328  C CE  A LYS B 1 4  ? 67.124 32.944 27.787 0.50 36.33  ? 3   LYS B CE  1 
ATOM   329  C CE  B LYS B 1 4  ? 70.359 38.958 27.980 0.50 35.58  ? 3   LYS B CE  1 
ATOM   330  N NZ  A LYS B 1 4  ? 67.562 31.546 28.135 0.50 36.62  ? 3   LYS B NZ  1 
ATOM   331  N NZ  B LYS B 1 4  ? 70.034 40.246 27.329 0.50 29.67  ? 3   LYS B NZ  1 
ATOM   332  N N   . GLN B 1 5  ? 68.195 37.711 24.799 1.00 29.06  ? 4   GLN B N   1 
ATOM   333  C CA  . GLN B 1 5  ? 67.256 38.740 24.359 1.00 36.09  ? 4   GLN B CA  1 
ATOM   334  C C   . GLN B 1 5  ? 66.302 38.185 23.277 1.00 37.06  ? 4   GLN B C   1 
ATOM   335  O O   . GLN B 1 5  ? 65.091 38.468 23.285 1.00 34.00  ? 4   GLN B O   1 
ATOM   336  C CB  . GLN B 1 5  ? 68.012 39.931 23.794 1.00 34.69  ? 4   GLN B CB  1 
ATOM   337  C CG  . GLN B 1 5  ? 67.193 41.128 23.392 1.00 40.28  ? 4   GLN B CG  1 
ATOM   338  C CD  . GLN B 1 5  ? 67.967 42.188 22.641 1.00 48.98  ? 4   GLN B CD  1 
ATOM   339  O OE1 . GLN B 1 5  ? 69.125 42.004 22.291 1.00 39.71  ? 4   GLN B OE1 1 
ATOM   340  N NE2 . GLN B 1 5  ? 67.355 43.342 22.375 1.00 48.35  ? 4   GLN B NE2 1 
ATOM   341  N N   . LEU B 1 6  ? 66.788 37.363 22.360 1.00 32.19  ? 5   LEU B N   1 
ATOM   342  C CA  . LEU B 1 6  ? 65.965 36.855 21.245 1.00 34.69  ? 5   LEU B CA  1 
ATOM   343  C C   . LEU B 1 6  ? 65.150 35.652 21.654 1.00 39.36  ? 5   LEU B C   1 
ATOM   344  O O   . LEU B 1 6  ? 64.032 35.451 21.169 1.00 28.57  ? 5   LEU B O   1 
ATOM   345  C CB  . LEU B 1 6  ? 66.851 36.557 20.025 1.00 26.48  ? 5   LEU B CB  1 
ATOM   346  C CG  . LEU B 1 6  ? 67.716 37.699 19.496 1.00 25.90  ? 5   LEU B CG  1 
ATOM   347  C CD1 . LEU B 1 6  ? 68.293 37.241 18.136 1.00 30.11  ? 5   LEU B CD1 1 
ATOM   348  C CD2 . LEU B 1 6  ? 67.012 39.031 19.321 1.00 26.96  ? 5   LEU B CD2 1 
ATOM   349  N N   . GLU B 1 7  ? 65.628 34.822 22.583 1.00 31.80  ? 6   GLU B N   1 
ATOM   350  C CA  . GLU B 1 7  ? 64.834 33.756 23.153 1.00 33.42  ? 6   GLU B CA  1 
ATOM   351  C C   . GLU B 1 7  ? 63.617 34.328 23.905 1.00 32.87  ? 6   GLU B C   1 
ATOM   352  O O   . GLU B 1 7  ? 62.498 33.790 23.805 1.00 39.26  ? 6   GLU B O   1 
ATOM   353  C CB  . GLU B 1 7  ? 65.640 32.906 24.146 1.00 36.25  ? 6   GLU B CB  1 
ATOM   354  C CG  . GLU B 1 7  ? 66.695 32.060 23.480 1.00 40.84  ? 6   GLU B CG  1 
ATOM   355  C CD  . GLU B 1 7  ? 67.668 31.438 24.483 1.00 43.45  ? 6   GLU B CD  1 
ATOM   356  O OE1 . GLU B 1 7  ? 67.965 32.145 25.459 1.00 39.19  ? 6   GLU B OE1 1 
ATOM   357  O OE2 . GLU B 1 7  ? 68.057 30.287 24.253 1.00 43.42  ? 6   GLU B OE2 1 
ATOM   358  N N   . ASP B 1 8  ? 63.827 35.404 24.651 1.00 33.00  ? 7   ASP B N   1 
ATOM   359  C CA  . ASP B 1 8  ? 62.752 36.031 25.389 1.00 37.42  ? 7   ASP B CA  1 
ATOM   360  C C   . ASP B 1 8  ? 61.775 36.626 24.369 1.00 40.70  ? 7   ASP B C   1 
ATOM   361  O O   . ASP B 1 8  ? 60.572 36.530 24.548 1.00 33.58  ? 7   ASP B O   1 
ATOM   362  C CB  . ASP B 1 8  ? 63.212 37.123 26.340 1.00 35.37  ? 7   ASP B CB  1 
ATOM   363  C CG  . ASP B 1 8  ? 63.919 36.559 27.587 1.00 35.11  ? 7   ASP B CG  1 
ATOM   364  O OD1 . ASP B 1 8  ? 63.898 35.346 27.842 1.00 36.12  ? 7   ASP B OD1 1 
ATOM   365  O OD2 . ASP B 1 8  ? 64.628 37.382 28.179 1.00 38.15  ? 7   ASP B OD2 1 
ATOM   366  N N   . LYS B 1 9  ? 62.278 37.251 23.314 1.00 32.02  ? 8   LYS B N   1 
ATOM   367  C CA  . LYS B 1 9  ? 61.442 37.870 22.308 1.00 31.14  ? 8   LYS B CA  1 
ATOM   368  C C   . LYS B 1 9  ? 60.571 36.837 21.604 1.00 25.56  ? 8   LYS B C   1 
ATOM   369  O O   . LYS B 1 9  ? 59.393 37.206 21.386 1.00 33.07  ? 8   LYS B O   1 
ATOM   370  C CB  . LYS B 1 9  ? 62.214 38.693 21.276 1.00 34.06  ? 8   LYS B CB  1 
ATOM   371  C CG  . LYS B 1 9  ? 61.346 39.205 20.135 1.00 35.83  ? 8   LYS B CG  1 
ATOM   372  C CD  . LYS B 1 9  ? 60.437 40.363 20.532 1.00 40.06  ? 8   LYS B CD  1 
ATOM   373  C CE  A LYS B 1 9  ? 61.204 41.501 21.179 0.50 36.98  ? 8   LYS B CE  1 
ATOM   374  N NZ  A LYS B 1 9  ? 60.328 42.578 21.711 0.50 44.30  ? 8   LYS B NZ  1 
ATOM   375  N N   . VAL B 1 10 ? 61.107 35.669 21.277 1.00 26.41  ? 9   VAL B N   1 
ATOM   376  C CA  . VAL B 1 10 ? 60.257 34.698 20.574 1.00 32.26  ? 9   VAL B CA  1 
ATOM   377  C C   . VAL B 1 10 ? 59.182 34.177 21.533 1.00 37.59  ? 9   VAL B C   1 
ATOM   378  O O   . VAL B 1 10 ? 58.068 33.925 21.092 1.00 25.76  ? 9   VAL B O   1 
ATOM   379  C CB  . VAL B 1 10 ? 61.028 33.587 19.902 1.00 29.22  ? 9   VAL B CB  1 
ATOM   380  C CG1 . VAL B 1 10 ? 61.479 32.485 20.885 1.00 29.59  ? 9   VAL B CG1 1 
ATOM   381  C CG2 . VAL B 1 10 ? 60.186 32.930 18.791 1.00 26.35  ? 9   VAL B CG2 1 
ATOM   382  N N   . GLU B 1 11 ? 59.468 33.981 22.812 1.00 30.70  ? 10  GLU B N   1 
ATOM   383  C CA  . GLU B 1 11 ? 58.416 33.569 23.766 1.00 32.02  ? 10  GLU B CA  1 
ATOM   384  C C   . GLU B 1 11 ? 57.351 34.639 23.923 1.00 24.19  ? 10  GLU B C   1 
ATOM   385  O O   . GLU B 1 11 ? 56.149 34.374 23.975 1.00 27.97  ? 10  GLU B O   1 
ATOM   386  C CB  . GLU B 1 11 ? 59.052 33.302 25.139 1.00 39.03  ? 10  GLU B CB  1 
ATOM   387  C CG  . GLU B 1 11 ? 59.979 32.096 25.151 1.00 37.61  ? 10  GLU B CG  1 
ATOM   388  C CD  . GLU B 1 11 ? 59.315 30.841 24.638 1.00 52.16  ? 10  GLU B CD  1 
ATOM   389  O OE1 . GLU B 1 11 ? 58.096 30.735 24.899 1.00 54.87  ? 10  GLU B OE1 1 
ATOM   390  O OE2 . GLU B 1 11 ? 59.945 30.014 23.954 1.00 46.95  ? 10  GLU B OE2 1 
ATOM   391  N N   . GLU B 1 12 ? 57.700 35.902 23.984 1.00 27.06  ? 11  GLU B N   1 
ATOM   392  C CA  . GLU B 1 12 ? 56.759 37.008 24.060 1.00 31.44  ? 11  GLU B CA  1 
ATOM   393  C C   . GLU B 1 12 ? 55.855 37.035 22.825 1.00 37.28  ? 11  GLU B C   1 
ATOM   394  O O   . GLU B 1 12 ? 54.643 37.278 22.940 1.00 28.51  ? 11  GLU B O   1 
ATOM   395  C CB  . GLU B 1 12 ? 57.529 38.310 24.156 1.00 28.92  ? 11  GLU B CB  1 
ATOM   396  C CG  . GLU B 1 12 ? 56.694 39.563 24.142 1.00 35.34  ? 11  GLU B CG  1 
ATOM   397  C CD  A GLU B 1 12 ? 57.508 40.825 23.931 0.50 45.58  ? 11  GLU B CD  1 
ATOM   398  O OE1 A GLU B 1 12 ? 58.752 40.804 23.807 0.50 41.24  ? 11  GLU B OE1 1 
ATOM   399  O OE2 A GLU B 1 12 ? 56.866 41.896 23.888 0.50 54.33  ? 11  GLU B OE2 1 
ATOM   400  N N   . LEU B 1 13 ? 56.407 36.835 21.625 1.00 28.92  ? 12  LEU B N   1 
ATOM   401  C CA  . LEU B 1 13 ? 55.589 36.846 20.424 1.00 26.68  ? 12  LEU B CA  1 
ATOM   402  C C   . LEU B 1 13 ? 54.718 35.606 20.338 1.00 22.26  ? 12  LEU B C   1 
ATOM   403  O O   . LEU B 1 13 ? 53.589 35.717 19.853 1.00 23.56  ? 12  LEU B O   1 
ATOM   404  C CB  . LEU B 1 13 ? 56.394 37.031 19.126 1.00 27.71  ? 12  LEU B CB  1 
ATOM   405  C CG  . LEU B 1 13 ? 57.200 38.348 19.112 1.00 24.73  ? 12  LEU B CG  1 
ATOM   406  C CD1 . LEU B 1 13 ? 57.992 38.526 17.811 1.00 26.42  ? 12  LEU B CD1 1 
ATOM   407  C CD2 . LEU B 1 13 ? 56.246 39.540 19.222 1.00 27.63  ? 12  LEU B CD2 1 
ATOM   408  N N   . LEU B 1 14 ? 55.191 34.435 20.714 1.00 24.03  ? 13  LEU B N   1 
ATOM   409  C CA  . LEU B 1 14 ? 54.359 33.252 20.703 1.00 22.48  ? 13  LEU B CA  1 
ATOM   410  C C   . LEU B 1 14 ? 53.177 33.422 21.677 1.00 25.08  ? 13  LEU B C   1 
ATOM   411  O O   . LEU B 1 14 ? 52.089 32.899 21.375 1.00 29.04  ? 13  LEU B O   1 
ATOM   412  C CB  . LEU B 1 14 ? 55.178 32.023 21.037 1.00 23.05  ? 13  LEU B CB  1 
ATOM   413  C CG  . LEU B 1 14 ? 56.008 31.440 19.873 1.00 32.33  ? 13  LEU B CG  1 
ATOM   414  C CD1 . LEU B 1 14 ? 57.061 30.468 20.421 1.00 26.62  ? 13  LEU B CD1 1 
ATOM   415  C CD2 . LEU B 1 14 ? 55.128 30.717 18.882 1.00 31.58  ? 13  LEU B CD2 1 
ATOM   416  N N   . SER B 1 15 ? 53.377 34.112 22.801 1.00 30.16  ? 14  SER B N   1 
ATOM   417  C CA  . SER B 1 15 ? 52.292 34.316 23.759 1.00 32.64  ? 14  SER B CA  1 
ATOM   418  C C   . SER B 1 15 ? 51.245 35.230 23.144 1.00 29.08  ? 14  SER B C   1 
ATOM   419  O O   . SER B 1 15 ? 50.039 35.017 23.213 1.00 28.80  ? 14  SER B O   1 
ATOM   420  C CB  . SER B 1 15 ? 52.832 34.910 25.071 1.00 33.17  ? 14  SER B CB  1 
ATOM   421  O OG  A SER B 1 15 ? 51.826 35.428 25.893 0.50 31.76  ? 14  SER B OG  1 
ATOM   422  O OG  B SER B 1 15 ? 53.595 33.912 25.754 0.50 27.76  ? 14  SER B OG  1 
ATOM   423  N N   . LYS B 1 16 ? 51.688 36.255 22.436 1.00 24.98  ? 15  LYS B N   1 
ATOM   424  C CA  . LYS B 1 16 ? 50.820 37.174 21.711 1.00 25.55  ? 15  LYS B CA  1 
ATOM   425  C C   . LYS B 1 16 ? 50.023 36.396 20.678 1.00 23.91  ? 15  LYS B C   1 
ATOM   426  O O   . LYS B 1 16 ? 48.789 36.615 20.541 1.00 23.54  ? 15  LYS B O   1 
ATOM   427  C CB  . LYS B 1 16 ? 51.576 38.327 21.058 1.00 25.37  ? 15  LYS B CB  1 
ATOM   428  C CG  . LYS B 1 16 ? 51.785 39.558 21.927 1.00 35.33  ? 15  LYS B CG  1 
ATOM   429  C CD  . LYS B 1 16 ? 52.592 40.598 21.126 1.00 45.59  ? 15  LYS B CD  1 
ATOM   430  C CE  . LYS B 1 16 ? 52.690 41.928 21.854 1.00 45.97  ? 15  LYS B CE  1 
ATOM   431  N NZ  . LYS B 1 16 ? 53.284 41.748 23.203 1.00 62.78  ? 15  LYS B NZ  1 
ATOM   432  N N   . ALA B 1 17 ? 50.693 35.502 19.932 1.00 22.13  ? 16  ALA B N   1 
ATOM   433  C CA  . ALA B 1 17 ? 49.987 34.730 18.908 1.00 25.57  ? 16  ALA B CA  1 
ATOM   434  C C   . ALA B 1 17 ? 48.889 33.847 19.565 1.00 22.60  ? 16  ALA B C   1 
ATOM   435  O O   . ALA B 1 17 ? 47.833 33.689 18.949 1.00 21.95  ? 16  ALA B O   1 
ATOM   436  C CB  . ALA B 1 17 ? 50.998 33.818 18.207 1.00 21.25  ? 16  ALA B CB  1 
ATOM   437  N N   . TYR B 1 18 ? 49.215 33.198 20.685 1.00 24.53  ? 17  TYR B N   1 
ATOM   438  C CA  . TYR B 1 18 ? 48.194 32.428 21.405 1.00 26.59  ? 17  TYR B CA  1 
ATOM   439  C C   . TYR B 1 18 ? 46.982 33.288 21.769 1.00 21.17  ? 17  TYR B C   1 
ATOM   440  O O   . TYR B 1 18 ? 45.830 32.863 21.511 1.00 26.33  ? 17  TYR B O   1 
ATOM   441  C CB  . TYR B 1 18 ? 48.844 31.856 22.684 1.00 26.86  ? 17  TYR B CB  1 
ATOM   442  C CG  . TYR B 1 18 ? 47.769 31.330 23.642 1.00 34.78  ? 17  TYR B CG  1 
ATOM   443  C CD1 . TYR B 1 18 ? 47.181 30.110 23.387 1.00 36.08  ? 17  TYR B CD1 1 
ATOM   444  C CD2 . TYR B 1 18 ? 47.381 32.065 24.752 1.00 33.96  ? 17  TYR B CD2 1 
ATOM   445  C CE1 . TYR B 1 18 ? 46.209 29.623 24.239 1.00 41.16  ? 17  TYR B CE1 1 
ATOM   446  C CE2 . TYR B 1 18 ? 46.413 31.569 25.621 1.00 41.43  ? 17  TYR B CE2 1 
ATOM   447  C CZ  . TYR B 1 18 ? 45.837 30.345 25.338 1.00 40.34  ? 17  TYR B CZ  1 
ATOM   448  O OH  . TYR B 1 18 ? 44.862 29.833 26.165 1.00 51.74  ? 17  TYR B OH  1 
ATOM   449  N N   . HIS B 1 19 ? 47.182 34.470 22.342 1.00 25.50  ? 18  HIS B N   1 
ATOM   450  C CA  . HIS B 1 19 ? 45.998 35.292 22.702 1.00 28.50  ? 18  HIS B CA  1 
ATOM   451  C C   . HIS B 1 19 ? 45.235 35.754 21.484 1.00 30.71  ? 18  HIS B C   1 
ATOM   452  O O   . HIS B 1 19 ? 44.002 35.880 21.535 1.00 24.32  ? 18  HIS B O   1 
ATOM   453  C CB  . HIS B 1 19 ? 46.321 36.452 23.653 1.00 28.85  ? 18  HIS B CB  1 
ATOM   454  C CG  . HIS B 1 19 ? 46.755 35.889 24.980 1.00 37.14  ? 18  HIS B CG  1 
ATOM   455  N ND1 . HIS B 1 19 ? 45.858 35.349 25.875 1.00 35.11  ? 18  HIS B ND1 1 
ATOM   456  C CD2 . HIS B 1 19 ? 47.995 35.760 25.527 1.00 36.72  ? 18  HIS B CD2 1 
ATOM   457  C CE1 . HIS B 1 19 ? 46.512 34.901 26.928 1.00 41.74  ? 18  HIS B CE1 1 
ATOM   458  N NE2 . HIS B 1 19 ? 47.815 35.147 26.749 1.00 44.10  ? 18  HIS B NE2 1 
ATOM   459  N N   . LEU B 1 20 ? 45.879 35.984 20.344 1.00 21.52  ? 19  LEU B N   1 
ATOM   460  C CA  . LEU B 1 20 ? 45.229 36.346 19.103 1.00 21.67  ? 19  LEU B CA  1 
ATOM   461  C C   . LEU B 1 20 ? 44.441 35.202 18.541 1.00 21.43  ? 19  LEU B C   1 
ATOM   462  O O   . LEU B 1 20 ? 43.363 35.433 17.981 1.00 21.44  ? 19  LEU B O   1 
ATOM   463  C CB  . LEU B 1 20 ? 46.225 36.903 18.033 1.00 23.21  ? 19  LEU B CB  1 
ATOM   464  C CG  . LEU B 1 20 ? 46.850 38.223 18.510 1.00 25.79  ? 19  LEU B CG  1 
ATOM   465  C CD1 . LEU B 1 20 ? 47.878 38.727 17.477 1.00 31.37  ? 19  LEU B CD1 1 
ATOM   466  C CD2 . LEU B 1 20 ? 45.837 39.346 18.732 1.00 24.73  ? 19  LEU B CD2 1 
ATOM   467  N N   . GLU B 1 21 ? 44.913 33.959 18.631 1.00 19.77  ? 20  GLU B N   1 
ATOM   468  C CA  . GLU B 1 21 ? 44.127 32.797 18.234 1.00 26.67  ? 20  GLU B CA  1 
ATOM   469  C C   . GLU B 1 21 ? 42.824 32.708 19.069 1.00 22.04  ? 20  GLU B C   1 
ATOM   470  O O   . GLU B 1 21 ? 41.810 32.325 18.434 1.00 23.64  ? 20  GLU B O   1 
ATOM   471  C CB  . GLU B 1 21 ? 44.946 31.513 18.492 1.00 22.55  ? 20  GLU B CB  1 
ATOM   472  C CG  . GLU B 1 21 ? 46.027 31.397 17.382 1.00 30.65  ? 20  GLU B CG  1 
ATOM   473  C CD  . GLU B 1 21 ? 47.139 30.429 17.703 1.00 33.81  ? 20  GLU B CD  1 
ATOM   474  O OE1 . GLU B 1 21 ? 47.208 29.833 18.792 1.00 28.09  ? 20  GLU B OE1 1 
ATOM   475  O OE2 . GLU B 1 21 ? 48.039 30.206 16.862 1.00 31.75  ? 20  GLU B OE2 1 
ATOM   476  N N   . ASN B 1 22 ? 42.963 32.955 20.373 1.00 21.91  ? 21  ASN B N   1 
ATOM   477  C CA  . ASN B 1 22 ? 41.756 32.997 21.220 1.00 25.22  ? 21  ASN B CA  1 
ATOM   478  C C   . ASN B 1 22 ? 40.767 34.024 20.685 1.00 25.41  ? 21  ASN B C   1 
ATOM   479  O O   . ASN B 1 22 ? 39.586 33.705 20.568 1.00 26.66  ? 21  ASN B O   1 
ATOM   480  C CB  . ASN B 1 22 ? 41.994 33.336 22.686 1.00 24.36  ? 21  ASN B CB  1 
ATOM   481  C CG  . ASN B 1 22 ? 42.499 32.141 23.483 1.00 34.84  ? 21  ASN B CG  1 
ATOM   482  O OD1 . ASN B 1 22 ? 42.495 31.039 22.956 1.00 35.95  ? 21  ASN B OD1 1 
ATOM   483  N ND2 . ASN B 1 22 ? 42.958 32.383 24.703 1.00 39.20  ? 21  ASN B ND2 1 
ATOM   484  N N   . GLU B 1 23 ? 41.247 35.229 20.364 1.00 22.46  ? 22  GLU B N   1 
ATOM   485  C CA  . GLU B 1 23 ? 40.369 36.268 19.813 1.00 21.98  ? 22  GLU B CA  1 
ATOM   486  C C   . GLU B 1 23 ? 39.768 35.839 18.493 1.00 25.89  ? 22  GLU B C   1 
ATOM   487  O O   . GLU B 1 23 ? 38.567 36.074 18.296 1.00 23.75  ? 22  GLU B O   1 
ATOM   488  C CB  . GLU B 1 23 ? 41.089 37.616 19.788 1.00 20.26  ? 22  GLU B CB  1 
ATOM   489  C CG  . GLU B 1 23 ? 40.239 38.741 19.150 1.00 26.05  ? 22  GLU B CG  1 
ATOM   490  C CD  . GLU B 1 23 ? 39.194 39.303 20.093 1.00 28.98  ? 22  GLU B CD  1 
ATOM   491  O OE1 . GLU B 1 23 ? 38.927 38.658 21.106 1.00 27.50  ? 22  GLU B OE1 1 
ATOM   492  O OE2 . GLU B 1 23 ? 38.599 40.388 19.885 1.00 25.73  ? 22  GLU B OE2 1 
ATOM   493  N N   . VAL B 1 24 ? 40.475 35.234 17.539 1.00 22.47  ? 23  VAL B N   1 
ATOM   494  C CA  . VAL B 1 24 ? 39.923 34.730 16.308 1.00 23.50  ? 23  VAL B CA  1 
ATOM   495  C C   . VAL B 1 24 ? 38.792 33.733 16.665 1.00 23.59  ? 23  VAL B C   1 
ATOM   496  O O   . VAL B 1 24 ? 37.730 33.824 16.018 1.00 24.61  ? 23  VAL B O   1 
ATOM   497  C CB  . VAL B 1 24 ? 40.982 33.969 15.471 1.00 23.18  ? 23  VAL B CB  1 
ATOM   498  C CG1 . VAL B 1 24 ? 40.377 33.031 14.421 1.00 22.76  ? 23  VAL B CG1 1 
ATOM   499  C CG2 . VAL B 1 24 ? 41.923 34.948 14.756 1.00 23.74  ? 23  VAL B CG2 1 
ATOM   500  N N   . ALA B 1 25 ? 38.986 32.809 17.599 1.00 24.42  ? 24  ALA B N   1 
ATOM   501  C CA  . ALA B 1 25 ? 37.875 31.888 17.908 1.00 28.15  ? 24  ALA B CA  1 
ATOM   502  C C   . ALA B 1 25 ? 36.644 32.657 18.442 1.00 23.84  ? 24  ALA B C   1 
ATOM   503  O O   . ALA B 1 25 ? 35.498 32.359 18.042 1.00 25.45  ? 24  ALA B O   1 
ATOM   504  C CB  . ALA B 1 25 ? 38.319 30.816 18.879 1.00 25.72  ? 24  ALA B CB  1 
ATOM   505  N N   . ARG B 1 26 ? 36.876 33.640 19.301 1.00 23.10  ? 25  ARG B N   1 
ATOM   506  C CA  . ARG B 1 26 ? 35.743 34.464 19.797 1.00 25.62  ? 25  ARG B CA  1 
ATOM   507  C C   . ARG B 1 26 ? 35.053 35.217 18.692 1.00 29.41  ? 25  ARG B C   1 
ATOM   508  O O   . ARG B 1 26 ? 33.807 35.318 18.567 1.00 27.21  ? 25  ARG B O   1 
ATOM   509  C CB  . ARG B 1 26 ? 36.228 35.482 20.817 1.00 25.32  ? 25  ARG B CB  1 
ATOM   510  C CG  . ARG B 1 26 ? 36.550 34.998 22.203 1.00 27.90  ? 25  ARG B CG  1 
ATOM   511  C CD  . ARG B 1 26 ? 35.261 34.464 22.858 1.00 30.77  ? 25  ARG B CD  1 
ATOM   512  N NE  . ARG B 1 26 ? 34.298 35.553 23.057 1.00 30.21  ? 25  ARG B NE  1 
ATOM   513  C CZ  . ARG B 1 26 ? 33.018 35.531 22.690 1.00 39.21  ? 25  ARG B CZ  1 
ATOM   514  N NH1 . ARG B 1 26 ? 32.506 34.452 22.082 1.00 35.39  ? 25  ARG B NH1 1 
ATOM   515  N NH2 . ARG B 1 26 ? 32.313 36.604 22.983 1.00 33.64  ? 25  ARG B NH2 1 
ATOM   516  N N   . LEU B 1 27 ? 35.793 35.815 17.730 1.00 24.90  ? 26  LEU B N   1 
ATOM   517  C CA  . LEU B 1 27 ? 35.155 36.576 16.680 1.00 22.65  ? 26  LEU B CA  1 
ATOM   518  C C   . LEU B 1 27 ? 34.371 35.658 15.744 1.00 28.28  ? 26  LEU B C   1 
ATOM   519  O O   . LEU B 1 27 ? 33.332 36.113 15.244 1.00 23.65  ? 26  LEU B O   1 
ATOM   520  C CB  . LEU B 1 27 ? 36.075 37.493 15.872 1.00 24.92  ? 26  LEU B CB  1 
ATOM   521  C CG  . LEU B 1 27 ? 36.949 38.451 16.716 1.00 27.87  ? 26  LEU B CG  1 
ATOM   522  C CD1 . LEU B 1 27 ? 37.534 39.536 15.825 1.00 30.24  ? 26  LEU B CD1 1 
ATOM   523  C CD2 . LEU B 1 27 ? 36.161 39.140 17.837 1.00 23.77  ? 26  LEU B CD2 1 
ATOM   524  N N   . LYS B 1 28 ? 34.844 34.421 15.529 1.00 24.39  ? 27  LYS B N   1 
ATOM   525  C CA  . LYS B 1 28 ? 34.025 33.535 14.671 1.00 25.86  ? 27  LYS B CA  1 
ATOM   526  C C   . LYS B 1 28 ? 32.661 33.217 15.332 1.00 21.93  ? 27  LYS B C   1 
ATOM   527  O O   . LYS B 1 28 ? 31.654 33.227 14.636 1.00 33.88  ? 27  LYS B O   1 
ATOM   528  C CB  . LYS B 1 28 ? 34.746 32.191 14.520 1.00 25.06  ? 27  LYS B CB  1 
ATOM   529  C CG  . LYS B 1 28 ? 35.927 32.304 13.519 1.00 27.04  ? 27  LYS B CG  1 
ATOM   530  C CD  . LYS B 1 28 ? 36.694 30.978 13.434 1.00 33.78  ? 27  LYS B CD  1 
ATOM   531  C CE  . LYS B 1 28 ? 37.893 31.054 12.475 1.00 34.48  ? 27  LYS B CE  1 
ATOM   532  N NZ  . LYS B 1 28 ? 38.652 29.747 12.571 1.00 35.99  ? 27  LYS B NZ  1 
ATOM   533  N N   . LYS B 1 29 ? 32.700 32.981 16.652 1.00 27.50  ? 28  LYS B N   1 
ATOM   534  C CA  . LYS B 1 29 ? 31.428 32.733 17.368 1.00 27.87  ? 28  LYS B CA  1 
ATOM   535  C C   . LYS B 1 29 ? 30.541 33.966 17.272 1.00 32.27  ? 28  LYS B C   1 
ATOM   536  O O   . LYS B 1 29 ? 29.351 33.961 16.908 1.00 35.40  ? 28  LYS B O   1 
ATOM   537  C CB  . LYS B 1 29 ? 31.732 32.347 18.802 1.00 29.18  ? 28  LYS B CB  1 
ATOM   538  C CG  . LYS B 1 29 ? 32.515 31.074 19.048 1.00 31.13  ? 28  LYS B CG  1 
ATOM   539  C CD  . LYS B 1 29 ? 31.753 29.775 19.206 1.00 44.35  ? 28  LYS B CD  1 
ATOM   540  C CE  . LYS B 1 29 ? 32.722 28.681 19.652 1.00 58.59  ? 28  LYS B CE  1 
ATOM   541  N NZ  . LYS B 1 29 ? 32.079 27.408 20.084 1.00 63.46  ? 28  LYS B NZ  1 
ATOM   542  N N   . LEU B 1 30 ? 31.111 35.154 17.516 1.00 27.74  ? 29  LEU B N   1 
ATOM   543  C CA  . LEU B 1 30 ? 30.372 36.398 17.411 1.00 27.76  ? 29  LEU B CA  1 
ATOM   544  C C   . LEU B 1 30 ? 29.768 36.692 16.056 1.00 35.67  ? 29  LEU B C   1 
ATOM   545  O O   . LEU B 1 30 ? 28.658 37.227 16.056 1.00 27.66  ? 29  LEU B O   1 
ATOM   546  C CB  . LEU B 1 30 ? 31.230 37.593 17.826 1.00 22.81  ? 29  LEU B CB  1 
ATOM   547  C CG  . LEU B 1 30 ? 31.535 37.726 19.318 1.00 22.45  ? 29  LEU B CG  1 
ATOM   548  C CD1 . LEU B 1 30 ? 32.540 38.867 19.505 1.00 29.18  ? 29  LEU B CD1 1 
ATOM   549  C CD2 . LEU B 1 30 ? 30.265 38.038 20.123 1.00 26.12  ? 29  LEU B CD2 1 
ATOM   550  N N   . VAL B 1 31 ? 30.389 36.386 14.927 1.00 26.10  ? 30  VAL B N   1 
ATOM   551  C CA  . VAL B 1 31 ? 29.899 36.664 13.604 1.00 27.73  ? 30  VAL B CA  1 
ATOM   552  C C   . VAL B 1 31 ? 28.876 35.625 13.105 1.00 23.95  ? 30  VAL B C   1 
ATOM   553  O O   . VAL B 1 31 ? 28.266 35.896 12.076 1.00 34.09  ? 30  VAL B O   1 
ATOM   554  C CB  . VAL B 1 31 ? 31.022 36.825 12.564 1.00 26.23  ? 30  VAL B CB  1 
ATOM   555  C CG1 . VAL B 1 31 ? 31.486 35.466 12.012 1.00 23.84  ? 30  VAL B CG1 1 
ATOM   556  C CG2 . VAL B 1 31 ? 30.676 37.782 11.406 1.00 25.29  ? 30  VAL B CG2 1 
ATOM   557  N N   . GLY B 1 32 ? 28.715 34.541 13.825 1.00 30.53  ? 31  GLY B N   1 
ATOM   558  C CA  . GLY B 1 32 ? 27.657 33.617 13.439 1.00 44.67  ? 31  GLY B CA  1 
ATOM   559  C C   A GLY B 1 32 ? 28.119 32.239 13.042 0.50 37.92  ? 31  GLY B C   1 
ATOM   560  O O   A GLY B 1 32 ? 27.270 31.414 12.692 0.50 40.53  ? 31  GLY B O   1 
ATOM   561  N N   A GLU B 1 33 ? 29.421 31.995 13.110 0.50 33.00  ? 32  GLU B N   1 
ATOM   562  C CA  A GLU B 1 33 ? 29.955 30.684 12.742 0.50 41.93  ? 32  GLU B CA  1 
ATOM   563  C C   A GLU B 1 33 ? 29.775 29.602 13.790 0.50 41.81  ? 32  GLU B C   1 
ATOM   564  O O   A GLU B 1 33 ? 29.973 29.845 14.981 0.50 48.51  ? 32  GLU B O   1 
ATOM   565  C CB  A GLU B 1 33 ? 31.474 30.838 12.515 0.50 30.47  ? 32  GLU B CB  1 
ATOM   566  C CG  A GLU B 1 33 ? 31.738 31.913 11.497 0.50 23.32  ? 32  GLU B CG  1 
ATOM   567  N N   A ARG B 1 34 ? 29.648 28.360 13.335 0.50 50.77  ? 33  ARG B N   1 
ATOM   568  C CA  A ARG B 1 34 ? 29.530 27.211 14.226 0.50 43.15  ? 33  ARG B CA  1 
HETATM 569  C C   . ACE C 1 1  ? 36.812 46.221 17.077 1.00 31.86  ? 0   ACE C C   1 
HETATM 570  O O   . ACE C 1 1  ? 37.885 46.650 16.650 1.00 30.91  ? 0   ACE C O   1 
HETATM 571  C CH3 . ACE C 1 1  ? 35.640 47.118 17.193 1.00 36.26  ? 0   ACE C CH3 1 
ATOM   572  N N   . ARG C 1 2  ? 36.234 45.082 17.499 1.00 30.88  ? 1   ARG C N   1 
ATOM   573  C CA  . ARG C 1 2  ? 37.082 43.965 17.706 1.00 28.35  ? 1   ARG C CA  1 
ATOM   574  C C   . ARG C 1 2  ? 37.717 43.540 16.380 1.00 22.37  ? 1   ARG C C   1 
ATOM   575  O O   . ARG C 1 2  ? 38.882 43.083 16.405 1.00 30.21  ? 1   ARG C O   1 
ATOM   576  C CB  . ARG C 1 2  ? 36.479 42.784 18.479 1.00 23.29  ? 1   ARG C CB  1 
ATOM   577  C CG  . ARG C 1 2  ? 36.403 43.381 19.915 1.00 29.58  ? 1   ARG C CG  1 
ATOM   578  C CD  . ARG C 1 2  ? 35.532 42.500 20.776 1.00 24.02  ? 1   ARG C CD  1 
ATOM   579  N NE  . ARG C 1 2  ? 36.218 41.218 21.049 1.00 29.90  ? 1   ARG C NE  1 
ATOM   580  C CZ  . ARG C 1 2  ? 35.630 40.342 21.867 1.00 36.39  ? 1   ARG C CZ  1 
ATOM   581  N NH1 . ARG C 1 2  ? 34.456 40.626 22.464 1.00 28.94  ? 1   ARG C NH1 1 
ATOM   582  N NH2 . ARG C 1 2  ? 36.231 39.182 22.076 1.00 25.98  ? 1   ARG C NH2 1 
ATOM   583  N N   . MET C 1 3  ? 36.996 43.614 15.276 1.00 25.37  ? 2   MET C N   1 
ATOM   584  C CA  . MET C 1 3  ? 37.576 43.186 13.997 1.00 30.07  ? 2   MET C CA  1 
ATOM   585  C C   . MET C 1 3  ? 38.786 44.033 13.623 1.00 32.80  ? 2   MET C C   1 
ATOM   586  O O   . MET C 1 3  ? 39.865 43.490 13.377 1.00 30.90  ? 2   MET C O   1 
ATOM   587  C CB  . MET C 1 3  ? 36.506 43.168 12.919 1.00 27.95  ? 2   MET C CB  1 
ATOM   588  C CG  . MET C 1 3  ? 36.863 42.648 11.547 1.00 31.40  ? 2   MET C CG  1 
ATOM   589  S SD  . MET C 1 3  ? 37.081 40.829 11.611 1.00 33.32  ? 2   MET C SD  1 
ATOM   590  C CE  . MET C 1 3  ? 38.875 40.779 11.565 1.00 42.34  ? 2   MET C CE  1 
ATOM   591  N N   . LYS C 1 4  ? 38.677 45.352 13.651 1.00 33.34  ? 3   LYS C N   1 
ATOM   592  C CA  . LYS C 1 4  ? 39.806 46.220 13.334 1.00 33.51  ? 3   LYS C CA  1 
ATOM   593  C C   . LYS C 1 4  ? 40.921 46.058 14.359 1.00 28.22  ? 3   LYS C C   1 
ATOM   594  O O   . LYS C 1 4  ? 42.092 46.033 13.981 1.00 30.53  ? 3   LYS C O   1 
ATOM   595  C CB  . LYS C 1 4  ? 39.349 47.682 13.243 1.00 33.20  ? 3   LYS C CB  1 
ATOM   596  C CG  . LYS C 1 4  ? 40.466 48.675 12.927 1.00 36.76  ? 3   LYS C CG  1 
ATOM   597  C CD  . LYS C 1 4  ? 41.078 48.332 11.569 1.00 45.71  ? 3   LYS C CD  1 
ATOM   598  C CE  . LYS C 1 4  ? 41.930 49.472 11.017 1.00 58.05  ? 3   LYS C CE  1 
ATOM   599  N NZ  . LYS C 1 4  ? 42.560 50.316 12.075 1.00 55.70  ? 3   LYS C NZ  1 
ATOM   600  N N   . GLN C 1 5  ? 40.630 45.968 15.658 1.00 27.96  ? 4   GLN C N   1 
ATOM   601  C CA  . GLN C 1 5  ? 41.654 45.802 16.674 1.00 30.28  ? 4   GLN C CA  1 
ATOM   602  C C   . GLN C 1 5  ? 42.482 44.534 16.408 1.00 34.62  ? 4   GLN C C   1 
ATOM   603  O O   . GLN C 1 5  ? 43.721 44.510 16.451 1.00 28.63  ? 4   GLN C O   1 
ATOM   604  C CB  . GLN C 1 5  ? 41.021 45.760 18.068 1.00 28.01  ? 4   GLN C CB  1 
ATOM   605  C CG  A GLN C 1 5  ? 40.446 47.129 18.465 0.50 26.24  ? 4   GLN C CG  1 
ATOM   606  C CG  B GLN C 1 5  ? 42.027 45.614 19.196 0.01 26.35  ? 4   GLN C CG  1 
ATOM   607  C CD  A GLN C 1 5  ? 39.595 47.083 19.707 0.50 35.23  ? 4   GLN C CD  1 
ATOM   608  C CD  B GLN C 1 5  ? 41.401 45.639 20.574 0.01 25.76  ? 4   GLN C CD  1 
ATOM   609  O OE1 A GLN C 1 5  ? 38.849 46.131 19.947 0.50 35.64  ? 4   GLN C OE1 1 
ATOM   610  O OE1 B GLN C 1 5  ? 41.893 46.317 21.478 0.01 25.12  ? 4   GLN C OE1 1 
ATOM   611  N NE2 A GLN C 1 5  ? 39.674 48.135 20.509 0.50 47.70  ? 4   GLN C NE2 1 
ATOM   612  N NE2 B GLN C 1 5  ? 40.316 44.895 20.758 0.01 25.94  ? 4   GLN C NE2 1 
ATOM   613  N N   . LEU C 1 6  ? 41.787 43.458 16.036 1.00 27.74  ? 5   LEU C N   1 
ATOM   614  C CA  . LEU C 1 6  ? 42.415 42.187 15.723 1.00 30.68  ? 5   LEU C CA  1 
ATOM   615  C C   . LEU C 1 6  ? 43.277 42.357 14.481 1.00 26.38  ? 5   LEU C C   1 
ATOM   616  O O   . LEU C 1 6  ? 44.428 41.891 14.489 1.00 26.23  ? 5   LEU C O   1 
ATOM   617  C CB  . LEU C 1 6  ? 41.430 41.027 15.526 1.00 21.93  ? 5   LEU C CB  1 
ATOM   618  C CG  . LEU C 1 6  ? 42.044 39.700 15.050 1.00 23.04  ? 5   LEU C CG  1 
ATOM   619  C CD1 . LEU C 1 6  ? 42.938 39.156 16.174 1.00 28.31  ? 5   LEU C CD1 1 
ATOM   620  C CD2 . LEU C 1 6  ? 40.976 38.650 14.734 1.00 25.21  ? 5   LEU C CD2 1 
ATOM   621  N N   A GLU C 1 7  ? 42.761 42.977 13.419 0.50 24.09  ? 6   GLU C N   1 
ATOM   622  N N   B GLU C 1 7  ? 42.761 42.984 13.431 0.50 23.28  ? 6   GLU C N   1 
ATOM   623  C CA  A GLU C 1 7  ? 43.592 43.141 12.227 0.50 31.05  ? 6   GLU C CA  1 
ATOM   624  C CA  B GLU C 1 7  ? 43.580 43.177 12.232 0.50 30.00  ? 6   GLU C CA  1 
ATOM   625  C C   A GLU C 1 7  ? 44.901 43.866 12.554 0.50 31.82  ? 6   GLU C C   1 
ATOM   626  C C   B GLU C 1 7  ? 44.912 43.841 12.589 0.50 31.20  ? 6   GLU C C   1 
ATOM   627  O O   A GLU C 1 7  ? 45.970 43.424 12.108 0.50 29.00  ? 6   GLU C O   1 
ATOM   628  O O   B GLU C 1 7  ? 45.972 43.415 12.111 0.50 28.57  ? 6   GLU C O   1 
ATOM   629  C CB  A GLU C 1 7  ? 42.869 43.876 11.095 0.50 33.13  ? 6   GLU C CB  1 
ATOM   630  C CB  B GLU C 1 7  ? 42.839 44.048 11.217 0.50 30.99  ? 6   GLU C CB  1 
ATOM   631  C CG  A GLU C 1 7  ? 43.573 43.672 9.763  0.50 34.99  ? 6   GLU C CG  1 
ATOM   632  C CG  B GLU C 1 7  ? 41.561 43.367 10.746 0.50 28.83  ? 6   GLU C CG  1 
ATOM   633  C CD  A GLU C 1 7  ? 42.875 44.245 8.557  0.50 35.54  ? 6   GLU C CD  1 
ATOM   634  C CD  B GLU C 1 7  ? 40.666 44.317 9.967  0.50 43.15  ? 6   GLU C CD  1 
ATOM   635  O OE1 A GLU C 1 7  ? 41.997 45.120 8.697  0.50 29.70  ? 6   GLU C OE1 1 
ATOM   636  O OE1 B GLU C 1 7  ? 41.201 45.159 9.222  0.50 35.95  ? 6   GLU C OE1 1 
ATOM   637  O OE2 A GLU C 1 7  ? 43.201 43.812 7.436  0.50 30.07  ? 6   GLU C OE2 1 
ATOM   638  O OE2 B GLU C 1 7  ? 39.437 44.174 10.113 0.50 27.89  ? 6   GLU C OE2 1 
ATOM   639  N N   . ASP C 1 8  ? 44.837 44.958 13.299 1.00 30.11  ? 7   ASP C N   1 
ATOM   640  C CA  . ASP C 1 8  ? 46.008 45.739 13.653 1.00 30.93  ? 7   ASP C CA  1 
ATOM   641  C C   . ASP C 1 8  ? 46.990 44.933 14.493 1.00 39.91  ? 7   ASP C C   1 
ATOM   642  O O   . ASP C 1 8  ? 48.200 45.014 14.264 1.00 28.00  ? 7   ASP C O   1 
ATOM   643  C CB  . ASP C 1 8  ? 45.660 47.022 14.405 1.00 37.43  ? 7   ASP C CB  1 
ATOM   644  C CG  . ASP C 1 8  ? 44.875 48.016 13.562 1.00 40.62  ? 7   ASP C CG  1 
ATOM   645  O OD1 . ASP C 1 8  ? 44.283 48.907 14.181 1.00 37.04  ? 7   ASP C OD1 1 
ATOM   646  O OD2 . ASP C 1 8  ? 44.749 47.992 12.327 1.00 38.66  ? 7   ASP C OD2 1 
ATOM   647  N N   . LYS C 1 9  ? 46.526 44.148 15.468 1.00 28.26  ? 8   LYS C N   1 
ATOM   648  C CA  . LYS C 1 9  ? 47.422 43.352 16.285 1.00 26.35  ? 8   LYS C CA  1 
ATOM   649  C C   . LYS C 1 9  ? 48.088 42.270 15.441 1.00 24.85  ? 8   LYS C C   1 
ATOM   650  O O   . LYS C 1 9  ? 49.253 41.930 15.749 1.00 28.64  ? 8   LYS C O   1 
ATOM   651  C CB  . LYS C 1 9  ? 46.672 42.771 17.490 1.00 27.29  ? 8   LYS C CB  1 
ATOM   652  C CG  . LYS C 1 9  ? 46.305 43.719 18.622 1.00 31.25  ? 8   LYS C CG  1 
ATOM   653  C CD  A LYS C 1 9  ? 47.474 44.613 19.005 0.50 31.46  ? 8   LYS C CD  1 
ATOM   654  C CE  A LYS C 1 9  ? 47.140 45.996 19.499 0.50 36.62  ? 8   LYS C CE  1 
ATOM   655  N NZ  A LYS C 1 9  ? 47.246 47.065 18.460 0.50 43.77  ? 8   LYS C NZ  1 
ATOM   656  N N   . VAL C 1 10 ? 47.421 41.699 14.445 1.00 23.39  ? 9   VAL C N   1 
ATOM   657  C CA  . VAL C 1 10 ? 47.966 40.636 13.596 1.00 24.57  ? 9   VAL C CA  1 
ATOM   658  C C   . VAL C 1 10 ? 49.039 41.233 12.676 1.00 32.89  ? 9   VAL C C   1 
ATOM   659  O O   . VAL C 1 10 ? 50.146 40.713 12.545 1.00 25.11  ? 9   VAL C O   1 
ATOM   660  C CB  . VAL C 1 10 ? 46.908 39.828 12.822 1.00 22.57  ? 9   VAL C CB  1 
ATOM   661  C CG1 . VAL C 1 10 ? 47.514 38.882 11.765 1.00 22.78  ? 9   VAL C CG1 1 
ATOM   662  C CG2 . VAL C 1 10 ? 46.105 38.952 13.813 1.00 22.92  ? 9   VAL C CG2 1 
ATOM   663  N N   . GLU C 1 11 ? 48.829 42.432 12.170 1.00 29.17  ? 10  GLU C N   1 
ATOM   664  C CA  . GLU C 1 11 ? 49.836 43.164 11.386 1.00 34.51  ? 10  GLU C CA  1 
ATOM   665  C C   . GLU C 1 11 ? 51.067 43.495 12.230 1.00 26.96  ? 10  GLU C C   1 
ATOM   666  O O   . GLU C 1 11 ? 52.195 43.318 11.733 1.00 27.86  ? 10  GLU C O   1 
ATOM   667  C CB  . GLU C 1 11 ? 49.211 44.457 10.851 1.00 28.83  ? 10  GLU C CB  1 
ATOM   668  C CG  A GLU C 1 11 ? 50.235 45.409 10.236 0.50 33.42  ? 10  GLU C CG  1 
ATOM   669  C CG  B GLU C 1 11 ? 48.277 44.143 9.690  0.50 21.75  ? 10  GLU C CG  1 
ATOM   670  N N   . GLU C 1 12 ? 50.892 43.893 13.484 1.00 26.88  ? 11  GLU C N   1 
ATOM   671  C CA  . GLU C 1 12 ? 52.025 44.128 14.374 1.00 28.77  ? 11  GLU C CA  1 
ATOM   672  C C   . GLU C 1 12 ? 52.772 42.832 14.653 1.00 30.87  ? 11  GLU C C   1 
ATOM   673  O O   . GLU C 1 12 ? 54.014 42.803 14.631 1.00 29.12  ? 11  GLU C O   1 
ATOM   674  C CB  . GLU C 1 12 ? 51.600 44.821 15.653 1.00 28.22  ? 11  GLU C CB  1 
ATOM   675  C CG  A GLU C 1 12 ? 52.608 44.805 16.784 0.50 33.58  ? 11  GLU C CG  1 
ATOM   676  C CG  B GLU C 1 12 ? 51.195 46.264 15.329 0.50 35.07  ? 11  GLU C CG  1 
ATOM   677  C CD  A GLU C 1 12 ? 52.020 44.942 18.177 0.50 46.32  ? 11  GLU C CD  1 
ATOM   678  C CD  B GLU C 1 12 ? 50.527 46.964 16.496 0.50 45.91  ? 11  GLU C CD  1 
ATOM   679  O OE1 A GLU C 1 12 ? 51.976 43.972 18.975 0.50 30.16  ? 11  GLU C OE1 1 
ATOM   680  O OE1 B GLU C 1 12 ? 50.765 46.538 17.640 0.50 41.54  ? 11  GLU C OE1 1 
ATOM   681  O OE2 A GLU C 1 12 ? 51.620 46.079 18.506 0.50 42.55  ? 11  GLU C OE2 1 
ATOM   682  O OE2 B GLU C 1 12 ? 49.771 47.933 16.251 0.50 53.16  ? 11  GLU C OE2 1 
ATOM   683  N N   . LEU C 1 13 ? 52.036 41.725 14.867 1.00 24.98  ? 12  LEU C N   1 
ATOM   684  C CA  . LEU C 1 13 ? 52.673 40.448 15.105 1.00 22.68  ? 12  LEU C CA  1 
ATOM   685  C C   . LEU C 1 13 ? 53.542 40.057 13.932 1.00 21.10  ? 12  LEU C C   1 
ATOM   686  O O   . LEU C 1 13 ? 54.675 39.560 14.099 1.00 24.96  ? 12  LEU C O   1 
ATOM   687  C CB  . LEU C 1 13 ? 51.625 39.338 15.389 1.00 24.08  ? 12  LEU C CB  1 
ATOM   688  C CG  . LEU C 1 13 ? 52.221 37.939 15.596 1.00 24.66  ? 12  LEU C CG  1 
ATOM   689  C CD1 . LEU C 1 13 ? 52.853 37.942 17.008 1.00 28.50  ? 12  LEU C CD1 1 
ATOM   690  C CD2 . LEU C 1 13 ? 51.146 36.865 15.438 1.00 22.78  ? 12  LEU C CD2 1 
ATOM   691  N N   . LEU C 1 14 ? 53.022 40.175 12.709 1.00 23.48  ? 13  LEU C N   1 
ATOM   692  C CA  . LEU C 1 14 ? 53.775 39.783 11.514 1.00 30.63  ? 13  LEU C CA  1 
ATOM   693  C C   . LEU C 1 14 ? 55.072 40.613 11.379 1.00 27.02  ? 13  LEU C C   1 
ATOM   694  O O   . LEU C 1 14 ? 56.165 40.078 11.153 1.00 25.58  ? 13  LEU C O   1 
ATOM   695  C CB  . LEU C 1 14 ? 52.906 40.041 10.279 1.00 29.25  ? 13  LEU C CB  1 
ATOM   696  C CG  . LEU C 1 14 ? 51.767 39.057 10.022 1.00 27.62  ? 13  LEU C CG  1 
ATOM   697  C CD1 . LEU C 1 14 ? 50.744 39.654 9.041  1.00 27.85  ? 13  LEU C CD1 1 
ATOM   698  C CD2 . LEU C 1 14 ? 52.302 37.728 9.509  1.00 27.35  ? 13  LEU C CD2 1 
ATOM   699  N N   . SER C 1 15 ? 54.903 41.910 11.556 1.00 26.59  ? 14  SER C N   1 
ATOM   700  C CA  . SER C 1 15 ? 56.051 42.822 11.443 1.00 33.00  ? 14  SER C CA  1 
ATOM   701  C C   . SER C 1 15 ? 57.136 42.465 12.447 1.00 37.78  ? 14  SER C C   1 
ATOM   702  O O   . SER C 1 15 ? 58.342 42.303 12.133 1.00 25.88  ? 14  SER C O   1 
ATOM   703  C CB  . SER C 1 15 ? 55.491 44.236 11.632 1.00 36.74  ? 14  SER C CB  1 
ATOM   704  O OG  . SER C 1 15 ? 56.573 45.105 11.814 1.00 47.40  ? 14  SER C OG  1 
ATOM   705  N N   . LYS C 1 16 ? 56.753 42.287 13.711 1.00 26.19  ? 15  LYS C N   1 
ATOM   706  C CA  . LYS C 1 16 ? 57.660 41.911 14.785 1.00 27.24  ? 15  LYS C CA  1 
ATOM   707  C C   . LYS C 1 16 ? 58.319 40.579 14.542 1.00 24.54  ? 15  LYS C C   1 
ATOM   708  O O   . LYS C 1 16 ? 59.520 40.350 14.790 1.00 24.96  ? 15  LYS C O   1 
ATOM   709  C CB  . LYS C 1 16 ? 56.994 41.944 16.176 1.00 32.34  ? 15  LYS C CB  1 
ATOM   710  C CG  . LYS C 1 16 ? 56.574 43.366 16.591 1.00 32.88  ? 15  LYS C CG  1 
ATOM   711  C CD  . LYS C 1 16 ? 55.916 43.306 17.994 1.00 31.99  ? 15  LYS C CD  1 
ATOM   712  C CE  . LYS C 1 16 ? 55.526 44.738 18.376 1.00 41.30  ? 15  LYS C CE  1 
ATOM   713  N NZ  . LYS C 1 16 ? 54.501 44.723 19.453 1.00 45.58  ? 15  LYS C NZ  1 
ATOM   714  N N   . ALA C 1 17 ? 57.572 39.573 14.064 1.00 22.25  ? 16  ALA C N   1 
ATOM   715  C CA  . ALA C 1 17 ? 58.111 38.258 13.796 1.00 21.26  ? 16  ALA C CA  1 
ATOM   716  C C   . ALA C 1 17 ? 59.098 38.307 12.622 1.00 20.58  ? 16  ALA C C   1 
ATOM   717  O O   . ALA C 1 17 ? 60.088 37.588 12.735 1.00 24.37  ? 16  ALA C O   1 
ATOM   718  C CB  . ALA C 1 17 ? 57.003 37.259 13.514 1.00 20.43  ? 16  ALA C CB  1 
ATOM   719  N N   . TYR C 1 18 ? 58.807 39.092 11.572 1.00 23.89  ? 17  TYR C N   1 
ATOM   720  C CA  . TYR C 1 18 ? 59.784 39.135 10.446 1.00 24.40  ? 17  TYR C CA  1 
ATOM   721  C C   . TYR C 1 18 ? 61.054 39.830 10.963 1.00 24.97  ? 17  TYR C C   1 
ATOM   722  O O   . TYR C 1 18 ? 62.145 39.393 10.583 1.00 26.72  ? 17  TYR C O   1 
ATOM   723  C CB  . TYR C 1 18 ? 59.267 39.791 9.188  1.00 31.95  ? 17  TYR C CB  1 
ATOM   724  C CG  A TYR C 1 18 ? 60.240 40.452 8.233  0.50 49.87  ? 17  TYR C CG  1 
ATOM   725  C CG  B TYR C 1 18 ? 58.048 39.253 8.486  0.50 33.16  ? 17  TYR C CG  1 
ATOM   726  C CD1 A TYR C 1 18 ? 60.745 39.822 7.103  0.50 53.27  ? 17  TYR C CD1 1 
ATOM   727  C CD1 B TYR C 1 18 ? 56.969 40.129 8.326  0.50 34.72  ? 17  TYR C CD1 1 
ATOM   728  C CD2 A TYR C 1 18 ? 60.678 41.757 8.461  0.50 43.86  ? 17  TYR C CD2 1 
ATOM   729  C CD2 B TYR C 1 18 ? 57.902 37.974 7.987  0.50 43.99  ? 17  TYR C CD2 1 
ATOM   730  C CE1 A TYR C 1 18 ? 61.647 40.454 6.256  0.50 47.15  ? 17  TYR C CE1 1 
ATOM   731  C CE1 B TYR C 1 18 ? 55.800 39.742 7.711  0.50 37.27  ? 17  TYR C CE1 1 
ATOM   732  C CE2 A TYR C 1 18 ? 61.578 42.387 7.641  0.50 33.06  ? 17  TYR C CE2 1 
ATOM   733  C CE2 B TYR C 1 18 ? 56.728 37.577 7.351  0.50 45.40  ? 17  TYR C CE2 1 
ATOM   734  C CZ  A TYR C 1 18 ? 62.080 41.730 6.537  0.50 41.31  ? 17  TYR C CZ  1 
ATOM   735  C CZ  B TYR C 1 18 ? 55.684 38.463 7.218  0.50 36.84  ? 17  TYR C CZ  1 
ATOM   736  O OH  A TYR C 1 18 ? 62.995 42.380 5.726  0.50 37.70  ? 17  TYR C OH  1 
ATOM   737  O OH  B TYR C 1 18 ? 54.497 38.141 6.593  0.50 35.66  ? 17  TYR C OH  1 
ATOM   738  N N   . HIS C 1 19 ? 60.961 40.900 11.716 1.00 25.62  ? 18  HIS C N   1 
ATOM   739  C CA  . HIS C 1 19 ? 62.160 41.552 12.283 1.00 25.94  ? 18  HIS C CA  1 
ATOM   740  C C   . HIS C 1 19 ? 62.946 40.597 13.161 1.00 32.16  ? 18  HIS C C   1 
ATOM   741  O O   . HIS C 1 19 ? 64.184 40.469 13.077 1.00 25.95  ? 18  HIS C O   1 
ATOM   742  C CB  . HIS C 1 19 ? 61.752 42.798 13.082 1.00 31.32  ? 18  HIS C CB  1 
ATOM   743  C CG  A HIS C 1 19 ? 61.485 43.956 12.161 0.50 37.41  ? 18  HIS C CG  1 
ATOM   744  C CG  B HIS C 1 19 ? 62.901 43.358 13.877 0.50 30.35  ? 18  HIS C CG  1 
ATOM   745  N ND1 A HIS C 1 19 ? 62.186 44.116 10.972 0.50 43.00  ? 18  HIS C ND1 1 
ATOM   746  N ND1 B HIS C 1 19 ? 63.918 44.069 13.278 0.50 34.38  ? 18  HIS C ND1 1 
ATOM   747  C CD2 A HIS C 1 19 ? 60.653 45.016 12.249 0.50 45.32  ? 18  HIS C CD2 1 
ATOM   748  C CD2 B HIS C 1 19 ? 63.230 43.242 15.187 0.50 33.98  ? 18  HIS C CD2 1 
ATOM   749  C CE1 A HIS C 1 19 ? 61.775 45.209 10.367 0.50 40.12  ? 18  HIS C CE1 1 
ATOM   750  C CE1 B HIS C 1 19 ? 64.827 44.362 14.189 0.50 22.10  ? 18  HIS C CE1 1 
ATOM   751  N NE2 A HIS C 1 19 ? 60.839 45.775 11.113 0.50 42.10  ? 18  HIS C NE2 1 
ATOM   752  N NE2 B HIS C 1 19 ? 64.418 43.907 15.359 0.50 37.78  ? 18  HIS C NE2 1 
ATOM   753  N N   . LEU C 1 20 ? 62.268 39.833 14.026 1.00 26.79  ? 19  LEU C N   1 
ATOM   754  C CA  . LEU C 1 20 ? 62.904 38.818 14.834 1.00 24.02  ? 19  LEU C CA  1 
ATOM   755  C C   . LEU C 1 20 ? 63.615 37.777 13.985 1.00 28.75  ? 19  LEU C C   1 
ATOM   756  O O   . LEU C 1 20 ? 64.729 37.326 14.300 1.00 23.15  ? 19  LEU C O   1 
ATOM   757  C CB  . LEU C 1 20 ? 61.931 38.066 15.747 1.00 23.56  ? 19  LEU C CB  1 
ATOM   758  C CG  . LEU C 1 20 ? 62.553 37.001 16.642 1.00 25.68  ? 19  LEU C CG  1 
ATOM   759  C CD1 . LEU C 1 20 ? 63.613 37.598 17.550 1.00 26.02  ? 19  LEU C CD1 1 
ATOM   760  C CD2 . LEU C 1 20 ? 61.426 36.359 17.475 1.00 29.87  ? 19  LEU C CD2 1 
ATOM   761  N N   . GLU C 1 21 ? 62.994 37.273 12.927 1.00 23.74  ? 20  GLU C N   1 
ATOM   762  C CA  . GLU C 1 21 ? 63.623 36.299 12.027 1.00 23.46  ? 20  GLU C CA  1 
ATOM   763  C C   . GLU C 1 21 ? 64.952 36.871 11.491 1.00 20.44  ? 20  GLU C C   1 
ATOM   764  O O   . GLU C 1 21 ? 65.940 36.103 11.467 1.00 22.99  ? 20  GLU C O   1 
ATOM   765  C CB  . GLU C 1 21 ? 62.655 35.965 10.834 1.00 23.52  ? 20  GLU C CB  1 
ATOM   766  C CG  . GLU C 1 21 ? 63.194 34.886 9.915  1.00 25.06  ? 20  GLU C CG  1 
ATOM   767  C CD  . GLU C 1 21 ? 62.317 34.618 8.671  1.00 26.27  ? 20  GLU C CD  1 
ATOM   768  O OE1 . GLU C 1 21 ? 61.559 35.489 8.250  1.00 28.26  ? 20  GLU C OE1 1 
ATOM   769  O OE2 . GLU C 1 21 ? 62.392 33.529 8.097  1.00 33.19  ? 20  GLU C OE2 1 
ATOM   770  N N   . ASN C 1 22 ? 64.965 38.110 11.059 1.00 20.84  ? 21  ASN C N   1 
ATOM   771  C CA  . ASN C 1 22 ? 66.226 38.700 10.578 1.00 30.80  ? 21  ASN C CA  1 
ATOM   772  C C   . ASN C 1 22 ? 67.286 38.734 11.684 1.00 33.44  ? 21  ASN C C   1 
ATOM   773  O O   . ASN C 1 22 ? 68.457 38.432 11.422 1.00 25.75  ? 21  ASN C O   1 
ATOM   774  C CB  . ASN C 1 22 ? 66.029 40.113 10.067 1.00 24.78  ? 21  ASN C CB  1 
ATOM   775  C CG  . ASN C 1 22 ? 65.119 40.260 8.868  1.00 29.56  ? 21  ASN C CG  1 
ATOM   776  O OD1 . ASN C 1 22 ? 65.028 39.337 8.076  1.00 31.69  ? 21  ASN C OD1 1 
ATOM   777  N ND2 . ASN C 1 22 ? 64.437 41.375 8.708  1.00 28.23  ? 21  ASN C ND2 1 
ATOM   778  N N   . GLU C 1 23 ? 66.903 39.084 12.898 1.00 25.34  ? 22  GLU C N   1 
ATOM   779  C CA  A GLU C 1 23 ? 67.786 39.137 14.043 0.70 24.25  ? 22  GLU C CA  1 
ATOM   780  C CA  B GLU C 1 23 ? 67.818 39.153 14.020 0.30 25.76  ? 22  GLU C CA  1 
ATOM   781  C C   A GLU C 1 23 ? 68.359 37.785 14.394 0.70 26.59  ? 22  GLU C C   1 
ATOM   782  C C   B GLU C 1 23 ? 68.320 37.799 14.485 0.30 25.35  ? 22  GLU C C   1 
ATOM   783  O O   A GLU C 1 23 ? 69.564 37.680 14.675 0.70 25.39  ? 22  GLU C O   1 
ATOM   784  O O   B GLU C 1 23 ? 69.535 37.664 14.713 0.30 26.47  ? 22  GLU C O   1 
ATOM   785  C CB  A GLU C 1 23 ? 67.117 39.730 15.294 0.70 25.02  ? 22  GLU C CB  1 
ATOM   786  C CB  B GLU C 1 23 ? 67.218 39.942 15.188 0.30 28.54  ? 22  GLU C CB  1 
ATOM   787  C CG  A GLU C 1 23 ? 66.858 41.237 15.190 0.70 27.28  ? 22  GLU C CG  1 
ATOM   788  C CG  B GLU C 1 23 ? 66.603 41.276 14.820 0.30 27.62  ? 22  GLU C CG  1 
ATOM   789  C CD  A GLU C 1 23 ? 65.870 41.693 16.261 0.70 37.20  ? 22  GLU C CD  1 
ATOM   790  C CD  B GLU C 1 23 ? 67.490 42.257 14.102 0.30 36.14  ? 22  GLU C CD  1 
ATOM   791  O OE1 A GLU C 1 23 ? 65.221 40.854 16.936 0.70 41.85  ? 22  GLU C OE1 1 
ATOM   792  O OE1 B GLU C 1 23 ? 68.720 42.240 14.301 0.30 33.08  ? 22  GLU C OE1 1 
ATOM   793  O OE2 A GLU C 1 23 ? 65.724 42.915 16.444 0.70 42.63  ? 22  GLU C OE2 1 
ATOM   794  O OE2 B GLU C 1 23 ? 66.974 43.082 13.311 0.30 46.58  ? 22  GLU C OE2 1 
ATOM   795  N N   . VAL C 1 24 ? 67.533 36.741 14.327 1.00 23.34  ? 23  VAL C N   1 
ATOM   796  C CA  . VAL C 1 24 ? 67.945 35.384 14.611 1.00 21.10  ? 23  VAL C CA  1 
ATOM   797  C C   . VAL C 1 24 ? 68.935 34.914 13.541 1.00 24.32  ? 23  VAL C C   1 
ATOM   798  O O   . VAL C 1 24 ? 69.915 34.265 13.919 1.00 23.54  ? 23  VAL C O   1 
ATOM   799  C CB  . VAL C 1 24 ? 66.760 34.402 14.755 1.00 22.36  ? 23  VAL C CB  1 
ATOM   800  C CG1 . VAL C 1 24 ? 67.228 32.955 14.792 1.00 23.35  ? 23  VAL C CG1 1 
ATOM   801  C CG2 . VAL C 1 24 ? 66.008 34.718 16.077 1.00 22.83  ? 23  VAL C CG2 1 
ATOM   802  N N   . ALA C 1 25 ? 68.705 35.248 12.261 1.00 22.06  ? 24  ALA C N   1 
ATOM   803  C CA  . ALA C 1 25 ? 69.659 34.850 11.237 1.00 25.91  ? 24  ALA C CA  1 
ATOM   804  C C   . ALA C 1 25 ? 71.012 35.575 11.456 1.00 23.23  ? 24  ALA C C   1 
ATOM   805  O O   . ALA C 1 25 ? 72.011 34.886 11.190 1.00 23.69  ? 24  ALA C O   1 
ATOM   806  C CB  . ALA C 1 25 ? 69.144 35.150 9.823  1.00 24.77  ? 24  ALA C CB  1 
ATOM   807  N N   . ARG C 1 26 ? 71.000 36.830 11.837 1.00 26.65  ? 25  ARG C N   1 
ATOM   808  C CA  . ARG C 1 26 ? 72.254 37.570 12.121 1.00 26.05  ? 25  ARG C CA  1 
ATOM   809  C C   . ARG C 1 26 ? 72.950 36.921 13.308 1.00 30.13  ? 25  ARG C C   1 
ATOM   810  O O   . ARG C 1 26 ? 74.177 36.641 13.244 1.00 29.26  ? 25  ARG C O   1 
ATOM   811  C CB  . ARG C 1 26 ? 72.024 39.075 12.305 1.00 21.13  ? 25  ARG C CB  1 
ATOM   812  C CG  A ARG C 1 26 ? 71.690 39.743 10.970 0.50 29.01  ? 25  ARG C CG  1 
ATOM   813  C CG  B ARG C 1 26 ? 71.270 39.879 11.303 0.50 26.45  ? 25  ARG C CG  1 
ATOM   814  C CD  A ARG C 1 26 ? 71.840 41.225 10.833 0.50 28.89  ? 25  ARG C CD  1 
ATOM   815  C CD  B ARG C 1 26 ? 71.194 41.376 11.639 0.50 20.37  ? 25  ARG C CD  1 
ATOM   816  N NE  A ARG C 1 26 ? 71.578 41.938 9.622  0.50 31.36  ? 25  ARG C NE  1 
ATOM   817  N NE  B ARG C 1 26 ? 70.161 41.983 10.844 0.50 36.95  ? 25  ARG C NE  1 
ATOM   818  C CZ  A ARG C 1 26 ? 70.953 41.848 8.470  0.50 40.99  ? 25  ARG C CZ  1 
ATOM   819  C CZ  B ARG C 1 26 ? 68.997 42.503 11.153 0.50 32.27  ? 25  ARG C CZ  1 
ATOM   820  N NH1 A ARG C 1 26 ? 70.819 42.907 7.644  0.50 21.49  ? 25  ARG C NH1 1 
ATOM   821  N NH1 B ARG C 1 26 ? 68.531 42.579 12.394 0.50 20.86  ? 25  ARG C NH1 1 
ATOM   822  N NH2 A ARG C 1 26 ? 70.444 40.708 7.982  0.50 28.96  ? 25  ARG C NH2 1 
ATOM   823  N NH2 B ARG C 1 26 ? 68.288 42.981 10.133 0.50 34.85  ? 25  ARG C NH2 1 
ATOM   824  N N   . LEU C 1 27 ? 72.237 36.549 14.378 1.00 24.54  ? 26  LEU C N   1 
ATOM   825  C CA  . LEU C 1 27 ? 72.815 35.809 15.477 1.00 28.23  ? 26  LEU C CA  1 
ATOM   826  C C   . LEU C 1 27 ? 73.388 34.468 15.071 1.00 28.82  ? 26  LEU C C   1 
ATOM   827  O O   . LEU C 1 27 ? 74.495 34.044 15.488 1.00 27.57  ? 26  LEU C O   1 
ATOM   828  C CB  . LEU C 1 27 ? 71.804 35.622 16.648 1.00 24.40  ? 26  LEU C CB  1 
ATOM   829  C CG  . LEU C 1 27 ? 72.390 34.808 17.840 1.00 27.93  ? 26  LEU C CG  1 
ATOM   830  C CD1 . LEU C 1 27 ? 73.435 35.705 18.493 1.00 24.44  ? 26  LEU C CD1 1 
ATOM   831  C CD2 . LEU C 1 27 ? 71.212 34.496 18.783 1.00 36.83  ? 26  LEU C CD2 1 
ATOM   832  N N   . LYS C 1 28 ? 72.761 33.686 14.186 1.00 24.73  ? 27  LYS C N   1 
ATOM   833  C CA  . LYS C 1 28 ? 73.244 32.411 13.733 1.00 23.65  ? 27  LYS C CA  1 
ATOM   834  C C   . LYS C 1 28 ? 74.628 32.563 13.031 1.00 26.22  ? 27  LYS C C   1 
ATOM   835  O O   . LYS C 1 28 ? 75.459 31.654 13.161 1.00 25.20  ? 27  LYS C O   1 
ATOM   836  C CB  . LYS C 1 28 ? 72.247 31.809 12.753 1.00 23.27  ? 27  LYS C CB  1 
ATOM   837  C CG  . LYS C 1 28 ? 72.580 30.439 12.203 1.00 29.84  ? 27  LYS C CG  1 
ATOM   838  C CD  . LYS C 1 28 ? 72.686 29.415 13.318 1.00 39.11  ? 27  LYS C CD  1 
ATOM   839  C CE  . LYS C 1 28 ? 72.819 28.002 12.774 1.00 46.57  ? 27  LYS C CE  1 
ATOM   840  N NZ  . LYS C 1 28 ? 71.755 27.667 11.785 1.00 35.37  ? 27  LYS C NZ  1 
ATOM   841  N N   . LYS C 1 29 ? 74.840 33.687 12.342 1.00 24.22  ? 28  LYS C N   1 
ATOM   842  C CA  . LYS C 1 29 ? 76.156 33.901 11.707 1.00 30.49  ? 28  LYS C CA  1 
ATOM   843  C C   . LYS C 1 29 ? 77.257 33.956 12.761 1.00 32.26  ? 28  LYS C C   1 
ATOM   844  O O   . LYS C 1 29 ? 78.348 33.411 12.582 1.00 26.29  ? 28  LYS C O   1 
ATOM   845  C CB  . LYS C 1 29 ? 76.177 35.162 10.856 1.00 30.78  ? 28  LYS C CB  1 
ATOM   846  C CG  . LYS C 1 29 ? 75.254 34.987 9.635  1.00 29.01  ? 28  LYS C CG  1 
ATOM   847  C CD  . LYS C 1 29 ? 75.264 36.244 8.766  1.00 33.11  ? 28  LYS C CD  1 
ATOM   848  C CE  . LYS C 1 29 ? 74.444 36.002 7.491  1.00 35.97  ? 28  LYS C CE  1 
ATOM   849  N NZ  . LYS C 1 29 ? 74.315 37.260 6.692  1.00 33.71  ? 28  LYS C NZ  1 
ATOM   850  N N   . LEU C 1 30 ? 76.964 34.618 13.873 1.00 28.11  ? 29  LEU C N   1 
ATOM   851  C CA  . LEU C 1 30 ? 77.865 34.713 15.000 1.00 30.65  ? 29  LEU C CA  1 
ATOM   852  C C   . LEU C 1 30 ? 78.090 33.410 15.749 1.00 35.19  ? 29  LEU C C   1 
ATOM   853  O O   . LEU C 1 30 ? 79.235 33.060 16.096 1.00 28.23  ? 29  LEU C O   1 
ATOM   854  C CB  . LEU C 1 30 ? 77.284 35.727 16.002 1.00 23.70  ? 29  LEU C CB  1 
ATOM   855  C CG  . LEU C 1 30 ? 77.242 37.196 15.642 1.00 36.92  ? 29  LEU C CG  1 
ATOM   856  C CD1 . LEU C 1 30 ? 76.280 37.924 16.587 1.00 33.50  ? 29  LEU C CD1 1 
ATOM   857  C CD2 . LEU C 1 30 ? 78.618 37.827 15.799 1.00 34.10  ? 29  LEU C CD2 1 
ATOM   858  N N   . VAL C 1 31 ? 77.056 32.618 16.009 1.00 28.46  ? 30  VAL C N   1 
ATOM   859  C CA  . VAL C 1 31 ? 77.217 31.411 16.848 1.00 33.08  ? 30  VAL C CA  1 
ATOM   860  C C   . VAL C 1 31 ? 77.391 30.151 16.052 1.00 29.20  ? 30  VAL C C   1 
ATOM   861  O O   . VAL C 1 31 ? 78.038 29.178 16.472 1.00 39.15  ? 30  VAL C O   1 
ATOM   862  C CB  . VAL C 1 31 ? 75.986 31.378 17.793 1.00 46.39  ? 30  VAL C CB  1 
ATOM   863  C CG1 . VAL C 1 31 ? 75.861 30.094 18.573 1.00 50.89  ? 30  VAL C CG1 1 
ATOM   864  C CG2 . VAL C 1 31 ? 76.057 32.547 18.751 1.00 42.69  ? 30  VAL C CG2 1 
ATOM   865  N N   . GLY C 1 32 ? 76.963 30.124 14.806 1.00 34.45  ? 31  GLY C N   1 
ATOM   866  C CA  . GLY C 1 32 ? 77.107 28.996 13.900 1.00 35.63  ? 31  GLY C CA  1 
ATOM   867  C C   . GLY C 1 32 ? 76.266 27.799 14.356 1.00 43.33  ? 31  GLY C C   1 
ATOM   868  O O   . GLY C 1 32 ? 75.303 27.948 15.112 1.00 43.38  ? 31  GLY C O   1 
ATOM   869  N N   . GLU C 1 33 ? 76.685 26.612 13.939 1.00 60.33  ? 32  GLU C N   1 
ATOM   870  C CA  . GLU C 1 33 ? 75.960 25.382 14.286 1.00 69.07  ? 32  GLU C CA  1 
HETATM 871  O O   A HOH D 2 .  ? 53.899 31.351 5.951  0.50 21.29  ? 202 HOH A O   1 
HETATM 872  O O   A HOH D 2 .  ? 50.274 32.156 3.916  0.50 30.07  ? 203 HOH A O   1 
HETATM 873  O O   A HOH D 2 .  ? 55.079 33.199 7.530  0.50 38.47  ? 204 HOH A O   1 
HETATM 874  O O   A HOH D 2 .  ? 37.234 45.864 9.843  0.50 33.77  ? 205 HOH A O   1 
HETATM 875  O O   A HOH D 2 .  ? 36.301 46.911 11.174 0.50 40.64  ? 206 HOH A O   1 
HETATM 876  O O   . HOH D 2 .  ? 44.838 39.505 6.698  1.00 35.31  ? 207 HOH A O   1 
HETATM 877  O O   . HOH D 2 .  ? 66.951 28.490 22.420 1.00 40.91  ? 208 HOH A O   1 
HETATM 878  O O   . HOH D 2 .  ? 57.269 26.925 9.537  1.00 34.15  ? 209 HOH A O   1 
HETATM 879  O O   . HOH D 2 .  ? 68.398 31.639 11.224 1.00 33.82  ? 210 HOH A O   1 
HETATM 880  O O   . HOH D 2 .  ? 28.785 36.087 7.152  1.00 46.46  ? 211 HOH A O   1 
HETATM 881  O O   . HOH D 2 .  ? 59.207 24.941 13.735 1.00 43.39  ? 212 HOH A O   1 
HETATM 882  O O   . HOH D 2 .  ? 39.172 39.966 3.384  1.00 41.18  ? 213 HOH A O   1 
HETATM 883  O O   . HOH D 2 .  ? 41.863 34.131 4.081  1.00 45.82  ? 214 HOH A O   1 
HETATM 884  O O   . HOH D 2 .  ? 48.714 27.571 2.992  1.00 49.48  ? 215 HOH A O   1 
HETATM 885  O O   . HOH D 2 .  ? 48.608 27.172 16.138 1.00 56.29  ? 216 HOH A O   1 
HETATM 886  O O   . HOH D 2 .  ? 53.154 26.976 13.776 1.00 35.11  ? 217 HOH A O   1 
HETATM 887  O O   . HOH D 2 .  ? 50.848 27.176 12.419 1.00 36.39  ? 218 HOH A O   1 
HETATM 888  O O   . HOH D 2 .  ? 64.539 30.995 12.318 1.00 43.30  ? 219 HOH A O   1 
HETATM 889  O O   . HOH D 2 .  ? 50.608 31.440 1.007  1.00 45.95  ? 220 HOH A O   1 
HETATM 890  O O   . HOH D 2 .  ? 42.798 30.493 14.397 1.00 53.60  ? 221 HOH A O   1 
HETATM 891  O O   . HOH D 2 .  ? 38.581 33.197 10.125 1.00 44.99  ? 222 HOH A O   1 
HETATM 892  O O   . HOH D 2 .  ? 58.515 24.953 17.918 1.00 49.76  ? 223 HOH A O   1 
HETATM 893  O O   . HOH D 2 .  ? 71.937 24.764 17.870 1.00 54.73  ? 224 HOH A O   1 
HETATM 894  O O   . HOH D 2 .  ? 48.753 41.307 6.526  1.00 52.23  ? 225 HOH A O   1 
HETATM 895  O O   . HOH D 2 .  ? 49.052 34.764 4.905  1.00 56.23  ? 226 HOH A O   1 
HETATM 896  O O   . HOH D 2 .  ? 57.206 25.249 11.918 1.00 37.05  ? 227 HOH A O   1 
HETATM 897  O O   . HOH D 2 .  ? 46.465 40.899 8.767  1.00 52.77  ? 228 HOH A O   1 
HETATM 898  O O   . HOH D 2 .  ? 48.376 28.033 13.582 1.00 35.05  ? 229 HOH A O   1 
HETATM 899  O O   . HOH D 2 .  ? 34.301 43.391 7.021  1.00 49.08  ? 230 HOH A O   1 
HETATM 900  O O   . HOH D 2 .  ? 54.488 24.596 12.234 1.00 42.18  ? 231 HOH A O   1 
HETATM 901  O O   . HOH D 2 .  ? 45.085 30.835 13.280 1.00 45.16  ? 232 HOH A O   1 
HETATM 902  O O   . HOH D 2 .  ? 51.314 28.683 8.165  1.00 53.90  ? 233 HOH A O   1 
HETATM 903  O O   . HOH D 2 .  ? 73.782 26.747 19.851 1.00 65.22  ? 234 HOH A O   1 
HETATM 904  O O   . HOH D 2 .  ? 39.519 35.087 2.841  1.00 54.47  ? 235 HOH A O   1 
HETATM 905  O O   . HOH D 2 .  ? 45.702 39.184 4.151  1.00 52.27  ? 236 HOH A O   1 
HETATM 906  O O   . HOH D 2 .  ? 53.170 28.481 21.629 1.00 52.94  ? 237 HOH A O   1 
HETATM 907  O O   . HOH D 2 .  ? 51.351 25.612 15.109 1.00 58.16  ? 238 HOH A O   1 
HETATM 908  O O   . HOH D 2 .  ? 71.335 34.006 30.025 1.00 59.15  ? 239 HOH A O   1 
HETATM 909  O O   . HOH D 2 .  ? 44.061 35.770 2.480  1.00 56.62  ? 240 HOH A O   1 
HETATM 910  O O   . HOH D 2 .  ? 70.974 25.614 14.476 1.00 67.42  ? 241 HOH A O   1 
HETATM 911  O O   . HOH D 2 .  ? 37.307 33.381 2.735  1.00 46.60  ? 242 HOH A O   1 
HETATM 912  O O   . HOH D 2 .  ? 47.491 37.793 2.092  1.00 67.99  ? 243 HOH A O   1 
HETATM 913  O O   . HOH D 2 .  ? 61.155 24.145 11.685 1.00 62.63  ? 244 HOH A O   1 
HETATM 914  O O   . HOH D 2 .  ? 39.822 28.415 9.735  1.00 74.78  ? 245 HOH A O   1 
HETATM 915  O O   . HOH D 2 .  ? 48.325 34.854 2.012  1.00 78.36  ? 246 HOH A O   1 
HETATM 916  O O   . HOH D 2 .  ? 50.225 39.231 2.986  1.00 60.20  ? 247 HOH A O   1 
HETATM 917  O O   . HOH D 2 .  ? 46.878 38.747 -0.733 1.00 65.71  ? 248 HOH A O   1 
HETATM 918  O O   . HOH D 2 .  ? 57.549 26.402 21.266 1.00 54.51  ? 249 HOH A O   1 
HETATM 919  O O   . HOH D 2 .  ? 29.923 41.639 1.731  1.00 56.66  ? 250 HOH A O   1 
HETATM 920  O O   . HOH D 2 .  ? 63.110 31.405 9.747  1.00 55.34  ? 251 HOH A O   1 
HETATM 921  O O   . HOH D 2 .  ? 44.200 28.879 11.344 1.00 44.02  ? 252 HOH A O   1 
HETATM 922  O O   . HOH D 2 .  ? 35.289 34.436 4.559  1.00 44.40  ? 253 HOH A O   1 
HETATM 923  O O   . HOH D 2 .  ? 58.643 23.173 15.723 1.00 58.73  ? 254 HOH A O   1 
HETATM 924  O O   . HOH D 2 .  ? 34.733 44.779 9.674  1.00 55.95  ? 255 HOH A O   1 
HETATM 925  O O   . HOH D 2 .  ? 34.222 28.113 12.667 1.00 60.20  ? 256 HOH A O   1 
HETATM 926  O O   . HOH D 2 .  ? 45.420 29.554 7.073  1.00 64.19  ? 257 HOH A O   1 
HETATM 927  O O   . HOH D 2 .  ? 36.531 40.536 2.733  1.00 73.48  ? 258 HOH A O   1 
HETATM 928  O O   . HOH D 2 .  ? 63.945 25.510 12.193 1.00 61.96  ? 259 HOH A O   1 
HETATM 929  O O   . HOH D 2 .  ? 49.817 25.589 19.493 1.00 65.48  ? 260 HOH A O   1 
HETATM 930  O O   . HOH D 2 .  ? 34.072 30.250 10.886 1.00 56.46  ? 261 HOH A O   1 
HETATM 931  O O   . HOH D 2 .  ? 30.716 44.237 2.067  1.00 55.40  ? 262 HOH A O   1 
HETATM 932  O O   . HOH D 2 .  ? 32.726 33.940 3.678  1.00 53.92  ? 263 HOH A O   1 
HETATM 933  O O   . HOH D 2 .  ? 27.421 42.643 4.861  1.00 37.65  ? 264 HOH A O   1 
HETATM 934  O O   . HOH D 2 .  ? 37.178 43.546 3.265  1.00 69.93  ? 265 HOH A O   1 
HETATM 935  O O   . HOH D 2 .  ? 44.846 28.275 4.791  1.00 75.94  ? 266 HOH A O   1 
HETATM 936  O O   . HOH D 2 .  ? 36.152 46.251 5.210  1.00 82.16  ? 267 HOH A O   1 
HETATM 937  O O   . HOH D 2 .  ? 70.177 26.743 26.893 1.00 97.86  ? 268 HOH A O   1 
HETATM 938  O O   . HOH D 2 .  ? 35.206 32.088 5.619  1.00 64.28  ? 269 HOH A O   1 
HETATM 939  O O   A HOH E 2 .  ? 71.515 39.350 29.397 0.50 38.11  ? 207 HOH B O   1 
HETATM 940  O O   . HOH E 2 .  ? 47.820 30.665 14.142 1.00 25.41  ? 208 HOH B O   1 
HETATM 941  O O   . HOH E 2 .  ? 71.317 39.311 16.332 1.00 28.57  ? 209 HOH B O   1 
HETATM 942  O O   . HOH E 2 .  ? 40.089 42.277 18.779 1.00 26.33  ? 210 HOH B O   1 
HETATM 943  O O   . HOH E 2 .  ? 39.888 36.915 23.220 1.00 27.95  ? 211 HOH B O   1 
HETATM 944  O O   . HOH E 2 .  ? 48.007 38.945 21.719 1.00 32.01  ? 212 HOH B O   1 
HETATM 945  O O   . HOH E 2 .  ? 41.605 30.195 16.785 1.00 30.10  ? 213 HOH B O   1 
HETATM 946  O O   . HOH E 2 .  ? 38.442 32.040 22.467 1.00 31.42  ? 214 HOH B O   1 
HETATM 947  O O   . HOH E 2 .  ? 43.094 34.974 25.657 1.00 34.67  ? 215 HOH B O   1 
HETATM 948  O O   . HOH E 2 .  ? 51.732 30.336 20.417 1.00 30.49  ? 216 HOH B O   1 
HETATM 949  O O   . HOH E 2 .  ? 49.447 29.097 20.125 1.00 35.78  ? 217 HOH B O   1 
HETATM 950  O O   . HOH E 2 .  ? 42.453 36.879 23.527 1.00 31.20  ? 218 HOH B O   1 
HETATM 951  O O   . HOH E 2 .  ? 39.351 29.580 15.476 1.00 36.97  ? 219 HOH B O   1 
HETATM 952  O O   . HOH E 2 .  ? 63.886 40.521 24.583 1.00 39.32  ? 220 HOH B O   1 
HETATM 953  O O   . HOH E 2 .  ? 43.105 29.208 20.763 1.00 38.20  ? 221 HOH B O   1 
HETATM 954  O O   . HOH E 2 .  ? 50.875 37.870 25.488 1.00 32.44  ? 222 HOH B O   1 
HETATM 955  O O   . HOH E 2 .  ? 62.716 31.140 23.918 1.00 47.89  ? 223 HOH B O   1 
HETATM 956  O O   . HOH E 2 .  ? 61.163 40.268 25.123 1.00 44.24  ? 224 HOH B O   1 
HETATM 957  O O   . HOH E 2 .  ? 59.468 36.496 27.241 1.00 41.64  ? 225 HOH B O   1 
HETATM 958  O O   . HOH E 2 .  ? 63.220 32.841 27.484 1.00 57.32  ? 226 HOH B O   1 
HETATM 959  O O   . HOH E 2 .  ? 53.438 38.800 25.309 1.00 43.91  ? 227 HOH B O   1 
HETATM 960  O O   . HOH E 2 .  ? 28.452 34.336 9.597  1.00 45.44  ? 228 HOH B O   1 
HETATM 961  O O   . HOH E 2 .  ? 65.280 39.757 27.569 1.00 48.98  ? 229 HOH B O   1 
HETATM 962  O O   . HOH E 2 .  ? 43.523 31.585 27.571 1.00 66.21  ? 230 HOH B O   1 
HETATM 963  O O   . HOH E 2 .  ? 55.941 43.004 21.642 1.00 52.99  ? 231 HOH B O   1 
HETATM 964  O O   . HOH E 2 .  ? 45.571 28.638 20.252 1.00 41.81  ? 232 HOH B O   1 
HETATM 965  O O   . HOH E 2 .  ? 55.541 31.764 24.944 1.00 45.01  ? 233 HOH B O   1 
HETATM 966  O O   . HOH E 2 .  ? 50.091 41.629 24.435 1.00 59.63  ? 234 HOH B O   1 
HETATM 967  O O   . HOH E 2 .  ? 35.267 29.632 17.406 1.00 34.36  ? 235 HOH B O   1 
HETATM 968  O O   . HOH E 2 .  ? 48.871 39.264 24.447 1.00 32.36  ? 236 HOH B O   1 
HETATM 969  O O   . HOH E 2 .  ? 64.161 29.437 22.291 1.00 49.90  ? 237 HOH B O   1 
HETATM 970  O O   . HOH E 2 .  ? 72.270 35.973 28.874 1.00 49.02  ? 238 HOH B O   1 
HETATM 971  O O   . HOH E 2 .  ? 40.979 40.767 22.889 1.00 61.35  ? 239 HOH B O   1 
HETATM 972  O O   . HOH E 2 .  ? 48.820 26.939 21.706 1.00 54.98  ? 240 HOH B O   1 
HETATM 973  O O   . HOH E 2 .  ? 54.983 38.458 27.549 1.00 66.06  ? 241 HOH B O   1 
HETATM 974  O O   . HOH E 2 .  ? 46.654 39.646 26.531 1.00 79.00  ? 242 HOH B O   1 
HETATM 975  O O   . HOH E 2 .  ? 56.765 36.469 27.380 1.00 51.82  ? 243 HOH B O   1 
HETATM 976  O O   . HOH E 2 .  ? 71.071 42.165 24.044 1.00 56.75  ? 244 HOH B O   1 
HETATM 977  O O   . HOH E 2 .  ? 43.782 38.729 24.889 1.00 71.61  ? 245 HOH B O   1 
HETATM 978  O O   . HOH E 2 .  ? 63.526 30.352 26.405 1.00 64.20  ? 246 HOH B O   1 
HETATM 979  O O   . HOH E 2 .  ? 57.142 28.662 23.996 1.00 57.16  ? 247 HOH B O   1 
HETATM 980  O O   . HOH E 2 .  ? 37.052 27.352 12.138 1.00 57.21  ? 248 HOH B O   1 
HETATM 981  O O   . HOH E 2 .  ? 44.037 27.238 26.165 1.00 66.63  ? 249 HOH B O   1 
HETATM 982  O O   . HOH E 2 .  ? 46.165 26.591 21.914 1.00 58.35  ? 250 HOH B O   1 
HETATM 983  O O   . HOH E 2 .  ? 60.393 39.581 27.702 1.00 60.85  ? 251 HOH B O   1 
HETATM 984  O O   . HOH E 2 .  ? 49.562 34.835 28.937 1.00 73.59  ? 252 HOH B O   1 
HETATM 985  O O   . HOH E 2 .  ? 73.910 42.632 26.274 1.00 51.91  ? 253 HOH B O   1 
HETATM 986  O O   . HOH E 2 .  ? 65.345 42.195 26.370 1.00 80.59  ? 254 HOH B O   1 
HETATM 987  O O   . HOH E 2 .  ? 50.370 38.275 28.262 1.00 66.24  ? 255 HOH B O   1 
HETATM 988  O O   . HOH E 2 .  ? 55.257 27.582 22.777 1.00 58.76  ? 256 HOH B O   1 
HETATM 989  O O   . HOH E 2 .  ? 66.034 36.527 30.302 1.00 53.30  ? 257 HOH B O   1 
HETATM 990  O O   . HOH E 2 .  ? 67.638 41.386 27.669 1.00 61.91  ? 258 HOH B O   1 
HETATM 991  O O   . HOH E 2 .  ? 68.532 44.467 16.393 1.00 53.60  ? 259 HOH B O   1 
HETATM 992  O O   . HOH E 2 .  ? 60.379 33.749 28.217 1.00 56.83  ? 260 HOH B O   1 
HETATM 993  O O   . HOH E 2 .  ? 62.666 35.448 31.102 1.00 83.49  ? 261 HOH B O   1 
HETATM 994  O O   . HOH E 2 .  ? 58.165 43.895 25.948 1.00 76.00  ? 262 HOH B O   1 
HETATM 995  O O   . HOH E 2 .  ? 33.196 28.837 15.533 1.00 58.49  ? 263 HOH B O   1 
HETATM 996  O O   . HOH E 2 .  ? 28.268 30.906 16.626 1.00 51.27  ? 264 HOH B O   1 
HETATM 997  O O   . HOH E 2 .  ? 24.988 30.072 13.790 1.00 65.55  ? 265 HOH B O   1 
HETATM 998  O O   . HOH E 2 .  ? 25.890 29.864 16.490 1.00 76.18  ? 266 HOH B O   1 
HETATM 999  O O   . HOH E 2 .  ? 71.480 42.601 27.408 1.00 71.04  ? 267 HOH B O   1 
HETATM 1000 O O   . HOH E 2 .  ? 38.151 24.481 10.718 1.00 90.30  ? 268 HOH B O   1 
HETATM 1001 O O   . HOH E 2 .  ? 26.263 35.378 16.502 1.00 46.13  ? 269 HOH B O   1 
HETATM 1002 O O   A HOH F 2 .  ? 61.731 43.230 9.206  0.50 52.12  ? 201 HOH C O   1 
HETATM 1003 O O   A HOH F 2 .  ? 57.546 36.423 7.133  0.50 27.37  ? 202 HOH C O   1 
HETATM 1004 O O   A HOH F 2 .  ? 65.320 43.286 12.267 0.50 39.38  ? 203 HOH C O   1 
HETATM 1005 O O   A HOH F 2 .  ? 64.744 43.503 5.094  0.50 32.63  ? 204 HOH C O   1 
HETATM 1006 O O   A HOH F 2 .  ? 55.939 37.743 8.685  0.50 29.29  ? 205 HOH C O   1 
HETATM 1007 O O   . HOH F 2 .  ? 73.179 37.304 4.220  1.00 30.03  ? 206 HOH C O   1 
HETATM 1008 O O   . HOH F 2 .  ? 50.564 41.800 18.208 1.00 30.79  ? 207 HOH C O   1 
HETATM 1009 O O   . HOH F 2 .  ? 72.408 32.807 9.322  1.00 28.02  ? 208 HOH C O   1 
HETATM 1010 O O   . HOH F 2 .  ? 69.126 38.456 8.354  1.00 28.81  ? 209 HOH C O   1 
HETATM 1011 O O   . HOH F 2 .  ? 52.749 43.639 8.933  1.00 35.28  ? 210 HOH C O   1 
HETATM 1012 O O   . HOH F 2 .  ? 60.713 41.721 17.033 1.00 33.43  ? 211 HOH C O   1 
HETATM 1013 O O   . HOH F 2 .  ? 33.379 43.191 23.303 1.00 34.82  ? 212 HOH C O   1 
HETATM 1014 O O   . HOH F 2 .  ? 38.464 49.151 16.461 1.00 36.73  ? 213 HOH C O   1 
HETATM 1015 O O   . HOH F 2 .  ? 78.971 31.794 10.479 1.00 37.11  ? 214 HOH C O   1 
HETATM 1016 O O   . HOH F 2 .  ? 71.794 37.427 8.281  1.00 46.69  ? 215 HOH C O   1 
HETATM 1017 O O   . HOH F 2 .  ? 43.661 49.127 16.517 1.00 45.74  ? 216 HOH C O   1 
HETATM 1018 O O   . HOH F 2 .  ? 42.847 42.084 19.174 1.00 35.14  ? 217 HOH C O   1 
HETATM 1019 O O   . HOH F 2 .  ? 42.740 41.156 6.275  1.00 42.12  ? 218 HOH C O   1 
HETATM 1020 O O   . HOH F 2 .  ? 52.833 40.533 5.998  1.00 60.67  ? 219 HOH C O   1 
HETATM 1021 O O   . HOH F 2 .  ? 48.923 43.371 22.342 1.00 53.19  ? 220 HOH C O   1 
HETATM 1022 O O   . HOH F 2 .  ? 48.874 41.201 20.269 1.00 34.58  ? 221 HOH C O   1 
HETATM 1023 O O   . HOH F 2 .  ? 72.542 32.885 6.289  1.00 34.01  ? 222 HOH C O   1 
HETATM 1024 O O   . HOH F 2 .  ? 43.126 40.228 21.053 1.00 38.87  ? 223 HOH C O   1 
HETATM 1025 O O   . HOH F 2 .  ? 45.437 39.907 22.416 1.00 40.00  ? 224 HOH C O   1 
HETATM 1026 O O   . HOH F 2 .  ? 74.626 31.266 9.192  1.00 34.98  ? 225 HOH C O   1 
HETATM 1027 O O   . HOH F 2 .  ? 41.641 41.212 3.813  1.00 44.60  ? 226 HOH C O   1 
HETATM 1028 O O   . HOH F 2 .  ? 49.137 47.405 13.211 1.00 50.34  ? 227 HOH C O   1 
HETATM 1029 O O   . HOH F 2 .  ? 36.611 49.880 14.002 1.00 56.00  ? 228 HOH C O   1 
HETATM 1030 O O   . HOH F 2 .  ? 44.584 47.227 18.154 1.00 52.61  ? 229 HOH C O   1 
HETATM 1031 O O   . HOH F 2 .  ? 62.935 41.506 18.512 1.00 65.19  ? 230 HOH C O   1 
HETATM 1032 O O   . HOH F 2 .  ? 59.207 43.785 10.034 1.00 46.74  ? 231 HOH C O   1 
HETATM 1033 O O   . HOH F 2 .  ? 57.851 45.744 13.973 1.00 53.52  ? 232 HOH C O   1 
HETATM 1034 O O   . HOH F 2 .  ? 60.106 45.006 15.216 1.00 56.24  ? 233 HOH C O   1 
HETATM 1035 O O   . HOH F 2 .  ? 37.323 50.123 11.217 1.00 63.96  ? 234 HOH C O   1 
HETATM 1036 O O   . HOH F 2 .  ? 43.507 39.788 2.051  1.00 63.05  ? 235 HOH C O   1 
HETATM 1037 O O   . HOH F 2 .  ? 77.179 32.260 7.819  1.00 65.97  ? 236 HOH C O   1 
HETATM 1038 O O   . HOH F 2 .  ? 51.078 42.686 7.212  1.00 48.33  ? 237 HOH C O   1 
HETATM 1039 O O   . HOH F 2 .  ? 54.753 46.885 14.990 1.00 64.80  ? 238 HOH C O   1 
HETATM 1040 O O   . HOH F 2 .  ? 60.015 34.809 6.113  1.00 33.81  ? 239 HOH C O   1 
HETATM 1041 O O   . HOH F 2 .  ? 81.006 31.219 17.245 1.00 28.30  ? 240 HOH C O   1 
HETATM 1042 O O   . HOH F 2 .  ? 71.715 28.928 9.395  1.00 59.15  ? 241 HOH C O   1 
HETATM 1043 O O   . HOH F 2 .  ? 40.340 44.107 20.997 1.00 46.92  ? 242 HOH C O   1 
HETATM 1044 O O   . HOH F 2 .  ? 36.506 47.136 20.798 1.00 51.49  ? 243 HOH C O   1 
HETATM 1045 O O   . HOH F 2 .  ? 43.600 43.887 20.907 1.00 59.01  ? 244 HOH C O   1 
HETATM 1046 O O   . HOH F 2 .  ? 56.767 46.331 9.053  1.00 71.28  ? 245 HOH C O   1 
HETATM 1047 O O   . HOH F 2 .  ? 57.349 43.827 7.854  1.00 63.69  ? 246 HOH C O   1 
HETATM 1048 O O   . HOH F 2 .  ? 54.950 42.563 7.956  1.00 58.76  ? 247 HOH C O   1 
HETATM 1049 O O   . HOH F 2 .  ? 75.063 26.219 17.546 1.00 72.20  ? 248 HOH C O   1 
HETATM 1050 O O   . HOH F 2 .  ? 46.219 42.423 22.929 1.00 73.03  ? 249 HOH C O   1 
HETATM 1051 O O   . HOH F 2 .  ? 58.060 38.560 4.803  1.00 73.84  ? 250 HOH C O   1 
HETATM 1052 O O   . HOH F 2 .  ? 79.472 26.755 15.855 1.00 53.64  ? 251 HOH C O   1 
HETATM 1053 O O   . HOH F 2 .  ? 76.517 23.942 17.082 1.00 78.42  ? 252 HOH C O   1 
HETATM 1054 O O   . HOH F 2 .  ? 48.189 47.528 10.103 1.00 67.56  ? 253 HOH C O   1 
HETATM 1055 O O   . HOH F 2 .  ? 78.446 24.137 15.231 1.00 92.49  ? 254 HOH C O   1 
HETATM 1056 O O   . HOH F 2 .  ? 49.852 45.403 20.623 1.00 80.23  ? 255 HOH C O   1 
HETATM 1057 O O   . HOH F 2 .  ? 52.577 47.330 12.512 1.00 71.51  ? 256 HOH C O   1 
HETATM 1058 O O   . HOH F 2 .  ? 70.453 40.297 14.296 1.00 136.87 ? 257 HOH C O   1 
HETATM 1059 O O   . HOH F 2 .  ? 50.914 47.759 21.933 1.00 77.18  ? 258 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  0  1  ACE ARG A . n 
A 1 2  ARG 2  1  1  ARG ARG A . n 
A 1 3  MET 3  2  2  MET MET A . n 
A 1 4  LYS 4  3  3  LYS LYS A . n 
A 1 5  GLN 5  4  4  GLN GLN A . n 
A 1 6  LEU 6  5  5  LEU LEU A . n 
A 1 7  GLU 7  6  6  GLU GLU A . n 
A 1 8  ASP 8  7  7  ASP ASP A . n 
A 1 9  LYS 9  8  8  LYS LYS A . n 
A 1 10 VAL 10 9  9  VAL VAL A . n 
A 1 11 GLU 11 10 10 GLU GLU A . n 
A 1 12 GLU 12 11 11 GLU GLU A . n 
A 1 13 LEU 13 12 12 LEU LEU A . n 
A 1 14 LEU 14 13 13 LEU LEU A . n 
A 1 15 SER 15 14 14 SER SER A . n 
A 1 16 LYS 16 15 15 LYS LYS A . n 
A 1 17 ALA 17 16 16 ALA ALA A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 HIS 19 18 18 HIS HIS A . n 
A 1 20 LEU 20 19 19 LEU LEU A . n 
A 1 21 GLU 21 20 20 GLU GLU A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 GLU 23 22 22 GLU GLU A . n 
A 1 24 VAL 24 23 23 VAL VAL A . n 
A 1 25 ALA 25 24 24 ALA ALA A . n 
A 1 26 ARG 26 25 25 ARG ARG A . n 
A 1 27 LEU 27 26 26 LEU LEU A . n 
A 1 28 LYS 28 27 27 LYS LYS A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LEU 30 29 29 LEU LEU A . n 
A 1 31 VAL 31 30 30 VAL VAL A . n 
A 1 32 GLY 32 31 31 GLY GLY A . n 
A 1 33 GLU 33 32 32 GLU GLU A . n 
A 1 34 ARG 34 33 33 ARG ARG A . n 
B 1 1  ACE 1  0  1  ACE ARG B . n 
B 1 2  ARG 2  1  1  ARG ARG B . n 
B 1 3  MET 3  2  2  MET MET B . n 
B 1 4  LYS 4  3  3  LYS LYS B . n 
B 1 5  GLN 5  4  4  GLN GLN B . n 
B 1 6  LEU 6  5  5  LEU LEU B . n 
B 1 7  GLU 7  6  6  GLU GLU B . n 
B 1 8  ASP 8  7  7  ASP ASP B . n 
B 1 9  LYS 9  8  8  LYS LYS B . n 
B 1 10 VAL 10 9  9  VAL VAL B . n 
B 1 11 GLU 11 10 10 GLU GLU B . n 
B 1 12 GLU 12 11 11 GLU GLU B . n 
B 1 13 LEU 13 12 12 LEU LEU B . n 
B 1 14 LEU 14 13 13 LEU LEU B . n 
B 1 15 SER 15 14 14 SER SER B . n 
B 1 16 LYS 16 15 15 LYS LYS B . n 
B 1 17 ALA 17 16 16 ALA ALA B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 HIS 19 18 18 HIS HIS B . n 
B 1 20 LEU 20 19 19 LEU LEU B . n 
B 1 21 GLU 21 20 20 GLU GLU B . n 
B 1 22 ASN 22 21 21 ASN ASN B . n 
B 1 23 GLU 23 22 22 GLU GLU B . n 
B 1 24 VAL 24 23 23 VAL VAL B . n 
B 1 25 ALA 25 24 24 ALA ALA B . n 
B 1 26 ARG 26 25 25 ARG ARG B . n 
B 1 27 LEU 27 26 26 LEU LEU B . n 
B 1 28 LYS 28 27 27 LYS LYS B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LEU 30 29 29 LEU LEU B . n 
B 1 31 VAL 31 30 30 VAL VAL B . n 
B 1 32 GLY 32 31 31 GLY GLY B . n 
B 1 33 GLU 33 32 32 GLU GLU B . n 
B 1 34 ARG 34 33 33 ARG ARG B . n 
C 1 1  ACE 1  0  1  ACE ARG C . n 
C 1 2  ARG 2  1  1  ARG ARG C . n 
C 1 3  MET 3  2  2  MET MET C . n 
C 1 4  LYS 4  3  3  LYS LYS C . n 
C 1 5  GLN 5  4  4  GLN GLN C . n 
C 1 6  LEU 6  5  5  LEU LEU C . n 
C 1 7  GLU 7  6  6  GLU GLU C . n 
C 1 8  ASP 8  7  7  ASP ASP C . n 
C 1 9  LYS 9  8  8  LYS LYS C . n 
C 1 10 VAL 10 9  9  VAL VAL C . n 
C 1 11 GLU 11 10 10 GLU GLU C . n 
C 1 12 GLU 12 11 11 GLU GLU C . n 
C 1 13 LEU 13 12 12 LEU LEU C . n 
C 1 14 LEU 14 13 13 LEU LEU C . n 
C 1 15 SER 15 14 14 SER SER C . n 
C 1 16 LYS 16 15 15 LYS LYS C . n 
C 1 17 ALA 17 16 16 ALA ALA C . n 
C 1 18 TYR 18 17 17 TYR TYR C . n 
C 1 19 HIS 19 18 18 HIS HIS C . n 
C 1 20 LEU 20 19 19 LEU LEU C . n 
C 1 21 GLU 21 20 20 GLU GLU C . n 
C 1 22 ASN 22 21 21 ASN ASN C . n 
C 1 23 GLU 23 22 22 GLU GLU C . n 
C 1 24 VAL 24 23 23 VAL VAL C . n 
C 1 25 ALA 25 24 24 ALA ALA C . n 
C 1 26 ARG 26 25 25 ARG ARG C . n 
C 1 27 LEU 27 26 26 LEU LEU C . n 
C 1 28 LYS 28 27 27 LYS LYS C . n 
C 1 29 LYS 29 28 28 LYS LYS C . n 
C 1 30 LEU 30 29 29 LEU LEU C . n 
C 1 31 VAL 31 30 30 VAL VAL C . n 
C 1 32 GLY 32 31 31 GLY GLY C . n 
C 1 33 GLU 33 32 32 GLU GLU C . n 
C 1 34 ARG 34 33 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1  202 2   HOH WAT A . 
D 2 HOH 2  203 4   HOH WAT A . 
D 2 HOH 3  204 8   HOH WAT A . 
D 2 HOH 4  205 9   HOH WAT A . 
D 2 HOH 5  206 10  HOH WAT A . 
D 2 HOH 6  207 11  HOH WAT A . 
D 2 HOH 7  208 15  HOH WAT A . 
D 2 HOH 8  209 17  HOH WAT A . 
D 2 HOH 9  210 21  HOH WAT A . 
D 2 HOH 10 211 29  HOH WAT A . 
D 2 HOH 11 212 30  HOH WAT A . 
D 2 HOH 12 213 33  HOH WAT A . 
D 2 HOH 13 214 34  HOH WAT A . 
D 2 HOH 14 215 39  HOH WAT A . 
D 2 HOH 15 216 41  HOH WAT A . 
D 2 HOH 16 217 43  HOH WAT A . 
D 2 HOH 17 218 47  HOH WAT A . 
D 2 HOH 18 219 48  HOH WAT A . 
D 2 HOH 19 220 49  HOH WAT A . 
D 2 HOH 20 221 50  HOH WAT A . 
D 2 HOH 21 222 51  HOH WAT A . 
D 2 HOH 22 223 52  HOH WAT A . 
D 2 HOH 23 224 53  HOH WAT A . 
D 2 HOH 24 225 54  HOH WAT A . 
D 2 HOH 25 226 60  HOH WAT A . 
D 2 HOH 26 227 62  HOH WAT A . 
D 2 HOH 27 228 63  HOH WAT A . 
D 2 HOH 28 229 67  HOH WAT A . 
D 2 HOH 29 230 71  HOH WAT A . 
D 2 HOH 30 231 75  HOH WAT A . 
D 2 HOH 31 232 76  HOH WAT A . 
D 2 HOH 32 233 77  HOH WAT A . 
D 2 HOH 33 234 79  HOH WAT A . 
D 2 HOH 34 235 80  HOH WAT A . 
D 2 HOH 35 236 83  HOH WAT A . 
D 2 HOH 36 237 84  HOH WAT A . 
D 2 HOH 37 238 85  HOH WAT A . 
D 2 HOH 38 239 89  HOH WAT A . 
D 2 HOH 39 240 96  HOH WAT A . 
D 2 HOH 40 241 99  HOH WAT A . 
D 2 HOH 41 242 101 HOH WAT A . 
D 2 HOH 42 243 104 HOH WAT A . 
D 2 HOH 43 244 115 HOH WAT A . 
D 2 HOH 44 245 116 HOH WAT A . 
D 2 HOH 45 246 119 HOH WAT A . 
D 2 HOH 46 247 121 HOH WAT A . 
D 2 HOH 47 248 124 HOH WAT A . 
D 2 HOH 48 249 126 HOH WAT A . 
D 2 HOH 49 250 127 HOH WAT A . 
D 2 HOH 50 251 129 HOH WAT A . 
D 2 HOH 51 252 132 HOH WAT A . 
D 2 HOH 52 253 133 HOH WAT A . 
D 2 HOH 53 254 134 HOH WAT A . 
D 2 HOH 54 255 137 HOH WAT A . 
D 2 HOH 55 256 138 HOH WAT A . 
D 2 HOH 56 257 140 HOH WAT A . 
D 2 HOH 57 258 144 HOH WAT A . 
D 2 HOH 58 259 147 HOH WAT A . 
D 2 HOH 59 260 149 HOH WAT A . 
D 2 HOH 60 261 151 HOH WAT A . 
D 2 HOH 61 262 153 HOH WAT A . 
D 2 HOH 62 263 155 HOH WAT A . 
D 2 HOH 63 264 157 HOH WAT A . 
D 2 HOH 64 265 159 HOH WAT A . 
D 2 HOH 65 266 161 HOH WAT A . 
D 2 HOH 66 267 162 HOH WAT A . 
D 2 HOH 67 268 170 HOH WAT A . 
D 2 HOH 68 269 174 HOH WAT A . 
E 2 HOH 1  207 7   HOH WAT B . 
E 2 HOH 2  208 1   HOH WAT B . 
E 2 HOH 3  209 2   HOH WAT B . 
E 2 HOH 4  210 3   HOH WAT B . 
E 2 HOH 5  211 4   HOH WAT B . 
E 2 HOH 6  212 5   HOH WAT B . 
E 2 HOH 7  213 6   HOH WAT B . 
E 2 HOH 8  214 7   HOH WAT B . 
E 2 HOH 9  215 9   HOH WAT B . 
E 2 HOH 10 216 10  HOH WAT B . 
E 2 HOH 11 217 16  HOH WAT B . 
E 2 HOH 12 218 18  HOH WAT B . 
E 2 HOH 13 219 22  HOH WAT B . 
E 2 HOH 14 220 23  HOH WAT B . 
E 2 HOH 15 221 25  HOH WAT B . 
E 2 HOH 16 222 26  HOH WAT B . 
E 2 HOH 17 223 31  HOH WAT B . 
E 2 HOH 18 224 32  HOH WAT B . 
E 2 HOH 19 225 35  HOH WAT B . 
E 2 HOH 20 226 37  HOH WAT B . 
E 2 HOH 21 227 38  HOH WAT B . 
E 2 HOH 22 228 44  HOH WAT B . 
E 2 HOH 23 229 45  HOH WAT B . 
E 2 HOH 24 230 46  HOH WAT B . 
E 2 HOH 25 231 56  HOH WAT B . 
E 2 HOH 26 232 58  HOH WAT B . 
E 2 HOH 27 233 61  HOH WAT B . 
E 2 HOH 28 234 64  HOH WAT B . 
E 2 HOH 29 235 66  HOH WAT B . 
E 2 HOH 30 236 69  HOH WAT B . 
E 2 HOH 31 237 78  HOH WAT B . 
E 2 HOH 32 238 81  HOH WAT B . 
E 2 HOH 33 239 86  HOH WAT B . 
E 2 HOH 34 240 87  HOH WAT B . 
E 2 HOH 35 241 88  HOH WAT B . 
E 2 HOH 36 242 90  HOH WAT B . 
E 2 HOH 37 243 93  HOH WAT B . 
E 2 HOH 38 244 94  HOH WAT B . 
E 2 HOH 39 245 95  HOH WAT B . 
E 2 HOH 40 246 98  HOH WAT B . 
E 2 HOH 41 247 100 HOH WAT B . 
E 2 HOH 42 248 102 HOH WAT B . 
E 2 HOH 43 249 105 HOH WAT B . 
E 2 HOH 44 250 108 HOH WAT B . 
E 2 HOH 45 251 109 HOH WAT B . 
E 2 HOH 46 252 110 HOH WAT B . 
E 2 HOH 47 253 111 HOH WAT B . 
E 2 HOH 48 254 113 HOH WAT B . 
E 2 HOH 49 255 118 HOH WAT B . 
E 2 HOH 50 256 122 HOH WAT B . 
E 2 HOH 51 257 128 HOH WAT B . 
E 2 HOH 52 258 131 HOH WAT B . 
E 2 HOH 53 259 136 HOH WAT B . 
E 2 HOH 54 260 148 HOH WAT B . 
E 2 HOH 55 261 156 HOH WAT B . 
E 2 HOH 56 262 160 HOH WAT B . 
E 2 HOH 57 263 165 HOH WAT B . 
E 2 HOH 58 264 166 HOH WAT B . 
E 2 HOH 59 265 167 HOH WAT B . 
E 2 HOH 60 266 168 HOH WAT B . 
E 2 HOH 61 267 171 HOH WAT B . 
E 2 HOH 62 268 175 HOH WAT B . 
E 2 HOH 63 269 178 HOH WAT B . 
F 2 HOH 1  201 1   HOH WAT C . 
F 2 HOH 2  202 3   HOH WAT C . 
F 2 HOH 3  203 5   HOH WAT C . 
F 2 HOH 4  204 6   HOH WAT C . 
F 2 HOH 5  205 11  HOH WAT C . 
F 2 HOH 6  206 8   HOH WAT C . 
F 2 HOH 7  207 12  HOH WAT C . 
F 2 HOH 8  208 13  HOH WAT C . 
F 2 HOH 9  209 14  HOH WAT C . 
F 2 HOH 10 210 19  HOH WAT C . 
F 2 HOH 11 211 20  HOH WAT C . 
F 2 HOH 12 212 24  HOH WAT C . 
F 2 HOH 13 213 27  HOH WAT C . 
F 2 HOH 14 214 28  HOH WAT C . 
F 2 HOH 15 215 36  HOH WAT C . 
F 2 HOH 16 216 40  HOH WAT C . 
F 2 HOH 17 217 42  HOH WAT C . 
F 2 HOH 18 218 55  HOH WAT C . 
F 2 HOH 19 219 57  HOH WAT C . 
F 2 HOH 20 220 59  HOH WAT C . 
F 2 HOH 21 221 65  HOH WAT C . 
F 2 HOH 22 222 68  HOH WAT C . 
F 2 HOH 23 223 70  HOH WAT C . 
F 2 HOH 24 224 72  HOH WAT C . 
F 2 HOH 25 225 73  HOH WAT C . 
F 2 HOH 26 226 74  HOH WAT C . 
F 2 HOH 27 227 82  HOH WAT C . 
F 2 HOH 28 228 91  HOH WAT C . 
F 2 HOH 29 229 92  HOH WAT C . 
F 2 HOH 30 230 97  HOH WAT C . 
F 2 HOH 31 231 103 HOH WAT C . 
F 2 HOH 32 232 106 HOH WAT C . 
F 2 HOH 33 233 107 HOH WAT C . 
F 2 HOH 34 234 112 HOH WAT C . 
F 2 HOH 35 235 114 HOH WAT C . 
F 2 HOH 36 236 117 HOH WAT C . 
F 2 HOH 37 237 120 HOH WAT C . 
F 2 HOH 38 238 123 HOH WAT C . 
F 2 HOH 39 239 125 HOH WAT C . 
F 2 HOH 40 240 130 HOH WAT C . 
F 2 HOH 41 241 135 HOH WAT C . 
F 2 HOH 42 242 139 HOH WAT C . 
F 2 HOH 43 243 141 HOH WAT C . 
F 2 HOH 44 244 142 HOH WAT C . 
F 2 HOH 45 245 143 HOH WAT C . 
F 2 HOH 46 246 145 HOH WAT C . 
F 2 HOH 47 247 146 HOH WAT C . 
F 2 HOH 48 248 150 HOH WAT C . 
F 2 HOH 49 249 152 HOH WAT C . 
F 2 HOH 50 250 154 HOH WAT C . 
F 2 HOH 51 251 158 HOH WAT C . 
F 2 HOH 52 252 163 HOH WAT C . 
F 2 HOH 53 253 164 HOH WAT C . 
F 2 HOH 54 254 169 HOH WAT C . 
F 2 HOH 55 255 172 HOH WAT C . 
F 2 HOH 56 256 173 HOH WAT C . 
F 2 HOH 57 257 176 HOH WAT C . 
F 2 HOH 58 258 177 HOH WAT C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4190 ? 
1 MORE         -42  ? 
1 'SSA (A^2)'  6560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
REFMAC refinement       26/11/99  ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
CCP4   phasing          .         ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 C GLN 4 ? B O C HOH 242 ? ? 0.82 
2 1 CD  C GLN 4 ? B O C HOH 242 ? ? 1.91 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 25 ? B CZ A ARG 25 ? B NH2 A ARG 25 ? B 115.90 120.30 -4.40 0.50 N 
2  1 O  B ACE 0  ? ? C  B ACE 0  ? ? N   B ARG 1  ? ? 136.15 122.70 13.45 1.60 Y 
3  1 NE B ARG 25 ? ? CZ B ARG 25 ? ? NH2 B ARG 25 ? ? 116.09 120.30 -4.21 0.50 N 
4  1 O  C ACE 0  ? ? C  C ACE 0  ? ? N   C ARG 1  ? ? 141.06 122.70 18.36 1.60 Y 
5  1 CB C ASP 7  ? ? CG C ASP 7  ? ? OD2 C ASP 7  ? ? 126.22 118.30 7.92  0.90 N 
6  1 CB C TYR 17 ? ? CG C TYR 17 ? B CD2 C TYR 17 ? B 125.80 121.00 4.80  0.60 N 
7  1 CB C TYR 17 ? ? CG C TYR 17 ? B CD1 C TYR 17 ? B 116.99 121.00 -4.01 0.60 N 
8  1 CD C ARG 25 ? A NE C ARG 25 ? A CZ  C ARG 25 ? A 142.74 123.60 19.14 1.40 N 
9  1 CD C ARG 25 ? B NE C ARG 25 ? B CZ  C ARG 25 ? B 132.42 123.60 8.82  1.40 N 
10 1 NE C ARG 25 ? B CZ C ARG 25 ? B NH1 C ARG 25 ? B 123.66 120.30 3.36  0.50 N 
11 1 NE C ARG 25 ? A CZ C ARG 25 ? A NH2 C ARG 25 ? A 123.93 120.30 3.63  0.50 N 
12 1 NE C ARG 25 ? B CZ C ARG 25 ? B NH2 C ARG 25 ? B 115.75 120.30 -4.55 0.50 N 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ARG 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              25 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             B 
_pdbx_validate_main_chain_plane.improper_torsion_angle   10.15 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 4  ? CG  ? A GLN 5  CG  
2  1 Y 1 A GLN 4  ? CD  ? A GLN 5  CD  
3  1 Y 1 A GLN 4  ? OE1 ? A GLN 5  OE1 
4  1 Y 1 A GLN 4  ? NE2 ? A GLN 5  NE2 
5  1 Y 1 A LYS 28 ? CD  ? A LYS 29 CD  
6  1 Y 1 A LYS 28 ? CE  ? A LYS 29 CE  
7  1 Y 1 A LYS 28 ? NZ  ? A LYS 29 NZ  
8  1 Y 1 A ARG 33 ? O   ? A ARG 34 O   
9  1 Y 1 A ARG 33 ? CB  ? A ARG 34 CB  
10 1 Y 1 A ARG 33 ? CG  ? A ARG 34 CG  
11 1 Y 1 A ARG 33 ? CD  ? A ARG 34 CD  
12 1 Y 1 B GLU 32 ? CD  ? B GLU 33 CD  
13 1 Y 1 B GLU 32 ? OE1 ? B GLU 33 OE1 
14 1 Y 1 B GLU 32 ? OE2 ? B GLU 33 OE2 
15 1 Y 1 B ARG 33 ? C   ? B ARG 34 C   
16 1 Y 1 B ARG 33 ? O   ? B ARG 34 O   
17 1 Y 1 B ARG 33 ? CB  ? B ARG 34 CB  
18 1 Y 1 B ARG 33 ? CG  ? B ARG 34 CG  
19 1 Y 1 B ARG 33 ? CD  ? B ARG 34 CD  
20 1 Y 1 B ARG 33 ? NE  ? B ARG 34 NE  
21 1 Y 1 B ARG 33 ? CZ  ? B ARG 34 CZ  
22 1 Y 1 B ARG 33 ? NH1 ? B ARG 34 NH1 
23 1 Y 1 B ARG 33 ? NH2 ? B ARG 34 NH2 
24 1 Y 1 C GLU 10 ? CD  ? C GLU 11 CD  
25 1 Y 1 C GLU 10 ? OE1 ? C GLU 11 OE1 
26 1 Y 1 C GLU 10 ? OE2 ? C GLU 11 OE2 
27 1 Y 1 C GLU 32 ? C   ? C GLU 33 C   
28 1 Y 1 C GLU 32 ? O   ? C GLU 33 O   
29 1 Y 1 C GLU 32 ? CB  ? C GLU 33 CB  
30 1 Y 1 C GLU 32 ? CG  ? C GLU 33 CG  
31 1 Y 1 C GLU 32 ? CD  ? C GLU 33 CD  
32 1 Y 1 C GLU 32 ? OE1 ? C GLU 33 OE1 
33 1 Y 1 C GLU 32 ? OE2 ? C GLU 33 OE2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     C 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ARG 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      33 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    C 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ARG 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     34 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#